data_5MGX
# 
_entry.id   5MGX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MGX         
WWPDB D_1200002445 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MGX 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Roe, S.M.'      1 
'Blundell, K.L.' 2 
'Prodromou, C.'  3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'PLoS ONE' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            12 
_citation.language                  ? 
_citation.page_first                e0173543 
_citation.page_last                 e0173543 
_citation.title                     'The structure of FKBP38 in complex with the MEEVD tetratricopeptide binding-motif of Hsp90.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0173543 
_citation.pdbx_database_id_PubMed   28278223 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blundell, K.L.' 1 
primary 'Pal, M.'        2 
primary 'Roe, S.M.'      3 
primary 'Pearl, L.H.'    4 
primary 'Prodromou, C.'  5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   93.10 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MGX 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     74.290 
_cell.length_a_esd                 ? 
_cell.length_b                     105.640 
_cell.length_b_esd                 ? 
_cell.length_c                     100.190 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MGX 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'yeast HSP90 C-terminus'                    966.963   4    ?       ? ? ? 
2 polymer man 'Peptidyl-prolyl cis-trans isomerase FKBP8' 31804.686 4    5.2.1.8 ? ? ? 
3 water   nat water                                       18.015    1058 ?       ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'PPIase FKBP8,38 kDa FK506-binding protein,hFKBP38,FK506-binding protein 8,FKBP-8,FKBPR38,Rotamase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no DTEMEEVD DTEMEEVD A,B,C,D ? 
2 'polypeptide(L)' no no 
;EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAM
VTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKA
ITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILR
AALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPG
;
;EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAM
VTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKA
ITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILR
AALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPG
;
E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   THR n 
1 3   GLU n 
1 4   MET n 
1 5   GLU n 
1 6   GLU n 
1 7   VAL n 
1 8   ASP n 
2 1   GLU n 
2 2   GLU n 
2 3   TRP n 
2 4   LEU n 
2 5   ASP n 
2 6   ILE n 
2 7   LEU n 
2 8   GLY n 
2 9   ASN n 
2 10  GLY n 
2 11  LEU n 
2 12  LEU n 
2 13  ARG n 
2 14  LYS n 
2 15  LYS n 
2 16  THR n 
2 17  LEU n 
2 18  VAL n 
2 19  PRO n 
2 20  GLY n 
2 21  PRO n 
2 22  PRO n 
2 23  GLY n 
2 24  SER n 
2 25  SER n 
2 26  ARG n 
2 27  PRO n 
2 28  VAL n 
2 29  LYS n 
2 30  GLY n 
2 31  GLN n 
2 32  VAL n 
2 33  VAL n 
2 34  THR n 
2 35  VAL n 
2 36  HIS n 
2 37  LEU n 
2 38  GLN n 
2 39  THR n 
2 40  SER n 
2 41  LEU n 
2 42  GLU n 
2 43  ASN n 
2 44  GLY n 
2 45  THR n 
2 46  ARG n 
2 47  VAL n 
2 48  GLN n 
2 49  GLU n 
2 50  GLU n 
2 51  PRO n 
2 52  GLU n 
2 53  LEU n 
2 54  VAL n 
2 55  PHE n 
2 56  THR n 
2 57  LEU n 
2 58  GLY n 
2 59  ASP n 
2 60  CYS n 
2 61  ASP n 
2 62  VAL n 
2 63  ILE n 
2 64  GLN n 
2 65  ALA n 
2 66  LEU n 
2 67  ASP n 
2 68  LEU n 
2 69  SER n 
2 70  VAL n 
2 71  PRO n 
2 72  LEU n 
2 73  MET n 
2 74  ASP n 
2 75  VAL n 
2 76  GLY n 
2 77  GLU n 
2 78  THR n 
2 79  ALA n 
2 80  MET n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  ASP n 
2 85  SER n 
2 86  LYS n 
2 87  TYR n 
2 88  CYS n 
2 89  TYR n 
2 90  GLY n 
2 91  PRO n 
2 92  GLN n 
2 93  GLY n 
2 94  ARG n 
2 95  SER n 
2 96  PRO n 
2 97  TYR n 
2 98  ILE n 
2 99  PRO n 
2 100 PRO n 
2 101 HIS n 
2 102 ALA n 
2 103 ALA n 
2 104 LEU n 
2 105 CYS n 
2 106 LEU n 
2 107 GLU n 
2 108 VAL n 
2 109 THR n 
2 110 LEU n 
2 111 LYS n 
2 112 THR n 
2 113 ALA n 
2 114 VAL n 
2 115 ASP n 
2 116 GLY n 
2 117 PRO n 
2 118 ASP n 
2 119 LEU n 
2 120 GLU n 
2 121 MET n 
2 122 LEU n 
2 123 THR n 
2 124 GLY n 
2 125 GLN n 
2 126 GLU n 
2 127 ARG n 
2 128 VAL n 
2 129 ALA n 
2 130 LEU n 
2 131 ALA n 
2 132 ASN n 
2 133 ARG n 
2 134 LYS n 
2 135 ARG n 
2 136 GLU n 
2 137 CYS n 
2 138 GLY n 
2 139 ASN n 
2 140 ALA n 
2 141 HIS n 
2 142 TYR n 
2 143 GLN n 
2 144 ARG n 
2 145 ALA n 
2 146 ASP n 
2 147 PHE n 
2 148 VAL n 
2 149 LEU n 
2 150 ALA n 
2 151 ALA n 
2 152 ASN n 
2 153 SER n 
2 154 TYR n 
2 155 ASP n 
2 156 LEU n 
2 157 ALA n 
2 158 ILE n 
2 159 LYS n 
2 160 ALA n 
2 161 ILE n 
2 162 THR n 
2 163 SER n 
2 164 SER n 
2 165 ALA n 
2 166 LYS n 
2 167 VAL n 
2 168 ASP n 
2 169 MET n 
2 170 THR n 
2 171 PHE n 
2 172 GLU n 
2 173 GLU n 
2 174 GLU n 
2 175 ALA n 
2 176 GLN n 
2 177 LEU n 
2 178 LEU n 
2 179 GLN n 
2 180 LEU n 
2 181 LYS n 
2 182 VAL n 
2 183 LYS n 
2 184 CYS n 
2 185 LEU n 
2 186 ASN n 
2 187 ASN n 
2 188 LEU n 
2 189 ALA n 
2 190 ALA n 
2 191 SER n 
2 192 GLN n 
2 193 LEU n 
2 194 LYS n 
2 195 LEU n 
2 196 ASP n 
2 197 HIS n 
2 198 TYR n 
2 199 ARG n 
2 200 ALA n 
2 201 ALA n 
2 202 LEU n 
2 203 ARG n 
2 204 SER n 
2 205 CYS n 
2 206 SER n 
2 207 LEU n 
2 208 VAL n 
2 209 LEU n 
2 210 GLU n 
2 211 HIS n 
2 212 GLN n 
2 213 PRO n 
2 214 ASP n 
2 215 ASN n 
2 216 ILE n 
2 217 LYS n 
2 218 ALA n 
2 219 LEU n 
2 220 PHE n 
2 221 ARG n 
2 222 LYS n 
2 223 GLY n 
2 224 LYS n 
2 225 VAL n 
2 226 LEU n 
2 227 ALA n 
2 228 GLN n 
2 229 GLN n 
2 230 GLY n 
2 231 GLU n 
2 232 TYR n 
2 233 SER n 
2 234 GLU n 
2 235 ALA n 
2 236 ILE n 
2 237 PRO n 
2 238 ILE n 
2 239 LEU n 
2 240 ARG n 
2 241 ALA n 
2 242 ALA n 
2 243 LEU n 
2 244 LYS n 
2 245 LEU n 
2 246 GLU n 
2 247 PRO n 
2 248 SER n 
2 249 ASN n 
2 250 LYS n 
2 251 THR n 
2 252 ILE n 
2 253 HIS n 
2 254 ALA n 
2 255 GLU n 
2 256 LEU n 
2 257 SER n 
2 258 LYS n 
2 259 LEU n 
2 260 VAL n 
2 261 LYS n 
2 262 LYS n 
2 263 HIS n 
2 264 ALA n 
2 265 ALA n 
2 266 GLN n 
2 267 ARG n 
2 268 SER n 
2 269 THR n 
2 270 GLU n 
2 271 THR n 
2 272 ALA n 
2 273 LEU n 
2 274 TYR n 
2 275 ARG n 
2 276 LYS n 
2 277 MET n 
2 278 LEU n 
2 279 GLY n 
2 280 ASN n 
2 281 PRO n 
2 282 SER n 
2 283 ARG n 
2 284 LEU n 
2 285 PRO n 
2 286 ALA n 
2 287 LYS n 
2 288 CYS n 
2 289 PRO n 
2 290 GLY n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   290 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FKBP8, FKBP38' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       8 
_pdbx_entity_src_syn.organism_scientific    'Saccharomyces cerevisiae' 
_pdbx_entity_src_syn.organism_common_name   
;baker's yeast
;
_pdbx_entity_src_syn.ncbi_taxonomy_id       4932 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5MGX        5MGX   ? 1 ? 1  
2 UNP FKBP8_HUMAN Q14318 ? 2 
;EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAM
VTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKA
ITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILR
AALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPG
;
91 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5MGX A 1 ? 8   ? 5MGX   702 ? 709 ? 702 709 
2 1 5MGX B 1 ? 8   ? 5MGX   702 ? 709 ? 702 709 
3 1 5MGX C 1 ? 8   ? 5MGX   702 ? 709 ? 702 709 
4 1 5MGX D 1 ? 8   ? 5MGX   702 ? 709 ? 702 709 
5 2 5MGX E 1 ? 290 ? Q14318 91  ? 380 ? 91  380 
6 2 5MGX F 1 ? 290 ? Q14318 91  ? 380 ? 91  380 
7 2 5MGX G 1 ? 290 ? Q14318 91  ? 380 ? 91  380 
8 2 5MGX H 1 ? 290 ? Q14318 91  ? 380 ? 91  380 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MGX 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.99 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.93 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.02 M sodium potassium phosphate, 20 % w/v PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-02-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.917 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.917 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            23.10 
_reflns.entry_id                         5MGX 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.18 
_reflns.d_resolution_low                 100 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       76276 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.9 
_reflns.pdbx_Rmerge_I_obs                0.111 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.947 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.18 
_reflns_shell.d_res_low                   2.24 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        96.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.492 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.733 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -2.01120 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.91150 
_refine.aniso_B[2][2]                            13.53600 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            -11.52490 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               33.57 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.872 
_refine.correlation_coeff_Fo_to_Fc_free          0.814 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MGX 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.18 
_refine.ls_d_res_low                             100 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     76276 
_refine.ls_number_reflns_R_free                  3524 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.7 
_refine.ls_percent_reflns_R_free                 4.620 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.249 
_refine.ls_R_factor_R_free                       0.308 
_refine.ls_R_factor_R_free_error                 0.000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.246 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '2AWG and 2FBN' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.237 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.244 
_refine.pdbx_overall_SU_R_Blow_DPI               0.284 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.264 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5MGX 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        8162 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             1058 
_refine_hist.number_atoms_total               9220 
_refine_hist.d_res_high                       2.18 
_refine_hist.d_res_low                        100 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009 ? 8293  ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.15  ? 11260 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 3904  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 212   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1193  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 8293  ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 3.22  ? ?     ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 2.93  ? ?     ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1116  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 9945  ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.18 
_refine_ls_shell.d_res_low                        2.24 
_refine_ls_shell.number_reflns_all                5509 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             275 
_refine_ls_shell.number_reflns_R_work             5234 
_refine_ls_shell.percent_reflns_obs               92.87 
_refine_ls_shell.percent_reflns_R_free            4.99 
_refine_ls_shell.R_factor_all                     0.331 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.364 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.R_factor_R_work                  0.330 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5MGX 
_struct.title                        'The structure of FKBP38 in complex with the MEEVD tetratricopeptide binding-motif of Hsp90' 
_struct.pdbx_descriptor              'yeast HSP90 C-terminus, Peptidyl-prolyl cis-trans isomerase FKBP8 (E.C.5.2.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MGX 
_struct_keywords.text            'Hsp90, PPIase, teratricopeptide, immunophilin, isomerase' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ILE E 63  ? VAL E 70  ? ILE E 153 VAL E 160 1 ? 8  
HELX_P HELX_P2  AA2 PRO E 71  ? MET E 73  ? PRO E 161 MET E 163 5 ? 3  
HELX_P HELX_P3  AA3 SER E 85  ? CYS E 88  ? SER E 175 CYS E 178 5 ? 4  
HELX_P HELX_P4  AA4 ASP E 118 ? LEU E 122 ? ASP E 208 LEU E 212 5 ? 5  
HELX_P HELX_P5  AA5 THR E 123 ? ARG E 144 ? THR E 213 ARG E 234 1 ? 22 
HELX_P HELX_P6  AA6 ASP E 146 ? SER E 163 ? ASP E 236 SER E 253 1 ? 18 
HELX_P HELX_P7  AA7 THR E 170 ? LEU E 195 ? THR E 260 LEU E 285 1 ? 26 
HELX_P HELX_P8  AA8 HIS E 197 ? GLN E 212 ? HIS E 287 GLN E 302 1 ? 16 
HELX_P HELX_P9  AA9 ASN E 215 ? GLY E 230 ? ASN E 305 GLY E 320 1 ? 16 
HELX_P HELX_P10 AB1 GLU E 231 ? GLU E 246 ? GLU E 321 GLU E 336 1 ? 16 
HELX_P HELX_P11 AB2 ASN E 249 ? ALA E 265 ? ASN E 339 ALA E 355 1 ? 17 
HELX_P HELX_P12 AB3 ILE F 63  ? VAL F 70  ? ILE F 153 VAL F 160 1 ? 8  
HELX_P HELX_P13 AB4 PRO F 71  ? MET F 73  ? PRO F 161 MET F 163 5 ? 3  
HELX_P HELX_P14 AB5 SER F 85  ? CYS F 88  ? SER F 175 CYS F 178 5 ? 4  
HELX_P HELX_P15 AB6 ASP F 118 ? LEU F 122 ? ASP F 208 LEU F 212 5 ? 5  
HELX_P HELX_P16 AB7 THR F 123 ? ARG F 144 ? THR F 213 ARG F 234 1 ? 22 
HELX_P HELX_P17 AB8 ASP F 146 ? SER F 163 ? ASP F 236 SER F 253 1 ? 18 
HELX_P HELX_P18 AB9 THR F 170 ? LEU F 195 ? THR F 260 LEU F 285 1 ? 26 
HELX_P HELX_P19 AC1 HIS F 197 ? GLN F 212 ? HIS F 287 GLN F 302 1 ? 16 
HELX_P HELX_P20 AC2 ASN F 215 ? GLY F 230 ? ASN F 305 GLY F 320 1 ? 16 
HELX_P HELX_P21 AC3 GLU F 231 ? LYS F 244 ? GLU F 321 LYS F 334 1 ? 14 
HELX_P HELX_P22 AC4 ASN F 249 ? HIS F 263 ? ASN F 339 HIS F 353 1 ? 15 
HELX_P HELX_P23 AC5 ILE G 63  ? VAL G 70  ? ILE G 153 VAL G 160 1 ? 8  
HELX_P HELX_P24 AC6 PRO G 71  ? MET G 73  ? PRO G 161 MET G 163 5 ? 3  
HELX_P HELX_P25 AC7 SER G 85  ? CYS G 88  ? SER G 175 CYS G 178 5 ? 4  
HELX_P HELX_P26 AC8 ASP G 118 ? LEU G 122 ? ASP G 208 LEU G 212 5 ? 5  
HELX_P HELX_P27 AC9 THR G 123 ? ARG G 144 ? THR G 213 ARG G 234 1 ? 22 
HELX_P HELX_P28 AD1 ASP G 146 ? SER G 163 ? ASP G 236 SER G 253 1 ? 18 
HELX_P HELX_P29 AD2 THR G 170 ? LEU G 195 ? THR G 260 LEU G 285 1 ? 26 
HELX_P HELX_P30 AD3 HIS G 197 ? GLN G 212 ? HIS G 287 GLN G 302 1 ? 16 
HELX_P HELX_P31 AD4 ASN G 215 ? GLN G 229 ? ASN G 305 GLN G 319 1 ? 15 
HELX_P HELX_P32 AD5 GLU G 231 ? GLU G 246 ? GLU G 321 GLU G 336 1 ? 16 
HELX_P HELX_P33 AD6 ASN G 249 ? GLN G 266 ? ASN G 339 GLN G 356 1 ? 18 
HELX_P HELX_P34 AD7 ILE H 63  ? VAL H 70  ? ILE H 153 VAL H 160 1 ? 8  
HELX_P HELX_P35 AD8 PRO H 71  ? MET H 73  ? PRO H 161 MET H 163 5 ? 3  
HELX_P HELX_P36 AD9 SER H 85  ? CYS H 88  ? SER H 175 CYS H 178 5 ? 4  
HELX_P HELX_P37 AE1 ASP H 118 ? LEU H 122 ? ASP H 208 LEU H 212 5 ? 5  
HELX_P HELX_P38 AE2 THR H 123 ? ARG H 144 ? THR H 213 ARG H 234 1 ? 22 
HELX_P HELX_P39 AE3 ASP H 146 ? SER H 163 ? ASP H 236 SER H 253 1 ? 18 
HELX_P HELX_P40 AE4 THR H 170 ? LEU H 195 ? THR H 260 LEU H 285 1 ? 26 
HELX_P HELX_P41 AE5 HIS H 197 ? GLN H 212 ? HIS H 287 GLN H 302 1 ? 16 
HELX_P HELX_P42 AE6 ASN H 215 ? GLY H 230 ? ASN H 305 GLY H 320 1 ? 16 
HELX_P HELX_P43 AE7 GLU H 231 ? GLU H 246 ? GLU H 321 GLU H 336 1 ? 16 
HELX_P HELX_P44 AE8 ASN H 249 ? ALA H 264 ? ASN H 339 ALA H 354 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 6 ? 
AA4 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU E 4   ? ASP E 5   ? LEU E 94  ASP E 95  
AA1 2 LEU E 12  ? VAL E 18  ? LEU E 102 VAL E 108 
AA1 3 THR E 78  ? ALA E 83  ? THR E 168 ALA E 173 
AA1 4 LEU E 104 ? VAL E 114 ? LEU E 194 VAL E 204 
AA1 5 VAL E 32  ? LEU E 41  ? VAL E 122 LEU E 131 
AA1 6 GLU E 52  ? THR E 56  ? GLU E 142 THR E 146 
AA2 1 LEU F 4   ? ASP F 5   ? LEU F 94  ASP F 95  
AA2 2 LEU F 12  ? VAL F 18  ? LEU F 102 VAL F 108 
AA2 3 THR F 78  ? ALA F 83  ? THR F 168 ALA F 173 
AA2 4 LEU F 104 ? VAL F 114 ? LEU F 194 VAL F 204 
AA2 5 VAL F 32  ? LEU F 41  ? VAL F 122 LEU F 131 
AA2 6 ARG F 46  ? THR F 56  ? ARG F 136 THR F 146 
AA3 1 LEU G 4   ? ASP G 5   ? LEU G 94  ASP G 95  
AA3 2 LEU G 12  ? VAL G 18  ? LEU G 102 VAL G 108 
AA3 3 THR G 78  ? ALA G 83  ? THR G 168 ALA G 173 
AA3 4 LEU G 104 ? VAL G 114 ? LEU G 194 VAL G 204 
AA3 5 VAL G 32  ? LEU G 41  ? VAL G 122 LEU G 131 
AA3 6 ARG G 46  ? THR G 56  ? ARG G 136 THR G 146 
AA4 1 LEU H 4   ? ASP H 5   ? LEU H 94  ASP H 95  
AA4 2 LEU H 12  ? VAL H 18  ? LEU H 102 VAL H 108 
AA4 3 THR H 78  ? ALA H 83  ? THR H 168 ALA H 173 
AA4 4 LEU H 104 ? VAL H 114 ? LEU H 194 VAL H 204 
AA4 5 VAL H 32  ? LEU H 41  ? VAL H 122 LEU H 131 
AA4 6 GLU H 52  ? THR H 56  ? GLU H 142 THR H 146 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU E 4   ? N LEU E 94  O LYS E 14  ? O LYS E 104 
AA1 2 3 N LEU E 17  ? N LEU E 107 O THR E 78  ? O THR E 168 
AA1 3 4 N VAL E 81  ? N VAL E 171 O LEU E 106 ? O LEU E 196 
AA1 4 5 O CYS E 105 ? O CYS E 195 N SER E 40  ? N SER E 130 
AA1 5 6 N VAL E 35  ? N VAL E 125 O LEU E 53  ? O LEU E 143 
AA2 1 2 N LEU F 4   ? N LEU F 94  O LYS F 14  ? O LYS F 104 
AA2 2 3 N LYS F 15  ? N LYS F 105 O MET F 80  ? O MET F 170 
AA2 3 4 N VAL F 81  ? N VAL F 171 O LEU F 106 ? O LEU F 196 
AA2 4 5 O CYS F 105 ? O CYS F 195 N SER F 40  ? N SER F 130 
AA2 5 6 N VAL F 35  ? N VAL F 125 O LEU F 53  ? O LEU F 143 
AA3 1 2 N LEU G 4   ? N LEU G 94  O LYS G 14  ? O LYS G 104 
AA3 2 3 N LYS G 15  ? N LYS G 105 O MET G 80  ? O MET G 170 
AA3 3 4 N VAL G 81  ? N VAL G 171 O LEU G 106 ? O LEU G 196 
AA3 4 5 O CYS G 105 ? O CYS G 195 N SER G 40  ? N SER G 130 
AA3 5 6 N LEU G 37  ? N LEU G 127 O GLU G 50  ? O GLU G 140 
AA4 1 2 N LEU H 4   ? N LEU H 94  O LYS H 14  ? O LYS H 104 
AA4 2 3 N LYS H 15  ? N LYS H 105 O MET H 80  ? O MET H 170 
AA4 3 4 N VAL H 81  ? N VAL H 171 O LEU H 106 ? O LEU H 196 
AA4 4 5 O CYS H 105 ? O CYS H 195 N SER H 40  ? N SER H 130 
AA4 5 6 N VAL H 35  ? N VAL H 125 O LEU H 53  ? O LEU H 143 
# 
_atom_sites.entry_id                    5MGX 
_atom_sites.fract_transf_matrix[1][1]   0.013461 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000729 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009466 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009996 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? -41.413 29.950  64.405  1.00 47.57  ? 702 ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? -42.138 28.747  64.819  1.00 47.33  ? 702 ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? -41.497 27.487  64.195  1.00 49.47  ? 702 ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? -41.253 26.532  64.937  1.00 50.00  ? 702 ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? -43.637 28.858  64.479  1.00 49.48  ? 702 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? -44.500 27.694  64.918  1.00 56.98  ? 702 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? -44.640 27.486  66.150  1.00 58.17  ? 702 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? -45.096 27.033  64.034  1.00 58.90  ? 702 ASP A OD2 1 
ATOM   9    N N   . THR A 1 2   ? -41.209 27.474  62.859  1.00 43.47  ? 703 THR A N   1 
ATOM   10   C CA  . THR A 1 2   ? -40.520 26.325  62.236  1.00 41.42  ? 703 THR A CA  1 
ATOM   11   C C   . THR A 1 2   ? -39.008 26.511  62.344  1.00 43.08  ? 703 THR A C   1 
ATOM   12   O O   . THR A 1 2   ? -38.470 27.516  61.872  1.00 42.40  ? 703 THR A O   1 
ATOM   13   C CB  . THR A 1 2   ? -40.925 26.063  60.772  1.00 38.34  ? 703 THR A CB  1 
ATOM   14   O OG1 . THR A 1 2   ? -42.275 25.621  60.737  1.00 39.19  ? 703 THR A OG1 1 
ATOM   15   C CG2 . THR A 1 2   ? -40.054 24.991  60.103  1.00 32.01  ? 703 THR A CG2 1 
ATOM   16   N N   . GLU A 1 3   ? -38.330 25.507  62.927  1.00 37.98  ? 704 GLU A N   1 
ATOM   17   C CA  . GLU A 1 3   ? -36.885 25.491  63.048  1.00 36.72  ? 704 GLU A CA  1 
ATOM   18   C C   . GLU A 1 3   ? -36.272 24.965  61.760  1.00 38.43  ? 704 GLU A C   1 
ATOM   19   O O   . GLU A 1 3   ? -36.407 23.790  61.428  1.00 38.16  ? 704 GLU A O   1 
ATOM   20   C CB  . GLU A 1 3   ? -36.430 24.659  64.259  1.00 38.00  ? 704 GLU A CB  1 
ATOM   21   N N   . MET A 1 4   ? -35.655 25.871  61.003  1.00 33.89  ? 705 MET A N   1 
ATOM   22   C CA  . MET A 1 4   ? -34.871 25.589  59.817  1.00 33.10  ? 705 MET A CA  1 
ATOM   23   C C   . MET A 1 4   ? -33.617 25.010  60.431  1.00 39.44  ? 705 MET A C   1 
ATOM   24   O O   . MET A 1 4   ? -33.321 25.338  61.589  1.00 40.71  ? 705 MET A O   1 
ATOM   25   C CB  . MET A 1 4   ? -34.590 26.853  58.991  1.00 34.85  ? 705 MET A CB  1 
ATOM   26   C CG  . MET A 1 4   ? -35.812 27.708  58.711  1.00 37.99  ? 705 MET A CG  1 
ATOM   27   S SD  . MET A 1 4   ? -37.074 26.932  57.675  1.00 40.90  ? 705 MET A SD  1 
ATOM   28   C CE  . MET A 1 4   ? -38.477 27.868  58.175  1.00 37.22  ? 705 MET A CE  1 
ATOM   29   N N   . GLU A 1 5   ? -32.883 24.167  59.729  1.00 35.73  ? 706 GLU A N   1 
ATOM   30   C CA  . GLU A 1 5   ? -31.712 23.440  60.239  1.00 35.65  ? 706 GLU A CA  1 
ATOM   31   C C   . GLU A 1 5   ? -32.170 22.123  60.844  1.00 37.83  ? 706 GLU A C   1 
ATOM   32   O O   . GLU A 1 5   ? -31.396 21.180  60.771  1.00 38.23  ? 706 GLU A O   1 
ATOM   33   C CB  . GLU A 1 5   ? -30.784 24.211  61.226  1.00 37.29  ? 706 GLU A CB  1 
ATOM   34   C CG  . GLU A 1 5   ? -29.625 24.954  60.565  1.00 47.83  ? 706 GLU A CG  1 
ATOM   35   C CD  . GLU A 1 5   ? -29.978 26.128  59.672  1.00 70.40  ? 706 GLU A CD  1 
ATOM   36   O OE1 . GLU A 1 5   ? -30.874 26.928  60.031  1.00 68.18  ? 706 GLU A OE1 1 
ATOM   37   O OE2 . GLU A 1 5   ? -29.323 26.268  58.617  1.00 65.19  ? 706 GLU A OE2 1 
ATOM   38   N N   . GLU A 1 6   ? -33.413 22.007  61.378  1.00 32.33  ? 707 GLU A N   1 
ATOM   39   C CA  . GLU A 1 6   ? -33.929 20.742  61.903  1.00 31.25  ? 707 GLU A CA  1 
ATOM   40   C C   . GLU A 1 6   ? -34.241 19.791  60.761  1.00 32.20  ? 707 GLU A C   1 
ATOM   41   O O   . GLU A 1 6   ? -34.618 20.225  59.667  1.00 32.13  ? 707 GLU A O   1 
ATOM   42   C CB  . GLU A 1 6   ? -35.163 20.938  62.787  1.00 32.48  ? 707 GLU A CB  1 
ATOM   43   C CG  . GLU A 1 6   ? -34.812 21.133  64.256  1.00 44.44  ? 707 GLU A CG  1 
ATOM   44   C CD  . GLU A 1 6   ? -35.944 21.034  65.264  1.00 62.28  ? 707 GLU A CD  1 
ATOM   45   O OE1 . GLU A 1 6   ? -37.084 20.708  64.860  1.00 65.67  ? 707 GLU A OE1 1 
ATOM   46   O OE2 . GLU A 1 6   ? -35.680 21.255  66.468  1.00 49.89  ? 707 GLU A OE2 1 
ATOM   47   N N   . VAL A 1 7   ? -34.060 18.504  61.017  1.00 25.07  ? 708 VAL A N   1 
ATOM   48   C CA  . VAL A 1 7   ? -34.242 17.445  60.047  1.00 24.16  ? 708 VAL A CA  1 
ATOM   49   C C   . VAL A 1 7   ? -35.499 16.641  60.459  1.00 30.29  ? 708 VAL A C   1 
ATOM   50   O O   . VAL A 1 7   ? -35.834 16.603  61.654  1.00 29.76  ? 708 VAL A O   1 
ATOM   51   C CB  . VAL A 1 7   ? -32.893 16.690  60.045  1.00 26.51  ? 708 VAL A CB  1 
ATOM   52   C CG1 . VAL A 1 7   ? -32.805 15.544  61.028  1.00 26.27  ? 708 VAL A CG1 1 
ATOM   53   C CG2 . VAL A 1 7   ? -32.391 16.360  58.668  1.00 25.78  ? 708 VAL A CG2 1 
ATOM   54   N N   . ASP A 1 8   ? -36.255 16.104  59.465  1.00 27.89  ? 709 ASP A N   1 
ATOM   55   C CA  . ASP A 1 8   ? -37.525 15.399  59.722  1.00 33.66  ? 709 ASP A CA  1 
ATOM   56   C C   . ASP A 1 8   ? -37.418 13.852  59.705  1.00 39.67  ? 709 ASP A C   1 
ATOM   57   O O   . ASP A 1 8   ? -36.333 13.302  59.409  1.00 43.92  ? 709 ASP A O   1 
ATOM   58   C CB  . ASP A 1 8   ? -38.596 15.847  58.703  1.00 36.44  ? 709 ASP A CB  1 
ATOM   59   C CG  . ASP A 1 8   ? -38.921 17.335  58.681  1.00 47.52  ? 709 ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 8   ? -39.089 17.927  59.773  1.00 47.39  ? 709 ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 8   ? -39.086 17.885  57.574  1.00 55.48  ? 709 ASP A OD2 1 
ATOM   62   O OXT . ASP A 1 8   ? -38.447 13.191  59.980  1.00 56.81  ? 709 ASP A OXT 1 
ATOM   63   N N   . ASP B 1 1   ? -40.454 7.463   -15.494 1.00 35.90  ? 702 ASP B N   1 
ATOM   64   C CA  . ASP B 1 1   ? -39.844 7.140   -14.198 1.00 35.84  ? 702 ASP B CA  1 
ATOM   65   C C   . ASP B 1 1   ? -38.873 8.229   -13.730 1.00 37.24  ? 702 ASP B C   1 
ATOM   66   O O   . ASP B 1 1   ? -38.149 8.809   -14.551 1.00 36.75  ? 702 ASP B O   1 
ATOM   67   C CB  . ASP B 1 1   ? -39.120 5.786   -14.237 1.00 37.73  ? 702 ASP B CB  1 
ATOM   68   C CG  . ASP B 1 1   ? -40.018 4.570   -14.099 1.00 48.81  ? 702 ASP B CG  1 
ATOM   69   O OD1 . ASP B 1 1   ? -41.191 4.733   -13.690 1.00 49.34  ? 702 ASP B OD1 1 
ATOM   70   O OD2 . ASP B 1 1   ? -39.538 3.450   -14.367 1.00 57.03  ? 702 ASP B OD2 1 
ATOM   71   N N   . THR B 1 2   ? -38.859 8.478   -12.400 1.00 31.55  ? 703 THR B N   1 
ATOM   72   C CA  . THR B 1 2   ? -38.055 9.495   -11.712 1.00 30.03  ? 703 THR B CA  1 
ATOM   73   C C   . THR B 1 2   ? -36.544 9.252   -11.857 1.00 33.32  ? 703 THR B C   1 
ATOM   74   O O   . THR B 1 2   ? -36.019 8.207   -11.450 1.00 33.09  ? 703 THR B O   1 
ATOM   75   C CB  . THR B 1 2   ? -38.427 9.604   -10.210 1.00 31.64  ? 703 THR B CB  1 
ATOM   76   O OG1 . THR B 1 2   ? -39.805 9.914   -10.066 1.00 29.26  ? 703 THR B OG1 1 
ATOM   77   C CG2 . THR B 1 2   ? -37.614 10.673  -9.472  1.00 26.03  ? 703 THR B CG2 1 
ATOM   78   N N   . GLU B 1 3   ? -35.849 10.277  -12.378 1.00 28.62  ? 704 GLU B N   1 
ATOM   79   C CA  . GLU B 1 3   ? -34.404 10.305  -12.529 1.00 27.71  ? 704 GLU B CA  1 
ATOM   80   C C   . GLU B 1 3   ? -33.804 10.798  -11.211 1.00 29.49  ? 704 GLU B C   1 
ATOM   81   O O   . GLU B 1 3   ? -33.921 11.973  -10.871 1.00 29.32  ? 704 GLU B O   1 
ATOM   82   C CB  . GLU B 1 3   ? -33.999 11.180  -13.729 1.00 28.89  ? 704 GLU B CB  1 
ATOM   83   C CG  . GLU B 1 3   ? -34.365 10.586  -15.079 1.00 41.79  ? 704 GLU B CG  1 
ATOM   84   C CD  . GLU B 1 3   ? -33.654 9.291   -15.429 1.00 70.70  ? 704 GLU B CD  1 
ATOM   85   O OE1 . GLU B 1 3   ? -34.310 8.224   -15.394 1.00 77.37  ? 704 GLU B OE1 1 
ATOM   86   O OE2 . GLU B 1 3   ? -32.437 9.340   -15.719 1.00 64.69  ? 704 GLU B OE2 1 
ATOM   87   N N   . MET B 1 4   ? -33.201 9.883   -10.458 1.00 25.27  ? 705 MET B N   1 
ATOM   88   C CA  . MET B 1 4   ? -32.618 10.145  -9.135  1.00 25.09  ? 705 MET B CA  1 
ATOM   89   C C   . MET B 1 4   ? -31.435 11.128  -9.093  1.00 28.37  ? 705 MET B C   1 
ATOM   90   O O   . MET B 1 4   ? -31.266 11.831  -8.086  1.00 27.80  ? 705 MET B O   1 
ATOM   91   C CB  . MET B 1 4   ? -32.197 8.820   -8.498  1.00 27.16  ? 705 MET B CB  1 
ATOM   92   C CG  . MET B 1 4   ? -33.356 7.848   -8.297  1.00 29.73  ? 705 MET B CG  1 
ATOM   93   S SD  . MET B 1 4   ? -34.645 8.478   -7.203  1.00 32.21  ? 705 MET B SD  1 
ATOM   94   C CE  . MET B 1 4   ? -36.018 7.612   -7.811  1.00 28.27  ? 705 MET B CE  1 
ATOM   95   N N   . GLU B 1 5   ? -30.630 11.181  -10.144 1.00 24.36  ? 706 GLU B N   1 
ATOM   96   C CA  . GLU B 1 5   ? -29.475 12.061  -10.161 1.00 24.53  ? 706 GLU B CA  1 
ATOM   97   C C   . GLU B 1 5   ? -29.876 13.488  -10.604 1.00 28.11  ? 706 GLU B C   1 
ATOM   98   O O   . GLU B 1 5   ? -29.117 14.429  -10.385 1.00 27.71  ? 706 GLU B O   1 
ATOM   99   C CB  . GLU B 1 5   ? -28.372 11.451  -11.042 1.00 26.25  ? 706 GLU B CB  1 
ATOM   100  C CG  . GLU B 1 5   ? -27.302 10.679  -10.267 1.00 35.07  ? 706 GLU B CG  1 
ATOM   101  C CD  . GLU B 1 5   ? -27.670 9.535   -9.332  1.00 55.14  ? 706 GLU B CD  1 
ATOM   102  O OE1 . GLU B 1 5   ? -28.523 8.697   -9.704  1.00 60.61  ? 706 GLU B OE1 1 
ATOM   103  O OE2 . GLU B 1 5   ? -27.034 9.430   -8.259  1.00 41.00  ? 706 GLU B OE2 1 
ATOM   104  N N   . GLU B 1 6   ? -31.105 13.642  -11.130 1.00 25.24  ? 707 GLU B N   1 
ATOM   105  C CA  . GLU B 1 6   ? -31.678 14.918  -11.552 1.00 24.71  ? 707 GLU B CA  1 
ATOM   106  C C   . GLU B 1 6   ? -32.004 15.781  -10.341 1.00 28.53  ? 707 GLU B C   1 
ATOM   107  O O   . GLU B 1 6   ? -32.300 15.288  -9.253  1.00 27.26  ? 707 GLU B O   1 
ATOM   108  C CB  . GLU B 1 6   ? -32.919 14.722  -12.424 1.00 26.22  ? 707 GLU B CB  1 
ATOM   109  C CG  . GLU B 1 6   ? -32.600 14.661  -13.910 1.00 34.05  ? 707 GLU B CG  1 
ATOM   110  C CD  . GLU B 1 6   ? -33.797 14.570  -14.839 1.00 53.62  ? 707 GLU B CD  1 
ATOM   111  O OE1 . GLU B 1 6   ? -34.918 14.927  -14.410 1.00 50.77  ? 707 GLU B OE1 1 
ATOM   112  O OE2 . GLU B 1 6   ? -33.616 14.131  -15.999 1.00 44.81  ? 707 GLU B OE2 1 
ATOM   113  N N   . VAL B 1 7   ? -31.902 17.082  -10.543 1.00 25.20  ? 708 VAL B N   1 
ATOM   114  C CA  . VAL B 1 7   ? -32.074 18.105  -9.533  1.00 23.81  ? 708 VAL B CA  1 
ATOM   115  C C   . VAL B 1 7   ? -33.386 18.870  -9.852  1.00 25.97  ? 708 VAL B C   1 
ATOM   116  O O   . VAL B 1 7   ? -33.806 18.909  -11.015 1.00 24.49  ? 708 VAL B O   1 
ATOM   117  C CB  . VAL B 1 7   ? -30.761 18.927  -9.596  1.00 27.14  ? 708 VAL B CB  1 
ATOM   118  C CG1 . VAL B 1 7   ? -30.778 20.077  -10.591 1.00 26.52  ? 708 VAL B CG1 1 
ATOM   119  C CG2 . VAL B 1 7   ? -30.215 19.287  -8.230  1.00 27.10  ? 708 VAL B CG2 1 
ATOM   120  N N   . ASP B 1 8   ? -34.064 19.407  -8.816  1.00 20.96  ? 709 ASP B N   1 
ATOM   121  C CA  . ASP B 1 8   ? -35.377 20.064  -8.965  1.00 17.66  ? 709 ASP B CA  1 
ATOM   122  C C   . ASP B 1 8   ? -35.321 21.613  -8.956  1.00 32.12  ? 709 ASP B C   1 
ATOM   123  O O   . ASP B 1 8   ? -34.238 22.206  -8.704  1.00 30.51  ? 709 ASP B O   1 
ATOM   124  C CB  . ASP B 1 8   ? -36.331 19.592  -7.838  1.00 18.96  ? 709 ASP B CB  1 
ATOM   125  C CG  . ASP B 1 8   ? -36.583 18.089  -7.772  1.00 23.36  ? 709 ASP B CG  1 
ATOM   126  O OD1 . ASP B 1 8   ? -36.796 17.476  -8.833  1.00 23.80  ? 709 ASP B OD1 1 
ATOM   127  O OD2 . ASP B 1 8   ? -36.636 17.548  -6.651  1.00 29.49  ? 709 ASP B OD2 1 
ATOM   128  O OXT . ASP B 1 8   ? -36.394 22.230  -9.162  1.00 49.09  ? 709 ASP B OXT 1 
ATOM   129  C CA  . GLU C 1 3   ? -2.569  -0.621  -12.456 1.00 13.58  ? 704 GLU C CA  1 
ATOM   130  C C   . GLU C 1 3   ? -3.161  -1.220  -11.187 1.00 18.79  ? 704 GLU C C   1 
ATOM   131  O O   . GLU C 1 3   ? -3.026  -2.411  -10.928 1.00 19.51  ? 704 GLU C O   1 
ATOM   132  C CB  . GLU C 1 3   ? -1.026  -0.577  -12.356 1.00 15.35  ? 704 GLU C CB  1 
ATOM   133  C CG  . GLU C 1 3   ? -0.389  0.702   -11.836 1.00 17.77  ? 704 GLU C CG  1 
ATOM   134  C CD  . GLU C 1 3   ? 1.128   0.658   -11.931 1.00 37.54  ? 704 GLU C CD  1 
ATOM   135  O OE1 . GLU C 1 3   ? 1.667   0.979   -13.020 1.00 20.65  ? 704 GLU C OE1 1 
ATOM   136  O OE2 . GLU C 1 3   ? 1.777   0.265   -10.932 1.00 26.19  ? 704 GLU C OE2 1 
ATOM   137  N N   . MET C 1 4   ? -3.894  -0.399  -10.449 1.00 15.47  ? 705 MET C N   1 
ATOM   138  C CA  . MET C 1 4   ? -4.532  -0.686  -9.156  1.00 15.69  ? 705 MET C CA  1 
ATOM   139  C C   . MET C 1 4   ? -5.748  -1.655  -9.167  1.00 18.86  ? 705 MET C C   1 
ATOM   140  O O   . MET C 1 4   ? -5.989  -2.324  -8.165  1.00 17.71  ? 705 MET C O   1 
ATOM   141  C CB  . MET C 1 4   ? -4.966  0.643   -8.528  1.00 18.14  ? 705 MET C CB  1 
ATOM   142  C CG  . MET C 1 4   ? -3.813  1.623   -8.313  1.00 22.63  ? 705 MET C CG  1 
ATOM   143  S SD  . MET C 1 4   ? -2.391  0.894   -7.450  1.00 27.16  ? 705 MET C SD  1 
ATOM   144  C CE  . MET C 1 4   ? -1.165  2.018   -7.859  1.00 23.51  ? 705 MET C CE  1 
ATOM   145  N N   . GLU C 1 5   ? -6.517  -1.693  -10.249 1.00 15.63  ? 706 GLU C N   1 
ATOM   146  C CA  . GLU C 1 5   ? -7.694  -2.564  -10.401 1.00 16.08  ? 706 GLU C CA  1 
ATOM   147  C C   . GLU C 1 5   ? -7.255  -4.013  -10.780 1.00 21.69  ? 706 GLU C C   1 
ATOM   148  O O   . GLU C 1 5   ? -8.017  -4.967  -10.608 1.00 22.33  ? 706 GLU C O   1 
ATOM   149  C CB  . GLU C 1 5   ? -8.664  -1.986  -11.460 1.00 17.08  ? 706 GLU C CB  1 
ATOM   150  C CG  . GLU C 1 5   ? -9.272  -0.610  -11.149 1.00 13.53  ? 706 GLU C CG  1 
ATOM   151  C CD  . GLU C 1 5   ? -10.273 -0.521  -10.016 1.00 28.88  ? 706 GLU C CD  1 
ATOM   152  O OE1 . GLU C 1 5   ? -11.256 -1.298  -10.037 1.00 35.67  ? 706 GLU C OE1 1 
ATOM   153  O OE2 . GLU C 1 5   ? -10.103 0.347   -9.129  1.00 23.07  ? 706 GLU C OE2 1 
ATOM   154  N N   . GLU C 1 6   ? -6.013  -4.166  -11.237 1.00 18.81  ? 707 GLU C N   1 
ATOM   155  C CA  . GLU C 1 6   ? -5.425  -5.460  -11.612 1.00 17.94  ? 707 GLU C CA  1 
ATOM   156  C C   . GLU C 1 6   ? -5.165  -6.331  -10.391 1.00 19.80  ? 707 GLU C C   1 
ATOM   157  O O   . GLU C 1 6   ? -4.862  -5.830  -9.310  1.00 18.60  ? 707 GLU C O   1 
ATOM   158  C CB  . GLU C 1 6   ? -4.111  -5.264  -12.362 1.00 19.26  ? 707 GLU C CB  1 
ATOM   159  C CG  . GLU C 1 6   ? -4.253  -5.099  -13.867 1.00 30.55  ? 707 GLU C CG  1 
ATOM   160  C CD  . GLU C 1 6   ? -2.941  -4.951  -14.623 1.00 52.62  ? 707 GLU C CD  1 
ATOM   161  O OE1 . GLU C 1 6   ? -1.871  -5.243  -14.038 1.00 43.78  ? 707 GLU C OE1 1 
ATOM   162  O OE2 . GLU C 1 6   ? -2.987  -4.554  -15.811 1.00 51.16  ? 707 GLU C OE2 1 
ATOM   163  N N   . VAL C 1 7   ? -5.273  -7.644  -10.575 1.00 15.99  ? 708 VAL C N   1 
ATOM   164  C CA  . VAL C 1 7   ? -4.987  -8.591  -9.509  1.00 15.31  ? 708 VAL C CA  1 
ATOM   165  C C   . VAL C 1 7   ? -3.690  -9.382  -9.882  1.00 19.43  ? 708 VAL C C   1 
ATOM   166  O O   . VAL C 1 7   ? -3.341  -9.467  -11.060 1.00 19.06  ? 708 VAL C O   1 
ATOM   167  C CB  . VAL C 1 7   ? -6.188  -9.499  -9.111  1.00 18.72  ? 708 VAL C CB  1 
ATOM   168  C CG1 . VAL C 1 7   ? -7.186  -8.780  -8.209  1.00 17.35  ? 708 VAL C CG1 1 
ATOM   169  C CG2 . VAL C 1 7   ? -6.849  -10.186 -10.302 1.00 18.19  ? 708 VAL C CG2 1 
ATOM   170  N N   . ASP C 1 8   ? -2.958  -9.895  -8.876  1.00 16.15  ? 709 ASP C N   1 
ATOM   171  C CA  . ASP C 1 8   ? -1.661  -10.552 -9.066  1.00 17.42  ? 709 ASP C CA  1 
ATOM   172  C C   . ASP C 1 8   ? -1.719  -12.104 -8.979  1.00 16.81  ? 709 ASP C C   1 
ATOM   173  O O   . ASP C 1 8   ? -2.822  -12.687 -8.918  1.00 16.75  ? 709 ASP C O   1 
ATOM   174  C CB  . ASP C 1 8   ? -0.637  -10.019 -8.029  1.00 19.77  ? 709 ASP C CB  1 
ATOM   175  C CG  . ASP C 1 8   ? -0.391  -8.518  -8.022  1.00 31.90  ? 709 ASP C CG  1 
ATOM   176  O OD1 . ASP C 1 8   ? -0.242  -7.937  -9.115  1.00 34.10  ? 709 ASP C OD1 1 
ATOM   177  O OD2 . ASP C 1 8   ? -0.267  -7.942  -6.915  1.00 35.39  ? 709 ASP C OD2 1 
ATOM   178  O OXT . ASP C 1 8   ? -0.647  -12.743 -8.923  1.00 19.45  ? 709 ASP C OXT 1 
ATOM   179  N N   . GLU D 1 3   ? 0.205   -15.628 36.663  1.00 52.64  ? 704 GLU D N   1 
ATOM   180  C CA  . GLU D 1 3   ? -0.188  -15.734 38.067  1.00 52.60  ? 704 GLU D CA  1 
ATOM   181  C C   . GLU D 1 3   ? 0.978   -16.206 38.960  1.00 56.49  ? 704 GLU D C   1 
ATOM   182  O O   . GLU D 1 3   ? 1.981   -16.731 38.463  1.00 56.62  ? 704 GLU D O   1 
ATOM   183  C CB  . GLU D 1 3   ? -1.388  -16.687 38.218  1.00 53.90  ? 704 GLU D CB  1 
ATOM   184  N N   . MET D 1 4   ? 0.836   -15.988 40.287  1.00 52.38  ? 705 MET D N   1 
ATOM   185  C CA  . MET D 1 4   ? 1.749   -16.356 41.387  1.00 52.08  ? 705 MET D CA  1 
ATOM   186  C C   . MET D 1 4   ? 3.055   -15.516 41.401  1.00 56.07  ? 705 MET D C   1 
ATOM   187  O O   . MET D 1 4   ? 3.596   -15.236 42.481  1.00 54.59  ? 705 MET D O   1 
ATOM   188  C CB  . MET D 1 4   ? 2.064   -17.868 41.399  1.00 54.32  ? 705 MET D CB  1 
ATOM   189  C CG  . MET D 1 4   ? 0.815   -18.785 41.400  1.00 57.76  ? 705 MET D CG  1 
ATOM   190  S SD  . MET D 1 4   ? -0.425  -18.515 42.702  1.00 61.61  ? 705 MET D SD  1 
ATOM   191  C CE  . MET D 1 4   ? -1.899  -18.337 41.699  1.00 58.22  ? 705 MET D CE  1 
ATOM   192  N N   . GLU D 1 5   ? 3.539   -15.108 40.213  1.00 53.71  ? 706 GLU D N   1 
ATOM   193  C CA  . GLU D 1 5   ? 4.720   -14.261 40.036  1.00 53.87  ? 706 GLU D CA  1 
ATOM   194  C C   . GLU D 1 5   ? 4.273   -12.897 39.456  1.00 57.36  ? 706 GLU D C   1 
ATOM   195  O O   . GLU D 1 5   ? 4.458   -12.651 38.259  1.00 57.74  ? 706 GLU D O   1 
ATOM   196  C CB  . GLU D 1 5   ? 5.771   -14.948 39.126  1.00 55.47  ? 706 GLU D CB  1 
ATOM   197  C CG  . GLU D 1 5   ? 6.178   -16.359 39.529  1.00 66.84  ? 706 GLU D CG  1 
ATOM   198  C CD  . GLU D 1 5   ? 7.102   -16.453 40.726  1.00 82.65  ? 706 GLU D CD  1 
ATOM   199  O OE1 . GLU D 1 5   ? 8.292   -16.087 40.591  1.00 77.06  ? 706 GLU D OE1 1 
ATOM   200  O OE2 . GLU D 1 5   ? 6.642   -16.923 41.791  1.00 70.30  ? 706 GLU D OE2 1 
ATOM   201  N N   . GLU D 1 6   ? 3.647   -12.035 40.300  1.00 52.81  ? 707 GLU D N   1 
ATOM   202  C CA  . GLU D 1 6   ? 3.144   -10.695 39.935  1.00 61.35  ? 707 GLU D CA  1 
ATOM   203  C C   . GLU D 1 6   ? 4.268   -9.806  39.359  1.00 93.11  ? 707 GLU D C   1 
ATOM   204  O O   . GLU D 1 6   ? 4.308   -9.552  38.151  1.00 48.83  ? 707 GLU D O   1 
ATOM   205  C CB  . GLU D 1 6   ? 2.491   -10.018 41.161  1.00 62.57  ? 707 GLU D CB  1 
ATOM   206  C CG  . GLU D 1 6   ? 2.205   -8.523  41.036  1.00 72.16  ? 707 GLU D CG  1 
ATOM   207  C CD  . GLU D 1 6   ? 0.979   -8.094  40.252  1.00 81.02  ? 707 GLU D CD  1 
ATOM   208  O OE1 . GLU D 1 6   ? 0.064   -7.501  40.867  1.00 69.01  ? 707 GLU D OE1 1 
ATOM   209  O OE2 . GLU D 1 6   ? 0.964   -8.281  39.014  1.00 67.13  ? 707 GLU D OE2 1 
ATOM   210  N N   . GLU E 2 2   ? -38.395 -35.819 -18.772 1.00 41.19  ? 92  GLU E N   1 
ATOM   211  C CA  . GLU E 2 2   ? -37.022 -36.262 -18.539 1.00 39.97  ? 92  GLU E CA  1 
ATOM   212  C C   . GLU E 2 2   ? -36.139 -35.094 -17.984 1.00 42.54  ? 92  GLU E C   1 
ATOM   213  O O   . GLU E 2 2   ? -35.109 -35.373 -17.355 1.00 42.05  ? 92  GLU E O   1 
ATOM   214  C CB  . GLU E 2 2   ? -36.433 -36.865 -19.836 1.00 40.95  ? 92  GLU E CB  1 
ATOM   215  C CG  . GLU E 2 2   ? -35.117 -37.618 -19.682 1.00 48.73  ? 92  GLU E CG  1 
ATOM   216  C CD  . GLU E 2 2   ? -35.186 -39.003 -19.072 1.00 66.21  ? 92  GLU E CD  1 
ATOM   217  O OE1 . GLU E 2 2   ? -35.410 -39.112 -17.843 1.00 52.82  ? 92  GLU E OE1 1 
ATOM   218  O OE2 . GLU E 2 2   ? -34.941 -39.980 -19.815 1.00 59.42  ? 92  GLU E OE2 1 
ATOM   219  N N   . TRP E 2 3   ? -36.562 -33.805 -18.184 1.00 37.11  ? 93  TRP E N   1 
ATOM   220  C CA  . TRP E 2 3   ? -35.842 -32.619 -17.696 1.00 35.37  ? 93  TRP E CA  1 
ATOM   221  C C   . TRP E 2 3   ? -36.103 -32.376 -16.211 1.00 34.83  ? 93  TRP E C   1 
ATOM   222  O O   . TRP E 2 3   ? -37.260 -32.213 -15.810 1.00 35.43  ? 93  TRP E O   1 
ATOM   223  C CB  . TRP E 2 3   ? -36.225 -31.349 -18.483 1.00 34.11  ? 93  TRP E CB  1 
ATOM   224  C CG  . TRP E 2 3   ? -35.554 -31.195 -19.816 1.00 35.21  ? 93  TRP E CG  1 
ATOM   225  C CD1 . TRP E 2 3   ? -36.120 -31.385 -21.042 1.00 38.09  ? 93  TRP E CD1 1 
ATOM   226  C CD2 . TRP E 2 3   ? -34.209 -30.751 -20.057 1.00 35.20  ? 93  TRP E CD2 1 
ATOM   227  N NE1 . TRP E 2 3   ? -35.202 -31.124 -22.034 1.00 37.82  ? 93  TRP E NE1 1 
ATOM   228  C CE2 . TRP E 2 3   ? -34.026 -30.712 -21.458 1.00 39.56  ? 93  TRP E CE2 1 
ATOM   229  C CE3 . TRP E 2 3   ? -33.135 -30.390 -19.225 1.00 36.41  ? 93  TRP E CE3 1 
ATOM   230  C CZ2 . TRP E 2 3   ? -32.815 -30.319 -22.044 1.00 38.76  ? 93  TRP E CZ2 1 
ATOM   231  C CZ3 . TRP E 2 3   ? -31.938 -30.006 -19.809 1.00 37.86  ? 93  TRP E CZ3 1 
ATOM   232  C CH2 . TRP E 2 3   ? -31.787 -29.976 -21.202 1.00 38.42  ? 93  TRP E CH2 1 
ATOM   233  N N   . LEU E 2 4   ? -35.032 -32.348 -15.395 1.00 25.52  ? 94  LEU E N   1 
ATOM   234  C CA  . LEU E 2 4   ? -35.160 -32.055 -13.976 1.00 22.62  ? 94  LEU E CA  1 
ATOM   235  C C   . LEU E 2 4   ? -34.951 -30.560 -13.772 1.00 26.45  ? 94  LEU E C   1 
ATOM   236  O O   . LEU E 2 4   ? -33.920 -30.032 -14.179 1.00 25.02  ? 94  LEU E O   1 
ATOM   237  C CB  . LEU E 2 4   ? -34.170 -32.878 -13.124 1.00 21.11  ? 94  LEU E CB  1 
ATOM   238  C CG  . LEU E 2 4   ? -33.971 -32.438 -11.655 1.00 24.30  ? 94  LEU E CG  1 
ATOM   239  C CD1 . LEU E 2 4   ? -35.208 -32.670 -10.812 1.00 23.79  ? 94  LEU E CD1 1 
ATOM   240  C CD2 . LEU E 2 4   ? -32.812 -33.161 -11.029 1.00 26.07  ? 94  LEU E CD2 1 
ATOM   241  N N   . ASP E 2 5   ? -35.935 -29.885 -13.161 1.00 23.11  ? 95  ASP E N   1 
ATOM   242  C CA  . ASP E 2 5   ? -35.876 -28.470 -12.846 1.00 22.79  ? 95  ASP E CA  1 
ATOM   243  C C   . ASP E 2 5   ? -35.290 -28.394 -11.452 1.00 28.17  ? 95  ASP E C   1 
ATOM   244  O O   . ASP E 2 5   ? -36.025 -28.476 -10.462 1.00 27.98  ? 95  ASP E O   1 
ATOM   245  C CB  . ASP E 2 5   ? -37.279 -27.837 -12.953 1.00 25.13  ? 95  ASP E CB  1 
ATOM   246  C CG  . ASP E 2 5   ? -37.333 -26.329 -12.791 1.00 34.83  ? 95  ASP E CG  1 
ATOM   247  O OD1 . ASP E 2 5   ? -36.265 -25.706 -12.663 1.00 33.48  ? 95  ASP E OD1 1 
ATOM   248  O OD2 . ASP E 2 5   ? -38.446 -25.773 -12.788 1.00 47.45  ? 95  ASP E OD2 1 
ATOM   249  N N   . ILE E 2 6   ? -33.936 -28.329 -11.385 1.00 23.67  ? 96  ILE E N   1 
ATOM   250  C CA  . ILE E 2 6   ? -33.127 -28.393 -10.163 1.00 21.89  ? 96  ILE E CA  1 
ATOM   251  C C   . ILE E 2 6   ? -33.563 -27.368 -9.089  1.00 24.65  ? 96  ILE E C   1 
ATOM   252  O O   . ILE E 2 6   ? -33.821 -27.752 -7.950  1.00 24.52  ? 96  ILE E O   1 
ATOM   253  C CB  . ILE E 2 6   ? -31.615 -28.259 -10.501 1.00 23.38  ? 96  ILE E CB  1 
ATOM   254  C CG1 . ILE E 2 6   ? -31.174 -29.355 -11.502 1.00 22.22  ? 96  ILE E CG1 1 
ATOM   255  C CG2 . ILE E 2 6   ? -30.761 -28.282 -9.219  1.00 22.51  ? 96  ILE E CG2 1 
ATOM   256  C CD1 . ILE E 2 6   ? -29.854 -29.162 -12.161 1.00 18.57  ? 96  ILE E CD1 1 
ATOM   257  N N   . LEU E 2 7   ? -33.606 -26.092 -9.433  1.00 21.05  ? 97  LEU E N   1 
ATOM   258  C CA  . LEU E 2 7   ? -33.919 -25.063 -8.451  1.00 22.00  ? 97  LEU E CA  1 
ATOM   259  C C   . LEU E 2 7   ? -35.418 -24.700 -8.412  1.00 29.12  ? 97  LEU E C   1 
ATOM   260  O O   . LEU E 2 7   ? -35.837 -23.920 -7.545  1.00 30.84  ? 97  LEU E O   1 
ATOM   261  C CB  . LEU E 2 7   ? -33.067 -23.825 -8.728  1.00 22.01  ? 97  LEU E CB  1 
ATOM   262  C CG  . LEU E 2 7   ? -31.559 -24.064 -8.788  1.00 25.36  ? 97  LEU E CG  1 
ATOM   263  C CD1 . LEU E 2 7   ? -30.888 -22.957 -9.508  1.00 25.41  ? 97  LEU E CD1 1 
ATOM   264  C CD2 . LEU E 2 7   ? -30.968 -24.266 -7.400  1.00 24.54  ? 97  LEU E CD2 1 
ATOM   265  N N   . GLY E 2 8   ? -36.202 -25.304 -9.302  1.00 24.38  ? 98  GLY E N   1 
ATOM   266  C CA  . GLY E 2 8   ? -37.644 -25.113 -9.370  1.00 24.97  ? 98  GLY E CA  1 
ATOM   267  C C   . GLY E 2 8   ? -38.114 -23.888 -10.133 1.00 29.86  ? 98  GLY E C   1 
ATOM   268  O O   . GLY E 2 8   ? -39.325 -23.723 -10.317 1.00 29.07  ? 98  GLY E O   1 
ATOM   269  N N   . ASN E 2 9   ? -37.167 -23.024 -10.586 1.00 26.04  ? 99  ASN E N   1 
ATOM   270  C CA  . ASN E 2 9   ? -37.453 -21.755 -11.276 1.00 26.32  ? 99  ASN E CA  1 
ATOM   271  C C   . ASN E 2 9   ? -37.339 -21.836 -12.825 1.00 30.77  ? 99  ASN E C   1 
ATOM   272  O O   . ASN E 2 9   ? -37.630 -20.857 -13.514 1.00 30.30  ? 99  ASN E O   1 
ATOM   273  C CB  . ASN E 2 9   ? -36.524 -20.632 -10.731 1.00 26.30  ? 99  ASN E CB  1 
ATOM   274  C CG  . ASN E 2 9   ? -35.047 -20.959 -10.684 1.00 40.15  ? 99  ASN E CG  1 
ATOM   275  O OD1 . ASN E 2 9   ? -34.527 -21.753 -11.482 1.00 34.95  ? 99  ASN E OD1 1 
ATOM   276  N ND2 . ASN E 2 9   ? -34.328 -20.323 -9.762  1.00 26.23  ? 99  ASN E ND2 1 
ATOM   277  N N   . GLY E 2 10  ? -36.903 -22.980 -13.343 1.00 27.81  ? 100 GLY E N   1 
ATOM   278  C CA  . GLY E 2 10  ? -36.711 -23.192 -14.777 1.00 27.62  ? 100 GLY E CA  1 
ATOM   279  C C   . GLY E 2 10  ? -35.412 -22.632 -15.333 1.00 30.01  ? 100 GLY E C   1 
ATOM   280  O O   . GLY E 2 10  ? -35.173 -22.725 -16.540 1.00 30.80  ? 100 GLY E O   1 
ATOM   281  N N   . LEU E 2 11  ? -34.555 -22.069 -14.463 1.00 24.61  ? 101 LEU E N   1 
ATOM   282  C CA  . LEU E 2 11  ? -33.283 -21.447 -14.853 1.00 23.58  ? 101 LEU E CA  1 
ATOM   283  C C   . LEU E 2 11  ? -32.083 -22.403 -14.855 1.00 25.80  ? 101 LEU E C   1 
ATOM   284  O O   . LEU E 2 11  ? -31.042 -22.028 -15.376 1.00 25.68  ? 101 LEU E O   1 
ATOM   285  C CB  . LEU E 2 11  ? -32.967 -20.252 -13.951 1.00 22.96  ? 101 LEU E CB  1 
ATOM   286  C CG  . LEU E 2 11  ? -33.920 -19.071 -13.967 1.00 27.02  ? 101 LEU E CG  1 
ATOM   287  C CD1 . LEU E 2 11  ? -33.387 -17.976 -13.114 1.00 26.62  ? 101 LEU E CD1 1 
ATOM   288  C CD2 . LEU E 2 11  ? -34.149 -18.555 -15.369 1.00 30.45  ? 101 LEU E CD2 1 
ATOM   289  N N   . LEU E 2 12  ? -32.207 -23.598 -14.260 1.00 21.36  ? 102 LEU E N   1 
ATOM   290  C CA  . LEU E 2 12  ? -31.140 -24.600 -14.211 1.00 21.34  ? 102 LEU E CA  1 
ATOM   291  C C   . LEU E 2 12  ? -31.777 -25.989 -14.352 1.00 27.74  ? 102 LEU E C   1 
ATOM   292  O O   . LEU E 2 12  ? -32.292 -26.545 -13.370 1.00 27.82  ? 102 LEU E O   1 
ATOM   293  C CB  . LEU E 2 12  ? -30.310 -24.455 -12.916 1.00 20.83  ? 102 LEU E CB  1 
ATOM   294  C CG  . LEU E 2 12  ? -29.127 -25.393 -12.733 1.00 24.74  ? 102 LEU E CG  1 
ATOM   295  C CD1 . LEU E 2 12  ? -27.974 -25.011 -13.623 1.00 24.54  ? 102 LEU E CD1 1 
ATOM   296  C CD2 . LEU E 2 12  ? -28.655 -25.376 -11.303 1.00 27.14  ? 102 LEU E CD2 1 
ATOM   297  N N   . ARG E 2 13  ? -31.801 -26.503 -15.601 1.00 24.63  ? 103 ARG E N   1 
ATOM   298  C CA  . ARG E 2 13  ? -32.444 -27.776 -15.948 1.00 25.35  ? 103 ARG E CA  1 
ATOM   299  C C   . ARG E 2 13  ? -31.429 -28.843 -16.390 1.00 28.50  ? 103 ARG E C   1 
ATOM   300  O O   . ARG E 2 13  ? -30.521 -28.531 -17.149 1.00 29.83  ? 103 ARG E O   1 
ATOM   301  C CB  . ARG E 2 13  ? -33.484 -27.547 -17.053 1.00 25.95  ? 103 ARG E CB  1 
ATOM   302  C CG  . ARG E 2 13  ? -34.665 -26.655 -16.651 1.00 38.23  ? 103 ARG E CG  1 
ATOM   303  C CD  . ARG E 2 13  ? -35.371 -26.065 -17.854 1.00 50.46  ? 103 ARG E CD  1 
ATOM   304  N NE  . ARG E 2 13  ? -35.720 -27.114 -18.818 1.00 68.08  ? 103 ARG E NE  1 
ATOM   305  C CZ  . ARG E 2 13  ? -36.546 -26.960 -19.850 1.00 92.34  ? 103 ARG E CZ  1 
ATOM   306  N NH1 . ARG E 2 13  ? -37.073 -25.777 -20.114 1.00 87.04  ? 103 ARG E NH1 1 
ATOM   307  N NH2 . ARG E 2 13  ? -36.812 -27.979 -20.651 1.00 80.53  ? 103 ARG E NH2 1 
ATOM   308  N N   . LYS E 2 14  ? -31.600 -30.093 -15.929 1.00 23.26  ? 104 LYS E N   1 
ATOM   309  C CA  . LYS E 2 14  ? -30.709 -31.218 -16.228 1.00 22.63  ? 104 LYS E CA  1 
ATOM   310  C C   . LYS E 2 14  ? -31.440 -32.406 -16.880 1.00 26.90  ? 104 LYS E C   1 
ATOM   311  O O   . LYS E 2 14  ? -32.464 -32.858 -16.385 1.00 27.83  ? 104 LYS E O   1 
ATOM   312  C CB  . LYS E 2 14  ? -30.013 -31.687 -14.935 1.00 23.79  ? 104 LYS E CB  1 
ATOM   313  C CG  . LYS E 2 14  ? -29.043 -32.845 -15.115 1.00 27.15  ? 104 LYS E CG  1 
ATOM   314  C CD  . LYS E 2 14  ? -28.681 -33.455 -13.791 1.00 37.66  ? 104 LYS E CD  1 
ATOM   315  C CE  . LYS E 2 14  ? -28.075 -34.818 -13.953 1.00 38.09  ? 104 LYS E CE  1 
ATOM   316  N NZ  . LYS E 2 14  ? -29.115 -35.859 -14.131 1.00 39.14  ? 104 LYS E NZ  1 
ATOM   317  N N   . LYS E 2 15  ? -30.873 -32.938 -17.956 1.00 23.92  ? 105 LYS E N   1 
ATOM   318  C CA  . LYS E 2 15  ? -31.403 -34.111 -18.644 1.00 24.21  ? 105 LYS E CA  1 
ATOM   319  C C   . LYS E 2 15  ? -30.284 -35.132 -18.802 1.00 29.05  ? 105 LYS E C   1 
ATOM   320  O O   . LYS E 2 15  ? -29.237 -34.798 -19.353 1.00 28.88  ? 105 LYS E O   1 
ATOM   321  C CB  . LYS E 2 15  ? -32.013 -33.725 -19.999 1.00 26.53  ? 105 LYS E CB  1 
ATOM   322  C CG  . LYS E 2 15  ? -32.902 -34.804 -20.617 1.00 40.10  ? 105 LYS E CG  1 
ATOM   323  C CD  . LYS E 2 15  ? -33.548 -34.310 -21.899 1.00 47.30  ? 105 LYS E CD  1 
ATOM   324  C CE  . LYS E 2 15  ? -34.425 -35.327 -22.569 1.00 60.81  ? 105 LYS E CE  1 
ATOM   325  N NZ  . LYS E 2 15  ? -34.851 -34.845 -23.907 1.00 73.85  ? 105 LYS E NZ  1 
ATOM   326  N N   . THR E 2 16  ? -30.484 -36.360 -18.279 1.00 26.14  ? 106 THR E N   1 
ATOM   327  C CA  . THR E 2 16  ? -29.487 -37.444 -18.376 1.00 25.20  ? 106 THR E CA  1 
ATOM   328  C C   . THR E 2 16  ? -29.527 -37.995 -19.793 1.00 28.46  ? 106 THR E C   1 
ATOM   329  O O   . THR E 2 16  ? -30.602 -38.366 -20.264 1.00 28.27  ? 106 THR E O   1 
ATOM   330  C CB  . THR E 2 16  ? -29.739 -38.532 -17.313 1.00 27.32  ? 106 THR E CB  1 
ATOM   331  O OG1 . THR E 2 16  ? -29.710 -37.924 -16.028 1.00 28.47  ? 106 THR E OG1 1 
ATOM   332  C CG2 . THR E 2 16  ? -28.713 -39.674 -17.361 1.00 27.91  ? 106 THR E CG2 1 
ATOM   333  N N   . LEU E 2 17  ? -28.375 -37.990 -20.483 1.00 23.77  ? 107 LEU E N   1 
ATOM   334  C CA  . LEU E 2 17  ? -28.244 -38.492 -21.852 1.00 23.30  ? 107 LEU E CA  1 
ATOM   335  C C   . LEU E 2 17  ? -27.809 -39.949 -21.803 1.00 29.41  ? 107 LEU E C   1 
ATOM   336  O O   . LEU E 2 17  ? -28.465 -40.817 -22.380 1.00 30.01  ? 107 LEU E O   1 
ATOM   337  C CB  . LEU E 2 17  ? -27.240 -37.644 -22.680 1.00 23.29  ? 107 LEU E CB  1 
ATOM   338  C CG  . LEU E 2 17  ? -27.543 -36.149 -22.903 1.00 28.40  ? 107 LEU E CG  1 
ATOM   339  C CD1 . LEU E 2 17  ? -26.558 -35.531 -23.827 1.00 32.39  ? 107 LEU E CD1 1 
ATOM   340  C CD2 . LEU E 2 17  ? -28.975 -35.902 -23.327 1.00 28.16  ? 107 LEU E CD2 1 
ATOM   341  N N   . VAL E 2 18  ? -26.706 -40.208 -21.084 1.00 26.47  ? 108 VAL E N   1 
ATOM   342  C CA  . VAL E 2 18  ? -26.118 -41.517 -20.865 1.00 27.14  ? 108 VAL E CA  1 
ATOM   343  C C   . VAL E 2 18  ? -26.018 -41.718 -19.354 1.00 33.70  ? 108 VAL E C   1 
ATOM   344  O O   . VAL E 2 18  ? -25.353 -40.923 -18.691 1.00 33.96  ? 108 VAL E O   1 
ATOM   345  C CB  . VAL E 2 18  ? -24.733 -41.679 -21.559 1.00 31.16  ? 108 VAL E CB  1 
ATOM   346  C CG1 . VAL E 2 18  ? -24.093 -43.024 -21.222 1.00 31.47  ? 108 VAL E CG1 1 
ATOM   347  C CG2 . VAL E 2 18  ? -24.833 -41.496 -23.064 1.00 30.81  ? 108 VAL E CG2 1 
ATOM   348  N N   . PRO E 2 19  ? -26.649 -42.761 -18.777 1.00 31.38  ? 109 PRO E N   1 
ATOM   349  C CA  . PRO E 2 19  ? -26.500 -42.977 -17.332 1.00 30.42  ? 109 PRO E CA  1 
ATOM   350  C C   . PRO E 2 19  ? -25.133 -43.569 -17.012 1.00 31.01  ? 109 PRO E C   1 
ATOM   351  O O   . PRO E 2 19  ? -24.416 -43.995 -17.916 1.00 29.79  ? 109 PRO E O   1 
ATOM   352  C CB  . PRO E 2 19  ? -27.642 -43.936 -16.989 1.00 32.80  ? 109 PRO E CB  1 
ATOM   353  C CG  . PRO E 2 19  ? -27.927 -44.669 -18.256 1.00 38.55  ? 109 PRO E CG  1 
ATOM   354  C CD  . PRO E 2 19  ? -27.473 -43.815 -19.411 1.00 34.11  ? 109 PRO E CD  1 
ATOM   355  N N   . GLY E 2 20  ? -24.777 -43.543 -15.733 1.00 27.00  ? 110 GLY E N   1 
ATOM   356  C CA  . GLY E 2 20  ? -23.525 -44.078 -15.224 1.00 26.94  ? 110 GLY E CA  1 
ATOM   357  C C   . GLY E 2 20  ? -23.490 -45.598 -15.289 1.00 31.71  ? 110 GLY E C   1 
ATOM   358  O O   . GLY E 2 20  ? -24.547 -46.242 -15.279 1.00 31.00  ? 110 GLY E O   1 
ATOM   359  N N   . PRO E 2 21  ? -22.289 -46.204 -15.408 1.00 27.64  ? 111 PRO E N   1 
ATOM   360  C CA  . PRO E 2 21  ? -22.225 -47.669 -15.505 1.00 27.34  ? 111 PRO E CA  1 
ATOM   361  C C   . PRO E 2 21  ? -22.740 -48.369 -14.243 1.00 31.86  ? 111 PRO E C   1 
ATOM   362  O O   . PRO E 2 21  ? -22.823 -47.733 -13.189 1.00 30.53  ? 111 PRO E O   1 
ATOM   363  C CB  . PRO E 2 21  ? -20.740 -47.952 -15.740 1.00 28.87  ? 111 PRO E CB  1 
ATOM   364  C CG  . PRO E 2 21  ? -20.031 -46.760 -15.292 1.00 33.24  ? 111 PRO E CG  1 
ATOM   365  C CD  . PRO E 2 21  ? -20.947 -45.597 -15.458 1.00 28.73  ? 111 PRO E CD  1 
ATOM   366  N N   . PRO E 2 22  ? -23.117 -49.665 -14.317 1.00 29.98  ? 112 PRO E N   1 
ATOM   367  C CA  . PRO E 2 22  ? -23.581 -50.349 -13.097 1.00 30.05  ? 112 PRO E CA  1 
ATOM   368  C C   . PRO E 2 22  ? -22.528 -50.273 -11.974 1.00 33.68  ? 112 PRO E C   1 
ATOM   369  O O   . PRO E 2 22  ? -21.323 -50.456 -12.229 1.00 32.03  ? 112 PRO E O   1 
ATOM   370  C CB  . PRO E 2 22  ? -23.825 -51.795 -13.570 1.00 31.83  ? 112 PRO E CB  1 
ATOM   371  C CG  . PRO E 2 22  ? -24.070 -51.682 -15.057 1.00 36.19  ? 112 PRO E CG  1 
ATOM   372  C CD  . PRO E 2 22  ? -23.128 -50.578 -15.487 1.00 32.04  ? 112 PRO E CD  1 
ATOM   373  N N   . GLY E 2 23  ? -22.988 -49.932 -10.760 1.00 30.99  ? 113 GLY E N   1 
ATOM   374  C CA  . GLY E 2 23  ? -22.131 -49.771 -9.580  1.00 30.24  ? 113 GLY E CA  1 
ATOM   375  C C   . GLY E 2 23  ? -21.674 -48.344 -9.267  1.00 32.26  ? 113 GLY E C   1 
ATOM   376  O O   . GLY E 2 23  ? -21.139 -48.096 -8.177  1.00 31.77  ? 113 GLY E O   1 
ATOM   377  N N   . SER E 2 24  ? -21.911 -47.388 -10.201 1.00 26.56  ? 114 SER E N   1 
ATOM   378  C CA  . SER E 2 24  ? -21.505 -45.966 -10.097 1.00 25.69  ? 114 SER E CA  1 
ATOM   379  C C   . SER E 2 24  ? -22.417 -45.127 -9.211  1.00 29.46  ? 114 SER E C   1 
ATOM   380  O O   . SER E 2 24  ? -23.632 -45.226 -9.335  1.00 29.01  ? 114 SER E O   1 
ATOM   381  C CB  . SER E 2 24  ? -21.462 -45.320 -11.475 1.00 25.05  ? 114 SER E CB  1 
ATOM   382  O OG  . SER E 2 24  ? -22.772 -45.049 -11.940 1.00 28.52  ? 114 SER E OG  1 
ATOM   383  N N   . SER E 2 25  ? -21.826 -44.220 -8.403  1.00 25.66  ? 115 SER E N   1 
ATOM   384  C CA  . SER E 2 25  ? -22.575 -43.337 -7.501  1.00 24.26  ? 115 SER E CA  1 
ATOM   385  C C   . SER E 2 25  ? -22.252 -41.845 -7.737  1.00 26.82  ? 115 SER E C   1 
ATOM   386  O O   . SER E 2 25  ? -21.366 -41.516 -8.530  1.00 25.86  ? 115 SER E O   1 
ATOM   387  C CB  . SER E 2 25  ? -22.310 -43.719 -6.052  1.00 27.22  ? 115 SER E CB  1 
ATOM   388  O OG  . SER E 2 25  ? -20.936 -44.001 -5.860  1.00 35.48  ? 115 SER E OG  1 
ATOM   389  N N   . ARG E 2 26  ? -23.011 -40.951 -7.072  1.00 23.22  ? 116 ARG E N   1 
ATOM   390  C CA  . ARG E 2 26  ? -22.894 -39.493 -7.166  1.00 22.78  ? 116 ARG E CA  1 
ATOM   391  C C   . ARG E 2 26  ? -21.708 -38.920 -6.362  1.00 26.42  ? 116 ARG E C   1 
ATOM   392  O O   . ARG E 2 26  ? -21.424 -39.398 -5.262  1.00 26.58  ? 116 ARG E O   1 
ATOM   393  C CB  . ARG E 2 26  ? -24.185 -38.831 -6.704  1.00 19.39  ? 116 ARG E CB  1 
ATOM   394  C CG  . ARG E 2 26  ? -25.179 -38.664 -7.818  1.00 18.12  ? 116 ARG E CG  1 
ATOM   395  C CD  . ARG E 2 26  ? -26.578 -38.831 -7.324  1.00 17.79  ? 116 ARG E CD  1 
ATOM   396  N NE  . ARG E 2 26  ? -27.515 -38.841 -8.445  1.00 26.00  ? 116 ARG E NE  1 
ATOM   397  C CZ  . ARG E 2 26  ? -28.719 -38.292 -8.412  1.00 28.24  ? 116 ARG E CZ  1 
ATOM   398  N NH1 . ARG E 2 26  ? -29.146 -37.679 -7.316  1.00 10.49  ? 116 ARG E NH1 1 
ATOM   399  N NH2 . ARG E 2 26  ? -29.506 -38.348 -9.473  1.00 20.43  ? 116 ARG E NH2 1 
ATOM   400  N N   . PRO E 2 27  ? -21.035 -37.862 -6.874  1.00 22.38  ? 117 PRO E N   1 
ATOM   401  C CA  . PRO E 2 27  ? -19.935 -37.260 -6.113  1.00 21.38  ? 117 PRO E CA  1 
ATOM   402  C C   . PRO E 2 27  ? -20.469 -36.461 -4.924  1.00 23.84  ? 117 PRO E C   1 
ATOM   403  O O   . PRO E 2 27  ? -21.630 -36.059 -4.945  1.00 23.51  ? 117 PRO E O   1 
ATOM   404  C CB  . PRO E 2 27  ? -19.248 -36.374 -7.148  1.00 22.84  ? 117 PRO E CB  1 
ATOM   405  C CG  . PRO E 2 27  ? -20.328 -35.969 -8.064  1.00 27.82  ? 117 PRO E CG  1 
ATOM   406  C CD  . PRO E 2 27  ? -21.249 -37.148 -8.148  1.00 23.90  ? 117 PRO E CD  1 
ATOM   407  N N   . VAL E 2 28  ? -19.645 -36.273 -3.882  1.00 18.16  ? 118 VAL E N   1 
ATOM   408  C CA  . VAL E 2 28  ? -20.005 -35.552 -2.664  1.00 17.82  ? 118 VAL E CA  1 
ATOM   409  C C   . VAL E 2 28  ? -19.149 -34.258 -2.557  1.00 23.01  ? 118 VAL E C   1 
ATOM   410  O O   . VAL E 2 28  ? -18.055 -34.184 -3.122  1.00 21.38  ? 118 VAL E O   1 
ATOM   411  C CB  . VAL E 2 28  ? -19.902 -36.439 -1.382  1.00 21.65  ? 118 VAL E CB  1 
ATOM   412  C CG1 . VAL E 2 28  ? -20.671 -37.764 -1.540  1.00 21.66  ? 118 VAL E CG1 1 
ATOM   413  C CG2 . VAL E 2 28  ? -18.458 -36.714 -0.984  1.00 21.58  ? 118 VAL E CG2 1 
ATOM   414  N N   . LYS E 2 29  ? -19.653 -33.258 -1.822  1.00 19.41  ? 119 LYS E N   1 
ATOM   415  C CA  . LYS E 2 29  ? -18.988 -31.972 -1.587  1.00 18.98  ? 119 LYS E CA  1 
ATOM   416  C C   . LYS E 2 29  ? -17.567 -32.207 -1.076  1.00 23.50  ? 119 LYS E C   1 
ATOM   417  O O   . LYS E 2 29  ? -17.371 -33.010 -0.171  1.00 24.64  ? 119 LYS E O   1 
ATOM   418  C CB  . LYS E 2 29  ? -19.802 -31.151 -0.573  1.00 20.95  ? 119 LYS E CB  1 
ATOM   419  C CG  . LYS E 2 29  ? -19.199 -29.814 -0.156  1.00 25.84  ? 119 LYS E CG  1 
ATOM   420  C CD  . LYS E 2 29  ? -20.007 -29.225 0.991   1.00 40.67  ? 119 LYS E CD  1 
ATOM   421  C CE  . LYS E 2 29  ? -19.610 -27.833 1.368   1.00 51.00  ? 119 LYS E CE  1 
ATOM   422  N NZ  . LYS E 2 29  ? -20.647 -27.223 2.247   1.00 57.09  ? 119 LYS E NZ  1 
ATOM   423  N N   . GLY E 2 30  ? -16.604 -31.539 -1.695  1.00 19.59  ? 120 GLY E N   1 
ATOM   424  C CA  . GLY E 2 30  ? -15.190 -31.636 -1.346  1.00 19.52  ? 120 GLY E CA  1 
ATOM   425  C C   . GLY E 2 30  ? -14.375 -32.505 -2.282  1.00 22.99  ? 120 GLY E C   1 
ATOM   426  O O   . GLY E 2 30  ? -13.156 -32.386 -2.319  1.00 24.80  ? 120 GLY E O   1 
ATOM   427  N N   . GLN E 2 31  ? -15.033 -33.396 -3.037  1.00 16.91  ? 121 GLN E N   1 
ATOM   428  C CA  . GLN E 2 31  ? -14.346 -34.302 -3.950  1.00 15.45  ? 121 GLN E CA  1 
ATOM   429  C C   . GLN E 2 31  ? -13.795 -33.568 -5.136  1.00 14.71  ? 121 GLN E C   1 
ATOM   430  O O   . GLN E 2 31  ? -14.390 -32.603 -5.612  1.00 12.96  ? 121 GLN E O   1 
ATOM   431  C CB  . GLN E 2 31  ? -15.264 -35.440 -4.423  1.00 15.46  ? 121 GLN E CB  1 
ATOM   432  C CG  . GLN E 2 31  ? -15.554 -36.456 -3.323  1.00 18.07  ? 121 GLN E CG  1 
ATOM   433  C CD  . GLN E 2 31  ? -16.114 -37.770 -3.813  1.00 28.23  ? 121 GLN E CD  1 
ATOM   434  O OE1 . GLN E 2 31  ? -16.835 -37.858 -4.823  1.00 23.29  ? 121 GLN E OE1 1 
ATOM   435  N NE2 . GLN E 2 31  ? -15.821 -38.820 -3.079  1.00 20.89  ? 121 GLN E NE2 1 
ATOM   436  N N   . VAL E 2 32  ? -12.654 -34.036 -5.604  1.00 12.75  ? 122 VAL E N   1 
ATOM   437  C CA  . VAL E 2 32  ? -12.054 -33.429 -6.782  1.00 14.07  ? 122 VAL E CA  1 
ATOM   438  C C   . VAL E 2 32  ? -12.636 -34.193 -7.952  1.00 18.40  ? 122 VAL E C   1 
ATOM   439  O O   . VAL E 2 32  ? -12.395 -35.401 -8.070  1.00 16.55  ? 122 VAL E O   1 
ATOM   440  C CB  . VAL E 2 32  ? -10.510 -33.395 -6.760  1.00 17.71  ? 122 VAL E CB  1 
ATOM   441  C CG1 . VAL E 2 32  ? -9.961  -32.834 -8.071  1.00 17.86  ? 122 VAL E CG1 1 
ATOM   442  C CG2 . VAL E 2 32  ? -9.999  -32.583 -5.581  1.00 17.00  ? 122 VAL E CG2 1 
ATOM   443  N N   . VAL E 2 33  ? -13.433 -33.490 -8.786  1.00 16.51  ? 123 VAL E N   1 
ATOM   444  C CA  . VAL E 2 33  ? -14.104 -34.090 -9.937  1.00 16.06  ? 123 VAL E CA  1 
ATOM   445  C C   . VAL E 2 33  ? -13.455 -33.643 -11.248 1.00 21.60  ? 123 VAL E C   1 
ATOM   446  O O   . VAL E 2 33  ? -13.010 -32.495 -11.364 1.00 23.61  ? 123 VAL E O   1 
ATOM   447  C CB  . VAL E 2 33  ? -15.640 -33.816 -9.947  1.00 19.10  ? 123 VAL E CB  1 
ATOM   448  C CG1 . VAL E 2 33  ? -16.349 -34.485 -8.771  1.00 18.23  ? 123 VAL E CG1 1 
ATOM   449  C CG2 . VAL E 2 33  ? -15.962 -32.323 -10.004 1.00 18.93  ? 123 VAL E CG2 1 
ATOM   450  N N   . THR E 2 34  ? -13.403 -34.558 -12.232 1.00 16.06  ? 124 THR E N   1 
ATOM   451  C CA  . THR E 2 34  ? -12.897 -34.313 -13.586 1.00 14.01  ? 124 THR E CA  1 
ATOM   452  C C   . THR E 2 34  ? -14.047 -34.499 -14.546 1.00 17.79  ? 124 THR E C   1 
ATOM   453  O O   . THR E 2 34  ? -14.705 -35.543 -14.533 1.00 17.97  ? 124 THR E O   1 
ATOM   454  C CB  . THR E 2 34  ? -11.707 -35.222 -13.933 1.00 17.13  ? 124 THR E CB  1 
ATOM   455  O OG1 . THR E 2 34  ? -10.707 -35.083 -12.949 1.00 22.29  ? 124 THR E OG1 1 
ATOM   456  C CG2 . THR E 2 34  ? -11.082 -34.896 -15.279 1.00 11.88  ? 124 THR E CG2 1 
ATOM   457  N N   . VAL E 2 35  ? -14.318 -33.484 -15.365 1.00 14.07  ? 125 VAL E N   1 
ATOM   458  C CA  . VAL E 2 35  ? -15.406 -33.565 -16.338 1.00 13.78  ? 125 VAL E CA  1 
ATOM   459  C C   . VAL E 2 35  ? -14.871 -33.296 -17.764 1.00 19.83  ? 125 VAL E C   1 
ATOM   460  O O   . VAL E 2 35  ? -13.767 -32.772 -17.929 1.00 17.57  ? 125 VAL E O   1 
ATOM   461  C CB  . VAL E 2 35  ? -16.597 -32.609 -15.981 1.00 17.11  ? 125 VAL E CB  1 
ATOM   462  C CG1 . VAL E 2 35  ? -17.183 -32.913 -14.605 1.00 16.89  ? 125 VAL E CG1 1 
ATOM   463  C CG2 . VAL E 2 35  ? -16.205 -31.136 -16.087 1.00 16.84  ? 125 VAL E CG2 1 
ATOM   464  N N   . HIS E 2 36  ? -15.656 -33.699 -18.775 1.00 18.90  ? 126 HIS E N   1 
ATOM   465  C CA  . HIS E 2 36  ? -15.482 -33.380 -20.180 1.00 19.40  ? 126 HIS E CA  1 
ATOM   466  C C   . HIS E 2 36  ? -16.673 -32.503 -20.515 1.00 24.26  ? 126 HIS E C   1 
ATOM   467  O O   . HIS E 2 36  ? -17.808 -32.986 -20.544 1.00 23.63  ? 126 HIS E O   1 
ATOM   468  C CB  . HIS E 2 36  ? -15.375 -34.614 -21.087 1.00 20.98  ? 126 HIS E CB  1 
ATOM   469  C CG  . HIS E 2 36  ? -15.168 -34.243 -22.527 1.00 25.37  ? 126 HIS E CG  1 
ATOM   470  N ND1 . HIS E 2 36  ? -13.900 -34.154 -23.072 1.00 27.92  ? 126 HIS E ND1 1 
ATOM   471  C CD2 . HIS E 2 36  ? -16.072 -33.906 -23.473 1.00 28.01  ? 126 HIS E CD2 1 
ATOM   472  C CE1 . HIS E 2 36  ? -14.073 -33.776 -24.328 1.00 27.84  ? 126 HIS E CE1 1 
ATOM   473  N NE2 . HIS E 2 36  ? -15.363 -33.604 -24.611 1.00 28.26  ? 126 HIS E NE2 1 
ATOM   474  N N   . LEU E 2 37  ? -16.426 -31.207 -20.690 1.00 22.08  ? 127 LEU E N   1 
ATOM   475  C CA  . LEU E 2 37  ? -17.466 -30.213 -20.883 1.00 22.48  ? 127 LEU E CA  1 
ATOM   476  C C   . LEU E 2 37  ? -17.486 -29.650 -22.315 1.00 27.77  ? 127 LEU E C   1 
ATOM   477  O O   . LEU E 2 37  ? -16.446 -29.293 -22.861 1.00 26.65  ? 127 LEU E O   1 
ATOM   478  C CB  . LEU E 2 37  ? -17.256 -29.080 -19.838 1.00 22.04  ? 127 LEU E CB  1 
ATOM   479  C CG  . LEU E 2 37  ? -18.279 -27.948 -19.768 1.00 27.36  ? 127 LEU E CG  1 
ATOM   480  C CD1 . LEU E 2 37  ? -19.549 -28.384 -19.080 1.00 28.20  ? 127 LEU E CD1 1 
ATOM   481  C CD2 . LEU E 2 37  ? -17.712 -26.752 -19.015 1.00 30.82  ? 127 LEU E CD2 1 
ATOM   482  N N   . GLN E 2 38  ? -18.691 -29.560 -22.904 1.00 26.82  ? 128 GLN E N   1 
ATOM   483  C CA  . GLN E 2 38  ? -18.923 -28.987 -24.238 1.00 28.12  ? 128 GLN E CA  1 
ATOM   484  C C   . GLN E 2 38  ? -19.964 -27.860 -24.088 1.00 34.41  ? 128 GLN E C   1 
ATOM   485  O O   . GLN E 2 38  ? -21.180 -28.106 -24.123 1.00 33.55  ? 128 GLN E O   1 
ATOM   486  C CB  . GLN E 2 38  ? -19.346 -30.048 -25.288 1.00 29.22  ? 128 GLN E CB  1 
ATOM   487  C CG  . GLN E 2 38  ? -18.409 -31.254 -25.403 1.00 35.44  ? 128 GLN E CG  1 
ATOM   488  C CD  . GLN E 2 38  ? -17.987 -31.603 -26.809 1.00 48.97  ? 128 GLN E CD  1 
ATOM   489  O OE1 . GLN E 2 38  ? -18.273 -30.892 -27.767 1.00 43.21  ? 128 GLN E OE1 1 
ATOM   490  N NE2 . GLN E 2 38  ? -17.247 -32.700 -26.963 1.00 44.26  ? 128 GLN E NE2 1 
ATOM   491  N N   . THR E 2 39  ? -19.456 -26.620 -23.898 1.00 33.30  ? 129 THR E N   1 
ATOM   492  C CA  . THR E 2 39  ? -20.240 -25.404 -23.651 1.00 33.21  ? 129 THR E CA  1 
ATOM   493  C C   . THR E 2 39  ? -20.660 -24.734 -24.960 1.00 37.81  ? 129 THR E C   1 
ATOM   494  O O   . THR E 2 39  ? -19.847 -24.576 -25.866 1.00 38.69  ? 129 THR E O   1 
ATOM   495  C CB  . THR E 2 39  ? -19.434 -24.425 -22.764 1.00 32.54  ? 129 THR E CB  1 
ATOM   496  O OG1 . THR E 2 39  ? -18.892 -25.132 -21.652 1.00 32.58  ? 129 THR E OG1 1 
ATOM   497  C CG2 . THR E 2 39  ? -20.264 -23.238 -22.272 1.00 26.10  ? 129 THR E CG2 1 
ATOM   498  N N   . SER E 2 40  ? -21.924 -24.308 -25.028 1.00 33.79  ? 130 SER E N   1 
ATOM   499  C CA  . SER E 2 40  ? -22.479 -23.600 -26.173 1.00 33.75  ? 130 SER E CA  1 
ATOM   500  C C   . SER E 2 40  ? -23.498 -22.582 -25.704 1.00 38.17  ? 130 SER E C   1 
ATOM   501  O O   . SER E 2 40  ? -24.077 -22.730 -24.627 1.00 37.05  ? 130 SER E O   1 
ATOM   502  C CB  . SER E 2 40  ? -23.093 -24.559 -27.188 1.00 37.57  ? 130 SER E CB  1 
ATOM   503  O OG  . SER E 2 40  ? -24.127 -25.349 -26.621 1.00 50.76  ? 130 SER E OG  1 
ATOM   504  N N   . LEU E 2 41  ? -23.687 -21.526 -26.496 1.00 36.63  ? 131 LEU E N   1 
ATOM   505  C CA  . LEU E 2 41  ? -24.620 -20.444 -26.207 1.00 37.49  ? 131 LEU E CA  1 
ATOM   506  C C   . LEU E 2 41  ? -26.033 -20.846 -26.622 1.00 45.31  ? 131 LEU E C   1 
ATOM   507  O O   . LEU E 2 41  ? -26.220 -21.892 -27.249 1.00 44.28  ? 131 LEU E O   1 
ATOM   508  C CB  . LEU E 2 41  ? -24.185 -19.138 -26.914 1.00 37.49  ? 131 LEU E CB  1 
ATOM   509  C CG  . LEU E 2 41  ? -22.769 -18.618 -26.632 1.00 41.86  ? 131 LEU E CG  1 
ATOM   510  C CD1 . LEU E 2 41  ? -22.405 -17.526 -27.602 1.00 42.79  ? 131 LEU E CD1 1 
ATOM   511  C CD2 . LEU E 2 41  ? -22.623 -18.122 -25.210 1.00 43.12  ? 131 LEU E CD2 1 
ATOM   512  N N   . GLU E 2 42  ? -27.024 -20.006 -26.278 1.00 45.77  ? 132 GLU E N   1 
ATOM   513  C CA  . GLU E 2 42  ? -28.441 -20.224 -26.586 1.00 47.35  ? 132 GLU E CA  1 
ATOM   514  C C   . GLU E 2 42  ? -28.699 -20.328 -28.100 1.00 51.54  ? 132 GLU E C   1 
ATOM   515  O O   . GLU E 2 42  ? -29.605 -21.056 -28.507 1.00 51.88  ? 132 GLU E O   1 
ATOM   516  C CB  . GLU E 2 42  ? -29.281 -19.081 -25.992 1.00 49.37  ? 132 GLU E CB  1 
ATOM   517  C CG  . GLU E 2 42  ? -30.655 -19.500 -25.506 1.00 61.79  ? 132 GLU E CG  1 
ATOM   518  C CD  . GLU E 2 42  ? -31.274 -18.565 -24.483 1.00 86.44  ? 132 GLU E CD  1 
ATOM   519  O OE1 . GLU E 2 42  ? -31.099 -17.330 -24.606 1.00 88.87  ? 132 GLU E OE1 1 
ATOM   520  O OE2 . GLU E 2 42  ? -31.930 -19.072 -23.545 1.00 79.37  ? 132 GLU E OE2 1 
ATOM   521  N N   . ASN E 2 43  ? -27.885 -19.631 -28.922 1.00 47.35  ? 133 ASN E N   1 
ATOM   522  C CA  . ASN E 2 43  ? -27.994 -19.629 -30.384 1.00 46.64  ? 133 ASN E CA  1 
ATOM   523  C C   . ASN E 2 43  ? -27.220 -20.797 -31.056 1.00 48.57  ? 133 ASN E C   1 
ATOM   524  O O   . ASN E 2 43  ? -27.312 -20.958 -32.274 1.00 49.41  ? 133 ASN E O   1 
ATOM   525  C CB  . ASN E 2 43  ? -27.530 -18.283 -30.950 1.00 47.56  ? 133 ASN E CB  1 
ATOM   526  C CG  . ASN E 2 43  ? -26.094 -17.945 -30.653 1.00 65.96  ? 133 ASN E CG  1 
ATOM   527  O OD1 . ASN E 2 43  ? -25.194 -18.242 -31.438 1.00 54.11  ? 133 ASN E OD1 1 
ATOM   528  N ND2 . ASN E 2 43  ? -25.856 -17.294 -29.525 1.00 59.81  ? 133 ASN E ND2 1 
ATOM   529  N N   . GLY E 2 44  ? -26.482 -21.584 -30.271 1.00 42.72  ? 134 GLY E N   1 
ATOM   530  C CA  . GLY E 2 44  ? -25.731 -22.737 -30.764 1.00 41.31  ? 134 GLY E CA  1 
ATOM   531  C C   . GLY E 2 44  ? -24.237 -22.552 -30.957 1.00 43.17  ? 134 GLY E C   1 
ATOM   532  O O   . GLY E 2 44  ? -23.539 -23.513 -31.307 1.00 42.93  ? 134 GLY E O   1 
ATOM   533  N N   . THR E 2 45  ? -23.728 -21.328 -30.734 1.00 38.83  ? 135 THR E N   1 
ATOM   534  C CA  . THR E 2 45  ? -22.301 -21.004 -30.874 1.00 38.28  ? 135 THR E CA  1 
ATOM   535  C C   . THR E 2 45  ? -21.509 -21.680 -29.742 1.00 42.25  ? 135 THR E C   1 
ATOM   536  O O   . THR E 2 45  ? -21.841 -21.517 -28.573 1.00 41.55  ? 135 THR E O   1 
ATOM   537  C CB  . THR E 2 45  ? -22.105 -19.477 -30.913 1.00 41.40  ? 135 THR E CB  1 
ATOM   538  O OG1 . THR E 2 45  ? -22.689 -18.982 -32.118 1.00 41.76  ? 135 THR E OG1 1 
ATOM   539  C CG2 . THR E 2 45  ? -20.643 -19.058 -30.864 1.00 36.26  ? 135 THR E CG2 1 
ATOM   540  N N   . ARG E 2 46  ? -20.471 -22.436 -30.106 1.00 39.39  ? 136 ARG E N   1 
ATOM   541  C CA  . ARG E 2 46  ? -19.629 -23.150 -29.151 1.00 39.21  ? 136 ARG E CA  1 
ATOM   542  C C   . ARG E 2 46  ? -18.645 -22.211 -28.462 1.00 43.23  ? 136 ARG E C   1 
ATOM   543  O O   . ARG E 2 46  ? -18.057 -21.335 -29.090 1.00 42.73  ? 136 ARG E O   1 
ATOM   544  C CB  . ARG E 2 46  ? -18.881 -24.286 -29.838 1.00 38.13  ? 136 ARG E CB  1 
ATOM   545  C CG  . ARG E 2 46  ? -19.806 -25.339 -30.451 1.00 47.74  ? 136 ARG E CG  1 
ATOM   546  C CD  . ARG E 2 46  ? -19.054 -26.218 -31.426 1.00 52.49  ? 136 ARG E CD  1 
ATOM   547  N NE  . ARG E 2 46  ? -18.115 -27.112 -30.746 1.00 52.16  ? 136 ARG E NE  1 
ATOM   548  C CZ  . ARG E 2 46  ? -18.427 -28.315 -30.277 1.00 65.88  ? 136 ARG E CZ  1 
ATOM   549  N NH1 . ARG E 2 46  ? -19.658 -28.794 -30.422 1.00 45.81  ? 136 ARG E NH1 1 
ATOM   550  N NH2 . ARG E 2 46  ? -17.514 -29.048 -29.655 1.00 59.74  ? 136 ARG E NH2 1 
ATOM   551  N N   . VAL E 2 47  ? -18.476 -22.412 -27.161 1.00 40.26  ? 137 VAL E N   1 
ATOM   552  C CA  . VAL E 2 47  ? -17.611 -21.596 -26.332 1.00 40.67  ? 137 VAL E CA  1 
ATOM   553  C C   . VAL E 2 47  ? -16.204 -22.201 -26.292 1.00 48.46  ? 137 VAL E C   1 
ATOM   554  O O   . VAL E 2 47  ? -16.041 -23.375 -25.948 1.00 48.05  ? 137 VAL E O   1 
ATOM   555  C CB  . VAL E 2 47  ? -18.227 -21.429 -24.919 1.00 43.53  ? 137 VAL E CB  1 
ATOM   556  C CG1 . VAL E 2 47  ? -17.270 -20.710 -23.973 1.00 43.25  ? 137 VAL E CG1 1 
ATOM   557  C CG2 . VAL E 2 47  ? -19.571 -20.702 -24.989 1.00 42.93  ? 137 VAL E CG2 1 
ATOM   558  N N   . GLN E 2 48  ? -15.196 -21.371 -26.639 1.00 48.12  ? 138 GLN E N   1 
ATOM   559  C CA  . GLN E 2 48  ? -13.757 -21.664 -26.659 1.00 49.28  ? 138 GLN E CA  1 
ATOM   560  C C   . GLN E 2 48  ? -13.474 -23.164 -26.893 1.00 56.69  ? 138 GLN E C   1 
ATOM   561  O O   . GLN E 2 48  ? -13.871 -23.691 -27.943 1.00 57.56  ? 138 GLN E O   1 
ATOM   562  C CB  . GLN E 2 48  ? -13.091 -21.163 -25.363 1.00 50.62  ? 138 GLN E CB  1 
ATOM   563  N N   . GLU E 2 49  ? -12.812 -23.843 -25.918 1.00 53.98  ? 139 GLU E N   1 
ATOM   564  C CA  . GLU E 2 49  ? -12.461 -25.272 -25.946 1.00 53.49  ? 139 GLU E CA  1 
ATOM   565  C C   . GLU E 2 49  ? -11.823 -25.700 -24.620 1.00 55.23  ? 139 GLU E C   1 
ATOM   566  O O   . GLU E 2 49  ? -10.648 -25.420 -24.364 1.00 54.32  ? 139 GLU E O   1 
ATOM   567  C CB  . GLU E 2 49  ? -11.519 -25.614 -27.129 1.00 54.96  ? 139 GLU E CB  1 
ATOM   568  N N   . GLU E 2 50  ? -12.614 -26.369 -23.777 1.00 51.62  ? 140 GLU E N   1 
ATOM   569  C CA  . GLU E 2 50  ? -12.165 -26.921 -22.498 1.00 50.76  ? 140 GLU E CA  1 
ATOM   570  C C   . GLU E 2 50  ? -12.353 -28.433 -22.561 1.00 53.19  ? 140 GLU E C   1 
ATOM   571  O O   . GLU E 2 50  ? -13.488 -28.915 -22.502 1.00 52.14  ? 140 GLU E O   1 
ATOM   572  C CB  . GLU E 2 50  ? -12.898 -26.295 -21.296 1.00 51.91  ? 140 GLU E CB  1 
ATOM   573  N N   . PRO E 2 51  ? -11.275 -29.206 -22.803 1.00 49.53  ? 141 PRO E N   1 
ATOM   574  C CA  . PRO E 2 51  ? -11.446 -30.669 -22.871 1.00 48.19  ? 141 PRO E CA  1 
ATOM   575  C C   . PRO E 2 51  ? -11.661 -31.187 -21.449 1.00 47.47  ? 141 PRO E C   1 
ATOM   576  O O   . PRO E 2 51  ? -12.789 -31.125 -20.959 1.00 47.31  ? 141 PRO E O   1 
ATOM   577  C CB  . PRO E 2 51  ? -10.154 -31.164 -23.549 1.00 50.23  ? 141 PRO E CB  1 
ATOM   578  C CG  . PRO E 2 51  ? -9.228  -29.968 -23.628 1.00 55.17  ? 141 PRO E CG  1 
ATOM   579  C CD  . PRO E 2 51  ? -9.853  -28.811 -22.918 1.00 51.08  ? 141 PRO E CD  1 
ATOM   580  N N   . GLU E 2 52  ? -10.596 -31.600 -20.758 1.00 40.33  ? 142 GLU E N   1 
ATOM   581  C CA  . GLU E 2 52  ? -10.736 -32.008 -19.371 1.00 38.93  ? 142 GLU E CA  1 
ATOM   582  C C   . GLU E 2 52  ? -10.782 -30.762 -18.485 1.00 38.39  ? 142 GLU E C   1 
ATOM   583  O O   . GLU E 2 52  ? -10.035 -29.796 -18.701 1.00 38.18  ? 142 GLU E O   1 
ATOM   584  C CB  . GLU E 2 52  ? -9.614  -32.965 -18.920 1.00 40.36  ? 142 GLU E CB  1 
ATOM   585  C CG  . GLU E 2 52  ? -9.700  -34.347 -19.539 1.00 50.73  ? 142 GLU E CG  1 
ATOM   586  N N   . LEU E 2 53  ? -11.694 -30.782 -17.514 1.00 29.64  ? 143 LEU E N   1 
ATOM   587  C CA  . LEU E 2 53  ? -11.843 -29.731 -16.520 1.00 26.71  ? 143 LEU E CA  1 
ATOM   588  C C   . LEU E 2 53  ? -11.819 -30.371 -15.134 1.00 26.52  ? 143 LEU E C   1 
ATOM   589  O O   . LEU E 2 53  ? -12.592 -31.285 -14.877 1.00 26.81  ? 143 LEU E O   1 
ATOM   590  C CB  . LEU E 2 53  ? -13.125 -28.919 -16.764 1.00 26.32  ? 143 LEU E CB  1 
ATOM   591  C CG  . LEU E 2 53  ? -13.474 -27.838 -15.742 1.00 30.50  ? 143 LEU E CG  1 
ATOM   592  C CD1 . LEU E 2 53  ? -12.439 -26.686 -15.737 1.00 30.69  ? 143 LEU E CD1 1 
ATOM   593  C CD2 . LEU E 2 53  ? -14.859 -27.295 -16.001 1.00 33.11  ? 143 LEU E CD2 1 
ATOM   594  N N   . VAL E 2 54  ? -10.910 -29.917 -14.267 1.00 20.41  ? 144 VAL E N   1 
ATOM   595  C CA  . VAL E 2 54  ? -10.721 -30.432 -12.913 1.00 20.04  ? 144 VAL E CA  1 
ATOM   596  C C   . VAL E 2 54  ? -11.091 -29.327 -11.911 1.00 23.82  ? 144 VAL E C   1 
ATOM   597  O O   . VAL E 2 54  ? -10.529 -28.222 -11.951 1.00 24.56  ? 144 VAL E O   1 
ATOM   598  C CB  . VAL E 2 54  ? -9.266  -30.961 -12.704 1.00 24.18  ? 144 VAL E CB  1 
ATOM   599  C CG1 . VAL E 2 54  ? -9.004  -31.353 -11.249 1.00 24.07  ? 144 VAL E CG1 1 
ATOM   600  C CG2 . VAL E 2 54  ? -8.948  -32.126 -13.644 1.00 23.52  ? 144 VAL E CG2 1 
ATOM   601  N N   . PHE E 2 55  ? -12.046 -29.626 -11.020 1.00 16.86  ? 145 PHE E N   1 
ATOM   602  C CA  . PHE E 2 55  ? -12.477 -28.673 -10.011 1.00 14.15  ? 145 PHE E CA  1 
ATOM   603  C C   . PHE E 2 55  ? -12.979 -29.402 -8.783  1.00 16.79  ? 145 PHE E C   1 
ATOM   604  O O   . PHE E 2 55  ? -13.322 -30.579 -8.868  1.00 17.30  ? 145 PHE E O   1 
ATOM   605  C CB  . PHE E 2 55  ? -13.543 -27.705 -10.575 1.00 14.97  ? 145 PHE E CB  1 
ATOM   606  C CG  . PHE E 2 55  ? -14.839 -28.326 -11.056 1.00 14.84  ? 145 PHE E CG  1 
ATOM   607  C CD1 . PHE E 2 55  ? -14.976 -28.757 -12.369 1.00 15.52  ? 145 PHE E CD1 1 
ATOM   608  C CD2 . PHE E 2 55  ? -15.941 -28.417 -10.213 1.00 13.79  ? 145 PHE E CD2 1 
ATOM   609  C CE1 . PHE E 2 55  ? -16.177 -29.320 -12.815 1.00 15.96  ? 145 PHE E CE1 1 
ATOM   610  C CE2 . PHE E 2 55  ? -17.133 -28.987 -10.657 1.00 15.78  ? 145 PHE E CE2 1 
ATOM   611  C CZ  . PHE E 2 55  ? -17.250 -29.422 -11.960 1.00 13.88  ? 145 PHE E CZ  1 
ATOM   612  N N   . THR E 2 56  ? -12.943 -28.725 -7.627  1.00 12.89  ? 146 THR E N   1 
ATOM   613  C CA  . THR E 2 56  ? -13.398 -29.261 -6.337  1.00 11.49  ? 146 THR E CA  1 
ATOM   614  C C   . THR E 2 56  ? -14.871 -28.888 -6.177  1.00 16.02  ? 146 THR E C   1 
ATOM   615  O O   . THR E 2 56  ? -15.237 -27.714 -6.302  1.00 16.13  ? 146 THR E O   1 
ATOM   616  C CB  . THR E 2 56  ? -12.530 -28.724 -5.203  1.00 15.06  ? 146 THR E CB  1 
ATOM   617  O OG1 . THR E 2 56  ? -11.149 -28.861 -5.533  1.00 17.21  ? 146 THR E OG1 1 
ATOM   618  C CG2 . THR E 2 56  ? -12.803 -29.399 -3.879  1.00 7.71   ? 146 THR E CG2 1 
ATOM   619  N N   . LEU E 2 57  ? -15.715 -29.891 -5.941  1.00 12.63  ? 147 LEU E N   1 
ATOM   620  C CA  . LEU E 2 57  ? -17.157 -29.732 -5.788  1.00 10.43  ? 147 LEU E CA  1 
ATOM   621  C C   . LEU E 2 57  ? -17.498 -28.902 -4.555  1.00 15.07  ? 147 LEU E C   1 
ATOM   622  O O   . LEU E 2 57  ? -17.035 -29.201 -3.454  1.00 14.94  ? 147 LEU E O   1 
ATOM   623  C CB  . LEU E 2 57  ? -17.785 -31.129 -5.703  1.00 9.88   ? 147 LEU E CB  1 
ATOM   624  C CG  . LEU E 2 57  ? -19.187 -31.332 -6.259  1.00 13.62  ? 147 LEU E CG  1 
ATOM   625  C CD1 . LEU E 2 57  ? -19.361 -30.737 -7.674  1.00 16.35  ? 147 LEU E CD1 1 
ATOM   626  C CD2 . LEU E 2 57  ? -19.534 -32.811 -6.289  1.00 12.51  ? 147 LEU E CD2 1 
ATOM   627  N N   . GLY E 2 58  ? -18.325 -27.875 -4.760  1.00 12.59  ? 148 GLY E N   1 
ATOM   628  C CA  . GLY E 2 58  ? -18.790 -26.967 -3.709  1.00 12.60  ? 148 GLY E CA  1 
ATOM   629  C C   . GLY E 2 58  ? -17.873 -25.786 -3.412  1.00 17.74  ? 148 GLY E C   1 
ATOM   630  O O   . GLY E 2 58  ? -18.165 -25.012 -2.503  1.00 18.19  ? 148 GLY E O   1 
ATOM   631  N N   . ASP E 2 59  ? -16.745 -25.654 -4.153  1.00 13.64  ? 149 ASP E N   1 
ATOM   632  C CA  . ASP E 2 59  ? -15.726 -24.605 -3.999  1.00 14.04  ? 149 ASP E CA  1 
ATOM   633  C C   . ASP E 2 59  ? -15.939 -23.422 -4.976  1.00 21.48  ? 149 ASP E C   1 
ATOM   634  O O   . ASP E 2 59  ? -15.251 -22.413 -4.854  1.00 22.42  ? 149 ASP E O   1 
ATOM   635  C CB  . ASP E 2 59  ? -14.311 -25.202 -4.230  1.00 14.94  ? 149 ASP E CB  1 
ATOM   636  C CG  . ASP E 2 59  ? -13.592 -25.768 -3.009  1.00 17.23  ? 149 ASP E CG  1 
ATOM   637  O OD1 . ASP E 2 59  ? -14.226 -25.929 -1.967  1.00 16.13  ? 149 ASP E OD1 1 
ATOM   638  O OD2 . ASP E 2 59  ? -12.390 -26.062 -3.111  1.00 25.61  ? 149 ASP E OD2 1 
ATOM   639  N N   . CYS E 2 60  ? -16.858 -23.570 -5.961  1.00 18.37  ? 150 CYS E N   1 
ATOM   640  C CA  . CYS E 2 60  ? -17.207 -22.573 -6.998  1.00 18.24  ? 150 CYS E CA  1 
ATOM   641  C C   . CYS E 2 60  ? -15.966 -22.067 -7.727  1.00 19.51  ? 150 CYS E C   1 
ATOM   642  O O   . CYS E 2 60  ? -15.799 -20.856 -7.907  1.00 16.51  ? 150 CYS E O   1 
ATOM   643  C CB  . CYS E 2 60  ? -18.017 -21.415 -6.419  1.00 18.25  ? 150 CYS E CB  1 
ATOM   644  S SG  . CYS E 2 60  ? -19.598 -21.906 -5.694  1.00 21.93  ? 150 CYS E SG  1 
ATOM   645  N N   . ASP E 2 61  ? -15.115 -23.017 -8.148  1.00 15.99  ? 151 ASP E N   1 
ATOM   646  C CA  . ASP E 2 61  ? -13.879 -22.799 -8.888  1.00 15.22  ? 151 ASP E CA  1 
ATOM   647  C C   . ASP E 2 61  ? -14.130 -22.208 -10.258 1.00 20.93  ? 151 ASP E C   1 
ATOM   648  O O   . ASP E 2 61  ? -13.296 -21.440 -10.726 1.00 23.66  ? 151 ASP E O   1 
ATOM   649  C CB  . ASP E 2 61  ? -13.112 -24.132 -9.075  1.00 15.49  ? 151 ASP E CB  1 
ATOM   650  C CG  . ASP E 2 61  ? -12.354 -24.664 -7.878  1.00 15.93  ? 151 ASP E CG  1 
ATOM   651  O OD1 . ASP E 2 61  ? -12.204 -23.926 -6.894  1.00 11.77  ? 151 ASP E OD1 1 
ATOM   652  O OD2 . ASP E 2 61  ? -11.844 -25.799 -7.959  1.00 25.59  ? 151 ASP E OD2 1 
ATOM   653  N N   . VAL E 2 62  ? -15.204 -22.626 -10.949 1.00 15.28  ? 152 VAL E N   1 
ATOM   654  C CA  . VAL E 2 62  ? -15.437 -22.178 -12.340 1.00 14.00  ? 152 VAL E CA  1 
ATOM   655  C C   . VAL E 2 62  ? -16.738 -21.388 -12.411 1.00 20.91  ? 152 VAL E C   1 
ATOM   656  O O   . VAL E 2 62  ? -16.691 -20.158 -12.512 1.00 23.87  ? 152 VAL E O   1 
ATOM   657  C CB  . VAL E 2 62  ? -15.406 -23.365 -13.365 1.00 16.26  ? 152 VAL E CB  1 
ATOM   658  C CG1 . VAL E 2 62  ? -15.421 -22.861 -14.810 1.00 14.85  ? 152 VAL E CG1 1 
ATOM   659  C CG2 . VAL E 2 62  ? -14.197 -24.280 -13.142 1.00 15.51  ? 152 VAL E CG2 1 
ATOM   660  N N   . ILE E 2 63  ? -17.891 -22.076 -12.374 1.00 17.60  ? 153 ILE E N   1 
ATOM   661  C CA  . ILE E 2 63  ? -19.218 -21.444 -12.421 1.00 17.25  ? 153 ILE E CA  1 
ATOM   662  C C   . ILE E 2 63  ? -20.153 -22.159 -11.459 1.00 19.77  ? 153 ILE E C   1 
ATOM   663  O O   . ILE E 2 63  ? -19.991 -23.352 -11.235 1.00 20.28  ? 153 ILE E O   1 
ATOM   664  C CB  . ILE E 2 63  ? -19.827 -21.357 -13.861 1.00 19.60  ? 153 ILE E CB  1 
ATOM   665  C CG1 . ILE E 2 63  ? -19.729 -22.691 -14.625 1.00 19.40  ? 153 ILE E CG1 1 
ATOM   666  C CG2 . ILE E 2 63  ? -19.207 -20.207 -14.660 1.00 19.50  ? 153 ILE E CG2 1 
ATOM   667  C CD1 . ILE E 2 63  ? -20.640 -22.779 -15.809 1.00 20.50  ? 153 ILE E CD1 1 
ATOM   668  N N   . GLN E 2 64  ? -21.127 -21.431 -10.890 1.00 14.96  ? 154 GLN E N   1 
ATOM   669  C CA  . GLN E 2 64  ? -22.129 -21.973 -9.962  1.00 13.75  ? 154 GLN E CA  1 
ATOM   670  C C   . GLN E 2 64  ? -22.932 -23.121 -10.586 1.00 17.47  ? 154 GLN E C   1 
ATOM   671  O O   . GLN E 2 64  ? -23.300 -24.052 -9.876  1.00 19.17  ? 154 GLN E O   1 
ATOM   672  C CB  . GLN E 2 64  ? -23.096 -20.862 -9.530  1.00 15.00  ? 154 GLN E CB  1 
ATOM   673  C CG  . GLN E 2 64  ? -22.911 -20.381 -8.111  1.00 29.43  ? 154 GLN E CG  1 
ATOM   674  C CD  . GLN E 2 64  ? -24.006 -19.415 -7.726  1.00 55.56  ? 154 GLN E CD  1 
ATOM   675  O OE1 . GLN E 2 64  ? -23.823 -18.191 -7.727  1.00 52.03  ? 154 GLN E OE1 1 
ATOM   676  N NE2 . GLN E 2 64  ? -25.178 -19.938 -7.394  1.00 51.47  ? 154 GLN E NE2 1 
ATOM   677  N N   . ALA E 2 65  ? -23.239 -23.033 -11.898 1.00 12.32  ? 155 ALA E N   1 
ATOM   678  C CA  . ALA E 2 65  ? -23.998 -24.017 -12.659 1.00 11.51  ? 155 ALA E CA  1 
ATOM   679  C C   . ALA E 2 65  ? -23.404 -25.423 -12.504 1.00 15.80  ? 155 ALA E C   1 
ATOM   680  O O   . ALA E 2 65  ? -24.148 -26.378 -12.278 1.00 16.63  ? 155 ALA E O   1 
ATOM   681  C CB  . ALA E 2 65  ? -24.036 -23.618 -14.123 1.00 12.45  ? 155 ALA E CB  1 
ATOM   682  N N   . LEU E 2 66  ? -22.068 -25.539 -12.546 1.00 10.46  ? 156 LEU E N   1 
ATOM   683  C CA  . LEU E 2 66  ? -21.386 -26.817 -12.389 1.00 9.79   ? 156 LEU E CA  1 
ATOM   684  C C   . LEU E 2 66  ? -21.490 -27.363 -10.953 1.00 14.24  ? 156 LEU E C   1 
ATOM   685  O O   . LEU E 2 66  ? -21.738 -28.546 -10.776 1.00 15.11  ? 156 LEU E O   1 
ATOM   686  C CB  . LEU E 2 66  ? -19.916 -26.688 -12.791 1.00 10.20  ? 156 LEU E CB  1 
ATOM   687  C CG  . LEU E 2 66  ? -19.622 -26.519 -14.276 1.00 14.22  ? 156 LEU E CG  1 
ATOM   688  C CD1 . LEU E 2 66  ? -18.157 -26.241 -14.484 1.00 14.03  ? 156 LEU E CD1 1 
ATOM   689  C CD2 . LEU E 2 66  ? -20.065 -27.734 -15.072 1.00 16.51  ? 156 LEU E CD2 1 
ATOM   690  N N   . ASP E 2 67  ? -21.308 -26.514 -9.938  1.00 10.29  ? 157 ASP E N   1 
ATOM   691  C CA  . ASP E 2 67  ? -21.383 -26.937 -8.533  1.00 10.32  ? 157 ASP E CA  1 
ATOM   692  C C   . ASP E 2 67  ? -22.803 -27.327 -8.108  1.00 15.92  ? 157 ASP E C   1 
ATOM   693  O O   . ASP E 2 67  ? -22.963 -28.037 -7.125  1.00 17.46  ? 157 ASP E O   1 
ATOM   694  C CB  . ASP E 2 67  ? -20.860 -25.830 -7.618  1.00 10.83  ? 157 ASP E CB  1 
ATOM   695  C CG  . ASP E 2 67  ? -19.378 -25.612 -7.732  1.00 16.82  ? 157 ASP E CG  1 
ATOM   696  O OD1 . ASP E 2 67  ? -18.934 -25.086 -8.771  1.00 13.74  ? 157 ASP E OD1 1 
ATOM   697  O OD2 . ASP E 2 67  ? -18.657 -25.966 -6.784  1.00 25.49  ? 157 ASP E OD2 1 
ATOM   698  N N   . LEU E 2 68  ? -23.816 -26.843 -8.830  1.00 12.56  ? 158 LEU E N   1 
ATOM   699  C CA  . LEU E 2 68  ? -25.224 -27.098 -8.539  1.00 12.26  ? 158 LEU E CA  1 
ATOM   700  C C   . LEU E 2 68  ? -25.771 -28.306 -9.290  1.00 16.68  ? 158 LEU E C   1 
ATOM   701  O O   . LEU E 2 68  ? -26.677 -28.974 -8.789  1.00 15.78  ? 158 LEU E O   1 
ATOM   702  C CB  . LEU E 2 68  ? -26.074 -25.858 -8.875  1.00 11.50  ? 158 LEU E CB  1 
ATOM   703  C CG  . LEU E 2 68  ? -26.040 -24.641 -7.916  1.00 15.18  ? 158 LEU E CG  1 
ATOM   704  C CD1 . LEU E 2 68  ? -26.758 -23.449 -8.547  1.00 14.14  ? 158 LEU E CD1 1 
ATOM   705  C CD2 . LEU E 2 68  ? -26.625 -24.979 -6.554  1.00 19.66  ? 158 LEU E CD2 1 
ATOM   706  N N   . SER E 2 69  ? -25.225 -28.605 -10.476 1.00 13.60  ? 159 SER E N   1 
ATOM   707  C CA  . SER E 2 69  ? -25.715 -29.700 -11.307 1.00 11.89  ? 159 SER E CA  1 
ATOM   708  C C   . SER E 2 69  ? -24.885 -30.998 -11.218 1.00 16.42  ? 159 SER E C   1 
ATOM   709  O O   . SER E 2 69  ? -25.464 -32.084 -11.282 1.00 16.58  ? 159 SER E O   1 
ATOM   710  C CB  . SER E 2 69  ? -25.787 -29.242 -12.758 1.00 15.56  ? 159 SER E CB  1 
ATOM   711  O OG  . SER E 2 69  ? -24.511 -28.866 -13.256 1.00 22.77  ? 159 SER E OG  1 
ATOM   712  N N   . VAL E 2 70  ? -23.554 -30.903 -11.080 1.00 13.68  ? 160 VAL E N   1 
ATOM   713  C CA  . VAL E 2 70  ? -22.662 -32.074 -11.046 1.00 13.07  ? 160 VAL E CA  1 
ATOM   714  C C   . VAL E 2 70  ? -22.961 -32.991 -9.811  1.00 17.61  ? 160 VAL E C   1 
ATOM   715  O O   . VAL E 2 70  ? -22.881 -34.202 -9.992  1.00 16.15  ? 160 VAL E O   1 
ATOM   716  C CB  . VAL E 2 70  ? -21.163 -31.660 -11.157 1.00 15.96  ? 160 VAL E CB  1 
ATOM   717  C CG1 . VAL E 2 70  ? -20.206 -32.810 -10.810 1.00 14.61  ? 160 VAL E CG1 1 
ATOM   718  C CG2 . VAL E 2 70  ? -20.866 -31.119 -12.549 1.00 15.73  ? 160 VAL E CG2 1 
ATOM   719  N N   . PRO E 2 71  ? -23.359 -32.490 -8.602  1.00 15.20  ? 161 PRO E N   1 
ATOM   720  C CA  . PRO E 2 71  ? -23.677 -33.416 -7.493  1.00 15.14  ? 161 PRO E CA  1 
ATOM   721  C C   . PRO E 2 71  ? -24.897 -34.309 -7.773  1.00 19.44  ? 161 PRO E C   1 
ATOM   722  O O   . PRO E 2 71  ? -25.161 -35.228 -7.000  1.00 17.64  ? 161 PRO E O   1 
ATOM   723  C CB  . PRO E 2 71  ? -23.995 -32.473 -6.323  1.00 16.31  ? 161 PRO E CB  1 
ATOM   724  C CG  . PRO E 2 71  ? -23.395 -31.184 -6.682  1.00 20.67  ? 161 PRO E CG  1 
ATOM   725  C CD  . PRO E 2 71  ? -23.501 -31.089 -8.161  1.00 16.54  ? 161 PRO E CD  1 
ATOM   726  N N   . LEU E 2 72  ? -25.648 -34.004 -8.857  1.00 15.30  ? 162 LEU E N   1 
ATOM   727  C CA  . LEU E 2 72  ? -26.845 -34.728 -9.271  1.00 14.21  ? 162 LEU E CA  1 
ATOM   728  C C   . LEU E 2 72  ? -26.521 -35.713 -10.387 1.00 18.65  ? 162 LEU E C   1 
ATOM   729  O O   . LEU E 2 72  ? -27.447 -36.274 -10.973 1.00 19.02  ? 162 LEU E O   1 
ATOM   730  C CB  . LEU E 2 72  ? -27.950 -33.745 -9.733  1.00 13.68  ? 162 LEU E CB  1 
ATOM   731  C CG  . LEU E 2 72  ? -28.419 -32.700 -8.753  1.00 18.69  ? 162 LEU E CG  1 
ATOM   732  C CD1 . LEU E 2 72  ? -29.416 -31.791 -9.398  1.00 19.38  ? 162 LEU E CD1 1 
ATOM   733  C CD2 . LEU E 2 72  ? -28.999 -33.330 -7.499  1.00 16.62  ? 162 LEU E CD2 1 
ATOM   734  N N   . MET E 2 73  ? -25.212 -35.919 -10.685 1.00 14.03  ? 163 MET E N   1 
ATOM   735  C CA  . MET E 2 73  ? -24.726 -36.841 -11.719 1.00 13.44  ? 163 MET E CA  1 
ATOM   736  C C   . MET E 2 73  ? -23.966 -38.016 -11.120 1.00 17.66  ? 163 MET E C   1 
ATOM   737  O O   . MET E 2 73  ? -23.207 -37.807 -10.175 1.00 17.47  ? 163 MET E O   1 
ATOM   738  C CB  . MET E 2 73  ? -23.769 -36.124 -12.684 1.00 15.46  ? 163 MET E CB  1 
ATOM   739  C CG  . MET E 2 73  ? -24.419 -35.181 -13.647 1.00 17.81  ? 163 MET E CG  1 
ATOM   740  S SD  . MET E 2 73  ? -23.116 -34.266 -14.500 1.00 21.29  ? 163 MET E SD  1 
ATOM   741  C CE  . MET E 2 73  ? -22.829 -35.319 -15.882 1.00 18.14  ? 163 MET E CE  1 
ATOM   742  N N   . ASP E 2 74  ? -24.092 -39.227 -11.705 1.00 11.92  ? 164 ASP E N   1 
ATOM   743  C CA  . ASP E 2 74  ? -23.307 -40.379 -11.238 1.00 11.43  ? 164 ASP E CA  1 
ATOM   744  C C   . ASP E 2 74  ? -21.967 -40.378 -11.913 1.00 16.49  ? 164 ASP E C   1 
ATOM   745  O O   . ASP E 2 74  ? -21.897 -40.000 -13.077 1.00 15.48  ? 164 ASP E O   1 
ATOM   746  C CB  . ASP E 2 74  ? -24.006 -41.710 -11.539 1.00 12.83  ? 164 ASP E CB  1 
ATOM   747  C CG  . ASP E 2 74  ? -25.279 -41.958 -10.776 1.00 19.03  ? 164 ASP E CG  1 
ATOM   748  O OD1 . ASP E 2 74  ? -25.245 -41.892 -9.532  1.00 18.41  ? 164 ASP E OD1 1 
ATOM   749  O OD2 . ASP E 2 74  ? -26.286 -42.304 -11.415 1.00 27.66  ? 164 ASP E OD2 1 
ATOM   750  N N   . VAL E 2 75  ? -20.922 -40.883 -11.237 1.00 15.28  ? 165 VAL E N   1 
ATOM   751  C CA  . VAL E 2 75  ? -19.593 -40.995 -11.840 1.00 16.19  ? 165 VAL E CA  1 
ATOM   752  C C   . VAL E 2 75  ? -19.710 -41.892 -13.103 1.00 22.87  ? 165 VAL E C   1 
ATOM   753  O O   . VAL E 2 75  ? -19.862 -43.104 -12.996 1.00 26.17  ? 165 VAL E O   1 
ATOM   754  C CB  . VAL E 2 75  ? -18.515 -41.480 -10.828 1.00 19.28  ? 165 VAL E CB  1 
ATOM   755  C CG1 . VAL E 2 75  ? -17.134 -41.556 -11.486 1.00 19.68  ? 165 VAL E CG1 1 
ATOM   756  C CG2 . VAL E 2 75  ? -18.463 -40.566 -9.609  1.00 18.82  ? 165 VAL E CG2 1 
ATOM   757  N N   . GLY E 2 76  ? -19.732 -41.259 -14.269 1.00 18.99  ? 166 GLY E N   1 
ATOM   758  C CA  . GLY E 2 76  ? -19.869 -41.921 -15.563 1.00 18.04  ? 166 GLY E CA  1 
ATOM   759  C C   . GLY E 2 76  ? -20.972 -41.343 -16.423 1.00 20.05  ? 166 GLY E C   1 
ATOM   760  O O   . GLY E 2 76  ? -21.022 -41.583 -17.634 1.00 18.68  ? 166 GLY E O   1 
ATOM   761  N N   . GLU E 2 77  ? -21.853 -40.568 -15.804 1.00 17.25  ? 167 GLU E N   1 
ATOM   762  C CA  . GLU E 2 77  ? -23.012 -39.985 -16.462 1.00 17.84  ? 167 GLU E CA  1 
ATOM   763  C C   . GLU E 2 77  ? -22.658 -38.891 -17.477 1.00 23.47  ? 167 GLU E C   1 
ATOM   764  O O   . GLU E 2 77  ? -21.709 -38.135 -17.302 1.00 22.66  ? 167 GLU E O   1 
ATOM   765  C CB  . GLU E 2 77  ? -23.948 -39.398 -15.393 1.00 19.16  ? 167 GLU E CB  1 
ATOM   766  C CG  . GLU E 2 77  ? -25.343 -39.047 -15.876 1.00 22.63  ? 167 GLU E CG  1 
ATOM   767  C CD  . GLU E 2 77  ? -26.295 -38.596 -14.787 1.00 34.14  ? 167 GLU E CD  1 
ATOM   768  O OE1 . GLU E 2 77  ? -26.187 -39.092 -13.642 1.00 19.33  ? 167 GLU E OE1 1 
ATOM   769  O OE2 . GLU E 2 77  ? -27.145 -37.726 -15.081 1.00 29.11  ? 167 GLU E OE2 1 
ATOM   770  N N   . THR E 2 78  ? -23.437 -38.829 -18.538 1.00 21.01  ? 168 THR E N   1 
ATOM   771  C CA  . THR E 2 78  ? -23.401 -37.757 -19.507 1.00 20.55  ? 168 THR E CA  1 
ATOM   772  C C   . THR E 2 78  ? -24.748 -37.106 -19.393 1.00 26.26  ? 168 THR E C   1 
ATOM   773  O O   . THR E 2 78  ? -25.769 -37.766 -19.588 1.00 26.14  ? 168 THR E O   1 
ATOM   774  C CB  . THR E 2 78  ? -23.049 -38.211 -20.919 1.00 26.80  ? 168 THR E CB  1 
ATOM   775  O OG1 . THR E 2 78  ? -21.736 -38.747 -20.908 1.00 26.24  ? 168 THR E OG1 1 
ATOM   776  C CG2 . THR E 2 78  ? -23.078 -37.060 -21.912 1.00 25.45  ? 168 THR E CG2 1 
ATOM   777  N N   . ALA E 2 79  ? -24.760 -35.835 -19.020 1.00 22.86  ? 169 ALA E N   1 
ATOM   778  C CA  . ALA E 2 79  ? -25.980 -35.062 -18.919 1.00 22.85  ? 169 ALA E CA  1 
ATOM   779  C C   . ALA E 2 79  ? -25.854 -33.757 -19.693 1.00 27.23  ? 169 ALA E C   1 
ATOM   780  O O   . ALA E 2 79  ? -24.750 -33.297 -20.000 1.00 26.43  ? 169 ALA E O   1 
ATOM   781  C CB  . ALA E 2 79  ? -26.316 -34.779 -17.458 1.00 23.85  ? 169 ALA E CB  1 
ATOM   782  N N   . MET E 2 80  ? -27.005 -33.174 -20.010 1.00 24.14  ? 170 MET E N   1 
ATOM   783  C CA  . MET E 2 80  ? -27.143 -31.891 -20.657 1.00 23.96  ? 170 MET E CA  1 
ATOM   784  C C   . MET E 2 80  ? -27.713 -30.946 -19.607 1.00 24.35  ? 170 MET E C   1 
ATOM   785  O O   . MET E 2 80  ? -28.712 -31.291 -18.984 1.00 22.97  ? 170 MET E O   1 
ATOM   786  C CB  . MET E 2 80  ? -28.059 -32.050 -21.877 1.00 27.48  ? 170 MET E CB  1 
ATOM   787  C CG  . MET E 2 80  ? -28.405 -30.755 -22.575 1.00 32.89  ? 170 MET E CG  1 
ATOM   788  S SD  . MET E 2 80  ? -27.108 -30.135 -23.661 1.00 39.20  ? 170 MET E SD  1 
ATOM   789  C CE  . MET E 2 80  ? -27.214 -31.335 -24.997 1.00 35.87  ? 170 MET E CE  1 
ATOM   790  N N   . VAL E 2 81  ? -27.075 -29.781 -19.376 1.00 19.99  ? 171 VAL E N   1 
ATOM   791  C CA  . VAL E 2 81  ? -27.559 -28.808 -18.391 1.00 18.97  ? 171 VAL E CA  1 
ATOM   792  C C   . VAL E 2 81  ? -27.786 -27.453 -19.069 1.00 22.86  ? 171 VAL E C   1 
ATOM   793  O O   . VAL E 2 81  ? -26.897 -26.930 -19.718 1.00 24.09  ? 171 VAL E O   1 
ATOM   794  C CB  . VAL E 2 81  ? -26.624 -28.695 -17.155 1.00 21.57  ? 171 VAL E CB  1 
ATOM   795  C CG1 . VAL E 2 81  ? -26.978 -27.515 -16.259 1.00 20.60  ? 171 VAL E CG1 1 
ATOM   796  C CG2 . VAL E 2 81  ? -26.593 -29.986 -16.348 1.00 21.11  ? 171 VAL E CG2 1 
ATOM   797  N N   . THR E 2 82  ? -28.988 -26.906 -18.937 1.00 18.93  ? 172 THR E N   1 
ATOM   798  C CA  . THR E 2 82  ? -29.297 -25.579 -19.460 1.00 18.44  ? 172 THR E CA  1 
ATOM   799  C C   . THR E 2 82  ? -29.259 -24.650 -18.269 1.00 22.41  ? 172 THR E C   1 
ATOM   800  O O   . THR E 2 82  ? -29.961 -24.893 -17.287 1.00 22.83  ? 172 THR E O   1 
ATOM   801  C CB  . THR E 2 82  ? -30.625 -25.536 -20.242 1.00 31.51  ? 172 THR E CB  1 
ATOM   802  O OG1 . THR E 2 82  ? -31.724 -25.779 -19.363 1.00 36.31  ? 172 THR E OG1 1 
ATOM   803  C CG2 . THR E 2 82  ? -30.648 -26.484 -21.442 1.00 27.27  ? 172 THR E CG2 1 
ATOM   804  N N   . ALA E 2 83  ? -28.412 -23.622 -18.315 1.00 18.68  ? 173 ALA E N   1 
ATOM   805  C CA  . ALA E 2 83  ? -28.306 -22.712 -17.190 1.00 19.04  ? 173 ALA E CA  1 
ATOM   806  C C   . ALA E 2 83  ? -28.431 -21.247 -17.595 1.00 24.88  ? 173 ALA E C   1 
ATOM   807  O O   . ALA E 2 83  ? -27.875 -20.841 -18.613 1.00 25.94  ? 173 ALA E O   1 
ATOM   808  C CB  . ALA E 2 83  ? -26.983 -22.935 -16.480 1.00 19.90  ? 173 ALA E CB  1 
ATOM   809  N N   . ASP E 2 84  ? -29.121 -20.447 -16.768 1.00 22.08  ? 174 ASP E N   1 
ATOM   810  C CA  . ASP E 2 84  ? -29.249 -18.999 -16.947 1.00 22.26  ? 174 ASP E CA  1 
ATOM   811  C C   . ASP E 2 84  ? -27.906 -18.347 -16.621 1.00 25.86  ? 174 ASP E C   1 
ATOM   812  O O   . ASP E 2 84  ? -27.125 -18.920 -15.866 1.00 27.01  ? 174 ASP E O   1 
ATOM   813  C CB  . ASP E 2 84  ? -30.369 -18.451 -16.047 1.00 24.76  ? 174 ASP E CB  1 
ATOM   814  C CG  . ASP E 2 84  ? -30.678 -16.987 -16.243 1.00 35.79  ? 174 ASP E CG  1 
ATOM   815  O OD1 . ASP E 2 84  ? -30.293 -16.185 -15.380 1.00 37.43  ? 174 ASP E OD1 1 
ATOM   816  O OD2 . ASP E 2 84  ? -31.299 -16.647 -17.259 1.00 44.35  ? 174 ASP E OD2 1 
ATOM   817  N N   . SER E 2 85  ? -27.634 -17.150 -17.174 1.00 21.86  ? 175 SER E N   1 
ATOM   818  C CA  . SER E 2 85  ? -26.400 -16.381 -16.994 1.00 19.72  ? 175 SER E CA  1 
ATOM   819  C C   . SER E 2 85  ? -26.018 -16.149 -15.550 1.00 20.24  ? 175 SER E C   1 
ATOM   820  O O   . SER E 2 85  ? -24.830 -16.100 -15.262 1.00 17.46  ? 175 SER E O   1 
ATOM   821  C CB  . SER E 2 85  ? -26.504 -15.023 -17.677 1.00 24.96  ? 175 SER E CB  1 
ATOM   822  O OG  . SER E 2 85  ? -27.614 -14.263 -17.228 1.00 35.11  ? 175 SER E OG  1 
ATOM   823  N N   . LYS E 2 86  ? -26.999 -16.015 -14.635 1.00 18.11  ? 176 LYS E N   1 
ATOM   824  C CA  . LYS E 2 86  ? -26.733 -15.760 -13.213 1.00 17.64  ? 176 LYS E CA  1 
ATOM   825  C C   . LYS E 2 86  ? -25.959 -16.916 -12.525 1.00 20.47  ? 176 LYS E C   1 
ATOM   826  O O   . LYS E 2 86  ? -25.267 -16.682 -11.528 1.00 20.41  ? 176 LYS E O   1 
ATOM   827  C CB  . LYS E 2 86  ? -28.018 -15.402 -12.450 1.00 20.31  ? 176 LYS E CB  1 
ATOM   828  C CG  . LYS E 2 86  ? -29.070 -16.497 -12.333 1.00 22.61  ? 176 LYS E CG  1 
ATOM   829  C CD  . LYS E 2 86  ? -29.797 -16.380 -11.006 1.00 33.39  ? 176 LYS E CD  1 
ATOM   830  C CE  . LYS E 2 86  ? -31.129 -15.726 -11.092 1.00 41.37  ? 176 LYS E CE  1 
ATOM   831  N NZ  . LYS E 2 86  ? -31.882 -16.027 -9.869  1.00 47.63  ? 176 LYS E NZ  1 
ATOM   832  N N   . TYR E 2 87  ? -26.053 -18.143 -13.063 1.00 17.11  ? 177 TYR E N   1 
ATOM   833  C CA  . TYR E 2 87  ? -25.314 -19.292 -12.525 1.00 15.77  ? 177 TYR E CA  1 
ATOM   834  C C   . TYR E 2 87  ? -24.050 -19.554 -13.337 1.00 19.33  ? 177 TYR E C   1 
ATOM   835  O O   . TYR E 2 87  ? -23.298 -20.462 -13.018 1.00 20.15  ? 177 TYR E O   1 
ATOM   836  C CB  . TYR E 2 87  ? -26.192 -20.542 -12.485 1.00 16.13  ? 177 TYR E CB  1 
ATOM   837  C CG  . TYR E 2 87  ? -27.490 -20.300 -11.755 1.00 17.61  ? 177 TYR E CG  1 
ATOM   838  C CD1 . TYR E 2 87  ? -27.507 -20.087 -10.379 1.00 19.49  ? 177 TYR E CD1 1 
ATOM   839  C CD2 . TYR E 2 87  ? -28.702 -20.287 -12.435 1.00 17.34  ? 177 TYR E CD2 1 
ATOM   840  C CE1 . TYR E 2 87  ? -28.697 -19.837 -9.703  1.00 19.84  ? 177 TYR E CE1 1 
ATOM   841  C CE2 . TYR E 2 87  ? -29.899 -20.050 -11.767 1.00 17.76  ? 177 TYR E CE2 1 
ATOM   842  C CZ  . TYR E 2 87  ? -29.889 -19.824 -10.399 1.00 19.93  ? 177 TYR E CZ  1 
ATOM   843  O OH  . TYR E 2 87  ? -31.053 -19.580 -9.725  1.00 19.30  ? 177 TYR E OH  1 
ATOM   844  N N   . CYS E 2 88  ? -23.812 -18.721 -14.358 1.00 17.15  ? 178 CYS E N   1 
ATOM   845  C CA  . CYS E 2 88  ? -22.710 -18.822 -15.292 1.00 17.02  ? 178 CYS E CA  1 
ATOM   846  C C   . CYS E 2 88  ? -21.774 -17.587 -15.226 1.00 23.10  ? 178 CYS E C   1 
ATOM   847  O O   . CYS E 2 88  ? -21.124 -17.361 -14.197 1.00 23.50  ? 178 CYS E O   1 
ATOM   848  C CB  . CYS E 2 88  ? -23.254 -19.060 -16.696 1.00 17.34  ? 178 CYS E CB  1 
ATOM   849  S SG  . CYS E 2 88  ? -24.219 -20.589 -16.862 1.00 21.26  ? 178 CYS E SG  1 
ATOM   850  N N   . TYR E 2 89  ? -21.682 -16.809 -16.312 1.00 21.10  ? 179 TYR E N   1 
ATOM   851  C CA  . TYR E 2 89  ? -20.740 -15.692 -16.420 1.00 20.75  ? 179 TYR E CA  1 
ATOM   852  C C   . TYR E 2 89  ? -21.405 -14.317 -16.209 1.00 26.70  ? 179 TYR E C   1 
ATOM   853  O O   . TYR E 2 89  ? -20.734 -13.294 -16.292 1.00 26.96  ? 179 TYR E O   1 
ATOM   854  C CB  . TYR E 2 89  ? -19.968 -15.778 -17.755 1.00 20.66  ? 179 TYR E CB  1 
ATOM   855  C CG  . TYR E 2 89  ? -19.118 -17.031 -17.809 1.00 21.17  ? 179 TYR E CG  1 
ATOM   856  C CD1 . TYR E 2 89  ? -17.916 -17.110 -17.113 1.00 21.75  ? 179 TYR E CD1 1 
ATOM   857  C CD2 . TYR E 2 89  ? -19.583 -18.188 -18.438 1.00 22.37  ? 179 TYR E CD2 1 
ATOM   858  C CE1 . TYR E 2 89  ? -17.158 -18.279 -17.106 1.00 22.01  ? 179 TYR E CE1 1 
ATOM   859  C CE2 . TYR E 2 89  ? -18.838 -19.371 -18.426 1.00 22.67  ? 179 TYR E CE2 1 
ATOM   860  C CZ  . TYR E 2 89  ? -17.625 -19.409 -17.760 1.00 29.13  ? 179 TYR E CZ  1 
ATOM   861  O OH  . TYR E 2 89  ? -16.871 -20.558 -17.748 1.00 32.49  ? 179 TYR E OH  1 
ATOM   862  N N   . GLY E 2 90  ? -22.666 -14.332 -15.808 1.00 25.05  ? 180 GLY E N   1 
ATOM   863  C CA  . GLY E 2 90  ? -23.451 -13.165 -15.425 1.00 25.98  ? 180 GLY E CA  1 
ATOM   864  C C   . GLY E 2 90  ? -23.564 -11.969 -16.353 1.00 33.35  ? 180 GLY E C   1 
ATOM   865  O O   . GLY E 2 90  ? -23.441 -12.100 -17.580 1.00 33.81  ? 180 GLY E O   1 
ATOM   866  N N   . PRO E 2 91  ? -23.821 -10.772 -15.744 1.00 29.80  ? 181 PRO E N   1 
ATOM   867  C CA  . PRO E 2 91  ? -24.025 -9.546  -16.540 1.00 28.99  ? 181 PRO E CA  1 
ATOM   868  C C   . PRO E 2 91  ? -22.824 -9.028  -17.312 1.00 30.38  ? 181 PRO E C   1 
ATOM   869  O O   . PRO E 2 91  ? -23.033 -8.253  -18.230 1.00 31.42  ? 181 PRO E O   1 
ATOM   870  C CB  . PRO E 2 91  ? -24.431 -8.501  -15.501 1.00 30.96  ? 181 PRO E CB  1 
ATOM   871  C CG  . PRO E 2 91  ? -24.837 -9.268  -14.299 1.00 35.64  ? 181 PRO E CG  1 
ATOM   872  C CD  . PRO E 2 91  ? -24.000 -10.499 -14.305 1.00 31.20  ? 181 PRO E CD  1 
ATOM   873  N N   . GLN E 2 92  ? -21.589 -9.416  -16.964 1.00 24.40  ? 182 GLN E N   1 
ATOM   874  C CA  . GLN E 2 92  ? -20.440 -8.907  -17.704 1.00 22.75  ? 182 GLN E CA  1 
ATOM   875  C C   . GLN E 2 92  ? -19.888 -9.914  -18.711 1.00 24.73  ? 182 GLN E C   1 
ATOM   876  O O   . GLN E 2 92  ? -19.226 -9.507  -19.669 1.00 22.74  ? 182 GLN E O   1 
ATOM   877  C CB  . GLN E 2 92  ? -19.336 -8.446  -16.766 1.00 24.34  ? 182 GLN E CB  1 
ATOM   878  C CG  . GLN E 2 92  ? -19.752 -7.213  -15.952 1.00 45.39  ? 182 GLN E CG  1 
ATOM   879  C CD  . GLN E 2 92  ? -18.642 -6.239  -15.670 1.00 64.44  ? 182 GLN E CD  1 
ATOM   880  O OE1 . GLN E 2 92  ? -17.499 -6.373  -16.129 1.00 57.14  ? 182 GLN E OE1 1 
ATOM   881  N NE2 . GLN E 2 92  ? -18.968 -5.240  -14.871 1.00 63.00  ? 182 GLN E NE2 1 
ATOM   882  N N   . GLY E 2 93  ? -20.179 -11.199 -18.492 1.00 21.25  ? 183 GLY E N   1 
ATOM   883  C CA  . GLY E 2 93  ? -19.692 -12.284 -19.332 1.00 21.29  ? 183 GLY E CA  1 
ATOM   884  C C   . GLY E 2 93  ? -18.274 -12.650 -18.949 1.00 28.12  ? 183 GLY E C   1 
ATOM   885  O O   . GLY E 2 93  ? -17.869 -12.436 -17.800 1.00 27.33  ? 183 GLY E O   1 
ATOM   886  N N   . ARG E 2 94  ? -17.496 -13.183 -19.909 1.00 26.77  ? 184 ARG E N   1 
ATOM   887  C CA  . ARG E 2 94  ? -16.111 -13.595 -19.660 1.00 26.89  ? 184 ARG E CA  1 
ATOM   888  C C   . ARG E 2 94  ? -15.172 -13.138 -20.769 1.00 33.24  ? 184 ARG E C   1 
ATOM   889  O O   . ARG E 2 94  ? -15.610 -13.017 -21.915 1.00 31.40  ? 184 ARG E O   1 
ATOM   890  C CB  . ARG E 2 94  ? -16.035 -15.122 -19.522 1.00 24.84  ? 184 ARG E CB  1 
ATOM   891  N N   . SER E 2 95  ? -13.879 -12.877 -20.420 1.00 33.98  ? 185 SER E N   1 
ATOM   892  C CA  . SER E 2 95  ? -12.800 -12.515 -21.361 1.00 35.55  ? 185 SER E CA  1 
ATOM   893  C C   . SER E 2 95  ? -12.443 -13.731 -22.246 1.00 41.12  ? 185 SER E C   1 
ATOM   894  O O   . SER E 2 95  ? -12.476 -13.522 -23.458 1.00 41.10  ? 185 SER E O   1 
ATOM   895  C CB  . SER E 2 95  ? -11.588 -11.935 -20.652 1.00 41.54  ? 185 SER E CB  1 
ATOM   896  O OG  . SER E 2 95  ? -11.779 -10.536 -20.500 1.00 56.71  ? 185 SER E OG  1 
ATOM   897  N N   . PRO E 2 96  ? -12.217 -15.004 -21.756 1.00 38.37  ? 186 PRO E N   1 
ATOM   898  C CA  . PRO E 2 96  ? -12.202 -16.150 -22.697 1.00 37.87  ? 186 PRO E CA  1 
ATOM   899  C C   . PRO E 2 96  ? -13.693 -16.344 -23.069 1.00 39.49  ? 186 PRO E C   1 
ATOM   900  O O   . PRO E 2 96  ? -14.415 -17.178 -22.538 1.00 41.00  ? 186 PRO E O   1 
ATOM   901  C CB  . PRO E 2 96  ? -11.579 -17.295 -21.875 1.00 39.69  ? 186 PRO E CB  1 
ATOM   902  C CG  . PRO E 2 96  ? -11.388 -16.762 -20.468 1.00 44.08  ? 186 PRO E CG  1 
ATOM   903  C CD  . PRO E 2 96  ? -12.177 -15.490 -20.358 1.00 39.96  ? 186 PRO E CD  1 
ATOM   904  N N   . TYR E 2 97  ? -14.098 -15.534 -24.047 1.00 31.37  ? 187 TYR E N   1 
ATOM   905  C CA  . TYR E 2 97  ? -15.323 -14.931 -24.504 1.00 28.28  ? 187 TYR E CA  1 
ATOM   906  C C   . TYR E 2 97  ? -16.611 -15.714 -24.350 1.00 28.90  ? 187 TYR E C   1 
ATOM   907  O O   . TYR E 2 97  ? -16.846 -16.755 -24.950 1.00 29.47  ? 187 TYR E O   1 
ATOM   908  C CB  . TYR E 2 97  ? -15.252 -14.439 -25.945 1.00 28.36  ? 187 TYR E CB  1 
ATOM   909  C CG  . TYR E 2 97  ? -16.228 -13.305 -26.142 1.00 27.69  ? 187 TYR E CG  1 
ATOM   910  C CD1 . TYR E 2 97  ? -16.027 -12.071 -25.524 1.00 28.65  ? 187 TYR E CD1 1 
ATOM   911  C CD2 . TYR E 2 97  ? -17.430 -13.507 -26.814 1.00 28.50  ? 187 TYR E CD2 1 
ATOM   912  C CE1 . TYR E 2 97  ? -16.962 -11.046 -25.638 1.00 28.51  ? 187 TYR E CE1 1 
ATOM   913  C CE2 . TYR E 2 97  ? -18.378 -12.494 -26.922 1.00 29.63  ? 187 TYR E CE2 1 
ATOM   914  C CZ  . TYR E 2 97  ? -18.135 -11.262 -26.345 1.00 34.08  ? 187 TYR E CZ  1 
ATOM   915  O OH  . TYR E 2 97  ? -19.085 -10.286 -26.477 1.00 35.71  ? 187 TYR E OH  1 
ATOM   916  N N   . ILE E 2 98  ? -17.515 -15.027 -23.643 1.00 23.40  ? 188 ILE E N   1 
ATOM   917  C CA  . ILE E 2 98  ? -18.914 -15.327 -23.345 1.00 21.42  ? 188 ILE E CA  1 
ATOM   918  C C   . ILE E 2 98  ? -19.616 -13.957 -23.322 1.00 24.61  ? 188 ILE E C   1 
ATOM   919  O O   . ILE E 2 98  ? -19.199 -13.075 -22.577 1.00 23.40  ? 188 ILE E O   1 
ATOM   920  C CB  . ILE E 2 98  ? -19.122 -16.141 -22.035 1.00 24.16  ? 188 ILE E CB  1 
ATOM   921  C CG1 . ILE E 2 98  ? -18.740 -17.609 -22.193 1.00 23.67  ? 188 ILE E CG1 1 
ATOM   922  C CG2 . ILE E 2 98  ? -20.558 -16.030 -21.519 1.00 26.21  ? 188 ILE E CG2 1 
ATOM   923  C CD1 . ILE E 2 98  ? -17.537 -17.958 -21.469 1.00 31.73  ? 188 ILE E CD1 1 
ATOM   924  N N   . PRO E 2 99  ? -20.663 -13.747 -24.144 1.00 21.21  ? 189 PRO E N   1 
ATOM   925  C CA  . PRO E 2 99  ? -21.357 -12.449 -24.139 1.00 20.58  ? 189 PRO E CA  1 
ATOM   926  C C   . PRO E 2 99  ? -22.080 -12.165 -22.814 1.00 26.29  ? 189 PRO E C   1 
ATOM   927  O O   . PRO E 2 99  ? -22.320 -13.111 -22.060 1.00 26.54  ? 189 PRO E O   1 
ATOM   928  C CB  . PRO E 2 99  ? -22.374 -12.586 -25.286 1.00 21.82  ? 189 PRO E CB  1 
ATOM   929  C CG  . PRO E 2 99  ? -21.901 -13.716 -26.102 1.00 26.87  ? 189 PRO E CG  1 
ATOM   930  C CD  . PRO E 2 99  ? -21.266 -14.664 -25.128 1.00 22.08  ? 189 PRO E CD  1 
ATOM   931  N N   . PRO E 2 100 ? -22.451 -10.891 -22.520 1.00 22.62  ? 190 PRO E N   1 
ATOM   932  C CA  . PRO E 2 100 ? -23.164 -10.605 -21.265 1.00 23.00  ? 190 PRO E CA  1 
ATOM   933  C C   . PRO E 2 100 ? -24.571 -11.200 -21.275 1.00 27.97  ? 190 PRO E C   1 
ATOM   934  O O   . PRO E 2 100 ? -25.165 -11.346 -22.349 1.00 27.04  ? 190 PRO E O   1 
ATOM   935  C CB  . PRO E 2 100 ? -23.211 -9.069  -21.228 1.00 24.62  ? 190 PRO E CB  1 
ATOM   936  C CG  . PRO E 2 100 ? -22.264 -8.594  -22.275 1.00 28.27  ? 190 PRO E CG  1 
ATOM   937  C CD  . PRO E 2 100 ? -22.244 -9.655  -23.307 1.00 23.77  ? 190 PRO E CD  1 
ATOM   938  N N   . HIS E 2 101 ? -25.080 -11.591 -20.089 1.00 26.43  ? 191 HIS E N   1 
ATOM   939  C CA  . HIS E 2 101 ? -26.417 -12.194 -19.889 1.00 27.17  ? 191 HIS E CA  1 
ATOM   940  C C   . HIS E 2 101 ? -26.655 -13.390 -20.819 1.00 28.85  ? 191 HIS E C   1 
ATOM   941  O O   . HIS E 2 101 ? -27.759 -13.565 -21.360 1.00 30.17  ? 191 HIS E O   1 
ATOM   942  C CB  . HIS E 2 101 ? -27.533 -11.144 -20.060 1.00 28.76  ? 191 HIS E CB  1 
ATOM   943  C CG  . HIS E 2 101 ? -27.338 -9.948  -19.197 1.00 32.96  ? 191 HIS E CG  1 
ATOM   944  N ND1 . HIS E 2 101 ? -26.618 -8.858  -19.643 1.00 35.22  ? 191 HIS E ND1 1 
ATOM   945  C CD2 . HIS E 2 101 ? -27.750 -9.714  -17.930 1.00 35.56  ? 191 HIS E CD2 1 
ATOM   946  C CE1 . HIS E 2 101 ? -26.610 -7.998  -18.637 1.00 35.04  ? 191 HIS E CE1 1 
ATOM   947  N NE2 . HIS E 2 101 ? -27.292 -8.462  -17.591 1.00 35.39  ? 191 HIS E NE2 1 
ATOM   948  N N   . ALA E 2 102 ? -25.621 -14.226 -20.965 1.00 23.01  ? 192 ALA E N   1 
ATOM   949  C CA  . ALA E 2 102 ? -25.686 -15.366 -21.859 1.00 22.62  ? 192 ALA E CA  1 
ATOM   950  C C   . ALA E 2 102 ? -26.083 -16.623 -21.129 1.00 27.76  ? 192 ALA E C   1 
ATOM   951  O O   . ALA E 2 102 ? -25.463 -16.989 -20.141 1.00 27.37  ? 192 ALA E O   1 
ATOM   952  C CB  . ALA E 2 102 ? -24.354 -15.564 -22.565 1.00 23.11  ? 192 ALA E CB  1 
ATOM   953  N N   . ALA E 2 103 ? -27.158 -17.266 -21.606 1.00 25.08  ? 193 ALA E N   1 
ATOM   954  C CA  . ALA E 2 103 ? -27.623 -18.551 -21.095 1.00 24.17  ? 193 ALA E CA  1 
ATOM   955  C C   . ALA E 2 103 ? -26.774 -19.638 -21.744 1.00 27.54  ? 193 ALA E C   1 
ATOM   956  O O   . ALA E 2 103 ? -26.476 -19.531 -22.929 1.00 26.57  ? 193 ALA E O   1 
ATOM   957  C CB  . ALA E 2 103 ? -29.094 -18.743 -21.427 1.00 24.75  ? 193 ALA E CB  1 
ATOM   958  N N   . LEU E 2 104 ? -26.348 -20.648 -20.984 1.00 24.45  ? 194 LEU E N   1 
ATOM   959  C CA  . LEU E 2 104 ? -25.461 -21.675 -21.520 1.00 23.94  ? 194 LEU E CA  1 
ATOM   960  C C   . LEU E 2 104 ? -26.081 -23.071 -21.529 1.00 29.60  ? 194 LEU E C   1 
ATOM   961  O O   . LEU E 2 104 ? -26.902 -23.407 -20.673 1.00 28.00  ? 194 LEU E O   1 
ATOM   962  C CB  . LEU E 2 104 ? -24.165 -21.714 -20.693 1.00 23.74  ? 194 LEU E CB  1 
ATOM   963  C CG  . LEU E 2 104 ? -23.144 -20.565 -20.792 1.00 28.45  ? 194 LEU E CG  1 
ATOM   964  C CD1 . LEU E 2 104 ? -23.648 -19.284 -20.316 1.00 28.82  ? 194 LEU E CD1 1 
ATOM   965  C CD2 . LEU E 2 104 ? -21.977 -20.855 -19.915 1.00 31.71  ? 194 LEU E CD2 1 
ATOM   966  N N   . CYS E 2 105 ? -25.659 -23.884 -22.512 1.00 29.59  ? 195 CYS E N   1 
ATOM   967  C CA  . CYS E 2 105 ? -25.980 -25.304 -22.644 1.00 30.28  ? 195 CYS E CA  1 
ATOM   968  C C   . CYS E 2 105 ? -24.692 -26.035 -22.398 1.00 29.80  ? 195 CYS E C   1 
ATOM   969  O O   . CYS E 2 105 ? -23.753 -25.918 -23.188 1.00 28.63  ? 195 CYS E O   1 
ATOM   970  C CB  . CYS E 2 105 ? -26.569 -25.653 -24.007 1.00 32.44  ? 195 CYS E CB  1 
ATOM   971  S SG  . CYS E 2 105 ? -28.047 -24.726 -24.452 1.00 37.58  ? 195 CYS E SG  1 
ATOM   972  N N   . LEU E 2 106 ? -24.623 -26.743 -21.283 1.00 24.16  ? 196 LEU E N   1 
ATOM   973  C CA  . LEU E 2 106 ? -23.430 -27.460 -20.866 1.00 22.71  ? 196 LEU E CA  1 
ATOM   974  C C   . LEU E 2 106 ? -23.609 -28.957 -21.054 1.00 28.48  ? 196 LEU E C   1 
ATOM   975  O O   . LEU E 2 106 ? -24.490 -29.543 -20.444 1.00 29.57  ? 196 LEU E O   1 
ATOM   976  C CB  . LEU E 2 106 ? -23.094 -27.133 -19.393 1.00 21.73  ? 196 LEU E CB  1 
ATOM   977  C CG  . LEU E 2 106 ? -22.959 -25.656 -18.959 1.00 25.13  ? 196 LEU E CG  1 
ATOM   978  C CD1 . LEU E 2 106 ? -22.899 -25.540 -17.446 1.00 24.49  ? 196 LEU E CD1 1 
ATOM   979  C CD2 . LEU E 2 106 ? -21.699 -25.032 -19.503 1.00 25.75  ? 196 LEU E CD2 1 
ATOM   980  N N   . GLU E 2 107 ? -22.783 -29.565 -21.917 1.00 26.19  ? 197 GLU E N   1 
ATOM   981  C CA  . GLU E 2 107 ? -22.771 -30.998 -22.193 1.00 26.11  ? 197 GLU E CA  1 
ATOM   982  C C   . GLU E 2 107 ? -21.711 -31.581 -21.255 1.00 28.69  ? 197 GLU E C   1 
ATOM   983  O O   . GLU E 2 107 ? -20.518 -31.426 -21.511 1.00 30.12  ? 197 GLU E O   1 
ATOM   984  C CB  . GLU E 2 107 ? -22.503 -31.225 -23.698 1.00 27.72  ? 197 GLU E CB  1 
ATOM   985  C CG  . GLU E 2 107 ? -21.857 -32.548 -24.091 1.00 40.77  ? 197 GLU E CG  1 
ATOM   986  C CD  . GLU E 2 107 ? -22.761 -33.685 -24.517 1.00 60.61  ? 197 GLU E CD  1 
ATOM   987  O OE1 . GLU E 2 107 ? -22.223 -34.704 -25.004 1.00 49.45  ? 197 GLU E OE1 1 
ATOM   988  O OE2 . GLU E 2 107 ? -23.998 -33.570 -24.357 1.00 55.68  ? 197 GLU E OE2 1 
ATOM   989  N N   . VAL E 2 108 ? -22.139 -32.149 -20.110 1.00 22.48  ? 198 VAL E N   1 
ATOM   990  C CA  . VAL E 2 108 ? -21.208 -32.626 -19.089 1.00 21.43  ? 198 VAL E CA  1 
ATOM   991  C C   . VAL E 2 108 ? -21.118 -34.142 -19.075 1.00 24.91  ? 198 VAL E C   1 
ATOM   992  O O   . VAL E 2 108 ? -22.139 -34.810 -19.154 1.00 22.99  ? 198 VAL E O   1 
ATOM   993  C CB  . VAL E 2 108 ? -21.559 -32.103 -17.662 1.00 24.42  ? 198 VAL E CB  1 
ATOM   994  C CG1 . VAL E 2 108 ? -20.336 -32.142 -16.748 1.00 23.36  ? 198 VAL E CG1 1 
ATOM   995  C CG2 . VAL E 2 108 ? -22.151 -30.699 -17.701 1.00 24.47  ? 198 VAL E CG2 1 
ATOM   996  N N   . THR E 2 109 ? -19.885 -34.666 -18.924 1.00 21.16  ? 199 THR E N   1 
ATOM   997  C CA  . THR E 2 109 ? -19.575 -36.075 -18.781 1.00 20.05  ? 199 THR E CA  1 
ATOM   998  C C   . THR E 2 109 ? -18.739 -36.167 -17.528 1.00 23.01  ? 199 THR E C   1 
ATOM   999  O O   . THR E 2 109 ? -17.603 -35.688 -17.529 1.00 25.10  ? 199 THR E O   1 
ATOM   1000 C CB  . THR E 2 109 ? -18.880 -36.631 -20.042 1.00 27.51  ? 199 THR E CB  1 
ATOM   1001 O OG1 . THR E 2 109 ? -19.715 -36.417 -21.182 1.00 28.12  ? 199 THR E OG1 1 
ATOM   1002 C CG2 . THR E 2 109 ? -18.540 -38.118 -19.921 1.00 27.21  ? 199 THR E CG2 1 
ATOM   1003 N N   . LEU E 2 110 ? -19.294 -36.722 -16.446 1.00 15.92  ? 200 LEU E N   1 
ATOM   1004 C CA  . LEU E 2 110 ? -18.534 -36.847 -15.211 1.00 15.41  ? 200 LEU E CA  1 
ATOM   1005 C C   . LEU E 2 110 ? -17.612 -38.069 -15.327 1.00 21.40  ? 200 LEU E C   1 
ATOM   1006 O O   . LEU E 2 110 ? -18.072 -39.220 -15.257 1.00 19.96  ? 200 LEU E O   1 
ATOM   1007 C CB  . LEU E 2 110 ? -19.467 -36.928 -13.987 1.00 14.80  ? 200 LEU E CB  1 
ATOM   1008 C CG  . LEU E 2 110 ? -18.810 -37.162 -12.621 1.00 17.73  ? 200 LEU E CG  1 
ATOM   1009 C CD1 . LEU E 2 110 ? -17.830 -36.074 -12.260 1.00 17.61  ? 200 LEU E CD1 1 
ATOM   1010 C CD2 . LEU E 2 110 ? -19.829 -37.212 -11.568 1.00 17.79  ? 200 LEU E CD2 1 
ATOM   1011 N N   . LYS E 2 111 ? -16.317 -37.808 -15.523 1.00 19.34  ? 201 LYS E N   1 
ATOM   1012 C CA  . LYS E 2 111 ? -15.311 -38.855 -15.740 1.00 19.26  ? 201 LYS E CA  1 
ATOM   1013 C C   . LYS E 2 111 ? -14.887 -39.534 -14.439 1.00 23.18  ? 201 LYS E C   1 
ATOM   1014 O O   . LYS E 2 111 ? -15.017 -40.753 -14.330 1.00 24.33  ? 201 LYS E O   1 
ATOM   1015 C CB  . LYS E 2 111 ? -14.082 -38.287 -16.471 1.00 21.43  ? 201 LYS E CB  1 
ATOM   1016 C CG  . LYS E 2 111 ? -14.395 -37.784 -17.886 1.00 40.04  ? 201 LYS E CG  1 
ATOM   1017 C CD  . LYS E 2 111 ? -13.254 -36.972 -18.479 1.00 49.46  ? 201 LYS E CD  1 
ATOM   1018 C CE  . LYS E 2 111 ? -12.469 -37.754 -19.501 1.00 57.96  ? 201 LYS E CE  1 
ATOM   1019 N NZ  . LYS E 2 111 ? -11.419 -36.929 -20.145 1.00 64.44  ? 201 LYS E NZ  1 
ATOM   1020 N N   . THR E 2 112 ? -14.345 -38.770 -13.475 1.00 18.02  ? 202 THR E N   1 
ATOM   1021 C CA  . THR E 2 112 ? -13.888 -39.308 -12.187 1.00 17.00  ? 202 THR E CA  1 
ATOM   1022 C C   . THR E 2 112 ? -14.294 -38.400 -11.041 1.00 17.96  ? 202 THR E C   1 
ATOM   1023 O O   . THR E 2 112 ? -14.651 -37.250 -11.268 1.00 16.85  ? 202 THR E O   1 
ATOM   1024 C CB  . THR E 2 112 ? -12.353 -39.519 -12.169 1.00 30.38  ? 202 THR E CB  1 
ATOM   1025 O OG1 . THR E 2 112 ? -11.695 -38.327 -12.585 1.00 31.50  ? 202 THR E OG1 1 
ATOM   1026 C CG2 . THR E 2 112 ? -11.888 -40.695 -13.034 1.00 32.56  ? 202 THR E CG2 1 
ATOM   1027 N N   . ALA E 2 113 ? -14.231 -38.938 -9.800  1.00 13.40  ? 203 ALA E N   1 
ATOM   1028 C CA  . ALA E 2 113 ? -14.509 -38.254 -8.541  1.00 11.75  ? 203 ALA E CA  1 
ATOM   1029 C C   . ALA E 2 113 ? -13.701 -38.933 -7.466  1.00 19.73  ? 203 ALA E C   1 
ATOM   1030 O O   . ALA E 2 113 ? -13.966 -40.086 -7.136  1.00 20.72  ? 203 ALA E O   1 
ATOM   1031 C CB  . ALA E 2 113 ? -15.992 -38.271 -8.204  1.00 10.84  ? 203 ALA E CB  1 
ATOM   1032 N N   . VAL E 2 114 ? -12.650 -38.251 -6.981  1.00 17.66  ? 204 VAL E N   1 
ATOM   1033 C CA  . VAL E 2 114 ? -11.751 -38.783 -5.955  1.00 17.72  ? 204 VAL E CA  1 
ATOM   1034 C C   . VAL E 2 114 ? -11.881 -37.928 -4.719  1.00 24.80  ? 204 VAL E C   1 
ATOM   1035 O O   . VAL E 2 114 ? -12.224 -36.754 -4.824  1.00 25.35  ? 204 VAL E O   1 
ATOM   1036 C CB  . VAL E 2 114 ? -10.278 -38.911 -6.435  1.00 21.67  ? 204 VAL E CB  1 
ATOM   1037 C CG1 . VAL E 2 114 ? -10.173 -39.869 -7.631  1.00 21.96  ? 204 VAL E CG1 1 
ATOM   1038 C CG2 . VAL E 2 114 ? -9.648  -37.547 -6.762  1.00 20.42  ? 204 VAL E CG2 1 
ATOM   1039 N N   . ASP E 2 115 ? -11.624 -38.503 -3.550  1.00 24.44  ? 205 ASP E N   1 
ATOM   1040 C CA  . ASP E 2 115 ? -11.736 -37.770 -2.295  1.00 25.63  ? 205 ASP E CA  1 
ATOM   1041 C C   . ASP E 2 115 ? -10.814 -36.548 -2.287  1.00 33.01  ? 205 ASP E C   1 
ATOM   1042 O O   . ASP E 2 115 ? -9.719  -36.590 -2.862  1.00 33.61  ? 205 ASP E O   1 
ATOM   1043 C CB  . ASP E 2 115 ? -11.447 -38.683 -1.100  1.00 27.54  ? 205 ASP E CB  1 
ATOM   1044 C CG  . ASP E 2 115 ? -12.657 -39.487 -0.637  1.00 37.87  ? 205 ASP E CG  1 
ATOM   1045 O OD1 . ASP E 2 115 ? -13.805 -39.012 -0.835  1.00 37.04  ? 205 ASP E OD1 1 
ATOM   1046 O OD2 . ASP E 2 115 ? -12.458 -40.575 -0.060  1.00 45.00  ? 205 ASP E OD2 1 
ATOM   1047 N N   . GLY E 2 116 ? -11.310 -35.461 -1.693  1.00 29.95  ? 206 GLY E N   1 
ATOM   1048 C CA  . GLY E 2 116 ? -10.591 -34.196 -1.578  1.00 29.07  ? 206 GLY E CA  1 
ATOM   1049 C C   . GLY E 2 116 ? -9.279  -34.343 -0.845  1.00 30.32  ? 206 GLY E C   1 
ATOM   1050 O O   . GLY E 2 116 ? -9.158  -35.226 0.013   1.00 29.70  ? 206 GLY E O   1 
ATOM   1051 N N   . PRO E 2 117 ? -8.255  -33.528 -1.190  1.00 26.33  ? 207 PRO E N   1 
ATOM   1052 C CA  . PRO E 2 117 ? -6.956  -33.681 -0.516  1.00 25.30  ? 207 PRO E CA  1 
ATOM   1053 C C   . PRO E 2 117 ? -6.997  -33.236 0.930   1.00 28.39  ? 207 PRO E C   1 
ATOM   1054 O O   . PRO E 2 117 ? -7.751  -32.319 1.262   1.00 28.40  ? 207 PRO E O   1 
ATOM   1055 C CB  . PRO E 2 117 ? -6.017  -32.791 -1.333  1.00 26.77  ? 207 PRO E CB  1 
ATOM   1056 C CG  . PRO E 2 117 ? -6.887  -31.786 -1.959  1.00 31.90  ? 207 PRO E CG  1 
ATOM   1057 C CD  . PRO E 2 117 ? -8.212  -32.451 -2.203  1.00 27.92  ? 207 PRO E CD  1 
ATOM   1058 N N   . ASP E 2 118 ? -6.217  -33.908 1.793   1.00 23.39  ? 208 ASP E N   1 
ATOM   1059 C CA  . ASP E 2 118 ? -6.084  -33.490 3.177   1.00 22.66  ? 208 ASP E CA  1 
ATOM   1060 C C   . ASP E 2 118 ? -5.059  -32.377 3.146   1.00 27.70  ? 208 ASP E C   1 
ATOM   1061 O O   . ASP E 2 118 ? -3.871  -32.645 2.942   1.00 27.91  ? 208 ASP E O   1 
ATOM   1062 C CB  . ASP E 2 118 ? -5.665  -34.650 4.098   1.00 24.26  ? 208 ASP E CB  1 
ATOM   1063 C CG  . ASP E 2 118 ? -5.541  -34.285 5.571   1.00 34.56  ? 208 ASP E CG  1 
ATOM   1064 O OD1 . ASP E 2 118 ? -5.834  -33.120 5.929   1.00 32.28  ? 208 ASP E OD1 1 
ATOM   1065 O OD2 . ASP E 2 118 ? -5.176  -35.169 6.369   1.00 46.83  ? 208 ASP E OD2 1 
ATOM   1066 N N   . LEU E 2 119 ? -5.532  -31.124 3.267   1.00 23.28  ? 209 LEU E N   1 
ATOM   1067 C CA  . LEU E 2 119 ? -4.699  -29.919 3.201   1.00 21.99  ? 209 LEU E CA  1 
ATOM   1068 C C   . LEU E 2 119 ? -3.507  -30.006 4.135   1.00 25.84  ? 209 LEU E C   1 
ATOM   1069 O O   . LEU E 2 119 ? -2.419  -29.561 3.768   1.00 24.30  ? 209 LEU E O   1 
ATOM   1070 C CB  . LEU E 2 119 ? -5.518  -28.657 3.518   1.00 20.84  ? 209 LEU E CB  1 
ATOM   1071 C CG  . LEU E 2 119 ? -6.697  -28.324 2.606   1.00 24.78  ? 209 LEU E CG  1 
ATOM   1072 C CD1 . LEU E 2 119 ? -7.281  -27.041 2.987   1.00 24.18  ? 209 LEU E CD1 1 
ATOM   1073 C CD2 . LEU E 2 119 ? -6.292  -28.239 1.160   1.00 28.00  ? 209 LEU E CD2 1 
ATOM   1074 N N   . GLU E 2 120 ? -3.715  -30.628 5.309   1.00 22.66  ? 210 GLU E N   1 
ATOM   1075 C CA  . GLU E 2 120 ? -2.706  -30.823 6.333   1.00 23.84  ? 210 GLU E CA  1 
ATOM   1076 C C   . GLU E 2 120 ? -1.632  -31.844 5.927   1.00 29.85  ? 210 GLU E C   1 
ATOM   1077 O O   . GLU E 2 120 ? -0.564  -31.850 6.518   1.00 30.97  ? 210 GLU E O   1 
ATOM   1078 C CB  . GLU E 2 120 ? -3.367  -31.254 7.645   1.00 25.41  ? 210 GLU E CB  1 
ATOM   1079 C CG  . GLU E 2 120 ? -4.068  -30.102 8.356   1.00 39.49  ? 210 GLU E CG  1 
ATOM   1080 C CD  . GLU E 2 120 ? -4.108  -30.198 9.869   1.00 66.23  ? 210 GLU E CD  1 
ATOM   1081 O OE1 . GLU E 2 120 ? -3.430  -29.380 10.532  1.00 58.98  ? 210 GLU E OE1 1 
ATOM   1082 O OE2 . GLU E 2 120 ? -4.800  -31.102 10.392  1.00 67.15  ? 210 GLU E OE2 1 
ATOM   1083 N N   . MET E 2 121 ? -1.895  -32.668 4.919   1.00 27.25  ? 211 MET E N   1 
ATOM   1084 C CA  . MET E 2 121 ? -0.988  -33.717 4.466   1.00 27.95  ? 211 MET E CA  1 
ATOM   1085 C C   . MET E 2 121 ? -0.376  -33.426 3.089   1.00 29.77  ? 211 MET E C   1 
ATOM   1086 O O   . MET E 2 121 ? 0.325   -34.280 2.536   1.00 30.06  ? 211 MET E O   1 
ATOM   1087 C CB  . MET E 2 121 ? -1.727  -35.070 4.442   1.00 30.73  ? 211 MET E CB  1 
ATOM   1088 C CG  . MET E 2 121 ? -1.944  -35.661 5.822   1.00 35.04  ? 211 MET E CG  1 
ATOM   1089 S SD  . MET E 2 121 ? -0.400  -35.971 6.708   1.00 39.97  ? 211 MET E SD  1 
ATOM   1090 C CE  . MET E 2 121 ? 0.228   -37.372 5.799   1.00 36.47  ? 211 MET E CE  1 
ATOM   1091 N N   . LEU E 2 122 ? -0.616  -32.222 2.551   1.00 24.03  ? 212 LEU E N   1 
ATOM   1092 C CA  . LEU E 2 122 ? -0.069  -31.820 1.246   1.00 22.93  ? 212 LEU E CA  1 
ATOM   1093 C C   . LEU E 2 122 ? 1.425   -31.548 1.330   1.00 23.95  ? 212 LEU E C   1 
ATOM   1094 O O   . LEU E 2 122 ? 1.897   -31.070 2.364   1.00 25.26  ? 212 LEU E O   1 
ATOM   1095 C CB  . LEU E 2 122 ? -0.771  -30.551 0.718   1.00 22.48  ? 212 LEU E CB  1 
ATOM   1096 C CG  . LEU E 2 122 ? -2.185  -30.689 0.182   1.00 26.46  ? 212 LEU E CG  1 
ATOM   1097 C CD1 . LEU E 2 122 ? -2.789  -29.322 -0.074  1.00 26.32  ? 212 LEU E CD1 1 
ATOM   1098 C CD2 . LEU E 2 122 ? -2.221  -31.551 -1.086  1.00 28.52  ? 212 LEU E CD2 1 
ATOM   1099 N N   . THR E 2 123 ? 2.157   -31.828 0.243   1.00 16.55  ? 213 THR E N   1 
ATOM   1100 C CA  . THR E 2 123 ? 3.582   -31.534 0.156   1.00 15.23  ? 213 THR E CA  1 
ATOM   1101 C C   . THR E 2 123 ? 3.705   -30.043 -0.228  1.00 17.47  ? 213 THR E C   1 
ATOM   1102 O O   . THR E 2 123 ? 2.722   -29.465 -0.701  1.00 15.10  ? 213 THR E O   1 
ATOM   1103 C CB  . THR E 2 123 ? 4.281   -32.509 -0.805  1.00 22.08  ? 213 THR E CB  1 
ATOM   1104 O OG1 . THR E 2 123 ? 5.649   -32.661 -0.426  1.00 34.84  ? 213 THR E OG1 1 
ATOM   1105 C CG2 . THR E 2 123 ? 4.208   -32.105 -2.238  1.00 7.23   ? 213 THR E CG2 1 
ATOM   1106 N N   . GLY E 2 124 ? 4.895   -29.459 -0.043  1.00 13.79  ? 214 GLY E N   1 
ATOM   1107 C CA  . GLY E 2 124 ? 5.185   -28.084 -0.422  1.00 13.45  ? 214 GLY E CA  1 
ATOM   1108 C C   . GLY E 2 124 ? 4.866   -27.805 -1.872  1.00 17.85  ? 214 GLY E C   1 
ATOM   1109 O O   . GLY E 2 124 ? 4.169   -26.827 -2.149  1.00 19.11  ? 214 GLY E O   1 
ATOM   1110 N N   . GLN E 2 125 ? 5.326   -28.690 -2.814  1.00 13.50  ? 215 GLN E N   1 
ATOM   1111 C CA  . GLN E 2 125 ? 5.054   -28.505 -4.257  1.00 13.45  ? 215 GLN E CA  1 
ATOM   1112 C C   . GLN E 2 125 ? 3.551   -28.628 -4.596  1.00 23.14  ? 215 GLN E C   1 
ATOM   1113 O O   . GLN E 2 125 ? 3.101   -27.940 -5.530  1.00 23.80  ? 215 GLN E O   1 
ATOM   1114 C CB  . GLN E 2 125 ? 5.839   -29.490 -5.106  1.00 13.96  ? 215 GLN E CB  1 
ATOM   1115 C CG  . GLN E 2 125 ? 6.093   -29.002 -6.530  1.00 38.10  ? 215 GLN E CG  1 
ATOM   1116 N N   . GLU E 2 126 ? 2.792   -29.552 -3.888  1.00 20.23  ? 216 GLU E N   1 
ATOM   1117 C CA  . GLU E 2 126 ? 1.337   -29.737 -4.087  1.00 19.46  ? 216 GLU E CA  1 
ATOM   1118 C C   . GLU E 2 126 ? 0.568   -28.530 -3.557  1.00 21.01  ? 216 GLU E C   1 
ATOM   1119 O O   . GLU E 2 126 ? -0.458  -28.141 -4.132  1.00 19.06  ? 216 GLU E O   1 
ATOM   1120 C CB  . GLU E 2 126 ? 0.829   -30.997 -3.384  1.00 21.21  ? 216 GLU E CB  1 
ATOM   1121 C CG  . GLU E 2 126 ? 1.117   -32.294 -4.129  1.00 33.64  ? 216 GLU E CG  1 
ATOM   1122 C CD  . GLU E 2 126 ? 1.071   -33.542 -3.265  1.00 53.31  ? 216 GLU E CD  1 
ATOM   1123 O OE1 . GLU E 2 126 ? 1.104   -33.409 -2.021  1.00 39.06  ? 216 GLU E OE1 1 
ATOM   1124 O OE2 . GLU E 2 126 ? 1.040   -34.657 -3.834  1.00 54.60  ? 216 GLU E OE2 1 
ATOM   1125 N N   . ARG E 2 127 ? 1.061   -27.974 -2.426  1.00 16.21  ? 217 ARG E N   1 
ATOM   1126 C CA  . ARG E 2 127 ? 0.532   -26.813 -1.735  1.00 15.99  ? 217 ARG E CA  1 
ATOM   1127 C C   . ARG E 2 127 ? 0.628   -25.596 -2.616  1.00 19.46  ? 217 ARG E C   1 
ATOM   1128 O O   . ARG E 2 127 ? -0.304  -24.814 -2.639  1.00 21.46  ? 217 ARG E O   1 
ATOM   1129 C CB  . ARG E 2 127 ? 1.291   -26.579 -0.422  1.00 15.35  ? 217 ARG E CB  1 
ATOM   1130 C CG  . ARG E 2 127 ? 0.476   -25.834 0.591   1.00 15.35  ? 217 ARG E CG  1 
ATOM   1131 C CD  . ARG E 2 127 ? 1.095   -25.821 1.957   1.00 10.53  ? 217 ARG E CD  1 
ATOM   1132 N NE  . ARG E 2 127 ? 1.146   -27.145 2.567   1.00 21.43  ? 217 ARG E NE  1 
ATOM   1133 C CZ  . ARG E 2 127 ? 0.146   -27.715 3.241   1.00 44.76  ? 217 ARG E CZ  1 
ATOM   1134 N NH1 . ARG E 2 127 ? -1.025  -27.097 3.358   1.00 34.65  ? 217 ARG E NH1 1 
ATOM   1135 N NH2 . ARG E 2 127 ? 0.303   -28.918 3.779   1.00 26.18  ? 217 ARG E NH2 1 
ATOM   1136 N N   . VAL E 2 128 ? 1.742   -25.460 -3.363  1.00 15.08  ? 218 VAL E N   1 
ATOM   1137 C CA  . VAL E 2 128 ? 2.029   -24.377 -4.295  1.00 14.47  ? 218 VAL E CA  1 
ATOM   1138 C C   . VAL E 2 128 ? 1.035   -24.487 -5.454  1.00 19.92  ? 218 VAL E C   1 
ATOM   1139 O O   . VAL E 2 128 ? 0.385   -23.494 -5.777  1.00 19.29  ? 218 VAL E O   1 
ATOM   1140 C CB  . VAL E 2 128 ? 3.531   -24.404 -4.762  1.00 17.12  ? 218 VAL E CB  1 
ATOM   1141 C CG1 . VAL E 2 128 ? 3.744   -23.693 -6.096  1.00 15.40  ? 218 VAL E CG1 1 
ATOM   1142 C CG2 . VAL E 2 128 ? 4.465   -23.828 -3.691  1.00 16.34  ? 218 VAL E CG2 1 
ATOM   1143 N N   . ALA E 2 129 ? 0.902   -25.696 -6.042  1.00 16.82  ? 219 ALA E N   1 
ATOM   1144 C CA  . ALA E 2 129 ? 0.022   -26.004 -7.176  1.00 17.17  ? 219 ALA E CA  1 
ATOM   1145 C C   . ALA E 2 129 ? -1.467  -25.802 -6.848  1.00 20.31  ? 219 ALA E C   1 
ATOM   1146 O O   . ALA E 2 129 ? -2.210  -25.331 -7.705  1.00 21.96  ? 219 ALA E O   1 
ATOM   1147 C CB  . ALA E 2 129 ? 0.261   -27.441 -7.643  1.00 18.22  ? 219 ALA E CB  1 
ATOM   1148 N N   . LEU E 2 130 ? -1.912  -26.176 -5.637  1.00 13.45  ? 220 LEU E N   1 
ATOM   1149 C CA  . LEU E 2 130 ? -3.310  -25.998 -5.264  1.00 12.46  ? 220 LEU E CA  1 
ATOM   1150 C C   . LEU E 2 130 ? -3.631  -24.503 -5.022  1.00 17.01  ? 220 LEU E C   1 
ATOM   1151 O O   . LEU E 2 130 ? -4.637  -24.012 -5.529  1.00 16.57  ? 220 LEU E O   1 
ATOM   1152 C CB  . LEU E 2 130 ? -3.695  -26.837 -4.020  1.00 11.77  ? 220 LEU E CB  1 
ATOM   1153 C CG  . LEU E 2 130 ? -5.187  -26.742 -3.602  1.00 13.59  ? 220 LEU E CG  1 
ATOM   1154 C CD1 . LEU E 2 130 ? -6.120  -27.226 -4.710  1.00 12.45  ? 220 LEU E CD1 1 
ATOM   1155 C CD2 . LEU E 2 130 ? -5.449  -27.505 -2.369  1.00 14.06  ? 220 LEU E CD2 1 
ATOM   1156 N N   . ALA E 2 131 ? -2.762  -23.786 -4.271  1.00 13.92  ? 221 ALA E N   1 
ATOM   1157 C CA  . ALA E 2 131 ? -2.930  -22.358 -3.968  1.00 11.52  ? 221 ALA E CA  1 
ATOM   1158 C C   . ALA E 2 131 ? -2.914  -21.543 -5.237  1.00 11.93  ? 221 ALA E C   1 
ATOM   1159 O O   . ALA E 2 131 ? -3.715  -20.628 -5.373  1.00 12.22  ? 221 ALA E O   1 
ATOM   1160 C CB  . ALA E 2 131 ? -1.848  -21.888 -3.033  1.00 12.03  ? 221 ALA E CB  1 
ATOM   1161 N N   . ASN E 2 132 ? -2.047  -21.890 -6.191  1.00 8.90   ? 222 ASN E N   1 
ATOM   1162 C CA  . ASN E 2 132 ? -1.969  -21.185 -7.479  1.00 7.90   ? 222 ASN E CA  1 
ATOM   1163 C C   . ASN E 2 132 ? -3.189  -21.413 -8.314  1.00 9.30   ? 222 ASN E C   1 
ATOM   1164 O O   . ASN E 2 132 ? -3.604  -20.510 -9.027  1.00 12.40  ? 222 ASN E O   1 
ATOM   1165 C CB  . ASN E 2 132 ? -0.724  -21.558 -8.255  1.00 13.64  ? 222 ASN E CB  1 
ATOM   1166 C CG  . ASN E 2 132 ? 0.367   -20.526 -8.125  1.00 38.92  ? 222 ASN E CG  1 
ATOM   1167 O OD1 . ASN E 2 132 ? 0.187   -19.344 -8.449  1.00 36.13  ? 222 ASN E OD1 1 
ATOM   1168 N ND2 . ASN E 2 132 ? 1.541   -20.970 -7.727  1.00 29.51  ? 222 ASN E ND2 1 
ATOM   1169 N N   . ARG E 2 133 ? -3.772  -22.609 -8.242  1.00 7.47   ? 223 ARG E N   1 
ATOM   1170 C CA  . ARG E 2 133 ? -4.984  -22.953 -9.001  1.00 6.99   ? 223 ARG E CA  1 
ATOM   1171 C C   . ARG E 2 133 ? -6.168  -22.150 -8.472  1.00 11.72  ? 223 ARG E C   1 
ATOM   1172 O O   . ARG E 2 133 ? -6.946  -21.616 -9.263  1.00 14.02  ? 223 ARG E O   1 
ATOM   1173 C CB  . ARG E 2 133 ? -5.253  -24.471 -8.945  1.00 9.69   ? 223 ARG E CB  1 
ATOM   1174 C CG  . ARG E 2 133 ? -6.569  -24.956 -9.594  1.00 10.04  ? 223 ARG E CG  1 
ATOM   1175 C CD  . ARG E 2 133 ? -6.744  -24.531 -11.059 1.00 17.94  ? 223 ARG E CD  1 
ATOM   1176 N NE  . ARG E 2 133 ? -8.081  -24.860 -11.561 1.00 31.08  ? 223 ARG E NE  1 
ATOM   1177 C CZ  . ARG E 2 133 ? -8.658  -24.281 -12.607 1.00 44.36  ? 223 ARG E CZ  1 
ATOM   1178 N NH1 . ARG E 2 133 ? -8.031  -23.314 -13.271 1.00 22.04  ? 223 ARG E NH1 1 
ATOM   1179 N NH2 . ARG E 2 133 ? -9.872  -24.657 -12.994 1.00 30.66  ? 223 ARG E NH2 1 
ATOM   1180 N N   . LYS E 2 134 ? -6.299  -22.048 -7.140  1.00 6.90   ? 224 LYS E N   1 
ATOM   1181 C CA  . LYS E 2 134 ? -7.379  -21.301 -6.513  1.00 6.15   ? 224 LYS E CA  1 
ATOM   1182 C C   . LYS E 2 134 ? -7.221  -19.814 -6.798  1.00 10.79  ? 224 LYS E C   1 
ATOM   1183 O O   . LYS E 2 134 ? -8.219  -19.148 -7.074  1.00 11.25  ? 224 LYS E O   1 
ATOM   1184 C CB  . LYS E 2 134 ? -7.442  -21.596 -5.010  1.00 8.91   ? 224 LYS E CB  1 
ATOM   1185 C CG  . LYS E 2 134 ? -7.758  -23.059 -4.634  1.00 16.90  ? 224 LYS E CG  1 
ATOM   1186 C CD  . LYS E 2 134 ? -9.077  -23.559 -5.184  1.00 15.85  ? 224 LYS E CD  1 
ATOM   1187 C CE  . LYS E 2 134 ? -9.571  -24.772 -4.448  1.00 31.87  ? 224 LYS E CE  1 
ATOM   1188 N NZ  . LYS E 2 134 ? -10.660 -25.466 -5.188  1.00 34.87  ? 224 LYS E NZ  1 
ATOM   1189 N N   . ARG E 2 135 ? -5.965  -19.305 -6.791  1.00 9.41   ? 225 ARG E N   1 
ATOM   1190 C CA  . ARG E 2 135 ? -5.605  -17.922 -7.143  1.00 9.14   ? 225 ARG E CA  1 
ATOM   1191 C C   . ARG E 2 135 ? -6.002  -17.626 -8.576  1.00 11.17  ? 225 ARG E C   1 
ATOM   1192 O O   . ARG E 2 135 ? -6.532  -16.552 -8.857  1.00 11.71  ? 225 ARG E O   1 
ATOM   1193 C CB  . ARG E 2 135 ? -4.079  -17.699 -6.975  1.00 11.45  ? 225 ARG E CB  1 
ATOM   1194 C CG  . ARG E 2 135 ? -3.646  -16.221 -7.016  1.00 20.00  ? 225 ARG E CG  1 
ATOM   1195 C CD  . ARG E 2 135 ? -2.141  -16.002 -7.209  1.00 20.80  ? 225 ARG E CD  1 
ATOM   1196 N NE  . ARG E 2 135 ? -1.542  -16.878 -8.219  1.00 23.52  ? 225 ARG E NE  1 
ATOM   1197 C CZ  . ARG E 2 135 ? -1.541  -16.642 -9.529  1.00 41.44  ? 225 ARG E CZ  1 
ATOM   1198 N NH1 . ARG E 2 135 ? -2.109  -15.543 -10.016 1.00 30.22  ? 225 ARG E NH1 1 
ATOM   1199 N NH2 . ARG E 2 135 ? -0.979  -17.504 -10.362 1.00 33.71  ? 225 ARG E NH2 1 
ATOM   1200 N N   . GLU E 2 136 ? -5.765  -18.569 -9.484  1.00 9.22   ? 226 GLU E N   1 
ATOM   1201 C CA  . GLU E 2 136 ? -6.133  -18.381 -10.905 1.00 11.87  ? 226 GLU E CA  1 
ATOM   1202 C C   . GLU E 2 136 ? -7.660  -18.365 -11.079 1.00 17.51  ? 226 GLU E C   1 
ATOM   1203 O O   . GLU E 2 136 ? -8.165  -17.652 -11.950 1.00 21.05  ? 226 GLU E O   1 
ATOM   1204 C CB  . GLU E 2 136 ? -5.488  -19.447 -11.807 1.00 13.34  ? 226 GLU E CB  1 
ATOM   1205 C CG  . GLU E 2 136 ? -4.017  -19.178 -12.075 1.00 27.94  ? 226 GLU E CG  1 
ATOM   1206 C CD  . GLU E 2 136 ? -3.224  -20.282 -12.754 1.00 51.17  ? 226 GLU E CD  1 
ATOM   1207 O OE1 . GLU E 2 136 ? -2.058  -20.498 -12.354 1.00 45.40  ? 226 GLU E OE1 1 
ATOM   1208 O OE2 . GLU E 2 136 ? -3.737  -20.884 -13.725 1.00 49.85  ? 226 GLU E OE2 1 
ATOM   1209 N N   . CYS E 2 137 ? -8.378  -19.126 -10.250 1.00 13.19  ? 227 CYS E N   1 
ATOM   1210 C CA  . CYS E 2 137 ? -9.839  -19.180 -10.230 1.00 13.43  ? 227 CYS E CA  1 
ATOM   1211 C C   . CYS E 2 137 ? -10.383 -17.841 -9.756  1.00 16.26  ? 227 CYS E C   1 
ATOM   1212 O O   . CYS E 2 137 ? -11.185 -17.232 -10.468 1.00 14.44  ? 227 CYS E O   1 
ATOM   1213 C CB  . CYS E 2 137 ? -10.349 -20.340 -9.369  1.00 13.50  ? 227 CYS E CB  1 
ATOM   1214 S SG  . CYS E 2 137 ? -10.098 -21.968 -10.119 1.00 17.37  ? 227 CYS E SG  1 
ATOM   1215 N N   . GLY E 2 138 ? -9.896  -17.378 -8.598  1.00 13.54  ? 228 GLY E N   1 
ATOM   1216 C CA  . GLY E 2 138 ? -10.256 -16.087 -8.029  1.00 14.66  ? 228 GLY E CA  1 
ATOM   1217 C C   . GLY E 2 138 ? -10.028 -14.946 -9.000  1.00 20.50  ? 228 GLY E C   1 
ATOM   1218 O O   . GLY E 2 138 ? -10.888 -14.071 -9.132  1.00 21.38  ? 228 GLY E O   1 
ATOM   1219 N N   . ASN E 2 139 ? -8.892  -14.982 -9.735  1.00 17.11  ? 229 ASN E N   1 
ATOM   1220 C CA  . ASN E 2 139 ? -8.545  -13.970 -10.735 1.00 16.27  ? 229 ASN E CA  1 
ATOM   1221 C C   . ASN E 2 139 ? -9.586  -13.939 -11.844 1.00 19.52  ? 229 ASN E C   1 
ATOM   1222 O O   . ASN E 2 139 ? -10.028 -12.854 -12.204 1.00 18.63  ? 229 ASN E O   1 
ATOM   1223 C CB  . ASN E 2 139 ? -7.143  -14.201 -11.318 1.00 16.92  ? 229 ASN E CB  1 
ATOM   1224 C CG  . ASN E 2 139 ? -6.005  -13.810 -10.407 1.00 29.63  ? 229 ASN E CG  1 
ATOM   1225 O OD1 . ASN E 2 139 ? -6.193  -13.459 -9.239  1.00 18.04  ? 229 ASN E OD1 1 
ATOM   1226 N ND2 . ASN E 2 139 ? -4.790  -13.887 -10.924 1.00 19.76  ? 229 ASN E ND2 1 
ATOM   1227 N N   . ALA E 2 140 ? -10.014 -15.119 -12.344 1.00 15.76  ? 230 ALA E N   1 
ATOM   1228 C CA  . ALA E 2 140 ? -11.030 -15.250 -13.404 1.00 14.74  ? 230 ALA E CA  1 
ATOM   1229 C C   . ALA E 2 140 ? -12.376 -14.663 -12.971 1.00 17.90  ? 230 ALA E C   1 
ATOM   1230 O O   . ALA E 2 140 ? -13.030 -14.010 -13.778 1.00 20.17  ? 230 ALA E O   1 
ATOM   1231 C CB  . ALA E 2 140 ? -11.202 -16.705 -13.805 1.00 15.09  ? 230 ALA E CB  1 
ATOM   1232 N N   . HIS E 2 141 ? -12.772 -14.894 -11.708 1.00 11.73  ? 231 HIS E N   1 
ATOM   1233 C CA  . HIS E 2 141 ? -14.000 -14.381 -11.080 1.00 10.21  ? 231 HIS E CA  1 
ATOM   1234 C C   . HIS E 2 141 ? -13.942 -12.869 -10.909 1.00 15.67  ? 231 HIS E C   1 
ATOM   1235 O O   . HIS E 2 141 ? -14.960 -12.203 -11.040 1.00 16.19  ? 231 HIS E O   1 
ATOM   1236 C CB  . HIS E 2 141 ? -14.177 -15.000 -9.685  1.00 9.98   ? 231 HIS E CB  1 
ATOM   1237 C CG  . HIS E 2 141 ? -14.482 -16.467 -9.638  1.00 13.03  ? 231 HIS E CG  1 
ATOM   1238 N ND1 . HIS E 2 141 ? -15.462 -17.024 -10.418 1.00 14.63  ? 231 HIS E ND1 1 
ATOM   1239 C CD2 . HIS E 2 141 ? -14.010 -17.410 -8.796  1.00 15.53  ? 231 HIS E CD2 1 
ATOM   1240 C CE1 . HIS E 2 141 ? -15.513 -18.299 -10.077 1.00 14.81  ? 231 HIS E CE1 1 
ATOM   1241 N NE2 . HIS E 2 141 ? -14.680 -18.569 -9.079  1.00 15.33  ? 231 HIS E NE2 1 
ATOM   1242 N N   . TYR E 2 142 ? -12.755 -12.332 -10.557 1.00 11.92  ? 232 TYR E N   1 
ATOM   1243 C CA  . TYR E 2 142 ? -12.515 -10.908 -10.345 1.00 10.87  ? 232 TYR E CA  1 
ATOM   1244 C C   . TYR E 2 142 ? -12.631 -10.128 -11.654 1.00 17.25  ? 232 TYR E C   1 
ATOM   1245 O O   . TYR E 2 142 ? -13.266 -9.062  -11.654 1.00 14.66  ? 232 TYR E O   1 
ATOM   1246 C CB  . TYR E 2 142 ? -11.144 -10.701 -9.716  1.00 11.19  ? 232 TYR E CB  1 
ATOM   1247 C CG  . TYR E 2 142 ? -10.849 -9.265  -9.353  1.00 11.86  ? 232 TYR E CG  1 
ATOM   1248 C CD1 . TYR E 2 142 ? -10.272 -8.393  -10.278 1.00 12.43  ? 232 TYR E CD1 1 
ATOM   1249 C CD2 . TYR E 2 142 ? -11.121 -8.778  -8.078  1.00 11.33  ? 232 TYR E CD2 1 
ATOM   1250 C CE1 . TYR E 2 142 ? -9.991  -7.071  -9.945  1.00 11.63  ? 232 TYR E CE1 1 
ATOM   1251 C CE2 . TYR E 2 142 ? -10.810 -7.462  -7.726  1.00 11.45  ? 232 TYR E CE2 1 
ATOM   1252 C CZ  . TYR E 2 142 ? -10.268 -6.605  -8.673  1.00 18.53  ? 232 TYR E CZ  1 
ATOM   1253 O OH  . TYR E 2 142 ? -9.982  -5.294  -8.362  1.00 21.32  ? 232 TYR E OH  1 
ATOM   1254 N N   . GLN E 2 143 ? -12.016 -10.644 -12.769 1.00 15.25  ? 233 GLN E N   1 
ATOM   1255 C CA  . GLN E 2 143 ? -12.057 -9.990  -14.087 1.00 17.06  ? 233 GLN E CA  1 
ATOM   1256 C C   . GLN E 2 143 ? -13.496 -9.719  -14.582 1.00 23.01  ? 233 GLN E C   1 
ATOM   1257 O O   . GLN E 2 143 ? -13.740 -8.697  -15.218 1.00 24.16  ? 233 GLN E O   1 
ATOM   1258 C CB  . GLN E 2 143 ? -11.315 -10.806 -15.172 1.00 18.98  ? 233 GLN E CB  1 
ATOM   1259 C CG  . GLN E 2 143 ? -9.933  -11.401 -14.823 1.00 47.53  ? 233 GLN E CG  1 
ATOM   1260 C CD  . GLN E 2 143 ? -8.849  -10.458 -14.334 1.00 69.75  ? 233 GLN E CD  1 
ATOM   1261 O OE1 . GLN E 2 143 ? -8.070  -10.810 -13.443 1.00 65.55  ? 233 GLN E OE1 1 
ATOM   1262 N NE2 . GLN E 2 143 ? -8.742  -9.260  -14.910 1.00 63.86  ? 233 GLN E NE2 1 
ATOM   1263 N N   . ARG E 2 144 ? -14.424 -10.656 -14.331 1.00 22.05  ? 234 ARG E N   1 
ATOM   1264 C CA  . ARG E 2 144 ? -15.840 -10.606 -14.725 1.00 22.03  ? 234 ARG E CA  1 
ATOM   1265 C C   . ARG E 2 144 ? -16.711 -9.884  -13.632 1.00 26.55  ? 234 ARG E C   1 
ATOM   1266 O O   . ARG E 2 144 ? -17.921 -9.795  -13.795 1.00 28.60  ? 234 ARG E O   1 
ATOM   1267 C CB  . ARG E 2 144 ? -16.326 -12.050 -15.066 1.00 23.32  ? 234 ARG E CB  1 
ATOM   1268 C CG  . ARG E 2 144 ? -17.496 -12.662 -14.267 1.00 27.08  ? 234 ARG E CG  1 
ATOM   1269 C CD  . ARG E 2 144 ? -17.971 -14.027 -14.779 1.00 19.46  ? 234 ARG E CD  1 
ATOM   1270 N NE  . ARG E 2 144 ? -16.991 -15.091 -14.546 1.00 15.75  ? 234 ARG E NE  1 
ATOM   1271 C CZ  . ARG E 2 144 ? -16.873 -15.771 -13.412 1.00 20.81  ? 234 ARG E CZ  1 
ATOM   1272 N NH1 . ARG E 2 144 ? -17.698 -15.540 -12.403 1.00 10.56  ? 234 ARG E NH1 1 
ATOM   1273 N NH2 . ARG E 2 144 ? -15.919 -16.670 -13.272 1.00 26.18  ? 234 ARG E NH2 1 
ATOM   1274 N N   . ALA E 2 145 ? -16.077 -9.299  -12.586 1.00 22.59  ? 235 ALA E N   1 
ATOM   1275 C CA  . ALA E 2 145 ? -16.656 -8.514  -11.480 1.00 21.50  ? 235 ALA E CA  1 
ATOM   1276 C C   . ALA E 2 145 ? -17.539 -9.352  -10.544 1.00 21.61  ? 235 ALA E C   1 
ATOM   1277 O O   . ALA E 2 145 ? -18.513 -8.858  -9.964  1.00 21.15  ? 235 ALA E O   1 
ATOM   1278 C CB  . ALA E 2 145 ? -17.409 -7.275  -11.999 1.00 22.69  ? 235 ALA E CB  1 
ATOM   1279 N N   . ASP E 2 146 ? -17.148 -10.617 -10.342 1.00 16.45  ? 236 ASP E N   1 
ATOM   1280 C CA  . ASP E 2 146 ? -17.811 -11.491 -9.375  1.00 16.43  ? 236 ASP E CA  1 
ATOM   1281 C C   . ASP E 2 146 ? -16.876 -11.506 -8.196  1.00 20.46  ? 236 ASP E C   1 
ATOM   1282 O O   . ASP E 2 146 ? -15.943 -12.318 -8.133  1.00 21.00  ? 236 ASP E O   1 
ATOM   1283 C CB  . ASP E 2 146 ? -18.097 -12.886 -9.956  1.00 17.75  ? 236 ASP E CB  1 
ATOM   1284 C CG  . ASP E 2 146 ? -19.069 -13.713 -9.141  1.00 29.01  ? 236 ASP E CG  1 
ATOM   1285 O OD1 . ASP E 2 146 ? -19.124 -13.521 -7.893  1.00 27.67  ? 236 ASP E OD1 1 
ATOM   1286 O OD2 . ASP E 2 146 ? -19.775 -14.558 -9.742  1.00 37.50  ? 236 ASP E OD2 1 
ATOM   1287 N N   . PHE E 2 147 ? -17.040 -10.516 -7.334  1.00 16.15  ? 237 PHE E N   1 
ATOM   1288 C CA  . PHE E 2 147 ? -16.166 -10.260 -6.192  1.00 15.78  ? 237 PHE E CA  1 
ATOM   1289 C C   . PHE E 2 147 ? -16.480 -11.159 -5.024  1.00 17.80  ? 237 PHE E C   1 
ATOM   1290 O O   . PHE E 2 147 ? -15.576 -11.457 -4.243  1.00 17.45  ? 237 PHE E O   1 
ATOM   1291 C CB  . PHE E 2 147 ? -16.227 -8.769  -5.796  1.00 17.36  ? 237 PHE E CB  1 
ATOM   1292 C CG  . PHE E 2 147 ? -15.851 -7.855  -6.944  1.00 18.04  ? 237 PHE E CG  1 
ATOM   1293 C CD1 . PHE E 2 147 ? -14.563 -7.868  -7.473  1.00 19.37  ? 237 PHE E CD1 1 
ATOM   1294 C CD2 . PHE E 2 147 ? -16.793 -6.994  -7.509  1.00 19.29  ? 237 PHE E CD2 1 
ATOM   1295 C CE1 . PHE E 2 147 ? -14.225 -7.048  -8.553  1.00 20.89  ? 237 PHE E CE1 1 
ATOM   1296 C CE2 . PHE E 2 147 ? -16.452 -6.169  -8.581  1.00 21.91  ? 237 PHE E CE2 1 
ATOM   1297 C CZ  . PHE E 2 147 ? -15.168 -6.197  -9.094  1.00 20.47  ? 237 PHE E CZ  1 
ATOM   1298 N N   . VAL E 2 148 ? -17.725 -11.651 -4.931  1.00 14.43  ? 238 VAL E N   1 
ATOM   1299 C CA  . VAL E 2 148 ? -18.117 -12.596 -3.876  1.00 13.55  ? 238 VAL E CA  1 
ATOM   1300 C C   . VAL E 2 148 ? -17.383 -13.944 -4.124  1.00 16.74  ? 238 VAL E C   1 
ATOM   1301 O O   . VAL E 2 148 ? -16.840 -14.524 -3.184  1.00 14.68  ? 238 VAL E O   1 
ATOM   1302 C CB  . VAL E 2 148 ? -19.662 -12.761 -3.783  1.00 17.09  ? 238 VAL E CB  1 
ATOM   1303 C CG1 . VAL E 2 148 ? -20.057 -13.873 -2.823  1.00 16.66  ? 238 VAL E CG1 1 
ATOM   1304 C CG2 . VAL E 2 148 ? -20.343 -11.444 -3.387  1.00 16.17  ? 238 VAL E CG2 1 
ATOM   1305 N N   . LEU E 2 149 ? -17.346 -14.408 -5.388  1.00 12.65  ? 239 LEU E N   1 
ATOM   1306 C CA  . LEU E 2 149 ? -16.717 -15.668 -5.765  1.00 12.32  ? 239 LEU E CA  1 
ATOM   1307 C C   . LEU E 2 149 ? -15.190 -15.529 -5.772  1.00 17.45  ? 239 LEU E C   1 
ATOM   1308 O O   . LEU E 2 149 ? -14.511 -16.453 -5.323  1.00 17.51  ? 239 LEU E O   1 
ATOM   1309 C CB  . LEU E 2 149 ? -17.216 -16.176 -7.138  1.00 12.64  ? 239 LEU E CB  1 
ATOM   1310 C CG  . LEU E 2 149 ? -18.557 -16.986 -7.214  1.00 17.07  ? 239 LEU E CG  1 
ATOM   1311 C CD1 . LEU E 2 149 ? -18.639 -17.753 -8.487  1.00 16.64  ? 239 LEU E CD1 1 
ATOM   1312 C CD2 . LEU E 2 149 ? -18.789 -17.900 -6.034  1.00 20.99  ? 239 LEU E CD2 1 
ATOM   1313 N N   . ALA E 2 150 ? -14.650 -14.382 -6.276  1.00 12.18  ? 240 ALA E N   1 
ATOM   1314 C CA  . ALA E 2 150 ? -13.217 -14.070 -6.267  1.00 11.01  ? 240 ALA E CA  1 
ATOM   1315 C C   . ALA E 2 150 ? -12.694 -14.145 -4.840  1.00 13.01  ? 240 ALA E C   1 
ATOM   1316 O O   . ALA E 2 150 ? -11.730 -14.872 -4.585  1.00 11.73  ? 240 ALA E O   1 
ATOM   1317 C CB  . ALA E 2 150 ? -12.968 -12.684 -6.851  1.00 12.05  ? 240 ALA E CB  1 
ATOM   1318 N N   . ALA E 2 151 ? -13.381 -13.473 -3.893  1.00 8.93   ? 241 ALA E N   1 
ATOM   1319 C CA  . ALA E 2 151 ? -12.983 -13.485 -2.474  1.00 8.74   ? 241 ALA E CA  1 
ATOM   1320 C C   . ALA E 2 151 ? -13.002 -14.893 -1.896  1.00 10.73  ? 241 ALA E C   1 
ATOM   1321 O O   . ALA E 2 151 ? -12.135 -15.217 -1.085  1.00 12.42  ? 241 ALA E O   1 
ATOM   1322 C CB  . ALA E 2 151 ? -13.888 -12.577 -1.651  1.00 9.44   ? 241 ALA E CB  1 
ATOM   1323 N N   . ASN E 2 152 ? -13.993 -15.728 -2.295  1.00 5.19   ? 242 ASN E N   1 
ATOM   1324 C CA  . ASN E 2 152 ? -14.116 -17.101 -1.813  1.00 5.04   ? 242 ASN E CA  1 
ATOM   1325 C C   . ASN E 2 152 ? -12.914 -17.955 -2.258  1.00 8.13   ? 242 ASN E C   1 
ATOM   1326 O O   . ASN E 2 152 ? -12.292 -18.598 -1.413  1.00 9.09   ? 242 ASN E O   1 
ATOM   1327 C CB  . ASN E 2 152 ? -15.426 -17.717 -2.291  1.00 10.52  ? 242 ASN E CB  1 
ATOM   1328 C CG  . ASN E 2 152 ? -15.561 -19.182 -2.005  1.00 22.15  ? 242 ASN E CG  1 
ATOM   1329 O OD1 . ASN E 2 152 ? -15.610 -19.609 -0.839  1.00 19.76  ? 242 ASN E OD1 1 
ATOM   1330 N ND2 . ASN E 2 152 ? -15.613 -19.980 -3.071  1.00 5.15   ? 242 ASN E ND2 1 
ATOM   1331 N N   . SER E 2 153 ? -12.572 -17.927 -3.567  1.00 3.00   ? 243 SER E N   1 
ATOM   1332 C CA  . SER E 2 153 ? -11.438 -18.629 -4.126  1.00 4.02   ? 243 SER E CA  1 
ATOM   1333 C C   . SER E 2 153 ? -10.094 -18.158 -3.476  1.00 9.63   ? 243 SER E C   1 
ATOM   1334 O O   . SER E 2 153 ? -9.259  -19.008 -3.108  1.00 8.94   ? 243 SER E O   1 
ATOM   1335 C CB  . SER E 2 153 ? -11.383 -18.416 -5.630  1.00 9.54   ? 243 SER E CB  1 
ATOM   1336 O OG  . SER E 2 153 ? -12.549 -18.826 -6.324  1.00 15.96  ? 243 SER E OG  1 
ATOM   1337 N N   . TYR E 2 154 ? -9.896  -16.820 -3.316  1.00 5.19   ? 244 TYR E N   1 
ATOM   1338 C CA  . TYR E 2 154 ? -8.672  -16.306 -2.694  1.00 5.59   ? 244 TYR E CA  1 
ATOM   1339 C C   . TYR E 2 154 ? -8.553  -16.812 -1.289  1.00 11.02  ? 244 TYR E C   1 
ATOM   1340 O O   . TYR E 2 154 ? -7.438  -17.147 -0.877  1.00 11.57  ? 244 TYR E O   1 
ATOM   1341 C CB  . TYR E 2 154 ? -8.596  -14.755 -2.677  1.00 5.26   ? 244 TYR E CB  1 
ATOM   1342 C CG  . TYR E 2 154 ? -8.521  -14.140 -4.056  1.00 5.16   ? 244 TYR E CG  1 
ATOM   1343 C CD1 . TYR E 2 154 ? -7.628  -14.621 -5.008  1.00 7.13   ? 244 TYR E CD1 1 
ATOM   1344 C CD2 . TYR E 2 154 ? -9.341  -13.077 -4.408  1.00 3.38   ? 244 TYR E CD2 1 
ATOM   1345 C CE1 . TYR E 2 154 ? -7.574  -14.078 -6.287  1.00 7.46   ? 244 TYR E CE1 1 
ATOM   1346 C CE2 . TYR E 2 154 ? -9.263  -12.496 -5.668  1.00 4.01   ? 244 TYR E CE2 1 
ATOM   1347 C CZ  . TYR E 2 154 ? -8.364  -12.988 -6.599  1.00 9.12   ? 244 TYR E CZ  1 
ATOM   1348 O OH  . TYR E 2 154 ? -8.300  -12.427 -7.844  1.00 4.69   ? 244 TYR E OH  1 
ATOM   1349 N N   . ASP E 2 155 ? -9.687  -16.873 -0.544  1.00 7.22   ? 245 ASP E N   1 
ATOM   1350 C CA  . ASP E 2 155 ? -9.656  -17.405 0.827   1.00 8.28   ? 245 ASP E CA  1 
ATOM   1351 C C   . ASP E 2 155 ? -9.348  -18.902 0.839   1.00 12.94  ? 245 ASP E C   1 
ATOM   1352 O O   . ASP E 2 155 ? -8.825  -19.403 1.837   1.00 12.00  ? 245 ASP E O   1 
ATOM   1353 C CB  . ASP E 2 155 ? -10.965 -17.162 1.572   1.00 11.07  ? 245 ASP E CB  1 
ATOM   1354 C CG  . ASP E 2 155 ? -10.856 -17.348 3.082   1.00 34.32  ? 245 ASP E CG  1 
ATOM   1355 O OD1 . ASP E 2 155 ? -9.747  -17.104 3.642   1.00 36.90  ? 245 ASP E OD1 1 
ATOM   1356 O OD2 . ASP E 2 155 ? -11.875 -17.715 3.709   1.00 41.12  ? 245 ASP E OD2 1 
ATOM   1357 N N   . LEU E 2 156 ? -9.724  -19.629 -0.232  1.00 9.33   ? 246 LEU E N   1 
ATOM   1358 C CA  . LEU E 2 156 ? -9.447  -21.070 -0.298  1.00 9.62   ? 246 LEU E CA  1 
ATOM   1359 C C   . LEU E 2 156 ? -7.965  -21.271 -0.603  1.00 13.02  ? 246 LEU E C   1 
ATOM   1360 O O   . LEU E 2 156 ? -7.348  -22.159 -0.009  1.00 10.95  ? 246 LEU E O   1 
ATOM   1361 C CB  . LEU E 2 156 ? -10.337 -21.807 -1.315  1.00 9.67   ? 246 LEU E CB  1 
ATOM   1362 C CG  . LEU E 2 156 ? -11.848 -21.845 -1.016  1.00 15.39  ? 246 LEU E CG  1 
ATOM   1363 C CD1 . LEU E 2 156 ? -12.602 -22.345 -2.210  1.00 15.68  ? 246 LEU E CD1 1 
ATOM   1364 C CD2 . LEU E 2 156 ? -12.165 -22.695 0.219   1.00 17.40  ? 246 LEU E CD2 1 
ATOM   1365 N N   . ALA E 2 157 ? -7.395  -20.405 -1.497  1.00 9.49   ? 247 ALA E N   1 
ATOM   1366 C CA  . ALA E 2 157 ? -5.968  -20.373 -1.828  1.00 9.89   ? 247 ALA E CA  1 
ATOM   1367 C C   . ALA E 2 157 ? -5.123  -20.104 -0.575  1.00 15.62  ? 247 ALA E C   1 
ATOM   1368 O O   . ALA E 2 157 ? -4.121  -20.786 -0.388  1.00 16.44  ? 247 ALA E O   1 
ATOM   1369 C CB  . ALA E 2 157 ? -5.682  -19.326 -2.893  1.00 9.76   ? 247 ALA E CB  1 
ATOM   1370 N N   . ILE E 2 158 ? -5.561  -19.180 0.299   1.00 13.99  ? 248 ILE E N   1 
ATOM   1371 C CA  . ILE E 2 158 ? -4.889  -18.858 1.578   1.00 14.64  ? 248 ILE E CA  1 
ATOM   1372 C C   . ILE E 2 158 ? -4.978  -20.051 2.548   1.00 19.18  ? 248 ILE E C   1 
ATOM   1373 O O   . ILE E 2 158 ? -3.956  -20.444 3.119   1.00 19.23  ? 248 ILE E O   1 
ATOM   1374 C CB  . ILE E 2 158 ? -5.437  -17.548 2.222   1.00 17.73  ? 248 ILE E CB  1 
ATOM   1375 C CG1 . ILE E 2 158 ? -5.038  -16.314 1.385   1.00 17.54  ? 248 ILE E CG1 1 
ATOM   1376 C CG2 . ILE E 2 158 ? -4.966  -17.374 3.692   1.00 19.68  ? 248 ILE E CG2 1 
ATOM   1377 C CD1 . ILE E 2 158 ? -5.992  -15.132 1.506   1.00 13.97  ? 248 ILE E CD1 1 
ATOM   1378 N N   . LYS E 2 159 ? -6.183  -20.628 2.724   1.00 16.36  ? 249 LYS E N   1 
ATOM   1379 C CA  . LYS E 2 159 ? -6.429  -21.754 3.631   1.00 15.63  ? 249 LYS E CA  1 
ATOM   1380 C C   . LYS E 2 159 ? -5.530  -22.956 3.277   1.00 17.49  ? 249 LYS E C   1 
ATOM   1381 O O   . LYS E 2 159 ? -5.093  -23.672 4.189   1.00 17.35  ? 249 LYS E O   1 
ATOM   1382 C CB  . LYS E 2 159 ? -7.912  -22.133 3.624   1.00 19.01  ? 249 LYS E CB  1 
ATOM   1383 C CG  . LYS E 2 159 ? -8.214  -23.430 2.896   1.00 44.42  ? 249 LYS E CG  1 
ATOM   1384 C CD  . LYS E 2 159 ? -9.706  -23.729 2.766   1.00 51.56  ? 249 LYS E CD  1 
ATOM   1385 C CE  . LYS E 2 159 ? -9.994  -25.046 2.077   1.00 52.70  ? 249 LYS E CE  1 
ATOM   1386 N NZ  . LYS E 2 159 ? -9.276  -25.193 0.773   1.00 52.78  ? 249 LYS E NZ  1 
ATOM   1387 N N   . ALA E 2 160 ? -5.238  -23.120 1.954   1.00 10.01  ? 250 ALA E N   1 
ATOM   1388 C CA  . ALA E 2 160 ? -4.386  -24.144 1.365   1.00 10.30  ? 250 ALA E CA  1 
ATOM   1389 C C   . ALA E 2 160 ? -2.893  -23.879 1.686   1.00 16.30  ? 250 ALA E C   1 
ATOM   1390 O O   . ALA E 2 160 ? -2.148  -24.819 1.905   1.00 15.91  ? 250 ALA E O   1 
ATOM   1391 C CB  . ALA E 2 160 ? -4.616  -24.212 -0.146  1.00 10.32  ? 250 ALA E CB  1 
ATOM   1392 N N   . ILE E 2 161 ? -2.480  -22.608 1.791   1.00 13.48  ? 251 ILE E N   1 
ATOM   1393 C CA  . ILE E 2 161 ? -1.102  -22.236 2.127   1.00 12.52  ? 251 ILE E CA  1 
ATOM   1394 C C   . ILE E 2 161 ? -0.842  -22.417 3.640   1.00 19.48  ? 251 ILE E C   1 
ATOM   1395 O O   . ILE E 2 161 ? 0.183   -22.987 4.031   1.00 19.87  ? 251 ILE E O   1 
ATOM   1396 C CB  . ILE E 2 161 ? -0.810  -20.765 1.670   1.00 14.34  ? 251 ILE E CB  1 
ATOM   1397 C CG1 . ILE E 2 161 ? -0.770  -20.642 0.140   1.00 13.01  ? 251 ILE E CG1 1 
ATOM   1398 C CG2 . ILE E 2 161 ? 0.503   -20.239 2.254   1.00 14.84  ? 251 ILE E CG2 1 
ATOM   1399 C CD1 . ILE E 2 161 ? -0.960  -19.247 -0.419  1.00 7.93   ? 251 ILE E CD1 1 
ATOM   1400 N N   . THR E 2 162 ? -1.763  -21.921 4.474   1.00 17.30  ? 252 THR E N   1 
ATOM   1401 C CA  . THR E 2 162 ? -1.631  -21.835 5.928   1.00 17.00  ? 252 THR E CA  1 
ATOM   1402 C C   . THR E 2 162 ? -1.900  -23.149 6.704   1.00 22.75  ? 252 THR E C   1 
ATOM   1403 O O   . THR E 2 162 ? -1.627  -23.212 7.909   1.00 20.38  ? 252 THR E O   1 
ATOM   1404 C CB  . THR E 2 162 ? -2.547  -20.712 6.458   1.00 19.81  ? 252 THR E CB  1 
ATOM   1405 O OG1 . THR E 2 162 ? -3.903  -21.082 6.295   1.00 12.02  ? 252 THR E OG1 1 
ATOM   1406 C CG2 . THR E 2 162 ? -2.276  -19.347 5.800   1.00 14.71  ? 252 THR E CG2 1 
ATOM   1407 N N   . SER E 2 163 ? -2.422  -24.193 6.054   1.00 22.23  ? 253 SER E N   1 
ATOM   1408 C CA  . SER E 2 163 ? -2.680  -25.444 6.787   1.00 23.02  ? 253 SER E CA  1 
ATOM   1409 C C   . SER E 2 163 ? -1.465  -26.393 6.638   1.00 31.27  ? 253 SER E C   1 
ATOM   1410 O O   . SER E 2 163 ? -1.583  -27.475 6.069   1.00 32.59  ? 253 SER E O   1 
ATOM   1411 C CB  . SER E 2 163 ? -3.977  -26.086 6.304   1.00 25.75  ? 253 SER E CB  1 
ATOM   1412 O OG  . SER E 2 163 ? -4.027  -26.070 4.889   1.00 39.71  ? 253 SER E OG  1 
ATOM   1413 N N   . SER E 2 164 ? -0.287  -25.956 7.145   1.00 29.25  ? 254 SER E N   1 
ATOM   1414 C CA  . SER E 2 164 ? 0.997   -26.656 7.008   1.00 28.82  ? 254 SER E CA  1 
ATOM   1415 C C   . SER E 2 164 ? 1.653   -27.052 8.351   1.00 33.56  ? 254 SER E C   1 
ATOM   1416 O O   . SER E 2 164 ? 2.839   -27.393 8.366   1.00 34.70  ? 254 SER E O   1 
ATOM   1417 C CB  . SER E 2 164 ? 1.964   -25.771 6.219   1.00 31.10  ? 254 SER E CB  1 
ATOM   1418 O OG  . SER E 2 164 ? 2.209   -24.528 6.860   1.00 34.20  ? 254 SER E OG  1 
ATOM   1419 N N   . ALA E 2 165 ? 0.889   -27.038 9.456   1.00 29.36  ? 255 ALA E N   1 
ATOM   1420 C CA  . ALA E 2 165 ? 1.369   -27.349 10.804  1.00 29.40  ? 255 ALA E CA  1 
ATOM   1421 C C   . ALA E 2 165 ? 1.870   -28.805 11.010  1.00 36.26  ? 255 ALA E C   1 
ATOM   1422 O O   . ALA E 2 165 ? 2.571   -29.049 11.992  1.00 35.56  ? 255 ALA E O   1 
ATOM   1423 C CB  . ALA E 2 165 ? 0.281   -27.049 11.817  1.00 29.86  ? 255 ALA E CB  1 
ATOM   1424 N N   . LYS E 2 166 ? 1.526   -29.756 10.111  1.00 34.78  ? 256 LYS E N   1 
ATOM   1425 C CA  . LYS E 2 166 ? 1.909   -31.165 10.265  1.00 34.92  ? 256 LYS E CA  1 
ATOM   1426 C C   . LYS E 2 166 ? 2.847   -31.696 9.145   1.00 39.96  ? 256 LYS E C   1 
ATOM   1427 O O   . LYS E 2 166 ? 3.152   -32.888 9.137   1.00 40.80  ? 256 LYS E O   1 
ATOM   1428 C CB  . LYS E 2 166 ? 0.639   -32.038 10.337  1.00 37.00  ? 256 LYS E CB  1 
ATOM   1429 C CG  . LYS E 2 166 ? -0.187  -31.831 11.605  1.00 48.13  ? 256 LYS E CG  1 
ATOM   1430 C CD  . LYS E 2 166 ? -1.652  -32.221 11.421  1.00 56.70  ? 256 LYS E CD  1 
ATOM   1431 C CE  . LYS E 2 166 ? -1.895  -33.708 11.294  1.00 70.49  ? 256 LYS E CE  1 
ATOM   1432 N NZ  . LYS E 2 166 ? -3.227  -34.000 10.708  1.00 84.62  ? 256 LYS E NZ  1 
ATOM   1433 N N   . VAL E 2 167 ? 3.306   -30.836 8.224   1.00 36.55  ? 257 VAL E N   1 
ATOM   1434 C CA  . VAL E 2 167 ? 4.195   -31.250 7.122   1.00 36.17  ? 257 VAL E CA  1 
ATOM   1435 C C   . VAL E 2 167 ? 5.483   -30.423 7.185   1.00 40.67  ? 257 VAL E C   1 
ATOM   1436 O O   . VAL E 2 167 ? 5.433   -29.222 7.473   1.00 41.83  ? 257 VAL E O   1 
ATOM   1437 C CB  . VAL E 2 167 ? 3.505   -31.172 5.721   1.00 39.12  ? 257 VAL E CB  1 
ATOM   1438 C CG1 . VAL E 2 167 ? 4.499   -31.377 4.594   1.00 38.66  ? 257 VAL E CG1 1 
ATOM   1439 C CG2 . VAL E 2 167 ? 2.383   -32.192 5.603   1.00 38.71  ? 257 VAL E CG2 1 
ATOM   1440 N N   . ASP E 2 168 ? 6.639   -31.079 6.937   1.00 35.14  ? 258 ASP E N   1 
ATOM   1441 C CA  . ASP E 2 168 ? 7.951   -30.432 6.935   1.00 33.31  ? 258 ASP E CA  1 
ATOM   1442 C C   . ASP E 2 168 ? 8.360   -30.070 5.507   1.00 34.33  ? 258 ASP E C   1 
ATOM   1443 O O   . ASP E 2 168 ? 8.712   -30.944 4.706   1.00 35.38  ? 258 ASP E O   1 
ATOM   1444 C CB  . ASP E 2 168 ? 9.023   -31.319 7.594   1.00 35.22  ? 258 ASP E CB  1 
ATOM   1445 C CG  . ASP E 2 168 ? 8.851   -31.571 9.074   1.00 53.26  ? 258 ASP E CG  1 
ATOM   1446 O OD1 . ASP E 2 168 ? 9.245   -32.668 9.537   1.00 56.37  ? 258 ASP E OD1 1 
ATOM   1447 O OD2 . ASP E 2 168 ? 8.313   -30.678 9.772   1.00 59.77  ? 258 ASP E OD2 1 
ATOM   1448 N N   . MET E 2 169 ? 8.308   -28.772 5.197   1.00 26.77  ? 259 MET E N   1 
ATOM   1449 C CA  . MET E 2 169 ? 8.676   -28.204 3.895   1.00 24.27  ? 259 MET E CA  1 
ATOM   1450 C C   . MET E 2 169 ? 10.070  -27.599 3.988   1.00 24.06  ? 259 MET E C   1 
ATOM   1451 O O   . MET E 2 169 ? 10.523  -27.287 5.093   1.00 22.92  ? 259 MET E O   1 
ATOM   1452 C CB  . MET E 2 169 ? 7.679   -27.105 3.493   1.00 26.49  ? 259 MET E CB  1 
ATOM   1453 C CG  . MET E 2 169 ? 6.258   -27.589 3.212   1.00 29.76  ? 259 MET E CG  1 
ATOM   1454 S SD  . MET E 2 169 ? 5.028   -26.234 3.188   1.00 32.82  ? 259 MET E SD  1 
ATOM   1455 C CE  . MET E 2 169 ? 5.934   -24.984 2.393   1.00 29.10  ? 259 MET E CE  1 
ATOM   1456 N N   . THR E 2 170 ? 10.728  -27.384 2.844   1.00 17.69  ? 260 THR E N   1 
ATOM   1457 C CA  . THR E 2 170 ? 12.053  -26.746 2.808   1.00 18.11  ? 260 THR E CA  1 
ATOM   1458 C C   . THR E 2 170 ? 11.903  -25.233 3.006   1.00 26.29  ? 260 THR E C   1 
ATOM   1459 O O   . THR E 2 170 ? 10.788  -24.712 2.891   1.00 28.81  ? 260 THR E O   1 
ATOM   1460 C CB  . THR E 2 170 ? 12.779  -27.054 1.474   1.00 22.83  ? 260 THR E CB  1 
ATOM   1461 O OG1 . THR E 2 170 ? 12.058  -26.430 0.411   1.00 16.75  ? 260 THR E OG1 1 
ATOM   1462 C CG2 . THR E 2 170 ? 12.931  -28.567 1.186   1.00 13.75  ? 260 THR E CG2 1 
ATOM   1463 N N   . PHE E 2 171 ? 13.011  -24.513 3.264   1.00 24.19  ? 261 PHE E N   1 
ATOM   1464 C CA  . PHE E 2 171 ? 12.961  -23.058 3.446   1.00 23.61  ? 261 PHE E CA  1 
ATOM   1465 C C   . PHE E 2 171 ? 12.493  -22.369 2.161   1.00 28.87  ? 261 PHE E C   1 
ATOM   1466 O O   . PHE E 2 171 ? 11.655  -21.463 2.210   1.00 30.33  ? 261 PHE E O   1 
ATOM   1467 C CB  . PHE E 2 171 ? 14.318  -22.507 3.929   1.00 25.28  ? 261 PHE E CB  1 
ATOM   1468 C CG  . PHE E 2 171 ? 14.477  -21.004 3.849   1.00 25.61  ? 261 PHE E CG  1 
ATOM   1469 C CD1 . PHE E 2 171 ? 15.200  -20.420 2.814   1.00 28.63  ? 261 PHE E CD1 1 
ATOM   1470 C CD2 . PHE E 2 171 ? 13.900  -20.174 4.801   1.00 24.97  ? 261 PHE E CD2 1 
ATOM   1471 C CE1 . PHE E 2 171 ? 15.362  -19.034 2.747   1.00 28.62  ? 261 PHE E CE1 1 
ATOM   1472 C CE2 . PHE E 2 171 ? 14.022  -18.784 4.705   1.00 28.33  ? 261 PHE E CE2 1 
ATOM   1473 C CZ  . PHE E 2 171 ? 14.755  -18.223 3.682   1.00 27.09  ? 261 PHE E CZ  1 
ATOM   1474 N N   . GLU E 2 172 ? 13.003  -22.847 1.018   1.00 24.58  ? 262 GLU E N   1 
ATOM   1475 C CA  . GLU E 2 172 ? 12.706  -22.362 -0.328  1.00 24.96  ? 262 GLU E CA  1 
ATOM   1476 C C   . GLU E 2 172 ? 11.207  -22.460 -0.633  1.00 28.77  ? 262 GLU E C   1 
ATOM   1477 O O   . GLU E 2 172 ? 10.656  -21.560 -1.251  1.00 28.99  ? 262 GLU E O   1 
ATOM   1478 C CB  . GLU E 2 172 ? 13.526  -23.139 -1.367  1.00 26.62  ? 262 GLU E CB  1 
ATOM   1479 C CG  . GLU E 2 172 ? 15.039  -22.898 -1.319  1.00 36.14  ? 262 GLU E CG  1 
ATOM   1480 C CD  . GLU E 2 172 ? 15.867  -23.560 -0.225  1.00 51.27  ? 262 GLU E CD  1 
ATOM   1481 O OE1 . GLU E 2 172 ? 17.017  -23.110 -0.011  1.00 57.69  ? 262 GLU E OE1 1 
ATOM   1482 O OE2 . GLU E 2 172 ? 15.384  -24.525 0.412   1.00 23.36  ? 262 GLU E OE2 1 
ATOM   1483 N N   . GLU E 2 173 ? 10.551  -23.528 -0.155  1.00 25.49  ? 263 GLU E N   1 
ATOM   1484 C CA  . GLU E 2 173 ? 9.112   -23.785 -0.286  1.00 24.01  ? 263 GLU E CA  1 
ATOM   1485 C C   . GLU E 2 173 ? 8.306   -22.827 0.586   1.00 25.17  ? 263 GLU E C   1 
ATOM   1486 O O   . GLU E 2 173 ? 7.312   -22.284 0.105   1.00 22.94  ? 263 GLU E O   1 
ATOM   1487 C CB  . GLU E 2 173 ? 8.778   -25.240 0.090   1.00 25.36  ? 263 GLU E CB  1 
ATOM   1488 C CG  . GLU E 2 173 ? 9.131   -26.245 -0.988  1.00 32.34  ? 263 GLU E CG  1 
ATOM   1489 C CD  . GLU E 2 173 ? 9.010   -27.707 -0.605  1.00 43.79  ? 263 GLU E CD  1 
ATOM   1490 O OE1 . GLU E 2 173 ? 8.776   -28.521 -1.527  1.00 27.41  ? 263 GLU E OE1 1 
ATOM   1491 O OE2 . GLU E 2 173 ? 9.153   -28.047 0.594   1.00 29.47  ? 263 GLU E OE2 1 
ATOM   1492 N N   . GLU E 2 174 ? 8.725   -22.632 1.864   1.00 22.70  ? 264 GLU E N   1 
ATOM   1493 C CA  . GLU E 2 174 ? 8.104   -21.716 2.823   1.00 22.57  ? 264 GLU E CA  1 
ATOM   1494 C C   . GLU E 2 174 ? 8.095   -20.282 2.261   1.00 26.54  ? 264 GLU E C   1 
ATOM   1495 O O   . GLU E 2 174 ? 7.052   -19.633 2.278   1.00 27.81  ? 264 GLU E O   1 
ATOM   1496 C CB  . GLU E 2 174 ? 8.837   -21.743 4.179   1.00 24.26  ? 264 GLU E CB  1 
ATOM   1497 C CG  . GLU E 2 174 ? 8.742   -23.041 4.966   1.00 35.51  ? 264 GLU E CG  1 
ATOM   1498 C CD  . GLU E 2 174 ? 7.509   -23.238 5.828   1.00 55.20  ? 264 GLU E CD  1 
ATOM   1499 O OE1 . GLU E 2 174 ? 6.634   -22.342 5.842   1.00 45.17  ? 264 GLU E OE1 1 
ATOM   1500 O OE2 . GLU E 2 174 ? 7.422   -24.290 6.503   1.00 46.65  ? 264 GLU E OE2 1 
ATOM   1501 N N   . ALA E 2 175 ? 9.243   -19.826 1.716   1.00 23.02  ? 265 ALA E N   1 
ATOM   1502 C CA  . ALA E 2 175 ? 9.428   -18.494 1.112   1.00 23.10  ? 265 ALA E CA  1 
ATOM   1503 C C   . ALA E 2 175 ? 8.539   -18.312 -0.129  1.00 25.78  ? 265 ALA E C   1 
ATOM   1504 O O   . ALA E 2 175 ? 7.857   -17.291 -0.250  1.00 25.06  ? 265 ALA E O   1 
ATOM   1505 C CB  . ALA E 2 175 ? 10.890  -18.278 0.751   1.00 23.71  ? 265 ALA E CB  1 
ATOM   1506 N N   . GLN E 2 176 ? 8.503   -19.329 -1.013  1.00 21.30  ? 266 GLN E N   1 
ATOM   1507 C CA  . GLN E 2 176 ? 7.678   -19.344 -2.226  1.00 20.80  ? 266 GLN E CA  1 
ATOM   1508 C C   . GLN E 2 176 ? 6.184   -19.216 -1.872  1.00 22.70  ? 266 GLN E C   1 
ATOM   1509 O O   . GLN E 2 176 ? 5.451   -18.486 -2.539  1.00 21.14  ? 266 GLN E O   1 
ATOM   1510 C CB  . GLN E 2 176 ? 7.921   -20.647 -3.009  1.00 22.14  ? 266 GLN E CB  1 
ATOM   1511 C CG  . GLN E 2 176 ? 7.737   -20.509 -4.524  1.00 30.78  ? 266 GLN E CG  1 
ATOM   1512 C CD  . GLN E 2 176 ? 7.693   -21.833 -5.253  1.00 36.80  ? 266 GLN E CD  1 
ATOM   1513 O OE1 . GLN E 2 176 ? 8.101   -22.885 -4.743  1.00 26.95  ? 266 GLN E OE1 1 
ATOM   1514 N NE2 . GLN E 2 176 ? 7.209   -21.800 -6.488  1.00 27.11  ? 266 GLN E NE2 1 
ATOM   1515 N N   . LEU E 2 177 ? 5.759   -19.904 -0.792  1.00 17.47  ? 267 LEU E N   1 
ATOM   1516 C CA  . LEU E 2 177 ? 4.385   -19.909 -0.326  1.00 15.52  ? 267 LEU E CA  1 
ATOM   1517 C C   . LEU E 2 177 ? 4.034   -18.604 0.380   1.00 17.92  ? 267 LEU E C   1 
ATOM   1518 O O   . LEU E 2 177 ? 2.862   -18.225 0.378   1.00 17.21  ? 267 LEU E O   1 
ATOM   1519 C CB  . LEU E 2 177 ? 4.114   -21.117 0.566   1.00 15.37  ? 267 LEU E CB  1 
ATOM   1520 C CG  . LEU E 2 177 ? 3.728   -22.398 -0.197  1.00 19.61  ? 267 LEU E CG  1 
ATOM   1521 C CD1 . LEU E 2 177 ? 4.051   -23.608 0.583   1.00 19.42  ? 267 LEU E CD1 1 
ATOM   1522 C CD2 . LEU E 2 177 ? 2.255   -22.438 -0.499  1.00 18.98  ? 267 LEU E CD2 1 
ATOM   1523 N N   . LEU E 2 178 ? 5.034   -17.917 0.984   1.00 13.46  ? 268 LEU E N   1 
ATOM   1524 C CA  . LEU E 2 178 ? 4.846   -16.618 1.630   1.00 11.90  ? 268 LEU E CA  1 
ATOM   1525 C C   . LEU E 2 178 ? 4.584   -15.581 0.561   1.00 16.03  ? 268 LEU E C   1 
ATOM   1526 O O   . LEU E 2 178 ? 3.684   -14.761 0.717   1.00 16.72  ? 268 LEU E O   1 
ATOM   1527 C CB  . LEU E 2 178 ? 6.058   -16.212 2.477   1.00 12.03  ? 268 LEU E CB  1 
ATOM   1528 C CG  . LEU E 2 178 ? 6.042   -16.614 3.950   1.00 16.27  ? 268 LEU E CG  1 
ATOM   1529 C CD1 . LEU E 2 178 ? 7.383   -16.373 4.575   1.00 15.41  ? 268 LEU E CD1 1 
ATOM   1530 C CD2 . LEU E 2 178 ? 4.972   -15.850 4.726   1.00 18.45  ? 268 LEU E CD2 1 
ATOM   1531 N N   . GLN E 2 179 ? 5.328   -15.660 -0.564  1.00 12.17  ? 269 GLN E N   1 
ATOM   1532 C CA  . GLN E 2 179 ? 5.163   -14.766 -1.706  1.00 13.26  ? 269 GLN E CA  1 
ATOM   1533 C C   . GLN E 2 179 ? 3.770   -14.907 -2.327  1.00 18.67  ? 269 GLN E C   1 
ATOM   1534 O O   . GLN E 2 179 ? 3.186   -13.925 -2.779  1.00 21.32  ? 269 GLN E O   1 
ATOM   1535 C CB  . GLN E 2 179 ? 6.234   -15.032 -2.775  1.00 14.93  ? 269 GLN E CB  1 
ATOM   1536 C CG  . GLN E 2 179 ? 7.653   -14.591 -2.389  1.00 35.38  ? 269 GLN E CG  1 
ATOM   1537 C CD  . GLN E 2 179 ? 7.747   -13.128 -1.995  1.00 64.86  ? 269 GLN E CD  1 
ATOM   1538 O OE1 . GLN E 2 179 ? 7.785   -12.786 -0.801  1.00 56.84  ? 269 GLN E OE1 1 
ATOM   1539 N NE2 . GLN E 2 179 ? 7.737   -12.238 -2.982  1.00 63.92  ? 269 GLN E NE2 1 
ATOM   1540 N N   . LEU E 2 180 ? 3.243   -16.115 -2.318  1.00 12.76  ? 270 LEU E N   1 
ATOM   1541 C CA  . LEU E 2 180 ? 1.924   -16.473 -2.846  1.00 11.30  ? 270 LEU E CA  1 
ATOM   1542 C C   . LEU E 2 180 ? 0.831   -15.994 -1.931  1.00 10.56  ? 270 LEU E C   1 
ATOM   1543 O O   . LEU E 2 180 ? -0.178  -15.506 -2.414  1.00 12.53  ? 270 LEU E O   1 
ATOM   1544 C CB  . LEU E 2 180 ? 1.844   -17.996 -2.962  1.00 11.85  ? 270 LEU E CB  1 
ATOM   1545 C CG  . LEU E 2 180 ? 1.127   -18.624 -4.148  1.00 18.27  ? 270 LEU E CG  1 
ATOM   1546 C CD1 . LEU E 2 180 ? 1.580   -20.107 -4.273  1.00 18.50  ? 270 LEU E CD1 1 
ATOM   1547 C CD2 . LEU E 2 180 ? -0.342  -18.523 -4.041  1.00 21.25  ? 270 LEU E CD2 1 
ATOM   1548 N N   . LYS E 2 181 ? 1.018   -16.128 -0.619  1.00 3.54   ? 271 LYS E N   1 
ATOM   1549 C CA  . LYS E 2 181 ? 0.062   -15.712 0.400   1.00 3.10   ? 271 LYS E CA  1 
ATOM   1550 C C   . LYS E 2 181 ? -0.184  -14.200 0.329   1.00 9.22   ? 271 LYS E C   1 
ATOM   1551 O O   . LYS E 2 181 ? -1.332  -13.777 0.392   1.00 8.93   ? 271 LYS E O   1 
ATOM   1552 C CB  . LYS E 2 181 ? 0.587   -16.125 1.779   1.00 6.39   ? 271 LYS E CB  1 
ATOM   1553 C CG  . LYS E 2 181 ? -0.382  -15.858 2.911   1.00 16.51  ? 271 LYS E CG  1 
ATOM   1554 C CD  . LYS E 2 181 ? 0.006   -16.635 4.149   1.00 18.06  ? 271 LYS E CD  1 
ATOM   1555 C CE  . LYS E 2 181 ? 0.913   -15.909 5.101   1.00 29.78  ? 271 LYS E CE  1 
ATOM   1556 N NZ  . LYS E 2 181 ? 0.387   -14.580 5.510   1.00 49.38  ? 271 LYS E NZ  1 
ATOM   1557 N N   . VAL E 2 182 ? 0.896   -13.387 0.170   1.00 8.12   ? 272 VAL E N   1 
ATOM   1558 C CA  . VAL E 2 182 ? 0.848   -11.906 0.066   1.00 5.76   ? 272 VAL E CA  1 
ATOM   1559 C C   . VAL E 2 182 ? 0.075   -11.541 -1.207  1.00 12.26  ? 272 VAL E C   1 
ATOM   1560 O O   . VAL E 2 182 ? -0.785  -10.667 -1.138  1.00 14.34  ? 272 VAL E O   1 
ATOM   1561 C CB  . VAL E 2 182 ? 2.271   -11.264 0.101   1.00 6.82   ? 272 VAL E CB  1 
ATOM   1562 C CG1 . VAL E 2 182 ? 2.217   -9.750  0.009   1.00 6.25   ? 272 VAL E CG1 1 
ATOM   1563 C CG2 . VAL E 2 182 ? 3.032   -11.664 1.355   1.00 5.57   ? 272 VAL E CG2 1 
ATOM   1564 N N   . LYS E 2 183 ? 0.330   -12.240 -2.345  1.00 7.96   ? 273 LYS E N   1 
ATOM   1565 C CA  . LYS E 2 183 ? -0.412  -12.010 -3.599  1.00 8.35   ? 273 LYS E CA  1 
ATOM   1566 C C   . LYS E 2 183 ? -1.913  -12.320 -3.422  1.00 16.13  ? 273 LYS E C   1 
ATOM   1567 O O   . LYS E 2 183 ? -2.749  -11.541 -3.892  1.00 15.22  ? 273 LYS E O   1 
ATOM   1568 C CB  . LYS E 2 183 ? 0.149   -12.854 -4.749  1.00 10.37  ? 273 LYS E CB  1 
ATOM   1569 C CG  . LYS E 2 183 ? 1.477   -12.332 -5.277  1.00 23.25  ? 273 LYS E CG  1 
ATOM   1570 C CD  . LYS E 2 183 ? 2.040   -13.202 -6.357  1.00 27.27  ? 273 LYS E CD  1 
ATOM   1571 C CE  . LYS E 2 183 ? 3.221   -12.538 -7.025  1.00 26.62  ? 273 LYS E CE  1 
ATOM   1572 N NZ  . LYS E 2 183 ? 3.518   -13.186 -8.312  1.00 27.36  ? 273 LYS E NZ  1 
ATOM   1573 N N   . CYS E 2 184 ? -2.248  -13.427 -2.709  1.00 13.10  ? 274 CYS E N   1 
ATOM   1574 C CA  . CYS E 2 184 ? -3.633  -13.826 -2.457  1.00 15.43  ? 274 CYS E CA  1 
ATOM   1575 C C   . CYS E 2 184 ? -4.337  -12.850 -1.510  1.00 19.80  ? 274 CYS E C   1 
ATOM   1576 O O   . CYS E 2 184 ? -5.511  -12.561 -1.726  1.00 19.54  ? 274 CYS E O   1 
ATOM   1577 C CB  . CYS E 2 184 ? -3.702  -15.252 -1.921  1.00 17.75  ? 274 CYS E CB  1 
ATOM   1578 S SG  . CYS E 2 184 ? -3.138  -16.514 -3.088  1.00 23.06  ? 274 CYS E SG  1 
ATOM   1579 N N   . LEU E 2 185 ? -3.644  -12.383 -0.446  1.00 15.90  ? 275 LEU E N   1 
ATOM   1580 C CA  . LEU E 2 185 ? -4.182  -11.448 0.544   1.00 14.64  ? 275 LEU E CA  1 
ATOM   1581 C C   . LEU E 2 185 ? -4.471  -10.081 -0.077  1.00 20.53  ? 275 LEU E C   1 
ATOM   1582 O O   . LEU E 2 185 ? -5.452  -9.440  0.281   1.00 22.53  ? 275 LEU E O   1 
ATOM   1583 C CB  . LEU E 2 185 ? -3.216  -11.290 1.727   1.00 13.68  ? 275 LEU E CB  1 
ATOM   1584 C CG  . LEU E 2 185 ? -3.298  -12.339 2.820   1.00 17.08  ? 275 LEU E CG  1 
ATOM   1585 C CD1 . LEU E 2 185 ? -2.104  -12.257 3.704   1.00 17.58  ? 275 LEU E CD1 1 
ATOM   1586 C CD2 . LEU E 2 185 ? -4.570  -12.198 3.647   1.00 15.96  ? 275 LEU E CD2 1 
ATOM   1587 N N   . ASN E 2 186 ? -3.589  -9.632  -0.961  1.00 16.62  ? 276 ASN E N   1 
ATOM   1588 C CA  . ASN E 2 186 ? -3.711  -8.401  -1.725  1.00 14.97  ? 276 ASN E CA  1 
ATOM   1589 C C   . ASN E 2 186 ? -4.934  -8.508  -2.655  1.00 15.09  ? 276 ASN E C   1 
ATOM   1590 O O   . ASN E 2 186 ? -5.739  -7.584  -2.733  1.00 13.46  ? 276 ASN E O   1 
ATOM   1591 C CB  . ASN E 2 186 ? -2.419  -8.156  -2.521  1.00 7.61   ? 276 ASN E CB  1 
ATOM   1592 C CG  . ASN E 2 186 ? -2.004  -6.707  -2.611  1.00 22.62  ? 276 ASN E CG  1 
ATOM   1593 O OD1 . ASN E 2 186 ? -2.791  -5.781  -2.340  1.00 13.28  ? 276 ASN E OD1 1 
ATOM   1594 N ND2 . ASN E 2 186 ? -0.732  -6.484  -2.947  1.00 14.02  ? 276 ASN E ND2 1 
ATOM   1595 N N   . ASN E 2 187 ? -5.074  -9.651  -3.332  1.00 10.96  ? 277 ASN E N   1 
ATOM   1596 C CA  . ASN E 2 187 ? -6.193  -9.985  -4.235  1.00 10.77  ? 277 ASN E CA  1 
ATOM   1597 C C   . ASN E 2 187 ? -7.517  -10.061 -3.466  1.00 12.25  ? 277 ASN E C   1 
ATOM   1598 O O   . ASN E 2 187 ? -8.554  -9.634  -3.971  1.00 9.61   ? 277 ASN E O   1 
ATOM   1599 C CB  . ASN E 2 187 ? -5.903  -11.307 -4.916  1.00 8.99   ? 277 ASN E CB  1 
ATOM   1600 C CG  . ASN E 2 187 ? -4.935  -11.193 -6.054  1.00 26.59  ? 277 ASN E CG  1 
ATOM   1601 O OD1 . ASN E 2 187 ? -4.318  -10.150 -6.261  1.00 17.06  ? 277 ASN E OD1 1 
ATOM   1602 N ND2 . ASN E 2 187 ? -4.765  -12.280 -6.804  1.00 17.76  ? 277 ASN E ND2 1 
ATOM   1603 N N   . LEU E 2 188 ? -7.461  -10.585 -2.225  1.00 9.56   ? 278 LEU E N   1 
ATOM   1604 C CA  . LEU E 2 188 ? -8.601  -10.663 -1.318  1.00 9.62   ? 278 LEU E CA  1 
ATOM   1605 C C   . LEU E 2 188 ? -9.012  -9.240  -0.938  1.00 12.91  ? 278 LEU E C   1 
ATOM   1606 O O   . LEU E 2 188 ? -10.206 -8.922  -0.961  1.00 12.31  ? 278 LEU E O   1 
ATOM   1607 C CB  . LEU E 2 188 ? -8.228  -11.505 -0.090  1.00 10.51  ? 278 LEU E CB  1 
ATOM   1608 C CG  . LEU E 2 188 ? -9.333  -11.818 0.915   1.00 15.40  ? 278 LEU E CG  1 
ATOM   1609 C CD1 . LEU E 2 188 ? -10.511 -12.550 0.251   1.00 15.47  ? 278 LEU E CD1 1 
ATOM   1610 C CD2 . LEU E 2 188 ? -8.780  -12.596 2.084   1.00 14.68  ? 278 LEU E CD2 1 
ATOM   1611 N N   . ALA E 2 189 ? -8.015  -8.368  -0.651  1.00 10.87  ? 279 ALA E N   1 
ATOM   1612 C CA  . ALA E 2 189 ? -8.212  -6.953  -0.299  1.00 11.52  ? 279 ALA E CA  1 
ATOM   1613 C C   . ALA E 2 189 ? -8.930  -6.226  -1.438  1.00 13.01  ? 279 ALA E C   1 
ATOM   1614 O O   . ALA E 2 189 ? -9.941  -5.563  -1.206  1.00 12.24  ? 279 ALA E O   1 
ATOM   1615 C CB  . ALA E 2 189 ? -6.863  -6.288  -0.013  1.00 12.74  ? 279 ALA E CB  1 
ATOM   1616 N N   . ALA E 2 190 ? -8.431  -6.396  -2.674  1.00 8.45   ? 280 ALA E N   1 
ATOM   1617 C CA  . ALA E 2 190 ? -9.028  -5.814  -3.869  1.00 8.05   ? 280 ALA E CA  1 
ATOM   1618 C C   . ALA E 2 190 ? -10.500 -6.177  -3.960  1.00 13.23  ? 280 ALA E C   1 
ATOM   1619 O O   . ALA E 2 190 ? -11.315 -5.299  -4.219  1.00 13.97  ? 280 ALA E O   1 
ATOM   1620 C CB  . ALA E 2 190 ? -8.295  -6.313  -5.114  1.00 8.59   ? 280 ALA E CB  1 
ATOM   1621 N N   . SER E 2 191 ? -10.836 -7.465  -3.705  1.00 9.15   ? 281 SER E N   1 
ATOM   1622 C CA  . SER E 2 191 ? -12.187 -8.029  -3.780  1.00 9.18   ? 281 SER E CA  1 
ATOM   1623 C C   . SER E 2 191 ? -13.100 -7.498  -2.691  1.00 10.40  ? 281 SER E C   1 
ATOM   1624 O O   . SER E 2 191 ? -14.227 -7.104  -2.993  1.00 8.53   ? 281 SER E O   1 
ATOM   1625 C CB  . SER E 2 191 ? -12.124 -9.556  -3.712  1.00 12.38  ? 281 SER E CB  1 
ATOM   1626 O OG  . SER E 2 191 ? -11.413 -10.058 -4.834  1.00 13.19  ? 281 SER E OG  1 
ATOM   1627 N N   . GLN E 2 192 ? -12.609 -7.472  -1.440  1.00 7.23   ? 282 GLN E N   1 
ATOM   1628 C CA  . GLN E 2 192 ? -13.357 -7.002  -0.272  1.00 7.76   ? 282 GLN E CA  1 
ATOM   1629 C C   . GLN E 2 192 ? -13.621 -5.480  -0.346  1.00 15.51  ? 282 GLN E C   1 
ATOM   1630 O O   . GLN E 2 192 ? -14.612 -5.021  0.219   1.00 13.95  ? 282 GLN E O   1 
ATOM   1631 C CB  . GLN E 2 192 ? -12.633 -7.351  1.032   1.00 8.85   ? 282 GLN E CB  1 
ATOM   1632 C CG  . GLN E 2 192 ? -12.034 -8.738  1.042   1.00 5.05   ? 282 GLN E CG  1 
ATOM   1633 C CD  . GLN E 2 192 ? -11.425 -9.094  2.348   1.00 20.74  ? 282 GLN E CD  1 
ATOM   1634 O OE1 . GLN E 2 192 ? -10.364 -8.606  2.708   1.00 23.51  ? 282 GLN E OE1 1 
ATOM   1635 N NE2 . GLN E 2 192 ? -12.040 -10.018 3.044   1.00 10.38  ? 282 GLN E NE2 1 
ATOM   1636 N N   . LEU E 2 193 ? -12.734 -4.716  -1.045  1.00 14.36  ? 283 LEU E N   1 
ATOM   1637 C CA  . LEU E 2 193 ? -12.867 -3.268  -1.273  1.00 14.73  ? 283 LEU E CA  1 
ATOM   1638 C C   . LEU E 2 193 ? -14.085 -3.021  -2.157  1.00 17.38  ? 283 LEU E C   1 
ATOM   1639 O O   . LEU E 2 193 ? -14.919 -2.186  -1.830  1.00 16.37  ? 283 LEU E O   1 
ATOM   1640 C CB  . LEU E 2 193 ? -11.578 -2.693  -1.916  1.00 15.27  ? 283 LEU E CB  1 
ATOM   1641 C CG  . LEU E 2 193 ? -11.663 -1.365  -2.701  1.00 21.12  ? 283 LEU E CG  1 
ATOM   1642 C CD1 . LEU E 2 193 ? -11.917 -0.173  -1.779  1.00 22.52  ? 283 LEU E CD1 1 
ATOM   1643 C CD2 . LEU E 2 193 ? -10.377 -1.098  -3.471  1.00 24.28  ? 283 LEU E CD2 1 
ATOM   1644 N N   . LYS E 2 194 ? -14.217 -3.810  -3.227  1.00 14.59  ? 284 LYS E N   1 
ATOM   1645 C CA  . LYS E 2 194 ? -15.312 -3.757  -4.193  1.00 14.64  ? 284 LYS E CA  1 
ATOM   1646 C C   . LYS E 2 194 ? -16.669 -4.134  -3.584  1.00 19.12  ? 284 LYS E C   1 
ATOM   1647 O O   . LYS E 2 194 ? -17.701 -3.718  -4.106  1.00 19.16  ? 284 LYS E O   1 
ATOM   1648 C CB  . LYS E 2 194 ? -15.009 -4.679  -5.376  1.00 15.89  ? 284 LYS E CB  1 
ATOM   1649 C CG  . LYS E 2 194 ? -13.928 -4.126  -6.306  1.00 16.34  ? 284 LYS E CG  1 
ATOM   1650 C CD  . LYS E 2 194 ? -14.489 -3.044  -7.234  1.00 9.96   ? 284 LYS E CD  1 
ATOM   1651 C CE  . LYS E 2 194 ? -13.415 -2.381  -8.072  1.00 21.57  ? 284 LYS E CE  1 
ATOM   1652 N NZ  . LYS E 2 194 ? -12.434 -1.641  -7.234  1.00 19.70  ? 284 LYS E NZ  1 
ATOM   1653 N N   . LEU E 2 195 ? -16.668 -4.884  -2.474  1.00 15.80  ? 285 LEU E N   1 
ATOM   1654 C CA  . LEU E 2 195 ? -17.890 -5.299  -1.776  1.00 15.72  ? 285 LEU E CA  1 
ATOM   1655 C C   . LEU E 2 195 ? -18.163 -4.419  -0.561  1.00 21.51  ? 285 LEU E C   1 
ATOM   1656 O O   . LEU E 2 195 ? -19.023 -4.743  0.256   1.00 22.26  ? 285 LEU E O   1 
ATOM   1657 C CB  . LEU E 2 195 ? -17.772 -6.768  -1.336  1.00 14.83  ? 285 LEU E CB  1 
ATOM   1658 C CG  . LEU E 2 195 ? -17.827 -7.822  -2.427  1.00 16.75  ? 285 LEU E CG  1 
ATOM   1659 C CD1 . LEU E 2 195 ? -17.304 -9.163  -1.917  1.00 14.25  ? 285 LEU E CD1 1 
ATOM   1660 C CD2 . LEU E 2 195 ? -19.247 -7.971  -2.963  1.00 15.35  ? 285 LEU E CD2 1 
ATOM   1661 N N   . ASP E 2 196 ? -17.435 -3.301  -0.442  1.00 19.23  ? 286 ASP E N   1 
ATOM   1662 C CA  . ASP E 2 196 ? -17.512 -2.340  0.674   1.00 18.24  ? 286 ASP E CA  1 
ATOM   1663 C C   . ASP E 2 196 ? -17.299 -3.031  2.024   1.00 22.95  ? 286 ASP E C   1 
ATOM   1664 O O   . ASP E 2 196 ? -17.792 -2.536  3.037   1.00 23.13  ? 286 ASP E O   1 
ATOM   1665 C CB  . ASP E 2 196 ? -18.828 -1.533  0.676   1.00 18.78  ? 286 ASP E CB  1 
ATOM   1666 C CG  . ASP E 2 196 ? -19.142 -0.743  -0.579  1.00 24.25  ? 286 ASP E CG  1 
ATOM   1667 O OD1 . ASP E 2 196 ? -18.256 -0.640  -1.463  1.00 26.96  ? 286 ASP E OD1 1 
ATOM   1668 O OD2 . ASP E 2 196 ? -20.267 -0.210  -0.673  1.00 26.86  ? 286 ASP E OD2 1 
ATOM   1669 N N   . HIS E 2 197 ? -16.559 -4.161  2.051   1.00 20.92  ? 287 HIS E N   1 
ATOM   1670 C CA  . HIS E 2 197 ? -16.251 -4.842  3.311   1.00 22.72  ? 287 HIS E CA  1 
ATOM   1671 C C   . HIS E 2 197 ? -14.945 -4.238  3.835   1.00 22.70  ? 287 HIS E C   1 
ATOM   1672 O O   . HIS E 2 197 ? -13.896 -4.878  3.854   1.00 21.27  ? 287 HIS E O   1 
ATOM   1673 C CB  . HIS E 2 197 ? -16.174 -6.377  3.149   1.00 25.85  ? 287 HIS E CB  1 
ATOM   1674 C CG  . HIS E 2 197 ? -16.319 -7.134  4.438   1.00 31.20  ? 287 HIS E CG  1 
ATOM   1675 N ND1 . HIS E 2 197 ? -16.249 -6.501  5.688   1.00 34.43  ? 287 HIS E ND1 1 
ATOM   1676 C CD2 . HIS E 2 197 ? -16.508 -8.460  4.638   1.00 34.75  ? 287 HIS E CD2 1 
ATOM   1677 C CE1 . HIS E 2 197 ? -16.413 -7.461  6.590   1.00 34.36  ? 287 HIS E CE1 1 
ATOM   1678 N NE2 . HIS E 2 197 ? -16.572 -8.657  6.008   1.00 34.78  ? 287 HIS E NE2 1 
ATOM   1679 N N   . TYR E 2 198 ? -15.049 -2.972  4.249   1.00 16.15  ? 288 TYR E N   1 
ATOM   1680 C CA  . TYR E 2 198 ? -13.972 -2.087  4.664   1.00 14.37  ? 288 TYR E CA  1 
ATOM   1681 C C   . TYR E 2 198 ? -13.143 -2.611  5.805   1.00 18.03  ? 288 TYR E C   1 
ATOM   1682 O O   . TYR E 2 198 ? -11.918 -2.567  5.695   1.00 18.01  ? 288 TYR E O   1 
ATOM   1683 C CB  . TYR E 2 198 ? -14.538 -0.693  4.994   1.00 14.16  ? 288 TYR E CB  1 
ATOM   1684 C CG  . TYR E 2 198 ? -15.208 -0.024  3.806   1.00 12.26  ? 288 TYR E CG  1 
ATOM   1685 C CD1 . TYR E 2 198 ? -14.658 -0.107  2.533   1.00 13.35  ? 288 TYR E CD1 1 
ATOM   1686 C CD2 . TYR E 2 198 ? -16.379 0.714   3.962   1.00 12.51  ? 288 TYR E CD2 1 
ATOM   1687 C CE1 . TYR E 2 198 ? -15.276 0.491   1.435   1.00 11.57  ? 288 TYR E CE1 1 
ATOM   1688 C CE2 . TYR E 2 198 ? -16.995 1.335   2.869   1.00 12.12  ? 288 TYR E CE2 1 
ATOM   1689 C CZ  . TYR E 2 198 ? -16.440 1.213   1.609   1.00 10.65  ? 288 TYR E CZ  1 
ATOM   1690 O OH  . TYR E 2 198 ? -17.015 1.814   0.514   1.00 13.26  ? 288 TYR E OH  1 
ATOM   1691 N N   . ARG E 2 199 ? -13.775 -3.113  6.887   1.00 15.65  ? 289 ARG E N   1 
ATOM   1692 C CA  . ARG E 2 199 ? -13.040 -3.632  8.038   1.00 15.37  ? 289 ARG E CA  1 
ATOM   1693 C C   . ARG E 2 199 ? -12.199 -4.864  7.667   1.00 19.36  ? 289 ARG E C   1 
ATOM   1694 O O   . ARG E 2 199 ? -11.062 -4.982  8.117   1.00 18.02  ? 289 ARG E O   1 
ATOM   1695 C CB  . ARG E 2 199 ? -13.979 -3.949  9.194   1.00 19.27  ? 289 ARG E CB  1 
ATOM   1696 C CG  . ARG E 2 199 ? -14.169 -2.755  10.134  1.00 31.74  ? 289 ARG E CG  1 
ATOM   1697 C CD  . ARG E 2 199 ? -14.940 -3.104  11.405  1.00 47.22  ? 289 ARG E CD  1 
ATOM   1698 N NE  . ARG E 2 199 ? -16.352 -3.414  11.139  1.00 58.73  ? 289 ARG E NE  1 
ATOM   1699 C CZ  . ARG E 2 199 ? -17.326 -2.510  11.045  1.00 64.87  ? 289 ARG E CZ  1 
ATOM   1700 N NH1 . ARG E 2 199 ? -17.062 -1.217  11.198  1.00 49.26  ? 289 ARG E NH1 1 
ATOM   1701 N NH2 . ARG E 2 199 ? -18.571 -2.892  10.791  1.00 47.90  ? 289 ARG E NH2 1 
ATOM   1702 N N   . ALA E 2 200 ? -12.733 -5.726  6.783   1.00 15.64  ? 290 ALA E N   1 
ATOM   1703 C CA  . ALA E 2 200 ? -12.050 -6.921  6.317   1.00 14.27  ? 290 ALA E CA  1 
ATOM   1704 C C   . ALA E 2 200 ? -10.909 -6.550  5.398   1.00 17.20  ? 290 ALA E C   1 
ATOM   1705 O O   . ALA E 2 200 ? -9.798  -7.019  5.633   1.00 16.16  ? 290 ALA E O   1 
ATOM   1706 C CB  . ALA E 2 200 ? -13.018 -7.847  5.613   1.00 14.53  ? 290 ALA E CB  1 
ATOM   1707 N N   . ALA E 2 201 ? -11.176 -5.699  4.372   1.00 13.23  ? 291 ALA E N   1 
ATOM   1708 C CA  . ALA E 2 201 ? -10.209 -5.219  3.375   1.00 13.39  ? 291 ALA E CA  1 
ATOM   1709 C C   . ALA E 2 201 ? -8.997  -4.580  4.052   1.00 16.66  ? 291 ALA E C   1 
ATOM   1710 O O   . ALA E 2 201 ? -7.862  -4.763  3.598   1.00 13.04  ? 291 ALA E O   1 
ATOM   1711 C CB  . ALA E 2 201 ? -10.868 -4.208  2.457   1.00 14.14  ? 291 ALA E CB  1 
ATOM   1712 N N   . LEU E 2 202 ? -9.253  -3.858  5.162   1.00 13.60  ? 292 LEU E N   1 
ATOM   1713 C CA  . LEU E 2 202 ? -8.227  -3.213  5.987   1.00 14.20  ? 292 LEU E CA  1 
ATOM   1714 C C   . LEU E 2 202 ? -7.299  -4.242  6.615   1.00 17.57  ? 292 LEU E C   1 
ATOM   1715 O O   . LEU E 2 202 ? -6.098  -4.022  6.637   1.00 17.49  ? 292 LEU E O   1 
ATOM   1716 C CB  . LEU E 2 202 ? -8.874  -2.355  7.102   1.00 14.02  ? 292 LEU E CB  1 
ATOM   1717 C CG  . LEU E 2 202 ? -8.924  -0.873  6.832   1.00 17.94  ? 292 LEU E CG  1 
ATOM   1718 C CD1 . LEU E 2 202 ? -10.006 -0.201  7.651   1.00 16.45  ? 292 LEU E CD1 1 
ATOM   1719 C CD2 . LEU E 2 202 ? -7.553  -0.229  7.042   1.00 21.60  ? 292 LEU E CD2 1 
ATOM   1720 N N   . ARG E 2 203 ? -7.859  -5.353  7.133   1.00 15.10  ? 293 ARG E N   1 
ATOM   1721 C CA  . ARG E 2 203 ? -7.094  -6.445  7.756   1.00 15.53  ? 293 ARG E CA  1 
ATOM   1722 C C   . ARG E 2 203 ? -6.183  -7.097  6.727   1.00 18.78  ? 293 ARG E C   1 
ATOM   1723 O O   . ARG E 2 203 ? -4.991  -7.279  6.985   1.00 21.11  ? 293 ARG E O   1 
ATOM   1724 C CB  . ARG E 2 203 ? -8.027  -7.498  8.386   1.00 18.12  ? 293 ARG E CB  1 
ATOM   1725 C CG  . ARG E 2 203 ? -8.345  -7.250  9.851   1.00 28.03  ? 293 ARG E CG  1 
ATOM   1726 C CD  . ARG E 2 203 ? -9.029  -8.446  10.495  1.00 42.91  ? 293 ARG E CD  1 
ATOM   1727 N NE  . ARG E 2 203 ? -10.346 -8.724  9.907   1.00 49.08  ? 293 ARG E NE  1 
ATOM   1728 C CZ  . ARG E 2 203 ? -11.495 -8.204  10.332  1.00 57.08  ? 293 ARG E CZ  1 
ATOM   1729 N NH1 . ARG E 2 203 ? -11.514 -7.374  11.368  1.00 56.99  ? 293 ARG E NH1 1 
ATOM   1730 N NH2 . ARG E 2 203 ? -12.634 -8.511  9.724   1.00 28.34  ? 293 ARG E NH2 1 
ATOM   1731 N N   . SER E 2 204 ? -6.744  -7.429  5.554   1.00 10.84  ? 294 SER E N   1 
ATOM   1732 C CA  . SER E 2 204 ? -6.018  -8.005  4.425   1.00 9.84   ? 294 SER E CA  1 
ATOM   1733 C C   . SER E 2 204 ? -4.885  -7.079  3.957   1.00 13.26  ? 294 SER E C   1 
ATOM   1734 O O   . SER E 2 204 ? -3.784  -7.557  3.715   1.00 13.25  ? 294 SER E O   1 
ATOM   1735 C CB  . SER E 2 204 ? -6.987  -8.283  3.286   1.00 11.96  ? 294 SER E CB  1 
ATOM   1736 O OG  . SER E 2 204 ? -7.972  -9.211  3.715   1.00 12.83  ? 294 SER E OG  1 
ATOM   1737 N N   . CYS E 2 205 ? -5.149  -5.768  3.859   1.00 11.33  ? 295 CYS E N   1 
ATOM   1738 C CA  . CYS E 2 205 ? -4.199  -4.707  3.463   1.00 11.11  ? 295 CYS E CA  1 
ATOM   1739 C C   . CYS E 2 205 ? -3.059  -4.601  4.485   1.00 14.60  ? 295 CYS E C   1 
ATOM   1740 O O   . CYS E 2 205 ? -1.898  -4.569  4.106   1.00 13.71  ? 295 CYS E O   1 
ATOM   1741 C CB  . CYS E 2 205 ? -4.926  -3.368  3.319   1.00 11.12  ? 295 CYS E CB  1 
ATOM   1742 S SG  . CYS E 2 205 ? -5.679  -3.104  1.694   1.00 14.44  ? 295 CYS E SG  1 
ATOM   1743 N N   . SER E 2 206 ? -3.403  -4.553  5.778   1.00 11.93  ? 296 SER E N   1 
ATOM   1744 C CA  . SER E 2 206 ? -2.436  -4.455  6.872   1.00 13.38  ? 296 SER E CA  1 
ATOM   1745 C C   . SER E 2 206 ? -1.552  -5.700  6.988   1.00 19.32  ? 296 SER E C   1 
ATOM   1746 O O   . SER E 2 206 ? -0.392  -5.561  7.378   1.00 20.90  ? 296 SER E O   1 
ATOM   1747 C CB  . SER E 2 206 ? -3.148  -4.187  8.192   1.00 17.25  ? 296 SER E CB  1 
ATOM   1748 O OG  . SER E 2 206 ? -3.754  -2.903  8.132   1.00 22.33  ? 296 SER E OG  1 
ATOM   1749 N N   . LEU E 2 207 ? -2.080  -6.904  6.650   1.00 15.34  ? 297 LEU E N   1 
ATOM   1750 C CA  . LEU E 2 207 ? -1.305  -8.144  6.673   1.00 14.89  ? 297 LEU E CA  1 
ATOM   1751 C C   . LEU E 2 207 ? -0.296  -8.141  5.544   1.00 18.04  ? 297 LEU E C   1 
ATOM   1752 O O   . LEU E 2 207 ? 0.832   -8.572  5.747   1.00 18.93  ? 297 LEU E O   1 
ATOM   1753 C CB  . LEU E 2 207 ? -2.197  -9.405  6.601   1.00 15.74  ? 297 LEU E CB  1 
ATOM   1754 C CG  . LEU E 2 207 ? -2.836  -9.862  7.925   1.00 22.21  ? 297 LEU E CG  1 
ATOM   1755 C CD1 . LEU E 2 207 ? -4.062  -10.715 7.670   1.00 23.03  ? 297 LEU E CD1 1 
ATOM   1756 C CD2 . LEU E 2 207 ? -1.854  -10.649 8.775   1.00 26.81  ? 297 LEU E CD2 1 
ATOM   1757 N N   . VAL E 2 208 ? -0.685  -7.659  4.357   1.00 14.62  ? 298 VAL E N   1 
ATOM   1758 C CA  . VAL E 2 208 ? 0.215   -7.554  3.197   1.00 13.76  ? 298 VAL E CA  1 
ATOM   1759 C C   . VAL E 2 208 ? 1.356   -6.593  3.535   1.00 18.19  ? 298 VAL E C   1 
ATOM   1760 O O   . VAL E 2 208 ? 2.521   -6.920  3.281   1.00 18.19  ? 298 VAL E O   1 
ATOM   1761 C CB  . VAL E 2 208 ? -0.510  -7.119  1.894   1.00 15.79  ? 298 VAL E CB  1 
ATOM   1762 C CG1 . VAL E 2 208 ? 0.473   -6.834  0.765   1.00 15.01  ? 298 VAL E CG1 1 
ATOM   1763 C CG2 . VAL E 2 208 ? -1.511  -8.163  1.452   1.00 15.50  ? 298 VAL E CG2 1 
ATOM   1764 N N   . LEU E 2 209 ? 1.028   -5.428  4.130   1.00 12.65  ? 299 LEU E N   1 
ATOM   1765 C CA  . LEU E 2 209 ? 2.012   -4.391  4.450   1.00 11.74  ? 299 LEU E CA  1 
ATOM   1766 C C   . LEU E 2 209 ? 2.957   -4.799  5.581   1.00 17.38  ? 299 LEU E C   1 
ATOM   1767 O O   . LEU E 2 209 ? 4.055   -4.243  5.688   1.00 16.73  ? 299 LEU E O   1 
ATOM   1768 C CB  . LEU E 2 209 ? 1.340   -3.043  4.764   1.00 10.63  ? 299 LEU E CB  1 
ATOM   1769 C CG  . LEU E 2 209 ? 0.619   -2.401  3.562   1.00 14.23  ? 299 LEU E CG  1 
ATOM   1770 C CD1 . LEU E 2 209 ? -0.322  -1.303  4.006   1.00 13.47  ? 299 LEU E CD1 1 
ATOM   1771 C CD2 . LEU E 2 209 ? 1.599   -1.936  2.479   1.00 13.75  ? 299 LEU E CD2 1 
ATOM   1772 N N   . GLU E 2 210 ? 2.567   -5.792  6.389   1.00 14.82  ? 300 GLU E N   1 
ATOM   1773 C CA  . GLU E 2 210 ? 3.434   -6.316  7.432   1.00 15.07  ? 300 GLU E CA  1 
ATOM   1774 C C   . GLU E 2 210 ? 4.562   -7.138  6.795   1.00 18.74  ? 300 GLU E C   1 
ATOM   1775 O O   . GLU E 2 210 ? 5.659   -7.176  7.336   1.00 17.82  ? 300 GLU E O   1 
ATOM   1776 C CB  . GLU E 2 210 ? 2.638   -7.145  8.431   1.00 16.38  ? 300 GLU E CB  1 
ATOM   1777 C CG  . GLU E 2 210 ? 2.009   -6.291  9.518   1.00 26.21  ? 300 GLU E CG  1 
ATOM   1778 C CD  . GLU E 2 210 ? 2.819   -6.165  10.791  1.00 58.36  ? 300 GLU E CD  1 
ATOM   1779 O OE1 . GLU E 2 210 ? 2.344   -6.653  11.842  1.00 69.14  ? 300 GLU E OE1 1 
ATOM   1780 O OE2 . GLU E 2 210 ? 3.917   -5.565  10.746  1.00 54.42  ? 300 GLU E OE2 1 
ATOM   1781 N N   . HIS E 2 211 ? 4.294   -7.763  5.628   1.00 16.17  ? 301 HIS E N   1 
ATOM   1782 C CA  . HIS E 2 211 ? 5.272   -8.569  4.893   1.00 16.10  ? 301 HIS E CA  1 
ATOM   1783 C C   . HIS E 2 211 ? 6.019   -7.721  3.893   1.00 20.21  ? 301 HIS E C   1 
ATOM   1784 O O   . HIS E 2 211 ? 7.225   -7.890  3.734   1.00 20.84  ? 301 HIS E O   1 
ATOM   1785 C CB  . HIS E 2 211 ? 4.595   -9.738  4.166   1.00 16.43  ? 301 HIS E CB  1 
ATOM   1786 C CG  . HIS E 2 211 ? 4.071   -10.802 5.073   1.00 20.12  ? 301 HIS E CG  1 
ATOM   1787 N ND1 . HIS E 2 211 ? 4.780   -11.963 5.284   1.00 21.88  ? 301 HIS E ND1 1 
ATOM   1788 C CD2 . HIS E 2 211 ? 2.927   -10.853 5.796   1.00 22.25  ? 301 HIS E CD2 1 
ATOM   1789 C CE1 . HIS E 2 211 ? 4.066   -12.674 6.139   1.00 21.50  ? 301 HIS E CE1 1 
ATOM   1790 N NE2 . HIS E 2 211 ? 2.948   -12.044 6.484   1.00 22.02  ? 301 HIS E NE2 1 
ATOM   1791 N N   . GLN E 2 212 ? 5.291   -6.839  3.187   1.00 15.60  ? 302 GLN E N   1 
ATOM   1792 C CA  . GLN E 2 212 ? 5.823   -5.955  2.158   1.00 15.72  ? 302 GLN E CA  1 
ATOM   1793 C C   . GLN E 2 212 ? 5.364   -4.511  2.417   1.00 20.63  ? 302 GLN E C   1 
ATOM   1794 O O   . GLN E 2 212 ? 4.362   -4.088  1.851   1.00 22.38  ? 302 GLN E O   1 
ATOM   1795 C CB  . GLN E 2 212 ? 5.418   -6.446  0.752   1.00 17.17  ? 302 GLN E CB  1 
ATOM   1796 C CG  . GLN E 2 212 ? 6.121   -7.733  0.331   1.00 29.78  ? 302 GLN E CG  1 
ATOM   1797 C CD  . GLN E 2 212 ? 5.570   -8.368  -0.917  1.00 49.22  ? 302 GLN E CD  1 
ATOM   1798 O OE1 . GLN E 2 212 ? 4.838   -7.758  -1.704  1.00 38.11  ? 302 GLN E OE1 1 
ATOM   1799 N NE2 . GLN E 2 212 ? 5.936   -9.622  -1.133  1.00 51.04  ? 302 GLN E NE2 1 
ATOM   1800 N N   . PRO E 2 213 ? 6.113   -3.730  3.240   1.00 17.74  ? 303 PRO E N   1 
ATOM   1801 C CA  . PRO E 2 213 ? 5.677   -2.357  3.564   1.00 17.17  ? 303 PRO E CA  1 
ATOM   1802 C C   . PRO E 2 213 ? 5.704   -1.352  2.409   1.00 19.62  ? 303 PRO E C   1 
ATOM   1803 O O   . PRO E 2 213 ? 5.099   -0.296  2.549   1.00 19.56  ? 303 PRO E O   1 
ATOM   1804 C CB  . PRO E 2 213 ? 6.622   -1.939  4.694   1.00 19.14  ? 303 PRO E CB  1 
ATOM   1805 C CG  . PRO E 2 213 ? 7.822   -2.781  4.504   1.00 23.58  ? 303 PRO E CG  1 
ATOM   1806 C CD  . PRO E 2 213 ? 7.336   -4.091  3.984   1.00 18.94  ? 303 PRO E CD  1 
ATOM   1807 N N   . ASP E 2 214 ? 6.338   -1.672  1.275   1.00 16.95  ? 304 ASP E N   1 
ATOM   1808 C CA  . ASP E 2 214 ? 6.364   -0.765  0.115   1.00 17.54  ? 304 ASP E CA  1 
ATOM   1809 C C   . ASP E 2 214 ? 5.571   -1.348  -1.073  1.00 21.84  ? 304 ASP E C   1 
ATOM   1810 O O   . ASP E 2 214 ? 5.891   -1.080  -2.243  1.00 22.65  ? 304 ASP E O   1 
ATOM   1811 C CB  . ASP E 2 214 ? 7.818   -0.413  -0.305  1.00 20.78  ? 304 ASP E CB  1 
ATOM   1812 C CG  . ASP E 2 214 ? 8.650   0.218   0.799   1.00 35.83  ? 304 ASP E CG  1 
ATOM   1813 O OD1 . ASP E 2 214 ? 8.136   1.129   1.491   1.00 37.88  ? 304 ASP E OD1 1 
ATOM   1814 O OD2 . ASP E 2 214 ? 9.812   -0.204  0.981   1.00 43.31  ? 304 ASP E OD2 1 
ATOM   1815 N N   . ASN E 2 215 ? 4.523   -2.152  -0.767  1.00 17.17  ? 305 ASN E N   1 
ATOM   1816 C CA  . ASN E 2 215 ? 3.622   -2.729  -1.769  1.00 13.74  ? 305 ASN E CA  1 
ATOM   1817 C C   . ASN E 2 215 ? 2.648   -1.622  -2.131  1.00 12.22  ? 305 ASN E C   1 
ATOM   1818 O O   . ASN E 2 215 ? 1.817   -1.250  -1.303  1.00 8.94   ? 305 ASN E O   1 
ATOM   1819 C CB  . ASN E 2 215 ? 2.898   -3.981  -1.223  1.00 15.36  ? 305 ASN E CB  1 
ATOM   1820 C CG  . ASN E 2 215 ? 2.096   -4.719  -2.253  1.00 17.95  ? 305 ASN E CG  1 
ATOM   1821 O OD1 . ASN E 2 215 ? 1.177   -4.188  -2.872  1.00 8.85   ? 305 ASN E OD1 1 
ATOM   1822 N ND2 . ASN E 2 215 ? 2.400   -5.974  -2.432  1.00 13.28  ? 305 ASN E ND2 1 
ATOM   1823 N N   . ILE E 2 216 ? 2.789   -1.068  -3.358  1.00 8.50   ? 306 ILE E N   1 
ATOM   1824 C CA  . ILE E 2 216 ? 2.017   0.074   -3.824  1.00 8.63   ? 306 ILE E CA  1 
ATOM   1825 C C   . ILE E 2 216 ? 0.516   -0.250  -3.880  1.00 16.25  ? 306 ILE E C   1 
ATOM   1826 O O   . ILE E 2 216 ? -0.282  0.607   -3.511  1.00 17.92  ? 306 ILE E O   1 
ATOM   1827 C CB  . ILE E 2 216 ? 2.547   0.634   -5.157  1.00 10.65  ? 306 ILE E CB  1 
ATOM   1828 C CG1 . ILE E 2 216 ? 1.940   2.049   -5.436  1.00 11.90  ? 306 ILE E CG1 1 
ATOM   1829 C CG2 . ILE E 2 216 ? 2.376   -0.361  -6.319  1.00 7.05   ? 306 ILE E CG2 1 
ATOM   1830 C CD1 . ILE E 2 216 ? 2.499   2.763   -6.631  1.00 14.52  ? 306 ILE E CD1 1 
ATOM   1831 N N   . LYS E 2 217 ? 0.144   -1.487  -4.296  1.00 11.48  ? 307 LYS E N   1 
ATOM   1832 C CA  . LYS E 2 217 ? -1.249  -1.908  -4.403  1.00 9.04   ? 307 LYS E CA  1 
ATOM   1833 C C   . LYS E 2 217 ? -1.899  -1.944  -3.048  1.00 14.21  ? 307 LYS E C   1 
ATOM   1834 O O   . LYS E 2 217 ? -2.959  -1.362  -2.897  1.00 15.57  ? 307 LYS E O   1 
ATOM   1835 C CB  . LYS E 2 217 ? -1.367  -3.238  -5.117  1.00 9.05   ? 307 LYS E CB  1 
ATOM   1836 C CG  . LYS E 2 217 ? -1.288  -3.094  -6.639  1.00 12.81  ? 307 LYS E CG  1 
ATOM   1837 C CD  . LYS E 2 217 ? -1.436  -4.447  -7.305  1.00 15.92  ? 307 LYS E CD  1 
ATOM   1838 C CE  . LYS E 2 217 ? -1.406  -4.322  -8.800  1.00 22.49  ? 307 LYS E CE  1 
ATOM   1839 N NZ  . LYS E 2 217 ? -1.759  -5.603  -9.448  1.00 20.73  ? 307 LYS E NZ  1 
ATOM   1840 N N   . ALA E 2 218 ? -1.237  -2.543  -2.039  1.00 11.01  ? 308 ALA E N   1 
ATOM   1841 C CA  . ALA E 2 218 ? -1.768  -2.607  -0.680  1.00 9.21   ? 308 ALA E CA  1 
ATOM   1842 C C   . ALA E 2 218 ? -1.854  -1.227  -0.036  1.00 14.10  ? 308 ALA E C   1 
ATOM   1843 O O   . ALA E 2 218 ? -2.771  -0.989  0.751   1.00 11.99  ? 308 ALA E O   1 
ATOM   1844 C CB  . ALA E 2 218 ? -0.915  -3.511  0.170   1.00 9.29   ? 308 ALA E CB  1 
ATOM   1845 N N   . LEU E 2 219 ? -0.892  -0.320  -0.341  1.00 12.13  ? 309 LEU E N   1 
ATOM   1846 C CA  . LEU E 2 219 ? -0.915  1.048   0.194   1.00 12.17  ? 309 LEU E CA  1 
ATOM   1847 C C   . LEU E 2 219 ? -2.095  1.814   -0.396  1.00 15.19  ? 309 LEU E C   1 
ATOM   1848 O O   . LEU E 2 219 ? -2.895  2.365   0.367   1.00 15.45  ? 309 LEU E O   1 
ATOM   1849 C CB  . LEU E 2 219 ? 0.407   1.795   -0.084  1.00 12.81  ? 309 LEU E CB  1 
ATOM   1850 C CG  . LEU E 2 219 ? 1.619   1.401   0.779   1.00 15.93  ? 309 LEU E CG  1 
ATOM   1851 C CD1 . LEU E 2 219 ? 2.931   1.819   0.114   1.00 14.30  ? 309 LEU E CD1 1 
ATOM   1852 C CD2 . LEU E 2 219 ? 1.506   1.978   2.175   1.00 16.91  ? 309 LEU E CD2 1 
ATOM   1853 N N   . PHE E 2 220 ? -2.257  1.767   -1.734  1.00 11.93  ? 310 PHE E N   1 
ATOM   1854 C CA  . PHE E 2 220 ? -3.363  2.439   -2.423  1.00 14.58  ? 310 PHE E CA  1 
ATOM   1855 C C   . PHE E 2 220 ? -4.729  1.911   -1.948  1.00 21.37  ? 310 PHE E C   1 
ATOM   1856 O O   . PHE E 2 220 ? -5.640  2.710   -1.707  1.00 22.42  ? 310 PHE E O   1 
ATOM   1857 C CB  . PHE E 2 220 ? -3.235  2.298   -3.941  1.00 17.29  ? 310 PHE E CB  1 
ATOM   1858 C CG  . PHE E 2 220 ? -4.410  2.859   -4.713  1.00 20.02  ? 310 PHE E CG  1 
ATOM   1859 C CD1 . PHE E 2 220 ? -4.503  4.225   -4.986  1.00 22.59  ? 310 PHE E CD1 1 
ATOM   1860 C CD2 . PHE E 2 220 ? -5.429  2.026   -5.158  1.00 22.51  ? 310 PHE E CD2 1 
ATOM   1861 C CE1 . PHE E 2 220 ? -5.602  4.743   -5.682  1.00 23.27  ? 310 PHE E CE1 1 
ATOM   1862 C CE2 . PHE E 2 220 ? -6.516  2.547   -5.872  1.00 25.70  ? 310 PHE E CE2 1 
ATOM   1863 C CZ  . PHE E 2 220 ? -6.590  3.899   -6.127  1.00 23.55  ? 310 PHE E CZ  1 
ATOM   1864 N N   . ARG E 2 221 ? -4.869  0.574   -1.805  1.00 16.46  ? 311 ARG E N   1 
ATOM   1865 C CA  . ARG E 2 221 ? -6.129  -0.035  -1.380  1.00 15.19  ? 311 ARG E CA  1 
ATOM   1866 C C   . ARG E 2 221 ? -6.437  0.309   0.088   1.00 18.05  ? 311 ARG E C   1 
ATOM   1867 O O   . ARG E 2 221 ? -7.599  0.540   0.421   1.00 18.54  ? 311 ARG E O   1 
ATOM   1868 C CB  . ARG E 2 221 ? -6.090  -1.547  -1.614  1.00 15.27  ? 311 ARG E CB  1 
ATOM   1869 C CG  . ARG E 2 221 ? -6.252  -1.900  -3.081  1.00 17.06  ? 311 ARG E CG  1 
ATOM   1870 C CD  . ARG E 2 221 ? -5.812  -3.307  -3.397  1.00 18.13  ? 311 ARG E CD  1 
ATOM   1871 N NE  . ARG E 2 221 ? -5.850  -3.548  -4.842  1.00 14.45  ? 311 ARG E NE  1 
ATOM   1872 C CZ  . ARG E 2 221 ? -5.247  -4.569  -5.431  1.00 16.55  ? 311 ARG E CZ  1 
ATOM   1873 N NH1 . ARG E 2 221 ? -4.596  -5.467  -4.706  1.00 3.00   ? 311 ARG E NH1 1 
ATOM   1874 N NH2 . ARG E 2 221 ? -5.316  -4.717  -6.750  1.00 3.00   ? 311 ARG E NH2 1 
ATOM   1875 N N   . LYS E 2 222 ? -5.410  0.392   0.948   1.00 13.29  ? 312 LYS E N   1 
ATOM   1876 C CA  . LYS E 2 222 ? -5.635  0.764   2.348   1.00 14.23  ? 312 LYS E CA  1 
ATOM   1877 C C   . LYS E 2 222 ? -6.086  2.235   2.425   1.00 21.79  ? 312 LYS E C   1 
ATOM   1878 O O   . LYS E 2 222 ? -7.007  2.537   3.176   1.00 22.74  ? 312 LYS E O   1 
ATOM   1879 C CB  . LYS E 2 222 ? -4.397  0.518   3.240   1.00 14.76  ? 312 LYS E CB  1 
ATOM   1880 C CG  . LYS E 2 222 ? -4.698  0.705   4.739   1.00 8.40   ? 312 LYS E CG  1 
ATOM   1881 C CD  . LYS E 2 222 ? -3.471  0.477   5.609   1.00 20.76  ? 312 LYS E CD  1 
ATOM   1882 C CE  . LYS E 2 222 ? -3.788  0.764   7.059   1.00 21.00  ? 312 LYS E CE  1 
ATOM   1883 N NZ  . LYS E 2 222 ? -2.845  0.071   7.983   1.00 21.54  ? 312 LYS E NZ  1 
ATOM   1884 N N   . GLY E 2 223 ? -5.451  3.099   1.630   1.00 20.67  ? 313 GLY E N   1 
ATOM   1885 C CA  . GLY E 2 223 ? -5.775  4.524   1.534   1.00 21.41  ? 313 GLY E CA  1 
ATOM   1886 C C   . GLY E 2 223 ? -7.182  4.754   1.001   1.00 22.91  ? 313 GLY E C   1 
ATOM   1887 O O   . GLY E 2 223 ? -7.942  5.509   1.596   1.00 22.27  ? 313 GLY E O   1 
ATOM   1888 N N   . LYS E 2 224 ? -7.555  4.054   -0.088  1.00 18.90  ? 314 LYS E N   1 
ATOM   1889 C CA  . LYS E 2 224 ? -8.892  4.118   -0.706  1.00 19.08  ? 314 LYS E CA  1 
ATOM   1890 C C   . LYS E 2 224 ? -9.986  3.665   0.282   1.00 24.01  ? 314 LYS E C   1 
ATOM   1891 O O   . LYS E 2 224 ? -11.054 4.266   0.310   1.00 25.60  ? 314 LYS E O   1 
ATOM   1892 C CB  . LYS E 2 224 ? -8.931  3.277   -1.984  1.00 20.58  ? 314 LYS E CB  1 
ATOM   1893 C CG  . LYS E 2 224 ? -10.139 3.549   -2.865  1.00 25.75  ? 314 LYS E CG  1 
ATOM   1894 C CD  . LYS E 2 224 ? -9.986  2.848   -4.191  1.00 27.63  ? 314 LYS E CD  1 
ATOM   1895 C CE  . LYS E 2 224 ? -11.184 3.051   -5.074  1.00 39.67  ? 314 LYS E CE  1 
ATOM   1896 N NZ  . LYS E 2 224 ? -10.923 2.614   -6.475  1.00 53.00  ? 314 LYS E NZ  1 
ATOM   1897 N N   . VAL E 2 225 ? -9.703  2.639   1.113   1.00 19.45  ? 315 VAL E N   1 
ATOM   1898 C CA  . VAL E 2 225 ? -10.637 2.148   2.130   1.00 18.23  ? 315 VAL E CA  1 
ATOM   1899 C C   . VAL E 2 225 ? -10.799 3.211   3.233   1.00 21.89  ? 315 VAL E C   1 
ATOM   1900 O O   . VAL E 2 225 ? -11.920 3.532   3.613   1.00 20.99  ? 315 VAL E O   1 
ATOM   1901 C CB  . VAL E 2 225 ? -10.214 0.763   2.708   1.00 21.11  ? 315 VAL E CB  1 
ATOM   1902 C CG1 . VAL E 2 225 ? -10.973 0.441   3.995   1.00 20.63  ? 315 VAL E CG1 1 
ATOM   1903 C CG2 . VAL E 2 225 ? -10.439 -0.345  1.677   1.00 20.44  ? 315 VAL E CG2 1 
ATOM   1904 N N   . LEU E 2 226 ? -9.678  3.759   3.728   1.00 19.15  ? 316 LEU E N   1 
ATOM   1905 C CA  . LEU E 2 226 ? -9.656  4.786   4.763   1.00 18.42  ? 316 LEU E CA  1 
ATOM   1906 C C   . LEU E 2 226 ? -10.408 6.033   4.297   1.00 25.45  ? 316 LEU E C   1 
ATOM   1907 O O   . LEU E 2 226 ? -11.142 6.623   5.088   1.00 27.61  ? 316 LEU E O   1 
ATOM   1908 C CB  . LEU E 2 226 ? -8.214  5.136   5.126   1.00 16.88  ? 316 LEU E CB  1 
ATOM   1909 C CG  . LEU E 2 226 ? -7.419  4.116   5.924   1.00 18.68  ? 316 LEU E CG  1 
ATOM   1910 C CD1 . LEU E 2 226 ? -5.941  4.367   5.770   1.00 16.91  ? 316 LEU E CD1 1 
ATOM   1911 C CD2 . LEU E 2 226 ? -7.782  4.140   7.394   1.00 19.84  ? 316 LEU E CD2 1 
ATOM   1912 N N   . ALA E 2 227 ? -10.265 6.391   3.003   1.00 21.49  ? 317 ALA E N   1 
ATOM   1913 C CA  . ALA E 2 227 ? -10.915 7.533   2.357   1.00 20.98  ? 317 ALA E CA  1 
ATOM   1914 C C   . ALA E 2 227 ? -12.422 7.332   2.250   1.00 25.68  ? 317 ALA E C   1 
ATOM   1915 O O   . ALA E 2 227 ? -13.181 8.256   2.531   1.00 25.50  ? 317 ALA E O   1 
ATOM   1916 C CB  . ALA E 2 227 ? -10.329 7.757   0.972   1.00 21.50  ? 317 ALA E CB  1 
ATOM   1917 N N   . GLN E 2 228 ? -12.859 6.130   1.839   1.00 24.27  ? 318 GLN E N   1 
ATOM   1918 C CA  . GLN E 2 228 ? -14.275 5.783   1.677   1.00 23.94  ? 318 GLN E CA  1 
ATOM   1919 C C   . GLN E 2 228 ? -14.969 5.656   3.030   1.00 30.95  ? 318 GLN E C   1 
ATOM   1920 O O   . GLN E 2 228 ? -16.175 5.865   3.106   1.00 31.35  ? 318 GLN E O   1 
ATOM   1921 C CB  . GLN E 2 228 ? -14.438 4.508   0.846   1.00 24.74  ? 318 GLN E CB  1 
ATOM   1922 C CG  . GLN E 2 228 ? -14.296 4.775   -0.660  1.00 30.69  ? 318 GLN E CG  1 
ATOM   1923 C CD  . GLN E 2 228 ? -14.208 3.536   -1.521  1.00 48.66  ? 318 GLN E CD  1 
ATOM   1924 O OE1 . GLN E 2 228 ? -14.602 2.432   -1.139  1.00 47.51  ? 318 GLN E OE1 1 
ATOM   1925 N NE2 . GLN E 2 228 ? -13.720 3.700   -2.734  1.00 42.13  ? 318 GLN E NE2 1 
ATOM   1926 N N   . GLN E 2 229 ? -14.206 5.363   4.103   1.00 29.17  ? 319 GLN E N   1 
ATOM   1927 C CA  . GLN E 2 229 ? -14.740 5.290   5.460   1.00 29.32  ? 319 GLN E CA  1 
ATOM   1928 C C   . GLN E 2 229 ? -14.924 6.696   6.052   1.00 33.72  ? 319 GLN E C   1 
ATOM   1929 O O   . GLN E 2 229 ? -15.676 6.860   7.016   1.00 34.33  ? 319 GLN E O   1 
ATOM   1930 C CB  . GLN E 2 229 ? -13.818 4.470   6.364   1.00 30.99  ? 319 GLN E CB  1 
ATOM   1931 C CG  . GLN E 2 229 ? -13.958 2.970   6.218   1.00 39.80  ? 319 GLN E CG  1 
ATOM   1932 C CD  . GLN E 2 229 ? -12.917 2.258   7.048   1.00 47.41  ? 319 GLN E CD  1 
ATOM   1933 O OE1 . GLN E 2 229 ? -11.733 2.604   7.024   1.00 35.20  ? 319 GLN E OE1 1 
ATOM   1934 N NE2 . GLN E 2 229 ? -13.332 1.234   7.791   1.00 42.21  ? 319 GLN E NE2 1 
ATOM   1935 N N   . GLY E 2 230 ? -14.216 7.677   5.493   1.00 29.92  ? 320 GLY E N   1 
ATOM   1936 C CA  . GLY E 2 230 ? -14.255 9.059   5.958   1.00 30.47  ? 320 GLY E CA  1 
ATOM   1937 C C   . GLY E 2 230 ? -13.087 9.460   6.841   1.00 34.21  ? 320 GLY E C   1 
ATOM   1938 O O   . GLY E 2 230 ? -13.080 10.568  7.384   1.00 33.44  ? 320 GLY E O   1 
ATOM   1939 N N   . GLU E 2 231 ? -12.088 8.561   6.983   1.00 31.35  ? 321 GLU E N   1 
ATOM   1940 C CA  . GLU E 2 231 ? -10.857 8.765   7.762   1.00 30.83  ? 321 GLU E CA  1 
ATOM   1941 C C   . GLU E 2 231 ? -9.810  9.416   6.846   1.00 33.87  ? 321 GLU E C   1 
ATOM   1942 O O   . GLU E 2 231 ? -8.806  8.802   6.491   1.00 32.60  ? 321 GLU E O   1 
ATOM   1943 C CB  . GLU E 2 231 ? -10.366 7.434   8.351   1.00 32.00  ? 321 GLU E CB  1 
ATOM   1944 C CG  . GLU E 2 231 ? -11.241 6.914   9.477   1.00 44.55  ? 321 GLU E CG  1 
ATOM   1945 C CD  . GLU E 2 231 ? -10.704 7.174   10.868  1.00 74.30  ? 321 GLU E CD  1 
ATOM   1946 O OE1 . GLU E 2 231 ? -10.372 8.342   11.175  1.00 78.64  ? 321 GLU E OE1 1 
ATOM   1947 O OE2 . GLU E 2 231 ? -10.627 6.205   11.659  1.00 74.52  ? 321 GLU E OE2 1 
ATOM   1948 N N   . TYR E 2 232 ? -10.091 10.665  6.441   1.00 31.52  ? 322 TYR E N   1 
ATOM   1949 C CA  . TYR E 2 232 ? -9.288  11.482  5.529   1.00 31.61  ? 322 TYR E CA  1 
ATOM   1950 C C   . TYR E 2 232 ? -7.898  11.790  6.107   1.00 35.19  ? 322 TYR E C   1 
ATOM   1951 O O   . TYR E 2 232 ? -6.918  11.786  5.361   1.00 34.84  ? 322 TYR E O   1 
ATOM   1952 C CB  . TYR E 2 232 ? -10.033 12.804  5.196   1.00 32.91  ? 322 TYR E CB  1 
ATOM   1953 C CG  . TYR E 2 232 ? -11.432 12.658  4.618   1.00 34.87  ? 322 TYR E CG  1 
ATOM   1954 C CD1 . TYR E 2 232 ? -11.729 11.663  3.689   1.00 37.72  ? 322 TYR E CD1 1 
ATOM   1955 C CD2 . TYR E 2 232 ? -12.430 13.581  4.916   1.00 35.59  ? 322 TYR E CD2 1 
ATOM   1956 C CE1 . TYR E 2 232 ? -13.000 11.556  3.117   1.00 38.98  ? 322 TYR E CE1 1 
ATOM   1957 C CE2 . TYR E 2 232 ? -13.700 13.493  4.341   1.00 36.22  ? 322 TYR E CE2 1 
ATOM   1958 C CZ  . TYR E 2 232 ? -13.984 12.471  3.448   1.00 41.94  ? 322 TYR E CZ  1 
ATOM   1959 O OH  . TYR E 2 232 ? -15.230 12.356  2.880   1.00 39.81  ? 322 TYR E OH  1 
ATOM   1960 N N   . SER E 2 233 ? -7.826  12.034  7.431   1.00 31.39  ? 323 SER E N   1 
ATOM   1961 C CA  . SER E 2 233 ? -6.602  12.341  8.178   1.00 31.58  ? 323 SER E CA  1 
ATOM   1962 C C   . SER E 2 233 ? -5.600  11.180  8.142   1.00 34.59  ? 323 SER E C   1 
ATOM   1963 O O   . SER E 2 233 ? -4.392  11.421  8.110   1.00 35.17  ? 323 SER E O   1 
ATOM   1964 C CB  . SER E 2 233 ? -6.935  12.689  9.627   1.00 37.94  ? 323 SER E CB  1 
ATOM   1965 O OG  . SER E 2 233 ? -7.631  11.632  10.273  1.00 54.07  ? 323 SER E OG  1 
ATOM   1966 N N   . GLU E 2 234 ? -6.099  9.926   8.140   1.00 28.31  ? 324 GLU E N   1 
ATOM   1967 C CA  . GLU E 2 234 ? -5.274  8.724   8.081   1.00 25.06  ? 324 GLU E CA  1 
ATOM   1968 C C   . GLU E 2 234 ? -5.000  8.283   6.646   1.00 25.89  ? 324 GLU E C   1 
ATOM   1969 O O   . GLU E 2 234 ? -3.969  7.669   6.391   1.00 26.19  ? 324 GLU E O   1 
ATOM   1970 C CB  . GLU E 2 234 ? -5.940  7.590   8.860   1.00 25.93  ? 324 GLU E CB  1 
ATOM   1971 C CG  . GLU E 2 234 ? -5.610  7.633   10.344  1.00 38.39  ? 324 GLU E CG  1 
ATOM   1972 C CD  . GLU E 2 234 ? -6.387  6.688   11.239  1.00 68.68  ? 324 GLU E CD  1 
ATOM   1973 O OE1 . GLU E 2 234 ? -6.940  7.169   12.254  1.00 66.83  ? 324 GLU E OE1 1 
ATOM   1974 O OE2 . GLU E 2 234 ? -6.428  5.469   10.947  1.00 66.82  ? 324 GLU E OE2 1 
ATOM   1975 N N   . ALA E 2 235 ? -5.901  8.606   5.709   1.00 20.74  ? 325 ALA E N   1 
ATOM   1976 C CA  . ALA E 2 235 ? -5.800  8.191   4.304   1.00 20.01  ? 325 ALA E CA  1 
ATOM   1977 C C   . ALA E 2 235 ? -4.750  8.943   3.491   1.00 24.38  ? 325 ALA E C   1 
ATOM   1978 O O   . ALA E 2 235 ? -4.102  8.325   2.640   1.00 23.63  ? 325 ALA E O   1 
ATOM   1979 C CB  . ALA E 2 235 ? -7.151  8.345   3.619   1.00 19.78  ? 325 ALA E CB  1 
ATOM   1980 N N   . ILE E 2 236 ? -4.629  10.283  3.696   1.00 20.64  ? 326 ILE E N   1 
ATOM   1981 C CA  . ILE E 2 236 ? -3.747  11.155  2.916   1.00 18.57  ? 326 ILE E CA  1 
ATOM   1982 C C   . ILE E 2 236 ? -2.249  10.755  3.085   1.00 20.48  ? 326 ILE E C   1 
ATOM   1983 O O   . ILE E 2 236 ? -1.617  10.620  2.031   1.00 19.05  ? 326 ILE E O   1 
ATOM   1984 C CB  . ILE E 2 236 ? -4.006  12.679  3.138   1.00 21.66  ? 326 ILE E CB  1 
ATOM   1985 C CG1 . ILE E 2 236 ? -3.222  13.537  2.124   1.00 21.96  ? 326 ILE E CG1 1 
ATOM   1986 C CG2 . ILE E 2 236 ? -3.802  13.162  4.578   1.00 22.09  ? 326 ILE E CG2 1 
ATOM   1987 C CD1 . ILE E 2 236 ? -3.761  14.921  1.919   1.00 29.41  ? 326 ILE E CD1 1 
ATOM   1988 N N   . PRO E 2 237 ? -1.651  10.501  4.289   1.00 17.68  ? 327 PRO E N   1 
ATOM   1989 C CA  . PRO E 2 237 ? -0.238  10.088  4.304   1.00 18.81  ? 327 PRO E CA  1 
ATOM   1990 C C   . PRO E 2 237 ? 0.009   8.732   3.610   1.00 23.07  ? 327 PRO E C   1 
ATOM   1991 O O   . PRO E 2 237 ? 1.037   8.568   2.949   1.00 23.54  ? 327 PRO E O   1 
ATOM   1992 C CB  . PRO E 2 237 ? 0.113   10.033  5.795   1.00 20.54  ? 327 PRO E CB  1 
ATOM   1993 C CG  . PRO E 2 237 ? -1.179  9.879   6.497   1.00 24.36  ? 327 PRO E CG  1 
ATOM   1994 C CD  . PRO E 2 237 ? -2.190  10.585  5.665   1.00 19.20  ? 327 PRO E CD  1 
ATOM   1995 N N   . ILE E 2 238 ? -0.940  7.788   3.724   1.00 18.76  ? 328 ILE E N   1 
ATOM   1996 C CA  . ILE E 2 238 ? -0.841  6.455   3.111   1.00 17.73  ? 328 ILE E CA  1 
ATOM   1997 C C   . ILE E 2 238 ? -0.923  6.586   1.579   1.00 17.20  ? 328 ILE E C   1 
ATOM   1998 O O   . ILE E 2 238 ? -0.071  6.032   0.881   1.00 13.35  ? 328 ILE E O   1 
ATOM   1999 C CB  . ILE E 2 238 ? -1.893  5.482   3.696   1.00 21.98  ? 328 ILE E CB  1 
ATOM   2000 C CG1 . ILE E 2 238 ? -1.462  5.049   5.113   1.00 23.49  ? 328 ILE E CG1 1 
ATOM   2001 C CG2 . ILE E 2 238 ? -2.074  4.255   2.787   1.00 22.98  ? 328 ILE E CG2 1 
ATOM   2002 C CD1 . ILE E 2 238 ? -2.563  4.579   6.026   1.00 37.23  ? 328 ILE E CD1 1 
ATOM   2003 N N   . LEU E 2 239 ? -1.896  7.368   1.070   1.00 14.53  ? 329 LEU E N   1 
ATOM   2004 C CA  . LEU E 2 239 ? -2.038  7.603   -0.382  1.00 14.03  ? 329 LEU E CA  1 
ATOM   2005 C C   . LEU E 2 239 ? -0.849  8.404   -0.917  1.00 19.47  ? 329 LEU E C   1 
ATOM   2006 O O   . LEU E 2 239 ? -0.503  8.251   -2.089  1.00 19.91  ? 329 LEU E O   1 
ATOM   2007 C CB  . LEU E 2 239 ? -3.353  8.325   -0.716  1.00 14.16  ? 329 LEU E CB  1 
ATOM   2008 C CG  . LEU E 2 239 ? -4.641  7.514   -0.714  1.00 19.74  ? 329 LEU E CG  1 
ATOM   2009 C CD1 . LEU E 2 239 ? -5.850  8.417   -0.951  1.00 20.07  ? 329 LEU E CD1 1 
ATOM   2010 C CD2 . LEU E 2 239 ? -4.622  6.399   -1.765  1.00 21.90  ? 329 LEU E CD2 1 
ATOM   2011 N N   . ARG E 2 240 ? -0.203  9.239   -0.060  1.00 16.02  ? 330 ARG E N   1 
ATOM   2012 C CA  . ARG E 2 240 ? 0.997   9.994   -0.447  1.00 16.46  ? 330 ARG E CA  1 
ATOM   2013 C C   . ARG E 2 240 ? 2.200   9.060   -0.472  1.00 21.85  ? 330 ARG E C   1 
ATOM   2014 O O   . ARG E 2 240 ? 2.977   9.125   -1.417  1.00 25.40  ? 330 ARG E O   1 
ATOM   2015 C CB  . ARG E 2 240 ? 1.245   11.205  0.472   1.00 15.72  ? 330 ARG E CB  1 
ATOM   2016 C CG  . ARG E 2 240 ? 0.444   12.424  0.033   1.00 13.65  ? 330 ARG E CG  1 
ATOM   2017 C CD  . ARG E 2 240 ? 0.460   13.513  1.072   1.00 25.36  ? 330 ARG E CD  1 
ATOM   2018 N NE  . ARG E 2 240 ? -0.012  14.790  0.529   1.00 27.28  ? 330 ARG E NE  1 
ATOM   2019 C CZ  . ARG E 2 240 ? -0.350  15.830  1.281   1.00 30.16  ? 330 ARG E CZ  1 
ATOM   2020 N NH1 . ARG E 2 240 ? -0.309  15.743  2.608   1.00 8.05   ? 330 ARG E NH1 1 
ATOM   2021 N NH2 . ARG E 2 240 ? -0.773  16.954  0.715   1.00 16.55  ? 330 ARG E NH2 1 
ATOM   2022 N N   . ALA E 2 241 ? 2.325   8.158   0.522   1.00 16.33  ? 331 ALA E N   1 
ATOM   2023 C CA  . ALA E 2 241 ? 3.393   7.137   0.583   1.00 16.64  ? 331 ALA E CA  1 
ATOM   2024 C C   . ALA E 2 241 ? 3.408   6.264   -0.691  1.00 21.45  ? 331 ALA E C   1 
ATOM   2025 O O   . ALA E 2 241 ? 4.481   5.905   -1.169  1.00 25.05  ? 331 ALA E O   1 
ATOM   2026 C CB  . ALA E 2 241 ? 3.209   6.264   1.806   1.00 17.45  ? 331 ALA E CB  1 
ATOM   2027 N N   . ALA E 2 242 ? 2.220   5.955   -1.244  1.00 13.98  ? 332 ALA E N   1 
ATOM   2028 C CA  . ALA E 2 242 ? 2.043   5.220   -2.506  1.00 12.33  ? 332 ALA E CA  1 
ATOM   2029 C C   . ALA E 2 242 ? 2.514   6.066   -3.670  1.00 13.68  ? 332 ALA E C   1 
ATOM   2030 O O   . ALA E 2 242 ? 3.225   5.558   -4.534  1.00 13.82  ? 332 ALA E O   1 
ATOM   2031 C CB  . ALA E 2 242 ? 0.577   4.817   -2.705  1.00 12.38  ? 332 ALA E CB  1 
ATOM   2032 N N   . LEU E 2 243 ? 2.137   7.366   -3.688  1.00 10.75  ? 333 LEU E N   1 
ATOM   2033 C CA  . LEU E 2 243 ? 2.510   8.313   -4.746  1.00 11.04  ? 333 LEU E CA  1 
ATOM   2034 C C   . LEU E 2 243 ? 4.012   8.534   -4.751  1.00 14.96  ? 333 LEU E C   1 
ATOM   2035 O O   . LEU E 2 243 ? 4.581   8.697   -5.818  1.00 13.82  ? 333 LEU E O   1 
ATOM   2036 C CB  . LEU E 2 243 ? 1.767   9.660   -4.604  1.00 11.64  ? 333 LEU E CB  1 
ATOM   2037 C CG  . LEU E 2 243 ? 1.826   10.612  -5.819  1.00 17.25  ? 333 LEU E CG  1 
ATOM   2038 C CD1 . LEU E 2 243 ? 1.107   10.028  -7.041  1.00 16.36  ? 333 LEU E CD1 1 
ATOM   2039 C CD2 . LEU E 2 243 ? 1.240   11.955  -5.473  1.00 20.54  ? 333 LEU E CD2 1 
ATOM   2040 N N   . LYS E 2 244 ? 4.653   8.476   -3.580  1.00 12.98  ? 334 LYS E N   1 
ATOM   2041 C CA  . LYS E 2 244 ? 6.103   8.624   -3.439  1.00 15.51  ? 334 LYS E CA  1 
ATOM   2042 C C   . LYS E 2 244 ? 6.866   7.518   -4.217  1.00 22.08  ? 334 LYS E C   1 
ATOM   2043 O O   . LYS E 2 244 ? 7.995   7.754   -4.651  1.00 23.70  ? 334 LYS E O   1 
ATOM   2044 C CB  . LYS E 2 244 ? 6.498   8.601   -1.946  1.00 19.39  ? 334 LYS E CB  1 
ATOM   2045 C CG  . LYS E 2 244 ? 7.826   9.312   -1.646  1.00 36.68  ? 334 LYS E CG  1 
ATOM   2046 C CD  . LYS E 2 244 ? 8.225   9.239   -0.173  1.00 45.08  ? 334 LYS E CD  1 
ATOM   2047 C CE  . LYS E 2 244 ? 9.549   9.928   0.099   1.00 51.46  ? 334 LYS E CE  1 
ATOM   2048 N NZ  . LYS E 2 244 ? 9.397   11.401  0.261   1.00 53.58  ? 334 LYS E NZ  1 
ATOM   2049 N N   . LEU E 2 245 ? 6.248   6.327   -4.391  1.00 17.41  ? 335 LEU E N   1 
ATOM   2050 C CA  . LEU E 2 245 ? 6.831   5.189   -5.109  1.00 17.19  ? 335 LEU E CA  1 
ATOM   2051 C C   . LEU E 2 245 ? 6.576   5.286   -6.614  1.00 21.00  ? 335 LEU E C   1 
ATOM   2052 O O   . LEU E 2 245 ? 7.360   4.749   -7.382  1.00 19.49  ? 335 LEU E O   1 
ATOM   2053 C CB  . LEU E 2 245 ? 6.294   3.839   -4.565  1.00 16.98  ? 335 LEU E CB  1 
ATOM   2054 C CG  . LEU E 2 245 ? 6.450   3.572   -3.056  1.00 20.24  ? 335 LEU E CG  1 
ATOM   2055 C CD1 . LEU E 2 245 ? 5.537   2.481   -2.615  1.00 19.76  ? 335 LEU E CD1 1 
ATOM   2056 C CD2 . LEU E 2 245 ? 7.862   3.215   -2.701  1.00 22.88  ? 335 LEU E CD2 1 
ATOM   2057 N N   . GLU E 2 246 ? 5.470   5.933   -7.019  1.00 20.51  ? 336 GLU E N   1 
ATOM   2058 C CA  . GLU E 2 246 ? 5.082   6.167   -8.420  1.00 22.32  ? 336 GLU E CA  1 
ATOM   2059 C C   . GLU E 2 246 ? 4.444   7.567   -8.557  1.00 27.56  ? 336 GLU E C   1 
ATOM   2060 O O   . GLU E 2 246 ? 3.206   7.707   -8.506  1.00 25.63  ? 336 GLU E O   1 
ATOM   2061 C CB  . GLU E 2 246 ? 4.127   5.079   -8.922  1.00 23.92  ? 336 GLU E CB  1 
ATOM   2062 C CG  . GLU E 2 246 ? 4.848   3.929   -9.585  1.00 36.24  ? 336 GLU E CG  1 
ATOM   2063 C CD  . GLU E 2 246 ? 3.957   2.751   -9.913  1.00 46.21  ? 336 GLU E CD  1 
ATOM   2064 O OE1 . GLU E 2 246 ? 4.366   1.615   -9.590  1.00 28.21  ? 336 GLU E OE1 1 
ATOM   2065 O OE2 . GLU E 2 246 ? 2.844   2.957   -10.453 1.00 29.40  ? 336 GLU E OE2 1 
ATOM   2066 N N   . PRO E 2 247 ? 5.282   8.629   -8.685  1.00 25.53  ? 337 PRO E N   1 
ATOM   2067 C CA  . PRO E 2 247 ? 4.726   9.994   -8.723  1.00 25.41  ? 337 PRO E CA  1 
ATOM   2068 C C   . PRO E 2 247 ? 3.903   10.322  -9.969  1.00 29.29  ? 337 PRO E C   1 
ATOM   2069 O O   . PRO E 2 247 ? 3.051   11.197  -9.887  1.00 28.26  ? 337 PRO E O   1 
ATOM   2070 C CB  . PRO E 2 247 ? 5.966   10.893  -8.623  1.00 27.41  ? 337 PRO E CB  1 
ATOM   2071 C CG  . PRO E 2 247 ? 7.076   9.996   -8.144  1.00 31.83  ? 337 PRO E CG  1 
ATOM   2072 C CD  . PRO E 2 247 ? 6.760   8.651   -8.699  1.00 26.90  ? 337 PRO E CD  1 
ATOM   2073 N N   . SER E 2 248 ? 4.133   9.638   -11.099 1.00 26.89  ? 338 SER E N   1 
ATOM   2074 C CA  . SER E 2 248 ? 3.414   9.913   -12.354 1.00 26.98  ? 338 SER E CA  1 
ATOM   2075 C C   . SER E 2 248 ? 2.050   9.189   -12.456 1.00 31.16  ? 338 SER E C   1 
ATOM   2076 O O   . SER E 2 248 ? 1.274   9.503   -13.359 1.00 31.31  ? 338 SER E O   1 
ATOM   2077 C CB  . SER E 2 248 ? 4.285   9.540   -13.548 1.00 31.28  ? 338 SER E CB  1 
ATOM   2078 O OG  . SER E 2 248 ? 4.668   8.172   -13.527 1.00 45.25  ? 338 SER E OG  1 
ATOM   2079 N N   . ASN E 2 249 ? 1.763   8.238   -11.541 1.00 27.75  ? 339 ASN E N   1 
ATOM   2080 C CA  . ASN E 2 249 ? 0.540   7.424   -11.511 1.00 26.86  ? 339 ASN E CA  1 
ATOM   2081 C C   . ASN E 2 249 ? -0.733  8.276   -11.351 1.00 29.11  ? 339 ASN E C   1 
ATOM   2082 O O   . ASN E 2 249 ? -1.019  8.810   -10.269 1.00 27.71  ? 339 ASN E O   1 
ATOM   2083 C CB  . ASN E 2 249 ? 0.620   6.382   -10.395 1.00 27.09  ? 339 ASN E CB  1 
ATOM   2084 C CG  . ASN E 2 249 ? -0.475  5.344   -10.452 1.00 31.22  ? 339 ASN E CG  1 
ATOM   2085 O OD1 . ASN E 2 249 ? -1.655  5.618   -10.202 1.00 31.60  ? 339 ASN E OD1 1 
ATOM   2086 N ND2 . ASN E 2 249 ? -0.098  4.124   -10.740 1.00 12.22  ? 339 ASN E ND2 1 
ATOM   2087 N N   . LYS E 2 250 ? -1.516  8.324   -12.439 1.00 25.37  ? 340 LYS E N   1 
ATOM   2088 C CA  . LYS E 2 250 ? -2.750  9.089   -12.595 1.00 25.85  ? 340 LYS E CA  1 
ATOM   2089 C C   . LYS E 2 250 ? -3.848  8.645   -11.630 1.00 28.72  ? 340 LYS E C   1 
ATOM   2090 O O   . LYS E 2 250 ? -4.586  9.492   -11.130 1.00 29.05  ? 340 LYS E O   1 
ATOM   2091 C CB  . LYS E 2 250 ? -3.252  9.005   -14.048 1.00 30.20  ? 340 LYS E CB  1 
ATOM   2092 C CG  . LYS E 2 250 ? -2.353  9.799   -15.005 1.00 50.23  ? 340 LYS E CG  1 
ATOM   2093 C CD  . LYS E 2 250 ? -2.057  9.048   -16.290 1.00 65.83  ? 340 LYS E CD  1 
ATOM   2094 C CE  . LYS E 2 250 ? -1.029  9.750   -17.154 1.00 81.22  ? 340 LYS E CE  1 
ATOM   2095 N NZ  . LYS E 2 250 ? 0.361   9.578   -16.645 1.00 91.59  ? 340 LYS E NZ  1 
ATOM   2096 N N   . THR E 2 251 ? -3.949  7.335   -11.345 1.00 23.50  ? 341 THR E N   1 
ATOM   2097 C CA  . THR E 2 251 ? -4.974  6.792   -10.448 1.00 21.29  ? 341 THR E CA  1 
ATOM   2098 C C   . THR E 2 251 ? -4.760  7.273   -8.994  1.00 21.45  ? 341 THR E C   1 
ATOM   2099 O O   . THR E 2 251 ? -5.730  7.643   -8.348  1.00 20.60  ? 341 THR E O   1 
ATOM   2100 C CB  . THR E 2 251 ? -5.006  5.254   -10.560 1.00 24.10  ? 341 THR E CB  1 
ATOM   2101 O OG1 . THR E 2 251 ? -5.207  4.907   -11.930 1.00 20.06  ? 341 THR E OG1 1 
ATOM   2102 C CG2 . THR E 2 251 ? -6.112  4.623   -9.716  1.00 20.60  ? 341 THR E CG2 1 
ATOM   2103 N N   . ILE E 2 252 ? -3.514  7.295   -8.502  1.00 17.36  ? 342 ILE E N   1 
ATOM   2104 C CA  . ILE E 2 252 ? -3.193  7.751   -7.141  1.00 17.00  ? 342 ILE E CA  1 
ATOM   2105 C C   . ILE E 2 252 ? -3.458  9.274   -7.012  1.00 23.09  ? 342 ILE E C   1 
ATOM   2106 O O   . ILE E 2 252 ? -3.917  9.720   -5.955  1.00 22.46  ? 342 ILE E O   1 
ATOM   2107 C CB  . ILE E 2 252 ? -1.742  7.378   -6.697  1.00 18.67  ? 342 ILE E CB  1 
ATOM   2108 C CG1 . ILE E 2 252 ? -1.448  5.884   -6.914  1.00 17.49  ? 342 ILE E CG1 1 
ATOM   2109 C CG2 . ILE E 2 252 ? -1.500  7.752   -5.219  1.00 19.53  ? 342 ILE E CG2 1 
ATOM   2110 C CD1 . ILE E 2 252 ? 0.034   5.519   -6.843  1.00 9.96   ? 342 ILE E CD1 1 
ATOM   2111 N N   . HIS E 2 253 ? -3.189  10.046  -8.086  1.00 21.66  ? 343 HIS E N   1 
ATOM   2112 C CA  . HIS E 2 253 ? -3.422  11.498  -8.133  1.00 22.88  ? 343 HIS E CA  1 
ATOM   2113 C C   . HIS E 2 253 ? -4.907  11.802  -8.025  1.00 25.76  ? 343 HIS E C   1 
ATOM   2114 O O   . HIS E 2 253 ? -5.318  12.603  -7.183  1.00 25.32  ? 343 HIS E O   1 
ATOM   2115 C CB  . HIS E 2 253 ? -2.864  12.098  -9.431  1.00 25.00  ? 343 HIS E CB  1 
ATOM   2116 C CG  . HIS E 2 253 ? -1.403  12.415  -9.386  1.00 29.47  ? 343 HIS E CG  1 
ATOM   2117 N ND1 . HIS E 2 253 ? -0.905  13.434  -8.583  1.00 31.96  ? 343 HIS E ND1 1 
ATOM   2118 C CD2 . HIS E 2 253 ? -0.384  11.887  -10.099 1.00 31.95  ? 343 HIS E CD2 1 
ATOM   2119 C CE1 . HIS E 2 253 ? 0.398   13.468  -8.813  1.00 31.48  ? 343 HIS E CE1 1 
ATOM   2120 N NE2 . HIS E 2 253 ? 0.757   12.557  -9.715  1.00 31.66  ? 343 HIS E NE2 1 
ATOM   2121 N N   . ALA E 2 254 ? -5.706  11.129  -8.876  1.00 22.06  ? 344 ALA E N   1 
ATOM   2122 C CA  . ALA E 2 254 ? -7.160  11.217  -8.966  1.00 21.68  ? 344 ALA E CA  1 
ATOM   2123 C C   . ALA E 2 254 ? -7.820  10.838  -7.640  1.00 23.45  ? 344 ALA E C   1 
ATOM   2124 O O   . ALA E 2 254 ? -8.826  11.427  -7.269  1.00 20.86  ? 344 ALA E O   1 
ATOM   2125 C CB  . ALA E 2 254 ? -7.665  10.308  -10.077 1.00 22.44  ? 344 ALA E CB  1 
ATOM   2126 N N   . GLU E 2 255 ? -7.229  9.884   -6.920  1.00 20.55  ? 345 GLU E N   1 
ATOM   2127 C CA  . GLU E 2 255 ? -7.726  9.437   -5.631  1.00 21.03  ? 345 GLU E CA  1 
ATOM   2128 C C   . GLU E 2 255 ? -7.422  10.482  -4.573  1.00 25.40  ? 345 GLU E C   1 
ATOM   2129 O O   . GLU E 2 255 ? -8.286  10.735  -3.735  1.00 26.58  ? 345 GLU E O   1 
ATOM   2130 C CB  . GLU E 2 255 ? -7.117  8.067   -5.261  1.00 22.39  ? 345 GLU E CB  1 
ATOM   2131 C CG  . GLU E 2 255 ? -7.811  7.331   -4.124  1.00 22.58  ? 345 GLU E CG  1 
ATOM   2132 C CD  . GLU E 2 255 ? -9.247  6.924   -4.389  1.00 30.03  ? 345 GLU E CD  1 
ATOM   2133 O OE1 . GLU E 2 255 ? -9.597  6.651   -5.559  1.00 13.14  ? 345 GLU E OE1 1 
ATOM   2134 O OE2 . GLU E 2 255 ? -10.027 6.879   -3.415  1.00 14.18  ? 345 GLU E OE2 1 
ATOM   2135 N N   . LEU E 2 256 ? -6.218  11.098  -4.608  1.00 20.51  ? 346 LEU E N   1 
ATOM   2136 C CA  . LEU E 2 256 ? -5.827  12.132  -3.654  1.00 19.75  ? 346 LEU E CA  1 
ATOM   2137 C C   . LEU E 2 256 ? -6.636  13.401  -3.849  1.00 22.58  ? 346 LEU E C   1 
ATOM   2138 O O   . LEU E 2 256 ? -7.148  13.960  -2.870  1.00 22.22  ? 346 LEU E O   1 
ATOM   2139 C CB  . LEU E 2 256 ? -4.340  12.453  -3.764  1.00 20.41  ? 346 LEU E CB  1 
ATOM   2140 C CG  . LEU E 2 256 ? -3.429  11.650  -2.855  1.00 25.32  ? 346 LEU E CG  1 
ATOM   2141 C CD1 . LEU E 2 256 ? -2.090  11.556  -3.455  1.00 27.18  ? 346 LEU E CD1 1 
ATOM   2142 C CD2 . LEU E 2 256 ? -3.283  12.310  -1.482  1.00 26.00  ? 346 LEU E CD2 1 
ATOM   2143 N N   . SER E 2 257 ? -6.773  13.837  -5.111  1.00 17.65  ? 347 SER E N   1 
ATOM   2144 C CA  . SER E 2 257 ? -7.512  15.033  -5.495  1.00 18.61  ? 347 SER E CA  1 
ATOM   2145 C C   . SER E 2 257 ? -8.981  14.945  -5.049  1.00 25.03  ? 347 SER E C   1 
ATOM   2146 O O   . SER E 2 257 ? -9.505  15.920  -4.510  1.00 23.79  ? 347 SER E O   1 
ATOM   2147 C CB  . SER E 2 257 ? -7.410  15.236  -7.007  1.00 23.54  ? 347 SER E CB  1 
ATOM   2148 O OG  . SER E 2 257 ? -8.499  15.964  -7.545  1.00 35.38  ? 347 SER E OG  1 
ATOM   2149 N N   . LYS E 2 258 ? -9.627  13.765  -5.265  1.00 23.31  ? 348 LYS E N   1 
ATOM   2150 C CA  . LYS E 2 258 ? -11.016 13.462  -4.894  1.00 23.58  ? 348 LYS E CA  1 
ATOM   2151 C C   . LYS E 2 258 ? -11.184 13.570  -3.388  1.00 26.88  ? 348 LYS E C   1 
ATOM   2152 O O   . LYS E 2 258 ? -12.143 14.173  -2.919  1.00 26.21  ? 348 LYS E O   1 
ATOM   2153 C CB  . LYS E 2 258 ? -11.372 12.035  -5.375  1.00 27.28  ? 348 LYS E CB  1 
ATOM   2154 C CG  . LYS E 2 258 ? -12.861 11.709  -5.433  1.00 41.40  ? 348 LYS E CG  1 
ATOM   2155 C CD  . LYS E 2 258 ? -13.122 10.243  -5.815  1.00 50.95  ? 348 LYS E CD  1 
ATOM   2156 C CE  . LYS E 2 258 ? -13.091 9.988   -7.310  1.00 61.29  ? 348 LYS E CE  1 
ATOM   2157 N NZ  . LYS E 2 258 ? -13.532 8.608   -7.649  1.00 66.05  ? 348 LYS E NZ  1 
ATOM   2158 N N   . LEU E 2 259 ? -10.218 13.008  -2.636  1.00 23.75  ? 349 LEU E N   1 
ATOM   2159 C CA  . LEU E 2 259 ? -10.169 12.982  -1.177  1.00 23.91  ? 349 LEU E CA  1 
ATOM   2160 C C   . LEU E 2 259 ? -10.004 14.392  -0.594  1.00 29.50  ? 349 LEU E C   1 
ATOM   2161 O O   . LEU E 2 259 ? -10.743 14.738  0.335   1.00 29.54  ? 349 LEU E O   1 
ATOM   2162 C CB  . LEU E 2 259 ? -9.025  12.044  -0.731  1.00 24.05  ? 349 LEU E CB  1 
ATOM   2163 C CG  . LEU E 2 259 ? -8.312  12.278  0.591   1.00 29.81  ? 349 LEU E CG  1 
ATOM   2164 C CD1 . LEU E 2 259 ? -8.995  11.559  1.717   1.00 30.32  ? 349 LEU E CD1 1 
ATOM   2165 C CD2 . LEU E 2 259 ? -6.879  11.812  0.510   1.00 30.97  ? 349 LEU E CD2 1 
ATOM   2166 N N   . VAL E 2 260 ? -9.054  15.199  -1.126  1.00 25.77  ? 350 VAL E N   1 
ATOM   2167 C CA  . VAL E 2 260 ? -8.794  16.546  -0.599  1.00 26.00  ? 350 VAL E CA  1 
ATOM   2168 C C   . VAL E 2 260 ? -9.996  17.487  -0.871  1.00 31.74  ? 350 VAL E C   1 
ATOM   2169 O O   . VAL E 2 260 ? -10.367 18.250  0.031   1.00 31.46  ? 350 VAL E O   1 
ATOM   2170 C CB  . VAL E 2 260 ? -7.439  17.176  -1.045  1.00 29.26  ? 350 VAL E CB  1 
ATOM   2171 C CG1 . VAL E 2 260 ? -6.256  16.303  -0.624  1.00 29.10  ? 350 VAL E CG1 1 
ATOM   2172 C CG2 . VAL E 2 260 ? -7.390  17.456  -2.546  1.00 29.04  ? 350 VAL E CG2 1 
ATOM   2173 N N   . LYS E 2 261 ? -10.627 17.389  -2.069  1.00 29.99  ? 351 LYS E N   1 
ATOM   2174 C CA  . LYS E 2 261 ? -11.799 18.187  -2.458  1.00 31.02  ? 351 LYS E CA  1 
ATOM   2175 C C   . LYS E 2 261 ? -12.992 17.881  -1.546  1.00 38.27  ? 351 LYS E C   1 
ATOM   2176 O O   . LYS E 2 261 ? -13.639 18.814  -1.078  1.00 40.04  ? 351 LYS E O   1 
ATOM   2177 C CB  . LYS E 2 261 ? -12.160 17.922  -3.937  1.00 34.23  ? 351 LYS E CB  1 
ATOM   2178 C CG  . LYS E 2 261 ? -12.880 19.060  -4.666  1.00 43.36  ? 351 LYS E CG  1 
ATOM   2179 C CD  . LYS E 2 261 ? -11.944 20.224  -5.081  1.00 46.74  ? 351 LYS E CD  1 
ATOM   2180 C CE  . LYS E 2 261 ? -12.626 21.274  -5.941  1.00 44.15  ? 351 LYS E CE  1 
ATOM   2181 N NZ  . LYS E 2 261 ? -13.711 21.979  -5.210  1.00 40.46  ? 351 LYS E NZ  1 
ATOM   2182 N N   . LYS E 2 262 ? -13.253 16.582  -1.266  1.00 35.98  ? 352 LYS E N   1 
ATOM   2183 C CA  . LYS E 2 262 ? -14.343 16.113  -0.406  1.00 36.45  ? 352 LYS E CA  1 
ATOM   2184 C C   . LYS E 2 262 ? -14.131 16.501  1.051   1.00 43.16  ? 352 LYS E C   1 
ATOM   2185 O O   . LYS E 2 262 ? -15.109 16.810  1.734   1.00 44.11  ? 352 LYS E O   1 
ATOM   2186 C CB  . LYS E 2 262 ? -14.526 14.587  -0.512  1.00 38.15  ? 352 LYS E CB  1 
ATOM   2187 C CG  . LYS E 2 262 ? -15.203 14.145  -1.807  1.00 46.84  ? 352 LYS E CG  1 
ATOM   2188 C CD  . LYS E 2 262 ? -15.230 12.635  -1.944  1.00 50.16  ? 352 LYS E CD  1 
ATOM   2189 C CE  . LYS E 2 262 ? -15.930 12.204  -3.212  1.00 53.71  ? 352 LYS E CE  1 
ATOM   2190 N NZ  . LYS E 2 262 ? -16.067 10.726  -3.297  1.00 54.83  ? 352 LYS E NZ  1 
ATOM   2191 N N   . HIS E 2 263 ? -12.887 16.436  1.545   1.00 40.90  ? 353 HIS E N   1 
ATOM   2192 C CA  . HIS E 2 263 ? -12.560 16.800  2.925   1.00 41.80  ? 353 HIS E CA  1 
ATOM   2193 C C   . HIS E 2 263 ? -12.817 18.294  3.153   1.00 48.00  ? 353 HIS E C   1 
ATOM   2194 O O   . HIS E 2 263 ? -13.533 18.648  4.098   1.00 48.19  ? 353 HIS E O   1 
ATOM   2195 C CB  . HIS E 2 263 ? -11.101 16.438  3.262   1.00 42.81  ? 353 HIS E CB  1 
ATOM   2196 C CG  . HIS E 2 263 ? -10.630 16.978  4.578   1.00 46.37  ? 353 HIS E CG  1 
ATOM   2197 N ND1 . HIS E 2 263 ? -11.018 16.402  5.776   1.00 48.26  ? 353 HIS E ND1 1 
ATOM   2198 C CD2 . HIS E 2 263 ? -9.842  18.044  4.840   1.00 48.24  ? 353 HIS E CD2 1 
ATOM   2199 C CE1 . HIS E 2 263 ? -10.446 17.124  6.726   1.00 47.86  ? 353 HIS E CE1 1 
ATOM   2200 N NE2 . HIS E 2 263 ? -9.729  18.124  6.213   1.00 48.22  ? 353 HIS E NE2 1 
ATOM   2201 N N   . ALA E 2 264 ? -12.259 19.146  2.257   1.00 45.85  ? 354 ALA E N   1 
ATOM   2202 C CA  . ALA E 2 264 ? -12.317 20.616  2.226   1.00 46.34  ? 354 ALA E CA  1 
ATOM   2203 C C   . ALA E 2 264 ? -13.695 21.181  2.593   1.00 52.87  ? 354 ALA E C   1 
ATOM   2204 O O   . ALA E 2 264 ? -13.767 22.101  3.413   1.00 53.23  ? 354 ALA E O   1 
ATOM   2205 C CB  . ALA E 2 264 ? -11.913 21.116  0.848   1.00 46.85  ? 354 ALA E CB  1 
ATOM   2206 N N   . ALA E 2 265 ? -14.778 20.629  1.994   1.00 50.24  ? 355 ALA E N   1 
ATOM   2207 C CA  . ALA E 2 265 ? -16.151 21.039  2.268   1.00 50.10  ? 355 ALA E CA  1 
ATOM   2208 C C   . ALA E 2 265 ? -16.589 20.461  3.625   1.00 55.16  ? 355 ALA E C   1 
ATOM   2209 O O   . ALA E 2 265 ? -16.607 19.237  3.810   1.00 54.99  ? 355 ALA E O   1 
ATOM   2210 C CB  . ALA E 2 265 ? -17.068 20.579  1.146   1.00 50.76  ? 355 ALA E CB  1 
ATOM   2211 N N   . GLN E 2 266 ? -16.848 21.356  4.599   1.00 52.31  ? 356 GLN E N   1 
ATOM   2212 C CA  . GLN E 2 266 ? -17.244 21.018  5.969   1.00 76.93  ? 356 GLN E CA  1 
ATOM   2213 C C   . GLN E 2 266 ? -17.963 22.195  6.626   1.00 87.45  ? 356 GLN E C   1 
ATOM   2214 O O   . GLN E 2 266 ? -19.183 22.173  6.773   1.00 41.68  ? 356 GLN E O   1 
ATOM   2215 C CB  . GLN E 2 266 ? -16.016 20.612  6.804   1.00 78.22  ? 356 GLN E CB  1 
ATOM   2216 N N   . GLU F 2 1   ? -5.112  -12.299 70.535  1.00 62.39  ? 91  GLU F N   1 
ATOM   2217 C CA  . GLU F 2 1   ? -3.776  -12.614 71.038  1.00 62.36  ? 91  GLU F CA  1 
ATOM   2218 C C   . GLU F 2 1   ? -2.875  -11.366 71.031  1.00 66.07  ? 91  GLU F C   1 
ATOM   2219 O O   . GLU F 2 1   ? -2.324  -11.002 72.074  1.00 66.38  ? 91  GLU F O   1 
ATOM   2220 C CB  . GLU F 2 1   ? -3.141  -13.745 70.212  1.00 63.84  ? 91  GLU F CB  1 
ATOM   2221 N N   . GLU F 2 2   ? -2.729  -10.722 69.855  1.00 61.11  ? 92  GLU F N   1 
ATOM   2222 C CA  . GLU F 2 2   ? -1.935  -9.506  69.666  1.00 59.95  ? 92  GLU F CA  1 
ATOM   2223 C C   . GLU F 2 2   ? -2.805  -8.404  69.057  1.00 60.71  ? 92  GLU F C   1 
ATOM   2224 O O   . GLU F 2 2   ? -3.879  -8.696  68.522  1.00 60.31  ? 92  GLU F O   1 
ATOM   2225 C CB  . GLU F 2 2   ? -0.708  -9.786  68.784  1.00 61.42  ? 92  GLU F CB  1 
ATOM   2226 N N   . TRP F 2 3   ? -2.354  -7.140  69.152  1.00 54.76  ? 93  TRP F N   1 
ATOM   2227 C CA  . TRP F 2 3   ? -3.098  -6.003  68.616  1.00 53.14  ? 93  TRP F CA  1 
ATOM   2228 C C   . TRP F 2 3   ? -2.865  -5.876  67.118  1.00 56.13  ? 93  TRP F C   1 
ATOM   2229 O O   . TRP F 2 3   ? -1.711  -5.823  66.674  1.00 56.52  ? 93  TRP F O   1 
ATOM   2230 C CB  . TRP F 2 3   ? -2.697  -4.700  69.316  1.00 51.44  ? 93  TRP F CB  1 
ATOM   2231 C CG  . TRP F 2 3   ? -3.328  -4.475  70.653  1.00 52.51  ? 93  TRP F CG  1 
ATOM   2232 C CD1 . TRP F 2 3   ? -2.728  -4.602  71.869  1.00 55.38  ? 93  TRP F CD1 1 
ATOM   2233 C CD2 . TRP F 2 3   ? -4.652  -3.990  70.906  1.00 52.28  ? 93  TRP F CD2 1 
ATOM   2234 N NE1 . TRP F 2 3   ? -3.604  -4.254  72.868  1.00 54.95  ? 93  TRP F NE1 1 
ATOM   2235 C CE2 . TRP F 2 3   ? -4.795  -3.875  72.307  1.00 56.24  ? 93  TRP F CE2 1 
ATOM   2236 C CE3 . TRP F 2 3   ? -5.746  -3.660  70.087  1.00 53.51  ? 93  TRP F CE3 1 
ATOM   2237 C CZ2 . TRP F 2 3   ? -5.989  -3.453  72.908  1.00 55.26  ? 93  TRP F CZ2 1 
ATOM   2238 C CZ3 . TRP F 2 3   ? -6.929  -3.238  70.683  1.00 54.73  ? 93  TRP F CZ3 1 
ATOM   2239 C CH2 . TRP F 2 3   ? -7.043  -3.139  72.076  1.00 55.25  ? 93  TRP F CH2 1 
ATOM   2240 N N   . LEU F 2 4   ? -3.950  -5.853  66.334  1.00 50.30  ? 94  LEU F N   1 
ATOM   2241 C CA  . LEU F 2 4   ? -3.842  -5.653  64.892  1.00 48.99  ? 94  LEU F CA  1 
ATOM   2242 C C   . LEU F 2 4   ? -4.041  -4.177  64.608  1.00 51.30  ? 94  LEU F C   1 
ATOM   2243 O O   . LEU F 2 4   ? -5.057  -3.608  65.001  1.00 51.31  ? 94  LEU F O   1 
ATOM   2244 C CB  . LEU F 2 4   ? -4.844  -6.522  64.100  1.00 48.81  ? 94  LEU F CB  1 
ATOM   2245 C CG  . LEU F 2 4   ? -5.095  -6.158  62.625  1.00 52.91  ? 94  LEU F CG  1 
ATOM   2246 C CD1 . LEU F 2 4   ? -4.021  -6.723  61.691  1.00 54.38  ? 94  LEU F CD1 1 
ATOM   2247 C CD2 . LEU F 2 4   ? -6.425  -6.664  62.196  1.00 53.23  ? 94  LEU F CD2 1 
ATOM   2248 N N   . ASP F 2 5   ? -3.055  -3.558  63.956  1.00 46.08  ? 95  ASP F N   1 
ATOM   2249 C CA  . ASP F 2 5   ? -3.100  -2.164  63.550  1.00 44.91  ? 95  ASP F CA  1 
ATOM   2250 C C   . ASP F 2 5   ? -3.713  -2.157  62.152  1.00 47.74  ? 95  ASP F C   1 
ATOM   2251 O O   . ASP F 2 5   ? -2.998  -2.291  61.154  1.00 46.70  ? 95  ASP F O   1 
ATOM   2252 C CB  . ASP F 2 5   ? -1.691  -1.556  63.599  1.00 46.47  ? 95  ASP F CB  1 
ATOM   2253 C CG  . ASP F 2 5   ? -1.613  -0.061  63.375  1.00 57.01  ? 95  ASP F CG  1 
ATOM   2254 O OD1 . ASP F 2 5   ? -2.682  0.581   63.246  1.00 58.13  ? 95  ASP F OD1 1 
ATOM   2255 O OD2 . ASP F 2 5   ? -0.483  0.469   63.331  1.00 62.95  ? 95  ASP F OD2 1 
ATOM   2256 N N   . ILE F 2 6   ? -5.059  -2.066  62.105  1.00 43.58  ? 96  ILE F N   1 
ATOM   2257 C CA  . ILE F 2 6   ? -5.895  -2.164  60.910  1.00 43.44  ? 96  ILE F CA  1 
ATOM   2258 C C   . ILE F 2 6   ? -5.475  -1.194  59.792  1.00 49.34  ? 96  ILE F C   1 
ATOM   2259 O O   . ILE F 2 6   ? -5.241  -1.640  58.670  1.00 48.16  ? 96  ILE F O   1 
ATOM   2260 C CB  . ILE F 2 6   ? -7.397  -1.987  61.276  1.00 46.01  ? 96  ILE F CB  1 
ATOM   2261 C CG1 . ILE F 2 6   ? -7.835  -3.034  62.336  1.00 45.70  ? 96  ILE F CG1 1 
ATOM   2262 C CG2 . ILE F 2 6   ? -8.286  -2.027  60.019  1.00 46.54  ? 96  ILE F CG2 1 
ATOM   2263 C CD1 . ILE F 2 6   ? -9.151  -2.785  63.009  1.00 50.00  ? 96  ILE F CD1 1 
ATOM   2264 N N   . LEU F 2 7   ? -5.401  0.105   60.086  1.00 47.59  ? 97  LEU F N   1 
ATOM   2265 C CA  . LEU F 2 7   ? -5.097  1.102   59.069  1.00 47.76  ? 97  LEU F CA  1 
ATOM   2266 C C   . LEU F 2 7   ? -3.599  1.433   58.983  1.00 53.39  ? 97  LEU F C   1 
ATOM   2267 O O   . LEU F 2 7   ? -3.201  2.207   58.108  1.00 53.97  ? 97  LEU F O   1 
ATOM   2268 C CB  . LEU F 2 7   ? -5.935  2.363   59.315  1.00 47.78  ? 97  LEU F CB  1 
ATOM   2269 C CG  . LEU F 2 7   ? -7.458  2.126   59.407  1.00 52.40  ? 97  LEU F CG  1 
ATOM   2270 C CD1 . LEU F 2 7   ? -8.141  3.269   60.057  1.00 52.25  ? 97  LEU F CD1 1 
ATOM   2271 C CD2 . LEU F 2 7   ? -8.086  1.853   58.046  1.00 55.45  ? 97  LEU F CD2 1 
ATOM   2272 N N   . GLY F 2 8   ? -2.782  0.806   59.833  1.00 49.76  ? 98  GLY F N   1 
ATOM   2273 C CA  . GLY F 2 8   ? -1.333  0.997   59.831  1.00 49.75  ? 98  GLY F CA  1 
ATOM   2274 C C   . GLY F 2 8   ? -0.838  2.207   60.600  1.00 54.45  ? 98  GLY F C   1 
ATOM   2275 O O   . GLY F 2 8   ? 0.368   2.364   60.828  1.00 54.81  ? 98  GLY F O   1 
ATOM   2276 N N   . ASN F 2 9   ? -1.778  3.078   60.969  1.00 50.47  ? 99  ASN F N   1 
ATOM   2277 C CA  . ASN F 2 9   ? -1.622  4.219   61.862  1.00 50.31  ? 99  ASN F CA  1 
ATOM   2278 C C   . ASN F 2 9   ? -2.281  3.733   63.125  1.00 54.11  ? 99  ASN F C   1 
ATOM   2279 O O   . ASN F 2 9   ? -3.326  3.092   63.010  1.00 54.64  ? 99  ASN F O   1 
ATOM   2280 C CB  . ASN F 2 9   ? -2.274  5.493   61.281  1.00 51.61  ? 99  ASN F CB  1 
ATOM   2281 C CG  . ASN F 2 9   ? -3.659  5.304   60.690  1.00 76.96  ? 99  ASN F CG  1 
ATOM   2282 O OD1 . ASN F 2 9   ? -4.659  5.172   61.399  1.00 70.90  ? 99  ASN F OD1 1 
ATOM   2283 N ND2 . ASN F 2 9   ? -3.754  5.330   59.370  1.00 70.50  ? 99  ASN F ND2 1 
ATOM   2284 N N   . GLY F 2 10  ? -1.674  3.940   64.292  1.00 49.10  ? 100 GLY F N   1 
ATOM   2285 C CA  . GLY F 2 10  ? -2.216  3.427   65.553  1.00 48.06  ? 100 GLY F CA  1 
ATOM   2286 C C   . GLY F 2 10  ? -3.564  3.965   65.995  1.00 50.19  ? 100 GLY F C   1 
ATOM   2287 O O   . GLY F 2 10  ? -3.862  3.976   67.193  1.00 51.35  ? 100 GLY F O   1 
ATOM   2288 N N   . LEU F 2 11  ? -4.405  4.378   65.037  1.00 44.28  ? 101 LEU F N   1 
ATOM   2289 C CA  . LEU F 2 11  ? -5.690  5.004   65.308  1.00 42.74  ? 101 LEU F CA  1 
ATOM   2290 C C   . LEU F 2 11  ? -6.873  4.042   65.340  1.00 44.86  ? 101 LEU F C   1 
ATOM   2291 O O   . LEU F 2 11  ? -7.915  4.424   65.858  1.00 44.98  ? 101 LEU F O   1 
ATOM   2292 C CB  . LEU F 2 11  ? -5.980  6.127   64.305  1.00 42.38  ? 101 LEU F CB  1 
ATOM   2293 C CG  . LEU F 2 11  ? -5.021  7.322   64.267  1.00 46.21  ? 101 LEU F CG  1 
ATOM   2294 C CD1 . LEU F 2 11  ? -5.577  8.388   63.384  1.00 46.18  ? 101 LEU F CD1 1 
ATOM   2295 C CD2 . LEU F 2 11  ? -4.763  7.902   65.658  1.00 47.96  ? 101 LEU F CD2 1 
ATOM   2296 N N   . LEU F 2 12  ? -6.737  2.826   64.796  1.00 39.67  ? 102 LEU F N   1 
ATOM   2297 C CA  . LEU F 2 12  ? -7.806  1.829   64.807  1.00 38.29  ? 102 LEU F CA  1 
ATOM   2298 C C   . LEU F 2 12  ? -7.167  0.443   65.002  1.00 40.97  ? 102 LEU F C   1 
ATOM   2299 O O   . LEU F 2 12  ? -6.682  -0.173  64.051  1.00 39.22  ? 102 LEU F O   1 
ATOM   2300 C CB  . LEU F 2 12  ? -8.670  1.922   63.530  1.00 37.60  ? 102 LEU F CB  1 
ATOM   2301 C CG  . LEU F 2 12  ? -9.873  0.979   63.407  1.00 40.43  ? 102 LEU F CG  1 
ATOM   2302 C CD1 . LEU F 2 12  ? -11.013 1.405   64.291  1.00 39.69  ? 102 LEU F CD1 1 
ATOM   2303 C CD2 . LEU F 2 12  ? -10.355 0.944   61.997  1.00 43.03  ? 102 LEU F CD2 1 
ATOM   2304 N N   . ARG F 2 13  ? -7.130  -0.005  66.268  1.00 38.27  ? 103 ARG F N   1 
ATOM   2305 C CA  . ARG F 2 13  ? -6.489  -1.254  66.682  1.00 38.42  ? 103 ARG F CA  1 
ATOM   2306 C C   . ARG F 2 13  ? -7.506  -2.274  67.206  1.00 42.84  ? 103 ARG F C   1 
ATOM   2307 O O   . ARG F 2 13  ? -8.415  -1.914  67.954  1.00 42.99  ? 103 ARG F O   1 
ATOM   2308 C CB  . ARG F 2 13  ? -5.433  -0.960  67.753  1.00 38.69  ? 103 ARG F CB  1 
ATOM   2309 C CG  . ARG F 2 13  ? -4.245  -0.127  67.265  1.00 47.62  ? 103 ARG F CG  1 
ATOM   2310 C CD  . ARG F 2 13  ? -3.503  0.550   68.408  1.00 61.73  ? 103 ARG F CD  1 
ATOM   2311 N NE  . ARG F 2 13  ? -3.232  -0.356  69.525  1.00 76.63  ? 103 ARG F NE  1 
ATOM   2312 C CZ  . ARG F 2 13  ? -2.102  -0.382  70.221  1.00 94.57  ? 103 ARG F CZ  1 
ATOM   2313 N NH1 . ARG F 2 13  ? -1.097  0.428   69.902  1.00 85.22  ? 103 ARG F NH1 1 
ATOM   2314 N NH2 . ARG F 2 13  ? -1.957  -1.235  71.226  1.00 81.42  ? 103 ARG F NH2 1 
ATOM   2315 N N   . LYS F 2 14  ? -7.343  -3.547  66.810  1.00 39.12  ? 104 LYS F N   1 
ATOM   2316 C CA  . LYS F 2 14  ? -8.242  -4.640  67.185  1.00 38.16  ? 104 LYS F CA  1 
ATOM   2317 C C   . LYS F 2 14  ? -7.506  -5.786  67.890  1.00 39.80  ? 104 LYS F C   1 
ATOM   2318 O O   . LYS F 2 14  ? -6.483  -6.265  67.403  1.00 37.97  ? 104 LYS F O   1 
ATOM   2319 C CB  . LYS F 2 14  ? -8.964  -5.172  65.931  1.00 40.10  ? 104 LYS F CB  1 
ATOM   2320 C CG  . LYS F 2 14  ? -9.930  -6.323  66.175  1.00 47.76  ? 104 LYS F CG  1 
ATOM   2321 C CD  . LYS F 2 14  ? -10.332 -6.962  64.861  1.00 54.75  ? 104 LYS F CD  1 
ATOM   2322 C CE  . LYS F 2 14  ? -10.886 -8.344  65.075  1.00 63.74  ? 104 LYS F CE  1 
ATOM   2323 N NZ  . LYS F 2 14  ? -9.830  -9.367  65.328  1.00 69.84  ? 104 LYS F NZ  1 
ATOM   2324 N N   . LYS F 2 15  ? -8.065  -6.243  69.016  1.00 35.69  ? 105 LYS F N   1 
ATOM   2325 C CA  . LYS F 2 15  ? -7.535  -7.377  69.761  1.00 34.98  ? 105 LYS F CA  1 
ATOM   2326 C C   . LYS F 2 15  ? -8.670  -8.369  69.989  1.00 37.89  ? 105 LYS F C   1 
ATOM   2327 O O   . LYS F 2 15  ? -9.705  -7.999  70.541  1.00 36.73  ? 105 LYS F O   1 
ATOM   2328 C CB  . LYS F 2 15  ? -6.890  -6.933  71.086  1.00 36.94  ? 105 LYS F CB  1 
ATOM   2329 C CG  . LYS F 2 15  ? -5.985  -7.997  71.706  1.00 47.26  ? 105 LYS F CG  1 
ATOM   2330 C CD  . LYS F 2 15  ? -5.246  -7.470  72.923  1.00 58.04  ? 105 LYS F CD  1 
ATOM   2331 C CE  . LYS F 2 15  ? -4.410  -8.543  73.573  1.00 71.25  ? 105 LYS F CE  1 
ATOM   2332 N NZ  . LYS F 2 15  ? -3.337  -8.008  74.446  1.00 80.68  ? 105 LYS F NZ  1 
ATOM   2333 N N   . THR F 2 16  ? -8.492  -9.619  69.534  1.00 33.50  ? 106 THR F N   1 
ATOM   2334 C CA  . THR F 2 16  ? -9.488  -10.671 69.703  1.00 32.68  ? 106 THR F CA  1 
ATOM   2335 C C   . THR F 2 16  ? -9.455  -11.129 71.159  1.00 36.64  ? 106 THR F C   1 
ATOM   2336 O O   . THR F 2 16  ? -8.391  -11.494 71.664  1.00 36.29  ? 106 THR F O   1 
ATOM   2337 C CB  . THR F 2 16  ? -9.221  -11.810 68.709  1.00 39.68  ? 106 THR F CB  1 
ATOM   2338 O OG1 . THR F 2 16  ? -9.203  -11.298 67.370  1.00 37.95  ? 106 THR F OG1 1 
ATOM   2339 C CG2 . THR F 2 16  ? -10.240 -12.928 68.821  1.00 35.59  ? 106 THR F CG2 1 
ATOM   2340 N N   . LEU F 2 17  ? -10.609 -11.063 71.843  1.00 33.68  ? 107 LEU F N   1 
ATOM   2341 C CA  . LEU F 2 17  ? -10.753 -11.482 73.246  1.00 32.92  ? 107 LEU F CA  1 
ATOM   2342 C C   . LEU F 2 17  ? -11.179 -12.930 73.284  1.00 36.04  ? 107 LEU F C   1 
ATOM   2343 O O   . LEU F 2 17  ? -10.529 -13.742 73.932  1.00 35.36  ? 107 LEU F O   1 
ATOM   2344 C CB  . LEU F 2 17  ? -11.763 -10.609 74.020  1.00 32.76  ? 107 LEU F CB  1 
ATOM   2345 C CG  . LEU F 2 17  ? -11.509 -9.112  74.164  1.00 37.31  ? 107 LEU F CG  1 
ATOM   2346 C CD1 . LEU F 2 17  ? -12.652 -8.443  74.907  1.00 37.36  ? 107 LEU F CD1 1 
ATOM   2347 C CD2 . LEU F 2 17  ? -10.185 -8.805  74.818  1.00 40.88  ? 107 LEU F CD2 1 
ATOM   2348 N N   . VAL F 2 18  ? -12.275 -13.247 72.563  1.00 32.96  ? 108 VAL F N   1 
ATOM   2349 C CA  . VAL F 2 18  ? -12.837 -14.584 72.407  1.00 32.43  ? 108 VAL F CA  1 
ATOM   2350 C C   . VAL F 2 18  ? -12.911 -14.867 70.912  1.00 37.35  ? 108 VAL F C   1 
ATOM   2351 O O   . VAL F 2 18  ? -13.574 -14.109 70.197  1.00 36.92  ? 108 VAL F O   1 
ATOM   2352 C CB  . VAL F 2 18  ? -14.221 -14.745 73.093  1.00 35.94  ? 108 VAL F CB  1 
ATOM   2353 C CG1 . VAL F 2 18  ? -14.809 -16.127 72.828  1.00 35.61  ? 108 VAL F CG1 1 
ATOM   2354 C CG2 . VAL F 2 18  ? -14.137 -14.478 74.590  1.00 35.71  ? 108 VAL F CG2 1 
ATOM   2355 N N   . PRO F 2 19  ? -12.249 -15.929 70.402  1.00 35.38  ? 109 PRO F N   1 
ATOM   2356 C CA  . PRO F 2 19  ? -12.354 -16.209 68.961  1.00 35.89  ? 109 PRO F CA  1 
ATOM   2357 C C   . PRO F 2 19  ? -13.716 -16.807 68.626  1.00 42.13  ? 109 PRO F C   1 
ATOM   2358 O O   . PRO F 2 19  ? -14.448 -17.218 69.535  1.00 42.91  ? 109 PRO F O   1 
ATOM   2359 C CB  . PRO F 2 19  ? -11.202 -17.190 68.696  1.00 37.84  ? 109 PRO F CB  1 
ATOM   2360 C CG  . PRO F 2 19  ? -10.929 -17.846 70.013  1.00 42.01  ? 109 PRO F CG  1 
ATOM   2361 C CD  . PRO F 2 19  ? -11.425 -16.940 71.106  1.00 37.22  ? 109 PRO F CD  1 
ATOM   2362 N N   . GLY F 2 20  ? -14.056 -16.817 67.337  1.00 38.68  ? 110 GLY F N   1 
ATOM   2363 C CA  . GLY F 2 20  ? -15.300 -17.398 66.856  1.00 38.98  ? 110 GLY F CA  1 
ATOM   2364 C C   . GLY F 2 20  ? -15.205 -18.913 66.797  1.00 45.13  ? 110 GLY F C   1 
ATOM   2365 O O   . GLY F 2 20  ? -14.095 -19.449 66.863  1.00 45.45  ? 110 GLY F O   1 
ATOM   2366 N N   . PRO F 2 21  ? -16.335 -19.644 66.621  1.00 42.98  ? 111 PRO F N   1 
ATOM   2367 C CA  . PRO F 2 21  ? -16.269 -21.122 66.538  1.00 43.72  ? 111 PRO F CA  1 
ATOM   2368 C C   . PRO F 2 21  ? -15.350 -21.651 65.416  1.00 49.88  ? 111 PRO F C   1 
ATOM   2369 O O   . PRO F 2 21  ? -15.146 -20.934 64.434  1.00 50.03  ? 111 PRO F O   1 
ATOM   2370 C CB  . PRO F 2 21  ? -17.727 -21.526 66.285  1.00 45.51  ? 111 PRO F CB  1 
ATOM   2371 C CG  . PRO F 2 21  ? -18.411 -20.282 65.820  1.00 49.45  ? 111 PRO F CG  1 
ATOM   2372 C CD  . PRO F 2 21  ? -17.729 -19.169 66.525  1.00 44.54  ? 111 PRO F CD  1 
ATOM   2373 N N   . PRO F 2 22  ? -14.792 -22.892 65.527  1.00 46.87  ? 112 PRO F N   1 
ATOM   2374 C CA  . PRO F 2 22  ? -13.847 -23.390 64.500  1.00 47.05  ? 112 PRO F CA  1 
ATOM   2375 C C   . PRO F 2 22  ? -14.241 -23.220 63.023  1.00 51.91  ? 112 PRO F C   1 
ATOM   2376 O O   . PRO F 2 22  ? -13.350 -23.033 62.194  1.00 52.00  ? 112 PRO F O   1 
ATOM   2377 C CB  . PRO F 2 22  ? -13.730 -24.877 64.829  1.00 48.71  ? 112 PRO F CB  1 
ATOM   2378 C CG  . PRO F 2 22  ? -13.900 -24.928 66.302  1.00 53.07  ? 112 PRO F CG  1 
ATOM   2379 C CD  . PRO F 2 22  ? -14.894 -23.846 66.654  1.00 48.43  ? 112 PRO F CD  1 
ATOM   2380 N N   . GLY F 2 23  ? -15.530 -23.295 62.702  1.00 48.53  ? 113 GLY F N   1 
ATOM   2381 C CA  . GLY F 2 23  ? -16.001 -23.157 61.325  1.00 48.57  ? 113 GLY F CA  1 
ATOM   2382 C C   . GLY F 2 23  ? -16.458 -21.772 60.896  1.00 52.87  ? 113 GLY F C   1 
ATOM   2383 O O   . GLY F 2 23  ? -16.790 -21.580 59.721  1.00 54.39  ? 113 GLY F O   1 
ATOM   2384 N N   . SER F 2 24  ? -16.478 -20.795 61.832  1.00 46.99  ? 114 SER F N   1 
ATOM   2385 C CA  . SER F 2 24  ? -16.948 -19.422 61.603  1.00 45.59  ? 114 SER F CA  1 
ATOM   2386 C C   . SER F 2 24  ? -16.197 -18.698 60.493  1.00 48.11  ? 114 SER F C   1 
ATOM   2387 O O   . SER F 2 24  ? -14.995 -18.908 60.306  1.00 48.48  ? 114 SER F O   1 
ATOM   2388 C CB  . SER F 2 24  ? -16.862 -18.592 62.882  1.00 47.69  ? 114 SER F CB  1 
ATOM   2389 O OG  . SER F 2 24  ? -15.532 -18.438 63.350  1.00 53.02  ? 114 SER F OG  1 
ATOM   2390 N N   . SER F 2 25  ? -16.924 -17.846 59.762  1.00 42.40  ? 115 SER F N   1 
ATOM   2391 C CA  . SER F 2 25  ? -16.395 -17.029 58.670  1.00 40.82  ? 115 SER F CA  1 
ATOM   2392 C C   . SER F 2 25  ? -16.620 -15.539 58.972  1.00 41.90  ? 115 SER F C   1 
ATOM   2393 O O   . SER F 2 25  ? -17.383 -15.201 59.881  1.00 40.11  ? 115 SER F O   1 
ATOM   2394 C CB  . SER F 2 25  ? -17.055 -17.407 57.341  1.00 44.23  ? 115 SER F CB  1 
ATOM   2395 O OG  . SER F 2 25  ? -17.785 -18.625 57.377  1.00 53.14  ? 115 SER F OG  1 
ATOM   2396 N N   . ARG F 2 26  ? -15.955 -14.655 58.213  1.00 37.57  ? 116 ARG F N   1 
ATOM   2397 C CA  . ARG F 2 26  ? -16.114 -13.210 58.345  1.00 36.65  ? 116 ARG F CA  1 
ATOM   2398 C C   . ARG F 2 26  ? -17.333 -12.692 57.558  1.00 38.01  ? 116 ARG F C   1 
ATOM   2399 O O   . ARG F 2 26  ? -17.654 -13.229 56.485  1.00 37.66  ? 116 ARG F O   1 
ATOM   2400 C CB  . ARG F 2 26  ? -14.858 -12.480 57.857  1.00 36.39  ? 116 ARG F CB  1 
ATOM   2401 C CG  . ARG F 2 26  ? -13.802 -12.343 58.924  1.00 43.99  ? 116 ARG F CG  1 
ATOM   2402 C CD  . ARG F 2 26  ? -12.497 -12.885 58.420  1.00 51.03  ? 116 ARG F CD  1 
ATOM   2403 N NE  . ARG F 2 26  ? -11.432 -12.807 59.417  1.00 52.39  ? 116 ARG F NE  1 
ATOM   2404 C CZ  . ARG F 2 26  ? -10.441 -11.926 59.378  1.00 60.41  ? 116 ARG F CZ  1 
ATOM   2405 N NH1 . ARG F 2 26  ? -10.387 -11.019 58.408  1.00 48.03  ? 116 ARG F NH1 1 
ATOM   2406 N NH2 . ARG F 2 26  ? -9.497  -11.940 60.309  1.00 40.80  ? 116 ARG F NH2 1 
ATOM   2407 N N   . PRO F 2 27  ? -17.992 -11.614 58.047  1.00 32.07  ? 117 PRO F N   1 
ATOM   2408 C CA  . PRO F 2 27  ? -19.096 -11.037 57.279  1.00 31.23  ? 117 PRO F CA  1 
ATOM   2409 C C   . PRO F 2 27  ? -18.560 -10.269 56.069  1.00 34.52  ? 117 PRO F C   1 
ATOM   2410 O O   . PRO F 2 27  ? -17.394 -9.871  56.067  1.00 33.67  ? 117 PRO F O   1 
ATOM   2411 C CB  . PRO F 2 27  ? -19.777 -10.119 58.291  1.00 32.81  ? 117 PRO F CB  1 
ATOM   2412 C CG  . PRO F 2 27  ? -18.684 -9.697  59.195  1.00 37.43  ? 117 PRO F CG  1 
ATOM   2413 C CD  . PRO F 2 27  ? -17.738 -10.841 59.281  1.00 33.02  ? 117 PRO F CD  1 
ATOM   2414 N N   . VAL F 2 28  ? -19.387 -10.104 55.028  1.00 30.89  ? 118 VAL F N   1 
ATOM   2415 C CA  . VAL F 2 28  ? -19.014 -9.397  53.808  1.00 31.14  ? 118 VAL F CA  1 
ATOM   2416 C C   . VAL F 2 28  ? -19.894 -8.139  53.648  1.00 34.98  ? 118 VAL F C   1 
ATOM   2417 O O   . VAL F 2 28  ? -20.987 -8.063  54.217  1.00 34.31  ? 118 VAL F O   1 
ATOM   2418 C CB  . VAL F 2 28  ? -19.067 -10.354 52.581  1.00 35.63  ? 118 VAL F CB  1 
ATOM   2419 C CG1 . VAL F 2 28  ? -20.295 -10.145 51.701  1.00 35.42  ? 118 VAL F CG1 1 
ATOM   2420 C CG2 . VAL F 2 28  ? -17.784 -10.252 51.773  1.00 35.72  ? 118 VAL F CG2 1 
ATOM   2421 N N   . LYS F 2 29  ? -19.391 -7.143  52.897  1.00 31.72  ? 119 LYS F N   1 
ATOM   2422 C CA  . LYS F 2 29  ? -20.085 -5.889  52.597  1.00 30.19  ? 119 LYS F CA  1 
ATOM   2423 C C   . LYS F 2 29  ? -21.497 -6.166  52.108  1.00 31.80  ? 119 LYS F C   1 
ATOM   2424 O O   . LYS F 2 29  ? -21.686 -6.990  51.216  1.00 31.12  ? 119 LYS F O   1 
ATOM   2425 C CB  . LYS F 2 29  ? -19.298 -5.104  51.530  1.00 32.95  ? 119 LYS F CB  1 
ATOM   2426 C CG  . LYS F 2 29  ? -19.928 -3.784  51.065  1.00 44.28  ? 119 LYS F CG  1 
ATOM   2427 C CD  . LYS F 2 29  ? -19.094 -3.123  49.960  1.00 54.05  ? 119 LYS F CD  1 
ATOM   2428 C CE  . LYS F 2 29  ? -19.467 -3.474  48.525  1.00 66.17  ? 119 LYS F CE  1 
ATOM   2429 N NZ  . LYS F 2 29  ? -20.763 -2.866  48.115  1.00 75.06  ? 119 LYS F NZ  1 
ATOM   2430 N N   . GLY F 2 30  ? -22.466 -5.487  52.711  1.00 28.64  ? 120 GLY F N   1 
ATOM   2431 C CA  . GLY F 2 30  ? -23.878 -5.614  52.371  1.00 28.58  ? 120 GLY F CA  1 
ATOM   2432 C C   . GLY F 2 30  ? -24.689 -6.468  53.330  1.00 33.15  ? 120 GLY F C   1 
ATOM   2433 O O   . GLY F 2 30  ? -25.913 -6.355  53.366  1.00 33.19  ? 120 GLY F O   1 
ATOM   2434 N N   . GLN F 2 31  ? -24.022 -7.339  54.102  1.00 29.60  ? 121 GLN F N   1 
ATOM   2435 C CA  . GLN F 2 31  ? -24.699 -8.218  55.055  1.00 29.12  ? 121 GLN F CA  1 
ATOM   2436 C C   . GLN F 2 31  ? -25.246 -7.435  56.235  1.00 32.40  ? 121 GLN F C   1 
ATOM   2437 O O   . GLN F 2 31  ? -24.646 -6.453  56.655  1.00 31.29  ? 121 GLN F O   1 
ATOM   2438 C CB  . GLN F 2 31  ? -23.773 -9.332  55.555  1.00 30.29  ? 121 GLN F CB  1 
ATOM   2439 C CG  . GLN F 2 31  ? -23.458 -10.367 54.486  1.00 33.11  ? 121 GLN F CG  1 
ATOM   2440 C CD  . GLN F 2 31  ? -22.924 -11.669 55.021  1.00 39.27  ? 121 GLN F CD  1 
ATOM   2441 O OE1 . GLN F 2 31  ? -23.468 -12.710 54.711  1.00 32.97  ? 121 GLN F OE1 1 
ATOM   2442 N NE2 . GLN F 2 31  ? -21.902 -11.661 55.846  1.00 28.68  ? 121 GLN F NE2 1 
ATOM   2443 N N   . VAL F 2 32  ? -26.406 -7.853  56.750  1.00 30.17  ? 122 VAL F N   1 
ATOM   2444 C CA  . VAL F 2 32  ? -27.007 -7.226  57.916  1.00 30.11  ? 122 VAL F CA  1 
ATOM   2445 C C   . VAL F 2 32  ? -26.426 -7.952  59.122  1.00 31.94  ? 122 VAL F C   1 
ATOM   2446 O O   . VAL F 2 32  ? -26.710 -9.134  59.332  1.00 32.59  ? 122 VAL F O   1 
ATOM   2447 C CB  . VAL F 2 32  ? -28.560 -7.217  57.897  1.00 34.11  ? 122 VAL F CB  1 
ATOM   2448 C CG1 . VAL F 2 32  ? -29.101 -6.442  59.093  1.00 33.86  ? 122 VAL F CG1 1 
ATOM   2449 C CG2 . VAL F 2 32  ? -29.101 -6.633  56.595  1.00 34.00  ? 122 VAL F CG2 1 
ATOM   2450 N N   . VAL F 2 33  ? -25.569 -7.258  59.869  1.00 25.86  ? 123 VAL F N   1 
ATOM   2451 C CA  . VAL F 2 33  ? -24.901 -7.815  61.025  1.00 24.66  ? 123 VAL F CA  1 
ATOM   2452 C C   . VAL F 2 33  ? -25.572 -7.334  62.318  1.00 28.69  ? 123 VAL F C   1 
ATOM   2453 O O   . VAL F 2 33  ? -26.037 -6.195  62.395  1.00 27.45  ? 123 VAL F O   1 
ATOM   2454 C CB  . VAL F 2 33  ? -23.365 -7.531  61.026  1.00 28.82  ? 123 VAL F CB  1 
ATOM   2455 C CG1 . VAL F 2 33  ? -22.669 -8.227  59.864  1.00 28.72  ? 123 VAL F CG1 1 
ATOM   2456 C CG2 . VAL F 2 33  ? -23.042 -6.035  61.031  1.00 28.48  ? 123 VAL F CG2 1 
ATOM   2457 N N   . THR F 2 34  ? -25.620 -8.217  63.333  1.00 25.19  ? 124 THR F N   1 
ATOM   2458 C CA  . THR F 2 34  ? -26.126 -7.930  64.675  1.00 24.57  ? 124 THR F CA  1 
ATOM   2459 C C   . THR F 2 34  ? -24.963 -8.062  65.642  1.00 28.88  ? 124 THR F C   1 
ATOM   2460 O O   . THR F 2 34  ? -24.302 -9.098  65.656  1.00 28.29  ? 124 THR F O   1 
ATOM   2461 C CB  . THR F 2 34  ? -27.295 -8.845  65.054  1.00 31.21  ? 124 THR F CB  1 
ATOM   2462 O OG1 . THR F 2 34  ? -28.293 -8.749  64.046  1.00 34.21  ? 124 THR F OG1 1 
ATOM   2463 C CG2 . THR F 2 34  ? -27.907 -8.499  66.413  1.00 29.51  ? 124 THR F CG2 1 
ATOM   2464 N N   . VAL F 2 35  ? -24.690 -7.014  66.422  1.00 26.55  ? 125 VAL F N   1 
ATOM   2465 C CA  . VAL F 2 35  ? -23.587 -7.024  67.391  1.00 26.30  ? 125 VAL F CA  1 
ATOM   2466 C C   . VAL F 2 35  ? -24.095 -6.653  68.800  1.00 29.98  ? 125 VAL F C   1 
ATOM   2467 O O   . VAL F 2 35  ? -25.193 -6.130  68.932  1.00 29.60  ? 125 VAL F O   1 
ATOM   2468 C CB  . VAL F 2 35  ? -22.409 -6.084  66.970  1.00 30.29  ? 125 VAL F CB  1 
ATOM   2469 C CG1 . VAL F 2 35  ? -21.824 -6.473  65.615  1.00 30.32  ? 125 VAL F CG1 1 
ATOM   2470 C CG2 . VAL F 2 35  ? -22.807 -4.603  66.997  1.00 30.01  ? 125 VAL F CG2 1 
ATOM   2471 N N   . HIS F 2 36  ? -23.287 -6.914  69.841  1.00 26.61  ? 126 HIS F N   1 
ATOM   2472 C CA  . HIS F 2 36  ? -23.496 -6.444  71.212  1.00 25.77  ? 126 HIS F CA  1 
ATOM   2473 C C   . HIS F 2 36  ? -22.357 -5.468  71.440  1.00 29.52  ? 126 HIS F C   1 
ATOM   2474 O O   . HIS F 2 36  ? -21.189 -5.879  71.440  1.00 27.04  ? 126 HIS F O   1 
ATOM   2475 C CB  . HIS F 2 36  ? -23.504 -7.591  72.242  1.00 26.62  ? 126 HIS F CB  1 
ATOM   2476 C CG  . HIS F 2 36  ? -23.714 -7.162  73.677  1.00 29.99  ? 126 HIS F CG  1 
ATOM   2477 N ND1 . HIS F 2 36  ? -23.872 -5.828  74.033  1.00 31.95  ? 126 HIS F ND1 1 
ATOM   2478 C CD2 . HIS F 2 36  ? -23.773 -7.911  74.800  1.00 31.74  ? 126 HIS F CD2 1 
ATOM   2479 C CE1 . HIS F 2 36  ? -24.035 -5.818  75.344  1.00 31.32  ? 126 HIS F CE1 1 
ATOM   2480 N NE2 . HIS F 2 36  ? -23.977 -7.045  75.851  1.00 31.78  ? 126 HIS F NE2 1 
ATOM   2481 N N   . LEU F 2 37  ? -22.675 -4.178  71.567  1.00 28.56  ? 127 LEU F N   1 
ATOM   2482 C CA  . LEU F 2 37  ? -21.624 -3.174  71.706  1.00 29.90  ? 127 LEU F CA  1 
ATOM   2483 C C   . LEU F 2 37  ? -21.591 -2.535  73.103  1.00 37.95  ? 127 LEU F C   1 
ATOM   2484 O O   . LEU F 2 37  ? -22.619 -2.131  73.649  1.00 38.09  ? 127 LEU F O   1 
ATOM   2485 C CB  . LEU F 2 37  ? -21.777 -2.106  70.607  1.00 29.81  ? 127 LEU F CB  1 
ATOM   2486 C CG  . LEU F 2 37  ? -20.724 -0.994  70.548  1.00 34.82  ? 127 LEU F CG  1 
ATOM   2487 C CD1 . LEU F 2 37  ? -19.434 -1.506  69.943  1.00 35.47  ? 127 LEU F CD1 1 
ATOM   2488 C CD2 . LEU F 2 37  ? -21.241 0.197   69.759  1.00 36.54  ? 127 LEU F CD2 1 
ATOM   2489 N N   . GLN F 2 38  ? -20.378 -2.462  73.668  1.00 37.37  ? 128 GLN F N   1 
ATOM   2490 C CA  . GLN F 2 38  ? -20.082 -1.835  74.958  1.00 38.12  ? 128 GLN F CA  1 
ATOM   2491 C C   . GLN F 2 38  ? -19.050 -0.744  74.677  1.00 42.39  ? 128 GLN F C   1 
ATOM   2492 O O   . GLN F 2 38  ? -17.885 -1.039  74.406  1.00 41.52  ? 128 GLN F O   1 
ATOM   2493 C CB  . GLN F 2 38  ? -19.595 -2.853  76.022  1.00 39.82  ? 128 GLN F CB  1 
ATOM   2494 C CG  . GLN F 2 38  ? -20.453 -4.110  76.159  1.00 58.27  ? 128 GLN F CG  1 
ATOM   2495 C CD  . GLN F 2 38  ? -20.356 -4.730  77.522  1.00 86.60  ? 128 GLN F CD  1 
ATOM   2496 O OE1 . GLN F 2 38  ? -21.150 -4.426  78.416  1.00 84.26  ? 128 GLN F OE1 1 
ATOM   2497 N NE2 . GLN F 2 38  ? -19.425 -5.657  77.692  1.00 81.68  ? 128 GLN F NE2 1 
ATOM   2498 N N   . THR F 2 39  ? -19.513 0.508   74.634  1.00 40.04  ? 129 THR F N   1 
ATOM   2499 C CA  . THR F 2 39  ? -18.683 1.670   74.333  1.00 41.00  ? 129 THR F CA  1 
ATOM   2500 C C   . THR F 2 39  ? -18.229 2.364   75.620  1.00 47.70  ? 129 THR F C   1 
ATOM   2501 O O   . THR F 2 39  ? -19.036 2.601   76.525  1.00 47.60  ? 129 THR F O   1 
ATOM   2502 C CB  . THR F 2 39  ? -19.447 2.649   73.419  1.00 50.46  ? 129 THR F CB  1 
ATOM   2503 O OG1 . THR F 2 39  ? -20.043 1.937   72.329  1.00 51.07  ? 129 THR F OG1 1 
ATOM   2504 C CG2 . THR F 2 39  ? -18.566 3.771   72.893  1.00 47.99  ? 129 THR F CG2 1 
ATOM   2505 N N   . SER F 2 40  ? -16.936 2.699   75.683  1.00 45.49  ? 130 SER F N   1 
ATOM   2506 C CA  . SER F 2 40  ? -16.341 3.407   76.807  1.00 46.34  ? 130 SER F CA  1 
ATOM   2507 C C   . SER F 2 40  ? -15.305 4.397   76.311  1.00 52.14  ? 130 SER F C   1 
ATOM   2508 O O   . SER F 2 40  ? -14.742 4.210   75.231  1.00 51.81  ? 130 SER F O   1 
ATOM   2509 C CB  . SER F 2 40  ? -15.734 2.436   77.818  1.00 50.59  ? 130 SER F CB  1 
ATOM   2510 O OG  . SER F 2 40  ? -14.744 1.595   77.255  1.00 61.89  ? 130 SER F OG  1 
ATOM   2511 N N   . LEU F 2 41  ? -15.081 5.469   77.083  1.00 50.49  ? 131 LEU F N   1 
ATOM   2512 C CA  . LEU F 2 41  ? -14.113 6.508   76.753  1.00 51.62  ? 131 LEU F CA  1 
ATOM   2513 C C   . LEU F 2 41  ? -12.699 6.061   77.135  1.00 59.01  ? 131 LEU F C   1 
ATOM   2514 O O   . LEU F 2 41  ? -12.533 5.012   77.771  1.00 59.13  ? 131 LEU F O   1 
ATOM   2515 C CB  . LEU F 2 41  ? -14.478 7.817   77.458  1.00 51.71  ? 131 LEU F CB  1 
ATOM   2516 N N   . GLU F 2 42  ? -11.679 6.850   76.737  1.00 57.65  ? 132 GLU F N   1 
ATOM   2517 C CA  . GLU F 2 42  ? -10.269 6.560   77.011  1.00 58.53  ? 132 GLU F CA  1 
ATOM   2518 C C   . GLU F 2 42  ? -9.965  6.463   78.522  1.00 64.12  ? 132 GLU F C   1 
ATOM   2519 O O   . GLU F 2 42  ? -9.068  5.713   78.909  1.00 63.30  ? 132 GLU F O   1 
ATOM   2520 C CB  . GLU F 2 42  ? -9.323  7.558   76.324  1.00 60.10  ? 132 GLU F CB  1 
ATOM   2521 C CG  . GLU F 2 42  ? -9.408  9.044   76.660  1.00 73.58  ? 132 GLU F CG  1 
ATOM   2522 C CD  . GLU F 2 42  ? -8.230  9.865   76.160  1.00 97.83  ? 132 GLU F CD  1 
ATOM   2523 O OE1 . GLU F 2 42  ? -7.760  9.632   75.021  1.00 85.78  ? 132 GLU F OE1 1 
ATOM   2524 O OE2 . GLU F 2 42  ? -7.770  10.744  76.924  1.00 95.93  ? 132 GLU F OE2 1 
ATOM   2525 N N   . ASN F 2 43  ? -10.720 7.206   79.356  1.00 62.44  ? 133 ASN F N   1 
ATOM   2526 C CA  . ASN F 2 43  ? -10.567 7.227   80.813  1.00 63.09  ? 133 ASN F CA  1 
ATOM   2527 C C   . ASN F 2 43  ? -11.355 6.087   81.522  1.00 68.40  ? 133 ASN F C   1 
ATOM   2528 O O   . ASN F 2 43  ? -11.212 5.917   82.736  1.00 68.59  ? 133 ASN F O   1 
ATOM   2529 C CB  . ASN F 2 43  ? -10.974 8.590   81.377  1.00 64.63  ? 133 ASN F CB  1 
ATOM   2530 C CG  . ASN F 2 43  ? -12.409 8.971   81.120  1.00 92.84  ? 133 ASN F CG  1 
ATOM   2531 O OD1 . ASN F 2 43  ? -13.301 8.698   81.925  1.00 90.05  ? 133 ASN F OD1 1 
ATOM   2532 N ND2 . ASN F 2 43  ? -12.656 9.623   79.994  1.00 84.36  ? 133 ASN F ND2 1 
ATOM   2533 N N   . GLY F 2 44  ? -12.150 5.327   80.766  1.00 65.17  ? 134 GLY F N   1 
ATOM   2534 C CA  . GLY F 2 44  ? -12.910 4.199   81.295  1.00 65.23  ? 134 GLY F CA  1 
ATOM   2535 C C   . GLY F 2 44  ? -14.388 4.423   81.535  1.00 69.13  ? 134 GLY F C   1 
ATOM   2536 O O   . GLY F 2 44  ? -15.085 3.481   81.926  1.00 69.04  ? 134 GLY F O   1 
ATOM   2537 N N   . THR F 2 45  ? -14.880 5.659   81.314  1.00 65.17  ? 135 THR F N   1 
ATOM   2538 C CA  . THR F 2 45  ? -16.291 6.012   81.498  1.00 64.73  ? 135 THR F CA  1 
ATOM   2539 C C   . THR F 2 45  ? -17.137 5.331   80.409  1.00 67.90  ? 135 THR F C   1 
ATOM   2540 O O   . THR F 2 45  ? -16.855 5.498   79.223  1.00 67.29  ? 135 THR F O   1 
ATOM   2541 C CB  . THR F 2 45  ? -16.453 7.540   81.506  1.00 72.47  ? 135 THR F CB  1 
ATOM   2542 O OG1 . THR F 2 45  ? -15.805 8.052   82.670  1.00 74.15  ? 135 THR F OG1 1 
ATOM   2543 C CG2 . THR F 2 45  ? -17.917 7.986   81.497  1.00 71.00  ? 135 THR F CG2 1 
ATOM   2544 N N   . ARG F 2 46  ? -18.150 4.550   80.824  1.00 63.89  ? 136 ARG F N   1 
ATOM   2545 C CA  . ARG F 2 46  ? -19.034 3.834   79.898  1.00 63.58  ? 136 ARG F CA  1 
ATOM   2546 C C   . ARG F 2 46  ? -20.079 4.788   79.334  1.00 67.24  ? 136 ARG F C   1 
ATOM   2547 O O   . ARG F 2 46  ? -20.635 5.599   80.078  1.00 67.18  ? 136 ARG F O   1 
ATOM   2548 C CB  . ARG F 2 46  ? -19.700 2.613   80.568  1.00 64.58  ? 136 ARG F CB  1 
ATOM   2549 C CG  . ARG F 2 46  ? -18.715 1.581   81.135  1.00 80.13  ? 136 ARG F CG  1 
ATOM   2550 C CD  . ARG F 2 46  ? -18.094 0.654   80.090  1.00 94.20  ? 136 ARG F CD  1 
ATOM   2551 N NE  . ARG F 2 46  ? -18.977 -0.458  79.746  1.00 103.24 ? 136 ARG F NE  1 
ATOM   2552 C CZ  . ARG F 2 46  ? -18.993 -1.619  80.388  1.00 119.15 ? 136 ARG F CZ  1 
ATOM   2553 N NH1 . ARG F 2 46  ? -18.170 -1.833  81.409  1.00 105.19 ? 136 ARG F NH1 1 
ATOM   2554 N NH2 . ARG F 2 46  ? -19.831 -2.574  80.019  1.00 109.11 ? 136 ARG F NH2 1 
ATOM   2555 N N   . VAL F 2 47  ? -20.336 4.696   78.020  1.00 62.77  ? 137 VAL F N   1 
ATOM   2556 C CA  . VAL F 2 47  ? -21.288 5.560   77.317  1.00 61.78  ? 137 VAL F CA  1 
ATOM   2557 C C   . VAL F 2 47  ? -22.677 4.879   77.259  1.00 63.73  ? 137 VAL F C   1 
ATOM   2558 O O   . VAL F 2 47  ? -23.644 5.449   77.772  1.00 63.65  ? 137 VAL F O   1 
ATOM   2559 C CB  . VAL F 2 47  ? -20.750 5.957   75.913  1.00 65.56  ? 137 VAL F CB  1 
ATOM   2560 C CG1 . VAL F 2 47  ? -21.842 6.569   75.036  1.00 65.48  ? 137 VAL F CG1 1 
ATOM   2561 C CG2 . VAL F 2 47  ? -19.563 6.910   76.037  1.00 65.23  ? 137 VAL F CG2 1 
ATOM   2562 N N   . GLN F 2 48  ? -22.778 3.690   76.621  1.00 57.96  ? 138 GLN F N   1 
ATOM   2563 C CA  . GLN F 2 48  ? -24.026 2.924   76.486  1.00 56.31  ? 138 GLN F CA  1 
ATOM   2564 C C   . GLN F 2 48  ? -23.731 1.460   76.190  1.00 56.34  ? 138 GLN F C   1 
ATOM   2565 O O   . GLN F 2 48  ? -22.584 1.102   75.900  1.00 55.60  ? 138 GLN F O   1 
ATOM   2566 C CB  . GLN F 2 48  ? -24.936 3.512   75.386  1.00 57.65  ? 138 GLN F CB  1 
ATOM   2567 N N   . GLU F 2 49  ? -24.770 0.613   76.276  1.00 50.60  ? 139 GLU F N   1 
ATOM   2568 C CA  . GLU F 2 49  ? -24.663 -0.816  76.000  1.00 49.32  ? 139 GLU F CA  1 
ATOM   2569 C C   . GLU F 2 49  ? -25.835 -1.244  75.134  1.00 50.07  ? 139 GLU F C   1 
ATOM   2570 O O   . GLU F 2 49  ? -26.970 -1.329  75.604  1.00 50.87  ? 139 GLU F O   1 
ATOM   2571 C CB  . GLU F 2 49  ? -24.568 -1.647  77.294  1.00 50.70  ? 139 GLU F CB  1 
ATOM   2572 N N   . GLU F 2 50  ? -25.557 -1.454  73.847  1.00 43.16  ? 140 GLU F N   1 
ATOM   2573 C CA  . GLU F 2 50  ? -26.541 -1.877  72.864  1.00 41.31  ? 140 GLU F CA  1 
ATOM   2574 C C   . GLU F 2 50  ? -26.403 -3.389  72.738  1.00 42.07  ? 140 GLU F C   1 
ATOM   2575 O O   . GLU F 2 50  ? -25.413 -3.846  72.176  1.00 41.66  ? 140 GLU F O   1 
ATOM   2576 C CB  . GLU F 2 50  ? -26.352 -1.143  71.517  1.00 42.66  ? 140 GLU F CB  1 
ATOM   2577 C CG  . GLU F 2 50  ? -26.401 0.383   71.586  1.00 56.85  ? 140 GLU F CG  1 
ATOM   2578 C CD  . GLU F 2 50  ? -25.088 1.114   71.833  1.00 83.99  ? 140 GLU F CD  1 
ATOM   2579 O OE1 . GLU F 2 50  ? -24.648 1.862   70.930  1.00 79.30  ? 140 GLU F OE1 1 
ATOM   2580 O OE2 . GLU F 2 50  ? -24.520 0.975   72.941  1.00 80.09  ? 140 GLU F OE2 1 
ATOM   2581 N N   . PRO F 2 51  ? -27.321 -4.186  73.329  1.00 37.95  ? 141 PRO F N   1 
ATOM   2582 C CA  . PRO F 2 51  ? -27.154 -5.652  73.288  1.00 37.79  ? 141 PRO F CA  1 
ATOM   2583 C C   . PRO F 2 51  ? -27.462 -6.299  71.930  1.00 41.26  ? 141 PRO F C   1 
ATOM   2584 O O   . PRO F 2 51  ? -27.033 -7.436  71.697  1.00 41.41  ? 141 PRO F O   1 
ATOM   2585 C CB  . PRO F 2 51  ? -28.115 -6.157  74.369  1.00 39.47  ? 141 PRO F CB  1 
ATOM   2586 C CG  . PRO F 2 51  ? -29.161 -5.109  74.477  1.00 43.98  ? 141 PRO F CG  1 
ATOM   2587 C CD  . PRO F 2 51  ? -28.524 -3.795  74.097  1.00 39.60  ? 141 PRO F CD  1 
ATOM   2588 N N   . GLU F 2 52  ? -28.192 -5.597  71.043  1.00 35.42  ? 142 GLU F N   1 
ATOM   2589 C CA  . GLU F 2 52  ? -28.539 -6.134  69.736  1.00 33.77  ? 142 GLU F CA  1 
ATOM   2590 C C   . GLU F 2 52  ? -28.535 -5.053  68.647  1.00 35.59  ? 142 GLU F C   1 
ATOM   2591 O O   . GLU F 2 52  ? -29.543 -4.917  67.940  1.00 36.24  ? 142 GLU F O   1 
ATOM   2592 C CB  . GLU F 2 52  ? -29.915 -6.813  69.800  1.00 35.12  ? 142 GLU F CB  1 
ATOM   2593 C CG  . GLU F 2 52  ? -29.877 -8.321  69.700  1.00 42.62  ? 142 GLU F CG  1 
ATOM   2594 C CD  . GLU F 2 52  ? -31.236 -8.877  69.338  1.00 66.29  ? 142 GLU F CD  1 
ATOM   2595 O OE1 . GLU F 2 52  ? -31.481 -9.113  68.133  1.00 58.78  ? 142 GLU F OE1 1 
ATOM   2596 O OE2 . GLU F 2 52  ? -32.083 -9.001  70.251  1.00 66.55  ? 142 GLU F OE2 1 
ATOM   2597 N N   . LEU F 2 53  ? -27.394 -4.313  68.480  1.00 28.71  ? 143 LEU F N   1 
ATOM   2598 C CA  . LEU F 2 53  ? -27.253 -3.283  67.446  1.00 27.53  ? 143 LEU F CA  1 
ATOM   2599 C C   . LEU F 2 53  ? -27.250 -3.959  66.082  1.00 30.61  ? 143 LEU F C   1 
ATOM   2600 O O   . LEU F 2 53  ? -26.434 -4.850  65.840  1.00 30.24  ? 143 LEU F O   1 
ATOM   2601 C CB  . LEU F 2 53  ? -25.975 -2.427  67.664  1.00 27.38  ? 143 LEU F CB  1 
ATOM   2602 C CG  . LEU F 2 53  ? -25.603 -1.389  66.594  1.00 31.80  ? 143 LEU F CG  1 
ATOM   2603 C CD1 . LEU F 2 53  ? -26.597 -0.239  66.555  1.00 30.95  ? 143 LEU F CD1 1 
ATOM   2604 C CD2 . LEU F 2 53  ? -24.198 -0.864  66.825  1.00 34.60  ? 143 LEU F CD2 1 
ATOM   2605 N N   . VAL F 2 54  ? -28.190 -3.566  65.213  1.00 27.01  ? 144 VAL F N   1 
ATOM   2606 C CA  . VAL F 2 54  ? -28.375 -4.134  63.874  1.00 27.37  ? 144 VAL F CA  1 
ATOM   2607 C C   . VAL F 2 54  ? -28.022 -3.077  62.816  1.00 32.89  ? 144 VAL F C   1 
ATOM   2608 O O   . VAL F 2 54  ? -28.598 -1.997  62.815  1.00 33.47  ? 144 VAL F O   1 
ATOM   2609 C CB  . VAL F 2 54  ? -29.825 -4.681  63.706  1.00 31.54  ? 144 VAL F CB  1 
ATOM   2610 C CG1 . VAL F 2 54  ? -30.110 -5.098  62.271  1.00 31.42  ? 144 VAL F CG1 1 
ATOM   2611 C CG2 . VAL F 2 54  ? -30.097 -5.844  64.663  1.00 31.35  ? 144 VAL F CG2 1 
ATOM   2612 N N   . PHE F 2 55  ? -27.081 -3.384  61.927  1.00 29.33  ? 145 PHE F N   1 
ATOM   2613 C CA  . PHE F 2 55  ? -26.645 -2.445  60.899  1.00 29.22  ? 145 PHE F CA  1 
ATOM   2614 C C   . PHE F 2 55  ? -26.131 -3.210  59.696  1.00 34.91  ? 145 PHE F C   1 
ATOM   2615 O O   . PHE F 2 55  ? -25.749 -4.377  59.819  1.00 36.08  ? 145 PHE F O   1 
ATOM   2616 C CB  . PHE F 2 55  ? -25.579 -1.464  61.458  1.00 31.04  ? 145 PHE F CB  1 
ATOM   2617 C CG  . PHE F 2 55  ? -24.257 -2.030  61.934  1.00 33.22  ? 145 PHE F CG  1 
ATOM   2618 C CD1 . PHE F 2 55  ? -23.061 -1.596  61.382  1.00 36.27  ? 145 PHE F CD1 1 
ATOM   2619 C CD2 . PHE F 2 55  ? -24.203 -2.933  62.992  1.00 36.44  ? 145 PHE F CD2 1 
ATOM   2620 C CE1 . PHE F 2 55  ? -21.840 -2.097  61.833  1.00 36.92  ? 145 PHE F CE1 1 
ATOM   2621 C CE2 . PHE F 2 55  ? -22.975 -3.443  63.436  1.00 38.90  ? 145 PHE F CE2 1 
ATOM   2622 C CZ  . PHE F 2 55  ? -21.804 -3.032  62.840  1.00 36.34  ? 145 PHE F CZ  1 
ATOM   2623 N N   . THR F 2 56  ? -26.150 -2.556  58.525  1.00 29.96  ? 146 THR F N   1 
ATOM   2624 C CA  . THR F 2 56  ? -25.681 -3.107  57.258  1.00 28.71  ? 146 THR F CA  1 
ATOM   2625 C C   . THR F 2 56  ? -24.213 -2.727  57.101  1.00 29.35  ? 146 THR F C   1 
ATOM   2626 O O   . THR F 2 56  ? -23.864 -1.547  57.184  1.00 28.29  ? 146 THR F O   1 
ATOM   2627 C CB  . THR F 2 56  ? -26.555 -2.597  56.095  1.00 40.83  ? 146 THR F CB  1 
ATOM   2628 O OG1 . THR F 2 56  ? -27.935 -2.741  56.437  1.00 43.09  ? 146 THR F OG1 1 
ATOM   2629 C CG2 . THR F 2 56  ? -26.272 -3.314  54.786  1.00 39.07  ? 146 THR F CG2 1 
ATOM   2630 N N   . LEU F 2 57  ? -23.356 -3.734  56.907  1.00 24.35  ? 147 LEU F N   1 
ATOM   2631 C CA  . LEU F 2 57  ? -21.923 -3.571  56.747  1.00 23.84  ? 147 LEU F CA  1 
ATOM   2632 C C   . LEU F 2 57  ? -21.590 -2.762  55.479  1.00 27.83  ? 147 LEU F C   1 
ATOM   2633 O O   . LEU F 2 57  ? -22.058 -3.091  54.382  1.00 26.71  ? 147 LEU F O   1 
ATOM   2634 C CB  . LEU F 2 57  ? -21.272 -4.966  56.681  1.00 24.00  ? 147 LEU F CB  1 
ATOM   2635 C CG  . LEU F 2 57  ? -19.882 -5.132  57.285  1.00 28.86  ? 147 LEU F CG  1 
ATOM   2636 C CD1 . LEU F 2 57  ? -19.473 -6.581  57.302  1.00 27.87  ? 147 LEU F CD1 1 
ATOM   2637 C CD2 . LEU F 2 57  ? -18.831 -4.290  56.574  1.00 33.63  ? 147 LEU F CD2 1 
ATOM   2638 N N   . GLY F 2 58  ? -20.788 -1.719  55.663  1.00 24.98  ? 148 GLY F N   1 
ATOM   2639 C CA  . GLY F 2 58  ? -20.323 -0.836  54.597  1.00 25.08  ? 148 GLY F CA  1 
ATOM   2640 C C   . GLY F 2 58  ? -21.242 0.325   54.265  1.00 29.16  ? 148 GLY F C   1 
ATOM   2641 O O   . GLY F 2 58  ? -20.945 1.087   53.341  1.00 29.50  ? 148 GLY F O   1 
ATOM   2642 N N   . ASP F 2 59  ? -22.368 0.465   55.004  1.00 24.63  ? 149 ASP F N   1 
ATOM   2643 C CA  . ASP F 2 59  ? -23.395 1.505   54.822  1.00 23.10  ? 149 ASP F CA  1 
ATOM   2644 C C   . ASP F 2 59  ? -23.204 2.712   55.769  1.00 30.45  ? 149 ASP F C   1 
ATOM   2645 O O   . ASP F 2 59  ? -23.901 3.715   55.611  1.00 29.84  ? 149 ASP F O   1 
ATOM   2646 C CB  . ASP F 2 59  ? -24.804 0.902   55.044  1.00 22.92  ? 149 ASP F CB  1 
ATOM   2647 C CG  . ASP F 2 59  ? -25.493 0.317   53.811  1.00 28.79  ? 149 ASP F CG  1 
ATOM   2648 O OD1 . ASP F 2 59  ? -24.835 0.170   52.772  1.00 30.54  ? 149 ASP F OD1 1 
ATOM   2649 O OD2 . ASP F 2 59  ? -26.684 -0.005  53.898  1.00 30.63  ? 149 ASP F OD2 1 
ATOM   2650 N N   . CYS F 2 60  ? -22.292 2.602   56.763  1.00 29.97  ? 150 CYS F N   1 
ATOM   2651 C CA  . CYS F 2 60  ? -21.965 3.630   57.770  1.00 30.60  ? 150 CYS F CA  1 
ATOM   2652 C C   . CYS F 2 60  ? -23.233 4.118   58.488  1.00 32.94  ? 150 CYS F C   1 
ATOM   2653 O O   . CYS F 2 60  ? -23.466 5.318   58.627  1.00 31.73  ? 150 CYS F O   1 
ATOM   2654 C CB  . CYS F 2 60  ? -21.188 4.791   57.154  1.00 31.60  ? 150 CYS F CB  1 
ATOM   2655 S SG  . CYS F 2 60  ? -19.602 4.315   56.436  1.00 36.14  ? 150 CYS F SG  1 
ATOM   2656 N N   . ASP F 2 61  ? -24.031 3.164   58.959  1.00 28.92  ? 151 ASP F N   1 
ATOM   2657 C CA  . ASP F 2 61  ? -25.268 3.381   59.699  1.00 27.32  ? 151 ASP F CA  1 
ATOM   2658 C C   . ASP F 2 61  ? -25.022 4.007   61.071  1.00 32.44  ? 151 ASP F C   1 
ATOM   2659 O O   . ASP F 2 61  ? -25.874 4.757   61.544  1.00 32.85  ? 151 ASP F O   1 
ATOM   2660 C CB  . ASP F 2 61  ? -26.020 2.049   59.886  1.00 27.39  ? 151 ASP F CB  1 
ATOM   2661 C CG  . ASP F 2 61  ? -26.773 1.499   58.673  1.00 30.78  ? 151 ASP F CG  1 
ATOM   2662 O OD1 . ASP F 2 61  ? -26.920 2.233   57.674  1.00 31.35  ? 151 ASP F OD1 1 
ATOM   2663 O OD2 . ASP F 2 61  ? -27.264 0.357   58.748  1.00 32.34  ? 151 ASP F OD2 1 
ATOM   2664 N N   . VAL F 2 62  ? -23.904 3.662   61.739  1.00 28.61  ? 152 VAL F N   1 
ATOM   2665 C CA  . VAL F 2 62  ? -23.628 4.150   63.095  1.00 28.47  ? 152 VAL F CA  1 
ATOM   2666 C C   . VAL F 2 62  ? -22.332 4.981   63.112  1.00 32.64  ? 152 VAL F C   1 
ATOM   2667 O O   . VAL F 2 62  ? -22.404 6.213   63.187  1.00 34.02  ? 152 VAL F O   1 
ATOM   2668 C CB  . VAL F 2 62  ? -23.597 2.996   64.146  1.00 32.20  ? 152 VAL F CB  1 
ATOM   2669 C CG1 . VAL F 2 62  ? -23.554 3.542   65.582  1.00 32.04  ? 152 VAL F CG1 1 
ATOM   2670 C CG2 . VAL F 2 62  ? -24.775 2.040   63.963  1.00 31.94  ? 152 VAL F CG2 1 
ATOM   2671 N N   . ILE F 2 63  ? -21.166 4.322   63.082  1.00 27.03  ? 153 ILE F N   1 
ATOM   2672 C CA  . ILE F 2 63  ? -19.842 4.968   63.088  1.00 25.92  ? 153 ILE F CA  1 
ATOM   2673 C C   . ILE F 2 63  ? -18.916 4.223   62.145  1.00 30.11  ? 153 ILE F C   1 
ATOM   2674 O O   . ILE F 2 63  ? -19.072 3.016   61.976  1.00 29.98  ? 153 ILE F O   1 
ATOM   2675 C CB  . ILE F 2 63  ? -19.203 5.117   64.510  1.00 27.72  ? 153 ILE F CB  1 
ATOM   2676 C CG1 . ILE F 2 63  ? -19.275 3.809   65.328  1.00 26.22  ? 153 ILE F CG1 1 
ATOM   2677 C CG2 . ILE F 2 63  ? -19.797 6.312   65.266  1.00 28.52  ? 153 ILE F CG2 1 
ATOM   2678 C CD1 . ILE F 2 63  ? -18.344 3.765   66.491  1.00 25.09  ? 153 ILE F CD1 1 
ATOM   2679 N N   . GLN F 2 64  ? -17.951 4.938   61.539  1.00 27.23  ? 154 GLN F N   1 
ATOM   2680 C CA  . GLN F 2 64  ? -16.962 4.365   60.614  1.00 27.67  ? 154 GLN F CA  1 
ATOM   2681 C C   . GLN F 2 64  ? -16.142 3.231   61.264  1.00 31.54  ? 154 GLN F C   1 
ATOM   2682 O O   . GLN F 2 64  ? -15.804 2.265   60.589  1.00 31.83  ? 154 GLN F O   1 
ATOM   2683 C CB  . GLN F 2 64  ? -16.011 5.461   60.127  1.00 29.00  ? 154 GLN F CB  1 
ATOM   2684 C CG  . GLN F 2 64  ? -16.215 5.868   58.679  1.00 43.04  ? 154 GLN F CG  1 
ATOM   2685 C CD  . GLN F 2 64  ? -15.122 6.802   58.241  1.00 61.76  ? 154 GLN F CD  1 
ATOM   2686 O OE1 . GLN F 2 64  ? -15.308 8.023   58.214  1.00 64.26  ? 154 GLN F OE1 1 
ATOM   2687 N NE2 . GLN F 2 64  ? -13.961 6.258   57.900  1.00 49.95  ? 154 GLN F NE2 1 
ATOM   2688 N N   . ALA F 2 65  ? -15.810 3.370   62.565  1.00 27.81  ? 155 ALA F N   1 
ATOM   2689 C CA  . ALA F 2 65  ? -15.038 2.404   63.355  1.00 27.01  ? 155 ALA F CA  1 
ATOM   2690 C C   . ALA F 2 65  ? -15.627 1.003   63.257  1.00 27.01  ? 155 ALA F C   1 
ATOM   2691 O O   . ALA F 2 65  ? -14.878 0.049   63.069  1.00 26.65  ? 155 ALA F O   1 
ATOM   2692 C CB  . ALA F 2 65  ? -14.995 2.850   64.809  1.00 28.10  ? 155 ALA F CB  1 
ATOM   2693 N N   . LEU F 2 66  ? -16.964 0.883   63.326  1.00 21.33  ? 156 LEU F N   1 
ATOM   2694 C CA  . LEU F 2 66  ? -17.655 -0.408  63.212  1.00 21.02  ? 156 LEU F CA  1 
ATOM   2695 C C   . LEU F 2 66  ? -17.557 -1.010  61.804  1.00 23.86  ? 156 LEU F C   1 
ATOM   2696 O O   . LEU F 2 66  ? -17.295 -2.200  61.675  1.00 21.89  ? 156 LEU F O   1 
ATOM   2697 C CB  . LEU F 2 66  ? -19.123 -0.271  63.603  1.00 21.23  ? 156 LEU F CB  1 
ATOM   2698 C CG  . LEU F 2 66  ? -19.413 -0.038  65.086  1.00 26.61  ? 156 LEU F CG  1 
ATOM   2699 C CD1 . LEU F 2 66  ? -20.872 0.209   65.276  1.00 26.27  ? 156 LEU F CD1 1 
ATOM   2700 C CD2 . LEU F 2 66  ? -18.960 -1.208  65.940  1.00 29.84  ? 156 LEU F CD2 1 
ATOM   2701 N N   . ASP F 2 67  ? -17.758 -0.197  60.757  1.00 22.12  ? 157 ASP F N   1 
ATOM   2702 C CA  . ASP F 2 67  ? -17.699 -0.670  59.369  1.00 22.83  ? 157 ASP F CA  1 
ATOM   2703 C C   . ASP F 2 67  ? -16.272 -1.060  58.936  1.00 28.17  ? 157 ASP F C   1 
ATOM   2704 O O   . ASP F 2 67  ? -16.114 -1.789  57.964  1.00 28.44  ? 157 ASP F O   1 
ATOM   2705 C CB  . ASP F 2 67  ? -18.243 0.412   58.430  1.00 24.75  ? 157 ASP F CB  1 
ATOM   2706 C CG  . ASP F 2 67  ? -19.730 0.641   58.572  1.00 36.42  ? 157 ASP F CG  1 
ATOM   2707 O OD1 . ASP F 2 67  ? -20.144 1.220   59.593  1.00 36.76  ? 157 ASP F OD1 1 
ATOM   2708 O OD2 . ASP F 2 67  ? -20.479 0.250   57.657  1.00 43.33  ? 157 ASP F OD2 1 
ATOM   2709 N N   . LEU F 2 68  ? -15.252 -0.536  59.626  1.00 24.64  ? 158 LEU F N   1 
ATOM   2710 C CA  . LEU F 2 68  ? -13.847 -0.799  59.329  1.00 24.09  ? 158 LEU F CA  1 
ATOM   2711 C C   . LEU F 2 68  ? -13.279 -1.978  60.125  1.00 26.42  ? 158 LEU F C   1 
ATOM   2712 O O   . LEU F 2 68  ? -12.362 -2.639  59.650  1.00 25.17  ? 158 LEU F O   1 
ATOM   2713 C CB  . LEU F 2 68  ? -13.001 0.458   59.622  1.00 24.21  ? 158 LEU F CB  1 
ATOM   2714 C CG  . LEU F 2 68  ? -13.048 1.631   58.614  1.00 28.76  ? 158 LEU F CG  1 
ATOM   2715 C CD1 . LEU F 2 68  ? -12.335 2.820   59.172  1.00 29.18  ? 158 LEU F CD1 1 
ATOM   2716 C CD2 . LEU F 2 68  ? -12.457 1.261   57.263  1.00 29.05  ? 158 LEU F CD2 1 
ATOM   2717 N N   . SER F 2 69  ? -13.814 -2.243  61.320  1.00 24.06  ? 159 SER F N   1 
ATOM   2718 C CA  . SER F 2 69  ? -13.307 -3.302  62.185  1.00 24.71  ? 159 SER F CA  1 
ATOM   2719 C C   . SER F 2 69  ? -14.120 -4.605  62.142  1.00 32.80  ? 159 SER F C   1 
ATOM   2720 O O   . SER F 2 69  ? -13.521 -5.682  62.251  1.00 34.67  ? 159 SER F O   1 
ATOM   2721 C CB  . SER F 2 69  ? -13.229 -2.810  63.629  1.00 27.52  ? 159 SER F CB  1 
ATOM   2722 O OG  . SER F 2 69  ? -14.493 -2.406  64.132  1.00 34.35  ? 159 SER F OG  1 
ATOM   2723 N N   . VAL F 2 70  ? -15.463 -4.525  62.009  1.00 28.91  ? 160 VAL F N   1 
ATOM   2724 C CA  . VAL F 2 70  ? -16.344 -5.698  62.013  1.00 28.57  ? 160 VAL F CA  1 
ATOM   2725 C C   . VAL F 2 70  ? -16.040 -6.654  60.807  1.00 32.96  ? 160 VAL F C   1 
ATOM   2726 O O   . VAL F 2 70  ? -16.082 -7.870  61.034  1.00 32.64  ? 160 VAL F O   1 
ATOM   2727 C CB  . VAL F 2 70  ? -17.848 -5.301  62.119  1.00 32.03  ? 160 VAL F CB  1 
ATOM   2728 C CG1 . VAL F 2 70  ? -18.776 -6.484  61.849  1.00 31.51  ? 160 VAL F CG1 1 
ATOM   2729 C CG2 . VAL F 2 70  ? -18.156 -4.701  63.493  1.00 31.68  ? 160 VAL F CG2 1 
ATOM   2730 N N   . PRO F 2 71  ? -15.640 -6.193  59.586  1.00 29.45  ? 161 PRO F N   1 
ATOM   2731 C CA  . PRO F 2 71  ? -15.312 -7.160  58.518  1.00 29.13  ? 161 PRO F CA  1 
ATOM   2732 C C   . PRO F 2 71  ? -14.089 -8.041  58.843  1.00 33.41  ? 161 PRO F C   1 
ATOM   2733 O O   . PRO F 2 71  ? -13.845 -9.029  58.149  1.00 33.45  ? 161 PRO F O   1 
ATOM   2734 C CB  . PRO F 2 71  ? -15.021 -6.266  57.302  1.00 30.64  ? 161 PRO F CB  1 
ATOM   2735 C CG  . PRO F 2 71  ? -15.574 -4.961  57.621  1.00 34.99  ? 161 PRO F CG  1 
ATOM   2736 C CD  . PRO F 2 71  ? -15.507 -4.808  59.093  1.00 30.72  ? 161 PRO F CD  1 
ATOM   2737 N N   . LEU F 2 72  ? -13.321 -7.667  59.884  1.00 29.11  ? 162 LEU F N   1 
ATOM   2738 C CA  . LEU F 2 72  ? -12.126 -8.378  60.351  1.00 28.68  ? 162 LEU F CA  1 
ATOM   2739 C C   . LEU F 2 72  ? -12.440 -9.330  61.519  1.00 33.72  ? 162 LEU F C   1 
ATOM   2740 O O   . LEU F 2 72  ? -11.516 -9.884  62.124  1.00 35.24  ? 162 LEU F O   1 
ATOM   2741 C CB  . LEU F 2 72  ? -11.045 -7.371  60.779  1.00 28.47  ? 162 LEU F CB  1 
ATOM   2742 C CG  . LEU F 2 72  ? -10.595 -6.364  59.733  1.00 32.51  ? 162 LEU F CG  1 
ATOM   2743 C CD1 . LEU F 2 72  ? -9.613  -5.445  60.310  1.00 32.83  ? 162 LEU F CD1 1 
ATOM   2744 C CD2 . LEU F 2 72  ? -9.985  -7.039  58.514  1.00 33.57  ? 162 LEU F CD2 1 
ATOM   2745 N N   . MET F 2 73  ? -13.733 -9.516  61.826  1.00 28.46  ? 163 MET F N   1 
ATOM   2746 C CA  . MET F 2 73  ? -14.229 -10.396 62.880  1.00 27.35  ? 163 MET F CA  1 
ATOM   2747 C C   . MET F 2 73  ? -14.972 -11.583 62.302  1.00 29.51  ? 163 MET F C   1 
ATOM   2748 O O   . MET F 2 73  ? -15.686 -11.431 61.321  1.00 28.36  ? 163 MET F O   1 
ATOM   2749 C CB  . MET F 2 73  ? -15.192 -9.636  63.804  1.00 29.73  ? 163 MET F CB  1 
ATOM   2750 C CG  . MET F 2 73  ? -14.531 -8.785  64.842  1.00 33.58  ? 163 MET F CG  1 
ATOM   2751 S SD  . MET F 2 73  ? -15.812 -7.893  65.750  1.00 38.15  ? 163 MET F SD  1 
ATOM   2752 C CE  . MET F 2 73  ? -16.070 -8.970  67.086  1.00 35.12  ? 163 MET F CE  1 
ATOM   2753 N N   . ASP F 2 74  ? -14.853 -12.753 62.930  1.00 25.67  ? 164 ASP F N   1 
ATOM   2754 C CA  . ASP F 2 74  ? -15.627 -13.908 62.501  1.00 25.14  ? 164 ASP F CA  1 
ATOM   2755 C C   . ASP F 2 74  ? -16.962 -13.893 63.260  1.00 27.74  ? 164 ASP F C   1 
ATOM   2756 O O   . ASP F 2 74  ? -17.040 -13.360 64.369  1.00 24.87  ? 164 ASP F O   1 
ATOM   2757 C CB  . ASP F 2 74  ? -14.858 -15.224 62.741  1.00 27.78  ? 164 ASP F CB  1 
ATOM   2758 C CG  . ASP F 2 74  ? -13.539 -15.368 61.996  1.00 38.67  ? 164 ASP F CG  1 
ATOM   2759 O OD1 . ASP F 2 74  ? -13.532 -15.200 60.754  1.00 40.67  ? 164 ASP F OD1 1 
ATOM   2760 O OD2 . ASP F 2 74  ? -12.534 -15.725 62.640  1.00 45.17  ? 164 ASP F OD2 1 
ATOM   2761 N N   . VAL F 2 75  ? -18.016 -14.447 62.659  1.00 25.56  ? 165 VAL F N   1 
ATOM   2762 C CA  . VAL F 2 75  ? -19.328 -14.513 63.306  1.00 25.34  ? 165 VAL F CA  1 
ATOM   2763 C C   . VAL F 2 75  ? -19.169 -15.345 64.608  1.00 28.12  ? 165 VAL F C   1 
ATOM   2764 O O   . VAL F 2 75  ? -18.817 -16.522 64.547  1.00 27.04  ? 165 VAL F O   1 
ATOM   2765 C CB  . VAL F 2 75  ? -20.427 -15.072 62.357  1.00 29.18  ? 165 VAL F CB  1 
ATOM   2766 C CG1 . VAL F 2 75  ? -21.794 -15.069 63.035  1.00 29.32  ? 165 VAL F CG1 1 
ATOM   2767 C CG2 . VAL F 2 75  ? -20.487 -14.282 61.059  1.00 28.83  ? 165 VAL F CG2 1 
ATOM   2768 N N   . GLY F 2 76  ? -19.362 -14.697 65.756  1.00 24.41  ? 166 GLY F N   1 
ATOM   2769 C CA  . GLY F 2 76  ? -19.199 -15.322 67.070  1.00 23.93  ? 166 GLY F CA  1 
ATOM   2770 C C   . GLY F 2 76  ? -17.984 -14.845 67.844  1.00 26.42  ? 166 GLY F C   1 
ATOM   2771 O O   . GLY F 2 76  ? -17.738 -15.297 68.964  1.00 26.36  ? 166 GLY F O   1 
ATOM   2772 N N   . GLU F 2 77  ? -17.227 -13.910 67.276  1.00 22.25  ? 167 GLU F N   1 
ATOM   2773 C CA  . GLU F 2 77  ? -16.033 -13.388 67.911  1.00 21.61  ? 167 GLU F CA  1 
ATOM   2774 C C   . GLU F 2 77  ? -16.339 -12.201 68.841  1.00 25.82  ? 167 GLU F C   1 
ATOM   2775 O O   . GLU F 2 77  ? -17.265 -11.436 68.595  1.00 25.71  ? 167 GLU F O   1 
ATOM   2776 C CB  . GLU F 2 77  ? -15.031 -12.975 66.821  1.00 23.03  ? 167 GLU F CB  1 
ATOM   2777 C CG  . GLU F 2 77  ? -13.666 -12.548 67.335  1.00 31.36  ? 167 GLU F CG  1 
ATOM   2778 C CD  . GLU F 2 77  ? -12.746 -11.935 66.305  1.00 43.46  ? 167 GLU F CD  1 
ATOM   2779 O OE1 . GLU F 2 77  ? -12.531 -12.553 65.239  1.00 29.34  ? 167 GLU F OE1 1 
ATOM   2780 O OE2 . GLU F 2 77  ? -12.191 -10.855 66.594  1.00 42.33  ? 167 GLU F OE2 1 
ATOM   2781 N N   . THR F 2 78  ? -15.545 -12.058 69.905  1.00 22.45  ? 168 THR F N   1 
ATOM   2782 C CA  . THR F 2 78  ? -15.599 -10.931 70.824  1.00 23.62  ? 168 THR F CA  1 
ATOM   2783 C C   . THR F 2 78  ? -14.257 -10.257 70.715  1.00 31.87  ? 168 THR F C   1 
ATOM   2784 O O   . THR F 2 78  ? -13.218 -10.904 70.925  1.00 33.03  ? 168 THR F O   1 
ATOM   2785 C CB  . THR F 2 78  ? -15.964 -11.341 72.248  1.00 26.36  ? 168 THR F CB  1 
ATOM   2786 O OG1 . THR F 2 78  ? -17.250 -11.958 72.228  1.00 26.80  ? 168 THR F OG1 1 
ATOM   2787 C CG2 . THR F 2 78  ? -15.970 -10.151 73.212  1.00 19.51  ? 168 THR F CG2 1 
ATOM   2788 N N   . ALA F 2 79  ? -14.273 -8.977  70.331  1.00 28.67  ? 169 ALA F N   1 
ATOM   2789 C CA  . ALA F 2 79  ? -13.053 -8.218  70.135  1.00 28.99  ? 169 ALA F CA  1 
ATOM   2790 C C   . ALA F 2 79  ? -13.111 -6.853  70.794  1.00 32.97  ? 169 ALA F C   1 
ATOM   2791 O O   . ALA F 2 79  ? -14.187 -6.293  71.003  1.00 32.34  ? 169 ALA F O   1 
ATOM   2792 C CB  . ALA F 2 79  ? -12.770 -8.071  68.647  1.00 29.98  ? 169 ALA F CB  1 
ATOM   2793 N N   . MET F 2 80  ? -11.934 -6.340  71.154  1.00 31.37  ? 170 MET F N   1 
ATOM   2794 C CA  . MET F 2 80  ? -11.743 -5.020  71.730  1.00 31.61  ? 170 MET F CA  1 
ATOM   2795 C C   . MET F 2 80  ? -11.171 -4.145  70.632  1.00 34.93  ? 170 MET F C   1 
ATOM   2796 O O   . MET F 2 80  ? -10.182 -4.529  70.006  1.00 34.93  ? 170 MET F O   1 
ATOM   2797 C CB  . MET F 2 80  ? -10.809 -5.118  72.938  1.00 34.47  ? 170 MET F CB  1 
ATOM   2798 C CG  . MET F 2 80  ? -10.476 -3.803  73.564  1.00 39.51  ? 170 MET F CG  1 
ATOM   2799 S SD  . MET F 2 80  ? -9.819  -4.031  75.238  1.00 45.56  ? 170 MET F SD  1 
ATOM   2800 C CE  . MET F 2 80  ? -11.294 -4.581  76.113  0.00 42.20  ? 170 MET F CE  1 
ATOM   2801 N N   . VAL F 2 81  ? -11.827 -3.016  70.349  1.00 31.16  ? 171 VAL F N   1 
ATOM   2802 C CA  . VAL F 2 81  ? -11.368 -2.121  69.294  1.00 31.33  ? 171 VAL F CA  1 
ATOM   2803 C C   . VAL F 2 81  ? -11.125 -0.731  69.852  1.00 34.71  ? 171 VAL F C   1 
ATOM   2804 O O   . VAL F 2 81  ? -12.013 -0.159  70.474  1.00 33.37  ? 171 VAL F O   1 
ATOM   2805 C CB  . VAL F 2 81  ? -12.260 -2.115  68.020  1.00 35.11  ? 171 VAL F CB  1 
ATOM   2806 C CG1 . VAL F 2 81  ? -12.000 -3.389  67.233  1.00 34.64  ? 171 VAL F CG1 1 
ATOM   2807 C CG2 . VAL F 2 81  ? -13.739 -1.980  68.315  1.00 35.11  ? 171 VAL F CG2 1 
ATOM   2808 N N   . THR F 2 82  ? -9.895  -0.217  69.684  1.00 31.39  ? 172 THR F N   1 
ATOM   2809 C CA  . THR F 2 82  ? -9.575  1.139   70.132  1.00 30.85  ? 172 THR F CA  1 
ATOM   2810 C C   . THR F 2 82  ? -9.631  1.997   68.896  1.00 33.97  ? 172 THR F C   1 
ATOM   2811 O O   . THR F 2 82  ? -8.949  1.699   67.915  1.00 33.07  ? 172 THR F O   1 
ATOM   2812 C CB  . THR F 2 82  ? -8.239  1.234   70.895  1.00 34.70  ? 172 THR F CB  1 
ATOM   2813 O OG1 . THR F 2 82  ? -7.150  0.947   70.019  1.00 38.21  ? 172 THR F OG1 1 
ATOM   2814 C CG2 . THR F 2 82  ? -8.201  0.362   72.142  1.00 31.39  ? 172 THR F CG2 1 
ATOM   2815 N N   . ALA F 2 83  ? -10.477 3.022   68.908  1.00 31.65  ? 173 ALA F N   1 
ATOM   2816 C CA  . ALA F 2 83  ? -10.620 3.875   67.734  1.00 31.31  ? 173 ALA F CA  1 
ATOM   2817 C C   . ALA F 2 83  ? -10.492 5.343   68.073  1.00 35.53  ? 173 ALA F C   1 
ATOM   2818 O O   . ALA F 2 83  ? -11.040 5.803   69.076  1.00 35.33  ? 173 ALA F O   1 
ATOM   2819 C CB  . ALA F 2 83  ? -11.959 3.617   67.063  1.00 31.91  ? 173 ALA F CB  1 
ATOM   2820 N N   . ASP F 2 84  ? -9.795  6.091   67.203  1.00 32.91  ? 174 ASP F N   1 
ATOM   2821 C CA  . ASP F 2 84  ? -9.647  7.539   67.312  1.00 33.18  ? 174 ASP F CA  1 
ATOM   2822 C C   . ASP F 2 84  ? -10.997 8.186   66.988  1.00 36.39  ? 174 ASP F C   1 
ATOM   2823 O O   . ASP F 2 84  ? -11.811 7.577   66.286  1.00 35.41  ? 174 ASP F O   1 
ATOM   2824 C CB  . ASP F 2 84  ? -8.546  8.032   66.360  1.00 35.63  ? 174 ASP F CB  1 
ATOM   2825 C CG  . ASP F 2 84  ? -8.217  9.506   66.490  1.00 49.18  ? 174 ASP F CG  1 
ATOM   2826 O OD1 . ASP F 2 84  ? -8.620  10.286  65.591  1.00 50.77  ? 174 ASP F OD1 1 
ATOM   2827 O OD2 . ASP F 2 84  ? -7.567  9.882   67.495  1.00 52.41  ? 174 ASP F OD2 1 
ATOM   2828 N N   . SER F 2 85  ? -11.230 9.406   67.493  1.00 33.16  ? 175 SER F N   1 
ATOM   2829 C CA  . SER F 2 85  ? -12.470 10.164  67.320  1.00 32.87  ? 175 SER F CA  1 
ATOM   2830 C C   . SER F 2 85  ? -12.899 10.339  65.875  1.00 37.85  ? 175 SER F C   1 
ATOM   2831 O O   . SER F 2 85  ? -14.097 10.389  65.623  1.00 37.64  ? 175 SER F O   1 
ATOM   2832 C CB  . SER F 2 85  ? -12.335 11.540  67.945  1.00 36.52  ? 175 SER F CB  1 
ATOM   2833 O OG  . SER F 2 85  ? -11.231 12.251  67.405  1.00 48.95  ? 175 SER F OG  1 
ATOM   2834 N N   . LYS F 2 86  ? -11.944 10.430  64.930  1.00 35.45  ? 176 LYS F N   1 
ATOM   2835 C CA  . LYS F 2 86  ? -12.235 10.642  63.511  1.00 35.72  ? 176 LYS F CA  1 
ATOM   2836 C C   . LYS F 2 86  ? -13.030 9.468   62.880  1.00 40.59  ? 176 LYS F C   1 
ATOM   2837 O O   . LYS F 2 86  ? -13.740 9.683   61.893  1.00 39.17  ? 176 LYS F O   1 
ATOM   2838 C CB  . LYS F 2 86  ? -10.955 10.958  62.712  1.00 38.39  ? 176 LYS F CB  1 
ATOM   2839 C CG  . LYS F 2 86  ? -9.941  9.829   62.575  1.00 52.24  ? 176 LYS F CG  1 
ATOM   2840 C CD  . LYS F 2 86  ? -9.118  9.915   61.264  1.00 63.49  ? 176 LYS F CD  1 
ATOM   2841 C CE  . LYS F 2 86  ? -9.832  10.172  59.936  1.00 74.08  ? 176 LYS F CE  1 
ATOM   2842 N NZ  . LYS F 2 86  ? -8.947  9.901   58.771  1.00 83.88  ? 176 LYS F NZ  1 
ATOM   2843 N N   . TYR F 2 87  ? -12.945 8.262   63.469  1.00 38.52  ? 177 TYR F N   1 
ATOM   2844 C CA  . TYR F 2 87  ? -13.704 7.100   62.989  1.00 39.09  ? 177 TYR F CA  1 
ATOM   2845 C C   . TYR F 2 87  ? -14.959 6.889   63.841  1.00 42.49  ? 177 TYR F C   1 
ATOM   2846 O O   . TYR F 2 87  ? -15.747 5.986   63.565  1.00 42.36  ? 177 TYR F O   1 
ATOM   2847 C CB  . TYR F 2 87  ? -12.827 5.835   62.989  1.00 40.86  ? 177 TYR F CB  1 
ATOM   2848 C CG  . TYR F 2 87  ? -11.536 6.024   62.226  1.00 43.84  ? 177 TYR F CG  1 
ATOM   2849 C CD1 . TYR F 2 87  ? -11.540 6.190   60.843  1.00 46.23  ? 177 TYR F CD1 1 
ATOM   2850 C CD2 . TYR F 2 87  ? -10.311 6.062   62.887  1.00 44.97  ? 177 TYR F CD2 1 
ATOM   2851 C CE1 . TYR F 2 87  ? -10.354 6.385   60.137  1.00 49.00  ? 177 TYR F CE1 1 
ATOM   2852 C CE2 . TYR F 2 87  ? -9.118  6.258   62.191  1.00 46.50  ? 177 TYR F CE2 1 
ATOM   2853 C CZ  . TYR F 2 87  ? -9.144  6.426   60.816  1.00 58.65  ? 177 TYR F CZ  1 
ATOM   2854 O OH  . TYR F 2 87  ? -7.965  6.629   60.128  1.00 62.89  ? 177 TYR F OH  1 
ATOM   2855 N N   . CYS F 2 88  ? -15.153 7.755   64.846  1.00 38.04  ? 178 CYS F N   1 
ATOM   2856 C CA  . CYS F 2 88  ? -16.243 7.691   65.797  1.00 37.38  ? 178 CYS F CA  1 
ATOM   2857 C C   . CYS F 2 88  ? -17.178 8.922   65.719  1.00 40.30  ? 178 CYS F C   1 
ATOM   2858 O O   . CYS F 2 88  ? -17.848 9.110   64.702  1.00 38.51  ? 178 CYS F O   1 
ATOM   2859 C CB  . CYS F 2 88  ? -15.680 7.505   67.201  1.00 37.74  ? 178 CYS F CB  1 
ATOM   2860 S SG  . CYS F 2 88  ? -14.725 5.983   67.421  1.00 41.48  ? 178 CYS F SG  1 
ATOM   2861 N N   . TYR F 2 89  ? -17.246 9.733   66.798  1.00 37.19  ? 179 TYR F N   1 
ATOM   2862 C CA  . TYR F 2 89  ? -18.160 10.870  66.893  1.00 37.48  ? 179 TYR F CA  1 
ATOM   2863 C C   . TYR F 2 89  ? -17.466 12.235  66.655  1.00 43.77  ? 179 TYR F C   1 
ATOM   2864 O O   . TYR F 2 89  ? -18.080 13.283  66.835  1.00 43.32  ? 179 TYR F O   1 
ATOM   2865 C CB  . TYR F 2 89  ? -18.914 10.818  68.233  1.00 38.81  ? 179 TYR F CB  1 
ATOM   2866 C CG  . TYR F 2 89  ? -19.773 9.568   68.337  1.00 40.55  ? 179 TYR F CG  1 
ATOM   2867 C CD1 . TYR F 2 89  ? -20.987 9.475   67.665  1.00 42.68  ? 179 TYR F CD1 1 
ATOM   2868 C CD2 . TYR F 2 89  ? -19.314 8.436   69.004  1.00 41.06  ? 179 TYR F CD2 1 
ATOM   2869 C CE1 . TYR F 2 89  ? -21.754 8.310   67.708  1.00 44.80  ? 179 TYR F CE1 1 
ATOM   2870 C CE2 . TYR F 2 89  ? -20.064 7.261   69.039  1.00 42.02  ? 179 TYR F CE2 1 
ATOM   2871 C CZ  . TYR F 2 89  ? -21.290 7.204   68.398  1.00 51.74  ? 179 TYR F CZ  1 
ATOM   2872 O OH  . TYR F 2 89  ? -22.038 6.050   68.429  1.00 55.95  ? 179 TYR F OH  1 
ATOM   2873 N N   . GLY F 2 90  ? -16.233 12.185  66.162  1.00 43.00  ? 180 GLY F N   1 
ATOM   2874 C CA  . GLY F 2 90  ? -15.425 13.321  65.731  1.00 44.06  ? 180 GLY F CA  1 
ATOM   2875 C C   . GLY F 2 90  ? -15.229 14.548  66.600  1.00 51.28  ? 180 GLY F C   1 
ATOM   2876 O O   . GLY F 2 90  ? -15.299 14.490  67.832  1.00 51.46  ? 180 GLY F O   1 
ATOM   2877 N N   . PRO F 2 91  ? -14.908 15.681  65.936  1.00 49.74  ? 181 PRO F N   1 
ATOM   2878 C CA  . PRO F 2 91  ? -14.647 16.933  66.660  1.00 50.05  ? 181 PRO F CA  1 
ATOM   2879 C C   . PRO F 2 91  ? -15.896 17.613  67.250  1.00 53.64  ? 181 PRO F C   1 
ATOM   2880 O O   . PRO F 2 91  ? -15.812 18.793  67.596  1.00 53.43  ? 181 PRO F O   1 
ATOM   2881 C CB  . PRO F 2 91  ? -14.030 17.828  65.567  1.00 51.96  ? 181 PRO F CB  1 
ATOM   2882 C CG  . PRO F 2 91  ? -13.649 16.904  64.450  1.00 56.16  ? 181 PRO F CG  1 
ATOM   2883 C CD  . PRO F 2 91  ? -14.727 15.882  64.488  1.00 51.66  ? 181 PRO F CD  1 
ATOM   2884 N N   . GLN F 2 92  ? -17.035 16.898  67.389  1.00 49.98  ? 182 GLN F N   1 
ATOM   2885 C CA  . GLN F 2 92  ? -18.259 17.507  67.906  1.00 50.13  ? 182 GLN F CA  1 
ATOM   2886 C C   . GLN F 2 92  ? -18.950 16.703  69.021  1.00 55.50  ? 182 GLN F C   1 
ATOM   2887 O O   . GLN F 2 92  ? -19.634 17.310  69.847  1.00 55.24  ? 182 GLN F O   1 
ATOM   2888 C CB  . GLN F 2 92  ? -19.253 17.742  66.761  1.00 51.38  ? 182 GLN F CB  1 
ATOM   2889 N N   . GLY F 2 93  ? -18.810 15.373  69.018  1.00 52.47  ? 183 GLY F N   1 
ATOM   2890 C CA  . GLY F 2 93  ? -19.454 14.517  70.012  1.00 52.42  ? 183 GLY F CA  1 
ATOM   2891 C C   . GLY F 2 93  ? -20.878 14.143  69.648  1.00 57.54  ? 183 GLY F C   1 
ATOM   2892 O O   . GLY F 2 93  ? -21.301 14.419  68.520  1.00 57.29  ? 183 GLY F O   1 
ATOM   2893 N N   . ARG F 2 94  ? -21.645 13.518  70.592  1.00 54.74  ? 184 ARG F N   1 
ATOM   2894 C CA  . ARG F 2 94  ? -23.016 13.069  70.293  1.00 55.22  ? 184 ARG F CA  1 
ATOM   2895 C C   . ARG F 2 94  ? -24.059 13.290  71.429  1.00 61.48  ? 184 ARG F C   1 
ATOM   2896 O O   . ARG F 2 94  ? -23.718 13.836  72.483  1.00 60.87  ? 184 ARG F O   1 
ATOM   2897 C CB  . ARG F 2 94  ? -23.005 11.587  69.907  1.00 55.16  ? 184 ARG F CB  1 
ATOM   2898 N N   . SER F 2 95  ? -25.354 12.883  71.157  1.00 59.16  ? 185 SER F N   1 
ATOM   2899 C CA  . SER F 2 95  ? -26.543 12.969  72.027  1.00 59.22  ? 185 SER F CA  1 
ATOM   2900 C C   . SER F 2 95  ? -26.363 12.113  73.300  1.00 63.09  ? 185 SER F C   1 
ATOM   2901 O O   . SER F 2 95  ? -26.314 12.736  74.367  1.00 62.74  ? 185 SER F O   1 
ATOM   2902 C CB  . SER F 2 95  ? -27.818 12.590  71.273  1.00 63.33  ? 185 SER F CB  1 
ATOM   2903 N N   . PRO F 2 96  ? -26.207 10.746  73.266  1.00 59.14  ? 186 PRO F N   1 
ATOM   2904 C CA  . PRO F 2 96  ? -25.883 10.017  74.509  1.00 58.42  ? 186 PRO F CA  1 
ATOM   2905 C C   . PRO F 2 96  ? -24.380 10.227  74.741  1.00 60.59  ? 186 PRO F C   1 
ATOM   2906 O O   . PRO F 2 96  ? -23.558 9.350   74.491  1.00 60.90  ? 186 PRO F O   1 
ATOM   2907 C CB  . PRO F 2 96  ? -26.284 8.563   74.188  1.00 60.25  ? 186 PRO F CB  1 
ATOM   2908 C CG  . PRO F 2 96  ? -26.732 8.561   72.739  1.00 64.85  ? 186 PRO F CG  1 
ATOM   2909 C CD  . PRO F 2 96  ? -26.206 9.812   72.123  1.00 60.63  ? 186 PRO F CD  1 
ATOM   2910 N N   . TYR F 2 97  ? -24.067 11.460  75.187  1.00 54.89  ? 187 TYR F N   1 
ATOM   2911 C CA  . TYR F 2 97  ? -22.843 12.243  75.331  1.00 53.43  ? 187 TYR F CA  1 
ATOM   2912 C C   . TYR F 2 97  ? -21.537 11.502  75.077  1.00 55.45  ? 187 TYR F C   1 
ATOM   2913 O O   . TYR F 2 97  ? -21.229 10.476  75.688  1.00 55.32  ? 187 TYR F O   1 
ATOM   2914 C CB  . TYR F 2 97  ? -22.723 12.987  76.679  1.00 54.00  ? 187 TYR F CB  1 
ATOM   2915 C CG  . TYR F 2 97  ? -21.617 14.029  76.634  1.00 55.08  ? 187 TYR F CG  1 
ATOM   2916 C CD1 . TYR F 2 97  ? -21.695 15.120  75.772  1.00 56.77  ? 187 TYR F CD1 1 
ATOM   2917 C CD2 . TYR F 2 97  ? -20.436 13.852  77.353  1.00 55.84  ? 187 TYR F CD2 1 
ATOM   2918 C CE1 . TYR F 2 97  ? -20.634 16.013  75.635  1.00 57.62  ? 187 TYR F CE1 1 
ATOM   2919 C CE2 . TYR F 2 97  ? -19.381 14.760  77.251  1.00 56.50  ? 187 TYR F CE2 1 
ATOM   2920 C CZ  . TYR F 2 97  ? -19.485 15.842  76.392  1.00 63.97  ? 187 TYR F CZ  1 
ATOM   2921 O OH  . TYR F 2 97  ? -18.458 16.757  76.302  1.00 64.78  ? 187 TYR F OH  1 
ATOM   2922 N N   . ILE F 2 98  ? -20.750 12.127  74.187  1.00 50.02  ? 188 ILE F N   1 
ATOM   2923 C CA  . ILE F 2 98  ? -19.392 11.796  73.783  1.00 48.81  ? 188 ILE F CA  1 
ATOM   2924 C C   . ILE F 2 98  ? -18.649 13.139  73.697  1.00 52.79  ? 188 ILE F C   1 
ATOM   2925 O O   . ILE F 2 98  ? -19.108 14.026  72.975  1.00 52.84  ? 188 ILE F O   1 
ATOM   2926 C CB  . ILE F 2 98  ? -19.322 10.966  72.466  1.00 51.13  ? 188 ILE F CB  1 
ATOM   2927 C CG1 . ILE F 2 98  ? -19.871 9.545   72.667  1.00 51.17  ? 188 ILE F CG1 1 
ATOM   2928 C CG2 . ILE F 2 98  ? -17.889 10.900  71.931  1.00 51.15  ? 188 ILE F CG2 1 
ATOM   2929 C CD1 . ILE F 2 98  ? -21.197 9.301   72.055  1.00 55.01  ? 188 ILE F CD1 1 
ATOM   2930 N N   . PRO F 2 99  ? -17.542 13.344  74.448  1.00 49.05  ? 189 PRO F N   1 
ATOM   2931 C CA  . PRO F 2 99  ? -16.834 14.640  74.367  1.00 48.45  ? 189 PRO F CA  1 
ATOM   2932 C C   . PRO F 2 99  ? -16.184 14.886  73.004  1.00 51.70  ? 189 PRO F C   1 
ATOM   2933 O O   . PRO F 2 99  ? -15.855 13.908  72.332  1.00 50.73  ? 189 PRO F O   1 
ATOM   2934 C CB  . PRO F 2 99  ? -15.758 14.537  75.458  1.00 50.07  ? 189 PRO F CB  1 
ATOM   2935 C CG  . PRO F 2 99  ? -16.103 13.337  76.267  1.00 54.79  ? 189 PRO F CG  1 
ATOM   2936 C CD  . PRO F 2 99  ? -16.868 12.419  75.381  1.00 50.51  ? 189 PRO F CD  1 
ATOM   2937 N N   . PRO F 2 100 ? -15.958 16.155  72.565  1.00 48.49  ? 190 PRO F N   1 
ATOM   2938 C CA  . PRO F 2 100 ? -15.258 16.355  71.285  1.00 48.35  ? 190 PRO F CA  1 
ATOM   2939 C C   . PRO F 2 100 ? -13.875 15.712  71.323  1.00 53.37  ? 190 PRO F C   1 
ATOM   2940 O O   . PRO F 2 100 ? -13.237 15.679  72.381  1.00 53.42  ? 190 PRO F O   1 
ATOM   2941 C CB  . PRO F 2 100 ? -15.154 17.879  71.151  1.00 49.84  ? 190 PRO F CB  1 
ATOM   2942 C CG  . PRO F 2 100 ? -16.140 18.427  72.103  1.00 53.95  ? 190 PRO F CG  1 
ATOM   2943 C CD  . PRO F 2 100 ? -16.249 17.448  73.217  1.00 49.55  ? 190 PRO F CD  1 
ATOM   2944 N N   . HIS F 2 101 ? -13.442 15.157  70.179  1.00 50.09  ? 191 HIS F N   1 
ATOM   2945 C CA  . HIS F 2 101 ? -12.158 14.471  69.986  1.00 49.83  ? 191 HIS F CA  1 
ATOM   2946 C C   . HIS F 2 101 ? -11.922 13.344  71.029  1.00 51.74  ? 191 HIS F C   1 
ATOM   2947 O O   . HIS F 2 101 ? -10.797 13.158  71.499  1.00 51.85  ? 191 HIS F O   1 
ATOM   2948 C CB  . HIS F 2 101 ? -10.988 15.470  69.989  1.00 51.04  ? 191 HIS F CB  1 
ATOM   2949 C CG  . HIS F 2 101 ? -11.170 16.585  69.019  1.00 55.13  ? 191 HIS F CG  1 
ATOM   2950 N ND1 . HIS F 2 101 ? -11.825 17.746  69.379  1.00 57.37  ? 191 HIS F ND1 1 
ATOM   2951 C CD2 . HIS F 2 101 ? -10.805 16.670  67.718  1.00 57.44  ? 191 HIS F CD2 1 
ATOM   2952 C CE1 . HIS F 2 101 ? -11.819 18.510  68.299  1.00 57.02  ? 191 HIS F CE1 1 
ATOM   2953 N NE2 . HIS F 2 101 ? -11.215 17.902  67.274  1.00 57.36  ? 191 HIS F NE2 1 
ATOM   2954 N N   . ALA F 2 102 ? -12.972 12.595  71.388  1.00 46.58  ? 192 ALA F N   1 
ATOM   2955 C CA  . ALA F 2 102 ? -12.808 11.519  72.361  1.00 45.90  ? 192 ALA F CA  1 
ATOM   2956 C C   . ALA F 2 102 ? -12.659 10.165  71.679  1.00 48.15  ? 192 ALA F C   1 
ATOM   2957 O O   . ALA F 2 102 ? -13.530 9.733   70.917  1.00 47.23  ? 192 ALA F O   1 
ATOM   2958 C CB  . ALA F 2 102 ? -13.964 11.488  73.343  1.00 46.62  ? 192 ALA F CB  1 
ATOM   2959 N N   . ALA F 2 103 ? -11.527 9.514   71.969  1.00 43.65  ? 193 ALA F N   1 
ATOM   2960 C CA  . ALA F 2 103 ? -11.142 8.193   71.501  1.00 42.94  ? 193 ALA F CA  1 
ATOM   2961 C C   . ALA F 2 103 ? -12.007 7.161   72.206  1.00 45.53  ? 193 ALA F C   1 
ATOM   2962 O O   . ALA F 2 103 ? -12.272 7.302   73.402  1.00 44.88  ? 193 ALA F O   1 
ATOM   2963 C CB  . ALA F 2 103 ? -9.668  7.960   71.797  1.00 43.72  ? 193 ALA F CB  1 
ATOM   2964 N N   . LEU F 2 104 ? -12.484 6.147   71.476  1.00 41.59  ? 194 LEU F N   1 
ATOM   2965 C CA  . LEU F 2 104 ? -13.367 5.152   72.074  1.00 41.03  ? 194 LEU F CA  1 
ATOM   2966 C C   . LEU F 2 104 ? -12.764 3.750   72.129  1.00 45.62  ? 194 LEU F C   1 
ATOM   2967 O O   . LEU F 2 104 ? -11.948 3.380   71.288  1.00 45.33  ? 194 LEU F O   1 
ATOM   2968 C CB  . LEU F 2 104 ? -14.704 5.088   71.311  1.00 40.74  ? 194 LEU F CB  1 
ATOM   2969 C CG  . LEU F 2 104 ? -15.617 6.327   71.297  1.00 44.90  ? 194 LEU F CG  1 
ATOM   2970 C CD1 . LEU F 2 104 ? -16.812 6.081   70.427  1.00 43.99  ? 194 LEU F CD1 1 
ATOM   2971 C CD2 . LEU F 2 104 ? -16.095 6.723   72.687  1.00 47.29  ? 194 LEU F CD2 1 
ATOM   2972 N N   . CYS F 2 105 ? -13.191 2.981   73.135  1.00 42.98  ? 195 CYS F N   1 
ATOM   2973 C CA  . CYS F 2 105 ? -12.886 1.575   73.313  1.00 43.12  ? 195 CYS F CA  1 
ATOM   2974 C C   . CYS F 2 105 ? -14.193 0.839   73.139  1.00 43.50  ? 195 CYS F C   1 
ATOM   2975 O O   . CYS F 2 105 ? -15.120 1.004   73.934  1.00 43.21  ? 195 CYS F O   1 
ATOM   2976 C CB  . CYS F 2 105 ? -12.236 1.276   74.660  1.00 44.63  ? 195 CYS F CB  1 
ATOM   2977 S SG  . CYS F 2 105 ? -11.606 -0.419  74.790  1.00 49.44  ? 195 CYS F SG  1 
ATOM   2978 N N   . LEU F 2 106 ? -14.294 0.090   72.052  1.00 37.82  ? 196 LEU F N   1 
ATOM   2979 C CA  . LEU F 2 106 ? -15.503 -0.628  71.701  1.00 36.25  ? 196 LEU F CA  1 
ATOM   2980 C C   . LEU F 2 106 ? -15.320 -2.122  71.951  1.00 39.41  ? 196 LEU F C   1 
ATOM   2981 O O   . LEU F 2 106 ? -14.428 -2.739  71.370  1.00 39.42  ? 196 LEU F O   1 
ATOM   2982 C CB  . LEU F 2 106 ? -15.866 -0.364  70.219  1.00 35.72  ? 196 LEU F CB  1 
ATOM   2983 C CG  . LEU F 2 106 ? -15.954 1.080   69.700  1.00 38.76  ? 196 LEU F CG  1 
ATOM   2984 C CD1 . LEU F 2 106 ? -16.027 1.092   68.194  1.00 38.57  ? 196 LEU F CD1 1 
ATOM   2985 C CD2 . LEU F 2 106 ? -17.187 1.773   70.217  1.00 39.61  ? 196 LEU F CD2 1 
ATOM   2986 N N   . GLU F 2 107 ? -16.145 -2.696  72.843  1.00 34.73  ? 197 GLU F N   1 
ATOM   2987 C CA  . GLU F 2 107 ? -16.121 -4.133  73.114  1.00 34.13  ? 197 GLU F CA  1 
ATOM   2988 C C   . GLU F 2 107 ? -17.271 -4.722  72.306  1.00 36.11  ? 197 GLU F C   1 
ATOM   2989 O O   . GLU F 2 107 ? -18.443 -4.583  72.668  1.00 35.46  ? 197 GLU F O   1 
ATOM   2990 C CB  . GLU F 2 107 ? -16.196 -4.453  74.619  1.00 35.77  ? 197 GLU F CB  1 
ATOM   2991 C CG  . GLU F 2 107 ? -15.798 -5.884  74.951  1.00 48.70  ? 197 GLU F CG  1 
ATOM   2992 C CD  . GLU F 2 107 ? -16.740 -6.606  75.897  1.00 76.50  ? 197 GLU F CD  1 
ATOM   2993 O OE1 . GLU F 2 107 ? -17.485 -7.501  75.432  1.00 72.81  ? 197 GLU F OE1 1 
ATOM   2994 O OE2 . GLU F 2 107 ? -16.740 -6.271  77.104  1.00 73.90  ? 197 GLU F OE2 1 
ATOM   2995 N N   . VAL F 2 108 ? -16.917 -5.306  71.158  1.00 31.09  ? 198 VAL F N   1 
ATOM   2996 C CA  . VAL F 2 108 ? -17.859 -5.816  70.173  1.00 29.61  ? 198 VAL F CA  1 
ATOM   2997 C C   . VAL F 2 108 ? -17.917 -7.317  70.232  1.00 29.73  ? 198 VAL F C   1 
ATOM   2998 O O   . VAL F 2 108 ? -16.877 -7.975  70.315  1.00 30.38  ? 198 VAL F O   1 
ATOM   2999 C CB  . VAL F 2 108 ? -17.492 -5.358  68.722  1.00 33.15  ? 198 VAL F CB  1 
ATOM   3000 C CG1 . VAL F 2 108 ? -18.684 -5.475  67.770  1.00 33.18  ? 198 VAL F CG1 1 
ATOM   3001 C CG2 . VAL F 2 108 ? -16.917 -3.946  68.698  1.00 32.70  ? 198 VAL F CG2 1 
ATOM   3002 N N   . THR F 2 109 ? -19.132 -7.842  70.094  1.00 21.92  ? 199 THR F N   1 
ATOM   3003 C CA  . THR F 2 109 ? -19.412 -9.259  69.997  1.00 20.81  ? 199 THR F CA  1 
ATOM   3004 C C   . THR F 2 109 ? -20.283 -9.423  68.769  1.00 26.76  ? 199 THR F C   1 
ATOM   3005 O O   . THR F 2 109 ? -21.469 -9.080  68.805  1.00 28.39  ? 199 THR F O   1 
ATOM   3006 C CB  . THR F 2 109 ? -20.028 -9.794  71.301  1.00 25.90  ? 199 THR F CB  1 
ATOM   3007 O OG1 . THR F 2 109 ? -19.089 -9.595  72.354  1.00 27.05  ? 199 THR F OG1 1 
ATOM   3008 C CG2 . THR F 2 109 ? -20.363 -11.274 71.222  1.00 20.76  ? 199 THR F CG2 1 
ATOM   3009 N N   . LEU F 2 110 ? -19.689 -9.870  67.656  1.00 23.33  ? 200 LEU F N   1 
ATOM   3010 C CA  . LEU F 2 110 ? -20.450 -10.135 66.441  1.00 22.93  ? 200 LEU F CA  1 
ATOM   3011 C C   . LEU F 2 110 ? -21.287 -11.397 66.688  1.00 26.43  ? 200 LEU F C   1 
ATOM   3012 O O   . LEU F 2 110 ? -20.737 -12.449 66.998  1.00 26.47  ? 200 LEU F O   1 
ATOM   3013 C CB  . LEU F 2 110 ? -19.505 -10.284 65.230  1.00 22.67  ? 200 LEU F CB  1 
ATOM   3014 C CG  . LEU F 2 110 ? -20.142 -10.623 63.879  1.00 26.57  ? 200 LEU F CG  1 
ATOM   3015 C CD1 . LEU F 2 110 ? -21.165 -9.569  63.455  1.00 26.81  ? 200 LEU F CD1 1 
ATOM   3016 C CD2 . LEU F 2 110 ? -19.075 -10.785 62.808  1.00 25.73  ? 200 LEU F CD2 1 
ATOM   3017 N N   . LYS F 2 111 ? -22.606 -11.266 66.635  1.00 22.37  ? 201 LYS F N   1 
ATOM   3018 C CA  . LYS F 2 111 ? -23.561 -12.340 66.946  1.00 21.73  ? 201 LYS F CA  1 
ATOM   3019 C C   . LYS F 2 111 ? -24.011 -13.079 65.692  1.00 27.71  ? 201 LYS F C   1 
ATOM   3020 O O   . LYS F 2 111 ? -23.839 -14.292 65.616  1.00 28.52  ? 201 LYS F O   1 
ATOM   3021 C CB  . LYS F 2 111 ? -24.779 -11.770 67.711  1.00 22.55  ? 201 LYS F CB  1 
ATOM   3022 C CG  . LYS F 2 111 ? -24.428 -11.163 69.077  1.00 28.38  ? 201 LYS F CG  1 
ATOM   3023 C CD  . LYS F 2 111 ? -25.573 -10.344 69.679  1.00 37.27  ? 201 LYS F CD  1 
ATOM   3024 C CE  . LYS F 2 111 ? -26.324 -11.086 70.750  1.00 55.77  ? 201 LYS F CE  1 
ATOM   3025 N NZ  . LYS F 2 111 ? -27.345 -10.222 71.398  1.00 71.52  ? 201 LYS F NZ  1 
ATOM   3026 N N   . THR F 2 112 ? -24.609 -12.370 64.724  1.00 24.56  ? 202 THR F N   1 
ATOM   3027 C CA  . THR F 2 112 ? -25.075 -12.964 63.468  1.00 25.01  ? 202 THR F CA  1 
ATOM   3028 C C   . THR F 2 112 ? -24.692 -12.090 62.276  1.00 29.08  ? 202 THR F C   1 
ATOM   3029 O O   . THR F 2 112 ? -24.340 -10.923 62.446  1.00 27.19  ? 202 THR F O   1 
ATOM   3030 C CB  . THR F 2 112 ? -26.602 -13.197 63.476  1.00 36.85  ? 202 THR F CB  1 
ATOM   3031 O OG1 . THR F 2 112 ? -27.275 -11.988 63.815  1.00 38.86  ? 202 THR F OG1 1 
ATOM   3032 C CG2 . THR F 2 112 ? -27.035 -14.326 64.400  1.00 34.40  ? 202 THR F CG2 1 
ATOM   3033 N N   . ALA F 2 113 ? -24.742 -12.678 61.075  1.00 29.60  ? 203 ALA F N   1 
ATOM   3034 C CA  . ALA F 2 113 ? -24.488 -12.032 59.789  1.00 30.09  ? 203 ALA F CA  1 
ATOM   3035 C C   . ALA F 2 113 ? -25.316 -12.746 58.746  1.00 36.80  ? 203 ALA F C   1 
ATOM   3036 O O   . ALA F 2 113 ? -25.060 -13.918 58.453  1.00 36.95  ? 203 ALA F O   1 
ATOM   3037 C CB  . ALA F 2 113 ? -23.004 -12.061 59.440  1.00 30.63  ? 203 ALA F CB  1 
ATOM   3038 N N   . VAL F 2 114 ? -26.375 -12.074 58.258  1.00 34.68  ? 204 VAL F N   1 
ATOM   3039 C CA  . VAL F 2 114 ? -27.271 -12.635 57.243  1.00 34.54  ? 204 VAL F CA  1 
ATOM   3040 C C   . VAL F 2 114 ? -27.125 -11.822 55.971  1.00 40.44  ? 204 VAL F C   1 
ATOM   3041 O O   . VAL F 2 114 ? -26.761 -10.652 56.036  1.00 40.48  ? 204 VAL F O   1 
ATOM   3042 C CB  . VAL F 2 114 ? -28.747 -12.740 57.718  1.00 37.92  ? 204 VAL F CB  1 
ATOM   3043 C CG1 . VAL F 2 114 ? -28.858 -13.641 58.947  1.00 37.49  ? 204 VAL F CG1 1 
ATOM   3044 C CG2 . VAL F 2 114 ? -29.358 -11.367 57.997  1.00 37.44  ? 204 VAL F CG2 1 
ATOM   3045 N N   . ASP F 2 115 ? -27.393 -12.433 54.816  1.00 38.56  ? 205 ASP F N   1 
ATOM   3046 C CA  . ASP F 2 115 ? -27.279 -11.746 53.535  1.00 39.05  ? 205 ASP F CA  1 
ATOM   3047 C C   . ASP F 2 115 ? -28.209 -10.537 53.483  1.00 43.45  ? 205 ASP F C   1 
ATOM   3048 O O   . ASP F 2 115 ? -29.306 -10.562 54.056  1.00 43.22  ? 205 ASP F O   1 
ATOM   3049 C CB  . ASP F 2 115 ? -27.562 -12.707 52.373  1.00 41.61  ? 205 ASP F CB  1 
ATOM   3050 C CG  . ASP F 2 115 ? -26.375 -13.563 51.965  1.00 57.06  ? 205 ASP F CG  1 
ATOM   3051 O OD1 . ASP F 2 115 ? -25.220 -13.123 52.175  1.00 57.99  ? 205 ASP F OD1 1 
ATOM   3052 O OD2 . ASP F 2 115 ? -26.600 -14.661 51.403  1.00 64.02  ? 205 ASP F OD2 1 
ATOM   3053 N N   . GLY F 2 116 ? -27.721 -9.466  52.866  1.00 39.93  ? 206 GLY F N   1 
ATOM   3054 C CA  . GLY F 2 116 ? -28.465 -8.222  52.716  1.00 39.59  ? 206 GLY F CA  1 
ATOM   3055 C C   . GLY F 2 116 ? -29.744 -8.405  51.918  1.00 43.13  ? 206 GLY F C   1 
ATOM   3056 O O   . GLY F 2 116 ? -29.813 -9.289  51.052  1.00 40.62  ? 206 GLY F O   1 
ATOM   3057 N N   . PRO F 2 117 ? -30.796 -7.608  52.210  1.00 40.90  ? 207 PRO F N   1 
ATOM   3058 C CA  . PRO F 2 117 ? -32.057 -7.789  51.477  1.00 40.81  ? 207 PRO F CA  1 
ATOM   3059 C C   . PRO F 2 117 ? -31.974 -7.336  50.026  1.00 44.32  ? 207 PRO F C   1 
ATOM   3060 O O   . PRO F 2 117 ? -31.230 -6.407  49.712  1.00 44.86  ? 207 PRO F O   1 
ATOM   3061 C CB  . PRO F 2 117 ? -33.042 -6.916  52.256  1.00 42.90  ? 207 PRO F CB  1 
ATOM   3062 C CG  . PRO F 2 117 ? -32.195 -5.864  52.897  1.00 47.20  ? 207 PRO F CG  1 
ATOM   3063 C CD  . PRO F 2 117 ? -30.899 -6.530  53.218  1.00 42.44  ? 207 PRO F CD  1 
ATOM   3064 N N   . ASP F 2 118 ? -32.718 -8.026  49.145  1.00 40.02  ? 208 ASP F N   1 
ATOM   3065 C CA  . ASP F 2 118 ? -32.836 -7.631  47.752  1.00 39.45  ? 208 ASP F CA  1 
ATOM   3066 C C   . ASP F 2 118 ? -33.875 -6.530  47.742  1.00 43.04  ? 208 ASP F C   1 
ATOM   3067 O O   . ASP F 2 118 ? -35.065 -6.801  47.926  1.00 41.92  ? 208 ASP F O   1 
ATOM   3068 C CB  . ASP F 2 118 ? -33.212 -8.806  46.832  1.00 41.09  ? 208 ASP F CB  1 
ATOM   3069 C CG  . ASP F 2 118 ? -33.329 -8.460  45.349  1.00 51.65  ? 208 ASP F CG  1 
ATOM   3070 O OD1 . ASP F 2 118 ? -33.045 -7.293  44.978  1.00 50.58  ? 208 ASP F OD1 1 
ATOM   3071 O OD2 . ASP F 2 118 ? -33.676 -9.363  44.555  1.00 60.58  ? 208 ASP F OD2 1 
ATOM   3072 N N   . LEU F 2 119 ? -33.410 -5.273  47.617  1.00 39.83  ? 209 LEU F N   1 
ATOM   3073 C CA  . LEU F 2 119 ? -34.256 -4.068  47.626  1.00 39.75  ? 209 LEU F CA  1 
ATOM   3074 C C   . LEU F 2 119 ? -35.432 -4.191  46.664  1.00 43.10  ? 209 LEU F C   1 
ATOM   3075 O O   . LEU F 2 119 ? -36.538 -3.768  46.994  1.00 43.06  ? 209 LEU F O   1 
ATOM   3076 C CB  . LEU F 2 119 ? -33.453 -2.800  47.284  1.00 39.86  ? 209 LEU F CB  1 
ATOM   3077 C CG  . LEU F 2 119 ? -32.233 -2.485  48.145  1.00 44.77  ? 209 LEU F CG  1 
ATOM   3078 C CD1 . LEU F 2 119 ? -30.994 -2.821  47.414  1.00 48.69  ? 209 LEU F CD1 1 
ATOM   3079 C CD2 . LEU F 2 119 ? -32.147 -1.026  48.493  1.00 45.10  ? 209 LEU F CD2 1 
ATOM   3080 N N   . GLU F 2 120 ? -35.196 -4.848  45.511  1.00 39.49  ? 210 GLU F N   1 
ATOM   3081 C CA  . GLU F 2 120 ? -36.161 -5.069  44.441  1.00 39.19  ? 210 GLU F CA  1 
ATOM   3082 C C   . GLU F 2 120 ? -37.239 -6.075  44.821  1.00 43.30  ? 210 GLU F C   1 
ATOM   3083 O O   . GLU F 2 120 ? -38.279 -6.110  44.157  1.00 43.69  ? 210 GLU F O   1 
ATOM   3084 C CB  . GLU F 2 120 ? -35.437 -5.552  43.177  1.00 40.57  ? 210 GLU F CB  1 
ATOM   3085 C CG  . GLU F 2 120 ? -34.614 -4.472  42.499  1.00 48.63  ? 210 GLU F CG  1 
ATOM   3086 C CD  . GLU F 2 120 ? -34.987 -4.273  41.048  1.00 68.84  ? 210 GLU F CD  1 
ATOM   3087 O OE1 . GLU F 2 120 ? -35.708 -3.295  40.745  1.00 60.41  ? 210 GLU F OE1 1 
ATOM   3088 O OE2 . GLU F 2 120 ? -34.592 -5.122  40.217  1.00 68.75  ? 210 GLU F OE2 1 
ATOM   3089 N N   . MET F 2 121 ? -37.003 -6.877  45.886  1.00 38.63  ? 211 MET F N   1 
ATOM   3090 C CA  . MET F 2 121 ? -37.906 -7.937  46.342  1.00 37.55  ? 211 MET F CA  1 
ATOM   3091 C C   . MET F 2 121 ? -38.559 -7.629  47.696  1.00 39.09  ? 211 MET F C   1 
ATOM   3092 O O   . MET F 2 121 ? -39.271 -8.477  48.235  1.00 38.63  ? 211 MET F O   1 
ATOM   3093 C CB  . MET F 2 121 ? -37.147 -9.279  46.403  1.00 39.75  ? 211 MET F CB  1 
ATOM   3094 C CG  . MET F 2 121 ? -36.899 -9.888  45.032  1.00 43.98  ? 211 MET F CG  1 
ATOM   3095 S SD  . MET F 2 121 ? -38.425 -10.189 44.071  1.00 48.55  ? 211 MET F SD  1 
ATOM   3096 C CE  . MET F 2 121 ? -37.856 -9.864  42.431  1.00 45.24  ? 211 MET F CE  1 
ATOM   3097 N N   . LEU F 2 122 ? -38.334 -6.422  48.235  1.00 34.67  ? 212 LEU F N   1 
ATOM   3098 C CA  . LEU F 2 122 ? -38.904 -5.998  49.523  1.00 33.42  ? 212 LEU F CA  1 
ATOM   3099 C C   . LEU F 2 122 ? -40.397 -5.751  49.429  1.00 36.63  ? 212 LEU F C   1 
ATOM   3100 O O   . LEU F 2 122 ? -40.879 -5.290  48.387  1.00 36.94  ? 212 LEU F O   1 
ATOM   3101 C CB  . LEU F 2 122 ? -38.228 -4.710  50.041  1.00 32.66  ? 212 LEU F CB  1 
ATOM   3102 C CG  . LEU F 2 122 ? -36.819 -4.827  50.600  1.00 36.35  ? 212 LEU F CG  1 
ATOM   3103 C CD1 . LEU F 2 122 ? -36.230 -3.458  50.843  1.00 36.38  ? 212 LEU F CD1 1 
ATOM   3104 C CD2 . LEU F 2 122 ? -36.789 -5.656  51.876  1.00 37.72  ? 212 LEU F CD2 1 
ATOM   3105 N N   . THR F 2 123 ? -41.123 -6.024  50.524  1.00 31.61  ? 213 THR F N   1 
ATOM   3106 C CA  . THR F 2 123 ? -42.554 -5.754  50.596  1.00 30.64  ? 213 THR F CA  1 
ATOM   3107 C C   . THR F 2 123 ? -42.708 -4.264  50.966  1.00 34.23  ? 213 THR F C   1 
ATOM   3108 O O   . THR F 2 123 ? -41.742 -3.662  51.438  1.00 34.04  ? 213 THR F O   1 
ATOM   3109 C CB  . THR F 2 123 ? -43.247 -6.743  51.564  1.00 36.91  ? 213 THR F CB  1 
ATOM   3110 O OG1 . THR F 2 123 ? -44.607 -6.914  51.161  1.00 44.86  ? 213 THR F OG1 1 
ATOM   3111 C CG2 . THR F 2 123 ? -43.202 -6.316  53.014  1.00 30.34  ? 213 THR F CG2 1 
ATOM   3112 N N   . GLY F 2 124 ? -43.899 -3.699  50.763  1.00 30.42  ? 214 GLY F N   1 
ATOM   3113 C CA  . GLY F 2 124 ? -44.202 -2.312  51.111  1.00 30.35  ? 214 GLY F CA  1 
ATOM   3114 C C   . GLY F 2 124 ? -43.905 -2.013  52.570  1.00 33.60  ? 214 GLY F C   1 
ATOM   3115 O O   . GLY F 2 124 ? -43.249 -1.014  52.871  1.00 33.04  ? 214 GLY F O   1 
ATOM   3116 N N   . GLN F 2 125 ? -44.309 -2.937  53.473  1.00 29.62  ? 215 GLN F N   1 
ATOM   3117 C CA  . GLN F 2 125 ? -44.095 -2.873  54.930  1.00 29.27  ? 215 GLN F CA  1 
ATOM   3118 C C   . GLN F 2 125 ? -42.599 -2.864  55.282  1.00 32.16  ? 215 GLN F C   1 
ATOM   3119 O O   . GLN F 2 125 ? -42.177 -2.087  56.135  1.00 31.59  ? 215 GLN F O   1 
ATOM   3120 C CB  . GLN F 2 125 ? -44.775 -4.064  55.643  1.00 30.50  ? 215 GLN F CB  1 
ATOM   3121 C CG  . GLN F 2 125 ? -46.283 -4.160  55.460  1.00 53.90  ? 215 GLN F CG  1 
ATOM   3122 C CD  . GLN F 2 125 ? -46.856 -5.340  56.193  1.00 71.28  ? 215 GLN F CD  1 
ATOM   3123 O OE1 . GLN F 2 125 ? -46.989 -5.330  57.423  1.00 65.73  ? 215 GLN F OE1 1 
ATOM   3124 N NE2 . GLN F 2 125 ? -47.241 -6.370  55.449  1.00 60.97  ? 215 GLN F NE2 1 
ATOM   3125 N N   . GLU F 2 126 ? -41.812 -3.739  54.628  1.00 28.37  ? 216 GLU F N   1 
ATOM   3126 C CA  . GLU F 2 126 ? -40.365 -3.875  54.824  1.00 28.24  ? 216 GLU F CA  1 
ATOM   3127 C C   . GLU F 2 126 ? -39.624 -2.653  54.284  1.00 30.33  ? 216 GLU F C   1 
ATOM   3128 O O   . GLU F 2 126 ? -38.622 -2.232  54.864  1.00 27.60  ? 216 GLU F O   1 
ATOM   3129 C CB  . GLU F 2 126 ? -39.839 -5.138  54.125  1.00 29.62  ? 216 GLU F CB  1 
ATOM   3130 C CG  . GLU F 2 126 ? -40.076 -6.426  54.895  1.00 38.92  ? 216 GLU F CG  1 
ATOM   3131 C CD  . GLU F 2 126 ? -40.012 -7.684  54.052  1.00 54.23  ? 216 GLU F CD  1 
ATOM   3132 O OE1 . GLU F 2 126 ? -40.040 -7.578  52.804  1.00 23.84  ? 216 GLU F OE1 1 
ATOM   3133 O OE2 . GLU F 2 126 ? -39.932 -8.784  54.644  1.00 56.49  ? 216 GLU F OE2 1 
ATOM   3134 N N   . ARG F 2 127 ? -40.119 -2.121  53.141  1.00 26.10  ? 217 ARG F N   1 
ATOM   3135 C CA  . ARG F 2 127 ? -39.598 -0.956  52.442  1.00 25.10  ? 217 ARG F CA  1 
ATOM   3136 C C   . ARG F 2 127 ? -39.727 0.273   53.318  1.00 28.72  ? 217 ARG F C   1 
ATOM   3137 O O   . ARG F 2 127 ? -38.808 1.080   53.352  1.00 28.52  ? 217 ARG F O   1 
ATOM   3138 C CB  . ARG F 2 127 ? -40.343 -0.754  51.122  1.00 23.24  ? 217 ARG F CB  1 
ATOM   3139 C CG  . ARG F 2 127 ? -39.527 -0.009  50.104  1.00 28.45  ? 217 ARG F CG  1 
ATOM   3140 C CD  . ARG F 2 127 ? -40.129 -0.029  48.721  1.00 28.59  ? 217 ARG F CD  1 
ATOM   3141 N NE  . ARG F 2 127 ? -40.154 -1.368  48.124  1.00 28.49  ? 217 ARG F NE  1 
ATOM   3142 C CZ  . ARG F 2 127 ? -39.138 -1.933  47.476  1.00 41.16  ? 217 ARG F CZ  1 
ATOM   3143 N NH1 . ARG F 2 127 ? -37.979 -1.298  47.358  1.00 30.35  ? 217 ARG F NH1 1 
ATOM   3144 N NH2 . ARG F 2 127 ? -39.267 -3.148  46.958  1.00 28.11  ? 217 ARG F NH2 1 
ATOM   3145 N N   . VAL F 2 128 ? -40.857 0.391   54.050  1.00 25.32  ? 218 VAL F N   1 
ATOM   3146 C CA  . VAL F 2 128 ? -41.162 1.477   54.982  1.00 24.52  ? 218 VAL F CA  1 
ATOM   3147 C C   . VAL F 2 128 ? -40.177 1.392   56.167  1.00 30.30  ? 218 VAL F C   1 
ATOM   3148 O O   . VAL F 2 128 ? -39.545 2.392   56.502  1.00 30.30  ? 218 VAL F O   1 
ATOM   3149 C CB  . VAL F 2 128 ? -42.660 1.425   55.422  1.00 27.28  ? 218 VAL F CB  1 
ATOM   3150 C CG1 . VAL F 2 128 ? -42.896 2.135   56.757  1.00 26.94  ? 218 VAL F CG1 1 
ATOM   3151 C CG2 . VAL F 2 128 ? -43.579 1.994   54.330  1.00 26.54  ? 218 VAL F CG2 1 
ATOM   3152 N N   . ALA F 2 129 ? -40.024 0.189   56.758  1.00 28.16  ? 219 ALA F N   1 
ATOM   3153 C CA  . ALA F 2 129 ? -39.148 -0.100  57.900  1.00 27.55  ? 219 ALA F CA  1 
ATOM   3154 C C   . ALA F 2 129 ? -37.658 0.114   57.584  1.00 30.01  ? 219 ALA F C   1 
ATOM   3155 O O   . ALA F 2 129 ? -36.928 0.605   58.446  1.00 29.54  ? 219 ALA F O   1 
ATOM   3156 C CB  . ALA F 2 129 ? -39.371 -1.528  58.373  1.00 28.23  ? 219 ALA F CB  1 
ATOM   3157 N N   . LEU F 2 130 ? -37.203 -0.260  56.380  1.00 27.15  ? 220 LEU F N   1 
ATOM   3158 C CA  . LEU F 2 130 ? -35.804 -0.069  56.010  1.00 27.71  ? 220 LEU F CA  1 
ATOM   3159 C C   . LEU F 2 130 ? -35.509 1.423   55.762  1.00 32.00  ? 220 LEU F C   1 
ATOM   3160 O O   . LEU F 2 130 ? -34.506 1.928   56.264  1.00 32.76  ? 220 LEU F O   1 
ATOM   3161 C CB  . LEU F 2 130 ? -35.403 -0.921  54.787  1.00 28.02  ? 220 LEU F CB  1 
ATOM   3162 C CG  . LEU F 2 130 ? -33.943 -0.760  54.304  1.00 32.79  ? 220 LEU F CG  1 
ATOM   3163 C CD1 . LEU F 2 130 ? -32.950 -1.182  55.365  1.00 33.42  ? 220 LEU F CD1 1 
ATOM   3164 C CD2 . LEU F 2 130 ? -33.707 -1.506  53.025  1.00 36.06  ? 220 LEU F CD2 1 
ATOM   3165 N N   . ALA F 2 131 ? -36.389 2.120   55.016  1.00 27.94  ? 221 ALA F N   1 
ATOM   3166 C CA  . ALA F 2 131 ? -36.232 3.542   54.692  1.00 26.51  ? 221 ALA F CA  1 
ATOM   3167 C C   . ALA F 2 131 ? -36.271 4.386   55.946  1.00 29.67  ? 221 ALA F C   1 
ATOM   3168 O O   . ALA F 2 131 ? -35.487 5.320   56.060  1.00 29.26  ? 221 ALA F O   1 
ATOM   3169 C CB  . ALA F 2 131 ? -37.303 3.986   53.722  1.00 26.81  ? 221 ALA F CB  1 
ATOM   3170 N N   . ASN F 2 132 ? -37.135 4.033   56.910  1.00 26.38  ? 222 ASN F N   1 
ATOM   3171 C CA  . ASN F 2 132 ? -37.229 4.759   58.162  1.00 25.77  ? 222 ASN F CA  1 
ATOM   3172 C C   . ASN F 2 132 ? -35.996 4.552   59.015  1.00 29.93  ? 222 ASN F C   1 
ATOM   3173 O O   . ASN F 2 132 ? -35.593 5.476   59.716  1.00 30.17  ? 222 ASN F O   1 
ATOM   3174 C CB  . ASN F 2 132 ? -38.469 4.373   58.940  1.00 25.71  ? 222 ASN F CB  1 
ATOM   3175 C CG  . ASN F 2 132 ? -39.569 5.392   58.815  1.00 53.40  ? 222 ASN F CG  1 
ATOM   3176 O OD1 . ASN F 2 132 ? -39.404 6.587   59.115  1.00 44.96  ? 222 ASN F OD1 1 
ATOM   3177 N ND2 . ASN F 2 132 ? -40.720 4.943   58.362  1.00 46.27  ? 222 ASN F ND2 1 
ATOM   3178 N N   . ARG F 2 133 ? -35.397 3.352   58.964  1.00 25.23  ? 223 ARG F N   1 
ATOM   3179 C CA  . ARG F 2 133 ? -34.185 3.034   59.717  1.00 23.98  ? 223 ARG F CA  1 
ATOM   3180 C C   . ARG F 2 133 ? -33.007 3.849   59.173  1.00 24.53  ? 223 ARG F C   1 
ATOM   3181 O O   . ARG F 2 133 ? -32.238 4.399   59.955  1.00 23.76  ? 223 ARG F O   1 
ATOM   3182 C CB  . ARG F 2 133 ? -33.888 1.508   59.677  1.00 25.49  ? 223 ARG F CB  1 
ATOM   3183 C CG  . ARG F 2 133 ? -32.562 1.065   60.329  1.00 36.40  ? 223 ARG F CG  1 
ATOM   3184 C CD  . ARG F 2 133 ? -32.409 1.486   61.793  1.00 51.90  ? 223 ARG F CD  1 
ATOM   3185 N NE  . ARG F 2 133 ? -31.057 1.233   62.308  1.00 62.82  ? 223 ARG F NE  1 
ATOM   3186 C CZ  . ARG F 2 133 ? -30.513 1.846   63.358  1.00 75.27  ? 223 ARG F CZ  1 
ATOM   3187 N NH1 . ARG F 2 133 ? -31.190 2.776   64.018  1.00 61.72  ? 223 ARG F NH1 1 
ATOM   3188 N NH2 . ARG F 2 133 ? -29.278 1.549   63.742  1.00 57.47  ? 223 ARG F NH2 1 
ATOM   3189 N N   . LYS F 2 134 ? -32.875 3.932   57.845  1.00 20.29  ? 224 LYS F N   1 
ATOM   3190 C CA  . LYS F 2 134 ? -31.807 4.695   57.206  1.00 19.73  ? 224 LYS F CA  1 
ATOM   3191 C C   . LYS F 2 134 ? -31.991 6.200   57.480  1.00 23.83  ? 224 LYS F C   1 
ATOM   3192 O O   . LYS F 2 134 ? -31.007 6.888   57.744  1.00 23.50  ? 224 LYS F O   1 
ATOM   3193 C CB  . LYS F 2 134 ? -31.740 4.396   55.702  1.00 20.54  ? 224 LYS F CB  1 
ATOM   3194 C CG  . LYS F 2 134 ? -31.408 2.946   55.340  1.00 31.93  ? 224 LYS F CG  1 
ATOM   3195 C CD  . LYS F 2 134 ? -30.068 2.476   55.893  1.00 36.60  ? 224 LYS F CD  1 
ATOM   3196 C CE  . LYS F 2 134 ? -29.554 1.253   55.188  1.00 38.89  ? 224 LYS F CE  1 
ATOM   3197 N NZ  . LYS F 2 134 ? -28.438 0.627   55.949  1.00 36.24  ? 224 LYS F NZ  1 
ATOM   3198 N N   . ARG F 2 135 ? -33.264 6.684   57.477  1.00 19.37  ? 225 ARG F N   1 
ATOM   3199 C CA  . ARG F 2 135 ? -33.642 8.064   57.789  1.00 18.37  ? 225 ARG F CA  1 
ATOM   3200 C C   . ARG F 2 135 ? -33.246 8.389   59.224  1.00 22.09  ? 225 ARG F C   1 
ATOM   3201 O O   . ARG F 2 135 ? -32.727 9.474   59.470  1.00 20.37  ? 225 ARG F O   1 
ATOM   3202 C CB  . ARG F 2 135 ? -35.159 8.268   57.599  1.00 15.40  ? 225 ARG F CB  1 
ATOM   3203 C CG  . ARG F 2 135 ? -35.615 9.737   57.632  1.00 22.06  ? 225 ARG F CG  1 
ATOM   3204 C CD  . ARG F 2 135 ? -37.125 9.935   57.821  1.00 19.27  ? 225 ARG F CD  1 
ATOM   3205 N NE  . ARG F 2 135 ? -37.709 9.062   58.856  1.00 20.63  ? 225 ARG F NE  1 
ATOM   3206 C CZ  . ARG F 2 135 ? -37.709 9.319   60.166  1.00 42.61  ? 225 ARG F CZ  1 
ATOM   3207 N NH1 . ARG F 2 135 ? -37.161 10.433  60.631  1.00 44.60  ? 225 ARG F NH1 1 
ATOM   3208 N NH2 . ARG F 2 135 ? -38.248 8.453   61.021  1.00 15.62  ? 225 ARG F NH2 1 
ATOM   3209 N N   . GLU F 2 136 ? -33.471 7.446   60.165  1.00 20.09  ? 226 GLU F N   1 
ATOM   3210 C CA  . GLU F 2 136 ? -33.119 7.641   61.575  1.00 21.49  ? 226 GLU F CA  1 
ATOM   3211 C C   . GLU F 2 136 ? -31.606 7.675   61.752  1.00 26.99  ? 226 GLU F C   1 
ATOM   3212 O O   . GLU F 2 136 ? -31.115 8.398   62.624  1.00 27.25  ? 226 GLU F O   1 
ATOM   3213 C CB  . GLU F 2 136 ? -33.750 6.561   62.465  1.00 23.06  ? 226 GLU F CB  1 
ATOM   3214 C CG  . GLU F 2 136 ? -35.225 6.817   62.739  1.00 34.26  ? 226 GLU F CG  1 
ATOM   3215 C CD  . GLU F 2 136 ? -35.994 5.710   63.435  1.00 58.79  ? 226 GLU F CD  1 
ATOM   3216 O OE1 . GLU F 2 136 ? -37.150 5.458   63.030  1.00 61.03  ? 226 GLU F OE1 1 
ATOM   3217 O OE2 . GLU F 2 136 ? -35.474 5.136   64.419  1.00 55.65  ? 226 GLU F OE2 1 
ATOM   3218 N N   . CYS F 2 137 ? -30.868 6.911   60.910  1.00 23.25  ? 227 CYS F N   1 
ATOM   3219 C CA  . CYS F 2 137 ? -29.403 6.887   60.919  1.00 22.45  ? 227 CYS F CA  1 
ATOM   3220 C C   . CYS F 2 137 ? -28.881 8.234   60.437  1.00 24.73  ? 227 CYS F C   1 
ATOM   3221 O O   . CYS F 2 137 ? -28.115 8.874   61.163  1.00 23.25  ? 227 CYS F O   1 
ATOM   3222 C CB  . CYS F 2 137 ? -28.859 5.738   60.081  1.00 22.51  ? 227 CYS F CB  1 
ATOM   3223 S SG  . CYS F 2 137 ? -29.074 4.114   60.841  1.00 26.41  ? 227 CYS F SG  1 
ATOM   3224 N N   . GLY F 2 138 ? -29.363 8.677   59.262  1.00 20.62  ? 228 GLY F N   1 
ATOM   3225 C CA  . GLY F 2 138 ? -29.033 9.972   58.679  1.00 19.50  ? 228 GLY F CA  1 
ATOM   3226 C C   . GLY F 2 138 ? -29.271 11.109  59.647  1.00 22.79  ? 228 GLY F C   1 
ATOM   3227 O O   . GLY F 2 138 ? -28.412 11.985  59.784  1.00 22.34  ? 228 GLY F O   1 
ATOM   3228 N N   . ASN F 2 139 ? -30.418 11.072  60.366  1.00 19.09  ? 229 ASN F N   1 
ATOM   3229 C CA  . ASN F 2 139 ? -30.784 12.084  61.365  1.00 18.94  ? 229 ASN F CA  1 
ATOM   3230 C C   . ASN F 2 139 ? -29.761 12.138  62.485  1.00 22.10  ? 229 ASN F C   1 
ATOM   3231 O O   . ASN F 2 139 ? -29.337 13.237  62.842  1.00 22.07  ? 229 ASN F O   1 
ATOM   3232 C CB  . ASN F 2 139 ? -32.188 11.838  61.927  1.00 21.01  ? 229 ASN F CB  1 
ATOM   3233 C CG  . ASN F 2 139 ? -33.325 12.203  60.998  1.00 33.74  ? 229 ASN F CG  1 
ATOM   3234 O OD1 . ASN F 2 139 ? -33.142 12.558  59.820  1.00 19.00  ? 229 ASN F OD1 1 
ATOM   3235 N ND2 . ASN F 2 139 ? -34.541 12.125  61.517  1.00 25.10  ? 229 ASN F ND2 1 
ATOM   3236 N N   . ALA F 2 140 ? -29.305 10.964  62.980  1.00 19.24  ? 230 ALA F N   1 
ATOM   3237 C CA  . ALA F 2 140 ? -28.298 10.865  64.052  1.00 18.48  ? 230 ALA F CA  1 
ATOM   3238 C C   . ALA F 2 140 ? -26.949 11.467  63.611  1.00 24.98  ? 230 ALA F C   1 
ATOM   3239 O O   . ALA F 2 140 ? -26.289 12.133  64.413  1.00 27.59  ? 230 ALA F O   1 
ATOM   3240 C CB  . ALA F 2 140 ? -28.126 9.422   64.485  1.00 18.32  ? 230 ALA F CB  1 
ATOM   3241 N N   . HIS F 2 141 ? -26.567 11.260  62.329  1.00 20.98  ? 231 HIS F N   1 
ATOM   3242 C CA  . HIS F 2 141 ? -25.333 11.776  61.705  1.00 19.62  ? 231 HIS F CA  1 
ATOM   3243 C C   . HIS F 2 141 ? -25.399 13.278  61.519  1.00 24.20  ? 231 HIS F C   1 
ATOM   3244 O O   . HIS F 2 141 ? -24.377 13.953  61.603  1.00 26.56  ? 231 HIS F O   1 
ATOM   3245 C CB  . HIS F 2 141 ? -25.092 11.126  60.328  1.00 18.97  ? 231 HIS F CB  1 
ATOM   3246 C CG  . HIS F 2 141 ? -24.752 9.670   60.371  1.00 21.51  ? 231 HIS F CG  1 
ATOM   3247 N ND1 . HIS F 2 141 ? -23.634 9.209   61.035  1.00 22.89  ? 231 HIS F ND1 1 
ATOM   3248 C CD2 . HIS F 2 141 ? -25.364 8.623   59.777  1.00 22.49  ? 231 HIS F CD2 1 
ATOM   3249 C CE1 . HIS F 2 141 ? -23.629 7.900   60.863  1.00 21.70  ? 231 HIS F CE1 1 
ATOM   3250 N NE2 . HIS F 2 141 ? -24.638 7.502   60.101  1.00 21.95  ? 231 HIS F NE2 1 
ATOM   3251 N N   . TYR F 2 142 ? -26.586 13.787  61.192  1.00 18.87  ? 232 TYR F N   1 
ATOM   3252 C CA  . TYR F 2 142 ? -26.865 15.198  60.960  1.00 18.84  ? 232 TYR F CA  1 
ATOM   3253 C C   . TYR F 2 142 ? -26.761 15.986  62.252  1.00 27.95  ? 232 TYR F C   1 
ATOM   3254 O O   . TYR F 2 142 ? -26.134 17.043  62.231  1.00 30.13  ? 232 TYR F O   1 
ATOM   3255 C CB  . TYR F 2 142 ? -28.258 15.376  60.333  1.00 18.44  ? 232 TYR F CB  1 
ATOM   3256 C CG  . TYR F 2 142 ? -28.580 16.799  59.940  1.00 19.59  ? 232 TYR F CG  1 
ATOM   3257 C CD1 . TYR F 2 142 ? -29.134 17.690  60.858  1.00 21.91  ? 232 TYR F CD1 1 
ATOM   3258 C CD2 . TYR F 2 142 ? -28.317 17.266  58.653  1.00 19.25  ? 232 TYR F CD2 1 
ATOM   3259 C CE1 . TYR F 2 142 ? -29.407 19.014  60.509  1.00 22.41  ? 232 TYR F CE1 1 
ATOM   3260 C CE2 . TYR F 2 142 ? -28.625 18.577  58.282  1.00 20.15  ? 232 TYR F CE2 1 
ATOM   3261 C CZ  . TYR F 2 142 ? -29.181 19.445  59.210  1.00 28.41  ? 232 TYR F CZ  1 
ATOM   3262 O OH  . TYR F 2 142 ? -29.484 20.744  58.853  1.00 27.77  ? 232 TYR F OH  1 
ATOM   3263 N N   . GLN F 2 143 ? -27.365 15.487  63.373  1.00 25.15  ? 233 GLN F N   1 
ATOM   3264 C CA  . GLN F 2 143 ? -27.327 16.151  64.689  1.00 25.83  ? 233 GLN F CA  1 
ATOM   3265 C C   . GLN F 2 143 ? -25.884 16.428  65.177  1.00 30.33  ? 233 GLN F C   1 
ATOM   3266 O O   . GLN F 2 143 ? -25.650 17.435  65.835  1.00 30.46  ? 233 GLN F O   1 
ATOM   3267 C CB  . GLN F 2 143 ? -28.069 15.346  65.777  1.00 27.31  ? 233 GLN F CB  1 
ATOM   3268 C CG  . GLN F 2 143 ? -29.424 14.711  65.423  1.00 50.94  ? 233 GLN F CG  1 
ATOM   3269 C CD  . GLN F 2 143 ? -30.536 15.621  64.959  1.00 77.28  ? 233 GLN F CD  1 
ATOM   3270 O OE1 . GLN F 2 143 ? -30.593 16.818  65.267  1.00 77.77  ? 233 GLN F OE1 1 
ATOM   3271 N NE2 . GLN F 2 143 ? -31.507 15.033  64.274  1.00 69.41  ? 233 GLN F NE2 1 
ATOM   3272 N N   . ARG F 2 144 ? -24.937 15.524  64.863  1.00 27.61  ? 234 ARG F N   1 
ATOM   3273 C CA  . ARG F 2 144 ? -23.513 15.589  65.215  1.00 27.95  ? 234 ARG F CA  1 
ATOM   3274 C C   . ARG F 2 144 ? -22.715 16.521  64.320  1.00 34.38  ? 234 ARG F C   1 
ATOM   3275 O O   . ARG F 2 144 ? -21.560 16.816  64.632  1.00 34.62  ? 234 ARG F O   1 
ATOM   3276 C CB  . ARG F 2 144 ? -22.868 14.197  65.082  1.00 26.75  ? 234 ARG F CB  1 
ATOM   3277 C CG  . ARG F 2 144 ? -23.422 13.114  65.978  1.00 28.20  ? 234 ARG F CG  1 
ATOM   3278 C CD  . ARG F 2 144 ? -22.405 11.995  66.134  1.00 30.16  ? 234 ARG F CD  1 
ATOM   3279 N NE  . ARG F 2 144 ? -21.838 11.487  64.873  1.00 23.21  ? 234 ARG F NE  1 
ATOM   3280 C CZ  . ARG F 2 144 ? -22.374 10.507  64.157  1.00 34.03  ? 234 ARG F CZ  1 
ATOM   3281 N NH1 . ARG F 2 144 ? -23.523 9.960   64.527  1.00 28.63  ? 234 ARG F NH1 1 
ATOM   3282 N NH2 . ARG F 2 144 ? -21.778 10.083  63.052  1.00 18.33  ? 234 ARG F NH2 1 
ATOM   3283 N N   . ALA F 2 145 ? -23.294 16.880  63.153  1.00 31.73  ? 235 ALA F N   1 
ATOM   3284 C CA  . ALA F 2 145 ? -22.748 17.697  62.063  1.00 31.34  ? 235 ALA F CA  1 
ATOM   3285 C C   . ALA F 2 145 ? -21.837 16.873  61.127  1.00 34.12  ? 235 ALA F C   1 
ATOM   3286 O O   . ALA F 2 145 ? -20.884 17.395  60.546  1.00 33.12  ? 235 ALA F O   1 
ATOM   3287 C CB  . ALA F 2 145 ? -22.030 18.944  62.584  1.00 32.05  ? 235 ALA F CB  1 
ATOM   3288 N N   . ASP F 2 146 ? -22.177 15.593  60.949  1.00 31.34  ? 236 ASP F N   1 
ATOM   3289 C CA  . ASP F 2 146 ? -21.518 14.703  59.998  1.00 30.48  ? 236 ASP F CA  1 
ATOM   3290 C C   . ASP F 2 146 ? -22.459 14.655  58.820  1.00 33.58  ? 236 ASP F C   1 
ATOM   3291 O O   . ASP F 2 146 ? -23.363 13.825  58.771  1.00 34.02  ? 236 ASP F O   1 
ATOM   3292 C CB  . ASP F 2 146 ? -21.220 13.318  60.600  1.00 31.99  ? 236 ASP F CB  1 
ATOM   3293 C CG  . ASP F 2 146 ? -20.242 12.485  59.790  1.00 42.02  ? 236 ASP F CG  1 
ATOM   3294 O OD1 . ASP F 2 146 ? -20.172 12.677  58.549  1.00 41.90  ? 236 ASP F OD1 1 
ATOM   3295 O OD2 . ASP F 2 146 ? -19.573 11.618  60.383  1.00 47.59  ? 236 ASP F OD2 1 
ATOM   3296 N N   . PHE F 2 147 ? -22.320 15.642  57.936  1.00 28.98  ? 237 PHE F N   1 
ATOM   3297 C CA  . PHE F 2 147 ? -23.194 15.862  56.796  1.00 27.54  ? 237 PHE F CA  1 
ATOM   3298 C C   . PHE F 2 147 ? -22.856 14.949  55.638  1.00 30.96  ? 237 PHE F C   1 
ATOM   3299 O O   . PHE F 2 147 ? -23.746 14.639  54.853  1.00 30.10  ? 237 PHE F O   1 
ATOM   3300 C CB  . PHE F 2 147 ? -23.180 17.349  56.388  1.00 28.89  ? 237 PHE F CB  1 
ATOM   3301 C CG  . PHE F 2 147 ? -23.587 18.270  57.520  1.00 29.27  ? 237 PHE F CG  1 
ATOM   3302 C CD1 . PHE F 2 147 ? -24.871 18.229  58.045  1.00 31.28  ? 237 PHE F CD1 1 
ATOM   3303 C CD2 . PHE F 2 147 ? -22.676 19.156  58.079  1.00 30.89  ? 237 PHE F CD2 1 
ATOM   3304 C CE1 . PHE F 2 147 ? -25.230 19.052  59.123  1.00 32.37  ? 237 PHE F CE1 1 
ATOM   3305 C CE2 . PHE F 2 147 ? -23.045 19.994  59.140  1.00 33.47  ? 237 PHE F CE2 1 
ATOM   3306 C CZ  . PHE F 2 147 ? -24.317 19.938  59.654  1.00 30.87  ? 237 PHE F CZ  1 
ATOM   3307 N N   . VAL F 2 148 ? -21.614 14.464  55.560  1.00 28.62  ? 238 VAL F N   1 
ATOM   3308 C CA  . VAL F 2 148 ? -21.219 13.514  54.518  1.00 29.13  ? 238 VAL F CA  1 
ATOM   3309 C C   . VAL F 2 148 ? -21.928 12.151  54.786  1.00 32.03  ? 238 VAL F C   1 
ATOM   3310 O O   . VAL F 2 148 ? -22.466 11.538  53.859  1.00 31.10  ? 238 VAL F O   1 
ATOM   3311 C CB  . VAL F 2 148 ? -19.679 13.355  54.374  1.00 33.94  ? 238 VAL F CB  1 
ATOM   3312 C CG1 . VAL F 2 148 ? -19.028 14.634  53.861  1.00 33.90  ? 238 VAL F CG1 1 
ATOM   3313 C CG2 . VAL F 2 148 ? -19.029 12.918  55.668  1.00 34.20  ? 238 VAL F CG2 1 
ATOM   3314 N N   . LEU F 2 149 ? -21.961 11.715  56.060  1.00 27.54  ? 239 LEU F N   1 
ATOM   3315 C CA  . LEU F 2 149 ? -22.585 10.455  56.464  1.00 27.58  ? 239 LEU F CA  1 
ATOM   3316 C C   . LEU F 2 149 ? -24.121 10.583  56.466  1.00 30.09  ? 239 LEU F C   1 
ATOM   3317 O O   . LEU F 2 149 ? -24.804 9.660   56.017  1.00 27.52  ? 239 LEU F O   1 
ATOM   3318 C CB  . LEU F 2 149 ? -22.063 10.006  57.841  1.00 27.93  ? 239 LEU F CB  1 
ATOM   3319 C CG  . LEU F 2 149 ? -20.860 9.015   57.880  1.00 32.08  ? 239 LEU F CG  1 
ATOM   3320 C CD1 . LEU F 2 149 ? -19.609 9.544   57.228  1.00 32.85  ? 239 LEU F CD1 1 
ATOM   3321 C CD2 . LEU F 2 149 ? -20.565 8.539   59.272  1.00 30.25  ? 239 LEU F CD2 1 
ATOM   3322 N N   . ALA F 2 150 ? -24.650 11.735  56.943  1.00 26.35  ? 240 ALA F N   1 
ATOM   3323 C CA  . ALA F 2 150 ? -26.088 12.027  56.925  1.00 25.64  ? 240 ALA F CA  1 
ATOM   3324 C C   . ALA F 2 150 ? -26.613 11.939  55.505  1.00 25.77  ? 240 ALA F C   1 
ATOM   3325 O O   . ALA F 2 150 ? -27.563 11.206  55.274  1.00 24.08  ? 240 ALA F O   1 
ATOM   3326 C CB  . ALA F 2 150 ? -26.359 13.408  57.501  1.00 26.87  ? 240 ALA F CB  1 
ATOM   3327 N N   . ALA F 2 151 ? -25.934 12.603  54.534  1.00 22.07  ? 241 ALA F N   1 
ATOM   3328 C CA  . ALA F 2 151 ? -26.324 12.572  53.124  1.00 22.55  ? 241 ALA F CA  1 
ATOM   3329 C C   . ALA F 2 151 ? -26.326 11.139  52.569  1.00 26.02  ? 241 ALA F C   1 
ATOM   3330 O O   . ALA F 2 151 ? -27.194 10.800  51.780  1.00 24.85  ? 241 ALA F O   1 
ATOM   3331 C CB  . ALA F 2 151 ? -25.400 13.457  52.285  1.00 23.22  ? 241 ALA F CB  1 
ATOM   3332 N N   . ASN F 2 152 ? -25.385 10.300  53.010  1.00 21.90  ? 242 ASN F N   1 
ATOM   3333 C CA  . ASN F 2 152 ? -25.269 8.928   52.541  1.00 21.25  ? 242 ASN F CA  1 
ATOM   3334 C C   . ASN F 2 152 ? -26.449 8.083   53.034  1.00 25.81  ? 242 ASN F C   1 
ATOM   3335 O O   . ASN F 2 152 ? -27.023 7.325   52.259  1.00 25.60  ? 242 ASN F O   1 
ATOM   3336 C CB  . ASN F 2 152 ? -23.937 8.360   53.002  1.00 19.57  ? 242 ASN F CB  1 
ATOM   3337 C CG  . ASN F 2 152 ? -23.669 6.944   52.610  1.00 37.92  ? 242 ASN F CG  1 
ATOM   3338 O OD1 . ASN F 2 152 ? -23.350 6.645   51.448  1.00 26.57  ? 242 ASN F OD1 1 
ATOM   3339 N ND2 . ASN F 2 152 ? -23.691 6.059   53.609  1.00 29.34  ? 242 ASN F ND2 1 
ATOM   3340 N N   . SER F 2 153 ? -26.835 8.241   54.302  1.00 22.36  ? 243 SER F N   1 
ATOM   3341 C CA  . SER F 2 153 ? -27.941 7.485   54.861  1.00 21.53  ? 243 SER F CA  1 
ATOM   3342 C C   . SER F 2 153 ? -29.248 7.910   54.197  1.00 22.88  ? 243 SER F C   1 
ATOM   3343 O O   . SER F 2 153 ? -30.054 7.048   53.857  1.00 20.38  ? 243 SER F O   1 
ATOM   3344 C CB  . SER F 2 153 ? -27.994 7.657   56.370  1.00 27.18  ? 243 SER F CB  1 
ATOM   3345 O OG  . SER F 2 153 ? -26.816 7.199   57.021  1.00 33.69  ? 243 SER F OG  1 
ATOM   3346 N N   . TYR F 2 154 ? -29.408 9.219   53.905  1.00 19.64  ? 244 TYR F N   1 
ATOM   3347 C CA  . TYR F 2 154 ? -30.613 9.709   53.238  1.00 19.24  ? 244 TYR F CA  1 
ATOM   3348 C C   . TYR F 2 154 ? -30.653 9.218   51.817  1.00 24.34  ? 244 TYR F C   1 
ATOM   3349 O O   . TYR F 2 154 ? -31.730 8.882   51.338  1.00 21.62  ? 244 TYR F O   1 
ATOM   3350 C CB  . TYR F 2 154 ? -30.732 11.232  53.270  1.00 19.67  ? 244 TYR F CB  1 
ATOM   3351 C CG  . TYR F 2 154 ? -30.779 11.824  54.665  1.00 20.92  ? 244 TYR F CG  1 
ATOM   3352 C CD1 . TYR F 2 154 ? -31.649 11.321  55.632  1.00 23.19  ? 244 TYR F CD1 1 
ATOM   3353 C CD2 . TYR F 2 154 ? -30.011 12.933  54.995  1.00 20.88  ? 244 TYR F CD2 1 
ATOM   3354 C CE1 . TYR F 2 154 ? -31.699 11.866  56.914  1.00 24.81  ? 244 TYR F CE1 1 
ATOM   3355 C CE2 . TYR F 2 154 ? -30.048 13.484  56.272  1.00 21.88  ? 244 TYR F CE2 1 
ATOM   3356 C CZ  . TYR F 2 154 ? -30.898 12.953  57.227  1.00 30.01  ? 244 TYR F CZ  1 
ATOM   3357 O OH  . TYR F 2 154 ? -30.949 13.523  58.474  1.00 29.01  ? 244 TYR F OH  1 
ATOM   3358 N N   . ASP F 2 155 ? -29.461 9.106   51.173  1.00 22.79  ? 245 ASP F N   1 
ATOM   3359 C CA  . ASP F 2 155 ? -29.304 8.603   49.805  1.00 22.74  ? 245 ASP F CA  1 
ATOM   3360 C C   . ASP F 2 155 ? -29.683 7.120   49.750  1.00 25.80  ? 245 ASP F C   1 
ATOM   3361 O O   . ASP F 2 155 ? -30.277 6.673   48.760  1.00 25.91  ? 245 ASP F O   1 
ATOM   3362 C CB  . ASP F 2 155 ? -27.864 8.833   49.321  1.00 25.13  ? 245 ASP F CB  1 
ATOM   3363 C CG  . ASP F 2 155 ? -27.552 8.255   47.962  1.00 46.35  ? 245 ASP F CG  1 
ATOM   3364 O OD1 . ASP F 2 155 ? -28.098 8.774   46.953  1.00 49.60  ? 245 ASP F OD1 1 
ATOM   3365 O OD2 . ASP F 2 155 ? -26.738 7.304   47.897  1.00 54.01  ? 245 ASP F OD2 1 
ATOM   3366 N N   . LEU F 2 156 ? -29.356 6.363   50.821  1.00 20.22  ? 246 LEU F N   1 
ATOM   3367 C CA  . LEU F 2 156 ? -29.663 4.935   50.921  1.00 19.80  ? 246 LEU F CA  1 
ATOM   3368 C C   . LEU F 2 156 ? -31.127 4.747   51.228  1.00 22.47  ? 246 LEU F C   1 
ATOM   3369 O O   . LEU F 2 156 ? -31.753 3.843   50.680  1.00 21.69  ? 246 LEU F O   1 
ATOM   3370 C CB  . LEU F 2 156 ? -28.788 4.233   51.975  1.00 20.24  ? 246 LEU F CB  1 
ATOM   3371 C CG  . LEU F 2 156 ? -27.258 4.196   51.720  1.00 24.07  ? 246 LEU F CG  1 
ATOM   3372 C CD1 . LEU F 2 156 ? -26.522 3.743   52.951  1.00 24.06  ? 246 LEU F CD1 1 
ATOM   3373 C CD2 . LEU F 2 156 ? -26.898 3.348   50.525  1.00 26.84  ? 246 LEU F CD2 1 
ATOM   3374 N N   . ALA F 2 157 ? -31.697 5.662   52.035  1.00 21.38  ? 247 ALA F N   1 
ATOM   3375 C CA  . ALA F 2 157 ? -33.110 5.654   52.390  1.00 21.86  ? 247 ALA F CA  1 
ATOM   3376 C C   . ALA F 2 157 ? -33.966 5.835   51.141  1.00 25.17  ? 247 ALA F C   1 
ATOM   3377 O O   . ALA F 2 157 ? -34.944 5.124   50.982  1.00 25.13  ? 247 ALA F O   1 
ATOM   3378 C CB  . ALA F 2 157 ? -33.409 6.751   53.398  1.00 22.93  ? 247 ALA F CB  1 
ATOM   3379 N N   . ILE F 2 158 ? -33.567 6.748   50.246  1.00 23.10  ? 248 ILE F N   1 
ATOM   3380 C CA  . ILE F 2 158 ? -34.260 7.040   48.991  1.00 24.63  ? 248 ILE F CA  1 
ATOM   3381 C C   . ILE F 2 158 ? -34.149 5.837   48.047  1.00 30.98  ? 248 ILE F C   1 
ATOM   3382 O O   . ILE F 2 158 ? -35.163 5.413   47.506  1.00 30.76  ? 248 ILE F O   1 
ATOM   3383 C CB  . ILE F 2 158 ? -33.734 8.361   48.341  1.00 27.98  ? 248 ILE F CB  1 
ATOM   3384 C CG1 . ILE F 2 158 ? -34.152 9.594   49.180  1.00 27.69  ? 248 ILE F CG1 1 
ATOM   3385 C CG2 . ILE F 2 158 ? -34.193 8.517   46.862  1.00 29.16  ? 248 ILE F CG2 1 
ATOM   3386 C CD1 . ILE F 2 158 ? -33.202 10.792  49.073  1.00 31.21  ? 248 ILE F CD1 1 
ATOM   3387 N N   . LYS F 2 159 ? -32.934 5.276   47.876  1.00 30.39  ? 249 LYS F N   1 
ATOM   3388 C CA  . LYS F 2 159 ? -32.656 4.126   46.997  1.00 30.46  ? 249 LYS F CA  1 
ATOM   3389 C C   . LYS F 2 159 ? -33.525 2.922   47.363  1.00 33.85  ? 249 LYS F C   1 
ATOM   3390 O O   . LYS F 2 159 ? -33.935 2.180   46.464  1.00 33.37  ? 249 LYS F O   1 
ATOM   3391 C CB  . LYS F 2 159 ? -31.160 3.740   47.030  1.00 33.08  ? 249 LYS F CB  1 
ATOM   3392 C CG  . LYS F 2 159 ? -30.297 4.560   46.055  1.00 45.89  ? 249 LYS F CG  1 
ATOM   3393 C CD  . LYS F 2 159 ? -28.799 4.300   46.198  1.00 51.32  ? 249 LYS F CD  1 
ATOM   3394 C CE  . LYS F 2 159 ? -27.975 5.312   45.428  1.00 55.74  ? 249 LYS F CE  1 
ATOM   3395 N NZ  . LYS F 2 159 ? -26.515 5.021   45.494  1.00 58.97  ? 249 LYS F NZ  1 
ATOM   3396 N N   . ALA F 2 160 ? -33.810 2.734   48.676  1.00 28.96  ? 250 ALA F N   1 
ATOM   3397 C CA  . ALA F 2 160 ? -34.670 1.673   49.217  1.00 28.04  ? 250 ALA F CA  1 
ATOM   3398 C C   . ALA F 2 160 ? -36.138 1.913   48.852  1.00 31.58  ? 250 ALA F C   1 
ATOM   3399 O O   . ALA F 2 160 ? -36.851 0.952   48.573  1.00 30.56  ? 250 ALA F O   1 
ATOM   3400 C CB  . ALA F 2 160 ? -34.524 1.598   50.735  1.00 28.44  ? 250 ALA F CB  1 
ATOM   3401 N N   . ILE F 2 161 ? -36.591 3.189   48.858  1.00 29.38  ? 251 ILE F N   1 
ATOM   3402 C CA  . ILE F 2 161 ? -37.969 3.568   48.512  1.00 29.08  ? 251 ILE F CA  1 
ATOM   3403 C C   . ILE F 2 161 ? -38.222 3.374   46.998  1.00 31.92  ? 251 ILE F C   1 
ATOM   3404 O O   . ILE F 2 161 ? -39.218 2.760   46.614  1.00 31.54  ? 251 ILE F O   1 
ATOM   3405 C CB  . ILE F 2 161 ? -38.287 5.042   48.960  1.00 32.71  ? 251 ILE F CB  1 
ATOM   3406 C CG1 . ILE F 2 161 ? -38.314 5.178   50.501  1.00 32.88  ? 251 ILE F CG1 1 
ATOM   3407 C CG2 . ILE F 2 161 ? -39.614 5.553   48.354  1.00 33.97  ? 251 ILE F CG2 1 
ATOM   3408 C CD1 . ILE F 2 161 ? -38.156 6.596   51.063  1.00 34.43  ? 251 ILE F CD1 1 
ATOM   3409 N N   . THR F 2 162 ? -37.314 3.884   46.157  1.00 28.34  ? 252 THR F N   1 
ATOM   3410 C CA  . THR F 2 162 ? -37.441 3.941   44.700  1.00 27.92  ? 252 THR F CA  1 
ATOM   3411 C C   . THR F 2 162 ? -37.137 2.618   43.941  1.00 32.91  ? 252 THR F C   1 
ATOM   3412 O O   . THR F 2 162 ? -37.416 2.547   42.740  1.00 30.92  ? 252 THR F O   1 
ATOM   3413 C CB  . THR F 2 162 ? -36.566 5.059   44.150  1.00 32.81  ? 252 THR F CB  1 
ATOM   3414 O OG1 . THR F 2 162 ? -35.195 4.717   44.327  1.00 36.76  ? 252 THR F OG1 1 
ATOM   3415 C CG2 . THR F 2 162 ? -36.868 6.416   44.785  1.00 32.69  ? 252 THR F CG2 1 
ATOM   3416 N N   . SER F 2 163 ? -36.593 1.586   44.606  1.00 31.43  ? 253 SER F N   1 
ATOM   3417 C CA  . SER F 2 163 ? -36.310 0.321   43.917  1.00 32.31  ? 253 SER F CA  1 
ATOM   3418 C C   . SER F 2 163 ? -37.509 -0.640  44.081  1.00 38.91  ? 253 SER F C   1 
ATOM   3419 O O   . SER F 2 163 ? -37.376 -1.717  44.665  1.00 38.92  ? 253 SER F O   1 
ATOM   3420 C CB  . SER F 2 163 ? -35.009 -0.292  44.435  1.00 37.15  ? 253 SER F CB  1 
ATOM   3421 O OG  . SER F 2 163 ? -34.959 -0.260  45.852  1.00 48.94  ? 253 SER F OG  1 
ATOM   3422 N N   . SER F 2 164 ? -38.683 -0.237  43.556  1.00 38.06  ? 254 SER F N   1 
ATOM   3423 C CA  . SER F 2 164 ? -39.957 -0.962  43.691  1.00 38.91  ? 254 SER F CA  1 
ATOM   3424 C C   . SER F 2 164 ? -40.594 -1.392  42.352  1.00 44.26  ? 254 SER F C   1 
ATOM   3425 O O   . SER F 2 164 ? -41.780 -1.732  42.332  1.00 44.27  ? 254 SER F O   1 
ATOM   3426 C CB  . SER F 2 164 ? -40.949 -0.086  44.453  1.00 42.87  ? 254 SER F CB  1 
ATOM   3427 O OG  . SER F 2 164 ? -41.209 1.135   43.776  1.00 52.90  ? 254 SER F OG  1 
ATOM   3428 N N   . ALA F 2 165 ? -39.810 -1.414  41.257  1.00 42.38  ? 255 ALA F N   1 
ATOM   3429 C CA  . ALA F 2 165 ? -40.280 -1.743  39.906  1.00 43.01  ? 255 ALA F CA  1 
ATOM   3430 C C   . ALA F 2 165 ? -40.799 -3.193  39.733  1.00 49.35  ? 255 ALA F C   1 
ATOM   3431 O O   . ALA F 2 165 ? -41.528 -3.445  38.769  1.00 49.98  ? 255 ALA F O   1 
ATOM   3432 C CB  . ALA F 2 165 ? -39.174 -1.485  38.899  1.00 43.70  ? 255 ALA F CB  1 
ATOM   3433 N N   . LYS F 2 166 ? -40.448 -4.131  40.644  1.00 46.55  ? 256 LYS F N   1 
ATOM   3434 C CA  . LYS F 2 166 ? -40.835 -5.545  40.507  1.00 46.26  ? 256 LYS F CA  1 
ATOM   3435 C C   . LYS F 2 166 ? -41.750 -6.067  41.644  1.00 51.22  ? 256 LYS F C   1 
ATOM   3436 O O   . LYS F 2 166 ? -42.057 -7.262  41.668  1.00 50.93  ? 256 LYS F O   1 
ATOM   3437 C CB  . LYS F 2 166 ? -39.582 -6.431  40.385  1.00 48.22  ? 256 LYS F CB  1 
ATOM   3438 C CG  . LYS F 2 166 ? -38.898 -6.288  39.029  1.00 63.07  ? 256 LYS F CG  1 
ATOM   3439 C CD  . LYS F 2 166 ? -37.413 -6.643  39.058  1.00 71.68  ? 256 LYS F CD  1 
ATOM   3440 C CE  . LYS F 2 166 ? -36.707 -6.174  37.802  1.00 75.16  ? 256 LYS F CE  1 
ATOM   3441 N NZ  . LYS F 2 166 ? -36.632 -4.688  37.716  1.00 80.34  ? 256 LYS F NZ  1 
ATOM   3442 N N   . VAL F 2 167 ? -42.219 -5.187  42.545  1.00 48.64  ? 257 VAL F N   1 
ATOM   3443 C CA  . VAL F 2 167 ? -43.120 -5.590  43.631  1.00 49.30  ? 257 VAL F CA  1 
ATOM   3444 C C   . VAL F 2 167 ? -44.415 -4.767  43.542  1.00 54.69  ? 257 VAL F C   1 
ATOM   3445 O O   . VAL F 2 167 ? -44.368 -3.569  43.253  1.00 54.59  ? 257 VAL F O   1 
ATOM   3446 C CB  . VAL F 2 167 ? -42.445 -5.490  45.035  1.00 53.40  ? 257 VAL F CB  1 
ATOM   3447 C CG1 . VAL F 2 167 ? -43.455 -5.676  46.169  1.00 53.07  ? 257 VAL F CG1 1 
ATOM   3448 C CG2 . VAL F 2 167 ? -41.320 -6.509  45.174  1.00 53.13  ? 257 VAL F CG2 1 
ATOM   3449 N N   . ASP F 2 168 ? -45.564 -5.425  43.782  1.00 52.38  ? 258 ASP F N   1 
ATOM   3450 C CA  . ASP F 2 168 ? -46.877 -4.793  43.774  1.00 52.04  ? 258 ASP F CA  1 
ATOM   3451 C C   . ASP F 2 168 ? -47.301 -4.419  45.194  1.00 55.42  ? 258 ASP F C   1 
ATOM   3452 O O   . ASP F 2 168 ? -47.630 -5.292  46.008  1.00 55.89  ? 258 ASP F O   1 
ATOM   3453 C CB  . ASP F 2 168 ? -47.926 -5.699  43.113  1.00 53.86  ? 258 ASP F CB  1 
ATOM   3454 C CG  . ASP F 2 168 ? -47.811 -5.857  41.608  1.00 63.92  ? 258 ASP F CG  1 
ATOM   3455 O OD1 . ASP F 2 168 ? -48.312 -6.870  41.084  1.00 65.49  ? 258 ASP F OD1 1 
ATOM   3456 O OD2 . ASP F 2 168 ? -47.248 -4.950  40.949  1.00 67.90  ? 258 ASP F OD2 1 
ATOM   3457 N N   . MET F 2 169 ? -47.259 -3.110  45.487  1.00 50.15  ? 259 MET F N   1 
ATOM   3458 C CA  . MET F 2 169 ? -47.658 -2.513  46.764  1.00 48.25  ? 259 MET F CA  1 
ATOM   3459 C C   . MET F 2 169 ? -49.051 -1.912  46.633  1.00 49.10  ? 259 MET F C   1 
ATOM   3460 O O   . MET F 2 169 ? -49.479 -1.616  45.515  1.00 49.14  ? 259 MET F O   1 
ATOM   3461 C CB  . MET F 2 169 ? -46.667 -1.417  47.185  1.00 50.32  ? 259 MET F CB  1 
ATOM   3462 C CG  . MET F 2 169 ? -45.251 -1.899  47.450  1.00 53.55  ? 259 MET F CG  1 
ATOM   3463 S SD  . MET F 2 169 ? -44.056 -0.535  47.541  1.00 57.17  ? 259 MET F SD  1 
ATOM   3464 C CE  . MET F 2 169 ? -44.185 0.109   45.962  1.00 53.78  ? 259 MET F CE  1 
ATOM   3465 N N   . THR F 2 170 ? -49.749 -1.700  47.764  1.00 42.90  ? 260 THR F N   1 
ATOM   3466 C CA  . THR F 2 170 ? -51.080 -1.077  47.771  1.00 41.83  ? 260 THR F CA  1 
ATOM   3467 C C   . THR F 2 170 ? -50.936 0.446   47.550  1.00 43.77  ? 260 THR F C   1 
ATOM   3468 O O   . THR F 2 170 ? -49.824 0.972   47.663  1.00 44.92  ? 260 THR F O   1 
ATOM   3469 C CB  . THR F 2 170 ? -51.832 -1.376  49.091  1.00 47.51  ? 260 THR F CB  1 
ATOM   3470 O OG1 . THR F 2 170 ? -51.143 -0.742  50.169  1.00 47.82  ? 260 THR F OG1 1 
ATOM   3471 C CG2 . THR F 2 170 ? -52.004 -2.871  49.378  1.00 42.72  ? 260 THR F CG2 1 
ATOM   3472 N N   . PHE F 2 171 ? -52.047 1.158   47.273  1.00 37.17  ? 261 PHE F N   1 
ATOM   3473 C CA  . PHE F 2 171 ? -52.023 2.611   47.083  1.00 35.74  ? 261 PHE F CA  1 
ATOM   3474 C C   . PHE F 2 171 ? -51.567 3.309   48.374  1.00 39.86  ? 261 PHE F C   1 
ATOM   3475 O O   . PHE F 2 171 ? -50.750 4.233   48.325  1.00 39.73  ? 261 PHE F O   1 
ATOM   3476 C CB  . PHE F 2 171 ? -53.403 3.135   46.626  1.00 36.88  ? 261 PHE F CB  1 
ATOM   3477 C CG  . PHE F 2 171 ? -53.581 4.641   46.698  1.00 37.49  ? 261 PHE F CG  1 
ATOM   3478 C CD1 . PHE F 2 171 ? -53.016 5.473   45.738  1.00 39.32  ? 261 PHE F CD1 1 
ATOM   3479 C CD2 . PHE F 2 171 ? -54.330 5.221   47.715  1.00 38.22  ? 261 PHE F CD2 1 
ATOM   3480 C CE1 . PHE F 2 171 ? -53.163 6.863   45.820  1.00 39.85  ? 261 PHE F CE1 1 
ATOM   3481 C CE2 . PHE F 2 171 ? -54.492 6.608   47.784  1.00 40.68  ? 261 PHE F CE2 1 
ATOM   3482 C CZ  . PHE F 2 171 ? -53.910 7.419   46.834  1.00 38.59  ? 261 PHE F CZ  1 
ATOM   3483 N N   . GLU F 2 172 ? -52.083 2.833   49.524  1.00 35.46  ? 262 GLU F N   1 
ATOM   3484 C CA  . GLU F 2 172 ? -51.798 3.321   50.873  1.00 34.89  ? 262 GLU F CA  1 
ATOM   3485 C C   . GLU F 2 172 ? -50.298 3.240   51.168  1.00 36.77  ? 262 GLU F C   1 
ATOM   3486 O O   . GLU F 2 172 ? -49.755 4.151   51.780  1.00 36.24  ? 262 GLU F O   1 
ATOM   3487 C CB  . GLU F 2 172 ? -52.608 2.524   51.916  1.00 36.43  ? 262 GLU F CB  1 
ATOM   3488 C CG  . GLU F 2 172 ? -54.119 2.752   51.869  1.00 49.26  ? 262 GLU F CG  1 
ATOM   3489 C CD  . GLU F 2 172 ? -54.944 2.108   50.759  1.00 78.86  ? 262 GLU F CD  1 
ATOM   3490 O OE1 . GLU F 2 172 ? -56.091 2.565   50.544  1.00 78.64  ? 262 GLU F OE1 1 
ATOM   3491 O OE2 . GLU F 2 172 ? -54.458 1.152   50.109  1.00 73.65  ? 262 GLU F OE2 1 
ATOM   3492 N N   . GLU F 2 173 ? -49.633 2.173   50.690  1.00 32.69  ? 263 GLU F N   1 
ATOM   3493 C CA  . GLU F 2 173 ? -48.195 1.937   50.842  1.00 32.21  ? 263 GLU F CA  1 
ATOM   3494 C C   . GLU F 2 173 ? -47.388 2.899   49.963  1.00 33.72  ? 263 GLU F C   1 
ATOM   3495 O O   . GLU F 2 173 ? -46.407 3.468   50.438  1.00 31.83  ? 263 GLU F O   1 
ATOM   3496 C CB  . GLU F 2 173 ? -47.840 0.480   50.500  1.00 33.86  ? 263 GLU F CB  1 
ATOM   3497 C CG  . GLU F 2 173 ? -48.205 -0.514  51.595  1.00 42.80  ? 263 GLU F CG  1 
ATOM   3498 C CD  . GLU F 2 173 ? -48.073 -1.986  51.249  1.00 50.47  ? 263 GLU F CD  1 
ATOM   3499 O OE1 . GLU F 2 173 ? -47.832 -2.785  52.181  1.00 51.00  ? 263 GLU F OE1 1 
ATOM   3500 O OE2 . GLU F 2 173 ? -48.218 -2.347  50.059  1.00 33.25  ? 263 GLU F OE2 1 
ATOM   3501 N N   . GLU F 2 174 ? -47.805 3.080   48.689  1.00 30.05  ? 264 GLU F N   1 
ATOM   3502 C CA  . GLU F 2 174 ? -47.171 3.988   47.727  1.00 29.53  ? 264 GLU F CA  1 
ATOM   3503 C C   . GLU F 2 174 ? -47.182 5.422   48.265  1.00 31.69  ? 264 GLU F C   1 
ATOM   3504 O O   . GLU F 2 174 ? -46.139 6.077   48.254  1.00 31.78  ? 264 GLU F O   1 
ATOM   3505 C CB  . GLU F 2 174 ? -47.880 3.933   46.358  1.00 31.50  ? 264 GLU F CB  1 
ATOM   3506 C CG  . GLU F 2 174 ? -47.741 2.618   45.603  1.00 44.25  ? 264 GLU F CG  1 
ATOM   3507 C CD  . GLU F 2 174 ? -46.492 2.411   44.766  1.00 68.32  ? 264 GLU F CD  1 
ATOM   3508 O OE1 . GLU F 2 174 ? -45.569 3.256   44.821  1.00 55.81  ? 264 GLU F OE1 1 
ATOM   3509 O OE2 . GLU F 2 174 ? -46.426 1.370   44.072  1.00 69.93  ? 264 GLU F OE2 1 
ATOM   3510 N N   . ALA F 2 175 ? -48.349 5.882   48.782  1.00 26.65  ? 265 ALA F N   1 
ATOM   3511 C CA  . ALA F 2 175 ? -48.555 7.214   49.364  1.00 25.66  ? 265 ALA F CA  1 
ATOM   3512 C C   . ALA F 2 175 ? -47.675 7.424   50.612  1.00 29.71  ? 265 ALA F C   1 
ATOM   3513 O O   . ALA F 2 175 ? -47.024 8.461   50.723  1.00 28.04  ? 265 ALA F O   1 
ATOM   3514 C CB  . ALA F 2 175 ? -50.021 7.413   49.720  1.00 25.93  ? 265 ALA F CB  1 
ATOM   3515 N N   . GLN F 2 176 ? -47.624 6.414   51.515  1.00 27.27  ? 266 GLN F N   1 
ATOM   3516 C CA  . GLN F 2 176 ? -46.817 6.413   52.736  1.00 27.23  ? 266 GLN F CA  1 
ATOM   3517 C C   . GLN F 2 176 ? -45.340 6.557   52.396  1.00 30.49  ? 266 GLN F C   1 
ATOM   3518 O O   . GLN F 2 176 ? -44.626 7.317   53.061  1.00 29.29  ? 266 GLN F O   1 
ATOM   3519 C CB  . GLN F 2 176 ? -47.049 5.112   53.526  1.00 28.95  ? 266 GLN F CB  1 
ATOM   3520 C CG  . GLN F 2 176 ? -46.945 5.260   55.041  1.00 40.31  ? 266 GLN F CG  1 
ATOM   3521 C CD  . GLN F 2 176 ? -46.854 3.942   55.778  1.00 53.39  ? 266 GLN F CD  1 
ATOM   3522 O OE1 . GLN F 2 176 ? -47.195 2.870   55.259  1.00 38.45  ? 266 GLN F OE1 1 
ATOM   3523 N NE2 . GLN F 2 176 ? -46.392 3.999   57.027  1.00 52.39  ? 266 GLN F NE2 1 
ATOM   3524 N N   . LEU F 2 177 ? -44.895 5.858   51.329  1.00 27.07  ? 267 LEU F N   1 
ATOM   3525 C CA  . LEU F 2 177 ? -43.509 5.869   50.878  1.00 26.61  ? 267 LEU F CA  1 
ATOM   3526 C C   . LEU F 2 177 ? -43.159 7.177   50.165  1.00 29.40  ? 267 LEU F C   1 
ATOM   3527 O O   . LEU F 2 177 ? -41.995 7.575   50.177  1.00 26.75  ? 267 LEU F O   1 
ATOM   3528 C CB  . LEU F 2 177 ? -43.211 4.653   49.995  1.00 26.83  ? 267 LEU F CB  1 
ATOM   3529 C CG  . LEU F 2 177 ? -42.820 3.385   50.777  1.00 32.19  ? 267 LEU F CG  1 
ATOM   3530 C CD1 . LEU F 2 177 ? -43.146 2.152   50.009  1.00 32.26  ? 267 LEU F CD1 1 
ATOM   3531 C CD2 . LEU F 2 177 ? -41.352 3.380   51.141  1.00 34.73  ? 267 LEU F CD2 1 
ATOM   3532 N N   . LEU F 2 178 ? -44.167 7.848   49.553  1.00 27.48  ? 268 LEU F N   1 
ATOM   3533 C CA  . LEU F 2 178 ? -43.994 9.146   48.895  1.00 26.83  ? 268 LEU F CA  1 
ATOM   3534 C C   . LEU F 2 178 ? -43.765 10.198  49.947  1.00 30.96  ? 268 LEU F C   1 
ATOM   3535 O O   . LEU F 2 178 ? -42.875 11.027  49.791  1.00 30.43  ? 268 LEU F O   1 
ATOM   3536 C CB  . LEU F 2 178 ? -45.192 9.515   48.012  1.00 26.77  ? 268 LEU F CB  1 
ATOM   3537 C CG  . LEU F 2 178 ? -45.133 9.057   46.551  1.00 31.37  ? 268 LEU F CG  1 
ATOM   3538 C CD1 . LEU F 2 178 ? -46.473 9.262   45.878  1.00 31.75  ? 268 LEU F CD1 1 
ATOM   3539 C CD2 . LEU F 2 178 ? -44.060 9.808   45.772  1.00 33.29  ? 268 LEU F CD2 1 
ATOM   3540 N N   . GLN F 2 179 ? -44.517 10.116  51.063  1.00 27.72  ? 269 GLN F N   1 
ATOM   3541 C CA  . GLN F 2 179 ? -44.379 11.023  52.209  1.00 27.85  ? 269 GLN F CA  1 
ATOM   3542 C C   . GLN F 2 179 ? -42.987 10.902  52.845  1.00 30.77  ? 269 GLN F C   1 
ATOM   3543 O O   . GLN F 2 179 ? -42.419 11.894  53.292  1.00 31.82  ? 269 GLN F O   1 
ATOM   3544 C CB  . GLN F 2 179 ? -45.467 10.740  53.267  1.00 29.52  ? 269 GLN F CB  1 
ATOM   3545 C CG  . GLN F 2 179 ? -46.887 11.153  52.872  1.00 43.78  ? 269 GLN F CG  1 
ATOM   3546 C CD  . GLN F 2 179 ? -47.001 12.610  52.483  1.00 72.68  ? 269 GLN F CD  1 
ATOM   3547 O OE1 . GLN F 2 179 ? -47.046 12.948  51.301  0.00 68.28  ? 269 GLN F OE1 1 
ATOM   3548 N NE2 . GLN F 2 179 ? -47.027 13.505  53.460  1.00 69.32  ? 269 GLN F NE2 1 
ATOM   3549 N N   . LEU F 2 180 ? -42.436 9.688   52.846  1.00 25.96  ? 270 LEU F N   1 
ATOM   3550 C CA  . LEU F 2 180 ? -41.127 9.354   53.401  1.00 24.87  ? 270 LEU F CA  1 
ATOM   3551 C C   . LEU F 2 180 ? -40.019 9.840   52.492  1.00 25.98  ? 270 LEU F C   1 
ATOM   3552 O O   . LEU F 2 180 ? -39.024 10.360  52.979  1.00 25.87  ? 270 LEU F O   1 
ATOM   3553 C CB  . LEU F 2 180 ? -41.061 7.834   53.581  1.00 24.96  ? 270 LEU F CB  1 
ATOM   3554 C CG  . LEU F 2 180 ? -40.228 7.246   54.720  1.00 29.86  ? 270 LEU F CG  1 
ATOM   3555 C CD1 . LEU F 2 180 ? -40.531 7.893   56.089  1.00 30.01  ? 270 LEU F CD1 1 
ATOM   3556 C CD2 . LEU F 2 180 ? -40.434 5.746   54.796  1.00 32.83  ? 270 LEU F CD2 1 
ATOM   3557 N N   . LYS F 2 181 ? -40.199 9.696   51.175  1.00 20.61  ? 271 LYS F N   1 
ATOM   3558 C CA  . LYS F 2 181 ? -39.241 10.121  50.164  1.00 20.19  ? 271 LYS F CA  1 
ATOM   3559 C C   . LYS F 2 181 ? -39.020 11.648  50.217  1.00 26.29  ? 271 LYS F C   1 
ATOM   3560 O O   . LYS F 2 181 ? -37.870 12.090  50.153  1.00 27.02  ? 271 LYS F O   1 
ATOM   3561 C CB  . LYS F 2 181 ? -39.744 9.684   48.785  1.00 21.16  ? 271 LYS F CB  1 
ATOM   3562 C CG  . LYS F 2 181 ? -38.796 9.979   47.649  1.00 17.56  ? 271 LYS F CG  1 
ATOM   3563 C CD  . LYS F 2 181 ? -39.128 9.144   46.443  1.00 21.38  ? 271 LYS F CD  1 
ATOM   3564 C CE  . LYS F 2 181 ? -39.986 9.851   45.439  1.00 29.17  ? 271 LYS F CE  1 
ATOM   3565 N NZ  . LYS F 2 181 ? -39.533 9.534   44.054  1.00 42.39  ? 271 LYS F NZ  1 
ATOM   3566 N N   . VAL F 2 182 ? -40.113 12.443  50.360  1.00 22.16  ? 272 VAL F N   1 
ATOM   3567 C CA  . VAL F 2 182 ? -40.088 13.913  50.458  1.00 22.17  ? 272 VAL F CA  1 
ATOM   3568 C C   . VAL F 2 182 ? -39.326 14.311  51.728  1.00 26.32  ? 272 VAL F C   1 
ATOM   3569 O O   . VAL F 2 182 ? -38.490 15.209  51.664  1.00 27.70  ? 272 VAL F O   1 
ATOM   3570 C CB  . VAL F 2 182 ? -41.522 14.539  50.406  1.00 26.75  ? 272 VAL F CB  1 
ATOM   3571 C CG1 . VAL F 2 182 ? -41.491 16.056  50.497  1.00 26.78  ? 272 VAL F CG1 1 
ATOM   3572 C CG2 . VAL F 2 182 ? -42.279 14.107  49.142  1.00 26.54  ? 272 VAL F CG2 1 
ATOM   3573 N N   . LYS F 2 183 ? -39.573 13.626  52.861  1.00 22.05  ? 273 LYS F N   1 
ATOM   3574 C CA  . LYS F 2 183 ? -38.857 13.885  54.118  1.00 22.01  ? 273 LYS F CA  1 
ATOM   3575 C C   . LYS F 2 183 ? -37.351 13.605  53.953  1.00 26.93  ? 273 LYS F C   1 
ATOM   3576 O O   . LYS F 2 183 ? -36.541 14.412  54.409  1.00 26.22  ? 273 LYS F O   1 
ATOM   3577 C CB  . LYS F 2 183 ? -39.419 13.046  55.276  1.00 22.93  ? 273 LYS F CB  1 
ATOM   3578 C CG  . LYS F 2 183 ? -40.745 13.542  55.802  1.00 37.77  ? 273 LYS F CG  1 
ATOM   3579 C CD  . LYS F 2 183 ? -41.260 12.636  56.895  1.00 49.26  ? 273 LYS F CD  1 
ATOM   3580 C CE  . LYS F 2 183 ? -42.426 13.227  57.635  1.00 55.00  ? 273 LYS F CE  1 
ATOM   3581 N NZ  . LYS F 2 183 ? -42.554 12.622  58.984  1.00 64.36  ? 273 LYS F NZ  1 
ATOM   3582 N N   . CYS F 2 184 ? -36.988 12.498  53.260  1.00 23.64  ? 274 CYS F N   1 
ATOM   3583 C CA  . CYS F 2 184 ? -35.593 12.105  53.028  1.00 23.46  ? 274 CYS F CA  1 
ATOM   3584 C C   . CYS F 2 184 ? -34.896 13.068  52.066  1.00 26.90  ? 274 CYS F C   1 
ATOM   3585 O O   . CYS F 2 184 ? -33.729 13.380  52.287  1.00 26.99  ? 274 CYS F O   1 
ATOM   3586 C CB  . CYS F 2 184 ? -35.506 10.663  52.530  1.00 24.26  ? 274 CYS F CB  1 
ATOM   3587 S SG  . CYS F 2 184 ? -36.064 9.429   53.734  1.00 28.69  ? 274 CYS F SG  1 
ATOM   3588 N N   . LEU F 2 185 ? -35.590 13.525  51.007  1.00 23.17  ? 275 LEU F N   1 
ATOM   3589 C CA  . LEU F 2 185 ? -35.051 14.461  50.007  1.00 22.37  ? 275 LEU F CA  1 
ATOM   3590 C C   . LEU F 2 185 ? -34.810 15.848  50.613  1.00 26.16  ? 275 LEU F C   1 
ATOM   3591 O O   . LEU F 2 185 ? -33.848 16.518  50.241  1.00 24.06  ? 275 LEU F O   1 
ATOM   3592 C CB  . LEU F 2 185 ? -35.990 14.583  48.804  1.00 22.02  ? 275 LEU F CB  1 
ATOM   3593 C CG  . LEU F 2 185 ? -35.890 13.523  47.728  1.00 26.54  ? 275 LEU F CG  1 
ATOM   3594 C CD1 . LEU F 2 185 ? -37.099 13.568  46.831  1.00 26.77  ? 275 LEU F CD1 1 
ATOM   3595 C CD2 . LEU F 2 185 ? -34.626 13.695  46.896  1.00 28.89  ? 275 LEU F CD2 1 
ATOM   3596 N N   . ASN F 2 186 ? -35.693 16.284  51.529  1.00 24.48  ? 276 ASN F N   1 
ATOM   3597 C CA  . ASN F 2 186 ? -35.551 17.562  52.242  1.00 24.66  ? 276 ASN F CA  1 
ATOM   3598 C C   . ASN F 2 186 ? -34.358 17.486  53.187  1.00 29.51  ? 276 ASN F C   1 
ATOM   3599 O O   . ASN F 2 186 ? -33.579 18.438  53.296  1.00 29.81  ? 276 ASN F O   1 
ATOM   3600 C CB  . ASN F 2 186 ? -36.825 17.902  53.032  1.00 23.67  ? 276 ASN F CB  1 
ATOM   3601 C CG  . ASN F 2 186 ? -37.212 19.368  52.992  1.00 31.08  ? 276 ASN F CG  1 
ATOM   3602 O OD1 . ASN F 2 186 ? -36.422 20.266  52.645  1.00 27.26  ? 276 ASN F OD1 1 
ATOM   3603 N ND2 . ASN F 2 186 ? -38.466 19.630  53.274  1.00 14.04  ? 276 ASN F ND2 1 
ATOM   3604 N N   . ASN F 2 187 ? -34.222 16.326  53.865  1.00 25.73  ? 277 ASN F N   1 
ATOM   3605 C CA  . ASN F 2 187 ? -33.126 16.012  54.780  1.00 24.08  ? 277 ASN F CA  1 
ATOM   3606 C C   . ASN F 2 187 ? -31.810 15.955  54.020  1.00 25.77  ? 277 ASN F C   1 
ATOM   3607 O O   . ASN F 2 187 ? -30.788 16.404  54.535  1.00 24.27  ? 277 ASN F O   1 
ATOM   3608 C CB  . ASN F 2 187 ? -33.393 14.695  55.483  1.00 20.90  ? 277 ASN F CB  1 
ATOM   3609 C CG  . ASN F 2 187 ? -34.390 14.786  56.603  1.00 33.32  ? 277 ASN F CG  1 
ATOM   3610 O OD1 . ASN F 2 187 ? -35.033 15.817  56.811  1.00 31.46  ? 277 ASN F OD1 1 
ATOM   3611 N ND2 . ASN F 2 187 ? -34.539 13.712  57.354  1.00 25.33  ? 277 ASN F ND2 1 
ATOM   3612 N N   . LEU F 2 188 ? -31.845 15.416  52.791  1.00 22.22  ? 278 LEU F N   1 
ATOM   3613 C CA  . LEU F 2 188 ? -30.692 15.344  51.890  1.00 22.17  ? 278 LEU F CA  1 
ATOM   3614 C C   . LEU F 2 188 ? -30.286 16.769  51.484  1.00 26.10  ? 278 LEU F C   1 
ATOM   3615 O O   . LEU F 2 188 ? -29.099 17.084  51.520  1.00 25.77  ? 278 LEU F O   1 
ATOM   3616 C CB  . LEU F 2 188 ? -31.033 14.474  50.666  1.00 22.18  ? 278 LEU F CB  1 
ATOM   3617 C CG  . LEU F 2 188 ? -29.921 14.161  49.676  1.00 27.38  ? 278 LEU F CG  1 
ATOM   3618 C CD1 . LEU F 2 188 ? -28.732 13.479  50.339  1.00 27.03  ? 278 LEU F CD1 1 
ATOM   3619 C CD2 . LEU F 2 188 ? -30.443 13.329  48.546  1.00 29.21  ? 278 LEU F CD2 1 
ATOM   3620 N N   . ALA F 2 189 ? -31.274 17.643  51.174  1.00 22.77  ? 279 ALA F N   1 
ATOM   3621 C CA  . ALA F 2 189 ? -31.042 19.046  50.793  1.00 22.79  ? 279 ALA F CA  1 
ATOM   3622 C C   . ALA F 2 189 ? -30.405 19.802  51.962  1.00 26.90  ? 279 ALA F C   1 
ATOM   3623 O O   . ALA F 2 189 ? -29.380 20.455  51.759  1.00 26.40  ? 279 ALA F O   1 
ATOM   3624 C CB  . ALA F 2 189 ? -32.338 19.713  50.353  1.00 23.22  ? 279 ALA F CB  1 
ATOM   3625 N N   . ALA F 2 190 ? -30.929 19.604  53.199  1.00 23.20  ? 280 ALA F N   1 
ATOM   3626 C CA  . ALA F 2 190 ? -30.359 20.181  54.415  1.00 22.75  ? 280 ALA F CA  1 
ATOM   3627 C C   . ALA F 2 190 ? -28.879 19.825  54.561  1.00 26.35  ? 280 ALA F C   1 
ATOM   3628 O O   . ALA F 2 190 ? -28.092 20.655  55.020  1.00 26.62  ? 280 ALA F O   1 
ATOM   3629 C CB  . ALA F 2 190 ? -31.120 19.690  55.644  1.00 23.45  ? 280 ALA F CB  1 
ATOM   3630 N N   . SER F 2 191 ? -28.522 18.576  54.210  1.00 22.14  ? 281 SER F N   1 
ATOM   3631 C CA  . SER F 2 191 ? -27.173 18.010  54.318  1.00 21.50  ? 281 SER F CA  1 
ATOM   3632 C C   . SER F 2 191 ? -26.253 18.540  53.212  1.00 25.71  ? 281 SER F C   1 
ATOM   3633 O O   . SER F 2 191 ? -25.141 18.962  53.512  1.00 27.13  ? 281 SER F O   1 
ATOM   3634 C CB  . SER F 2 191 ? -27.230 16.485  54.288  1.00 23.67  ? 281 SER F CB  1 
ATOM   3635 O OG  . SER F 2 191 ? -27.960 15.995  55.405  1.00 29.25  ? 281 SER F OG  1 
ATOM   3636 N N   . GLN F 2 192 ? -26.733 18.565  51.955  1.00 21.37  ? 282 GLN F N   1 
ATOM   3637 C CA  . GLN F 2 192 ? -25.991 19.065  50.795  1.00 22.21  ? 282 GLN F CA  1 
ATOM   3638 C C   . GLN F 2 192 ? -25.657 20.563  50.949  1.00 28.58  ? 282 GLN F C   1 
ATOM   3639 O O   . GLN F 2 192 ? -24.522 20.961  50.661  1.00 27.41  ? 282 GLN F O   1 
ATOM   3640 C CB  . GLN F 2 192 ? -26.773 18.807  49.487  1.00 22.95  ? 282 GLN F CB  1 
ATOM   3641 C CG  . GLN F 2 192 ? -26.796 17.330  49.085  1.00 24.17  ? 282 GLN F CG  1 
ATOM   3642 C CD  . GLN F 2 192 ? -27.895 16.950  48.125  1.00 34.92  ? 282 GLN F CD  1 
ATOM   3643 O OE1 . GLN F 2 192 ? -29.010 17.489  48.139  1.00 29.47  ? 282 GLN F OE1 1 
ATOM   3644 N NE2 . GLN F 2 192 ? -27.624 15.938  47.321  1.00 23.92  ? 282 GLN F NE2 1 
ATOM   3645 N N   . LEU F 2 193 ? -26.630 21.369  51.449  1.00 27.53  ? 283 LEU F N   1 
ATOM   3646 C CA  . LEU F 2 193 ? -26.495 22.817  51.681  1.00 28.51  ? 283 LEU F CA  1 
ATOM   3647 C C   . LEU F 2 193 ? -25.366 23.095  52.679  1.00 32.78  ? 283 LEU F C   1 
ATOM   3648 O O   . LEU F 2 193 ? -24.586 24.026  52.474  1.00 32.14  ? 283 LEU F O   1 
ATOM   3649 C CB  . LEU F 2 193 ? -27.838 23.410  52.165  1.00 29.08  ? 283 LEU F CB  1 
ATOM   3650 C CG  . LEU F 2 193 ? -27.890 24.865  52.705  1.00 34.41  ? 283 LEU F CG  1 
ATOM   3651 C CD1 . LEU F 2 193 ? -27.352 25.901  51.683  1.00 34.25  ? 283 LEU F CD1 1 
ATOM   3652 C CD2 . LEU F 2 193 ? -29.317 25.242  53.122  1.00 36.33  ? 283 LEU F CD2 1 
ATOM   3653 N N   . LYS F 2 194 ? -25.246 22.250  53.717  1.00 30.06  ? 284 LYS F N   1 
ATOM   3654 C CA  . LYS F 2 194 ? -24.188 22.345  54.728  1.00 30.44  ? 284 LYS F CA  1 
ATOM   3655 C C   . LYS F 2 194 ? -22.797 22.014  54.149  1.00 36.81  ? 284 LYS F C   1 
ATOM   3656 O O   . LYS F 2 194 ? -21.788 22.465  54.688  1.00 36.49  ? 284 LYS F O   1 
ATOM   3657 C CB  . LYS F 2 194 ? -24.497 21.426  55.920  1.00 32.01  ? 284 LYS F CB  1 
ATOM   3658 C CG  . LYS F 2 194 ? -25.600 21.956  56.826  1.00 34.74  ? 284 LYS F CG  1 
ATOM   3659 C CD  . LYS F 2 194 ? -25.124 23.070  57.743  1.00 39.86  ? 284 LYS F CD  1 
ATOM   3660 C CE  . LYS F 2 194 ? -26.258 23.708  58.507  1.00 45.61  ? 284 LYS F CE  1 
ATOM   3661 N NZ  . LYS F 2 194 ? -27.134 24.549  57.636  1.00 58.35  ? 284 LYS F NZ  1 
ATOM   3662 N N   . LEU F 2 195 ? -22.753 21.257  53.046  1.00 35.26  ? 285 LEU F N   1 
ATOM   3663 C CA  . LEU F 2 195 ? -21.517 20.858  52.369  1.00 35.55  ? 285 LEU F CA  1 
ATOM   3664 C C   . LEU F 2 195 ? -21.240 21.741  51.145  1.00 39.95  ? 285 LEU F C   1 
ATOM   3665 O O   . LEU F 2 195 ? -20.355 21.427  50.345  1.00 38.39  ? 285 LEU F O   1 
ATOM   3666 C CB  . LEU F 2 195 ? -21.621 19.378  51.939  1.00 35.63  ? 285 LEU F CB  1 
ATOM   3667 C CG  . LEU F 2 195 ? -21.554 18.322  53.047  1.00 39.52  ? 285 LEU F CG  1 
ATOM   3668 C CD1 . LEU F 2 195 ? -22.040 16.969  52.545  1.00 39.98  ? 285 LEU F CD1 1 
ATOM   3669 C CD2 . LEU F 2 195 ? -20.152 18.193  53.588  1.00 40.59  ? 285 LEU F CD2 1 
ATOM   3670 N N   . ASP F 2 196 ? -22.020 22.838  50.990  1.00 37.62  ? 286 ASP F N   1 
ATOM   3671 C CA  . ASP F 2 196 ? -21.960 23.788  49.878  1.00 37.75  ? 286 ASP F CA  1 
ATOM   3672 C C   . ASP F 2 196 ? -22.118 23.068  48.533  1.00 42.37  ? 286 ASP F C   1 
ATOM   3673 O O   . ASP F 2 196 ? -21.625 23.555  47.518  1.00 41.33  ? 286 ASP F O   1 
ATOM   3674 C CB  . ASP F 2 196 ? -20.669 24.641  49.904  1.00 39.88  ? 286 ASP F CB  1 
ATOM   3675 C CG  . ASP F 2 196 ? -20.436 25.461  51.161  1.00 51.29  ? 286 ASP F CG  1 
ATOM   3676 O OD1 . ASP F 2 196 ? -21.359 25.541  52.007  1.00 51.03  ? 286 ASP F OD1 1 
ATOM   3677 O OD2 . ASP F 2 196 ? -19.336 26.033  51.298  1.00 61.17  ? 286 ASP F OD2 1 
ATOM   3678 N N   . HIS F 2 197 ? -22.815 21.912  48.518  1.00 40.31  ? 287 HIS F N   1 
ATOM   3679 C CA  . HIS F 2 197 ? -23.093 21.189  47.277  1.00 40.55  ? 287 HIS F CA  1 
ATOM   3680 C C   . HIS F 2 197 ? -24.408 21.738  46.732  1.00 40.96  ? 287 HIS F C   1 
ATOM   3681 O O   . HIS F 2 197 ? -25.445 21.070  46.727  1.00 39.27  ? 287 HIS F O   1 
ATOM   3682 C CB  . HIS F 2 197 ? -23.122 19.665  47.489  1.00 42.35  ? 287 HIS F CB  1 
ATOM   3683 C CG  . HIS F 2 197 ? -22.962 18.864  46.230  1.00 46.76  ? 287 HIS F CG  1 
ATOM   3684 N ND1 . HIS F 2 197 ? -22.990 19.457  44.963  1.00 49.06  ? 287 HIS F ND1 1 
ATOM   3685 C CD2 . HIS F 2 197 ? -22.779 17.531  46.081  1.00 49.13  ? 287 HIS F CD2 1 
ATOM   3686 C CE1 . HIS F 2 197 ? -22.811 18.466  44.101  1.00 48.76  ? 287 HIS F CE1 1 
ATOM   3687 N NE2 . HIS F 2 197 ? -22.685 17.290  44.725  1.00 49.11  ? 287 HIS F NE2 1 
ATOM   3688 N N   . TYR F 2 198 ? -24.334 22.996  46.284  1.00 37.45  ? 288 TYR F N   1 
ATOM   3689 C CA  . TYR F 2 198 ? -25.429 23.846  45.828  1.00 36.59  ? 288 TYR F CA  1 
ATOM   3690 C C   . TYR F 2 198 ? -26.229 23.256  44.683  1.00 37.91  ? 288 TYR F C   1 
ATOM   3691 O O   . TYR F 2 198 ? -27.452 23.269  44.766  1.00 35.10  ? 288 TYR F O   1 
ATOM   3692 C CB  . TYR F 2 198 ? -24.902 25.240  45.460  1.00 38.24  ? 288 TYR F CB  1 
ATOM   3693 C CG  . TYR F 2 198 ? -24.263 25.964  46.632  1.00 40.83  ? 288 TYR F CG  1 
ATOM   3694 C CD1 . TYR F 2 198 ? -24.832 25.916  47.903  1.00 43.30  ? 288 TYR F CD1 1 
ATOM   3695 C CD2 . TYR F 2 198 ? -23.105 26.722  46.464  1.00 41.82  ? 288 TYR F CD2 1 
ATOM   3696 C CE1 . TYR F 2 198 ? -24.248 26.573  48.985  1.00 44.92  ? 288 TYR F CE1 1 
ATOM   3697 C CE2 . TYR F 2 198 ? -22.518 27.395  47.537  1.00 42.92  ? 288 TYR F CE2 1 
ATOM   3698 C CZ  . TYR F 2 198 ? -23.093 27.315  48.795  1.00 51.07  ? 288 TYR F CZ  1 
ATOM   3699 O OH  . TYR F 2 198 ? -22.522 27.977  49.853  1.00 54.31  ? 288 TYR F OH  1 
ATOM   3700 N N   . ARG F 2 199 ? -25.565 22.720  43.641  1.00 35.78  ? 289 ARG F N   1 
ATOM   3701 C CA  . ARG F 2 199 ? -26.269 22.135  42.494  1.00 35.34  ? 289 ARG F CA  1 
ATOM   3702 C C   . ARG F 2 199 ? -27.093 20.912  42.907  1.00 35.87  ? 289 ARG F C   1 
ATOM   3703 O O   . ARG F 2 199 ? -28.218 20.760  42.439  1.00 34.84  ? 289 ARG F O   1 
ATOM   3704 C CB  . ARG F 2 199 ? -25.304 21.782  41.356  1.00 36.58  ? 289 ARG F CB  1 
ATOM   3705 C CG  . ARG F 2 199 ? -24.984 22.974  40.457  1.00 47.97  ? 289 ARG F CG  1 
ATOM   3706 C CD  . ARG F 2 199 ? -24.552 22.566  39.054  1.00 57.46  ? 289 ARG F CD  1 
ATOM   3707 N NE  . ARG F 2 199 ? -25.681 22.074  38.260  1.00 66.16  ? 289 ARG F NE  1 
ATOM   3708 C CZ  . ARG F 2 199 ? -26.480 22.843  37.527  1.00 78.98  ? 289 ARG F CZ  1 
ATOM   3709 N NH1 . ARG F 2 199 ? -26.280 24.155  37.468  1.00 65.99  ? 289 ARG F NH1 1 
ATOM   3710 N NH2 . ARG F 2 199 ? -27.486 22.307  36.847  1.00 62.86  ? 289 ARG F NH2 1 
ATOM   3711 N N   . ALA F 2 200 ? -26.562 20.094  43.829  1.00 30.42  ? 290 ALA F N   1 
ATOM   3712 C CA  . ALA F 2 200 ? -27.231 18.906  44.337  1.00 29.30  ? 290 ALA F CA  1 
ATOM   3713 C C   . ALA F 2 200 ? -28.359 19.258  45.286  1.00 33.80  ? 290 ALA F C   1 
ATOM   3714 O O   . ALA F 2 200 ? -29.428 18.650  45.194  1.00 35.04  ? 290 ALA F O   1 
ATOM   3715 C CB  . ALA F 2 200 ? -26.237 18.008  45.030  1.00 29.84  ? 290 ALA F CB  1 
ATOM   3716 N N   . ALA F 2 201 ? -28.128 20.220  46.209  1.00 29.09  ? 291 ALA F N   1 
ATOM   3717 C CA  . ALA F 2 201 ? -29.120 20.700  47.173  1.00 28.30  ? 291 ALA F CA  1 
ATOM   3718 C C   . ALA F 2 201 ? -30.341 21.278  46.453  1.00 32.75  ? 291 ALA F C   1 
ATOM   3719 O O   . ALA F 2 201 ? -31.473 21.083  46.902  1.00 31.39  ? 291 ALA F O   1 
ATOM   3720 C CB  . ALA F 2 201 ? -28.497 21.755  48.077  1.00 28.74  ? 291 ALA F CB  1 
ATOM   3721 N N   . LEU F 2 202 ? -30.096 21.974  45.317  1.00 30.88  ? 292 LEU F N   1 
ATOM   3722 C CA  . LEU F 2 202 ? -31.115 22.583  44.470  1.00 31.47  ? 292 LEU F CA  1 
ATOM   3723 C C   . LEU F 2 202 ? -32.011 21.534  43.849  1.00 33.79  ? 292 LEU F C   1 
ATOM   3724 O O   . LEU F 2 202 ? -33.220 21.743  43.810  1.00 35.20  ? 292 LEU F O   1 
ATOM   3725 C CB  . LEU F 2 202 ? -30.472 23.419  43.362  1.00 32.33  ? 292 LEU F CB  1 
ATOM   3726 C CG  . LEU F 2 202 ? -30.457 24.907  43.578  1.00 37.86  ? 292 LEU F CG  1 
ATOM   3727 C CD1 . LEU F 2 202 ? -29.401 25.544  42.708  1.00 38.13  ? 292 LEU F CD1 1 
ATOM   3728 C CD2 . LEU F 2 202 ? -31.846 25.529  43.339  1.00 41.75  ? 292 LEU F CD2 1 
ATOM   3729 N N   . ARG F 2 203 ? -31.420 20.422  43.348  1.00 28.32  ? 293 ARG F N   1 
ATOM   3730 C CA  . ARG F 2 203 ? -32.147 19.297  42.751  1.00 28.31  ? 293 ARG F CA  1 
ATOM   3731 C C   . ARG F 2 203 ? -33.089 18.683  43.760  1.00 31.38  ? 293 ARG F C   1 
ATOM   3732 O O   . ARG F 2 203 ? -34.271 18.494  43.465  1.00 31.47  ? 293 ARG F O   1 
ATOM   3733 C CB  . ARG F 2 203 ? -31.177 18.222  42.235  1.00 30.04  ? 293 ARG F CB  1 
ATOM   3734 C CG  . ARG F 2 203 ? -30.822 18.367  40.754  1.00 41.07  ? 293 ARG F CG  1 
ATOM   3735 C CD  . ARG F 2 203 ? -30.112 17.135  40.213  1.00 47.31  ? 293 ARG F CD  1 
ATOM   3736 N NE  . ARG F 2 203 ? -28.802 16.913  40.836  1.00 52.52  ? 293 ARG F NE  1 
ATOM   3737 C CZ  . ARG F 2 203 ? -27.656 17.423  40.390  1.00 62.22  ? 293 ARG F CZ  1 
ATOM   3738 N NH1 . ARG F 2 203 ? -27.640 18.198  39.311  0.00 49.50  ? 293 ARG F NH1 1 
ATOM   3739 N NH2 . ARG F 2 203 ? -26.519 17.166  41.021  1.00 39.94  ? 293 ARG F NH2 1 
ATOM   3740 N N   . SER F 2 204 ? -32.565 18.415  44.968  1.00 26.80  ? 294 SER F N   1 
ATOM   3741 C CA  . SER F 2 204 ? -33.315 17.821  46.062  1.00 26.28  ? 294 SER F CA  1 
ATOM   3742 C C   . SER F 2 204 ? -34.454 18.753  46.482  1.00 30.75  ? 294 SER F C   1 
ATOM   3743 O O   . SER F 2 204 ? -35.585 18.281  46.618  1.00 30.26  ? 294 SER F O   1 
ATOM   3744 C CB  . SER F 2 204 ? -32.387 17.512  47.227  1.00 27.79  ? 294 SER F CB  1 
ATOM   3745 O OG  . SER F 2 204 ? -31.260 16.786  46.765  1.00 32.49  ? 294 SER F OG  1 
ATOM   3746 N N   . CYS F 2 205 ? -34.168 20.080  46.598  1.00 26.90  ? 295 CYS F N   1 
ATOM   3747 C CA  . CYS F 2 205 ? -35.137 21.133  46.950  1.00 26.55  ? 295 CYS F CA  1 
ATOM   3748 C C   . CYS F 2 205 ? -36.263 21.185  45.936  1.00 29.85  ? 295 CYS F C   1 
ATOM   3749 O O   . CYS F 2 205 ? -37.424 21.171  46.331  1.00 30.67  ? 295 CYS F O   1 
ATOM   3750 C CB  . CYS F 2 205 ? -34.446 22.489  47.073  1.00 26.32  ? 295 CYS F CB  1 
ATOM   3751 S SG  . CYS F 2 205 ? -33.704 22.795  48.694  1.00 29.84  ? 295 CYS F SG  1 
ATOM   3752 N N   . SER F 2 206 ? -35.918 21.213  44.638  1.00 26.06  ? 296 SER F N   1 
ATOM   3753 C CA  . SER F 2 206 ? -36.873 21.268  43.534  1.00 26.87  ? 296 SER F CA  1 
ATOM   3754 C C   . SER F 2 206 ? -37.735 20.012  43.449  1.00 31.17  ? 296 SER F C   1 
ATOM   3755 O O   . SER F 2 206 ? -38.898 20.127  43.071  1.00 32.45  ? 296 SER F O   1 
ATOM   3756 C CB  . SER F 2 206 ? -36.156 21.502  42.209  1.00 31.18  ? 296 SER F CB  1 
ATOM   3757 O OG  . SER F 2 206 ? -35.547 22.781  42.214  1.00 41.19  ? 296 SER F OG  1 
ATOM   3758 N N   . LEU F 2 207 ? -37.183 18.828  43.794  1.00 26.53  ? 297 LEU F N   1 
ATOM   3759 C CA  . LEU F 2 207 ? -37.939 17.577  43.781  1.00 26.15  ? 297 LEU F CA  1 
ATOM   3760 C C   . LEU F 2 207 ? -38.963 17.576  44.901  1.00 30.50  ? 297 LEU F C   1 
ATOM   3761 O O   . LEU F 2 207 ? -40.085 17.128  44.674  1.00 30.42  ? 297 LEU F O   1 
ATOM   3762 C CB  . LEU F 2 207 ? -37.028 16.341  43.873  1.00 26.48  ? 297 LEU F CB  1 
ATOM   3763 C CG  . LEU F 2 207 ? -36.379 15.867  42.552  1.00 31.89  ? 297 LEU F CG  1 
ATOM   3764 C CD1 . LEU F 2 207 ? -35.126 15.042  42.821  1.00 31.81  ? 297 LEU F CD1 1 
ATOM   3765 C CD2 . LEU F 2 207 ? -37.351 15.044  41.707  1.00 34.53  ? 297 LEU F CD2 1 
ATOM   3766 N N   . VAL F 2 208 ? -38.598 18.097  46.094  1.00 26.44  ? 298 VAL F N   1 
ATOM   3767 C CA  . VAL F 2 208 ? -39.509 18.197  47.240  1.00 26.33  ? 298 VAL F CA  1 
ATOM   3768 C C   . VAL F 2 208 ? -40.666 19.137  46.882  1.00 31.81  ? 298 VAL F C   1 
ATOM   3769 O O   . VAL F 2 208 ? -41.825 18.804  47.146  1.00 32.19  ? 298 VAL F O   1 
ATOM   3770 C CB  . VAL F 2 208 ? -38.789 18.669  48.541  1.00 29.22  ? 298 VAL F CB  1 
ATOM   3771 C CG1 . VAL F 2 208 ? -39.778 18.977  49.660  1.00 28.97  ? 298 VAL F CG1 1 
ATOM   3772 C CG2 . VAL F 2 208 ? -37.791 17.640  49.012  1.00 28.62  ? 298 VAL F CG2 1 
ATOM   3773 N N   . LEU F 2 209 ? -40.350 20.291  46.269  1.00 28.13  ? 299 LEU F N   1 
ATOM   3774 C CA  . LEU F 2 209 ? -41.348 21.313  45.930  1.00 27.99  ? 299 LEU F CA  1 
ATOM   3775 C C   . LEU F 2 209 ? -42.274 20.881  44.794  1.00 32.59  ? 299 LEU F C   1 
ATOM   3776 O O   . LEU F 2 209 ? -43.374 21.432  44.673  1.00 32.88  ? 299 LEU F O   1 
ATOM   3777 C CB  . LEU F 2 209 ? -40.693 22.659  45.611  1.00 27.59  ? 299 LEU F CB  1 
ATOM   3778 C CG  . LEU F 2 209 ? -40.000 23.330  46.791  1.00 31.59  ? 299 LEU F CG  1 
ATOM   3779 C CD1 . LEU F 2 209 ? -39.082 24.430  46.321  1.00 31.72  ? 299 LEU F CD1 1 
ATOM   3780 C CD2 . LEU F 2 209 ? -41.006 23.819  47.831  1.00 32.80  ? 299 LEU F CD2 1 
ATOM   3781 N N   . GLU F 2 210 ? -41.857 19.880  43.998  1.00 27.42  ? 300 GLU F N   1 
ATOM   3782 C CA  . GLU F 2 210 ? -42.698 19.321  42.951  1.00 26.77  ? 300 GLU F CA  1 
ATOM   3783 C C   . GLU F 2 210 ? -43.809 18.489  43.576  1.00 31.52  ? 300 GLU F C   1 
ATOM   3784 O O   . GLU F 2 210 ? -44.892 18.426  43.011  1.00 31.32  ? 300 GLU F O   1 
ATOM   3785 C CB  . GLU F 2 210 ? -41.876 18.493  41.967  1.00 27.99  ? 300 GLU F CB  1 
ATOM   3786 C CG  . GLU F 2 210 ? -41.240 19.347  40.879  1.00 39.06  ? 300 GLU F CG  1 
ATOM   3787 C CD  . GLU F 2 210 ? -42.027 19.544  39.598  1.00 58.28  ? 300 GLU F CD  1 
ATOM   3788 O OE1 . GLU F 2 210 ? -41.489 19.181  38.529  1.00 61.26  ? 300 GLU F OE1 1 
ATOM   3789 O OE2 . GLU F 2 210 ? -43.156 20.085  39.648  1.00 50.14  ? 300 GLU F OE2 1 
ATOM   3790 N N   . HIS F 2 211 ? -43.551 17.884  44.763  1.00 29.03  ? 301 HIS F N   1 
ATOM   3791 C CA  . HIS F 2 211 ? -44.528 17.081  45.510  1.00 28.69  ? 301 HIS F CA  1 
ATOM   3792 C C   . HIS F 2 211 ? -45.308 17.939  46.478  1.00 32.49  ? 301 HIS F C   1 
ATOM   3793 O O   . HIS F 2 211 ? -46.528 17.775  46.592  1.00 32.59  ? 301 HIS F O   1 
ATOM   3794 C CB  . HIS F 2 211 ? -43.844 15.941  46.274  1.00 29.29  ? 301 HIS F CB  1 
ATOM   3795 C CG  . HIS F 2 211 ? -43.293 14.873  45.396  1.00 32.42  ? 301 HIS F CG  1 
ATOM   3796 N ND1 . HIS F 2 211 ? -44.009 13.713  45.146  1.00 34.01  ? 301 HIS F ND1 1 
ATOM   3797 C CD2 . HIS F 2 211 ? -42.123 14.818  44.726  1.00 33.93  ? 301 HIS F CD2 1 
ATOM   3798 C CE1 . HIS F 2 211 ? -43.247 12.992  44.339  1.00 33.57  ? 301 HIS F CE1 1 
ATOM   3799 N NE2 . HIS F 2 211 ? -42.106 13.615  44.058  1.00 33.90  ? 301 HIS F NE2 1 
ATOM   3800 N N   . GLN F 2 212 ? -44.597 18.832  47.194  1.00 28.42  ? 302 GLN F N   1 
ATOM   3801 C CA  . GLN F 2 212 ? -45.156 19.727  48.196  1.00 27.90  ? 302 GLN F CA  1 
ATOM   3802 C C   . GLN F 2 212 ? -44.715 21.177  47.918  1.00 31.69  ? 302 GLN F C   1 
ATOM   3803 O O   . GLN F 2 212 ? -43.716 21.628  48.492  1.00 28.59  ? 302 GLN F O   1 
ATOM   3804 C CB  . GLN F 2 212 ? -44.753 19.273  49.609  1.00 29.38  ? 302 GLN F CB  1 
ATOM   3805 C CG  . GLN F 2 212 ? -45.462 17.996  50.057  1.00 42.16  ? 302 GLN F CG  1 
ATOM   3806 C CD  . GLN F 2 212 ? -44.918 17.392  51.330  1.00 53.79  ? 302 GLN F CD  1 
ATOM   3807 O OE1 . GLN F 2 212 ? -44.217 18.038  52.138  1.00 44.82  ? 302 GLN F OE1 1 
ATOM   3808 N NE2 . GLN F 2 212 ? -45.261 16.126  51.544  1.00 42.80  ? 302 GLN F NE2 1 
ATOM   3809 N N   . PRO F 2 213 ? -45.470 21.929  47.055  1.00 29.55  ? 303 PRO F N   1 
ATOM   3810 C CA  . PRO F 2 213 ? -45.071 23.318  46.739  1.00 29.94  ? 303 PRO F CA  1 
ATOM   3811 C C   . PRO F 2 213 ? -45.155 24.318  47.890  1.00 36.24  ? 303 PRO F C   1 
ATOM   3812 O O   . PRO F 2 213 ? -44.598 25.402  47.733  1.00 37.40  ? 303 PRO F O   1 
ATOM   3813 C CB  . PRO F 2 213 ? -46.026 23.733  45.619  1.00 31.68  ? 303 PRO F CB  1 
ATOM   3814 C CG  . PRO F 2 213 ? -47.172 22.817  45.725  1.00 35.83  ? 303 PRO F CG  1 
ATOM   3815 C CD  . PRO F 2 213 ? -46.672 21.528  46.297  1.00 30.60  ? 303 PRO F CD  1 
ATOM   3816 N N   . ASP F 2 214 ? -45.792 23.974  49.030  1.00 32.73  ? 304 ASP F N   1 
ATOM   3817 C CA  . ASP F 2 214 ? -45.861 24.869  50.184  1.00 32.84  ? 304 ASP F CA  1 
ATOM   3818 C C   . ASP F 2 214 ? -45.014 24.337  51.372  1.00 34.14  ? 304 ASP F C   1 
ATOM   3819 O O   . ASP F 2 214 ? -45.322 24.619  52.529  1.00 33.98  ? 304 ASP F O   1 
ATOM   3820 C CB  . ASP F 2 214 ? -47.314 25.185  50.619  1.00 35.85  ? 304 ASP F CB  1 
ATOM   3821 C CG  . ASP F 2 214 ? -48.431 24.343  50.037  1.00 56.06  ? 304 ASP F CG  1 
ATOM   3822 O OD1 . ASP F 2 214 ? -48.380 23.102  50.196  1.00 58.10  ? 304 ASP F OD1 1 
ATOM   3823 O OD2 . ASP F 2 214 ? -49.378 24.931  49.468  1.00 66.11  ? 304 ASP F OD2 1 
ATOM   3824 N N   . ASN F 2 215 ? -43.938 23.581  51.070  1.00 29.33  ? 305 ASN F N   1 
ATOM   3825 C CA  . ASN F 2 215 ? -43.014 23.063  52.079  1.00 28.27  ? 305 ASN F CA  1 
ATOM   3826 C C   . ASN F 2 215 ? -42.088 24.203  52.444  1.00 29.90  ? 305 ASN F C   1 
ATOM   3827 O O   . ASN F 2 215 ? -41.266 24.594  51.623  1.00 28.89  ? 305 ASN F O   1 
ATOM   3828 C CB  . ASN F 2 215 ? -42.237 21.831  51.550  1.00 27.04  ? 305 ASN F CB  1 
ATOM   3829 C CG  . ASN F 2 215 ? -41.438 21.111  52.611  1.00 33.01  ? 305 ASN F CG  1 
ATOM   3830 O OD1 . ASN F 2 215 ? -40.522 21.658  53.229  1.00 24.53  ? 305 ASN F OD1 1 
ATOM   3831 N ND2 . ASN F 2 215 ? -41.747 19.855  52.815  1.00 27.11  ? 305 ASN F ND2 1 
ATOM   3832 N N   . ILE F 2 216 ? -42.258 24.769  53.644  1.00 26.52  ? 306 ILE F N   1 
ATOM   3833 C CA  . ILE F 2 216 ? -41.514 25.943  54.112  1.00 25.94  ? 306 ILE F CA  1 
ATOM   3834 C C   . ILE F 2 216 ? -40.008 25.671  54.186  1.00 29.08  ? 306 ILE F C   1 
ATOM   3835 O O   . ILE F 2 216 ? -39.226 26.549  53.814  1.00 27.93  ? 306 ILE F O   1 
ATOM   3836 C CB  . ILE F 2 216 ? -42.083 26.501  55.453  1.00 29.02  ? 306 ILE F CB  1 
ATOM   3837 C CG1 . ILE F 2 216 ? -41.528 27.911  55.741  1.00 29.56  ? 306 ILE F CG1 1 
ATOM   3838 C CG2 . ILE F 2 216 ? -41.897 25.526  56.643  1.00 30.41  ? 306 ILE F CG2 1 
ATOM   3839 C CD1 . ILE F 2 216 ? -42.142 28.645  56.892  1.00 43.16  ? 306 ILE F CD1 1 
ATOM   3840 N N   . LYS F 2 217 ? -39.609 24.454  54.622  1.00 25.51  ? 307 LYS F N   1 
ATOM   3841 C CA  . LYS F 2 217 ? -38.208 24.068  54.755  1.00 23.37  ? 307 LYS F CA  1 
ATOM   3842 C C   . LYS F 2 217 ? -37.534 24.028  53.405  1.00 25.05  ? 307 LYS F C   1 
ATOM   3843 O O   . LYS F 2 217 ? -36.472 24.629  53.256  1.00 21.97  ? 307 LYS F O   1 
ATOM   3844 C CB  . LYS F 2 217 ? -38.072 22.734  55.489  1.00 24.12  ? 307 LYS F CB  1 
ATOM   3845 C CG  . LYS F 2 217 ? -38.196 22.899  56.996  1.00 27.98  ? 307 LYS F CG  1 
ATOM   3846 C CD  . LYS F 2 217 ? -37.997 21.612  57.742  1.00 26.94  ? 307 LYS F CD  1 
ATOM   3847 C CE  . LYS F 2 217 ? -38.063 21.883  59.217  1.00 29.16  ? 307 LYS F CE  1 
ATOM   3848 N NZ  . LYS F 2 217 ? -37.656 20.697  60.006  1.00 46.52  ? 307 LYS F NZ  1 
ATOM   3849 N N   . ALA F 2 218 ? -38.174 23.386  52.405  1.00 22.82  ? 308 ALA F N   1 
ATOM   3850 C CA  . ALA F 2 218 ? -37.635 23.289  51.053  1.00 22.84  ? 308 ALA F CA  1 
ATOM   3851 C C   . ALA F 2 218 ? -37.586 24.645  50.369  1.00 25.54  ? 308 ALA F C   1 
ATOM   3852 O O   . ALA F 2 218 ? -36.675 24.870  49.582  1.00 25.76  ? 308 ALA F O   1 
ATOM   3853 C CB  . ALA F 2 218 ? -38.459 22.325  50.226  1.00 23.72  ? 308 ALA F CB  1 
ATOM   3854 N N   . LEU F 2 219 ? -38.561 25.535  50.646  1.00 21.26  ? 309 LEU F N   1 
ATOM   3855 C CA  . LEU F 2 219 ? -38.592 26.886  50.078  1.00 21.11  ? 309 LEU F CA  1 
ATOM   3856 C C   . LEU F 2 219 ? -37.436 27.699  50.651  1.00 26.12  ? 309 LEU F C   1 
ATOM   3857 O O   . LEU F 2 219 ? -36.661 28.273  49.892  1.00 26.38  ? 309 LEU F O   1 
ATOM   3858 C CB  . LEU F 2 219 ? -39.950 27.594  50.347  1.00 20.91  ? 309 LEU F CB  1 
ATOM   3859 C CG  . LEU F 2 219 ? -41.139 27.147  49.485  1.00 25.40  ? 309 LEU F CG  1 
ATOM   3860 C CD1 . LEU F 2 219 ? -42.461 27.545  50.107  1.00 26.29  ? 309 LEU F CD1 1 
ATOM   3861 C CD2 . LEU F 2 219 ? -41.043 27.657  48.063  1.00 26.33  ? 309 LEU F CD2 1 
ATOM   3862 N N   . PHE F 2 220 ? -37.272 27.684  51.986  1.00 23.89  ? 310 PHE F N   1 
ATOM   3863 C CA  . PHE F 2 220 ? -36.199 28.415  52.657  1.00 25.16  ? 310 PHE F CA  1 
ATOM   3864 C C   . PHE F 2 220 ? -34.820 27.916  52.207  1.00 31.24  ? 310 PHE F C   1 
ATOM   3865 O O   . PHE F 2 220 ? -33.940 28.734  51.943  1.00 32.24  ? 310 PHE F O   1 
ATOM   3866 C CB  . PHE F 2 220 ? -36.343 28.326  54.182  1.00 27.15  ? 310 PHE F CB  1 
ATOM   3867 C CG  . PHE F 2 220 ? -35.198 28.936  54.948  1.00 28.57  ? 310 PHE F CG  1 
ATOM   3868 C CD1 . PHE F 2 220 ? -35.151 30.304  55.186  1.00 31.66  ? 310 PHE F CD1 1 
ATOM   3869 C CD2 . PHE F 2 220 ? -34.172 28.143  55.440  1.00 30.74  ? 310 PHE F CD2 1 
ATOM   3870 C CE1 . PHE F 2 220 ? -34.085 30.868  55.891  1.00 32.19  ? 310 PHE F CE1 1 
ATOM   3871 C CE2 . PHE F 2 220 ? -33.109 28.707  56.147  1.00 33.24  ? 310 PHE F CE2 1 
ATOM   3872 C CZ  . PHE F 2 220 ? -33.072 30.065  56.369  1.00 30.76  ? 310 PHE F CZ  1 
ATOM   3873 N N   . ARG F 2 221 ? -34.642 26.587  52.098  1.00 27.14  ? 311 ARG F N   1 
ATOM   3874 C CA  . ARG F 2 221 ? -33.373 25.992  51.682  1.00 26.39  ? 311 ARG F CA  1 
ATOM   3875 C C   . ARG F 2 221 ? -33.077 26.305  50.204  1.00 30.02  ? 311 ARG F C   1 
ATOM   3876 O O   . ARG F 2 221 ? -31.917 26.557  49.872  1.00 29.12  ? 311 ARG F O   1 
ATOM   3877 C CB  . ARG F 2 221 ? -33.353 24.476  51.955  1.00 25.28  ? 311 ARG F CB  1 
ATOM   3878 C CG  . ARG F 2 221 ? -33.185 24.159  53.436  1.00 26.79  ? 311 ARG F CG  1 
ATOM   3879 C CD  . ARG F 2 221 ? -33.617 22.753  53.787  1.00 27.85  ? 311 ARG F CD  1 
ATOM   3880 N NE  . ARG F 2 221 ? -33.595 22.568  55.237  1.00 34.63  ? 311 ARG F NE  1 
ATOM   3881 C CZ  . ARG F 2 221 ? -34.163 21.556  55.887  1.00 46.38  ? 311 ARG F CZ  1 
ATOM   3882 N NH1 . ARG F 2 221 ? -34.782 20.589  55.218  1.00 35.90  ? 311 ARG F NH1 1 
ATOM   3883 N NH2 . ARG F 2 221 ? -34.101 21.495  57.212  1.00 23.20  ? 311 ARG F NH2 1 
ATOM   3884 N N   . LYS F 2 222 ? -34.109 26.339  49.328  1.00 25.99  ? 312 LYS F N   1 
ATOM   3885 C CA  . LYS F 2 222 ? -33.883 26.674  47.917  1.00 25.51  ? 312 LYS F CA  1 
ATOM   3886 C C   . LYS F 2 222 ? -33.472 28.140  47.794  1.00 29.79  ? 312 LYS F C   1 
ATOM   3887 O O   . LYS F 2 222 ? -32.548 28.440  47.046  1.00 29.07  ? 312 LYS F O   1 
ATOM   3888 C CB  . LYS F 2 222 ? -35.103 26.372  47.038  1.00 27.76  ? 312 LYS F CB  1 
ATOM   3889 C CG  . LYS F 2 222 ? -34.792 26.480  45.545  1.00 28.86  ? 312 LYS F CG  1 
ATOM   3890 C CD  . LYS F 2 222 ? -35.991 26.197  44.663  1.00 30.81  ? 312 LYS F CD  1 
ATOM   3891 C CE  . LYS F 2 222 ? -35.669 26.472  43.204  1.00 33.79  ? 312 LYS F CE  1 
ATOM   3892 N NZ  . LYS F 2 222 ? -36.586 25.746  42.281  1.00 35.99  ? 312 LYS F NZ  1 
ATOM   3893 N N   . GLY F 2 223 ? -34.138 29.010  48.556  1.00 27.34  ? 313 GLY F N   1 
ATOM   3894 C CA  . GLY F 2 223 ? -33.867 30.443  48.629  1.00 27.24  ? 313 GLY F CA  1 
ATOM   3895 C C   . GLY F 2 223 ? -32.469 30.733  49.143  1.00 32.38  ? 313 GLY F C   1 
ATOM   3896 O O   . GLY F 2 223 ? -31.739 31.491  48.512  1.00 32.54  ? 313 GLY F O   1 
ATOM   3897 N N   . LYS F 2 224 ? -32.067 30.082  50.261  1.00 29.43  ? 314 LYS F N   1 
ATOM   3898 C CA  . LYS F 2 224 ? -30.744 30.196  50.881  1.00 29.23  ? 314 LYS F CA  1 
ATOM   3899 C C   . LYS F 2 224 ? -29.634 29.724  49.918  1.00 35.19  ? 314 LYS F C   1 
ATOM   3900 O O   . LYS F 2 224 ? -28.572 30.349  49.884  1.00 34.93  ? 314 LYS F O   1 
ATOM   3901 C CB  . LYS F 2 224 ? -30.697 29.393  52.194  1.00 31.00  ? 314 LYS F CB  1 
ATOM   3902 C CG  . LYS F 2 224 ? -29.501 29.692  53.071  1.00 35.21  ? 314 LYS F CG  1 
ATOM   3903 C CD  . LYS F 2 224 ? -29.646 29.042  54.418  1.00 40.31  ? 314 LYS F CD  1 
ATOM   3904 C CE  . LYS F 2 224 ? -28.449 29.310  55.293  1.00 52.36  ? 314 LYS F CE  1 
ATOM   3905 N NZ  . LYS F 2 224 ? -28.666 28.853  56.687  1.00 63.88  ? 314 LYS F NZ  1 
ATOM   3906 N N   . VAL F 2 225 ? -29.884 28.646  49.128  1.00 32.03  ? 315 VAL F N   1 
ATOM   3907 C CA  . VAL F 2 225 ? -28.923 28.111  48.148  1.00 31.73  ? 315 VAL F CA  1 
ATOM   3908 C C   . VAL F 2 225 ? -28.774 29.109  46.995  1.00 38.20  ? 315 VAL F C   1 
ATOM   3909 O O   . VAL F 2 225 ? -27.648 29.442  46.613  1.00 38.51  ? 315 VAL F O   1 
ATOM   3910 C CB  . VAL F 2 225 ? -29.297 26.698  47.632  1.00 34.67  ? 315 VAL F CB  1 
ATOM   3911 C CG1 . VAL F 2 225 ? -28.496 26.332  46.386  1.00 34.48  ? 315 VAL F CG1 1 
ATOM   3912 C CG2 . VAL F 2 225 ? -29.082 25.647  48.703  1.00 34.18  ? 315 VAL F CG2 1 
ATOM   3913 N N   . LEU F 2 226 ? -29.909 29.588  46.451  1.00 35.42  ? 316 LEU F N   1 
ATOM   3914 C CA  . LEU F 2 226 ? -29.923 30.551  45.353  1.00 35.09  ? 316 LEU F CA  1 
ATOM   3915 C C   . LEU F 2 226 ? -29.259 31.870  45.784  1.00 41.01  ? 316 LEU F C   1 
ATOM   3916 O O   . LEU F 2 226 ? -28.533 32.448  44.985  1.00 41.72  ? 316 LEU F O   1 
ATOM   3917 C CB  . LEU F 2 226 ? -31.350 30.774  44.831  1.00 34.49  ? 316 LEU F CB  1 
ATOM   3918 C CG  . LEU F 2 226 ? -31.891 29.645  43.934  1.00 37.68  ? 316 LEU F CG  1 
ATOM   3919 C CD1 . LEU F 2 226 ? -33.381 29.542  44.031  1.00 37.22  ? 316 LEU F CD1 1 
ATOM   3920 C CD2 . LEU F 2 226 ? -31.495 29.841  42.492  1.00 38.61  ? 316 LEU F CD2 1 
ATOM   3921 N N   . ALA F 2 227 ? -29.427 32.283  47.061  1.00 37.55  ? 317 ALA F N   1 
ATOM   3922 C CA  . ALA F 2 227 ? -28.814 33.479  47.646  1.00 37.30  ? 317 ALA F CA  1 
ATOM   3923 C C   . ALA F 2 227 ? -27.296 33.316  47.775  1.00 43.67  ? 317 ALA F C   1 
ATOM   3924 O O   . ALA F 2 227 ? -26.568 34.247  47.448  1.00 44.46  ? 317 ALA F O   1 
ATOM   3925 C CB  . ALA F 2 227 ? -29.418 33.763  49.014  1.00 37.94  ? 317 ALA F CB  1 
ATOM   3926 N N   . GLN F 2 228 ? -26.818 32.133  48.234  1.00 40.83  ? 318 GLN F N   1 
ATOM   3927 C CA  . GLN F 2 228 ? -25.393 31.837  48.420  1.00 40.88  ? 318 GLN F CA  1 
ATOM   3928 C C   . GLN F 2 228 ? -24.684 31.663  47.073  1.00 45.84  ? 318 GLN F C   1 
ATOM   3929 O O   . GLN F 2 228 ? -23.475 31.887  46.986  1.00 46.04  ? 318 GLN F O   1 
ATOM   3930 C CB  . GLN F 2 228 ? -25.196 30.611  49.324  1.00 42.23  ? 318 GLN F CB  1 
ATOM   3931 C CG  . GLN F 2 228 ? -25.349 30.951  50.812  1.00 55.10  ? 318 GLN F CG  1 
ATOM   3932 C CD  . GLN F 2 228 ? -25.420 29.755  51.738  1.00 79.01  ? 318 GLN F CD  1 
ATOM   3933 O OE1 . GLN F 2 228 ? -25.014 28.631  51.413  1.00 75.51  ? 318 GLN F OE1 1 
ATOM   3934 N NE2 . GLN F 2 228 ? -25.918 29.983  52.943  1.00 73.04  ? 318 GLN F NE2 1 
ATOM   3935 N N   . GLN F 2 229 ? -25.437 31.319  46.018  1.00 42.68  ? 319 GLN F N   1 
ATOM   3936 C CA  . GLN F 2 229 ? -24.906 31.209  44.658  1.00 42.84  ? 319 GLN F CA  1 
ATOM   3937 C C   . GLN F 2 229 ? -24.799 32.591  43.987  1.00 48.73  ? 319 GLN F C   1 
ATOM   3938 O O   . GLN F 2 229 ? -24.069 32.743  43.007  1.00 48.98  ? 319 GLN F O   1 
ATOM   3939 C CB  . GLN F 2 229 ? -25.795 30.303  43.804  1.00 43.89  ? 319 GLN F CB  1 
ATOM   3940 C CG  . GLN F 2 229 ? -25.572 28.820  44.040  1.00 54.25  ? 319 GLN F CG  1 
ATOM   3941 C CD  . GLN F 2 229 ? -26.568 28.031  43.250  1.00 65.37  ? 319 GLN F CD  1 
ATOM   3942 O OE1 . GLN F 2 229 ? -27.764 28.335  43.233  1.00 56.67  ? 319 GLN F OE1 1 
ATOM   3943 N NE2 . GLN F 2 229 ? -26.094 27.006  42.565  1.00 59.68  ? 319 GLN F NE2 1 
ATOM   3944 N N   . GLY F 2 230 ? -25.558 33.560  44.495  1.00 45.97  ? 320 GLY F N   1 
ATOM   3945 C CA  . GLY F 2 230 ? -25.594 34.916  43.962  1.00 46.17  ? 320 GLY F CA  1 
ATOM   3946 C C   . GLY F 2 230 ? -26.792 35.227  43.082  1.00 50.86  ? 320 GLY F C   1 
ATOM   3947 O O   . GLY F 2 230 ? -26.850 36.306  42.478  1.00 50.05  ? 320 GLY F O   1 
ATOM   3948 N N   . GLU F 2 231 ? -27.758 34.286  43.000  1.00 47.73  ? 321 GLU F N   1 
ATOM   3949 C CA  . GLU F 2 231 ? -28.993 34.418  42.218  1.00 47.36  ? 321 GLU F CA  1 
ATOM   3950 C C   . GLU F 2 231 ? -30.065 35.083  43.094  1.00 50.91  ? 321 GLU F C   1 
ATOM   3951 O O   . GLU F 2 231 ? -31.058 34.457  43.473  1.00 50.90  ? 321 GLU F O   1 
ATOM   3952 C CB  . GLU F 2 231 ? -29.450 33.042  41.693  1.00 48.80  ? 321 GLU F CB  1 
ATOM   3953 C CG  . GLU F 2 231 ? -28.563 32.483  40.595  1.00 59.04  ? 321 GLU F CG  1 
ATOM   3954 C CD  . GLU F 2 231 ? -29.109 32.657  39.191  1.00 82.44  ? 321 GLU F CD  1 
ATOM   3955 O OE1 . GLU F 2 231 ? -29.471 33.800  38.828  1.00 82.06  ? 321 GLU F OE1 1 
ATOM   3956 O OE2 . GLU F 2 231 ? -29.159 31.652  38.447  1.00 80.82  ? 321 GLU F OE2 1 
ATOM   3957 N N   . TYR F 2 232 ? -29.825 36.359  43.431  1.00 47.73  ? 322 TYR F N   1 
ATOM   3958 C CA  . TYR F 2 232 ? -30.657 37.186  44.310  1.00 47.98  ? 322 TYR F CA  1 
ATOM   3959 C C   . TYR F 2 232 ? -32.047 37.441  43.720  1.00 49.56  ? 322 TYR F C   1 
ATOM   3960 O O   . TYR F 2 232 ? -33.027 37.456  44.465  1.00 48.22  ? 322 TYR F O   1 
ATOM   3961 C CB  . TYR F 2 232 ? -29.960 38.528  44.617  1.00 50.19  ? 322 TYR F CB  1 
ATOM   3962 C CG  . TYR F 2 232 ? -28.551 38.463  45.194  1.00 53.50  ? 322 TYR F CG  1 
ATOM   3963 C CD1 . TYR F 2 232 ? -27.639 39.488  44.966  1.00 55.72  ? 322 TYR F CD1 1 
ATOM   3964 C CD2 . TYR F 2 232 ? -28.155 37.413  46.026  1.00 54.77  ? 322 TYR F CD2 1 
ATOM   3965 C CE1 . TYR F 2 232 ? -26.357 39.455  45.516  1.00 57.10  ? 322 TYR F CE1 1 
ATOM   3966 C CE2 . TYR F 2 232 ? -26.877 37.373  46.587  1.00 55.90  ? 322 TYR F CE2 1 
ATOM   3967 C CZ  . TYR F 2 232 ? -25.979 38.395  46.325  1.00 64.36  ? 322 TYR F CZ  1 
ATOM   3968 O OH  . TYR F 2 232 ? -24.713 38.354  46.866  1.00 65.72  ? 322 TYR F OH  1 
ATOM   3969 N N   . SER F 2 233 ? -32.122 37.618  42.387  1.00 46.25  ? 323 SER F N   1 
ATOM   3970 C CA  . SER F 2 233 ? -33.349 37.851  41.617  1.00 46.23  ? 323 SER F CA  1 
ATOM   3971 C C   . SER F 2 233 ? -34.324 36.663  41.713  1.00 48.23  ? 323 SER F C   1 
ATOM   3972 O O   . SER F 2 233 ? -35.540 36.863  41.722  1.00 47.75  ? 323 SER F O   1 
ATOM   3973 C CB  . SER F 2 233 ? -33.012 38.123  40.150  1.00 51.05  ? 323 SER F CB  1 
ATOM   3974 O OG  . SER F 2 233 ? -32.293 37.048  39.561  1.00 60.36  ? 323 SER F OG  1 
ATOM   3975 N N   . GLU F 2 234 ? -33.787 35.437  41.783  1.00 43.87  ? 324 GLU F N   1 
ATOM   3976 C CA  . GLU F 2 234 ? -34.587 34.221  41.895  1.00 42.58  ? 324 GLU F CA  1 
ATOM   3977 C C   . GLU F 2 234 ? -34.867 33.851  43.353  1.00 43.57  ? 324 GLU F C   1 
ATOM   3978 O O   . GLU F 2 234 ? -35.902 33.247  43.627  1.00 43.08  ? 324 GLU F O   1 
ATOM   3979 C CB  . GLU F 2 234 ? -33.886 33.060  41.181  1.00 43.92  ? 324 GLU F CB  1 
ATOM   3980 C CG  . GLU F 2 234 ? -34.217 33.010  39.699  1.00 56.47  ? 324 GLU F CG  1 
ATOM   3981 C CD  . GLU F 2 234 ? -33.418 32.028  38.864  1.00 83.14  ? 324 GLU F CD  1 
ATOM   3982 O OE1 . GLU F 2 234 ? -32.879 32.455  37.818  1.00 80.89  ? 324 GLU F OE1 1 
ATOM   3983 O OE2 . GLU F 2 234 ? -33.352 30.832  39.232  1.00 77.32  ? 324 GLU F OE2 1 
ATOM   3984 N N   . ALA F 2 235 ? -33.965 34.229  44.280  1.00 38.08  ? 325 ALA F N   1 
ATOM   3985 C CA  . ALA F 2 235 ? -34.052 33.891  45.701  1.00 36.98  ? 325 ALA F CA  1 
ATOM   3986 C C   . ALA F 2 235 ? -35.111 34.677  46.477  1.00 39.69  ? 325 ALA F C   1 
ATOM   3987 O O   . ALA F 2 235 ? -35.744 34.091  47.357  1.00 38.33  ? 325 ALA F O   1 
ATOM   3988 C CB  . ALA F 2 235 ? -32.698 34.090  46.364  1.00 37.64  ? 325 ALA F CB  1 
ATOM   3989 N N   . ILE F 2 236 ? -35.267 35.999  46.202  1.00 37.04  ? 326 ILE F N   1 
ATOM   3990 C CA  . ILE F 2 236 ? -36.177 36.885  46.943  1.00 36.74  ? 326 ILE F CA  1 
ATOM   3991 C C   . ILE F 2 236 ? -37.669 36.445  46.807  1.00 40.01  ? 326 ILE F C   1 
ATOM   3992 O O   . ILE F 2 236 ? -38.293 36.344  47.874  1.00 39.89  ? 326 ILE F O   1 
ATOM   3993 C CB  . ILE F 2 236 ? -35.975 38.406  46.647  1.00 40.00  ? 326 ILE F CB  1 
ATOM   3994 C CG1 . ILE F 2 236 ? -36.800 39.283  47.626  1.00 40.16  ? 326 ILE F CG1 1 
ATOM   3995 C CG2 . ILE F 2 236 ? -36.191 38.804  45.183  1.00 40.79  ? 326 ILE F CG2 1 
ATOM   3996 C CD1 . ILE F 2 236 ? -36.311 40.691  47.799  1.00 51.00  ? 326 ILE F CD1 1 
ATOM   3997 N N   . PRO F 2 237 ? -38.263 36.109  45.619  1.00 35.16  ? 327 PRO F N   1 
ATOM   3998 C CA  . PRO F 2 237 ? -39.672 35.673  45.631  1.00 34.09  ? 327 PRO F CA  1 
ATOM   3999 C C   . PRO F 2 237 ? -39.884 34.351  46.385  1.00 35.86  ? 327 PRO F C   1 
ATOM   4000 O O   . PRO F 2 237 ? -40.914 34.188  47.047  1.00 35.82  ? 327 PRO F O   1 
ATOM   4001 C CB  . PRO F 2 237 ? -40.023 35.552  44.143  1.00 35.87  ? 327 PRO F CB  1 
ATOM   4002 C CG  . PRO F 2 237 ? -38.728 35.375  43.445  1.00 40.62  ? 327 PRO F CG  1 
ATOM   4003 C CD  . PRO F 2 237 ? -37.726 36.132  44.236  1.00 36.72  ? 327 PRO F CD  1 
ATOM   4004 N N   . ILE F 2 238 ? -38.906 33.425  46.313  1.00 30.82  ? 328 ILE F N   1 
ATOM   4005 C CA  . ILE F 2 238 ? -38.961 32.117  46.988  1.00 29.49  ? 328 ILE F CA  1 
ATOM   4006 C C   . ILE F 2 238 ? -38.875 32.323  48.509  1.00 31.23  ? 328 ILE F C   1 
ATOM   4007 O O   . ILE F 2 238 ? -39.704 31.773  49.234  1.00 29.24  ? 328 ILE F O   1 
ATOM   4008 C CB  . ILE F 2 238 ? -37.880 31.154  46.429  1.00 31.76  ? 328 ILE F CB  1 
ATOM   4009 C CG1 . ILE F 2 238 ? -38.328 30.627  45.050  1.00 32.06  ? 328 ILE F CG1 1 
ATOM   4010 C CG2 . ILE F 2 238 ? -37.580 30.001  47.389  1.00 31.91  ? 328 ILE F CG2 1 
ATOM   4011 C CD1 . ILE F 2 238 ? -37.201 30.149  44.150  1.00 40.85  ? 328 ILE F CD1 1 
ATOM   4012 N N   . LEU F 2 239 ? -37.925 33.159  48.978  1.00 27.84  ? 329 LEU F N   1 
ATOM   4013 C CA  . LEU F 2 239 ? -37.780 33.467  50.408  1.00 26.96  ? 329 LEU F CA  1 
ATOM   4014 C C   . LEU F 2 239 ? -38.990 34.238  50.930  1.00 32.12  ? 329 LEU F C   1 
ATOM   4015 O O   . LEU F 2 239 ? -39.327 34.100  52.112  1.00 31.36  ? 329 LEU F O   1 
ATOM   4016 C CB  . LEU F 2 239 ? -36.487 34.240  50.703  1.00 26.46  ? 329 LEU F CB  1 
ATOM   4017 C CG  . LEU F 2 239 ? -35.170 33.445  50.749  1.00 29.96  ? 329 LEU F CG  1 
ATOM   4018 C CD1 . LEU F 2 239 ? -34.002 34.362  50.945  1.00 30.79  ? 329 LEU F CD1 1 
ATOM   4019 C CD2 . LEU F 2 239 ? -35.157 32.402  51.867  1.00 30.68  ? 329 LEU F CD2 1 
ATOM   4020 N N   . ARG F 2 240 ? -39.669 35.013  50.043  1.00 30.00  ? 330 ARG F N   1 
ATOM   4021 C CA  . ARG F 2 240 ? -40.886 35.746  50.403  1.00 30.49  ? 330 ARG F CA  1 
ATOM   4022 C C   . ARG F 2 240 ? -42.070 34.785  50.486  1.00 34.06  ? 330 ARG F C   1 
ATOM   4023 O O   . ARG F 2 240 ? -42.853 34.880  51.432  1.00 32.60  ? 330 ARG F O   1 
ATOM   4024 C CB  . ARG F 2 240 ? -41.164 36.896  49.427  1.00 31.56  ? 330 ARG F CB  1 
ATOM   4025 C CG  . ARG F 2 240 ? -40.391 38.158  49.785  1.00 39.47  ? 330 ARG F CG  1 
ATOM   4026 C CD  . ARG F 2 240 ? -40.470 39.194  48.693  1.00 40.19  ? 330 ARG F CD  1 
ATOM   4027 N NE  . ARG F 2 240 ? -40.068 40.508  49.186  1.00 50.85  ? 330 ARG F NE  1 
ATOM   4028 C CZ  . ARG F 2 240 ? -39.764 41.538  48.405  1.00 69.95  ? 330 ARG F CZ  1 
ATOM   4029 N NH1 . ARG F 2 240 ? -39.789 41.409  47.082  1.00 55.65  ? 330 ARG F NH1 1 
ATOM   4030 N NH2 . ARG F 2 240 ? -39.417 42.701  48.939  1.00 61.05  ? 330 ARG F NH2 1 
ATOM   4031 N N   . ALA F 2 241 ? -42.161 33.823  49.536  1.00 32.21  ? 331 ALA F N   1 
ATOM   4032 C CA  . ALA F 2 241 ? -43.196 32.781  49.507  1.00 32.66  ? 331 ALA F CA  1 
ATOM   4033 C C   . ALA F 2 241 ? -43.190 31.953  50.806  1.00 37.11  ? 331 ALA F C   1 
ATOM   4034 O O   . ALA F 2 241 ? -44.262 31.588  51.280  1.00 36.66  ? 331 ALA F O   1 
ATOM   4035 C CB  . ALA F 2 241 ? -43.003 31.873  48.305  1.00 33.39  ? 331 ALA F CB  1 
ATOM   4036 N N   . ALA F 2 242 ? -41.989 31.701  51.393  1.00 34.19  ? 332 ALA F N   1 
ATOM   4037 C CA  . ALA F 2 242 ? -41.784 30.985  52.664  1.00 33.69  ? 332 ALA F CA  1 
ATOM   4038 C C   . ALA F 2 242 ? -42.175 31.856  53.858  1.00 39.08  ? 332 ALA F C   1 
ATOM   4039 O O   . ALA F 2 242 ? -42.656 31.331  54.869  1.00 39.23  ? 332 ALA F O   1 
ATOM   4040 C CB  . ALA F 2 242 ? -40.333 30.557  52.798  1.00 34.19  ? 332 ALA F CB  1 
ATOM   4041 N N   . LEU F 2 243 ? -41.942 33.186  53.757  1.00 36.64  ? 333 LEU F N   1 
ATOM   4042 C CA  . LEU F 2 243 ? -42.320 34.142  54.799  1.00 37.00  ? 333 LEU F CA  1 
ATOM   4043 C C   . LEU F 2 243 ? -43.830 34.314  54.817  1.00 41.19  ? 333 LEU F C   1 
ATOM   4044 O O   . LEU F 2 243 ? -44.403 34.499  55.884  1.00 40.88  ? 333 LEU F O   1 
ATOM   4045 C CB  . LEU F 2 243 ? -41.616 35.501  54.618  1.00 37.14  ? 333 LEU F CB  1 
ATOM   4046 C CG  . LEU F 2 243 ? -41.717 36.498  55.798  1.00 41.42  ? 333 LEU F CG  1 
ATOM   4047 C CD1 . LEU F 2 243 ? -40.987 35.992  57.038  1.00 41.37  ? 333 LEU F CD1 1 
ATOM   4048 C CD2 . LEU F 2 243 ? -41.184 37.851  55.404  1.00 44.36  ? 333 LEU F CD2 1 
ATOM   4049 N N   . LYS F 2 244 ? -44.480 34.184  53.649  1.00 38.59  ? 334 LYS F N   1 
ATOM   4050 C CA  . LYS F 2 244 ? -45.935 34.284  53.518  1.00 38.82  ? 334 LYS F CA  1 
ATOM   4051 C C   . LYS F 2 244 ? -46.643 33.187  54.346  1.00 42.48  ? 334 LYS F C   1 
ATOM   4052 O O   . LYS F 2 244 ? -47.761 33.412  54.813  1.00 41.96  ? 334 LYS F O   1 
ATOM   4053 C CB  . LYS F 2 244 ? -46.348 34.210  52.036  1.00 41.30  ? 334 LYS F CB  1 
ATOM   4054 C CG  . LYS F 2 244 ? -47.700 34.856  51.738  1.00 56.72  ? 334 LYS F CG  1 
ATOM   4055 N N   . LEU F 2 245 ? -45.974 32.026  54.550  1.00 38.55  ? 335 LEU F N   1 
ATOM   4056 C CA  . LEU F 2 245 ? -46.508 30.884  55.301  1.00 38.54  ? 335 LEU F CA  1 
ATOM   4057 C C   . LEU F 2 245 ? -46.268 31.033  56.810  1.00 42.84  ? 335 LEU F C   1 
ATOM   4058 O O   . LEU F 2 245 ? -47.055 30.505  57.605  1.00 42.18  ? 335 LEU F O   1 
ATOM   4059 C CB  . LEU F 2 245 ? -45.906 29.558  54.792  1.00 38.67  ? 335 LEU F CB  1 
ATOM   4060 C CG  . LEU F 2 245 ? -46.096 29.231  53.301  1.00 42.74  ? 335 LEU F CG  1 
ATOM   4061 C CD1 . LEU F 2 245 ? -45.098 28.196  52.841  1.00 42.33  ? 335 LEU F CD1 1 
ATOM   4062 C CD2 . LEU F 2 245 ? -47.520 28.764  53.006  1.00 45.43  ? 335 LEU F CD2 1 
ATOM   4063 N N   . GLU F 2 246 ? -45.187 31.745  57.196  1.00 40.13  ? 336 GLU F N   1 
ATOM   4064 C CA  . GLU F 2 246 ? -44.817 32.043  58.586  1.00 40.65  ? 336 GLU F CA  1 
ATOM   4065 C C   . GLU F 2 246 ? -44.232 33.466  58.667  1.00 46.21  ? 336 GLU F C   1 
ATOM   4066 O O   . GLU F 2 246 ? -43.010 33.641  58.613  1.00 44.96  ? 336 GLU F O   1 
ATOM   4067 C CB  . GLU F 2 246 ? -43.838 31.005  59.139  1.00 41.94  ? 336 GLU F CB  1 
ATOM   4068 C CG  . GLU F 2 246 ? -44.517 29.843  59.830  1.00 49.98  ? 336 GLU F CG  1 
ATOM   4069 C CD  . GLU F 2 246 ? -43.587 28.701  60.193  1.00 59.40  ? 336 GLU F CD  1 
ATOM   4070 O OE1 . GLU F 2 246 ? -43.955 27.537  59.913  1.00 52.50  ? 336 GLU F OE1 1 
ATOM   4071 O OE2 . GLU F 2 246 ? -42.493 28.963  60.744  1.00 40.48  ? 336 GLU F OE2 1 
ATOM   4072 N N   . PRO F 2 247 ? -45.102 34.501  58.754  1.00 45.02  ? 337 PRO F N   1 
ATOM   4073 C CA  . PRO F 2 247 ? -44.605 35.888  58.736  1.00 45.38  ? 337 PRO F CA  1 
ATOM   4074 C C   . PRO F 2 247 ? -43.789 36.301  59.956  1.00 48.62  ? 337 PRO F C   1 
ATOM   4075 O O   . PRO F 2 247 ? -42.969 37.198  59.819  1.00 47.41  ? 337 PRO F O   1 
ATOM   4076 C CB  . PRO F 2 247 ? -45.889 36.730  58.637  1.00 47.34  ? 337 PRO F CB  1 
ATOM   4077 C CG  . PRO F 2 247 ? -46.951 35.784  58.177  1.00 51.76  ? 337 PRO F CG  1 
ATOM   4078 C CD  . PRO F 2 247 ? -46.579 34.470  58.786  1.00 47.11  ? 337 PRO F CD  1 
ATOM   4079 N N   . SER F 2 248 ? -44.000 35.665  61.124  1.00 45.77  ? 338 SER F N   1 
ATOM   4080 C CA  . SER F 2 248 ? -43.284 36.015  62.358  1.00 45.51  ? 338 SER F CA  1 
ATOM   4081 C C   . SER F 2 248 ? -41.898 35.335  62.480  1.00 49.19  ? 338 SER F C   1 
ATOM   4082 O O   . SER F 2 248 ? -41.128 35.697  63.377  1.00 49.21  ? 338 SER F O   1 
ATOM   4083 C CB  . SER F 2 248 ? -44.137 35.672  63.579  1.00 49.10  ? 338 SER F CB  1 
ATOM   4084 O OG  . SER F 2 248 ? -44.472 34.295  63.617  1.00 61.12  ? 338 SER F OG  1 
ATOM   4085 N N   . ASN F 2 249 ? -41.582 34.368  61.589  1.00 44.86  ? 339 ASN F N   1 
ATOM   4086 C CA  . ASN F 2 249 ? -40.334 33.591  61.599  1.00 43.92  ? 339 ASN F CA  1 
ATOM   4087 C C   . ASN F 2 249 ? -39.091 34.474  61.418  1.00 47.56  ? 339 ASN F C   1 
ATOM   4088 O O   . ASN F 2 249 ? -38.819 34.979  60.325  1.00 47.24  ? 339 ASN F O   1 
ATOM   4089 C CB  . ASN F 2 249 ? -40.377 32.496  60.537  1.00 42.15  ? 339 ASN F CB  1 
ATOM   4090 C CG  . ASN F 2 249 ? -39.263 31.490  60.652  1.00 58.42  ? 339 ASN F CG  1 
ATOM   4091 O OD1 . ASN F 2 249 ? -38.092 31.779  60.382  1.00 52.20  ? 339 ASN F OD1 1 
ATOM   4092 N ND2 . ASN F 2 249 ? -39.610 30.277  61.033  1.00 47.43  ? 339 ASN F ND2 1 
ATOM   4093 N N   . LYS F 2 250 ? -38.318 34.604  62.508  1.00 44.44  ? 340 LYS F N   1 
ATOM   4094 C CA  . LYS F 2 250 ? -37.100 35.409  62.622  1.00 43.89  ? 340 LYS F CA  1 
ATOM   4095 C C   . LYS F 2 250 ? -35.991 34.960  61.658  1.00 46.02  ? 340 LYS F C   1 
ATOM   4096 O O   . LYS F 2 250 ? -35.283 35.815  61.129  1.00 45.58  ? 340 LYS F O   1 
ATOM   4097 C CB  . LYS F 2 250 ? -36.568 35.380  64.072  1.00 46.80  ? 340 LYS F CB  1 
ATOM   4098 C CG  . LYS F 2 250 ? -37.557 35.867  65.145  1.00 66.59  ? 340 LYS F CG  1 
ATOM   4099 C CD  . LYS F 2 250 ? -37.512 37.378  65.407  1.00 79.86  ? 340 LYS F CD  1 
ATOM   4100 N N   . THR F 2 251 ? -35.846 33.640  61.429  1.00 40.73  ? 341 THR F N   1 
ATOM   4101 C CA  . THR F 2 251 ? -34.818 33.068  60.555  1.00 39.06  ? 341 THR F CA  1 
ATOM   4102 C C   . THR F 2 251 ? -35.047 33.483  59.091  1.00 39.99  ? 341 THR F C   1 
ATOM   4103 O O   . THR F 2 251 ? -34.081 33.842  58.425  1.00 38.37  ? 341 THR F O   1 
ATOM   4104 C CB  . THR F 2 251 ? -34.755 31.545  60.745  1.00 45.64  ? 341 THR F CB  1 
ATOM   4105 O OG1 . THR F 2 251 ? -34.541 31.274  62.133  1.00 46.71  ? 341 THR F OG1 1 
ATOM   4106 C CG2 . THR F 2 251 ? -33.654 30.890  59.933  1.00 44.14  ? 341 THR F CG2 1 
ATOM   4107 N N   . ILE F 2 252 ? -36.301 33.453  58.598  1.00 36.68  ? 342 ILE F N   1 
ATOM   4108 C CA  . ILE F 2 252 ? -36.635 33.846  57.218  1.00 36.01  ? 342 ILE F CA  1 
ATOM   4109 C C   . ILE F 2 252 ? -36.425 35.371  57.028  1.00 40.82  ? 342 ILE F C   1 
ATOM   4110 O O   . ILE F 2 252 ? -35.978 35.792  55.957  1.00 40.84  ? 342 ILE F O   1 
ATOM   4111 C CB  . ILE F 2 252 ? -38.063 33.407  56.787  1.00 38.72  ? 342 ILE F CB  1 
ATOM   4112 C CG1 . ILE F 2 252 ? -38.309 31.912  57.074  1.00 38.89  ? 342 ILE F CG1 1 
ATOM   4113 C CG2 . ILE F 2 252 ? -38.315 33.727  55.290  1.00 38.77  ? 342 ILE F CG2 1 
ATOM   4114 C CD1 . ILE F 2 252 ? -39.764 31.493  57.014  1.00 45.94  ? 342 ILE F CD1 1 
ATOM   4115 N N   . HIS F 2 253 ? -36.722 36.182  58.066  1.00 38.00  ? 343 HIS F N   1 
ATOM   4116 C CA  . HIS F 2 253 ? -36.531 37.635  58.047  1.00 38.28  ? 343 HIS F CA  1 
ATOM   4117 C C   . HIS F 2 253 ? -35.052 37.972  57.917  1.00 40.99  ? 343 HIS F C   1 
ATOM   4118 O O   . HIS F 2 253 ? -34.667 38.752  57.039  1.00 41.28  ? 343 HIS F O   1 
ATOM   4119 C CB  . HIS F 2 253 ? -37.096 38.280  59.322  1.00 39.74  ? 343 HIS F CB  1 
ATOM   4120 C CG  . HIS F 2 253 ? -38.563 38.558  59.288  1.00 43.88  ? 343 HIS F CG  1 
ATOM   4121 N ND1 . HIS F 2 253 ? -39.096 39.525  58.452  1.00 46.17  ? 343 HIS F ND1 1 
ATOM   4122 C CD2 . HIS F 2 253 ? -39.557 38.044  60.048  1.00 46.16  ? 343 HIS F CD2 1 
ATOM   4123 C CE1 . HIS F 2 253 ? -40.398 39.529  58.691  1.00 45.61  ? 343 HIS F CE1 1 
ATOM   4124 N NE2 . HIS F 2 253 ? -40.720 38.662  59.651  1.00 45.89  ? 343 HIS F NE2 1 
ATOM   4125 N N   . ALA F 2 254 ? -34.230 37.349  58.794  1.00 35.57  ? 344 ALA F N   1 
ATOM   4126 C CA  . ALA F 2 254 ? -32.777 37.488  58.877  1.00 34.59  ? 344 ALA F CA  1 
ATOM   4127 C C   . ALA F 2 254 ? -32.114 37.083  57.574  1.00 36.42  ? 344 ALA F C   1 
ATOM   4128 O O   . ALA F 2 254 ? -31.121 37.687  57.184  1.00 35.90  ? 344 ALA F O   1 
ATOM   4129 C CB  . ALA F 2 254 ? -32.237 36.650  60.027  1.00 35.23  ? 344 ALA F CB  1 
ATOM   4130 N N   . GLU F 2 255 ? -32.677 36.079  56.895  1.00 32.36  ? 345 GLU F N   1 
ATOM   4131 C CA  . GLU F 2 255 ? -32.171 35.591  55.618  1.00 31.90  ? 345 GLU F CA  1 
ATOM   4132 C C   . GLU F 2 255 ? -32.516 36.571  54.512  1.00 34.38  ? 345 GLU F C   1 
ATOM   4133 O O   . GLU F 2 255 ? -31.671 36.813  53.658  1.00 33.36  ? 345 GLU F O   1 
ATOM   4134 C CB  . GLU F 2 255 ? -32.731 34.193  55.308  1.00 33.62  ? 345 GLU F CB  1 
ATOM   4135 C CG  . GLU F 2 255 ? -31.986 33.437  54.209  1.00 43.74  ? 345 GLU F CG  1 
ATOM   4136 C CD  . GLU F 2 255 ? -30.533 33.092  54.487  1.00 56.54  ? 345 GLU F CD  1 
ATOM   4137 O OE1 . GLU F 2 255 ? -30.191 32.850  55.668  1.00 25.31  ? 345 GLU F OE1 1 
ATOM   4138 O OE2 . GLU F 2 255 ? -29.737 33.058  53.519  1.00 56.77  ? 345 GLU F OE2 1 
ATOM   4139 N N   . LEU F 2 256 ? -33.739 37.146  54.526  1.00 30.75  ? 346 LEU F N   1 
ATOM   4140 C CA  . LEU F 2 256 ? -34.163 38.131  53.525  1.00 30.53  ? 346 LEU F CA  1 
ATOM   4141 C C   . LEU F 2 256 ? -33.391 39.426  53.648  1.00 35.03  ? 346 LEU F C   1 
ATOM   4142 O O   . LEU F 2 256 ? -32.906 39.946  52.637  1.00 34.33  ? 346 LEU F O   1 
ATOM   4143 C CB  . LEU F 2 256 ? -35.656 38.424  53.632  1.00 30.58  ? 346 LEU F CB  1 
ATOM   4144 C CG  . LEU F 2 256 ? -36.544 37.578  52.764  1.00 35.00  ? 346 LEU F CG  1 
ATOM   4145 C CD1 . LEU F 2 256 ? -37.942 37.598  53.289  1.00 35.33  ? 346 LEU F CD1 1 
ATOM   4146 C CD2 . LEU F 2 256 ? -36.484 38.010  51.289  1.00 36.82  ? 346 LEU F CD2 1 
ATOM   4147 N N   . SER F 2 257 ? -33.254 39.926  54.893  1.00 33.35  ? 347 SER F N   1 
ATOM   4148 C CA  . SER F 2 257 ? -32.540 41.155  55.218  1.00 34.23  ? 347 SER F CA  1 
ATOM   4149 C C   . SER F 2 257 ? -31.076 41.083  54.777  1.00 41.32  ? 347 SER F C   1 
ATOM   4150 O O   . SER F 2 257 ? -30.577 42.046  54.192  1.00 42.36  ? 347 SER F O   1 
ATOM   4151 C CB  . SER F 2 257 ? -32.639 41.441  56.712  1.00 38.68  ? 347 SER F CB  1 
ATOM   4152 O OG  . SER F 2 257 ? -33.960 41.825  57.061  1.00 50.55  ? 347 SER F OG  1 
ATOM   4153 N N   . LYS F 2 258 ? -30.404 39.928  55.034  1.00 38.46  ? 348 LYS F N   1 
ATOM   4154 C CA  . LYS F 2 258 ? -29.010 39.641  54.669  1.00 38.18  ? 348 LYS F CA  1 
ATOM   4155 C C   . LYS F 2 258 ? -28.853 39.674  53.147  1.00 41.51  ? 348 LYS F C   1 
ATOM   4156 O O   . LYS F 2 258 ? -27.903 40.260  52.633  1.00 40.38  ? 348 LYS F O   1 
ATOM   4157 C CB  . LYS F 2 258 ? -28.605 38.263  55.228  1.00 40.97  ? 348 LYS F CB  1 
ATOM   4158 C CG  . LYS F 2 258 ? -27.102 37.996  55.281  1.00 59.48  ? 348 LYS F CG  1 
ATOM   4159 C CD  . LYS F 2 258 ? -26.779 36.568  55.734  1.00 68.62  ? 348 LYS F CD  1 
ATOM   4160 C CE  . LYS F 2 258 ? -26.788 36.369  57.233  1.00 76.31  ? 348 LYS F CE  1 
ATOM   4161 N NZ  . LYS F 2 258 ? -26.249 35.034  57.611  1.00 81.68  ? 348 LYS F NZ  1 
ATOM   4162 N N   . LEU F 2 259 ? -29.816 39.074  52.439  1.00 38.70  ? 349 LEU F N   1 
ATOM   4163 C CA  . LEU F 2 259 ? -29.862 38.986  50.981  1.00 39.19  ? 349 LEU F CA  1 
ATOM   4164 C C   . LEU F 2 259 ? -30.070 40.367  50.331  1.00 43.34  ? 349 LEU F C   1 
ATOM   4165 O O   . LEU F 2 259 ? -29.355 40.688  49.381  1.00 42.68  ? 349 LEU F O   1 
ATOM   4166 C CB  . LEU F 2 259 ? -30.984 38.005  50.580  1.00 39.67  ? 349 LEU F CB  1 
ATOM   4167 C CG  . LEU F 2 259 ? -31.685 38.170  49.233  1.00 45.00  ? 349 LEU F CG  1 
ATOM   4168 C CD1 . LEU F 2 259 ? -30.959 37.404  48.142  1.00 44.63  ? 349 LEU F CD1 1 
ATOM   4169 C CD2 . LEU F 2 259 ? -33.113 37.702  49.329  1.00 49.19  ? 349 LEU F CD2 1 
ATOM   4170 N N   . VAL F 2 260 ? -31.036 41.172  50.834  1.00 41.14  ? 350 VAL F N   1 
ATOM   4171 C CA  . VAL F 2 260 ? -31.337 42.488  50.258  1.00 41.10  ? 350 VAL F CA  1 
ATOM   4172 C C   . VAL F 2 260 ? -30.160 43.465  50.489  1.00 46.77  ? 350 VAL F C   1 
ATOM   4173 O O   . VAL F 2 260 ? -29.819 44.207  49.563  1.00 46.58  ? 350 VAL F O   1 
ATOM   4174 C CB  . VAL F 2 260 ? -32.707 43.092  50.682  1.00 44.98  ? 350 VAL F CB  1 
ATOM   4175 C CG1 . VAL F 2 260 ? -33.856 42.178  50.288  1.00 44.78  ? 350 VAL F CG1 1 
ATOM   4176 C CG2 . VAL F 2 260 ? -32.773 43.422  52.168  1.00 44.97  ? 350 VAL F CG2 1 
ATOM   4177 N N   . LYS F 2 261 ? -29.514 43.425  51.686  1.00 45.01  ? 351 LYS F N   1 
ATOM   4178 C CA  . LYS F 2 261 ? -28.358 44.268  52.031  1.00 45.26  ? 351 LYS F CA  1 
ATOM   4179 C C   . LYS F 2 261 ? -27.157 43.953  51.124  1.00 49.19  ? 351 LYS F C   1 
ATOM   4180 O O   . LYS F 2 261 ? -26.527 44.884  50.618  1.00 49.17  ? 351 LYS F O   1 
ATOM   4181 C CB  . LYS F 2 261 ? -27.970 44.096  53.508  1.00 48.26  ? 351 LYS F CB  1 
ATOM   4182 C CG  . LYS F 2 261 ? -28.741 45.018  54.444  1.00 68.41  ? 351 LYS F CG  1 
ATOM   4183 N N   . LYS F 2 262 ? -26.871 42.650  50.896  1.00 45.02  ? 352 LYS F N   1 
ATOM   4184 C CA  . LYS F 2 262 ? -25.775 42.181  50.037  1.00 44.95  ? 352 LYS F CA  1 
ATOM   4185 C C   . LYS F 2 262 ? -26.037 42.528  48.553  1.00 49.85  ? 352 LYS F C   1 
ATOM   4186 O O   . LYS F 2 262 ? -25.083 42.737  47.806  1.00 49.70  ? 352 LYS F O   1 
ATOM   4187 C CB  . LYS F 2 262 ? -25.549 40.666  50.203  1.00 46.80  ? 352 LYS F CB  1 
ATOM   4188 C CG  . LYS F 2 262 ? -24.861 40.276  51.505  1.00 51.84  ? 352 LYS F CG  1 
ATOM   4189 C CD  . LYS F 2 262 ? -24.836 38.760  51.678  1.00 56.54  ? 352 LYS F CD  1 
ATOM   4190 C CE  . LYS F 2 262 ? -24.105 38.335  52.925  1.00 58.72  ? 352 LYS F CE  1 
ATOM   4191 N NZ  . LYS F 2 262 ? -24.000 36.856  53.029  1.00 60.43  ? 352 LYS F NZ  1 
ATOM   4192 N N   . HIS F 2 263 ? -27.320 42.645  48.153  1.00 47.22  ? 353 HIS F N   1 
ATOM   4193 C CA  . HIS F 2 263 ? -27.797 43.003  46.808  1.00 47.71  ? 353 HIS F CA  1 
ATOM   4194 C C   . HIS F 2 263 ? -27.572 44.514  46.537  1.00 52.04  ? 353 HIS F C   1 
ATOM   4195 O O   . HIS F 2 263 ? -28.473 45.190  46.044  1.00 51.60  ? 353 HIS F O   1 
ATOM   4196 C CB  . HIS F 2 263 ? -29.298 42.646  46.718  1.00 48.84  ? 353 HIS F CB  1 
ATOM   4197 C CG  . HIS F 2 263 ? -29.814 42.283  45.357  1.00 52.75  ? 353 HIS F CG  1 
ATOM   4198 N ND1 . HIS F 2 263 ? -29.052 42.460  44.205  1.00 54.75  ? 353 HIS F ND1 1 
ATOM   4199 C CD2 . HIS F 2 263 ? -31.025 41.786  45.009  1.00 54.64  ? 353 HIS F CD2 1 
ATOM   4200 C CE1 . HIS F 2 263 ? -29.818 42.052  43.205  1.00 54.23  ? 353 HIS F CE1 1 
ATOM   4201 N NE2 . HIS F 2 263 ? -31.013 41.637  43.639  1.00 54.61  ? 353 HIS F NE2 1 
ATOM   4202 N N   . ALA F 2 264 ? -26.362 45.030  46.870  1.00 49.22  ? 354 ALA F N   1 
ATOM   4203 C CA  . ALA F 2 264 ? -25.948 46.436  46.753  1.00 48.79  ? 354 ALA F CA  1 
ATOM   4204 C C   . ALA F 2 264 ? -24.471 46.579  46.273  1.00 52.44  ? 354 ALA F C   1 
ATOM   4205 O O   . ALA F 2 264 ? -23.695 47.361  46.842  1.00 51.43  ? 354 ALA F O   1 
ATOM   4206 C CB  . ALA F 2 264 ? -26.139 47.139  48.093  1.00 49.31  ? 354 ALA F CB  1 
ATOM   4207 N N   . ALA F 2 265 ? -24.099 45.834  45.210  1.00 49.00  ? 355 ALA F N   1 
ATOM   4208 C CA  . ALA F 2 265 ? -22.751 45.896  44.645  1.00 83.18  ? 355 ALA F CA  1 
ATOM   4209 C C   . ALA F 2 265 ? -22.783 46.529  43.257  1.00 111.17 ? 355 ALA F C   1 
ATOM   4210 O O   . ALA F 2 265 ? -23.285 47.643  43.103  1.00 70.87  ? 355 ALA F O   1 
ATOM   4211 C CB  . ALA F 2 265 ? -22.133 44.508  44.587  1.00 83.92  ? 355 ALA F CB  1 
ATOM   4212 N N   . GLU G 2 1   ? -0.640  49.626  -17.419 1.00 42.23  ? 91  GLU G N   1 
ATOM   4213 C CA  . GLU G 2 1   ? -1.666  48.786  -18.028 1.00 41.51  ? 91  GLU G CA  1 
ATOM   4214 C C   . GLU G 2 1   ? -1.042  47.490  -18.540 1.00 44.52  ? 91  GLU G C   1 
ATOM   4215 O O   . GLU G 2 1   ? -1.096  47.169  -19.735 1.00 44.60  ? 91  GLU G O   1 
ATOM   4216 C CB  . GLU G 2 1   ? -2.417  49.540  -19.138 1.00 42.68  ? 91  GLU G CB  1 
ATOM   4217 C CG  . GLU G 2 1   ? -3.867  49.848  -18.789 1.00 50.03  ? 91  GLU G CG  1 
ATOM   4218 C CD  . GLU G 2 1   ? -4.164  50.923  -17.756 1.00 65.98  ? 91  GLU G CD  1 
ATOM   4219 O OE1 . GLU G 2 1   ? -5.358  51.263  -17.606 1.00 46.30  ? 91  GLU G OE1 1 
ATOM   4220 O OE2 . GLU G 2 1   ? -3.225  51.427  -17.097 1.00 65.44  ? 91  GLU G OE2 1 
ATOM   4221 N N   . GLU G 2 2   ? -0.455  46.743  -17.599 1.00 39.30  ? 92  GLU G N   1 
ATOM   4222 C CA  . GLU G 2 2   ? 0.185   45.450  -17.834 1.00 38.63  ? 92  GLU G CA  1 
ATOM   4223 C C   . GLU G 2 2   ? -0.813  44.332  -17.555 1.00 38.47  ? 92  GLU G C   1 
ATOM   4224 O O   . GLU G 2 2   ? -1.965  44.608  -17.230 1.00 39.18  ? 92  GLU G O   1 
ATOM   4225 C CB  . GLU G 2 2   ? 1.406   45.294  -16.894 1.00 40.47  ? 92  GLU G CB  1 
ATOM   4226 C CG  . GLU G 2 2   ? 2.436   46.409  -16.942 1.00 56.86  ? 92  GLU G CG  1 
ATOM   4227 C CD  . GLU G 2 2   ? 3.436   46.337  -15.805 1.00 85.85  ? 92  GLU G CD  1 
ATOM   4228 O OE1 . GLU G 2 2   ? 4.537   45.779  -16.015 1.00 80.37  ? 92  GLU G OE1 1 
ATOM   4229 O OE2 . GLU G 2 2   ? 3.106   46.810  -14.693 1.00 85.56  ? 92  GLU G OE2 1 
ATOM   4230 N N   . TRP G 2 3   ? -0.379  43.074  -17.663 1.00 31.35  ? 93  TRP G N   1 
ATOM   4231 C CA  . TRP G 2 3   ? -1.180  41.935  -17.241 1.00 29.22  ? 93  TRP G CA  1 
ATOM   4232 C C   . TRP G 2 3   ? -0.941  41.705  -15.747 1.00 32.01  ? 93  TRP G C   1 
ATOM   4233 O O   . TRP G 2 3   ? 0.217   41.540  -15.333 1.00 33.42  ? 93  TRP G O   1 
ATOM   4234 C CB  . TRP G 2 3   ? -0.825  40.673  -18.028 1.00 26.95  ? 93  TRP G CB  1 
ATOM   4235 C CG  . TRP G 2 3   ? -1.490  40.545  -19.365 1.00 27.51  ? 93  TRP G CG  1 
ATOM   4236 C CD1 . TRP G 2 3   ? -0.919  40.749  -20.588 1.00 29.97  ? 93  TRP G CD1 1 
ATOM   4237 C CD2 . TRP G 2 3   ? -2.835  40.114  -19.619 1.00 27.24  ? 93  TRP G CD2 1 
ATOM   4238 N NE1 . TRP G 2 3   ? -1.832  40.505  -21.584 1.00 28.69  ? 93  TRP G NE1 1 
ATOM   4239 C CE2 . TRP G 2 3   ? -3.015  40.106  -21.020 1.00 30.49  ? 93  TRP G CE2 1 
ATOM   4240 C CE3 . TRP G 2 3   ? -3.920  39.768  -18.797 1.00 28.44  ? 93  TRP G CE3 1 
ATOM   4241 C CZ2 . TRP G 2 3   ? -4.232  39.751  -21.617 1.00 29.96  ? 93  TRP G CZ2 1 
ATOM   4242 C CZ3 . TRP G 2 3   ? -5.124  39.415  -19.391 1.00 29.85  ? 93  TRP G CZ3 1 
ATOM   4243 C CH2 . TRP G 2 3   ? -5.273  39.411  -20.782 1.00 30.32  ? 93  TRP G CH2 1 
ATOM   4244 N N   . LEU G 2 4   ? -2.015  41.716  -14.931 1.00 23.87  ? 94  LEU G N   1 
ATOM   4245 C CA  . LEU G 2 4   ? -1.899  41.417  -13.508 1.00 21.87  ? 94  LEU G CA  1 
ATOM   4246 C C   . LEU G 2 4   ? -2.131  39.918  -13.314 1.00 26.57  ? 94  LEU G C   1 
ATOM   4247 O O   . LEU G 2 4   ? -3.169  39.400  -13.732 1.00 26.21  ? 94  LEU G O   1 
ATOM   4248 C CB  . LEU G 2 4   ? -2.872  42.254  -12.652 1.00 20.76  ? 94  LEU G CB  1 
ATOM   4249 C CG  . LEU G 2 4   ? -3.096  41.782  -11.191 1.00 24.75  ? 94  LEU G CG  1 
ATOM   4250 C CD1 . LEU G 2 4   ? -1.852  41.989  -10.326 1.00 24.56  ? 94  LEU G CD1 1 
ATOM   4251 C CD2 . LEU G 2 4   ? -4.264  42.491  -10.562 1.00 26.40  ? 94  LEU G CD2 1 
ATOM   4252 N N   . ASP G 2 5   ? -1.162  39.234  -12.701 1.00 22.89  ? 95  ASP G N   1 
ATOM   4253 C CA  . ASP G 2 5   ? -1.249  37.813  -12.398 1.00 22.03  ? 95  ASP G CA  1 
ATOM   4254 C C   . ASP G 2 5   ? -1.836  37.730  -11.000 1.00 25.14  ? 95  ASP G C   1 
ATOM   4255 O O   . ASP G 2 5   ? -1.104  37.788  -10.007 1.00 24.53  ? 95  ASP G O   1 
ATOM   4256 C CB  . ASP G 2 5   ? 0.153   37.174  -12.518 1.00 24.77  ? 95  ASP G CB  1 
ATOM   4257 C CG  . ASP G 2 5   ? 0.205   35.668  -12.373 1.00 36.26  ? 95  ASP G CG  1 
ATOM   4258 O OD1 . ASP G 2 5   ? -0.869  35.044  -12.260 1.00 35.74  ? 95  ASP G OD1 1 
ATOM   4259 O OD2 . ASP G 2 5   ? 1.321   35.114  -12.382 1.00 45.70  ? 95  ASP G OD2 1 
ATOM   4260 N N   . ILE G 2 6   ? -3.179  37.672  -10.933 1.00 20.11  ? 96  ILE G N   1 
ATOM   4261 C CA  . ILE G 2 6   ? -3.987  37.725  -9.721  1.00 19.17  ? 96  ILE G CA  1 
ATOM   4262 C C   . ILE G 2 6   ? -3.581  36.674  -8.669  1.00 23.71  ? 96  ILE G C   1 
ATOM   4263 O O   . ILE G 2 6   ? -3.325  37.035  -7.517  1.00 22.70  ? 96  ILE G O   1 
ATOM   4264 C CB  . ILE G 2 6   ? -5.500  37.622  -10.062 1.00 21.77  ? 96  ILE G CB  1 
ATOM   4265 C CG1 . ILE G 2 6   ? -5.922  38.736  -11.059 1.00 21.99  ? 96  ILE G CG1 1 
ATOM   4266 C CG2 . ILE G 2 6   ? -6.365  37.633  -8.783  1.00 21.00  ? 96  ILE G CG2 1 
ATOM   4267 C CD1 . ILE G 2 6   ? -7.252  38.566  -11.734 1.00 30.99  ? 96  ILE G CD1 1 
ATOM   4268 N N   . LEU G 2 7   ? -3.550  35.399  -9.043  1.00 21.29  ? 97  LEU G N   1 
ATOM   4269 C CA  . LEU G 2 7   ? -3.261  34.344  -8.085  1.00 20.74  ? 97  LEU G CA  1 
ATOM   4270 C C   . LEU G 2 7   ? -1.766  33.969  -8.034  1.00 25.83  ? 97  LEU G C   1 
ATOM   4271 O O   . LEU G 2 7   ? -1.369  33.165  -7.175  1.00 26.02  ? 97  LEU G O   1 
ATOM   4272 C CB  . LEU G 2 7   ? -4.132  33.124  -8.394  1.00 20.39  ? 97  LEU G CB  1 
ATOM   4273 C CG  . LEU G 2 7   ? -5.646  33.405  -8.436  1.00 23.44  ? 97  LEU G CG  1 
ATOM   4274 C CD1 . LEU G 2 7   ? -6.358  32.318  -9.151  1.00 23.92  ? 97  LEU G CD1 1 
ATOM   4275 C CD2 . LEU G 2 7   ? -6.247  33.624  -7.040  1.00 18.58  ? 97  LEU G CD2 1 
ATOM   4276 N N   . GLY G 2 8   ? -0.968  34.583  -8.907  1.00 20.57  ? 98  GLY G N   1 
ATOM   4277 C CA  . GLY G 2 8   ? 0.470   34.369  -8.979  1.00 21.26  ? 98  GLY G CA  1 
ATOM   4278 C C   . GLY G 2 8   ? 0.939   33.166  -9.781  1.00 25.48  ? 98  GLY G C   1 
ATOM   4279 O O   . GLY G 2 8   ? 2.145   33.016  -10.006 1.00 24.79  ? 98  GLY G O   1 
ATOM   4280 N N   . ASN G 2 9   ? -0.002  32.304  -10.220 1.00 21.79  ? 99  ASN G N   1 
ATOM   4281 C CA  . ASN G 2 9   ? 0.265   31.052  -10.942 1.00 22.16  ? 99  ASN G CA  1 
ATOM   4282 C C   . ASN G 2 9   ? 0.131   31.169  -12.494 1.00 27.67  ? 99  ASN G C   1 
ATOM   4283 O O   . ASN G 2 9   ? 0.374   30.192  -13.209 1.00 27.80  ? 99  ASN G O   1 
ATOM   4284 C CB  . ASN G 2 9   ? -0.679  29.938  -10.410 1.00 24.82  ? 99  ASN G CB  1 
ATOM   4285 C CG  . ASN G 2 9   ? -2.164  30.277  -10.363 1.00 41.08  ? 99  ASN G CG  1 
ATOM   4286 O OD1 . ASN G 2 9   ? -2.666  31.096  -11.145 1.00 36.89  ? 99  ASN G OD1 1 
ATOM   4287 N ND2 . ASN G 2 9   ? -2.914  29.624  -9.471  1.00 24.46  ? 99  ASN G ND2 1 
ATOM   4288 N N   . GLY G 2 10  ? -0.264  32.341  -12.989 1.00 24.45  ? 100 GLY G N   1 
ATOM   4289 C CA  . GLY G 2 10  ? -0.483  32.573  -14.415 1.00 24.05  ? 100 GLY G CA  1 
ATOM   4290 C C   . GLY G 2 10  ? -1.781  32.004  -14.970 1.00 27.49  ? 100 GLY G C   1 
ATOM   4291 O O   . GLY G 2 10  ? -2.012  32.077  -16.182 1.00 28.48  ? 100 GLY G O   1 
ATOM   4292 N N   . LEU G 2 11  ? -2.657  31.457  -14.093 1.00 22.31  ? 101 LEU G N   1 
ATOM   4293 C CA  . LEU G 2 11  ? -3.941  30.850  -14.484 1.00 20.93  ? 101 LEU G CA  1 
ATOM   4294 C C   . LEU G 2 11  ? -5.115  31.820  -14.473 1.00 25.16  ? 101 LEU G C   1 
ATOM   4295 O O   . LEU G 2 11  ? -6.170  31.471  -14.998 1.00 27.50  ? 101 LEU G O   1 
ATOM   4296 C CB  . LEU G 2 11  ? -4.276  29.658  -13.587 1.00 20.77  ? 101 LEU G CB  1 
ATOM   4297 C CG  . LEU G 2 11  ? -3.335  28.441  -13.626 1.00 24.90  ? 101 LEU G CG  1 
ATOM   4298 C CD1 . LEU G 2 11  ? -3.888  27.348  -12.781 1.00 25.33  ? 101 LEU G CD1 1 
ATOM   4299 C CD2 . LEU G 2 11  ? -3.120  27.935  -15.024 1.00 23.39  ? 101 LEU G CD2 1 
ATOM   4300 N N   . LEU G 2 12  ? -4.963  33.013  -13.865 1.00 18.86  ? 102 LEU G N   1 
ATOM   4301 C CA  . LEU G 2 12  ? -6.025  34.025  -13.819 1.00 17.38  ? 102 LEU G CA  1 
ATOM   4302 C C   . LEU G 2 12  ? -5.375  35.408  -13.951 1.00 19.52  ? 102 LEU G C   1 
ATOM   4303 O O   . LEU G 2 12  ? -4.874  35.956  -12.967 1.00 18.73  ? 102 LEU G O   1 
ATOM   4304 C CB  . LEU G 2 12  ? -6.860  33.881  -12.526 1.00 16.90  ? 102 LEU G CB  1 
ATOM   4305 C CG  . LEU G 2 12  ? -8.036  34.837  -12.340 1.00 20.83  ? 102 LEU G CG  1 
ATOM   4306 C CD1 . LEU G 2 12  ? -9.192  34.481  -13.238 1.00 21.87  ? 102 LEU G CD1 1 
ATOM   4307 C CD2 . LEU G 2 12  ? -8.517  34.817  -10.914 1.00 19.30  ? 102 LEU G CD2 1 
ATOM   4308 N N   . ARG G 2 13  ? -5.326  35.923  -15.191 1.00 15.38  ? 103 ARG G N   1 
ATOM   4309 C CA  . ARG G 2 13  ? -4.666  37.180  -15.531 1.00 16.72  ? 103 ARG G CA  1 
ATOM   4310 C C   . ARG G 2 13  ? -5.662  38.254  -15.968 1.00 21.99  ? 103 ARG G C   1 
ATOM   4311 O O   . ARG G 2 13  ? -6.580  37.963  -16.722 1.00 22.78  ? 103 ARG G O   1 
ATOM   4312 C CB  . ARG G 2 13  ? -3.635  36.933  -16.635 1.00 19.26  ? 103 ARG G CB  1 
ATOM   4313 C CG  . ARG G 2 13  ? -2.453  36.044  -16.224 1.00 28.24  ? 103 ARG G CG  1 
ATOM   4314 C CD  . ARG G 2 13  ? -1.761  35.415  -17.427 1.00 48.21  ? 103 ARG G CD  1 
ATOM   4315 N NE  . ARG G 2 13  ? -1.510  36.368  -18.513 1.00 63.84  ? 103 ARG G NE  1 
ATOM   4316 C CZ  . ARG G 2 13  ? -0.403  36.402  -19.244 1.00 83.00  ? 103 ARG G CZ  1 
ATOM   4317 N NH1 . ARG G 2 13  ? 0.584   35.542  -19.009 1.00 75.95  ? 103 ARG G NH1 1 
ATOM   4318 N NH2 . ARG G 2 13  ? -0.265  37.302  -20.205 1.00 71.43  ? 103 ARG G NH2 1 
ATOM   4319 N N   . LYS G 2 14  ? -5.470  39.498  -15.499 1.00 18.27  ? 104 LYS G N   1 
ATOM   4320 C CA  . LYS G 2 14  ? -6.349  40.632  -15.792 1.00 16.84  ? 104 LYS G CA  1 
ATOM   4321 C C   . LYS G 2 14  ? -5.589  41.800  -16.429 1.00 20.65  ? 104 LYS G C   1 
ATOM   4322 O O   . LYS G 2 14  ? -4.545  42.230  -15.934 1.00 17.00  ? 104 LYS G O   1 
ATOM   4323 C CB  . LYS G 2 14  ? -7.042  41.102  -14.495 1.00 18.68  ? 104 LYS G CB  1 
ATOM   4324 C CG  . LYS G 2 14  ? -7.980  42.286  -14.644 1.00 20.87  ? 104 LYS G CG  1 
ATOM   4325 C CD  . LYS G 2 14  ? -8.328  42.867  -13.285 1.00 21.43  ? 104 LYS G CD  1 
ATOM   4326 C CE  . LYS G 2 14  ? -8.869  44.256  -13.396 1.00 23.45  ? 104 LYS G CE  1 
ATOM   4327 N NZ  . LYS G 2 14  ? -7.793  45.270  -13.577 1.00 31.03  ? 104 LYS G NZ  1 
ATOM   4328 N N   . LYS G 2 15  ? -6.153  42.342  -17.510 1.00 18.84  ? 105 LYS G N   1 
ATOM   4329 C CA  . LYS G 2 15  ? -5.588  43.510  -18.177 1.00 18.93  ? 105 LYS G CA  1 
ATOM   4330 C C   . LYS G 2 15  ? -6.687  44.551  -18.320 1.00 23.11  ? 105 LYS G C   1 
ATOM   4331 O O   . LYS G 2 15  ? -7.737  44.250  -18.874 1.00 22.36  ? 105 LYS G O   1 
ATOM   4332 C CB  . LYS G 2 15  ? -4.970  43.131  -19.533 1.00 21.31  ? 105 LYS G CB  1 
ATOM   4333 C CG  . LYS G 2 15  ? -4.062  44.212  -20.122 1.00 38.81  ? 105 LYS G CG  1 
ATOM   4334 C CD  . LYS G 2 15  ? -3.418  43.731  -21.403 1.00 47.04  ? 105 LYS G CD  1 
ATOM   4335 C CE  . LYS G 2 15  ? -2.509  44.733  -22.054 1.00 54.64  ? 105 LYS G CE  1 
ATOM   4336 N NZ  . LYS G 2 15  ? -2.214  44.287  -23.440 1.00 66.82  ? 105 LYS G NZ  1 
ATOM   4337 N N   . THR G 2 16  ? -6.464  45.759  -17.778 1.00 20.88  ? 106 THR G N   1 
ATOM   4338 C CA  . THR G 2 16  ? -7.427  46.858  -17.835 1.00 20.58  ? 106 THR G CA  1 
ATOM   4339 C C   . THR G 2 16  ? -7.410  47.424  -19.249 1.00 25.36  ? 106 THR G C   1 
ATOM   4340 O O   . THR G 2 16  ? -6.342  47.782  -19.758 1.00 23.99  ? 106 THR G O   1 
ATOM   4341 C CB  . THR G 2 16  ? -7.116  47.908  -16.763 1.00 25.31  ? 106 THR G CB  1 
ATOM   4342 O OG1 . THR G 2 16  ? -7.105  47.280  -15.490 1.00 29.80  ? 106 THR G OG1 1 
ATOM   4343 C CG2 . THR G 2 16  ? -8.122  49.034  -16.744 1.00 25.62  ? 106 THR G CG2 1 
ATOM   4344 N N   . LEU G 2 17  ? -8.588  47.451  -19.894 1.00 23.65  ? 107 LEU G N   1 
ATOM   4345 C CA  . LEU G 2 17  ? -8.748  47.974  -21.262 1.00 24.01  ? 107 LEU G CA  1 
ATOM   4346 C C   . LEU G 2 17  ? -9.136  49.441  -21.178 1.00 28.16  ? 107 LEU G C   1 
ATOM   4347 O O   . LEU G 2 17  ? -8.482  50.292  -21.773 1.00 27.89  ? 107 LEU G O   1 
ATOM   4348 C CB  . LEU G 2 17  ? -9.797  47.182  -22.080 1.00 23.85  ? 107 LEU G CB  1 
ATOM   4349 C CG  . LEU G 2 17  ? -9.592  45.681  -22.319 1.00 27.55  ? 107 LEU G CG  1 
ATOM   4350 C CD1 . LEU G 2 17  ? -10.772 45.081  -23.065 1.00 26.80  ? 107 LEU G CD1 1 
ATOM   4351 C CD2 . LEU G 2 17  ? -8.292  45.380  -23.031 1.00 27.94  ? 107 LEU G CD2 1 
ATOM   4352 N N   . VAL G 2 18  ? -10.199 49.725  -20.409 1.00 24.82  ? 108 VAL G N   1 
ATOM   4353 C CA  . VAL G 2 18  ? -10.717 51.047  -20.126 1.00 23.86  ? 108 VAL G CA  1 
ATOM   4354 C C   . VAL G 2 18  ? -10.767 51.196  -18.609 1.00 29.14  ? 108 VAL G C   1 
ATOM   4355 O O   . VAL G 2 18  ? -11.469 50.412  -17.957 1.00 28.65  ? 108 VAL G O   1 
ATOM   4356 C CB  . VAL G 2 18  ? -12.107 51.315  -20.768 1.00 27.55  ? 108 VAL G CB  1 
ATOM   4357 C CG1 . VAL G 2 18  ? -12.616 52.716  -20.417 1.00 27.62  ? 108 VAL G CG1 1 
ATOM   4358 C CG2 . VAL G 2 18  ? -12.057 51.158  -22.264 1.00 27.41  ? 108 VAL G CG2 1 
ATOM   4359 N N   . PRO G 2 19  ? -10.077 52.193  -18.008 1.00 26.09  ? 109 PRO G N   1 
ATOM   4360 C CA  . PRO G 2 19  ? -10.227 52.380  -16.550 1.00 25.95  ? 109 PRO G CA  1 
ATOM   4361 C C   . PRO G 2 19  ? -11.579 53.035  -16.241 1.00 28.17  ? 109 PRO G C   1 
ATOM   4362 O O   . PRO G 2 19  ? -12.249 53.511  -17.144 1.00 25.95  ? 109 PRO G O   1 
ATOM   4363 C CB  . PRO G 2 19  ? -9.042  53.280  -16.176 1.00 27.73  ? 109 PRO G CB  1 
ATOM   4364 C CG  . PRO G 2 19  ? -8.665  53.976  -17.431 1.00 31.71  ? 109 PRO G CG  1 
ATOM   4365 C CD  . PRO G 2 19  ? -9.199  53.220  -18.612 1.00 27.01  ? 109 PRO G CD  1 
ATOM   4366 N N   . GLY G 2 20  ? -11.983 53.042  -14.984 1.00 26.09  ? 110 GLY G N   1 
ATOM   4367 C CA  . GLY G 2 20  ? -13.246 53.663  -14.612 1.00 26.67  ? 110 GLY G CA  1 
ATOM   4368 C C   . GLY G 2 20  ? -13.125 55.169  -14.486 1.00 33.42  ? 110 GLY G C   1 
ATOM   4369 O O   . GLY G 2 20  ? -12.011 55.691  -14.525 1.00 31.99  ? 110 GLY G O   1 
ATOM   4370 N N   . PRO G 2 21  ? -14.256 55.898  -14.271 1.00 33.68  ? 111 PRO G N   1 
ATOM   4371 C CA  . PRO G 2 21  ? -14.192 57.372  -14.087 1.00 33.86  ? 111 PRO G CA  1 
ATOM   4372 C C   . PRO G 2 21  ? -13.261 57.819  -12.948 1.00 38.14  ? 111 PRO G C   1 
ATOM   4373 O O   . PRO G 2 21  ? -13.040 57.033  -12.021 1.00 39.09  ? 111 PRO G O   1 
ATOM   4374 C CB  . PRO G 2 21  ? -15.640 57.757  -13.767 1.00 36.07  ? 111 PRO G CB  1 
ATOM   4375 C CG  . PRO G 2 21  ? -16.321 56.488  -13.396 1.00 40.86  ? 111 PRO G CG  1 
ATOM   4376 C CD  . PRO G 2 21  ? -15.648 55.416  -14.185 1.00 36.00  ? 111 PRO G CD  1 
ATOM   4377 N N   . PRO G 2 22  ? -12.703 59.061  -12.985 1.00 33.84  ? 112 PRO G N   1 
ATOM   4378 C CA  . PRO G 2 22  ? -11.699 59.463  -11.973 1.00 33.22  ? 112 PRO G CA  1 
ATOM   4379 C C   . PRO G 2 22  ? -12.015 59.169  -10.500 1.00 36.07  ? 112 PRO G C   1 
ATOM   4380 O O   . PRO G 2 22  ? -11.087 58.843  -9.753  1.00 37.06  ? 112 PRO G O   1 
ATOM   4381 C CB  . PRO G 2 22  ? -11.562 60.964  -12.196 1.00 34.79  ? 112 PRO G CB  1 
ATOM   4382 C CG  . PRO G 2 22  ? -11.805 61.123  -13.654 1.00 39.27  ? 112 PRO G CG  1 
ATOM   4383 C CD  . PRO G 2 22  ? -12.837 60.099  -14.031 1.00 34.95  ? 112 PRO G CD  1 
ATOM   4384 N N   . GLY G 2 23  ? -13.273 59.260  -10.097 1.00 30.95  ? 113 GLY G N   1 
ATOM   4385 C CA  . GLY G 2 23  ? -13.628 59.003  -8.705  1.00 30.71  ? 113 GLY G CA  1 
ATOM   4386 C C   . GLY G 2 23  ? -14.172 57.620  -8.383  1.00 34.12  ? 113 GLY G C   1 
ATOM   4387 O O   . GLY G 2 23  ? -14.529 57.374  -7.223  1.00 36.52  ? 113 GLY G O   1 
ATOM   4388 N N   . SER G 2 24  ? -14.234 56.700  -9.388  1.00 25.54  ? 114 SER G N   1 
ATOM   4389 C CA  . SER G 2 24  ? -14.802 55.349  -9.254  1.00 23.58  ? 114 SER G CA  1 
ATOM   4390 C C   . SER G 2 24  ? -14.096 54.498  -8.226  1.00 25.10  ? 114 SER G C   1 
ATOM   4391 O O   . SER G 2 24  ? -12.909 54.691  -7.958  1.00 27.24  ? 114 SER G O   1 
ATOM   4392 C CB  . SER G 2 24  ? -14.790 54.611  -10.587 1.00 25.40  ? 114 SER G CB  1 
ATOM   4393 O OG  . SER G 2 24  ? -13.470 54.452  -11.081 1.00 30.33  ? 114 SER G OG  1 
ATOM   4394 N N   . SER G 2 25  ? -14.818 53.537  -7.653  1.00 17.97  ? 115 SER G N   1 
ATOM   4395 C CA  . SER G 2 25  ? -14.229 52.649  -6.661  1.00 16.51  ? 115 SER G CA  1 
ATOM   4396 C C   . SER G 2 25  ? -14.603 51.190  -6.946  1.00 19.73  ? 115 SER G C   1 
ATOM   4397 O O   . SER G 2 25  ? -15.461 50.901  -7.798  1.00 16.75  ? 115 SER G O   1 
ATOM   4398 C CB  . SER G 2 25  ? -14.637 53.062  -5.250  1.00 18.80  ? 115 SER G CB  1 
ATOM   4399 O OG  . SER G 2 25  ? -16.050 53.090  -5.136  1.00 30.57  ? 115 SER G OG  1 
ATOM   4400 N N   . ARG G 2 26  ? -13.917 50.268  -6.245  1.00 16.02  ? 116 ARG G N   1 
ATOM   4401 C CA  . ARG G 2 26  ? -14.126 48.841  -6.415  1.00 16.09  ? 116 ARG G CA  1 
ATOM   4402 C C   . ARG G 2 26  ? -15.362 48.323  -5.668  1.00 21.84  ? 116 ARG G C   1 
ATOM   4403 O O   . ARG G 2 26  ? -15.687 48.816  -4.566  1.00 21.20  ? 116 ARG G O   1 
ATOM   4404 C CB  . ARG G 2 26  ? -12.880 48.064  -5.961  1.00 15.10  ? 116 ARG G CB  1 
ATOM   4405 C CG  . ARG G 2 26  ? -11.819 47.990  -7.049  1.00 18.32  ? 116 ARG G CG  1 
ATOM   4406 C CD  . ARG G 2 26  ? -10.505 48.384  -6.487  1.00 18.24  ? 116 ARG G CD  1 
ATOM   4407 N NE  . ARG G 2 26  ? -9.450  48.393  -7.495  1.00 18.96  ? 116 ARG G NE  1 
ATOM   4408 C CZ  . ARG G 2 26  ? -8.441  47.539  -7.505  1.00 32.11  ? 116 ARG G CZ  1 
ATOM   4409 N NH1 . ARG G 2 26  ? -8.371  46.572  -6.594  1.00 12.45  ? 116 ARG G NH1 1 
ATOM   4410 N NH2 . ARG G 2 26  ? -7.499  47.630  -8.431  1.00 20.37  ? 116 ARG G NH2 1 
ATOM   4411 N N   . PRO G 2 27  ? -16.008 47.261  -6.212  1.00 18.00  ? 117 PRO G N   1 
ATOM   4412 C CA  . PRO G 2 27  ? -17.139 46.671  -5.504  1.00 17.70  ? 117 PRO G CA  1 
ATOM   4413 C C   . PRO G 2 27  ? -16.650 45.856  -4.331  1.00 23.49  ? 117 PRO G C   1 
ATOM   4414 O O   . PRO G 2 27  ? -15.498 45.405  -4.343  1.00 24.07  ? 117 PRO G O   1 
ATOM   4415 C CB  . PRO G 2 27  ? -17.799 45.801  -6.567  1.00 19.71  ? 117 PRO G CB  1 
ATOM   4416 C CG  . PRO G 2 27  ? -16.693 45.400  -7.462  1.00 23.50  ? 117 PRO G CG  1 
ATOM   4417 C CD  . PRO G 2 27  ? -15.746 46.556  -7.487  1.00 19.88  ? 117 PRO G CD  1 
ATOM   4418 N N   . VAL G 2 28  ? -17.517 45.697  -3.301  1.00 21.65  ? 118 VAL G N   1 
ATOM   4419 C CA  . VAL G 2 28  ? -17.191 44.955  -2.071  1.00 21.71  ? 118 VAL G CA  1 
ATOM   4420 C C   . VAL G 2 28  ? -18.063 43.678  -1.984  1.00 24.60  ? 118 VAL G C   1 
ATOM   4421 O O   . VAL G 2 28  ? -19.153 43.624  -2.566  1.00 24.68  ? 118 VAL G O   1 
ATOM   4422 C CB  . VAL G 2 28  ? -17.288 45.832  -0.785  1.00 26.07  ? 118 VAL G CB  1 
ATOM   4423 C CG1 . VAL G 2 28  ? -16.481 47.125  -0.931  1.00 26.01  ? 118 VAL G CG1 1 
ATOM   4424 C CG2 . VAL G 2 28  ? -18.737 46.144  -0.399  1.00 25.47  ? 118 VAL G CG2 1 
ATOM   4425 N N   . LYS G 2 29  ? -17.575 42.668  -1.260  1.00 19.66  ? 119 LYS G N   1 
ATOM   4426 C CA  . LYS G 2 29  ? -18.252 41.389  -1.067  1.00 18.85  ? 119 LYS G CA  1 
ATOM   4427 C C   . LYS G 2 29  ? -19.686 41.620  -0.584  1.00 21.72  ? 119 LYS G C   1 
ATOM   4428 O O   . LYS G 2 29  ? -19.899 42.364  0.367   1.00 22.07  ? 119 LYS G O   1 
ATOM   4429 C CB  . LYS G 2 29  ? -17.457 40.537  -0.061  1.00 20.38  ? 119 LYS G CB  1 
ATOM   4430 C CG  . LYS G 2 29  ? -18.081 39.200  0.307   1.00 37.44  ? 119 LYS G CG  1 
ATOM   4431 C CD  . LYS G 2 29  ? -17.314 38.500  1.423   1.00 52.51  ? 119 LYS G CD  1 
ATOM   4432 C CE  . LYS G 2 29  ? -17.977 37.203  1.837   1.00 70.05  ? 119 LYS G CE  1 
ATOM   4433 N NZ  . LYS G 2 29  ? -19.268 37.419  2.553   1.00 80.09  ? 119 LYS G NZ  1 
ATOM   4434 N N   . GLY G 2 30  ? -20.634 40.987  -1.254  1.00 17.50  ? 120 GLY G N   1 
ATOM   4435 C CA  . GLY G 2 30  ? -22.049 41.070  -0.920  1.00 17.55  ? 120 GLY G CA  1 
ATOM   4436 C C   . GLY G 2 30  ? -22.850 41.964  -1.839  1.00 22.14  ? 120 GLY G C   1 
ATOM   4437 O O   . GLY G 2 30  ? -24.069 41.853  -1.885  1.00 22.35  ? 120 GLY G O   1 
ATOM   4438 N N   . GLN G 2 31  ? -22.179 42.859  -2.570  1.00 18.75  ? 121 GLN G N   1 
ATOM   4439 C CA  . GLN G 2 31  ? -22.843 43.792  -3.478  1.00 18.06  ? 121 GLN G CA  1 
ATOM   4440 C C   . GLN G 2 31  ? -23.368 43.076  -4.696  1.00 23.05  ? 121 GLN G C   1 
ATOM   4441 O O   . GLN G 2 31  ? -22.747 42.127  -5.165  1.00 25.50  ? 121 GLN G O   1 
ATOM   4442 C CB  . GLN G 2 31  ? -21.896 44.928  -3.909  1.00 18.80  ? 121 GLN G CB  1 
ATOM   4443 C CG  . GLN G 2 31  ? -21.596 45.920  -2.793  1.00 17.14  ? 121 GLN G CG  1 
ATOM   4444 C CD  . GLN G 2 31  ? -21.010 47.234  -3.267  1.00 33.53  ? 121 GLN G CD  1 
ATOM   4445 O OE1 . GLN G 2 31  ? -20.275 47.327  -4.255  1.00 35.32  ? 121 GLN G OE1 1 
ATOM   4446 N NE2 . GLN G 2 31  ? -21.297 48.282  -2.545  1.00 17.96  ? 121 GLN G NE2 1 
ATOM   4447 N N   . VAL G 2 32  ? -24.512 43.529  -5.216  1.00 17.67  ? 122 VAL G N   1 
ATOM   4448 C CA  . VAL G 2 32  ? -25.092 42.957  -6.413  1.00 17.14  ? 122 VAL G CA  1 
ATOM   4449 C C   . VAL G 2 32  ? -24.489 43.734  -7.571  1.00 20.11  ? 122 VAL G C   1 
ATOM   4450 O O   . VAL G 2 32  ? -24.769 44.924  -7.739  1.00 19.45  ? 122 VAL G O   1 
ATOM   4451 C CB  . VAL G 2 32  ? -26.648 42.931  -6.420  1.00 21.08  ? 122 VAL G CB  1 
ATOM   4452 C CG1 . VAL G 2 32  ? -27.176 42.246  -7.672  1.00 20.66  ? 122 VAL G CG1 1 
ATOM   4453 C CG2 . VAL G 2 32  ? -27.209 42.258  -5.178  1.00 20.84  ? 122 VAL G CG2 1 
ATOM   4454 N N   . VAL G 2 33  ? -23.626 43.069  -8.337  1.00 17.05  ? 123 VAL G N   1 
ATOM   4455 C CA  . VAL G 2 33  ? -22.945 43.676  -9.458  1.00 16.33  ? 123 VAL G CA  1 
ATOM   4456 C C   . VAL G 2 33  ? -23.599 43.261  -10.771 1.00 21.00  ? 123 VAL G C   1 
ATOM   4457 O O   . VAL G 2 33  ? -24.073 42.136  -10.903 1.00 22.47  ? 123 VAL G O   1 
ATOM   4458 C CB  . VAL G 2 33  ? -21.412 43.387  -9.457  1.00 20.55  ? 123 VAL G CB  1 
ATOM   4459 C CG1 . VAL G 2 33  ? -20.714 44.027  -8.262  1.00 19.45  ? 123 VAL G CG1 1 
ATOM   4460 C CG2 . VAL G 2 33  ? -21.103 41.891  -9.532  1.00 20.82  ? 123 VAL G CG2 1 
ATOM   4461 N N   . THR G 2 34  ? -23.623 44.194  -11.742 1.00 17.18  ? 124 THR G N   1 
ATOM   4462 C CA  . THR G 2 34  ? -24.137 43.983  -13.102 1.00 15.66  ? 124 THR G CA  1 
ATOM   4463 C C   . THR G 2 34  ? -22.975 44.159  -14.056 1.00 17.31  ? 124 THR G C   1 
ATOM   4464 O O   . THR G 2 34  ? -22.293 45.185  -14.015 1.00 18.15  ? 124 THR G O   1 
ATOM   4465 C CB  . THR G 2 34  ? -25.308 44.919  -13.428 1.00 17.17  ? 124 THR G CB  1 
ATOM   4466 O OG1 . THR G 2 34  ? -26.309 44.784  -12.432 1.00 21.02  ? 124 THR G OG1 1 
ATOM   4467 C CG2 . THR G 2 34  ? -25.916 44.645  -14.790 1.00 15.37  ? 124 THR G CG2 1 
ATOM   4468 N N   . VAL G 2 35  ? -22.726 43.159  -14.894 1.00 12.39  ? 125 VAL G N   1 
ATOM   4469 C CA  . VAL G 2 35  ? -21.629 43.231  -15.857 1.00 11.56  ? 125 VAL G CA  1 
ATOM   4470 C C   . VAL G 2 35  ? -22.136 42.996  -17.275 1.00 21.59  ? 125 VAL G C   1 
ATOM   4471 O O   . VAL G 2 35  ? -23.243 42.490  -17.474 1.00 24.15  ? 125 VAL G O   1 
ATOM   4472 C CB  . VAL G 2 35  ? -20.468 42.251  -15.513 1.00 13.71  ? 125 VAL G CB  1 
ATOM   4473 C CG1 . VAL G 2 35  ? -19.881 42.525  -14.122 1.00 11.46  ? 125 VAL G CG1 1 
ATOM   4474 C CG2 . VAL G 2 35  ? -20.887 40.785  -15.675 1.00 13.97  ? 125 VAL G CG2 1 
ATOM   4475 N N   . HIS G 2 36  ? -21.317 43.394  -18.251 1.00 19.66  ? 126 HIS G N   1 
ATOM   4476 C CA  . HIS G 2 36  ? -21.494 43.178  -19.679 1.00 19.37  ? 126 HIS G CA  1 
ATOM   4477 C C   . HIS G 2 36  ? -20.346 42.222  -20.020 1.00 22.18  ? 126 HIS G C   1 
ATOM   4478 O O   . HIS G 2 36  ? -19.176 42.606  -19.917 1.00 21.39  ? 126 HIS G O   1 
ATOM   4479 C CB  . HIS G 2 36  ? -21.463 44.522  -20.434 1.00 19.71  ? 126 HIS G CB  1 
ATOM   4480 C CG  . HIS G 2 36  ? -21.694 44.475  -21.919 1.00 23.17  ? 126 HIS G CG  1 
ATOM   4481 N ND1 . HIS G 2 36  ? -22.201 45.572  -22.595 1.00 25.08  ? 126 HIS G ND1 1 
ATOM   4482 C CD2 . HIS G 2 36  ? -21.422 43.501  -22.822 1.00 24.98  ? 126 HIS G CD2 1 
ATOM   4483 C CE1 . HIS G 2 36  ? -22.223 45.227  -23.872 1.00 24.43  ? 126 HIS G CE1 1 
ATOM   4484 N NE2 . HIS G 2 36  ? -21.778 43.983  -24.050 1.00 24.50  ? 126 HIS G NE2 1 
ATOM   4485 N N   . LEU G 2 37  ? -20.675 40.942  -20.274 1.00 16.90  ? 127 LEU G N   1 
ATOM   4486 C CA  . LEU G 2 37  ? -19.674 39.911  -20.507 1.00 15.89  ? 127 LEU G CA  1 
ATOM   4487 C C   . LEU G 2 37  ? -19.641 39.390  -21.941 1.00 23.04  ? 127 LEU G C   1 
ATOM   4488 O O   . LEU G 2 37  ? -20.683 39.125  -22.538 1.00 25.06  ? 127 LEU G O   1 
ATOM   4489 C CB  . LEU G 2 37  ? -19.920 38.726  -19.543 1.00 15.14  ? 127 LEU G CB  1 
ATOM   4490 C CG  . LEU G 2 37  ? -18.839 37.626  -19.486 1.00 17.37  ? 127 LEU G CG  1 
ATOM   4491 C CD1 . LEU G 2 37  ? -17.472 38.197  -19.104 1.00 15.58  ? 127 LEU G CD1 1 
ATOM   4492 C CD2 . LEU G 2 37  ? -19.217 36.550  -18.503 1.00 22.34  ? 127 LEU G CD2 1 
ATOM   4493 N N   . GLN G 2 38  ? -18.426 39.159  -22.443 1.00 20.37  ? 128 GLN G N   1 
ATOM   4494 C CA  . GLN G 2 38  ? -18.143 38.560  -23.744 1.00 20.93  ? 128 GLN G CA  1 
ATOM   4495 C C   . GLN G 2 38  ? -17.187 37.387  -23.507 1.00 26.78  ? 128 GLN G C   1 
ATOM   4496 O O   . GLN G 2 38  ? -16.014 37.618  -23.206 1.00 27.54  ? 128 GLN G O   1 
ATOM   4497 C CB  . GLN G 2 38  ? -17.563 39.589  -24.727 1.00 21.63  ? 128 GLN G CB  1 
ATOM   4498 C CG  . GLN G 2 38  ? -18.538 40.659  -25.186 1.00 23.15  ? 128 GLN G CG  1 
ATOM   4499 C CD  . GLN G 2 38  ? -18.052 41.334  -26.447 1.00 40.73  ? 128 GLN G CD  1 
ATOM   4500 O OE1 . GLN G 2 38  ? -18.237 40.835  -27.559 1.00 35.23  ? 128 GLN G OE1 1 
ATOM   4501 N NE2 . GLN G 2 38  ? -17.436 42.493  -26.303 1.00 35.76  ? 128 GLN G NE2 1 
ATOM   4502 N N   . THR G 2 39  ? -17.710 36.134  -23.550 1.00 23.06  ? 129 THR G N   1 
ATOM   4503 C CA  . THR G 2 39  ? -16.904 34.941  -23.307 1.00 23.58  ? 129 THR G CA  1 
ATOM   4504 C C   . THR G 2 39  ? -16.449 34.318  -24.633 1.00 30.97  ? 129 THR G C   1 
ATOM   4505 O O   . THR G 2 39  ? -17.242 34.167  -25.561 1.00 30.17  ? 129 THR G O   1 
ATOM   4506 C CB  . THR G 2 39  ? -17.681 33.943  -22.449 1.00 31.55  ? 129 THR G CB  1 
ATOM   4507 O OG1 . THR G 2 39  ? -18.241 34.613  -21.317 1.00 34.46  ? 129 THR G OG1 1 
ATOM   4508 C CG2 . THR G 2 39  ? -16.824 32.793  -21.963 1.00 27.64  ? 129 THR G CG2 1 
ATOM   4509 N N   . SER G 2 40  ? -15.155 33.967  -24.710 1.00 30.38  ? 130 SER G N   1 
ATOM   4510 C CA  . SER G 2 40  ? -14.565 33.308  -25.864 1.00 31.44  ? 130 SER G CA  1 
ATOM   4511 C C   . SER G 2 40  ? -13.551 32.265  -25.402 1.00 36.06  ? 130 SER G C   1 
ATOM   4512 O O   . SER G 2 40  ? -12.998 32.377  -24.305 1.00 34.91  ? 130 SER G O   1 
ATOM   4513 C CB  . SER G 2 40  ? -13.930 34.312  -26.822 1.00 36.62  ? 130 SER G CB  1 
ATOM   4514 O OG  . SER G 2 40  ? -12.912 35.083  -26.204 1.00 51.03  ? 130 SER G OG  1 
ATOM   4515 N N   . LEU G 2 41  ? -13.339 31.235  -26.228 1.00 33.32  ? 131 LEU G N   1 
ATOM   4516 C CA  . LEU G 2 41  ? -12.411 30.148  -25.935 1.00 34.22  ? 131 LEU G CA  1 
ATOM   4517 C C   . LEU G 2 41  ? -10.984 30.572  -26.278 1.00 43.39  ? 131 LEU G C   1 
ATOM   4518 O O   . LEU G 2 41  ? -10.779 31.642  -26.857 1.00 43.33  ? 131 LEU G O   1 
ATOM   4519 C CB  . LEU G 2 41  ? -12.806 28.867  -26.705 1.00 33.41  ? 131 LEU G CB  1 
ATOM   4520 C CG  . LEU G 2 41  ? -14.232 28.320  -26.487 1.00 36.82  ? 131 LEU G CG  1 
ATOM   4521 C CD1 . LEU G 2 41  ? -14.577 27.267  -27.517 1.00 36.15  ? 131 LEU G CD1 1 
ATOM   4522 C CD2 . LEU G 2 41  ? -14.425 27.751  -25.079 1.00 39.63  ? 131 LEU G CD2 1 
ATOM   4523 N N   . GLU G 2 42  ? -9.997  29.732  -25.924 1.00 43.35  ? 132 GLU G N   1 
ATOM   4524 C CA  . GLU G 2 42  ? -8.570  29.975  -26.154 1.00 44.45  ? 132 GLU G CA  1 
ATOM   4525 C C   . GLU G 2 42  ? -8.249  30.174  -27.638 1.00 49.23  ? 132 GLU G C   1 
ATOM   4526 O O   . GLU G 2 42  ? -7.353  30.954  -27.956 1.00 48.76  ? 132 GLU G O   1 
ATOM   4527 C CB  . GLU G 2 42  ? -7.755  28.799  -25.595 1.00 46.22  ? 132 GLU G CB  1 
ATOM   4528 C CG  . GLU G 2 42  ? -6.388  29.166  -25.054 1.00 56.95  ? 132 GLU G CG  1 
ATOM   4529 C CD  . GLU G 2 42  ? -5.827  28.163  -24.062 1.00 77.73  ? 132 GLU G CD  1 
ATOM   4530 O OE1 . GLU G 2 42  ? -6.033  26.939  -24.248 1.00 74.92  ? 132 GLU G OE1 1 
ATOM   4531 O OE2 . GLU G 2 42  ? -5.190  28.609  -23.082 1.00 72.64  ? 132 GLU G OE2 1 
ATOM   4532 N N   . ASN G 2 43  ? -9.006  29.500  -28.535 1.00 46.62  ? 133 ASN G N   1 
ATOM   4533 C CA  . ASN G 2 43  ? -8.837  29.552  -29.994 1.00 46.38  ? 133 ASN G CA  1 
ATOM   4534 C C   . ASN G 2 43  ? -9.588  30.734  -30.642 1.00 49.07  ? 133 ASN G C   1 
ATOM   4535 O O   . ASN G 2 43  ? -9.433  30.958  -31.844 1.00 49.54  ? 133 ASN G O   1 
ATOM   4536 C CB  . ASN G 2 43  ? -9.266  28.224  -30.638 1.00 48.30  ? 133 ASN G CB  1 
ATOM   4537 C CG  . ASN G 2 43  ? -10.709 27.854  -30.404 1.00 73.28  ? 133 ASN G CG  1 
ATOM   4538 O OD1 . ASN G 2 43  ? -11.584 28.183  -31.201 1.00 70.36  ? 133 ASN G OD1 1 
ATOM   4539 N ND2 . ASN G 2 43  ? -10.990 27.151  -29.316 1.00 65.74  ? 133 ASN G ND2 1 
ATOM   4540 N N   . GLY G 2 44  ? -10.371 31.472  -29.857 1.00 43.89  ? 134 GLY G N   1 
ATOM   4541 C CA  . GLY G 2 44  ? -11.100 32.643  -30.333 1.00 43.21  ? 134 GLY G CA  1 
ATOM   4542 C C   . GLY G 2 44  ? -12.576 32.454  -30.606 1.00 46.61  ? 134 GLY G C   1 
ATOM   4543 O O   . GLY G 2 44  ? -13.244 33.421  -30.975 1.00 46.48  ? 134 GLY G O   1 
ATOM   4544 N N   . THR G 2 45  ? -13.099 31.217  -30.443 1.00 42.46  ? 135 THR G N   1 
ATOM   4545 C CA  . THR G 2 45  ? -14.514 30.902  -30.661 1.00 42.33  ? 135 THR G CA  1 
ATOM   4546 C C   . THR G 2 45  ? -15.357 31.555  -29.547 1.00 45.34  ? 135 THR G C   1 
ATOM   4547 O O   . THR G 2 45  ? -15.093 31.331  -28.368 1.00 45.13  ? 135 THR G O   1 
ATOM   4548 C CB  . THR G 2 45  ? -14.710 29.381  -30.748 1.00 50.75  ? 135 THR G CB  1 
ATOM   4549 O OG1 . THR G 2 45  ? -14.068 28.913  -31.934 1.00 53.24  ? 135 THR G OG1 1 
ATOM   4550 C CG2 . THR G 2 45  ? -16.187 28.966  -30.756 1.00 48.17  ? 135 THR G CG2 1 
ATOM   4551 N N   . ARG G 2 46  ? -16.346 32.378  -29.937 1.00 40.01  ? 136 ARG G N   1 
ATOM   4552 C CA  . ARG G 2 46  ? -17.224 33.078  -29.004 1.00 39.01  ? 136 ARG G CA  1 
ATOM   4553 C C   . ARG G 2 46  ? -18.296 32.128  -28.486 1.00 40.81  ? 136 ARG G C   1 
ATOM   4554 O O   . ARG G 2 46  ? -18.855 31.344  -29.256 1.00 39.67  ? 136 ARG G O   1 
ATOM   4555 C CB  . ARG G 2 46  ? -17.856 34.309  -29.672 1.00 39.21  ? 136 ARG G CB  1 
ATOM   4556 C CG  . ARG G 2 46  ? -16.847 35.353  -30.142 1.00 45.34  ? 136 ARG G CG  1 
ATOM   4557 C CD  . ARG G 2 46  ? -17.498 36.375  -31.043 1.00 52.60  ? 136 ARG G CD  1 
ATOM   4558 N N   . VAL G 2 47  ? -18.570 32.184  -27.175 1.00 37.01  ? 137 VAL G N   1 
ATOM   4559 C CA  . VAL G 2 47  ? -19.545 31.308  -26.524 1.00 36.35  ? 137 VAL G CA  1 
ATOM   4560 C C   . VAL G 2 47  ? -20.891 32.032  -26.467 1.00 39.33  ? 137 VAL G C   1 
ATOM   4561 O O   . VAL G 2 47  ? -21.886 31.513  -26.985 1.00 38.36  ? 137 VAL G O   1 
ATOM   4562 C CB  . VAL G 2 47  ? -19.035 30.839  -25.133 1.00 40.36  ? 137 VAL G CB  1 
ATOM   4563 C CG1 . VAL G 2 47  ? -20.152 30.223  -24.292 1.00 39.96  ? 137 VAL G CG1 1 
ATOM   4564 C CG2 . VAL G 2 47  ? -17.862 29.867  -25.280 1.00 40.27  ? 137 VAL G CG2 1 
ATOM   4565 N N   . GLN G 2 48  ? -20.911 33.236  -25.861 1.00 36.01  ? 138 GLN G N   1 
ATOM   4566 C CA  . GLN G 2 48  ? -22.117 34.062  -25.740 1.00 35.69  ? 138 GLN G CA  1 
ATOM   4567 C C   . GLN G 2 48  ? -21.749 35.511  -25.421 1.00 37.11  ? 138 GLN G C   1 
ATOM   4568 O O   . GLN G 2 48  ? -20.571 35.853  -25.285 1.00 36.53  ? 138 GLN G O   1 
ATOM   4569 C CB  . GLN G 2 48  ? -23.127 33.490  -24.688 1.00 37.24  ? 138 GLN G CB  1 
ATOM   4570 C CG  . GLN G 2 48  ? -22.599 33.331  -23.253 1.00 52.72  ? 138 GLN G CG  1 
ATOM   4571 C CD  . GLN G 2 48  ? -23.641 32.859  -22.256 1.00 76.68  ? 138 GLN G CD  1 
ATOM   4572 O OE1 . GLN G 2 48  ? -24.834 33.184  -22.345 1.00 72.19  ? 138 GLN G OE1 1 
ATOM   4573 N NE2 . GLN G 2 48  ? -23.198 32.128  -21.235 1.00 71.77  ? 138 GLN G NE2 1 
ATOM   4574 N N   . GLU G 2 49  ? -22.778 36.358  -25.360 1.00 32.74  ? 139 GLU G N   1 
ATOM   4575 C CA  . GLU G 2 49  ? -22.713 37.770  -25.001 1.00 31.92  ? 139 GLU G CA  1 
ATOM   4576 C C   . GLU G 2 49  ? -23.868 38.055  -24.057 1.00 34.18  ? 139 GLU G C   1 
ATOM   4577 O O   . GLU G 2 49  ? -25.017 37.750  -24.375 1.00 33.01  ? 139 GLU G O   1 
ATOM   4578 C CB  . GLU G 2 49  ? -22.749 38.681  -26.237 1.00 33.15  ? 139 GLU G CB  1 
ATOM   4579 C CG  . GLU G 2 49  ? -21.985 39.976  -26.028 1.00 42.06  ? 139 GLU G CG  1 
ATOM   4580 C CD  . GLU G 2 49  ? -22.692 41.242  -26.466 1.00 55.59  ? 139 GLU G CD  1 
ATOM   4581 O OE1 . GLU G 2 49  ? -23.063 42.040  -25.576 1.00 22.14  ? 139 GLU G OE1 1 
ATOM   4582 O OE2 . GLU G 2 49  ? -22.866 41.446  -27.691 1.00 55.95  ? 139 GLU G OE2 1 
ATOM   4583 N N   . GLU G 2 50  ? -23.549 38.576  -22.870 1.00 30.53  ? 140 GLU G N   1 
ATOM   4584 C CA  . GLU G 2 50  ? -24.520 38.900  -21.830 1.00 29.38  ? 140 GLU G CA  1 
ATOM   4585 C C   . GLU G 2 50  ? -24.350 40.367  -21.450 1.00 31.54  ? 140 GLU G C   1 
ATOM   4586 O O   . GLU G 2 50  ? -23.416 40.693  -20.711 1.00 30.76  ? 140 GLU G O   1 
ATOM   4587 C CB  . GLU G 2 50  ? -24.346 37.982  -20.599 1.00 30.59  ? 140 GLU G CB  1 
ATOM   4588 C CG  . GLU G 2 50  ? -24.673 36.519  -20.836 1.00 40.77  ? 140 GLU G CG  1 
ATOM   4589 C CD  . GLU G 2 50  ? -24.048 35.590  -19.814 1.00 58.24  ? 140 GLU G CD  1 
ATOM   4590 O OE1 . GLU G 2 50  ? -22.858 35.240  -19.989 1.00 48.72  ? 140 GLU G OE1 1 
ATOM   4591 O OE2 . GLU G 2 50  ? -24.741 35.209  -18.841 1.00 56.17  ? 140 GLU G OE2 1 
ATOM   4592 N N   . PRO G 2 51  ? -25.214 41.281  -21.946 1.00 27.12  ? 141 PRO G N   1 
ATOM   4593 C CA  . PRO G 2 51  ? -25.043 42.704  -21.593 1.00 26.31  ? 141 PRO G CA  1 
ATOM   4594 C C   . PRO G 2 51  ? -25.483 43.014  -20.159 1.00 28.75  ? 141 PRO G C   1 
ATOM   4595 O O   . PRO G 2 51  ? -25.051 44.008  -19.596 1.00 29.91  ? 141 PRO G O   1 
ATOM   4596 C CB  . PRO G 2 51  ? -25.910 43.435  -22.618 1.00 27.99  ? 141 PRO G CB  1 
ATOM   4597 C CG  . PRO G 2 51  ? -26.958 42.453  -22.994 1.00 32.62  ? 141 PRO G CG  1 
ATOM   4598 C CD  . PRO G 2 51  ? -26.365 41.077  -22.851 1.00 28.54  ? 141 PRO G CD  1 
ATOM   4599 N N   . GLU G 2 52  ? -26.312 42.174  -19.557 1.00 23.14  ? 142 GLU G N   1 
ATOM   4600 C CA  . GLU G 2 52  ? -26.742 42.454  -18.200 1.00 22.13  ? 142 GLU G CA  1 
ATOM   4601 C C   . GLU G 2 52  ? -26.676 41.205  -17.306 1.00 24.35  ? 142 GLU G C   1 
ATOM   4602 O O   . GLU G 2 52  ? -27.710 40.788  -16.774 1.00 25.47  ? 142 GLU G O   1 
ATOM   4603 C CB  . GLU G 2 52  ? -28.151 43.087  -18.189 1.00 23.41  ? 142 GLU G CB  1 
ATOM   4604 C CG  . GLU G 2 52  ? -28.188 44.560  -18.567 1.00 27.45  ? 142 GLU G CG  1 
ATOM   4605 N N   . LEU G 2 53  ? -25.462 40.607  -17.124 1.00 17.06  ? 143 LEU G N   1 
ATOM   4606 C CA  . LEU G 2 53  ? -25.318 39.496  -16.167 1.00 14.74  ? 143 LEU G CA  1 
ATOM   4607 C C   . LEU G 2 53  ? -25.301 40.106  -14.736 1.00 17.52  ? 143 LEU G C   1 
ATOM   4608 O O   . LEU G 2 53  ? -24.506 40.994  -14.461 1.00 17.90  ? 143 LEU G O   1 
ATOM   4609 C CB  . LEU G 2 53  ? -24.059 38.656  -16.445 1.00 13.88  ? 143 LEU G CB  1 
ATOM   4610 C CG  . LEU G 2 53  ? -23.685 37.565  -15.414 1.00 17.61  ? 143 LEU G CG  1 
ATOM   4611 C CD1 . LEU G 2 53  ? -24.699 36.427  -15.406 1.00 15.72  ? 143 LEU G CD1 1 
ATOM   4612 C CD2 . LEU G 2 53  ? -22.285 37.037  -15.690 1.00 20.13  ? 143 LEU G CD2 1 
ATOM   4613 N N   . VAL G 2 54  ? -26.211 39.657  -13.868 1.00 13.89  ? 144 VAL G N   1 
ATOM   4614 C CA  . VAL G 2 54  ? -26.409 40.139  -12.510 1.00 13.00  ? 144 VAL G CA  1 
ATOM   4615 C C   . VAL G 2 54  ? -26.061 39.020  -11.537 1.00 19.05  ? 144 VAL G C   1 
ATOM   4616 O O   . VAL G 2 54  ? -26.637 37.928  -11.607 1.00 22.16  ? 144 VAL G O   1 
ATOM   4617 C CB  . VAL G 2 54  ? -27.861 40.673  -12.333 1.00 16.37  ? 144 VAL G CB  1 
ATOM   4618 C CG1 . VAL G 2 54  ? -28.169 41.007  -10.880 1.00 15.94  ? 144 VAL G CG1 1 
ATOM   4619 C CG2 . VAL G 2 54  ? -28.126 41.890  -13.229 1.00 16.18  ? 144 VAL G CG2 1 
ATOM   4620 N N   . PHE G 2 55  ? -25.106 39.287  -10.631 1.00 12.94  ? 145 PHE G N   1 
ATOM   4621 C CA  . PHE G 2 55  ? -24.677 38.303  -9.638  1.00 10.63  ? 145 PHE G CA  1 
ATOM   4622 C C   . PHE G 2 55  ? -24.183 39.007  -8.388  1.00 14.31  ? 145 PHE G C   1 
ATOM   4623 O O   . PHE G 2 55  ? -23.821 40.179  -8.449  1.00 14.85  ? 145 PHE G O   1 
ATOM   4624 C CB  . PHE G 2 55  ? -23.618 37.346  -10.209 1.00 11.01  ? 145 PHE G CB  1 
ATOM   4625 C CG  . PHE G 2 55  ? -22.314 37.958  -10.674 1.00 11.53  ? 145 PHE G CG  1 
ATOM   4626 C CD1 . PHE G 2 55  ? -22.163 38.407  -11.983 1.00 12.50  ? 145 PHE G CD1 1 
ATOM   4627 C CD2 . PHE G 2 55  ? -21.213 38.010  -9.832  1.00 11.33  ? 145 PHE G CD2 1 
ATOM   4628 C CE1 . PHE G 2 55  ? -20.957 38.963  -12.409 1.00 12.10  ? 145 PHE G CE1 1 
ATOM   4629 C CE2 . PHE G 2 55  ? -20.005 38.558  -10.269 1.00 11.56  ? 145 PHE G CE2 1 
ATOM   4630 C CZ  . PHE G 2 55  ? -19.889 39.034  -11.552 1.00 9.67   ? 145 PHE G CZ  1 
ATOM   4631 N N   . THR G 2 56  ? -24.226 38.309  -7.246  1.00 8.75   ? 146 THR G N   1 
ATOM   4632 C CA  . THR G 2 56  ? -23.771 38.810  -5.952  1.00 7.94   ? 146 THR G CA  1 
ATOM   4633 C C   . THR G 2 56  ? -22.296 38.437  -5.793  1.00 14.28  ? 146 THR G C   1 
ATOM   4634 O O   . THR G 2 56  ? -21.942 37.269  -5.920  1.00 16.38  ? 146 THR G O   1 
ATOM   4635 C CB  . THR G 2 56  ? -24.644 38.234  -4.828  1.00 12.73  ? 146 THR G CB  1 
ATOM   4636 O OG1 . THR G 2 56  ? -26.014 38.397  -5.175  1.00 19.74  ? 146 THR G OG1 1 
ATOM   4637 C CG2 . THR G 2 56  ? -24.384 38.886  -3.488  1.00 9.86   ? 146 THR G CG2 1 
ATOM   4638 N N   . LEU G 2 57  ? -21.445 39.428  -5.539  1.00 10.02  ? 147 LEU G N   1 
ATOM   4639 C CA  . LEU G 2 57  ? -20.010 39.265  -5.381  1.00 10.42  ? 147 LEU G CA  1 
ATOM   4640 C C   . LEU G 2 57  ? -19.665 38.411  -4.169  1.00 13.41  ? 147 LEU G C   1 
ATOM   4641 O O   . LEU G 2 57  ? -20.145 38.686  -3.055  1.00 14.30  ? 147 LEU G O   1 
ATOM   4642 C CB  . LEU G 2 57  ? -19.361 40.669  -5.247  1.00 10.85  ? 147 LEU G CB  1 
ATOM   4643 C CG  . LEU G 2 57  ? -17.939 40.820  -5.790  1.00 14.68  ? 147 LEU G CG  1 
ATOM   4644 C CD1 . LEU G 2 57  ? -17.926 40.754  -7.299  1.00 14.76  ? 147 LEU G CD1 1 
ATOM   4645 C CD2 . LEU G 2 57  ? -17.344 42.138  -5.351  1.00 15.20  ? 147 LEU G CD2 1 
ATOM   4646 N N   . GLY G 2 58  ? -18.849 37.390  -4.402  1.00 7.72   ? 148 GLY G N   1 
ATOM   4647 C CA  . GLY G 2 58  ? -18.385 36.464  -3.369  1.00 8.67   ? 148 GLY G CA  1 
ATOM   4648 C C   . GLY G 2 58  ? -19.296 35.287  -3.087  1.00 17.45  ? 148 GLY G C   1 
ATOM   4649 O O   . GLY G 2 58  ? -18.981 34.490  -2.203  1.00 16.92  ? 148 GLY G O   1 
ATOM   4650 N N   . ASP G 2 59  ? -20.438 35.172  -3.835  1.00 16.11  ? 149 ASP G N   1 
ATOM   4651 C CA  . ASP G 2 59  ? -21.454 34.125  -3.706  1.00 16.03  ? 149 ASP G CA  1 
ATOM   4652 C C   . ASP G 2 59  ? -21.253 32.950  -4.703  1.00 20.72  ? 149 ASP G C   1 
ATOM   4653 O O   . ASP G 2 59  ? -21.958 31.947  -4.585  1.00 19.97  ? 149 ASP G O   1 
ATOM   4654 C CB  . ASP G 2 59  ? -22.862 34.726  -3.917  1.00 17.13  ? 149 ASP G CB  1 
ATOM   4655 C CG  . ASP G 2 59  ? -23.560 35.234  -2.672  1.00 21.90  ? 149 ASP G CG  1 
ATOM   4656 O OD1 . ASP G 2 59  ? -22.903 35.314  -1.612  1.00 24.72  ? 149 ASP G OD1 1 
ATOM   4657 O OD2 . ASP G 2 59  ? -24.761 35.569  -2.759  1.00 24.94  ? 149 ASP G OD2 1 
ATOM   4658 N N   . CYS G 2 60  ? -20.330 33.096  -5.691  1.00 16.93  ? 150 CYS G N   1 
ATOM   4659 C CA  . CYS G 2 60  ? -19.996 32.127  -6.735  1.00 16.38  ? 150 CYS G CA  1 
ATOM   4660 C C   . CYS G 2 60  ? -21.246 31.641  -7.476  1.00 18.63  ? 150 CYS G C   1 
ATOM   4661 O O   . CYS G 2 60  ? -21.437 30.434  -7.660  1.00 16.74  ? 150 CYS G O   1 
ATOM   4662 C CB  . CYS G 2 60  ? -19.207 30.957  -6.162  1.00 17.74  ? 150 CYS G CB  1 
ATOM   4663 S SG  . CYS G 2 60  ? -17.625 31.418  -5.422  1.00 22.18  ? 150 CYS G SG  1 
ATOM   4664 N N   . ASP G 2 61  ? -22.073 32.604  -7.906  1.00 14.83  ? 151 ASP G N   1 
ATOM   4665 C CA  . ASP G 2 61  ? -23.313 32.400  -8.636  1.00 14.46  ? 151 ASP G CA  1 
ATOM   4666 C C   . ASP G 2 61  ? -23.076 31.821  -10.021 1.00 20.16  ? 151 ASP G C   1 
ATOM   4667 O O   . ASP G 2 61  ? -23.897 31.032  -10.495 1.00 19.54  ? 151 ASP G O   1 
ATOM   4668 C CB  . ASP G 2 61  ? -24.067 33.738  -8.792  1.00 15.24  ? 151 ASP G CB  1 
ATOM   4669 C CG  . ASP G 2 61  ? -24.817 34.248  -7.576  1.00 16.31  ? 151 ASP G CG  1 
ATOM   4670 O OD1 . ASP G 2 61  ? -24.969 33.476  -6.605  1.00 12.17  ? 151 ASP G OD1 1 
ATOM   4671 O OD2 . ASP G 2 61  ? -25.333 35.389  -7.635  1.00 22.72  ? 151 ASP G OD2 1 
ATOM   4672 N N   . VAL G 2 62  ? -22.019 32.270  -10.718 1.00 16.56  ? 152 VAL G N   1 
ATOM   4673 C CA  . VAL G 2 62  ? -21.800 31.842  -12.100 1.00 16.51  ? 152 VAL G CA  1 
ATOM   4674 C C   . VAL G 2 62  ? -20.515 31.010  -12.184 1.00 19.58  ? 152 VAL G C   1 
ATOM   4675 O O   . VAL G 2 62  ? -20.592 29.783  -12.314 1.00 19.46  ? 152 VAL G O   1 
ATOM   4676 C CB  . VAL G 2 62  ? -21.796 33.057  -13.089 1.00 20.86  ? 152 VAL G CB  1 
ATOM   4677 C CG1 . VAL G 2 62  ? -21.751 32.605  -14.552 1.00 19.99  ? 152 VAL G CG1 1 
ATOM   4678 C CG2 . VAL G 2 62  ? -22.993 33.977  -12.849 1.00 20.75  ? 152 VAL G CG2 1 
ATOM   4679 N N   . ILE G 2 63  ? -19.345 31.678  -12.134 1.00 16.23  ? 153 ILE G N   1 
ATOM   4680 C CA  . ILE G 2 63  ? -18.035 31.039  -12.182 1.00 15.17  ? 153 ILE G CA  1 
ATOM   4681 C C   . ILE G 2 63  ? -17.095 31.734  -11.205 1.00 17.75  ? 153 ILE G C   1 
ATOM   4682 O O   . ILE G 2 63  ? -17.235 32.924  -10.982 1.00 17.46  ? 153 ILE G O   1 
ATOM   4683 C CB  . ILE G 2 63  ? -17.433 30.966  -13.616 1.00 17.56  ? 153 ILE G CB  1 
ATOM   4684 C CG1 . ILE G 2 63  ? -17.507 32.308  -14.353 1.00 16.71  ? 153 ILE G CG1 1 
ATOM   4685 C CG2 . ILE G 2 63  ? -18.069 29.834  -14.442 1.00 18.14  ? 153 ILE G CG2 1 
ATOM   4686 C CD1 . ILE G 2 63  ? -16.597 32.398  -15.535 1.00 15.94  ? 153 ILE G CD1 1 
ATOM   4687 N N   . GLN G 2 64  ? -16.134 30.981  -10.628 1.00 12.18  ? 154 GLN G N   1 
ATOM   4688 C CA  . GLN G 2 64  ? -15.132 31.491  -9.711  1.00 11.08  ? 154 GLN G CA  1 
ATOM   4689 C C   . GLN G 2 64  ? -14.310 32.632  -10.312 1.00 12.92  ? 154 GLN G C   1 
ATOM   4690 O O   . GLN G 2 64  ? -13.943 33.540  -9.586  1.00 12.21  ? 154 GLN G O   1 
ATOM   4691 C CB  . GLN G 2 64  ? -14.188 30.365  -9.280  1.00 12.69  ? 154 GLN G CB  1 
ATOM   4692 C CG  . GLN G 2 64  ? -14.376 29.909  -7.850  1.00 30.17  ? 154 GLN G CG  1 
ATOM   4693 C CD  . GLN G 2 64  ? -13.344 28.880  -7.473  1.00 45.10  ? 154 GLN G CD  1 
ATOM   4694 O OE1 . GLN G 2 64  ? -13.579 27.670  -7.549  1.00 41.10  ? 154 GLN G OE1 1 
ATOM   4695 N NE2 . GLN G 2 64  ? -12.172 29.347  -7.074  1.00 28.55  ? 154 GLN G NE2 1 
ATOM   4696 N N   . ALA G 2 65  ? -13.982 32.559  -11.624 1.00 8.69   ? 155 ALA G N   1 
ATOM   4697 C CA  . ALA G 2 65  ? -13.212 33.540  -12.372 1.00 6.93   ? 155 ALA G CA  1 
ATOM   4698 C C   . ALA G 2 65  ? -13.776 34.945  -12.192 1.00 12.56  ? 155 ALA G C   1 
ATOM   4699 O O   . ALA G 2 65  ? -13.008 35.864  -11.943 1.00 12.60  ? 155 ALA G O   1 
ATOM   4700 C CB  . ALA G 2 65  ? -13.205 33.168  -13.847 1.00 7.14   ? 155 ALA G CB  1 
ATOM   4701 N N   . LEU G 2 66  ? -15.118 35.101  -12.241 1.00 9.27   ? 156 LEU G N   1 
ATOM   4702 C CA  . LEU G 2 66  ? -15.790 36.386  -12.045 1.00 9.01   ? 156 LEU G CA  1 
ATOM   4703 C C   . LEU G 2 66  ? -15.670 36.902  -10.609 1.00 16.55  ? 156 LEU G C   1 
ATOM   4704 O O   . LEU G 2 66  ? -15.401 38.085  -10.410 1.00 17.00  ? 156 LEU G O   1 
ATOM   4705 C CB  . LEU G 2 66  ? -17.266 36.279  -12.427 1.00 8.19   ? 156 LEU G CB  1 
ATOM   4706 C CG  . LEU G 2 66  ? -17.557 36.154  -13.931 1.00 10.99  ? 156 LEU G CG  1 
ATOM   4707 C CD1 . LEU G 2 66  ? -19.021 35.883  -14.170 1.00 10.00  ? 156 LEU G CD1 1 
ATOM   4708 C CD2 . LEU G 2 66  ? -17.097 37.386  -14.687 1.00 10.03  ? 156 LEU G CD2 1 
ATOM   4709 N N   . ASP G 2 67  ? -15.866 36.037  -9.613  1.00 14.45  ? 157 ASP G N   1 
ATOM   4710 C CA  . ASP G 2 67  ? -15.785 36.440  -8.191  1.00 14.72  ? 157 ASP G CA  1 
ATOM   4711 C C   . ASP G 2 67  ? -14.366 36.784  -7.752  1.00 19.57  ? 157 ASP G C   1 
ATOM   4712 O O   . ASP G 2 67  ? -14.200 37.460  -6.742  1.00 21.34  ? 157 ASP G O   1 
ATOM   4713 C CB  . ASP G 2 67  ? -16.319 35.329  -7.292  1.00 15.61  ? 157 ASP G CB  1 
ATOM   4714 C CG  . ASP G 2 67  ? -17.805 35.132  -7.416  1.00 24.05  ? 157 ASP G CG  1 
ATOM   4715 O OD1 . ASP G 2 67  ? -18.248 34.630  -8.473  1.00 25.76  ? 157 ASP G OD1 1 
ATOM   4716 O OD2 . ASP G 2 67  ? -18.527 35.475  -6.455  1.00 23.91  ? 157 ASP G OD2 1 
ATOM   4717 N N   . LEU G 2 68  ? -13.358 36.283  -8.476  1.00 14.74  ? 158 LEU G N   1 
ATOM   4718 C CA  . LEU G 2 68  ? -11.950 36.503  -8.170  1.00 14.81  ? 158 LEU G CA  1 
ATOM   4719 C C   . LEU G 2 68  ? -11.364 37.705  -8.919  1.00 17.72  ? 158 LEU G C   1 
ATOM   4720 O O   . LEU G 2 68  ? -10.436 38.328  -8.423  1.00 19.22  ? 158 LEU G O   1 
ATOM   4721 C CB  . LEU G 2 68  ? -11.132 35.250  -8.514  1.00 14.89  ? 158 LEU G CB  1 
ATOM   4722 C CG  . LEU G 2 68  ? -11.198 34.031  -7.571  1.00 19.55  ? 158 LEU G CG  1 
ATOM   4723 C CD1 . LEU G 2 68  ? -10.513 32.851  -8.201  1.00 19.22  ? 158 LEU G CD1 1 
ATOM   4724 C CD2 . LEU G 2 68  ? -10.632 34.339  -6.176  1.00 21.14  ? 158 LEU G CD2 1 
ATOM   4725 N N   . SER G 2 69  ? -11.915 38.055  -10.076 1.00 11.23  ? 159 SER G N   1 
ATOM   4726 C CA  . SER G 2 69  ? -11.394 39.142  -10.882 1.00 10.81  ? 159 SER G CA  1 
ATOM   4727 C C   . SER G 2 69  ? -12.187 40.459  -10.762 1.00 15.00  ? 159 SER G C   1 
ATOM   4728 O O   . SER G 2 69  ? -11.574 41.519  -10.769 1.00 15.13  ? 159 SER G O   1 
ATOM   4729 C CB  . SER G 2 69  ? -11.315 38.707  -12.343 1.00 12.08  ? 159 SER G CB  1 
ATOM   4730 O OG  . SER G 2 69  ? -12.593 38.372  -12.849 1.00 13.05  ? 159 SER G OG  1 
ATOM   4731 N N   . VAL G 2 70  ? -13.516 40.399  -10.624 1.00 12.82  ? 160 VAL G N   1 
ATOM   4732 C CA  . VAL G 2 70  ? -14.388 41.581  -10.559 1.00 12.57  ? 160 VAL G CA  1 
ATOM   4733 C C   . VAL G 2 70  ? -14.067 42.461  -9.298  1.00 17.74  ? 160 VAL G C   1 
ATOM   4734 O O   . VAL G 2 70  ? -14.114 43.701  -9.442  1.00 17.78  ? 160 VAL G O   1 
ATOM   4735 C CB  . VAL G 2 70  ? -15.897 41.206  -10.689 1.00 15.52  ? 160 VAL G CB  1 
ATOM   4736 C CG1 . VAL G 2 70  ? -16.812 42.379  -10.364 1.00 14.58  ? 160 VAL G CG1 1 
ATOM   4737 C CG2 . VAL G 2 70  ? -16.198 40.692  -12.104 1.00 15.50  ? 160 VAL G CG2 1 
ATOM   4738 N N   . PRO G 2 71  ? -13.675 41.920  -8.113  1.00 14.02  ? 161 PRO G N   1 
ATOM   4739 C CA  . PRO G 2 71  ? -13.357 42.818  -6.975  1.00 14.58  ? 161 PRO G CA  1 
ATOM   4740 C C   . PRO G 2 71  ? -12.112 43.681  -7.217  1.00 19.75  ? 161 PRO G C   1 
ATOM   4741 O O   . PRO G 2 71  ? -11.840 44.607  -6.445  1.00 18.27  ? 161 PRO G O   1 
ATOM   4742 C CB  . PRO G 2 71  ? -13.092 41.844  -5.811  1.00 16.59  ? 161 PRO G CB  1 
ATOM   4743 C CG  . PRO G 2 71  ? -13.678 40.568  -6.223  1.00 19.81  ? 161 PRO G CG  1 
ATOM   4744 C CD  . PRO G 2 71  ? -13.557 40.505  -7.704  1.00 15.18  ? 161 PRO G CD  1 
ATOM   4745 N N   . LEU G 2 72  ? -11.343 43.352  -8.277  1.00 18.44  ? 162 LEU G N   1 
ATOM   4746 C CA  . LEU G 2 72  ? -10.133 44.066  -8.697  1.00 18.54  ? 162 LEU G CA  1 
ATOM   4747 C C   . LEU G 2 72  ? -10.433 45.090  -9.797  1.00 19.11  ? 162 LEU G C   1 
ATOM   4748 O O   . LEU G 2 72  ? -9.498  45.656  -10.358 1.00 20.71  ? 162 LEU G O   1 
ATOM   4749 C CB  . LEU G 2 72  ? -9.063  43.075  -9.194  1.00 19.21  ? 162 LEU G CB  1 
ATOM   4750 C CG  . LEU G 2 72  ? -8.630  41.993  -8.225  1.00 25.23  ? 162 LEU G CG  1 
ATOM   4751 C CD1 . LEU G 2 72  ? -7.651  41.088  -8.866  1.00 25.70  ? 162 LEU G CD1 1 
ATOM   4752 C CD2 . LEU G 2 72  ? -8.053  42.570  -6.944  1.00 28.68  ? 162 LEU G CD2 1 
ATOM   4753 N N   . MET G 2 73  ? -11.729 45.334  -10.086 1.00 12.82  ? 163 MET G N   1 
ATOM   4754 C CA  . MET G 2 73  ? -12.181 46.288  -11.096 1.00 12.00  ? 163 MET G CA  1 
ATOM   4755 C C   . MET G 2 73  ? -12.948 47.397  -10.455 1.00 16.53  ? 163 MET G C   1 
ATOM   4756 O O   . MET G 2 73  ? -13.727 47.117  -9.545  1.00 18.32  ? 163 MET G O   1 
ATOM   4757 C CB  . MET G 2 73  ? -13.104 45.647  -12.163 1.00 13.94  ? 163 MET G CB  1 
ATOM   4758 C CG  . MET G 2 73  ? -12.561 44.432  -12.864 1.00 17.20  ? 163 MET G CG  1 
ATOM   4759 S SD  . MET G 2 73  ? -13.752 43.873  -14.112 1.00 20.74  ? 163 MET G SD  1 
ATOM   4760 C CE  . MET G 2 73  ? -13.507 45.166  -15.359 1.00 17.81  ? 163 MET G CE  1 
ATOM   4761 N N   . ASP G 2 74  ? -12.812 48.638  -10.976 1.00 10.48  ? 164 ASP G N   1 
ATOM   4762 C CA  . ASP G 2 74  ? -13.585 49.792  -10.519 1.00 10.24  ? 164 ASP G CA  1 
ATOM   4763 C C   . ASP G 2 74  ? -14.923 49.829  -11.240 1.00 18.08  ? 164 ASP G C   1 
ATOM   4764 O O   . ASP G 2 74  ? -15.013 49.310  -12.350 1.00 20.26  ? 164 ASP G O   1 
ATOM   4765 C CB  . ASP G 2 74  ? -12.817 51.094  -10.778 1.00 10.89  ? 164 ASP G CB  1 
ATOM   4766 C CG  . ASP G 2 74  ? -11.576 51.306  -9.945  1.00 16.52  ? 164 ASP G CG  1 
ATOM   4767 O OD1 . ASP G 2 74  ? -11.664 51.205  -8.706  1.00 18.19  ? 164 ASP G OD1 1 
ATOM   4768 O OD2 . ASP G 2 74  ? -10.570 51.731  -10.503 1.00 23.72  ? 164 ASP G OD2 1 
ATOM   4769 N N   . VAL G 2 75  ? -15.955 50.469  -10.657 1.00 16.51  ? 165 VAL G N   1 
ATOM   4770 C CA  . VAL G 2 75  ? -17.272 50.567  -11.307 1.00 16.04  ? 165 VAL G CA  1 
ATOM   4771 C C   . VAL G 2 75  ? -17.122 51.469  -12.534 1.00 18.86  ? 165 VAL G C   1 
ATOM   4772 O O   . VAL G 2 75  ? -16.818 52.663  -12.418 1.00 18.16  ? 165 VAL G O   1 
ATOM   4773 C CB  . VAL G 2 75  ? -18.411 51.010  -10.352 1.00 19.22  ? 165 VAL G CB  1 
ATOM   4774 C CG1 . VAL G 2 75  ? -19.765 51.008  -11.062 1.00 18.62  ? 165 VAL G CG1 1 
ATOM   4775 C CG2 . VAL G 2 75  ? -18.464 50.090  -9.135  1.00 18.96  ? 165 VAL G CG2 1 
ATOM   4776 N N   . GLY G 2 76  ? -17.247 50.841  -13.695 1.00 15.42  ? 166 GLY G N   1 
ATOM   4777 C CA  . GLY G 2 76  ? -17.123 51.499  -14.990 1.00 15.32  ? 166 GLY G CA  1 
ATOM   4778 C C   . GLY G 2 76  ? -15.959 50.948  -15.776 1.00 17.77  ? 166 GLY G C   1 
ATOM   4779 O O   . GLY G 2 76  ? -15.895 51.140  -16.991 1.00 17.36  ? 166 GLY G O   1 
ATOM   4780 N N   . GLU G 2 77  ? -15.050 50.233  -15.094 1.00 13.28  ? 167 GLU G N   1 
ATOM   4781 C CA  . GLU G 2 77  ? -13.872 49.631  -15.717 1.00 13.55  ? 167 GLU G CA  1 
ATOM   4782 C C   . GLU G 2 77  ? -14.221 48.497  -16.681 1.00 21.13  ? 167 GLU G C   1 
ATOM   4783 O O   . GLU G 2 77  ? -15.101 47.685  -16.375 1.00 22.78  ? 167 GLU G O   1 
ATOM   4784 C CB  . GLU G 2 77  ? -12.923 49.094  -14.650 1.00 14.27  ? 167 GLU G CB  1 
ATOM   4785 C CG  . GLU G 2 77  ? -11.578 48.623  -15.177 1.00 14.17  ? 167 GLU G CG  1 
ATOM   4786 C CD  . GLU G 2 77  ? -10.664 48.025  -14.132 1.00 17.39  ? 167 GLU G CD  1 
ATOM   4787 O OE1 . GLU G 2 77  ? -10.610 48.554  -12.999 1.00 10.56  ? 167 GLU G OE1 1 
ATOM   4788 O OE2 . GLU G 2 77  ? -9.950  47.057  -14.468 1.00 15.03  ? 167 GLU G OE2 1 
ATOM   4789 N N   . THR G 2 78  ? -13.524 48.454  -17.841 1.00 17.69  ? 168 THR G N   1 
ATOM   4790 C CA  . THR G 2 78  ? -13.565 47.360  -18.817 1.00 18.29  ? 168 THR G CA  1 
ATOM   4791 C C   . THR G 2 78  ? -12.207 46.667  -18.760 1.00 20.79  ? 168 THR G C   1 
ATOM   4792 O O   . THR G 2 78  ? -11.177 47.326  -18.857 1.00 20.97  ? 168 THR G O   1 
ATOM   4793 C CB  . THR G 2 78  ? -13.918 47.816  -20.240 1.00 31.55  ? 168 THR G CB  1 
ATOM   4794 O OG1 . THR G 2 78  ? -15.240 48.354  -20.256 1.00 28.99  ? 168 THR G OG1 1 
ATOM   4795 C CG2 . THR G 2 78  ? -13.831 46.663  -21.261 1.00 30.93  ? 168 THR G CG2 1 
ATOM   4796 N N   . ALA G 2 79  ? -12.200 45.360  -18.564 1.00 16.60  ? 169 ALA G N   1 
ATOM   4797 C CA  . ALA G 2 79  ? -10.965 44.571  -18.492 1.00 16.32  ? 169 ALA G CA  1 
ATOM   4798 C C   . ALA G 2 79  ? -11.124 43.277  -19.220 1.00 22.60  ? 169 ALA G C   1 
ATOM   4799 O O   . ALA G 2 79  ? -12.238 42.828  -19.483 1.00 22.57  ? 169 ALA G O   1 
ATOM   4800 C CB  . ALA G 2 79  ? -10.581 44.292  -17.049 1.00 16.78  ? 169 ALA G CB  1 
ATOM   4801 N N   . MET G 2 80  ? -9.995  42.679  -19.541 1.00 21.07  ? 170 MET G N   1 
ATOM   4802 C CA  . MET G 2 80  ? -9.879  41.398  -20.207 1.00 21.22  ? 170 MET G CA  1 
ATOM   4803 C C   . MET G 2 80  ? -9.327  40.433  -19.182 1.00 24.12  ? 170 MET G C   1 
ATOM   4804 O O   . MET G 2 80  ? -8.327  40.751  -18.543 1.00 22.88  ? 170 MET G O   1 
ATOM   4805 C CB  . MET G 2 80  ? -8.965  41.553  -21.434 1.00 24.26  ? 170 MET G CB  1 
ATOM   4806 C CG  . MET G 2 80  ? -8.656  40.284  -22.146 1.00 29.59  ? 170 MET G CG  1 
ATOM   4807 S SD  . MET G 2 80  ? -9.990  39.844  -23.256 1.00 36.25  ? 170 MET G SD  1 
ATOM   4808 C CE  . MET G 2 80  ? -10.441 38.443  -22.546 1.00 32.63  ? 170 MET G CE  1 
ATOM   4809 N N   . VAL G 2 81  ? -9.992  39.284  -18.969 1.00 21.67  ? 171 VAL G N   1 
ATOM   4810 C CA  . VAL G 2 81  ? -9.540  38.304  -17.979 1.00 20.69  ? 171 VAL G CA  1 
ATOM   4811 C C   . VAL G 2 81  ? -9.339  36.960  -18.658 1.00 24.13  ? 171 VAL G C   1 
ATOM   4812 O O   . VAL G 2 81  ? -10.252 36.466  -19.297 1.00 23.60  ? 171 VAL G O   1 
ATOM   4813 C CB  . VAL G 2 81  ? -10.492 38.208  -16.744 1.00 23.37  ? 171 VAL G CB  1 
ATOM   4814 C CG1 . VAL G 2 81  ? -10.168 37.010  -15.854 1.00 22.86  ? 171 VAL G CG1 1 
ATOM   4815 C CG2 . VAL G 2 81  ? -10.484 39.495  -15.930 1.00 22.82  ? 171 VAL G CG2 1 
ATOM   4816 N N   . THR G 2 82  ? -8.128  36.386  -18.564 1.00 20.49  ? 172 THR G N   1 
ATOM   4817 C CA  . THR G 2 82  ? -7.877  35.048  -19.125 1.00 19.21  ? 172 THR G CA  1 
ATOM   4818 C C   . THR G 2 82  ? -7.890  34.155  -17.931 1.00 19.77  ? 172 THR G C   1 
ATOM   4819 O O   . THR G 2 82  ? -7.189  34.450  -16.965 1.00 16.72  ? 172 THR G O   1 
ATOM   4820 C CB  . THR G 2 82  ? -6.587  34.936  -19.993 1.00 23.12  ? 172 THR G CB  1 
ATOM   4821 O OG1 . THR G 2 82  ? -5.453  35.340  -19.235 1.00 17.97  ? 172 THR G OG1 1 
ATOM   4822 C CG2 . THR G 2 82  ? -6.664  35.737  -21.285 1.00 20.48  ? 172 THR G CG2 1 
ATOM   4823 N N   . ALA G 2 83  ? -8.753  33.130  -17.945 1.00 17.06  ? 173 ALA G N   1 
ATOM   4824 C CA  . ALA G 2 83  ? -8.891  32.220  -16.820 1.00 17.35  ? 173 ALA G CA  1 
ATOM   4825 C C   . ALA G 2 83  ? -8.798  30.751  -17.237 1.00 20.75  ? 173 ALA G C   1 
ATOM   4826 O O   . ALA G 2 83  ? -9.375  30.359  -18.250 1.00 20.74  ? 173 ALA G O   1 
ATOM   4827 C CB  . ALA G 2 83  ? -10.224 32.474  -16.127 1.00 18.43  ? 173 ALA G CB  1 
ATOM   4828 N N   . ASP G 2 84  ? -8.111  29.934  -16.424 1.00 16.25  ? 174 ASP G N   1 
ATOM   4829 C CA  . ASP G 2 84  ? -8.006  28.490  -16.612 1.00 15.42  ? 174 ASP G CA  1 
ATOM   4830 C C   . ASP G 2 84  ? -9.364  27.856  -16.321 1.00 17.92  ? 174 ASP G C   1 
ATOM   4831 O O   . ASP G 2 84  ? -10.158 28.439  -15.585 1.00 17.90  ? 174 ASP G O   1 
ATOM   4832 C CB  . ASP G 2 84  ? -6.914  27.911  -15.701 1.00 17.65  ? 174 ASP G CB  1 
ATOM   4833 C CG  . ASP G 2 84  ? -6.624  26.444  -15.911 1.00 24.21  ? 174 ASP G CG  1 
ATOM   4834 O OD1 . ASP G 2 84  ? -7.047  25.638  -15.073 1.00 25.56  ? 174 ASP G OD1 1 
ATOM   4835 O OD2 . ASP G 2 84  ? -5.986  26.102  -16.925 1.00 32.74  ? 174 ASP G OD2 1 
ATOM   4836 N N   . SER G 2 85  ? -9.636  26.665  -16.897 1.00 14.85  ? 175 SER G N   1 
ATOM   4837 C CA  . SER G 2 85  ? -10.900 25.928  -16.747 1.00 13.37  ? 175 SER G CA  1 
ATOM   4838 C C   . SER G 2 85  ? -11.310 25.668  -15.306 1.00 15.36  ? 175 SER G C   1 
ATOM   4839 O O   . SER G 2 85  ? -12.501 25.626  -15.034 1.00 15.06  ? 175 SER G O   1 
ATOM   4840 C CB  . SER G 2 85  ? -10.823 24.595  -17.468 1.00 16.93  ? 175 SER G CB  1 
ATOM   4841 O OG  . SER G 2 85  ? -9.737  23.811  -17.011 1.00 23.89  ? 175 SER G OG  1 
ATOM   4842 N N   . LYS G 2 86  ? -10.348 25.519  -14.383 1.00 13.14  ? 176 LYS G N   1 
ATOM   4843 C CA  . LYS G 2 86  ? -10.629 25.242  -12.965 1.00 12.60  ? 176 LYS G CA  1 
ATOM   4844 C C   . LYS G 2 86  ? -11.374 26.395  -12.271 1.00 18.26  ? 176 LYS G C   1 
ATOM   4845 O O   . LYS G 2 86  ? -12.064 26.153  -11.283 1.00 20.30  ? 176 LYS G O   1 
ATOM   4846 C CB  . LYS G 2 86  ? -9.340  24.862  -12.198 1.00 14.60  ? 176 LYS G CB  1 
ATOM   4847 C CG  . LYS G 2 86  ? -8.285  25.944  -12.047 1.00 18.85  ? 176 LYS G CG  1 
ATOM   4848 C CD  . LYS G 2 86  ? -7.544  25.803  -10.704 1.00 24.22  ? 176 LYS G CD  1 
ATOM   4849 C CE  . LYS G 2 86  ? -6.222  25.118  -10.766 1.00 13.08  ? 176 LYS G CE  1 
ATOM   4850 N NZ  . LYS G 2 86  ? -5.418  25.444  -9.562  1.00 29.26  ? 176 LYS G NZ  1 
ATOM   4851 N N   . TYR G 2 87  ? -11.275 27.628  -12.799 1.00 16.92  ? 177 TYR G N   1 
ATOM   4852 C CA  . TYR G 2 87  ? -11.995 28.785  -12.251 1.00 16.10  ? 177 TYR G CA  1 
ATOM   4853 C C   . TYR G 2 87  ? -13.250 29.070  -13.076 1.00 23.16  ? 177 TYR G C   1 
ATOM   4854 O O   . TYR G 2 87  ? -14.003 29.988  -12.755 1.00 23.42  ? 177 TYR G O   1 
ATOM   4855 C CB  . TYR G 2 87  ? -11.082 30.029  -12.193 1.00 14.78  ? 177 TYR G CB  1 
ATOM   4856 C CG  . TYR G 2 87  ? -9.796  29.775  -11.449 1.00 14.69  ? 177 TYR G CG  1 
ATOM   4857 C CD1 . TYR G 2 87  ? -9.795  29.532  -10.077 1.00 15.61  ? 177 TYR G CD1 1 
ATOM   4858 C CD2 . TYR G 2 87  ? -8.577  29.743  -12.116 1.00 14.83  ? 177 TYR G CD2 1 
ATOM   4859 C CE1 . TYR G 2 87  ? -8.610  29.268  -9.392  1.00 15.49  ? 177 TYR G CE1 1 
ATOM   4860 C CE2 . TYR G 2 87  ? -7.386  29.480  -11.441 1.00 15.03  ? 177 TYR G CE2 1 
ATOM   4861 C CZ  . TYR G 2 87  ? -7.408  29.225  -10.084 1.00 23.32  ? 177 TYR G CZ  1 
ATOM   4862 O OH  . TYR G 2 87  ? -6.224  28.966  -9.425  1.00 30.88  ? 177 TYR G OH  1 
ATOM   4863 N N   . CYS G 2 88  ? -13.483 28.255  -14.117 1.00 20.97  ? 178 CYS G N   1 
ATOM   4864 C CA  . CYS G 2 88  ? -14.576 28.403  -15.063 1.00 20.54  ? 178 CYS G CA  1 
ATOM   4865 C C   . CYS G 2 88  ? -15.536 27.201  -15.046 1.00 27.15  ? 178 CYS G C   1 
ATOM   4866 O O   . CYS G 2 88  ? -16.195 26.970  -14.035 1.00 26.73  ? 178 CYS G O   1 
ATOM   4867 C CB  . CYS G 2 88  ? -14.018 28.646  -16.461 1.00 20.36  ? 178 CYS G CB  1 
ATOM   4868 S SG  . CYS G 2 88  ? -13.046 30.158  -16.613 1.00 24.69  ? 178 CYS G SG  1 
ATOM   4869 N N   . TYR G 2 89  ? -15.638 26.461  -16.169 1.00 25.43  ? 179 TYR G N   1 
ATOM   4870 C CA  . TYR G 2 89  ? -16.589 25.361  -16.322 1.00 25.72  ? 179 TYR G CA  1 
ATOM   4871 C C   . TYR G 2 89  ? -15.947 23.968  -16.129 1.00 31.65  ? 179 TYR G C   1 
ATOM   4872 O O   . TYR G 2 89  ? -16.623 22.954  -16.278 1.00 32.37  ? 179 TYR G O   1 
ATOM   4873 C CB  . TYR G 2 89  ? -17.336 25.490  -17.665 1.00 26.22  ? 179 TYR G CB  1 
ATOM   4874 C CG  . TYR G 2 89  ? -18.172 26.755  -17.694 1.00 28.65  ? 179 TYR G CG  1 
ATOM   4875 C CD1 . TYR G 2 89  ? -19.377 26.836  -16.996 1.00 31.12  ? 179 TYR G CD1 1 
ATOM   4876 C CD2 . TYR G 2 89  ? -17.691 27.916  -18.291 1.00 29.49  ? 179 TYR G CD2 1 
ATOM   4877 C CE1 . TYR G 2 89  ? -20.112 28.021  -16.951 1.00 32.90  ? 179 TYR G CE1 1 
ATOM   4878 C CE2 . TYR G 2 89  ? -18.410 29.111  -18.241 1.00 30.16  ? 179 TYR G CE2 1 
ATOM   4879 C CZ  . TYR G 2 89  ? -19.630 29.154  -17.586 1.00 38.78  ? 179 TYR G CZ  1 
ATOM   4880 O OH  . TYR G 2 89  ? -20.351 30.323  -17.557 1.00 38.52  ? 179 TYR G OH  1 
ATOM   4881 N N   . GLY G 2 90  ? -14.701 23.949  -15.674 1.00 28.67  ? 180 GLY G N   1 
ATOM   4882 C CA  . GLY G 2 90  ? -13.959 22.749  -15.295 1.00 28.47  ? 180 GLY G CA  1 
ATOM   4883 C C   . GLY G 2 90  ? -13.865 21.557  -16.235 1.00 31.51  ? 180 GLY G C   1 
ATOM   4884 O O   . GLY G 2 90  ? -13.939 21.702  -17.461 1.00 28.21  ? 180 GLY G O   1 
ATOM   4885 N N   . PRO G 2 91  ? -13.660 20.348  -15.646 1.00 30.32  ? 181 PRO G N   1 
ATOM   4886 C CA  . PRO G 2 91  ? -13.449 19.133  -16.465 1.00 31.28  ? 181 PRO G CA  1 
ATOM   4887 C C   . PRO G 2 91  ? -14.640 18.661  -17.292 1.00 36.08  ? 181 PRO G C   1 
ATOM   4888 O O   . PRO G 2 91  ? -14.429 17.887  -18.214 1.00 37.06  ? 181 PRO G O   1 
ATOM   4889 C CB  . PRO G 2 91  ? -13.099 18.056  -15.431 1.00 33.07  ? 181 PRO G CB  1 
ATOM   4890 C CG  . PRO G 2 91  ? -12.709 18.794  -14.205 1.00 36.97  ? 181 PRO G CG  1 
ATOM   4891 C CD  . PRO G 2 91  ? -13.520 20.045  -14.211 1.00 31.91  ? 181 PRO G CD  1 
ATOM   4892 N N   . GLN G 2 92  ? -15.867 19.074  -16.966 1.00 33.13  ? 182 GLN G N   1 
ATOM   4893 C CA  . GLN G 2 92  ? -17.037 18.618  -17.716 1.00 32.95  ? 182 GLN G CA  1 
ATOM   4894 C C   . GLN G 2 92  ? -17.585 19.671  -18.691 1.00 34.48  ? 182 GLN G C   1 
ATOM   4895 O O   . GLN G 2 92  ? -18.232 19.282  -19.663 1.00 34.42  ? 182 GLN G O   1 
ATOM   4896 C CB  . GLN G 2 92  ? -18.145 18.132  -16.772 1.00 34.59  ? 182 GLN G CB  1 
ATOM   4897 C CG  . GLN G 2 92  ? -17.751 16.858  -16.026 1.00 52.44  ? 182 GLN G CG  1 
ATOM   4898 C CD  . GLN G 2 92  ? -18.886 15.924  -15.732 1.00 71.99  ? 182 GLN G CD  1 
ATOM   4899 O OE1 . GLN G 2 92  ? -20.032 16.129  -16.146 1.00 67.28  ? 182 GLN G OE1 1 
ATOM   4900 N NE2 . GLN G 2 92  ? -18.588 14.885  -14.971 1.00 62.79  ? 182 GLN G NE2 1 
ATOM   4901 N N   . GLY G 2 93  ? -17.338 20.964  -18.439 1.00 28.63  ? 183 GLY G N   1 
ATOM   4902 C CA  . GLY G 2 93  ? -17.827 22.063  -19.281 1.00 27.11  ? 183 GLY G CA  1 
ATOM   4903 C C   . GLY G 2 93  ? -19.290 22.377  -19.042 1.00 29.97  ? 183 GLY G C   1 
ATOM   4904 O O   . GLY G 2 93  ? -19.809 21.995  -18.002 1.00 28.33  ? 183 GLY G O   1 
ATOM   4905 N N   . ARG G 2 94  ? -19.992 23.064  -19.984 1.00 29.31  ? 184 ARG G N   1 
ATOM   4906 C CA  . ARG G 2 94  ? -21.425 23.379  -19.797 1.00 30.40  ? 184 ARG G CA  1 
ATOM   4907 C C   . ARG G 2 94  ? -22.277 23.132  -21.054 1.00 36.20  ? 184 ARG G C   1 
ATOM   4908 O O   . ARG G 2 94  ? -21.739 23.198  -22.159 1.00 33.59  ? 184 ARG G O   1 
ATOM   4909 C CB  . ARG G 2 94  ? -21.629 24.839  -19.333 1.00 30.35  ? 184 ARG G CB  1 
ATOM   4910 C CG  . ARG G 2 94  ? -22.582 24.934  -18.139 1.00 37.29  ? 184 ARG G CG  1 
ATOM   4911 C CD  . ARG G 2 94  ? -23.169 26.313  -17.914 1.00 39.24  ? 184 ARG G CD  1 
ATOM   4912 N N   . SER G 2 95  ? -23.626 22.898  -20.857 1.00 36.53  ? 185 SER G N   1 
ATOM   4913 C CA  . SER G 2 95  ? -24.688 22.655  -21.858 1.00 38.10  ? 185 SER G CA  1 
ATOM   4914 C C   . SER G 2 95  ? -24.842 23.875  -22.789 1.00 44.77  ? 185 SER G C   1 
ATOM   4915 O O   . SER G 2 95  ? -24.749 23.620  -23.991 1.00 46.25  ? 185 SER G O   1 
ATOM   4916 C CB  . SER G 2 95  ? -26.013 22.267  -21.201 1.00 43.94  ? 185 SER G CB  1 
ATOM   4917 O OG  . SER G 2 95  ? -26.220 20.864  -21.223 1.00 56.08  ? 185 SER G OG  1 
ATOM   4918 N N   . PRO G 2 96  ? -24.989 25.175  -22.348 1.00 41.92  ? 186 PRO G N   1 
ATOM   4919 C CA  . PRO G 2 96  ? -24.851 26.296  -23.315 1.00 41.73  ? 186 PRO G CA  1 
ATOM   4920 C C   . PRO G 2 96  ? -23.341 26.349  -23.618 1.00 44.15  ? 186 PRO G C   1 
ATOM   4921 O O   . PRO G 2 96  ? -22.578 27.133  -23.068 1.00 44.81  ? 186 PRO G O   1 
ATOM   4922 C CB  . PRO G 2 96  ? -25.396 27.523  -22.549 1.00 43.32  ? 186 PRO G CB  1 
ATOM   4923 C CG  . PRO G 2 96  ? -25.774 27.024  -21.169 1.00 48.01  ? 186 PRO G CG  1 
ATOM   4924 C CD  . PRO G 2 96  ? -25.093 25.702  -20.970 1.00 43.88  ? 186 PRO G CD  1 
ATOM   4925 N N   . TYR G 2 97  ? -22.962 25.474  -24.544 1.00 38.21  ? 187 TYR G N   1 
ATOM   4926 C CA  . TYR G 2 97  ? -21.749 24.782  -24.901 1.00 36.82  ? 187 TYR G CA  1 
ATOM   4927 C C   . TYR G 2 97  ? -20.425 25.528  -24.727 1.00 40.33  ? 187 TYR G C   1 
ATOM   4928 O O   . TYR G 2 97  ? -20.102 26.505  -25.404 1.00 42.09  ? 187 TYR G O   1 
ATOM   4929 C CB  . TYR G 2 97  ? -21.769 24.179  -26.313 1.00 37.05  ? 187 TYR G CB  1 
ATOM   4930 C CG  . TYR G 2 97  ? -20.864 22.966  -26.352 1.00 37.09  ? 187 TYR G CG  1 
ATOM   4931 C CD1 . TYR G 2 97  ? -21.173 21.820  -25.621 1.00 38.51  ? 187 TYR G CD1 1 
ATOM   4932 C CD2 . TYR G 2 97  ? -19.620 23.024  -26.968 1.00 37.58  ? 187 TYR G CD2 1 
ATOM   4933 C CE1 . TYR G 2 97  ? -20.298 20.744  -25.555 1.00 37.99  ? 187 TYR G CE1 1 
ATOM   4934 C CE2 . TYR G 2 97  ? -18.736 21.950  -26.914 1.00 38.40  ? 187 TYR G CE2 1 
ATOM   4935 C CZ  . TYR G 2 97  ? -19.087 20.806  -26.214 1.00 45.64  ? 187 TYR G CZ  1 
ATOM   4936 O OH  . TYR G 2 97  ? -18.232 19.736  -26.143 1.00 47.56  ? 187 TYR G OH  1 
ATOM   4937 N N   . ILE G 2 98  ? -19.625 24.905  -23.851 1.00 33.91  ? 188 ILE G N   1 
ATOM   4938 C CA  . ILE G 2 98  ? -18.230 25.125  -23.488 1.00 31.84  ? 188 ILE G CA  1 
ATOM   4939 C C   . ILE G 2 98  ? -17.610 23.705  -23.343 1.00 30.68  ? 188 ILE G C   1 
ATOM   4940 O O   . ILE G 2 98  ? -18.104 22.893  -22.540 1.00 27.54  ? 188 ILE G O   1 
ATOM   4941 C CB  . ILE G 2 98  ? -18.012 26.019  -22.231 1.00 34.66  ? 188 ILE G CB  1 
ATOM   4942 C CG1 . ILE G 2 98  ? -18.529 27.441  -22.439 1.00 35.01  ? 188 ILE G CG1 1 
ATOM   4943 C CG2 . ILE G 2 98  ? -16.546 26.055  -21.804 1.00 34.67  ? 188 ILE G CG2 1 
ATOM   4944 C CD1 . ILE G 2 98  ? -19.606 27.784  -21.492 1.00 43.06  ? 188 ILE G CD1 1 
ATOM   4945 N N   . PRO G 2 99  ? -16.551 23.389  -24.131 1.00 25.69  ? 189 PRO G N   1 
ATOM   4946 C CA  . PRO G 2 99  ? -15.919 22.066  -24.019 1.00 24.38  ? 189 PRO G CA  1 
ATOM   4947 C C   . PRO G 2 99  ? -15.239 21.839  -22.665 1.00 27.35  ? 189 PRO G C   1 
ATOM   4948 O O   . PRO G 2 99  ? -14.945 22.813  -21.974 1.00 28.04  ? 189 PRO G O   1 
ATOM   4949 C CB  . PRO G 2 99  ? -14.862 22.086  -25.136 1.00 26.39  ? 189 PRO G CB  1 
ATOM   4950 C CG  . PRO G 2 99  ? -15.235 23.252  -26.037 1.00 31.14  ? 189 PRO G CG  1 
ATOM   4951 C CD  . PRO G 2 99  ? -15.869 24.233  -25.138 1.00 27.15  ? 189 PRO G CD  1 
ATOM   4952 N N   . PRO G 2 100 ? -14.984 20.570  -22.248 1.00 20.32  ? 190 PRO G N   1 
ATOM   4953 C CA  . PRO G 2 100 ? -14.235 20.337  -20.996 1.00 18.27  ? 190 PRO G CA  1 
ATOM   4954 C C   . PRO G 2 100 ? -12.835 20.914  -21.073 1.00 22.85  ? 190 PRO G C   1 
ATOM   4955 O O   . PRO G 2 100 ? -12.288 21.058  -22.169 1.00 22.64  ? 190 PRO G O   1 
ATOM   4956 C CB  . PRO G 2 100 ? -14.151 18.815  -20.925 1.00 19.73  ? 190 PRO G CB  1 
ATOM   4957 C CG  . PRO G 2 100 ? -15.301 18.341  -21.756 1.00 25.17  ? 190 PRO G CG  1 
ATOM   4958 C CD  . PRO G 2 100 ? -15.310 19.292  -22.906 1.00 20.55  ? 190 PRO G CD  1 
ATOM   4959 N N   . HIS G 2 101 ? -12.251 21.221  -19.913 1.00 21.03  ? 191 HIS G N   1 
ATOM   4960 C CA  . HIS G 2 101 ? -10.932 21.804  -19.713 1.00 22.62  ? 191 HIS G CA  1 
ATOM   4961 C C   . HIS G 2 101 ? -10.674 23.014  -20.655 1.00 25.00  ? 191 HIS G C   1 
ATOM   4962 O O   . HIS G 2 101 ? -9.566  23.169  -21.164 1.00 26.34  ? 191 HIS G O   1 
ATOM   4963 C CB  . HIS G 2 101 ? -9.840  20.735  -19.862 1.00 25.16  ? 191 HIS G CB  1 
ATOM   4964 C CG  . HIS G 2 101 ? -9.951  19.634  -18.856 1.00 29.20  ? 191 HIS G CG  1 
ATOM   4965 N ND1 . HIS G 2 101 ? -9.396  19.756  -17.596 1.00 31.54  ? 191 HIS G ND1 1 
ATOM   4966 C CD2 . HIS G 2 101 ? -10.592 18.453  -18.937 1.00 31.50  ? 191 HIS G CD2 1 
ATOM   4967 C CE1 . HIS G 2 101 ? -9.674  18.625  -16.967 1.00 31.36  ? 191 HIS G CE1 1 
ATOM   4968 N NE2 . HIS G 2 101 ? -10.401 17.817  -17.727 1.00 31.84  ? 191 HIS G NE2 1 
ATOM   4969 N N   . ALA G 2 102 ? -11.705 23.862  -20.880 1.00 18.86  ? 192 ALA G N   1 
ATOM   4970 C CA  . ALA G 2 102 ? -11.616 25.029  -21.765 1.00 18.11  ? 192 ALA G CA  1 
ATOM   4971 C C   . ALA G 2 102 ? -11.240 26.299  -21.010 1.00 23.20  ? 192 ALA G C   1 
ATOM   4972 O O   . ALA G 2 102 ? -11.982 26.750  -20.124 1.00 22.00  ? 192 ALA G O   1 
ATOM   4973 C CB  . ALA G 2 102 ? -12.933 25.238  -22.504 1.00 18.40  ? 192 ALA G CB  1 
ATOM   4974 N N   . ALA G 2 103 ? -10.053 26.843  -21.330 1.00 21.84  ? 193 ALA G N   1 
ATOM   4975 C CA  . ALA G 2 103 ? -9.563  28.109  -20.778 1.00 22.38  ? 193 ALA G CA  1 
ATOM   4976 C C   . ALA G 2 103 ? -10.374 29.217  -21.428 1.00 27.34  ? 193 ALA G C   1 
ATOM   4977 O O   . ALA G 2 103 ? -10.636 29.136  -22.626 1.00 26.74  ? 193 ALA G O   1 
ATOM   4978 C CB  . ALA G 2 103 ? -8.076  28.269  -21.066 1.00 23.37  ? 193 ALA G CB  1 
ATOM   4979 N N   . LEU G 2 104 ? -10.816 30.211  -20.662 1.00 25.29  ? 194 LEU G N   1 
ATOM   4980 C CA  . LEU G 2 104 ? -11.674 31.256  -21.207 1.00 24.96  ? 194 LEU G CA  1 
ATOM   4981 C C   . LEU G 2 104 ? -11.045 32.644  -21.180 1.00 30.79  ? 194 LEU G C   1 
ATOM   4982 O O   . LEU G 2 104 ? -10.241 32.960  -20.311 1.00 29.03  ? 194 LEU G O   1 
ATOM   4983 C CB  . LEU G 2 104 ? -13.015 31.296  -20.442 1.00 24.80  ? 194 LEU G CB  1 
ATOM   4984 C CG  . LEU G 2 104 ? -13.961 30.066  -20.505 1.00 29.30  ? 194 LEU G CG  1 
ATOM   4985 C CD1 . LEU G 2 104 ? -15.154 30.280  -19.629 1.00 30.26  ? 194 LEU G CD1 1 
ATOM   4986 C CD2 . LEU G 2 104 ? -14.466 29.781  -21.898 1.00 31.85  ? 194 LEU G CD2 1 
ATOM   4987 N N   . CYS G 2 105 ? -11.457 33.483  -22.141 1.00 30.39  ? 195 CYS G N   1 
ATOM   4988 C CA  . CYS G 2 105 ? -11.130 34.903  -22.245 1.00 30.34  ? 195 CYS G CA  1 
ATOM   4989 C C   . CYS G 2 105 ? -12.426 35.637  -22.024 1.00 27.10  ? 195 CYS G C   1 
ATOM   4990 O O   . CYS G 2 105 ? -13.355 35.519  -22.822 1.00 25.40  ? 195 CYS G O   1 
ATOM   4991 C CB  . CYS G 2 105 ? -10.496 35.260  -23.590 1.00 32.69  ? 195 CYS G CB  1 
ATOM   4992 S SG  . CYS G 2 105 ? -8.977  34.354  -23.969 1.00 37.91  ? 195 CYS G SG  1 
ATOM   4993 N N   . LEU G 2 106 ? -12.511 36.341  -20.913 1.00 21.06  ? 196 LEU G N   1 
ATOM   4994 C CA  . LEU G 2 106 ? -13.702 37.058  -20.494 1.00 19.70  ? 196 LEU G CA  1 
ATOM   4995 C C   . LEU G 2 106 ? -13.476 38.559  -20.621 1.00 22.66  ? 196 LEU G C   1 
ATOM   4996 O O   . LEU G 2 106 ? -12.628 39.108  -19.919 1.00 21.54  ? 196 LEU G O   1 
ATOM   4997 C CB  . LEU G 2 106 ? -14.055 36.691  -19.028 1.00 18.99  ? 196 LEU G CB  1 
ATOM   4998 C CG  . LEU G 2 106 ? -14.196 35.205  -18.604 1.00 23.16  ? 196 LEU G CG  1 
ATOM   4999 C CD1 . LEU G 2 106 ? -12.875 34.454  -18.686 1.00 25.44  ? 196 LEU G CD1 1 
ATOM   5000 C CD2 . LEU G 2 106 ? -14.426 35.115  -17.140 1.00 22.69  ? 196 LEU G CD2 1 
ATOM   5001 N N   . GLU G 2 107 ? -14.161 39.214  -21.557 1.00 18.90  ? 197 GLU G N   1 
ATOM   5002 C CA  . GLU G 2 107 ? -14.053 40.663  -21.703 1.00 18.12  ? 197 GLU G CA  1 
ATOM   5003 C C   . GLU G 2 107 ? -15.194 41.222  -20.901 1.00 20.72  ? 197 GLU G C   1 
ATOM   5004 O O   . GLU G 2 107 ? -16.338 41.075  -21.318 1.00 21.85  ? 197 GLU G O   1 
ATOM   5005 C CB  . GLU G 2 107 ? -14.124 41.060  -23.179 1.00 19.33  ? 197 GLU G CB  1 
ATOM   5006 C CG  . GLU G 2 107 ? -13.462 42.390  -23.493 1.00 23.38  ? 197 GLU G CG  1 
ATOM   5007 C CD  . GLU G 2 107 ? -13.427 42.733  -24.971 1.00 43.93  ? 197 GLU G CD  1 
ATOM   5008 O OE1 . GLU G 2 107 ? -13.920 43.825  -25.335 1.00 42.53  ? 197 GLU G OE1 1 
ATOM   5009 O OE2 . GLU G 2 107 ? -12.928 41.905  -25.769 1.00 32.38  ? 197 GLU G OE2 1 
ATOM   5010 N N   . VAL G 2 108 ? -14.919 41.761  -19.713 1.00 15.41  ? 198 VAL G N   1 
ATOM   5011 C CA  . VAL G 2 108 ? -15.971 42.212  -18.792 1.00 14.68  ? 198 VAL G CA  1 
ATOM   5012 C C   . VAL G 2 108 ? -15.904 43.748  -18.526 1.00 18.29  ? 198 VAL G C   1 
ATOM   5013 O O   . VAL G 2 108 ? -14.815 44.319  -18.436 1.00 18.91  ? 198 VAL G O   1 
ATOM   5014 C CB  . VAL G 2 108 ? -15.921 41.354  -17.486 1.00 18.60  ? 198 VAL G CB  1 
ATOM   5015 C CG1 . VAL G 2 108 ? -14.503 41.185  -16.955 1.00 18.59  ? 198 VAL G CG1 1 
ATOM   5016 C CG2 . VAL G 2 108 ? -16.867 41.849  -16.409 1.00 18.07  ? 198 VAL G CG2 1 
ATOM   5017 N N   . THR G 2 109 ? -17.095 44.391  -18.453 1.00 10.54  ? 199 THR G N   1 
ATOM   5018 C CA  . THR G 2 109 ? -17.328 45.807  -18.205 1.00 9.95   ? 199 THR G CA  1 
ATOM   5019 C C   . THR G 2 109 ? -18.188 45.866  -16.967 1.00 14.49  ? 199 THR G C   1 
ATOM   5020 O O   . THR G 2 109 ? -19.315 45.397  -17.009 1.00 15.54  ? 199 THR G O   1 
ATOM   5021 C CB  . THR G 2 109 ? -18.005 46.488  -19.445 1.00 14.49  ? 199 THR G CB  1 
ATOM   5022 O OG1 . THR G 2 109 ? -17.132 46.453  -20.563 1.00 20.78  ? 199 THR G OG1 1 
ATOM   5023 C CG2 . THR G 2 109 ? -18.410 47.936  -19.198 1.00 15.52  ? 199 THR G CG2 1 
ATOM   5024 N N   . LEU G 2 110 ? -17.652 46.363  -15.860 1.00 10.64  ? 200 LEU G N   1 
ATOM   5025 C CA  . LEU G 2 110 ? -18.412 46.473  -14.626 1.00 10.01  ? 200 LEU G CA  1 
ATOM   5026 C C   . LEU G 2 110 ? -19.306 47.676  -14.758 1.00 14.75  ? 200 LEU G C   1 
ATOM   5027 O O   . LEU G 2 110 ? -18.815 48.802  -14.850 1.00 12.76  ? 200 LEU G O   1 
ATOM   5028 C CB  . LEU G 2 110 ? -17.452 46.595  -13.430 1.00 9.91   ? 200 LEU G CB  1 
ATOM   5029 C CG  . LEU G 2 110 ? -18.082 46.692  -12.051 1.00 13.30  ? 200 LEU G CG  1 
ATOM   5030 C CD1 . LEU G 2 110 ? -19.080 45.567  -11.811 1.00 13.92  ? 200 LEU G CD1 1 
ATOM   5031 C CD2 . LEU G 2 110 ? -17.033 46.699  -11.004 1.00 13.31  ? 200 LEU G CD2 1 
ATOM   5032 N N   . LYS G 2 111 ? -20.613 47.435  -14.880 1.00 13.23  ? 201 LYS G N   1 
ATOM   5033 C CA  . LYS G 2 111 ? -21.576 48.515  -15.113 1.00 12.35  ? 201 LYS G CA  1 
ATOM   5034 C C   . LYS G 2 111 ? -22.005 49.177  -13.823 1.00 14.88  ? 201 LYS G C   1 
ATOM   5035 O O   . LYS G 2 111 ? -21.850 50.382  -13.690 1.00 14.95  ? 201 LYS G O   1 
ATOM   5036 C CB  . LYS G 2 111 ? -22.802 47.988  -15.894 1.00 15.13  ? 201 LYS G CB  1 
ATOM   5037 C CG  . LYS G 2 111 ? -22.467 47.504  -17.314 1.00 33.90  ? 201 LYS G CG  1 
ATOM   5038 C CD  . LYS G 2 111 ? -23.620 46.726  -17.948 1.00 43.37  ? 201 LYS G CD  1 
ATOM   5039 C CE  . LYS G 2 111 ? -24.330 47.532  -19.007 1.00 54.85  ? 201 LYS G CE  1 
ATOM   5040 N NZ  . LYS G 2 111 ? -25.438 46.763  -19.632 1.00 62.65  ? 201 LYS G NZ  1 
ATOM   5041 N N   . THR G 2 112 ? -22.583 48.417  -12.890 1.00 12.79  ? 202 THR G N   1 
ATOM   5042 C CA  . THR G 2 112 ? -23.052 48.940  -11.612 1.00 12.84  ? 202 THR G CA  1 
ATOM   5043 C C   . THR G 2 112 ? -22.694 48.011  -10.468 1.00 19.19  ? 202 THR G C   1 
ATOM   5044 O O   . THR G 2 112 ? -22.396 46.834  -10.692 1.00 18.61  ? 202 THR G O   1 
ATOM   5045 C CB  . THR G 2 112 ? -24.581 49.181  -11.618 1.00 20.31  ? 202 THR G CB  1 
ATOM   5046 O OG1 . THR G 2 112 ? -25.272 48.007  -12.016 1.00 24.85  ? 202 THR G OG1 1 
ATOM   5047 C CG2 . THR G 2 112 ? -25.003 50.381  -12.458 1.00 19.99  ? 202 THR G CG2 1 
ATOM   5048 N N   . ALA G 2 113 ? -22.722 48.552  -9.235  1.00 15.40  ? 203 ALA G N   1 
ATOM   5049 C CA  . ALA G 2 113 ? -22.497 47.821  -7.995  1.00 14.69  ? 203 ALA G CA  1 
ATOM   5050 C C   . ALA G 2 113 ? -23.339 48.490  -6.916  1.00 18.00  ? 203 ALA G C   1 
ATOM   5051 O O   . ALA G 2 113 ? -23.081 49.641  -6.559  1.00 16.94  ? 203 ALA G O   1 
ATOM   5052 C CB  . ALA G 2 113 ? -21.020 47.806  -7.628  1.00 15.00  ? 203 ALA G CB  1 
ATOM   5053 N N   . VAL G 2 114 ? -24.417 47.805  -6.482  1.00 14.99  ? 204 VAL G N   1 
ATOM   5054 C CA  . VAL G 2 114 ? -25.332 48.327  -5.470  1.00 14.84  ? 204 VAL G CA  1 
ATOM   5055 C C   . VAL G 2 114 ? -25.223 47.456  -4.243  1.00 20.25  ? 204 VAL G C   1 
ATOM   5056 O O   . VAL G 2 114 ? -24.879 46.273  -4.364  1.00 20.38  ? 204 VAL G O   1 
ATOM   5057 C CB  . VAL G 2 114 ? -26.793 48.464  -5.978  1.00 18.99  ? 204 VAL G CB  1 
ATOM   5058 C CG1 . VAL G 2 114 ? -26.873 49.428  -7.160  1.00 18.42  ? 204 VAL G CG1 1 
ATOM   5059 C CG2 . VAL G 2 114 ? -27.417 47.099  -6.333  1.00 18.96  ? 204 VAL G CG2 1 
ATOM   5060 N N   . ASP G 2 115 ? -25.502 48.015  -3.063  1.00 17.49  ? 205 ASP G N   1 
ATOM   5061 C CA  . ASP G 2 115 ? -25.416 47.257  -1.817  1.00 18.74  ? 205 ASP G CA  1 
ATOM   5062 C C   . ASP G 2 115 ? -26.365 46.053  -1.849  1.00 29.34  ? 205 ASP G C   1 
ATOM   5063 O O   . ASP G 2 115 ? -27.451 46.131  -2.431  1.00 29.45  ? 205 ASP G O   1 
ATOM   5064 C CB  . ASP G 2 115 ? -25.702 48.144  -0.601  1.00 20.47  ? 205 ASP G CB  1 
ATOM   5065 C CG  . ASP G 2 115 ? -24.494 48.935  -0.127  1.00 33.58  ? 205 ASP G CG  1 
ATOM   5066 O OD1 . ASP G 2 115 ? -23.345 48.447  -0.309  1.00 33.25  ? 205 ASP G OD1 1 
ATOM   5067 O OD2 . ASP G 2 115 ? -24.690 50.009  0.474   1.00 40.03  ? 205 ASP G OD2 1 
ATOM   5068 N N   . GLY G 2 116 ? -25.904 44.941  -1.287  1.00 29.18  ? 206 GLY G N   1 
ATOM   5069 C CA  . GLY G 2 116 ? -26.656 43.697  -1.224  1.00 30.24  ? 206 GLY G CA  1 
ATOM   5070 C C   . GLY G 2 116 ? -27.964 43.857  -0.478  1.00 36.50  ? 206 GLY G C   1 
ATOM   5071 O O   . GLY G 2 116 ? -28.057 44.700  0.424   1.00 36.12  ? 206 GLY G O   1 
ATOM   5072 N N   . PRO G 2 117 ? -29.002 43.068  -0.837  1.00 34.58  ? 207 PRO G N   1 
ATOM   5073 C CA  . PRO G 2 117 ? -30.296 43.229  -0.157  1.00 34.50  ? 207 PRO G CA  1 
ATOM   5074 C C   . PRO G 2 117 ? -30.254 42.759  1.288   1.00 37.25  ? 207 PRO G C   1 
ATOM   5075 O O   . PRO G 2 117 ? -29.499 41.832  1.611   1.00 37.68  ? 207 PRO G O   1 
ATOM   5076 C CB  . PRO G 2 117 ? -31.244 42.357  -0.994  1.00 36.02  ? 207 PRO G CB  1 
ATOM   5077 C CG  . PRO G 2 117 ? -30.370 41.332  -1.617  1.00 40.39  ? 207 PRO G CG  1 
ATOM   5078 C CD  . PRO G 2 117 ? -29.064 42.017  -1.874  1.00 35.91  ? 207 PRO G CD  1 
ATOM   5079 N N   . ASP G 2 118 ? -31.031 43.424  2.163   1.00 32.13  ? 208 ASP G N   1 
ATOM   5080 C CA  . ASP G 2 118 ? -31.172 42.981  3.543   1.00 30.44  ? 208 ASP G CA  1 
ATOM   5081 C C   . ASP G 2 118 ? -32.193 41.861  3.481   1.00 32.24  ? 208 ASP G C   1 
ATOM   5082 O O   . ASP G 2 118 ? -33.380 42.118  3.253   1.00 30.66  ? 208 ASP G O   1 
ATOM   5083 C CB  . ASP G 2 118 ? -31.583 44.115  4.495   1.00 32.04  ? 208 ASP G CB  1 
ATOM   5084 C CG  . ASP G 2 118 ? -31.732 43.712  5.968   1.00 46.03  ? 208 ASP G CG  1 
ATOM   5085 O OD1 . ASP G 2 118 ? -31.436 42.536  6.307   1.00 46.82  ? 208 ASP G OD1 1 
ATOM   5086 O OD2 . ASP G 2 118 ? -32.123 44.578  6.787   1.00 50.44  ? 208 ASP G OD2 1 
ATOM   5087 N N   . LEU G 2 119 ? -31.708 40.609  3.586   1.00 28.57  ? 209 LEU G N   1 
ATOM   5088 C CA  . LEU G 2 119 ? -32.528 39.396  3.513   1.00 27.49  ? 209 LEU G CA  1 
ATOM   5089 C C   . LEU G 2 119 ? -33.727 39.468  4.447   1.00 32.56  ? 209 LEU G C   1 
ATOM   5090 O O   . LEU G 2 119 ? -34.803 39.027  4.061   1.00 34.20  ? 209 LEU G O   1 
ATOM   5091 C CB  . LEU G 2 119 ? -31.699 38.148  3.836   1.00 26.67  ? 209 LEU G CB  1 
ATOM   5092 C CG  . LEU G 2 119 ? -30.524 37.820  2.935   1.00 29.96  ? 209 LEU G CG  1 
ATOM   5093 C CD1 . LEU G 2 119 ? -29.890 36.528  3.362   1.00 29.68  ? 209 LEU G CD1 1 
ATOM   5094 C CD2 . LEU G 2 119 ? -30.938 37.722  1.476   1.00 30.13  ? 209 LEU G CD2 1 
ATOM   5095 N N   . GLU G 2 120 ? -33.547 40.076  5.635   1.00 28.43  ? 210 GLU G N   1 
ATOM   5096 C CA  . GLU G 2 120 ? -34.565 40.261  6.666   1.00 29.26  ? 210 GLU G CA  1 
ATOM   5097 C C   . GLU G 2 120 ? -35.583 41.365  6.324   1.00 35.67  ? 210 GLU G C   1 
ATOM   5098 O O   . GLU G 2 120 ? -36.543 41.536  7.072   1.00 36.43  ? 210 GLU G O   1 
ATOM   5099 C CB  . GLU G 2 120 ? -33.904 40.579  8.017   1.00 30.58  ? 210 GLU G CB  1 
ATOM   5100 C CG  . GLU G 2 120 ? -33.538 39.354  8.836   1.00 42.31  ? 210 GLU G CG  1 
ATOM   5101 C CD  . GLU G 2 120 ? -33.475 39.592  10.337  1.00 74.73  ? 210 GLU G CD  1 
ATOM   5102 O OE1 . GLU G 2 120 ? -34.163 38.856  11.081  1.00 73.01  ? 210 GLU G OE1 1 
ATOM   5103 O OE2 . GLU G 2 120 ? -32.752 40.519  10.772  1.00 71.91  ? 210 GLU G OE2 1 
ATOM   5104 N N   . MET G 2 121 ? -35.374 42.114  5.231   1.00 33.26  ? 211 MET G N   1 
ATOM   5105 C CA  . MET G 2 121 ? -36.270 43.186  4.792   1.00 33.55  ? 211 MET G CA  1 
ATOM   5106 C C   . MET G 2 121 ? -36.877 42.900  3.407   1.00 36.46  ? 211 MET G C   1 
ATOM   5107 O O   . MET G 2 121 ? -37.586 43.749  2.852   1.00 37.22  ? 211 MET G O   1 
ATOM   5108 C CB  . MET G 2 121 ? -35.539 44.533  4.789   1.00 36.49  ? 211 MET G CB  1 
ATOM   5109 C CG  . MET G 2 121 ? -35.340 45.113  6.173   1.00 40.81  ? 211 MET G CG  1 
ATOM   5110 S SD  . MET G 2 121 ? -36.887 45.402  7.081   1.00 45.65  ? 211 MET G SD  1 
ATOM   5111 C CE  . MET G 2 121 ? -36.352 45.030  8.745   1.00 42.31  ? 211 MET G CE  1 
ATOM   5112 N N   . LEU G 2 122 ? -36.628 41.695  2.861   1.00 30.91  ? 212 LEU G N   1 
ATOM   5113 C CA  . LEU G 2 122 ? -37.173 41.287  1.557   1.00 29.07  ? 212 LEU G CA  1 
ATOM   5114 C C   . LEU G 2 122 ? -38.670 41.011  1.639   1.00 31.68  ? 212 LEU G C   1 
ATOM   5115 O O   . LEU G 2 122 ? -39.155 40.534  2.668   1.00 30.98  ? 212 LEU G O   1 
ATOM   5116 C CB  . LEU G 2 122 ? -36.469 40.022  1.025   1.00 27.98  ? 212 LEU G CB  1 
ATOM   5117 C CG  . LEU G 2 122 ? -35.053 40.177  0.484   1.00 31.18  ? 212 LEU G CG  1 
ATOM   5118 C CD1 . LEU G 2 122 ? -34.428 38.822  0.222   1.00 30.63  ? 212 LEU G CD1 1 
ATOM   5119 C CD2 . LEU G 2 122 ? -35.028 41.022  -0.778  1.00 33.10  ? 212 LEU G CD2 1 
ATOM   5120 N N   . THR G 2 123 ? -39.396 41.290  0.547   1.00 26.42  ? 213 THR G N   1 
ATOM   5121 C CA  . THR G 2 123 ? -40.817 40.978  0.468   1.00 26.42  ? 213 THR G CA  1 
ATOM   5122 C C   . THR G 2 123 ? -40.932 39.481  0.084   1.00 32.44  ? 213 THR G C   1 
ATOM   5123 O O   . THR G 2 123 ? -39.954 38.907  -0.404  1.00 32.46  ? 213 THR G O   1 
ATOM   5124 C CB  . THR G 2 123 ? -41.541 41.901  -0.530  1.00 27.68  ? 213 THR G CB  1 
ATOM   5125 O OG1 . THR G 2 123 ? -41.145 41.535  -1.862  1.00 24.42  ? 213 THR G OG1 1 
ATOM   5126 C CG2 . THR G 2 123 ? -41.303 43.402  -0.268  1.00 24.10  ? 213 THR G CG2 1 
ATOM   5127 N N   . GLY G 2 124 ? -42.108 38.884  0.278   1.00 28.93  ? 214 GLY G N   1 
ATOM   5128 C CA  . GLY G 2 124 ? -42.387 37.499  -0.095  1.00 27.71  ? 214 GLY G CA  1 
ATOM   5129 C C   . GLY G 2 124 ? -42.086 37.234  -1.560  1.00 31.52  ? 214 GLY G C   1 
ATOM   5130 O O   . GLY G 2 124 ? -41.397 36.260  -1.878  1.00 30.35  ? 214 GLY G O   1 
ATOM   5131 N N   . GLN G 2 125 ? -42.520 38.158  -2.456  1.00 28.54  ? 215 GLN G N   1 
ATOM   5132 C CA  . GLN G 2 125 ? -42.295 38.076  -3.900  1.00 28.74  ? 215 GLN G CA  1 
ATOM   5133 C C   . GLN G 2 125 ? -40.799 38.120  -4.245  1.00 33.85  ? 215 GLN G C   1 
ATOM   5134 O O   . GLN G 2 125 ? -40.356 37.350  -5.101  1.00 35.40  ? 215 GLN G O   1 
ATOM   5135 C CB  . GLN G 2 125 ? -43.024 39.211  -4.620  1.00 30.64  ? 215 GLN G CB  1 
ATOM   5136 C CG  . GLN G 2 125 ? -43.427 38.845  -6.035  1.00 51.09  ? 215 GLN G CG  1 
ATOM   5137 C CD  . GLN G 2 125 ? -43.251 39.991  -6.997  1.00 74.44  ? 215 GLN G CD  1 
ATOM   5138 O OE1 . GLN G 2 125 ? -44.040 40.942  -7.027  1.00 69.37  ? 215 GLN G OE1 1 
ATOM   5139 N NE2 . GLN G 2 125 ? -42.214 39.911  -7.819  1.00 71.55  ? 215 GLN G NE2 1 
ATOM   5140 N N   . GLU G 2 126 ? -40.031 39.022  -3.586  1.00 28.91  ? 216 GLU G N   1 
ATOM   5141 C CA  . GLU G 2 126 ? -38.584 39.193  -3.785  1.00 27.47  ? 216 GLU G CA  1 
ATOM   5142 C C   . GLU G 2 126 ? -37.810 37.989  -3.258  1.00 26.57  ? 216 GLU G C   1 
ATOM   5143 O O   . GLU G 2 126 ? -36.790 37.615  -3.840  1.00 24.35  ? 216 GLU G O   1 
ATOM   5144 C CB  . GLU G 2 126 ? -38.086 40.458  -3.084  1.00 28.92  ? 216 GLU G CB  1 
ATOM   5145 C CG  . GLU G 2 126 ? -38.398 41.744  -3.835  1.00 36.66  ? 216 GLU G CG  1 
ATOM   5146 C CD  . GLU G 2 126 ? -38.349 42.990  -2.973  1.00 47.52  ? 216 GLU G CD  1 
ATOM   5147 O OE1 . GLU G 2 126 ? -38.358 42.862  -1.728  1.00 16.29  ? 216 GLU G OE1 1 
ATOM   5148 O OE2 . GLU G 2 126 ? -38.335 44.101  -3.547  1.00 50.39  ? 216 GLU G OE2 1 
ATOM   5149 N N   . ARG G 2 127 ? -38.286 37.432  -2.126  1.00 21.73  ? 217 ARG G N   1 
ATOM   5150 C CA  . ARG G 2 127 ? -37.742 36.271  -1.434  1.00 21.55  ? 217 ARG G CA  1 
ATOM   5151 C C   . ARG G 2 127 ? -37.840 35.047  -2.323  1.00 25.98  ? 217 ARG G C   1 
ATOM   5152 O O   . ARG G 2 127 ? -36.906 34.260  -2.356  1.00 27.60  ? 217 ARG G O   1 
ATOM   5153 C CB  . ARG G 2 127 ? -38.494 36.039  -0.120  1.00 20.70  ? 217 ARG G CB  1 
ATOM   5154 C CG  . ARG G 2 127 ? -37.678 35.298  0.894   1.00 24.86  ? 217 ARG G CG  1 
ATOM   5155 C CD  . ARG G 2 127 ? -38.303 35.288  2.268   1.00 25.20  ? 217 ARG G CD  1 
ATOM   5156 N NE  . ARG G 2 127 ? -38.356 36.611  2.877   1.00 30.17  ? 217 ARG G NE  1 
ATOM   5157 C CZ  . ARG G 2 127 ? -37.363 37.179  3.554   1.00 41.54  ? 217 ARG G CZ  1 
ATOM   5158 N NH1 . ARG G 2 127 ? -36.195 36.562  3.679   1.00 28.55  ? 217 ARG G NH1 1 
ATOM   5159 N NH2 . ARG G 2 127 ? -37.521 38.379  4.087   1.00 24.86  ? 217 ARG G NH2 1 
ATOM   5160 N N   . VAL G 2 128 ? -38.955 34.910  -3.059  1.00 21.78  ? 218 VAL G N   1 
ATOM   5161 C CA  . VAL G 2 128 ? -39.235 33.838  -4.015  1.00 20.71  ? 218 VAL G CA  1 
ATOM   5162 C C   . VAL G 2 128 ? -38.252 33.971  -5.194  1.00 22.72  ? 218 VAL G C   1 
ATOM   5163 O O   . VAL G 2 128 ? -37.602 32.996  -5.553  1.00 22.24  ? 218 VAL G O   1 
ATOM   5164 C CB  . VAL G 2 128 ? -40.736 33.858  -4.468  1.00 23.72  ? 218 VAL G CB  1 
ATOM   5165 C CG1 . VAL G 2 128 ? -40.951 33.153  -5.809  1.00 23.97  ? 218 VAL G CG1 1 
ATOM   5166 C CG2 . VAL G 2 128 ? -41.646 33.266  -3.404  1.00 22.93  ? 218 VAL G CG2 1 
ATOM   5167 N N   . ALA G 2 129 ? -38.134 35.175  -5.766  1.00 18.90  ? 219 ALA G N   1 
ATOM   5168 C CA  . ALA G 2 129 ? -37.265 35.495  -6.906  1.00 18.54  ? 219 ALA G CA  1 
ATOM   5169 C C   . ALA G 2 129 ? -35.773 35.315  -6.586  1.00 20.80  ? 219 ALA G C   1 
ATOM   5170 O O   . ALA G 2 129 ? -35.035 34.866  -7.449  1.00 20.11  ? 219 ALA G O   1 
ATOM   5171 C CB  . ALA G 2 129 ? -37.521 36.927  -7.372  1.00 19.70  ? 219 ALA G CB  1 
ATOM   5172 N N   . LEU G 2 130 ? -35.323 35.679  -5.366  1.00 16.42  ? 220 LEU G N   1 
ATOM   5173 C CA  . LEU G 2 130 ? -33.916 35.528  -5.014  1.00 15.52  ? 220 LEU G CA  1 
ATOM   5174 C C   . LEU G 2 130 ? -33.582 34.032  -4.790  1.00 21.56  ? 220 LEU G C   1 
ATOM   5175 O O   . LEU G 2 130 ? -32.566 33.554  -5.304  1.00 19.50  ? 220 LEU G O   1 
ATOM   5176 C CB  . LEU G 2 130 ? -33.545 36.364  -3.777  1.00 14.90  ? 220 LEU G CB  1 
ATOM   5177 C CG  . LEU G 2 130 ? -32.059 36.278  -3.334  1.00 18.59  ? 220 LEU G CG  1 
ATOM   5178 C CD1 . LEU G 2 130 ? -31.098 36.767  -4.436  1.00 17.63  ? 220 LEU G CD1 1 
ATOM   5179 C CD2 . LEU G 2 130 ? -31.828 37.019  -2.054  1.00 17.49  ? 220 LEU G CD2 1 
ATOM   5180 N N   . ALA G 2 131 ? -34.442 33.305  -4.037  1.00 18.55  ? 221 ALA G N   1 
ATOM   5181 C CA  . ALA G 2 131 ? -34.268 31.880  -3.749  1.00 17.69  ? 221 ALA G CA  1 
ATOM   5182 C C   . ALA G 2 131 ? -34.290 31.070  -5.028  1.00 18.34  ? 221 ALA G C   1 
ATOM   5183 O O   . ALA G 2 131 ? -33.496 30.160  -5.162  1.00 17.00  ? 221 ALA G O   1 
ATOM   5184 C CB  . ALA G 2 131 ? -35.338 31.397  -2.797  1.00 18.25  ? 221 ALA G CB  1 
ATOM   5185 N N   . ASN G 2 132 ? -35.150 31.431  -5.989  1.00 14.94  ? 222 ASN G N   1 
ATOM   5186 C CA  . ASN G 2 132 ? -35.225 30.715  -7.260  1.00 14.09  ? 222 ASN G CA  1 
ATOM   5187 C C   . ASN G 2 132 ? -34.000 30.966  -8.114  1.00 16.66  ? 222 ASN G C   1 
ATOM   5188 O O   . ASN G 2 132 ? -33.587 30.077  -8.846  1.00 15.49  ? 222 ASN G O   1 
ATOM   5189 C CB  . ASN G 2 132 ? -36.479 31.085  -8.029  1.00 18.12  ? 222 ASN G CB  1 
ATOM   5190 C CG  . ASN G 2 132 ? -37.559 30.051  -7.934  1.00 44.15  ? 222 ASN G CG  1 
ATOM   5191 O OD1 . ASN G 2 132 ? -37.366 28.881  -8.268  1.00 42.62  ? 222 ASN G OD1 1 
ATOM   5192 N ND2 . ASN G 2 132 ? -38.729 30.458  -7.480  1.00 39.77  ? 222 ASN G ND2 1 
ATOM   5193 N N   . ARG G 2 133 ? -33.426 32.170  -8.037  1.00 16.07  ? 223 ARG G N   1 
ATOM   5194 C CA  . ARG G 2 133 ? -32.220 32.532  -8.780  1.00 15.55  ? 223 ARG G CA  1 
ATOM   5195 C C   . ARG G 2 133 ? -31.022 31.727  -8.252  1.00 15.22  ? 223 ARG G C   1 
ATOM   5196 O O   . ARG G 2 133 ? -30.238 31.215  -9.049  1.00 14.14  ? 223 ARG G O   1 
ATOM   5197 C CB  . ARG G 2 133 ? -31.959 34.050  -8.697  1.00 18.56  ? 223 ARG G CB  1 
ATOM   5198 C CG  . ARG G 2 133 ? -30.619 34.533  -9.320  1.00 29.44  ? 223 ARG G CG  1 
ATOM   5199 C CD  . ARG G 2 133 ? -30.420 34.162  -10.786 1.00 37.54  ? 223 ARG G CD  1 
ATOM   5200 N NE  . ARG G 2 133 ? -29.081 34.516  -11.258 1.00 50.96  ? 223 ARG G NE  1 
ATOM   5201 C CZ  . ARG G 2 133 ? -28.478 33.959  -12.303 1.00 58.00  ? 223 ARG G CZ  1 
ATOM   5202 N NH1 . ARG G 2 133 ? -29.083 33.000  -12.997 1.00 41.73  ? 223 ARG G NH1 1 
ATOM   5203 N NH2 . ARG G 2 133 ? -27.267 34.360  -12.667 1.00 38.20  ? 223 ARG G NH2 1 
ATOM   5204 N N   . LYS G 2 134 ? -30.895 31.615  -6.929  1.00 10.56  ? 224 LYS G N   1 
ATOM   5205 C CA  . LYS G 2 134 ? -29.810 30.873  -6.293  1.00 10.78  ? 224 LYS G CA  1 
ATOM   5206 C C   . LYS G 2 134 ? -29.964 29.368  -6.601  1.00 16.77  ? 224 LYS G C   1 
ATOM   5207 O O   . LYS G 2 134 ? -28.966 28.701  -6.881  1.00 17.56  ? 224 LYS G O   1 
ATOM   5208 C CB  . LYS G 2 134 ? -29.765 31.144  -4.780  1.00 11.91  ? 224 LYS G CB  1 
ATOM   5209 C CG  . LYS G 2 134 ? -29.460 32.598  -4.384  1.00 16.90  ? 224 LYS G CG  1 
ATOM   5210 C CD  . LYS G 2 134 ? -28.140 33.130  -4.916  1.00 14.54  ? 224 LYS G CD  1 
ATOM   5211 C CE  . LYS G 2 134 ? -27.632 34.313  -4.133  1.00 28.11  ? 224 LYS G CE  1 
ATOM   5212 N NZ  . LYS G 2 134 ? -26.520 35.012  -4.839  1.00 39.01  ? 224 LYS G NZ  1 
ATOM   5213 N N   . ARG G 2 135 ? -31.219 28.862  -6.605  1.00 12.90  ? 225 ARG G N   1 
ATOM   5214 C CA  . ARG G 2 135 ? -31.579 27.482  -6.954  1.00 13.95  ? 225 ARG G CA  1 
ATOM   5215 C C   . ARG G 2 135 ? -31.179 27.194  -8.393  1.00 18.23  ? 225 ARG G C   1 
ATOM   5216 O O   . ARG G 2 135 ? -30.636 26.123  -8.664  1.00 18.51  ? 225 ARG G O   1 
ATOM   5217 C CB  . ARG G 2 135 ? -33.092 27.250  -6.772  1.00 16.63  ? 225 ARG G CB  1 
ATOM   5218 C CG  . ARG G 2 135 ? -33.522 25.767  -6.828  1.00 24.60  ? 225 ARG G CG  1 
ATOM   5219 C CD  . ARG G 2 135 ? -35.024 25.542  -7.030  1.00 26.85  ? 225 ARG G CD  1 
ATOM   5220 N NE  . ARG G 2 135 ? -35.620 26.429  -8.046  1.00 26.84  ? 225 ARG G NE  1 
ATOM   5221 C CZ  . ARG G 2 135 ? -35.616 26.202  -9.359  1.00 43.31  ? 225 ARG G CZ  1 
ATOM   5222 N NH1 . ARG G 2 135 ? -35.042 25.113  -9.849  1.00 36.35  ? 225 ARG G NH1 1 
ATOM   5223 N NH2 . ARG G 2 135 ? -36.174 27.074  -10.192 1.00 25.48  ? 225 ARG G NH2 1 
ATOM   5224 N N   . GLU G 2 136 ? -31.409 28.159  -9.311  1.00 13.45  ? 226 GLU G N   1 
ATOM   5225 C CA  . GLU G 2 136 ? -31.044 27.979  -10.724 1.00 14.68  ? 226 GLU G CA  1 
ATOM   5226 C C   . GLU G 2 136 ? -29.520 27.976  -10.894 1.00 19.41  ? 226 GLU G C   1 
ATOM   5227 O O   . GLU G 2 136 ? -29.013 27.297  -11.782 1.00 20.25  ? 226 GLU G O   1 
ATOM   5228 C CB  . GLU G 2 136 ? -31.693 29.056  -11.607 1.00 16.22  ? 226 GLU G CB  1 
ATOM   5229 C CG  . GLU G 2 136 ? -33.164 28.784  -11.887 1.00 27.54  ? 226 GLU G CG  1 
ATOM   5230 C CD  . GLU G 2 136 ? -33.954 29.896  -12.558 1.00 55.11  ? 226 GLU G CD  1 
ATOM   5231 O OE1 . GLU G 2 136 ? -35.119 30.116  -12.154 1.00 53.91  ? 226 GLU G OE1 1 
ATOM   5232 O OE2 . GLU G 2 136 ? -33.438 30.508  -13.522 1.00 54.95  ? 226 GLU G OE2 1 
ATOM   5233 N N   . CYS G 2 137 ? -28.799 28.729  -10.043 1.00 16.20  ? 227 CYS G N   1 
ATOM   5234 C CA  . CYS G 2 137 ? -27.336 28.787  -10.037 1.00 17.26  ? 227 CYS G CA  1 
ATOM   5235 C C   . CYS G 2 137 ? -26.796 27.436  -9.589  1.00 18.21  ? 227 CYS G C   1 
ATOM   5236 O O   . CYS G 2 137 ? -26.024 26.826  -10.327 1.00 15.19  ? 227 CYS G O   1 
ATOM   5237 C CB  . CYS G 2 137 ? -26.818 29.924  -9.153  1.00 18.14  ? 227 CYS G CB  1 
ATOM   5238 S SG  . CYS G 2 137 ? -27.071 31.568  -9.856  1.00 22.22  ? 227 CYS G SG  1 
ATOM   5239 N N   . GLY G 2 138 ? -27.257 26.972  -8.423  1.00 14.47  ? 228 GLY G N   1 
ATOM   5240 C CA  . GLY G 2 138 ? -26.921 25.665  -7.869  1.00 13.42  ? 228 GLY G CA  1 
ATOM   5241 C C   . GLY G 2 138 ? -27.145 24.544  -8.859  1.00 15.42  ? 228 GLY G C   1 
ATOM   5242 O O   . GLY G 2 138 ? -26.279 23.676  -9.007  1.00 14.16  ? 228 GLY G O   1 
ATOM   5243 N N   . ASN G 2 139 ? -28.294 24.578  -9.575  1.00 10.90  ? 229 ASN G N   1 
ATOM   5244 C CA  . ASN G 2 139 ? -28.636 23.584  -10.600 1.00 11.14  ? 229 ASN G CA  1 
ATOM   5245 C C   . ASN G 2 139 ? -27.590 23.574  -11.718 1.00 16.95  ? 229 ASN G C   1 
ATOM   5246 O O   . ASN G 2 139 ? -27.165 22.496  -12.116 1.00 18.93  ? 229 ASN G O   1 
ATOM   5247 C CB  . ASN G 2 139 ? -30.044 23.815  -11.177 1.00 3.00   ? 229 ASN G CB  1 
ATOM   5248 C CG  . ASN G 2 139 ? -31.169 23.418  -10.252 1.00 24.69  ? 229 ASN G CG  1 
ATOM   5249 O OD1 . ASN G 2 139 ? -30.982 23.076  -9.068  1.00 15.77  ? 229 ASN G OD1 1 
ATOM   5250 N ND2 . ASN G 2 139 ? -32.380 23.474  -10.768 1.00 18.37  ? 229 ASN G ND2 1 
ATOM   5251 N N   . ALA G 2 140 ? -27.140 24.750  -12.175 1.00 11.99  ? 230 ALA G N   1 
ATOM   5252 C CA  . ALA G 2 140 ? -26.141 24.882  -13.256 1.00 12.45  ? 230 ALA G CA  1 
ATOM   5253 C C   . ALA G 2 140 ? -24.791 24.287  -12.843 1.00 20.81  ? 230 ALA G C   1 
ATOM   5254 O O   . ALA G 2 140 ? -24.143 23.654  -13.663 1.00 22.98  ? 230 ALA G O   1 
ATOM   5255 C CB  . ALA G 2 140 ? -25.965 26.342  -13.650 1.00 12.09  ? 230 ALA G CB  1 
ATOM   5256 N N   . HIS G 2 141 ? -24.385 24.464  -11.576 1.00 17.21  ? 231 HIS G N   1 
ATOM   5257 C CA  . HIS G 2 141 ? -23.135 23.909  -11.037 1.00 15.58  ? 231 HIS G CA  1 
ATOM   5258 C C   . HIS G 2 141 ? -23.231 22.410  -10.900 1.00 22.11  ? 231 HIS G C   1 
ATOM   5259 O O   . HIS G 2 141 ? -22.256 21.708  -11.173 1.00 23.60  ? 231 HIS G O   1 
ATOM   5260 C CB  . HIS G 2 141 ? -22.836 24.514  -9.664  1.00 15.19  ? 231 HIS G CB  1 
ATOM   5261 C CG  . HIS G 2 141 ? -22.570 25.991  -9.660  1.00 17.53  ? 231 HIS G CG  1 
ATOM   5262 N ND1 . HIS G 2 141 ? -23.026 26.792  -8.639  1.00 19.26  ? 231 HIS G ND1 1 
ATOM   5263 C CD2 . HIS G 2 141 ? -21.816 26.739  -10.491 1.00 17.50  ? 231 HIS G CD2 1 
ATOM   5264 C CE1 . HIS G 2 141 ? -22.555 27.997  -8.890  1.00 17.60  ? 231 HIS G CE1 1 
ATOM   5265 N NE2 . HIS G 2 141 ? -21.826 28.011  -9.997  1.00 17.34  ? 231 HIS G NE2 1 
ATOM   5266 N N   . TYR G 2 142 ? -24.409 21.920  -10.464 1.00 18.44  ? 232 TYR G N   1 
ATOM   5267 C CA  . TYR G 2 142 ? -24.692 20.504  -10.262 1.00 18.21  ? 232 TYR G CA  1 
ATOM   5268 C C   . TYR G 2 142 ? -24.596 19.728  -11.556 1.00 21.21  ? 232 TYR G C   1 
ATOM   5269 O O   . TYR G 2 142 ? -23.970 18.668  -11.556 1.00 22.36  ? 232 TYR G O   1 
ATOM   5270 C CB  . TYR G 2 142 ? -26.080 20.310  -9.626  1.00 19.44  ? 232 TYR G CB  1 
ATOM   5271 C CG  . TYR G 2 142 ? -26.382 18.877  -9.249  1.00 19.76  ? 232 TYR G CG  1 
ATOM   5272 C CD1 . TYR G 2 142 ? -26.965 18.003  -10.166 1.00 21.00  ? 232 TYR G CD1 1 
ATOM   5273 C CD2 . TYR G 2 142 ? -26.105 18.396  -7.972  1.00 19.66  ? 232 TYR G CD2 1 
ATOM   5274 C CE1 . TYR G 2 142 ? -27.236 16.683  -9.834  1.00 20.06  ? 232 TYR G CE1 1 
ATOM   5275 C CE2 . TYR G 2 142 ? -26.394 17.075  -7.621  1.00 20.67  ? 232 TYR G CE2 1 
ATOM   5276 C CZ  . TYR G 2 142 ? -26.953 16.223  -8.561  1.00 25.48  ? 232 TYR G CZ  1 
ATOM   5277 O OH  . TYR G 2 142 ? -27.280 14.935  -8.245  1.00 29.77  ? 232 TYR G OH  1 
ATOM   5278 N N   . GLN G 2 143 ? -25.207 20.233  -12.650 1.00 16.84  ? 233 GLN G N   1 
ATOM   5279 C CA  . GLN G 2 143 ? -25.167 19.595  -13.980 1.00 17.63  ? 233 GLN G CA  1 
ATOM   5280 C C   . GLN G 2 143 ? -23.717 19.380  -14.479 1.00 25.28  ? 233 GLN G C   1 
ATOM   5281 O O   . GLN G 2 143 ? -23.440 18.423  -15.192 1.00 25.77  ? 233 GLN G O   1 
ATOM   5282 C CB  . GLN G 2 143 ? -25.942 20.428  -15.020 1.00 18.05  ? 233 GLN G CB  1 
ATOM   5283 N N   . ARG G 2 144 ? -22.815 20.288  -14.086 1.00 22.70  ? 234 ARG G N   1 
ATOM   5284 C CA  . ARG G 2 144 ? -21.393 20.358  -14.440 1.00 22.47  ? 234 ARG G CA  1 
ATOM   5285 C C   . ARG G 2 144 ? -20.530 19.484  -13.482 1.00 26.09  ? 234 ARG G C   1 
ATOM   5286 O O   . ARG G 2 144 ? -19.345 19.288  -13.726 1.00 26.13  ? 234 ARG G O   1 
ATOM   5287 C CB  . ARG G 2 144 ? -20.993 21.849  -14.336 1.00 22.41  ? 234 ARG G CB  1 
ATOM   5288 C CG  . ARG G 2 144 ? -19.711 22.255  -15.020 1.00 31.97  ? 234 ARG G CG  1 
ATOM   5289 C CD  . ARG G 2 144 ? -19.106 23.490  -14.384 1.00 39.83  ? 234 ARG G CD  1 
ATOM   5290 N NE  . ARG G 2 144 ? -20.024 24.621  -14.432 1.00 33.31  ? 234 ARG G NE  1 
ATOM   5291 C CZ  . ARG G 2 144 ? -20.222 25.460  -13.427 1.00 38.35  ? 234 ARG G CZ  1 
ATOM   5292 N NH1 . ARG G 2 144 ? -21.100 26.442  -13.541 1.00 31.78  ? 234 ARG G NH1 1 
ATOM   5293 N NH2 . ARG G 2 144 ? -19.537 25.329  -12.300 1.00 12.19  ? 234 ARG G NH2 1 
ATOM   5294 N N   . ALA G 2 145 ? -21.151 18.939  -12.418 1.00 21.81  ? 235 ALA G N   1 
ATOM   5295 C CA  . ALA G 2 145 ? -20.570 18.096  -11.354 1.00 20.67  ? 235 ALA G CA  1 
ATOM   5296 C C   . ALA G 2 145 ? -19.653 18.899  -10.401 1.00 21.63  ? 235 ALA G C   1 
ATOM   5297 O O   . ALA G 2 145 ? -18.675 18.376  -9.841  1.00 19.78  ? 235 ALA G O   1 
ATOM   5298 C CB  . ALA G 2 145 ? -19.851 16.868  -11.918 1.00 21.44  ? 235 ALA G CB  1 
ATOM   5299 N N   . ASP G 2 146 ? -20.006 20.170  -10.192 1.00 17.23  ? 236 ASP G N   1 
ATOM   5300 C CA  . ASP G 2 146 ? -19.346 21.044  -9.233  1.00 17.22  ? 236 ASP G CA  1 
ATOM   5301 C C   . ASP G 2 146 ? -20.296 21.071  -8.061  1.00 21.49  ? 236 ASP G C   1 
ATOM   5302 O O   . ASP G 2 146 ? -21.222 21.883  -8.019  1.00 21.16  ? 236 ASP G O   1 
ATOM   5303 C CB  . ASP G 2 146 ? -19.059 22.442  -9.816  1.00 19.54  ? 236 ASP G CB  1 
ATOM   5304 C CG  . ASP G 2 146 ? -18.092 23.272  -8.983  1.00 36.35  ? 236 ASP G CG  1 
ATOM   5305 O OD1 . ASP G 2 146 ? -18.036 23.063  -7.747  1.00 37.33  ? 236 ASP G OD1 1 
ATOM   5306 O OD2 . ASP G 2 146 ? -17.373 24.116  -9.570  1.00 44.20  ? 236 ASP G OD2 1 
ATOM   5307 N N   . PHE G 2 147 ? -20.141 20.085  -7.184  1.00 17.86  ? 237 PHE G N   1 
ATOM   5308 C CA  . PHE G 2 147 ? -21.020 19.834  -6.057  1.00 17.34  ? 237 PHE G CA  1 
ATOM   5309 C C   . PHE G 2 147 ? -20.696 20.726  -4.883  1.00 18.57  ? 237 PHE G C   1 
ATOM   5310 O O   . PHE G 2 147 ? -21.596 21.023  -4.100  1.00 18.15  ? 237 PHE G O   1 
ATOM   5311 C CB  . PHE G 2 147 ? -20.980 18.342  -5.676  1.00 18.98  ? 237 PHE G CB  1 
ATOM   5312 C CG  . PHE G 2 147 ? -21.370 17.437  -6.833  1.00 20.04  ? 237 PHE G CG  1 
ATOM   5313 C CD1 . PHE G 2 147 ? -22.661 17.465  -7.361  1.00 20.94  ? 237 PHE G CD1 1 
ATOM   5314 C CD2 . PHE G 2 147 ? -20.444 16.569  -7.403  1.00 21.86  ? 237 PHE G CD2 1 
ATOM   5315 C CE1 . PHE G 2 147 ? -23.008 16.658  -8.443  1.00 21.85  ? 237 PHE G CE1 1 
ATOM   5316 C CE2 . PHE G 2 147 ? -20.801 15.751  -8.483  1.00 23.80  ? 237 PHE G CE2 1 
ATOM   5317 C CZ  . PHE G 2 147 ? -22.082 15.795  -8.986  1.00 21.63  ? 237 PHE G CZ  1 
ATOM   5318 N N   . VAL G 2 148 ? -19.449 21.204  -4.779  1.00 14.86  ? 238 VAL G N   1 
ATOM   5319 C CA  . VAL G 2 148 ? -19.064 22.152  -3.726  1.00 14.74  ? 238 VAL G CA  1 
ATOM   5320 C C   . VAL G 2 148 ? -19.800 23.502  -3.984  1.00 17.27  ? 238 VAL G C   1 
ATOM   5321 O O   . VAL G 2 148 ? -20.364 24.083  -3.053  1.00 17.69  ? 238 VAL G O   1 
ATOM   5322 C CB  . VAL G 2 148 ? -17.522 22.337  -3.604  1.00 18.78  ? 238 VAL G CB  1 
ATOM   5323 C CG1 . VAL G 2 148 ? -17.160 23.488  -2.651  1.00 18.16  ? 238 VAL G CG1 1 
ATOM   5324 C CG2 . VAL G 2 148 ? -16.857 21.049  -3.139  1.00 18.30  ? 238 VAL G CG2 1 
ATOM   5325 N N   . LEU G 2 149 ? -19.826 23.956  -5.246  1.00 11.58  ? 239 LEU G N   1 
ATOM   5326 C CA  . LEU G 2 149 ? -20.472 25.221  -5.627  1.00 11.32  ? 239 LEU G CA  1 
ATOM   5327 C C   . LEU G 2 149 ? -21.995 25.082  -5.634  1.00 15.66  ? 239 LEU G C   1 
ATOM   5328 O O   . LEU G 2 149 ? -22.678 26.000  -5.190  1.00 14.99  ? 239 LEU G O   1 
ATOM   5329 C CB  . LEU G 2 149 ? -19.977 25.722  -6.993  1.00 10.75  ? 239 LEU G CB  1 
ATOM   5330 C CG  . LEU G 2 149 ? -18.670 26.559  -7.059  1.00 15.07  ? 239 LEU G CG  1 
ATOM   5331 C CD1 . LEU G 2 149 ? -18.620 27.334  -8.364  1.00 15.15  ? 239 LEU G CD1 1 
ATOM   5332 C CD2 . LEU G 2 149 ? -18.472 27.467  -5.857  1.00 15.40  ? 239 LEU G CD2 1 
ATOM   5333 N N   . ALA G 2 150 ? -22.525 23.932  -6.146  1.00 11.15  ? 240 ALA G N   1 
ATOM   5334 C CA  . ALA G 2 150 ? -23.955 23.632  -6.155  1.00 9.53   ? 240 ALA G CA  1 
ATOM   5335 C C   . ALA G 2 150 ? -24.486 23.698  -4.729  1.00 11.85  ? 240 ALA G C   1 
ATOM   5336 O O   . ALA G 2 150 ? -25.432 24.442  -4.489  1.00 10.59  ? 240 ALA G O   1 
ATOM   5337 C CB  . ALA G 2 150 ? -24.208 22.263  -6.763  1.00 10.65  ? 240 ALA G CB  1 
ATOM   5338 N N   . ALA G 2 151 ? -23.819 23.013  -3.770  1.00 8.39   ? 241 ALA G N   1 
ATOM   5339 C CA  . ALA G 2 151 ? -24.226 23.021  -2.355  1.00 8.61   ? 241 ALA G CA  1 
ATOM   5340 C C   . ALA G 2 151 ? -24.236 24.425  -1.783  1.00 14.30  ? 241 ALA G C   1 
ATOM   5341 O O   . ALA G 2 151 ? -25.139 24.751  -1.000  1.00 17.27  ? 241 ALA G O   1 
ATOM   5342 C CB  . ALA G 2 151 ? -23.316 22.129  -1.515  1.00 9.21   ? 241 ALA G CB  1 
ATOM   5343 N N   . ASN G 2 152 ? -23.213 25.242  -2.117  1.00 6.50   ? 242 ASN G N   1 
ATOM   5344 C CA  . ASN G 2 152 ? -23.110 26.618  -1.626  1.00 5.32   ? 242 ASN G CA  1 
ATOM   5345 C C   . ASN G 2 152 ? -24.317 27.469  -2.080  1.00 8.46   ? 242 ASN G C   1 
ATOM   5346 O O   . ASN G 2 152 ? -24.922 28.162  -1.265  1.00 8.07   ? 242 ASN G O   1 
ATOM   5347 C CB  . ASN G 2 152 ? -21.796 27.238  -2.121  1.00 6.23   ? 242 ASN G CB  1 
ATOM   5348 C CG  . ASN G 2 152 ? -21.655 28.711  -1.845  1.00 23.04  ? 242 ASN G CG  1 
ATOM   5349 O OD1 . ASN G 2 152 ? -21.494 29.146  -0.707  1.00 18.34  ? 242 ASN G OD1 1 
ATOM   5350 N ND2 . ASN G 2 152 ? -21.706 29.508  -2.909  1.00 6.52   ? 242 ASN G ND2 1 
ATOM   5351 N N   . SER G 2 153 ? -24.650 27.408  -3.381  1.00 3.00   ? 243 SER G N   1 
ATOM   5352 C CA  . SER G 2 153 ? -25.772 28.138  -3.962  1.00 3.55   ? 243 SER G CA  1 
ATOM   5353 C C   . SER G 2 153 ? -27.110 27.684  -3.384  1.00 9.90   ? 243 SER G C   1 
ATOM   5354 O O   . SER G 2 153 ? -27.976 28.546  -3.221  1.00 8.47   ? 243 SER G O   1 
ATOM   5355 C CB  . SER G 2 153 ? -25.788 27.985  -5.479  1.00 8.07   ? 243 SER G CB  1 
ATOM   5356 O OG  . SER G 2 153 ? -24.575 28.420  -6.077  1.00 8.34   ? 243 SER G OG  1 
ATOM   5357 N N   . TYR G 2 154 ? -27.289 26.353  -3.048  1.00 8.67   ? 244 TYR G N   1 
ATOM   5358 C CA  . TYR G 2 154 ? -28.532 25.840  -2.440  1.00 8.56   ? 244 TYR G CA  1 
ATOM   5359 C C   . TYR G 2 154 ? -28.639 26.304  -1.026  1.00 13.27  ? 244 TYR G C   1 
ATOM   5360 O O   . TYR G 2 154 ? -29.729 26.660  -0.612  1.00 14.83  ? 244 TYR G O   1 
ATOM   5361 C CB  . TYR G 2 154 ? -28.651 24.304  -2.491  1.00 9.61   ? 244 TYR G CB  1 
ATOM   5362 C CG  . TYR G 2 154 ? -28.686 23.728  -3.889  1.00 9.61   ? 244 TYR G CG  1 
ATOM   5363 C CD1 . TYR G 2 154 ? -29.555 24.234  -4.853  1.00 12.42  ? 244 TYR G CD1 1 
ATOM   5364 C CD2 . TYR G 2 154 ? -27.895 22.640  -4.230  1.00 8.75   ? 244 TYR G CD2 1 
ATOM   5365 C CE1 . TYR G 2 154 ? -29.577 23.716  -6.144  1.00 13.03  ? 244 TYR G CE1 1 
ATOM   5366 C CE2 . TYR G 2 154 ? -27.906 22.115  -5.513  1.00 9.84   ? 244 TYR G CE2 1 
ATOM   5367 C CZ  . TYR G 2 154 ? -28.757 22.642  -6.464  1.00 16.66  ? 244 TYR G CZ  1 
ATOM   5368 O OH  . TYR G 2 154 ? -28.775 22.074  -7.709  1.00 14.50  ? 244 TYR G OH  1 
ATOM   5369 N N   . ASP G 2 155 ? -27.521 26.332  -0.276  1.00 10.70  ? 245 ASP G N   1 
ATOM   5370 C CA  . ASP G 2 155 ? -27.547 26.875  1.097   1.00 12.07  ? 245 ASP G CA  1 
ATOM   5371 C C   . ASP G 2 155 ? -27.921 28.396  1.087   1.00 16.47  ? 245 ASP G C   1 
ATOM   5372 O O   . ASP G 2 155 ? -28.602 28.853  1.990   1.00 17.85  ? 245 ASP G O   1 
ATOM   5373 C CB  . ASP G 2 155 ? -26.200 26.645  1.792   1.00 14.21  ? 245 ASP G CB  1 
ATOM   5374 C CG  . ASP G 2 155 ? -26.104 27.212  3.191   1.00 34.81  ? 245 ASP G CG  1 
ATOM   5375 O OD1 . ASP G 2 155 ? -26.951 26.840  4.045   1.00 39.83  ? 245 ASP G OD1 1 
ATOM   5376 O OD2 . ASP G 2 155 ? -25.175 28.030  3.443   1.00 38.61  ? 245 ASP G OD2 1 
ATOM   5377 N N   . LEU G 2 156 ? -27.497 29.157  0.070   1.00 13.25  ? 246 LEU G N   1 
ATOM   5378 C CA  . LEU G 2 156 ? -27.794 30.600  0.005   1.00 13.53  ? 246 LEU G CA  1 
ATOM   5379 C C   . LEU G 2 156 ? -29.273 30.812  -0.301  1.00 17.94  ? 246 LEU G C   1 
ATOM   5380 O O   . LEU G 2 156 ? -29.892 31.680  0.304   1.00 18.53  ? 246 LEU G O   1 
ATOM   5381 C CB  . LEU G 2 156 ? -26.908 31.329  -1.004  1.00 13.35  ? 246 LEU G CB  1 
ATOM   5382 C CG  . LEU G 2 156 ? -25.392 31.353  -0.717  1.00 16.85  ? 246 LEU G CG  1 
ATOM   5383 C CD1 . LEU G 2 156 ? -24.633 31.855  -1.925  1.00 15.20  ? 246 LEU G CD1 1 
ATOM   5384 C CD2 . LEU G 2 156 ? -25.067 32.186  0.509   1.00 17.77  ? 246 LEU G CD2 1 
ATOM   5385 N N   . ALA G 2 157 ? -29.841 29.988  -1.193  1.00 14.73  ? 247 ALA G N   1 
ATOM   5386 C CA  . ALA G 2 157 ? -31.272 29.905  -1.494  1.00 13.23  ? 247 ALA G CA  1 
ATOM   5387 C C   . ALA G 2 157 ? -32.053 29.660  -0.201  1.00 17.41  ? 247 ALA G C   1 
ATOM   5388 O O   . ALA G 2 157 ? -32.997 30.377  0.054   1.00 15.64  ? 247 ALA G O   1 
ATOM   5389 C CB  . ALA G 2 157 ? -31.537 28.780  -2.475  1.00 12.89  ? 247 ALA G CB  1 
ATOM   5390 N N   . ILE G 2 158 ? -31.631 28.680  0.622   1.00 17.53  ? 248 ILE G N   1 
ATOM   5391 C CA  . ILE G 2 158 ? -32.303 28.339  1.891   1.00 19.15  ? 248 ILE G CA  1 
ATOM   5392 C C   . ILE G 2 158 ? -32.225 29.516  2.876   1.00 23.01  ? 248 ILE G C   1 
ATOM   5393 O O   . ILE G 2 158 ? -33.248 29.890  3.442   1.00 23.38  ? 248 ILE G O   1 
ATOM   5394 C CB  . ILE G 2 158 ? -31.749 27.028  2.508   1.00 23.03  ? 248 ILE G CB  1 
ATOM   5395 C CG1 . ILE G 2 158 ? -32.122 25.805  1.643   1.00 22.97  ? 248 ILE G CG1 1 
ATOM   5396 C CG2 . ILE G 2 158 ? -32.233 26.832  3.968   1.00 25.19  ? 248 ILE G CG2 1 
ATOM   5397 C CD1 . ILE G 2 158 ? -31.148 24.652  1.722   1.00 17.76  ? 248 ILE G CD1 1 
ATOM   5398 N N   . LYS G 2 159 ? -31.020 30.107  3.061   1.00 19.86  ? 249 LYS G N   1 
ATOM   5399 C CA  . LYS G 2 159 ? -30.775 31.233  3.972   1.00 17.97  ? 249 LYS G CA  1 
ATOM   5400 C C   . LYS G 2 159 ? -31.666 32.427  3.622   1.00 18.95  ? 249 LYS G C   1 
ATOM   5401 O O   . LYS G 2 159 ? -32.105 33.144  4.526   1.00 17.01  ? 249 LYS G O   1 
ATOM   5402 C CB  . LYS G 2 159 ? -29.290 31.646  3.954   1.00 21.28  ? 249 LYS G CB  1 
ATOM   5403 C CG  . LYS G 2 159 ? -28.419 30.857  4.931   1.00 39.57  ? 249 LYS G CG  1 
ATOM   5404 C CD  . LYS G 2 159 ? -26.926 31.099  4.772   1.00 43.96  ? 249 LYS G CD  1 
ATOM   5405 C CE  . LYS G 2 159 ? -26.121 30.214  5.697   1.00 51.48  ? 249 LYS G CE  1 
ATOM   5406 N NZ  . LYS G 2 159 ? -24.658 30.339  5.462   1.00 62.69  ? 249 LYS G NZ  1 
ATOM   5407 N N   . ALA G 2 160 ? -31.943 32.613  2.320   1.00 14.37  ? 250 ALA G N   1 
ATOM   5408 C CA  . ALA G 2 160 ? -32.793 33.680  1.768   1.00 15.16  ? 250 ALA G CA  1 
ATOM   5409 C C   . ALA G 2 160 ? -34.286 33.417  2.054   1.00 21.24  ? 250 ALA G C   1 
ATOM   5410 O O   . ALA G 2 160 ? -35.046 34.380  2.167   1.00 19.75  ? 250 ALA G O   1 
ATOM   5411 C CB  . ALA G 2 160 ? -32.572 33.807  0.254   1.00 15.57  ? 250 ALA G CB  1 
ATOM   5412 N N   . ILE G 2 161 ? -34.704 32.123  2.133   1.00 18.96  ? 251 ILE G N   1 
ATOM   5413 C CA  . ILE G 2 161 ? -36.081 31.715  2.442   1.00 19.39  ? 251 ILE G CA  1 
ATOM   5414 C C   . ILE G 2 161 ? -36.356 31.878  3.953   1.00 23.48  ? 251 ILE G C   1 
ATOM   5415 O O   . ILE G 2 161 ? -37.378 32.452  4.332   1.00 24.84  ? 251 ILE G O   1 
ATOM   5416 C CB  . ILE G 2 161 ? -36.363 30.244  1.965   1.00 22.82  ? 251 ILE G CB  1 
ATOM   5417 C CG1 . ILE G 2 161 ? -36.369 30.136  0.416   1.00 23.54  ? 251 ILE G CG1 1 
ATOM   5418 C CG2 . ILE G 2 161 ? -37.698 29.712  2.544   1.00 24.29  ? 251 ILE G CG2 1 
ATOM   5419 C CD1 . ILE G 2 161 ? -36.204 28.750  -0.156  1.00 30.87  ? 251 ILE G CD1 1 
ATOM   5420 N N   . THR G 2 162 ? -35.445 31.371  4.797   1.00 18.06  ? 252 THR G N   1 
ATOM   5421 C CA  . THR G 2 162 ? -35.582 31.282  6.245   1.00 18.35  ? 252 THR G CA  1 
ATOM   5422 C C   . THR G 2 162 ? -35.309 32.587  7.030   1.00 27.67  ? 252 THR G C   1 
ATOM   5423 O O   . THR G 2 162 ? -35.589 32.630  8.245   1.00 28.08  ? 252 THR G O   1 
ATOM   5424 C CB  . THR G 2 162 ? -34.669 30.162  6.786   1.00 21.11  ? 252 THR G CB  1 
ATOM   5425 O OG1 . THR G 2 162 ? -33.305 30.538  6.635   1.00 19.63  ? 252 THR G OG1 1 
ATOM   5426 C CG2 . THR G 2 162 ? -34.929 28.799  6.132   1.00 15.88  ? 252 THR G CG2 1 
ATOM   5427 N N   . SER G 2 163 ? -34.783 33.637  6.385   1.00 27.36  ? 253 SER G N   1 
ATOM   5428 C CA  . SER G 2 163 ? -34.516 34.899  7.099   1.00 28.60  ? 253 SER G CA  1 
ATOM   5429 C C   . SER G 2 163 ? -35.724 35.849  6.946   1.00 35.58  ? 253 SER G C   1 
ATOM   5430 O O   . SER G 2 163 ? -35.601 36.934  6.381   1.00 37.74  ? 253 SER G O   1 
ATOM   5431 C CB  . SER G 2 163 ? -33.223 35.532  6.601   1.00 32.06  ? 253 SER G CB  1 
ATOM   5432 O OG  . SER G 2 163 ? -33.197 35.537  5.184   1.00 43.50  ? 253 SER G OG  1 
ATOM   5433 N N   . SER G 2 164 ? -36.897 35.418  7.462   1.00 31.12  ? 254 SER G N   1 
ATOM   5434 C CA  . SER G 2 164 ? -38.177 36.116  7.338   1.00 29.73  ? 254 SER G CA  1 
ATOM   5435 C C   . SER G 2 164 ? -38.816 36.492  8.679   1.00 32.34  ? 254 SER G C   1 
ATOM   5436 O O   . SER G 2 164 ? -40.001 36.804  8.702   1.00 31.23  ? 254 SER G O   1 
ATOM   5437 C CB  . SER G 2 164 ? -39.153 35.234  6.556   1.00 32.72  ? 254 SER G CB  1 
ATOM   5438 O OG  . SER G 2 164 ? -39.395 33.992  7.201   1.00 35.38  ? 254 SER G OG  1 
ATOM   5439 N N   . ALA G 2 165 ? -38.050 36.500  9.772   1.00 29.89  ? 255 ALA G N   1 
ATOM   5440 C CA  . ALA G 2 165 ? -38.552 36.797  11.118  1.00 31.12  ? 255 ALA G CA  1 
ATOM   5441 C C   . ALA G 2 165 ? -39.103 38.235  11.317  1.00 38.37  ? 255 ALA G C   1 
ATOM   5442 O O   . ALA G 2 165 ? -39.864 38.450  12.268  1.00 39.21  ? 255 ALA G O   1 
ATOM   5443 C CB  . ALA G 2 165 ? -37.462 36.530  12.150  1.00 31.75  ? 255 ALA G CB  1 
ATOM   5444 N N   . LYS G 2 166 ? -38.747 39.197  10.437  1.00 35.95  ? 256 LYS G N   1 
ATOM   5445 C CA  . LYS G 2 166 ? -39.164 40.598  10.596  1.00 36.02  ? 256 LYS G CA  1 
ATOM   5446 C C   . LYS G 2 166 ? -40.068 41.127  9.453   1.00 41.33  ? 256 LYS G C   1 
ATOM   5447 O O   . LYS G 2 166 ? -40.402 42.320  9.447   1.00 41.68  ? 256 LYS G O   1 
ATOM   5448 C CB  . LYS G 2 166 ? -37.927 41.505  10.759  1.00 37.97  ? 256 LYS G CB  1 
ATOM   5449 C CG  . LYS G 2 166 ? -37.211 41.301  12.102  1.00 35.04  ? 256 LYS G CG  1 
ATOM   5450 C CD  . LYS G 2 166 ? -35.791 41.805  12.078  1.00 33.77  ? 256 LYS G CD  1 
ATOM   5451 N N   . VAL G 2 167 ? -40.490 40.260  8.516   1.00 38.28  ? 257 VAL G N   1 
ATOM   5452 C CA  . VAL G 2 167 ? -41.395 40.669  7.430   1.00 37.80  ? 257 VAL G CA  1 
ATOM   5453 C C   . VAL G 2 167 ? -42.665 39.818  7.495   1.00 41.85  ? 257 VAL G C   1 
ATOM   5454 O O   . VAL G 2 167 ? -42.582 38.613  7.749   1.00 41.84  ? 257 VAL G O   1 
ATOM   5455 C CB  . VAL G 2 167 ? -40.723 40.614  6.033   1.00 41.70  ? 257 VAL G CB  1 
ATOM   5456 C CG1 . VAL G 2 167 ? -41.735 40.803  4.903   1.00 41.03  ? 257 VAL G CG1 1 
ATOM   5457 C CG2 . VAL G 2 167 ? -39.620 41.658  5.920   1.00 41.44  ? 257 VAL G CG2 1 
ATOM   5458 N N   . ASP G 2 168 ? -43.837 40.454  7.290   1.00 37.60  ? 258 ASP G N   1 
ATOM   5459 C CA  . ASP G 2 168 ? -45.125 39.777  7.309   1.00 36.97  ? 258 ASP G CA  1 
ATOM   5460 C C   . ASP G 2 168 ? -45.559 39.440  5.887   1.00 41.27  ? 258 ASP G C   1 
ATOM   5461 O O   . ASP G 2 168 ? -45.921 40.329  5.103   1.00 41.88  ? 258 ASP G O   1 
ATOM   5462 C CB  . ASP G 2 168 ? -46.200 40.611  8.037   1.00 38.40  ? 258 ASP G CB  1 
ATOM   5463 C CG  . ASP G 2 168 ? -46.041 40.723  9.544   1.00 49.61  ? 258 ASP G CG  1 
ATOM   5464 O OD1 . ASP G 2 168 ? -46.536 41.707  10.115  1.00 52.03  ? 258 ASP G OD1 1 
ATOM   5465 O OD2 . ASP G 2 168 ? -45.438 39.815  10.153  1.00 56.00  ? 258 ASP G OD2 1 
ATOM   5466 N N   . MET G 2 169 ? -45.492 38.140  5.560   1.00 37.22  ? 259 MET G N   1 
ATOM   5467 C CA  . MET G 2 169 ? -45.876 37.580  4.259   1.00 36.85  ? 259 MET G CA  1 
ATOM   5468 C C   . MET G 2 169 ? -47.262 36.960  4.369   1.00 39.29  ? 259 MET G C   1 
ATOM   5469 O O   . MET G 2 169 ? -47.702 36.628  5.479   1.00 38.66  ? 259 MET G O   1 
ATOM   5470 C CB  . MET G 2 169 ? -44.866 36.507  3.803   1.00 39.28  ? 259 MET G CB  1 
ATOM   5471 C CG  . MET G 2 169 ? -43.463 37.016  3.542   1.00 43.14  ? 259 MET G CG  1 
ATOM   5472 S SD  . MET G 2 169 ? -42.254 35.668  3.415   1.00 47.89  ? 259 MET G SD  1 
ATOM   5473 C CE  . MET G 2 169 ? -42.372 34.965  5.010   1.00 44.49  ? 259 MET G CE  1 
ATOM   5474 N N   . THR G 2 170 ? -47.944 36.773  3.224   1.00 34.21  ? 260 THR G N   1 
ATOM   5475 C CA  . THR G 2 170 ? -49.268 36.137  3.191   1.00 33.71  ? 260 THR G CA  1 
ATOM   5476 C C   . THR G 2 170 ? -49.105 34.617  3.366   1.00 36.79  ? 260 THR G C   1 
ATOM   5477 O O   . THR G 2 170 ? -47.986 34.104  3.248   1.00 37.12  ? 260 THR G O   1 
ATOM   5478 C CB  . THR G 2 170 ? -50.011 36.475  1.885   1.00 41.67  ? 260 THR G CB  1 
ATOM   5479 O OG1 . THR G 2 170 ? -49.320 35.873  0.782   1.00 40.21  ? 260 THR G OG1 1 
ATOM   5480 C CG2 . THR G 2 170 ? -50.187 37.997  1.662   1.00 38.64  ? 260 THR G CG2 1 
ATOM   5481 N N   . PHE G 2 171 ? -50.211 33.888  3.614   1.00 31.87  ? 261 PHE G N   1 
ATOM   5482 C CA  . PHE G 2 171 ? -50.154 32.433  3.777   1.00 30.30  ? 261 PHE G CA  1 
ATOM   5483 C C   . PHE G 2 171 ? -49.692 31.768  2.473   1.00 31.13  ? 261 PHE G C   1 
ATOM   5484 O O   . PHE G 2 171 ? -48.854 30.858  2.492   1.00 31.65  ? 261 PHE G O   1 
ATOM   5485 C CB  . PHE G 2 171 ? -51.518 31.881  4.243   1.00 31.77  ? 261 PHE G CB  1 
ATOM   5486 C CG  . PHE G 2 171 ? -51.651 30.378  4.182   1.00 32.29  ? 261 PHE G CG  1 
ATOM   5487 C CD1 . PHE G 2 171 ? -51.088 29.573  5.166   1.00 34.56  ? 261 PHE G CD1 1 
ATOM   5488 C CD2 . PHE G 2 171 ? -52.365 29.770  3.158   1.00 34.09  ? 261 PHE G CD2 1 
ATOM   5489 C CE1 . PHE G 2 171 ? -51.195 28.182  5.098   1.00 34.84  ? 261 PHE G CE1 1 
ATOM   5490 C CE2 . PHE G 2 171 ? -52.489 28.378  3.101   1.00 36.23  ? 261 PHE G CE2 1 
ATOM   5491 C CZ  . PHE G 2 171 ? -51.900 27.593  4.070   1.00 33.95  ? 261 PHE G CZ  1 
ATOM   5492 N N   . GLU G 2 172 ? -50.219 32.256  1.350   1.00 25.64  ? 262 GLU G N   1 
ATOM   5493 C CA  . GLU G 2 172 ? -49.925 31.805  -0.013  1.00 25.05  ? 262 GLU G CA  1 
ATOM   5494 C C   . GLU G 2 172 ? -48.417 31.910  -0.323  1.00 26.23  ? 262 GLU G C   1 
ATOM   5495 O O   . GLU G 2 172 ? -47.856 31.016  -0.945  1.00 25.14  ? 262 GLU G O   1 
ATOM   5496 C CB  . GLU G 2 172 ? -50.751 32.622  -1.027  1.00 26.72  ? 262 GLU G CB  1 
ATOM   5497 C CG  . GLU G 2 172 ? -52.255 32.360  -0.989  1.00 38.99  ? 262 GLU G CG  1 
ATOM   5498 C CD  . GLU G 2 172 ? -53.090 32.949  0.139   1.00 61.00  ? 262 GLU G CD  1 
ATOM   5499 O OE1 . GLU G 2 172 ? -54.230 32.462  0.332   1.00 55.17  ? 262 GLU G OE1 1 
ATOM   5500 O OE2 . GLU G 2 172 ? -52.626 33.900  0.814   1.00 51.16  ? 262 GLU G OE2 1 
ATOM   5501 N N   . GLU G 2 173 ? -47.767 32.973  0.174   1.00 22.51  ? 263 GLU G N   1 
ATOM   5502 C CA  . GLU G 2 173 ? -46.334 33.238  0.035   1.00 21.91  ? 263 GLU G CA  1 
ATOM   5503 C C   . GLU G 2 173 ? -45.517 32.261  0.892   1.00 25.35  ? 263 GLU G C   1 
ATOM   5504 O O   . GLU G 2 173 ? -44.522 31.726  0.405   1.00 27.19  ? 263 GLU G O   1 
ATOM   5505 C CB  . GLU G 2 173 ? -46.013 34.693  0.432   1.00 22.89  ? 263 GLU G CB  1 
ATOM   5506 C CG  . GLU G 2 173 ? -46.381 35.710  -0.633  1.00 27.89  ? 263 GLU G CG  1 
ATOM   5507 C CD  . GLU G 2 173 ? -46.258 37.172  -0.238  1.00 32.76  ? 263 GLU G CD  1 
ATOM   5508 O OE1 . GLU G 2 173 ? -46.010 37.991  -1.144  1.00 10.05  ? 263 GLU G OE1 1 
ATOM   5509 O OE2 . GLU G 2 173 ? -46.418 37.510  0.956   1.00 30.12  ? 263 GLU G OE2 1 
ATOM   5510 N N   . GLU G 2 174 ? -45.934 32.043  2.155   1.00 19.83  ? 264 GLU G N   1 
ATOM   5511 C CA  . GLU G 2 174 ? -45.302 31.123  3.103   1.00 19.92  ? 264 GLU G CA  1 
ATOM   5512 C C   . GLU G 2 174 ? -45.278 29.694  2.533   1.00 24.49  ? 264 GLU G C   1 
ATOM   5513 O O   . GLU G 2 174 ? -44.223 29.059  2.542   1.00 23.54  ? 264 GLU G O   1 
ATOM   5514 C CB  . GLU G 2 174 ? -46.026 31.140  4.465   1.00 20.98  ? 264 GLU G CB  1 
ATOM   5515 C CG  . GLU G 2 174 ? -45.884 32.426  5.256   1.00 28.68  ? 264 GLU G CG  1 
ATOM   5516 C CD  . GLU G 2 174 ? -44.645 32.605  6.114   1.00 49.73  ? 264 GLU G CD  1 
ATOM   5517 O OE1 . GLU G 2 174 ? -43.748 31.732  6.077   1.00 39.97  ? 264 GLU G OE1 1 
ATOM   5518 O OE2 . GLU G 2 174 ? -44.560 33.642  6.811   1.00 48.34  ? 264 GLU G OE2 1 
ATOM   5519 N N   . ALA G 2 175 ? -46.437 29.225  1.994   1.00 21.47  ? 265 ALA G N   1 
ATOM   5520 C CA  . ALA G 2 175 ? -46.622 27.909  1.386   1.00 20.95  ? 265 ALA G CA  1 
ATOM   5521 C C   . ALA G 2 175 ? -45.731 27.735  0.149   1.00 24.66  ? 265 ALA G C   1 
ATOM   5522 O O   . ALA G 2 175 ? -45.049 26.707  0.027   1.00 22.96  ? 265 ALA G O   1 
ATOM   5523 C CB  . ALA G 2 175 ? -48.083 27.701  1.023   1.00 21.48  ? 265 ALA G CB  1 
ATOM   5524 N N   . GLN G 2 176 ? -45.696 28.760  -0.729  1.00 21.73  ? 266 GLN G N   1 
ATOM   5525 C CA  . GLN G 2 176 ? -44.872 28.795  -1.944  1.00 21.80  ? 266 GLN G CA  1 
ATOM   5526 C C   . GLN G 2 176 ? -43.374 28.683  -1.584  1.00 25.51  ? 266 GLN G C   1 
ATOM   5527 O O   . GLN G 2 176 ? -42.621 27.973  -2.253  1.00 24.83  ? 266 GLN G O   1 
ATOM   5528 C CB  . GLN G 2 176 ? -45.137 30.096  -2.717  1.00 23.51  ? 266 GLN G CB  1 
ATOM   5529 C CG  . GLN G 2 176 ? -44.955 29.992  -4.233  1.00 31.09  ? 266 GLN G CG  1 
ATOM   5530 C CD  . GLN G 2 176 ? -44.912 31.341  -4.933  1.00 41.49  ? 266 GLN G CD  1 
ATOM   5531 O OE1 . GLN G 2 176 ? -45.274 32.389  -4.381  1.00 33.99  ? 266 GLN G OE1 1 
ATOM   5532 N NE2 . GLN G 2 176 ? -44.458 31.349  -6.184  1.00 27.86  ? 266 GLN G NE2 1 
ATOM   5533 N N   . LEU G 2 177 ? -42.959 29.372  -0.502  1.00 21.64  ? 267 LEU G N   1 
ATOM   5534 C CA  . LEU G 2 177 ? -41.571 29.377  -0.043  1.00 21.28  ? 267 LEU G CA  1 
ATOM   5535 C C   . LEU G 2 177 ? -41.202 28.064  0.660   1.00 22.13  ? 267 LEU G C   1 
ATOM   5536 O O   . LEU G 2 177 ? -40.024 27.696  0.656   1.00 21.53  ? 267 LEU G O   1 
ATOM   5537 C CB  . LEU G 2 177 ? -41.301 30.581  0.863   1.00 21.89  ? 267 LEU G CB  1 
ATOM   5538 C CG  . LEU G 2 177 ? -40.920 31.859  0.118   1.00 28.47  ? 267 LEU G CG  1 
ATOM   5539 C CD1 . LEU G 2 177 ? -41.275 33.080  0.900   1.00 28.63  ? 267 LEU G CD1 1 
ATOM   5540 C CD2 . LEU G 2 177 ? -39.437 31.896  -0.210  1.00 32.49  ? 267 LEU G CD2 1 
ATOM   5541 N N   . LEU G 2 178 ? -42.198 27.365  1.260   1.00 17.36  ? 268 LEU G N   1 
ATOM   5542 C CA  . LEU G 2 178 ? -42.016 26.054  1.890   1.00 16.05  ? 268 LEU G CA  1 
ATOM   5543 C C   . LEU G 2 178 ? -41.744 25.030  0.816   1.00 19.62  ? 268 LEU G C   1 
ATOM   5544 O O   . LEU G 2 178 ? -40.836 24.206  0.965   1.00 17.94  ? 268 LEU G O   1 
ATOM   5545 C CB  . LEU G 2 178 ? -43.221 25.631  2.739   1.00 15.94  ? 268 LEU G CB  1 
ATOM   5546 C CG  . LEU G 2 178 ? -43.188 26.043  4.217   1.00 19.89  ? 268 LEU G CG  1 
ATOM   5547 C CD1 . LEU G 2 178 ? -44.531 25.799  4.861   1.00 19.81  ? 268 LEU G CD1 1 
ATOM   5548 C CD2 . LEU G 2 178 ? -42.109 25.285  4.996   1.00 20.54  ? 268 LEU G CD2 1 
ATOM   5549 N N   . GLN G 2 179 ? -42.486 25.122  -0.304  1.00 16.58  ? 269 GLN G N   1 
ATOM   5550 C CA  . GLN G 2 179 ? -42.313 24.239  -1.458  1.00 16.39  ? 269 GLN G CA  1 
ATOM   5551 C C   . GLN G 2 179 ? -40.926 24.388  -2.062  1.00 20.44  ? 269 GLN G C   1 
ATOM   5552 O O   . GLN G 2 179 ? -40.334 23.401  -2.502  1.00 21.39  ? 269 GLN G O   1 
ATOM   5553 C CB  . GLN G 2 179 ? -43.382 24.512  -2.529  1.00 17.84  ? 269 GLN G CB  1 
ATOM   5554 C CG  . GLN G 2 179 ? -44.799 24.050  -2.152  1.00 35.82  ? 269 GLN G CG  1 
ATOM   5555 C CD  . GLN G 2 179 ? -44.885 22.566  -1.855  1.00 72.89  ? 269 GLN G CD  1 
ATOM   5556 O OE1 . GLN G 2 179 ? -45.013 21.725  -2.755  1.00 71.80  ? 269 GLN G OE1 1 
ATOM   5557 N NE2 . GLN G 2 179 ? -44.829 22.209  -0.580  1.00 70.05  ? 269 GLN G NE2 1 
ATOM   5558 N N   . LEU G 2 180 ? -40.400 25.609  -2.048  1.00 16.16  ? 270 LEU G N   1 
ATOM   5559 C CA  . LEU G 2 180 ? -39.093 25.971  -2.585  1.00 15.17  ? 270 LEU G CA  1 
ATOM   5560 C C   . LEU G 2 180 ? -37.987 25.491  -1.666  1.00 15.02  ? 270 LEU G C   1 
ATOM   5561 O O   . LEU G 2 180 ? -36.983 25.002  -2.147  1.00 16.91  ? 270 LEU G O   1 
ATOM   5562 C CB  . LEU G 2 180 ? -39.053 27.502  -2.747  1.00 15.06  ? 270 LEU G CB  1 
ATOM   5563 C CG  . LEU G 2 180 ? -38.191 28.103  -3.862  1.00 20.23  ? 270 LEU G CG  1 
ATOM   5564 C CD1 . LEU G 2 180 ? -38.462 27.491  -5.239  1.00 20.33  ? 270 LEU G CD1 1 
ATOM   5565 C CD2 . LEU G 2 180 ? -38.422 29.604  -3.935  1.00 22.96  ? 270 LEU G CD2 1 
ATOM   5566 N N   . LYS G 2 181 ? -38.173 25.621  -0.355  1.00 8.54   ? 271 LYS G N   1 
ATOM   5567 C CA  . LYS G 2 181 ? -37.214 25.193  0.664   1.00 6.87   ? 271 LYS G CA  1 
ATOM   5568 C C   . LYS G 2 181 ? -36.959 23.678  0.583   1.00 13.92  ? 271 LYS G C   1 
ATOM   5569 O O   . LYS G 2 181 ? -35.802 23.269  0.642   1.00 15.98  ? 271 LYS G O   1 
ATOM   5570 C CB  . LYS G 2 181 ? -37.751 25.587  2.038   1.00 8.97   ? 271 LYS G CB  1 
ATOM   5571 C CG  . LYS G 2 181 ? -36.782 25.314  3.177   1.00 15.89  ? 271 LYS G CG  1 
ATOM   5572 C CD  . LYS G 2 181 ? -37.175 26.084  4.406   1.00 20.31  ? 271 LYS G CD  1 
ATOM   5573 C CE  . LYS G 2 181 ? -38.029 25.310  5.367   1.00 23.41  ? 271 LYS G CE  1 
ATOM   5574 N NZ  . LYS G 2 181 ? -37.662 25.669  6.759   1.00 34.72  ? 271 LYS G NZ  1 
ATOM   5575 N N   . VAL G 2 182 ? -38.033 22.856  0.412   1.00 8.54   ? 272 VAL G N   1 
ATOM   5576 C CA  . VAL G 2 182 ? -37.977 21.392  0.300   1.00 7.44   ? 272 VAL G CA  1 
ATOM   5577 C C   . VAL G 2 182 ? -37.205 21.041  -0.973  1.00 14.19  ? 272 VAL G C   1 
ATOM   5578 O O   . VAL G 2 182 ? -36.355 20.163  -0.919  1.00 17.79  ? 272 VAL G O   1 
ATOM   5579 C CB  . VAL G 2 182 ? -39.409 20.728  0.342   1.00 11.96  ? 272 VAL G CB  1 
ATOM   5580 C CG1 . VAL G 2 182 ? -39.360 19.211  0.239   1.00 11.06  ? 272 VAL G CG1 1 
ATOM   5581 C CG2 . VAL G 2 182 ? -40.178 21.120  1.592   1.00 11.76  ? 272 VAL G CG2 1 
ATOM   5582 N N   . LYS G 2 183 ? -37.457 21.737  -2.098  1.00 9.72   ? 273 LYS G N   1 
ATOM   5583 C CA  . LYS G 2 183 ? -36.736 21.504  -3.357  1.00 9.34   ? 273 LYS G CA  1 
ATOM   5584 C C   . LYS G 2 183 ? -35.237 21.825  -3.195  1.00 16.82  ? 273 LYS G C   1 
ATOM   5585 O O   . LYS G 2 183 ? -34.409 21.054  -3.670  1.00 16.99  ? 273 LYS G O   1 
ATOM   5586 C CB  . LYS G 2 183 ? -37.311 22.339  -4.496  1.00 10.08  ? 273 LYS G CB  1 
ATOM   5587 C CG  . LYS G 2 183 ? -38.647 21.853  -5.028  1.00 23.74  ? 273 LYS G CG  1 
ATOM   5588 C CD  . LYS G 2 183 ? -39.172 22.785  -6.128  1.00 19.98  ? 273 LYS G CD  1 
ATOM   5589 C CE  . LYS G 2 183 ? -40.350 22.223  -6.866  1.00 35.45  ? 273 LYS G CE  1 
ATOM   5590 N NZ  . LYS G 2 183 ? -40.145 22.195  -8.354  1.00 42.49  ? 273 LYS G NZ  1 
ATOM   5591 N N   . CYS G 2 184 ? -34.898 22.932  -2.485  1.00 13.07  ? 274 CYS G N   1 
ATOM   5592 C CA  . CYS G 2 184 ? -33.513 23.348  -2.241  1.00 12.29  ? 274 CYS G CA  1 
ATOM   5593 C C   . CYS G 2 184 ? -32.797 22.394  -1.297  1.00 13.32  ? 274 CYS G C   1 
ATOM   5594 O O   . CYS G 2 184 ? -31.625 22.102  -1.543  1.00 10.95  ? 274 CYS G O   1 
ATOM   5595 C CB  . CYS G 2 184 ? -33.448 24.781  -1.730  1.00 13.49  ? 274 CYS G CB  1 
ATOM   5596 S SG  . CYS G 2 184 ? -34.040 26.011  -2.921  1.00 17.66  ? 274 CYS G SG  1 
ATOM   5597 N N   . LEU G 2 185 ? -33.486 21.899  -0.242  1.00 10.49  ? 275 LEU G N   1 
ATOM   5598 C CA  . LEU G 2 185 ? -32.934 20.954  0.737   1.00 11.37  ? 275 LEU G CA  1 
ATOM   5599 C C   . LEU G 2 185 ? -32.662 19.587  0.109   1.00 17.55  ? 275 LEU G C   1 
ATOM   5600 O O   . LEU G 2 185 ? -31.695 18.940  0.474   1.00 19.10  ? 275 LEU G O   1 
ATOM   5601 C CB  . LEU G 2 185 ? -33.885 20.782  1.930   1.00 11.42  ? 275 LEU G CB  1 
ATOM   5602 C CG  . LEU G 2 185 ? -33.798 21.818  3.027   1.00 15.89  ? 275 LEU G CG  1 
ATOM   5603 C CD1 . LEU G 2 185 ? -35.005 21.715  3.952   1.00 16.94  ? 275 LEU G CD1 1 
ATOM   5604 C CD2 . LEU G 2 185 ? -32.533 21.656  3.858   1.00 14.81  ? 275 LEU G CD2 1 
ATOM   5605 N N   . ASN G 2 186 ? -33.526 19.158  -0.816  1.00 13.77  ? 276 ASN G N   1 
ATOM   5606 C CA  . ASN G 2 186 ? -33.423 17.907  -1.539  1.00 13.54  ? 276 ASN G CA  1 
ATOM   5607 C C   . ASN G 2 186 ? -32.256 17.996  -2.533  1.00 17.99  ? 276 ASN G C   1 
ATOM   5608 O O   . ASN G 2 186 ? -31.548 17.006  -2.732  1.00 17.69  ? 276 ASN G O   1 
ATOM   5609 C CB  . ASN G 2 186 ? -34.757 17.580  -2.251  1.00 8.37   ? 276 ASN G CB  1 
ATOM   5610 C CG  . ASN G 2 186 ? -35.088 16.096  -2.355  1.00 24.17  ? 276 ASN G CG  1 
ATOM   5611 O OD1 . ASN G 2 186 ? -34.231 15.215  -2.224  1.00 16.82  ? 276 ASN G OD1 1 
ATOM   5612 N ND2 . ASN G 2 186 ? -36.355 15.783  -2.582  1.00 7.59   ? 276 ASN G ND2 1 
ATOM   5613 N N   . ASN G 2 187 ? -32.067 19.186  -3.145  1.00 13.24  ? 277 ASN G N   1 
ATOM   5614 C CA  . ASN G 2 187 ? -30.976 19.518  -4.066  1.00 12.85  ? 277 ASN G CA  1 
ATOM   5615 C C   . ASN G 2 187 ? -29.661 19.580  -3.312  1.00 17.45  ? 277 ASN G C   1 
ATOM   5616 O O   . ASN G 2 187 ? -28.634 19.158  -3.844  1.00 20.64  ? 277 ASN G O   1 
ATOM   5617 C CB  . ASN G 2 187 ? -31.264 20.861  -4.747  1.00 14.34  ? 277 ASN G CB  1 
ATOM   5618 C CG  . ASN G 2 187 ? -32.244 20.769  -5.874  1.00 18.43  ? 277 ASN G CG  1 
ATOM   5619 O OD1 . ASN G 2 187 ? -32.843 19.730  -6.102  1.00 12.56  ? 277 ASN G OD1 1 
ATOM   5620 N ND2 . ASN G 2 187 ? -32.413 21.851  -6.618  1.00 10.50  ? 277 ASN G ND2 1 
ATOM   5621 N N   . LEU G 2 188 ? -29.693 20.112  -2.066  1.00 11.30  ? 278 LEU G N   1 
ATOM   5622 C CA  . LEU G 2 188 ? -28.555 20.176  -1.161  1.00 9.89   ? 278 LEU G CA  1 
ATOM   5623 C C   . LEU G 2 188 ? -28.152 18.743  -0.814  1.00 18.07  ? 278 LEU G C   1 
ATOM   5624 O O   . LEU G 2 188 ? -26.967 18.419  -0.844  1.00 19.03  ? 278 LEU G O   1 
ATOM   5625 C CB  . LEU G 2 188 ? -28.915 20.989  0.086   1.00 9.11   ? 278 LEU G CB  1 
ATOM   5626 C CG  . LEU G 2 188 ? -27.809 21.324  1.077   1.00 13.23  ? 278 LEU G CG  1 
ATOM   5627 C CD1 . LEU G 2 188 ? -26.645 22.037  0.415   1.00 12.83  ? 278 LEU G CD1 1 
ATOM   5628 C CD2 . LEU G 2 188 ? -28.332 22.153  2.188   1.00 18.09  ? 278 LEU G CD2 1 
ATOM   5629 N N   . ALA G 2 189 ? -29.162 17.861  -0.597  1.00 16.14  ? 279 ALA G N   1 
ATOM   5630 C CA  . ALA G 2 189 ? -28.965 16.434  -0.284  1.00 15.76  ? 279 ALA G CA  1 
ATOM   5631 C C   . ALA G 2 189 ? -28.268 15.697  -1.428  1.00 15.30  ? 279 ALA G C   1 
ATOM   5632 O O   . ALA G 2 189 ? -27.330 14.943  -1.189  1.00 16.32  ? 279 ALA G O   1 
ATOM   5633 C CB  . ALA G 2 189 ? -30.299 15.783  0.019   1.00 16.95  ? 279 ALA G CB  1 
ATOM   5634 N N   . ALA G 2 190 ? -28.684 15.953  -2.660  1.00 8.75   ? 280 ALA G N   1 
ATOM   5635 C CA  . ALA G 2 190 ? -28.082 15.365  -3.848  1.00 9.32   ? 280 ALA G CA  1 
ATOM   5636 C C   . ALA G 2 190 ? -26.627 15.793  -3.999  1.00 15.86  ? 280 ALA G C   1 
ATOM   5637 O O   . ALA G 2 190 ? -25.815 15.032  -4.533  1.00 17.94  ? 280 ALA G O   1 
ATOM   5638 C CB  . ALA G 2 190 ? -28.868 15.781  -5.080  1.00 9.92   ? 280 ALA G CB  1 
ATOM   5639 N N   . SER G 2 191 ? -26.312 17.025  -3.562  1.00 10.21  ? 281 SER G N   1 
ATOM   5640 C CA  . SER G 2 191 ? -24.979 17.609  -3.651  1.00 8.57   ? 281 SER G CA  1 
ATOM   5641 C C   . SER G 2 191 ? -24.056 17.055  -2.576  1.00 12.46  ? 281 SER G C   1 
ATOM   5642 O O   . SER G 2 191 ? -22.944 16.654  -2.903  1.00 13.08  ? 281 SER G O   1 
ATOM   5643 C CB  . SER G 2 191 ? -25.062 19.135  -3.567  1.00 8.15   ? 281 SER G CB  1 
ATOM   5644 O OG  . SER G 2 191 ? -25.770 19.634  -4.693  1.00 9.07   ? 281 SER G OG  1 
ATOM   5645 N N   . GLN G 2 192 ? -24.501 17.008  -1.312  1.00 6.84   ? 282 GLN G N   1 
ATOM   5646 C CA  . GLN G 2 192 ? -23.716 16.503  -0.189  1.00 8.53   ? 282 GLN G CA  1 
ATOM   5647 C C   . GLN G 2 192 ? -23.400 15.001  -0.335  1.00 17.08  ? 282 GLN G C   1 
ATOM   5648 O O   . GLN G 2 192 ? -22.284 14.590  -0.028  1.00 18.40  ? 282 GLN G O   1 
ATOM   5649 C CB  . GLN G 2 192 ? -24.452 16.787  1.136   1.00 10.21  ? 282 GLN G CB  1 
ATOM   5650 C CG  . GLN G 2 192 ? -24.689 18.284  1.353   1.00 10.02  ? 282 GLN G CG  1 
ATOM   5651 C CD  . GLN G 2 192 ? -25.695 18.602  2.415   1.00 21.56  ? 282 GLN G CD  1 
ATOM   5652 O OE1 . GLN G 2 192 ? -26.814 18.066  2.437   1.00 12.08  ? 282 GLN G OE1 1 
ATOM   5653 N NE2 . GLN G 2 192 ? -25.343 19.562  3.277   1.00 12.83  ? 282 GLN G NE2 1 
ATOM   5654 N N   . LEU G 2 193 ? -24.359 14.198  -0.835  1.00 17.02  ? 283 LEU G N   1 
ATOM   5655 C CA  . LEU G 2 193 ? -24.205 12.754  -1.101  1.00 17.35  ? 283 LEU G CA  1 
ATOM   5656 C C   . LEU G 2 193 ? -23.054 12.523  -2.102  1.00 20.64  ? 283 LEU G C   1 
ATOM   5657 O O   . LEU G 2 193 ? -22.246 11.607  -1.923  1.00 19.27  ? 283 LEU G O   1 
ATOM   5658 C CB  . LEU G 2 193 ? -25.541 12.161  -1.638  1.00 17.87  ? 283 LEU G CB  1 
ATOM   5659 C CG  . LEU G 2 193 ? -25.544 10.747  -2.277  1.00 23.86  ? 283 LEU G CG  1 
ATOM   5660 C CD1 . LEU G 2 193 ? -24.992 9.678   -1.315  1.00 25.01  ? 283 LEU G CD1 1 
ATOM   5661 C CD2 . LEU G 2 193 ? -26.951 10.345  -2.729  1.00 21.34  ? 283 LEU G CD2 1 
ATOM   5662 N N   . LYS G 2 194 ? -22.958 13.386  -3.123  1.00 17.12  ? 284 LYS G N   1 
ATOM   5663 C CA  . LYS G 2 194 ? -21.894 13.328  -4.117  1.00 16.57  ? 284 LYS G CA  1 
ATOM   5664 C C   . LYS G 2 194 ? -20.524 13.682  -3.518  1.00 21.96  ? 284 LYS G C   1 
ATOM   5665 O O   . LYS G 2 194 ? -19.500 13.272  -4.062  1.00 24.38  ? 284 LYS G O   1 
ATOM   5666 C CB  . LYS G 2 194 ? -22.217 14.248  -5.292  1.00 17.56  ? 284 LYS G CB  1 
ATOM   5667 C CG  . LYS G 2 194 ? -23.305 13.697  -6.217  1.00 19.89  ? 284 LYS G CG  1 
ATOM   5668 C CD  . LYS G 2 194 ? -22.766 12.628  -7.157  1.00 16.60  ? 284 LYS G CD  1 
ATOM   5669 C CE  . LYS G 2 194 ? -23.840 11.975  -7.993  1.00 20.76  ? 284 LYS G CE  1 
ATOM   5670 N NZ  . LYS G 2 194 ? -24.758 11.143  -7.175  1.00 28.97  ? 284 LYS G NZ  1 
ATOM   5671 N N   . LEU G 2 195 ? -20.505 14.410  -2.402  1.00 18.45  ? 285 LEU G N   1 
ATOM   5672 C CA  . LEU G 2 195 ? -19.285 14.834  -1.704  1.00 17.77  ? 285 LEU G CA  1 
ATOM   5673 C C   . LEU G 2 195 ? -18.986 13.941  -0.508  1.00 22.22  ? 285 LEU G C   1 
ATOM   5674 O O   . LEU G 2 195 ? -18.125 14.262  0.312   1.00 22.59  ? 285 LEU G O   1 
ATOM   5675 C CB  . LEU G 2 195 ? -19.443 16.298  -1.237  1.00 17.68  ? 285 LEU G CB  1 
ATOM   5676 C CG  . LEU G 2 195 ? -19.361 17.369  -2.318  1.00 22.52  ? 285 LEU G CG  1 
ATOM   5677 C CD1 . LEU G 2 195 ? -19.886 18.709  -1.786  1.00 22.29  ? 285 LEU G CD1 1 
ATOM   5678 C CD2 . LEU G 2 195 ? -17.953 17.521  -2.842  1.00 22.40  ? 285 LEU G CD2 1 
ATOM   5679 N N   . ASP G 2 196 ? -19.710 12.829  -0.392  1.00 19.30  ? 286 ASP G N   1 
ATOM   5680 C CA  . ASP G 2 196 ? -19.631 11.857  0.699   1.00 19.33  ? 286 ASP G CA  1 
ATOM   5681 C C   . ASP G 2 196 ? -19.833 12.537  2.059   1.00 24.56  ? 286 ASP G C   1 
ATOM   5682 O O   . ASP G 2 196 ? -19.347 12.024  3.066   1.00 24.83  ? 286 ASP G O   1 
ATOM   5683 C CB  . ASP G 2 196 ? -18.318 11.034  0.674   1.00 21.55  ? 286 ASP G CB  1 
ATOM   5684 C CG  . ASP G 2 196 ? -18.006 10.269  -0.595  1.00 28.47  ? 286 ASP G CG  1 
ATOM   5685 O OD1 . ASP G 2 196 ? -18.896 10.182  -1.477  1.00 28.49  ? 286 ASP G OD1 1 
ATOM   5686 O OD2 . ASP G 2 196 ? -16.886 9.720   -0.691  1.00 35.80  ? 286 ASP G OD2 1 
ATOM   5687 N N   . HIS G 2 197 ? -20.566 13.676  2.101   1.00 22.45  ? 287 HIS G N   1 
ATOM   5688 C CA  . HIS G 2 197 ? -20.853 14.306  3.387   1.00 23.94  ? 287 HIS G CA  1 
ATOM   5689 C C   . HIS G 2 197 ? -22.183 13.734  3.870   1.00 26.38  ? 287 HIS G C   1 
ATOM   5690 O O   . HIS G 2 197 ? -23.214 14.414  3.924   1.00 26.61  ? 287 HIS G O   1 
ATOM   5691 C CB  . HIS G 2 197 ? -20.817 15.855  3.391   1.00 25.89  ? 287 HIS G CB  1 
ATOM   5692 C CG  . HIS G 2 197 ? -20.790 16.405  4.797   1.00 30.70  ? 287 HIS G CG  1 
ATOM   5693 N ND1 . HIS G 2 197 ? -20.617 17.755  5.051   1.00 33.48  ? 287 HIS G ND1 1 
ATOM   5694 C CD2 . HIS G 2 197 ? -20.956 15.755  5.984   1.00 33.13  ? 287 HIS G CD2 1 
ATOM   5695 C CE1 . HIS G 2 197 ? -20.670 17.879  6.372   1.00 33.21  ? 287 HIS G CE1 1 
ATOM   5696 N NE2 . HIS G 2 197 ? -20.867 16.700  6.975   1.00 33.32  ? 287 HIS G NE2 1 
ATOM   5697 N N   . TYR G 2 198 ? -22.107 12.461  4.257   1.00 19.85  ? 288 TYR G N   1 
ATOM   5698 C CA  . TYR G 2 198 ? -23.176 11.578  4.679   1.00 17.72  ? 288 TYR G CA  1 
ATOM   5699 C C   . TYR G 2 198 ? -23.996 12.120  5.836   1.00 23.37  ? 288 TYR G C   1 
ATOM   5700 O O   . TYR G 2 198 ? -25.217 12.104  5.730   1.00 23.03  ? 288 TYR G O   1 
ATOM   5701 C CB  . TYR G 2 198 ? -22.594 10.190  5.012   1.00 16.84  ? 288 TYR G CB  1 
ATOM   5702 C CG  . TYR G 2 198 ? -21.929 9.522   3.817   1.00 14.16  ? 288 TYR G CG  1 
ATOM   5703 C CD1 . TYR G 2 198 ? -22.485 9.612   2.539   1.00 14.46  ? 288 TYR G CD1 1 
ATOM   5704 C CD2 . TYR G 2 198 ? -20.758 8.780   3.967   1.00 14.06  ? 288 TYR G CD2 1 
ATOM   5705 C CE1 . TYR G 2 198 ? -21.876 9.012   1.438   1.00 12.87  ? 288 TYR G CE1 1 
ATOM   5706 C CE2 . TYR G 2 198 ? -20.146 8.161   2.870   1.00 14.35  ? 288 TYR G CE2 1 
ATOM   5707 C CZ  . TYR G 2 198 ? -20.707 8.286   1.608   1.00 18.08  ? 288 TYR G CZ  1 
ATOM   5708 O OH  . TYR G 2 198 ? -20.115 7.697   0.518   1.00 20.14  ? 288 TYR G OH  1 
ATOM   5709 N N   . ARG G 2 199 ? -23.360 12.618  6.905   1.00 22.11  ? 289 ARG G N   1 
ATOM   5710 C CA  . ARG G 2 199 ? -24.064 13.168  8.068   1.00 22.98  ? 289 ARG G CA  1 
ATOM   5711 C C   . ARG G 2 199 ? -24.921 14.386  7.698   1.00 29.39  ? 289 ARG G C   1 
ATOM   5712 O O   . ARG G 2 199 ? -26.047 14.493  8.185   1.00 29.93  ? 289 ARG G O   1 
ATOM   5713 C CB  . ARG G 2 199 ? -23.090 13.528  9.197   1.00 23.02  ? 289 ARG G CB  1 
ATOM   5714 C CG  . ARG G 2 199 ? -22.790 12.349  10.108  1.00 37.63  ? 289 ARG G CG  1 
ATOM   5715 C CD  . ARG G 2 199 ? -22.043 12.782  11.355  1.00 47.88  ? 289 ARG G CD  1 
ATOM   5716 N N   . ALA G 2 200 ? -24.423 15.261  6.804   1.00 25.93  ? 290 ALA G N   1 
ATOM   5717 C CA  . ALA G 2 200 ? -25.151 16.450  6.357   1.00 24.86  ? 290 ALA G CA  1 
ATOM   5718 C C   . ALA G 2 200 ? -26.253 16.067  5.380   1.00 27.62  ? 290 ALA G C   1 
ATOM   5719 O O   . ALA G 2 200 ? -27.376 16.537  5.531   1.00 26.37  ? 290 ALA G O   1 
ATOM   5720 C CB  . ALA G 2 200 ? -24.199 17.452  5.723   1.00 25.36  ? 290 ALA G CB  1 
ATOM   5721 N N   . ALA G 2 201 ? -25.943 15.214  4.385   1.00 25.35  ? 291 ALA G N   1 
ATOM   5722 C CA  . ALA G 2 201 ? -26.913 14.731  3.400   1.00 25.34  ? 291 ALA G CA  1 
ATOM   5723 C C   . ALA G 2 201 ? -28.128 14.098  4.099   1.00 30.77  ? 291 ALA G C   1 
ATOM   5724 O O   . ALA G 2 201 ? -29.263 14.301  3.659   1.00 30.78  ? 291 ALA G O   1 
ATOM   5725 C CB  . ALA G 2 201 ? -26.255 13.719  2.482   1.00 26.12  ? 291 ALA G CB  1 
ATOM   5726 N N   . LEU G 2 202 ? -27.877 13.378  5.215   1.00 28.41  ? 292 LEU G N   1 
ATOM   5727 C CA  . LEU G 2 202 ? -28.886 12.725  6.036   1.00 29.37  ? 292 LEU G CA  1 
ATOM   5728 C C   . LEU G 2 202 ? -29.808 13.734  6.681   1.00 33.16  ? 292 LEU G C   1 
ATOM   5729 O O   . LEU G 2 202 ? -31.014 13.487  6.708   1.00 33.87  ? 292 LEU G O   1 
ATOM   5730 C CB  . LEU G 2 202 ? -28.242 11.856  7.123   1.00 29.69  ? 292 LEU G CB  1 
ATOM   5731 C CG  . LEU G 2 202 ? -28.191 10.367  6.835   1.00 34.74  ? 292 LEU G CG  1 
ATOM   5732 C CD1 . LEU G 2 202 ? -27.120 9.703   7.665   1.00 34.58  ? 292 LEU G CD1 1 
ATOM   5733 C CD2 . LEU G 2 202 ? -29.554 9.712   7.061   1.00 37.35  ? 292 LEU G CD2 1 
ATOM   5734 N N   . ARG G 2 203 ? -29.245 14.849  7.222   1.00 27.23  ? 293 ARG G N   1 
ATOM   5735 C CA  . ARG G 2 203 ? -30.003 15.935  7.847   1.00 26.10  ? 293 ARG G CA  1 
ATOM   5736 C C   . ARG G 2 203 ? -30.948 16.583  6.833   1.00 25.02  ? 293 ARG G C   1 
ATOM   5737 O O   . ARG G 2 203 ? -32.121 16.760  7.128   1.00 24.96  ? 293 ARG G O   1 
ATOM   5738 C CB  . ARG G 2 203 ? -29.063 16.994  8.435   1.00 31.03  ? 293 ARG G CB  1 
ATOM   5739 C CG  . ARG G 2 203 ? -28.695 16.786  9.899   1.00 45.95  ? 293 ARG G CG  1 
ATOM   5740 C CD  . ARG G 2 203 ? -28.014 18.020  10.483  1.00 60.99  ? 293 ARG G CD  1 
ATOM   5741 N NE  . ARG G 2 203 ? -26.718 18.301  9.853   1.00 72.75  ? 293 ARG G NE  1 
ATOM   5742 C CZ  . ARG G 2 203 ? -25.553 17.813  10.274  1.00 87.30  ? 293 ARG G CZ  1 
ATOM   5743 N NH1 . ARG G 2 203 ? -25.502 17.017  11.336  0.57 75.62  ? 293 ARG G NH1 1 
ATOM   5744 N NH2 . ARG G 2 203 ? -24.431 18.117  9.636   0.73 71.66  ? 293 ARG G NH2 1 
ATOM   5745 N N   . SER G 2 204 ? -30.430 16.896  5.635   1.00 19.21  ? 294 SER G N   1 
ATOM   5746 C CA  . SER G 2 204 ? -31.138 17.471  4.498   1.00 17.83  ? 294 SER G CA  1 
ATOM   5747 C C   . SER G 2 204 ? -32.272 16.547  4.055   1.00 22.37  ? 294 SER G C   1 
ATOM   5748 O O   . SER G 2 204 ? -33.391 17.010  3.862   1.00 22.96  ? 294 SER G O   1 
ATOM   5749 C CB  . SER G 2 204 ? -30.169 17.725  3.344   1.00 18.42  ? 294 SER G CB  1 
ATOM   5750 O OG  . SER G 2 204 ? -29.153 18.642  3.709   1.00 21.26  ? 294 SER G OG  1 
ATOM   5751 N N   . CYS G 2 205 ? -31.992 15.235  3.964   1.00 19.02  ? 295 CYS G N   1 
ATOM   5752 C CA  . CYS G 2 205 ? -32.937 14.170  3.584   1.00 17.87  ? 295 CYS G CA  1 
ATOM   5753 C C   . CYS G 2 205 ? -34.059 14.071  4.602   1.00 20.74  ? 295 CYS G C   1 
ATOM   5754 O O   . CYS G 2 205 ? -35.226 14.060  4.221   1.00 21.70  ? 295 CYS G O   1 
ATOM   5755 C CB  . CYS G 2 205 ? -32.213 12.832  3.421   1.00 18.14  ? 295 CYS G CB  1 
ATOM   5756 S SG  . CYS G 2 205 ? -31.432 12.605  1.800   1.00 22.26  ? 295 CYS G SG  1 
ATOM   5757 N N   . SER G 2 206 ? -33.711 14.028  5.894   1.00 16.99  ? 296 SER G N   1 
ATOM   5758 C CA  . SER G 2 206 ? -34.667 13.921  6.999   1.00 16.21  ? 296 SER G CA  1 
ATOM   5759 C C   . SER G 2 206 ? -35.566 15.148  7.120   1.00 20.85  ? 296 SER G C   1 
ATOM   5760 O O   . SER G 2 206 ? -36.728 14.992  7.499   1.00 21.70  ? 296 SER G O   1 
ATOM   5761 C CB  . SER G 2 206 ? -33.933 13.670  8.309   1.00 20.64  ? 296 SER G CB  1 
ATOM   5762 O OG  . SER G 2 206 ? -33.330 12.384  8.252   1.00 33.63  ? 296 SER G OG  1 
ATOM   5763 N N   . LEU G 2 207 ? -35.049 16.365  6.797   1.00 17.36  ? 297 LEU G N   1 
ATOM   5764 C CA  . LEU G 2 207 ? -35.838 17.601  6.840   1.00 16.81  ? 297 LEU G CA  1 
ATOM   5765 C C   . LEU G 2 207 ? -36.851 17.613  5.712   1.00 18.15  ? 297 LEU G C   1 
ATOM   5766 O O   . LEU G 2 207 ? -37.981 18.021  5.934   1.00 19.85  ? 297 LEU G O   1 
ATOM   5767 C CB  . LEU G 2 207 ? -34.963 18.868  6.798   1.00 17.43  ? 297 LEU G CB  1 
ATOM   5768 C CG  . LEU G 2 207 ? -34.330 19.295  8.141   1.00 23.27  ? 297 LEU G CG  1 
ATOM   5769 C CD1 . LEU G 2 207 ? -33.118 20.171  7.914   1.00 23.76  ? 297 LEU G CD1 1 
ATOM   5770 C CD2 . LEU G 2 207 ? -35.336 20.010  9.043   1.00 26.12  ? 297 LEU G CD2 1 
ATOM   5771 N N   . VAL G 2 208 ? -36.463 17.154  4.519   1.00 13.09  ? 298 VAL G N   1 
ATOM   5772 C CA  . VAL G 2 208 ? -37.368 17.031  3.368   1.00 12.60  ? 298 VAL G CA  1 
ATOM   5773 C C   . VAL G 2 208 ? -38.499 16.048  3.694   1.00 16.62  ? 298 VAL G C   1 
ATOM   5774 O O   . VAL G 2 208 ? -39.663 16.351  3.435   1.00 16.92  ? 298 VAL G O   1 
ATOM   5775 C CB  . VAL G 2 208 ? -36.631 16.609  2.060   1.00 15.04  ? 298 VAL G CB  1 
ATOM   5776 C CG1 . VAL G 2 208 ? -37.607 16.295  0.924   1.00 14.48  ? 298 VAL G CG1 1 
ATOM   5777 C CG2 . VAL G 2 208 ? -35.643 17.669  1.620   1.00 14.34  ? 298 VAL G CG2 1 
ATOM   5778 N N   . LEU G 2 209 ? -38.160 14.904  4.289   1.00 14.49  ? 299 LEU G N   1 
ATOM   5779 C CA  . LEU G 2 209 ? -39.130 13.836  4.594   1.00 14.77  ? 299 LEU G CA  1 
ATOM   5780 C C   . LEU G 2 209 ? -40.064 14.203  5.739   1.00 21.77  ? 299 LEU G C   1 
ATOM   5781 O O   . LEU G 2 209 ? -41.141 13.614  5.851   1.00 22.34  ? 299 LEU G O   1 
ATOM   5782 C CB  . LEU G 2 209 ? -38.434 12.506  4.875   1.00 14.40  ? 299 LEU G CB  1 
ATOM   5783 C CG  . LEU G 2 209 ? -37.723 11.876  3.667   1.00 18.45  ? 299 LEU G CG  1 
ATOM   5784 C CD1 . LEU G 2 209 ? -36.780 10.776  4.114   1.00 19.00  ? 299 LEU G CD1 1 
ATOM   5785 C CD2 . LEU G 2 209 ? -38.696 11.394  2.620   1.00 18.92  ? 299 LEU G CD2 1 
ATOM   5786 N N   . GLU G 2 210 ? -39.700 15.212  6.536   1.00 19.53  ? 300 GLU G N   1 
ATOM   5787 C CA  . GLU G 2 210 ? -40.564 15.705  7.604   1.00 19.29  ? 300 GLU G CA  1 
ATOM   5788 C C   . GLU G 2 210 ? -41.694 16.507  6.987   1.00 24.39  ? 300 GLU G C   1 
ATOM   5789 O O   . GLU G 2 210 ? -42.776 16.535  7.554   1.00 24.39  ? 300 GLU G O   1 
ATOM   5790 C CB  . GLU G 2 210 ? -39.768 16.552  8.604   1.00 20.36  ? 300 GLU G CB  1 
ATOM   5791 C CG  . GLU G 2 210 ? -39.106 15.709  9.682   1.00 30.40  ? 300 GLU G CG  1 
ATOM   5792 C CD  . GLU G 2 210 ? -39.894 15.554  10.966  1.00 50.13  ? 300 GLU G CD  1 
ATOM   5793 O OE1 . GLU G 2 210 ? -39.400 16.034  12.011  1.00 53.84  ? 300 GLU G OE1 1 
ATOM   5794 O OE2 . GLU G 2 210 ? -41.001 14.965  10.933  1.00 41.15  ? 300 GLU G OE2 1 
ATOM   5795 N N   . HIS G 2 211 ? -41.443 17.157  5.821   1.00 20.70  ? 301 HIS G N   1 
ATOM   5796 C CA  . HIS G 2 211 ? -42.443 17.949  5.101   1.00 19.71  ? 301 HIS G CA  1 
ATOM   5797 C C   . HIS G 2 211 ? -43.181 17.089  4.102   1.00 24.38  ? 301 HIS G C   1 
ATOM   5798 O O   . HIS G 2 211 ? -44.388 17.240  3.938   1.00 25.85  ? 301 HIS G O   1 
ATOM   5799 C CB  . HIS G 2 211 ? -41.807 19.148  4.383   1.00 19.62  ? 301 HIS G CB  1 
ATOM   5800 C CG  . HIS G 2 211 ? -41.286 20.203  5.302   1.00 22.44  ? 301 HIS G CG  1 
ATOM   5801 N ND1 . HIS G 2 211 ? -42.023 21.345  5.573   1.00 23.59  ? 301 HIS G ND1 1 
ATOM   5802 C CD2 . HIS G 2 211 ? -40.109 20.278  5.968   1.00 23.91  ? 301 HIS G CD2 1 
ATOM   5803 C CE1 . HIS G 2 211 ? -41.287 22.064  6.408   1.00 23.23  ? 301 HIS G CE1 1 
ATOM   5804 N NE2 . HIS G 2 211 ? -40.133 21.465  6.684   1.00 23.61  ? 301 HIS G NE2 1 
ATOM   5805 N N   . GLN G 2 212 ? -42.450 16.222  3.393   1.00 20.52  ? 302 GLN G N   1 
ATOM   5806 C CA  . GLN G 2 212 ? -42.991 15.340  2.356   1.00 20.20  ? 302 GLN G CA  1 
ATOM   5807 C C   . GLN G 2 212 ? -42.508 13.898  2.592   1.00 26.07  ? 302 GLN G C   1 
ATOM   5808 O O   . GLN G 2 212 ? -41.496 13.493  2.011   1.00 26.96  ? 302 GLN G O   1 
ATOM   5809 C CB  . GLN G 2 212 ? -42.597 15.847  0.958   1.00 21.61  ? 302 GLN G CB  1 
ATOM   5810 C CG  . GLN G 2 212 ? -43.281 17.159  0.561   1.00 33.06  ? 302 GLN G CG  1 
ATOM   5811 C CD  . GLN G 2 212 ? -42.746 17.803  -0.699  1.00 43.25  ? 302 GLN G CD  1 
ATOM   5812 O OE1 . GLN G 2 212 ? -42.049 17.179  -1.510  1.00 31.39  ? 302 GLN G OE1 1 
ATOM   5813 N NE2 . GLN G 2 212 ? -43.096 19.074  -0.900  1.00 40.48  ? 302 GLN G NE2 1 
ATOM   5814 N N   . PRO G 2 213 ? -43.229 13.100  3.430   1.00 22.68  ? 303 PRO G N   1 
ATOM   5815 C CA  . PRO G 2 213 ? -42.777 11.724  3.729   1.00 20.98  ? 303 PRO G CA  1 
ATOM   5816 C C   . PRO G 2 213 ? -42.815 10.732  2.562   1.00 20.55  ? 303 PRO G C   1 
ATOM   5817 O O   . PRO G 2 213 ? -42.195 9.675   2.691   1.00 19.14  ? 303 PRO G O   1 
ATOM   5818 C CB  . PRO G 2 213 ? -43.702 11.278  4.857   1.00 22.63  ? 303 PRO G CB  1 
ATOM   5819 C CG  . PRO G 2 213 ? -44.894 12.116  4.724   1.00 27.64  ? 303 PRO G CG  1 
ATOM   5820 C CD  . PRO G 2 213 ? -44.433 13.439  4.214   1.00 23.65  ? 303 PRO G CD  1 
ATOM   5821 N N   . ASP G 2 214 ? -43.462 11.069  1.428   1.00 16.50  ? 304 ASP G N   1 
ATOM   5822 C CA  . ASP G 2 214 ? -43.499 10.207  0.238   1.00 16.04  ? 304 ASP G CA  1 
ATOM   5823 C C   . ASP G 2 214 ? -42.701 10.802  -0.931  1.00 16.89  ? 304 ASP G C   1 
ATOM   5824 O O   . ASP G 2 214 ? -43.002 10.542  -2.109  1.00 13.45  ? 304 ASP G O   1 
ATOM   5825 C CB  . ASP G 2 214 ? -44.945 9.882   -0.188  1.00 19.39  ? 304 ASP G CB  1 
ATOM   5826 C CG  . ASP G 2 214 ? -45.793 9.258   0.916   1.00 36.97  ? 304 ASP G CG  1 
ATOM   5827 O OD1 . ASP G 2 214 ? -45.319 8.293   1.558   1.00 38.46  ? 304 ASP G OD1 1 
ATOM   5828 O OD2 . ASP G 2 214 ? -46.937 9.726   1.127   1.00 43.34  ? 304 ASP G OD2 1 
ATOM   5829 N N   . ASN G 2 215 ? -41.652 11.583  -0.605  1.00 16.30  ? 305 ASN G N   1 
ATOM   5830 C CA  . ASN G 2 215 ? -40.742 12.171  -1.603  1.00 15.92  ? 305 ASN G CA  1 
ATOM   5831 C C   . ASN G 2 215 ? -39.775 11.072  -2.002  1.00 19.84  ? 305 ASN G C   1 
ATOM   5832 O O   . ASN G 2 215 ? -38.933 10.692  -1.191  1.00 21.29  ? 305 ASN G O   1 
ATOM   5833 C CB  . ASN G 2 215 ? -40.005 13.415  -1.034  1.00 14.27  ? 305 ASN G CB  1 
ATOM   5834 C CG  . ASN G 2 215 ? -39.221 14.186  -2.056  1.00 26.22  ? 305 ASN G CG  1 
ATOM   5835 O OD1 . ASN G 2 215 ? -38.314 13.672  -2.697  1.00 15.04  ? 305 ASN G OD1 1 
ATOM   5836 N ND2 . ASN G 2 215 ? -39.567 15.445  -2.235  1.00 27.45  ? 305 ASN G ND2 1 
ATOM   5837 N N   . ILE G 2 216 ? -39.919 10.540  -3.223  1.00 16.22  ? 306 ILE G N   1 
ATOM   5838 C CA  . ILE G 2 216 ? -39.147 9.419   -3.735  1.00 15.63  ? 306 ILE G CA  1 
ATOM   5839 C C   . ILE G 2 216 ? -37.649 9.739   -3.789  1.00 20.24  ? 306 ILE G C   1 
ATOM   5840 O O   . ILE G 2 216 ? -36.840 8.872   -3.426  1.00 19.45  ? 306 ILE G O   1 
ATOM   5841 C CB  . ILE G 2 216 ? -39.687 8.903   -5.100  1.00 18.90  ? 306 ILE G CB  1 
ATOM   5842 C CG1 . ILE G 2 216 ? -39.088 7.509   -5.447  1.00 18.98  ? 306 ILE G CG1 1 
ATOM   5843 C CG2 . ILE G 2 216 ? -39.502 9.929   -6.246  1.00 18.98  ? 306 ILE G CG2 1 
ATOM   5844 C CD1 . ILE G 2 216 ? -39.654 6.808   -6.631  1.00 19.07  ? 306 ILE G CD1 1 
ATOM   5845 N N   . LYS G 2 217 ? -37.284 10.986  -4.191  1.00 16.11  ? 307 LYS G N   1 
ATOM   5846 C CA  . LYS G 2 217 ? -35.885 11.411  -4.301  1.00 13.48  ? 307 LYS G CA  1 
ATOM   5847 C C   . LYS G 2 217 ? -35.230 11.441  -2.942  1.00 13.62  ? 307 LYS G C   1 
ATOM   5848 O O   . LYS G 2 217 ? -34.152 10.872  -2.784  1.00 12.72  ? 307 LYS G O   1 
ATOM   5849 C CB  . LYS G 2 217 ? -35.773 12.751  -5.003  1.00 14.61  ? 307 LYS G CB  1 
ATOM   5850 C CG  . LYS G 2 217 ? -35.836 12.602  -6.523  1.00 3.00   ? 307 LYS G CG  1 
ATOM   5851 C CD  . LYS G 2 217 ? -35.722 13.949  -7.174  1.00 3.03   ? 307 LYS G CD  1 
ATOM   5852 C CE  . LYS G 2 217 ? -35.702 13.808  -8.674  1.00 21.28  ? 307 LYS G CE  1 
ATOM   5853 N NZ  . LYS G 2 217 ? -35.428 15.103  -9.341  1.00 33.23  ? 307 LYS G NZ  1 
ATOM   5854 N N   . ALA G 2 218 ? -35.904 12.009  -1.947  1.00 10.99  ? 308 ALA G N   1 
ATOM   5855 C CA  . ALA G 2 218 ? -35.368 12.077  -0.575  1.00 10.76  ? 308 ALA G CA  1 
ATOM   5856 C C   . ALA G 2 218 ? -35.268 10.698  0.062   1.00 17.56  ? 308 ALA G C   1 
ATOM   5857 O O   . ALA G 2 218 ? -34.342 10.466  0.835   1.00 19.45  ? 308 ALA G O   1 
ATOM   5858 C CB  . ALA G 2 218 ? -36.218 12.986  0.280   1.00 10.83  ? 308 ALA G CB  1 
ATOM   5859 N N   . LEU G 2 219 ? -36.219 9.784   -0.249  1.00 15.05  ? 309 LEU G N   1 
ATOM   5860 C CA  . LEU G 2 219 ? -36.195 8.412   0.264   1.00 13.47  ? 309 LEU G CA  1 
ATOM   5861 C C   . LEU G 2 219 ? -35.013 7.653   -0.341  1.00 13.89  ? 309 LEU G C   1 
ATOM   5862 O O   . LEU G 2 219 ? -34.223 7.078   0.400   1.00 13.98  ? 309 LEU G O   1 
ATOM   5863 C CB  . LEU G 2 219 ? -37.524 7.673   -0.015  1.00 13.71  ? 309 LEU G CB  1 
ATOM   5864 C CG  . LEU G 2 219 ? -38.729 8.051   0.869   1.00 16.61  ? 309 LEU G CG  1 
ATOM   5865 C CD1 . LEU G 2 219 ? -40.030 7.632   0.221   1.00 15.05  ? 309 LEU G CD1 1 
ATOM   5866 C CD2 . LEU G 2 219 ? -38.588 7.498   2.276   1.00 17.45  ? 309 LEU G CD2 1 
ATOM   5867 N N   . PHE G 2 220 ? -34.849 7.709   -1.678  1.00 9.93   ? 310 PHE G N   1 
ATOM   5868 C CA  . PHE G 2 220 ? -33.747 7.048   -2.374  1.00 10.04  ? 310 PHE G CA  1 
ATOM   5869 C C   . PHE G 2 220 ? -32.387 7.576   -1.899  1.00 17.49  ? 310 PHE G C   1 
ATOM   5870 O O   . PHE G 2 220 ? -31.477 6.777   -1.662  1.00 19.80  ? 310 PHE G O   1 
ATOM   5871 C CB  . PHE G 2 220 ? -33.892 7.210   -3.891  1.00 13.04  ? 310 PHE G CB  1 
ATOM   5872 C CG  . PHE G 2 220 ? -32.727 6.666   -4.688  1.00 15.80  ? 310 PHE G CG  1 
ATOM   5873 C CD1 . PHE G 2 220 ? -32.642 5.311   -5.001  1.00 18.88  ? 310 PHE G CD1 1 
ATOM   5874 C CD2 . PHE G 2 220 ? -31.699 7.506   -5.110  1.00 18.89  ? 310 PHE G CD2 1 
ATOM   5875 C CE1 . PHE G 2 220 ? -31.540 4.807   -5.720  1.00 19.93  ? 310 PHE G CE1 1 
ATOM   5876 C CE2 . PHE G 2 220 ? -30.619 7.005   -5.856  1.00 21.40  ? 310 PHE G CE2 1 
ATOM   5877 C CZ  . PHE G 2 220 ? -30.550 5.663   -6.153  1.00 19.57  ? 310 PHE G CZ  1 
ATOM   5878 N N   . ARG G 2 221 ? -32.246 8.906   -1.736  1.00 13.37  ? 311 ARG G N   1 
ATOM   5879 C CA  . ARG G 2 221 ? -30.986 9.517   -1.293  1.00 11.76  ? 311 ARG G CA  1 
ATOM   5880 C C   . ARG G 2 221 ? -30.697 9.156   0.178   1.00 14.37  ? 311 ARG G C   1 
ATOM   5881 O O   . ARG G 2 221 ? -29.541 8.920   0.520   1.00 13.61  ? 311 ARG G O   1 
ATOM   5882 C CB  . ARG G 2 221 ? -31.011 11.041  -1.499  1.00 10.37  ? 311 ARG G CB  1 
ATOM   5883 C CG  . ARG G 2 221 ? -30.866 11.407  -2.982  1.00 15.93  ? 311 ARG G CG  1 
ATOM   5884 C CD  . ARG G 2 221 ? -31.344 12.803  -3.301  1.00 21.85  ? 311 ARG G CD  1 
ATOM   5885 N NE  . ARG G 2 221 ? -31.284 13.058  -4.742  1.00 15.90  ? 311 ARG G NE  1 
ATOM   5886 C CZ  . ARG G 2 221 ? -31.875 14.085  -5.346  1.00 26.34  ? 311 ARG G CZ  1 
ATOM   5887 N NH1 . ARG G 2 221 ? -32.555 14.983  -4.639  1.00 5.34   ? 311 ARG G NH1 1 
ATOM   5888 N NH2 . ARG G 2 221 ? -31.795 14.221  -6.662  1.00 14.62  ? 311 ARG G NH2 1 
ATOM   5889 N N   . LYS G 2 222 ? -31.729 9.045   1.022   1.00 9.38   ? 312 LYS G N   1 
ATOM   5890 C CA  . LYS G 2 222 ? -31.505 8.668   2.426   1.00 10.57  ? 312 LYS G CA  1 
ATOM   5891 C C   . LYS G 2 222 ? -31.037 7.203   2.497   1.00 17.85  ? 312 LYS G C   1 
ATOM   5892 O O   . LYS G 2 222 ? -30.109 6.908   3.240   1.00 18.21  ? 312 LYS G O   1 
ATOM   5893 C CB  . LYS G 2 222 ? -32.740 8.904   3.306   1.00 11.81  ? 312 LYS G CB  1 
ATOM   5894 C CG  . LYS G 2 222 ? -32.448 8.747   4.800   1.00 17.82  ? 312 LYS G CG  1 
ATOM   5895 C CD  . LYS G 2 222 ? -33.664 8.999   5.680   1.00 16.39  ? 312 LYS G CD  1 
ATOM   5896 C CE  . LYS G 2 222 ? -33.349 8.696   7.126   1.00 19.45  ? 312 LYS G CE  1 
ATOM   5897 N NZ  . LYS G 2 222 ? -34.288 9.383   8.059   1.00 33.59  ? 312 LYS G NZ  1 
ATOM   5898 N N   . GLY G 2 223 ? -31.645 6.334   1.691   1.00 17.45  ? 313 GLY G N   1 
ATOM   5899 C CA  . GLY G 2 223 ? -31.300 4.918   1.591   1.00 18.61  ? 313 GLY G CA  1 
ATOM   5900 C C   . GLY G 2 223 ? -29.898 4.712   1.054   1.00 22.58  ? 313 GLY G C   1 
ATOM   5901 O O   . GLY G 2 223 ? -29.115 3.992   1.670   1.00 22.37  ? 313 GLY G O   1 
ATOM   5902 N N   . LYS G 2 224 ? -29.560 5.387   -0.069  1.00 18.91  ? 314 LYS G N   1 
ATOM   5903 C CA  . LYS G 2 224 ? -28.231 5.349   -0.695  1.00 18.06  ? 314 LYS G CA  1 
ATOM   5904 C C   . LYS G 2 224 ? -27.140 5.814   0.281   1.00 24.71  ? 314 LYS G C   1 
ATOM   5905 O O   . LYS G 2 224 ? -26.066 5.210   0.296   1.00 25.40  ? 314 LYS G O   1 
ATOM   5906 C CB  . LYS G 2 224 ? -28.212 6.200   -1.967  1.00 18.93  ? 314 LYS G CB  1 
ATOM   5907 C CG  . LYS G 2 224 ? -27.008 5.962   -2.851  1.00 14.38  ? 314 LYS G CG  1 
ATOM   5908 C CD  . LYS G 2 224 ? -27.158 6.665   -4.173  1.00 20.05  ? 314 LYS G CD  1 
ATOM   5909 C CE  . LYS G 2 224 ? -25.946 6.457   -5.055  1.00 26.46  ? 314 LYS G CE  1 
ATOM   5910 N NZ  . LYS G 2 224 ? -26.189 6.937   -6.443  1.00 40.84  ? 314 LYS G NZ  1 
ATOM   5911 N N   . VAL G 2 225 ? -27.424 6.842   1.119   1.00 22.09  ? 315 VAL G N   1 
ATOM   5912 C CA  . VAL G 2 225 ? -26.487 7.339   2.139   1.00 23.01  ? 315 VAL G CA  1 
ATOM   5913 C C   . VAL G 2 225 ? -26.336 6.275   3.236   1.00 28.81  ? 315 VAL G C   1 
ATOM   5914 O O   . VAL G 2 225 ? -25.220 5.955   3.629   1.00 30.61  ? 315 VAL G O   1 
ATOM   5915 C CB  . VAL G 2 225 ? -26.917 8.713   2.726   1.00 27.20  ? 315 VAL G CB  1 
ATOM   5916 C CG1 . VAL G 2 225 ? -26.153 9.045   4.002   1.00 27.59  ? 315 VAL G CG1 1 
ATOM   5917 C CG2 . VAL G 2 225 ? -26.726 9.824   1.712   1.00 27.23  ? 315 VAL G CG2 1 
ATOM   5918 N N   . LEU G 2 226 ? -27.463 5.716   3.711   1.00 25.29  ? 316 LEU G N   1 
ATOM   5919 C CA  . LEU G 2 226 ? -27.484 4.685   4.749   1.00 24.32  ? 316 LEU G CA  1 
ATOM   5920 C C   . LEU G 2 226 ? -26.767 3.410   4.299   1.00 28.43  ? 316 LEU G C   1 
ATOM   5921 O O   . LEU G 2 226 ? -26.111 2.757   5.117   1.00 29.36  ? 316 LEU G O   1 
ATOM   5922 C CB  . LEU G 2 226 ? -28.926 4.377   5.171   1.00 24.00  ? 316 LEU G CB  1 
ATOM   5923 C CG  . LEU G 2 226 ? -29.574 5.385   6.142   1.00 28.13  ? 316 LEU G CG  1 
ATOM   5924 C CD1 . LEU G 2 226 ? -31.021 5.069   6.349   1.00 27.70  ? 316 LEU G CD1 1 
ATOM   5925 C CD2 . LEU G 2 226 ? -28.878 5.407   7.500   1.00 30.31  ? 316 LEU G CD2 1 
ATOM   5926 N N   . ALA G 2 227 ? -26.846 3.098   2.998   1.00 23.27  ? 317 ALA G N   1 
ATOM   5927 C CA  . ALA G 2 227 ? -26.198 1.953   2.369   1.00 22.81  ? 317 ALA G CA  1 
ATOM   5928 C C   . ALA G 2 227 ? -24.695 2.159   2.266   1.00 26.04  ? 317 ALA G C   1 
ATOM   5929 O O   . ALA G 2 227 ? -23.932 1.234   2.545   1.00 25.20  ? 317 ALA G O   1 
ATOM   5930 C CB  . ALA G 2 227 ? -26.784 1.714   0.979   1.00 23.33  ? 317 ALA G CB  1 
ATOM   5931 N N   . GLN G 2 228 ? -24.265 3.373   1.875   1.00 23.10  ? 318 GLN G N   1 
ATOM   5932 C CA  . GLN G 2 228 ? -22.850 3.722   1.709   1.00 22.13  ? 318 GLN G CA  1 
ATOM   5933 C C   . GLN G 2 228 ? -22.150 3.853   3.074   1.00 28.43  ? 318 GLN G C   1 
ATOM   5934 O O   . GLN G 2 228 ? -20.937 3.650   3.156   1.00 28.34  ? 318 GLN G O   1 
ATOM   5935 C CB  . GLN G 2 228 ? -22.695 4.992   0.870   1.00 22.40  ? 318 GLN G CB  1 
ATOM   5936 C CG  . GLN G 2 228 ? -22.814 4.708   -0.635  1.00 33.62  ? 318 GLN G CG  1 
ATOM   5937 C CD  . GLN G 2 228 ? -22.918 5.935   -1.511  1.00 51.83  ? 318 GLN G CD  1 
ATOM   5938 O OE1 . GLN G 2 228 ? -22.530 7.044   -1.139  1.00 55.19  ? 318 GLN G OE1 1 
ATOM   5939 N NE2 . GLN G 2 228 ? -23.400 5.751   -2.728  1.00 38.46  ? 318 GLN G NE2 1 
ATOM   5940 N N   . GLN G 2 229 ? -22.922 4.137   4.140   1.00 25.24  ? 319 GLN G N   1 
ATOM   5941 C CA  . GLN G 2 229 ? -22.419 4.206   5.507   1.00 25.67  ? 319 GLN G CA  1 
ATOM   5942 C C   . GLN G 2 229 ? -22.240 2.809   6.107   1.00 34.30  ? 319 GLN G C   1 
ATOM   5943 O O   . GLN G 2 229 ? -21.524 2.668   7.106   1.00 34.62  ? 319 GLN G O   1 
ATOM   5944 C CB  . GLN G 2 229 ? -23.363 5.029   6.390   1.00 25.96  ? 319 GLN G CB  1 
ATOM   5945 C CG  . GLN G 2 229 ? -23.205 6.532   6.232   1.00 25.15  ? 319 GLN G CG  1 
ATOM   5946 C CD  . GLN G 2 229 ? -24.219 7.263   7.064   1.00 38.09  ? 319 GLN G CD  1 
ATOM   5947 O OE1 . GLN G 2 229 ? -25.411 6.929   7.068   1.00 37.29  ? 319 GLN G OE1 1 
ATOM   5948 N NE2 . GLN G 2 229 ? -23.774 8.280   7.791   1.00 25.52  ? 319 GLN G NE2 1 
ATOM   5949 N N   . GLY G 2 230 ? -22.921 1.809   5.522   1.00 33.20  ? 320 GLY G N   1 
ATOM   5950 C CA  . GLY G 2 230 ? -22.895 0.420   5.970   1.00 33.72  ? 320 GLY G CA  1 
ATOM   5951 C C   . GLY G 2 230 ? -24.074 0.014   6.839   1.00 38.48  ? 320 GLY G C   1 
ATOM   5952 O O   . GLY G 2 230 ? -24.077 -1.087  7.395   1.00 38.30  ? 320 GLY G O   1 
ATOM   5953 N N   . GLU G 2 231 ? -25.077 0.906   6.975   1.00 35.36  ? 321 GLU G N   1 
ATOM   5954 C CA  . GLU G 2 231 ? -26.310 0.693   7.746   1.00 34.73  ? 321 GLU G CA  1 
ATOM   5955 C C   . GLU G 2 231 ? -27.350 0.052   6.816   1.00 39.62  ? 321 GLU G C   1 
ATOM   5956 O O   . GLU G 2 231 ? -28.351 0.675   6.448   1.00 38.32  ? 321 GLU G O   1 
ATOM   5957 C CB  . GLU G 2 231 ? -26.803 2.024   8.342   1.00 35.84  ? 321 GLU G CB  1 
ATOM   5958 C CG  . GLU G 2 231 ? -25.937 2.550   9.474   1.00 46.00  ? 321 GLU G CG  1 
ATOM   5959 C CD  . GLU G 2 231 ? -26.464 2.266   10.864  1.00 70.35  ? 321 GLU G CD  1 
ATOM   5960 O OE1 . GLU G 2 231 ? -26.791 1.093   11.157  1.00 62.74  ? 321 GLU G OE1 1 
ATOM   5961 O OE2 . GLU G 2 231 ? -26.539 3.224   11.667  1.00 73.40  ? 321 GLU G OE2 1 
ATOM   5962 N N   . TYR G 2 232 ? -27.063 -1.203  6.405   1.00 37.16  ? 322 TYR G N   1 
ATOM   5963 C CA  . TYR G 2 232 ? -27.858 -2.013  5.483   1.00 36.59  ? 322 TYR G CA  1 
ATOM   5964 C C   . TYR G 2 232 ? -29.244 -2.316  6.043   1.00 37.86  ? 322 TYR G C   1 
ATOM   5965 O O   . TYR G 2 232 ? -30.219 -2.298  5.288   1.00 36.99  ? 322 TYR G O   1 
ATOM   5966 C CB  . TYR G 2 232 ? -27.122 -3.328  5.146   1.00 38.43  ? 322 TYR G CB  1 
ATOM   5967 C CG  . TYR G 2 232 ? -25.717 -3.186  4.580   1.00 41.17  ? 322 TYR G CG  1 
ATOM   5968 C CD1 . TYR G 2 232 ? -25.411 -2.194  3.651   1.00 43.62  ? 322 TYR G CD1 1 
ATOM   5969 C CD2 . TYR G 2 232 ? -24.715 -4.091  4.917   1.00 41.94  ? 322 TYR G CD2 1 
ATOM   5970 C CE1 . TYR G 2 232 ? -24.136 -2.091  3.094   1.00 45.46  ? 322 TYR G CE1 1 
ATOM   5971 C CE2 . TYR G 2 232 ? -23.441 -4.004  4.359   1.00 43.02  ? 322 TYR G CE2 1 
ATOM   5972 C CZ  . TYR G 2 232 ? -23.155 -3.003  3.448   1.00 51.08  ? 322 TYR G CZ  1 
ATOM   5973 O OH  . TYR G 2 232 ? -21.892 -2.907  2.917   1.00 51.93  ? 322 TYR G OH  1 
ATOM   5974 N N   . SER G 2 233 ? -29.326 -2.567  7.367   1.00 33.23  ? 323 SER G N   1 
ATOM   5975 C CA  . SER G 2 233 ? -30.550 -2.883  8.110   1.00 32.00  ? 323 SER G CA  1 
ATOM   5976 C C   . SER G 2 233 ? -31.547 -1.716  8.078   1.00 33.28  ? 323 SER G C   1 
ATOM   5977 O O   . SER G 2 233 ? -32.750 -1.950  8.050   1.00 33.27  ? 323 SER G O   1 
ATOM   5978 C CB  . SER G 2 233 ? -30.218 -3.244  9.556   1.00 35.22  ? 323 SER G CB  1 
ATOM   5979 O OG  . SER G 2 233 ? -29.536 -2.179  10.205  1.00 46.13  ? 323 SER G OG  1 
ATOM   5980 N N   . GLU G 2 234 ? -31.048 -0.475  8.076   1.00 28.43  ? 324 GLU G N   1 
ATOM   5981 C CA  . GLU G 2 234 ? -31.878 0.728   8.025   1.00 28.19  ? 324 GLU G CA  1 
ATOM   5982 C C   . GLU G 2 234 ? -32.159 1.171   6.593   1.00 31.83  ? 324 GLU G C   1 
ATOM   5983 O O   . GLU G 2 234 ? -33.208 1.752   6.345   1.00 33.34  ? 324 GLU G O   1 
ATOM   5984 C CB  . GLU G 2 234 ? -31.217 1.868   8.809   1.00 29.68  ? 324 GLU G CB  1 
ATOM   5985 C CG  . GLU G 2 234 ? -31.550 1.815   10.290  1.00 42.80  ? 324 GLU G CG  1 
ATOM   5986 C CD  . GLU G 2 234 ? -30.782 2.766   11.186  1.00 77.50  ? 324 GLU G CD  1 
ATOM   5987 O OE1 . GLU G 2 234 ? -30.235 2.292   12.207  1.00 80.83  ? 324 GLU G OE1 1 
ATOM   5988 O OE2 . GLU G 2 234 ? -30.740 3.983   10.885  1.00 77.02  ? 324 GLU G OE2 1 
ATOM   5989 N N   . ALA G 2 235 ? -31.253 0.870   5.649   1.00 27.24  ? 325 ALA G N   1 
ATOM   5990 C CA  . ALA G 2 235 ? -31.350 1.288   4.248   1.00 26.06  ? 325 ALA G CA  1 
ATOM   5991 C C   . ALA G 2 235 ? -32.375 0.523   3.428   1.00 29.67  ? 325 ALA G C   1 
ATOM   5992 O O   . ALA G 2 235 ? -33.027 1.137   2.583   1.00 31.62  ? 325 ALA G O   1 
ATOM   5993 C CB  . ALA G 2 235 ? -29.995 1.162   3.578   1.00 26.76  ? 325 ALA G CB  1 
ATOM   5994 N N   . ILE G 2 236 ? -32.488 -0.809  3.621   1.00 24.84  ? 326 ILE G N   1 
ATOM   5995 C CA  . ILE G 2 236 ? -33.364 -1.682  2.828   1.00 24.28  ? 326 ILE G CA  1 
ATOM   5996 C C   . ILE G 2 236 ? -34.870 -1.299  2.999   1.00 22.77  ? 326 ILE G C   1 
ATOM   5997 O O   . ILE G 2 236 ? -35.487 -1.157  1.946   1.00 18.77  ? 326 ILE G O   1 
ATOM   5998 C CB  . ILE G 2 236 ? -33.098 -3.206  3.027   1.00 28.41  ? 326 ILE G CB  1 
ATOM   5999 C CG1 . ILE G 2 236 ? -33.878 -4.032  1.985   1.00 29.97  ? 326 ILE G CG1 1 
ATOM   6000 C CG2 . ILE G 2 236 ? -33.303 -3.715  4.463   1.00 29.49  ? 326 ILE G CG2 1 
ATOM   6001 C CD1 . ILE G 2 236 ? -33.343 -5.443  1.753   1.00 42.21  ? 326 ILE G CD1 1 
ATOM   6002 N N   . PRO G 2 237 ? -35.476 -1.051  4.204   1.00 19.23  ? 327 PRO G N   1 
ATOM   6003 C CA  . PRO G 2 237 ? -36.888 -0.656  4.217   1.00 19.55  ? 327 PRO G CA  1 
ATOM   6004 C C   . PRO G 2 237 ? -37.146 0.702   3.537   1.00 24.05  ? 327 PRO G C   1 
ATOM   6005 O O   . PRO G 2 237 ? -38.179 0.862   2.871   1.00 23.54  ? 327 PRO G O   1 
ATOM   6006 C CB  . PRO G 2 237 ? -37.248 -0.630  5.704   1.00 21.54  ? 327 PRO G CB  1 
ATOM   6007 C CG  . PRO G 2 237 ? -35.964 -0.479  6.421   1.00 25.66  ? 327 PRO G CG  1 
ATOM   6008 C CD  . PRO G 2 237 ? -34.947 -1.155  5.585   1.00 21.19  ? 327 PRO G CD  1 
ATOM   6009 N N   . ILE G 2 238 ? -36.212 1.658   3.675   1.00 19.87  ? 328 ILE G N   1 
ATOM   6010 C CA  . ILE G 2 238 ? -36.321 2.992   3.077   1.00 19.10  ? 328 ILE G CA  1 
ATOM   6011 C C   . ILE G 2 238 ? -36.220 2.867   1.548   1.00 21.13  ? 328 ILE G C   1 
ATOM   6012 O O   . ILE G 2 238 ? -37.070 3.433   0.852   1.00 20.25  ? 328 ILE G O   1 
ATOM   6013 C CB  . ILE G 2 238 ? -35.259 3.959   3.684   1.00 22.61  ? 328 ILE G CB  1 
ATOM   6014 C CG1 . ILE G 2 238 ? -35.693 4.402   5.090   1.00 23.03  ? 328 ILE G CG1 1 
ATOM   6015 C CG2 . ILE G 2 238 ? -35.033 5.181   2.790   1.00 22.58  ? 328 ILE G CG2 1 
ATOM   6016 C CD1 . ILE G 2 238 ? -34.592 4.888   5.991   1.00 31.76  ? 328 ILE G CD1 1 
ATOM   6017 N N   . LEU G 2 239 ? -35.226 2.084   1.030   1.00 15.57  ? 329 LEU G N   1 
ATOM   6018 C CA  . LEU G 2 239 ? -35.080 1.874   -0.421  1.00 15.48  ? 329 LEU G CA  1 
ATOM   6019 C C   . LEU G 2 239 ? -36.267 1.093   -0.987  1.00 21.13  ? 329 LEU G C   1 
ATOM   6020 O O   . LEU G 2 239 ? -36.598 1.265   -2.163  1.00 21.96  ? 329 LEU G O   1 
ATOM   6021 C CB  . LEU G 2 239 ? -33.769 1.153   -0.770  1.00 15.08  ? 329 LEU G CB  1 
ATOM   6022 C CG  . LEU G 2 239 ? -32.481 1.975   -0.759  1.00 19.75  ? 329 LEU G CG  1 
ATOM   6023 C CD1 . LEU G 2 239 ? -31.267 1.078   -1.016  1.00 20.01  ? 329 LEU G CD1 1 
ATOM   6024 C CD2 . LEU G 2 239 ? -32.515 3.099   -1.806  1.00 21.28  ? 329 LEU G CD2 1 
ATOM   6025 N N   . ARG G 2 240 ? -36.910 0.244   -0.150  1.00 17.04  ? 330 ARG G N   1 
ATOM   6026 C CA  . ARG G 2 240 ? -38.102 -0.516  -0.546  1.00 17.75  ? 330 ARG G CA  1 
ATOM   6027 C C   . ARG G 2 240 ? -39.317 0.416   -0.567  1.00 22.09  ? 330 ARG G C   1 
ATOM   6028 O O   . ARG G 2 240 ? -40.085 0.366   -1.525  1.00 21.65  ? 330 ARG G O   1 
ATOM   6029 C CB  . ARG G 2 240 ? -38.340 -1.739  0.363   1.00 13.02  ? 330 ARG G CB  1 
ATOM   6030 C CG  . ARG G 2 240 ? -37.517 -2.938  -0.057  1.00 13.57  ? 330 ARG G CG  1 
ATOM   6031 C CD  . ARG G 2 240 ? -37.572 -4.037  0.969   1.00 28.12  ? 330 ARG G CD  1 
ATOM   6032 N NE  . ARG G 2 240 ? -37.108 -5.316  0.421   1.00 36.34  ? 330 ARG G NE  1 
ATOM   6033 C CZ  . ARG G 2 240 ? -36.761 -6.360  1.168   1.00 39.74  ? 330 ARG G CZ  1 
ATOM   6034 N NH1 . ARG G 2 240 ? -36.790 -6.274  2.494   1.00 10.71  ? 330 ARG G NH1 1 
ATOM   6035 N NH2 . ARG G 2 240 ? -36.354 -7.485  0.598   1.00 23.54  ? 330 ARG G NH2 1 
ATOM   6036 N N   . ALA G 2 241 ? -39.458 1.293   0.449   1.00 19.41  ? 331 ALA G N   1 
ATOM   6037 C CA  . ALA G 2 241 ? -40.527 2.314   0.533   1.00 20.96  ? 331 ALA G CA  1 
ATOM   6038 C C   . ALA G 2 241 ? -40.553 3.202   -0.718  1.00 28.27  ? 331 ALA G C   1 
ATOM   6039 O O   . ALA G 2 241 ? -41.632 3.557   -1.174  1.00 30.17  ? 331 ALA G O   1 
ATOM   6040 C CB  . ALA G 2 241 ? -40.341 3.174   1.773   1.00 21.44  ? 331 ALA G CB  1 
ATOM   6041 N N   . ALA G 2 242 ? -39.369 3.513   -1.292  1.00 25.39  ? 332 ALA G N   1 
ATOM   6042 C CA  . ALA G 2 242 ? -39.197 4.287   -2.519  1.00 24.92  ? 332 ALA G CA  1 
ATOM   6043 C C   . ALA G 2 242 ? -39.622 3.467   -3.730  1.00 26.03  ? 332 ALA G C   1 
ATOM   6044 O O   . ALA G 2 242 ? -40.241 4.013   -4.646  1.00 23.93  ? 332 ALA G O   1 
ATOM   6045 C CB  . ALA G 2 242 ? -37.739 4.714   -2.666  1.00 26.16  ? 332 ALA G CB  1 
ATOM   6046 N N   . LEU G 2 243 ? -39.262 2.152   -3.750  1.00 22.07  ? 333 LEU G N   1 
ATOM   6047 C CA  . LEU G 2 243 ? -39.626 1.215   -4.827  1.00 20.63  ? 333 LEU G CA  1 
ATOM   6048 C C   . LEU G 2 243 ? -41.131 0.989   -4.833  1.00 23.39  ? 333 LEU G C   1 
ATOM   6049 O O   . LEU G 2 243 ? -41.705 0.829   -5.903  1.00 23.41  ? 333 LEU G O   1 
ATOM   6050 C CB  . LEU G 2 243 ? -38.877 -0.137  -4.707  1.00 20.54  ? 333 LEU G CB  1 
ATOM   6051 C CG  . LEU G 2 243 ? -38.945 -1.077  -5.933  1.00 25.15  ? 333 LEU G CG  1 
ATOM   6052 C CD1 . LEU G 2 243 ? -38.224 -0.483  -7.143  1.00 24.23  ? 333 LEU G CD1 1 
ATOM   6053 C CD2 . LEU G 2 243 ? -38.356 -2.418  -5.611  1.00 28.35  ? 333 LEU G CD2 1 
ATOM   6054 N N   . LYS G 2 244 ? -41.780 1.037   -3.651  1.00 20.00  ? 334 LYS G N   1 
ATOM   6055 C CA  . LYS G 2 244 ? -43.231 0.890   -3.504  1.00 20.33  ? 334 LYS G CA  1 
ATOM   6056 C C   . LYS G 2 244 ? -43.982 1.994   -4.274  1.00 28.73  ? 334 LYS G C   1 
ATOM   6057 O O   . LYS G 2 244 ? -45.088 1.746   -4.743  1.00 30.12  ? 334 LYS G O   1 
ATOM   6058 C CB  . LYS G 2 244 ? -43.625 0.905   -2.014  1.00 22.23  ? 334 LYS G CB  1 
ATOM   6059 C CG  . LYS G 2 244 ? -44.962 0.215   -1.709  1.00 25.10  ? 334 LYS G CG  1 
ATOM   6060 C CD  . LYS G 2 244 ? -45.333 0.269   -0.234  1.00 33.99  ? 334 LYS G CD  1 
ATOM   6061 N N   . LEU G 2 245 ? -43.365 3.191   -4.439  1.00 25.77  ? 335 LEU G N   1 
ATOM   6062 C CA  . LEU G 2 245 ? -43.941 4.341   -5.140  1.00 25.24  ? 335 LEU G CA  1 
ATOM   6063 C C   . LEU G 2 245 ? -43.694 4.256   -6.647  1.00 29.49  ? 335 LEU G C   1 
ATOM   6064 O O   . LEU G 2 245 ? -44.502 4.770   -7.413  1.00 28.88  ? 335 LEU G O   1 
ATOM   6065 C CB  . LEU G 2 245 ? -43.389 5.672   -4.575  1.00 25.64  ? 335 LEU G CB  1 
ATOM   6066 C CG  . LEU G 2 245 ? -43.579 5.932   -3.056  1.00 30.18  ? 335 LEU G CG  1 
ATOM   6067 C CD1 . LEU G 2 245 ? -42.645 7.000   -2.563  1.00 29.48  ? 335 LEU G CD1 1 
ATOM   6068 C CD2 . LEU G 2 245 ? -45.026 6.305   -2.716  1.00 32.75  ? 335 LEU G CD2 1 
ATOM   6069 N N   . GLU G 2 246 ? -42.585 3.608   -7.070  1.00 27.29  ? 336 GLU G N   1 
ATOM   6070 C CA  . GLU G 2 246 ? -42.210 3.386   -8.478  1.00 26.85  ? 336 GLU G CA  1 
ATOM   6071 C C   . GLU G 2 246 ? -41.571 1.988   -8.630  1.00 30.59  ? 336 GLU G C   1 
ATOM   6072 O O   . GLU G 2 246 ? -40.340 1.852   -8.587  1.00 29.64  ? 336 GLU G O   1 
ATOM   6073 C CB  . GLU G 2 246 ? -41.269 4.483   -8.981  1.00 28.25  ? 336 GLU G CB  1 
ATOM   6074 C CG  . GLU G 2 246 ? -42.002 5.638   -9.620  1.00 41.16  ? 336 GLU G CG  1 
ATOM   6075 C CD  . GLU G 2 246 ? -41.128 6.833   -9.924  1.00 60.93  ? 336 GLU G CD  1 
ATOM   6076 O OE1 . GLU G 2 246 ? -41.553 7.964   -9.591  1.00 57.71  ? 336 GLU G OE1 1 
ATOM   6077 O OE2 . GLU G 2 246 ? -40.017 6.641   -10.473 1.00 51.67  ? 336 GLU G OE2 1 
ATOM   6078 N N   . PRO G 2 247 ? -42.403 0.926   -8.762  1.00 27.93  ? 337 PRO G N   1 
ATOM   6079 C CA  . PRO G 2 247 ? -41.854 -0.439  -8.822  1.00 28.04  ? 337 PRO G CA  1 
ATOM   6080 C C   . PRO G 2 247 ? -41.027 -0.747  -10.075 1.00 33.20  ? 337 PRO G C   1 
ATOM   6081 O O   . PRO G 2 247 ? -40.161 -1.614  -9.999  1.00 32.81  ? 337 PRO G O   1 
ATOM   6082 C CB  . PRO G 2 247 ? -43.106 -1.330  -8.768  1.00 29.77  ? 337 PRO G CB  1 
ATOM   6083 C CG  . PRO G 2 247 ? -44.185 -0.456  -8.228  1.00 33.86  ? 337 PRO G CG  1 
ATOM   6084 C CD  . PRO G 2 247 ? -43.882 0.898   -8.775  1.00 29.39  ? 337 PRO G CD  1 
ATOM   6085 N N   . SER G 2 248 ? -41.276 -0.057  -11.206 1.00 29.74  ? 338 SER G N   1 
ATOM   6086 C CA  . SER G 2 248 ? -40.550 -0.313  -12.453 1.00 30.66  ? 338 SER G CA  1 
ATOM   6087 C C   . SER G 2 248 ? -39.184 0.422   -12.544 1.00 35.51  ? 338 SER G C   1 
ATOM   6088 O O   . SER G 2 248 ? -38.406 0.129   -13.457 1.00 36.33  ? 338 SER G O   1 
ATOM   6089 C CB  . SER G 2 248 ? -41.411 0.070   -13.653 1.00 36.04  ? 338 SER G CB  1 
ATOM   6090 O OG  . SER G 2 248 ? -41.814 1.430   -13.599 1.00 49.97  ? 338 SER G OG  1 
ATOM   6091 N N   . ASN G 2 249 ? -38.898 1.358   -11.611 1.00 31.06  ? 339 ASN G N   1 
ATOM   6092 C CA  . ASN G 2 249 ? -37.679 2.168   -11.585 1.00 30.29  ? 339 ASN G CA  1 
ATOM   6093 C C   . ASN G 2 249 ? -36.399 1.315   -11.448 1.00 33.78  ? 339 ASN G C   1 
ATOM   6094 O O   . ASN G 2 249 ? -36.098 0.776   -10.379 1.00 32.24  ? 339 ASN G O   1 
ATOM   6095 C CB  . ASN G 2 249 ? -37.758 3.204   -10.466 1.00 31.42  ? 339 ASN G CB  1 
ATOM   6096 C CG  . ASN G 2 249 ? -36.676 4.251   -10.524 1.00 42.65  ? 339 ASN G CG  1 
ATOM   6097 O OD1 . ASN G 2 249 ? -35.494 3.982   -10.277 1.00 31.82  ? 339 ASN G OD1 1 
ATOM   6098 N ND2 . ASN G 2 249 ? -37.066 5.472   -10.825 1.00 34.97  ? 339 ASN G ND2 1 
ATOM   6099 N N   . LYS G 2 250 ? -35.631 1.268   -12.543 1.00 31.32  ? 340 LYS G N   1 
ATOM   6100 C CA  . LYS G 2 250 ? -34.377 0.529   -12.715 1.00 31.70  ? 340 LYS G CA  1 
ATOM   6101 C C   . LYS G 2 250 ? -33.281 0.968   -11.736 1.00 35.18  ? 340 LYS G C   1 
ATOM   6102 O O   . LYS G 2 250 ? -32.526 0.117   -11.264 1.00 35.36  ? 340 LYS G O   1 
ATOM   6103 C CB  . LYS G 2 250 ? -33.858 0.691   -14.169 1.00 34.95  ? 340 LYS G CB  1 
ATOM   6104 C CG  . LYS G 2 250 ? -34.857 0.322   -15.277 1.00 59.19  ? 340 LYS G CG  1 
ATOM   6105 C CD  . LYS G 2 250 ? -34.770 -1.146  -15.713 1.00 74.61  ? 340 LYS G CD  1 
ATOM   6106 C CE  . LYS G 2 250 ? -35.880 -1.552  -16.658 1.00 88.24  ? 340 LYS G CE  1 
ATOM   6107 N NZ  . LYS G 2 250 ? -37.161 -1.802  -15.941 1.00 99.05  ? 340 LYS G NZ  1 
ATOM   6108 N N   . THR G 2 251 ? -33.194 2.279   -11.428 1.00 30.03  ? 341 THR G N   1 
ATOM   6109 C CA  . THR G 2 251 ? -32.177 2.834   -10.532 1.00 28.29  ? 341 THR G CA  1 
ATOM   6110 C C   . THR G 2 251 ? -32.376 2.331   -9.094  1.00 27.68  ? 341 THR G C   1 
ATOM   6111 O O   . THR G 2 251 ? -31.393 1.978   -8.449  1.00 27.34  ? 341 THR G O   1 
ATOM   6112 C CB  . THR G 2 251 ? -32.165 4.374   -10.632 1.00 35.01  ? 341 THR G CB  1 
ATOM   6113 O OG1 . THR G 2 251 ? -31.968 4.738   -12.004 1.00 31.10  ? 341 THR G OG1 1 
ATOM   6114 C CG2 . THR G 2 251 ? -31.080 5.022   -9.766  1.00 31.92  ? 341 THR G CG2 1 
ATOM   6115 N N   . ILE G 2 252 ? -33.623 2.284   -8.605  1.00 23.34  ? 342 ILE G N   1 
ATOM   6116 C CA  . ILE G 2 252 ? -33.933 1.814   -7.237  1.00 22.86  ? 342 ILE G CA  1 
ATOM   6117 C C   . ILE G 2 252 ? -33.654 0.291   -7.128  1.00 27.44  ? 342 ILE G C   1 
ATOM   6118 O O   . ILE G 2 252 ? -33.176 -0.161  -6.082  1.00 26.91  ? 342 ILE G O   1 
ATOM   6119 C CB  . ILE G 2 252 ? -35.383 2.177   -6.779  1.00 24.53  ? 342 ILE G CB  1 
ATOM   6120 C CG1 . ILE G 2 252 ? -35.684 3.680   -6.981  1.00 23.43  ? 342 ILE G CG1 1 
ATOM   6121 C CG2 . ILE G 2 252 ? -35.626 1.771   -5.313  1.00 22.92  ? 342 ILE G CG2 1 
ATOM   6122 C CD1 . ILE G 2 252 ? -37.165 4.041   -6.909  1.00 22.60  ? 342 ILE G CD1 1 
ATOM   6123 N N   . HIS G 2 253 ? -33.924 -0.474  -8.207  1.00 24.95  ? 343 HIS G N   1 
ATOM   6124 C CA  . HIS G 2 253 ? -33.681 -1.918  -8.265  1.00 26.70  ? 343 HIS G CA  1 
ATOM   6125 C C   . HIS G 2 253 ? -32.188 -2.211  -8.167  1.00 29.48  ? 343 HIS G C   1 
ATOM   6126 O O   . HIS G 2 253 ? -31.768 -3.027  -7.340  1.00 29.26  ? 343 HIS G O   1 
ATOM   6127 C CB  . HIS G 2 253 ? -34.237 -2.513  -9.569  1.00 29.10  ? 343 HIS G CB  1 
ATOM   6128 C CG  . HIS G 2 253 ? -35.700 -2.839  -9.535  1.00 33.78  ? 343 HIS G CG  1 
ATOM   6129 N ND1 . HIS G 2 253 ? -36.197 -3.856  -8.730  1.00 36.16  ? 343 HIS G ND1 1 
ATOM   6130 C CD2 . HIS G 2 253 ? -36.716 -2.327  -10.266 1.00 35.97  ? 343 HIS G CD2 1 
ATOM   6131 C CE1 . HIS G 2 253 ? -37.499 -3.893  -8.962  1.00 35.66  ? 343 HIS G CE1 1 
ATOM   6132 N NE2 . HIS G 2 253 ? -37.856 -3.000  -9.883  1.00 36.00  ? 343 HIS G NE2 1 
ATOM   6133 N N   . ALA G 2 254 ? -31.390 -1.511  -9.015  1.00 24.62  ? 344 ALA G N   1 
ATOM   6134 C CA  . ALA G 2 254 ? -29.933 -1.592  -9.108  1.00 23.68  ? 344 ALA G CA  1 
ATOM   6135 C C   . ALA G 2 254 ? -29.279 -1.252  -7.775  1.00 24.89  ? 344 ALA G C   1 
ATOM   6136 O O   . ALA G 2 254 ? -28.275 -1.853  -7.414  1.00 24.30  ? 344 ALA G O   1 
ATOM   6137 C CB  . ALA G 2 254 ? -29.433 -0.642  -10.197 1.00 24.46  ? 344 ALA G CB  1 
ATOM   6138 N N   . GLU G 2 255 ? -29.862 -0.295  -7.049  1.00 21.50  ? 345 GLU G N   1 
ATOM   6139 C CA  . GLU G 2 255 ? -29.381 0.137   -5.741  1.00 21.16  ? 345 GLU G CA  1 
ATOM   6140 C C   . GLU G 2 255 ? -29.678 -0.928  -4.692  1.00 22.99  ? 345 GLU G C   1 
ATOM   6141 O O   . GLU G 2 255 ? -28.827 -1.186  -3.849  1.00 23.59  ? 345 GLU G O   1 
ATOM   6142 C CB  . GLU G 2 255 ? -30.016 1.496   -5.345  1.00 22.05  ? 345 GLU G CB  1 
ATOM   6143 C CG  . GLU G 2 255 ? -29.323 2.220   -4.200  1.00 21.01  ? 345 GLU G CG  1 
ATOM   6144 C CD  . GLU G 2 255 ? -27.877 2.614   -4.435  1.00 36.80  ? 345 GLU G CD  1 
ATOM   6145 O OE1 . GLU G 2 255 ? -27.502 2.907   -5.598  1.00 18.18  ? 345 GLU G OE1 1 
ATOM   6146 O OE2 . GLU G 2 255 ? -27.117 2.631   -3.439  1.00 27.11  ? 345 GLU G OE2 1 
ATOM   6147 N N   . LEU G 2 256 ? -30.870 -1.532  -4.735  1.00 17.86  ? 346 LEU G N   1 
ATOM   6148 C CA  . LEU G 2 256 ? -31.268 -2.572  -3.789  1.00 17.40  ? 346 LEU G CA  1 
ATOM   6149 C C   . LEU G 2 256 ? -30.467 -3.831  -3.978  1.00 20.67  ? 346 LEU G C   1 
ATOM   6150 O O   . LEU G 2 256 ? -29.981 -4.392  -2.990  1.00 18.00  ? 346 LEU G O   1 
ATOM   6151 C CB  . LEU G 2 256 ? -32.762 -2.894  -3.912  1.00 17.14  ? 346 LEU G CB  1 
ATOM   6152 C CG  . LEU G 2 256 ? -33.676 -2.089  -3.003  1.00 20.31  ? 346 LEU G CG  1 
ATOM   6153 C CD1 . LEU G 2 256 ? -35.073 -2.149  -3.510  1.00 20.85  ? 346 LEU G CD1 1 
ATOM   6154 C CD2 . LEU G 2 256 ? -33.599 -2.571  -1.554  1.00 19.50  ? 346 LEU G CD2 1 
ATOM   6155 N N   . SER G 2 257 ? -30.315 -4.263  -5.248  1.00 20.09  ? 347 SER G N   1 
ATOM   6156 C CA  . SER G 2 257 ? -29.568 -5.451  -5.633  1.00 21.99  ? 347 SER G CA  1 
ATOM   6157 C C   . SER G 2 257 ? -28.102 -5.358  -5.181  1.00 28.11  ? 347 SER G C   1 
ATOM   6158 O O   . SER G 2 257 ? -27.575 -6.333  -4.648  1.00 27.53  ? 347 SER G O   1 
ATOM   6159 C CB  . SER G 2 257 ? -29.657 -5.673  -7.140  1.00 27.91  ? 347 SER G CB  1 
ATOM   6160 O OG  . SER G 2 257 ? -29.034 -4.646  -7.889  1.00 43.10  ? 347 SER G OG  1 
ATOM   6161 N N   . LYS G 2 258 ? -27.462 -4.179  -5.376  1.00 26.97  ? 348 LYS G N   1 
ATOM   6162 C CA  . LYS G 2 258 ? -26.075 -3.879  -4.990  1.00 27.34  ? 348 LYS G CA  1 
ATOM   6163 C C   . LYS G 2 258 ? -25.919 -4.001  -3.471  1.00 30.62  ? 348 LYS G C   1 
ATOM   6164 O O   . LYS G 2 258 ? -24.960 -4.594  -2.990  1.00 31.34  ? 348 LYS G O   1 
ATOM   6165 C CB  . LYS G 2 258 ? -25.715 -2.449  -5.462  1.00 30.31  ? 348 LYS G CB  1 
ATOM   6166 C CG  . LYS G 2 258 ? -24.220 -2.115  -5.465  1.00 44.15  ? 348 LYS G CG  1 
ATOM   6167 C CD  . LYS G 2 258 ? -23.948 -0.635  -5.781  1.00 52.71  ? 348 LYS G CD  1 
ATOM   6168 C CE  . LYS G 2 258 ? -23.981 -0.301  -7.250  1.00 64.35  ? 348 LYS G CE  1 
ATOM   6169 N NZ  . LYS G 2 258 ? -23.411 1.047   -7.509  1.00 73.55  ? 348 LYS G NZ  1 
ATOM   6170 N N   . LEU G 2 259 ? -26.892 -3.462  -2.731  1.00 27.04  ? 349 LEU G N   1 
ATOM   6171 C CA  . LEU G 2 259 ? -26.948 -3.450  -1.276  1.00 27.62  ? 349 LEU G CA  1 
ATOM   6172 C C   . LEU G 2 259 ? -27.120 -4.864  -0.708  1.00 31.20  ? 349 LEU G C   1 
ATOM   6173 O O   . LEU G 2 259 ? -26.399 -5.216  0.237   1.00 30.70  ? 349 LEU G O   1 
ATOM   6174 C CB  . LEU G 2 259 ? -28.094 -2.516  -0.827  1.00 28.48  ? 349 LEU G CB  1 
ATOM   6175 C CG  . LEU G 2 259 ? -28.804 -2.771  0.502   1.00 34.51  ? 349 LEU G CG  1 
ATOM   6176 C CD1 . LEU G 2 259 ? -28.131 -2.050  1.639   1.00 35.25  ? 349 LEU G CD1 1 
ATOM   6177 C CD2 . LEU G 2 259 ? -30.242 -2.303  0.416   1.00 38.98  ? 349 LEU G CD2 1 
ATOM   6178 N N   . VAL G 2 260 ? -28.068 -5.664  -1.270  1.00 25.52  ? 350 VAL G N   1 
ATOM   6179 C CA  . VAL G 2 260 ? -28.336 -7.010  -0.762  1.00 25.16  ? 350 VAL G CA  1 
ATOM   6180 C C   . VAL G 2 260 ? -27.139 -7.942  -1.062  1.00 28.88  ? 350 VAL G C   1 
ATOM   6181 O O   . VAL G 2 260 ? -26.807 -8.752  -0.197  1.00 29.04  ? 350 VAL G O   1 
ATOM   6182 C CB  . VAL G 2 260 ? -29.698 -7.622  -1.215  1.00 28.28  ? 350 VAL G CB  1 
ATOM   6183 C CG1 . VAL G 2 260 ? -30.869 -6.746  -0.777  1.00 27.00  ? 350 VAL G CG1 1 
ATOM   6184 C CG2 . VAL G 2 260 ? -29.748 -7.881  -2.717  1.00 28.31  ? 350 VAL G CG2 1 
ATOM   6185 N N   . LYS G 2 261 ? -26.461 -7.756  -2.231  1.00 24.05  ? 351 LYS G N   1 
ATOM   6186 C CA  . LYS G 2 261 ? -25.292 -8.533  -2.678  1.00 24.87  ? 351 LYS G CA  1 
ATOM   6187 C C   . LYS G 2 261 ? -24.076 -8.291  -1.788  1.00 31.34  ? 351 LYS G C   1 
ATOM   6188 O O   . LYS G 2 261 ? -23.327 -9.226  -1.525  1.00 31.35  ? 351 LYS G O   1 
ATOM   6189 C CB  . LYS G 2 261 ? -24.934 -8.191  -4.134  1.00 27.67  ? 351 LYS G CB  1 
ATOM   6190 C CG  . LYS G 2 261 ? -24.346 -9.353  -4.928  1.00 46.09  ? 351 LYS G CG  1 
ATOM   6191 C CD  . LYS G 2 261 ? -24.034 -8.981  -6.385  1.00 57.34  ? 351 LYS G CD  1 
ATOM   6192 C CE  . LYS G 2 261 ? -22.626 -8.445  -6.573  1.00 73.48  ? 351 LYS G CE  1 
ATOM   6193 N NZ  . LYS G 2 261 ? -22.328 -8.115  -7.997  1.00 82.44  ? 351 LYS G NZ  1 
ATOM   6194 N N   . LYS G 2 262 ? -23.878 -7.038  -1.348  1.00 30.07  ? 352 LYS G N   1 
ATOM   6195 C CA  . LYS G 2 262 ? -22.789 -6.620  -0.459  1.00 31.25  ? 352 LYS G CA  1 
ATOM   6196 C C   . LYS G 2 262 ? -23.082 -7.056  0.984   1.00 41.20  ? 352 LYS G C   1 
ATOM   6197 O O   . LYS G 2 262 ? -22.160 -7.387  1.724   1.00 42.46  ? 352 LYS G O   1 
ATOM   6198 C CB  . LYS G 2 262 ? -22.585 -5.095  -0.532  1.00 32.20  ? 352 LYS G CB  1 
ATOM   6199 C CG  . LYS G 2 262 ? -21.912 -4.617  -1.811  1.00 24.03  ? 352 LYS G CG  1 
ATOM   6200 C CD  . LYS G 2 262 ? -21.926 -3.097  -1.922  1.00 16.80  ? 352 LYS G CD  1 
ATOM   6201 C CE  . LYS G 2 262 ? -21.209 -2.584  -3.138  1.00 15.00  ? 352 LYS G CE  1 
ATOM   6202 N NZ  . LYS G 2 262 ? -21.139 -1.098  -3.130  1.00 22.55  ? 352 LYS G NZ  1 
ATOM   6203 N N   . HIS G 2 263 ? -24.366 -7.064  1.371   1.00 41.01  ? 353 HIS G N   1 
ATOM   6204 C CA  . HIS G 2 263 ? -24.842 -7.481  2.695   1.00 42.75  ? 353 HIS G CA  1 
ATOM   6205 C C   . HIS G 2 263 ? -24.751 -9.002  2.877   1.00 45.80  ? 353 HIS G C   1 
ATOM   6206 O O   . HIS G 2 263 ? -24.378 -9.462  3.958   1.00 46.05  ? 353 HIS G O   1 
ATOM   6207 C CB  . HIS G 2 263 ? -26.302 -7.027  2.903   1.00 44.72  ? 353 HIS G CB  1 
ATOM   6208 C CG  . HIS G 2 263 ? -26.844 -7.313  4.265   1.00 49.12  ? 353 HIS G CG  1 
ATOM   6209 N ND1 . HIS G 2 263 ? -26.222 -6.832  5.405   1.00 51.65  ? 353 HIS G ND1 1 
ATOM   6210 C CD2 . HIS G 2 263 ? -27.951 -8.000  4.625   1.00 52.04  ? 353 HIS G CD2 1 
ATOM   6211 C CE1 . HIS G 2 263 ? -26.965 -7.239  6.419   1.00 51.70  ? 353 HIS G CE1 1 
ATOM   6212 N NE2 . HIS G 2 263 ? -28.014 -7.956  6.000   1.00 52.19  ? 353 HIS G NE2 1 
ATOM   6213 N N   . ALA G 2 264 ? -25.170 -9.771  1.851   1.00 41.00  ? 354 ALA G N   1 
ATOM   6214 C CA  . ALA G 2 264 ? -25.165 -11.237 1.875   1.00 40.13  ? 354 ALA G CA  1 
ATOM   6215 C C   . ALA G 2 264 ? -23.738 -11.791 1.889   1.00 44.78  ? 354 ALA G C   1 
ATOM   6216 O O   . ALA G 2 264 ? -23.525 -12.891 2.411   1.00 44.75  ? 354 ALA G O   1 
ATOM   6217 C CB  . ALA G 2 264 ? -25.926 -11.784 0.682   1.00 40.40  ? 354 ALA G CB  1 
ATOM   6218 N N   . ALA G 2 265 ? -22.773 -11.026 1.317   1.00 40.59  ? 355 ALA G N   1 
ATOM   6219 C CA  . ALA G 2 265 ? -21.350 -11.378 1.218   1.00 39.91  ? 355 ALA G CA  1 
ATOM   6220 C C   . ALA G 2 265 ? -20.647 -11.348 2.577   1.00 42.49  ? 355 ALA G C   1 
ATOM   6221 O O   . ALA G 2 265 ? -19.848 -12.246 2.849   1.00 42.80  ? 355 ALA G O   1 
ATOM   6222 C CB  . ALA G 2 265 ? -20.643 -10.435 0.251   1.00 40.57  ? 355 ALA G CB  1 
ATOM   6223 N N   . GLN G 2 266 ? -20.937 -10.327 3.419   1.00 37.72  ? 356 GLN G N   1 
ATOM   6224 C CA  . GLN G 2 266 ? -20.344 -10.137 4.751   1.00 55.05  ? 356 GLN G CA  1 
ATOM   6225 C C   . GLN G 2 266 ? -21.277 -10.569 5.875   1.00 91.07  ? 356 GLN G C   1 
ATOM   6226 O O   . GLN G 2 266 ? -21.929 -11.603 5.785   1.00 62.96  ? 356 GLN G O   1 
ATOM   6227 C CB  . GLN G 2 266 ? -19.974 -8.665  4.957   1.00 56.37  ? 356 GLN G CB  1 
ATOM   6228 N N   . GLU H 2 1   ? 32.505  21.371  31.781  1.00 63.96  ? 91  GLU H N   1 
ATOM   6229 C CA  . GLU H 2 1   ? 33.898  21.759  31.562  1.00 63.71  ? 91  GLU H CA  1 
ATOM   6230 C C   . GLU H 2 1   ? 34.831  20.533  31.512  1.00 66.48  ? 91  GLU H C   1 
ATOM   6231 O O   . GLU H 2 1   ? 35.701  20.460  30.639  1.00 66.70  ? 91  GLU H O   1 
ATOM   6232 C CB  . GLU H 2 1   ? 34.364  22.739  32.651  1.00 65.19  ? 91  GLU H CB  1 
ATOM   6233 N N   . GLU H 2 2   ? 34.657  19.584  32.451  1.00 61.17  ? 92  GLU H N   1 
ATOM   6234 C CA  . GLU H 2 2   ? 35.445  18.348  32.541  1.00 59.97  ? 92  GLU H CA  1 
ATOM   6235 C C   . GLU H 2 2   ? 34.567  17.209  33.068  1.00 60.89  ? 92  GLU H C   1 
ATOM   6236 O O   . GLU H 2 2   ? 33.504  17.475  33.634  1.00 60.59  ? 92  GLU H O   1 
ATOM   6237 C CB  . GLU H 2 2   ? 36.680  18.551  33.442  1.00 61.31  ? 92  GLU H CB  1 
ATOM   6238 N N   . TRP H 2 3   ? 34.992  15.947  32.865  1.00 54.88  ? 93  TRP H N   1 
ATOM   6239 C CA  . TRP H 2 3   ? 34.230  14.786  33.333  1.00 53.18  ? 93  TRP H CA  1 
ATOM   6240 C C   . TRP H 2 3   ? 34.460  14.556  34.824  1.00 51.41  ? 93  TRP H C   1 
ATOM   6241 O O   . TRP H 2 3   ? 35.608  14.420  35.256  1.00 50.67  ? 93  TRP H O   1 
ATOM   6242 C CB  . TRP H 2 3   ? 34.600  13.511  32.555  1.00 52.36  ? 93  TRP H CB  1 
ATOM   6243 C CG  . TRP H 2 3   ? 33.961  13.377  31.207  1.00 53.73  ? 93  TRP H CG  1 
ATOM   6244 C CD1 . TRP H 2 3   ? 34.561  13.562  29.997  1.00 56.79  ? 93  TRP H CD1 1 
ATOM   6245 C CD2 . TRP H 2 3   ? 32.624  12.942  30.930  1.00 53.67  ? 93  TRP H CD2 1 
ATOM   6246 N NE1 . TRP H 2 3   ? 33.673  13.292  28.981  1.00 56.39  ? 93  TRP H NE1 1 
ATOM   6247 C CE2 . TRP H 2 3   ? 32.473  12.916  29.527  1.00 57.83  ? 93  TRP H CE2 1 
ATOM   6248 C CE3 . TRP H 2 3   ? 31.524  12.597  31.732  1.00 54.93  ? 93  TRP H CE3 1 
ATOM   6249 C CZ2 . TRP H 2 3   ? 31.270  12.554  28.909  1.00 57.13  ? 93  TRP H CZ2 1 
ATOM   6250 C CZ3 . TRP H 2 3   ? 30.330  12.244  31.118  1.00 56.30  ? 93  TRP H CZ3 1 
ATOM   6251 C CH2 . TRP H 2 3   ? 30.208  12.233  29.724  1.00 56.90  ? 93  TRP H CH2 1 
ATOM   6252 N N   . LEU H 2 4   ? 33.377  14.511  35.608  1.00 44.15  ? 94  LEU H N   1 
ATOM   6253 C CA  . LEU H 2 4   ? 33.467  14.216  37.030  1.00 41.89  ? 94  LEU H CA  1 
ATOM   6254 C C   . LEU H 2 4   ? 33.235  12.727  37.218  1.00 43.28  ? 94  LEU H C   1 
ATOM   6255 O O   . LEU H 2 4   ? 32.202  12.210  36.788  1.00 42.80  ? 94  LEU H O   1 
ATOM   6256 C CB  . LEU H 2 4   ? 32.476  15.054  37.866  1.00 41.47  ? 94  LEU H CB  1 
ATOM   6257 C CG  . LEU H 2 4   ? 32.231  14.603  39.326  1.00 46.11  ? 94  LEU H CG  1 
ATOM   6258 C CD1 . LEU H 2 4   ? 33.462  14.810  40.209  1.00 46.36  ? 94  LEU H CD1 1 
ATOM   6259 C CD2 . LEU H 2 4   ? 31.056  15.321  39.923  1.00 46.46  ? 94  LEU H CD2 1 
ATOM   6260 N N   . ASP H 2 5   ? 34.210  12.037  37.828  1.00 37.64  ? 95  ASP H N   1 
ATOM   6261 C CA  . ASP H 2 5   ? 34.117  10.619  38.132  1.00 36.61  ? 95  ASP H CA  1 
ATOM   6262 C C   . ASP H 2 5   ? 33.509  10.548  39.529  1.00 39.01  ? 95  ASP H C   1 
ATOM   6263 O O   . ASP H 2 5   ? 34.232  10.607  40.524  1.00 39.56  ? 95  ASP H O   1 
ATOM   6264 C CB  . ASP H 2 5   ? 35.499  9.945   38.022  1.00 38.44  ? 95  ASP H CB  1 
ATOM   6265 C CG  . ASP H 2 5   ? 35.518  8.431   38.177  1.00 43.72  ? 95  ASP H CG  1 
ATOM   6266 O OD1 . ASP H 2 5   ? 34.431  7.830   38.300  1.00 41.07  ? 95  ASP H OD1 1 
ATOM   6267 O OD2 . ASP H 2 5   ? 36.624  7.846   38.164  1.00 48.35  ? 95  ASP H OD2 1 
ATOM   6268 N N   . ILE H 2 6   ? 32.159  10.496  39.581  1.00 32.49  ? 96  ILE H N   1 
ATOM   6269 C CA  . ILE H 2 6   ? 31.326  10.553  40.780  1.00 31.00  ? 96  ILE H CA  1 
ATOM   6270 C C   . ILE H 2 6   ? 31.726  9.514   41.840  1.00 36.79  ? 96  ILE H C   1 
ATOM   6271 O O   . ILE H 2 6   ? 31.985  9.890   42.978  1.00 36.93  ? 96  ILE H O   1 
ATOM   6272 C CB  . ILE H 2 6   ? 29.815  10.439  40.410  1.00 32.42  ? 96  ILE H CB  1 
ATOM   6273 C CG1 . ILE H 2 6   ? 29.403  11.551  39.413  1.00 31.23  ? 96  ILE H CG1 1 
ATOM   6274 C CG2 . ILE H 2 6   ? 28.929  10.450  41.668  1.00 32.02  ? 96  ILE H CG2 1 
ATOM   6275 C CD1 . ILE H 2 6   ? 28.072  11.374  38.721  1.00 30.20  ? 96  ILE H CD1 1 
ATOM   6276 N N   . LEU H 2 7   ? 31.756  8.234   41.485  1.00 33.89  ? 97  LEU H N   1 
ATOM   6277 C CA  . LEU H 2 7   ? 32.035  7.179   42.454  1.00 33.23  ? 97  LEU H CA  1 
ATOM   6278 C C   . LEU H 2 7   ? 33.521  6.798   42.510  1.00 35.97  ? 97  LEU H C   1 
ATOM   6279 O O   . LEU H 2 7   ? 33.913  6.004   43.370  1.00 34.80  ? 97  LEU H O   1 
ATOM   6280 C CB  . LEU H 2 7   ? 31.158  5.956   42.143  1.00 33.28  ? 97  LEU H CB  1 
ATOM   6281 C CG  . LEU H 2 7   ? 29.651  6.234   42.051  1.00 37.99  ? 97  LEU H CG  1 
ATOM   6282 C CD1 . LEU H 2 7   ? 28.951  5.139   41.313  1.00 38.36  ? 97  LEU H CD1 1 
ATOM   6283 C CD2 . LEU H 2 7   ? 29.035  6.455   43.424  1.00 39.06  ? 97  LEU H CD2 1 
ATOM   6284 N N   . GLY H 2 8   ? 34.326  7.399   41.634  1.00 32.00  ? 98  GLY H N   1 
ATOM   6285 C CA  . GLY H 2 8   ? 35.767  7.173   41.565  1.00 31.62  ? 98  GLY H CA  1 
ATOM   6286 C C   . GLY H 2 8   ? 36.219  5.944   40.801  1.00 35.73  ? 98  GLY H C   1 
ATOM   6287 O O   . GLY H 2 8   ? 37.426  5.762   40.598  1.00 34.83  ? 98  GLY H O   1 
ATOM   6288 N N   . ASN H 2 9   ? 35.261  5.094   40.357  1.00 32.45  ? 99  ASN H N   1 
ATOM   6289 C CA  . ASN H 2 9   ? 35.524  3.819   39.657  1.00 32.11  ? 99  ASN H CA  1 
ATOM   6290 C C   . ASN H 2 9   ? 35.416  3.908   38.114  1.00 36.82  ? 99  ASN H C   1 
ATOM   6291 O O   . ASN H 2 9   ? 35.666  2.913   37.434  1.00 38.45  ? 99  ASN H O   1 
ATOM   6292 C CB  . ASN H 2 9   ? 34.569  2.718   40.187  1.00 29.41  ? 99  ASN H CB  1 
ATOM   6293 C CG  . ASN H 2 9   ? 33.094  3.072   40.210  1.00 48.14  ? 99  ASN H CG  1 
ATOM   6294 O OD1 . ASN H 2 9   ? 32.599  3.890   39.422  1.00 44.88  ? 99  ASN H OD1 1 
ATOM   6295 N ND2 . ASN H 2 9   ? 32.348  2.435   41.107  1.00 38.59  ? 99  ASN H ND2 1 
ATOM   6296 N N   . GLY H 2 10  ? 35.035  5.073   37.592  1.00 32.76  ? 100 GLY H N   1 
ATOM   6297 C CA  . GLY H 2 10  ? 34.851  5.317   36.163  1.00 31.71  ? 100 GLY H CA  1 
ATOM   6298 C C   . GLY H 2 10  ? 33.551  4.779   35.586  1.00 32.94  ? 100 GLY H C   1 
ATOM   6299 O O   . GLY H 2 10  ? 33.340  4.871   34.374  1.00 32.28  ? 100 GLY H O   1 
ATOM   6300 N N   . LEU H 2 11  ? 32.662  4.227   36.443  1.00 27.62  ? 101 LEU H N   1 
ATOM   6301 C CA  . LEU H 2 11  ? 31.388  3.634   36.024  1.00 27.04  ? 101 LEU H CA  1 
ATOM   6302 C C   . LEU H 2 11  ? 30.214  4.622   36.002  1.00 30.69  ? 101 LEU H C   1 
ATOM   6303 O O   . LEU H 2 11  ? 29.171  4.288   35.444  1.00 31.05  ? 101 LEU H O   1 
ATOM   6304 C CB  . LEU H 2 11  ? 31.027  2.444   36.921  1.00 26.88  ? 101 LEU H CB  1 
ATOM   6305 C CG  . LEU H 2 11  ? 31.964  1.239   36.894  1.00 30.70  ? 101 LEU H CG  1 
ATOM   6306 C CD1 . LEU H 2 11  ? 31.400  0.135   37.716  1.00 30.18  ? 101 LEU H CD1 1 
ATOM   6307 C CD2 . LEU H 2 11  ? 32.218  0.744   35.461  1.00 31.38  ? 101 LEU H CD2 1 
ATOM   6308 N N   . LEU H 2 12  ? 30.363  5.811   36.618  1.00 24.84  ? 102 LEU H N   1 
ATOM   6309 C CA  . LEU H 2 12  ? 29.318  6.834   36.655  1.00 23.51  ? 102 LEU H CA  1 
ATOM   6310 C C   . LEU H 2 12  ? 29.990  8.206   36.547  1.00 28.05  ? 102 LEU H C   1 
ATOM   6311 O O   . LEU H 2 12  ? 30.481  8.750   37.542  1.00 26.64  ? 102 LEU H O   1 
ATOM   6312 C CB  . LEU H 2 12  ? 28.460  6.689   37.929  1.00 23.06  ? 102 LEU H CB  1 
ATOM   6313 C CG  . LEU H 2 12  ? 27.281  7.643   38.105  1.00 27.00  ? 102 LEU H CG  1 
ATOM   6314 C CD1 . LEU H 2 12  ? 26.142  7.287   37.196  1.00 26.73  ? 102 LEU H CD1 1 
ATOM   6315 C CD2 . LEU H 2 12  ? 26.793  7.627   39.527  1.00 28.34  ? 102 LEU H CD2 1 
ATOM   6316 N N   . ARG H 2 13  ? 30.046  8.733   35.309  1.00 24.83  ? 103 ARG H N   1 
ATOM   6317 C CA  . ARG H 2 13  ? 30.718  9.990   34.980  1.00 25.32  ? 103 ARG H CA  1 
ATOM   6318 C C   . ARG H 2 13  ? 29.731  11.065  34.525  1.00 29.15  ? 103 ARG H C   1 
ATOM   6319 O O   . ARG H 2 13  ? 28.826  10.772  33.749  1.00 29.16  ? 103 ARG H O   1 
ATOM   6320 C CB  . ARG H 2 13  ? 31.769  9.740   33.890  1.00 28.31  ? 103 ARG H CB  1 
ATOM   6321 C CG  . ARG H 2 13  ? 32.925  8.834   34.319  1.00 41.48  ? 103 ARG H CG  1 
ATOM   6322 C CD  . ARG H 2 13  ? 33.655  8.216   33.129  1.00 54.45  ? 103 ARG H CD  1 
ATOM   6323 N NE  . ARG H 2 13  ? 33.959  9.195   32.085  1.00 70.13  ? 103 ARG H NE  1 
ATOM   6324 C CZ  . ARG H 2 13  ? 35.087  9.234   31.386  1.00 90.94  ? 103 ARG H CZ  1 
ATOM   6325 N NH1 . ARG H 2 13  ? 36.060  8.363   31.633  1.00 81.83  ? 103 ARG H NH1 1 
ATOM   6326 N NH2 . ARG H 2 13  ? 35.260  10.154  30.447  1.00 79.45  ? 103 ARG H NH2 1 
ATOM   6327 N N   . LYS H 2 14  ? 29.923  12.310  34.994  1.00 26.49  ? 104 LYS H N   1 
ATOM   6328 C CA  . LYS H 2 14  ? 29.051  13.448  34.686  1.00 26.55  ? 104 LYS H CA  1 
ATOM   6329 C C   . LYS H 2 14  ? 29.816  14.624  34.058  1.00 33.10  ? 104 LYS H C   1 
ATOM   6330 O O   . LYS H 2 14  ? 30.846  15.055  34.582  1.00 32.44  ? 104 LYS H O   1 
ATOM   6331 C CB  . LYS H 2 14  ? 28.335  13.919  35.968  1.00 27.83  ? 104 LYS H CB  1 
ATOM   6332 C CG  . LYS H 2 14  ? 27.399  15.100  35.787  1.00 29.74  ? 104 LYS H CG  1 
ATOM   6333 C CD  . LYS H 2 14  ? 27.026  15.693  37.118  1.00 32.36  ? 104 LYS H CD  1 
ATOM   6334 C CE  . LYS H 2 14  ? 26.480  17.086  36.967  1.00 37.13  ? 104 LYS H CE  1 
ATOM   6335 N NZ  . LYS H 2 14  ? 27.556  18.105  36.791  1.00 41.54  ? 104 LYS H NZ  1 
ATOM   6336 N N   . LYS H 2 15  ? 29.269  15.174  32.965  1.00 30.73  ? 105 LYS H N   1 
ATOM   6337 C CA  . LYS H 2 15  ? 29.826  16.340  32.297  1.00 30.97  ? 105 LYS H CA  1 
ATOM   6338 C C   . LYS H 2 15  ? 28.717  17.367  32.119  1.00 34.78  ? 105 LYS H C   1 
ATOM   6339 O O   . LYS H 2 15  ? 27.679  17.042  31.558  1.00 34.20  ? 105 LYS H O   1 
ATOM   6340 C CB  . LYS H 2 15  ? 30.467  15.952  30.947  1.00 34.50  ? 105 LYS H CB  1 
ATOM   6341 C CG  . LYS H 2 15  ? 31.388  17.023  30.374  1.00 48.44  ? 105 LYS H CG  1 
ATOM   6342 N N   . THR H 2 16  ? 28.911  18.582  32.639  1.00 32.91  ? 106 THR H N   1 
ATOM   6343 C CA  . THR H 2 16  ? 27.935  19.674  32.527  1.00 33.60  ? 106 THR H CA  1 
ATOM   6344 C C   . THR H 2 16  ? 27.995  20.221  31.112  1.00 39.66  ? 106 THR H C   1 
ATOM   6345 O O   . THR H 2 16  ? 29.071  20.589  30.646  1.00 39.83  ? 106 THR H O   1 
ATOM   6346 C CB  . THR H 2 16  ? 28.218  20.755  33.595  1.00 39.51  ? 106 THR H CB  1 
ATOM   6347 O OG1 . THR H 2 16  ? 28.209  20.141  34.885  1.00 41.55  ? 106 THR H OG1 1 
ATOM   6348 C CG2 . THR H 2 16  ? 27.220  21.911  33.552  1.00 33.89  ? 106 THR H CG2 1 
ATOM   6349 N N   . LEU H 2 17  ? 26.853  20.237  30.424  1.00 38.86  ? 107 LEU H N   1 
ATOM   6350 C CA  . LEU H 2 17  ? 26.730  20.727  29.044  1.00 39.89  ? 107 LEU H CA  1 
ATOM   6351 C C   . LEU H 2 17  ? 26.332  22.198  29.080  1.00 46.74  ? 107 LEU H C   1 
ATOM   6352 O O   . LEU H 2 17  ? 27.007  23.045  28.488  1.00 47.44  ? 107 LEU H O   1 
ATOM   6353 C CB  . LEU H 2 17  ? 25.686  19.890  28.264  1.00 39.80  ? 107 LEU H CB  1 
ATOM   6354 C CG  . LEU H 2 17  ? 26.056  18.491  27.757  1.00 44.21  ? 107 LEU H CG  1 
ATOM   6355 C CD1 . LEU H 2 17  ? 26.912  17.670  28.671  1.00 44.46  ? 107 LEU H CD1 1 
ATOM   6356 C CD2 . LEU H 2 17  ? 24.858  17.762  27.190  1.00 45.95  ? 107 LEU H CD2 1 
ATOM   6357 N N   . VAL H 2 18  ? 25.242  22.491  29.802  1.00 43.87  ? 108 VAL H N   1 
ATOM   6358 C CA  . VAL H 2 18  ? 24.703  23.823  30.015  1.00 44.18  ? 108 VAL H CA  1 
ATOM   6359 C C   . VAL H 2 18  ? 24.621  24.035  31.525  1.00 50.79  ? 108 VAL H C   1 
ATOM   6360 O O   . VAL H 2 18  ? 23.922  23.265  32.194  1.00 50.30  ? 108 VAL H O   1 
ATOM   6361 C CB  . VAL H 2 18  ? 23.322  24.034  29.329  1.00 47.52  ? 108 VAL H CB  1 
ATOM   6362 C CG1 . VAL H 2 18  ? 22.748  25.410  29.654  1.00 47.15  ? 108 VAL H CG1 1 
ATOM   6363 C CG2 . VAL H 2 18  ? 23.409  23.829  27.819  1.00 47.19  ? 108 VAL H CG2 1 
ATOM   6364 N N   . PRO H 2 19  ? 25.308  25.055  32.096  1.00 48.58  ? 109 PRO H N   1 
ATOM   6365 C CA  . PRO H 2 19  ? 25.166  25.291  33.540  1.00 49.00  ? 109 PRO H CA  1 
ATOM   6366 C C   . PRO H 2 19  ? 23.813  25.935  33.842  1.00 53.57  ? 109 PRO H C   1 
ATOM   6367 O O   . PRO H 2 19  ? 23.137  26.414  32.924  1.00 52.55  ? 109 PRO H O   1 
ATOM   6368 C CB  . PRO H 2 19  ? 26.340  26.215  33.876  1.00 50.76  ? 109 PRO H CB  1 
ATOM   6369 C CG  . PRO H 2 19  ? 26.675  26.894  32.604  1.00 54.70  ? 109 PRO H CG  1 
ATOM   6370 C CD  . PRO H 2 19  ? 26.172  26.072  31.457  1.00 50.23  ? 109 PRO H CD  1 
ATOM   6371 N N   . GLY H 2 20  ? 23.421  25.912  35.110  1.00 51.75  ? 110 GLY H N   1 
ATOM   6372 C CA  . GLY H 2 20  ? 22.160  26.495  35.544  1.00 52.63  ? 110 GLY H CA  1 
ATOM   6373 C C   . GLY H 2 20  ? 22.248  28.005  35.645  1.00 59.49  ? 110 GLY H C   1 
ATOM   6374 O O   . GLY H 2 20  ? 23.357  28.554  35.608  1.00 59.35  ? 110 GLY H O   1 
ATOM   6375 N N   . PRO H 2 21  ? 21.096  28.712  35.827  1.00 57.63  ? 111 PRO H N   1 
ATOM   6376 C CA  . PRO H 2 21  ? 21.135  30.187  35.975  1.00 57.70  ? 111 PRO H CA  1 
ATOM   6377 C C   . PRO H 2 21  ? 22.032  30.667  37.138  1.00 61.55  ? 111 PRO H C   1 
ATOM   6378 O O   . PRO H 2 21  ? 22.229  29.907  38.090  1.00 61.58  ? 111 PRO H O   1 
ATOM   6379 C CB  . PRO H 2 21  ? 19.667  30.560  36.226  1.00 59.62  ? 111 PRO H CB  1 
ATOM   6380 C CG  . PRO H 2 21  ? 18.994  29.285  36.639  1.00 64.07  ? 111 PRO H CG  1 
ATOM   6381 C CD  . PRO H 2 21  ? 19.708  28.207  35.896  1.00 59.40  ? 111 PRO H CD  1 
ATOM   6382 N N   . PRO H 2 22  ? 22.582  31.916  37.089  1.00 57.15  ? 112 PRO H N   1 
ATOM   6383 C CA  . PRO H 2 22  ? 23.505  32.380  38.150  1.00 56.16  ? 112 PRO H CA  1 
ATOM   6384 C C   . PRO H 2 22  ? 23.091  32.149  39.615  1.00 58.04  ? 112 PRO H C   1 
ATOM   6385 O O   . PRO H 2 22  ? 23.971  31.927  40.447  1.00 57.63  ? 112 PRO H O   1 
ATOM   6386 C CB  . PRO H 2 22  ? 23.611  33.873  37.878  1.00 58.14  ? 112 PRO H CB  1 
ATOM   6387 C CG  . PRO H 2 22  ? 23.463  33.977  36.415  1.00 62.86  ? 112 PRO H CG  1 
ATOM   6388 C CD  . PRO H 2 22  ? 22.480  32.919  36.007  1.00 58.38  ? 112 PRO H CD  1 
ATOM   6389 N N   . GLY H 2 23  ? 21.796  32.198  39.920  1.00 53.36  ? 113 GLY H N   1 
ATOM   6390 C CA  . GLY H 2 23  ? 21.304  31.993  41.281  1.00 52.61  ? 113 GLY H CA  1 
ATOM   6391 C C   . GLY H 2 23  ? 20.836  30.591  41.639  1.00 54.09  ? 113 GLY H C   1 
ATOM   6392 O O   . GLY H 2 23  ? 20.448  30.360  42.789  1.00 53.52  ? 113 GLY H O   1 
ATOM   6393 N N   . SER H 2 24  ? 20.876  29.645  40.671  1.00 48.87  ? 114 SER H N   1 
ATOM   6394 C CA  . SER H 2 24  ? 20.401  28.257  40.830  1.00 47.68  ? 114 SER H CA  1 
ATOM   6395 C C   . SER H 2 24  ? 21.122  27.483  41.935  1.00 50.20  ? 114 SER H C   1 
ATOM   6396 O O   . SER H 2 24  ? 22.313  27.695  42.170  1.00 50.30  ? 114 SER H O   1 
ATOM   6397 C CB  . SER H 2 24  ? 20.514  27.483  39.520  1.00 49.39  ? 114 SER H CB  1 
ATOM   6398 O OG  . SER H 2 24  ? 21.855  27.371  39.072  1.00 54.14  ? 114 SER H OG  1 
ATOM   6399 N N   . SER H 2 25  ? 20.380  26.577  42.597  1.00 44.92  ? 115 SER H N   1 
ATOM   6400 C CA  . SER H 2 25  ? 20.862  25.736  43.689  1.00 43.83  ? 115 SER H CA  1 
ATOM   6401 C C   . SER H 2 25  ? 20.554  24.250  43.443  1.00 44.70  ? 115 SER H C   1 
ATOM   6402 O O   . SER H 2 25  ? 19.590  23.925  42.747  1.00 43.87  ? 115 SER H O   1 
ATOM   6403 C CB  . SER H 2 25  ? 20.244  26.187  45.008  1.00 47.44  ? 115 SER H CB  1 
ATOM   6404 O OG  . SER H 2 25  ? 20.888  25.578  46.114  1.00 56.30  ? 115 SER H OG  1 
ATOM   6405 N N   . ARG H 2 26  ? 21.362  23.356  44.054  1.00 39.27  ? 116 ARG H N   1 
ATOM   6406 C CA  . ARG H 2 26  ? 21.259  21.885  43.937  1.00 37.98  ? 116 ARG H CA  1 
ATOM   6407 C C   . ARG H 2 26  ? 19.998  21.289  44.617  1.00 40.81  ? 116 ARG H C   1 
ATOM   6408 O O   . ARG H 2 26  ? 19.631  21.768  45.692  1.00 41.15  ? 116 ARG H O   1 
ATOM   6409 C CB  . ARG H 2 26  ? 22.507  21.216  44.567  1.00 34.00  ? 116 ARG H CB  1 
ATOM   6410 C CG  . ARG H 2 26  ? 23.848  21.669  43.998  1.00 34.54  ? 116 ARG H CG  1 
ATOM   6411 C CD  . ARG H 2 26  ? 24.164  21.013  42.670  1.00 31.67  ? 116 ARG H CD  1 
ATOM   6412 N NE  . ARG H 2 26  ? 25.527  21.300  42.238  1.00 35.54  ? 116 ARG H NE  1 
ATOM   6413 C CZ  . ARG H 2 26  ? 26.597  20.613  42.624  1.00 43.98  ? 116 ARG H CZ  1 
ATOM   6414 N NH1 . ARG H 2 26  ? 26.470  19.588  43.458  1.00 30.17  ? 116 ARG H NH1 1 
ATOM   6415 N NH2 . ARG H 2 26  ? 27.801  20.943  42.176  1.00 22.63  ? 116 ARG H NH2 1 
ATOM   6416 N N   . PRO H 2 27  ? 19.365  20.201  44.085  1.00 36.44  ? 117 PRO H N   1 
ATOM   6417 C CA  . PRO H 2 27  ? 18.229  19.605  44.805  1.00 35.30  ? 117 PRO H CA  1 
ATOM   6418 C C   . PRO H 2 27  ? 18.721  18.792  46.005  1.00 38.47  ? 117 PRO H C   1 
ATOM   6419 O O   . PRO H 2 27  ? 19.880  18.337  46.022  1.00 37.80  ? 117 PRO H O   1 
ATOM   6420 C CB  . PRO H 2 27  ? 17.561  18.726  43.746  1.00 37.03  ? 117 PRO H CB  1 
ATOM   6421 C CG  . PRO H 2 27  ? 18.657  18.316  42.866  1.00 41.46  ? 117 PRO H CG  1 
ATOM   6422 C CD  . PRO H 2 27  ? 19.639  19.463  42.835  1.00 37.36  ? 117 PRO H CD  1 
ATOM   6423 N N   . VAL H 2 28  ? 17.841  18.632  47.017  1.00 34.39  ? 118 VAL H N   1 
ATOM   6424 C CA  . VAL H 2 28  ? 18.144  17.906  48.254  1.00 33.79  ? 118 VAL H CA  1 
ATOM   6425 C C   . VAL H 2 28  ? 17.263  16.649  48.344  1.00 36.53  ? 118 VAL H C   1 
ATOM   6426 O O   . VAL H 2 28  ? 16.186  16.602  47.740  1.00 36.36  ? 118 VAL H O   1 
ATOM   6427 C CB  . VAL H 2 28  ? 18.033  18.805  49.530  1.00 37.71  ? 118 VAL H CB  1 
ATOM   6428 C CG1 . VAL H 2 28  ? 18.857  20.081  49.387  1.00 37.64  ? 118 VAL H CG1 1 
ATOM   6429 C CG2 . VAL H 2 28  ? 16.584  19.145  49.877  1.00 37.31  ? 118 VAL H CG2 1 
ATOM   6430 N N   . LYS H 2 29  ? 17.728  15.636  49.093  1.00 32.80  ? 119 LYS H N   1 
ATOM   6431 C CA  . LYS H 2 29  ? 17.041  14.362  49.301  1.00 32.42  ? 119 LYS H CA  1 
ATOM   6432 C C   . LYS H 2 29  ? 15.609  14.609  49.776  1.00 36.91  ? 119 LYS H C   1 
ATOM   6433 O O   . LYS H 2 29  ? 15.395  15.395  50.704  1.00 36.77  ? 119 LYS H O   1 
ATOM   6434 C CB  . LYS H 2 29  ? 17.821  13.519  50.318  1.00 34.75  ? 119 LYS H CB  1 
ATOM   6435 C CG  . LYS H 2 29  ? 17.193  12.179  50.677  1.00 44.82  ? 119 LYS H CG  1 
ATOM   6436 C CD  . LYS H 2 29  ? 17.972  11.476  51.785  1.00 51.81  ? 119 LYS H CD  1 
ATOM   6437 C CE  . LYS H 2 29  ? 17.294  10.207  52.229  1.00 64.21  ? 119 LYS H CE  1 
ATOM   6438 N NZ  . LYS H 2 29  ? 16.061  10.479  53.018  1.00 74.62  ? 119 LYS H NZ  1 
ATOM   6439 N N   . GLY H 2 30  ? 14.658  13.958  49.108  1.00 32.96  ? 120 GLY H N   1 
ATOM   6440 C CA  . GLY H 2 30  ? 13.239  14.065  49.418  1.00 32.05  ? 120 GLY H CA  1 
ATOM   6441 C C   . GLY H 2 30  ? 12.457  14.961  48.478  1.00 34.73  ? 120 GLY H C   1 
ATOM   6442 O O   . GLY H 2 30  ? 11.230  14.864  48.420  1.00 35.05  ? 120 GLY H O   1 
ATOM   6443 N N   . GLN H 2 31  ? 13.147  15.857  47.757  1.00 29.27  ? 121 GLN H N   1 
ATOM   6444 C CA  . GLN H 2 31  ? 12.500  16.775  46.820  1.00 28.10  ? 121 GLN H CA  1 
ATOM   6445 C C   . GLN H 2 31  ? 11.973  16.037  45.602  1.00 30.85  ? 121 GLN H C   1 
ATOM   6446 O O   . GLN H 2 31  ? 12.596  15.077  45.141  1.00 29.96  ? 121 GLN H O   1 
ATOM   6447 C CB  . GLN H 2 31  ? 13.459  17.892  46.369  1.00 29.13  ? 121 GLN H CB  1 
ATOM   6448 C CG  . GLN H 2 31  ? 13.751  18.903  47.472  1.00 39.25  ? 121 GLN H CG  1 
ATOM   6449 C CD  . GLN H 2 31  ? 14.345  20.212  46.989  1.00 54.16  ? 121 GLN H CD  1 
ATOM   6450 O OE1 . GLN H 2 31  ? 15.092  20.289  45.997  1.00 42.74  ? 121 GLN H OE1 1 
ATOM   6451 N NE2 . GLN H 2 31  ? 14.063  21.274  47.723  1.00 46.51  ? 121 GLN H NE2 1 
ATOM   6452 N N   . VAL H 2 32  ? 10.831  16.485  45.078  1.00 26.79  ? 122 VAL H N   1 
ATOM   6453 C CA  . VAL H 2 32  ? 10.255  15.908  43.872  1.00 26.17  ? 122 VAL H CA  1 
ATOM   6454 C C   . VAL H 2 32  ? 10.870  16.674  42.705  1.00 30.40  ? 122 VAL H C   1 
ATOM   6455 O O   . VAL H 2 32  ? 10.626  17.876  42.536  1.00 31.23  ? 122 VAL H O   1 
ATOM   6456 C CB  . VAL H 2 32  ? 8.701   15.904  43.862  1.00 29.61  ? 122 VAL H CB  1 
ATOM   6457 C CG1 . VAL H 2 32  ? 8.167   15.188  42.631  1.00 28.79  ? 122 VAL H CG1 1 
ATOM   6458 C CG2 . VAL H 2 32  ? 8.132   15.268  45.131  1.00 29.23  ? 122 VAL H CG2 1 
ATOM   6459 N N   . VAL H 2 33  ? 11.728  15.995  41.951  1.00 25.29  ? 123 VAL H N   1 
ATOM   6460 C CA  . VAL H 2 33  ? 12.415  16.602  40.820  1.00 24.81  ? 123 VAL H CA  1 
ATOM   6461 C C   . VAL H 2 33  ? 11.752  16.179  39.504  1.00 29.66  ? 123 VAL H C   1 
ATOM   6462 O O   . VAL H 2 33  ? 11.273  15.045  39.379  1.00 31.48  ? 123 VAL H O   1 
ATOM   6463 C CB  . VAL H 2 33  ? 13.949  16.306  40.825  1.00 28.01  ? 123 VAL H CB  1 
ATOM   6464 C CG1 . VAL H 2 33  ? 14.636  16.945  42.027  1.00 27.26  ? 123 VAL H CG1 1 
ATOM   6465 C CG2 . VAL H 2 33  ? 14.246  14.812  40.768  1.00 27.58  ? 123 VAL H CG2 1 
ATOM   6466 N N   . THR H 2 34  ? 11.733  17.096  38.529  1.00 23.84  ? 124 THR H N   1 
ATOM   6467 C CA  . THR H 2 34  ? 11.213  16.867  37.174  1.00 22.95  ? 124 THR H CA  1 
ATOM   6468 C C   . THR H 2 34  ? 12.366  17.042  36.216  1.00 25.35  ? 124 THR H C   1 
ATOM   6469 O O   . THR H 2 34  ? 13.034  18.080  36.238  1.00 25.74  ? 124 THR H O   1 
ATOM   6470 C CB  . THR H 2 34  ? 10.026  17.808  36.836  1.00 30.23  ? 124 THR H CB  1 
ATOM   6471 O OG1 . THR H 2 34  ? 9.030   17.685  37.848  1.00 32.21  ? 124 THR H OG1 1 
ATOM   6472 C CG2 . THR H 2 34  ? 9.397   17.503  35.470  1.00 23.65  ? 124 THR H CG2 1 
ATOM   6473 N N   . VAL H 2 35  ? 12.617  16.039  35.385  1.00 22.37  ? 125 VAL H N   1 
ATOM   6474 C CA  . VAL H 2 35  ? 13.723  16.102  34.424  1.00 22.21  ? 125 VAL H CA  1 
ATOM   6475 C C   . VAL H 2 35  ? 13.216  15.832  32.999  1.00 28.63  ? 125 VAL H C   1 
ATOM   6476 O O   . VAL H 2 35  ? 12.116  15.312  32.826  1.00 28.13  ? 125 VAL H O   1 
ATOM   6477 C CB  . VAL H 2 35  ? 14.899  15.134  34.797  1.00 25.38  ? 125 VAL H CB  1 
ATOM   6478 C CG1 . VAL H 2 35  ? 15.484  15.446  36.185  1.00 25.44  ? 125 VAL H CG1 1 
ATOM   6479 C CG2 . VAL H 2 35  ? 14.490  13.667  34.690  1.00 24.88  ? 125 VAL H CG2 1 
ATOM   6480 N N   . HIS H 2 36  ? 14.020  16.237  31.994  1.00 26.93  ? 126 HIS H N   1 
ATOM   6481 C CA  . HIS H 2 36  ? 13.878  15.922  30.573  1.00 26.16  ? 126 HIS H CA  1 
ATOM   6482 C C   . HIS H 2 36  ? 15.044  14.994  30.278  1.00 30.47  ? 126 HIS H C   1 
ATOM   6483 O O   . HIS H 2 36  ? 16.204  15.423  30.325  1.00 30.31  ? 126 HIS H O   1 
ATOM   6484 C CB  . HIS H 2 36  ? 13.863  17.159  29.674  1.00 26.28  ? 126 HIS H CB  1 
ATOM   6485 C CG  . HIS H 2 36  ? 13.757  16.816  28.218  1.00 29.69  ? 126 HIS H CG  1 
ATOM   6486 N ND1 . HIS H 2 36  ? 12.531  16.779  27.573  1.00 31.69  ? 126 HIS H ND1 1 
ATOM   6487 C CD2 . HIS H 2 36  ? 14.723  16.462  27.335  1.00 30.31  ? 126 HIS H CD2 1 
ATOM   6488 C CE1 . HIS H 2 36  ? 12.802  16.449  26.318  1.00 30.27  ? 126 HIS H CE1 1 
ATOM   6489 N NE2 . HIS H 2 36  ? 14.105  16.226  26.138  1.00 30.18  ? 126 HIS H NE2 1 
ATOM   6490 N N   . LEU H 2 37  ? 14.745  13.710  30.066  1.00 27.12  ? 127 LEU H N   1 
ATOM   6491 C CA  . LEU H 2 37  ? 15.767  12.696  29.878  1.00 27.02  ? 127 LEU H CA  1 
ATOM   6492 C C   . LEU H 2 37  ? 15.823  12.158  28.443  1.00 31.49  ? 127 LEU H C   1 
ATOM   6493 O O   . LEU H 2 37  ? 14.807  11.811  27.848  1.00 30.82  ? 127 LEU H O   1 
ATOM   6494 C CB  . LEU H 2 37  ? 15.516  11.547  30.885  1.00 26.89  ? 127 LEU H CB  1 
ATOM   6495 C CG  . LEU H 2 37  ? 16.551  10.408  30.957  1.00 31.08  ? 127 LEU H CG  1 
ATOM   6496 C CD1 . LEU H 2 37  ? 17.832  10.853  31.645  1.00 30.86  ? 127 LEU H CD1 1 
ATOM   6497 C CD2 . LEU H 2 37  ? 15.983  9.208   31.691  1.00 32.58  ? 127 LEU H CD2 1 
ATOM   6498 N N   . GLN H 2 38  ? 17.037  12.097  27.907  1.00 29.76  ? 128 GLN H N   1 
ATOM   6499 C CA  . GLN H 2 38  ? 17.346  11.524  26.602  1.00 29.67  ? 128 GLN H CA  1 
ATOM   6500 C C   . GLN H 2 38  ? 18.319  10.376  26.857  1.00 34.74  ? 128 GLN H C   1 
ATOM   6501 O O   . GLN H 2 38  ? 19.493  10.611  27.168  1.00 34.67  ? 128 GLN H O   1 
ATOM   6502 C CB  . GLN H 2 38  ? 17.917  12.565  25.618  1.00 30.95  ? 128 GLN H CB  1 
ATOM   6503 C CG  . GLN H 2 38  ? 17.035  13.777  25.362  1.00 43.92  ? 128 GLN H CG  1 
ATOM   6504 C CD  . GLN H 2 38  ? 17.357  14.419  24.029  1.00 60.19  ? 128 GLN H CD  1 
ATOM   6505 O OE1 . GLN H 2 38  ? 18.470  14.901  23.776  1.00 54.15  ? 128 GLN H OE1 1 
ATOM   6506 N NE2 . GLN H 2 38  ? 16.382  14.449  23.141  1.00 51.45  ? 128 GLN H NE2 1 
ATOM   6507 N N   . THR H 2 39  ? 17.804  9.141   26.815  1.00 30.97  ? 129 THR H N   1 
ATOM   6508 C CA  . THR H 2 39  ? 18.583  7.934   27.068  1.00 30.70  ? 129 THR H CA  1 
ATOM   6509 C C   . THR H 2 39  ? 19.014  7.314   25.758  1.00 35.72  ? 129 THR H C   1 
ATOM   6510 O O   . THR H 2 39  ? 18.201  7.171   24.843  1.00 36.25  ? 129 THR H O   1 
ATOM   6511 C CB  . THR H 2 39  ? 17.766  6.927   27.919  1.00 35.39  ? 129 THR H CB  1 
ATOM   6512 O OG1 . THR H 2 39  ? 17.195  7.597   29.040  1.00 40.16  ? 129 THR H OG1 1 
ATOM   6513 C CG2 . THR H 2 39  ? 18.591  5.747   28.404  1.00 31.26  ? 129 THR H CG2 1 
ATOM   6514 N N   . SER H 2 40  ? 20.290  6.935   25.676  1.00 31.64  ? 130 SER H N   1 
ATOM   6515 C CA  . SER H 2 40  ? 20.853  6.260   24.520  1.00 31.62  ? 130 SER H CA  1 
ATOM   6516 C C   . SER H 2 40  ? 21.843  5.200   24.963  1.00 34.26  ? 130 SER H C   1 
ATOM   6517 O O   . SER H 2 40  ? 22.440  5.303   26.041  1.00 33.07  ? 130 SER H O   1 
ATOM   6518 C CB  . SER H 2 40  ? 21.493  7.237   23.539  1.00 36.22  ? 130 SER H CB  1 
ATOM   6519 O OG  . SER H 2 40  ? 22.537  7.984   24.133  1.00 46.50  ? 130 SER H OG  1 
ATOM   6520 N N   . LEU H 2 41  ? 21.964  4.158   24.148  1.00 30.94  ? 131 LEU H N   1 
ATOM   6521 C CA  . LEU H 2 41  ? 22.838  3.033   24.408  1.00 31.21  ? 131 LEU H CA  1 
ATOM   6522 C C   . LEU H 2 41  ? 24.261  3.368   23.992  1.00 38.18  ? 131 LEU H C   1 
ATOM   6523 O O   . LEU H 2 41  ? 24.499  4.411   23.374  1.00 37.51  ? 131 LEU H O   1 
ATOM   6524 C CB  . LEU H 2 41  ? 22.323  1.767   23.673  1.00 31.06  ? 131 LEU H CB  1 
ATOM   6525 C CG  . LEU H 2 41  ? 20.893  1.297   23.979  1.00 35.24  ? 131 LEU H CG  1 
ATOM   6526 C CD1 . LEU H 2 41  ? 20.447  0.237   22.994  1.00 34.18  ? 131 LEU H CD1 1 
ATOM   6527 C CD2 . LEU H 2 41  ? 20.772  0.766   25.391  1.00 38.83  ? 131 LEU H CD2 1 
ATOM   6528 N N   . GLU H 2 42  ? 25.204  2.459   24.318  1.00 37.37  ? 132 GLU H N   1 
ATOM   6529 C CA  . GLU H 2 42  ? 26.623  2.569   23.993  1.00 38.06  ? 132 GLU H CA  1 
ATOM   6530 C C   . GLU H 2 42  ? 26.874  2.699   22.468  1.00 41.84  ? 132 GLU H C   1 
ATOM   6531 O O   . GLU H 2 42  ? 27.828  3.357   22.066  1.00 41.36  ? 132 GLU H O   1 
ATOM   6532 C CB  . GLU H 2 42  ? 27.370  1.356   24.558  1.00 39.76  ? 132 GLU H CB  1 
ATOM   6533 C CG  . GLU H 2 42  ? 28.760  1.682   25.061  1.00 55.01  ? 132 GLU H CG  1 
ATOM   6534 C CD  . GLU H 2 42  ? 29.330  0.720   26.087  1.00 79.73  ? 132 GLU H CD  1 
ATOM   6535 O OE1 . GLU H 2 42  ? 29.073  -0.501  25.979  1.00 74.12  ? 132 GLU H OE1 1 
ATOM   6536 O OE2 . GLU H 2 42  ? 30.035  1.194   27.006  1.00 77.82  ? 132 GLU H OE2 1 
ATOM   6537 N N   . ASN H 2 43  ? 25.998  2.112   21.630  1.00 38.72  ? 133 ASN H N   1 
ATOM   6538 C CA  . ASN H 2 43  ? 26.100  2.144   20.162  1.00 37.51  ? 133 ASN H CA  1 
ATOM   6539 C C   . ASN H 2 43  ? 25.383  3.365   19.525  1.00 39.37  ? 133 ASN H C   1 
ATOM   6540 O O   . ASN H 2 43  ? 25.463  3.558   18.306  1.00 38.55  ? 133 ASN H O   1 
ATOM   6541 C CB  . ASN H 2 43  ? 25.563  0.846   19.561  1.00 38.62  ? 133 ASN H CB  1 
ATOM   6542 C CG  . ASN H 2 43  ? 24.116  0.562   19.875  1.00 64.65  ? 133 ASN H CG  1 
ATOM   6543 O OD1 . ASN H 2 43  ? 23.222  0.920   19.113  1.00 48.46  ? 133 ASN H OD1 1 
ATOM   6544 N ND2 . ASN H 2 43  ? 23.859  -0.113  20.991  1.00 64.65  ? 133 ASN H ND2 1 
ATOM   6545 N N   . GLY H 2 44  ? 24.696  4.163   20.340  1.00 33.84  ? 134 GLY H N   1 
ATOM   6546 C CA  . GLY H 2 44  ? 24.003  5.362   19.874  1.00 32.48  ? 134 GLY H CA  1 
ATOM   6547 C C   . GLY H 2 44  ? 22.499  5.256   19.693  1.00 34.49  ? 134 GLY H C   1 
ATOM   6548 O O   . GLY H 2 44  ? 21.850  6.253   19.364  1.00 34.25  ? 134 GLY H O   1 
ATOM   6549 N N   . THR H 2 45  ? 21.925  4.058   19.901  1.00 29.96  ? 135 THR H N   1 
ATOM   6550 C CA  . THR H 2 45  ? 20.478  3.815   19.779  1.00 28.92  ? 135 THR H CA  1 
ATOM   6551 C C   . THR H 2 45  ? 19.726  4.475   20.935  1.00 30.06  ? 135 THR H C   1 
ATOM   6552 O O   . THR H 2 45  ? 20.105  4.296   22.086  1.00 27.94  ? 135 THR H O   1 
ATOM   6553 C CB  . THR H 2 45  ? 20.205  2.294   19.724  1.00 40.11  ? 135 THR H CB  1 
ATOM   6554 O OG1 . THR H 2 45  ? 20.738  1.765   18.512  1.00 38.16  ? 135 THR H OG1 1 
ATOM   6555 C CG2 . THR H 2 45  ? 18.717  1.937   19.821  1.00 41.46  ? 135 THR H CG2 1 
ATOM   6556 N N   . ARG H 2 46  ? 18.618  5.169   20.625  1.00 27.34  ? 136 ARG H N   1 
ATOM   6557 C CA  . ARG H 2 46  ? 17.761  5.811   21.617  1.00 27.34  ? 136 ARG H CA  1 
ATOM   6558 C C   . ARG H 2 46  ? 16.716  4.831   22.094  1.00 34.07  ? 136 ARG H C   1 
ATOM   6559 O O   . ARG H 2 46  ? 16.205  4.017   21.321  1.00 34.26  ? 136 ARG H O   1 
ATOM   6560 C CB  . ARG H 2 46  ? 17.138  7.097   21.089  1.00 27.94  ? 136 ARG H CB  1 
ATOM   6561 C CG  . ARG H 2 46  ? 18.204  8.146   20.897  1.00 44.67  ? 136 ARG H CG  1 
ATOM   6562 C CD  . ARG H 2 46  ? 17.717  9.564   20.684  1.00 57.87  ? 136 ARG H CD  1 
ATOM   6563 N NE  . ARG H 2 46  ? 18.845  10.377  20.227  1.00 57.10  ? 136 ARG H NE  1 
ATOM   6564 C CZ  . ARG H 2 46  ? 19.724  10.967  21.031  1.00 53.29  ? 136 ARG H CZ  1 
ATOM   6565 N NH1 . ARG H 2 46  ? 19.580  10.899  22.350  1.00 30.51  ? 136 ARG H NH1 1 
ATOM   6566 N NH2 . ARG H 2 46  ? 20.754  11.628  20.522  1.00 20.83  ? 136 ARG H NH2 1 
ATOM   6567 N N   . VAL H 2 47  ? 16.407  4.933   23.381  1.00 32.47  ? 137 VAL H N   1 
ATOM   6568 C CA  . VAL H 2 47  ? 15.587  4.044   24.179  1.00 33.56  ? 137 VAL H CA  1 
ATOM   6569 C C   . VAL H 2 47  ? 14.094  4.074   23.840  1.00 39.54  ? 137 VAL H C   1 
ATOM   6570 O O   . VAL H 2 47  ? 13.478  2.994   23.833  1.00 40.85  ? 137 VAL H O   1 
ATOM   6571 C CB  . VAL H 2 47  ? 15.847  4.353   25.676  1.00 37.53  ? 137 VAL H CB  1 
ATOM   6572 C CG1 . VAL H 2 47  ? 14.657  4.006   26.576  1.00 36.87  ? 137 VAL H CG1 1 
ATOM   6573 C CG2 . VAL H 2 47  ? 17.099  3.612   26.136  1.00 37.53  ? 137 VAL H CG2 1 
ATOM   6574 N N   . GLN H 2 48  ? 13.515  5.257   23.570  1.00 35.30  ? 138 GLN H N   1 
ATOM   6575 C CA  . GLN H 2 48  ? 12.082  5.418   23.309  1.00 35.41  ? 138 GLN H CA  1 
ATOM   6576 C C   . GLN H 2 48  ? 11.324  5.216   24.625  1.00 39.72  ? 138 GLN H C   1 
ATOM   6577 O O   . GLN H 2 48  ? 11.155  4.093   25.124  1.00 38.15  ? 138 GLN H O   1 
ATOM   6578 C CB  . GLN H 2 48  ? 11.548  4.505   22.184  1.00 36.60  ? 138 GLN H CB  1 
ATOM   6579 N N   . GLU H 2 49  ? 10.938  6.356   25.207  1.00 37.24  ? 139 GLU H N   1 
ATOM   6580 C CA  . GLU H 2 49  ? 10.230  6.524   26.474  1.00 37.39  ? 139 GLU H CA  1 
ATOM   6581 C C   . GLU H 2 49  ? 9.723   7.969   26.564  1.00 42.61  ? 139 GLU H C   1 
ATOM   6582 O O   . GLU H 2 49  ? 10.071  8.789   25.708  1.00 42.08  ? 139 GLU H O   1 
ATOM   6583 C CB  . GLU H 2 49  ? 11.156  6.184   27.672  1.00 38.57  ? 139 GLU H CB  1 
ATOM   6584 C CG  . GLU H 2 49  ? 12.482  6.939   27.686  1.00 46.05  ? 139 GLU H CG  1 
ATOM   6585 C CD  . GLU H 2 49  ? 13.443  6.619   28.817  1.00 62.73  ? 139 GLU H CD  1 
ATOM   6586 O OE1 . GLU H 2 49  ? 13.263  5.582   29.497  1.00 42.14  ? 139 GLU H OE1 1 
ATOM   6587 O OE2 . GLU H 2 49  ? 14.398  7.407   29.007  1.00 55.00  ? 139 GLU H OE2 1 
ATOM   6588 N N   . GLU H 2 50  ? 8.915   8.286   27.602  1.00 40.00  ? 140 GLU H N   1 
ATOM   6589 C CA  . GLU H 2 50  ? 8.433   9.647   27.821  1.00 39.43  ? 140 GLU H CA  1 
ATOM   6590 C C   . GLU H 2 50  ? 9.623   10.499  28.318  1.00 42.00  ? 140 GLU H C   1 
ATOM   6591 O O   . GLU H 2 50  ? 10.333  10.070  29.234  1.00 40.68  ? 140 GLU H O   1 
ATOM   6592 C CB  . GLU H 2 50  ? 7.251   9.663   28.801  1.00 40.78  ? 140 GLU H CB  1 
ATOM   6593 N N   . PRO H 2 51  ? 9.916   11.651  27.667  1.00 38.45  ? 141 PRO H N   1 
ATOM   6594 C CA  . PRO H 2 51  ? 11.078  12.460  28.083  1.00 37.49  ? 141 PRO H CA  1 
ATOM   6595 C C   . PRO H 2 51  ? 10.906  13.152  29.445  1.00 38.29  ? 141 PRO H C   1 
ATOM   6596 O O   . PRO H 2 51  ? 11.887  13.237  30.189  1.00 38.00  ? 141 PRO H O   1 
ATOM   6597 C CB  . PRO H 2 51  ? 11.209  13.478  26.955  1.00 39.49  ? 141 PRO H CB  1 
ATOM   6598 C CG  . PRO H 2 51  ? 9.831   13.630  26.420  1.00 44.32  ? 141 PRO H CG  1 
ATOM   6599 C CD  . PRO H 2 51  ? 9.202   12.276  26.534  1.00 40.05  ? 141 PRO H CD  1 
ATOM   6600 N N   . GLU H 2 52  ? 9.674   13.628  29.771  1.00 32.20  ? 142 GLU H N   1 
ATOM   6601 C CA  . GLU H 2 52  ? 9.314   14.297  31.036  1.00 30.98  ? 142 GLU H CA  1 
ATOM   6602 C C   . GLU H 2 52  ? 9.172   13.251  32.131  1.00 34.91  ? 142 GLU H C   1 
ATOM   6603 O O   . GLU H 2 52  ? 8.311   12.367  32.046  1.00 35.35  ? 142 GLU H O   1 
ATOM   6604 C CB  . GLU H 2 52  ? 8.016   15.120  30.885  1.00 31.79  ? 142 GLU H CB  1 
ATOM   6605 C CG  . GLU H 2 52  ? 8.210   16.598  31.149  1.00 41.99  ? 142 GLU H CG  1 
ATOM   6606 C CD  . GLU H 2 52  ? 7.093   17.252  31.937  1.00 70.75  ? 142 GLU H CD  1 
ATOM   6607 O OE1 . GLU H 2 52  ? 6.866   16.856  33.106  1.00 54.17  ? 142 GLU H OE1 1 
ATOM   6608 O OE2 . GLU H 2 52  ? 6.456   18.181  31.389  1.00 73.87  ? 142 GLU H OE2 1 
ATOM   6609 N N   . LEU H 2 53  ? 10.020  13.340  33.152  1.00 30.39  ? 143 LEU H N   1 
ATOM   6610 C CA  . LEU H 2 53  ? 10.081  12.336  34.196  1.00 29.90  ? 143 LEU H CA  1 
ATOM   6611 C C   . LEU H 2 53  ? 10.065  12.976  35.571  1.00 31.50  ? 143 LEU H C   1 
ATOM   6612 O O   . LEU H 2 53  ? 10.866  13.859  35.836  1.00 31.19  ? 143 LEU H O   1 
ATOM   6613 C CB  . LEU H 2 53  ? 11.363  11.495  33.976  1.00 30.10  ? 143 LEU H CB  1 
ATOM   6614 C CG  . LEU H 2 53  ? 11.695  10.401  34.995  1.00 34.93  ? 143 LEU H CG  1 
ATOM   6615 C CD1 . LEU H 2 53  ? 10.655  9.256   34.986  1.00 35.38  ? 143 LEU H CD1 1 
ATOM   6616 C CD2 . LEU H 2 53  ? 13.066  9.843   34.732  1.00 35.48  ? 143 LEU H CD2 1 
ATOM   6617 N N   . VAL H 2 54  ? 9.145   12.530  36.437  1.00 27.63  ? 144 VAL H N   1 
ATOM   6618 C CA  . VAL H 2 54  ? 8.947   13.043  37.796  1.00 26.45  ? 144 VAL H CA  1 
ATOM   6619 C C   . VAL H 2 54  ? 9.277   11.939  38.803  1.00 31.85  ? 144 VAL H C   1 
ATOM   6620 O O   . VAL H 2 54  ? 8.692   10.859  38.765  1.00 31.82  ? 144 VAL H O   1 
ATOM   6621 C CB  . VAL H 2 54  ? 7.498   13.588  37.967  1.00 29.73  ? 144 VAL H CB  1 
ATOM   6622 C CG1 . VAL H 2 54  ? 7.193   13.946  39.420  1.00 29.03  ? 144 VAL H CG1 1 
ATOM   6623 C CG2 . VAL H 2 54  ? 7.239   14.785  37.052  1.00 29.50  ? 144 VAL H CG2 1 
ATOM   6624 N N   . PHE H 2 55  ? 10.226  12.210  39.699  1.00 30.98  ? 145 PHE H N   1 
ATOM   6625 C CA  . PHE H 2 55  ? 10.641  11.242  40.703  1.00 31.65  ? 145 PHE H CA  1 
ATOM   6626 C C   . PHE H 2 55  ? 11.138  11.955  41.952  1.00 36.63  ? 145 PHE H C   1 
ATOM   6627 O O   . PHE H 2 55  ? 11.506  13.128  41.882  1.00 37.64  ? 145 PHE H O   1 
ATOM   6628 C CB  . PHE H 2 55  ? 11.704  10.271  40.142  1.00 33.75  ? 145 PHE H CB  1 
ATOM   6629 C CG  . PHE H 2 55  ? 13.011  10.875  39.682  1.00 35.46  ? 145 PHE H CG  1 
ATOM   6630 C CD1 . PHE H 2 55  ? 13.167  11.325  38.377  1.00 38.89  ? 145 PHE H CD1 1 
ATOM   6631 C CD2 . PHE H 2 55  ? 14.108  10.930  40.533  1.00 37.34  ? 145 PHE H CD2 1 
ATOM   6632 C CE1 . PHE H 2 55  ? 14.389  11.859  37.945  1.00 39.82  ? 145 PHE H CE1 1 
ATOM   6633 C CE2 . PHE H 2 55  ? 15.324  11.460  40.101  1.00 39.68  ? 145 PHE H CE2 1 
ATOM   6634 C CZ  . PHE H 2 55  ? 15.458  11.917  38.809  1.00 38.06  ? 145 PHE H CZ  1 
ATOM   6635 N N   . THR H 2 56  ? 11.099  11.254  43.095  1.00 31.84  ? 146 THR H N   1 
ATOM   6636 C CA  . THR H 2 56  ? 11.542  11.763  44.394  1.00 31.05  ? 146 THR H CA  1 
ATOM   6637 C C   . THR H 2 56  ? 13.009  11.378  44.562  1.00 34.15  ? 146 THR H C   1 
ATOM   6638 O O   . THR H 2 56  ? 13.359  10.199  44.438  1.00 32.74  ? 146 THR H O   1 
ATOM   6639 C CB  . THR H 2 56  ? 10.643  11.212  45.518  1.00 33.22  ? 146 THR H CB  1 
ATOM   6640 O OG1 . THR H 2 56  ? 9.273   11.382  45.155  1.00 31.00  ? 146 THR H OG1 1 
ATOM   6641 C CG2 . THR H 2 56  ? 10.902  11.873  46.854  1.00 32.95  ? 146 THR H CG2 1 
ATOM   6642 N N   . LEU H 2 57  ? 13.860  12.374  44.829  1.00 30.83  ? 147 LEU H N   1 
ATOM   6643 C CA  . LEU H 2 57  ? 15.297  12.205  45.003  1.00 31.07  ? 147 LEU H CA  1 
ATOM   6644 C C   . LEU H 2 57  ? 15.620  11.350  46.228  1.00 33.59  ? 147 LEU H C   1 
ATOM   6645 O O   . LEU H 2 57  ? 15.130  11.635  47.329  1.00 34.43  ? 147 LEU H O   1 
ATOM   6646 C CB  . LEU H 2 57  ? 15.959  13.593  45.125  1.00 31.66  ? 147 LEU H CB  1 
ATOM   6647 C CG  . LEU H 2 57  ? 17.375  13.730  44.578  1.00 36.33  ? 147 LEU H CG  1 
ATOM   6648 C CD1 . LEU H 2 57  ? 17.376  13.669  43.073  1.00 36.15  ? 147 LEU H CD1 1 
ATOM   6649 C CD2 . LEU H 2 57  ? 17.989  15.035  45.014  1.00 39.74  ? 147 LEU H CD2 1 
ATOM   6650 N N   . GLY H 2 58  ? 16.433  10.314  46.010  1.00 27.82  ? 148 GLY H N   1 
ATOM   6651 C CA  . GLY H 2 58  ? 16.871  9.377   47.039  1.00 27.10  ? 148 GLY H CA  1 
ATOM   6652 C C   . GLY H 2 58  ? 15.924  8.221   47.320  1.00 30.81  ? 148 GLY H C   1 
ATOM   6653 O O   . GLY H 2 58  ? 16.195  7.431   48.225  1.00 30.33  ? 148 GLY H O   1 
ATOM   6654 N N   . ASP H 2 59  ? 14.803  8.115   46.553  1.00 26.89  ? 149 ASP H N   1 
ATOM   6655 C CA  . ASP H 2 59  ? 13.765  7.079   46.687  1.00 26.55  ? 149 ASP H CA  1 
ATOM   6656 C C   . ASP H 2 59  ? 13.960  5.894   45.715  1.00 31.55  ? 149 ASP H C   1 
ATOM   6657 O O   . ASP H 2 59  ? 13.262  4.881   45.848  1.00 29.63  ? 149 ASP H O   1 
ATOM   6658 C CB  . ASP H 2 59  ? 12.362  7.681   46.471  1.00 27.76  ? 149 ASP H CB  1 
ATOM   6659 C CG  . ASP H 2 59  ? 11.658  8.227   47.702  1.00 40.91  ? 149 ASP H CG  1 
ATOM   6660 O OD1 . ASP H 2 59  ? 12.307  8.331   48.767  1.00 41.75  ? 149 ASP H OD1 1 
ATOM   6661 O OD2 . ASP H 2 59  ? 10.453  8.546   47.601  1.00 48.85  ? 149 ASP H OD2 1 
ATOM   6662 N N   . CYS H 2 60  ? 14.888  6.031   44.736  1.00 30.21  ? 150 CYS H N   1 
ATOM   6663 C CA  . CYS H 2 60  ? 15.223  5.033   43.700  1.00 30.33  ? 150 CYS H CA  1 
ATOM   6664 C C   . CYS H 2 60  ? 13.954  4.566   42.961  1.00 29.29  ? 150 CYS H C   1 
ATOM   6665 O O   . CYS H 2 60  ? 13.712  3.373   42.791  1.00 27.46  ? 150 CYS H O   1 
ATOM   6666 C CB  . CYS H 2 60  ? 16.008  3.860   44.284  1.00 31.78  ? 150 CYS H CB  1 
ATOM   6667 S SG  . CYS H 2 60  ? 17.595  4.324   45.023  1.00 36.40  ? 150 CYS H SG  1 
ATOM   6668 N N   . ASP H 2 61  ? 13.155  5.537   42.533  1.00 24.33  ? 151 ASP H N   1 
ATOM   6669 C CA  . ASP H 2 61  ? 11.922  5.344   41.786  1.00 24.12  ? 151 ASP H CA  1 
ATOM   6670 C C   . ASP H 2 61  ? 12.160  4.740   40.412  1.00 27.78  ? 151 ASP H C   1 
ATOM   6671 O O   . ASP H 2 61  ? 11.322  3.968   39.948  1.00 27.55  ? 151 ASP H O   1 
ATOM   6672 C CB  . ASP H 2 61  ? 11.193  6.694   41.604  1.00 25.59  ? 151 ASP H CB  1 
ATOM   6673 C CG  . ASP H 2 61  ? 10.427  7.222   42.799  1.00 34.49  ? 151 ASP H CG  1 
ATOM   6674 O OD1 . ASP H 2 61  ? 10.252  6.469   43.774  1.00 36.30  ? 151 ASP H OD1 1 
ATOM   6675 O OD2 . ASP H 2 61  ? 9.951   8.370   42.731  1.00 41.90  ? 151 ASP H OD2 1 
ATOM   6676 N N   . VAL H 2 62  ? 13.264  5.139   39.735  1.00 24.67  ? 152 VAL H N   1 
ATOM   6677 C CA  . VAL H 2 62  ? 13.526  4.714   38.357  1.00 24.50  ? 152 VAL H CA  1 
ATOM   6678 C C   . VAL H 2 62  ? 14.818  3.873   38.301  1.00 29.38  ? 152 VAL H C   1 
ATOM   6679 O O   . VAL H 2 62  ? 14.744  2.646   38.178  1.00 28.97  ? 152 VAL H O   1 
ATOM   6680 C CB  . VAL H 2 62  ? 13.558  5.931   37.378  1.00 28.07  ? 152 VAL H CB  1 
ATOM   6681 C CG1 . VAL H 2 62  ? 13.595  5.471   35.925  1.00 28.06  ? 152 VAL H CG1 1 
ATOM   6682 C CG2 . VAL H 2 62  ? 12.365  6.862   37.601  1.00 27.79  ? 152 VAL H CG2 1 
ATOM   6683 N N   . ILE H 2 63  ? 15.984  4.529   38.346  1.00 25.94  ? 153 ILE H N   1 
ATOM   6684 C CA  . ILE H 2 63  ? 17.294  3.874   38.294  1.00 25.71  ? 153 ILE H CA  1 
ATOM   6685 C C   . ILE H 2 63  ? 18.232  4.570   39.267  1.00 29.03  ? 153 ILE H C   1 
ATOM   6686 O O   . ILE H 2 63  ? 18.094  5.771   39.490  1.00 28.82  ? 153 ILE H O   1 
ATOM   6687 C CB  . ILE H 2 63  ? 17.911  3.804   36.857  1.00 28.60  ? 153 ILE H CB  1 
ATOM   6688 C CG1 . ILE H 2 63  ? 17.854  5.159   36.115  1.00 28.64  ? 153 ILE H CG1 1 
ATOM   6689 C CG2 . ILE H 2 63  ? 17.280  2.684   36.030  1.00 28.84  ? 153 ILE H CG2 1 
ATOM   6690 C CD1 . ILE H 2 63  ? 18.777  5.256   34.913  1.00 26.30  ? 153 ILE H CD1 1 
ATOM   6691 N N   . GLN H 2 64  ? 19.191  3.817   39.830  1.00 24.89  ? 154 GLN H N   1 
ATOM   6692 C CA  . GLN H 2 64  ? 20.200  4.320   40.760  1.00 24.96  ? 154 GLN H CA  1 
ATOM   6693 C C   . GLN H 2 64  ? 21.023  5.465   40.149  1.00 28.23  ? 154 GLN H C   1 
ATOM   6694 O O   . GLN H 2 64  ? 21.356  6.401   40.857  1.00 28.52  ? 154 GLN H O   1 
ATOM   6695 C CB  . GLN H 2 64  ? 21.136  3.183   41.184  1.00 25.88  ? 154 GLN H CB  1 
ATOM   6696 C CG  . GLN H 2 64  ? 20.928  2.739   42.619  1.00 42.81  ? 154 GLN H CG  1 
ATOM   6697 N N   . ALA H 2 65  ? 21.340  5.385   38.841  1.00 25.10  ? 155 ALA H N   1 
ATOM   6698 C CA  . ALA H 2 65  ? 22.117  6.372   38.091  1.00 24.33  ? 155 ALA H CA  1 
ATOM   6699 C C   . ALA H 2 65  ? 21.544  7.787   38.268  1.00 26.00  ? 155 ALA H C   1 
ATOM   6700 O O   . ALA H 2 65  ? 22.310  8.718   38.503  1.00 25.38  ? 155 ALA H O   1 
ATOM   6701 C CB  . ALA H 2 65  ? 22.154  6.003   36.619  1.00 25.25  ? 155 ALA H CB  1 
ATOM   6702 N N   . LEU H 2 66  ? 20.204  7.934   38.212  1.00 20.22  ? 156 LEU H N   1 
ATOM   6703 C CA  . LEU H 2 66  ? 19.531  9.217   38.388  1.00 19.51  ? 156 LEU H CA  1 
ATOM   6704 C C   . LEU H 2 66  ? 19.641  9.748   39.821  1.00 23.71  ? 156 LEU H C   1 
ATOM   6705 O O   . LEU H 2 66  ? 19.937  10.930  40.007  1.00 22.50  ? 156 LEU H O   1 
ATOM   6706 C CB  . LEU H 2 66  ? 18.054  9.125   37.980  1.00 19.14  ? 156 LEU H CB  1 
ATOM   6707 C CG  . LEU H 2 66  ? 17.782  8.966   36.482  1.00 21.96  ? 156 LEU H CG  1 
ATOM   6708 C CD1 . LEU H 2 66  ? 16.340  8.725   36.243  1.00 20.81  ? 156 LEU H CD1 1 
ATOM   6709 C CD2 . LEU H 2 66  ? 18.246  10.185  35.688  1.00 23.43  ? 156 LEU H CD2 1 
ATOM   6710 N N   . ASP H 2 67  ? 19.436  8.888   40.827  1.00 21.05  ? 157 ASP H N   1 
ATOM   6711 C CA  . ASP H 2 67  ? 19.515  9.300   42.241  1.00 21.34  ? 157 ASP H CA  1 
ATOM   6712 C C   . ASP H 2 67  ? 20.940  9.633   42.688  1.00 25.85  ? 157 ASP H C   1 
ATOM   6713 O O   . ASP H 2 67  ? 21.114  10.310  43.699  1.00 23.94  ? 157 ASP H O   1 
ATOM   6714 C CB  . ASP H 2 67  ? 18.950  8.210   43.148  1.00 22.93  ? 157 ASP H CB  1 
ATOM   6715 C CG  . ASP H 2 67  ? 17.454  8.030   42.998  1.00 27.34  ? 157 ASP H CG  1 
ATOM   6716 O OD1 . ASP H 2 67  ? 17.018  7.503   41.944  1.00 27.35  ? 157 ASP H OD1 1 
ATOM   6717 O OD2 . ASP H 2 67  ? 16.722  8.384   43.939  1.00 28.00  ? 157 ASP H OD2 1 
ATOM   6718 N N   . LEU H 2 68  ? 21.945  9.132   41.958  1.00 23.72  ? 158 LEU H N   1 
ATOM   6719 C CA  . LEU H 2 68  ? 23.350  9.348   42.275  1.00 24.50  ? 158 LEU H CA  1 
ATOM   6720 C C   . LEU H 2 68  ? 23.934  10.554  41.535  1.00 28.56  ? 158 LEU H C   1 
ATOM   6721 O O   . LEU H 2 68  ? 24.861  11.175  42.043  1.00 28.02  ? 158 LEU H O   1 
ATOM   6722 C CB  . LEU H 2 68  ? 24.169  8.092   41.921  1.00 24.86  ? 158 LEU H CB  1 
ATOM   6723 C CG  . LEU H 2 68  ? 24.216  6.890   42.894  1.00 29.85  ? 158 LEU H CG  1 
ATOM   6724 C CD1 . LEU H 2 68  ? 24.692  7.252   44.302  1.00 30.23  ? 158 LEU H CD1 1 
ATOM   6725 C CD2 . LEU H 2 68  ? 23.060  6.019   42.857  1.00 33.73  ? 158 LEU H CD2 1 
ATOM   6726 N N   . SER H 2 69  ? 23.409  10.884  40.349  1.00 24.98  ? 159 SER H N   1 
ATOM   6727 C CA  . SER H 2 69  ? 23.935  11.979  39.539  1.00 25.13  ? 159 SER H CA  1 
ATOM   6728 C C   . SER H 2 69  ? 23.134  13.293  39.653  1.00 29.53  ? 159 SER H C   1 
ATOM   6729 O O   . SER H 2 69  ? 23.746  14.369  39.612  1.00 30.53  ? 159 SER H O   1 
ATOM   6730 C CB  . SER H 2 69  ? 24.007  11.552  38.072  1.00 29.70  ? 159 SER H CB  1 
ATOM   6731 O OG  . SER H 2 69  ? 22.730  11.209  37.549  1.00 39.38  ? 159 SER H OG  1 
ATOM   6732 N N   . VAL H 2 70  ? 21.795  13.224  39.796  1.00 24.47  ? 160 VAL H N   1 
ATOM   6733 C CA  . VAL H 2 70  ? 20.930  14.415  39.843  1.00 24.24  ? 160 VAL H CA  1 
ATOM   6734 C C   . VAL H 2 70  ? 21.253  15.314  41.089  1.00 29.63  ? 160 VAL H C   1 
ATOM   6735 O O   . VAL H 2 70  ? 21.229  16.541  40.927  1.00 28.39  ? 160 VAL H O   1 
ATOM   6736 C CB  . VAL H 2 70  ? 19.421  14.050  39.713  1.00 26.94  ? 160 VAL H CB  1 
ATOM   6737 C CG1 . VAL H 2 70  ? 18.514  15.240  40.022  1.00 26.45  ? 160 VAL H CG1 1 
ATOM   6738 C CG2 . VAL H 2 70  ? 19.121  13.518  38.302  1.00 25.98  ? 160 VAL H CG2 1 
ATOM   6739 N N   . PRO H 2 71  ? 21.637  14.787  42.286  1.00 28.03  ? 161 PRO H N   1 
ATOM   6740 C CA  . PRO H 2 71  ? 21.970  15.695  43.409  1.00 28.21  ? 161 PRO H CA  1 
ATOM   6741 C C   . PRO H 2 71  ? 23.209  16.559  43.135  1.00 32.13  ? 161 PRO H C   1 
ATOM   6742 O O   . PRO H 2 71  ? 23.484  17.491  43.898  1.00 33.41  ? 161 PRO H O   1 
ATOM   6743 C CB  . PRO H 2 71  ? 22.237  14.736  44.575  1.00 29.50  ? 161 PRO H CB  1 
ATOM   6744 C CG  . PRO H 2 71  ? 21.615  13.461  44.186  1.00 33.81  ? 161 PRO H CG  1 
ATOM   6745 C CD  . PRO H 2 71  ? 21.743  13.378  42.712  1.00 29.78  ? 161 PRO H CD  1 
ATOM   6746 N N   . LEU H 2 72  ? 23.962  16.230  42.054  1.00 26.12  ? 162 LEU H N   1 
ATOM   6747 C CA  . LEU H 2 72  ? 25.173  16.931  41.620  1.00 24.52  ? 162 LEU H CA  1 
ATOM   6748 C C   . LEU H 2 72  ? 24.877  17.939  40.496  1.00 27.37  ? 162 LEU H C   1 
ATOM   6749 O O   . LEU H 2 72  ? 25.820  18.492  39.937  1.00 26.94  ? 162 LEU H O   1 
ATOM   6750 C CB  . LEU H 2 72  ? 26.244  15.928  41.161  1.00 24.08  ? 162 LEU H CB  1 
ATOM   6751 C CG  . LEU H 2 72  ? 26.670  14.851  42.158  1.00 28.65  ? 162 LEU H CG  1 
ATOM   6752 C CD1 . LEU H 2 72  ? 27.648  13.932  41.540  1.00 27.86  ? 162 LEU H CD1 1 
ATOM   6753 C CD2 . LEU H 2 72  ? 27.257  15.445  43.421  1.00 31.93  ? 162 LEU H CD2 1 
ATOM   6754 N N   . MET H 2 73  ? 23.577  18.181  40.169  1.00 22.66  ? 163 MET H N   1 
ATOM   6755 C CA  . MET H 2 73  ? 23.125  19.106  39.130  1.00 21.90  ? 163 MET H CA  1 
ATOM   6756 C C   . MET H 2 73  ? 22.346  20.275  39.693  1.00 30.69  ? 163 MET H C   1 
ATOM   6757 O O   . MET H 2 73  ? 21.505  20.065  40.562  1.00 32.41  ? 163 MET H O   1 
ATOM   6758 C CB  . MET H 2 73  ? 22.197  18.389  38.149  1.00 23.27  ? 163 MET H CB  1 
ATOM   6759 C CG  . MET H 2 73  ? 22.885  17.589  37.117  1.00 24.88  ? 163 MET H CG  1 
ATOM   6760 S SD  . MET H 2 73  ? 21.616  16.651  36.259  1.00 27.29  ? 163 MET H SD  1 
ATOM   6761 C CE  . MET H 2 73  ? 21.077  17.852  35.042  1.00 23.36  ? 163 MET H CE  1 
ATOM   6762 N N   . ASP H 2 74  ? 22.557  21.494  39.149  1.00 27.94  ? 164 ASP H N   1 
ATOM   6763 C CA  . ASP H 2 74  ? 21.814  22.686  39.548  1.00 27.40  ? 164 ASP H CA  1 
ATOM   6764 C C   . ASP H 2 74  ? 20.445  22.700  38.884  1.00 29.60  ? 164 ASP H C   1 
ATOM   6765 O O   . ASP H 2 74  ? 20.312  22.166  37.792  1.00 27.38  ? 164 ASP H O   1 
ATOM   6766 C CB  . ASP H 2 74  ? 22.594  23.955  39.156  1.00 29.71  ? 164 ASP H CB  1 
ATOM   6767 C CG  . ASP H 2 74  ? 23.697  24.329  40.123  1.00 37.03  ? 164 ASP H CG  1 
ATOM   6768 O OD1 . ASP H 2 74  ? 23.421  24.410  41.330  1.00 37.34  ? 164 ASP H OD1 1 
ATOM   6769 O OD2 . ASP H 2 74  ? 24.830  24.549  39.667  1.00 44.27  ? 164 ASP H OD2 1 
ATOM   6770 N N   . VAL H 2 75  ? 19.422  23.319  39.516  1.00 27.91  ? 165 VAL H N   1 
ATOM   6771 C CA  . VAL H 2 75  ? 18.100  23.410  38.876  1.00 28.03  ? 165 VAL H CA  1 
ATOM   6772 C C   . VAL H 2 75  ? 18.249  24.322  37.651  1.00 31.80  ? 165 VAL H C   1 
ATOM   6773 O O   . VAL H 2 75  ? 18.575  25.507  37.782  1.00 31.77  ? 165 VAL H O   1 
ATOM   6774 C CB  . VAL H 2 75  ? 16.961  23.858  39.822  1.00 32.46  ? 165 VAL H CB  1 
ATOM   6775 C CG1 . VAL H 2 75  ? 15.620  23.854  39.089  1.00 32.44  ? 165 VAL H CG1 1 
ATOM   6776 C CG2 . VAL H 2 75  ? 16.898  22.972  41.071  1.00 32.20  ? 165 VAL H CG2 1 
ATOM   6777 N N   . GLY H 2 76  ? 18.112  23.722  36.476  1.00 26.80  ? 166 GLY H N   1 
ATOM   6778 C CA  . GLY H 2 76  ? 18.275  24.402  35.202  1.00 25.85  ? 166 GLY H CA  1 
ATOM   6779 C C   . GLY H 2 76  ? 19.425  23.830  34.416  1.00 28.92  ? 166 GLY H C   1 
ATOM   6780 O O   . GLY H 2 76  ? 19.513  24.030  33.207  1.00 29.26  ? 166 GLY H O   1 
ATOM   6781 N N   . GLU H 2 77  ? 20.304  23.094  35.092  1.00 24.66  ? 167 GLU H N   1 
ATOM   6782 C CA  . GLU H 2 77  ? 21.475  22.505  34.468  1.00 24.66  ? 167 GLU H CA  1 
ATOM   6783 C C   . GLU H 2 77  ? 21.103  21.390  33.473  1.00 28.87  ? 167 GLU H C   1 
ATOM   6784 O O   . GLU H 2 77  ? 20.072  20.743  33.638  1.00 27.63  ? 167 GLU H O   1 
ATOM   6785 C CB  . GLU H 2 77  ? 22.400  21.955  35.562  1.00 25.47  ? 167 GLU H CB  1 
ATOM   6786 C CG  . GLU H 2 77  ? 23.791  21.568  35.102  1.00 29.60  ? 167 GLU H CG  1 
ATOM   6787 C CD  . GLU H 2 77  ? 24.694  21.016  36.181  1.00 38.12  ? 167 GLU H CD  1 
ATOM   6788 O OE1 . GLU H 2 77  ? 24.708  21.568  37.305  1.00 38.55  ? 167 GLU H OE1 1 
ATOM   6789 O OE2 . GLU H 2 77  ? 25.404  20.030  35.890  1.00 29.81  ? 167 GLU H OE2 1 
ATOM   6790 N N   . THR H 2 78  ? 21.927  21.233  32.413  1.00 26.74  ? 168 THR H N   1 
ATOM   6791 C CA  . THR H 2 78  ? 21.862  20.161  31.426  1.00 27.49  ? 168 THR H CA  1 
ATOM   6792 C C   . THR H 2 78  ? 23.201  19.446  31.496  1.00 34.19  ? 168 THR H C   1 
ATOM   6793 O O   . THR H 2 78  ? 24.240  20.080  31.295  1.00 33.31  ? 168 THR H O   1 
ATOM   6794 C CB  . THR H 2 78  ? 21.509  20.652  30.013  1.00 34.38  ? 168 THR H CB  1 
ATOM   6795 O OG1 . THR H 2 78  ? 20.227  21.262  30.064  1.00 34.99  ? 168 THR H OG1 1 
ATOM   6796 C CG2 . THR H 2 78  ? 21.478  19.509  28.980  1.00 26.93  ? 168 THR H CG2 1 
ATOM   6797 N N   . ALA H 2 79  ? 23.176  18.145  31.836  1.00 32.06  ? 169 ALA H N   1 
ATOM   6798 C CA  . ALA H 2 79  ? 24.381  17.339  31.970  1.00 32.19  ? 169 ALA H CA  1 
ATOM   6799 C C   . ALA H 2 79  ? 24.269  16.040  31.218  1.00 37.64  ? 169 ALA H C   1 
ATOM   6800 O O   . ALA H 2 79  ? 23.168  15.564  30.939  1.00 39.71  ? 169 ALA H O   1 
ATOM   6801 C CB  . ALA H 2 79  ? 24.668  17.058  33.437  1.00 33.03  ? 169 ALA H CB  1 
ATOM   6802 N N   . MET H 2 80  ? 25.422  15.481  30.867  1.00 32.82  ? 170 MET H N   1 
ATOM   6803 C CA  . MET H 2 80  ? 25.558  14.206  30.203  1.00 33.04  ? 170 MET H CA  1 
ATOM   6804 C C   . MET H 2 80  ? 26.109  13.247  31.251  1.00 35.42  ? 170 MET H C   1 
ATOM   6805 O O   . MET H 2 80  ? 27.109  13.570  31.892  1.00 35.74  ? 170 MET H O   1 
ATOM   6806 C CB  . MET H 2 80  ? 26.475  14.360  28.985  1.00 36.13  ? 170 MET H CB  1 
ATOM   6807 C CG  . MET H 2 80  ? 26.840  13.079  28.300  1.00 41.23  ? 170 MET H CG  1 
ATOM   6808 S SD  . MET H 2 80  ? 27.459  13.374  26.628  1.00 46.97  ? 170 MET H SD  1 
ATOM   6809 C CE  . MET H 2 80  ? 28.873  14.438  26.952  0.44 43.62  ? 170 MET H CE  1 
ATOM   6810 N N   . VAL H 2 81  ? 25.438  12.106  31.472  1.00 29.57  ? 171 VAL H N   1 
ATOM   6811 C CA  . VAL H 2 81  ? 25.882  11.123  32.465  1.00 27.70  ? 171 VAL H CA  1 
ATOM   6812 C C   . VAL H 2 81  ? 26.095  9.783   31.785  1.00 30.07  ? 171 VAL H C   1 
ATOM   6813 O O   . VAL H 2 81  ? 25.200  9.279   31.112  1.00 30.01  ? 171 VAL H O   1 
ATOM   6814 C CB  . VAL H 2 81  ? 24.916  11.023  33.682  1.00 30.29  ? 171 VAL H CB  1 
ATOM   6815 C CG1 . VAL H 2 81  ? 25.236  9.828   34.576  1.00 29.83  ? 171 VAL H CG1 1 
ATOM   6816 C CG2 . VAL H 2 81  ? 24.904  12.311  34.497  1.00 29.83  ? 171 VAL H CG2 1 
ATOM   6817 N N   . THR H 2 82  ? 27.297  9.220   31.932  1.00 26.10  ? 172 THR H N   1 
ATOM   6818 C CA  . THR H 2 82  ? 27.590  7.894   31.381  1.00 25.56  ? 172 THR H CA  1 
ATOM   6819 C C   . THR H 2 82  ? 27.519  6.951   32.548  1.00 27.90  ? 172 THR H C   1 
ATOM   6820 O O   . THR H 2 82  ? 28.211  7.171   33.538  1.00 27.93  ? 172 THR H O   1 
ATOM   6821 C CB  . THR H 2 82  ? 28.927  7.826   30.607  1.00 31.50  ? 172 THR H CB  1 
ATOM   6822 O OG1 . THR H 2 82  ? 30.033  8.037   31.483  1.00 20.37  ? 172 THR H OG1 1 
ATOM   6823 C CG2 . THR H 2 82  ? 28.976  8.785   29.421  1.00 36.61  ? 172 THR H CG2 1 
ATOM   6824 N N   . ALA H 2 83  ? 26.650  5.940   32.473  1.00 22.42  ? 173 ALA H N   1 
ATOM   6825 C CA  . ALA H 2 83  ? 26.488  5.026   33.593  1.00 20.85  ? 173 ALA H CA  1 
ATOM   6826 C C   . ALA H 2 83  ? 26.586  3.571   33.162  1.00 24.24  ? 173 ALA H C   1 
ATOM   6827 O O   . ALA H 2 83  ? 26.044  3.188   32.130  1.00 24.78  ? 173 ALA H O   1 
ATOM   6828 C CB  . ALA H 2 83  ? 25.150  5.282   34.287  1.00 20.70  ? 173 ALA H CB  1 
ATOM   6829 N N   . ASP H 2 84  ? 27.249  2.754   33.988  1.00 20.92  ? 174 ASP H N   1 
ATOM   6830 C CA  . ASP H 2 84  ? 27.358  1.306   33.791  1.00 20.80  ? 174 ASP H CA  1 
ATOM   6831 C C   . ASP H 2 84  ? 25.998  0.677   34.081  1.00 25.56  ? 174 ASP H C   1 
ATOM   6832 O O   . ASP H 2 84  ? 25.213  1.259   34.830  1.00 26.33  ? 174 ASP H O   1 
ATOM   6833 C CB  . ASP H 2 84  ? 28.448  0.728   34.714  1.00 22.54  ? 174 ASP H CB  1 
ATOM   6834 C CG  . ASP H 2 84  ? 28.735  -0.743  34.510  1.00 28.39  ? 174 ASP H CG  1 
ATOM   6835 O OD1 . ASP H 2 84  ? 28.299  -1.548  35.342  1.00 29.57  ? 174 ASP H OD1 1 
ATOM   6836 O OD2 . ASP H 2 84  ? 29.372  -1.087  33.498  1.00 36.92  ? 174 ASP H OD2 1 
ATOM   6837 N N   . SER H 2 85  ? 25.716  -0.506  33.495  1.00 22.11  ? 175 SER H N   1 
ATOM   6838 C CA  . SER H 2 85  ? 24.446  -1.226  33.643  1.00 21.97  ? 175 SER H CA  1 
ATOM   6839 C C   . SER H 2 85  ? 24.025  -1.476  35.084  1.00 26.80  ? 175 SER H C   1 
ATOM   6840 O O   . SER H 2 85  ? 22.829  -1.499  35.347  1.00 26.44  ? 175 SER H O   1 
ATOM   6841 C CB  . SER H 2 85  ? 24.506  -2.562  32.920  1.00 26.66  ? 175 SER H CB  1 
ATOM   6842 O OG  . SER H 2 85  ? 25.589  -3.364  33.367  1.00 34.93  ? 175 SER H OG  1 
ATOM   6843 N N   . LYS H 2 86  ? 24.985  -1.645  36.014  1.00 24.96  ? 176 LYS H N   1 
ATOM   6844 C CA  . LYS H 2 86  ? 24.698  -1.928  37.425  1.00 25.17  ? 176 LYS H CA  1 
ATOM   6845 C C   . LYS H 2 86  ? 23.948  -0.784  38.126  1.00 29.42  ? 176 LYS H C   1 
ATOM   6846 O O   . LYS H 2 86  ? 23.249  -1.043  39.111  1.00 29.71  ? 176 LYS H O   1 
ATOM   6847 C CB  . LYS H 2 86  ? 25.972  -2.317  38.209  1.00 28.44  ? 176 LYS H CB  1 
ATOM   6848 C CG  . LYS H 2 86  ? 27.023  -1.227  38.384  1.00 40.22  ? 176 LYS H CG  1 
ATOM   6849 C CD  . LYS H 2 86  ? 27.794  -1.412  39.691  1.00 51.82  ? 176 LYS H CD  1 
ATOM   6850 N N   . TYR H 2 87  ? 24.056  0.459   37.608  1.00 25.58  ? 177 TYR H N   1 
ATOM   6851 C CA  . TYR H 2 87  ? 23.337  1.615   38.174  1.00 24.24  ? 177 TYR H CA  1 
ATOM   6852 C C   . TYR H 2 87  ? 22.096  1.915   37.364  1.00 28.57  ? 177 TYR H C   1 
ATOM   6853 O O   . TYR H 2 87  ? 21.347  2.828   37.704  1.00 29.03  ? 177 TYR H O   1 
ATOM   6854 C CB  . TYR H 2 87  ? 24.248  2.853   38.239  1.00 23.56  ? 177 TYR H CB  1 
ATOM   6855 C CG  . TYR H 2 87  ? 25.531  2.581   38.991  1.00 23.27  ? 177 TYR H CG  1 
ATOM   6856 C CD1 . TYR H 2 87  ? 25.519  2.336   40.364  1.00 24.89  ? 177 TYR H CD1 1 
ATOM   6857 C CD2 . TYR H 2 87  ? 26.753  2.548   38.332  1.00 23.22  ? 177 TYR H CD2 1 
ATOM   6858 C CE1 . TYR H 2 87  ? 26.691  2.060   41.060  1.00 24.78  ? 177 TYR H CE1 1 
ATOM   6859 C CE2 . TYR H 2 87  ? 27.934  2.282   39.019  1.00 24.02  ? 177 TYR H CE2 1 
ATOM   6860 C CZ  . TYR H 2 87  ? 27.896  2.030   40.383  1.00 31.73  ? 177 TYR H CZ  1 
ATOM   6861 O OH  . TYR H 2 87  ? 29.049  1.754   41.074  1.00 35.38  ? 177 TYR H OH  1 
ATOM   6862 N N   . CYS H 2 88  ? 21.863  1.114   36.311  1.00 24.51  ? 178 CYS H N   1 
ATOM   6863 C CA  . CYS H 2 88  ? 20.778  1.269   35.362  1.00 22.98  ? 178 CYS H CA  1 
ATOM   6864 C C   . CYS H 2 88  ? 19.805  0.068   35.383  1.00 27.79  ? 178 CYS H C   1 
ATOM   6865 O O   . CYS H 2 88  ? 19.137  -0.166  36.407  1.00 26.77  ? 178 CYS H O   1 
ATOM   6866 C CB  . CYS H 2 88  ? 21.343  1.518   33.964  1.00 22.42  ? 178 CYS H CB  1 
ATOM   6867 S SG  . CYS H 2 88  ? 22.340  3.026   33.825  1.00 25.46  ? 178 CYS H SG  1 
ATOM   6868 N N   . TYR H 2 89  ? 19.691  -0.657  34.257  1.00 25.56  ? 179 TYR H N   1 
ATOM   6869 C CA  . TYR H 2 89  ? 18.723  -1.747  34.121  1.00 26.60  ? 179 TYR H CA  1 
ATOM   6870 C C   . TYR H 2 89  ? 19.350  -3.154  34.303  1.00 32.14  ? 179 TYR H C   1 
ATOM   6871 O O   . TYR H 2 89  ? 18.655  -4.161  34.148  1.00 34.05  ? 179 TYR H O   1 
ATOM   6872 C CB  . TYR H 2 89  ? 17.968  -1.607  32.792  1.00 28.28  ? 179 TYR H CB  1 
ATOM   6873 C CG  . TYR H 2 89  ? 17.162  -0.326  32.763  1.00 30.39  ? 179 TYR H CG  1 
ATOM   6874 C CD1 . TYR H 2 89  ? 15.965  -0.219  33.462  1.00 32.74  ? 179 TYR H CD1 1 
ATOM   6875 C CD2 . TYR H 2 89  ? 17.662  0.822   32.156  1.00 31.13  ? 179 TYR H CD2 1 
ATOM   6876 C CE1 . TYR H 2 89  ? 15.234  0.967   33.472  1.00 34.15  ? 179 TYR H CE1 1 
ATOM   6877 C CE2 . TYR H 2 89  ? 16.956  2.024   32.184  1.00 32.17  ? 179 TYR H CE2 1 
ATOM   6878 C CZ  . TYR H 2 89  ? 15.734  2.087   32.833  1.00 40.83  ? 179 TYR H CZ  1 
ATOM   6879 O OH  . TYR H 2 89  ? 15.029  3.265   32.873  1.00 44.27  ? 179 TYR H OH  1 
ATOM   6880 N N   . GLY H 2 90  ? 20.602  -3.184  34.749  1.00 28.74  ? 180 GLY H N   1 
ATOM   6881 C CA  . GLY H 2 90  ? 21.354  -4.378  35.107  1.00 29.10  ? 180 GLY H CA  1 
ATOM   6882 C C   . GLY H 2 90  ? 21.441  -5.555  34.154  1.00 34.70  ? 180 GLY H C   1 
ATOM   6883 O O   . GLY H 2 90  ? 21.334  -5.401  32.929  1.00 34.56  ? 180 GLY H O   1 
ATOM   6884 N N   . PRO H 2 91  ? 21.667  -6.757  34.743  1.00 31.05  ? 181 PRO H N   1 
ATOM   6885 C CA  . PRO H 2 91  ? 21.868  -7.973  33.928  1.00 30.96  ? 181 PRO H CA  1 
ATOM   6886 C C   . PRO H 2 91  ? 20.660  -8.484  33.155  1.00 34.28  ? 181 PRO H C   1 
ATOM   6887 O O   . PRO H 2 91  ? 20.851  -9.254  32.219  1.00 34.93  ? 181 PRO H O   1 
ATOM   6888 C CB  . PRO H 2 91  ? 22.290  -9.032  34.950  1.00 33.19  ? 181 PRO H CB  1 
ATOM   6889 C CG  . PRO H 2 91  ? 22.677  -8.277  36.175  1.00 37.76  ? 181 PRO H CG  1 
ATOM   6890 C CD  . PRO H 2 91  ? 21.850  -7.038  36.180  1.00 33.01  ? 181 PRO H CD  1 
ATOM   6891 N N   . GLN H 2 92  ? 19.443  -8.102  33.526  1.00 29.76  ? 182 GLN H N   1 
ATOM   6892 C CA  . GLN H 2 92  ? 18.274  -8.601  32.805  1.00 29.19  ? 182 GLN H CA  1 
ATOM   6893 C C   . GLN H 2 92  ? 17.730  -7.603  31.774  1.00 30.37  ? 182 GLN H C   1 
ATOM   6894 O O   . GLN H 2 92  ? 17.055  -8.021  30.833  1.00 28.56  ? 182 GLN H O   1 
ATOM   6895 C CB  . GLN H 2 92  ? 17.165  -8.998  33.794  1.00 31.31  ? 182 GLN H CB  1 
ATOM   6896 C CG  . GLN H 2 92  ? 17.516  -10.250 34.612  1.00 54.60  ? 182 GLN H CG  1 
ATOM   6897 C CD  . GLN H 2 92  ? 16.377  -11.257 34.717  1.00 73.41  ? 182 GLN H CD  1 
ATOM   6898 O OE1 . GLN H 2 92  ? 15.218  -10.991 34.362  1.00 67.63  ? 182 GLN H OE1 1 
ATOM   6899 N NE2 . GLN H 2 92  ? 16.705  -12.473 35.146  1.00 67.99  ? 182 GLN H NE2 1 
ATOM   6900 N N   . GLY H 2 93  ? 18.036  -6.320  31.937  1.00 26.85  ? 183 GLY H N   1 
ATOM   6901 C CA  . GLY H 2 93  ? 17.517  -5.305  31.033  1.00 27.23  ? 183 GLY H CA  1 
ATOM   6902 C C   . GLY H 2 93  ? 16.097  -4.964  31.414  1.00 32.60  ? 183 GLY H C   1 
ATOM   6903 O O   . GLY H 2 93  ? 15.658  -5.349  32.495  1.00 32.27  ? 183 GLY H O   1 
ATOM   6904 N N   . ARG H 2 94  ? 15.345  -4.284  30.538  1.00 31.34  ? 184 ARG H N   1 
ATOM   6905 C CA  . ARG H 2 94  ? 14.003  -3.845  30.925  1.00 31.85  ? 184 ARG H CA  1 
ATOM   6906 C C   . ARG H 2 94  ? 12.934  -4.102  29.841  1.00 37.42  ? 184 ARG H C   1 
ATOM   6907 O O   . ARG H 2 94  ? 13.283  -4.347  28.690  1.00 36.88  ? 184 ARG H O   1 
ATOM   6908 C CB  . ARG H 2 94  ? 14.105  -2.338  31.267  1.00 30.24  ? 184 ARG H CB  1 
ATOM   6909 C CG  . ARG H 2 94  ? 12.953  -1.682  32.026  1.00 39.53  ? 184 ARG H CG  1 
ATOM   6910 C CD  . ARG H 2 94  ? 12.816  -2.011  33.499  1.00 49.40  ? 184 ARG H CD  1 
ATOM   6911 N N   . SER H 2 95  ? 11.630  -4.092  30.243  1.00 36.11  ? 185 SER H N   1 
ATOM   6912 C CA  . SER H 2 95  ? 10.457  -4.189  29.352  1.00 36.83  ? 185 SER H CA  1 
ATOM   6913 C C   . SER H 2 95  ? 10.272  -2.836  28.632  1.00 40.67  ? 185 SER H C   1 
ATOM   6914 O O   . SER H 2 95  ? 10.274  -2.910  27.407  1.00 40.10  ? 185 SER H O   1 
ATOM   6915 C CB  . SER H 2 95  ? 9.205   -4.648  30.085  1.00 42.75  ? 185 SER H CB  1 
ATOM   6916 O OG  . SER H 2 95  ? 9.175   -6.066  30.098  1.00 54.89  ? 185 SER H OG  1 
ATOM   6917 N N   . PRO H 2 96  ? 10.225  -1.605  29.269  1.00 38.05  ? 186 PRO H N   1 
ATOM   6918 C CA  . PRO H 2 96  ? 10.353  -0.358  28.466  1.00 37.71  ? 186 PRO H CA  1 
ATOM   6919 C C   . PRO H 2 96  ? 11.840  -0.319  28.048  1.00 39.56  ? 186 PRO H C   1 
ATOM   6920 O O   . PRO H 2 96  ? 12.677  0.351   28.641  1.00 39.85  ? 186 PRO H O   1 
ATOM   6921 C CB  . PRO H 2 96  ? 9.937   0.759   29.447  1.00 39.72  ? 186 PRO H CB  1 
ATOM   6922 C CG  . PRO H 2 96  ? 9.711   0.094   30.784  1.00 44.03  ? 186 PRO H CG  1 
ATOM   6923 C CD  . PRO H 2 96  ? 10.243  -1.291  30.714  1.00 39.58  ? 186 PRO H CD  1 
ATOM   6924 N N   . TYR H 2 97  ? 12.114  -1.061  26.971  1.00 34.37  ? 187 TYR H N   1 
ATOM   6925 C CA  . TYR H 2 97  ? 13.265  -1.754  26.437  1.00 32.90  ? 187 TYR H CA  1 
ATOM   6926 C C   . TYR H 2 97  ? 14.625  -1.105  26.576  1.00 32.54  ? 187 TYR H C   1 
ATOM   6927 O O   . TYR H 2 97  ? 14.926  -0.057  26.015  1.00 32.97  ? 187 TYR H O   1 
ATOM   6928 C CB  . TYR H 2 97  ? 13.116  -2.170  24.976  1.00 34.42  ? 187 TYR H CB  1 
ATOM   6929 C CG  . TYR H 2 97  ? 13.944  -3.408  24.702  1.00 36.79  ? 187 TYR H CG  1 
ATOM   6930 C CD1 . TYR H 2 97  ? 13.564  -4.645  25.209  1.00 38.89  ? 187 TYR H CD1 1 
ATOM   6931 C CD2 . TYR H 2 97  ? 15.174  -3.319  24.062  1.00 38.30  ? 187 TYR H CD2 1 
ATOM   6932 C CE1 . TYR H 2 97  ? 14.383  -5.766  25.079  1.00 40.45  ? 187 TYR H CE1 1 
ATOM   6933 C CE2 . TYR H 2 97  ? 15.993  -4.438  23.907  1.00 40.02  ? 187 TYR H CE2 1 
ATOM   6934 C CZ  . TYR H 2 97  ? 15.602  -5.657  24.437  1.00 50.60  ? 187 TYR H CZ  1 
ATOM   6935 O OH  . TYR H 2 97  ? 16.389  -6.774  24.305  1.00 56.04  ? 187 TYR H OH  1 
ATOM   6936 N N   . ILE H 2 98  ? 15.484  -1.878  27.252  1.00 25.15  ? 188 ILE H N   1 
ATOM   6937 C CA  . ILE H 2 98  ? 16.914  -1.725  27.457  1.00 23.18  ? 188 ILE H CA  1 
ATOM   6938 C C   . ILE H 2 98  ? 17.490  -3.151  27.451  1.00 25.61  ? 188 ILE H C   1 
ATOM   6939 O O   . ILE H 2 98  ? 17.024  -3.996  28.219  1.00 24.47  ? 188 ILE H O   1 
ATOM   6940 C CB  . ILE H 2 98  ? 17.315  -0.906  28.723  1.00 25.58  ? 188 ILE H CB  1 
ATOM   6941 C CG1 . ILE H 2 98  ? 17.082  0.602   28.532  1.00 24.77  ? 188 ILE H CG1 1 
ATOM   6942 C CG2 . ILE H 2 98  ? 18.784  -1.151  29.082  1.00 27.02  ? 188 ILE H CG2 1 
ATOM   6943 C CD1 . ILE H 2 98  ? 15.800  1.085   29.059  1.00 29.32  ? 188 ILE H CD1 1 
ATOM   6944 N N   . PRO H 2 99  ? 18.468  -3.450  26.569  1.00 22.41  ? 189 PRO H N   1 
ATOM   6945 C CA  . PRO H 2 99  ? 19.067  -4.794  26.539  1.00 22.29  ? 189 PRO H CA  1 
ATOM   6946 C C   . PRO H 2 99  ? 19.854  -5.148  27.813  1.00 29.79  ? 189 PRO H C   1 
ATOM   6947 O O   . PRO H 2 99  ? 20.202  -4.236  28.572  1.00 29.18  ? 189 PRO H O   1 
ATOM   6948 C CB  . PRO H 2 99  ? 20.031  -4.706  25.342  1.00 23.61  ? 189 PRO H CB  1 
ATOM   6949 C CG  . PRO H 2 99  ? 19.610  -3.538  24.575  1.00 27.69  ? 189 PRO H CG  1 
ATOM   6950 C CD  . PRO H 2 99  ? 19.114  -2.575  25.578  1.00 23.81  ? 189 PRO H CD  1 
ATOM   6951 N N   . PRO H 2 100 ? 20.193  -6.453  28.044  1.00 28.60  ? 190 PRO H N   1 
ATOM   6952 C CA  . PRO H 2 100 ? 20.984  -6.817  29.243  1.00 28.96  ? 190 PRO H CA  1 
ATOM   6953 C C   . PRO H 2 100 ? 22.399  -6.251  29.213  1.00 34.08  ? 190 PRO H C   1 
ATOM   6954 O O   . PRO H 2 100 ? 22.978  -6.138  28.128  1.00 33.99  ? 190 PRO H O   1 
ATOM   6955 C CB  . PRO H 2 100 ? 21.033  -8.353  29.197  1.00 30.24  ? 190 PRO H CB  1 
ATOM   6956 C CG  . PRO H 2 100 ? 19.997  -8.762  28.210  1.00 34.66  ? 190 PRO H CG  1 
ATOM   6957 C CD  . PRO H 2 100 ? 19.858  -7.647  27.238  1.00 29.89  ? 190 PRO H CD  1 
ATOM   6958 N N   . HIS H 2 101 ? 22.943  -5.887  30.401  1.00 30.65  ? 191 HIS H N   1 
ATOM   6959 C CA  . HIS H 2 101 ? 24.283  -5.311  30.602  1.00 31.21  ? 191 HIS H CA  1 
ATOM   6960 C C   . HIS H 2 101 ? 24.560  -4.099  29.684  1.00 35.83  ? 191 HIS H C   1 
ATOM   6961 O O   . HIS H 2 101 ? 25.680  -3.935  29.191  1.00 37.05  ? 191 HIS H O   1 
ATOM   6962 C CB  . HIS H 2 101 ? 25.378  -6.370  30.425  1.00 32.66  ? 191 HIS H CB  1 
ATOM   6963 C CG  . HIS H 2 101 ? 25.165  -7.575  31.268  1.00 36.58  ? 191 HIS H CG  1 
ATOM   6964 N ND1 . HIS H 2 101 ? 24.426  -8.646  30.804  1.00 38.63  ? 191 HIS H ND1 1 
ATOM   6965 C CD2 . HIS H 2 101 ? 25.585  -7.839  32.527  1.00 38.95  ? 191 HIS H CD2 1 
ATOM   6966 C CE1 . HIS H 2 101 ? 24.428  -9.533  31.785  1.00 38.46  ? 191 HIS H CE1 1 
ATOM   6967 N NE2 . HIS H 2 101 ? 25.115  -9.092  32.843  1.00 38.86  ? 191 HIS H NE2 1 
ATOM   6968 N N   . ALA H 2 102 ? 23.546  -3.239  29.478  1.00 31.13  ? 192 ALA H N   1 
ATOM   6969 C CA  . ALA H 2 102 ? 23.668  -2.074  28.615  1.00 30.01  ? 192 ALA H CA  1 
ATOM   6970 C C   . ALA H 2 102 ? 24.078  -0.828  29.390  1.00 32.00  ? 192 ALA H C   1 
ATOM   6971 O O   . ALA H 2 102 ? 23.357  -0.381  30.287  1.00 32.10  ? 192 ALA H O   1 
ATOM   6972 C CB  . ALA H 2 102 ? 22.370  -1.823  27.863  1.00 30.62  ? 192 ALA H CB  1 
ATOM   6973 N N   . ALA H 2 103 ? 25.265  -0.292  29.047  1.00 27.20  ? 193 ALA H N   1 
ATOM   6974 C CA  . ALA H 2 103 ? 25.782  0.966   29.572  1.00 26.44  ? 193 ALA H CA  1 
ATOM   6975 C C   . ALA H 2 103 ? 24.970  2.080   28.918  1.00 28.77  ? 193 ALA H C   1 
ATOM   6976 O O   . ALA H 2 103 ? 24.681  2.009   27.713  1.00 28.09  ? 193 ALA H O   1 
ATOM   6977 C CB  . ALA H 2 103 ? 27.263  1.103   29.257  1.00 27.23  ? 193 ALA H CB  1 
ATOM   6978 N N   . LEU H 2 104 ? 24.535  3.066   29.719  1.00 22.82  ? 194 LEU H N   1 
ATOM   6979 C CA  . LEU H 2 104 ? 23.692  4.123   29.188  1.00 20.93  ? 194 LEU H CA  1 
ATOM   6980 C C   . LEU H 2 104 ? 24.336  5.495   29.224  1.00 25.65  ? 194 LEU H C   1 
ATOM   6981 O O   . LEU H 2 104 ? 25.138  5.790   30.104  1.00 24.39  ? 194 LEU H O   1 
ATOM   6982 C CB  . LEU H 2 104 ? 22.360  4.182   29.977  1.00 20.04  ? 194 LEU H CB  1 
ATOM   6983 C CG  . LEU H 2 104 ? 21.397  2.976   29.915  1.00 23.46  ? 194 LEU H CG  1 
ATOM   6984 C CD1 . LEU H 2 104 ? 20.225  3.188   30.823  1.00 23.68  ? 194 LEU H CD1 1 
ATOM   6985 C CD2 . LEU H 2 104 ? 20.887  2.715   28.520  1.00 23.10  ? 194 LEU H CD2 1 
ATOM   6986 N N   . CYS H 2 105 ? 23.956  6.334   28.250  1.00 24.37  ? 195 CYS H N   1 
ATOM   6987 C CA  . CYS H 2 105 ? 24.309  7.746   28.163  1.00 24.92  ? 195 CYS H CA  1 
ATOM   6988 C C   . CYS H 2 105 ? 23.032  8.513   28.383  1.00 29.30  ? 195 CYS H C   1 
ATOM   6989 O O   . CYS H 2 105 ? 22.114  8.433   27.563  1.00 29.75  ? 195 CYS H O   1 
ATOM   6990 C CB  . CYS H 2 105 ? 24.969  8.105   26.835  1.00 26.13  ? 195 CYS H CB  1 
ATOM   6991 S SG  . CYS H 2 105 ? 25.520  9.832   26.752  1.00 30.93  ? 195 CYS H SG  1 
ATOM   6992 N N   . LEU H 2 106 ? 22.937  9.193   29.519  1.00 24.97  ? 196 LEU H N   1 
ATOM   6993 C CA  . LEU H 2 106 ? 21.745  9.921   29.920  1.00 24.65  ? 196 LEU H CA  1 
ATOM   6994 C C   . LEU H 2 106 ? 21.952  11.418  29.782  1.00 29.91  ? 196 LEU H C   1 
ATOM   6995 O O   . LEU H 2 106 ? 22.837  11.971  30.435  1.00 30.17  ? 196 LEU H O   1 
ATOM   6996 C CB  . LEU H 2 106 ? 21.362  9.572   31.389  1.00 24.40  ? 196 LEU H CB  1 
ATOM   6997 C CG  . LEU H 2 106 ? 21.210  8.093   31.806  1.00 28.50  ? 196 LEU H CG  1 
ATOM   6998 C CD1 . LEU H 2 106 ? 21.095  7.965   33.304  1.00 29.30  ? 196 LEU H CD1 1 
ATOM   6999 C CD2 . LEU H 2 106 ? 19.956  7.493   31.234  1.00 27.99  ? 196 LEU H CD2 1 
ATOM   7000 N N   . GLU H 2 107 ? 21.155  12.073  28.911  1.00 26.39  ? 197 GLU H N   1 
ATOM   7001 C CA  . GLU H 2 107 ? 21.180  13.528  28.743  1.00 25.55  ? 197 GLU H CA  1 
ATOM   7002 C C   . GLU H 2 107 ? 20.100  14.054  29.631  1.00 26.84  ? 197 GLU H C   1 
ATOM   7003 O O   . GLU H 2 107 ? 18.931  13.837  29.347  1.00 26.68  ? 197 GLU H O   1 
ATOM   7004 C CB  . GLU H 2 107 ? 20.967  13.965  27.294  1.00 27.25  ? 197 GLU H CB  1 
ATOM   7005 C CG  . GLU H 2 107 ? 22.064  13.583  26.315  0.00 40.01  ? 197 GLU H CG  1 
ATOM   7006 C CD  . GLU H 2 107 ? 21.715  13.901  24.874  1.00 68.07  ? 197 GLU H CD  1 
ATOM   7007 O OE1 . GLU H 2 107 ? 21.755  12.979  24.026  1.00 54.05  ? 197 GLU H OE1 1 
ATOM   7008 O OE2 . GLU H 2 107 ? 21.366  15.072  24.598  1.00 70.79  ? 197 GLU H OE2 1 
ATOM   7009 N N   . VAL H 2 108 ? 20.478  14.644  30.762  1.00 21.17  ? 198 VAL H N   1 
ATOM   7010 C CA  . VAL H 2 108 ? 19.523  15.098  31.758  1.00 20.38  ? 198 VAL H CA  1 
ATOM   7011 C C   . VAL H 2 108 ? 19.469  16.618  31.811  1.00 23.44  ? 198 VAL H C   1 
ATOM   7012 O O   . VAL H 2 108 ? 20.505  17.278  31.805  1.00 22.05  ? 198 VAL H O   1 
ATOM   7013 C CB  . VAL H 2 108 ? 19.845  14.532  33.164  1.00 24.42  ? 198 VAL H CB  1 
ATOM   7014 C CG1 . VAL H 2 108 ? 18.622  14.594  34.066  1.00 25.01  ? 198 VAL H CG1 1 
ATOM   7015 C CG2 . VAL H 2 108 ? 20.383  13.107  33.103  1.00 24.27  ? 198 VAL H CG2 1 
ATOM   7016 N N   . THR H 2 109 ? 18.256  17.154  31.910  1.00 19.27  ? 199 THR H N   1 
ATOM   7017 C CA  . THR H 2 109 ? 17.974  18.565  32.099  1.00 19.65  ? 199 THR H CA  1 
ATOM   7018 C C   . THR H 2 109 ? 17.116  18.637  33.343  1.00 26.15  ? 199 THR H C   1 
ATOM   7019 O O   . THR H 2 109 ? 15.965  18.202  33.297  1.00 26.10  ? 199 THR H O   1 
ATOM   7020 C CB  . THR H 2 109 ? 17.309  19.180  30.860  1.00 27.97  ? 199 THR H CB  1 
ATOM   7021 O OG1 . THR H 2 109 ? 18.147  18.983  29.727  1.00 32.85  ? 199 THR H OG1 1 
ATOM   7022 C CG2 . THR H 2 109 ? 17.021  20.667  31.022  1.00 26.00  ? 199 THR H CG2 1 
ATOM   7023 N N   . LEU H 2 110 ? 17.668  19.135  34.462  1.00 24.56  ? 200 LEU H N   1 
ATOM   7024 C CA  . LEU H 2 110 ? 16.911  19.262  35.710  1.00 25.71  ? 200 LEU H CA  1 
ATOM   7025 C C   . LEU H 2 110 ? 16.008  20.510  35.631  1.00 33.91  ? 200 LEU H C   1 
ATOM   7026 O O   . LEU H 2 110 ? 16.464  21.623  35.883  1.00 33.71  ? 200 LEU H O   1 
ATOM   7027 C CB  . LEU H 2 110 ? 17.883  19.312  36.905  1.00 25.95  ? 200 LEU H CB  1 
ATOM   7028 C CG  . LEU H 2 110 ? 17.306  19.407  38.331  1.00 30.71  ? 200 LEU H CG  1 
ATOM   7029 C CD1 . LEU H 2 110 ? 16.175  18.411  38.576  1.00 30.71  ? 200 LEU H CD1 1 
ATOM   7030 C CD2 . LEU H 2 110 ? 18.398  19.221  39.354  1.00 33.87  ? 200 LEU H CD2 1 
ATOM   7031 N N   . LYS H 2 111 ? 14.720  20.309  35.271  1.00 33.28  ? 201 LYS H N   1 
ATOM   7032 C CA  . LYS H 2 111 ? 13.733  21.375  35.051  1.00 32.96  ? 201 LYS H CA  1 
ATOM   7033 C C   . LYS H 2 111 ? 13.335  22.058  36.354  1.00 38.21  ? 201 LYS H C   1 
ATOM   7034 O O   . LYS H 2 111 ? 13.537  23.266  36.478  1.00 38.25  ? 201 LYS H O   1 
ATOM   7035 C CB  . LYS H 2 111 ? 12.490  20.837  34.307  1.00 34.90  ? 201 LYS H CB  1 
ATOM   7036 C CG  . LYS H 2 111 ? 12.798  20.328  32.896  1.00 42.55  ? 201 LYS H CG  1 
ATOM   7037 C CD  . LYS H 2 111 ? 11.650  19.522  32.291  1.00 51.67  ? 201 LYS H CD  1 
ATOM   7038 C CE  . LYS H 2 111 ? 10.914  20.295  31.225  1.00 69.10  ? 201 LYS H CE  1 
ATOM   7039 N NZ  . LYS H 2 111 ? 9.876   19.465  30.560  1.00 78.81  ? 201 LYS H NZ  1 
ATOM   7040 N N   . THR H 2 112 ? 12.753  21.304  37.313  1.00 34.40  ? 202 THR H N   1 
ATOM   7041 C CA  . THR H 2 112 ? 12.312  21.848  38.598  1.00 33.64  ? 202 THR H CA  1 
ATOM   7042 C C   . THR H 2 112 ? 12.681  20.918  39.745  1.00 37.87  ? 202 THR H C   1 
ATOM   7043 O O   . THR H 2 112 ? 12.991  19.746  39.523  1.00 36.83  ? 202 THR H O   1 
ATOM   7044 C CB  . THR H 2 112 ? 10.787  22.094  38.609  1.00 41.38  ? 202 THR H CB  1 
ATOM   7045 O OG1 . THR H 2 112 ? 10.108  20.903  38.215  1.00 41.78  ? 202 THR H OG1 1 
ATOM   7046 C CG2 . THR H 2 112 ? 10.349  23.280  37.740  1.00 39.13  ? 202 THR H CG2 1 
ATOM   7047 N N   . ALA H 2 113 ? 12.651  21.458  40.974  1.00 35.42  ? 203 ALA H N   1 
ATOM   7048 C CA  . ALA H 2 113 ? 12.880  20.754  42.232  1.00 36.28  ? 203 ALA H CA  1 
ATOM   7049 C C   . ALA H 2 113 ? 12.051  21.439  43.300  1.00 43.65  ? 203 ALA H C   1 
ATOM   7050 O O   . ALA H 2 113 ? 12.327  22.588  43.656  1.00 44.30  ? 203 ALA H O   1 
ATOM   7051 C CB  . ALA H 2 113 ? 14.358  20.734  42.596  1.00 36.96  ? 203 ALA H CB  1 
ATOM   7052 N N   . VAL H 2 114 ? 10.974  20.770  43.736  1.00 41.56  ? 204 VAL H N   1 
ATOM   7053 C CA  . VAL H 2 114 ? 10.054  21.301  44.737  1.00 42.09  ? 204 VAL H CA  1 
ATOM   7054 C C   . VAL H 2 114 ? 10.152  20.446  45.979  1.00 49.51  ? 204 VAL H C   1 
ATOM   7055 O O   . VAL H 2 114 ? 10.487  19.265  45.874  1.00 49.12  ? 204 VAL H O   1 
ATOM   7056 C CB  . VAL H 2 114 ? 8.591   21.434  44.223  1.00 45.52  ? 204 VAL H CB  1 
ATOM   7057 C CG1 . VAL H 2 114 ? 8.509   22.416  43.060  1.00 45.16  ? 204 VAL H CG1 1 
ATOM   7058 C CG2 . VAL H 2 114 ? 7.977   20.084  43.846  1.00 45.12  ? 204 VAL H CG2 1 
ATOM   7059 N N   . ASP H 2 115 ? 9.879   21.031  47.154  1.00 49.41  ? 205 ASP H N   1 
ATOM   7060 C CA  . ASP H 2 115 ? 9.944   20.288  48.404  1.00 50.88  ? 205 ASP H CA  1 
ATOM   7061 C C   . ASP H 2 115 ? 8.992   19.087  48.379  1.00 56.60  ? 205 ASP H C   1 
ATOM   7062 O O   . ASP H 2 115 ? 7.912   19.160  47.777  1.00 56.35  ? 205 ASP H O   1 
ATOM   7063 C CB  . ASP H 2 115 ? 9.645   21.202  49.597  1.00 53.56  ? 205 ASP H CB  1 
ATOM   7064 C CG  . ASP H 2 115 ? 10.855  21.959  50.114  1.00 71.96  ? 205 ASP H CG  1 
ATOM   7065 O OD1 . ASP H 2 115 ? 11.993  21.449  49.959  1.00 73.95  ? 205 ASP H OD1 1 
ATOM   7066 O OD2 . ASP H 2 115 ? 10.665  23.021  50.734  1.00 80.71  ? 205 ASP H OD2 1 
ATOM   7067 N N   . GLY H 2 116 ? 9.442   17.981  48.977  1.00 54.24  ? 206 GLY H N   1 
ATOM   7068 C CA  . GLY H 2 116 ? 8.678   16.743  49.071  1.00 54.61  ? 206 GLY H CA  1 
ATOM   7069 C C   . GLY H 2 116 ? 7.363   16.942  49.799  1.00 60.28  ? 206 GLY H C   1 
ATOM   7070 O O   . GLY H 2 116 ? 7.274   17.811  50.675  1.00 60.01  ? 206 GLY H O   1 
ATOM   7071 N N   . PRO H 2 117 ? 6.299   16.188  49.442  1.00 58.15  ? 207 PRO H N   1 
ATOM   7072 C CA  . PRO H 2 117 ? 5.005   16.398  50.113  1.00 58.22  ? 207 PRO H CA  1 
ATOM   7073 C C   . PRO H 2 117 ? 5.022   15.973  51.570  1.00 61.97  ? 207 PRO H C   1 
ATOM   7074 O O   . PRO H 2 117 ? 5.749   15.042  51.928  1.00 61.22  ? 207 PRO H O   1 
ATOM   7075 C CB  . PRO H 2 117 ? 4.042   15.524  49.307  1.00 60.07  ? 207 PRO H CB  1 
ATOM   7076 C CG  . PRO H 2 117 ? 4.898   14.469  48.704  1.00 64.34  ? 207 PRO H CG  1 
ATOM   7077 C CD  . PRO H 2 117 ? 6.215   15.120  48.423  1.00 59.81  ? 207 PRO H CD  1 
ATOM   7078 N N   . ASP H 2 118 ? 4.240   16.672  52.412  1.00 58.59  ? 208 ASP H N   1 
ATOM   7079 C CA  . ASP H 2 118 ? 4.086   16.297  53.811  1.00 58.31  ? 208 ASP H CA  1 
ATOM   7080 C C   . ASP H 2 118 ? 3.064   15.181  53.815  1.00 61.39  ? 208 ASP H C   1 
ATOM   7081 O O   . ASP H 2 118 ? 1.877   15.435  53.593  1.00 59.64  ? 208 ASP H O   1 
ATOM   7082 C CB  . ASP H 2 118 ? 3.662   17.494  54.678  1.00 60.20  ? 208 ASP H CB  1 
ATOM   7083 N N   . LEU H 2 119 ? 3.542   13.935  53.960  1.00 58.81  ? 209 LEU H N   1 
ATOM   7084 C CA  . LEU H 2 119 ? 2.715   12.733  53.927  1.00 58.99  ? 209 LEU H CA  1 
ATOM   7085 C C   . LEU H 2 119 ? 1.495   12.826  54.854  1.00 63.37  ? 209 LEU H C   1 
ATOM   7086 O O   . LEU H 2 119 ? 0.434   12.374  54.441  1.00 63.52  ? 209 LEU H O   1 
ATOM   7087 C CB  . LEU H 2 119 ? 3.531   11.473  54.264  1.00 59.03  ? 209 LEU H CB  1 
ATOM   7088 C CG  . LEU H 2 119 ? 4.704   11.107  53.357  1.00 63.67  ? 209 LEU H CG  1 
ATOM   7089 C CD1 . LEU H 2 119 ? 5.314   9.798   53.803  1.00 63.77  ? 209 LEU H CD1 1 
ATOM   7090 C CD2 . LEU H 2 119 ? 4.276   10.980  51.905  1.00 66.40  ? 209 LEU H CD2 1 
ATOM   7091 N N   . GLU H 2 120 ? 1.612   13.420  56.072  1.00 59.28  ? 210 GLU H N   1 
ATOM   7092 C CA  . GLU H 2 120 ? 0.457   13.524  56.981  1.00 58.90  ? 210 GLU H CA  1 
ATOM   7093 C C   . GLU H 2 120 ? -0.511  14.662  56.570  1.00 61.93  ? 210 GLU H C   1 
ATOM   7094 O O   . GLU H 2 120 ? -1.610  14.737  57.120  1.00 61.57  ? 210 GLU H O   1 
ATOM   7095 C CB  . GLU H 2 120 ? 0.865   13.636  58.471  1.00 60.31  ? 210 GLU H CB  1 
ATOM   7096 C CG  . GLU H 2 120 ? 1.735   14.821  58.854  1.00 72.81  ? 210 GLU H CG  1 
ATOM   7097 C CD  . GLU H 2 120 ? 2.288   14.757  60.267  1.00 99.14  ? 210 GLU H CD  1 
ATOM   7098 O OE1 . GLU H 2 120 ? 3.510   14.526  60.414  1.00 98.00  ? 210 GLU H OE1 1 
ATOM   7099 O OE2 . GLU H 2 120 ? 1.502   14.929  61.227  1.00 93.16  ? 210 GLU H OE2 1 
ATOM   7100 N N   . MET H 2 121 ? -0.132  15.504  55.581  1.00 57.93  ? 211 MET H N   1 
ATOM   7101 C CA  . MET H 2 121 ? -0.999  16.582  55.092  1.00 57.49  ? 211 MET H CA  1 
ATOM   7102 C C   . MET H 2 121 ? -1.621  16.253  53.720  1.00 60.75  ? 211 MET H C   1 
ATOM   7103 O O   . MET H 2 121 ? -2.324  17.099  53.150  1.00 60.46  ? 211 MET H O   1 
ATOM   7104 C CB  . MET H 2 121 ? -0.242  17.925  55.019  1.00 59.81  ? 211 MET H CB  1 
ATOM   7105 C CG  . MET H 2 121 ? -0.029  18.571  56.364  1.00 63.45  ? 211 MET H CG  1 
ATOM   7106 S SD  . MET H 2 121 ? -1.577  18.994  57.194  1.00 67.68  ? 211 MET H SD  1 
ATOM   7107 C CE  . MET H 2 121 ? -1.090  18.763  58.881  1.00 64.39  ? 211 MET H CE  1 
ATOM   7108 N N   . LEU H 2 122 ? -1.375  15.032  53.194  1.00 56.11  ? 212 LEU H N   1 
ATOM   7109 C CA  . LEU H 2 122 ? -1.917  14.602  51.902  1.00 55.36  ? 212 LEU H CA  1 
ATOM   7110 C C   . LEU H 2 122 ? -3.408  14.341  51.985  1.00 58.23  ? 212 LEU H C   1 
ATOM   7111 O O   . LEU H 2 122 ? -3.894  13.881  53.024  1.00 57.67  ? 212 LEU H O   1 
ATOM   7112 C CB  . LEU H 2 122 ? -1.217  13.323  51.399  1.00 55.36  ? 212 LEU H CB  1 
ATOM   7113 C CG  . LEU H 2 122 ? 0.200   13.453  50.861  1.00 59.28  ? 212 LEU H CG  1 
ATOM   7114 C CD1 . LEU H 2 122 ? 0.802   12.085  50.625  1.00 58.86  ? 212 LEU H CD1 1 
ATOM   7115 C CD2 . LEU H 2 122 ? 0.237   14.274  49.577  1.00 61.00  ? 212 LEU H CD2 1 
ATOM   7116 N N   . THR H 2 123 ? -4.129  14.609  50.885  1.00 53.91  ? 213 THR H N   1 
ATOM   7117 C CA  . THR H 2 123 ? -5.556  14.322  50.801  1.00 53.23  ? 213 THR H CA  1 
ATOM   7118 C C   . THR H 2 123 ? -5.689  12.829  50.443  1.00 58.43  ? 213 THR H C   1 
ATOM   7119 O O   . THR H 2 123 ? -4.711  12.233  49.978  1.00 59.30  ? 213 THR H O   1 
ATOM   7120 C CB  . THR H 2 123 ? -6.255  15.295  49.823  1.00 52.72  ? 213 THR H CB  1 
ATOM   7121 O OG1 . THR H 2 123 ? -7.614  15.454  50.221  1.00 50.11  ? 213 THR H OG1 1 
ATOM   7122 C CG2 . THR H 2 123 ? -6.194  14.866  48.376  1.00 48.05  ? 213 THR H CG2 1 
ATOM   7123 N N   . GLY H 2 124 ? -6.877  12.252  50.655  1.00 53.94  ? 214 GLY H N   1 
ATOM   7124 C CA  . GLY H 2 124 ? -7.168  10.859  50.323  1.00 53.20  ? 214 GLY H CA  1 
ATOM   7125 C C   . GLY H 2 124 ? -6.865  10.550  48.870  1.00 56.26  ? 214 GLY H C   1 
ATOM   7126 O O   . GLY H 2 124 ? -6.194  9.557   48.581  1.00 56.36  ? 214 GLY H O   1 
ATOM   7127 N N   . GLN H 2 125 ? -7.285  11.458  47.956  1.00 51.67  ? 215 GLN H N   1 
ATOM   7128 C CA  . GLN H 2 125 ? -7.068  11.374  46.503  1.00 50.87  ? 215 GLN H CA  1 
ATOM   7129 C C   . GLN H 2 125 ? -5.572  11.384  46.154  1.00 53.08  ? 215 GLN H C   1 
ATOM   7130 O O   . GLN H 2 125 ? -5.146  10.598  45.310  1.00 52.58  ? 215 GLN H O   1 
ATOM   7131 C CB  . GLN H 2 125 ? -7.777  12.534  45.763  1.00 52.22  ? 215 GLN H CB  1 
ATOM   7132 C CG  . GLN H 2 125 ? -9.293  12.643  45.978  1.00 71.01  ? 215 GLN H CG  1 
ATOM   7133 C CD  . GLN H 2 125 ? -10.085 11.512  45.356  1.00 92.26  ? 215 GLN H CD  1 
ATOM   7134 O OE1 . GLN H 2 125 ? -10.293 11.450  44.137  1.00 89.28  ? 215 GLN H OE1 1 
ATOM   7135 N NE2 . GLN H 2 125 ? -10.574 10.609  46.191  1.00 81.67  ? 215 GLN H NE2 1 
ATOM   7136 N N   . GLU H 2 126 ? -4.789  12.280  46.795  1.00 48.66  ? 216 GLU H N   1 
ATOM   7137 C CA  . GLU H 2 126 ? -3.339  12.431  46.599  1.00 47.94  ? 216 GLU H CA  1 
ATOM   7138 C C   . GLU H 2 126 ? -2.585  11.228  47.150  1.00 51.33  ? 216 GLU H C   1 
ATOM   7139 O O   . GLU H 2 126 ? -1.576  10.816  46.576  1.00 51.75  ? 216 GLU H O   1 
ATOM   7140 C CB  . GLU H 2 126 ? -2.817  13.703  47.280  1.00 49.04  ? 216 GLU H CB  1 
ATOM   7141 C CG  . GLU H 2 126 ? -3.077  14.983  46.512  1.00 58.31  ? 216 GLU H CG  1 
ATOM   7142 C CD  . GLU H 2 126 ? -3.004  16.247  47.348  1.00 73.87  ? 216 GLU H CD  1 
ATOM   7143 O OE1 . GLU H 2 126 ? -3.037  16.154  48.598  1.00 44.49  ? 216 GLU H OE1 1 
ATOM   7144 O OE2 . GLU H 2 126 ? -2.951  17.342  46.742  1.00 73.71  ? 216 GLU H OE2 1 
ATOM   7145 N N   . ARG H 2 127 ? -3.068  10.699  48.288  1.00 46.82  ? 217 ARG H N   1 
ATOM   7146 C CA  . ARG H 2 127 ? -2.535  9.542   48.989  1.00 46.31  ? 217 ARG H CA  1 
ATOM   7147 C C   . ARG H 2 127 ? -2.647  8.299   48.115  1.00 51.29  ? 217 ARG H C   1 
ATOM   7148 O O   . ARG H 2 127 ? -1.718  7.499   48.086  1.00 51.04  ? 217 ARG H O   1 
ATOM   7149 C CB  . ARG H 2 127 ? -3.284  9.334   50.306  1.00 44.34  ? 217 ARG H CB  1 
ATOM   7150 C CG  . ARG H 2 127 ? -2.461  8.589   51.323  1.00 47.77  ? 217 ARG H CG  1 
ATOM   7151 C CD  . ARG H 2 127 ? -3.075  8.600   52.701  1.00 53.48  ? 217 ARG H CD  1 
ATOM   7152 N NE  . ARG H 2 127 ? -3.129  9.937   53.290  1.00 58.20  ? 217 ARG H NE  1 
ATOM   7153 C CZ  . ARG H 2 127 ? -2.125  10.510  53.945  1.00 73.31  ? 217 ARG H CZ  1 
ATOM   7154 N NH1 . ARG H 2 127 ? -0.960  9.883   54.073  1.00 61.76  ? 217 ARG H NH1 1 
ATOM   7155 N NH2 . ARG H 2 127 ? -2.271  11.722  54.461  1.00 60.07  ? 217 ARG H NH2 1 
ATOM   7156 N N   . VAL H 2 128 ? -3.775  8.165   47.386  1.00 47.86  ? 218 VAL H N   1 
ATOM   7157 C CA  . VAL H 2 128 ? -4.069  7.072   46.457  1.00 47.58  ? 218 VAL H CA  1 
ATOM   7158 C C   . VAL H 2 128 ? -3.090  7.171   45.274  1.00 51.07  ? 218 VAL H C   1 
ATOM   7159 O O   . VAL H 2 128 ? -2.443  6.176   44.938  1.00 51.71  ? 218 VAL H O   1 
ATOM   7160 C CB  . VAL H 2 128 ? -5.573  7.094   46.020  1.00 51.37  ? 218 VAL H CB  1 
ATOM   7161 C CG1 . VAL H 2 128 ? -5.807  6.361   44.700  1.00 51.35  ? 218 VAL H CG1 1 
ATOM   7162 C CG2 . VAL H 2 128 ? -6.479  6.533   47.115  1.00 51.00  ? 218 VAL H CG2 1 
ATOM   7163 N N   . ALA H 2 129 ? -2.960  8.375   44.682  1.00 46.29  ? 219 ALA H N   1 
ATOM   7164 C CA  . ALA H 2 129 ? -2.091  8.669   43.533  1.00 45.51  ? 219 ALA H CA  1 
ATOM   7165 C C   . ALA H 2 129 ? -0.593  8.479   43.840  1.00 47.47  ? 219 ALA H C   1 
ATOM   7166 O O   . ALA H 2 129 ? 0.137   8.003   42.973  1.00 47.29  ? 219 ALA H O   1 
ATOM   7167 C CB  . ALA H 2 129 ? -2.336  10.088  43.054  1.00 46.37  ? 219 ALA H CB  1 
ATOM   7168 N N   . LEU H 2 130 ? -0.133  8.860   45.047  1.00 42.61  ? 220 LEU H N   1 
ATOM   7169 C CA  . LEU H 2 130 ? 1.270   8.692   45.409  1.00 41.69  ? 220 LEU H CA  1 
ATOM   7170 C C   . LEU H 2 130 ? 1.592   7.207   45.657  1.00 43.62  ? 220 LEU H C   1 
ATOM   7171 O O   . LEU H 2 130 ? 2.605   6.714   45.149  1.00 44.03  ? 220 LEU H O   1 
ATOM   7172 C CB  . LEU H 2 130 ? 1.655   9.553   46.630  1.00 41.85  ? 220 LEU H CB  1 
ATOM   7173 C CG  . LEU H 2 130 ? 3.126   9.464   47.084  1.00 46.83  ? 220 LEU H CG  1 
ATOM   7174 C CD1 . LEU H 2 130 ? 4.102   9.927   45.990  1.00 46.82  ? 220 LEU H CD1 1 
ATOM   7175 C CD2 . LEU H 2 130 ? 3.348   10.203  48.377  1.00 49.55  ? 220 LEU H CD2 1 
ATOM   7176 N N   . ALA H 2 131 ? 0.729   6.499   46.413  1.00 37.69  ? 221 ALA H N   1 
ATOM   7177 C CA  . ALA H 2 131 ? 0.902   5.078   46.731  1.00 36.55  ? 221 ALA H CA  1 
ATOM   7178 C C   . ALA H 2 131 ? 0.874   4.232   45.468  1.00 38.90  ? 221 ALA H C   1 
ATOM   7179 O O   . ALA H 2 131 ? 1.671   3.306   45.350  1.00 37.92  ? 221 ALA H O   1 
ATOM   7180 C CB  . ALA H 2 131 ? -0.171  4.618   47.700  1.00 37.18  ? 221 ALA H CB  1 
ATOM   7181 N N   . ASN H 2 132 ? 0.007   4.587   44.499  1.00 35.31  ? 222 ASN H N   1 
ATOM   7182 C CA  . ASN H 2 132 ? -0.081  3.864   43.238  1.00 34.64  ? 222 ASN H CA  1 
ATOM   7183 C C   . ASN H 2 132 ? 1.148   4.092   42.384  1.00 37.03  ? 222 ASN H C   1 
ATOM   7184 O O   . ASN H 2 132 ? 1.552   3.183   41.668  1.00 36.42  ? 222 ASN H O   1 
ATOM   7185 C CB  . ASN H 2 132 ? -1.331  4.242   42.470  1.00 37.32  ? 222 ASN H CB  1 
ATOM   7186 C CG  . ASN H 2 132 ? -2.424  3.215   42.592  1.00 66.90  ? 222 ASN H CG  1 
ATOM   7187 O OD1 . ASN H 2 132 ? -2.245  2.031   42.286  1.00 62.94  ? 222 ASN H OD1 1 
ATOM   7188 N ND2 . ASN H 2 132 ? -3.591  3.643   43.040  1.00 61.08  ? 222 ASN H ND2 1 
ATOM   7189 N N   . ARG H 2 133 ? 1.742   5.295   42.451  1.00 33.22  ? 223 ARG H N   1 
ATOM   7190 C CA  . ARG H 2 133 ? 2.953   5.637   41.699  1.00 32.42  ? 223 ARG H CA  1 
ATOM   7191 C C   . ARG H 2 133 ? 4.138   4.820   42.228  1.00 32.93  ? 223 ARG H C   1 
ATOM   7192 O O   . ARG H 2 133 ? 4.908   4.289   41.431  1.00 33.14  ? 223 ARG H O   1 
ATOM   7193 C CB  . ARG H 2 133 ? 3.236   7.160   41.766  1.00 35.13  ? 223 ARG H CB  1 
ATOM   7194 C CG  . ARG H 2 133 ? 4.571   7.631   41.136  1.00 54.30  ? 223 ARG H CG  1 
ATOM   7195 C CD  . ARG H 2 133 ? 4.765   7.246   39.669  1.00 73.91  ? 223 ARG H CD  1 
ATOM   7196 N NE  . ARG H 2 133 ? 6.119   7.554   39.188  1.00 89.37  ? 223 ARG H NE  1 
ATOM   7197 C CZ  . ARG H 2 133 ? 6.692   6.978   38.133  1.00 102.22 ? 223 ARG H CZ  1 
ATOM   7198 N NH1 . ARG H 2 133 ? 6.048   6.037   37.448  1.00 89.37  ? 223 ARG H NH1 1 
ATOM   7199 N NH2 . ARG H 2 133 ? 7.923   7.322   37.767  1.00 85.45  ? 223 ARG H NH2 1 
ATOM   7200 N N   . LYS H 2 134 ? 4.273   4.715   43.552  1.00 26.85  ? 224 LYS H N   1 
ATOM   7201 C CA  . LYS H 2 134 ? 5.347   3.958   44.189  1.00 26.53  ? 224 LYS H CA  1 
ATOM   7202 C C   . LYS H 2 134 ? 5.176   2.459   43.891  1.00 30.99  ? 224 LYS H C   1 
ATOM   7203 O O   . LYS H 2 134 ? 6.169   1.776   43.613  1.00 31.01  ? 224 LYS H O   1 
ATOM   7204 C CB  . LYS H 2 134 ? 5.394   4.237   45.703  1.00 28.22  ? 224 LYS H CB  1 
ATOM   7205 N N   . ARG H 2 135 ? 3.909   1.972   43.891  1.00 27.08  ? 225 ARG H N   1 
ATOM   7206 C CA  . ARG H 2 135 ? 3.533   0.594   43.553  1.00 27.14  ? 225 ARG H CA  1 
ATOM   7207 C C   . ARG H 2 135 ? 3.929   0.292   42.099  1.00 31.44  ? 225 ARG H C   1 
ATOM   7208 O O   . ARG H 2 135 ? 4.467   -0.779  41.826  1.00 31.30  ? 225 ARG H O   1 
ATOM   7209 C CB  . ARG H 2 135 ? 2.020   0.378   43.762  1.00 26.15  ? 225 ARG H CB  1 
ATOM   7210 C CG  . ARG H 2 135 ? 1.575   -1.095  43.696  1.00 33.26  ? 225 ARG H CG  1 
ATOM   7211 C CD  . ARG H 2 135 ? 0.069   -1.308  43.516  1.00 39.24  ? 225 ARG H CD  1 
ATOM   7212 N NE  . ARG H 2 135 ? -0.528  -0.428  42.500  1.00 50.06  ? 225 ARG H NE  1 
ATOM   7213 C CZ  . ARG H 2 135 ? -0.534  -0.662  41.188  1.00 63.76  ? 225 ARG H CZ  1 
ATOM   7214 N NH1 . ARG H 2 135 ? 0.030   -1.757  40.697  1.00 49.53  ? 225 ARG H NH1 1 
ATOM   7215 N NH2 . ARG H 2 135 ? -1.102  0.203   40.357  1.00 50.97  ? 225 ARG H NH2 1 
ATOM   7216 N N   . GLU H 2 136 ? 3.694   1.241   41.185  1.00 28.02  ? 226 GLU H N   1 
ATOM   7217 C CA  . GLU H 2 136 ? 4.050   1.062   39.777  1.00 29.60  ? 226 GLU H CA  1 
ATOM   7218 C C   . GLU H 2 136 ? 5.571   1.043   39.590  1.00 33.17  ? 226 GLU H C   1 
ATOM   7219 O O   . GLU H 2 136 ? 6.061   0.344   38.702  1.00 32.94  ? 226 GLU H O   1 
ATOM   7220 C CB  . GLU H 2 136 ? 3.407   2.144   38.898  1.00 32.03  ? 226 GLU H CB  1 
ATOM   7221 C CG  . GLU H 2 136 ? 1.930   1.881   38.629  1.00 47.14  ? 226 GLU H CG  1 
ATOM   7222 C CD  . GLU H 2 136 ? 1.148   2.990   37.947  1.00 78.50  ? 226 GLU H CD  1 
ATOM   7223 O OE1 . GLU H 2 136 ? -0.015  3.221   38.352  1.00 73.33  ? 226 GLU H OE1 1 
ATOM   7224 O OE2 . GLU H 2 136 ? 1.675   3.599   36.986  1.00 79.02  ? 226 GLU H OE2 1 
ATOM   7225 N N   . CYS H 2 137 ? 6.311   1.791   40.441  1.00 28.84  ? 227 CYS H N   1 
ATOM   7226 C CA  . CYS H 2 137 ? 7.773   1.828   40.430  1.00 27.71  ? 227 CYS H CA  1 
ATOM   7227 C C   . CYS H 2 137 ? 8.302   0.469   40.889  1.00 32.44  ? 227 CYS H C   1 
ATOM   7228 O O   . CYS H 2 137 ? 9.086   -0.154  40.168  1.00 32.97  ? 227 CYS H O   1 
ATOM   7229 C CB  . CYS H 2 137 ? 8.309   2.969   41.292  1.00 27.32  ? 227 CYS H CB  1 
ATOM   7230 S SG  . CYS H 2 137 ? 8.097   4.614   40.562  1.00 30.72  ? 227 CYS H SG  1 
ATOM   7231 N N   . GLY H 2 138 ? 7.819   0.004   42.043  1.00 27.74  ? 228 GLY H N   1 
ATOM   7232 C CA  . GLY H 2 138 ? 8.158   -1.300  42.592  1.00 27.83  ? 228 GLY H CA  1 
ATOM   7233 C C   . GLY H 2 138 ? 7.909   -2.427  41.609  1.00 33.96  ? 228 GLY H C   1 
ATOM   7234 O O   . GLY H 2 138 ? 8.756   -3.313  41.465  1.00 34.26  ? 228 GLY H O   1 
ATOM   7235 N N   . ASN H 2 139 ? 6.758   -2.375  40.887  1.00 29.89  ? 229 ASN H N   1 
ATOM   7236 C CA  . ASN H 2 139 ? 6.396   -3.367  39.880  1.00 29.14  ? 229 ASN H CA  1 
ATOM   7237 C C   . ASN H 2 139 ? 7.429   -3.402  38.761  1.00 31.87  ? 229 ASN H C   1 
ATOM   7238 O O   . ASN H 2 139 ? 7.842   -4.491  38.385  1.00 31.16  ? 229 ASN H O   1 
ATOM   7239 C CB  . ASN H 2 139 ? 4.995   -3.112  39.325  1.00 30.14  ? 229 ASN H CB  1 
ATOM   7240 C CG  . ASN H 2 139 ? 3.862   -3.506  40.245  1.00 42.74  ? 229 ASN H CG  1 
ATOM   7241 O OD1 . ASN H 2 139 ? 4.049   -3.875  41.414  1.00 32.34  ? 229 ASN H OD1 1 
ATOM   7242 N ND2 . ASN H 2 139 ? 2.647   -3.415  39.730  1.00 31.85  ? 229 ASN H ND2 1 
ATOM   7243 N N   . ALA H 2 140 ? 7.891   -2.226  38.279  1.00 27.88  ? 230 ALA H N   1 
ATOM   7244 C CA  . ALA H 2 140 ? 8.894   -2.112  37.218  1.00 28.14  ? 230 ALA H CA  1 
ATOM   7245 C C   . ALA H 2 140 ? 10.244  -2.753  37.619  1.00 33.74  ? 230 ALA H C   1 
ATOM   7246 O O   . ALA H 2 140 ? 10.852  -3.415  36.781  1.00 33.74  ? 230 ALA H O   1 
ATOM   7247 C CB  . ALA H 2 140 ? 9.095   -0.659  36.829  1.00 28.66  ? 230 ALA H CB  1 
ATOM   7248 N N   . HIS H 2 141 ? 10.704  -2.561  38.879  1.00 30.67  ? 231 HIS H N   1 
ATOM   7249 C CA  . HIS H 2 141 ? 11.927  -3.153  39.434  1.00 29.98  ? 231 HIS H CA  1 
ATOM   7250 C C   . HIS H 2 141 ? 11.767  -4.659  39.577  1.00 34.27  ? 231 HIS H C   1 
ATOM   7251 O O   . HIS H 2 141 ? 12.718  -5.409  39.352  1.00 34.23  ? 231 HIS H O   1 
ATOM   7252 C CB  . HIS H 2 141 ? 12.251  -2.571  40.828  1.00 30.79  ? 231 HIS H CB  1 
ATOM   7253 C CG  . HIS H 2 141 ? 12.545  -1.105  40.880  1.00 34.29  ? 231 HIS H CG  1 
ATOM   7254 N ND1 . HIS H 2 141 ? 13.604  -0.557  40.193  1.00 36.20  ? 231 HIS H ND1 1 
ATOM   7255 C CD2 . HIS H 2 141 ? 11.982  -0.143  41.647  1.00 36.32  ? 231 HIS H CD2 1 
ATOM   7256 C CE1 . HIS H 2 141 ? 13.601  0.733   40.493  1.00 35.50  ? 231 HIS H CE1 1 
ATOM   7257 N NE2 . HIS H 2 141 ? 12.658  1.024   41.380  1.00 35.99  ? 231 HIS H NE2 1 
ATOM   7258 N N   . TYR H 2 142 ? 10.572  -5.101  40.001  1.00 31.22  ? 232 TYR H N   1 
ATOM   7259 C CA  . TYR H 2 142 ? 10.265  -6.516  40.205  1.00 31.10  ? 232 TYR H CA  1 
ATOM   7260 C C   . TYR H 2 142 ? 10.349  -7.289  38.902  1.00 34.02  ? 232 TYR H C   1 
ATOM   7261 O O   . TYR H 2 142 ? 10.970  -8.347  38.902  1.00 33.85  ? 232 TYR H O   1 
ATOM   7262 C CB  . TYR H 2 142 ? 8.878   -6.687  40.837  1.00 32.56  ? 232 TYR H CB  1 
ATOM   7263 C CG  . TYR H 2 142 ? 8.544   -8.111  41.212  1.00 34.91  ? 232 TYR H CG  1 
ATOM   7264 C CD1 . TYR H 2 142 ? 7.947   -8.975  40.294  1.00 36.51  ? 232 TYR H CD1 1 
ATOM   7265 C CD2 . TYR H 2 142 ? 8.812   -8.597  42.488  1.00 35.93  ? 232 TYR H CD2 1 
ATOM   7266 C CE1 . TYR H 2 142 ? 7.655   -10.295 40.628  1.00 37.02  ? 232 TYR H CE1 1 
ATOM   7267 C CE2 . TYR H 2 142 ? 8.489   -9.908  42.845  1.00 36.92  ? 232 TYR H CE2 1 
ATOM   7268 C CZ  . TYR H 2 142 ? 7.915   -10.754 41.908  1.00 40.62  ? 232 TYR H CZ  1 
ATOM   7269 O OH  . TYR H 2 142 ? 7.595   -12.045 42.249  1.00 37.20  ? 232 TYR H OH  1 
ATOM   7270 N N   . GLN H 2 143 ? 9.743   -6.772  37.802  1.00 30.95  ? 233 GLN H N   1 
ATOM   7271 C CA  . GLN H 2 143 ? 9.758   -7.412  36.466  1.00 31.64  ? 233 GLN H CA  1 
ATOM   7272 C C   . GLN H 2 143 ? 11.199  -7.689  35.957  1.00 38.04  ? 233 GLN H C   1 
ATOM   7273 O O   . GLN H 2 143 ? 11.430  -8.701  35.297  1.00 38.73  ? 233 GLN H O   1 
ATOM   7274 C CB  . GLN H 2 143 ? 9.023   -6.567  35.396  1.00 32.28  ? 233 GLN H CB  1 
ATOM   7275 C CG  . GLN H 2 143 ? 7.684   -5.916  35.769  1.00 49.11  ? 233 GLN H CG  1 
ATOM   7276 C CD  . GLN H 2 143 ? 6.567   -6.830  36.222  1.00 75.78  ? 233 GLN H CD  1 
ATOM   7277 O OE1 . GLN H 2 143 ? 6.486   -8.018  35.876  1.00 72.55  ? 233 GLN H OE1 1 
ATOM   7278 N NE2 . GLN H 2 143 ? 5.621   -6.255  36.946  1.00 70.64  ? 233 GLN H NE2 1 
ATOM   7279 N N   . ARG H 2 144 ? 12.139  -6.765  36.273  1.00 34.90  ? 234 ARG H N   1 
ATOM   7280 C CA  . ARG H 2 144 ? 13.562  -6.711  35.926  1.00 34.38  ? 234 ARG H CA  1 
ATOM   7281 C C   . ARG H 2 144 ? 14.429  -7.563  36.884  1.00 36.92  ? 234 ARG H C   1 
ATOM   7282 O O   . ARG H 2 144 ? 15.631  -7.713  36.646  1.00 37.55  ? 234 ARG H O   1 
ATOM   7283 C CB  . ARG H 2 144 ? 13.980  -5.230  35.999  1.00 36.09  ? 234 ARG H CB  1 
ATOM   7284 C CG  . ARG H 2 144 ? 15.310  -4.865  35.362  1.00 46.22  ? 234 ARG H CG  1 
ATOM   7285 C CD  . ARG H 2 144 ? 15.526  -3.358  35.314  1.00 44.80  ? 234 ARG H CD  1 
ATOM   7286 N NE  . ARG H 2 144 ? 15.913  -2.813  36.614  1.00 35.44  ? 234 ARG H NE  1 
ATOM   7287 C CZ  . ARG H 2 144 ? 15.245  -1.874  37.274  1.00 36.00  ? 234 ARG H CZ  1 
ATOM   7288 N NH1 . ARG H 2 144 ? 14.165  -1.319  36.742  1.00 16.98  ? 234 ARG H NH1 1 
ATOM   7289 N NH2 . ARG H 2 144 ? 15.668  -1.463  38.460  1.00 32.52  ? 234 ARG H NH2 1 
ATOM   7290 N N   . ALA H 2 145 ? 13.808  -8.111  37.959  1.00 31.06  ? 235 ALA H N   1 
ATOM   7291 C CA  . ALA H 2 145 ? 14.368  -8.949  39.030  1.00 29.79  ? 235 ALA H CA  1 
ATOM   7292 C C   . ALA H 2 145 ? 15.288  -8.152  39.986  1.00 31.89  ? 235 ALA H C   1 
ATOM   7293 O O   . ALA H 2 145 ? 16.257  -8.693  40.551  1.00 30.33  ? 235 ALA H O   1 
ATOM   7294 C CB  . ALA H 2 145 ? 15.080  -10.177 38.473  1.00 30.59  ? 235 ALA H CB  1 
ATOM   7295 N N   . ASP H 2 146 ? 14.949  -6.871  40.192  1.00 26.71  ? 236 ASP H N   1 
ATOM   7296 C CA  . ASP H 2 146 ? 15.628  -6.020  41.161  1.00 26.26  ? 236 ASP H CA  1 
ATOM   7297 C C   . ASP H 2 146 ? 14.696  -6.002  42.354  1.00 31.91  ? 236 ASP H C   1 
ATOM   7298 O O   . ASP H 2 146 ? 13.785  -5.176  42.431  1.00 32.87  ? 236 ASP H O   1 
ATOM   7299 C CB  . ASP H 2 146 ? 15.931  -4.620  40.593  1.00 27.34  ? 236 ASP H CB  1 
ATOM   7300 C CG  . ASP H 2 146 ? 16.903  -3.797  41.407  1.00 42.25  ? 236 ASP H CG  1 
ATOM   7301 O OD1 . ASP H 2 146 ? 16.985  -4.014  42.644  1.00 43.19  ? 236 ASP H OD1 1 
ATOM   7302 O OD2 . ASP H 2 146 ? 17.568  -2.911  40.816  1.00 52.64  ? 236 ASP H OD2 1 
ATOM   7303 N N   . PHE H 2 147 ? 14.848  -7.004  43.212  1.00 28.80  ? 237 PHE H N   1 
ATOM   7304 C CA  . PHE H 2 147 ? 13.967  -7.243  44.350  1.00 28.75  ? 237 PHE H CA  1 
ATOM   7305 C C   . PHE H 2 147 ? 14.309  -6.362  45.531  1.00 29.87  ? 237 PHE H C   1 
ATOM   7306 O O   . PHE H 2 147 ? 13.420  -6.060  46.318  1.00 28.77  ? 237 PHE H O   1 
ATOM   7307 C CB  . PHE H 2 147 ? 13.974  -8.732  44.729  1.00 30.73  ? 237 PHE H CB  1 
ATOM   7308 C CG  . PHE H 2 147 ? 13.561  -9.627  43.572  1.00 32.38  ? 237 PHE H CG  1 
ATOM   7309 C CD1 . PHE H 2 147 ? 12.267  -9.577  43.053  1.00 35.61  ? 237 PHE H CD1 1 
ATOM   7310 C CD2 . PHE H 2 147 ? 14.470  -10.502 42.988  1.00 34.72  ? 237 PHE H CD2 1 
ATOM   7311 C CE1 . PHE H 2 147 ? 11.898  -10.379 41.964  1.00 36.46  ? 237 PHE H CE1 1 
ATOM   7312 C CE2 . PHE H 2 147 ? 14.092  -11.313 41.908  1.00 37.50  ? 237 PHE H CE2 1 
ATOM   7313 C CZ  . PHE H 2 147 ? 12.807  -11.250 41.410  1.00 35.50  ? 237 PHE H CZ  1 
ATOM   7314 N N   . VAL H 2 148 ? 15.561  -5.878  45.620  1.00 26.84  ? 238 VAL H N   1 
ATOM   7315 C CA  . VAL H 2 148 ? 15.968  -4.940  46.682  1.00 26.42  ? 238 VAL H CA  1 
ATOM   7316 C C   . VAL H 2 148 ? 15.253  -3.584  46.445  1.00 29.67  ? 238 VAL H C   1 
ATOM   7317 O O   . VAL H 2 148 ? 14.699  -3.014  47.386  1.00 30.22  ? 238 VAL H O   1 
ATOM   7318 C CB  . VAL H 2 148 ? 17.516  -4.789  46.763  1.00 30.45  ? 238 VAL H CB  1 
ATOM   7319 C CG1 . VAL H 2 148 ? 17.933  -3.646  47.696  1.00 30.25  ? 238 VAL H CG1 1 
ATOM   7320 C CG2 . VAL H 2 148 ? 18.181  -6.098  47.182  1.00 29.91  ? 238 VAL H CG2 1 
ATOM   7321 N N   . LEU H 2 149 ? 15.227  -3.106  45.182  1.00 24.91  ? 239 LEU H N   1 
ATOM   7322 C CA  . LEU H 2 149 ? 14.594  -1.842  44.806  1.00 23.72  ? 239 LEU H CA  1 
ATOM   7323 C C   . LEU H 2 149 ? 13.062  -1.971  44.800  1.00 27.80  ? 239 LEU H C   1 
ATOM   7324 O O   . LEU H 2 149 ? 12.382  -1.055  45.270  1.00 27.79  ? 239 LEU H O   1 
ATOM   7325 C CB  . LEU H 2 149 ? 15.119  -1.362  43.447  1.00 23.56  ? 239 LEU H CB  1 
ATOM   7326 C CG  . LEU H 2 149 ? 16.310  -0.370  43.422  1.00 27.48  ? 239 LEU H CG  1 
ATOM   7327 C CD1 . LEU H 2 149 ? 17.566  -0.912  44.020  1.00 27.75  ? 239 LEU H CD1 1 
ATOM   7328 C CD2 . LEU H 2 149 ? 16.584  0.140   42.031  1.00 29.37  ? 239 LEU H CD2 1 
ATOM   7329 N N   . ALA H 2 150 ? 12.527  -3.105  44.281  1.00 24.53  ? 240 ALA H N   1 
ATOM   7330 C CA  . ALA H 2 150 ? 11.086  -3.399  44.289  1.00 24.16  ? 240 ALA H CA  1 
ATOM   7331 C C   . ALA H 2 150 ? 10.555  -3.332  45.717  1.00 26.34  ? 240 ALA H C   1 
ATOM   7332 O O   . ALA H 2 150 ? 9.607   -2.590  45.957  1.00 26.33  ? 240 ALA H O   1 
ATOM   7333 C CB  . ALA H 2 150 ? 10.806  -4.771  43.688  1.00 24.74  ? 240 ALA H CB  1 
ATOM   7334 N N   . ALA H 2 151 ? 11.223  -4.030  46.671  1.00 21.74  ? 241 ALA H N   1 
ATOM   7335 C CA  . ALA H 2 151 ? 10.833  -4.027  48.091  1.00 22.15  ? 241 ALA H CA  1 
ATOM   7336 C C   . ALA H 2 151 ? 10.839  -2.618  48.679  1.00 26.97  ? 241 ALA H C   1 
ATOM   7337 O O   . ALA H 2 151 ? 9.955   -2.295  49.480  1.00 28.64  ? 241 ALA H O   1 
ATOM   7338 C CB  . ALA H 2 151 ? 11.750  -4.927  48.908  1.00 22.82  ? 241 ALA H CB  1 
ATOM   7339 N N   . ASN H 2 152 ? 11.824  -1.785  48.287  1.00 20.74  ? 242 ASN H N   1 
ATOM   7340 C CA  . ASN H 2 152 ? 11.959  -0.427  48.789  1.00 20.01  ? 242 ASN H CA  1 
ATOM   7341 C C   . ASN H 2 152 ? 10.763  0.433   48.359  1.00 24.32  ? 242 ASN H C   1 
ATOM   7342 O O   . ASN H 2 152 ? 10.186  1.111   49.209  1.00 22.98  ? 242 ASN H O   1 
ATOM   7343 C CB  . ASN H 2 152 ? 13.281  0.178   48.315  1.00 21.26  ? 242 ASN H CB  1 
ATOM   7344 C CG  . ASN H 2 152 ? 13.449  1.636   48.629  1.00 32.86  ? 242 ASN H CG  1 
ATOM   7345 O OD1 . ASN H 2 152 ? 13.521  2.043   49.789  1.00 17.44  ? 242 ASN H OD1 1 
ATOM   7346 N ND2 . ASN H 2 152 ? 13.492  2.454   47.586  1.00 27.14  ? 242 ASN H ND2 1 
ATOM   7347 N N   . SER H 2 153 ? 10.384  0.383   47.054  1.00 22.25  ? 243 SER H N   1 
ATOM   7348 C CA  . SER H 2 153 ? 9.252   1.113   46.484  1.00 23.41  ? 243 SER H CA  1 
ATOM   7349 C C   . SER H 2 153 ? 7.935   0.670   47.116  1.00 31.31  ? 243 SER H C   1 
ATOM   7350 O O   . SER H 2 153 ? 7.064   1.514   47.339  1.00 31.97  ? 243 SER H O   1 
ATOM   7351 C CB  . SER H 2 153 ? 9.172   0.927   44.970  1.00 28.47  ? 243 SER H CB  1 
ATOM   7352 O OG  . SER H 2 153 ? 10.401  1.087   44.281  1.00 38.53  ? 243 SER H OG  1 
ATOM   7353 N N   . TYR H 2 154 ? 7.789   -0.638  47.434  1.00 29.32  ? 244 TYR H N   1 
ATOM   7354 C CA  . TYR H 2 154 ? 6.557   -1.122  48.075  1.00 29.14  ? 244 TYR H CA  1 
ATOM   7355 C C   . TYR H 2 154 ? 6.463   -0.637  49.529  1.00 31.69  ? 244 TYR H C   1 
ATOM   7356 O O   . TYR H 2 154 ? 5.371   -0.282  49.953  1.00 32.33  ? 244 TYR H O   1 
ATOM   7357 C CB  . TYR H 2 154 ? 6.422   -2.648  48.009  1.00 29.52  ? 244 TYR H CB  1 
ATOM   7358 C CG  . TYR H 2 154 ? 6.373   -3.215  46.605  1.00 30.56  ? 244 TYR H CG  1 
ATOM   7359 C CD1 . TYR H 2 154 ? 5.507   -2.690  45.648  1.00 32.08  ? 244 TYR H CD1 1 
ATOM   7360 C CD2 . TYR H 2 154 ? 7.137   -4.321  46.252  1.00 30.99  ? 244 TYR H CD2 1 
ATOM   7361 C CE1 . TYR H 2 154 ? 5.462   -3.209  44.355  1.00 33.03  ? 244 TYR H CE1 1 
ATOM   7362 C CE2 . TYR H 2 154 ? 7.098   -4.849  44.967  1.00 31.67  ? 244 TYR H CE2 1 
ATOM   7363 C CZ  . TYR H 2 154 ? 6.253   -4.298  44.024  1.00 37.87  ? 244 TYR H CZ  1 
ATOM   7364 O OH  . TYR H 2 154 ? 6.205   -4.856  42.774  1.00 39.41  ? 244 TYR H OH  1 
ATOM   7365 N N   . ASP H 2 155 ? 7.588   -0.559  50.270  1.00 26.12  ? 245 ASP H N   1 
ATOM   7366 C CA  . ASP H 2 155 ? 7.584   -0.066  51.659  1.00 25.88  ? 245 ASP H CA  1 
ATOM   7367 C C   . ASP H 2 155 ? 7.277   1.443   51.677  1.00 31.51  ? 245 ASP H C   1 
ATOM   7368 O O   . ASP H 2 155 ? 6.641   1.918   52.619  1.00 30.85  ? 245 ASP H O   1 
ATOM   7369 C CB  . ASP H 2 155 ? 8.907   -0.372  52.389  1.00 26.86  ? 245 ASP H CB  1 
ATOM   7370 C CG  . ASP H 2 155 ? 8.802   -0.268  53.904  0.00 36.76  ? 245 ASP H CG  1 
ATOM   7371 O OD1 . ASP H 2 155 ? 8.251   -1.204  54.529  1.00 39.50  ? 245 ASP H OD1 1 
ATOM   7372 O OD2 . ASP H 2 155 ? 9.282   0.742   54.466  1.00 37.77  ? 245 ASP H OD2 1 
ATOM   7373 N N   . LEU H 2 156 ? 7.703   2.181   50.628  1.00 29.05  ? 246 LEU H N   1 
ATOM   7374 C CA  . LEU H 2 156 ? 7.427   3.616   50.504  1.00 28.77  ? 246 LEU H CA  1 
ATOM   7375 C C   . LEU H 2 156 ? 5.951   3.827   50.180  1.00 33.61  ? 246 LEU H C   1 
ATOM   7376 O O   . LEU H 2 156 ? 5.335   4.748   50.726  1.00 32.91  ? 246 LEU H O   1 
ATOM   7377 C CB  . LEU H 2 156 ? 8.316   4.284   49.440  1.00 28.40  ? 246 LEU H CB  1 
ATOM   7378 C CG  . LEU H 2 156 ? 9.810   4.349   49.719  1.00 32.10  ? 246 LEU H CG  1 
ATOM   7379 C CD1 . LEU H 2 156 ? 10.555  4.850   48.500  1.00 31.77  ? 246 LEU H CD1 1 
ATOM   7380 C CD2 . LEU H 2 156 ? 10.123  5.216   50.937  1.00 34.16  ? 246 LEU H CD2 1 
ATOM   7381 N N   . ALA H 2 157 ? 5.373   2.922   49.340  1.00 31.54  ? 247 ALA H N   1 
ATOM   7382 C CA  . ALA H 2 157 ? 3.950   2.918   48.974  1.00 31.78  ? 247 ALA H CA  1 
ATOM   7383 C C   . ALA H 2 157 ? 3.075   2.696   50.214  1.00 37.85  ? 247 ALA H C   1 
ATOM   7384 O O   . ALA H 2 157 ? 2.044   3.358   50.350  1.00 38.20  ? 247 ALA H O   1 
ATOM   7385 C CB  . ALA H 2 157 ? 3.662   1.851   47.930  1.00 32.27  ? 247 ALA H CB  1 
ATOM   7386 N N   . ILE H 2 158 ? 3.519   1.814   51.138  1.00 35.11  ? 248 ILE H N   1 
ATOM   7387 C CA  . ILE H 2 158 ? 2.826   1.509   52.402  1.00 35.00  ? 248 ILE H CA  1 
ATOM   7388 C C   . ILE H 2 158 ? 2.930   2.713   53.363  1.00 39.04  ? 248 ILE H C   1 
ATOM   7389 O O   . ILE H 2 158 ? 1.912   3.120   53.922  1.00 39.66  ? 248 ILE H O   1 
ATOM   7390 C CB  . ILE H 2 158 ? 3.374   0.195   53.034  1.00 37.87  ? 248 ILE H CB  1 
ATOM   7391 C CG1 . ILE H 2 158 ? 2.976   -1.036  52.177  1.00 37.78  ? 248 ILE H CG1 1 
ATOM   7392 C CG2 . ILE H 2 158 ? 2.914   0.026   54.501  1.00 39.26  ? 248 ILE H CG2 1 
ATOM   7393 C CD1 . ILE H 2 158 ? 3.933   -2.234  52.257  1.00 42.46  ? 248 ILE H CD1 1 
ATOM   7394 N N   . LYS H 2 159 ? 4.146   3.282   53.542  1.00 34.95  ? 249 LYS H N   1 
ATOM   7395 C CA  . LYS H 2 159 ? 4.411   4.443   54.411  1.00 34.18  ? 249 LYS H CA  1 
ATOM   7396 C C   . LYS H 2 159 ? 3.534   5.650   54.028  1.00 37.08  ? 249 LYS H C   1 
ATOM   7397 O O   . LYS H 2 159 ? 3.105   6.403   54.909  1.00 35.15  ? 249 LYS H O   1 
ATOM   7398 C CB  . LYS H 2 159 ? 5.898   4.835   54.380  1.00 36.94  ? 249 LYS H CB  1 
ATOM   7399 C CG  . LYS H 2 159 ? 6.765   4.054   55.373  1.00 59.32  ? 249 LYS H CG  1 
ATOM   7400 C CD  . LYS H 2 159 ? 8.254   4.363   55.227  1.00 74.17  ? 249 LYS H CD  1 
ATOM   7401 C CE  . LYS H 2 159 ? 9.091   3.646   56.265  1.00 90.68  ? 249 LYS H CE  1 
ATOM   7402 N NZ  . LYS H 2 159 ? 10.546  3.910   56.088  1.00 101.09 ? 249 LYS H NZ  1 
ATOM   7403 N N   . ALA H 2 160 ? 3.256   5.796   52.714  1.00 34.37  ? 250 ALA H N   1 
ATOM   7404 C CA  . ALA H 2 160 ? 2.402   6.833   52.119  1.00 34.54  ? 250 ALA H CA  1 
ATOM   7405 C C   . ALA H 2 160 ? 0.934   6.629   52.500  1.00 38.05  ? 250 ALA H C   1 
ATOM   7406 O O   . ALA H 2 160 ? 0.235   7.607   52.744  1.00 37.63  ? 250 ALA H O   1 
ATOM   7407 C CB  . ALA H 2 160 ? 2.547   6.822   50.598  1.00 34.99  ? 250 ALA H CB  1 
ATOM   7408 N N   . ILE H 2 161 ? 0.477   5.363   52.563  1.00 35.11  ? 251 ILE H N   1 
ATOM   7409 C CA  . ILE H 2 161 ? -0.904  4.996   52.905  1.00 34.96  ? 251 ILE H CA  1 
ATOM   7410 C C   . ILE H 2 161 ? -1.163  5.183   54.417  1.00 43.70  ? 251 ILE H C   1 
ATOM   7411 O O   . ILE H 2 161 ? -2.170  5.785   54.800  1.00 44.18  ? 251 ILE H O   1 
ATOM   7412 C CB  . ILE H 2 161 ? -1.208  3.530   52.451  1.00 36.64  ? 251 ILE H CB  1 
ATOM   7413 C CG1 . ILE H 2 161 ? -1.231  3.398   50.913  1.00 35.08  ? 251 ILE H CG1 1 
ATOM   7414 C CG2 . ILE H 2 161 ? -2.519  2.991   53.066  1.00 37.59  ? 251 ILE H CG2 1 
ATOM   7415 C CD1 . ILE H 2 161 ? -1.067  1.994   50.354  1.00 24.50  ? 251 ILE H CD1 1 
ATOM   7416 N N   . THR H 2 162 ? -0.254  4.665   55.256  1.00 42.82  ? 252 THR H N   1 
ATOM   7417 C CA  . THR H 2 162 ? -0.375  4.609   56.716  1.00 44.26  ? 252 THR H CA  1 
ATOM   7418 C C   . THR H 2 162 ? -0.081  5.933   57.467  1.00 51.16  ? 252 THR H C   1 
ATOM   7419 O O   . THR H 2 162 ? -0.359  6.000   58.665  1.00 50.00  ? 252 THR H O   1 
ATOM   7420 C CB  . THR H 2 162 ? 0.531   3.490   57.267  1.00 56.07  ? 252 THR H CB  1 
ATOM   7421 O OG1 . THR H 2 162 ? 1.902   3.847   57.079  1.00 58.69  ? 252 THR H OG1 1 
ATOM   7422 C CG2 . THR H 2 162 ? 0.238   2.119   56.637  1.00 53.11  ? 252 THR H CG2 1 
ATOM   7423 N N   . SER H 2 163 ? 0.457   6.972   56.800  1.00 51.00  ? 253 SER H N   1 
ATOM   7424 C CA  . SER H 2 163 ? 0.736   8.237   57.493  1.00 52.02  ? 253 SER H CA  1 
ATOM   7425 C C   . SER H 2 163 ? -0.459  9.195   57.331  1.00 58.41  ? 253 SER H C   1 
ATOM   7426 O O   . SER H 2 163 ? -0.329  10.269  56.748  1.00 58.20  ? 253 SER H O   1 
ATOM   7427 C CB  . SER H 2 163 ? 2.032   8.856   56.982  1.00 55.58  ? 253 SER H CB  1 
ATOM   7428 N N   . SER H 2 164 ? -1.624  8.797   57.875  1.00 57.12  ? 254 SER H N   1 
ATOM   7429 C CA  . SER H 2 164 ? -2.890  9.528   57.751  1.00 57.88  ? 254 SER H CA  1 
ATOM   7430 C C   . SER H 2 164 ? -3.498  9.970   59.110  1.00 63.02  ? 254 SER H C   1 
ATOM   7431 O O   . SER H 2 164 ? -4.685  10.302  59.169  1.00 62.24  ? 254 SER H O   1 
ATOM   7432 C CB  . SER H 2 164 ? -3.895  8.660   56.996  1.00 62.02  ? 254 SER H CB  1 
ATOM   7433 N N   . ALA H 2 165 ? -2.675  10.037  60.169  1.00 60.87  ? 255 ALA H N   1 
ATOM   7434 C CA  . ALA H 2 165 ? -3.095  10.416  61.521  1.00 61.27  ? 255 ALA H CA  1 
ATOM   7435 C C   . ALA H 2 165 ? -3.592  11.878  61.664  1.00 66.53  ? 255 ALA H C   1 
ATOM   7436 O O   . ALA H 2 165 ? -4.268  12.180  62.657  1.00 65.76  ? 255 ALA H O   1 
ATOM   7437 C CB  . ALA H 2 165 ? -1.954  10.177  62.500  1.00 62.15  ? 255 ALA H CB  1 
ATOM   7438 N N   . LYS H 2 166 ? -3.269  12.776  60.704  1.00 64.32  ? 256 LYS H N   1 
ATOM   7439 C CA  . LYS H 2 166 ? -3.643  14.196  60.802  1.00 64.45  ? 256 LYS H CA  1 
ATOM   7440 C C   . LYS H 2 166 ? -4.624  14.675  59.695  1.00 68.29  ? 256 LYS H C   1 
ATOM   7441 O O   . LYS H 2 166 ? -4.957  15.866  59.656  1.00 68.13  ? 256 LYS H O   1 
ATOM   7442 C CB  . LYS H 2 166 ? -2.377  15.075  60.802  1.00 66.97  ? 256 LYS H CB  1 
ATOM   7443 N N   . VAL H 2 167 ? -5.108  13.765  58.832  1.00 64.18  ? 257 VAL H N   1 
ATOM   7444 C CA  . VAL H 2 167 ? -6.054  14.131  57.778  1.00 63.80  ? 257 VAL H CA  1 
ATOM   7445 C C   . VAL H 2 167 ? -7.338  13.307  57.909  1.00 67.41  ? 257 VAL H C   1 
ATOM   7446 O O   . VAL H 2 167 ? -7.277  12.119  58.230  1.00 66.60  ? 257 VAL H O   1 
ATOM   7447 C CB  . VAL H 2 167 ? -5.431  13.987  56.371  1.00 67.59  ? 257 VAL H CB  1 
ATOM   7448 N N   . ASP H 2 168 ? -8.498  13.954  57.686  1.00 64.08  ? 258 ASP H N   1 
ATOM   7449 C CA  . ASP H 2 168 ? -9.819  13.320  57.737  1.00 63.52  ? 258 ASP H CA  1 
ATOM   7450 C C   . ASP H 2 168 ? -10.265 12.934  56.321  1.00 65.22  ? 258 ASP H C   1 
ATOM   7451 O O   . ASP H 2 168 ? -10.621 13.801  55.511  1.00 64.94  ? 258 ASP H O   1 
ATOM   7452 C CB  . ASP H 2 168 ? -10.866 14.226  58.419  1.00 65.44  ? 258 ASP H CB  1 
ATOM   7453 C CG  . ASP H 2 168 ? -10.701 14.344  59.920  1.00 75.60  ? 258 ASP H CG  1 
ATOM   7454 N N   . MET H 2 169 ? -10.202 11.627  56.023  1.00 59.39  ? 259 MET H N   1 
ATOM   7455 C CA  . MET H 2 169 ? -10.606 11.043  54.743  1.00 57.91  ? 259 MET H CA  1 
ATOM   7456 C C   . MET H 2 169 ? -11.987 10.436  54.879  1.00 58.20  ? 259 MET H C   1 
ATOM   7457 O O   . MET H 2 169 ? -12.412 10.142  56.001  1.00 57.94  ? 259 MET H O   1 
ATOM   7458 C CB  . MET H 2 169 ? -9.596  9.969   54.302  1.00 60.33  ? 259 MET H CB  1 
ATOM   7459 N N   . THR H 2 170 ? -12.683 10.222  53.752  1.00 51.88  ? 260 THR H N   1 
ATOM   7460 C CA  . THR H 2 170 ? -14.004 9.590   53.775  1.00 50.64  ? 260 THR H CA  1 
ATOM   7461 C C   . THR H 2 170 ? -13.852 8.076   53.984  1.00 52.25  ? 260 THR H C   1 
ATOM   7462 O O   . THR H 2 170 ? -12.742 7.559   53.852  1.00 52.10  ? 260 THR H O   1 
ATOM   7463 C CB  . THR H 2 170 ? -14.805 9.917   52.517  1.00 58.32  ? 260 THR H CB  1 
ATOM   7464 O OG1 . THR H 2 170 ? -16.099 9.355   52.690  1.00 59.90  ? 260 THR H OG1 1 
ATOM   7465 C CG2 . THR H 2 170 ? -14.198 9.385   51.275  1.00 56.21  ? 260 THR H CG2 1 
ATOM   7466 N N   . PHE H 2 171 ? -14.955 7.364   54.288  1.00 47.23  ? 261 PHE H N   1 
ATOM   7467 C CA  . PHE H 2 171 ? -14.921 5.907   54.484  1.00 46.03  ? 261 PHE H CA  1 
ATOM   7468 C C   . PHE H 2 171 ? -14.486 5.201   53.181  1.00 49.27  ? 261 PHE H C   1 
ATOM   7469 O O   . PHE H 2 171 ? -13.669 4.277   53.211  1.00 47.78  ? 261 PHE H O   1 
ATOM   7470 C CB  . PHE H 2 171 ? -16.290 5.397   54.968  1.00 47.01  ? 261 PHE H CB  1 
ATOM   7471 C CG  . PHE H 2 171 ? -16.460 3.899   54.944  1.00 47.60  ? 261 PHE H CG  1 
ATOM   7472 C CD1 . PHE H 2 171 ? -15.897 3.103   55.933  1.00 49.78  ? 261 PHE H CD1 1 
ATOM   7473 C CD2 . PHE H 2 171 ? -17.207 3.285   53.944  1.00 48.86  ? 261 PHE H CD2 1 
ATOM   7474 C CE1 . PHE H 2 171 ? -16.051 1.718   55.902  1.00 50.66  ? 261 PHE H CE1 1 
ATOM   7475 C CE2 . PHE H 2 171 ? -17.379 1.902   53.928  1.00 51.34  ? 261 PHE H CE2 1 
ATOM   7476 C CZ  . PHE H 2 171 ? -16.796 1.127   54.905  1.00 49.42  ? 261 PHE H CZ  1 
ATOM   7477 N N   . GLU H 2 172 ? -15.017 5.687   52.046  1.00 46.19  ? 262 GLU H N   1 
ATOM   7478 C CA  . GLU H 2 172 ? -14.748 5.202   50.692  1.00 46.33  ? 262 GLU H CA  1 
ATOM   7479 C C   . GLU H 2 172 ? -13.248 5.287   50.365  1.00 47.84  ? 262 GLU H C   1 
ATOM   7480 O O   . GLU H 2 172 ? -12.709 4.376   49.738  1.00 46.69  ? 262 GLU H O   1 
ATOM   7481 C CB  . GLU H 2 172 ? -15.580 6.002   49.668  1.00 48.20  ? 262 GLU H CB  1 
ATOM   7482 C CG  . GLU H 2 172 ? -17.088 5.746   49.721  1.00 60.61  ? 262 GLU H CG  1 
ATOM   7483 C CD  . GLU H 2 172 ? -17.906 6.349   50.854  1.00 81.07  ? 262 GLU H CD  1 
ATOM   7484 O OE1 . GLU H 2 172 ? -19.039 5.864   51.080  1.00 75.03  ? 262 GLU H OE1 1 
ATOM   7485 O OE2 . GLU H 2 172 ? -17.427 7.304   51.509  1.00 75.05  ? 262 GLU H OE2 1 
ATOM   7486 N N   . GLU H 2 173 ? -12.581 6.353   50.841  1.00 43.70  ? 263 GLU H N   1 
ATOM   7487 C CA  . GLU H 2 173 ? -11.148 6.596   50.672  1.00 43.35  ? 263 GLU H CA  1 
ATOM   7488 C C   . GLU H 2 173 ? -10.325 5.637   51.531  1.00 46.42  ? 263 GLU H C   1 
ATOM   7489 O O   . GLU H 2 173 ? -9.335  5.094   51.043  1.00 45.36  ? 263 GLU H O   1 
ATOM   7490 C CB  . GLU H 2 173 ? -10.792 8.053   51.012  1.00 44.84  ? 263 GLU H CB  1 
ATOM   7491 C CG  . GLU H 2 173 ? -11.159 9.046   49.916  1.00 57.24  ? 263 GLU H CG  1 
ATOM   7492 C CD  . GLU H 2 173 ? -11.031 10.520  50.256  1.00 76.42  ? 263 GLU H CD  1 
ATOM   7493 O OE1 . GLU H 2 173 ? -10.811 11.319  49.318  1.00 71.20  ? 263 GLU H OE1 1 
ATOM   7494 O OE2 . GLU H 2 173 ? -11.162 10.883  51.447  1.00 70.98  ? 263 GLU H OE2 1 
ATOM   7495 N N   . GLU H 2 174 ? -10.733 5.438   52.805  1.00 43.98  ? 264 GLU H N   1 
ATOM   7496 C CA  . GLU H 2 174 ? -10.089 4.532   53.769  1.00 44.09  ? 264 GLU H CA  1 
ATOM   7497 C C   . GLU H 2 174 ? -10.070 3.101   53.230  1.00 47.55  ? 264 GLU H C   1 
ATOM   7498 O O   . GLU H 2 174 ? -9.009  2.469   53.223  1.00 46.75  ? 264 GLU H O   1 
ATOM   7499 C CB  . GLU H 2 174 ? -10.797 4.577   55.143  1.00 45.74  ? 264 GLU H CB  1 
ATOM   7500 C CG  . GLU H 2 174 ? -10.645 5.894   55.903  1.00 60.18  ? 264 GLU H CG  1 
ATOM   7501 C CD  . GLU H 2 174 ? -9.368  6.126   56.700  1.00 81.90  ? 264 GLU H CD  1 
ATOM   7502 O OE1 . GLU H 2 174 ? -8.470  5.252   56.687  1.00 82.94  ? 264 GLU H OE1 1 
ATOM   7503 O OE2 . GLU H 2 174 ? -9.270  7.195   57.342  1.00 70.55  ? 264 GLU H OE2 1 
ATOM   7504 N N   . ALA H 2 175 ? -11.231 2.609   52.753  1.00 44.76  ? 265 ALA H N   1 
ATOM   7505 C CA  . ALA H 2 175 ? -11.386 1.270   52.177  1.00 44.87  ? 265 ALA H CA  1 
ATOM   7506 C C   . ALA H 2 175 ? -10.530 1.112   50.896  1.00 50.24  ? 265 ALA H C   1 
ATOM   7507 O O   . ALA H 2 175 ? -9.820  0.105   50.775  1.00 50.82  ? 265 ALA H O   1 
ATOM   7508 C CB  . ALA H 2 175 ? -12.854 0.989   51.885  1.00 45.47  ? 265 ALA H CB  1 
ATOM   7509 N N   . GLN H 2 176 ? -10.551 2.126   49.980  1.00 45.71  ? 266 GLN H N   1 
ATOM   7510 C CA  . GLN H 2 176 ? -9.757  2.145   48.740  1.00 45.11  ? 266 GLN H CA  1 
ATOM   7511 C C   . GLN H 2 176 ? -8.253  2.021   49.060  1.00 47.30  ? 266 GLN H C   1 
ATOM   7512 O O   . GLN H 2 176 ? -7.527  1.292   48.380  1.00 46.32  ? 266 GLN H O   1 
ATOM   7513 C CB  . GLN H 2 176 ? -10.027 3.440   47.953  1.00 46.44  ? 266 GLN H CB  1 
ATOM   7514 C CG  . GLN H 2 176 ? -9.885  3.303   46.437  1.00 60.86  ? 266 GLN H CG  1 
ATOM   7515 C CD  . GLN H 2 176 ? -9.819  4.627   45.702  1.00 75.15  ? 266 GLN H CD  1 
ATOM   7516 O OE1 . GLN H 2 176 ? -10.171 5.687   46.227  1.00 71.44  ? 266 GLN H OE1 1 
ATOM   7517 N NE2 . GLN H 2 176 ? -9.379  4.590   44.453  1.00 64.53  ? 266 GLN H NE2 1 
ATOM   7518 N N   . LEU H 2 177 ? -7.804  2.715   50.120  1.00 42.52  ? 267 LEU H N   1 
ATOM   7519 C CA  . LEU H 2 177 ? -6.416  2.711   50.549  1.00 41.86  ? 267 LEU H CA  1 
ATOM   7520 C C   . LEU H 2 177 ? -6.050  1.395   51.256  1.00 46.75  ? 267 LEU H C   1 
ATOM   7521 O O   . LEU H 2 177 ? -4.879  1.005   51.220  1.00 46.61  ? 267 LEU H O   1 
ATOM   7522 C CB  . LEU H 2 177 ? -6.130  3.923   51.440  1.00 41.32  ? 267 LEU H CB  1 
ATOM   7523 C CG  . LEU H 2 177 ? -5.741  5.189   50.680  1.00 44.57  ? 267 LEU H CG  1 
ATOM   7524 C CD1 . LEU H 2 177 ? -6.318  6.409   51.332  1.00 46.34  ? 267 LEU H CD1 1 
ATOM   7525 C CD2 . LEU H 2 177 ? -4.252  5.350   50.658  1.00 43.80  ? 267 LEU H CD2 1 
ATOM   7526 N N   . LEU H 2 178 ? -7.044  0.714   51.882  1.00 42.30  ? 268 LEU H N   1 
ATOM   7527 C CA  . LEU H 2 178 ? -6.850  -0.585  52.525  1.00 41.59  ? 268 LEU H CA  1 
ATOM   7528 C C   . LEU H 2 178 ? -6.630  -1.626  51.454  1.00 45.17  ? 268 LEU H C   1 
ATOM   7529 O O   . LEU H 2 178 ? -5.737  -2.460  51.601  1.00 44.89  ? 268 LEU H O   1 
ATOM   7530 C CB  . LEU H 2 178 ? -8.037  -0.973  53.418  1.00 41.54  ? 268 LEU H CB  1 
ATOM   7531 C CG  . LEU H 2 178 ? -7.959  -0.553  54.885  1.00 46.29  ? 268 LEU H CG  1 
ATOM   7532 C CD1 . LEU H 2 178 ? -9.292  -0.755  55.573  1.00 46.86  ? 268 LEU H CD1 1 
ATOM   7533 C CD2 . LEU H 2 178 ? -6.912  -1.352  55.633  1.00 48.40  ? 268 LEU H CD2 1 
ATOM   7534 N N   . GLN H 2 179 ? -7.395  -1.539  50.339  1.00 40.85  ? 269 GLN H N   1 
ATOM   7535 C CA  . GLN H 2 179 ? -7.264  -2.428  49.177  1.00 40.20  ? 269 GLN H CA  1 
ATOM   7536 C C   . GLN H 2 179 ? -5.882  -2.307  48.540  1.00 43.57  ? 269 GLN H C   1 
ATOM   7537 O O   . GLN H 2 179 ? -5.317  -3.304  48.081  1.00 42.75  ? 269 GLN H O   1 
ATOM   7538 C CB  . GLN H 2 179 ? -8.347  -2.141  48.125  1.00 41.84  ? 269 GLN H CB  1 
ATOM   7539 C CG  . GLN H 2 179 ? -9.773  -2.517  48.531  1.00 62.30  ? 269 GLN H CG  1 
ATOM   7540 C CD  . GLN H 2 179 ? -9.930  -3.971  48.865  1.00 90.97  ? 269 GLN H CD  1 
ATOM   7541 O OE1 . GLN H 2 179 ? -10.142 -4.814  47.989  1.00 88.63  ? 269 GLN H OE1 1 
ATOM   7542 N NE2 . GLN H 2 179 ? -9.870  -4.295  50.149  1.00 86.23  ? 269 GLN H NE2 1 
ATOM   7543 N N   . LEU H 2 180 ? -5.331  -1.084  48.546  1.00 39.62  ? 270 LEU H N   1 
ATOM   7544 C CA  . LEU H 2 180 ? -4.025  -0.753  47.990  1.00 38.92  ? 270 LEU H CA  1 
ATOM   7545 C C   . LEU H 2 180 ? -2.910  -1.256  48.892  1.00 39.77  ? 270 LEU H C   1 
ATOM   7546 O O   . LEU H 2 180 ? -1.920  -1.774  48.394  1.00 38.31  ? 270 LEU H O   1 
ATOM   7547 C CB  . LEU H 2 180 ? -3.945  0.768   47.824  1.00 39.13  ? 270 LEU H CB  1 
ATOM   7548 C CG  . LEU H 2 180 ? -3.100  1.345   46.680  1.00 44.03  ? 270 LEU H CG  1 
ATOM   7549 C CD1 . LEU H 2 180 ? -3.413  0.714   45.309  1.00 43.71  ? 270 LEU H CD1 1 
ATOM   7550 C CD2 . LEU H 2 180 ? -3.295  2.836   46.599  1.00 46.82  ? 270 LEU H CD2 1 
ATOM   7551 N N   . LYS H 2 181 ? -3.079  -1.116  50.214  1.00 35.07  ? 271 LYS H N   1 
ATOM   7552 C CA  . LYS H 2 181 ? -2.117  -1.550  51.218  1.00 34.48  ? 271 LYS H CA  1 
ATOM   7553 C C   . LYS H 2 181 ? -1.893  -3.066  51.146  1.00 41.12  ? 271 LYS H C   1 
ATOM   7554 O O   . LYS H 2 181 ? -0.741  -3.501  51.193  1.00 42.32  ? 271 LYS H O   1 
ATOM   7555 C CB  . LYS H 2 181 ? -2.604  -1.126  52.597  1.00 35.71  ? 271 LYS H CB  1 
ATOM   7556 C CG  . LYS H 2 181 ? -1.628  -1.402  53.720  1.00 39.46  ? 271 LYS H CG  1 
ATOM   7557 C CD  . LYS H 2 181 ? -1.978  -0.616  54.960  1.00 43.76  ? 271 LYS H CD  1 
ATOM   7558 C CE  . LYS H 2 181 ? -2.815  -1.388  55.952  1.00 54.11  ? 271 LYS H CE  1 
ATOM   7559 N NZ  . LYS H 2 181 ? -2.358  -1.111  57.335  1.00 62.19  ? 271 LYS H NZ  1 
ATOM   7560 N N   . VAL H 2 182 ? -2.986  -3.855  51.009  1.00 38.27  ? 272 VAL H N   1 
ATOM   7561 C CA  . VAL H 2 182 ? -2.964  -5.317  50.886  1.00 38.38  ? 272 VAL H CA  1 
ATOM   7562 C C   . VAL H 2 182 ? -2.206  -5.706  49.603  1.00 41.62  ? 272 VAL H C   1 
ATOM   7563 O O   . VAL H 2 182 ? -1.366  -6.603  49.666  1.00 42.51  ? 272 VAL H O   1 
ATOM   7564 C CB  . VAL H 2 182 ? -4.362  -6.013  50.972  1.00 42.60  ? 272 VAL H CB  1 
ATOM   7565 C CG1 . VAL H 2 182 ? -4.837  -6.179  52.407  1.00 42.42  ? 272 VAL H CG1 1 
ATOM   7566 C CG2 . VAL H 2 182 ? -5.416  -5.371  50.113  1.00 42.49  ? 272 VAL H CG2 1 
ATOM   7567 N N   . LYS H 2 183 ? -2.458  -5.005  48.470  1.00 35.96  ? 273 LYS H N   1 
ATOM   7568 C CA  . LYS H 2 183 ? -1.750  -5.257  47.214  1.00 35.50  ? 273 LYS H CA  1 
ATOM   7569 C C   . LYS H 2 183 ? -0.244  -4.981  47.369  1.00 39.01  ? 273 LYS H C   1 
ATOM   7570 O O   . LYS H 2 183 ? 0.562   -5.779  46.894  1.00 40.32  ? 273 LYS H O   1 
ATOM   7571 C CB  . LYS H 2 183 ? -2.316  -4.415  46.066  1.00 37.59  ? 273 LYS H CB  1 
ATOM   7572 C CG  . LYS H 2 183 ? -3.646  -4.905  45.540  1.00 49.75  ? 273 LYS H CG  1 
ATOM   7573 C CD  . LYS H 2 183 ? -4.171  -3.987  44.449  1.00 54.43  ? 273 LYS H CD  1 
ATOM   7574 C CE  . LYS H 2 183 ? -5.383  -4.566  43.759  1.00 58.71  ? 273 LYS H CE  1 
ATOM   7575 N NZ  . LYS H 2 183 ? -5.476  -4.109  42.349  1.00 66.91  ? 273 LYS H NZ  1 
ATOM   7576 N N   . CYS H 2 184 ? 0.125   -3.889  48.064  1.00 33.49  ? 274 CYS H N   1 
ATOM   7577 C CA  . CYS H 2 184 ? 1.524   -3.496  48.297  1.00 32.81  ? 274 CYS H CA  1 
ATOM   7578 C C   . CYS H 2 184 ? 2.231   -4.468  49.234  1.00 39.51  ? 274 CYS H C   1 
ATOM   7579 O O   . CYS H 2 184 ? 3.396   -4.785  48.983  1.00 39.37  ? 274 CYS H O   1 
ATOM   7580 C CB  . CYS H 2 184 ? 1.620   -2.065  48.816  1.00 32.06  ? 274 CYS H CB  1 
ATOM   7581 S SG  . CYS H 2 184 ? 1.058   -0.822  47.629  1.00 35.43  ? 274 CYS H SG  1 
ATOM   7582 N N   . LEU H 2 185 ? 1.538   -4.938  50.307  1.00 37.09  ? 275 LEU H N   1 
ATOM   7583 C CA  . LEU H 2 185 ? 2.078   -5.898  51.279  1.00 36.89  ? 275 LEU H CA  1 
ATOM   7584 C C   . LEU H 2 185 ? 2.320   -7.270  50.630  1.00 41.17  ? 275 LEU H C   1 
ATOM   7585 O O   . LEU H 2 185 ? 3.289   -7.945  50.968  1.00 41.31  ? 275 LEU H O   1 
ATOM   7586 C CB  . LEU H 2 185 ? 1.137   -6.042  52.483  1.00 36.83  ? 275 LEU H CB  1 
ATOM   7587 C CG  . LEU H 2 185 ? 1.248   -5.000  53.583  1.00 41.24  ? 275 LEU H CG  1 
ATOM   7588 C CD1 . LEU H 2 185 ? 0.039   -5.070  54.506  1.00 40.69  ? 275 LEU H CD1 1 
ATOM   7589 C CD2 . LEU H 2 185 ? 2.530   -5.186  54.400  1.00 43.92  ? 275 LEU H CD2 1 
ATOM   7590 N N   . ASN H 2 186 ? 1.442   -7.658  49.688  1.00 37.97  ? 276 ASN H N   1 
ATOM   7591 C CA  . ASN H 2 186 ? 1.489   -8.897  48.896  1.00 37.81  ? 276 ASN H CA  1 
ATOM   7592 C C   . ASN H 2 186 ? 2.674   -8.841  47.948  1.00 40.60  ? 276 ASN H C   1 
ATOM   7593 O O   . ASN H 2 186 ? 3.398   -9.821  47.782  1.00 38.82  ? 276 ASN H O   1 
ATOM   7594 C CB  . ASN H 2 186 ? 0.176   -9.044  48.101  1.00 40.49  ? 276 ASN H CB  1 
ATOM   7595 C CG  . ASN H 2 186 ? -0.184  -10.433 47.613  1.00 65.43  ? 276 ASN H CG  1 
ATOM   7596 O OD1 . ASN H 2 186 ? -0.745  -10.592 46.522  1.00 58.63  ? 276 ASN H OD1 1 
ATOM   7597 N ND2 . ASN H 2 186 ? 0.071   -11.465 48.419  1.00 56.75  ? 276 ASN H ND2 1 
ATOM   7598 N N   . ASN H 2 187 ? 2.883   -7.658  47.355  1.00 37.73  ? 277 ASN H N   1 
ATOM   7599 C CA  . ASN H 2 187 ? 3.979   -7.350  46.443  1.00 37.00  ? 277 ASN H CA  1 
ATOM   7600 C C   . ASN H 2 187 ? 5.299   -7.330  47.194  1.00 38.62  ? 277 ASN H C   1 
ATOM   7601 O O   . ASN H 2 187 ? 6.311   -7.783  46.657  1.00 38.64  ? 277 ASN H O   1 
ATOM   7602 C CB  . ASN H 2 187 ? 3.715   -6.011  45.769  1.00 36.65  ? 277 ASN H CB  1 
ATOM   7603 C CG  . ASN H 2 187 ? 2.716   -6.085  44.644  1.00 59.90  ? 277 ASN H CG  1 
ATOM   7604 O OD1 . ASN H 2 187 ? 2.057   -7.104  44.417  1.00 54.53  ? 277 ASN H OD1 1 
ATOM   7605 N ND2 . ASN H 2 187 ? 2.580   -5.000  43.908  1.00 50.58  ? 277 ASN H ND2 1 
ATOM   7606 N N   . LEU H 2 188 ? 5.278   -6.823  48.437  1.00 34.21  ? 278 LEU H N   1 
ATOM   7607 C CA  . LEU H 2 188 ? 6.430   -6.765  49.334  1.00 34.01  ? 278 LEU H CA  1 
ATOM   7608 C C   . LEU H 2 188 ? 6.858   -8.187  49.718  1.00 39.00  ? 278 LEU H C   1 
ATOM   7609 O O   . LEU H 2 188 ? 8.042   -8.492  49.631  1.00 38.58  ? 278 LEU H O   1 
ATOM   7610 C CB  . LEU H 2 188 ? 6.095   -5.928  50.580  1.00 33.96  ? 278 LEU H CB  1 
ATOM   7611 C CG  . LEU H 2 188 ? 7.223   -5.632  51.571  1.00 39.17  ? 278 LEU H CG  1 
ATOM   7612 C CD1 . LEU H 2 188 ? 8.387   -4.904  50.909  1.00 39.72  ? 278 LEU H CD1 1 
ATOM   7613 C CD2 . LEU H 2 188 ? 6.711   -4.825  52.733  1.00 42.03  ? 278 LEU H CD2 1 
ATOM   7614 N N   . ALA H 2 189 ? 5.906   -9.047  50.158  1.00 35.85  ? 279 ALA H N   1 
ATOM   7615 C CA  . ALA H 2 189 ? 6.165   -10.445 50.522  1.00 35.77  ? 279 ALA H CA  1 
ATOM   7616 C C   . ALA H 2 189 ? 6.802   -11.199 49.345  1.00 37.42  ? 279 ALA H C   1 
ATOM   7617 O O   . ALA H 2 189 ? 7.802   -11.895 49.537  1.00 35.05  ? 279 ALA H O   1 
ATOM   7618 C CB  . ALA H 2 189 ? 4.871   -11.128 50.939  1.00 36.85  ? 279 ALA H CB  1 
ATOM   7619 N N   . ALA H 2 190 ? 6.249   -11.007 48.121  1.00 33.58  ? 280 ALA H N   1 
ATOM   7620 C CA  . ALA H 2 190 ? 6.757   -11.598 46.880  1.00 33.15  ? 280 ALA H CA  1 
ATOM   7621 C C   . ALA H 2 190 ? 8.232   -11.225 46.653  1.00 38.18  ? 280 ALA H C   1 
ATOM   7622 O O   . ALA H 2 190 ? 9.031   -12.089 46.296  1.00 38.21  ? 280 ALA H O   1 
ATOM   7623 C CB  . ALA H 2 190 ? 5.916   -11.145 45.701  1.00 33.58  ? 280 ALA H CB  1 
ATOM   7624 N N   . SER H 2 191 ? 8.585   -9.942  46.898  1.00 35.15  ? 281 SER H N   1 
ATOM   7625 C CA  . SER H 2 191 ? 9.936   -9.390  46.775  1.00 34.30  ? 281 SER H CA  1 
ATOM   7626 C C   . SER H 2 191 ? 10.854  -9.945  47.856  1.00 38.56  ? 281 SER H C   1 
ATOM   7627 O O   . SER H 2 191 ? 11.962  -10.368 47.535  1.00 38.85  ? 281 SER H O   1 
ATOM   7628 C CB  . SER H 2 191 ? 9.898   -7.870  46.858  1.00 35.81  ? 281 SER H CB  1 
ATOM   7629 O OG  . SER H 2 191 ? 9.178   -7.353  45.754  1.00 39.79  ? 281 SER H OG  1 
ATOM   7630 N N   . GLN H 2 192 ? 10.394  -9.935  49.132  1.00 34.25  ? 282 GLN H N   1 
ATOM   7631 C CA  . GLN H 2 192 ? 11.098  -10.429 50.329  1.00 32.84  ? 282 GLN H CA  1 
ATOM   7632 C C   . GLN H 2 192 ? 11.426  -11.926 50.211  1.00 36.22  ? 282 GLN H C   1 
ATOM   7633 O O   . GLN H 2 192 ? 12.523  -12.341 50.597  1.00 36.27  ? 282 GLN H O   1 
ATOM   7634 C CB  . GLN H 2 192 ? 10.255  -10.169 51.591  1.00 33.60  ? 282 GLN H CB  1 
ATOM   7635 C CG  . GLN H 2 192 ? 10.240  -8.711  52.048  1.00 41.04  ? 282 GLN H CG  1 
ATOM   7636 C CD  . GLN H 2 192 ? 9.144   -8.388  53.041  1.00 61.08  ? 282 GLN H CD  1 
ATOM   7637 O OE1 . GLN H 2 192 ? 8.019   -8.913  52.994  1.00 54.25  ? 282 GLN H OE1 1 
ATOM   7638 N NE2 . GLN H 2 192 ? 9.426   -7.440  53.918  1.00 54.63  ? 282 GLN H NE2 1 
ATOM   7639 N N   . LEU H 2 193 ? 10.478  -12.721 49.673  1.00 32.40  ? 283 LEU H N   1 
ATOM   7640 C CA  . LEU H 2 193 ? 10.615  -14.160 49.426  1.00 33.01  ? 283 LEU H CA  1 
ATOM   7641 C C   . LEU H 2 193 ? 11.781  -14.398 48.433  1.00 38.58  ? 283 LEU H C   1 
ATOM   7642 O O   . LEU H 2 193 ? 12.647  -15.218 48.730  1.00 40.23  ? 283 LEU H O   1 
ATOM   7643 C CB  . LEU H 2 193 ? 9.267   -14.746 48.913  1.00 33.01  ? 283 LEU H CB  1 
ATOM   7644 C CG  . LEU H 2 193 ? 9.219   -16.024 48.058  1.00 37.93  ? 283 LEU H CG  1 
ATOM   7645 C CD1 . LEU H 2 193 ? 9.721   -17.251 48.822  1.00 38.14  ? 283 LEU H CD1 1 
ATOM   7646 C CD2 . LEU H 2 193 ? 7.797   -16.298 47.590  1.00 40.34  ? 283 LEU H CD2 1 
ATOM   7647 N N   . LYS H 2 194 ? 11.843  -13.632 47.314  1.00 34.52  ? 284 LYS H N   1 
ATOM   7648 C CA  . LYS H 2 194 ? 12.909  -13.711 46.301  1.00 34.18  ? 284 LYS H CA  1 
ATOM   7649 C C   . LYS H 2 194 ? 14.303  -13.379 46.871  1.00 39.61  ? 284 LYS H C   1 
ATOM   7650 O O   . LYS H 2 194 ? 15.314  -13.812 46.310  1.00 40.01  ? 284 LYS H O   1 
ATOM   7651 C CB  . LYS H 2 194 ? 12.607  -12.782 45.120  1.00 35.70  ? 284 LYS H CB  1 
ATOM   7652 C CG  . LYS H 2 194 ? 11.516  -13.304 44.197  1.00 43.13  ? 284 LYS H CG  1 
ATOM   7653 C CD  . LYS H 2 194 ? 12.017  -14.391 43.252  1.00 48.12  ? 284 LYS H CD  1 
ATOM   7654 C CE  . LYS H 2 194 ? 10.902  -15.052 42.484  1.00 56.44  ? 284 LYS H CE  1 
ATOM   7655 N NZ  . LYS H 2 194 ? 10.270  -14.133 41.502  1.00 67.14  ? 284 LYS H NZ  1 
ATOM   7656 N N   . LEU H 2 195 ? 14.349  -12.640 47.991  1.00 36.25  ? 285 LEU H N   1 
ATOM   7657 C CA  . LEU H 2 195 ? 15.576  -12.252 48.687  1.00 36.34  ? 285 LEU H CA  1 
ATOM   7658 C C   . LEU H 2 195 ? 15.858  -13.164 49.869  1.00 41.16  ? 285 LEU H C   1 
ATOM   7659 O O   . LEU H 2 195 ? 16.737  -12.874 50.680  1.00 39.76  ? 285 LEU H O   1 
ATOM   7660 C CB  . LEU H 2 195 ? 15.467  -10.791 49.166  1.00 36.11  ? 285 LEU H CB  1 
ATOM   7661 C CG  . LEU H 2 195 ? 15.566  -9.723  48.084  1.00 40.91  ? 285 LEU H CG  1 
ATOM   7662 C CD1 . LEU H 2 195 ? 15.071  -8.384  48.601  1.00 41.29  ? 285 LEU H CD1 1 
ATOM   7663 C CD2 . LEU H 2 195 ? 16.988  -9.586  47.568  1.00 42.60  ? 285 LEU H CD2 1 
ATOM   7664 N N   . ASP H 2 196 ? 15.102  -14.267 49.966  1.00 41.08  ? 286 ASP H N   1 
ATOM   7665 C CA  . ASP H 2 196 ? 15.156  -15.261 51.042  1.00 41.89  ? 286 ASP H CA  1 
ATOM   7666 C C   . ASP H 2 196 ? 14.977  -14.596 52.422  1.00 48.85  ? 286 ASP H C   1 
ATOM   7667 O O   . ASP H 2 196 ? 15.436  -15.150 53.425  1.00 49.78  ? 286 ASP H O   1 
ATOM   7668 C CB  . ASP H 2 196 ? 16.448  -16.114 50.996  1.00 43.46  ? 286 ASP H CB  1 
ATOM   7669 C CG  . ASP H 2 196 ? 16.712  -16.882 49.708  1.00 50.88  ? 286 ASP H CG  1 
ATOM   7670 O OD1 . ASP H 2 196 ? 15.811  -16.930 48.839  1.00 50.28  ? 286 ASP H OD1 1 
ATOM   7671 O OD2 . ASP H 2 196 ? 17.805  -17.450 49.578  1.00 59.01  ? 286 ASP H OD2 1 
ATOM   7672 N N   . HIS H 2 197 ? 14.301  -13.418 52.474  1.00 45.99  ? 287 HIS H N   1 
ATOM   7673 C CA  . HIS H 2 197 ? 13.973  -12.705 53.716  1.00 46.04  ? 287 HIS H CA  1 
ATOM   7674 C C   . HIS H 2 197 ? 12.635  -13.289 54.207  1.00 50.26  ? 287 HIS H C   1 
ATOM   7675 O O   . HIS H 2 197 ? 11.599  -12.616 54.194  1.00 50.64  ? 287 HIS H O   1 
ATOM   7676 C CB  . HIS H 2 197 ? 13.922  -11.177 53.490  1.00 46.66  ? 287 HIS H CB  1 
ATOM   7677 N N   . TYR H 2 198 ? 12.679  -14.592 54.580  1.00 45.90  ? 288 TYR H N   1 
ATOM   7678 C CA  . TYR H 2 198 ? 11.579  -15.463 54.985  1.00 44.71  ? 288 TYR H CA  1 
ATOM   7679 C C   . TYR H 2 198 ? 10.794  -14.936 56.173  1.00 49.15  ? 288 TYR H C   1 
ATOM   7680 O O   . TYR H 2 198 ? 9.569   -14.930 56.095  1.00 48.64  ? 288 TYR H O   1 
ATOM   7681 C CB  . TYR H 2 198 ? 12.096  -16.890 55.274  1.00 44.68  ? 288 TYR H CB  1 
ATOM   7682 C CG  . TYR H 2 198 ? 12.733  -17.555 54.067  1.00 44.58  ? 288 TYR H CG  1 
ATOM   7683 C CD1 . TYR H 2 198 ? 12.175  -17.423 52.798  1.00 45.70  ? 288 TYR H CD1 1 
ATOM   7684 C CD2 . TYR H 2 198 ? 13.881  -18.333 54.199  1.00 44.74  ? 288 TYR H CD2 1 
ATOM   7685 C CE1 . TYR H 2 198 ? 12.762  -18.017 51.684  1.00 45.16  ? 288 TYR H CE1 1 
ATOM   7686 C CE2 . TYR H 2 198 ? 14.465  -18.952 53.092  1.00 44.74  ? 288 TYR H CE2 1 
ATOM   7687 C CZ  . TYR H 2 198 ? 13.902  -18.786 51.836  1.00 48.07  ? 288 TYR H CZ  1 
ATOM   7688 O OH  . TYR H 2 198 ? 14.457  -19.381 50.732  1.00 45.24  ? 288 TYR H OH  1 
ATOM   7689 N N   . ARG H 2 199 ? 11.472  -14.493 57.254  1.00 46.19  ? 289 ARG H N   1 
ATOM   7690 C CA  . ARG H 2 199 ? 10.810  -13.970 58.458  1.00 46.81  ? 289 ARG H CA  1 
ATOM   7691 C C   . ARG H 2 199 ? 9.970   -12.728 58.146  1.00 52.09  ? 289 ARG H C   1 
ATOM   7692 O O   . ARG H 2 199 ? 8.848   -12.606 58.642  1.00 51.79  ? 289 ARG H O   1 
ATOM   7693 C CB  . ARG H 2 199 ? 11.841  -13.648 59.550  1.00 46.90  ? 289 ARG H CB  1 
ATOM   7694 N N   . ALA H 2 200 ? 10.504  -11.836 57.291  1.00 49.20  ? 290 ALA H N   1 
ATOM   7695 C CA  . ALA H 2 200 ? 9.873   -10.595 56.850  1.00 48.61  ? 290 ALA H CA  1 
ATOM   7696 C C   . ALA H 2 200 ? 8.704   -10.867 55.914  1.00 51.89  ? 290 ALA H C   1 
ATOM   7697 O O   . ALA H 2 200 ? 7.651   -10.255 56.076  1.00 51.08  ? 290 ALA H O   1 
ATOM   7698 C CB  . ALA H 2 200 ? 10.903  -9.712  56.157  1.00 49.24  ? 290 ALA H CB  1 
ATOM   7699 N N   . ALA H 2 201 ? 8.900   -11.763 54.918  1.00 49.03  ? 291 ALA H N   1 
ATOM   7700 C CA  . ALA H 2 201 ? 7.888   -12.152 53.932  1.00 48.73  ? 291 ALA H CA  1 
ATOM   7701 C C   . ALA H 2 201 ? 6.686   -12.777 54.628  1.00 52.89  ? 291 ALA H C   1 
ATOM   7702 O O   . ALA H 2 201 ? 5.545   -12.500 54.249  1.00 52.29  ? 291 ALA H O   1 
ATOM   7703 C CB  . ALA H 2 201 ? 8.481   -13.123 52.925  1.00 49.52  ? 291 ALA H CB  1 
ATOM   7704 N N   . LEU H 2 202 ? 6.953   -13.590 55.676  1.00 50.02  ? 292 LEU H N   1 
ATOM   7705 C CA  . LEU H 2 202 ? 5.938   -14.237 56.502  1.00 49.58  ? 292 LEU H CA  1 
ATOM   7706 C C   . LEU H 2 202 ? 5.056   -13.208 57.182  1.00 51.58  ? 292 LEU H C   1 
ATOM   7707 O O   . LEU H 2 202 ? 3.844   -13.401 57.206  1.00 50.22  ? 292 LEU H O   1 
ATOM   7708 C CB  . LEU H 2 202 ? 6.578   -15.146 57.551  1.00 49.67  ? 292 LEU H CB  1 
ATOM   7709 C CG  . LEU H 2 202 ? 6.585   -16.628 57.217  1.00 54.63  ? 292 LEU H CG  1 
ATOM   7710 C CD1 . LEU H 2 202 ? 7.652   -17.351 58.015  1.00 54.94  ? 292 LEU H CD1 1 
ATOM   7711 C CD2 . LEU H 2 202 ? 5.215   -17.261 57.442  1.00 57.05  ? 292 LEU H CD2 1 
ATOM   7712 N N   . ARG H 2 203 ? 5.661   -12.120 57.725  1.00 47.73  ? 293 ARG H N   1 
ATOM   7713 C CA  . ARG H 2 203 ? 4.952   -11.009 58.376  1.00 47.48  ? 293 ARG H CA  1 
ATOM   7714 C C   . ARG H 2 203 ? 4.010   -10.325 57.388  1.00 51.24  ? 293 ARG H C   1 
ATOM   7715 O O   . ARG H 2 203 ? 2.840   -10.124 57.712  1.00 51.36  ? 293 ARG H O   1 
ATOM   7716 C CB  . ARG H 2 203 ? 5.934   -9.980  58.965  1.00 47.87  ? 293 ARG H CB  1 
ATOM   7717 C CG  . ARG H 2 203 ? 6.293   -10.220 60.426  1.00 56.02  ? 293 ARG H CG  1 
ATOM   7718 N N   . SER H 2 204 ? 4.505   -10.003 56.172  1.00 46.95  ? 294 SER H N   1 
ATOM   7719 C CA  . SER H 2 204 ? 3.715   -9.360  55.119  1.00 45.97  ? 294 SER H CA  1 
ATOM   7720 C C   . SER H 2 204 ? 2.606   -10.290 54.627  1.00 49.34  ? 294 SER H C   1 
ATOM   7721 O O   . SER H 2 204 ? 1.503   -9.818  54.378  1.00 48.59  ? 294 SER H O   1 
ATOM   7722 C CB  . SER H 2 204 ? 4.607   -8.924  53.962  1.00 48.25  ? 294 SER H CB  1 
ATOM   7723 O OG  . SER H 2 204 ? 5.544   -7.947  54.384  1.00 53.85  ? 294 SER H OG  1 
ATOM   7724 N N   . CYS H 2 205 ? 2.887   -11.609 54.520  1.00 46.63  ? 295 CYS H N   1 
ATOM   7725 C CA  . CYS H 2 205 ? 1.913   -12.637 54.123  1.00 46.01  ? 295 CYS H CA  1 
ATOM   7726 C C   . CYS H 2 205 ? 0.790   -12.719 55.162  1.00 49.04  ? 295 CYS H C   1 
ATOM   7727 O O   . CYS H 2 205 ? -0.384  -12.684 54.793  1.00 48.71  ? 295 CYS H O   1 
ATOM   7728 C CB  . CYS H 2 205 ? 2.593   -13.993 53.942  1.00 46.10  ? 295 CYS H CB  1 
ATOM   7729 S SG  . CYS H 2 205 ? 3.318   -14.254 52.306  1.00 49.80  ? 295 CYS H SG  1 
ATOM   7730 N N   . SER H 2 206 ? 1.156   -12.802 56.455  1.00 44.68  ? 296 SER H N   1 
ATOM   7731 C CA  . SER H 2 206 ? 0.220   -12.895 57.572  1.00 43.87  ? 296 SER H CA  1 
ATOM   7732 C C   . SER H 2 206 ? -0.628  -11.627 57.732  1.00 46.43  ? 296 SER H C   1 
ATOM   7733 O O   . SER H 2 206 ? -1.784  -11.747 58.133  1.00 45.64  ? 296 SER H O   1 
ATOM   7734 C CB  . SER H 2 206 ? 0.959   -13.208 58.865  1.00 47.60  ? 296 SER H CB  1 
ATOM   7735 O OG  . SER H 2 206 ? 1.539   -14.501 58.783  1.00 57.06  ? 296 SER H OG  1 
ATOM   7736 N N   . LEU H 2 207 ? -0.077  -10.431 57.414  1.00 42.73  ? 297 LEU H N   1 
ATOM   7737 C CA  . LEU H 2 207 ? -0.819  -9.162  57.477  1.00 42.28  ? 297 LEU H CA  1 
ATOM   7738 C C   . LEU H 2 207 ? -1.863  -9.112  56.371  1.00 42.64  ? 297 LEU H C   1 
ATOM   7739 O O   . LEU H 2 207 ? -2.976  -8.669  56.622  1.00 42.12  ? 297 LEU H O   1 
ATOM   7740 C CB  . LEU H 2 207 ? 0.107   -7.927  57.400  1.00 42.83  ? 297 LEU H CB  1 
ATOM   7741 C CG  . LEU H 2 207 ? 0.779   -7.500  58.716  1.00 48.17  ? 297 LEU H CG  1 
ATOM   7742 C CD1 . LEU H 2 207 ? 2.007   -6.660  58.446  1.00 48.61  ? 297 LEU H CD1 1 
ATOM   7743 C CD2 . LEU H 2 207 ? -0.184  -6.720  59.622  1.00 50.87  ? 297 LEU H CD2 1 
ATOM   7744 N N   . VAL H 2 208 ? -1.518  -9.598  55.164  1.00 37.77  ? 298 VAL H N   1 
ATOM   7745 C CA  . VAL H 2 208 ? -2.447  -9.659  54.026  1.00 36.78  ? 298 VAL H CA  1 
ATOM   7746 C C   . VAL H 2 208 ? -3.605  -10.601 54.372  1.00 39.49  ? 298 VAL H C   1 
ATOM   7747 O O   . VAL H 2 208 ? -4.766  -10.255 54.151  1.00 38.78  ? 298 VAL H O   1 
ATOM   7748 C CB  . VAL H 2 208 ? -1.749  -10.096 52.703  1.00 40.15  ? 298 VAL H CB  1 
ATOM   7749 C CG1 . VAL H 2 208 ? -2.774  -10.341 51.587  1.00 39.80  ? 298 VAL H CG1 1 
ATOM   7750 C CG2 . VAL H 2 208 ? -0.713  -9.077  52.251  1.00 39.81  ? 298 VAL H CG2 1 
ATOM   7751 N N   . LEU H 2 209 ? -3.281  -11.778 54.938  1.00 36.68  ? 299 LEU H N   1 
ATOM   7752 C CA  . LEU H 2 209 ? -4.275  -12.807 55.261  1.00 37.39  ? 299 LEU H CA  1 
ATOM   7753 C C   . LEU H 2 209 ? -5.177  -12.413 56.439  1.00 44.06  ? 299 LEU H C   1 
ATOM   7754 O O   . LEU H 2 209 ? -6.267  -12.972 56.573  1.00 43.85  ? 299 LEU H O   1 
ATOM   7755 C CB  . LEU H 2 209 ? -3.613  -14.173 55.508  1.00 37.20  ? 299 LEU H CB  1 
ATOM   7756 C CG  . LEU H 2 209 ? -2.942  -14.808 54.275  1.00 40.52  ? 299 LEU H CG  1 
ATOM   7757 C CD1 . LEU H 2 209 ? -2.031  -15.933 54.677  1.00 40.20  ? 299 LEU H CD1 1 
ATOM   7758 C CD2 . LEU H 2 209 ? -3.959  -15.241 53.219  1.00 39.71  ? 299 LEU H CD2 1 
ATOM   7759 N N   . GLU H 2 210 ? -4.753  -11.431 57.251  1.00 41.52  ? 300 GLU H N   1 
ATOM   7760 C CA  . GLU H 2 210 ? -5.574  -10.907 58.335  1.00 41.99  ? 300 GLU H CA  1 
ATOM   7761 C C   . GLU H 2 210 ? -6.705  -10.059 57.749  1.00 48.62  ? 300 GLU H C   1 
ATOM   7762 O O   . GLU H 2 210 ? -7.779  -10.006 58.340  1.00 49.00  ? 300 GLU H O   1 
ATOM   7763 C CB  . GLU H 2 210 ? -4.731  -10.092 59.315  1.00 43.04  ? 300 GLU H CB  1 
ATOM   7764 C CG  . GLU H 2 210 ? -4.073  -10.945 60.383  1.00 51.62  ? 300 GLU H CG  1 
ATOM   7765 C CD  . GLU H 2 210 ? -4.850  -11.049 61.678  1.00 69.73  ? 300 GLU H CD  1 
ATOM   7766 O OE1 . GLU H 2 210 ? -4.370  -10.509 62.700  1.00 62.00  ? 300 GLU H OE1 1 
ATOM   7767 O OE2 . GLU H 2 210 ? -5.946  -11.655 61.669  1.00 64.16  ? 300 GLU H OE2 1 
ATOM   7768 N N   . HIS H 2 211 ? -6.469  -9.418  56.582  1.00 46.03  ? 301 HIS H N   1 
ATOM   7769 C CA  . HIS H 2 211 ? -7.476  -8.599  55.901  1.00 46.23  ? 301 HIS H CA  1 
ATOM   7770 C C   . HIS H 2 211 ? -8.252  -9.431  54.902  1.00 49.28  ? 301 HIS H C   1 
ATOM   7771 O O   . HIS H 2 211 ? -9.464  -9.264  54.773  1.00 47.69  ? 301 HIS H O   1 
ATOM   7772 C CB  . HIS H 2 211 ? -6.865  -7.377  55.173  1.00 47.44  ? 301 HIS H CB  1 
ATOM   7773 C CG  . HIS H 2 211 ? -6.036  -6.463  56.028  1.00 51.33  ? 301 HIS H CG  1 
ATOM   7774 N ND1 . HIS H 2 211 ? -4.657  -6.529  55.971  1.00 53.41  ? 301 HIS H ND1 1 
ATOM   7775 C CD2 . HIS H 2 211 ? -6.384  -5.600  57.010  1.00 53.18  ? 301 HIS H CD2 1 
ATOM   7776 C CE1 . HIS H 2 211 ? -4.211  -5.678  56.877  1.00 52.77  ? 301 HIS H CE1 1 
ATOM   7777 N NE2 . HIS H 2 211 ? -5.207  -5.103  57.536  1.00 52.94  ? 301 HIS H NE2 1 
ATOM   7778 N N   . GLN H 2 212 ? -7.545  -10.294 54.160  1.00 47.55  ? 302 GLN H N   1 
ATOM   7779 C CA  . GLN H 2 212 ? -8.120  -11.153 53.127  1.00 48.27  ? 302 GLN H CA  1 
ATOM   7780 C C   . GLN H 2 212 ? -7.666  -12.612 53.337  1.00 54.80  ? 302 GLN H C   1 
ATOM   7781 O O   . GLN H 2 212 ? -6.672  -13.038 52.734  1.00 55.35  ? 302 GLN H O   1 
ATOM   7782 C CB  . GLN H 2 212 ? -7.748  -10.642 51.724  1.00 49.42  ? 302 GLN H CB  1 
ATOM   7783 C CG  . GLN H 2 212 ? -8.436  -9.338  51.345  1.00 66.93  ? 302 GLN H CG  1 
ATOM   7784 C CD  . GLN H 2 212 ? -7.914  -8.710  50.076  1.00 90.72  ? 302 GLN H CD  1 
ATOM   7785 O OE1 . GLN H 2 212 ? -7.258  -9.334  49.236  1.00 85.71  ? 302 GLN H OE1 1 
ATOM   7786 N NE2 . GLN H 2 212 ? -8.229  -7.446  49.893  1.00 86.85  ? 302 GLN H NE2 1 
ATOM   7787 N N   . PRO H 2 213 ? -8.397  -13.404 54.169  1.00 52.20  ? 303 PRO H N   1 
ATOM   7788 C CA  . PRO H 2 213 ? -7.970  -14.798 54.430  1.00 51.75  ? 303 PRO H CA  1 
ATOM   7789 C C   . PRO H 2 213 ? -8.064  -15.758 53.236  1.00 53.97  ? 303 PRO H C   1 
ATOM   7790 O O   . PRO H 2 213 ? -7.491  -16.838 53.327  1.00 53.52  ? 303 PRO H O   1 
ATOM   7791 C CB  . PRO H 2 213 ? -8.889  -15.252 55.570  1.00 53.52  ? 303 PRO H CB  1 
ATOM   7792 C CG  . PRO H 2 213 ? -10.071 -14.362 55.485  1.00 58.33  ? 303 PRO H CG  1 
ATOM   7793 C CD  . PRO H 2 213 ? -9.583  -13.044 54.977  1.00 53.85  ? 303 PRO H CD  1 
ATOM   7794 N N   . ASP H 2 214 ? -8.738  -15.380 52.130  1.00 49.58  ? 304 ASP H N   1 
ATOM   7795 C CA  . ASP H 2 214 ? -8.841  -16.229 50.934  1.00 49.16  ? 304 ASP H CA  1 
ATOM   7796 C C   . ASP H 2 214 ? -8.045  -15.631 49.751  1.00 51.81  ? 304 ASP H C   1 
ATOM   7797 O O   . ASP H 2 214 ? -8.394  -15.855 48.586  1.00 50.63  ? 304 ASP H O   1 
ATOM   7798 C CB  . ASP H 2 214 ? -10.311 -16.474 50.541  1.00 51.31  ? 304 ASP H CB  1 
ATOM   7799 C CG  . ASP H 2 214 ? -11.153 -17.135 51.621  1.00 61.54  ? 304 ASP H CG  1 
ATOM   7800 O OD1 . ASP H 2 214 ? -11.138 -16.652 52.768  1.00 61.94  ? 304 ASP H OD1 1 
ATOM   7801 O OD2 . ASP H 2 214 ? -11.897 -18.086 51.296  1.00 67.21  ? 304 ASP H OD2 1 
ATOM   7802 N N   . ASN H 2 215 ? -6.954  -14.886 50.059  1.00 47.97  ? 305 ASN H N   1 
ATOM   7803 C CA  . ASN H 2 215 ? -6.060  -14.308 49.054  1.00 47.32  ? 305 ASN H CA  1 
ATOM   7804 C C   . ASN H 2 215 ? -5.136  -15.432 48.609  1.00 49.51  ? 305 ASN H C   1 
ATOM   7805 O O   . ASN H 2 215 ? -4.291  -15.871 49.393  1.00 48.52  ? 305 ASN H O   1 
ATOM   7806 C CB  . ASN H 2 215 ? -5.277  -13.105 49.623  1.00 48.50  ? 305 ASN H CB  1 
ATOM   7807 C CG  . ASN H 2 215 ? -4.484  -12.337 48.586  1.00 71.34  ? 305 ASN H CG  1 
ATOM   7808 O OD1 . ASN H 2 215 ? -3.590  -12.860 47.913  1.00 59.57  ? 305 ASN H OD1 1 
ATOM   7809 N ND2 . ASN H 2 215 ? -4.779  -11.061 48.449  1.00 68.35  ? 305 ASN H ND2 1 
ATOM   7810 N N   . ILE H 2 216 ? -5.334  -15.931 47.379  1.00 44.56  ? 306 ILE H N   1 
ATOM   7811 C CA  . ILE H 2 216 ? -4.602  -17.067 46.831  1.00 43.90  ? 306 ILE H CA  1 
ATOM   7812 C C   . ILE H 2 216 ? -3.093  -16.784 46.744  1.00 44.57  ? 306 ILE H C   1 
ATOM   7813 O O   . ILE H 2 216 ? -2.313  -17.676 47.075  1.00 44.17  ? 306 ILE H O   1 
ATOM   7814 C CB  . ILE H 2 216 ? -5.196  -17.538 45.471  1.00 47.33  ? 306 ILE H CB  1 
ATOM   7815 C CG1 . ILE H 2 216 ? -4.647  -18.940 45.079  1.00 47.50  ? 306 ILE H CG1 1 
ATOM   7816 C CG2 . ILE H 2 216 ? -5.033  -16.486 44.342  1.00 48.09  ? 306 ILE H CG2 1 
ATOM   7817 C CD1 . ILE H 2 216 ? -5.289  -19.587 43.876  1.00 53.44  ? 306 ILE H CD1 1 
ATOM   7818 N N   . LYS H 2 217 ? -2.694  -15.550 46.355  1.00 38.33  ? 307 LYS H N   1 
ATOM   7819 C CA  . LYS H 2 217 ? -1.290  -15.161 46.230  1.00 36.34  ? 307 LYS H CA  1 
ATOM   7820 C C   . LYS H 2 217 ? -0.600  -15.180 47.580  1.00 40.42  ? 307 LYS H C   1 
ATOM   7821 O O   . LYS H 2 217 ? 0.458   -15.790 47.693  1.00 39.73  ? 307 LYS H O   1 
ATOM   7822 C CB  . LYS H 2 217 ? -1.146  -13.800 45.553  1.00 36.60  ? 307 LYS H CB  1 
ATOM   7823 C CG  . LYS H 2 217 ? -1.254  -13.915 44.043  1.00 33.91  ? 307 LYS H CG  1 
ATOM   7824 C CD  . LYS H 2 217 ? -1.057  -12.595 43.351  1.00 36.03  ? 307 LYS H CD  1 
ATOM   7825 C CE  . LYS H 2 217 ? -1.104  -12.757 41.852  1.00 30.74  ? 307 LYS H CE  1 
ATOM   7826 N NZ  . LYS H 2 217 ? -0.677  -11.512 41.166  1.00 31.98  ? 307 LYS H NZ  1 
ATOM   7827 N N   . ALA H 2 218 ? -1.230  -14.602 48.617  1.00 37.71  ? 308 ALA H N   1 
ATOM   7828 C CA  . ALA H 2 218 ? -0.671  -14.582 49.972  1.00 37.87  ? 308 ALA H CA  1 
ATOM   7829 C C   . ALA H 2 218 ? -0.602  -15.975 50.579  1.00 41.56  ? 308 ALA H C   1 
ATOM   7830 O O   . ALA H 2 218 ? 0.330   -16.249 51.334  1.00 39.57  ? 308 ALA H O   1 
ATOM   7831 C CB  . ALA H 2 218 ? -1.482  -13.673 50.863  1.00 38.62  ? 308 ALA H CB  1 
ATOM   7832 N N   . LEU H 2 219 ? -1.582  -16.851 50.258  1.00 39.86  ? 309 LEU H N   1 
ATOM   7833 C CA  . LEU H 2 219 ? -1.597  -18.228 50.752  1.00 40.29  ? 309 LEU H CA  1 
ATOM   7834 C C   . LEU H 2 219 ? -0.453  -19.013 50.104  1.00 44.94  ? 309 LEU H C   1 
ATOM   7835 O O   . LEU H 2 219 ? 0.337   -19.627 50.818  1.00 44.12  ? 309 LEU H O   1 
ATOM   7836 C CB  . LEU H 2 219 ? -2.953  -18.919 50.485  1.00 40.50  ? 309 LEU H CB  1 
ATOM   7837 C CG  . LEU H 2 219 ? -4.124  -18.535 51.393  1.00 44.76  ? 309 LEU H CG  1 
ATOM   7838 C CD1 . LEU H 2 219 ? -5.462  -18.902 50.752  1.00 44.46  ? 309 LEU H CD1 1 
ATOM   7839 C CD2 . LEU H 2 219 ? -3.982  -19.144 52.785  1.00 46.53  ? 309 LEU H CD2 1 
ATOM   7840 N N   . PHE H 2 220 ? -0.316  -18.924 48.763  1.00 42.46  ? 310 PHE H N   1 
ATOM   7841 C CA  . PHE H 2 220 ? 0.745   -19.606 48.023  1.00 42.59  ? 310 PHE H CA  1 
ATOM   7842 C C   . PHE H 2 220 ? 2.133   -19.138 48.479  1.00 46.19  ? 310 PHE H C   1 
ATOM   7843 O O   . PHE H 2 220 ? 3.017   -19.969 48.671  1.00 46.15  ? 310 PHE H O   1 
ATOM   7844 C CB  . PHE H 2 220 ? 0.570   -19.429 46.505  1.00 44.94  ? 310 PHE H CB  1 
ATOM   7845 C CG  . PHE H 2 220 ? 1.704   -19.979 45.665  1.00 47.65  ? 310 PHE H CG  1 
ATOM   7846 C CD1 . PHE H 2 220 ? 2.432   -19.151 44.828  1.00 51.42  ? 310 PHE H CD1 1 
ATOM   7847 C CD2 . PHE H 2 220 ? 2.049   -21.328 45.717  1.00 50.85  ? 310 PHE H CD2 1 
ATOM   7848 C CE1 . PHE H 2 220 ? 3.468   -19.666 44.041  1.00 52.92  ? 310 PHE H CE1 1 
ATOM   7849 C CE2 . PHE H 2 220 ? 3.117   -21.828 44.964  1.00 53.83  ? 310 PHE H CE2 1 
ATOM   7850 C CZ  . PHE H 2 220 ? 3.804   -21.005 44.115  1.00 51.98  ? 310 PHE H CZ  1 
ATOM   7851 N N   . ARG H 2 221 ? 2.310   -17.822 48.687  1.00 41.58  ? 311 ARG H N   1 
ATOM   7852 C CA  . ARG H 2 221 ? 3.586   -17.254 49.114  1.00 41.18  ? 311 ARG H CA  1 
ATOM   7853 C C   . ARG H 2 221 ? 3.911   -17.652 50.550  1.00 47.16  ? 311 ARG H C   1 
ATOM   7854 O O   . ARG H 2 221 ? 5.078   -17.921 50.833  1.00 46.54  ? 311 ARG H O   1 
ATOM   7855 C CB  . ARG H 2 221 ? 3.602   -15.723 48.943  1.00 38.43  ? 311 ARG H CB  1 
ATOM   7856 C CG  . ARG H 2 221 ? 3.769   -15.326 47.492  1.00 38.24  ? 311 ARG H CG  1 
ATOM   7857 C CD  . ARG H 2 221 ? 3.352   -13.911 47.188  1.00 38.57  ? 311 ARG H CD  1 
ATOM   7858 N NE  . ARG H 2 221 ? 3.384   -13.697 45.737  1.00 41.68  ? 311 ARG H NE  1 
ATOM   7859 C CZ  . ARG H 2 221 ? 2.821   -12.669 45.121  1.00 48.24  ? 311 ARG H CZ  1 
ATOM   7860 N NH1 . ARG H 2 221 ? 2.203   -11.728 45.820  1.00 35.04  ? 311 ARG H NH1 1 
ATOM   7861 N NH2 . ARG H 2 221 ? 2.888   -12.561 43.800  1.00 24.56  ? 311 ARG H NH2 1 
ATOM   7862 N N   . LYS H 2 222 ? 2.899   -17.739 51.441  1.00 45.10  ? 312 LYS H N   1 
ATOM   7863 C CA  . LYS H 2 222 ? 3.146   -18.158 52.829  1.00 45.34  ? 312 LYS H CA  1 
ATOM   7864 C C   . LYS H 2 222 ? 3.548   -19.641 52.846  1.00 49.30  ? 312 LYS H C   1 
ATOM   7865 O O   . LYS H 2 222 ? 4.477   -20.000 53.569  1.00 48.50  ? 312 LYS H O   1 
ATOM   7866 C CB  . LYS H 2 222 ? 1.937   -17.894 53.745  1.00 47.54  ? 312 LYS H CB  1 
ATOM   7867 C CG  . LYS H 2 222 ? 2.257   -18.082 55.226  1.00 57.28  ? 312 LYS H CG  1 
ATOM   7868 C CD  . LYS H 2 222 ? 1.065   -17.826 56.132  1.00 65.64  ? 312 LYS H CD  1 
ATOM   7869 C CE  . LYS H 2 222 ? 1.396   -18.167 57.566  1.00 76.76  ? 312 LYS H CE  1 
ATOM   7870 N NZ  . LYS H 2 222 ? 0.496   -17.481 58.535  1.00 84.26  ? 312 LYS H NZ  1 
ATOM   7871 N N   . GLY H 2 223 ? 2.888   -20.441 51.997  1.00 46.29  ? 313 GLY H N   1 
ATOM   7872 C CA  . GLY H 2 223 ? 3.131   -21.869 51.821  1.00 46.58  ? 313 GLY H CA  1 
ATOM   7873 C C   . GLY H 2 223 ? 4.514   -22.164 51.276  1.00 50.95  ? 313 GLY H C   1 
ATOM   7874 O O   . GLY H 2 223 ? 5.221   -23.027 51.806  1.00 51.26  ? 313 GLY H O   1 
ATOM   7875 N N   . LYS H 2 224 ? 4.912   -21.425 50.221  1.00 46.35  ? 314 LYS H N   1 
ATOM   7876 C CA  . LYS H 2 224 ? 6.223   -21.512 49.574  1.00 45.16  ? 314 LYS H CA  1 
ATOM   7877 C C   . LYS H 2 224 ? 7.344   -21.092 50.548  1.00 48.49  ? 314 LYS H C   1 
ATOM   7878 O O   . LYS H 2 224 ? 8.408   -21.711 50.522  1.00 48.53  ? 314 LYS H O   1 
ATOM   7879 C CB  . LYS H 2 224 ? 6.240   -20.653 48.308  1.00 46.68  ? 314 LYS H CB  1 
ATOM   7880 C CG  . LYS H 2 224 ? 7.412   -20.933 47.388  1.00 52.72  ? 314 LYS H CG  1 
ATOM   7881 C CD  . LYS H 2 224 ? 7.273   -20.175 46.089  1.00 57.34  ? 314 LYS H CD  1 
ATOM   7882 C CE  . LYS H 2 224 ? 8.462   -20.371 45.189  1.00 65.25  ? 314 LYS H CE  1 
ATOM   7883 N NZ  . LYS H 2 224 ? 8.212   -19.806 43.840  1.00 75.33  ? 314 LYS H NZ  1 
ATOM   7884 N N   . VAL H 2 225 ? 7.101   -20.078 51.420  1.00 44.46  ? 315 VAL H N   1 
ATOM   7885 C CA  . VAL H 2 225 ? 8.073   -19.603 52.425  1.00 43.93  ? 315 VAL H CA  1 
ATOM   7886 C C   . VAL H 2 225 ? 8.232   -20.672 53.504  1.00 48.40  ? 315 VAL H C   1 
ATOM   7887 O O   . VAL H 2 225 ? 9.361   -21.028 53.851  1.00 48.03  ? 315 VAL H O   1 
ATOM   7888 C CB  . VAL H 2 225 ? 7.712   -18.213 53.035  1.00 47.18  ? 315 VAL H CB  1 
ATOM   7889 C CG1 . VAL H 2 225 ? 8.508   -17.920 54.303  1.00 46.56  ? 315 VAL H CG1 1 
ATOM   7890 C CG2 . VAL H 2 225 ? 7.931   -17.098 52.027  1.00 47.03  ? 315 VAL H CG2 1 
ATOM   7891 N N   . LEU H 2 226 ? 7.117   -21.186 54.036  1.00 44.93  ? 316 LEU H N   1 
ATOM   7892 C CA  . LEU H 2 226 ? 7.197   -22.213 55.070  1.00 44.49  ? 316 LEU H CA  1 
ATOM   7893 C C   . LEU H 2 226 ? 7.813   -23.519 54.516  1.00 50.00  ? 316 LEU H C   1 
ATOM   7894 O O   . LEU H 2 226 ? 8.537   -24.184 55.258  1.00 49.94  ? 316 LEU H O   1 
ATOM   7895 C CB  . LEU H 2 226 ? 5.837   -22.451 55.715  1.00 44.26  ? 316 LEU H CB  1 
ATOM   7896 C CG  . LEU H 2 226 ? 5.331   -21.294 56.589  1.00 48.40  ? 316 LEU H CG  1 
ATOM   7897 C CD1 . LEU H 2 226 ? 3.829   -21.322 56.702  1.00 48.47  ? 316 LEU H CD1 1 
ATOM   7898 C CD2 . LEU H 2 226 ? 5.995   -21.287 57.976  1.00 50.18  ? 316 LEU H CD2 1 
ATOM   7899 N N   . ALA H 2 227 ? 7.607   -23.832 53.206  1.00 47.36  ? 317 ALA H N   1 
ATOM   7900 C CA  . ALA H 2 227 ? 8.210   -24.992 52.528  1.00 47.76  ? 317 ALA H CA  1 
ATOM   7901 C C   . ALA H 2 227 ? 9.726   -24.820 52.405  1.00 53.14  ? 317 ALA H C   1 
ATOM   7902 O O   . ALA H 2 227 ? 10.467  -25.765 52.670  1.00 53.02  ? 317 ALA H O   1 
ATOM   7903 C CB  . ALA H 2 227 ? 7.595   -25.190 51.142  1.00 48.47  ? 317 ALA H CB  1 
ATOM   7904 N N   . GLN H 2 228 ? 10.188  -23.610 52.021  1.00 50.58  ? 318 GLN H N   1 
ATOM   7905 C CA  . GLN H 2 228 ? 11.612  -23.297 51.855  1.00 50.63  ? 318 GLN H CA  1 
ATOM   7906 C C   . GLN H 2 228 ? 12.324  -23.218 53.213  1.00 56.17  ? 318 GLN H C   1 
ATOM   7907 O O   . GLN H 2 228 ? 13.531  -23.451 53.281  1.00 55.26  ? 318 GLN H O   1 
ATOM   7908 C CB  . GLN H 2 228 ? 11.803  -22.007 51.045  1.00 51.67  ? 318 GLN H CB  1 
ATOM   7909 C CG  . GLN H 2 228 ? 11.630  -22.227 49.537  1.00 60.70  ? 318 GLN H CG  1 
ATOM   7910 C CD  . GLN H 2 228 ? 11.532  -20.963 48.704  1.00 72.37  ? 318 GLN H CD  1 
ATOM   7911 O OE1 . GLN H 2 228 ? 11.944  -19.867 49.106  1.00 67.15  ? 318 GLN H OE1 1 
ATOM   7912 N NE2 . GLN H 2 228 ? 11.015  -21.100 47.494  1.00 61.52  ? 318 GLN H NE2 1 
ATOM   7913 N N   . GLN H 2 229 ? 11.570  -22.937 54.296  1.00 54.75  ? 319 GLN H N   1 
ATOM   7914 C CA  . GLN H 2 229 ? 12.092  -22.899 55.666  1.00 55.39  ? 319 GLN H CA  1 
ATOM   7915 C C   . GLN H 2 229 ? 12.231  -24.318 56.237  1.00 61.54  ? 319 GLN H C   1 
ATOM   7916 O O   . GLN H 2 229 ? 12.968  -24.516 57.206  1.00 61.12  ? 319 GLN H O   1 
ATOM   7917 C CB  . GLN H 2 229 ? 11.180  -22.058 56.570  1.00 56.65  ? 319 GLN H CB  1 
ATOM   7918 N N   . GLY H 2 230 ? 11.506  -25.273 55.648  1.00 59.63  ? 320 GLY H N   1 
ATOM   7919 C CA  . GLY H 2 230 ? 11.505  -26.670 56.070  1.00 60.38  ? 320 GLY H CA  1 
ATOM   7920 C C   . GLY H 2 230 ? 10.319  -27.076 56.926  1.00 65.75  ? 320 GLY H C   1 
ATOM   7921 O O   . GLY H 2 230 ? 10.282  -28.200 57.440  1.00 65.62  ? 320 GLY H O   1 
ATOM   7922 N N   . GLU H 2 231 ? 9.342   -26.161 57.090  1.00 62.69  ? 321 GLU H N   1 
ATOM   7923 C CA  . GLU H 2 231 ? 8.114   -26.373 57.863  1.00 62.55  ? 321 GLU H CA  1 
ATOM   7924 C C   . GLU H 2 231 ? 7.052   -26.981 56.930  1.00 67.76  ? 321 GLU H C   1 
ATOM   7925 O O   . GLU H 2 231 ? 6.050   -26.333 56.610  1.00 67.38  ? 321 GLU H O   1 
ATOM   7926 C CB  . GLU H 2 231 ? 7.639   -25.043 58.488  1.00 63.60  ? 321 GLU H CB  1 
ATOM   7927 C CG  . GLU H 2 231 ? 8.524   -24.525 59.606  1.00 70.49  ? 321 GLU H CG  1 
ATOM   7928 C CD  . GLU H 2 231 ? 8.020   -24.820 61.003  1.00 83.09  ? 321 GLU H CD  1 
ATOM   7929 O OE1 . GLU H 2 231 ? 7.702   -25.996 61.291  1.00 77.85  ? 321 GLU H OE1 1 
ATOM   7930 O OE2 . GLU H 2 231 ? 7.958   -23.872 61.818  1.00 70.00  ? 321 GLU H OE2 1 
ATOM   7931 N N   . TYR H 2 232 ? 7.313   -28.221 56.460  1.00 65.07  ? 322 TYR H N   1 
ATOM   7932 C CA  . TYR H 2 232 ? 6.474   -28.975 55.516  1.00 65.13  ? 322 TYR H CA  1 
ATOM   7933 C C   . TYR H 2 232 ? 5.093   -29.288 56.092  1.00 68.88  ? 322 TYR H C   1 
ATOM   7934 O O   . TYR H 2 232 ? 4.106   -29.242 55.356  1.00 67.66  ? 322 TYR H O   1 
ATOM   7935 C CB  . TYR H 2 232 ? 7.172   -30.278 55.093  1.00 66.41  ? 322 TYR H CB  1 
ATOM   7936 N N   . SER H 2 233 ? 5.031   -29.589 57.410  1.00 66.36  ? 323 SER H N   1 
ATOM   7937 C CA  . SER H 2 233 ? 3.812   -29.908 58.162  1.00 66.22  ? 323 SER H CA  1 
ATOM   7938 C C   . SER H 2 233 ? 2.836   -28.730 58.190  1.00 68.95  ? 323 SER H C   1 
ATOM   7939 O O   . SER H 2 233 ? 1.624   -28.949 58.167  1.00 68.89  ? 323 SER H O   1 
ATOM   7940 C CB  . SER H 2 233 ? 4.160   -30.322 59.589  1.00 70.44  ? 323 SER H CB  1 
ATOM   7941 N N   . GLU H 2 234 ? 3.361   -27.492 58.226  1.00 63.93  ? 324 GLU H N   1 
ATOM   7942 C CA  . GLU H 2 234 ? 2.550   -26.278 58.234  1.00 62.84  ? 324 GLU H CA  1 
ATOM   7943 C C   . GLU H 2 234 ? 2.269   -25.767 56.825  1.00 64.15  ? 324 GLU H C   1 
ATOM   7944 O O   . GLU H 2 234 ? 1.236   -25.132 56.622  1.00 64.33  ? 324 GLU H O   1 
ATOM   7945 C CB  . GLU H 2 234 ? 3.230   -25.184 59.063  1.00 64.26  ? 324 GLU H CB  1 
ATOM   7946 C CG  . GLU H 2 234 ? 2.920   -25.299 60.546  1.00 75.73  ? 324 GLU H CG  1 
ATOM   7947 C CD  . GLU H 2 234 ? 3.710   -24.391 61.469  1.00 104.11 ? 324 GLU H CD  1 
ATOM   7948 O OE1 . GLU H 2 234 ? 4.289   -24.912 62.450  1.00 102.00 ? 324 GLU H OE1 1 
ATOM   7949 O OE2 . GLU H 2 234 ? 3.729   -23.161 61.233  1.00 102.56 ? 324 GLU H OE2 1 
ATOM   7950 N N   . ALA H 2 235 ? 3.159   -26.056 55.854  1.00 58.56  ? 325 ALA H N   1 
ATOM   7951 C CA  . ALA H 2 235 ? 3.054   -25.592 54.464  1.00 57.39  ? 325 ALA H CA  1 
ATOM   7952 C C   . ALA H 2 235 ? 1.983   -26.304 53.637  1.00 59.46  ? 325 ALA H C   1 
ATOM   7953 O O   . ALA H 2 235 ? 1.332   -25.641 52.823  1.00 58.48  ? 325 ALA H O   1 
ATOM   7954 C CB  . ALA H 2 235 ? 4.392   -25.732 53.761  1.00 58.04  ? 325 ALA H CB  1 
ATOM   7955 N N   . ILE H 2 236 ? 1.837   -27.643 53.792  1.00 55.60  ? 326 ILE H N   1 
ATOM   7956 C CA  . ILE H 2 236 ? 0.910   -28.462 52.998  1.00 55.20  ? 326 ILE H CA  1 
ATOM   7957 C C   . ILE H 2 236 ? -0.576  -28.032 53.203  1.00 59.28  ? 326 ILE H C   1 
ATOM   7958 O O   . ILE H 2 236 ? -1.224  -27.848 52.169  1.00 58.36  ? 326 ILE H O   1 
ATOM   7959 C CB  . ILE H 2 236 ? 1.109   -29.993 53.186  1.00 58.26  ? 326 ILE H CB  1 
ATOM   7960 C CG1 . ILE H 2 236 ? 0.314   -30.794 52.133  1.00 58.67  ? 326 ILE H CG1 1 
ATOM   7961 C CD1 . ILE H 2 236 ? 0.792   -32.194 51.929  1.00 69.80  ? 326 ILE H CD1 1 
ATOM   7962 N N   . PRO H 2 237 ? -1.149  -27.804 54.427  1.00 55.84  ? 327 PRO H N   1 
ATOM   7963 C CA  . PRO H 2 237 ? -2.561  -27.370 54.481  1.00 55.65  ? 327 PRO H CA  1 
ATOM   7964 C C   . PRO H 2 237 ? -2.783  -25.984 53.849  1.00 59.26  ? 327 PRO H C   1 
ATOM   7965 O O   . PRO H 2 237 ? -3.818  -25.776 53.216  1.00 58.49  ? 327 PRO H O   1 
ATOM   7966 C CB  . PRO H 2 237 ? -2.887  -27.374 55.980  1.00 57.40  ? 327 PRO H CB  1 
ATOM   7967 C CG  . PRO H 2 237 ? -1.579  -27.269 56.668  1.00 61.47  ? 327 PRO H CG  1 
ATOM   7968 C CD  . PRO H 2 237 ? -0.587  -27.961 55.789  1.00 56.95  ? 327 PRO H CD  1 
ATOM   7969 N N   . ILE H 2 238 ? -1.807  -25.060 53.989  1.00 55.94  ? 328 ILE H N   1 
ATOM   7970 C CA  . ILE H 2 238 ? -1.873  -23.709 53.426  1.00 55.99  ? 328 ILE H CA  1 
ATOM   7971 C C   . ILE H 2 238 ? -1.812  -23.795 51.883  1.00 59.67  ? 328 ILE H C   1 
ATOM   7972 O O   . ILE H 2 238 ? -2.658  -23.191 51.221  1.00 58.84  ? 328 ILE H O   1 
ATOM   7973 C CB  . ILE H 2 238 ? -0.773  -22.796 54.043  1.00 59.15  ? 328 ILE H CB  1 
ATOM   7974 C CG1 . ILE H 2 238 ? -1.162  -22.382 55.480  1.00 59.23  ? 328 ILE H CG1 1 
ATOM   7975 C CG2 . ILE H 2 238 ? -0.511  -21.555 53.186  1.00 60.56  ? 328 ILE H CG2 1 
ATOM   7976 C CD1 . ILE H 2 238 ? -0.012  -21.947 56.387  1.00 64.52  ? 328 ILE H CD1 1 
ATOM   7977 N N   . LEU H 2 239 ? -0.865  -24.588 51.321  1.00 56.54  ? 329 LEU H N   1 
ATOM   7978 C CA  . LEU H 2 239 ? -0.755  -24.779 49.866  1.00 56.30  ? 329 LEU H CA  1 
ATOM   7979 C C   . LEU H 2 239 ? -1.981  -25.516 49.311  1.00 60.32  ? 329 LEU H C   1 
ATOM   7980 O O   . LEU H 2 239 ? -2.339  -25.312 48.149  1.00 59.35  ? 329 LEU H O   1 
ATOM   7981 C CB  . LEU H 2 239 ? 0.526   -25.534 49.475  1.00 56.35  ? 329 LEU H CB  1 
ATOM   7982 C CG  . LEU H 2 239 ? 1.845   -24.752 49.481  1.00 60.91  ? 329 LEU H CG  1 
ATOM   7983 C CD1 . LEU H 2 239 ? 3.018   -25.671 49.183  1.00 60.73  ? 329 LEU H CD1 1 
ATOM   7984 C CD2 . LEU H 2 239 ? 1.837   -23.626 48.455  1.00 62.98  ? 329 LEU H CD2 1 
ATOM   7985 N N   . ARG H 2 240 ? -2.633  -26.356 50.146  1.00 57.73  ? 330 ARG H N   1 
ATOM   7986 C CA  . ARG H 2 240 ? -3.853  -27.070 49.755  1.00 57.83  ? 330 ARG H CA  1 
ATOM   7987 C C   . ARG H 2 240 ? -5.038  -26.106 49.780  1.00 60.87  ? 330 ARG H C   1 
ATOM   7988 O O   . ARG H 2 240 ? -5.844  -26.133 48.852  1.00 59.87  ? 330 ARG H O   1 
ATOM   7989 C CB  . ARG H 2 240 ? -4.117  -28.296 50.641  1.00 59.12  ? 330 ARG H CB  1 
ATOM   7990 N N   . ALA H 2 241 ? -5.114  -25.221 50.807  1.00 57.25  ? 331 ALA H N   1 
ATOM   7991 C CA  . ALA H 2 241 ? -6.154  -24.189 50.938  1.00 57.04  ? 331 ALA H CA  1 
ATOM   7992 C C   . ALA H 2 241 ? -6.173  -23.278 49.711  1.00 60.12  ? 331 ALA H C   1 
ATOM   7993 O O   . ALA H 2 241 ? -7.249  -22.876 49.279  1.00 59.58  ? 331 ALA H O   1 
ATOM   7994 C CB  . ALA H 2 241 ? -5.926  -23.365 52.195  1.00 57.88  ? 331 ALA H CB  1 
ATOM   7995 N N   . ALA H 2 242 ? -4.986  -23.002 49.128  1.00 56.68  ? 332 ALA H N   1 
ATOM   7996 C CA  . ALA H 2 242 ? -4.811  -22.207 47.910  1.00 56.54  ? 332 ALA H CA  1 
ATOM   7997 C C   . ALA H 2 242 ? -5.298  -22.988 46.690  1.00 59.83  ? 332 ALA H C   1 
ATOM   7998 O O   . ALA H 2 242 ? -5.937  -22.404 45.814  1.00 59.16  ? 332 ALA H O   1 
ATOM   7999 C CB  . ALA H 2 242 ? -3.347  -21.819 47.738  1.00 57.28  ? 332 ALA H CB  1 
ATOM   8000 N N   . LEU H 2 243 ? -4.994  -24.311 46.636  1.00 56.47  ? 333 LEU H N   1 
ATOM   8001 C CA  . LEU H 2 243 ? -5.411  -25.204 45.548  1.00 56.30  ? 333 LEU H CA  1 
ATOM   8002 C C   . LEU H 2 243 ? -6.928  -25.388 45.573  1.00 61.51  ? 333 LEU H C   1 
ATOM   8003 O O   . LEU H 2 243 ? -7.534  -25.523 44.518  1.00 60.55  ? 333 LEU H O   1 
ATOM   8004 C CB  . LEU H 2 243 ? -4.695  -26.570 45.614  1.00 56.03  ? 333 LEU H CB  1 
ATOM   8005 C CG  . LEU H 2 243 ? -4.825  -27.487 44.373  1.00 60.15  ? 333 LEU H CG  1 
ATOM   8006 C CD1 . LEU H 2 243 ? -4.124  -26.902 43.158  1.00 59.98  ? 333 LEU H CD1 1 
ATOM   8007 C CD2 . LEU H 2 243 ? -4.283  -28.857 44.659  1.00 62.08  ? 333 LEU H CD2 1 
ATOM   8008 N N   . LYS H 2 244 ? -7.545  -25.335 46.769  1.00 59.18  ? 334 LYS H N   1 
ATOM   8009 C CA  . LYS H 2 244 ? -8.995  -25.446 46.938  1.00 59.41  ? 334 LYS H CA  1 
ATOM   8010 C C   . LYS H 2 244 ? -9.732  -24.293 46.216  1.00 64.59  ? 334 LYS H C   1 
ATOM   8011 O O   . LYS H 2 244 ? -10.861 -24.488 45.771  1.00 64.64  ? 334 LYS H O   1 
ATOM   8012 C CB  . LYS H 2 244 ? -9.361  -25.471 48.431  1.00 61.68  ? 334 LYS H CB  1 
ATOM   8013 N N   . LEU H 2 245 ? -9.078  -23.119 46.078  1.00 61.71  ? 335 LEU H N   1 
ATOM   8014 C CA  . LEU H 2 245 ? -9.628  -21.933 45.417  1.00 62.10  ? 335 LEU H CA  1 
ATOM   8015 C C   . LEU H 2 245 ? -9.419  -21.989 43.895  1.00 67.62  ? 335 LEU H C   1 
ATOM   8016 O O   . LEU H 2 245 ? -10.228 -21.422 43.157  1.00 67.20  ? 335 LEU H O   1 
ATOM   8017 C CB  . LEU H 2 245 ? -9.016  -20.638 45.997  1.00 62.22  ? 335 LEU H CB  1 
ATOM   8018 C CG  . LEU H 2 245 ? -9.163  -20.406 47.520  1.00 66.90  ? 335 LEU H CG  1 
ATOM   8019 C CD1 . LEU H 2 245 ? -8.162  -19.389 48.028  1.00 66.96  ? 335 LEU H CD1 1 
ATOM   8020 C CD2 . LEU H 2 245 ? -10.564 -19.969 47.888  1.00 69.62  ? 335 LEU H CD2 1 
ATOM   8021 N N   . GLU H 2 246 ? -8.341  -22.670 43.432  1.00 65.22  ? 336 GLU H N   1 
ATOM   8022 C CA  . GLU H 2 246 ? -8.005  -22.865 42.012  1.00 65.53  ? 336 GLU H CA  1 
ATOM   8023 C C   . GLU H 2 246 ? -7.422  -24.280 41.811  1.00 70.24  ? 336 GLU H C   1 
ATOM   8024 O O   . GLU H 2 246 ? -6.197  -24.457 41.822  1.00 70.15  ? 336 GLU H O   1 
ATOM   8025 C CB  . GLU H 2 246 ? -7.041  -21.782 41.510  1.00 66.92  ? 336 GLU H CB  1 
ATOM   8026 N N   . PRO H 2 247 ? -8.292  -25.312 41.678  1.00 66.91  ? 337 PRO H N   1 
ATOM   8027 C CA  . PRO H 2 247 ? -7.787  -26.695 41.579  1.00 66.52  ? 337 PRO H CA  1 
ATOM   8028 C C   . PRO H 2 247 ? -7.003  -27.017 40.304  1.00 68.60  ? 337 PRO H C   1 
ATOM   8029 O O   . PRO H 2 247 ? -6.175  -27.919 40.344  1.00 68.24  ? 337 PRO H O   1 
ATOM   8030 C CB  . PRO H 2 247 ? -9.061  -27.546 41.656  1.00 68.60  ? 337 PRO H CB  1 
ATOM   8031 C CG  . PRO H 2 247 ? -10.118 -26.634 42.219  1.00 73.10  ? 337 PRO H CG  1 
ATOM   8032 C CD  . PRO H 2 247 ? -9.769  -25.285 41.696  1.00 68.60  ? 337 PRO H CD  1 
ATOM   8033 N N   . SER H 2 248 ? -7.250  -26.306 39.193  1.00 63.48  ? 338 SER H N   1 
ATOM   8034 C CA  . SER H 2 248 ? -6.573  -26.558 37.914  1.00 62.51  ? 338 SER H CA  1 
ATOM   8035 C C   . SER H 2 248 ? -5.187  -25.867 37.796  1.00 63.34  ? 338 SER H C   1 
ATOM   8036 O O   . SER H 2 248 ? -4.442  -26.173 36.859  1.00 62.54  ? 338 SER H O   1 
ATOM   8037 C CB  . SER H 2 248 ? -7.463  -26.119 36.754  1.00 66.73  ? 338 SER H CB  1 
ATOM   8038 O OG  . SER H 2 248 ? -7.815  -24.746 36.841  1.00 76.40  ? 338 SER H OG  1 
ATOM   8039 N N   . ASN H 2 249 ? -4.849  -24.952 38.734  1.00 57.96  ? 339 ASN H N   1 
ATOM   8040 C CA  . ASN H 2 249 ? -3.601  -24.181 38.752  1.00 56.89  ? 339 ASN H CA  1 
ATOM   8041 C C   . ASN H 2 249 ? -2.348  -25.076 38.843  1.00 59.88  ? 339 ASN H C   1 
ATOM   8042 O O   . ASN H 2 249 ? -2.048  -25.651 39.897  1.00 59.89  ? 339 ASN H O   1 
ATOM   8043 C CB  . ASN H 2 249 ? -3.615  -23.169 39.893  1.00 56.06  ? 339 ASN H CB  1 
ATOM   8044 C CG  . ASN H 2 249 ? -2.501  -22.155 39.823  1.00 60.68  ? 339 ASN H CG  1 
ATOM   8045 O OD1 . ASN H 2 249 ? -1.324  -22.462 40.035  1.00 46.63  ? 339 ASN H OD1 1 
ATOM   8046 N ND2 . ASN H 2 249 ? -2.858  -20.914 39.559  1.00 51.14  ? 339 ASN H ND2 1 
ATOM   8047 N N   . LYS H 2 250 ? -1.602  -25.130 37.724  1.00 55.07  ? 340 LYS H N   1 
ATOM   8048 C CA  . LYS H 2 250 ? -0.379  -25.909 37.522  1.00 54.07  ? 340 LYS H CA  1 
ATOM   8049 C C   . LYS H 2 250 ? 0.753   -25.525 38.487  1.00 56.97  ? 340 LYS H C   1 
ATOM   8050 O O   . LYS H 2 250 ? 1.478   -26.412 38.934  1.00 56.45  ? 340 LYS H O   1 
ATOM   8051 C CB  . LYS H 2 250 ? 0.109   -25.754 36.074  1.00 56.13  ? 340 LYS H CB  1 
ATOM   8052 N N   . THR H 2 251 ? 0.904   -24.226 38.807  1.00 52.35  ? 341 THR H N   1 
ATOM   8053 C CA  . THR H 2 251 ? 1.956   -23.721 39.696  1.00 51.29  ? 341 THR H CA  1 
ATOM   8054 C C   . THR H 2 251 ? 1.763   -24.241 41.137  1.00 54.58  ? 341 THR H C   1 
ATOM   8055 O O   . THR H 2 251 ? 2.752   -24.637 41.760  1.00 53.79  ? 341 THR H O   1 
ATOM   8056 C CB  . THR H 2 251 ? 2.018   -22.185 39.629  1.00 54.24  ? 341 THR H CB  1 
ATOM   8057 O OG1 . THR H 2 251 ? 2.182   -21.797 38.261  1.00 51.47  ? 341 THR H OG1 1 
ATOM   8058 C CG2 . THR H 2 251 ? 3.140   -21.593 40.487  1.00 50.69  ? 341 THR H CG2 1 
ATOM   8059 N N   . ILE H 2 252 ? 0.515   -24.252 41.655  1.00 51.08  ? 342 ILE H N   1 
ATOM   8060 C CA  . ILE H 2 252 ? 0.220   -24.732 43.014  1.00 51.13  ? 342 ILE H CA  1 
ATOM   8061 C C   . ILE H 2 252 ? 0.446   -26.263 43.093  1.00 56.38  ? 342 ILE H C   1 
ATOM   8062 O O   . ILE H 2 252 ? 0.928   -26.754 44.122  1.00 56.50  ? 342 ILE H O   1 
ATOM   8063 C CB  . ILE H 2 252 ? -1.198  -24.327 43.508  1.00 53.96  ? 342 ILE H CB  1 
ATOM   8064 C CG1 . ILE H 2 252 ? -1.444  -22.814 43.340  1.00 53.97  ? 342 ILE H CG1 1 
ATOM   8065 C CG2 . ILE H 2 252 ? -1.412  -24.744 44.983  1.00 54.86  ? 342 ILE H CG2 1 
ATOM   8066 C CD1 . ILE H 2 252 ? -2.907  -22.403 43.452  1.00 61.73  ? 342 ILE H CD1 1 
ATOM   8067 N N   . HIS H 2 253 ? 0.123   -26.999 42.007  1.00 53.10  ? 343 HIS H N   1 
ATOM   8068 C CA  . HIS H 2 253 ? 0.320   -28.452 41.914  1.00 53.21  ? 343 HIS H CA  1 
ATOM   8069 C C   . HIS H 2 253 ? 1.805   -28.792 41.978  1.00 54.95  ? 343 HIS H C   1 
ATOM   8070 O O   . HIS H 2 253 ? 2.216   -29.627 42.787  1.00 53.95  ? 343 HIS H O   1 
ATOM   8071 C CB  . HIS H 2 253 ? -0.278  -29.008 40.608  1.00 54.77  ? 343 HIS H CB  1 
ATOM   8072 C CG  . HIS H 2 253 ? -1.744  -29.293 40.665  1.00 58.98  ? 343 HIS H CG  1 
ATOM   8073 N ND1 . HIS H 2 253 ? -2.251  -30.314 41.450  1.00 61.14  ? 343 HIS H ND1 1 
ATOM   8074 C CD2 . HIS H 2 253 ? -2.762  -28.728 39.976  1.00 61.28  ? 343 HIS H CD2 1 
ATOM   8075 C CE1 . HIS H 2 253 ? -3.559  -30.307 41.247  1.00 60.73  ? 343 HIS H CE1 1 
ATOM   8076 N NE2 . HIS H 2 253 ? -3.910  -29.376 40.362  1.00 61.10  ? 343 HIS H NE2 1 
ATOM   8077 N N   . ALA H 2 254 ? 2.604   -28.107 41.128  1.00 50.35  ? 344 ALA H N   1 
ATOM   8078 C CA  . ALA H 2 254 ? 4.054   -28.236 41.001  1.00 49.10  ? 344 ALA H CA  1 
ATOM   8079 C C   . ALA H 2 254 ? 4.746   -27.927 42.316  1.00 50.12  ? 344 ALA H C   1 
ATOM   8080 O O   . ALA H 2 254 ? 5.738   -28.570 42.635  1.00 48.96  ? 344 ALA H O   1 
ATOM   8081 C CB  . ALA H 2 254 ? 4.564   -27.307 39.909  1.00 49.84  ? 344 ALA H CB  1 
ATOM   8082 N N   . GLU H 2 255 ? 4.211   -26.964 43.083  1.00 46.13  ? 345 GLU H N   1 
ATOM   8083 C CA  . GLU H 2 255 ? 4.747   -26.574 44.381  1.00 45.51  ? 345 GLU H CA  1 
ATOM   8084 C C   . GLU H 2 255 ? 4.431   -27.644 45.415  1.00 48.22  ? 345 GLU H C   1 
ATOM   8085 O O   . GLU H 2 255 ? 5.298   -27.952 46.229  1.00 46.99  ? 345 GLU H O   1 
ATOM   8086 C CB  . GLU H 2 255 ? 4.196   -25.210 44.820  1.00 46.91  ? 345 GLU H CB  1 
ATOM   8087 C CG  . GLU H 2 255 ? 4.967   -24.566 45.975  1.00 58.99  ? 345 GLU H CG  1 
ATOM   8088 C CD  . GLU H 2 255 ? 6.417   -24.190 45.711  1.00 80.03  ? 345 GLU H CD  1 
ATOM   8089 O OE1 . GLU H 2 255 ? 6.761   -23.877 44.544  1.00 70.42  ? 345 GLU H OE1 1 
ATOM   8090 O OE2 . GLU H 2 255 ? 7.211   -24.209 46.682  1.00 68.92  ? 345 GLU H OE2 1 
ATOM   8091 N N   . LEU H 2 256 ? 3.205   -28.217 45.384  1.00 44.65  ? 346 LEU H N   1 
ATOM   8092 C CA  . LEU H 2 256 ? 2.804   -29.265 46.324  1.00 44.67  ? 346 LEU H CA  1 
ATOM   8093 C C   . LEU H 2 256 ? 3.570   -30.545 46.081  1.00 50.00  ? 346 LEU H C   1 
ATOM   8094 O O   . LEU H 2 256 ? 4.079   -31.137 47.037  1.00 50.22  ? 346 LEU H O   1 
ATOM   8095 C CB  . LEU H 2 256 ? 1.307   -29.545 46.239  1.00 44.44  ? 346 LEU H CB  1 
ATOM   8096 C CG  . LEU H 2 256 ? 0.442   -28.742 47.182  1.00 48.58  ? 346 LEU H CG  1 
ATOM   8097 C CD1 . LEU H 2 256 ? -0.973  -28.728 46.692  1.00 48.53  ? 346 LEU H CD1 1 
ATOM   8098 C CD2 . LEU H 2 256 ? 0.527   -29.266 48.619  1.00 49.35  ? 346 LEU H CD2 1 
ATOM   8099 N N   . SER H 2 257 ? 3.665   -30.958 44.799  1.00 46.56  ? 347 SER H N   1 
ATOM   8100 C CA  . SER H 2 257 ? 4.361   -32.164 44.364  1.00 46.95  ? 347 SER H CA  1 
ATOM   8101 C C   . SER H 2 257 ? 5.841   -32.128 44.770  1.00 52.19  ? 347 SER H C   1 
ATOM   8102 O O   . SER H 2 257 ? 6.355   -33.128 45.270  1.00 51.63  ? 347 SER H O   1 
ATOM   8103 C CB  . SER H 2 257 ? 4.222   -32.342 42.855  1.00 50.13  ? 347 SER H CB  1 
ATOM   8104 O OG  . SER H 2 257 ? 2.891   -32.679 42.496  1.00 57.88  ? 347 SER H OG  1 
ATOM   8105 N N   . LYS H 2 258 ? 6.507   -30.966 44.574  1.00 49.61  ? 348 LYS H N   1 
ATOM   8106 C CA  . LYS H 2 258 ? 7.912   -30.709 44.916  1.00 49.56  ? 348 LYS H CA  1 
ATOM   8107 C C   . LYS H 2 258 ? 8.116   -30.860 46.422  1.00 53.39  ? 348 LYS H C   1 
ATOM   8108 O O   . LYS H 2 258 ? 9.071   -31.501 46.846  1.00 52.42  ? 348 LYS H O   1 
ATOM   8109 C CB  . LYS H 2 258 ? 8.309   -29.289 44.454  1.00 51.85  ? 348 LYS H CB  1 
ATOM   8110 C CG  . LYS H 2 258 ? 9.808   -29.018 44.381  1.00 68.02  ? 348 LYS H CG  1 
ATOM   8111 C CD  . LYS H 2 258 ? 10.125  -27.560 44.027  1.00 79.58  ? 348 LYS H CD  1 
ATOM   8112 C CE  . LYS H 2 258 ? 10.079  -27.285 42.536  1.00 94.25  ? 348 LYS H CE  1 
ATOM   8113 N NZ  . LYS H 2 258 ? 10.620  -25.944 42.195  1.00 104.34 ? 348 LYS H NZ  1 
ATOM   8114 N N   . LEU H 2 259 ? 7.186   -30.295 47.216  1.00 50.39  ? 349 LEU H N   1 
ATOM   8115 C CA  . LEU H 2 259 ? 7.173   -30.310 48.674  1.00 50.25  ? 349 LEU H CA  1 
ATOM   8116 C C   . LEU H 2 259 ? 6.972   -31.727 49.219  1.00 53.66  ? 349 LEU H C   1 
ATOM   8117 O O   . LEU H 2 259 ? 7.715   -32.115 50.124  1.00 54.11  ? 349 LEU H O   1 
ATOM   8118 C CB  . LEU H 2 259 ? 6.069   -29.350 49.178  1.00 50.48  ? 349 LEU H CB  1 
ATOM   8119 C CG  . LEU H 2 259 ? 5.390   -29.608 50.533  1.00 55.29  ? 349 LEU H CG  1 
ATOM   8120 C CD1 . LEU H 2 259 ? 6.136   -28.923 51.671  1.00 55.28  ? 349 LEU H CD1 1 
ATOM   8121 C CD2 . LEU H 2 259 ? 3.953   -29.123 50.506  1.00 57.53  ? 349 LEU H CD2 1 
ATOM   8122 N N   . VAL H 2 260 ? 5.984   -32.488 48.689  1.00 48.39  ? 350 VAL H N   1 
ATOM   8123 C CA  . VAL H 2 260 ? 5.691   -33.839 49.179  1.00 47.91  ? 350 VAL H CA  1 
ATOM   8124 C C   . VAL H 2 260 ? 6.848   -34.814 48.838  1.00 52.79  ? 350 VAL H C   1 
ATOM   8125 O O   . VAL H 2 260 ? 7.201   -35.629 49.692  1.00 52.25  ? 350 VAL H O   1 
ATOM   8126 C CB  . VAL H 2 260 ? 4.302   -34.403 48.757  1.00 51.38  ? 350 VAL H CB  1 
ATOM   8127 C CG1 . VAL H 2 260 ? 3.171   -33.508 49.251  1.00 50.98  ? 350 VAL H CG1 1 
ATOM   8128 C CG2 . VAL H 2 260 ? 4.192   -34.633 47.251  1.00 51.06  ? 350 VAL H CG2 1 
ATOM   8129 N N   . LYS H 2 261 ? 7.458   -34.698 47.628  1.00 49.87  ? 351 LYS H N   1 
ATOM   8130 C CA  . LYS H 2 261 ? 8.584   -35.534 47.186  1.00 49.67  ? 351 LYS H CA  1 
ATOM   8131 C C   . LYS H 2 261 ? 9.815   -35.301 48.069  1.00 54.56  ? 351 LYS H C   1 
ATOM   8132 O O   . LYS H 2 261 ? 10.450  -36.271 48.487  1.00 54.05  ? 351 LYS H O   1 
ATOM   8133 C CB  . LYS H 2 261 ? 8.925   -35.268 45.713  1.00 51.71  ? 351 LYS H CB  1 
ATOM   8134 N N   . LYS H 2 262 ? 10.121  -34.021 48.382  1.00 52.05  ? 352 LYS H N   1 
ATOM   8135 C CA  . LYS H 2 262 ? 11.246  -33.618 49.236  1.00 52.77  ? 352 LYS H CA  1 
ATOM   8136 C C   . LYS H 2 262 ? 11.016  -34.036 50.693  1.00 60.01  ? 352 LYS H C   1 
ATOM   8137 O O   . LYS H 2 262 ? 11.977  -34.358 51.395  1.00 58.99  ? 352 LYS H O   1 
ATOM   8138 C CB  . LYS H 2 262 ? 11.486  -32.100 49.152  1.00 54.17  ? 352 LYS H CB  1 
ATOM   8139 C CG  . LYS H 2 262 ? 12.149  -31.667 47.846  1.00 58.22  ? 352 LYS H CG  1 
ATOM   8140 C CD  . LYS H 2 262 ? 12.241  -30.158 47.723  1.00 59.75  ? 352 LYS H CD  1 
ATOM   8141 C CE  . LYS H 2 262 ? 12.943  -29.750 46.449  1.00 57.64  ? 352 LYS H CE  1 
ATOM   8142 N NZ  . LYS H 2 262 ? 13.145  -28.280 46.378  1.00 62.40  ? 352 LYS H NZ  1 
ATOM   8143 N N   . HIS H 2 263 ? 9.732   -34.043 51.131  1.00 59.83  ? 353 HIS H N   1 
ATOM   8144 C CA  . HIS H 2 263 ? 9.307   -34.434 52.481  1.00 60.85  ? 353 HIS H CA  1 
ATOM   8145 C C   . HIS H 2 263 ? 9.535   -35.938 52.690  1.00 65.64  ? 353 HIS H C   1 
ATOM   8146 O O   . HIS H 2 263 ? 9.816   -36.364 53.814  1.00 65.41  ? 353 HIS H O   1 
ATOM   8147 C CB  . HIS H 2 263 ? 7.843   -34.036 52.738  1.00 62.03  ? 353 HIS H CB  1 
ATOM   8148 C CG  . HIS H 2 263 ? 7.381   -34.263 54.144  1.00 65.87  ? 353 HIS H CG  1 
ATOM   8149 N ND1 . HIS H 2 263 ? 8.058   -33.724 55.230  1.00 67.86  ? 353 HIS H ND1 1 
ATOM   8150 C CD2 . HIS H 2 263 ? 6.312   -34.955 54.597  1.00 67.95  ? 353 HIS H CD2 1 
ATOM   8151 C CE1 . HIS H 2 263 ? 7.387   -34.117 56.300  1.00 67.40  ? 353 HIS H CE1 1 
ATOM   8152 N NE2 . HIS H 2 263 ? 6.327   -34.854 55.971  1.00 67.82  ? 353 HIS H NE2 1 
ATOM   8153 N N   . ALA H 2 264 ? 9.518   -36.720 51.590  1.00 62.65  ? 354 ALA H N   1 
ATOM   8154 C CA  . ALA H 2 264 ? 9.819   -38.150 51.606  1.00 62.56  ? 354 ALA H CA  1 
ATOM   8155 C C   . ALA H 2 264 ? 11.364  -38.365 51.515  1.00 66.47  ? 354 ALA H C   1 
ATOM   8156 O O   . ALA H 2 264 ? 11.881  -38.874 50.514  1.00 65.99  ? 354 ALA H O   1 
ATOM   8157 C CB  . ALA H 2 264 ? 9.089   -38.846 50.467  1.00 63.28  ? 354 ALA H CB  1 
ATOM   8158 N N   . ALA H 2 265 ? 12.089  -37.928 52.573  1.00 62.86  ? 355 ALA H N   1 
ATOM   8159 C CA  . ALA H 2 265 ? 13.544  -38.022 52.722  1.00 62.76  ? 355 ALA H CA  1 
ATOM   8160 C C   . ALA H 2 265 ? 13.931  -37.977 54.210  1.00 67.61  ? 355 ALA H C   1 
ATOM   8161 O O   . ALA H 2 265 ? 13.682  -36.970 54.876  1.00 67.32  ? 355 ALA H O   1 
ATOM   8162 C CB  . ALA H 2 265 ? 14.228  -36.895 51.959  1.00 63.47  ? 355 ALA H CB  1 
ATOM   8163 N N   . GLN H 2 266 ? 14.514  -39.084 54.730  1.00 64.49  ? 356 GLN H N   1 
ATOM   8164 C CA  . GLN H 2 266 ? 14.926  -39.235 56.130  1.00 91.27  ? 356 GLN H CA  1 
ATOM   8165 C C   . GLN H 2 266 ? 16.451  -39.287 56.260  1.00 113.25 ? 356 GLN H C   1 
ATOM   8166 O O   . GLN H 2 266 ? 16.998  -38.953 57.312  1.00 72.96  ? 356 GLN H O   1 
ATOM   8167 C CB  . GLN H 2 266 ? 14.303  -40.503 56.735  1.00 92.63  ? 356 GLN H CB  1 
HETATM 8168 O O   . HOH I 3 .   ? -30.390 26.366  56.197  1.00 38.65  ? 801 HOH A O   1 
HETATM 8169 O O   . HOH I 3 .   ? -43.113 31.873  63.308  1.00 45.04  ? 802 HOH A O   1 
HETATM 8170 O O   . HOH I 3 .   ? -40.002 17.365  54.986  1.00 18.09  ? 803 HOH A O   1 
HETATM 8171 O O   . HOH I 3 .   ? -41.039 20.309  60.183  1.00 24.48  ? 804 HOH A O   1 
HETATM 8172 O O   . HOH I 3 .   ? -34.185 17.255  64.317  1.00 32.50  ? 805 HOH A O   1 
HETATM 8173 O O   . HOH I 3 .   ? -28.764 20.452  63.924  1.00 44.22  ? 806 HOH A O   1 
HETATM 8174 O O   . HOH I 3 .   ? -43.353 24.050  68.373  1.00 25.55  ? 807 HOH A O   1 
HETATM 8175 O O   . HOH I 3 .   ? -46.308 26.250  70.931  1.00 24.58  ? 808 HOH A O   1 
HETATM 8176 O O   . HOH I 3 .   ? -28.526 24.007  64.114  1.00 51.27  ? 809 HOH A O   1 
HETATM 8177 O O   . HOH I 3 .   ? -44.024 20.122  60.351  1.00 26.85  ? 810 HOH A O   1 
HETATM 8178 O O   . HOH I 3 .   ? -40.712 12.599  66.146  1.00 37.27  ? 811 HOH A O   1 
HETATM 8179 O O   . HOH I 3 .   ? -28.816 24.659  66.950  1.00 29.86  ? 812 HOH A O   1 
HETATM 8180 O O   . HOH J 3 .   ? -37.589 17.872  -4.119  1.00 19.64  ? 801 HOH B O   1 
HETATM 8181 O O   . HOH J 3 .   ? -38.941 15.799  -8.939  1.00 31.79  ? 802 HOH B O   1 
HETATM 8182 O O   . HOH J 3 .   ? -39.522 3.472   -17.097 1.00 31.86  ? 803 HOH B O   1 
HETATM 8183 O O   . HOH J 3 .   ? -36.927 3.158   -15.136 1.00 46.07  ? 804 HOH B O   1 
HETATM 8184 O O   . HOH J 3 .   ? -42.957 8.497   -14.786 1.00 38.75  ? 805 HOH B O   1 
HETATM 8185 O O   . HOH J 3 .   ? -36.749 16.998  -11.727 1.00 43.69  ? 806 HOH B O   1 
HETATM 8186 O O   . HOH J 3 .   ? -31.089 10.312  -13.277 1.00 28.03  ? 807 HOH B O   1 
HETATM 8187 O O   . HOH J 3 .   ? -39.177 15.919  -6.225  1.00 6.36   ? 808 HOH B O   1 
HETATM 8188 O O   . HOH J 3 .   ? -34.502 20.876  -13.263 1.00 31.56  ? 809 HOH B O   1 
HETATM 8189 O O   . HOH J 3 .   ? -30.722 12.927  -16.143 1.00 38.71  ? 810 HOH B O   1 
HETATM 8190 O O   . HOH J 3 .   ? -29.576 7.354   -12.385 1.00 51.91  ? 811 HOH B O   1 
HETATM 8191 O O   . HOH J 3 .   ? -37.600 12.883  -13.318 1.00 27.38  ? 812 HOH B O   1 
HETATM 8192 O O   . HOH J 3 .   ? -35.142 5.065   -14.016 1.00 34.71  ? 813 HOH B O   1 
HETATM 8193 O O   . HOH J 3 .   ? -40.899 11.641  -14.233 1.00 56.53  ? 814 HOH B O   1 
HETATM 8194 O O   . HOH J 3 .   ? -43.941 13.840  -10.470 1.00 42.10  ? 815 HOH B O   1 
HETATM 8195 O O   . HOH J 3 .   ? -43.801 11.267  -18.202 1.00 44.18  ? 816 HOH B O   1 
HETATM 8196 O O   . HOH J 3 .   ? -45.503 7.623   -18.539 1.00 37.59  ? 817 HOH B O   1 
HETATM 8197 O O   . HOH J 3 .   ? -29.791 4.432   -19.250 1.00 27.77  ? 818 HOH B O   1 
HETATM 8198 O O   . HOH J 3 .   ? -33.524 11.998  -22.900 1.00 33.46  ? 819 HOH B O   1 
HETATM 8199 O O   . HOH J 3 .   ? -47.679 7.757   -16.651 1.00 42.27  ? 820 HOH B O   1 
HETATM 8200 O O   . HOH J 3 .   ? -47.219 4.923   -22.437 1.00 30.57  ? 821 HOH B O   1 
HETATM 8201 O O   . HOH J 3 .   ? -41.244 14.602  -23.340 1.00 43.61  ? 822 HOH B O   1 
HETATM 8202 O O   . HOH J 3 .   ? -50.680 5.243   -19.556 1.00 29.81  ? 823 HOH B O   1 
HETATM 8203 O O   . HOH J 3 .   ? -46.514 15.244  -24.671 1.00 34.59  ? 824 HOH B O   1 
HETATM 8204 O O   . HOH K 3 .   ? 0.262   -1.076  -9.230  1.00 24.76  ? 801 HOH C O   1 
HETATM 8205 O O   . HOH K 3 .   ? 1.480   -12.054 -10.401 1.00 26.07  ? 802 HOH C O   1 
HETATM 8206 O O   . HOH K 3 .   ? -9.456  0.219   -6.524  1.00 10.00  ? 803 HOH C O   1 
HETATM 8207 O O   . HOH K 3 .   ? 1.680   -6.113  -6.607  1.00 21.87  ? 804 HOH C O   1 
HETATM 8208 O O   . HOH K 3 .   ? 0.671   -8.421  -4.409  1.00 5.88   ? 805 HOH C O   1 
HETATM 8209 O O   . HOH K 3 .   ? -1.613  -8.610  -12.980 1.00 52.96  ? 806 HOH C O   1 
HETATM 8210 O O   . HOH K 3 .   ? 0.108   -3.336  -13.189 1.00 21.66  ? 807 HOH C O   1 
HETATM 8211 O O   . HOH K 3 .   ? -5.459  1.854   -11.704 1.00 61.49  ? 808 HOH C O   1 
HETATM 8212 O O   . HOH K 3 .   ? 2.847   3.063   -14.937 1.00 35.33  ? 809 HOH C O   1 
HETATM 8213 O O   . HOH K 3 .   ? 1.253   -14.841 -10.153 1.00 26.09  ? 810 HOH C O   1 
HETATM 8214 O O   . HOH K 3 .   ? 4.669   1.112   -14.469 1.00 33.22  ? 811 HOH C O   1 
HETATM 8215 O O   . HOH K 3 .   ? 2.197   -5.795  -10.135 1.00 16.46  ? 812 HOH C O   1 
HETATM 8216 O O   . HOH K 3 .   ? -5.763  -0.221  -13.961 1.00 24.49  ? 813 HOH C O   1 
HETATM 8217 O O   . HOH K 3 .   ? 4.436   -1.887  -13.157 1.00 43.20  ? 814 HOH C O   1 
HETATM 8218 O O   . HOH K 3 .   ? 3.265   -3.094  -9.079  1.00 53.44  ? 815 HOH C O   1 
HETATM 8219 O O   . HOH K 3 .   ? -3.392  -0.454  -15.867 1.00 35.35  ? 816 HOH C O   1 
HETATM 8220 O O   . HOH K 3 .   ? 1.398   -2.062  -15.824 1.00 23.85  ? 817 HOH C O   1 
HETATM 8221 O O   . HOH K 3 .   ? -1.457  -12.170 -13.674 1.00 22.37  ? 818 HOH C O   1 
HETATM 8222 O O   . HOH K 3 .   ? 0.908   -10.566 -14.818 1.00 31.92  ? 819 HOH C O   1 
HETATM 8223 O O   . HOH K 3 .   ? 6.156   1.469   -16.729 1.00 62.05  ? 820 HOH C O   1 
HETATM 8224 O O   . HOH L 3 .   ? 6.704   -16.715 44.432  1.00 57.94  ? 801 HOH D O   1 
HETATM 8225 O O   . HOH L 3 .   ? -1.706  -6.045  42.326  1.00 56.27  ? 802 HOH D O   1 
HETATM 8226 O O   . HOH L 3 .   ? 0.258   -16.893 34.175  1.00 30.64  ? 803 HOH D O   1 
HETATM 8227 O O   . HOH M 3 .   ? 12.422  -26.517 -2.087  1.00 17.53  ? 401 HOH E O   1 
HETATM 8228 O O   . HOH M 3 .   ? -15.939 -24.588 -0.649  1.00 13.43  ? 402 HOH E O   1 
HETATM 8229 O O   . HOH M 3 .   ? -28.373 -38.683 -12.292 1.00 17.41  ? 403 HOH E O   1 
HETATM 8230 O O   . HOH M 3 .   ? -11.478 -36.308 -10.762 1.00 17.42  ? 404 HOH E O   1 
HETATM 8231 O O   . HOH M 3 .   ? -1.627  -24.798 -10.209 1.00 22.11  ? 405 HOH E O   1 
HETATM 8232 O O   . HOH M 3 .   ? -21.577 -28.528 -4.949  1.00 34.93  ? 406 HOH E O   1 
HETATM 8233 O O   . HOH M 3 .   ? 4.429   0.906   4.795   1.00 18.69  ? 407 HOH E O   1 
HETATM 8234 O O   . HOH M 3 .   ? -12.808 -19.031 -11.673 1.00 25.70  ? 408 HOH E O   1 
HETATM 8235 O O   . HOH M 3 .   ? -18.105 5.686   1.305   1.00 17.32  ? 409 HOH E O   1 
HETATM 8236 O O   . HOH M 3 .   ? -26.550 -42.210 -14.047 1.00 18.08  ? 410 HOH E O   1 
HETATM 8237 O O   . HOH M 3 .   ? 3.090   9.991   3.857   1.00 13.31  ? 411 HOH E O   1 
HETATM 8238 O O   . HOH M 3 .   ? -21.260 -18.223 -11.685 1.00 17.69  ? 412 HOH E O   1 
HETATM 8239 O O   . HOH M 3 .   ? -22.962 -16.616 -19.313 1.00 19.13  ? 413 HOH E O   1 
HETATM 8240 O O   . HOH M 3 .   ? -11.735 -30.582 -0.971  1.00 26.68  ? 414 HOH E O   1 
HETATM 8241 O O   . HOH M 3 .   ? -15.348 -19.389 -5.724  1.00 14.51  ? 415 HOH E O   1 
HETATM 8242 O O   . HOH M 3 .   ? -16.281 -28.205 -1.095  1.00 23.90  ? 416 HOH E O   1 
HETATM 8243 O O   . HOH M 3 .   ? -33.953 -24.675 -11.814 1.00 46.30  ? 417 HOH E O   1 
HETATM 8244 O O   . HOH M 3 .   ? -10.512 9.300   -2.365  1.00 23.30  ? 418 HOH E O   1 
HETATM 8245 O O   . HOH M 3 .   ? -14.506 -18.918 -13.685 1.00 11.43  ? 419 HOH E O   1 
HETATM 8246 O O   . HOH M 3 .   ? 9.252   -34.653 11.350  1.00 46.26  ? 420 HOH E O   1 
HETATM 8247 O O   . HOH M 3 .   ? -40.696 -27.144 -12.254 1.00 28.73  ? 421 HOH E O   1 
HETATM 8248 O O   . HOH M 3 .   ? 6.697   5.956   0.353   1.00 13.25  ? 422 HOH E O   1 
HETATM 8249 O O   . HOH M 3 .   ? 12.374  -28.171 6.837   1.00 22.00  ? 423 HOH E O   1 
HETATM 8250 O O   . HOH M 3 .   ? -27.108 -29.727 -6.240  1.00 19.09  ? 424 HOH E O   1 
HETATM 8251 O O   . HOH M 3 .   ? 4.684   -2.556  7.701   1.00 23.33  ? 425 HOH E O   1 
HETATM 8252 O O   . HOH M 3 .   ? 3.271   -28.816 2.935   1.00 41.39  ? 426 HOH E O   1 
HETATM 8253 O O   . HOH M 3 .   ? -17.144 -24.648 -10.746 1.00 12.08  ? 427 HOH E O   1 
HETATM 8254 O O   . HOH M 3 .   ? -16.820 -14.280 -0.487  1.00 9.64   ? 428 HOH E O   1 
HETATM 8255 O O   . HOH M 3 .   ? 6.856   -31.441 2.796   1.00 33.34  ? 429 HOH E O   1 
HETATM 8256 O O   . HOH M 3 .   ? -17.880 -2.491  -6.515  1.00 18.55  ? 430 HOH E O   1 
HETATM 8257 O O   . HOH M 3 .   ? -36.358 -29.612 -8.023  1.00 24.73  ? 431 HOH E O   1 
HETATM 8258 O O   . HOH M 3 .   ? -10.406 -3.651  -6.172  1.00 9.41   ? 432 HOH E O   1 
HETATM 8259 O O   . HOH M 3 .   ? -12.865 -21.500 -5.875  1.00 11.35  ? 433 HOH E O   1 
HETATM 8260 O O   . HOH M 3 .   ? -6.483  -32.727 8.534   1.00 65.38  ? 434 HOH E O   1 
HETATM 8261 O O   . HOH M 3 .   ? -29.854 -15.392 -19.183 1.00 33.51  ? 435 HOH E O   1 
HETATM 8262 O O   . HOH M 3 .   ? 7.712   -31.001 -1.827  1.00 29.11  ? 436 HOH E O   1 
HETATM 8263 O O   . HOH M 3 .   ? -22.476 -13.946 -19.477 1.00 18.08  ? 437 HOH E O   1 
HETATM 8264 O O   . HOH M 3 .   ? -19.340 3.204   0.756   1.00 41.53  ? 438 HOH E O   1 
HETATM 8265 O O   . HOH M 3 .   ? -16.216 -25.869 -8.048  1.00 10.36  ? 439 HOH E O   1 
HETATM 8266 O O   . HOH M 3 .   ? 8.392   -30.656 0.781   1.00 17.99  ? 440 HOH E O   1 
HETATM 8267 O O   . HOH M 3 .   ? -9.293  -27.170 -18.731 1.00 26.40  ? 441 HOH E O   1 
HETATM 8268 O O   . HOH M 3 .   ? 9.196   -9.776  3.816   1.00 50.41  ? 442 HOH E O   1 
HETATM 8269 O O   . HOH M 3 .   ? -10.796 12.731  -8.638  1.00 37.21  ? 443 HOH E O   1 
HETATM 8270 O O   . HOH M 3 .   ? 1.834   -3.737  -5.484  1.00 16.67  ? 444 HOH E O   1 
HETATM 8271 O O   . HOH M 3 .   ? -20.471 -10.704 -14.164 1.00 25.51  ? 445 HOH E O   1 
HETATM 8272 O O   . HOH M 3 .   ? -9.736  -35.238 2.689   1.00 51.68  ? 446 HOH E O   1 
HETATM 8273 O O   . HOH M 3 .   ? -26.622 -12.180 -15.754 1.00 21.40  ? 447 HOH E O   1 
HETATM 8274 O O   . HOH M 3 .   ? 6.855   -11.049 1.100   1.00 14.54  ? 448 HOH E O   1 
HETATM 8275 O O   . HOH M 3 .   ? -22.679 -16.888 -9.849  1.00 16.85  ? 449 HOH E O   1 
HETATM 8276 O O   . HOH M 3 .   ? -19.132 -33.757 -22.817 1.00 26.05  ? 450 HOH E O   1 
HETATM 8277 O O   . HOH M 3 .   ? -17.526 -22.539 -1.506  1.00 12.65  ? 451 HOH E O   1 
HETATM 8278 O O   . HOH M 3 .   ? -10.688 -25.782 -10.629 1.00 28.20  ? 452 HOH E O   1 
HETATM 8279 O O   . HOH M 3 .   ? -19.724 -51.341 -14.276 1.00 23.37  ? 453 HOH E O   1 
HETATM 8280 O O   . HOH M 3 .   ? 6.426   -31.800 11.429  1.00 31.84  ? 454 HOH E O   1 
HETATM 8281 O O   . HOH M 3 .   ? -27.524 -36.413 -5.488  1.00 13.13  ? 455 HOH E O   1 
HETATM 8282 O O   . HOH M 3 .   ? -3.386  -23.671 9.981   1.00 36.14  ? 456 HOH E O   1 
HETATM 8283 O O   . HOH M 3 .   ? 6.374   7.211   -11.581 1.00 21.43  ? 457 HOH E O   1 
HETATM 8284 O O   . HOH M 3 .   ? -22.750 -40.607 -3.163  1.00 21.19  ? 458 HOH E O   1 
HETATM 8285 O O   . HOH M 3 .   ? -17.399 -22.779 -19.304 1.00 18.15  ? 459 HOH E O   1 
HETATM 8286 O O   . HOH M 3 .   ? 4.626   -11.592 -3.236  1.00 8.58   ? 460 HOH E O   1 
HETATM 8287 O O   . HOH M 3 .   ? -3.398  -7.474  -6.216  1.00 14.34  ? 461 HOH E O   1 
HETATM 8288 O O   . HOH M 3 .   ? 5.335   -18.167 -5.306  1.00 23.38  ? 462 HOH E O   1 
HETATM 8289 O O   . HOH M 3 .   ? -31.795 -35.389 -14.738 1.00 15.59  ? 463 HOH E O   1 
HETATM 8290 O O   . HOH M 3 .   ? -8.752  -26.455 -1.657  1.00 36.92  ? 464 HOH E O   1 
HETATM 8291 O O   . HOH M 3 .   ? -14.019 0.361   -6.113  1.00 23.21  ? 465 HOH E O   1 
HETATM 8292 O O   . HOH M 3 .   ? -40.205 -37.900 -18.342 1.00 41.79  ? 466 HOH E O   1 
HETATM 8293 O O   . HOH M 3 .   ? -0.910  -14.849 -12.441 1.00 50.75  ? 467 HOH E O   1 
HETATM 8294 O O   . HOH M 3 .   ? -7.989  -35.741 -12.862 1.00 39.39  ? 468 HOH E O   1 
HETATM 8295 O O   . HOH M 3 .   ? -18.479 10.690  -4.722  1.00 43.73  ? 469 HOH E O   1 
HETATM 8296 O O   . HOH M 3 .   ? 5.430   -26.243 6.234   1.00 41.63  ? 470 HOH E O   1 
HETATM 8297 O O   . HOH M 3 .   ? -34.445 -24.273 -5.134  1.00 30.62  ? 471 HOH E O   1 
HETATM 8298 O O   . HOH M 3 .   ? -16.072 7.679   -6.899  1.00 30.79  ? 472 HOH E O   1 
HETATM 8299 O O   . HOH M 3 .   ? 5.017   -15.199 -9.572  1.00 31.86  ? 473 HOH E O   1 
HETATM 8300 O O   . HOH M 3 .   ? -0.606  -29.378 8.320   1.00 46.23  ? 474 HOH E O   1 
HETATM 8301 O O   . HOH M 3 .   ? -25.474 -34.566 -4.286  1.00 21.61  ? 475 HOH E O   1 
HETATM 8302 O O   . HOH M 3 .   ? -28.628 -16.000 -24.407 1.00 38.50  ? 476 HOH E O   1 
HETATM 8303 O O   . HOH M 3 .   ? 8.258   -13.229 1.937   1.00 13.00  ? 477 HOH E O   1 
HETATM 8304 O O   . HOH M 3 .   ? -1.305  -15.571 7.529   1.00 32.26  ? 478 HOH E O   1 
HETATM 8305 O O   . HOH M 3 .   ? -11.201 -26.741 -0.578  1.00 34.81  ? 479 HOH E O   1 
HETATM 8306 O O   . HOH M 3 .   ? 7.913   -3.937  0.709   1.00 17.81  ? 480 HOH E O   1 
HETATM 8307 O O   . HOH M 3 .   ? -14.184 -23.678 -23.464 1.00 36.79  ? 481 HOH E O   1 
HETATM 8308 O O   . HOH M 3 .   ? -36.095 -36.401 -25.908 1.00 60.27  ? 482 HOH E O   1 
HETATM 8309 O O   . HOH M 3 .   ? -28.643 -41.086 -10.448 1.00 28.41  ? 483 HOH E O   1 
HETATM 8310 O O   . HOH M 3 .   ? -9.141  6.658   -8.350  1.00 29.29  ? 484 HOH E O   1 
HETATM 8311 O O   . HOH M 3 .   ? -9.813  -3.752  10.340  1.00 23.25  ? 485 HOH E O   1 
HETATM 8312 O O   . HOH M 3 .   ? 6.456   -33.691 8.021   1.00 31.38  ? 486 HOH E O   1 
HETATM 8313 O O   . HOH M 3 .   ? -9.630  -30.262 0.737   1.00 39.67  ? 487 HOH E O   1 
HETATM 8314 O O   . HOH M 3 .   ? -10.953 -41.258 -3.372  1.00 25.43  ? 488 HOH E O   1 
HETATM 8315 O O   . HOH M 3 .   ? -13.878 -19.386 -20.828 1.00 25.84  ? 489 HOH E O   1 
HETATM 8316 O O   . HOH M 3 .   ? 16.629  -25.385 2.831   1.00 41.52  ? 490 HOH E O   1 
HETATM 8317 O O   . HOH M 3 .   ? -8.895  -28.067 -7.112  1.00 37.47  ? 491 HOH E O   1 
HETATM 8318 O O   . HOH M 3 .   ? -14.689 7.281   -9.909  1.00 28.64  ? 492 HOH E O   1 
HETATM 8319 O O   . HOH M 3 .   ? -15.574 -5.100  -14.396 1.00 30.64  ? 493 HOH E O   1 
HETATM 8320 O O   . HOH M 3 .   ? 9.616   -26.884 7.809   1.00 26.06  ? 494 HOH E O   1 
HETATM 8321 O O   . HOH M 3 .   ? -2.300  -29.804 -5.620  1.00 26.82  ? 495 HOH E O   1 
HETATM 8322 O O   . HOH M 3 .   ? 7.451   -12.173 4.190   1.00 24.66  ? 496 HOH E O   1 
HETATM 8323 O O   . HOH M 3 .   ? -13.166 21.417  -2.285  1.00 32.30  ? 497 HOH E O   1 
HETATM 8324 O O   . HOH M 3 .   ? -25.999 -48.761 -15.117 1.00 24.56  ? 498 HOH E O   1 
HETATM 8325 O O   . HOH M 3 .   ? -6.228  -37.656 7.461   1.00 45.90  ? 499 HOH E O   1 
HETATM 8326 O O   . HOH M 3 .   ? -16.205 -35.035 1.581   1.00 38.53  ? 500 HOH E O   1 
HETATM 8327 O O   . HOH M 3 .   ? -19.113 -7.106  1.988   1.00 27.98  ? 501 HOH E O   1 
HETATM 8328 O O   . HOH M 3 .   ? 0.453   -6.937  14.064  1.00 36.52  ? 502 HOH E O   1 
HETATM 8329 O O   . HOH M 3 .   ? -3.446  14.865  -7.160  1.00 37.49  ? 503 HOH E O   1 
HETATM 8330 O O   . HOH M 3 .   ? -29.884 -15.469 -22.061 1.00 29.64  ? 504 HOH E O   1 
HETATM 8331 O O   . HOH M 3 .   ? -26.077 -12.552 -24.875 1.00 42.63  ? 505 HOH E O   1 
HETATM 8332 O O   . HOH M 3 .   ? -7.740  -11.488 5.570   1.00 21.21  ? 506 HOH E O   1 
HETATM 8333 O O   . HOH M 3 .   ? -21.588 -15.054 -12.423 1.00 23.94  ? 507 HOH E O   1 
HETATM 8334 O O   . HOH M 3 .   ? -14.794 -42.774 -8.039  1.00 26.91  ? 508 HOH E O   1 
HETATM 8335 O O   . HOH M 3 .   ? -13.525 -28.961 -25.466 1.00 58.09  ? 509 HOH E O   1 
HETATM 8336 O O   . HOH M 3 .   ? -4.405  -15.779 -13.176 1.00 27.42  ? 510 HOH E O   1 
HETATM 8337 O O   . HOH M 3 .   ? -15.032 24.263  -6.575  1.00 29.34  ? 511 HOH E O   1 
HETATM 8338 O O   . HOH M 3 .   ? 10.681  -34.420 7.600   1.00 22.43  ? 512 HOH E O   1 
HETATM 8339 O O   . HOH M 3 .   ? 2.802   -29.302 14.953  1.00 33.97  ? 513 HOH E O   1 
HETATM 8340 O O   . HOH M 3 .   ? -12.933 -43.523 0.038   1.00 36.23  ? 514 HOH E O   1 
HETATM 8341 O O   . HOH M 3 .   ? -37.692 -18.773 -15.658 1.00 50.79  ? 515 HOH E O   1 
HETATM 8342 O O   . HOH M 3 .   ? -32.640 -37.355 -16.252 1.00 29.24  ? 516 HOH E O   1 
HETATM 8343 O O   . HOH M 3 .   ? -8.445  -20.480 -14.153 1.00 36.50  ? 517 HOH E O   1 
HETATM 8344 O O   . HOH M 3 .   ? -22.299 -34.011 -0.631  1.00 17.87  ? 518 HOH E O   1 
HETATM 8345 O O   . HOH M 3 .   ? 6.065   3.285   1.782   1.00 23.74  ? 519 HOH E O   1 
HETATM 8346 O O   . HOH M 3 .   ? -18.088 16.772  2.132   1.00 23.97  ? 520 HOH E O   1 
HETATM 8347 O O   . HOH M 3 .   ? 3.266   -34.536 3.134   1.00 25.50  ? 521 HOH E O   1 
HETATM 8348 O O   . HOH M 3 .   ? -19.739 23.994  4.431   1.00 31.79  ? 522 HOH E O   1 
HETATM 8349 O O   . HOH M 3 .   ? -17.591 -4.593  7.648   1.00 35.92  ? 523 HOH E O   1 
HETATM 8350 O O   . HOH M 3 .   ? -20.374 -1.137  9.066   1.00 44.25  ? 524 HOH E O   1 
HETATM 8351 O O   . HOH M 3 .   ? -16.045 16.675  5.374   1.00 42.09  ? 525 HOH E O   1 
HETATM 8352 O O   . HOH M 3 .   ? -6.833  -37.000 -3.788  1.00 36.19  ? 526 HOH E O   1 
HETATM 8353 O O   . HOH M 3 .   ? -21.061 -11.537 -6.595  1.00 29.25  ? 527 HOH E O   1 
HETATM 8354 O O   . HOH M 3 .   ? -18.815 -49.541 -6.788  1.00 27.83  ? 528 HOH E O   1 
HETATM 8355 O O   . HOH M 3 .   ? 0.440   13.427  4.495   1.00 46.72  ? 529 HOH E O   1 
HETATM 8356 O O   . HOH M 3 .   ? 9.990   12.255  -2.643  1.00 45.78  ? 530 HOH E O   1 
HETATM 8357 O O   . HOH M 3 .   ? -8.314  -2.142  -6.080  1.00 8.03   ? 531 HOH E O   1 
HETATM 8358 O O   . HOH M 3 .   ? -25.342 -42.013 -5.294  1.00 23.18  ? 532 HOH E O   1 
HETATM 8359 O O   . HOH M 3 .   ? -17.981 -26.702 -27.653 1.00 50.37  ? 533 HOH E O   1 
HETATM 8360 O O   . HOH M 3 .   ? 4.420   -2.962  -5.229  1.00 20.21  ? 534 HOH E O   1 
HETATM 8361 O O   . HOH M 3 .   ? -40.726 -34.658 -20.501 1.00 38.53  ? 535 HOH E O   1 
HETATM 8362 O O   . HOH M 3 .   ? -18.693 -34.184 2.419   1.00 37.59  ? 536 HOH E O   1 
HETATM 8363 O O   . HOH M 3 .   ? -12.946 -6.155  -12.792 1.00 35.35  ? 537 HOH E O   1 
HETATM 8364 O O   . HOH M 3 .   ? 10.271  7.871   -6.841  1.00 52.14  ? 538 HOH E O   1 
HETATM 8365 O O   . HOH M 3 .   ? -7.336  -37.793 0.320   1.00 19.16  ? 539 HOH E O   1 
HETATM 8366 O O   . HOH M 3 .   ? -17.421 -17.989 -27.817 1.00 30.56  ? 540 HOH E O   1 
HETATM 8367 O O   . HOH M 3 .   ? -13.849 -35.635 0.206   1.00 8.07   ? 541 HOH E O   1 
HETATM 8368 O O   . HOH M 3 .   ? -15.688 -7.627  9.724   1.00 32.27  ? 542 HOH E O   1 
HETATM 8369 O O   . HOH M 3 .   ? -8.698  11.808  13.264  1.00 45.54  ? 543 HOH E O   1 
HETATM 8370 O O   . HOH M 3 .   ? -8.316  -30.971 4.808   1.00 33.77  ? 544 HOH E O   1 
HETATM 8371 O O   . HOH M 3 .   ? -33.052 -40.533 -16.239 1.00 41.01  ? 545 HOH E O   1 
HETATM 8372 O O   . HOH M 3 .   ? 2.927   6.827   -15.835 1.00 51.87  ? 546 HOH E O   1 
HETATM 8373 O O   . HOH M 3 .   ? -22.324 -15.422 -7.215  1.00 36.04  ? 547 HOH E O   1 
HETATM 8374 O O   . HOH M 3 .   ? 4.501   -20.569 -8.847  1.00 29.33  ? 548 HOH E O   1 
HETATM 8375 O O   . HOH M 3 .   ? -1.659  6.822   8.429   1.00 35.51  ? 549 HOH E O   1 
HETATM 8376 O O   . HOH M 3 .   ? -18.048 -0.523  -4.668  1.00 41.94  ? 550 HOH E O   1 
HETATM 8377 O O   . HOH M 3 .   ? -8.053  4.494   -13.366 1.00 26.87  ? 551 HOH E O   1 
HETATM 8378 O O   . HOH M 3 .   ? 6.292   6.570   -15.795 1.00 29.64  ? 552 HOH E O   1 
HETATM 8379 O O   . HOH M 3 .   ? 3.099   -9.300  -3.931  1.00 22.99  ? 553 HOH E O   1 
HETATM 8380 O O   . HOH M 3 .   ? -32.316 -41.454 -18.669 1.00 31.21  ? 554 HOH E O   1 
HETATM 8381 O O   . HOH M 3 .   ? -11.850 -10.575 7.369   1.00 35.69  ? 555 HOH E O   1 
HETATM 8382 O O   . HOH M 3 .   ? 3.088   5.355   -13.515 1.00 29.82  ? 556 HOH E O   1 
HETATM 8383 O O   . HOH M 3 .   ? -38.966 -27.855 -18.237 1.00 43.74  ? 557 HOH E O   1 
HETATM 8384 O O   . HOH M 3 .   ? -7.892  -27.131 -13.861 1.00 43.49  ? 558 HOH E O   1 
HETATM 8385 O O   . HOH M 3 .   ? -7.643  2.498   10.511  1.00 42.62  ? 559 HOH E O   1 
HETATM 8386 O O   . HOH M 3 .   ? -12.386 -20.618 5.057   1.00 44.07  ? 560 HOH E O   1 
HETATM 8387 O O   . HOH M 3 .   ? -26.061 -48.883 -10.995 1.00 39.77  ? 561 HOH E O   1 
HETATM 8388 O O   . HOH M 3 .   ? -30.047 -12.333 -16.236 1.00 51.55  ? 562 HOH E O   1 
HETATM 8389 O O   . HOH M 3 .   ? -4.357  3.374   9.456   1.00 32.73  ? 563 HOH E O   1 
HETATM 8390 O O   . HOH M 3 .   ? -38.837 -31.380 -12.580 1.00 29.77  ? 564 HOH E O   1 
HETATM 8391 O O   . HOH M 3 .   ? -13.105 -42.054 -9.961  1.00 31.71  ? 565 HOH E O   1 
HETATM 8392 O O   . HOH M 3 .   ? -19.353 2.725   -1.930  1.00 27.35  ? 566 HOH E O   1 
HETATM 8393 O O   . HOH M 3 .   ? -9.257  -28.886 -2.798  1.00 41.30  ? 567 HOH E O   1 
HETATM 8394 O O   . HOH M 3 .   ? -11.694 -22.524 -14.801 1.00 22.97  ? 568 HOH E O   1 
HETATM 8395 O O   . HOH M 3 .   ? -38.147 -34.651 -21.896 1.00 57.44  ? 569 HOH E O   1 
HETATM 8396 O O   . HOH M 3 .   ? -16.239 -26.698 -25.608 1.00 34.40  ? 570 HOH E O   1 
HETATM 8397 O O   . HOH M 3 .   ? -26.988 -45.284 -9.641  1.00 48.57  ? 571 HOH E O   1 
HETATM 8398 O O   . HOH M 3 .   ? 11.104  -2.815  -0.715  1.00 35.55  ? 572 HOH E O   1 
HETATM 8399 O O   . HOH M 3 .   ? -21.714 -24.485 0.578   1.00 43.37  ? 573 HOH E O   1 
HETATM 8400 O O   . HOH M 3 .   ? 10.345  -11.739 1.170   1.00 18.70  ? 574 HOH E O   1 
HETATM 8401 O O   . HOH M 3 .   ? 8.096   -26.275 -4.528  1.00 40.62  ? 575 HOH E O   1 
HETATM 8402 O O   . HOH M 3 .   ? -19.061 6.296   7.116   1.00 25.05  ? 576 HOH E O   1 
HETATM 8403 O O   . HOH M 3 .   ? 10.551  -3.438  1.894   1.00 26.69  ? 577 HOH E O   1 
HETATM 8404 O O   . HOH M 3 .   ? -17.103 -45.088 -12.423 1.00 34.13  ? 578 HOH E O   1 
HETATM 8405 O O   . HOH M 3 .   ? -32.639 -22.430 -19.205 1.00 35.04  ? 579 HOH E O   1 
HETATM 8406 O O   . HOH M 3 .   ? -13.042 10.200  -1.667  1.00 13.11  ? 580 HOH E O   1 
HETATM 8407 O O   . HOH M 3 .   ? 4.599   11.892  -2.925  1.00 14.49  ? 581 HOH E O   1 
HETATM 8408 O O   . HOH M 3 .   ? 10.276  -6.294  3.195   1.00 29.48  ? 582 HOH E O   1 
HETATM 8409 O O   . HOH M 3 .   ? 9.916   5.901   -2.395  1.00 25.77  ? 583 HOH E O   1 
HETATM 8410 O O   . HOH M 3 .   ? -19.263 -4.147  -11.564 1.00 23.09  ? 584 HOH E O   1 
HETATM 8411 O O   . HOH M 3 .   ? -13.295 14.056  7.844   1.00 37.20  ? 585 HOH E O   1 
HETATM 8412 O O   . HOH M 3 .   ? -33.026 -14.448 -25.318 1.00 45.80  ? 586 HOH E O   1 
HETATM 8413 O O   . HOH M 3 .   ? -39.780 -29.807 -21.279 1.00 31.67  ? 587 HOH E O   1 
HETATM 8414 O O   . HOH M 3 .   ? -2.269  3.165   -13.379 1.00 15.63  ? 588 HOH E O   1 
HETATM 8415 O O   . HOH M 3 .   ? 5.573   -2.447  10.265  1.00 45.77  ? 589 HOH E O   1 
HETATM 8416 O O   . HOH M 3 .   ? -33.621 -14.371 -15.780 1.00 30.30  ? 590 HOH E O   1 
HETATM 8417 O O   . HOH M 3 .   ? -17.782 -41.240 -5.532  1.00 20.91  ? 591 HOH E O   1 
HETATM 8418 O O   . HOH M 3 .   ? -8.626  -11.802 -19.357 1.00 28.45  ? 592 HOH E O   1 
HETATM 8419 O O   . HOH M 3 .   ? -23.370 -13.718 -10.843 1.00 40.97  ? 593 HOH E O   1 
HETATM 8420 O O   . HOH M 3 .   ? -2.999  -24.157 -12.461 1.00 37.04  ? 594 HOH E O   1 
HETATM 8421 O O   . HOH M 3 .   ? -12.573 20.907  6.715   1.00 57.79  ? 595 HOH E O   1 
HETATM 8422 O O   . HOH M 3 .   ? -13.621 -41.635 -3.442  1.00 31.96  ? 596 HOH E O   1 
HETATM 8423 O O   . HOH M 3 .   ? 6.119   -5.921  -4.527  1.00 26.46  ? 597 HOH E O   1 
HETATM 8424 O O   . HOH M 3 .   ? -11.042 -32.944 2.594   1.00 23.80  ? 598 HOH E O   1 
HETATM 8425 O O   . HOH M 3 .   ? -14.465 -25.345 -31.113 1.00 45.77  ? 599 HOH E O   1 
HETATM 8426 O O   . HOH M 3 .   ? -3.455  -35.922 0.567   1.00 34.66  ? 600 HOH E O   1 
HETATM 8427 O O   . HOH M 3 .   ? -14.889 -22.659 -31.277 1.00 27.47  ? 601 HOH E O   1 
HETATM 8428 O O   . HOH M 3 .   ? -13.950 7.823   -2.670  1.00 19.97  ? 602 HOH E O   1 
HETATM 8429 O O   . HOH M 3 .   ? -3.776  -28.617 -7.977  1.00 7.20   ? 603 HOH E O   1 
HETATM 8430 O O   . HOH M 3 .   ? 4.946   11.980  -0.240  1.00 30.87  ? 604 HOH E O   1 
HETATM 8431 O O   . HOH M 3 .   ? -13.832 -19.089 -16.273 1.00 28.22  ? 605 HOH E O   1 
HETATM 8432 O O   . HOH M 3 .   ? 10.854  5.432   -5.093  1.00 47.55  ? 606 HOH E O   1 
HETATM 8433 O O   . HOH M 3 .   ? 2.704   -17.071 -10.188 1.00 31.96  ? 607 HOH E O   1 
HETATM 8434 O O   . HOH M 3 .   ? -26.751 -45.885 -12.308 1.00 16.98  ? 608 HOH E O   1 
HETATM 8435 O O   . HOH M 3 .   ? 11.767  -23.611 -4.157  1.00 26.73  ? 609 HOH E O   1 
HETATM 8436 O O   . HOH M 3 .   ? -30.159 -22.263 -22.758 1.00 33.77  ? 610 HOH E O   1 
HETATM 8437 O O   . HOH M 3 .   ? -39.196 -37.591 -21.960 1.00 36.74  ? 611 HOH E O   1 
HETATM 8438 O O   . HOH M 3 .   ? -35.569 -28.495 -24.693 1.00 64.13  ? 612 HOH E O   1 
HETATM 8439 O O   . HOH M 3 .   ? -17.213 -44.771 -15.075 1.00 27.51  ? 613 HOH E O   1 
HETATM 8440 O O   . HOH M 3 .   ? -3.930  16.280  -4.828  1.00 34.65  ? 614 HOH E O   1 
HETATM 8441 O O   . HOH M 3 .   ? -15.655 -23.187 -21.313 1.00 37.01  ? 615 HOH E O   1 
HETATM 8442 O O   . HOH M 3 .   ? -6.071  -3.787  11.001  1.00 30.05  ? 616 HOH E O   1 
HETATM 8443 O O   . HOH M 3 .   ? -6.747  20.469  6.284   1.00 28.44  ? 617 HOH E O   1 
HETATM 8444 O O   . HOH M 3 .   ? -17.398 -1.915  7.230   1.00 26.64  ? 618 HOH E O   1 
HETATM 8445 O O   . HOH M 3 .   ? -8.648  -36.059 4.991   1.00 23.35  ? 619 HOH E O   1 
HETATM 8446 O O   . HOH M 3 .   ? -13.389 -32.031 1.520   1.00 36.28  ? 620 HOH E O   1 
HETATM 8447 O O   . HOH M 3 .   ? -2.766  -34.005 -3.944  1.00 18.40  ? 621 HOH E O   1 
HETATM 8448 O O   . HOH M 3 .   ? 5.547   13.581  -11.681 1.00 30.13  ? 622 HOH E O   1 
HETATM 8449 O O   . HOH M 3 .   ? -21.178 -11.319 -11.483 1.00 39.46  ? 623 HOH E O   1 
HETATM 8450 O O   . HOH M 3 .   ? -16.163 22.943  9.204   1.00 51.36  ? 624 HOH E O   1 
HETATM 8451 O O   . HOH M 3 .   ? -11.660 -13.789 4.664   1.00 27.54  ? 625 HOH E O   1 
HETATM 8452 O O   . HOH M 3 .   ? -6.679  -28.787 -11.176 1.00 34.87  ? 626 HOH E O   1 
HETATM 8453 O O   . HOH M 3 .   ? -1.946  -19.233 -16.860 1.00 33.00  ? 627 HOH E O   1 
HETATM 8454 O O   . HOH M 3 .   ? -17.092 6.888   -3.711  1.00 52.07  ? 628 HOH E O   1 
HETATM 8455 O O   . HOH M 3 .   ? -18.017 -47.921 -10.915 1.00 38.64  ? 629 HOH E O   1 
HETATM 8456 O O   . HOH M 3 .   ? -28.455 -4.752  -16.654 1.00 26.03  ? 630 HOH E O   1 
HETATM 8457 O O   . HOH M 3 .   ? -6.916  16.681  3.761   1.00 24.72  ? 631 HOH E O   1 
HETATM 8458 O O   . HOH M 3 .   ? 6.924   3.204   -12.261 1.00 24.27  ? 632 HOH E O   1 
HETATM 8459 O O   . HOH M 3 .   ? -20.253 -0.753  13.760  1.00 45.86  ? 633 HOH E O   1 
HETATM 8460 O O   . HOH M 3 .   ? 3.742   -33.601 13.067  1.00 46.17  ? 634 HOH E O   1 
HETATM 8461 O O   . HOH M 3 .   ? -25.673 -28.940 -4.212  1.00 26.41  ? 635 HOH E O   1 
HETATM 8462 O O   . HOH M 3 .   ? -0.723  14.782  6.552   1.00 19.82  ? 636 HOH E O   1 
HETATM 8463 O O   . HOH M 3 .   ? -11.073 -20.147 -13.903 1.00 31.62  ? 637 HOH E O   1 
HETATM 8464 O O   . HOH M 3 .   ? -22.980 -31.488 -3.407  1.00 43.86  ? 638 HOH E O   1 
HETATM 8465 O O   . HOH M 3 .   ? 4.156   8.214   5.607   1.00 46.21  ? 639 HOH E O   1 
HETATM 8466 O O   . HOH M 3 .   ? -4.189  2.186   12.048  1.00 24.16  ? 640 HOH E O   1 
HETATM 8467 O O   . HOH M 3 .   ? -8.708  8.435   15.771  1.00 31.86  ? 641 HOH E O   1 
HETATM 8468 O O   . HOH M 3 .   ? -24.759 -13.894 -8.494  1.00 39.39  ? 642 HOH E O   1 
HETATM 8469 O O   . HOH M 3 .   ? 2.514   5.225   5.001   1.00 38.14  ? 643 HOH E O   1 
HETATM 8470 O O   . HOH M 3 .   ? -35.449 -16.065 -17.141 1.00 32.13  ? 644 HOH E O   1 
HETATM 8471 O O   . HOH M 3 .   ? -8.506  -23.873 -21.088 1.00 16.39  ? 645 HOH E O   1 
HETATM 8472 O O   . HOH M 3 .   ? -3.639  -28.104 -10.574 1.00 14.28  ? 646 HOH E O   1 
HETATM 8473 O O   . HOH M 3 .   ? 3.080   14.457  -12.708 1.00 26.67  ? 647 HOH E O   1 
HETATM 8474 O O   . HOH M 3 .   ? -38.612 -36.721 -24.491 1.00 36.72  ? 648 HOH E O   1 
HETATM 8475 O O   . HOH M 3 .   ? -4.802  -35.934 -1.792  1.00 59.25  ? 649 HOH E O   1 
HETATM 8476 O O   . HOH M 3 .   ? -22.982 -4.169  -15.777 1.00 40.88  ? 650 HOH E O   1 
HETATM 8477 O O   . HOH M 3 .   ? 0.300   0.148   10.890  1.00 26.58  ? 651 HOH E O   1 
HETATM 8478 O O   . HOH M 3 .   ? -7.944  -26.767 -16.471 1.00 36.52  ? 652 HOH E O   1 
HETATM 8479 O O   . HOH M 3 .   ? -17.499 10.725  7.668   1.00 32.18  ? 653 HOH E O   1 
HETATM 8480 O O   . HOH M 3 .   ? 8.481   12.046  -4.876  1.00 27.22  ? 654 HOH E O   1 
HETATM 8481 O O   . HOH M 3 .   ? -15.073 -12.712 6.359   1.00 30.44  ? 655 HOH E O   1 
HETATM 8482 O O   . HOH M 3 .   ? 10.273  7.737   2.466   1.00 27.07  ? 656 HOH E O   1 
HETATM 8483 O O   . HOH M 3 .   ? -13.403 -0.570  13.573  1.00 22.81  ? 657 HOH E O   1 
HETATM 8484 O O   . HOH M 3 .   ? -3.749  -37.427 2.818   1.00 36.54  ? 658 HOH E O   1 
HETATM 8485 O O   . HOH M 3 .   ? -2.095  6.312   11.224  1.00 47.66  ? 659 HOH E O   1 
HETATM 8486 O O   . HOH M 3 .   ? -11.058 -14.784 7.191   1.00 49.33  ? 660 HOH E O   1 
HETATM 8487 O O   . HOH M 3 .   ? 7.267   11.210  4.157   1.00 22.97  ? 661 HOH E O   1 
HETATM 8488 O O   . HOH M 3 .   ? 4.149   -14.700 -12.448 1.00 33.39  ? 662 HOH E O   1 
HETATM 8489 O O   . HOH M 3 .   ? -7.975  -29.123 7.977   1.00 38.91  ? 663 HOH E O   1 
HETATM 8490 O O   . HOH M 3 .   ? -25.558 -4.960  -15.434 1.00 34.54  ? 664 HOH E O   1 
HETATM 8491 O O   . HOH M 3 .   ? -17.499 9.214   10.357  1.00 21.08  ? 665 HOH E O   1 
HETATM 8492 O O   . HOH M 3 .   ? -16.901 -24.771 1.812   1.00 30.24  ? 666 HOH E O   1 
HETATM 8493 O O   . HOH M 3 .   ? 3.579   -29.004 -9.903  1.00 37.26  ? 667 HOH E O   1 
HETATM 8494 O O   . HOH M 3 .   ? -29.421 -45.490 -12.189 1.00 49.69  ? 668 HOH E O   1 
HETATM 8495 O O   . HOH M 3 .   ? 6.267   6.955   2.870   1.00 11.16  ? 669 HOH E O   1 
HETATM 8496 O O   . HOH M 3 .   ? 11.887  -20.605 -5.835  1.00 26.85  ? 670 HOH E O   1 
HETATM 8497 O O   . HOH M 3 .   ? 5.289   -8.431  -6.184  1.00 30.26  ? 671 HOH E O   1 
HETATM 8498 O O   . HOH M 3 .   ? -7.012  -38.295 2.867   1.00 28.43  ? 672 HOH E O   1 
HETATM 8499 O O   . HOH M 3 .   ? -18.033 24.260  10.694  1.00 41.58  ? 673 HOH E O   1 
HETATM 8500 O O   . HOH M 3 .   ? 4.157   13.805  2.300   1.00 54.35  ? 674 HOH E O   1 
HETATM 8501 O O   . HOH M 3 .   ? -4.175  -30.942 -4.038  1.00 32.63  ? 675 HOH E O   1 
HETATM 8502 O O   . HOH M 3 .   ? -6.814  -30.550 -5.698  1.00 21.81  ? 676 HOH E O   1 
HETATM 8503 O O   . HOH M 3 .   ? -14.858 -44.187 -1.775  1.00 38.01  ? 677 HOH E O   1 
HETATM 8504 O O   . HOH M 3 .   ? -17.585 -12.815 7.904   1.00 48.74  ? 678 HOH E O   1 
HETATM 8505 O O   . HOH M 3 .   ? 3.045   12.593  4.605   1.00 23.11  ? 679 HOH E O   1 
HETATM 8506 O O   . HOH M 3 .   ? -9.420  -24.805 5.925   1.00 32.04  ? 680 HOH E O   1 
HETATM 8507 O O   . HOH M 3 .   ? -13.329 -34.515 2.595   1.00 40.64  ? 681 HOH E O   1 
HETATM 8508 O O   . HOH M 3 .   ? 9.395   5.639   0.252   1.00 18.19  ? 682 HOH E O   1 
HETATM 8509 O O   . HOH M 3 .   ? -11.275 -43.480 -4.867  1.00 36.09  ? 683 HOH E O   1 
HETATM 8510 O O   . HOH M 3 .   ? -11.154 -28.612 3.766   1.00 24.77  ? 684 HOH E O   1 
HETATM 8511 O O   . HOH M 3 .   ? -19.769 -15.328 -28.714 1.00 41.04  ? 685 HOH E O   1 
HETATM 8512 O O   . HOH M 3 .   ? 6.690   -9.442  -8.915  1.00 41.64  ? 686 HOH E O   1 
HETATM 8513 O O   . HOH M 3 .   ? -6.072  -30.254 -15.716 1.00 33.37  ? 687 HOH E O   1 
HETATM 8514 O O   . HOH M 3 .   ? -19.342 -3.982  -8.852  1.00 39.40  ? 688 HOH E O   1 
HETATM 8515 O O   . HOH M 3 .   ? -11.638 11.351  -11.610 1.00 32.69  ? 689 HOH E O   1 
HETATM 8516 O O   . HOH M 3 .   ? 0.579   -15.131 -14.700 1.00 59.02  ? 690 HOH E O   1 
HETATM 8517 O O   . HOH M 3 .   ? 10.427  11.775  -7.032  1.00 19.31  ? 691 HOH E O   1 
HETATM 8518 O O   . HOH M 3 .   ? -8.380  -39.335 7.549   1.00 28.12  ? 692 HOH E O   1 
HETATM 8519 O O   . HOH M 3 .   ? -1.514  -29.961 -10.463 1.00 45.64  ? 693 HOH E O   1 
HETATM 8520 O O   . HOH M 3 .   ? 9.759   11.505  -10.095 1.00 32.99  ? 694 HOH E O   1 
HETATM 8521 O O   . HOH M 3 .   ? -5.116  -24.801 -24.990 1.00 25.52  ? 695 HOH E O   1 
HETATM 8522 O O   . HOH M 3 .   ? -14.061 -46.117 0.376   1.00 35.28  ? 696 HOH E O   1 
HETATM 8523 O O   . HOH M 3 .   ? -43.124 -32.570 -19.591 1.00 30.05  ? 697 HOH E O   1 
HETATM 8524 O O   . HOH M 3 .   ? 10.780  -6.644  -2.338  1.00 37.56  ? 698 HOH E O   1 
HETATM 8525 O O   . HOH M 3 .   ? -14.715 -20.464 8.160   1.00 28.09  ? 699 HOH E O   1 
HETATM 8526 O O   . HOH M 3 .   ? -34.333 -45.963 -20.503 1.00 39.38  ? 700 HOH E O   1 
HETATM 8527 O O   . HOH M 3 .   ? -12.436 19.145  11.583  1.00 30.77  ? 701 HOH E O   1 
HETATM 8528 O O   . HOH M 3 .   ? 6.422   6.248   5.508   1.00 31.64  ? 702 HOH E O   1 
HETATM 8529 O O   . HOH M 3 .   ? 8.244   0.966   -14.707 1.00 45.75  ? 703 HOH E O   1 
HETATM 8530 O O   . HOH M 3 .   ? 3.520   10.416  8.620   1.00 40.38  ? 704 HOH E O   1 
HETATM 8531 O O   . HOH M 3 .   ? 2.439   -17.012 -15.891 1.00 28.89  ? 705 HOH E O   1 
HETATM 8532 O O   . HOH M 3 .   ? -5.350  -32.497 -9.942  1.00 33.61  ? 706 HOH E O   1 
HETATM 8533 O O   . HOH M 3 .   ? -5.522  -33.218 -7.337  1.00 35.13  ? 707 HOH E O   1 
HETATM 8534 O O   . HOH M 3 .   ? 4.505   1.709   8.984   1.00 33.28  ? 708 HOH E O   1 
HETATM 8535 O O   . HOH M 3 .   ? -29.277 -50.500 -8.016  1.00 40.62  ? 709 HOH E O   1 
HETATM 8536 O O   . HOH M 3 .   ? -31.875 -11.478 -28.271 1.00 44.77  ? 710 HOH E O   1 
HETATM 8537 O O   . HOH M 3 .   ? -3.981  7.905   18.608  1.00 35.45  ? 711 HOH E O   1 
HETATM 8538 O O   . HOH M 3 .   ? -34.272 -46.194 -23.198 1.00 31.06  ? 712 HOH E O   1 
HETATM 8539 O O   . HOH M 3 .   ? -2.730  16.107  -15.327 1.00 30.46  ? 713 HOH E O   1 
HETATM 8540 O O   . HOH M 3 .   ? -1.961  -13.640 -17.704 1.00 53.14  ? 714 HOH E O   1 
HETATM 8541 O O   . HOH M 3 .   ? -23.769 -5.194  15.586  1.00 48.62  ? 715 HOH E O   1 
HETATM 8542 O O   . HOH M 3 .   ? 0.617   -13.425 -16.797 1.00 45.28  ? 716 HOH E O   1 
HETATM 8543 O O   . HOH M 3 .   ? 12.366  -16.343 -8.553  1.00 29.50  ? 717 HOH E O   1 
HETATM 8544 O O   . HOH M 3 .   ? -2.919  -34.423 -18.009 1.00 26.62  ? 718 HOH E O   1 
HETATM 8545 O O   . HOH M 3 .   ? 10.946  -18.572 -13.522 1.00 37.32  ? 719 HOH E O   1 
HETATM 8546 O O   . HOH M 3 .   ? 3.036   8.778   12.413  1.00 27.88  ? 720 HOH E O   1 
HETATM 8547 O O   . HOH M 3 .   ? -7.341  -39.361 17.142  1.00 32.93  ? 721 HOH E O   1 
HETATM 8548 O O   . HOH M 3 .   ? 17.628  7.442   -3.631  1.00 30.39  ? 722 HOH E O   1 
HETATM 8549 O O   . HOH M 3 .   ? -9.611  24.815  13.998  1.00 33.88  ? 723 HOH E O   1 
HETATM 8550 O O   . HOH M 3 .   ? -40.771 -49.057 -19.516 1.00 43.82  ? 724 HOH E O   1 
HETATM 8551 O O   . HOH M 3 .   ? -34.107 -51.428 -11.359 1.00 47.80  ? 725 HOH E O   1 
HETATM 8552 O O   . HOH M 3 .   ? -15.051 -33.932 14.416  1.00 40.51  ? 726 HOH E O   1 
HETATM 8553 O O   . HOH M 3 .   ? -13.552 -41.315 15.077  1.00 28.22  ? 727 HOH E O   1 
HETATM 8554 O O   . HOH M 3 .   ? 12.968  -21.334 -19.123 1.00 24.77  ? 728 HOH E O   1 
HETATM 8555 O O   . HOH M 3 .   ? -9.648  0.196   24.655  1.00 31.76  ? 729 HOH E O   1 
HETATM 8556 O O   . HOH M 3 .   ? -8.231  -1.990  25.267  1.00 41.96  ? 730 HOH E O   1 
HETATM 8557 O O   . HOH M 3 .   ? -17.385 30.078  22.030  1.00 31.88  ? 731 HOH E O   1 
HETATM 8558 O O   . HOH M 3 .   ? 15.844  -13.756 -21.049 1.00 27.67  ? 732 HOH E O   1 
HETATM 8559 O O   . HOH N 3 .   ? -23.886 6.910   56.608  1.00 15.22  ? 401 HOH F O   1 
HETATM 8560 O O   . HOH N 3 .   ? -22.826 -12.136 51.628  1.00 51.97  ? 402 HOH F O   1 
HETATM 8561 O O   . HOH N 3 .   ? -43.365 5.327   58.206  1.00 25.02  ? 403 HOH F O   1 
HETATM 8562 O O   . HOH N 3 .   ? -41.369 3.455   45.178  1.00 16.42  ? 404 HOH F O   1 
HETATM 8563 O O   . HOH N 3 .   ? -5.461  1.581   62.420  1.00 55.77  ? 405 HOH F O   1 
HETATM 8564 O O   . HOH N 3 .   ? -19.628 -7.351  73.723  1.00 28.36  ? 406 HOH F O   1 
HETATM 8565 O O   . HOH N 3 .   ? -24.336 7.401   64.670  1.00 14.86  ? 407 HOH F O   1 
HETATM 8566 O O   . HOH N 3 .   ? -46.201 13.743  48.871  1.00 38.00  ? 408 HOH F O   1 
HETATM 8567 O O   . HOH N 3 .   ? -29.305 46.740  48.083  1.00 47.16  ? 409 HOH F O   1 
HETATM 8568 O O   . HOH N 3 .   ? -43.690 14.259  53.516  1.00 37.84  ? 410 HOH F O   1 
HETATM 8569 O O   . HOH N 3 .   ? -30.208 -3.786  55.436  1.00 26.56  ? 411 HOH F O   1 
HETATM 8570 O O   . HOH N 3 .   ? -26.327 4.582   56.411  1.00 22.96  ? 412 HOH F O   1 
HETATM 8571 O O   . HOH N 3 .   ? -27.437 -10.157 61.728  1.00 51.21  ? 413 HOH F O   1 
HETATM 8572 O O   . HOH N 3 .   ? -17.596 -14.611 71.578  1.00 28.73  ? 414 HOH F O   1 
HETATM 8573 O O   . HOH N 3 .   ? -49.344 35.505  55.495  1.00 31.96  ? 415 HOH F O   1 
HETATM 8574 O O   . HOH N 3 .   ? -26.491 7.201   62.547  1.00 19.90  ? 416 HOH F O   1 
HETATM 8575 O O   . HOH N 3 .   ? -30.492 33.613  58.256  1.00 25.93  ? 417 HOH F O   1 
HETATM 8576 O O   . HOH N 3 .   ? -50.256 -6.075  39.363  1.00 31.56  ? 418 HOH F O   1 
HETATM 8577 O O   . HOH N 3 .   ? -41.765 19.389  55.490  1.00 17.72  ? 419 HOH F O   1 
HETATM 8578 O O   . HOH N 3 .   ? -43.664 -0.994  58.128  1.00 27.81  ? 420 HOH F O   1 
HETATM 8579 O O   . HOH N 3 .   ? -34.694 -8.758  42.110  1.00 44.75  ? 421 HOH F O   1 
HETATM 8580 O O   . HOH N 3 .   ? -23.922 7.828   49.069  1.00 26.89  ? 422 HOH F O   1 
HETATM 8581 O O   . HOH N 3 .   ? -30.346 39.739  58.793  1.00 33.16  ? 423 HOH F O   1 
HETATM 8582 O O   . HOH N 3 .   ? -23.053 0.623   59.019  1.00 20.44  ? 424 HOH F O   1 
HETATM 8583 O O   . HOH N 3 .   ? -15.638 9.948   69.201  1.00 20.45  ? 425 HOH F O   1 
HETATM 8584 O O   . HOH N 3 .   ? -10.338 -12.301 63.637  1.00 34.28  ? 426 HOH F O   1 
HETATM 8585 O O   . HOH N 3 .   ? 1.363   2.183   64.382  1.00 38.24  ? 427 HOH F O   1 
HETATM 8586 O O   . HOH N 3 .   ? -17.240 10.788  59.234  1.00 36.65  ? 428 HOH F O   1 
HETATM 8587 O O   . HOH N 3 .   ? -31.925 18.436  63.517  1.00 33.70  ? 429 HOH F O   1 
HETATM 8588 O O   . HOH N 3 .   ? -44.639 7.520   55.787  1.00 24.22  ? 430 HOH F O   1 
HETATM 8589 O O   . HOH N 3 .   ? -47.913 -1.578  43.274  1.00 22.25  ? 431 HOH F O   1 
HETATM 8590 O O   . HOH N 3 .   ? -15.576 12.608  69.796  1.00 32.17  ? 432 HOH F O   1 
HETATM 8591 O O   . HOH N 3 .   ? -46.955 -4.758  49.794  1.00 30.07  ? 433 HOH F O   1 
HETATM 8592 O O   . HOH N 3 .   ? -17.604 10.768  62.090  1.00 34.12  ? 434 HOH F O   1 
HETATM 8593 O O   . HOH N 3 .   ? -18.022 7.668   62.368  1.00 33.48  ? 435 HOH F O   1 
HETATM 8594 O O   . HOH N 3 .   ? -29.439 22.531  56.515  1.00 28.00  ? 436 HOH F O   1 
HETATM 8595 O O   . HOH N 3 .   ? -8.267  12.892  64.774  1.00 30.68  ? 437 HOH F O   1 
HETATM 8596 O O   . HOH N 3 .   ? -22.903 -1.693  52.122  1.00 28.30  ? 438 HOH F O   1 
HETATM 8597 O O   . HOH N 3 .   ? -6.199  3.786   68.670  1.00 47.07  ? 439 HOH F O   1 
HETATM 8598 O O   . HOH N 3 .   ? -12.170 -3.635  57.068  1.00 44.93  ? 440 HOH F O   1 
HETATM 8599 O O   . HOH N 3 .   ? -35.904 18.441  56.578  1.00 28.78  ? 441 HOH F O   1 
HETATM 8600 O O   . HOH N 3 .   ? -24.491 -15.817 60.397  1.00 23.90  ? 442 HOH F O   1 
HETATM 8601 O O   . HOH N 3 .   ? -31.697 24.062  56.638  1.00 27.55  ? 443 HOH F O   1 
HETATM 8602 O O   . HOH N 3 .   ? -15.355 -10.008 54.146  1.00 46.40  ? 444 HOH F O   1 
HETATM 8603 O O   . HOH N 3 .   ? -29.868 -1.253  57.831  1.00 43.67  ? 445 HOH F O   1 
HETATM 8604 O O   . HOH N 3 .   ? -46.904 -7.157  52.770  1.00 35.78  ? 446 HOH F O   1 
HETATM 8605 O O   . HOH N 3 .   ? -37.395 10.702  42.640  1.00 33.19  ? 447 HOH F O   1 
HETATM 8606 O O   . HOH N 3 .   ? -39.161 7.423   63.479  1.00 36.91  ? 448 HOH F O   1 
HETATM 8607 O O   . HOH N 3 .   ? -12.266 2.357   78.679  1.00 37.08  ? 449 HOH F O   1 
HETATM 8608 O O   . HOH N 3 .   ? -6.126  -10.158 67.650  1.00 44.81  ? 450 HOH F O   1 
HETATM 8609 O O   . HOH N 3 .   ? -25.434 16.070  72.725  1.00 47.66  ? 451 HOH F O   1 
HETATM 8610 O O   . HOH N 3 .   ? -1.730  3.268   68.910  1.00 56.69  ? 452 HOH F O   1 
HETATM 8611 O O   . HOH N 3 .   ? -6.219  -14.411 69.008  1.00 29.69  ? 453 HOH F O   1 
HETATM 8612 O O   . HOH N 3 .   ? -41.528 8.379   59.660  1.00 34.69  ? 454 HOH F O   1 
HETATM 8613 O O   . HOH N 3 .   ? -12.274 -15.541 65.461  1.00 9.89   ? 455 HOH F O   1 
HETATM 8614 O O   . HOH N 3 .   ? -46.665 13.296  46.093  1.00 23.16  ? 456 HOH F O   1 
HETATM 8615 O O   . HOH N 3 .   ? -9.936  11.239  74.110  1.00 41.28  ? 457 HOH F O   1 
HETATM 8616 O O   . HOH N 3 .   ? -19.747 -18.261 60.040  1.00 43.08  ? 458 HOH F O   1 
HETATM 8617 O O   . HOH N 3 .   ? -37.899 0.971   61.133  1.00 18.42  ? 459 HOH F O   1 
HETATM 8618 O O   . HOH N 3 .   ? -27.743 -1.211  78.389  1.00 60.60  ? 460 HOH F O   1 
HETATM 8619 O O   . HOH N 3 .   ? -40.921 -9.192  57.342  1.00 38.82  ? 461 HOH F O   1 
HETATM 8620 O O   . HOH N 3 .   ? -44.004 23.178  55.347  1.00 18.79  ? 462 HOH F O   1 
HETATM 8621 O O   . HOH N 3 .   ? -24.817 5.263   48.687  1.00 57.50  ? 463 HOH F O   1 
HETATM 8622 O O   . HOH N 3 .   ? -29.178 22.082  40.028  1.00 30.89  ? 464 HOH F O   1 
HETATM 8623 O O   . HOH N 3 .   ? -37.234 32.051  41.323  1.00 38.64  ? 465 HOH F O   1 
HETATM 8624 O O   . HOH N 3 .   ? -23.865 4.354   72.232  1.00 34.67  ? 466 HOH F O   1 
HETATM 8625 O O   . HOH N 3 .   ? -43.615 34.883  46.164  1.00 35.90  ? 467 HOH F O   1 
HETATM 8626 O O   . HOH N 3 .   ? -23.292 -8.609  49.380  1.00 23.20  ? 468 HOH F O   1 
HETATM 8627 O O   . HOH N 3 .   ? -36.703 -4.272  55.765  1.00 30.36  ? 469 HOH F O   1 
HETATM 8628 O O   . HOH N 3 .   ? -36.919 41.779  57.133  1.00 25.19  ? 470 HOH F O   1 
HETATM 8629 O O   . HOH N 3 .   ? -50.366 -2.611  42.867  1.00 32.52  ? 471 HOH F O   1 
HETATM 8630 O O   . HOH N 3 .   ? -22.911 3.149   68.899  1.00 42.44  ? 472 HOH F O   1 
HETATM 8631 O O   . HOH N 3 .   ? -30.928 -9.723  65.029  1.00 27.54  ? 473 HOH F O   1 
HETATM 8632 O O   . HOH N 3 .   ? -41.353 22.015  56.085  1.00 45.72  ? 474 HOH F O   1 
HETATM 8633 O O   . HOH N 3 .   ? -16.347 26.248  51.435  1.00 47.90  ? 475 HOH F O   1 
HETATM 8634 O O   . HOH N 3 .   ? -24.688 7.039   67.420  1.00 37.77  ? 476 HOH F O   1 
HETATM 8635 O O   . HOH N 3 .   ? -42.319 16.566  53.950  1.00 21.60  ? 477 HOH F O   1 
HETATM 8636 O O   . HOH N 3 .   ? -16.108 -1.251  76.837  1.00 49.82  ? 478 HOH F O   1 
HETATM 8637 O O   . HOH N 3 .   ? -54.414 -0.672  46.796  1.00 32.97  ? 479 HOH F O   1 
HETATM 8638 O O   . HOH N 3 .   ? -29.782 -1.770  76.658  1.00 40.23  ? 480 HOH F O   1 
HETATM 8639 O O   . HOH N 3 .   ? -18.971 -9.667  76.958  1.00 30.28  ? 481 HOH F O   1 
HETATM 8640 O O   . HOH N 3 .   ? -6.674  -14.645 71.678  1.00 32.62  ? 482 HOH F O   1 
HETATM 8641 O O   . HOH N 3 .   ? -20.841 -8.057  48.472  1.00 27.10  ? 483 HOH F O   1 
HETATM 8642 O O   . HOH N 3 .   ? -37.134 -9.652  53.716  1.00 34.09  ? 484 HOH F O   1 
HETATM 8643 O O   . HOH N 3 .   ? -24.258 -16.016 68.144  1.00 26.93  ? 485 HOH F O   1 
HETATM 8644 O O   . HOH N 3 .   ? -22.525 3.381   52.004  1.00 26.16  ? 486 HOH F O   1 
HETATM 8645 O O   . HOH N 3 .   ? -0.139  -4.451  63.422  1.00 23.15  ? 487 HOH F O   1 
HETATM 8646 O O   . HOH N 3 .   ? -20.929 23.698  44.502  1.00 28.79  ? 488 HOH F O   1 
HETATM 8647 O O   . HOH N 3 .   ? -48.403 27.773  48.694  1.00 44.81  ? 489 HOH F O   1 
HETATM 8648 O O   . HOH N 3 .   ? -29.921 30.006  35.919  1.00 44.58  ? 490 HOH F O   1 
HETATM 8649 O O   . HOH N 3 .   ? -33.599 43.228  42.905  1.00 33.32  ? 491 HOH F O   1 
HETATM 8650 O O   . HOH N 3 .   ? -3.128  -9.472  65.585  1.00 50.01  ? 492 HOH F O   1 
HETATM 8651 O O   . HOH N 3 .   ? -36.778 -9.211  49.982  1.00 34.92  ? 493 HOH F O   1 
HETATM 8652 O O   . HOH N 3 .   ? -43.610 5.081   46.503  1.00 42.69  ? 494 HOH F O   1 
HETATM 8653 O O   . HOH N 3 .   ? -30.600 -1.661  65.990  1.00 22.41  ? 495 HOH F O   1 
HETATM 8654 O O   . HOH N 3 .   ? -51.018 -6.219  42.616  1.00 32.95  ? 496 HOH F O   1 
HETATM 8655 O O   . HOH N 3 .   ? 1.826   0.026   59.223  1.00 25.13  ? 497 HOH F O   1 
HETATM 8656 O O   . HOH N 3 .   ? -8.187  13.251  67.436  1.00 27.70  ? 498 HOH F O   1 
HETATM 8657 O O   . HOH N 3 .   ? -38.586 17.892  39.003  1.00 24.03  ? 499 HOH F O   1 
HETATM 8658 O O   . HOH N 3 .   ? -16.375 -7.209  51.794  1.00 28.91  ? 500 HOH F O   1 
HETATM 8659 O O   . HOH N 3 .   ? -15.811 18.632  76.076  1.00 32.36  ? 501 HOH F O   1 
HETATM 8660 O O   . HOH N 3 .   ? -24.616 -16.803 52.908  1.00 32.68  ? 502 HOH F O   1 
HETATM 8661 O O   . HOH N 3 .   ? -24.895 43.592  42.934  1.00 26.45  ? 503 HOH F O   1 
HETATM 8662 O O   . HOH N 3 .   ? -5.263  2.189   55.534  1.00 34.77  ? 504 HOH F O   1 
HETATM 8663 O O   . HOH N 3 .   ? -0.036  -8.390  65.418  1.00 50.58  ? 505 HOH F O   1 
HETATM 8664 O O   . HOH N 3 .   ? -36.638 -0.114  40.642  1.00 39.93  ? 506 HOH F O   1 
HETATM 8665 O O   . HOH N 3 .   ? -49.878 30.867  55.878  1.00 48.43  ? 507 HOH F O   1 
HETATM 8666 O O   . HOH N 3 .   ? -24.672 -9.976  51.191  1.00 38.20  ? 508 HOH F O   1 
HETATM 8667 O O   . HOH N 3 .   ? -41.505 -10.951 47.925  1.00 38.62  ? 509 HOH F O   1 
HETATM 8668 O O   . HOH N 3 .   ? -56.798 0.015   47.983  1.00 33.30  ? 510 HOH F O   1 
HETATM 8669 O O   . HOH N 3 .   ? -16.820 -3.226  78.543  1.00 33.41  ? 511 HOH F O   1 
HETATM 8670 O O   . HOH N 3 .   ? -14.033 -1.918  55.305  1.00 26.40  ? 512 HOH F O   1 
HETATM 8671 O O   . HOH N 3 .   ? -5.884  -11.651 73.931  1.00 44.36  ? 513 HOH F O   1 
HETATM 8672 O O   . HOH N 3 .   ? -21.125 -14.921 56.380  1.00 26.93  ? 514 HOH F O   1 
HETATM 8673 O O   . HOH N 3 .   ? -12.290 -19.679 63.078  1.00 40.98  ? 515 HOH F O   1 
HETATM 8674 O O   . HOH N 3 .   ? -28.409 8.422   43.583  1.00 40.71  ? 516 HOH F O   1 
HETATM 8675 O O   . HOH N 3 .   ? -26.048 20.188  63.793  1.00 48.38  ? 517 HOH F O   1 
HETATM 8676 O O   . HOH N 3 .   ? -2.237  -11.835 66.624  1.00 26.40  ? 518 HOH F O   1 
HETATM 8677 O O   . HOH N 3 .   ? -23.133 18.426  67.998  1.00 48.09  ? 519 HOH F O   1 
HETATM 8678 O O   . HOH N 3 .   ? -29.929 11.523  45.897  1.00 31.10  ? 520 HOH F O   1 
HETATM 8679 O O   . HOH N 3 .   ? -45.306 37.541  54.407  1.00 46.81  ? 521 HOH F O   1 
HETATM 8680 O O   . HOH N 3 .   ? -29.611 -2.249  71.451  1.00 47.67  ? 522 HOH F O   1 
HETATM 8681 O O   . HOH N 3 .   ? -32.879 -6.270  66.529  1.00 42.93  ? 523 HOH F O   1 
HETATM 8682 O O   . HOH N 3 .   ? -24.074 7.546   71.452  1.00 32.20  ? 524 HOH F O   1 
HETATM 8683 O O   . HOH N 3 .   ? -5.938  6.184   80.564  1.00 25.38  ? 525 HOH F O   1 
HETATM 8684 O O   . HOH N 3 .   ? -25.924 10.303  68.746  1.00 24.86  ? 526 HOH F O   1 
HETATM 8685 O O   . HOH N 3 .   ? -34.766 -10.946 49.499  1.00 38.36  ? 527 HOH F O   1 
HETATM 8686 O O   . HOH N 3 .   ? -52.679 25.262  50.940  1.00 34.88  ? 528 HOH F O   1 
HETATM 8687 O O   . HOH N 3 .   ? -18.120 15.844  63.884  1.00 21.67  ? 529 HOH F O   1 
HETATM 8688 O O   . HOH N 3 .   ? -39.929 23.445  41.938  1.00 33.86  ? 530 HOH F O   1 
HETATM 8689 O O   . HOH N 3 .   ? -51.605 -0.471  53.788  1.00 36.31  ? 531 HOH F O   1 
HETATM 8690 O O   . HOH N 3 .   ? -51.414 22.876  52.233  1.00 36.33  ? 532 HOH F O   1 
HETATM 8691 O O   . HOH N 3 .   ? -49.471 19.866  47.326  1.00 29.83  ? 533 HOH F O   1 
HETATM 8692 O O   . HOH N 3 .   ? -45.374 35.134  48.232  1.00 40.89  ? 534 HOH F O   1 
HETATM 8693 O O   . HOH N 3 .   ? -29.696 9.904   72.287  1.00 24.54  ? 535 HOH F O   1 
HETATM 8694 O O   . HOH N 3 .   ? -49.260 10.905  48.992  1.00 39.96  ? 536 HOH F O   1 
HETATM 8695 O O   . HOH N 3 .   ? 0.482   -3.642  60.936  1.00 46.54  ? 537 HOH F O   1 
HETATM 8696 O O   . HOH N 3 .   ? -38.785 39.623  62.729  1.00 30.75  ? 538 HOH F O   1 
HETATM 8697 O O   . HOH N 3 .   ? -45.964 21.420  54.475  1.00 32.54  ? 539 HOH F O   1 
HETATM 8698 O O   . HOH N 3 .   ? -30.173 -16.014 51.534  1.00 39.51  ? 540 HOH F O   1 
HETATM 8699 O O   . HOH N 3 .   ? -24.325 25.700  59.968  1.00 18.18  ? 541 HOH F O   1 
HETATM 8700 O O   . HOH N 3 .   ? -28.867 5.636   65.120  1.00 39.13  ? 542 HOH F O   1 
HETATM 8701 O O   . HOH N 3 .   ? -46.444 32.069  66.065  1.00 31.54  ? 543 HOH F O   1 
HETATM 8702 O O   . HOH N 3 .   ? -17.562 23.295  48.421  1.00 47.04  ? 544 HOH F O   1 
HETATM 8703 O O   . HOH N 3 .   ? -27.364 36.387  51.046  1.00 33.63  ? 545 HOH F O   1 
HETATM 8704 O O   . HOH N 3 .   ? -32.190 -8.771  55.993  1.00 30.52  ? 546 HOH F O   1 
HETATM 8705 O O   . HOH N 3 .   ? -18.095 20.934  70.021  1.00 38.06  ? 547 HOH F O   1 
HETATM 8706 O O   . HOH N 3 .   ? -31.209 -3.501  58.515  1.00 43.57  ? 548 HOH F O   1 
HETATM 8707 O O   . HOH N 3 .   ? -48.378 22.574  54.120  1.00 28.93  ? 549 HOH F O   1 
HETATM 8708 O O   . HOH N 3 .   ? -28.591 41.649  58.105  1.00 24.00  ? 550 HOH F O   1 
HETATM 8709 O O   . HOH N 3 .   ? -37.009 42.245  54.497  1.00 33.93  ? 551 HOH F O   1 
HETATM 8710 O O   . HOH N 3 .   ? -17.674 -3.211  53.624  1.00 33.22  ? 552 HOH F O   1 
HETATM 8711 O O   . HOH N 3 .   ? -21.848 -16.358 58.586  1.00 40.29  ? 553 HOH F O   1 
HETATM 8712 O O   . HOH N 3 .   ? -50.907 27.452  52.249  1.00 27.05  ? 554 HOH F O   1 
HETATM 8713 O O   . HOH N 3 .   ? -15.945 -5.436  54.205  1.00 53.61  ? 555 HOH F O   1 
HETATM 8714 O O   . HOH N 3 .   ? -31.203 -13.028 70.194  1.00 37.23  ? 556 HOH F O   1 
HETATM 8715 O O   . HOH N 3 .   ? -18.556 20.939  56.857  1.00 31.05  ? 557 HOH F O   1 
HETATM 8716 O O   . HOH N 3 .   ? -40.215 11.278  63.396  1.00 52.16  ? 558 HOH F O   1 
HETATM 8717 O O   . HOH N 3 .   ? -49.708 8.429   54.553  1.00 20.89  ? 559 HOH F O   1 
HETATM 8718 O O   . HOH N 3 .   ? -26.152 5.088   68.642  1.00 29.80  ? 560 HOH F O   1 
HETATM 8719 O O   . HOH N 3 .   ? -31.102 33.723  62.565  1.00 34.98  ? 561 HOH F O   1 
HETATM 8720 O O   . HOH N 3 .   ? -27.242 29.128  35.611  1.00 31.54  ? 562 HOH F O   1 
HETATM 8721 O O   . HOH N 3 .   ? -32.794 34.256  64.643  1.00 19.75  ? 563 HOH F O   1 
HETATM 8722 O O   . HOH N 3 .   ? -35.325 -13.333 43.999  1.00 36.59  ? 564 HOH F O   1 
HETATM 8723 O O   . HOH N 3 .   ? -36.747 1.315   66.023  1.00 37.94  ? 565 HOH F O   1 
HETATM 8724 O O   . HOH N 3 .   ? -37.470 33.950  39.153  1.00 24.55  ? 566 HOH F O   1 
HETATM 8725 O O   . HOH N 3 .   ? -48.037 -8.110  36.932  1.00 32.59  ? 567 HOH F O   1 
HETATM 8726 O O   . HOH N 3 .   ? -15.223 1.280   85.672  1.00 34.90  ? 568 HOH F O   1 
HETATM 8727 O O   . HOH N 3 .   ? -21.927 -16.429 70.143  1.00 47.28  ? 569 HOH F O   1 
HETATM 8728 O O   . HOH N 3 .   ? -47.709 30.298  62.096  1.00 55.78  ? 570 HOH F O   1 
HETATM 8729 O O   . HOH N 3 .   ? -30.834 -10.991 60.968  1.00 30.17  ? 571 HOH F O   1 
HETATM 8730 O O   . HOH N 3 .   ? -38.354 7.659   66.949  1.00 36.63  ? 572 HOH F O   1 
HETATM 8731 O O   . HOH N 3 .   ? -44.454 7.707   58.946  1.00 42.53  ? 573 HOH F O   1 
HETATM 8732 O O   . HOH N 3 .   ? -25.281 42.999  55.457  1.00 32.95  ? 574 HOH F O   1 
HETATM 8733 O O   . HOH N 3 .   ? -44.855 38.720  49.404  1.00 74.46  ? 575 HOH F O   1 
HETATM 8734 O O   . HOH N 3 .   ? -20.065 49.986  40.428  1.00 32.84  ? 576 HOH F O   1 
HETATM 8735 O O   . HOH N 3 .   ? -39.912 31.627  41.492  1.00 31.76  ? 577 HOH F O   1 
HETATM 8736 O O   . HOH N 3 .   ? -21.550 -22.205 60.383  1.00 26.15  ? 578 HOH F O   1 
HETATM 8737 O O   . HOH N 3 .   ? -50.037 -2.952  60.352  1.00 36.43  ? 579 HOH F O   1 
HETATM 8738 O O   . HOH N 3 .   ? -31.135 40.321  61.354  1.00 37.65  ? 580 HOH F O   1 
HETATM 8739 O O   . HOH N 3 .   ? -32.778 -4.298  56.098  1.00 23.59  ? 581 HOH F O   1 
HETATM 8740 O O   . HOH N 3 .   ? -25.084 50.809  39.521  1.00 37.77  ? 582 HOH F O   1 
HETATM 8741 O O   . HOH N 3 .   ? -36.105 3.614   69.271  1.00 31.94  ? 583 HOH F O   1 
HETATM 8742 O O   . HOH N 3 .   ? -45.050 41.348  46.586  1.00 28.89  ? 584 HOH F O   1 
HETATM 8743 O O   . HOH N 3 .   ? -22.317 22.584  60.841  1.00 39.17  ? 585 HOH F O   1 
HETATM 8744 O O   . HOH N 3 .   ? -39.435 37.377  68.371  1.00 20.73  ? 586 HOH F O   1 
HETATM 8745 O O   . HOH N 3 .   ? -30.681 0.329   69.356  1.00 89.94  ? 587 HOH F O   1 
HETATM 8746 O O   . HOH N 3 .   ? -24.573 22.871  62.291  1.00 31.33  ? 588 HOH F O   1 
HETATM 8747 O O   . HOH N 3 .   ? -26.178 46.922  38.324  1.00 27.36  ? 589 HOH F O   1 
HETATM 8748 O O   . HOH N 3 .   ? -38.197 -3.676  62.089  1.00 45.90  ? 590 HOH F O   1 
HETATM 8749 O O   . HOH N 3 .   ? -29.870 25.942  33.049  1.00 43.61  ? 591 HOH F O   1 
HETATM 8750 O O   . HOH N 3 .   ? -0.798  9.312   66.888  1.00 15.80  ? 592 HOH F O   1 
HETATM 8751 O O   . HOH N 3 .   ? -32.422 26.300  35.359  1.00 37.88  ? 593 HOH F O   1 
HETATM 8752 O O   . HOH N 3 .   ? -7.344  -0.251  75.973  1.00 27.60  ? 594 HOH F O   1 
HETATM 8753 O O   . HOH N 3 .   ? -21.880 23.148  65.424  1.00 39.35  ? 595 HOH F O   1 
HETATM 8754 O O   . HOH N 3 .   ? -39.379 30.188  37.091  1.00 30.57  ? 596 HOH F O   1 
HETATM 8755 O O   . HOH N 3 .   ? -43.063 8.953   66.697  1.00 27.21  ? 597 HOH F O   1 
HETATM 8756 O O   . HOH N 3 .   ? -21.422 37.397  37.052  1.00 39.72  ? 598 HOH F O   1 
HETATM 8757 O O   . HOH N 3 .   ? -53.242 19.627  55.286  1.00 26.75  ? 599 HOH F O   1 
HETATM 8758 O O   . HOH N 3 .   ? -28.633 36.754  65.628  1.00 34.87  ? 600 HOH F O   1 
HETATM 8759 O O   . HOH N 3 .   ? -17.969 14.834  86.942  1.00 24.66  ? 601 HOH F O   1 
HETATM 8760 O O   . HOH N 3 .   ? -19.949 28.154  33.225  1.00 30.91  ? 602 HOH F O   1 
HETATM 8761 O O   . HOH N 3 .   ? -40.850 34.977  72.646  1.00 39.33  ? 603 HOH F O   1 
HETATM 8762 O O   . HOH N 3 .   ? -5.027  -22.273 67.064  1.00 36.36  ? 604 HOH F O   1 
HETATM 8763 O O   . HOH N 3 .   ? -44.985 13.969  68.111  1.00 35.21  ? 605 HOH F O   1 
HETATM 8764 O O   . HOH N 3 .   ? -22.299 35.539  31.578  1.00 40.20  ? 606 HOH F O   1 
HETATM 8765 O O   . HOH N 3 .   ? -32.123 41.908  30.269  1.00 40.45  ? 607 HOH F O   1 
HETATM 8766 O O   . HOH N 3 .   ? -50.309 -2.335  69.362  1.00 66.68  ? 608 HOH F O   1 
HETATM 8767 O O   . HOH N 3 .   ? -19.916 35.803  29.042  1.00 20.67  ? 609 HOH F O   1 
HETATM 8768 O O   . HOH N 3 .   ? -49.125 -0.945  71.343  1.00 45.50  ? 610 HOH F O   1 
HETATM 8769 O O   . HOH N 3 .   ? -48.334 -2.621  74.810  1.00 29.28  ? 611 HOH F O   1 
HETATM 8770 O O   . HOH O 3 .   ? -20.995 35.497  -7.453  1.00 6.84   ? 401 HOH G O   1 
HETATM 8771 O O   . HOH O 3 .   ? -35.863 34.023  -9.717  1.00 37.10  ? 402 HOH G O   1 
HETATM 8772 O O   . HOH O 3 .   ? -26.692 13.085  -6.568  1.00 11.75  ? 403 HOH G O   1 
HETATM 8773 O O   . HOH O 3 .   ? -3.032  33.821  -11.507 1.00 16.79  ? 404 HOH G O   1 
HETATM 8774 O O   . HOH O 3 .   ? -16.094 28.112  -11.665 1.00 10.78  ? 405 HOH G O   1 
HETATM 8775 O O   . HOH O 3 .   ? -10.399 51.583  -13.128 1.00 13.00  ? 406 HOH G O   1 
HETATM 8776 O O   . HOH O 3 .   ? -21.686 28.581  -5.380  1.00 6.62   ? 407 HOH G O   1 
HETATM 8777 O O   . HOH O 3 .   ? -46.331 -0.375  -5.717  1.00 22.04  ? 408 HOH G O   1 
HETATM 8778 O O   . HOH O 3 .   ? -8.281  48.169  -11.787 1.00 22.61  ? 409 HOH G O   1 
HETATM 8779 O O   . HOH O 3 .   ? -10.320 38.826  -5.811  1.00 15.99  ? 410 HOH G O   1 
HETATM 8780 O O   . HOH O 3 .   ? -7.898  25.131  -18.507 1.00 33.27  ? 411 HOH G O   1 
HETATM 8781 O O   . HOH O 3 .   ? -32.161 32.809  -13.091 1.00 38.69  ? 412 HOH G O   1 
HETATM 8782 O O   . HOH O 3 .   ? -49.383 29.509  -2.529  1.00 39.45  ? 413 HOH G O   1 
HETATM 8783 O O   . HOH O 3 .   ? -20.209 24.144  -0.385  1.00 15.51  ? 414 HOH G O   1 
HETATM 8784 O O   . HOH O 3 .   ? -14.866 23.584  -19.124 1.00 20.78  ? 415 HOH G O   1 
HETATM 8785 O O   . HOH O 3 .   ? -30.282 26.605  -14.037 1.00 22.24  ? 416 HOH G O   1 
HETATM 8786 O O   . HOH O 3 .   ? -20.206 -13.578 6.339   1.00 20.83  ? 417 HOH G O   1 
HETATM 8787 O O   . HOH O 3 .   ? -17.148 20.469  -14.705 1.00 22.05  ? 418 HOH G O   1 
HETATM 8788 O O   . HOH O 3 .   ? -8.294  50.367  -10.103 1.00 31.39  ? 419 HOH G O   1 
HETATM 8789 O O   . HOH O 3 .   ? -45.794 37.614  -3.793  1.00 20.81  ? 420 HOH G O   1 
HETATM 8790 O O   . HOH O 3 .   ? -30.370 40.527  -16.486 1.00 28.38  ? 421 HOH G O   1 
HETATM 8791 O O   . HOH O 3 .   ? -0.270  39.404  -8.016  1.00 28.26  ? 422 HOH G O   1 
HETATM 8792 O O   . HOH O 3 .   ? -29.201 48.156  -2.086  1.00 31.90  ? 423 HOH G O   1 
HETATM 8793 O O   . HOH O 3 .   ? -37.895 12.676  8.258   1.00 28.25  ? 424 HOH G O   1 
HETATM 8794 O O   . HOH O 3 .   ? -47.703 33.152  -3.475  1.00 44.17  ? 425 HOH G O   1 
HETATM 8795 O O   . HOH O 3 .   ? -33.801 17.209  -5.881  1.00 19.00  ? 426 HOH G O   1 
HETATM 8796 O O   . HOH O 3 .   ? -10.389 57.556  -15.631 1.00 40.00  ? 427 HOH G O   1 
HETATM 8797 O O   . HOH O 3 .   ? -14.113 37.290  -25.112 1.00 20.47  ? 428 HOH G O   1 
HETATM 8798 O O   . HOH O 3 .   ? -47.993 9.337   -1.341  1.00 36.42  ? 429 HOH G O   1 
HETATM 8799 O O   . HOH O 3 .   ? -15.675 50.993  -19.691 1.00 17.75  ? 430 HOH G O   1 
HETATM 8800 O O   . HOH O 3 .   ? -24.453 31.138  -5.329  1.00 3.00   ? 431 HOH G O   1 
HETATM 8801 O O   . HOH O 3 .   ? -41.221 9.004   5.135   1.00 17.79  ? 432 HOH G O   1 
HETATM 8802 O O   . HOH O 3 .   ? -21.957 33.509  -18.101 1.00 30.81  ? 433 HOH G O   1 
HETATM 8803 O O   . HOH O 3 .   ? -26.081 45.985  -10.007 1.00 29.16  ? 434 HOH G O   1 
HETATM 8804 O O   . HOH O 3 .   ? -7.517  21.680  -22.145 1.00 25.52  ? 435 HOH G O   1 
HETATM 8805 O O   . HOH O 3 .   ? -27.817 38.477  -3.144  1.00 36.53  ? 436 HOH G O   1 
HETATM 8806 O O   . HOH O 3 .   ? -45.072 10.850  -3.852  1.00 37.10  ? 437 HOH G O   1 
HETATM 8807 O O   . HOH O 3 .   ? -23.933 44.602  0.562   1.00 26.65  ? 438 HOH G O   1 
HETATM 8808 O O   . HOH O 3 .   ? -22.257 17.347  -17.398 1.00 33.93  ? 439 HOH G O   1 
HETATM 8809 O O   . HOH O 3 .   ? 3.991   35.680  -12.389 1.00 58.75  ? 440 HOH G O   1 
HETATM 8810 O O   . HOH O 3 .   ? -24.622 3.096   -4.444  1.00 27.26  ? 441 HOH G O   1 
HETATM 8811 O O   . HOH O 3 .   ? -46.725 36.043  7.960   1.00 34.67  ? 442 HOH G O   1 
HETATM 8812 O O   . HOH O 3 .   ? -31.895 28.532  7.836   1.00 35.96  ? 443 HOH G O   1 
HETATM 8813 O O   . HOH O 3 .   ? -16.067 24.359  -11.956 1.00 39.26  ? 444 HOH G O   1 
HETATM 8814 O O   . HOH O 3 .   ? -22.698 28.595  -14.061 1.00 30.26  ? 445 HOH G O   1 
HETATM 8815 O O   . HOH O 3 .   ? -37.863 16.362  14.246  1.00 26.21  ? 446 HOH G O   1 
HETATM 8816 O O   . HOH O 3 .   ? -44.632 21.720  4.853   1.00 27.89  ? 447 HOH G O   1 
HETATM 8817 O O   . HOH O 3 .   ? -45.820 7.971   4.225   1.00 36.65  ? 448 HOH G O   1 
HETATM 8818 O O   . HOH O 3 .   ? -26.073 6.881   9.720   1.00 23.15  ? 449 HOH G O   1 
HETATM 8819 O O   . HOH O 3 .   ? -20.165 34.522  -10.420 1.00 23.93  ? 450 HOH G O   1 
HETATM 8820 O O   . HOH O 3 .   ? -41.738 21.123  -3.072  1.00 17.05  ? 451 HOH G O   1 
HETATM 8821 O O   . HOH O 3 .   ? -25.104 50.687  -2.594  1.00 24.22  ? 452 HOH G O   1 
HETATM 8822 O O   . HOH O 3 .   ? -27.301 36.095  -9.414  1.00 48.65  ? 453 HOH G O   1 
HETATM 8823 O O   . HOH O 3 .   ? -43.331 6.401   1.490   1.00 24.99  ? 454 HOH G O   1 
HETATM 8824 O O   . HOH O 3 .   ? -24.347 -10.608 6.638   1.00 36.37  ? 455 HOH G O   1 
HETATM 8825 O O   . HOH O 3 .   ? -16.973 16.255  -9.423  1.00 17.45  ? 456 HOH G O   1 
HETATM 8826 O O   . HOH O 3 .   ? -11.636 44.287  -3.718  1.00 18.40  ? 457 HOH G O   1 
HETATM 8827 O O   . HOH O 3 .   ? -28.944 45.401  -12.950 1.00 37.90  ? 458 HOH G O   1 
HETATM 8828 O O   . HOH O 3 .   ? -0.287  45.955  -24.514 1.00 34.19  ? 459 HOH G O   1 
HETATM 8829 O O   . HOH O 3 .   ? -10.242 54.807  -7.204  1.00 25.39  ? 460 HOH G O   1 
HETATM 8830 O O   . HOH O 3 .   ? -44.074 4.074   0.078   1.00 28.92  ? 461 HOH G O   1 
HETATM 8831 O O   . HOH O 3 .   ? -44.764 20.611  1.712   1.00 28.92  ? 462 HOH G O   1 
HETATM 8832 O O   . HOH O 3 .   ? -7.165  21.438  -17.441 1.00 26.05  ? 463 HOH G O   1 
HETATM 8833 O O   . HOH O 3 .   ? -4.002  46.544  -16.694 1.00 18.31  ? 464 HOH G O   1 
HETATM 8834 O O   . HOH O 3 .   ? -28.107 2.518   -8.316  1.00 38.94  ? 465 HOH G O   1 
HETATM 8835 O O   . HOH O 3 .   ? -21.105 37.672  -0.612  1.00 26.34  ? 466 HOH G O   1 
HETATM 8836 O O   . HOH O 3 .   ? -20.523 19.930  3.267   1.00 33.38  ? 467 HOH G O   1 
HETATM 8837 O O   . HOH O 3 .   ? -52.618 35.349  3.643   1.00 31.70  ? 468 HOH G O   1 
HETATM 8838 O O   . HOH O 3 .   ? -20.574 -0.110  -5.707  1.00 40.00  ? 469 HOH G O   1 
HETATM 8839 O O   . HOH O 3 .   ? -20.647 47.855  -21.978 1.00 25.74  ? 470 HOH G O   1 
HETATM 8840 O O   . HOH O 3 .   ? -17.584 43.326  -22.507 1.00 14.46  ? 471 HOH G O   1 
HETATM 8841 O O   . HOH O 3 .   ? -23.340 9.093   -5.820  1.00 17.18  ? 472 HOH G O   1 
HETATM 8842 O O   . HOH O 3 .   ? -46.311 19.235  -2.346  1.00 12.55  ? 473 HOH G O   1 
HETATM 8843 O O   . HOH O 3 .   ? -38.480 24.376  -9.110  1.00 16.71  ? 474 HOH G O   1 
HETATM 8844 O O   . HOH O 3 .   ? -43.364 41.421  11.266  1.00 32.60  ? 475 HOH G O   1 
HETATM 8845 O O   . HOH O 3 .   ? -35.092 2.505   8.346   1.00 33.14  ? 476 HOH G O   1 
HETATM 8846 O O   . HOH O 3 .   ? 1.945   33.705  -17.288 1.00 36.88  ? 477 HOH G O   1 
HETATM 8847 O O   . HOH O 3 .   ? -8.473  25.676  -23.425 1.00 18.50  ? 478 HOH G O   1 
HETATM 8848 O O   . HOH O 3 .   ? -43.741 43.188  6.428   1.00 24.50  ? 479 HOH G O   1 
HETATM 8849 O O   . HOH O 3 .   ? -39.021 13.384  -5.471  1.00 14.61  ? 480 HOH G O   1 
HETATM 8850 O O   . HOH O 3 .   ? -46.040 40.287  1.613   1.00 46.96  ? 481 HOH G O   1 
HETATM 8851 O O   . HOH O 3 .   ? -14.778 50.031  -2.118  1.00 27.34  ? 482 HOH G O   1 
HETATM 8852 O O   . HOH O 3 .   ? -19.941 32.429  -19.488 1.00 28.30  ? 483 HOH G O   1 
HETATM 8853 O O   . HOH O 3 .   ? -24.870 29.333  -12.618 1.00 26.73  ? 484 HOH G O   1 
HETATM 8854 O O   . HOH O 3 .   ? -20.619 52.139  -15.673 1.00 13.94  ? 485 HOH G O   1 
HETATM 8855 O O   . HOH O 3 .   ? -21.495 34.023  0.612   1.00 32.76  ? 486 HOH G O   1 
HETATM 8856 O O   . HOH O 3 .   ? -44.962 40.730  -1.239  1.00 30.98  ? 487 HOH G O   1 
HETATM 8857 O O   . HOH O 3 .   ? -34.555 32.976  -11.819 1.00 23.98  ? 488 HOH G O   1 
HETATM 8858 O O   . HOH O 3 .   ? -23.426 21.791  3.546   1.00 48.51  ? 489 HOH G O   1 
HETATM 8859 O O   . HOH O 3 .   ? -43.472 40.354  2.446   1.00 31.29  ? 490 HOH G O   1 
HETATM 8860 O O   . HOH O 3 .   ? -29.132 11.395  -5.897  1.00 18.56  ? 491 HOH G O   1 
HETATM 8861 O O   . HOH O 3 .   ? -27.259 36.097  -1.269  1.00 19.87  ? 492 HOH G O   1 
HETATM 8862 O O   . HOH O 3 .   ? -32.734 47.222  5.613   1.00 24.35  ? 493 HOH G O   1 
HETATM 8863 O O   . HOH O 3 .   ? -41.480 29.373  -7.478  1.00 26.82  ? 494 HOH G O   1 
HETATM 8864 O O   . HOH O 3 .   ? -38.511 28.835  -11.006 1.00 32.19  ? 495 HOH G O   1 
HETATM 8865 O O   . HOH O 3 .   ? -15.253 26.144  -10.027 1.00 34.33  ? 496 HOH G O   1 
HETATM 8866 O O   . HOH O 3 .   ? -6.535  45.332  -10.470 1.00 19.66  ? 497 HOH G O   1 
HETATM 8867 O O   . HOH O 3 .   ? -30.770 -0.801  12.557  1.00 31.81  ? 498 HOH G O   1 
HETATM 8868 O O   . HOH O 3 .   ? -43.379 16.684  11.528  1.00 20.82  ? 499 HOH G O   1 
HETATM 8869 O O   . HOH O 3 .   ? -9.856  55.138  -12.519 1.00 21.05  ? 500 HOH G O   1 
HETATM 8870 O O   . HOH O 3 .   ? -29.095 40.166  5.052   1.00 36.40  ? 501 HOH G O   1 
HETATM 8871 O O   . HOH O 3 .   ? -20.822 35.950  -22.258 1.00 39.99  ? 502 HOH G O   1 
HETATM 8872 O O   . HOH O 3 .   ? -39.918 18.849  -2.921  1.00 22.30  ? 503 HOH G O   1 
HETATM 8873 O O   . HOH O 3 .   ? -25.468 -14.872 3.725   1.00 29.02  ? 504 HOH G O   1 
HETATM 8874 O O   . HOH O 3 .   ? -29.219 20.794  5.900   1.00 17.71  ? 505 HOH G O   1 
HETATM 8875 O O   . HOH O 3 .   ? -21.584 9.132   -3.640  1.00 25.23  ? 506 HOH G O   1 
HETATM 8876 O O   . HOH O 3 .   ? 4.432   34.899  -9.131  1.00 20.79  ? 507 HOH G O   1 
HETATM 8877 O O   . HOH O 3 .   ? -17.626 6.743   -1.107  1.00 32.25  ? 508 HOH G O   1 
HETATM 8878 O O   . HOH O 3 .   ? -28.290 34.301  0.710   1.00 45.51  ? 509 HOH G O   1 
HETATM 8879 O O   . HOH O 3 .   ? -41.416 11.542  8.140   1.00 29.72  ? 510 HOH G O   1 
HETATM 8880 O O   . HOH O 3 .   ? -5.254  31.152  -21.309 1.00 26.67  ? 511 HOH G O   1 
HETATM 8881 O O   . HOH O 3 .   ? -23.293 51.684  -4.233  1.00 25.43  ? 512 HOH G O   1 
HETATM 8882 O O   . HOH O 3 .   ? -46.441 19.587  4.215   1.00 37.91  ? 513 HOH G O   1 
HETATM 8883 O O   . HOH O 3 .   ? -28.079 37.874  -7.470  1.00 34.03  ? 514 HOH G O   1 
HETATM 8884 O O   . HOH O 3 .   ? -22.322 29.370  -20.010 1.00 27.79  ? 515 HOH G O   1 
HETATM 8885 O O   . HOH O 3 .   ? -24.811 -1.283  11.732  1.00 27.17  ? 516 HOH G O   1 
HETATM 8886 O O   . HOH O 3 .   ? -27.874 39.529  -20.244 1.00 29.94  ? 517 HOH G O   1 
HETATM 8887 O O   . HOH O 3 .   ? -41.499 12.535  -5.082  1.00 31.76  ? 518 HOH G O   1 
HETATM 8888 O O   . HOH O 3 .   ? -17.689 10.159  4.996   1.00 24.32  ? 519 HOH G O   1 
HETATM 8889 O O   . HOH O 3 .   ? -23.734 8.497   -8.587  1.00 19.48  ? 520 HOH G O   1 
HETATM 8890 O O   . HOH O 3 .   ? -34.291 33.780  10.901  1.00 36.46  ? 521 HOH G O   1 
HETATM 8891 O O   . HOH O 3 .   ? -26.170 18.066  -19.716 1.00 32.27  ? 522 HOH G O   1 
HETATM 8892 O O   . HOH O 3 .   ? -4.740  45.193  -14.472 1.00 22.46  ? 523 HOH G O   1 
HETATM 8893 O O   . HOH O 3 .   ? -38.800 21.659  -11.213 1.00 28.09  ? 524 HOH G O   1 
HETATM 8894 O O   . HOH O 3 .   ? -43.947 43.372  9.130   1.00 29.48  ? 525 HOH G O   1 
HETATM 8895 O O   . HOH O 3 .   ? -7.354  34.186  -28.043 1.00 52.89  ? 526 HOH G O   1 
HETATM 8896 O O   . HOH O 3 .   ? -17.872 54.174  -8.572  1.00 27.33  ? 527 HOH G O   1 
HETATM 8897 O O   . HOH O 3 .   ? -32.705 43.768  9.897   1.00 22.07  ? 528 HOH G O   1 
HETATM 8898 O O   . HOH O 3 .   ? -11.704 51.544  -4.204  1.00 34.84  ? 529 HOH G O   1 
HETATM 8899 O O   . HOH O 3 .   ? -20.123 12.454  7.413   1.00 18.53  ? 530 HOH G O   1 
HETATM 8900 O O   . HOH O 3 .   ? -9.632  52.179  -6.319  1.00 41.86  ? 531 HOH G O   1 
HETATM 8901 O O   . HOH O 3 .   ? -14.354 43.311  -1.221  1.00 25.62  ? 532 HOH G O   1 
HETATM 8902 O O   . HOH O 3 .   ? -21.732 19.467  -18.867 1.00 39.74  ? 533 HOH G O   1 
HETATM 8903 O O   . HOH O 3 .   ? -20.308 2.180   -7.694  1.00 37.79  ? 534 HOH G O   1 
HETATM 8904 O O   . HOH O 3 .   ? -18.276 3.148   7.535   1.00 19.67  ? 535 HOH G O   1 
HETATM 8905 O O   . HOH O 3 .   ? -5.875  30.668  -18.764 1.00 37.32  ? 536 HOH G O   1 
HETATM 8906 O O   . HOH O 3 .   ? -11.326 55.972  -19.177 1.00 45.13  ? 537 HOH G O   1 
HETATM 8907 O O   . HOH O 3 .   ? -20.532 40.964  -30.013 1.00 37.56  ? 538 HOH G O   1 
HETATM 8908 O O   . HOH O 3 .   ? -21.937 31.187  3.731   1.00 37.59  ? 539 HOH G O   1 
HETATM 8909 O O   . HOH O 3 .   ? -8.966  53.218  -23.304 1.00 15.38  ? 540 HOH G O   1 
HETATM 8910 O O   . HOH O 3 .   ? -4.341  43.840  -25.974 1.00 31.04  ? 541 HOH G O   1 
HETATM 8911 O O   . HOH O 3 .   ? -16.004 20.437  -7.381  1.00 22.54  ? 542 HOH G O   1 
HETATM 8912 O O   . HOH O 3 .   ? -26.436 40.516  1.892   1.00 46.65  ? 543 HOH G O   1 
HETATM 8913 O O   . HOH O 3 .   ? -26.550 19.838  6.388   1.00 41.51  ? 544 HOH G O   1 
HETATM 8914 O O   . HOH O 3 .   ? -7.210  22.298  -14.893 1.00 21.65  ? 545 HOH G O   1 
HETATM 8915 O O   . HOH O 3 .   ? -23.438 51.814  -9.484  1.00 22.44  ? 546 HOH G O   1 
HETATM 8916 O O   . HOH O 3 .   ? -35.950 23.604  -12.700 1.00 54.09  ? 547 HOH G O   1 
HETATM 8917 O O   . HOH O 3 .   ? -24.316 -0.547  -2.205  1.00 41.80  ? 548 HOH G O   1 
HETATM 8918 O O   . HOH O 3 .   ? -20.895 -0.128  -9.401  1.00 33.49  ? 549 HOH G O   1 
HETATM 8919 O O   . HOH O 3 .   ? -22.314 0.618   9.701   1.00 68.56  ? 550 HOH G O   1 
HETATM 8920 O O   . HOH O 3 .   ? -47.670 3.433   -3.379  1.00 31.77  ? 551 HOH G O   1 
HETATM 8921 O O   . HOH O 3 .   ? -52.211 36.708  -1.051  1.00 19.96  ? 552 HOH G O   1 
HETATM 8922 O O   . HOH O 3 .   ? -18.932 50.733  -2.414  1.00 41.93  ? 553 HOH G O   1 
HETATM 8923 O O   . HOH O 3 .   ? -48.037 26.888  -2.361  1.00 25.60  ? 554 HOH G O   1 
HETATM 8924 O O   . HOH O 3 .   ? -47.389 5.578   1.493   1.00 38.65  ? 555 HOH G O   1 
HETATM 8925 O O   . HOH O 3 .   ? -21.737 45.881  1.282   1.00 52.98  ? 556 HOH G O   1 
HETATM 8926 O O   . HOH O 3 .   ? -44.562 35.640  -5.220  1.00 29.03  ? 557 HOH G O   1 
HETATM 8927 O O   . HOH O 3 .   ? -40.316 45.643  3.814   1.00 22.61  ? 558 HOH G O   1 
HETATM 8928 O O   . HOH O 3 .   ? -26.765 31.631  -19.928 1.00 21.48  ? 559 HOH G O   1 
HETATM 8929 O O   . HOH O 3 .   ? -9.868  55.061  -9.856  1.00 34.67  ? 560 HOH G O   1 
HETATM 8930 O O   . HOH O 3 .   ? -29.700 47.368  1.915   1.00 45.80  ? 561 HOH G O   1 
HETATM 8931 O O   . HOH O 3 .   ? -39.678 26.757  -9.776  1.00 37.73  ? 562 HOH G O   1 
HETATM 8932 O O   . HOH O 3 .   ? -41.355 -2.762  -2.387  1.00 30.63  ? 563 HOH G O   1 
HETATM 8933 O O   . HOH O 3 .   ? -7.246  23.738  -24.901 1.00 44.22  ? 564 HOH G O   1 
HETATM 8934 O O   . HOH O 3 .   ? -23.944 15.563  -13.141 1.00 24.49  ? 565 HOH G O   1 
HETATM 8935 O O   . HOH O 3 .   ? -20.550 12.051  -15.523 1.00 46.79  ? 566 HOH G O   1 
HETATM 8936 O O   . HOH O 3 .   ? -30.861 46.635  -0.430  1.00 26.77  ? 567 HOH G O   1 
HETATM 8937 O O   . HOH O 3 .   ? -18.656 53.422  -2.792  1.00 33.39  ? 568 HOH G O   1 
HETATM 8938 O O   . HOH O 3 .   ? -30.809 45.542  -3.335  1.00 38.58  ? 569 HOH G O   1 
HETATM 8939 O O   . HOH O 3 .   ? -42.456 -2.445  -4.827  1.00 37.35  ? 570 HOH G O   1 
HETATM 8940 O O   . HOH O 3 .   ? -15.648 20.179  -10.062 1.00 42.83  ? 571 HOH G O   1 
HETATM 8941 O O   . HOH O 3 .   ? -38.214 25.075  -12.293 1.00 40.18  ? 572 HOH G O   1 
HETATM 8942 O O   . HOH O 3 .   ? -38.270 -3.732  4.481   1.00 35.96  ? 573 HOH G O   1 
HETATM 8943 O O   . HOH O 3 .   ? -46.932 24.620  2.205   1.00 19.63  ? 574 HOH G O   1 
HETATM 8944 O O   . HOH O 3 .   ? -14.138 33.592  -34.422 1.00 34.76  ? 575 HOH G O   1 
HETATM 8945 O O   . HOH O 3 .   ? -33.950 -4.317  10.450  1.00 19.13  ? 576 HOH G O   1 
HETATM 8946 O O   . HOH O 3 .   ? -27.725 35.681  -23.226 1.00 37.45  ? 577 HOH G O   1 
HETATM 8947 O O   . HOH O 3 .   ? -44.586 8.365   -7.546  1.00 35.05  ? 578 HOH G O   1 
HETATM 8948 O O   . HOH O 3 .   ? -42.362 -0.193  2.006   1.00 32.62  ? 579 HOH G O   1 
HETATM 8949 O O   . HOH O 3 .   ? -33.337 46.245  2.045   1.00 31.88  ? 580 HOH G O   1 
HETATM 8950 O O   . HOH O 3 .   ? -47.739 16.128  3.002   1.00 30.33  ? 581 HOH G O   1 
HETATM 8951 O O   . HOH O 3 .   ? -20.094 -5.518  -6.723  1.00 33.16  ? 582 HOH G O   1 
HETATM 8952 O O   . HOH O 3 .   ? -35.738 31.995  -15.981 1.00 37.32  ? 583 HOH G O   1 
HETATM 8953 O O   . HOH O 3 .   ? -7.505  31.993  -22.607 1.00 27.97  ? 584 HOH G O   1 
HETATM 8954 O O   . HOH O 3 .   ? -48.621 12.464  -0.715  1.00 21.94  ? 585 HOH G O   1 
HETATM 8955 O O   . HOH O 3 .   ? -47.480 40.873  -8.432  1.00 40.03  ? 586 HOH G O   1 
HETATM 8956 O O   . HOH O 3 .   ? -18.949 50.650  -5.262  1.00 12.24  ? 587 HOH G O   1 
HETATM 8957 O O   . HOH O 3 .   ? -17.245 51.035  -21.874 1.00 23.51  ? 588 HOH G O   1 
HETATM 8958 O O   . HOH O 3 .   ? -47.016 39.663  -5.200  1.00 20.28  ? 589 HOH G O   1 
HETATM 8959 O O   . HOH O 3 .   ? -48.059 3.609   -6.038  1.00 39.58  ? 590 HOH G O   1 
HETATM 8960 O O   . HOH O 3 .   ? -30.615 12.822  10.823  1.00 25.85  ? 591 HOH G O   1 
HETATM 8961 O O   . HOH O 3 .   ? -21.157 -13.627 8.874   1.00 53.48  ? 592 HOH G O   1 
HETATM 8962 O O   . HOH O 3 .   ? -32.377 33.423  -15.705 1.00 34.16  ? 593 HOH G O   1 
HETATM 8963 O O   . HOH O 3 .   ? -33.768 38.458  -7.513  1.00 21.12  ? 594 HOH G O   1 
HETATM 8964 O O   . HOH O 3 .   ? -28.687 -4.213  -11.658 1.00 35.41  ? 595 HOH G O   1 
HETATM 8965 O O   . HOH O 3 .   ? -28.719 37.260  -15.458 1.00 29.83  ? 596 HOH G O   1 
HETATM 8966 O O   . HOH O 3 .   ? -33.601 44.865  -0.282  1.00 45.08  ? 597 HOH G O   1 
HETATM 8967 O O   . HOH O 3 .   ? -23.763 30.422  -15.799 1.00 35.64  ? 598 HOH G O   1 
HETATM 8968 O O   . HOH O 3 .   ? -19.635 12.726  -17.998 1.00 29.69  ? 599 HOH G O   1 
HETATM 8969 O O   . HOH O 3 .   ? -22.419 -6.894  6.208   1.00 23.61  ? 600 HOH G O   1 
HETATM 8970 O O   . HOH O 3 .   ? -44.153 27.935  -8.038  1.00 49.53  ? 601 HOH G O   1 
HETATM 8971 O O   . HOH O 3 .   ? -28.575 49.685  0.445   1.00 38.66  ? 602 HOH G O   1 
HETATM 8972 O O   . HOH O 3 .   ? -29.126 2.534   -13.587 1.00 48.62  ? 603 HOH G O   1 
HETATM 8973 O O   . HOH O 3 .   ? -29.322 20.973  8.536   1.00 30.36  ? 604 HOH G O   1 
HETATM 8974 O O   . HOH O 3 .   ? -17.230 -14.410 4.887   1.00 51.45  ? 605 HOH G O   1 
HETATM 8975 O O   . HOH O 3 .   ? -26.999 30.079  -14.687 1.00 33.65  ? 606 HOH G O   1 
HETATM 8976 O O   . HOH O 3 .   ? -8.736  57.681  -13.464 1.00 41.62  ? 607 HOH G O   1 
HETATM 8977 O O   . HOH O 3 .   ? -27.113 47.864  -15.548 1.00 21.18  ? 608 HOH G O   1 
HETATM 8978 O O   . HOH O 3 .   ? -21.538 26.621  2.577   1.00 36.70  ? 609 HOH G O   1 
HETATM 8979 O O   . HOH O 3 .   ? -11.976 37.876  -3.396  1.00 29.92  ? 610 HOH G O   1 
HETATM 8980 O O   . HOH O 3 .   ? -21.063 12.952  -12.422 1.00 43.65  ? 611 HOH G O   1 
HETATM 8981 O O   . HOH O 3 .   ? -10.512 62.176  -7.463  1.00 24.86  ? 612 HOH G O   1 
HETATM 8982 O O   . HOH O 3 .   ? -24.169 11.528  -11.205 1.00 66.63  ? 613 HOH G O   1 
HETATM 8983 O O   . HOH O 3 .   ? -42.785 -2.372  -0.108  1.00 28.85  ? 614 HOH G O   1 
HETATM 8984 O O   . HOH O 3 .   ? -32.132 -5.963  8.676   1.00 35.78  ? 615 HOH G O   1 
HETATM 8985 O O   . HOH O 3 .   ? -34.306 43.820  -4.511  1.00 35.04  ? 616 HOH G O   1 
HETATM 8986 O O   . HOH O 3 .   ? -15.792 37.988  -1.632  1.00 21.09  ? 617 HOH G O   1 
HETATM 8987 O O   . HOH O 3 .   ? -44.193 34.288  -9.155  1.00 60.68  ? 618 HOH G O   1 
HETATM 8988 O O   . HOH O 3 .   ? -16.618 14.397  -6.898  1.00 41.93  ? 619 HOH G O   1 
HETATM 8989 O O   . HOH O 3 .   ? -27.135 6.050   14.746  1.00 23.59  ? 620 HOH G O   1 
HETATM 8990 O O   . HOH O 3 .   ? -3.249  36.329  -23.034 1.00 28.93  ? 621 HOH G O   1 
HETATM 8991 O O   . HOH O 3 .   ? -25.820 -2.244  -10.852 1.00 71.51  ? 622 HOH G O   1 
HETATM 8992 O O   . HOH O 3 .   ? -21.967 10.260  -10.264 1.00 30.18  ? 623 HOH G O   1 
HETATM 8993 O O   . HOH O 3 .   ? -5.385  18.775  -18.695 1.00 30.53  ? 624 HOH G O   1 
HETATM 8994 O O   . HOH O 3 .   ? -46.302 -2.237  -3.754  1.00 43.30  ? 625 HOH G O   1 
HETATM 8995 O O   . HOH O 3 .   ? -21.179 -16.262 3.621   1.00 44.03  ? 626 HOH G O   1 
HETATM 8996 O O   . HOH O 3 .   ? -4.840  48.190  -23.768 1.00 50.12  ? 627 HOH G O   1 
HETATM 8997 O O   . HOH O 3 .   ? -35.832 47.593  3.733   1.00 32.48  ? 628 HOH G O   1 
HETATM 8998 O O   . HOH O 3 .   ? -2.876  32.068  -20.424 1.00 33.12  ? 629 HOH G O   1 
HETATM 8999 O O   . HOH O 3 .   ? -43.303 14.532  -4.698  1.00 39.51  ? 630 HOH G O   1 
HETATM 9000 O O   . HOH O 3 .   ? -33.921 -3.784  -13.815 1.00 34.48  ? 631 HOH G O   1 
HETATM 9001 O O   . HOH O 3 .   ? -12.283 36.349  -34.052 1.00 31.19  ? 632 HOH G O   1 
HETATM 9002 O O   . HOH O 3 .   ? -29.132 6.090   -15.024 1.00 32.51  ? 633 HOH G O   1 
HETATM 9003 O O   . HOH O 3 .   ? -21.214 -3.084  -7.028  1.00 36.01  ? 634 HOH G O   1 
HETATM 9004 O O   . HOH O 3 .   ? -31.824 17.769  11.379  1.00 55.31  ? 635 HOH G O   1 
HETATM 9005 O O   . HOH O 3 .   ? -17.540 60.257  -9.771  1.00 33.22  ? 636 HOH G O   1 
HETATM 9006 O O   . HOH O 3 .   ? -6.914  52.183  -13.008 1.00 66.44  ? 637 HOH G O   1 
HETATM 9007 O O   . HOH O 3 .   ? -50.432 40.129  4.931   1.00 49.11  ? 638 HOH G O   1 
HETATM 9008 O O   . HOH O 3 .   ? -22.838 13.046  -14.492 1.00 40.81  ? 639 HOH G O   1 
HETATM 9009 O O   . HOH O 3 .   ? -49.348 7.105   -1.660  1.00 28.14  ? 640 HOH G O   1 
HETATM 9010 O O   . HOH O 3 .   ? -18.820 14.035  10.011  1.00 43.37  ? 641 HOH G O   1 
HETATM 9011 O O   . HOH O 3 .   ? -29.497 49.024  -10.691 1.00 26.24  ? 642 HOH G O   1 
HETATM 9012 O O   . HOH O 3 .   ? -27.576 2.178   -10.973 1.00 26.27  ? 643 HOH G O   1 
HETATM 9013 O O   . HOH O 3 .   ? -36.170 43.549  -7.555  1.00 32.07  ? 644 HOH G O   1 
HETATM 9014 O O   . HOH O 3 .   ? -5.969  54.801  -20.501 1.00 28.04  ? 645 HOH G O   1 
HETATM 9015 O O   . HOH O 3 .   ? -24.118 42.200  2.726   1.00 37.09  ? 646 HOH G O   1 
HETATM 9016 O O   . HOH O 3 .   ? -46.811 3.785   -0.844  1.00 26.81  ? 647 HOH G O   1 
HETATM 9017 O O   . HOH O 3 .   ? -30.455 40.081  -5.660  1.00 18.79  ? 648 HOH G O   1 
HETATM 9018 O O   . HOH O 3 .   ? -4.354  55.966  -16.008 1.00 21.74  ? 649 HOH G O   1 
HETATM 9019 O O   . HOH O 3 .   ? -9.991  40.182  -29.172 1.00 80.61  ? 650 HOH G O   1 
HETATM 9020 O O   . HOH O 3 .   ? -39.756 5.005   4.881   1.00 32.13  ? 651 HOH G O   1 
HETATM 9021 O O   . HOH O 3 .   ? -31.076 44.856  -11.405 1.00 14.93  ? 652 HOH G O   1 
HETATM 9022 O O   . HOH O 3 .   ? -43.743 29.105  -10.463 1.00 40.67  ? 653 HOH G O   1 
HETATM 9023 O O   . HOH O 3 .   ? -19.185 13.072  -10.334 1.00 24.52  ? 654 HOH G O   1 
HETATM 9024 O O   . HOH O 3 .   ? -5.708  27.582  -32.115 1.00 31.65  ? 655 HOH G O   1 
HETATM 9025 O O   . HOH O 3 .   ? -31.099 43.938  -14.188 1.00 20.51  ? 656 HOH G O   1 
HETATM 9026 O O   . HOH O 3 .   ? -41.702 -3.496  2.095   1.00 21.19  ? 657 HOH G O   1 
HETATM 9027 O O   . HOH O 3 .   ? -23.778 54.399  3.148   1.00 38.86  ? 658 HOH G O   1 
HETATM 9028 O O   . HOH O 3 .   ? -47.829 9.273   -4.005  1.00 18.79  ? 659 HOH G O   1 
HETATM 9029 O O   . HOH O 3 .   ? -5.719  40.649  -25.219 1.00 21.82  ? 660 HOH G O   1 
HETATM 9030 O O   . HOH O 3 .   ? -4.076  19.491  -16.438 1.00 19.74  ? 661 HOH G O   1 
HETATM 9031 O O   . HOH O 3 .   ? -46.939 36.952  -9.351  1.00 36.02  ? 662 HOH G O   1 
HETATM 9032 O O   . HOH O 3 .   ? -45.536 12.171  -6.822  1.00 22.10  ? 663 HOH G O   1 
HETATM 9033 O O   . HOH O 3 .   ? -39.668 -3.872  6.791   1.00 22.62  ? 664 HOH G O   1 
HETATM 9034 O O   . HOH O 3 .   ? -45.883 -3.653  -8.521  1.00 26.63  ? 665 HOH G O   1 
HETATM 9035 O O   . HOH O 3 .   ? -5.964  37.966  -24.777 1.00 29.14  ? 666 HOH G O   1 
HETATM 9036 O O   . HOH O 3 .   ? -48.831 8.858   -7.023  1.00 40.24  ? 667 HOH G O   1 
HETATM 9037 O O   . HOH O 3 .   ? -22.359 10.655  -13.058 1.00 39.43  ? 668 HOH G O   1 
HETATM 9038 O O   . HOH O 3 .   ? -3.475  49.642  -26.290 1.00 42.00  ? 669 HOH G O   1 
HETATM 9039 O O   . HOH O 3 .   ? -18.348 -12.436 10.810  1.00 43.48  ? 670 HOH G O   1 
HETATM 9040 O O   . HOH O 3 .   ? -39.778 23.089  -14.562 1.00 43.10  ? 671 HOH G O   1 
HETATM 9041 O O   . HOH O 3 .   ? -21.897 9.657   -16.368 1.00 52.83  ? 672 HOH G O   1 
HETATM 9042 O O   . HOH O 3 .   ? -45.978 37.130  -12.132 1.00 40.23  ? 673 HOH G O   1 
HETATM 9043 O O   . HOH O 3 .   ? -19.800 -15.231 10.566  1.00 43.67  ? 674 HOH G O   1 
HETATM 9044 O O   . HOH O 3 .   ? -37.047 23.280  -15.721 1.00 37.73  ? 675 HOH G O   1 
HETATM 9045 O O   . HOH O 3 .   ? -31.366 26.457  -18.664 1.00 25.18  ? 676 HOH G O   1 
HETATM 9046 O O   . HOH O 3 .   ? -32.313 46.596  -15.957 1.00 38.86  ? 677 HOH G O   1 
HETATM 9047 O O   . HOH O 3 .   ? -35.275 -0.511  18.811  1.00 20.86  ? 678 HOH G O   1 
HETATM 9048 O O   . HOH O 3 .   ? -37.867 -6.206  13.903  1.00 29.63  ? 679 HOH G O   1 
HETATM 9049 O O   . HOH O 3 .   ? -34.346 48.019  -17.419 1.00 36.05  ? 680 HOH G O   1 
HETATM 9050 O O   . HOH O 3 .   ? 2.358   23.309  -20.850 1.00 29.25  ? 681 HOH G O   1 
HETATM 9051 O O   . HOH O 3 .   ? -48.728 19.549  -13.312 1.00 39.05  ? 682 HOH G O   1 
HETATM 9052 O O   . HOH O 3 .   ? -21.735 24.630  17.287  1.00 30.14  ? 683 HOH G O   1 
HETATM 9053 O O   . HOH O 3 .   ? -35.523 -0.496  22.353  1.00 35.83  ? 684 HOH G O   1 
HETATM 9054 O O   . HOH O 3 .   ? -35.386 -10.598 19.190  1.00 39.30  ? 685 HOH G O   1 
HETATM 9055 O O   . HOH O 3 .   ? -39.607 -9.057  18.784  1.00 51.77  ? 686 HOH G O   1 
HETATM 9056 O O   . HOH O 3 .   ? -51.677 36.943  -20.704 1.00 45.64  ? 687 HOH G O   1 
HETATM 9057 O O   . HOH O 3 .   ? -51.427 34.233  -20.864 1.00 47.61  ? 688 HOH G O   1 
HETATM 9058 O O   . HOH O 3 .   ? -58.049 0.257   -17.488 1.00 31.00  ? 689 HOH G O   1 
HETATM 9059 O O   . HOH P 3 .   ? 18.824  -7.479  23.775  1.00 40.35  ? 401 HOH H O   1 
HETATM 9060 O O   . HOH P 3 .   ? 25.115  11.676  44.613  1.00 33.12  ? 402 HOH H O   1 
HETATM 9061 O O   . HOH P 3 .   ? 21.523  10.585  25.140  1.00 12.08  ? 403 HOH H O   1 
HETATM 9062 O O   . HOH P 3 .   ? 24.967  7.028   23.109  1.00 14.24  ? 404 HOH H O   1 
HETATM 9063 O O   . HOH P 3 .   ? 10.689  4.325   45.308  1.00 19.73  ? 405 HOH H O   1 
HETATM 9064 O O   . HOH P 3 .   ? 18.911  0.656   38.944  1.00 27.33  ? 406 HOH H O   1 
HETATM 9065 O O   . HOH P 3 .   ? 31.282  5.777   32.188  1.00 22.79  ? 407 HOH H O   1 
HETATM 9066 O O   . HOH P 3 .   ? -7.905  0.721   45.783  1.00 19.05  ? 408 HOH H O   1 
HETATM 9067 O O   . HOH P 3 .   ? 17.619  16.856  28.173  1.00 31.57  ? 409 HOH H O   1 
HETATM 9068 O O   . HOH P 3 .   ? 13.521  10.673  49.300  1.00 29.18  ? 410 HOH H O   1 
HETATM 9069 O O   . HOH P 3 .   ? 28.463  18.467  39.425  1.00 24.26  ? 411 HOH H O   1 
HETATM 9070 O O   . HOH P 3 .   ? 10.829  1.586   38.792  1.00 18.96  ? 412 HOH H O   1 
HETATM 9071 O O   . HOH P 3 .   ? 32.009  6.905   39.068  1.00 18.42  ? 413 HOH H O   1 
HETATM 9072 O O   . HOH P 3 .   ? 7.502   10.001  33.079  1.00 24.05  ? 414 HOH H O   1 
HETATM 9073 O O   . HOH P 3 .   ? 9.597   18.880  40.223  1.00 38.85  ? 415 HOH H O   1 
HETATM 9074 O O   . HOH P 3 .   ? 18.744  -5.769  43.747  1.00 58.74  ? 416 HOH H O   1 
HETATM 9075 O O   . HOH P 3 .   ? 10.586  25.737  50.617  1.00 23.36  ? 417 HOH H O   1 
HETATM 9076 O O   . HOH P 3 .   ? 27.152  20.972  38.347  1.00 24.74  ? 418 HOH H O   1 
HETATM 9077 O O   . HOH P 3 .   ? 21.981  17.009  47.134  1.00 57.11  ? 419 HOH H O   1 
HETATM 9078 O O   . HOH P 3 .   ? 25.424  24.565  37.009  1.00 33.76  ? 420 HOH H O   1 
HETATM 9079 O O   . HOH P 3 .   ? 7.750   -13.798 44.587  1.00 27.46  ? 421 HOH H O   1 
HETATM 9080 O O   . HOH P 3 .   ? 9.352   -23.998 43.662  1.00 35.02  ? 422 HOH H O   1 
HETATM 9081 O O   . HOH P 3 .   ? 14.868  -13.070 37.089  1.00 41.99  ? 423 HOH H O   1 
HETATM 9082 O O   . HOH P 3 .   ? 20.348  -3.383  31.355  1.00 14.45  ? 424 HOH H O   1 
HETATM 9083 O O   . HOH P 3 .   ? 13.631  1.630   44.949  1.00 20.51  ? 425 HOH H O   1 
HETATM 9084 O O   . HOH P 3 .   ? 25.591  25.062  42.922  1.00 39.61  ? 426 HOH H O   1 
HETATM 9085 O O   . HOH P 3 .   ? 36.511  13.332  38.676  1.00 26.67  ? 427 HOH H O   1 
HETATM 9086 O O   . HOH P 3 .   ? 14.157  8.120   42.663  1.00 12.72  ? 428 HOH H O   1 
HETATM 9087 O O   . HOH P 3 .   ? 12.738  7.213   51.275  1.00 38.62  ? 429 HOH H O   1 
HETATM 9088 O O   . HOH P 3 .   ? 20.901  -0.570  31.583  1.00 29.29  ? 430 HOH H O   1 
HETATM 9089 O O   . HOH P 3 .   ? 32.316  9.244   29.833  1.00 30.80  ? 431 HOH H O   1 
HETATM 9090 O O   . HOH P 3 .   ? -9.799  13.315  51.332  1.00 22.65  ? 432 HOH H O   1 
HETATM 9091 O O   . HOH P 3 .   ? 24.530  0.097   25.684  1.00 41.67  ? 433 HOH H O   1 
HETATM 9092 O O   . HOH P 3 .   ? 9.868   -19.119 41.694  1.00 41.87  ? 434 HOH H O   1 
HETATM 9093 O O   . HOH P 3 .   ? -0.322  -1.155  37.982  1.00 40.81  ? 435 HOH H O   1 
HETATM 9094 O O   . HOH P 3 .   ? 15.133  8.472   26.275  1.00 38.61  ? 436 HOH H O   1 
HETATM 9095 O O   . HOH P 3 .   ? 20.612  -1.036  18.368  1.00 20.57  ? 437 HOH H O   1 
HETATM 9096 O O   . HOH P 3 .   ? 12.075  -11.314 36.104  1.00 28.52  ? 438 HOH H O   1 
HETATM 9097 O O   . HOH P 3 .   ? 13.092  4.454   55.013  1.00 52.66  ? 439 HOH H O   1 
HETATM 9098 O O   . HOH P 3 .   ? -0.098  -21.566 36.602  1.00 54.82  ? 440 HOH H O   1 
HETATM 9099 O O   . HOH P 3 .   ? -2.210  -9.133  41.347  1.00 25.45  ? 441 HOH H O   1 
HETATM 9100 O O   . HOH P 3 .   ? 9.042   3.328   26.855  1.00 17.94  ? 442 HOH H O   1 
HETATM 9101 O O   . HOH P 3 .   ? 7.649   21.247  30.567  1.00 41.73  ? 443 HOH H O   1 
HETATM 9102 O O   . HOH P 3 .   ? 5.506   20.464  48.615  1.00 38.87  ? 444 HOH H O   1 
HETATM 9103 O O   . HOH P 3 .   ? -10.299 -13.026 51.540  1.00 51.61  ? 445 HOH H O   1 
HETATM 9104 O O   . HOH P 3 .   ? 23.950  -4.430  26.007  1.00 28.44  ? 446 HOH H O   1 
HETATM 9105 O O   . HOH P 3 .   ? 26.618  -2.152  27.108  1.00 38.51  ? 447 HOH H O   1 
HETATM 9106 O O   . HOH P 3 .   ? 13.048  -25.447 40.683  1.00 41.48  ? 448 HOH H O   1 
HETATM 9107 O O   . HOH P 3 .   ? 15.799  5.419   31.068  1.00 43.39  ? 449 HOH H O   1 
HETATM 9108 O O   . HOH P 3 .   ? -11.998 -27.172 45.709  1.00 27.68  ? 450 HOH H O   1 
HETATM 9109 O O   . HOH P 3 .   ? -6.612  -22.093 36.968  1.00 42.60  ? 451 HOH H O   1 
HETATM 9110 O O   . HOH P 3 .   ? 14.501  8.008   23.706  1.00 37.97  ? 452 HOH H O   1 
HETATM 9111 O O   . HOH P 3 .   ? 10.265  7.936   31.257  1.00 34.06  ? 453 HOH H O   1 
HETATM 9112 O O   . HOH P 3 .   ? 15.584  -10.218 29.543  1.00 35.29  ? 454 HOH H O   1 
HETATM 9113 O O   . HOH P 3 .   ? 17.433  -11.945 45.291  1.00 30.22  ? 455 HOH H O   1 
HETATM 9114 O O   . HOH P 3 .   ? -7.873  -11.194 46.943  1.00 31.84  ? 456 HOH H O   1 
HETATM 9115 O O   . HOH P 3 .   ? 16.162  23.427  48.038  1.00 29.16  ? 457 HOH H O   1 
HETATM 9116 O O   . HOH P 3 .   ? -7.502  -14.340 45.911  1.00 32.73  ? 458 HOH H O   1 
HETATM 9117 O O   . HOH P 3 .   ? -13.240 -22.947 46.939  1.00 42.53  ? 459 HOH H O   1 
HETATM 9118 O O   . HOH P 3 .   ? 14.504  3.388   18.840  1.00 26.55  ? 460 HOH H O   1 
HETATM 9119 O O   . HOH P 3 .   ? 31.441  18.597  35.641  1.00 31.55  ? 461 HOH H O   1 
HETATM 9120 O O   . HOH P 3 .   ? 17.448  26.908  41.665  1.00 26.35  ? 462 HOH H O   1 
HETATM 9121 O O   . HOH P 3 .   ? 19.792  8.381   18.043  1.00 31.08  ? 463 HOH H O   1 
HETATM 9122 O O   . HOH P 3 .   ? 39.498  7.328   42.317  1.00 30.52  ? 464 HOH H O   1 
HETATM 9123 O O   . HOH P 3 .   ? 7.496   10.270  41.581  1.00 54.74  ? 465 HOH H O   1 
HETATM 9124 O O   . HOH P 3 .   ? 24.801  -5.491  35.511  1.00 35.06  ? 466 HOH H O   1 
HETATM 9125 O O   . HOH P 3 .   ? 21.659  22.635  47.927  1.00 24.19  ? 467 HOH H O   1 
HETATM 9126 O O   . HOH P 3 .   ? -3.547  -9.069  46.352  1.00 33.03  ? 468 HOH H O   1 
HETATM 9127 O O   . HOH P 3 .   ? 11.672  17.992  51.203  1.00 44.27  ? 469 HOH H O   1 
HETATM 9128 O O   . HOH P 3 .   ? 20.740  15.508  50.061  1.00 33.42  ? 470 HOH H O   1 
HETATM 9129 O O   . HOH P 3 .   ? 26.204  29.870  35.121  1.00 38.78  ? 471 HOH H O   1 
HETATM 9130 O O   . HOH P 3 .   ? -5.647  -19.967 38.365  1.00 70.15  ? 472 HOH H O   1 
HETATM 9131 O O   . HOH P 3 .   ? 38.871  9.917   39.180  1.00 31.53  ? 473 HOH H O   1 
HETATM 9132 O O   . HOH P 3 .   ? 7.637   3.229   37.123  1.00 24.92  ? 474 HOH H O   1 
HETATM 9133 O O   . HOH P 3 .   ? 15.315  -7.493  28.132  1.00 23.03  ? 475 HOH H O   1 
HETATM 9134 O O   . HOH P 3 .   ? 6.552   12.960  29.043  1.00 31.40  ? 476 HOH H O   1 
HETATM 9135 O O   . HOH P 3 .   ? 8.010   6.196   30.010  1.00 29.48  ? 477 HOH H O   1 
HETATM 9136 O O   . HOH P 3 .   ? 9.536   4.966   36.005  1.00 45.72  ? 478 HOH H O   1 
HETATM 9137 O O   . HOH P 3 .   ? 33.434  12.276  25.742  1.00 29.96  ? 479 HOH H O   1 
HETATM 9138 O O   . HOH P 3 .   ? 1.106   12.556  45.372  1.00 29.14  ? 480 HOH H O   1 
HETATM 9139 O O   . HOH P 3 .   ? -11.398 -2.292  52.634  1.00 48.15  ? 481 HOH H O   1 
HETATM 9140 O O   . HOH P 3 .   ? -2.993  19.578  49.332  1.00 30.96  ? 482 HOH H O   1 
HETATM 9141 O O   . HOH P 3 .   ? -3.860  -1.894  40.273  1.00 28.39  ? 483 HOH H O   1 
HETATM 9142 O O   . HOH P 3 .   ? 25.829  -7.945  27.465  1.00 48.97  ? 484 HOH H O   1 
HETATM 9143 O O   . HOH P 3 .   ? 16.560  23.805  44.386  1.00 35.32  ? 485 HOH H O   1 
HETATM 9144 O O   . HOH P 3 .   ? 1.832   18.468  50.700  1.00 41.21  ? 486 HOH H O   1 
HETATM 9145 O O   . HOH P 3 .   ? 4.823   9.532   36.616  1.00 30.66  ? 487 HOH H O   1 
HETATM 9146 O O   . HOH P 3 .   ? 13.428  -8.063  32.387  1.00 34.56  ? 488 HOH H O   1 
HETATM 9147 O O   . HOH P 3 .   ? 2.603   -23.252 35.085  1.00 33.23  ? 489 HOH H O   1 
HETATM 9148 O O   . HOH P 3 .   ? 4.935   -8.259  42.661  1.00 21.54  ? 490 HOH H O   1 
HETATM 9149 O O   . HOH P 3 .   ? 8.156   24.164  47.084  1.00 36.64  ? 491 HOH H O   1 
HETATM 9150 O O   . HOH P 3 .   ? -3.743  -18.683 36.862  1.00 33.53  ? 492 HOH H O   1 
HETATM 9151 O O   . HOH P 3 .   ? -6.770  8.206   54.927  1.00 25.94  ? 493 HOH H O   1 
HETATM 9152 O O   . HOH P 3 .   ? 5.059   20.634  51.286  1.00 41.82  ? 494 HOH H O   1 
HETATM 9153 O O   . HOH P 3 .   ? -7.169  -30.795 42.380  1.00 13.72  ? 495 HOH H O   1 
HETATM 9154 O O   . HOH P 3 .   ? 13.038  11.300  24.672  1.00 44.82  ? 496 HOH H O   1 
HETATM 9155 O O   . HOH P 3 .   ? -12.854 -23.628 41.793  1.00 33.16  ? 497 HOH H O   1 
HETATM 9156 O O   . HOH P 3 .   ? 8.305   -34.819 59.110  1.00 39.00  ? 498 HOH H O   1 
HETATM 9157 O O   . HOH P 3 .   ? 35.909  4.657   31.388  1.00 25.83  ? 499 HOH H O   1 
HETATM 9158 O O   . HOH P 3 .   ? -3.607  -30.666 52.766  1.00 40.93  ? 500 HOH H O   1 
HETATM 9159 O O   . HOH P 3 .   ? 9.567   -4.000  56.678  1.00 50.81  ? 501 HOH H O   1 
HETATM 9160 O O   . HOH P 3 .   ? 18.185  -11.039 42.819  1.00 33.94  ? 502 HOH H O   1 
HETATM 9161 O O   . HOH P 3 .   ? 11.595  -29.840 54.224  1.00 34.47  ? 503 HOH H O   1 
HETATM 9162 O O   . HOH P 3 .   ? 14.783  20.529  52.485  1.00 36.30  ? 504 HOH H O   1 
HETATM 9163 O O   . HOH P 3 .   ? -8.002  -29.429 44.766  1.00 32.24  ? 505 HOH H O   1 
HETATM 9164 O O   . HOH P 3 .   ? 0.060   -22.394 59.965  1.00 34.98  ? 506 HOH H O   1 
HETATM 9165 O O   . HOH P 3 .   ? 6.577   -1.616  26.558  1.00 30.67  ? 507 HOH H O   1 
HETATM 9166 O O   . HOH P 3 .   ? 23.584  11.265  46.746  1.00 33.28  ? 508 HOH H O   1 
HETATM 9167 O O   . HOH P 3 .   ? -4.577  -17.283 39.114  1.00 42.18  ? 509 HOH H O   1 
HETATM 9168 O O   . HOH P 3 .   ? 33.272  8.174   27.495  1.00 26.73  ? 510 HOH H O   1 
HETATM 9169 O O   . HOH P 3 .   ? 11.775  -2.533  56.109  1.00 29.99  ? 511 HOH H O   1 
HETATM 9170 O O   . HOH P 3 .   ? -16.872 2.533   49.993  1.00 36.12  ? 512 HOH H O   1 
HETATM 9171 O O   . HOH P 3 .   ? 2.898   17.822  57.968  1.00 33.54  ? 513 HOH H O   1 
HETATM 9172 O O   . HOH P 3 .   ? 20.493  -3.068  44.650  1.00 36.02  ? 514 HOH H O   1 
HETATM 9173 O O   . HOH P 3 .   ? 14.521  5.985   18.065  1.00 28.24  ? 515 HOH H O   1 
HETATM 9174 O O   . HOH P 3 .   ? 27.800  4.923   26.989  1.00 20.84  ? 516 HOH H O   1 
HETATM 9175 O O   . HOH P 3 .   ? 14.382  25.742  41.717  1.00 50.75  ? 517 HOH H O   1 
HETATM 9176 O O   . HOH P 3 .   ? 30.291  3.553   31.140  1.00 21.99  ? 518 HOH H O   1 
HETATM 9177 O O   . HOH P 3 .   ? -9.509  -4.978  55.123  1.00 40.19  ? 519 HOH H O   1 
HETATM 9178 O O   . HOH P 3 .   ? 25.355  -2.207  17.043  1.00 22.62  ? 520 HOH H O   1 
HETATM 9179 O O   . HOH P 3 .   ? 31.704  14.548  25.327  1.00 48.07  ? 521 HOH H O   1 
HETATM 9180 O O   . HOH P 3 .   ? 13.543  -39.524 59.904  1.00 35.13  ? 522 HOH H O   1 
HETATM 9181 O O   . HOH P 3 .   ? -8.919  -20.647 35.404  1.00 39.44  ? 523 HOH H O   1 
HETATM 9182 O O   . HOH P 3 .   ? 28.705  -0.007  18.744  1.00 30.54  ? 524 HOH H O   1 
HETATM 9183 O O   . HOH P 3 .   ? 15.597  -16.652 33.893  1.00 48.39  ? 525 HOH H O   1 
HETATM 9184 O O   . HOH P 3 .   ? -13.631 -12.896 53.501  1.00 31.04  ? 526 HOH H O   1 
HETATM 9185 O O   . HOH P 3 .   ? 14.430  23.314  53.447  1.00 37.95  ? 527 HOH H O   1 
HETATM 9186 O O   . HOH P 3 .   ? -15.833 13.352  55.242  1.00 35.54  ? 528 HOH H O   1 
HETATM 9187 O O   . HOH P 3 .   ? 24.365  28.818  46.698  1.00 42.29  ? 529 HOH H O   1 
HETATM 9188 O O   . HOH P 3 .   ? 30.421  6.826   26.796  1.00 29.12  ? 530 HOH H O   1 
HETATM 9189 O O   . HOH P 3 .   ? 5.363   -5.168  27.191  1.00 51.80  ? 531 HOH H O   1 
HETATM 9190 O O   . HOH P 3 .   ? 17.319  25.383  49.489  1.00 29.05  ? 532 HOH H O   1 
HETATM 9191 O O   . HOH P 3 .   ? -10.483 -29.407 45.816  1.00 40.43  ? 533 HOH H O   1 
HETATM 9192 O O   . HOH P 3 .   ? 13.922  -22.677 40.529  1.00 27.91  ? 534 HOH H O   1 
HETATM 9193 O O   . HOH P 3 .   ? 15.057  -40.117 62.079  1.00 32.55  ? 535 HOH H O   1 
HETATM 9194 O O   . HOH P 3 .   ? -13.141 -9.631  50.986  1.00 24.21  ? 536 HOH H O   1 
HETATM 9195 O O   . HOH P 3 .   ? -6.041  -19.195 35.522  1.00 36.29  ? 537 HOH H O   1 
HETATM 9196 O O   . HOH P 3 .   ? -14.254 -22.445 39.234  1.00 41.80  ? 538 HOH H O   1 
HETATM 9197 O O   . HOH P 3 .   ? 3.955   -3.490  30.105  1.00 30.49  ? 539 HOH H O   1 
HETATM 9198 O O   . HOH P 3 .   ? 13.578  -42.075 60.849  1.00 57.55  ? 540 HOH H O   1 
HETATM 9199 O O   . HOH P 3 .   ? 8.906   11.390  60.428  1.00 29.78  ? 541 HOH H O   1 
HETATM 9200 O O   . HOH P 3 .   ? 2.748   -1.034  32.607  1.00 37.71  ? 542 HOH H O   1 
HETATM 9201 O O   . HOH P 3 .   ? 12.764  -31.788 62.418  1.00 43.74  ? 543 HOH H O   1 
HETATM 9202 O O   . HOH P 3 .   ? -8.962  -10.895 42.920  1.00 38.41  ? 544 HOH H O   1 
HETATM 9203 O O   . HOH P 3 .   ? 30.221  27.636  36.282  1.00 31.12  ? 545 HOH H O   1 
HETATM 9204 O O   . HOH P 3 .   ? 16.815  24.504  53.939  1.00 29.12  ? 546 HOH H O   1 
HETATM 9205 O O   . HOH P 3 .   ? 14.378  28.423  53.655  1.00 39.73  ? 547 HOH H O   1 
HETATM 9206 O O   . HOH P 3 .   ? -7.859  -17.938 33.978  1.00 41.57  ? 548 HOH H O   1 
HETATM 9207 O O   . HOH P 3 .   ? 0.065   14.575  30.538  1.00 32.92  ? 549 HOH H O   1 
HETATM 9208 O O   . HOH P 3 .   ? -11.872 -10.593 43.341  1.00 35.15  ? 550 HOH H O   1 
HETATM 9209 O O   . HOH P 3 .   ? -15.696 -8.998  44.759  1.00 26.48  ? 551 HOH H O   1 
HETATM 9210 O O   . HOH P 3 .   ? 7.772   -23.437 69.648  1.00 40.52  ? 552 HOH H O   1 
HETATM 9211 O O   . HOH P 3 .   ? 11.113  14.156  58.243  1.00 38.94  ? 553 HOH H O   1 
HETATM 9212 O O   . HOH P 3 .   ? 16.738  26.912  55.158  1.00 41.21  ? 554 HOH H O   1 
HETATM 9213 O O   . HOH P 3 .   ? -12.802 -19.736 31.570  1.00 38.48  ? 555 HOH H O   1 
HETATM 9214 O O   . HOH P 3 .   ? 43.969  14.871  32.268  1.00 28.58  ? 556 HOH H O   1 
HETATM 9215 O O   . HOH P 3 .   ? -11.326 -21.758 28.800  1.00 37.53  ? 557 HOH H O   1 
HETATM 9216 O O   . HOH P 3 .   ? -13.774 -13.898 35.584  1.00 11.03  ? 558 HOH H O   1 
HETATM 9217 O O   . HOH P 3 .   ? -0.675  -23.010 26.132  1.00 24.51  ? 559 HOH H O   1 
HETATM 9218 O O   . HOH P 3 .   ? 21.451  -41.933 68.115  1.00 56.74  ? 560 HOH H O   1 
HETATM 9219 O O   . HOH P 3 .   ? 16.202  -51.027 56.144  1.00 32.32  ? 561 HOH H O   1 
HETATM 9220 O O   . HOH P 3 .   ? -12.995 -19.031 27.257  1.00 49.87  ? 562 HOH H O   1 
HETATM 9221 O O   . HOH P 3 .   ? 18.805  -2.089  63.173  1.00 34.97  ? 563 HOH H O   1 
HETATM 9222 O O   . HOH P 3 .   ? -7.029  6.854   28.518  1.00 23.75  ? 564 HOH H O   1 
HETATM 9223 O O   . HOH P 3 .   ? 16.617  -39.584 69.943  1.00 52.98  ? 565 HOH H O   1 
HETATM 9224 O O   . HOH P 3 .   ? 14.625  -48.562 65.917  1.00 44.11  ? 566 HOH H O   1 
HETATM 9225 O O   . HOH P 3 .   ? -2.918  22.972  23.086  1.00 22.64  ? 567 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   702 702 ASP ASP A . n 
A 1 2   THR 2   703 703 THR THR A . n 
A 1 3   GLU 3   704 704 GLU GLU A . n 
A 1 4   MET 4   705 705 MET MET A . n 
A 1 5   GLU 5   706 706 GLU GLU A . n 
A 1 6   GLU 6   707 707 GLU GLU A . n 
A 1 7   VAL 7   708 708 VAL VAL A . n 
A 1 8   ASP 8   709 709 ASP ASP A . n 
B 1 1   ASP 1   702 702 ASP ASP B . n 
B 1 2   THR 2   703 703 THR THR B . n 
B 1 3   GLU 3   704 704 GLU GLU B . n 
B 1 4   MET 4   705 705 MET MET B . n 
B 1 5   GLU 5   706 706 GLU GLU B . n 
B 1 6   GLU 6   707 707 GLU GLU B . n 
B 1 7   VAL 7   708 708 VAL VAL B . n 
B 1 8   ASP 8   709 709 ASP ASP B . n 
C 1 1   ASP 1   702 ?   ?   ?   C . n 
C 1 2   THR 2   703 ?   ?   ?   C . n 
C 1 3   GLU 3   704 704 GLU GLU C . n 
C 1 4   MET 4   705 705 MET MET C . n 
C 1 5   GLU 5   706 706 GLU GLU C . n 
C 1 6   GLU 6   707 707 GLU GLU C . n 
C 1 7   VAL 7   708 708 VAL VAL C . n 
C 1 8   ASP 8   709 709 ASP ASP C . n 
D 1 1   ASP 1   702 ?   ?   ?   D . n 
D 1 2   THR 2   703 ?   ?   ?   D . n 
D 1 3   GLU 3   704 704 GLU GLU D . n 
D 1 4   MET 4   705 705 MET MET D . n 
D 1 5   GLU 5   706 706 GLU GLU D . n 
D 1 6   GLU 6   707 707 GLU GLU D . n 
D 1 7   VAL 7   708 ?   ?   ?   D . n 
D 1 8   ASP 8   709 ?   ?   ?   D . n 
E 2 1   GLU 1   91  ?   ?   ?   E . n 
E 2 2   GLU 2   92  92  GLU GLU E . n 
E 2 3   TRP 3   93  93  TRP TRP E . n 
E 2 4   LEU 4   94  94  LEU LEU E . n 
E 2 5   ASP 5   95  95  ASP ASP E . n 
E 2 6   ILE 6   96  96  ILE ILE E . n 
E 2 7   LEU 7   97  97  LEU LEU E . n 
E 2 8   GLY 8   98  98  GLY GLY E . n 
E 2 9   ASN 9   99  99  ASN ASN E . n 
E 2 10  GLY 10  100 100 GLY GLY E . n 
E 2 11  LEU 11  101 101 LEU LEU E . n 
E 2 12  LEU 12  102 102 LEU LEU E . n 
E 2 13  ARG 13  103 103 ARG ARG E . n 
E 2 14  LYS 14  104 104 LYS LYS E . n 
E 2 15  LYS 15  105 105 LYS LYS E . n 
E 2 16  THR 16  106 106 THR THR E . n 
E 2 17  LEU 17  107 107 LEU LEU E . n 
E 2 18  VAL 18  108 108 VAL VAL E . n 
E 2 19  PRO 19  109 109 PRO PRO E . n 
E 2 20  GLY 20  110 110 GLY GLY E . n 
E 2 21  PRO 21  111 111 PRO PRO E . n 
E 2 22  PRO 22  112 112 PRO PRO E . n 
E 2 23  GLY 23  113 113 GLY GLY E . n 
E 2 24  SER 24  114 114 SER SER E . n 
E 2 25  SER 25  115 115 SER SER E . n 
E 2 26  ARG 26  116 116 ARG ARG E . n 
E 2 27  PRO 27  117 117 PRO PRO E . n 
E 2 28  VAL 28  118 118 VAL VAL E . n 
E 2 29  LYS 29  119 119 LYS LYS E . n 
E 2 30  GLY 30  120 120 GLY GLY E . n 
E 2 31  GLN 31  121 121 GLN GLN E . n 
E 2 32  VAL 32  122 122 VAL VAL E . n 
E 2 33  VAL 33  123 123 VAL VAL E . n 
E 2 34  THR 34  124 124 THR THR E . n 
E 2 35  VAL 35  125 125 VAL VAL E . n 
E 2 36  HIS 36  126 126 HIS HIS E . n 
E 2 37  LEU 37  127 127 LEU LEU E . n 
E 2 38  GLN 38  128 128 GLN GLN E . n 
E 2 39  THR 39  129 129 THR THR E . n 
E 2 40  SER 40  130 130 SER SER E . n 
E 2 41  LEU 41  131 131 LEU LEU E . n 
E 2 42  GLU 42  132 132 GLU GLU E . n 
E 2 43  ASN 43  133 133 ASN ASN E . n 
E 2 44  GLY 44  134 134 GLY GLY E . n 
E 2 45  THR 45  135 135 THR THR E . n 
E 2 46  ARG 46  136 136 ARG ARG E . n 
E 2 47  VAL 47  137 137 VAL VAL E . n 
E 2 48  GLN 48  138 138 GLN GLN E . n 
E 2 49  GLU 49  139 139 GLU GLU E . n 
E 2 50  GLU 50  140 140 GLU GLU E . n 
E 2 51  PRO 51  141 141 PRO PRO E . n 
E 2 52  GLU 52  142 142 GLU GLU E . n 
E 2 53  LEU 53  143 143 LEU LEU E . n 
E 2 54  VAL 54  144 144 VAL VAL E . n 
E 2 55  PHE 55  145 145 PHE PHE E . n 
E 2 56  THR 56  146 146 THR THR E . n 
E 2 57  LEU 57  147 147 LEU LEU E . n 
E 2 58  GLY 58  148 148 GLY GLY E . n 
E 2 59  ASP 59  149 149 ASP ASP E . n 
E 2 60  CYS 60  150 150 CYS CYS E . n 
E 2 61  ASP 61  151 151 ASP ASP E . n 
E 2 62  VAL 62  152 152 VAL VAL E . n 
E 2 63  ILE 63  153 153 ILE ILE E . n 
E 2 64  GLN 64  154 154 GLN GLN E . n 
E 2 65  ALA 65  155 155 ALA ALA E . n 
E 2 66  LEU 66  156 156 LEU LEU E . n 
E 2 67  ASP 67  157 157 ASP ASP E . n 
E 2 68  LEU 68  158 158 LEU LEU E . n 
E 2 69  SER 69  159 159 SER SER E . n 
E 2 70  VAL 70  160 160 VAL VAL E . n 
E 2 71  PRO 71  161 161 PRO PRO E . n 
E 2 72  LEU 72  162 162 LEU LEU E . n 
E 2 73  MET 73  163 163 MET MET E . n 
E 2 74  ASP 74  164 164 ASP ASP E . n 
E 2 75  VAL 75  165 165 VAL VAL E . n 
E 2 76  GLY 76  166 166 GLY GLY E . n 
E 2 77  GLU 77  167 167 GLU GLU E . n 
E 2 78  THR 78  168 168 THR THR E . n 
E 2 79  ALA 79  169 169 ALA ALA E . n 
E 2 80  MET 80  170 170 MET MET E . n 
E 2 81  VAL 81  171 171 VAL VAL E . n 
E 2 82  THR 82  172 172 THR THR E . n 
E 2 83  ALA 83  173 173 ALA ALA E . n 
E 2 84  ASP 84  174 174 ASP ASP E . n 
E 2 85  SER 85  175 175 SER SER E . n 
E 2 86  LYS 86  176 176 LYS LYS E . n 
E 2 87  TYR 87  177 177 TYR TYR E . n 
E 2 88  CYS 88  178 178 CYS CYS E . n 
E 2 89  TYR 89  179 179 TYR TYR E . n 
E 2 90  GLY 90  180 180 GLY GLY E . n 
E 2 91  PRO 91  181 181 PRO PRO E . n 
E 2 92  GLN 92  182 182 GLN GLN E . n 
E 2 93  GLY 93  183 183 GLY GLY E . n 
E 2 94  ARG 94  184 184 ARG ARG E . n 
E 2 95  SER 95  185 185 SER SER E . n 
E 2 96  PRO 96  186 186 PRO PRO E . n 
E 2 97  TYR 97  187 187 TYR TYR E . n 
E 2 98  ILE 98  188 188 ILE ILE E . n 
E 2 99  PRO 99  189 189 PRO PRO E . n 
E 2 100 PRO 100 190 190 PRO PRO E . n 
E 2 101 HIS 101 191 191 HIS HIS E . n 
E 2 102 ALA 102 192 192 ALA ALA E . n 
E 2 103 ALA 103 193 193 ALA ALA E . n 
E 2 104 LEU 104 194 194 LEU LEU E . n 
E 2 105 CYS 105 195 195 CYS CYS E . n 
E 2 106 LEU 106 196 196 LEU LEU E . n 
E 2 107 GLU 107 197 197 GLU GLU E . n 
E 2 108 VAL 108 198 198 VAL VAL E . n 
E 2 109 THR 109 199 199 THR THR E . n 
E 2 110 LEU 110 200 200 LEU LEU E . n 
E 2 111 LYS 111 201 201 LYS LYS E . n 
E 2 112 THR 112 202 202 THR THR E . n 
E 2 113 ALA 113 203 203 ALA ALA E . n 
E 2 114 VAL 114 204 204 VAL VAL E . n 
E 2 115 ASP 115 205 205 ASP ASP E . n 
E 2 116 GLY 116 206 206 GLY GLY E . n 
E 2 117 PRO 117 207 207 PRO PRO E . n 
E 2 118 ASP 118 208 208 ASP ASP E . n 
E 2 119 LEU 119 209 209 LEU LEU E . n 
E 2 120 GLU 120 210 210 GLU GLU E . n 
E 2 121 MET 121 211 211 MET MET E . n 
E 2 122 LEU 122 212 212 LEU LEU E . n 
E 2 123 THR 123 213 213 THR THR E . n 
E 2 124 GLY 124 214 214 GLY GLY E . n 
E 2 125 GLN 125 215 215 GLN GLN E . n 
E 2 126 GLU 126 216 216 GLU GLU E . n 
E 2 127 ARG 127 217 217 ARG ARG E . n 
E 2 128 VAL 128 218 218 VAL VAL E . n 
E 2 129 ALA 129 219 219 ALA ALA E . n 
E 2 130 LEU 130 220 220 LEU LEU E . n 
E 2 131 ALA 131 221 221 ALA ALA E . n 
E 2 132 ASN 132 222 222 ASN ASN E . n 
E 2 133 ARG 133 223 223 ARG ARG E . n 
E 2 134 LYS 134 224 224 LYS LYS E . n 
E 2 135 ARG 135 225 225 ARG ARG E . n 
E 2 136 GLU 136 226 226 GLU GLU E . n 
E 2 137 CYS 137 227 227 CYS CYS E . n 
E 2 138 GLY 138 228 228 GLY GLY E . n 
E 2 139 ASN 139 229 229 ASN ASN E . n 
E 2 140 ALA 140 230 230 ALA ALA E . n 
E 2 141 HIS 141 231 231 HIS HIS E . n 
E 2 142 TYR 142 232 232 TYR TYR E . n 
E 2 143 GLN 143 233 233 GLN GLN E . n 
E 2 144 ARG 144 234 234 ARG ARG E . n 
E 2 145 ALA 145 235 235 ALA ALA E . n 
E 2 146 ASP 146 236 236 ASP ASP E . n 
E 2 147 PHE 147 237 237 PHE PHE E . n 
E 2 148 VAL 148 238 238 VAL VAL E . n 
E 2 149 LEU 149 239 239 LEU LEU E . n 
E 2 150 ALA 150 240 240 ALA ALA E . n 
E 2 151 ALA 151 241 241 ALA ALA E . n 
E 2 152 ASN 152 242 242 ASN ASN E . n 
E 2 153 SER 153 243 243 SER SER E . n 
E 2 154 TYR 154 244 244 TYR TYR E . n 
E 2 155 ASP 155 245 245 ASP ASP E . n 
E 2 156 LEU 156 246 246 LEU LEU E . n 
E 2 157 ALA 157 247 247 ALA ALA E . n 
E 2 158 ILE 158 248 248 ILE ILE E . n 
E 2 159 LYS 159 249 249 LYS LYS E . n 
E 2 160 ALA 160 250 250 ALA ALA E . n 
E 2 161 ILE 161 251 251 ILE ILE E . n 
E 2 162 THR 162 252 252 THR THR E . n 
E 2 163 SER 163 253 253 SER SER E . n 
E 2 164 SER 164 254 254 SER SER E . n 
E 2 165 ALA 165 255 255 ALA ALA E . n 
E 2 166 LYS 166 256 256 LYS LYS E . n 
E 2 167 VAL 167 257 257 VAL VAL E . n 
E 2 168 ASP 168 258 258 ASP ASP E . n 
E 2 169 MET 169 259 259 MET MET E . n 
E 2 170 THR 170 260 260 THR THR E . n 
E 2 171 PHE 171 261 261 PHE PHE E . n 
E 2 172 GLU 172 262 262 GLU GLU E . n 
E 2 173 GLU 173 263 263 GLU GLU E . n 
E 2 174 GLU 174 264 264 GLU GLU E . n 
E 2 175 ALA 175 265 265 ALA ALA E . n 
E 2 176 GLN 176 266 266 GLN GLN E . n 
E 2 177 LEU 177 267 267 LEU LEU E . n 
E 2 178 LEU 178 268 268 LEU LEU E . n 
E 2 179 GLN 179 269 269 GLN GLN E . n 
E 2 180 LEU 180 270 270 LEU LEU E . n 
E 2 181 LYS 181 271 271 LYS LYS E . n 
E 2 182 VAL 182 272 272 VAL VAL E . n 
E 2 183 LYS 183 273 273 LYS LYS E . n 
E 2 184 CYS 184 274 274 CYS CYS E . n 
E 2 185 LEU 185 275 275 LEU LEU E . n 
E 2 186 ASN 186 276 276 ASN ASN E . n 
E 2 187 ASN 187 277 277 ASN ASN E . n 
E 2 188 LEU 188 278 278 LEU LEU E . n 
E 2 189 ALA 189 279 279 ALA ALA E . n 
E 2 190 ALA 190 280 280 ALA ALA E . n 
E 2 191 SER 191 281 281 SER SER E . n 
E 2 192 GLN 192 282 282 GLN GLN E . n 
E 2 193 LEU 193 283 283 LEU LEU E . n 
E 2 194 LYS 194 284 284 LYS LYS E . n 
E 2 195 LEU 195 285 285 LEU LEU E . n 
E 2 196 ASP 196 286 286 ASP ASP E . n 
E 2 197 HIS 197 287 287 HIS HIS E . n 
E 2 198 TYR 198 288 288 TYR TYR E . n 
E 2 199 ARG 199 289 289 ARG ARG E . n 
E 2 200 ALA 200 290 290 ALA ALA E . n 
E 2 201 ALA 201 291 291 ALA ALA E . n 
E 2 202 LEU 202 292 292 LEU LEU E . n 
E 2 203 ARG 203 293 293 ARG ARG E . n 
E 2 204 SER 204 294 294 SER SER E . n 
E 2 205 CYS 205 295 295 CYS CYS E . n 
E 2 206 SER 206 296 296 SER SER E . n 
E 2 207 LEU 207 297 297 LEU LEU E . n 
E 2 208 VAL 208 298 298 VAL VAL E . n 
E 2 209 LEU 209 299 299 LEU LEU E . n 
E 2 210 GLU 210 300 300 GLU GLU E . n 
E 2 211 HIS 211 301 301 HIS HIS E . n 
E 2 212 GLN 212 302 302 GLN GLN E . n 
E 2 213 PRO 213 303 303 PRO PRO E . n 
E 2 214 ASP 214 304 304 ASP ASP E . n 
E 2 215 ASN 215 305 305 ASN ASN E . n 
E 2 216 ILE 216 306 306 ILE ILE E . n 
E 2 217 LYS 217 307 307 LYS LYS E . n 
E 2 218 ALA 218 308 308 ALA ALA E . n 
E 2 219 LEU 219 309 309 LEU LEU E . n 
E 2 220 PHE 220 310 310 PHE PHE E . n 
E 2 221 ARG 221 311 311 ARG ARG E . n 
E 2 222 LYS 222 312 312 LYS LYS E . n 
E 2 223 GLY 223 313 313 GLY GLY E . n 
E 2 224 LYS 224 314 314 LYS LYS E . n 
E 2 225 VAL 225 315 315 VAL VAL E . n 
E 2 226 LEU 226 316 316 LEU LEU E . n 
E 2 227 ALA 227 317 317 ALA ALA E . n 
E 2 228 GLN 228 318 318 GLN GLN E . n 
E 2 229 GLN 229 319 319 GLN GLN E . n 
E 2 230 GLY 230 320 320 GLY GLY E . n 
E 2 231 GLU 231 321 321 GLU GLU E . n 
E 2 232 TYR 232 322 322 TYR TYR E . n 
E 2 233 SER 233 323 323 SER SER E . n 
E 2 234 GLU 234 324 324 GLU GLU E . n 
E 2 235 ALA 235 325 325 ALA ALA E . n 
E 2 236 ILE 236 326 326 ILE ILE E . n 
E 2 237 PRO 237 327 327 PRO PRO E . n 
E 2 238 ILE 238 328 328 ILE ILE E . n 
E 2 239 LEU 239 329 329 LEU LEU E . n 
E 2 240 ARG 240 330 330 ARG ARG E . n 
E 2 241 ALA 241 331 331 ALA ALA E . n 
E 2 242 ALA 242 332 332 ALA ALA E . n 
E 2 243 LEU 243 333 333 LEU LEU E . n 
E 2 244 LYS 244 334 334 LYS LYS E . n 
E 2 245 LEU 245 335 335 LEU LEU E . n 
E 2 246 GLU 246 336 336 GLU GLU E . n 
E 2 247 PRO 247 337 337 PRO PRO E . n 
E 2 248 SER 248 338 338 SER SER E . n 
E 2 249 ASN 249 339 339 ASN ASN E . n 
E 2 250 LYS 250 340 340 LYS LYS E . n 
E 2 251 THR 251 341 341 THR THR E . n 
E 2 252 ILE 252 342 342 ILE ILE E . n 
E 2 253 HIS 253 343 343 HIS HIS E . n 
E 2 254 ALA 254 344 344 ALA ALA E . n 
E 2 255 GLU 255 345 345 GLU GLU E . n 
E 2 256 LEU 256 346 346 LEU LEU E . n 
E 2 257 SER 257 347 347 SER SER E . n 
E 2 258 LYS 258 348 348 LYS LYS E . n 
E 2 259 LEU 259 349 349 LEU LEU E . n 
E 2 260 VAL 260 350 350 VAL VAL E . n 
E 2 261 LYS 261 351 351 LYS LYS E . n 
E 2 262 LYS 262 352 352 LYS LYS E . n 
E 2 263 HIS 263 353 353 HIS HIS E . n 
E 2 264 ALA 264 354 354 ALA ALA E . n 
E 2 265 ALA 265 355 355 ALA ALA E . n 
E 2 266 GLN 266 356 356 GLN GLN E . n 
E 2 267 ARG 267 357 ?   ?   ?   E . n 
E 2 268 SER 268 358 ?   ?   ?   E . n 
E 2 269 THR 269 359 ?   ?   ?   E . n 
E 2 270 GLU 270 360 ?   ?   ?   E . n 
E 2 271 THR 271 361 ?   ?   ?   E . n 
E 2 272 ALA 272 362 ?   ?   ?   E . n 
E 2 273 LEU 273 363 ?   ?   ?   E . n 
E 2 274 TYR 274 364 ?   ?   ?   E . n 
E 2 275 ARG 275 365 ?   ?   ?   E . n 
E 2 276 LYS 276 366 ?   ?   ?   E . n 
E 2 277 MET 277 367 ?   ?   ?   E . n 
E 2 278 LEU 278 368 ?   ?   ?   E . n 
E 2 279 GLY 279 369 ?   ?   ?   E . n 
E 2 280 ASN 280 370 ?   ?   ?   E . n 
E 2 281 PRO 281 371 ?   ?   ?   E . n 
E 2 282 SER 282 372 ?   ?   ?   E . n 
E 2 283 ARG 283 373 ?   ?   ?   E . n 
E 2 284 LEU 284 374 ?   ?   ?   E . n 
E 2 285 PRO 285 375 ?   ?   ?   E . n 
E 2 286 ALA 286 376 ?   ?   ?   E . n 
E 2 287 LYS 287 377 ?   ?   ?   E . n 
E 2 288 CYS 288 378 ?   ?   ?   E . n 
E 2 289 PRO 289 379 ?   ?   ?   E . n 
E 2 290 GLY 290 380 ?   ?   ?   E . n 
F 2 1   GLU 1   91  91  GLU GLU F . n 
F 2 2   GLU 2   92  92  GLU GLU F . n 
F 2 3   TRP 3   93  93  TRP TRP F . n 
F 2 4   LEU 4   94  94  LEU LEU F . n 
F 2 5   ASP 5   95  95  ASP ASP F . n 
F 2 6   ILE 6   96  96  ILE ILE F . n 
F 2 7   LEU 7   97  97  LEU LEU F . n 
F 2 8   GLY 8   98  98  GLY GLY F . n 
F 2 9   ASN 9   99  99  ASN ASN F . n 
F 2 10  GLY 10  100 100 GLY GLY F . n 
F 2 11  LEU 11  101 101 LEU LEU F . n 
F 2 12  LEU 12  102 102 LEU LEU F . n 
F 2 13  ARG 13  103 103 ARG ARG F . n 
F 2 14  LYS 14  104 104 LYS LYS F . n 
F 2 15  LYS 15  105 105 LYS LYS F . n 
F 2 16  THR 16  106 106 THR THR F . n 
F 2 17  LEU 17  107 107 LEU LEU F . n 
F 2 18  VAL 18  108 108 VAL VAL F . n 
F 2 19  PRO 19  109 109 PRO PRO F . n 
F 2 20  GLY 20  110 110 GLY GLY F . n 
F 2 21  PRO 21  111 111 PRO PRO F . n 
F 2 22  PRO 22  112 112 PRO PRO F . n 
F 2 23  GLY 23  113 113 GLY GLY F . n 
F 2 24  SER 24  114 114 SER SER F . n 
F 2 25  SER 25  115 115 SER SER F . n 
F 2 26  ARG 26  116 116 ARG ARG F . n 
F 2 27  PRO 27  117 117 PRO PRO F . n 
F 2 28  VAL 28  118 118 VAL VAL F . n 
F 2 29  LYS 29  119 119 LYS LYS F . n 
F 2 30  GLY 30  120 120 GLY GLY F . n 
F 2 31  GLN 31  121 121 GLN GLN F . n 
F 2 32  VAL 32  122 122 VAL VAL F . n 
F 2 33  VAL 33  123 123 VAL VAL F . n 
F 2 34  THR 34  124 124 THR THR F . n 
F 2 35  VAL 35  125 125 VAL VAL F . n 
F 2 36  HIS 36  126 126 HIS HIS F . n 
F 2 37  LEU 37  127 127 LEU LEU F . n 
F 2 38  GLN 38  128 128 GLN GLN F . n 
F 2 39  THR 39  129 129 THR THR F . n 
F 2 40  SER 40  130 130 SER SER F . n 
F 2 41  LEU 41  131 131 LEU LEU F . n 
F 2 42  GLU 42  132 132 GLU GLU F . n 
F 2 43  ASN 43  133 133 ASN ASN F . n 
F 2 44  GLY 44  134 134 GLY GLY F . n 
F 2 45  THR 45  135 135 THR THR F . n 
F 2 46  ARG 46  136 136 ARG ARG F . n 
F 2 47  VAL 47  137 137 VAL VAL F . n 
F 2 48  GLN 48  138 138 GLN GLN F . n 
F 2 49  GLU 49  139 139 GLU GLU F . n 
F 2 50  GLU 50  140 140 GLU GLU F . n 
F 2 51  PRO 51  141 141 PRO PRO F . n 
F 2 52  GLU 52  142 142 GLU GLU F . n 
F 2 53  LEU 53  143 143 LEU LEU F . n 
F 2 54  VAL 54  144 144 VAL VAL F . n 
F 2 55  PHE 55  145 145 PHE PHE F . n 
F 2 56  THR 56  146 146 THR THR F . n 
F 2 57  LEU 57  147 147 LEU LEU F . n 
F 2 58  GLY 58  148 148 GLY GLY F . n 
F 2 59  ASP 59  149 149 ASP ASP F . n 
F 2 60  CYS 60  150 150 CYS CYS F . n 
F 2 61  ASP 61  151 151 ASP ASP F . n 
F 2 62  VAL 62  152 152 VAL VAL F . n 
F 2 63  ILE 63  153 153 ILE ILE F . n 
F 2 64  GLN 64  154 154 GLN GLN F . n 
F 2 65  ALA 65  155 155 ALA ALA F . n 
F 2 66  LEU 66  156 156 LEU LEU F . n 
F 2 67  ASP 67  157 157 ASP ASP F . n 
F 2 68  LEU 68  158 158 LEU LEU F . n 
F 2 69  SER 69  159 159 SER SER F . n 
F 2 70  VAL 70  160 160 VAL VAL F . n 
F 2 71  PRO 71  161 161 PRO PRO F . n 
F 2 72  LEU 72  162 162 LEU LEU F . n 
F 2 73  MET 73  163 163 MET MET F . n 
F 2 74  ASP 74  164 164 ASP ASP F . n 
F 2 75  VAL 75  165 165 VAL VAL F . n 
F 2 76  GLY 76  166 166 GLY GLY F . n 
F 2 77  GLU 77  167 167 GLU GLU F . n 
F 2 78  THR 78  168 168 THR THR F . n 
F 2 79  ALA 79  169 169 ALA ALA F . n 
F 2 80  MET 80  170 170 MET MET F . n 
F 2 81  VAL 81  171 171 VAL VAL F . n 
F 2 82  THR 82  172 172 THR THR F . n 
F 2 83  ALA 83  173 173 ALA ALA F . n 
F 2 84  ASP 84  174 174 ASP ASP F . n 
F 2 85  SER 85  175 175 SER SER F . n 
F 2 86  LYS 86  176 176 LYS LYS F . n 
F 2 87  TYR 87  177 177 TYR TYR F . n 
F 2 88  CYS 88  178 178 CYS CYS F . n 
F 2 89  TYR 89  179 179 TYR TYR F . n 
F 2 90  GLY 90  180 180 GLY GLY F . n 
F 2 91  PRO 91  181 181 PRO PRO F . n 
F 2 92  GLN 92  182 182 GLN GLN F . n 
F 2 93  GLY 93  183 183 GLY GLY F . n 
F 2 94  ARG 94  184 184 ARG ARG F . n 
F 2 95  SER 95  185 185 SER SER F . n 
F 2 96  PRO 96  186 186 PRO PRO F . n 
F 2 97  TYR 97  187 187 TYR TYR F . n 
F 2 98  ILE 98  188 188 ILE ILE F . n 
F 2 99  PRO 99  189 189 PRO PRO F . n 
F 2 100 PRO 100 190 190 PRO PRO F . n 
F 2 101 HIS 101 191 191 HIS HIS F . n 
F 2 102 ALA 102 192 192 ALA ALA F . n 
F 2 103 ALA 103 193 193 ALA ALA F . n 
F 2 104 LEU 104 194 194 LEU LEU F . n 
F 2 105 CYS 105 195 195 CYS CYS F . n 
F 2 106 LEU 106 196 196 LEU LEU F . n 
F 2 107 GLU 107 197 197 GLU GLU F . n 
F 2 108 VAL 108 198 198 VAL VAL F . n 
F 2 109 THR 109 199 199 THR THR F . n 
F 2 110 LEU 110 200 200 LEU LEU F . n 
F 2 111 LYS 111 201 201 LYS LYS F . n 
F 2 112 THR 112 202 202 THR THR F . n 
F 2 113 ALA 113 203 203 ALA ALA F . n 
F 2 114 VAL 114 204 204 VAL VAL F . n 
F 2 115 ASP 115 205 205 ASP ASP F . n 
F 2 116 GLY 116 206 206 GLY GLY F . n 
F 2 117 PRO 117 207 207 PRO PRO F . n 
F 2 118 ASP 118 208 208 ASP ASP F . n 
F 2 119 LEU 119 209 209 LEU LEU F . n 
F 2 120 GLU 120 210 210 GLU GLU F . n 
F 2 121 MET 121 211 211 MET MET F . n 
F 2 122 LEU 122 212 212 LEU LEU F . n 
F 2 123 THR 123 213 213 THR THR F . n 
F 2 124 GLY 124 214 214 GLY GLY F . n 
F 2 125 GLN 125 215 215 GLN GLN F . n 
F 2 126 GLU 126 216 216 GLU GLU F . n 
F 2 127 ARG 127 217 217 ARG ARG F . n 
F 2 128 VAL 128 218 218 VAL VAL F . n 
F 2 129 ALA 129 219 219 ALA ALA F . n 
F 2 130 LEU 130 220 220 LEU LEU F . n 
F 2 131 ALA 131 221 221 ALA ALA F . n 
F 2 132 ASN 132 222 222 ASN ASN F . n 
F 2 133 ARG 133 223 223 ARG ARG F . n 
F 2 134 LYS 134 224 224 LYS LYS F . n 
F 2 135 ARG 135 225 225 ARG ARG F . n 
F 2 136 GLU 136 226 226 GLU GLU F . n 
F 2 137 CYS 137 227 227 CYS CYS F . n 
F 2 138 GLY 138 228 228 GLY GLY F . n 
F 2 139 ASN 139 229 229 ASN ASN F . n 
F 2 140 ALA 140 230 230 ALA ALA F . n 
F 2 141 HIS 141 231 231 HIS HIS F . n 
F 2 142 TYR 142 232 232 TYR TYR F . n 
F 2 143 GLN 143 233 233 GLN GLN F . n 
F 2 144 ARG 144 234 234 ARG ARG F . n 
F 2 145 ALA 145 235 235 ALA ALA F . n 
F 2 146 ASP 146 236 236 ASP ASP F . n 
F 2 147 PHE 147 237 237 PHE PHE F . n 
F 2 148 VAL 148 238 238 VAL VAL F . n 
F 2 149 LEU 149 239 239 LEU LEU F . n 
F 2 150 ALA 150 240 240 ALA ALA F . n 
F 2 151 ALA 151 241 241 ALA ALA F . n 
F 2 152 ASN 152 242 242 ASN ASN F . n 
F 2 153 SER 153 243 243 SER SER F . n 
F 2 154 TYR 154 244 244 TYR TYR F . n 
F 2 155 ASP 155 245 245 ASP ASP F . n 
F 2 156 LEU 156 246 246 LEU LEU F . n 
F 2 157 ALA 157 247 247 ALA ALA F . n 
F 2 158 ILE 158 248 248 ILE ILE F . n 
F 2 159 LYS 159 249 249 LYS LYS F . n 
F 2 160 ALA 160 250 250 ALA ALA F . n 
F 2 161 ILE 161 251 251 ILE ILE F . n 
F 2 162 THR 162 252 252 THR THR F . n 
F 2 163 SER 163 253 253 SER SER F . n 
F 2 164 SER 164 254 254 SER SER F . n 
F 2 165 ALA 165 255 255 ALA ALA F . n 
F 2 166 LYS 166 256 256 LYS LYS F . n 
F 2 167 VAL 167 257 257 VAL VAL F . n 
F 2 168 ASP 168 258 258 ASP ASP F . n 
F 2 169 MET 169 259 259 MET MET F . n 
F 2 170 THR 170 260 260 THR THR F . n 
F 2 171 PHE 171 261 261 PHE PHE F . n 
F 2 172 GLU 172 262 262 GLU GLU F . n 
F 2 173 GLU 173 263 263 GLU GLU F . n 
F 2 174 GLU 174 264 264 GLU GLU F . n 
F 2 175 ALA 175 265 265 ALA ALA F . n 
F 2 176 GLN 176 266 266 GLN GLN F . n 
F 2 177 LEU 177 267 267 LEU LEU F . n 
F 2 178 LEU 178 268 268 LEU LEU F . n 
F 2 179 GLN 179 269 269 GLN GLN F . n 
F 2 180 LEU 180 270 270 LEU LEU F . n 
F 2 181 LYS 181 271 271 LYS LYS F . n 
F 2 182 VAL 182 272 272 VAL VAL F . n 
F 2 183 LYS 183 273 273 LYS LYS F . n 
F 2 184 CYS 184 274 274 CYS CYS F . n 
F 2 185 LEU 185 275 275 LEU LEU F . n 
F 2 186 ASN 186 276 276 ASN ASN F . n 
F 2 187 ASN 187 277 277 ASN ASN F . n 
F 2 188 LEU 188 278 278 LEU LEU F . n 
F 2 189 ALA 189 279 279 ALA ALA F . n 
F 2 190 ALA 190 280 280 ALA ALA F . n 
F 2 191 SER 191 281 281 SER SER F . n 
F 2 192 GLN 192 282 282 GLN GLN F . n 
F 2 193 LEU 193 283 283 LEU LEU F . n 
F 2 194 LYS 194 284 284 LYS LYS F . n 
F 2 195 LEU 195 285 285 LEU LEU F . n 
F 2 196 ASP 196 286 286 ASP ASP F . n 
F 2 197 HIS 197 287 287 HIS HIS F . n 
F 2 198 TYR 198 288 288 TYR TYR F . n 
F 2 199 ARG 199 289 289 ARG ARG F . n 
F 2 200 ALA 200 290 290 ALA ALA F . n 
F 2 201 ALA 201 291 291 ALA ALA F . n 
F 2 202 LEU 202 292 292 LEU LEU F . n 
F 2 203 ARG 203 293 293 ARG ARG F . n 
F 2 204 SER 204 294 294 SER SER F . n 
F 2 205 CYS 205 295 295 CYS CYS F . n 
F 2 206 SER 206 296 296 SER SER F . n 
F 2 207 LEU 207 297 297 LEU LEU F . n 
F 2 208 VAL 208 298 298 VAL VAL F . n 
F 2 209 LEU 209 299 299 LEU LEU F . n 
F 2 210 GLU 210 300 300 GLU GLU F . n 
F 2 211 HIS 211 301 301 HIS HIS F . n 
F 2 212 GLN 212 302 302 GLN GLN F . n 
F 2 213 PRO 213 303 303 PRO PRO F . n 
F 2 214 ASP 214 304 304 ASP ASP F . n 
F 2 215 ASN 215 305 305 ASN ASN F . n 
F 2 216 ILE 216 306 306 ILE ILE F . n 
F 2 217 LYS 217 307 307 LYS LYS F . n 
F 2 218 ALA 218 308 308 ALA ALA F . n 
F 2 219 LEU 219 309 309 LEU LEU F . n 
F 2 220 PHE 220 310 310 PHE PHE F . n 
F 2 221 ARG 221 311 311 ARG ARG F . n 
F 2 222 LYS 222 312 312 LYS LYS F . n 
F 2 223 GLY 223 313 313 GLY GLY F . n 
F 2 224 LYS 224 314 314 LYS LYS F . n 
F 2 225 VAL 225 315 315 VAL VAL F . n 
F 2 226 LEU 226 316 316 LEU LEU F . n 
F 2 227 ALA 227 317 317 ALA ALA F . n 
F 2 228 GLN 228 318 318 GLN GLN F . n 
F 2 229 GLN 229 319 319 GLN GLN F . n 
F 2 230 GLY 230 320 320 GLY GLY F . n 
F 2 231 GLU 231 321 321 GLU GLU F . n 
F 2 232 TYR 232 322 322 TYR TYR F . n 
F 2 233 SER 233 323 323 SER SER F . n 
F 2 234 GLU 234 324 324 GLU GLU F . n 
F 2 235 ALA 235 325 325 ALA ALA F . n 
F 2 236 ILE 236 326 326 ILE ILE F . n 
F 2 237 PRO 237 327 327 PRO PRO F . n 
F 2 238 ILE 238 328 328 ILE ILE F . n 
F 2 239 LEU 239 329 329 LEU LEU F . n 
F 2 240 ARG 240 330 330 ARG ARG F . n 
F 2 241 ALA 241 331 331 ALA ALA F . n 
F 2 242 ALA 242 332 332 ALA ALA F . n 
F 2 243 LEU 243 333 333 LEU LEU F . n 
F 2 244 LYS 244 334 334 LYS LYS F . n 
F 2 245 LEU 245 335 335 LEU LEU F . n 
F 2 246 GLU 246 336 336 GLU GLU F . n 
F 2 247 PRO 247 337 337 PRO PRO F . n 
F 2 248 SER 248 338 338 SER SER F . n 
F 2 249 ASN 249 339 339 ASN ASN F . n 
F 2 250 LYS 250 340 340 LYS LYS F . n 
F 2 251 THR 251 341 341 THR THR F . n 
F 2 252 ILE 252 342 342 ILE ILE F . n 
F 2 253 HIS 253 343 343 HIS HIS F . n 
F 2 254 ALA 254 344 344 ALA ALA F . n 
F 2 255 GLU 255 345 345 GLU GLU F . n 
F 2 256 LEU 256 346 346 LEU LEU F . n 
F 2 257 SER 257 347 347 SER SER F . n 
F 2 258 LYS 258 348 348 LYS LYS F . n 
F 2 259 LEU 259 349 349 LEU LEU F . n 
F 2 260 VAL 260 350 350 VAL VAL F . n 
F 2 261 LYS 261 351 351 LYS LYS F . n 
F 2 262 LYS 262 352 352 LYS LYS F . n 
F 2 263 HIS 263 353 353 HIS HIS F . n 
F 2 264 ALA 264 354 354 ALA ALA F . n 
F 2 265 ALA 265 355 355 ALA ALA F . n 
F 2 266 GLN 266 356 ?   ?   ?   F . n 
F 2 267 ARG 267 357 ?   ?   ?   F . n 
F 2 268 SER 268 358 ?   ?   ?   F . n 
F 2 269 THR 269 359 ?   ?   ?   F . n 
F 2 270 GLU 270 360 ?   ?   ?   F . n 
F 2 271 THR 271 361 ?   ?   ?   F . n 
F 2 272 ALA 272 362 ?   ?   ?   F . n 
F 2 273 LEU 273 363 ?   ?   ?   F . n 
F 2 274 TYR 274 364 ?   ?   ?   F . n 
F 2 275 ARG 275 365 ?   ?   ?   F . n 
F 2 276 LYS 276 366 ?   ?   ?   F . n 
F 2 277 MET 277 367 ?   ?   ?   F . n 
F 2 278 LEU 278 368 ?   ?   ?   F . n 
F 2 279 GLY 279 369 ?   ?   ?   F . n 
F 2 280 ASN 280 370 ?   ?   ?   F . n 
F 2 281 PRO 281 371 ?   ?   ?   F . n 
F 2 282 SER 282 372 ?   ?   ?   F . n 
F 2 283 ARG 283 373 ?   ?   ?   F . n 
F 2 284 LEU 284 374 ?   ?   ?   F . n 
F 2 285 PRO 285 375 ?   ?   ?   F . n 
F 2 286 ALA 286 376 ?   ?   ?   F . n 
F 2 287 LYS 287 377 ?   ?   ?   F . n 
F 2 288 CYS 288 378 ?   ?   ?   F . n 
F 2 289 PRO 289 379 ?   ?   ?   F . n 
F 2 290 GLY 290 380 ?   ?   ?   F . n 
G 2 1   GLU 1   91  91  GLU GLU G . n 
G 2 2   GLU 2   92  92  GLU GLU G . n 
G 2 3   TRP 3   93  93  TRP TRP G . n 
G 2 4   LEU 4   94  94  LEU LEU G . n 
G 2 5   ASP 5   95  95  ASP ASP G . n 
G 2 6   ILE 6   96  96  ILE ILE G . n 
G 2 7   LEU 7   97  97  LEU LEU G . n 
G 2 8   GLY 8   98  98  GLY GLY G . n 
G 2 9   ASN 9   99  99  ASN ASN G . n 
G 2 10  GLY 10  100 100 GLY GLY G . n 
G 2 11  LEU 11  101 101 LEU LEU G . n 
G 2 12  LEU 12  102 102 LEU LEU G . n 
G 2 13  ARG 13  103 103 ARG ARG G . n 
G 2 14  LYS 14  104 104 LYS LYS G . n 
G 2 15  LYS 15  105 105 LYS LYS G . n 
G 2 16  THR 16  106 106 THR THR G . n 
G 2 17  LEU 17  107 107 LEU LEU G . n 
G 2 18  VAL 18  108 108 VAL VAL G . n 
G 2 19  PRO 19  109 109 PRO PRO G . n 
G 2 20  GLY 20  110 110 GLY GLY G . n 
G 2 21  PRO 21  111 111 PRO PRO G . n 
G 2 22  PRO 22  112 112 PRO PRO G . n 
G 2 23  GLY 23  113 113 GLY GLY G . n 
G 2 24  SER 24  114 114 SER SER G . n 
G 2 25  SER 25  115 115 SER SER G . n 
G 2 26  ARG 26  116 116 ARG ARG G . n 
G 2 27  PRO 27  117 117 PRO PRO G . n 
G 2 28  VAL 28  118 118 VAL VAL G . n 
G 2 29  LYS 29  119 119 LYS LYS G . n 
G 2 30  GLY 30  120 120 GLY GLY G . n 
G 2 31  GLN 31  121 121 GLN GLN G . n 
G 2 32  VAL 32  122 122 VAL VAL G . n 
G 2 33  VAL 33  123 123 VAL VAL G . n 
G 2 34  THR 34  124 124 THR THR G . n 
G 2 35  VAL 35  125 125 VAL VAL G . n 
G 2 36  HIS 36  126 126 HIS HIS G . n 
G 2 37  LEU 37  127 127 LEU LEU G . n 
G 2 38  GLN 38  128 128 GLN GLN G . n 
G 2 39  THR 39  129 129 THR THR G . n 
G 2 40  SER 40  130 130 SER SER G . n 
G 2 41  LEU 41  131 131 LEU LEU G . n 
G 2 42  GLU 42  132 132 GLU GLU G . n 
G 2 43  ASN 43  133 133 ASN ASN G . n 
G 2 44  GLY 44  134 134 GLY GLY G . n 
G 2 45  THR 45  135 135 THR THR G . n 
G 2 46  ARG 46  136 136 ARG ARG G . n 
G 2 47  VAL 47  137 137 VAL VAL G . n 
G 2 48  GLN 48  138 138 GLN GLN G . n 
G 2 49  GLU 49  139 139 GLU GLU G . n 
G 2 50  GLU 50  140 140 GLU GLU G . n 
G 2 51  PRO 51  141 141 PRO PRO G . n 
G 2 52  GLU 52  142 142 GLU GLU G . n 
G 2 53  LEU 53  143 143 LEU LEU G . n 
G 2 54  VAL 54  144 144 VAL VAL G . n 
G 2 55  PHE 55  145 145 PHE PHE G . n 
G 2 56  THR 56  146 146 THR THR G . n 
G 2 57  LEU 57  147 147 LEU LEU G . n 
G 2 58  GLY 58  148 148 GLY GLY G . n 
G 2 59  ASP 59  149 149 ASP ASP G . n 
G 2 60  CYS 60  150 150 CYS CYS G . n 
G 2 61  ASP 61  151 151 ASP ASP G . n 
G 2 62  VAL 62  152 152 VAL VAL G . n 
G 2 63  ILE 63  153 153 ILE ILE G . n 
G 2 64  GLN 64  154 154 GLN GLN G . n 
G 2 65  ALA 65  155 155 ALA ALA G . n 
G 2 66  LEU 66  156 156 LEU LEU G . n 
G 2 67  ASP 67  157 157 ASP ASP G . n 
G 2 68  LEU 68  158 158 LEU LEU G . n 
G 2 69  SER 69  159 159 SER SER G . n 
G 2 70  VAL 70  160 160 VAL VAL G . n 
G 2 71  PRO 71  161 161 PRO PRO G . n 
G 2 72  LEU 72  162 162 LEU LEU G . n 
G 2 73  MET 73  163 163 MET MET G . n 
G 2 74  ASP 74  164 164 ASP ASP G . n 
G 2 75  VAL 75  165 165 VAL VAL G . n 
G 2 76  GLY 76  166 166 GLY GLY G . n 
G 2 77  GLU 77  167 167 GLU GLU G . n 
G 2 78  THR 78  168 168 THR THR G . n 
G 2 79  ALA 79  169 169 ALA ALA G . n 
G 2 80  MET 80  170 170 MET MET G . n 
G 2 81  VAL 81  171 171 VAL VAL G . n 
G 2 82  THR 82  172 172 THR THR G . n 
G 2 83  ALA 83  173 173 ALA ALA G . n 
G 2 84  ASP 84  174 174 ASP ASP G . n 
G 2 85  SER 85  175 175 SER SER G . n 
G 2 86  LYS 86  176 176 LYS LYS G . n 
G 2 87  TYR 87  177 177 TYR TYR G . n 
G 2 88  CYS 88  178 178 CYS CYS G . n 
G 2 89  TYR 89  179 179 TYR TYR G . n 
G 2 90  GLY 90  180 180 GLY GLY G . n 
G 2 91  PRO 91  181 181 PRO PRO G . n 
G 2 92  GLN 92  182 182 GLN GLN G . n 
G 2 93  GLY 93  183 183 GLY GLY G . n 
G 2 94  ARG 94  184 184 ARG ARG G . n 
G 2 95  SER 95  185 185 SER SER G . n 
G 2 96  PRO 96  186 186 PRO PRO G . n 
G 2 97  TYR 97  187 187 TYR TYR G . n 
G 2 98  ILE 98  188 188 ILE ILE G . n 
G 2 99  PRO 99  189 189 PRO PRO G . n 
G 2 100 PRO 100 190 190 PRO PRO G . n 
G 2 101 HIS 101 191 191 HIS HIS G . n 
G 2 102 ALA 102 192 192 ALA ALA G . n 
G 2 103 ALA 103 193 193 ALA ALA G . n 
G 2 104 LEU 104 194 194 LEU LEU G . n 
G 2 105 CYS 105 195 195 CYS CYS G . n 
G 2 106 LEU 106 196 196 LEU LEU G . n 
G 2 107 GLU 107 197 197 GLU GLU G . n 
G 2 108 VAL 108 198 198 VAL VAL G . n 
G 2 109 THR 109 199 199 THR THR G . n 
G 2 110 LEU 110 200 200 LEU LEU G . n 
G 2 111 LYS 111 201 201 LYS LYS G . n 
G 2 112 THR 112 202 202 THR THR G . n 
G 2 113 ALA 113 203 203 ALA ALA G . n 
G 2 114 VAL 114 204 204 VAL VAL G . n 
G 2 115 ASP 115 205 205 ASP ASP G . n 
G 2 116 GLY 116 206 206 GLY GLY G . n 
G 2 117 PRO 117 207 207 PRO PRO G . n 
G 2 118 ASP 118 208 208 ASP ASP G . n 
G 2 119 LEU 119 209 209 LEU LEU G . n 
G 2 120 GLU 120 210 210 GLU GLU G . n 
G 2 121 MET 121 211 211 MET MET G . n 
G 2 122 LEU 122 212 212 LEU LEU G . n 
G 2 123 THR 123 213 213 THR THR G . n 
G 2 124 GLY 124 214 214 GLY GLY G . n 
G 2 125 GLN 125 215 215 GLN GLN G . n 
G 2 126 GLU 126 216 216 GLU GLU G . n 
G 2 127 ARG 127 217 217 ARG ARG G . n 
G 2 128 VAL 128 218 218 VAL VAL G . n 
G 2 129 ALA 129 219 219 ALA ALA G . n 
G 2 130 LEU 130 220 220 LEU LEU G . n 
G 2 131 ALA 131 221 221 ALA ALA G . n 
G 2 132 ASN 132 222 222 ASN ASN G . n 
G 2 133 ARG 133 223 223 ARG ARG G . n 
G 2 134 LYS 134 224 224 LYS LYS G . n 
G 2 135 ARG 135 225 225 ARG ARG G . n 
G 2 136 GLU 136 226 226 GLU GLU G . n 
G 2 137 CYS 137 227 227 CYS CYS G . n 
G 2 138 GLY 138 228 228 GLY GLY G . n 
G 2 139 ASN 139 229 229 ASN ASN G . n 
G 2 140 ALA 140 230 230 ALA ALA G . n 
G 2 141 HIS 141 231 231 HIS HIS G . n 
G 2 142 TYR 142 232 232 TYR TYR G . n 
G 2 143 GLN 143 233 233 GLN GLN G . n 
G 2 144 ARG 144 234 234 ARG ARG G . n 
G 2 145 ALA 145 235 235 ALA ALA G . n 
G 2 146 ASP 146 236 236 ASP ASP G . n 
G 2 147 PHE 147 237 237 PHE PHE G . n 
G 2 148 VAL 148 238 238 VAL VAL G . n 
G 2 149 LEU 149 239 239 LEU LEU G . n 
G 2 150 ALA 150 240 240 ALA ALA G . n 
G 2 151 ALA 151 241 241 ALA ALA G . n 
G 2 152 ASN 152 242 242 ASN ASN G . n 
G 2 153 SER 153 243 243 SER SER G . n 
G 2 154 TYR 154 244 244 TYR TYR G . n 
G 2 155 ASP 155 245 245 ASP ASP G . n 
G 2 156 LEU 156 246 246 LEU LEU G . n 
G 2 157 ALA 157 247 247 ALA ALA G . n 
G 2 158 ILE 158 248 248 ILE ILE G . n 
G 2 159 LYS 159 249 249 LYS LYS G . n 
G 2 160 ALA 160 250 250 ALA ALA G . n 
G 2 161 ILE 161 251 251 ILE ILE G . n 
G 2 162 THR 162 252 252 THR THR G . n 
G 2 163 SER 163 253 253 SER SER G . n 
G 2 164 SER 164 254 254 SER SER G . n 
G 2 165 ALA 165 255 255 ALA ALA G . n 
G 2 166 LYS 166 256 256 LYS LYS G . n 
G 2 167 VAL 167 257 257 VAL VAL G . n 
G 2 168 ASP 168 258 258 ASP ASP G . n 
G 2 169 MET 169 259 259 MET MET G . n 
G 2 170 THR 170 260 260 THR THR G . n 
G 2 171 PHE 171 261 261 PHE PHE G . n 
G 2 172 GLU 172 262 262 GLU GLU G . n 
G 2 173 GLU 173 263 263 GLU GLU G . n 
G 2 174 GLU 174 264 264 GLU GLU G . n 
G 2 175 ALA 175 265 265 ALA ALA G . n 
G 2 176 GLN 176 266 266 GLN GLN G . n 
G 2 177 LEU 177 267 267 LEU LEU G . n 
G 2 178 LEU 178 268 268 LEU LEU G . n 
G 2 179 GLN 179 269 269 GLN GLN G . n 
G 2 180 LEU 180 270 270 LEU LEU G . n 
G 2 181 LYS 181 271 271 LYS LYS G . n 
G 2 182 VAL 182 272 272 VAL VAL G . n 
G 2 183 LYS 183 273 273 LYS LYS G . n 
G 2 184 CYS 184 274 274 CYS CYS G . n 
G 2 185 LEU 185 275 275 LEU LEU G . n 
G 2 186 ASN 186 276 276 ASN ASN G . n 
G 2 187 ASN 187 277 277 ASN ASN G . n 
G 2 188 LEU 188 278 278 LEU LEU G . n 
G 2 189 ALA 189 279 279 ALA ALA G . n 
G 2 190 ALA 190 280 280 ALA ALA G . n 
G 2 191 SER 191 281 281 SER SER G . n 
G 2 192 GLN 192 282 282 GLN GLN G . n 
G 2 193 LEU 193 283 283 LEU LEU G . n 
G 2 194 LYS 194 284 284 LYS LYS G . n 
G 2 195 LEU 195 285 285 LEU LEU G . n 
G 2 196 ASP 196 286 286 ASP ASP G . n 
G 2 197 HIS 197 287 287 HIS HIS G . n 
G 2 198 TYR 198 288 288 TYR TYR G . n 
G 2 199 ARG 199 289 289 ARG ARG G . n 
G 2 200 ALA 200 290 290 ALA ALA G . n 
G 2 201 ALA 201 291 291 ALA ALA G . n 
G 2 202 LEU 202 292 292 LEU LEU G . n 
G 2 203 ARG 203 293 293 ARG ARG G . n 
G 2 204 SER 204 294 294 SER SER G . n 
G 2 205 CYS 205 295 295 CYS CYS G . n 
G 2 206 SER 206 296 296 SER SER G . n 
G 2 207 LEU 207 297 297 LEU LEU G . n 
G 2 208 VAL 208 298 298 VAL VAL G . n 
G 2 209 LEU 209 299 299 LEU LEU G . n 
G 2 210 GLU 210 300 300 GLU GLU G . n 
G 2 211 HIS 211 301 301 HIS HIS G . n 
G 2 212 GLN 212 302 302 GLN GLN G . n 
G 2 213 PRO 213 303 303 PRO PRO G . n 
G 2 214 ASP 214 304 304 ASP ASP G . n 
G 2 215 ASN 215 305 305 ASN ASN G . n 
G 2 216 ILE 216 306 306 ILE ILE G . n 
G 2 217 LYS 217 307 307 LYS LYS G . n 
G 2 218 ALA 218 308 308 ALA ALA G . n 
G 2 219 LEU 219 309 309 LEU LEU G . n 
G 2 220 PHE 220 310 310 PHE PHE G . n 
G 2 221 ARG 221 311 311 ARG ARG G . n 
G 2 222 LYS 222 312 312 LYS LYS G . n 
G 2 223 GLY 223 313 313 GLY GLY G . n 
G 2 224 LYS 224 314 314 LYS LYS G . n 
G 2 225 VAL 225 315 315 VAL VAL G . n 
G 2 226 LEU 226 316 316 LEU LEU G . n 
G 2 227 ALA 227 317 317 ALA ALA G . n 
G 2 228 GLN 228 318 318 GLN GLN G . n 
G 2 229 GLN 229 319 319 GLN GLN G . n 
G 2 230 GLY 230 320 320 GLY GLY G . n 
G 2 231 GLU 231 321 321 GLU GLU G . n 
G 2 232 TYR 232 322 322 TYR TYR G . n 
G 2 233 SER 233 323 323 SER SER G . n 
G 2 234 GLU 234 324 324 GLU GLU G . n 
G 2 235 ALA 235 325 325 ALA ALA G . n 
G 2 236 ILE 236 326 326 ILE ILE G . n 
G 2 237 PRO 237 327 327 PRO PRO G . n 
G 2 238 ILE 238 328 328 ILE ILE G . n 
G 2 239 LEU 239 329 329 LEU LEU G . n 
G 2 240 ARG 240 330 330 ARG ARG G . n 
G 2 241 ALA 241 331 331 ALA ALA G . n 
G 2 242 ALA 242 332 332 ALA ALA G . n 
G 2 243 LEU 243 333 333 LEU LEU G . n 
G 2 244 LYS 244 334 334 LYS LYS G . n 
G 2 245 LEU 245 335 335 LEU LEU G . n 
G 2 246 GLU 246 336 336 GLU GLU G . n 
G 2 247 PRO 247 337 337 PRO PRO G . n 
G 2 248 SER 248 338 338 SER SER G . n 
G 2 249 ASN 249 339 339 ASN ASN G . n 
G 2 250 LYS 250 340 340 LYS LYS G . n 
G 2 251 THR 251 341 341 THR THR G . n 
G 2 252 ILE 252 342 342 ILE ILE G . n 
G 2 253 HIS 253 343 343 HIS HIS G . n 
G 2 254 ALA 254 344 344 ALA ALA G . n 
G 2 255 GLU 255 345 345 GLU GLU G . n 
G 2 256 LEU 256 346 346 LEU LEU G . n 
G 2 257 SER 257 347 347 SER SER G . n 
G 2 258 LYS 258 348 348 LYS LYS G . n 
G 2 259 LEU 259 349 349 LEU LEU G . n 
G 2 260 VAL 260 350 350 VAL VAL G . n 
G 2 261 LYS 261 351 351 LYS LYS G . n 
G 2 262 LYS 262 352 352 LYS LYS G . n 
G 2 263 HIS 263 353 353 HIS HIS G . n 
G 2 264 ALA 264 354 354 ALA ALA G . n 
G 2 265 ALA 265 355 355 ALA ALA G . n 
G 2 266 GLN 266 356 356 GLN GLN G . n 
G 2 267 ARG 267 357 ?   ?   ?   G . n 
G 2 268 SER 268 358 ?   ?   ?   G . n 
G 2 269 THR 269 359 ?   ?   ?   G . n 
G 2 270 GLU 270 360 ?   ?   ?   G . n 
G 2 271 THR 271 361 ?   ?   ?   G . n 
G 2 272 ALA 272 362 ?   ?   ?   G . n 
G 2 273 LEU 273 363 ?   ?   ?   G . n 
G 2 274 TYR 274 364 ?   ?   ?   G . n 
G 2 275 ARG 275 365 ?   ?   ?   G . n 
G 2 276 LYS 276 366 ?   ?   ?   G . n 
G 2 277 MET 277 367 ?   ?   ?   G . n 
G 2 278 LEU 278 368 ?   ?   ?   G . n 
G 2 279 GLY 279 369 ?   ?   ?   G . n 
G 2 280 ASN 280 370 ?   ?   ?   G . n 
G 2 281 PRO 281 371 ?   ?   ?   G . n 
G 2 282 SER 282 372 ?   ?   ?   G . n 
G 2 283 ARG 283 373 ?   ?   ?   G . n 
G 2 284 LEU 284 374 ?   ?   ?   G . n 
G 2 285 PRO 285 375 ?   ?   ?   G . n 
G 2 286 ALA 286 376 ?   ?   ?   G . n 
G 2 287 LYS 287 377 ?   ?   ?   G . n 
G 2 288 CYS 288 378 ?   ?   ?   G . n 
G 2 289 PRO 289 379 ?   ?   ?   G . n 
G 2 290 GLY 290 380 ?   ?   ?   G . n 
H 2 1   GLU 1   91  91  GLU GLU H . n 
H 2 2   GLU 2   92  92  GLU GLU H . n 
H 2 3   TRP 3   93  93  TRP TRP H . n 
H 2 4   LEU 4   94  94  LEU LEU H . n 
H 2 5   ASP 5   95  95  ASP ASP H . n 
H 2 6   ILE 6   96  96  ILE ILE H . n 
H 2 7   LEU 7   97  97  LEU LEU H . n 
H 2 8   GLY 8   98  98  GLY GLY H . n 
H 2 9   ASN 9   99  99  ASN ASN H . n 
H 2 10  GLY 10  100 100 GLY GLY H . n 
H 2 11  LEU 11  101 101 LEU LEU H . n 
H 2 12  LEU 12  102 102 LEU LEU H . n 
H 2 13  ARG 13  103 103 ARG ARG H . n 
H 2 14  LYS 14  104 104 LYS LYS H . n 
H 2 15  LYS 15  105 105 LYS LYS H . n 
H 2 16  THR 16  106 106 THR THR H . n 
H 2 17  LEU 17  107 107 LEU LEU H . n 
H 2 18  VAL 18  108 108 VAL VAL H . n 
H 2 19  PRO 19  109 109 PRO PRO H . n 
H 2 20  GLY 20  110 110 GLY GLY H . n 
H 2 21  PRO 21  111 111 PRO PRO H . n 
H 2 22  PRO 22  112 112 PRO PRO H . n 
H 2 23  GLY 23  113 113 GLY GLY H . n 
H 2 24  SER 24  114 114 SER SER H . n 
H 2 25  SER 25  115 115 SER SER H . n 
H 2 26  ARG 26  116 116 ARG ARG H . n 
H 2 27  PRO 27  117 117 PRO PRO H . n 
H 2 28  VAL 28  118 118 VAL VAL H . n 
H 2 29  LYS 29  119 119 LYS LYS H . n 
H 2 30  GLY 30  120 120 GLY GLY H . n 
H 2 31  GLN 31  121 121 GLN GLN H . n 
H 2 32  VAL 32  122 122 VAL VAL H . n 
H 2 33  VAL 33  123 123 VAL VAL H . n 
H 2 34  THR 34  124 124 THR THR H . n 
H 2 35  VAL 35  125 125 VAL VAL H . n 
H 2 36  HIS 36  126 126 HIS HIS H . n 
H 2 37  LEU 37  127 127 LEU LEU H . n 
H 2 38  GLN 38  128 128 GLN GLN H . n 
H 2 39  THR 39  129 129 THR THR H . n 
H 2 40  SER 40  130 130 SER SER H . n 
H 2 41  LEU 41  131 131 LEU LEU H . n 
H 2 42  GLU 42  132 132 GLU GLU H . n 
H 2 43  ASN 43  133 133 ASN ASN H . n 
H 2 44  GLY 44  134 134 GLY GLY H . n 
H 2 45  THR 45  135 135 THR THR H . n 
H 2 46  ARG 46  136 136 ARG ARG H . n 
H 2 47  VAL 47  137 137 VAL VAL H . n 
H 2 48  GLN 48  138 138 GLN GLN H . n 
H 2 49  GLU 49  139 139 GLU GLU H . n 
H 2 50  GLU 50  140 140 GLU GLU H . n 
H 2 51  PRO 51  141 141 PRO PRO H . n 
H 2 52  GLU 52  142 142 GLU GLU H . n 
H 2 53  LEU 53  143 143 LEU LEU H . n 
H 2 54  VAL 54  144 144 VAL VAL H . n 
H 2 55  PHE 55  145 145 PHE PHE H . n 
H 2 56  THR 56  146 146 THR THR H . n 
H 2 57  LEU 57  147 147 LEU LEU H . n 
H 2 58  GLY 58  148 148 GLY GLY H . n 
H 2 59  ASP 59  149 149 ASP ASP H . n 
H 2 60  CYS 60  150 150 CYS CYS H . n 
H 2 61  ASP 61  151 151 ASP ASP H . n 
H 2 62  VAL 62  152 152 VAL VAL H . n 
H 2 63  ILE 63  153 153 ILE ILE H . n 
H 2 64  GLN 64  154 154 GLN GLN H . n 
H 2 65  ALA 65  155 155 ALA ALA H . n 
H 2 66  LEU 66  156 156 LEU LEU H . n 
H 2 67  ASP 67  157 157 ASP ASP H . n 
H 2 68  LEU 68  158 158 LEU LEU H . n 
H 2 69  SER 69  159 159 SER SER H . n 
H 2 70  VAL 70  160 160 VAL VAL H . n 
H 2 71  PRO 71  161 161 PRO PRO H . n 
H 2 72  LEU 72  162 162 LEU LEU H . n 
H 2 73  MET 73  163 163 MET MET H . n 
H 2 74  ASP 74  164 164 ASP ASP H . n 
H 2 75  VAL 75  165 165 VAL VAL H . n 
H 2 76  GLY 76  166 166 GLY GLY H . n 
H 2 77  GLU 77  167 167 GLU GLU H . n 
H 2 78  THR 78  168 168 THR THR H . n 
H 2 79  ALA 79  169 169 ALA ALA H . n 
H 2 80  MET 80  170 170 MET MET H . n 
H 2 81  VAL 81  171 171 VAL VAL H . n 
H 2 82  THR 82  172 172 THR THR H . n 
H 2 83  ALA 83  173 173 ALA ALA H . n 
H 2 84  ASP 84  174 174 ASP ASP H . n 
H 2 85  SER 85  175 175 SER SER H . n 
H 2 86  LYS 86  176 176 LYS LYS H . n 
H 2 87  TYR 87  177 177 TYR TYR H . n 
H 2 88  CYS 88  178 178 CYS CYS H . n 
H 2 89  TYR 89  179 179 TYR TYR H . n 
H 2 90  GLY 90  180 180 GLY GLY H . n 
H 2 91  PRO 91  181 181 PRO PRO H . n 
H 2 92  GLN 92  182 182 GLN GLN H . n 
H 2 93  GLY 93  183 183 GLY GLY H . n 
H 2 94  ARG 94  184 184 ARG ARG H . n 
H 2 95  SER 95  185 185 SER SER H . n 
H 2 96  PRO 96  186 186 PRO PRO H . n 
H 2 97  TYR 97  187 187 TYR TYR H . n 
H 2 98  ILE 98  188 188 ILE ILE H . n 
H 2 99  PRO 99  189 189 PRO PRO H . n 
H 2 100 PRO 100 190 190 PRO PRO H . n 
H 2 101 HIS 101 191 191 HIS HIS H . n 
H 2 102 ALA 102 192 192 ALA ALA H . n 
H 2 103 ALA 103 193 193 ALA ALA H . n 
H 2 104 LEU 104 194 194 LEU LEU H . n 
H 2 105 CYS 105 195 195 CYS CYS H . n 
H 2 106 LEU 106 196 196 LEU LEU H . n 
H 2 107 GLU 107 197 197 GLU GLU H . n 
H 2 108 VAL 108 198 198 VAL VAL H . n 
H 2 109 THR 109 199 199 THR THR H . n 
H 2 110 LEU 110 200 200 LEU LEU H . n 
H 2 111 LYS 111 201 201 LYS LYS H . n 
H 2 112 THR 112 202 202 THR THR H . n 
H 2 113 ALA 113 203 203 ALA ALA H . n 
H 2 114 VAL 114 204 204 VAL VAL H . n 
H 2 115 ASP 115 205 205 ASP ASP H . n 
H 2 116 GLY 116 206 206 GLY GLY H . n 
H 2 117 PRO 117 207 207 PRO PRO H . n 
H 2 118 ASP 118 208 208 ASP ASP H . n 
H 2 119 LEU 119 209 209 LEU LEU H . n 
H 2 120 GLU 120 210 210 GLU GLU H . n 
H 2 121 MET 121 211 211 MET MET H . n 
H 2 122 LEU 122 212 212 LEU LEU H . n 
H 2 123 THR 123 213 213 THR THR H . n 
H 2 124 GLY 124 214 214 GLY GLY H . n 
H 2 125 GLN 125 215 215 GLN GLN H . n 
H 2 126 GLU 126 216 216 GLU GLU H . n 
H 2 127 ARG 127 217 217 ARG ARG H . n 
H 2 128 VAL 128 218 218 VAL VAL H . n 
H 2 129 ALA 129 219 219 ALA ALA H . n 
H 2 130 LEU 130 220 220 LEU LEU H . n 
H 2 131 ALA 131 221 221 ALA ALA H . n 
H 2 132 ASN 132 222 222 ASN ASN H . n 
H 2 133 ARG 133 223 223 ARG ARG H . n 
H 2 134 LYS 134 224 224 LYS LYS H . n 
H 2 135 ARG 135 225 225 ARG ARG H . n 
H 2 136 GLU 136 226 226 GLU GLU H . n 
H 2 137 CYS 137 227 227 CYS CYS H . n 
H 2 138 GLY 138 228 228 GLY GLY H . n 
H 2 139 ASN 139 229 229 ASN ASN H . n 
H 2 140 ALA 140 230 230 ALA ALA H . n 
H 2 141 HIS 141 231 231 HIS HIS H . n 
H 2 142 TYR 142 232 232 TYR TYR H . n 
H 2 143 GLN 143 233 233 GLN GLN H . n 
H 2 144 ARG 144 234 234 ARG ARG H . n 
H 2 145 ALA 145 235 235 ALA ALA H . n 
H 2 146 ASP 146 236 236 ASP ASP H . n 
H 2 147 PHE 147 237 237 PHE PHE H . n 
H 2 148 VAL 148 238 238 VAL VAL H . n 
H 2 149 LEU 149 239 239 LEU LEU H . n 
H 2 150 ALA 150 240 240 ALA ALA H . n 
H 2 151 ALA 151 241 241 ALA ALA H . n 
H 2 152 ASN 152 242 242 ASN ASN H . n 
H 2 153 SER 153 243 243 SER SER H . n 
H 2 154 TYR 154 244 244 TYR TYR H . n 
H 2 155 ASP 155 245 245 ASP ASP H . n 
H 2 156 LEU 156 246 246 LEU LEU H . n 
H 2 157 ALA 157 247 247 ALA ALA H . n 
H 2 158 ILE 158 248 248 ILE ILE H . n 
H 2 159 LYS 159 249 249 LYS LYS H . n 
H 2 160 ALA 160 250 250 ALA ALA H . n 
H 2 161 ILE 161 251 251 ILE ILE H . n 
H 2 162 THR 162 252 252 THR THR H . n 
H 2 163 SER 163 253 253 SER SER H . n 
H 2 164 SER 164 254 254 SER SER H . n 
H 2 165 ALA 165 255 255 ALA ALA H . n 
H 2 166 LYS 166 256 256 LYS LYS H . n 
H 2 167 VAL 167 257 257 VAL VAL H . n 
H 2 168 ASP 168 258 258 ASP ASP H . n 
H 2 169 MET 169 259 259 MET MET H . n 
H 2 170 THR 170 260 260 THR THR H . n 
H 2 171 PHE 171 261 261 PHE PHE H . n 
H 2 172 GLU 172 262 262 GLU GLU H . n 
H 2 173 GLU 173 263 263 GLU GLU H . n 
H 2 174 GLU 174 264 264 GLU GLU H . n 
H 2 175 ALA 175 265 265 ALA ALA H . n 
H 2 176 GLN 176 266 266 GLN GLN H . n 
H 2 177 LEU 177 267 267 LEU LEU H . n 
H 2 178 LEU 178 268 268 LEU LEU H . n 
H 2 179 GLN 179 269 269 GLN GLN H . n 
H 2 180 LEU 180 270 270 LEU LEU H . n 
H 2 181 LYS 181 271 271 LYS LYS H . n 
H 2 182 VAL 182 272 272 VAL VAL H . n 
H 2 183 LYS 183 273 273 LYS LYS H . n 
H 2 184 CYS 184 274 274 CYS CYS H . n 
H 2 185 LEU 185 275 275 LEU LEU H . n 
H 2 186 ASN 186 276 276 ASN ASN H . n 
H 2 187 ASN 187 277 277 ASN ASN H . n 
H 2 188 LEU 188 278 278 LEU LEU H . n 
H 2 189 ALA 189 279 279 ALA ALA H . n 
H 2 190 ALA 190 280 280 ALA ALA H . n 
H 2 191 SER 191 281 281 SER SER H . n 
H 2 192 GLN 192 282 282 GLN GLN H . n 
H 2 193 LEU 193 283 283 LEU LEU H . n 
H 2 194 LYS 194 284 284 LYS LYS H . n 
H 2 195 LEU 195 285 285 LEU LEU H . n 
H 2 196 ASP 196 286 286 ASP ASP H . n 
H 2 197 HIS 197 287 287 HIS HIS H . n 
H 2 198 TYR 198 288 288 TYR TYR H . n 
H 2 199 ARG 199 289 289 ARG ARG H . n 
H 2 200 ALA 200 290 290 ALA ALA H . n 
H 2 201 ALA 201 291 291 ALA ALA H . n 
H 2 202 LEU 202 292 292 LEU LEU H . n 
H 2 203 ARG 203 293 293 ARG ARG H . n 
H 2 204 SER 204 294 294 SER SER H . n 
H 2 205 CYS 205 295 295 CYS CYS H . n 
H 2 206 SER 206 296 296 SER SER H . n 
H 2 207 LEU 207 297 297 LEU LEU H . n 
H 2 208 VAL 208 298 298 VAL VAL H . n 
H 2 209 LEU 209 299 299 LEU LEU H . n 
H 2 210 GLU 210 300 300 GLU GLU H . n 
H 2 211 HIS 211 301 301 HIS HIS H . n 
H 2 212 GLN 212 302 302 GLN GLN H . n 
H 2 213 PRO 213 303 303 PRO PRO H . n 
H 2 214 ASP 214 304 304 ASP ASP H . n 
H 2 215 ASN 215 305 305 ASN ASN H . n 
H 2 216 ILE 216 306 306 ILE ILE H . n 
H 2 217 LYS 217 307 307 LYS LYS H . n 
H 2 218 ALA 218 308 308 ALA ALA H . n 
H 2 219 LEU 219 309 309 LEU LEU H . n 
H 2 220 PHE 220 310 310 PHE PHE H . n 
H 2 221 ARG 221 311 311 ARG ARG H . n 
H 2 222 LYS 222 312 312 LYS LYS H . n 
H 2 223 GLY 223 313 313 GLY GLY H . n 
H 2 224 LYS 224 314 314 LYS LYS H . n 
H 2 225 VAL 225 315 315 VAL VAL H . n 
H 2 226 LEU 226 316 316 LEU LEU H . n 
H 2 227 ALA 227 317 317 ALA ALA H . n 
H 2 228 GLN 228 318 318 GLN GLN H . n 
H 2 229 GLN 229 319 319 GLN GLN H . n 
H 2 230 GLY 230 320 320 GLY GLY H . n 
H 2 231 GLU 231 321 321 GLU GLU H . n 
H 2 232 TYR 232 322 322 TYR TYR H . n 
H 2 233 SER 233 323 323 SER SER H . n 
H 2 234 GLU 234 324 324 GLU GLU H . n 
H 2 235 ALA 235 325 325 ALA ALA H . n 
H 2 236 ILE 236 326 326 ILE ILE H . n 
H 2 237 PRO 237 327 327 PRO PRO H . n 
H 2 238 ILE 238 328 328 ILE ILE H . n 
H 2 239 LEU 239 329 329 LEU LEU H . n 
H 2 240 ARG 240 330 330 ARG ARG H . n 
H 2 241 ALA 241 331 331 ALA ALA H . n 
H 2 242 ALA 242 332 332 ALA ALA H . n 
H 2 243 LEU 243 333 333 LEU LEU H . n 
H 2 244 LYS 244 334 334 LYS LYS H . n 
H 2 245 LEU 245 335 335 LEU LEU H . n 
H 2 246 GLU 246 336 336 GLU GLU H . n 
H 2 247 PRO 247 337 337 PRO PRO H . n 
H 2 248 SER 248 338 338 SER SER H . n 
H 2 249 ASN 249 339 339 ASN ASN H . n 
H 2 250 LYS 250 340 340 LYS LYS H . n 
H 2 251 THR 251 341 341 THR THR H . n 
H 2 252 ILE 252 342 342 ILE ILE H . n 
H 2 253 HIS 253 343 343 HIS HIS H . n 
H 2 254 ALA 254 344 344 ALA ALA H . n 
H 2 255 GLU 255 345 345 GLU GLU H . n 
H 2 256 LEU 256 346 346 LEU LEU H . n 
H 2 257 SER 257 347 347 SER SER H . n 
H 2 258 LYS 258 348 348 LYS LYS H . n 
H 2 259 LEU 259 349 349 LEU LEU H . n 
H 2 260 VAL 260 350 350 VAL VAL H . n 
H 2 261 LYS 261 351 351 LYS LYS H . n 
H 2 262 LYS 262 352 352 LYS LYS H . n 
H 2 263 HIS 263 353 353 HIS HIS H . n 
H 2 264 ALA 264 354 354 ALA ALA H . n 
H 2 265 ALA 265 355 355 ALA ALA H . n 
H 2 266 GLN 266 356 356 GLN GLN H . n 
H 2 267 ARG 267 357 ?   ?   ?   H . n 
H 2 268 SER 268 358 ?   ?   ?   H . n 
H 2 269 THR 269 359 ?   ?   ?   H . n 
H 2 270 GLU 270 360 ?   ?   ?   H . n 
H 2 271 THR 271 361 ?   ?   ?   H . n 
H 2 272 ALA 272 362 ?   ?   ?   H . n 
H 2 273 LEU 273 363 ?   ?   ?   H . n 
H 2 274 TYR 274 364 ?   ?   ?   H . n 
H 2 275 ARG 275 365 ?   ?   ?   H . n 
H 2 276 LYS 276 366 ?   ?   ?   H . n 
H 2 277 MET 277 367 ?   ?   ?   H . n 
H 2 278 LEU 278 368 ?   ?   ?   H . n 
H 2 279 GLY 279 369 ?   ?   ?   H . n 
H 2 280 ASN 280 370 ?   ?   ?   H . n 
H 2 281 PRO 281 371 ?   ?   ?   H . n 
H 2 282 SER 282 372 ?   ?   ?   H . n 
H 2 283 ARG 283 373 ?   ?   ?   H . n 
H 2 284 LEU 284 374 ?   ?   ?   H . n 
H 2 285 PRO 285 375 ?   ?   ?   H . n 
H 2 286 ALA 286 376 ?   ?   ?   H . n 
H 2 287 LYS 287 377 ?   ?   ?   H . n 
H 2 288 CYS 288 378 ?   ?   ?   H . n 
H 2 289 PRO 289 379 ?   ?   ?   H . n 
H 2 290 GLY 290 380 ?   ?   ?   H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 3 HOH 1   801 53  HOH HOH A . 
I 3 HOH 2   802 146 HOH HOH A . 
I 3 HOH 3   803 298 HOH HOH A . 
I 3 HOH 4   804 351 HOH HOH A . 
I 3 HOH 5   805 652 HOH HOH A . 
I 3 HOH 6   806 532 HOH HOH A . 
I 3 HOH 7   807 248 HOH HOH A . 
I 3 HOH 8   808 816 HOH HOH A . 
I 3 HOH 9   809 541 HOH HOH A . 
I 3 HOH 10  810 209 HOH HOH A . 
I 3 HOH 11  811 355 HOH HOH A . 
I 3 HOH 12  812 124 HOH HOH A . 
J 3 HOH 1   801 174 HOH HOH B . 
J 3 HOH 2   802 274 HOH HOH B . 
J 3 HOH 3   803 890 HOH HOH B . 
J 3 HOH 4   804 112 HOH HOH B . 
J 3 HOH 5   805 295 HOH HOH B . 
J 3 HOH 6   806 162 HOH HOH B . 
J 3 HOH 7   807 212 HOH HOH B . 
J 3 HOH 8   808 122 HOH HOH B . 
J 3 HOH 9   809 105 HOH HOH B . 
J 3 HOH 10  810 397 HOH HOH B . 
J 3 HOH 11  811 132 HOH HOH B . 
J 3 HOH 12  812 108 HOH HOH B . 
J 3 HOH 13  813 516 HOH HOH B . 
J 3 HOH 14  814 120 HOH HOH B . 
J 3 HOH 15  815 407 HOH HOH B . 
J 3 HOH 16  816 713 HOH HOH B . 
J 3 HOH 17  817 395 HOH HOH B . 
J 3 HOH 18  818 758 HOH HOH B . 
J 3 HOH 19  819 390 HOH HOH B . 
J 3 HOH 20  820 445 HOH HOH B . 
J 3 HOH 21  821 73  HOH HOH B . 
J 3 HOH 22  822 136 HOH HOH B . 
J 3 HOH 23  823 373 HOH HOH B . 
J 3 HOH 24  824 380 HOH HOH B . 
K 3 HOH 1   801 305 HOH HOH C . 
K 3 HOH 2   802 34  HOH HOH C . 
K 3 HOH 3   803 33  HOH HOH C . 
K 3 HOH 4   804 411 HOH HOH C . 
K 3 HOH 5   805 197 HOH HOH C . 
K 3 HOH 6   806 574 HOH HOH C . 
K 3 HOH 7   807 199 HOH HOH C . 
K 3 HOH 8   808 342 HOH HOH C . 
K 3 HOH 9   809 600 HOH HOH C . 
K 3 HOH 10  810 241 HOH HOH C . 
K 3 HOH 11  811 99  HOH HOH C . 
K 3 HOH 12  812 273 HOH HOH C . 
K 3 HOH 13  813 67  HOH HOH C . 
K 3 HOH 14  814 415 HOH HOH C . 
K 3 HOH 15  815 167 HOH HOH C . 
K 3 HOH 16  816 223 HOH HOH C . 
K 3 HOH 17  817 130 HOH HOH C . 
K 3 HOH 18  818 844 HOH HOH C . 
K 3 HOH 19  819 260 HOH HOH C . 
K 3 HOH 20  820 308 HOH HOH C . 
L 3 HOH 1   801 296 HOH HOH D . 
L 3 HOH 2   802 647 HOH HOH D . 
L 3 HOH 3   803 30  HOH HOH D . 
M 3 HOH 1   401 473 HOH HOH E . 
M 3 HOH 2   402 187 HOH HOH E . 
M 3 HOH 3   403 75  HOH HOH E . 
M 3 HOH 4   404 56  HOH HOH E . 
M 3 HOH 5   405 392 HOH HOH E . 
M 3 HOH 6   406 772 HOH HOH E . 
M 3 HOH 7   407 26  HOH HOH E . 
M 3 HOH 8   408 152 HOH HOH E . 
M 3 HOH 9   409 107 HOH HOH E . 
M 3 HOH 10  410 36  HOH HOH E . 
M 3 HOH 11  411 460 HOH HOH E . 
M 3 HOH 12  412 21  HOH HOH E . 
M 3 HOH 13  413 196 HOH HOH E . 
M 3 HOH 14  414 724 HOH HOH E . 
M 3 HOH 15  415 3   HOH HOH E . 
M 3 HOH 16  416 25  HOH HOH E . 
M 3 HOH 17  417 854 HOH HOH E . 
M 3 HOH 18  418 82  HOH HOH E . 
M 3 HOH 19  419 172 HOH HOH E . 
M 3 HOH 20  420 207 HOH HOH E . 
M 3 HOH 21  421 83  HOH HOH E . 
M 3 HOH 22  422 34  HOH HOH E . 
M 3 HOH 23  423 318 HOH HOH E . 
M 3 HOH 24  424 17  HOH HOH E . 
M 3 HOH 25  425 324 HOH HOH E . 
M 3 HOH 26  426 342 HOH HOH E . 
M 3 HOH 27  427 24  HOH HOH E . 
M 3 HOH 28  428 38  HOH HOH E . 
M 3 HOH 29  429 214 HOH HOH E . 
M 3 HOH 30  430 775 HOH HOH E . 
M 3 HOH 31  431 344 HOH HOH E . 
M 3 HOH 32  432 11  HOH HOH E . 
M 3 HOH 33  433 16  HOH HOH E . 
M 3 HOH 34  434 85  HOH HOH E . 
M 3 HOH 35  435 682 HOH HOH E . 
M 3 HOH 36  436 244 HOH HOH E . 
M 3 HOH 37  437 193 HOH HOH E . 
M 3 HOH 38  438 774 HOH HOH E . 
M 3 HOH 39  439 2   HOH HOH E . 
M 3 HOH 40  440 572 HOH HOH E . 
M 3 HOH 41  441 472 HOH HOH E . 
M 3 HOH 42  442 320 HOH HOH E . 
M 3 HOH 43  443 70  HOH HOH E . 
M 3 HOH 44  444 389 HOH HOH E . 
M 3 HOH 45  445 179 HOH HOH E . 
M 3 HOH 46  446 933 HOH HOH E . 
M 3 HOH 47  447 261 HOH HOH E . 
M 3 HOH 48  448 268 HOH HOH E . 
M 3 HOH 49  449 88  HOH HOH E . 
M 3 HOH 50  450 388 HOH HOH E . 
M 3 HOH 51  451 127 HOH HOH E . 
M 3 HOH 52  452 202 HOH HOH E . 
M 3 HOH 53  453 470 HOH HOH E . 
M 3 HOH 54  454 74  HOH HOH E . 
M 3 HOH 55  455 335 HOH HOH E . 
M 3 HOH 56  456 183 HOH HOH E . 
M 3 HOH 57  457 664 HOH HOH E . 
M 3 HOH 58  458 74  HOH HOH E . 
M 3 HOH 59  459 243 HOH HOH E . 
M 3 HOH 60  460 209 HOH HOH E . 
M 3 HOH 61  461 12  HOH HOH E . 
M 3 HOH 62  462 270 HOH HOH E . 
M 3 HOH 63  463 57  HOH HOH E . 
M 3 HOH 64  464 731 HOH HOH E . 
M 3 HOH 65  465 302 HOH HOH E . 
M 3 HOH 66  466 95  HOH HOH E . 
M 3 HOH 67  467 349 HOH HOH E . 
M 3 HOH 68  468 377 HOH HOH E . 
M 3 HOH 69  469 165 HOH HOH E . 
M 3 HOH 70  470 214 HOH HOH E . 
M 3 HOH 71  471 316 HOH HOH E . 
M 3 HOH 72  472 138 HOH HOH E . 
M 3 HOH 73  473 332 HOH HOH E . 
M 3 HOH 74  474 288 HOH HOH E . 
M 3 HOH 75  475 64  HOH HOH E . 
M 3 HOH 76  476 169 HOH HOH E . 
M 3 HOH 77  477 307 HOH HOH E . 
M 3 HOH 78  478 328 HOH HOH E . 
M 3 HOH 79  479 871 HOH HOH E . 
M 3 HOH 80  480 303 HOH HOH E . 
M 3 HOH 81  481 299 HOH HOH E . 
M 3 HOH 82  482 255 HOH HOH E . 
M 3 HOH 83  483 336 HOH HOH E . 
M 3 HOH 84  484 416 HOH HOH E . 
M 3 HOH 85  485 918 HOH HOH E . 
M 3 HOH 86  486 365 HOH HOH E . 
M 3 HOH 87  487 833 HOH HOH E . 
M 3 HOH 88  488 367 HOH HOH E . 
M 3 HOH 89  489 251 HOH HOH E . 
M 3 HOH 90  490 899 HOH HOH E . 
M 3 HOH 91  491 47  HOH HOH E . 
M 3 HOH 92  492 226 HOH HOH E . 
M 3 HOH 93  493 482 HOH HOH E . 
M 3 HOH 94  494 536 HOH HOH E . 
M 3 HOH 95  495 236 HOH HOH E . 
M 3 HOH 96  496 313 HOH HOH E . 
M 3 HOH 97  497 489 HOH HOH E . 
M 3 HOH 98  498 37  HOH HOH E . 
M 3 HOH 99  499 343 HOH HOH E . 
M 3 HOH 100 500 412 HOH HOH E . 
M 3 HOH 101 501 901 HOH HOH E . 
M 3 HOH 102 502 658 HOH HOH E . 
M 3 HOH 103 503 551 HOH HOH E . 
M 3 HOH 104 504 694 HOH HOH E . 
M 3 HOH 105 505 614 HOH HOH E . 
M 3 HOH 106 506 500 HOH HOH E . 
M 3 HOH 107 507 300 HOH HOH E . 
M 3 HOH 108 508 625 HOH HOH E . 
M 3 HOH 109 509 178 HOH HOH E . 
M 3 HOH 110 510 16  HOH HOH E . 
M 3 HOH 111 511 502 HOH HOH E . 
M 3 HOH 112 512 747 HOH HOH E . 
M 3 HOH 113 513 154 HOH HOH E . 
M 3 HOH 114 514 283 HOH HOH E . 
M 3 HOH 115 515 195 HOH HOH E . 
M 3 HOH 116 516 503 HOH HOH E . 
M 3 HOH 117 517 716 HOH HOH E . 
M 3 HOH 118 518 96  HOH HOH E . 
M 3 HOH 119 519 807 HOH HOH E . 
M 3 HOH 120 520 687 HOH HOH E . 
M 3 HOH 121 521 334 HOH HOH E . 
M 3 HOH 122 522 121 HOH HOH E . 
M 3 HOH 123 523 399 HOH HOH E . 
M 3 HOH 124 524 63  HOH HOH E . 
M 3 HOH 125 525 8   HOH HOH E . 
M 3 HOH 126 526 276 HOH HOH E . 
M 3 HOH 127 527 829 HOH HOH E . 
M 3 HOH 128 528 222 HOH HOH E . 
M 3 HOH 129 529 346 HOH HOH E . 
M 3 HOH 130 530 148 HOH HOH E . 
M 3 HOH 131 531 19  HOH HOH E . 
M 3 HOH 132 532 256 HOH HOH E . 
M 3 HOH 133 533 372 HOH HOH E . 
M 3 HOH 134 534 465 HOH HOH E . 
M 3 HOH 135 535 122 HOH HOH E . 
M 3 HOH 136 536 312 HOH HOH E . 
M 3 HOH 137 537 416 HOH HOH E . 
M 3 HOH 138 538 424 HOH HOH E . 
M 3 HOH 139 539 610 HOH HOH E . 
M 3 HOH 140 540 478 HOH HOH E . 
M 3 HOH 141 541 771 HOH HOH E . 
M 3 HOH 142 542 50  HOH HOH E . 
M 3 HOH 143 543 348 HOH HOH E . 
M 3 HOH 144 544 423 HOH HOH E . 
M 3 HOH 145 545 905 HOH HOH E . 
M 3 HOH 146 546 626 HOH HOH E . 
M 3 HOH 147 547 92  HOH HOH E . 
M 3 HOH 148 548 319 HOH HOH E . 
M 3 HOH 149 549 287 HOH HOH E . 
M 3 HOH 150 550 728 HOH HOH E . 
M 3 HOH 151 551 52  HOH HOH E . 
M 3 HOH 152 552 313 HOH HOH E . 
M 3 HOH 153 553 217 HOH HOH E . 
M 3 HOH 154 554 898 HOH HOH E . 
M 3 HOH 155 555 767 HOH HOH E . 
M 3 HOH 156 556 698 HOH HOH E . 
M 3 HOH 157 557 375 HOH HOH E . 
M 3 HOH 158 558 428 HOH HOH E . 
M 3 HOH 159 559 35  HOH HOH E . 
M 3 HOH 160 560 742 HOH HOH E . 
M 3 HOH 161 561 156 HOH HOH E . 
M 3 HOH 162 562 177 HOH HOH E . 
M 3 HOH 163 563 84  HOH HOH E . 
M 3 HOH 164 564 82  HOH HOH E . 
M 3 HOH 165 565 269 HOH HOH E . 
M 3 HOH 166 566 781 HOH HOH E . 
M 3 HOH 167 567 441 HOH HOH E . 
M 3 HOH 168 568 846 HOH HOH E . 
M 3 HOH 169 569 945 HOH HOH E . 
M 3 HOH 170 570 205 HOH HOH E . 
M 3 HOH 171 571 778 HOH HOH E . 
M 3 HOH 172 572 386 HOH HOH E . 
M 3 HOH 173 573 180 HOH HOH E . 
M 3 HOH 174 574 140 HOH HOH E . 
M 3 HOH 175 575 37  HOH HOH E . 
M 3 HOH 176 576 265 HOH HOH E . 
M 3 HOH 177 577 340 HOH HOH E . 
M 3 HOH 178 578 881 HOH HOH E . 
M 3 HOH 179 579 697 HOH HOH E . 
M 3 HOH 180 580 1   HOH HOH E . 
M 3 HOH 181 581 723 HOH HOH E . 
M 3 HOH 182 582 938 HOH HOH E . 
M 3 HOH 183 583 359 HOH HOH E . 
M 3 HOH 184 584 654 HOH HOH E . 
M 3 HOH 185 585 356 HOH HOH E . 
M 3 HOH 186 586 408 HOH HOH E . 
M 3 HOH 187 587 403 HOH HOH E . 
M 3 HOH 188 588 17  HOH HOH E . 
M 3 HOH 189 589 876 HOH HOH E . 
M 3 HOH 190 590 322 HOH HOH E . 
M 3 HOH 191 591 4   HOH HOH E . 
M 3 HOH 192 592 64  HOH HOH E . 
M 3 HOH 193 593 444 HOH HOH E . 
M 3 HOH 194 594 436 HOH HOH E . 
M 3 HOH 195 595 291 HOH HOH E . 
M 3 HOH 196 596 459 HOH HOH E . 
M 3 HOH 197 597 511 HOH HOH E . 
M 3 HOH 198 598 181 HOH HOH E . 
M 3 HOH 199 599 360 HOH HOH E . 
M 3 HOH 200 600 537 HOH HOH E . 
M 3 HOH 201 601 301 HOH HOH E . 
M 3 HOH 202 602 507 HOH HOH E . 
M 3 HOH 203 603 350 HOH HOH E . 
M 3 HOH 204 604 365 HOH HOH E . 
M 3 HOH 205 605 217 HOH HOH E . 
M 3 HOH 206 606 636 HOH HOH E . 
M 3 HOH 207 607 25  HOH HOH E . 
M 3 HOH 208 608 733 HOH HOH E . 
M 3 HOH 209 609 68  HOH HOH E . 
M 3 HOH 210 610 63  HOH HOH E . 
M 3 HOH 211 611 283 HOH HOH E . 
M 3 HOH 212 612 912 HOH HOH E . 
M 3 HOH 213 613 161 HOH HOH E . 
M 3 HOH 214 614 62  HOH HOH E . 
M 3 HOH 215 615 54  HOH HOH E . 
M 3 HOH 216 616 908 HOH HOH E . 
M 3 HOH 217 617 886 HOH HOH E . 
M 3 HOH 218 618 394 HOH HOH E . 
M 3 HOH 219 619 913 HOH HOH E . 
M 3 HOH 220 620 339 HOH HOH E . 
M 3 HOH 221 621 690 HOH HOH E . 
M 3 HOH 222 622 520 HOH HOH E . 
M 3 HOH 223 623 208 HOH HOH E . 
M 3 HOH 224 624 757 HOH HOH E . 
M 3 HOH 225 625 294 HOH HOH E . 
M 3 HOH 226 626 327 HOH HOH E . 
M 3 HOH 227 627 438 HOH HOH E . 
M 3 HOH 228 628 836 HOH HOH E . 
M 3 HOH 229 629 104 HOH HOH E . 
M 3 HOH 230 630 388 HOH HOH E . 
M 3 HOH 231 631 534 HOH HOH E . 
M 3 HOH 232 632 483 HOH HOH E . 
M 3 HOH 233 633 916 HOH HOH E . 
M 3 HOH 234 634 382 HOH HOH E . 
M 3 HOH 235 635 601 HOH HOH E . 
M 3 HOH 236 636 46  HOH HOH E . 
M 3 HOH 237 637 569 HOH HOH E . 
M 3 HOH 238 638 106 HOH HOH E . 
M 3 HOH 239 639 321 HOH HOH E . 
M 3 HOH 240 640 216 HOH HOH E . 
M 3 HOH 241 641 114 HOH HOH E . 
M 3 HOH 242 642 279 HOH HOH E . 
M 3 HOH 243 643 442 HOH HOH E . 
M 3 HOH 244 644 786 HOH HOH E . 
M 3 HOH 245 645 299 HOH HOH E . 
M 3 HOH 246 646 11  HOH HOH E . 
M 3 HOH 247 647 553 HOH HOH E . 
M 3 HOH 248 648 242 HOH HOH E . 
M 3 HOH 249 649 344 HOH HOH E . 
M 3 HOH 250 650 805 HOH HOH E . 
M 3 HOH 251 651 222 HOH HOH E . 
M 3 HOH 252 652 474 HOH HOH E . 
M 3 HOH 253 653 740 HOH HOH E . 
M 3 HOH 254 654 865 HOH HOH E . 
M 3 HOH 255 655 927 HOH HOH E . 
M 3 HOH 256 656 695 HOH HOH E . 
M 3 HOH 257 657 450 HOH HOH E . 
M 3 HOH 258 658 297 HOH HOH E . 
M 3 HOH 259 659 708 HOH HOH E . 
M 3 HOH 260 660 420 HOH HOH E . 
M 3 HOH 261 661 282 HOH HOH E . 
M 3 HOH 262 662 357 HOH HOH E . 
M 3 HOH 263 663 413 HOH HOH E . 
M 3 HOH 264 664 186 HOH HOH E . 
M 3 HOH 265 665 166 HOH HOH E . 
M 3 HOH 266 666 891 HOH HOH E . 
M 3 HOH 267 667 115 HOH HOH E . 
M 3 HOH 268 668 144 HOH HOH E . 
M 3 HOH 269 669 30  HOH HOH E . 
M 3 HOH 270 670 513 HOH HOH E . 
M 3 HOH 271 671 331 HOH HOH E . 
M 3 HOH 272 672 443 HOH HOH E . 
M 3 HOH 273 673 109 HOH HOH E . 
M 3 HOH 274 674 725 HOH HOH E . 
M 3 HOH 275 675 394 HOH HOH E . 
M 3 HOH 276 676 415 HOH HOH E . 
M 3 HOH 277 677 369 HOH HOH E . 
M 3 HOH 278 678 81  HOH HOH E . 
M 3 HOH 279 679 111 HOH HOH E . 
M 3 HOH 280 680 402 HOH HOH E . 
M 3 HOH 281 681 543 HOH HOH E . 
M 3 HOH 282 682 655 HOH HOH E . 
M 3 HOH 283 683 21  HOH HOH E . 
M 3 HOH 284 684 680 HOH HOH E . 
M 3 HOH 285 685 696 HOH HOH E . 
M 3 HOH 286 686 818 HOH HOH E . 
M 3 HOH 287 687 385 HOH HOH E . 
M 3 HOH 288 688 862 HOH HOH E . 
M 3 HOH 289 689 335 HOH HOH E . 
M 3 HOH 290 690 160 HOH HOH E . 
M 3 HOH 291 691 564 HOH HOH E . 
M 3 HOH 292 692 107 HOH HOH E . 
M 3 HOH 293 693 134 HOH HOH E . 
M 3 HOH 294 694 397 HOH HOH E . 
M 3 HOH 295 695 100 HOH HOH E . 
M 3 HOH 296 696 29  HOH HOH E . 
M 3 HOH 297 697 235 HOH HOH E . 
M 3 HOH 298 698 790 HOH HOH E . 
M 3 HOH 299 699 718 HOH HOH E . 
M 3 HOH 300 700 168 HOH HOH E . 
M 3 HOH 301 701 349 HOH HOH E . 
M 3 HOH 302 702 447 HOH HOH E . 
M 3 HOH 303 703 156 HOH HOH E . 
M 3 HOH 304 704 589 HOH HOH E . 
M 3 HOH 305 705 755 HOH HOH E . 
M 3 HOH 306 706 295 HOH HOH E . 
M 3 HOH 307 707 55  HOH HOH E . 
M 3 HOH 308 708 364 HOH HOH E . 
M 3 HOH 309 709 77  HOH HOH E . 
M 3 HOH 310 710 169 HOH HOH E . 
M 3 HOH 311 711 152 HOH HOH E . 
M 3 HOH 312 712 229 HOH HOH E . 
M 3 HOH 313 713 247 HOH HOH E . 
M 3 HOH 314 714 477 HOH HOH E . 
M 3 HOH 315 715 171 HOH HOH E . 
M 3 HOH 316 716 675 HOH HOH E . 
M 3 HOH 317 717 343 HOH HOH E . 
M 3 HOH 318 718 318 HOH HOH E . 
M 3 HOH 319 719 98  HOH HOH E . 
M 3 HOH 320 720 275 HOH HOH E . 
M 3 HOH 321 721 555 HOH HOH E . 
M 3 HOH 322 722 835 HOH HOH E . 
M 3 HOH 323 723 83  HOH HOH E . 
M 3 HOH 324 724 72  HOH HOH E . 
M 3 HOH 325 725 151 HOH HOH E . 
M 3 HOH 326 726 410 HOH HOH E . 
M 3 HOH 327 727 377 HOH HOH E . 
M 3 HOH 328 728 338 HOH HOH E . 
M 3 HOH 329 729 347 HOH HOH E . 
M 3 HOH 330 730 325 HOH HOH E . 
M 3 HOH 331 731 337 HOH HOH E . 
M 3 HOH 332 732 277 HOH HOH E . 
N 3 HOH 1   401 129 HOH HOH F . 
N 3 HOH 2   402 147 HOH HOH F . 
N 3 HOH 3   403 146 HOH HOH F . 
N 3 HOH 4   404 73  HOH HOH F . 
N 3 HOH 5   405 539 HOH HOH F . 
N 3 HOH 6   406 208 HOH HOH F . 
N 3 HOH 7   407 55  HOH HOH F . 
N 3 HOH 8   408 158 HOH HOH F . 
N 3 HOH 9   409 223 HOH HOH F . 
N 3 HOH 10  410 143 HOH HOH F . 
N 3 HOH 11  411 337 HOH HOH F . 
N 3 HOH 12  412 7   HOH HOH F . 
N 3 HOH 13  413 231 HOH HOH F . 
N 3 HOH 14  414 190 HOH HOH F . 
N 3 HOH 15  415 128 HOH HOH F . 
N 3 HOH 16  416 609 HOH HOH F . 
N 3 HOH 17  417 43  HOH HOH F . 
N 3 HOH 18  418 578 HOH HOH F . 
N 3 HOH 19  419 137 HOH HOH F . 
N 3 HOH 20  420 141 HOH HOH F . 
N 3 HOH 21  421 371 HOH HOH F . 
N 3 HOH 22  422 693 HOH HOH F . 
N 3 HOH 23  423 752 HOH HOH F . 
N 3 HOH 24  424 18  HOH HOH F . 
N 3 HOH 25  425 297 HOH HOH F . 
N 3 HOH 26  426 300 HOH HOH F . 
N 3 HOH 27  427 627 HOH HOH F . 
N 3 HOH 28  428 745 HOH HOH F . 
N 3 HOH 29  429 628 HOH HOH F . 
N 3 HOH 30  430 45  HOH HOH F . 
N 3 HOH 31  431 585 HOH HOH F . 
N 3 HOH 32  432 234 HOH HOH F . 
N 3 HOH 33  433 558 HOH HOH F . 
N 3 HOH 34  434 306 HOH HOH F . 
N 3 HOH 35  435 351 HOH HOH F . 
N 3 HOH 36  436 71  HOH HOH F . 
N 3 HOH 37  437 769 HOH HOH F . 
N 3 HOH 38  438 91  HOH HOH F . 
N 3 HOH 39  439 567 HOH HOH F . 
N 3 HOH 40  440 645 HOH HOH F . 
N 3 HOH 41  441 20  HOH HOH F . 
N 3 HOH 42  442 201 HOH HOH F . 
N 3 HOH 43  443 220 HOH HOH F . 
N 3 HOH 44  444 42  HOH HOH F . 
N 3 HOH 45  445 31  HOH HOH F . 
N 3 HOH 46  446 329 HOH HOH F . 
N 3 HOH 47  447 515 HOH HOH F . 
N 3 HOH 48  448 153 HOH HOH F . 
N 3 HOH 49  449 418 HOH HOH F . 
N 3 HOH 50  450 272 HOH HOH F . 
N 3 HOH 51  451 776 HOH HOH F . 
N 3 HOH 52  452 429 HOH HOH F . 
N 3 HOH 53  453 264 HOH HOH F . 
N 3 HOH 54  454 737 HOH HOH F . 
N 3 HOH 55  455 39  HOH HOH F . 
N 3 HOH 56  456 375 HOH HOH F . 
N 3 HOH 57  457 94  HOH HOH F . 
N 3 HOH 58  458 738 HOH HOH F . 
N 3 HOH 59  459 307 HOH HOH F . 
N 3 HOH 60  460 182 HOH HOH F . 
N 3 HOH 61  461 475 HOH HOH F . 
N 3 HOH 62  462 216 HOH HOH F . 
N 3 HOH 63  463 168 HOH HOH F . 
N 3 HOH 64  464 85  HOH HOH F . 
N 3 HOH 65  465 877 HOH HOH F . 
N 3 HOH 66  466 719 HOH HOH F . 
N 3 HOH 67  467 54  HOH HOH F . 
N 3 HOH 68  468 928 HOH HOH F . 
N 3 HOH 69  469 134 HOH HOH F . 
N 3 HOH 70  470 646 HOH HOH F . 
N 3 HOH 71  471 857 HOH HOH F . 
N 3 HOH 72  472 78  HOH HOH F . 
N 3 HOH 73  473 116 HOH HOH F . 
N 3 HOH 74  474 330 HOH HOH F . 
N 3 HOH 75  475 584 HOH HOH F . 
N 3 HOH 76  476 252 HOH HOH F . 
N 3 HOH 77  477 437 HOH HOH F . 
N 3 HOH 78  478 661 HOH HOH F . 
N 3 HOH 79  479 362 HOH HOH F . 
N 3 HOH 80  480 185 HOH HOH F . 
N 3 HOH 81  481 340 HOH HOH F . 
N 3 HOH 82  482 352 HOH HOH F . 
N 3 HOH 83  483 497 HOH HOH F . 
N 3 HOH 84  484 192 HOH HOH F . 
N 3 HOH 85  485 290 HOH HOH F . 
N 3 HOH 86  486 254 HOH HOH F . 
N 3 HOH 87  487 84  HOH HOH F . 
N 3 HOH 88  488 495 HOH HOH F . 
N 3 HOH 89  489 464 HOH HOH F . 
N 3 HOH 90  490 106 HOH HOH F . 
N 3 HOH 91  491 940 HOH HOH F . 
N 3 HOH 92  492 404 HOH HOH F . 
N 3 HOH 93  493 262 HOH HOH F . 
N 3 HOH 94  494 849 HOH HOH F . 
N 3 HOH 95  495 27  HOH HOH F . 
N 3 HOH 96  496 582 HOH HOH F . 
N 3 HOH 97  497 316 HOH HOH F . 
N 3 HOH 98  498 770 HOH HOH F . 
N 3 HOH 99  499 303 HOH HOH F . 
N 3 HOH 100 500 200 HOH HOH F . 
N 3 HOH 101 501 378 HOH HOH F . 
N 3 HOH 102 502 379 HOH HOH F . 
N 3 HOH 103 503 413 HOH HOH F . 
N 3 HOH 104 504 387 HOH HOH F . 
N 3 HOH 105 505 145 HOH HOH F . 
N 3 HOH 106 506 273 HOH HOH F . 
N 3 HOH 107 507 386 HOH HOH F . 
N 3 HOH 108 508 917 HOH HOH F . 
N 3 HOH 109 509 43  HOH HOH F . 
N 3 HOH 110 510 105 HOH HOH F . 
N 3 HOH 111 511 132 HOH HOH F . 
N 3 HOH 112 512 183 HOH HOH F . 
N 3 HOH 113 513 263 HOH HOH F . 
N 3 HOH 114 514 803 HOH HOH F . 
N 3 HOH 115 515 358 HOH HOH F . 
N 3 HOH 116 516 253 HOH HOH F . 
N 3 HOH 117 517 692 HOH HOH F . 
N 3 HOH 118 518 384 HOH HOH F . 
N 3 HOH 119 519 756 HOH HOH F . 
N 3 HOH 120 520 185 HOH HOH F . 
N 3 HOH 121 521 53  HOH HOH F . 
N 3 HOH 122 522 184 HOH HOH F . 
N 3 HOH 123 523 93  HOH HOH F . 
N 3 HOH 124 524 200 HOH HOH F . 
N 3 HOH 125 525 401 HOH HOH F . 
N 3 HOH 126 526 213 HOH HOH F . 
N 3 HOH 127 527 250 HOH HOH F . 
N 3 HOH 128 528 13  HOH HOH F . 
N 3 HOH 129 529 202 HOH HOH F . 
N 3 HOH 130 530 103 HOH HOH F . 
N 3 HOH 131 531 370 HOH HOH F . 
N 3 HOH 132 532 526 HOH HOH F . 
N 3 HOH 133 533 254 HOH HOH F . 
N 3 HOH 134 534 125 HOH HOH F . 
N 3 HOH 135 535 285 HOH HOH F . 
N 3 HOH 136 536 123 HOH HOH F . 
N 3 HOH 137 537 333 HOH HOH F . 
N 3 HOH 138 538 90  HOH HOH F . 
N 3 HOH 139 539 291 HOH HOH F . 
N 3 HOH 140 540 385 HOH HOH F . 
N 3 HOH 141 541 60  HOH HOH F . 
N 3 HOH 142 542 112 HOH HOH F . 
N 3 HOH 143 543 119 HOH HOH F . 
N 3 HOH 144 544 427 HOH HOH F . 
N 3 HOH 145 545 245 HOH HOH F . 
N 3 HOH 146 546 28  HOH HOH F . 
N 3 HOH 147 547 706 HOH HOH F . 
N 3 HOH 148 548 145 HOH HOH F . 
N 3 HOH 149 549 354 HOH HOH F . 
N 3 HOH 150 550 133 HOH HOH F . 
N 3 HOH 151 551 240 HOH HOH F . 
N 3 HOH 152 552 448 HOH HOH F . 
N 3 HOH 153 553 376 HOH HOH F . 
N 3 HOH 154 554 419 HOH HOH F . 
N 3 HOH 155 555 422 HOH HOH F . 
N 3 HOH 156 556 49  HOH HOH F . 
N 3 HOH 157 557 323 HOH HOH F . 
N 3 HOH 158 558 117 HOH HOH F . 
N 3 HOH 159 559 246 HOH HOH F . 
N 3 HOH 160 560 135 HOH HOH F . 
N 3 HOH 161 561 384 HOH HOH F . 
N 3 HOH 162 562 238 HOH HOH F . 
N 3 HOH 163 563 381 HOH HOH F . 
N 3 HOH 164 564 237 HOH HOH F . 
N 3 HOH 165 565 834 HOH HOH F . 
N 3 HOH 166 566 149 HOH HOH F . 
N 3 HOH 167 567 290 HOH HOH F . 
N 3 HOH 168 568 576 HOH HOH F . 
N 3 HOH 169 569 710 HOH HOH F . 
N 3 HOH 170 570 271 HOH HOH F . 
N 3 HOH 171 571 176 HOH HOH F . 
N 3 HOH 172 572 639 HOH HOH F . 
N 3 HOH 173 573 762 HOH HOH F . 
N 3 HOH 174 574 843 HOH HOH F . 
N 3 HOH 175 575 101 HOH HOH F . 
N 3 HOH 176 576 268 HOH HOH F . 
N 3 HOH 177 577 175 HOH HOH F . 
N 3 HOH 178 578 304 HOH HOH F . 
N 3 HOH 179 579 616 HOH HOH F . 
N 3 HOH 180 580 350 HOH HOH F . 
N 3 HOH 181 581 42  HOH HOH F . 
N 3 HOH 182 582 878 HOH HOH F . 
N 3 HOH 183 583 369 HOH HOH F . 
N 3 HOH 184 584 467 HOH HOH F . 
N 3 HOH 185 585 869 HOH HOH F . 
N 3 HOH 186 586 230 HOH HOH F . 
N 3 HOH 187 587 387 HOH HOH F . 
N 3 HOH 188 588 853 HOH HOH F . 
N 3 HOH 189 589 481 HOH HOH F . 
N 3 HOH 190 590 354 HOH HOH F . 
N 3 HOH 191 591 488 HOH HOH F . 
N 3 HOH 192 592 232 HOH HOH F . 
N 3 HOH 193 593 139 HOH HOH F . 
N 3 HOH 194 594 5   HOH HOH F . 
N 3 HOH 195 595 80  HOH HOH F . 
N 3 HOH 196 596 367 HOH HOH F . 
N 3 HOH 197 597 215 HOH HOH F . 
N 3 HOH 198 598 512 HOH HOH F . 
N 3 HOH 199 599 381 HOH HOH F . 
N 3 HOH 200 600 86  HOH HOH F . 
N 3 HOH 201 601 417 HOH HOH F . 
N 3 HOH 202 602 336 HOH HOH F . 
N 3 HOH 203 603 314 HOH HOH F . 
N 3 HOH 204 604 398 HOH HOH F . 
N 3 HOH 205 605 270 HOH HOH F . 
N 3 HOH 206 606 286 HOH HOH F . 
N 3 HOH 207 607 129 HOH HOH F . 
N 3 HOH 208 608 131 HOH HOH F . 
N 3 HOH 209 609 339 HOH HOH F . 
N 3 HOH 210 610 137 HOH HOH F . 
N 3 HOH 211 611 319 HOH HOH F . 
O 3 HOH 1   401 1   HOH HOH G . 
O 3 HOH 2   402 302 HOH HOH G . 
O 3 HOH 3   403 210 HOH HOH G . 
O 3 HOH 4   404 529 HOH HOH G . 
O 3 HOH 5   405 198 HOH HOH G . 
O 3 HOH 6   406 195 HOH HOH G . 
O 3 HOH 7   407 852 HOH HOH G . 
O 3 HOH 8   408 278 HOH HOH G . 
O 3 HOH 9   409 175 HOH HOH G . 
O 3 HOH 10  410 153 HOH HOH G . 
O 3 HOH 11  411 178 HOH HOH G . 
O 3 HOH 12  412 193 HOH HOH G . 
O 3 HOH 13  413 456 HOH HOH G . 
O 3 HOH 14  414 540 HOH HOH G . 
O 3 HOH 15  415 194 HOH HOH G . 
O 3 HOH 16  416 946 HOH HOH G . 
O 3 HOH 17  417 561 HOH HOH G . 
O 3 HOH 18  418 391 HOH HOH G . 
O 3 HOH 19  419 212 HOH HOH G . 
O 3 HOH 20  420 40  HOH HOH G . 
O 3 HOH 21  421 907 HOH HOH G . 
O 3 HOH 22  422 362 HOH HOH G . 
O 3 HOH 23  423 310 HOH HOH G . 
O 3 HOH 24  424 874 HOH HOH G . 
O 3 HOH 25  425 163 HOH HOH G . 
O 3 HOH 26  426 13  HOH HOH G . 
O 3 HOH 27  427 779 HOH HOH G . 
O 3 HOH 28  428 10  HOH HOH G . 
O 3 HOH 29  429 65  HOH HOH G . 
O 3 HOH 30  430 453 HOH HOH G . 
O 3 HOH 31  431 247 HOH HOH G . 
O 3 HOH 32  432 89  HOH HOH G . 
O 3 HOH 33  433 542 HOH HOH G . 
O 3 HOH 34  434 653 HOH HOH G . 
O 3 HOH 35  435 164 HOH HOH G . 
O 3 HOH 36  436 501 HOH HOH G . 
O 3 HOH 37  437 164 HOH HOH G . 
O 3 HOH 38  438 431 HOH HOH G . 
O 3 HOH 39  439 754 HOH HOH G . 
O 3 HOH 40  440 700 HOH HOH G . 
O 3 HOH 41  441 12  HOH HOH G . 
O 3 HOH 42  442 225 HOH HOH G . 
O 3 HOH 43  443 229 HOH HOH G . 
O 3 HOH 44  444 218 HOH HOH G . 
O 3 HOH 45  445 900 HOH HOH G . 
O 3 HOH 46  446 66  HOH HOH G . 
O 3 HOH 47  447 312 HOH HOH G . 
O 3 HOH 48  448 191 HOH HOH G . 
O 3 HOH 49  449 151 HOH HOH G . 
O 3 HOH 50  450 6   HOH HOH G . 
O 3 HOH 51  451 773 HOH HOH G . 
O 3 HOH 52  452 856 HOH HOH G . 
O 3 HOH 53  453 828 HOH HOH G . 
O 3 HOH 54  454 159 HOH HOH G . 
O 3 HOH 55  455 60  HOH HOH G . 
O 3 HOH 56  456 203 HOH HOH G . 
O 3 HOH 57  457 763 HOH HOH G . 
O 3 HOH 58  458 237 HOH HOH G . 
O 3 HOH 59  459 103 HOH HOH G . 
O 3 HOH 60  460 702 HOH HOH G . 
O 3 HOH 61  461 14  HOH HOH G . 
O 3 HOH 62  462 720 HOH HOH G . 
O 3 HOH 63  463 213 HOH HOH G . 
O 3 HOH 64  464 571 HOH HOH G . 
O 3 HOH 65  465 355 HOH HOH G . 
O 3 HOH 66  466 243 HOH HOH G . 
O 3 HOH 67  467 32  HOH HOH G . 
O 3 HOH 68  468 703 HOH HOH G . 
O 3 HOH 69  469 405 HOH HOH G . 
O 3 HOH 70  470 140 HOH HOH G . 
O 3 HOH 71  471 58  HOH HOH G . 
O 3 HOH 72  472 61  HOH HOH G . 
O 3 HOH 73  473 506 HOH HOH G . 
O 3 HOH 74  474 638 HOH HOH G . 
O 3 HOH 75  475 404 HOH HOH G . 
O 3 HOH 76  476 87  HOH HOH G . 
O 3 HOH 77  477 705 HOH HOH G . 
O 3 HOH 78  478 40  HOH HOH G . 
O 3 HOH 79  479 405 HOH HOH G . 
O 3 HOH 80  480 721 HOH HOH G . 
O 3 HOH 81  481 651 HOH HOH G . 
O 3 HOH 82  482 130 HOH HOH G . 
O 3 HOH 83  483 637 HOH HOH G . 
O 3 HOH 84  484 24  HOH HOH G . 
O 3 HOH 85  485 59  HOH HOH G . 
O 3 HOH 86  486 883 HOH HOH G . 
O 3 HOH 87  487 519 HOH HOH G . 
O 3 HOH 88  488 390 HOH HOH G . 
O 3 HOH 89  489 143 HOH HOH G . 
O 3 HOH 90  490 795 HOH HOH G . 
O 3 HOH 91  491 44  HOH HOH G . 
O 3 HOH 92  492 402 HOH HOH G . 
O 3 HOH 93  493 391 HOH HOH G . 
O 3 HOH 94  494 806 HOH HOH G . 
O 3 HOH 95  495 258 HOH HOH G . 
O 3 HOH 96  496 79  HOH HOH G . 
O 3 HOH 97  497 81  HOH HOH G . 
O 3 HOH 98  498 419 HOH HOH G . 
O 3 HOH 99  499 530 HOH HOH G . 
O 3 HOH 100 500 726 HOH HOH G . 
O 3 HOH 101 501 66  HOH HOH G . 
O 3 HOH 102 502 271 HOH HOH G . 
O 3 HOH 103 503 679 HOH HOH G . 
O 3 HOH 104 504 552 HOH HOH G . 
O 3 HOH 105 505 135 HOH HOH G . 
O 3 HOH 106 506 909 HOH HOH G . 
O 3 HOH 107 507 201 HOH HOH G . 
O 3 HOH 108 508 573 HOH HOH G . 
O 3 HOH 109 509 753 HOH HOH G . 
O 3 HOH 110 510 399 HOH HOH G . 
O 3 HOH 111 511 929 HOH HOH G . 
O 3 HOH 112 512 926 HOH HOH G . 
O 3 HOH 113 513 288 HOH HOH G . 
O 3 HOH 114 514 23  HOH HOH G . 
O 3 HOH 115 515 231 HOH HOH G . 
O 3 HOH 116 516 61  HOH HOH G . 
O 3 HOH 117 517 234 HOH HOH G . 
O 3 HOH 118 518 531 HOH HOH G . 
O 3 HOH 119 519 97  HOH HOH G . 
O 3 HOH 120 520 131 HOH HOH G . 
O 3 HOH 121 521 196 HOH HOH G . 
O 3 HOH 122 522 417 HOH HOH G . 
O 3 HOH 123 523 629 HOH HOH G . 
O 3 HOH 124 524 76  HOH HOH G . 
O 3 HOH 125 525 56  HOH HOH G . 
O 3 HOH 126 526 51  HOH HOH G . 
O 3 HOH 127 527 360 HOH HOH G . 
O 3 HOH 128 528 123 HOH HOH G . 
O 3 HOH 129 529 72  HOH HOH G . 
O 3 HOH 130 530 71  HOH HOH G . 
O 3 HOH 131 531 550 HOH HOH G . 
O 3 HOH 132 532 48  HOH HOH G . 
O 3 HOH 133 533 672 HOH HOH G . 
O 3 HOH 134 534 363 HOH HOH G . 
O 3 HOH 135 535 233 HOH HOH G . 
O 3 HOH 136 536 941 HOH HOH G . 
O 3 HOH 137 537 149 HOH HOH G . 
O 3 HOH 138 538 320 HOH HOH G . 
O 3 HOH 139 539 323 HOH HOH G . 
O 3 HOH 140 540 722 HOH HOH G . 
O 3 HOH 141 541 366 HOH HOH G . 
O 3 HOH 142 542 277 HOH HOH G . 
O 3 HOH 143 543 239 HOH HOH G . 
O 3 HOH 144 544 333 HOH HOH G . 
O 3 HOH 145 545 887 HOH HOH G . 
O 3 HOH 146 546 439 HOH HOH G . 
O 3 HOH 147 547 87  HOH HOH G . 
O 3 HOH 148 548 69  HOH HOH G . 
O 3 HOH 149 549 88  HOH HOH G . 
O 3 HOH 150 550 751 HOH HOH G . 
O 3 HOH 151 551 936 HOH HOH G . 
O 3 HOH 152 552 408 HOH HOH G . 
O 3 HOH 153 553 606 HOH HOH G . 
O 3 HOH 154 554 49  HOH HOH G . 
O 3 HOH 155 555 242 HOH HOH G . 
O 3 HOH 156 556 784 HOH HOH G . 
O 3 HOH 157 557 278 HOH HOH G . 
O 3 HOH 158 558 39  HOH HOH G . 
O 3 HOH 159 559 207 HOH HOH G . 
O 3 HOH 160 560 370 HOH HOH G . 
O 3 HOH 161 561 31  HOH HOH G . 
O 3 HOH 162 562 280 HOH HOH G . 
O 3 HOH 163 563 735 HOH HOH G . 
O 3 HOH 164 564 396 HOH HOH G . 
O 3 HOH 165 565 3   HOH HOH G . 
O 3 HOH 166 566 484 HOH HOH G . 
O 3 HOH 167 567 205 HOH HOH G . 
O 3 HOH 168 568 597 HOH HOH G . 
O 3 HOH 169 569 211 HOH HOH G . 
O 3 HOH 170 570 549 HOH HOH G . 
O 3 HOH 171 571 433 HOH HOH G . 
O 3 HOH 172 572 89  HOH HOH G . 
O 3 HOH 173 573 514 HOH HOH G . 
O 3 HOH 174 574 605 HOH HOH G . 
O 3 HOH 175 575 128 HOH HOH G . 
O 3 HOH 176 576 590 HOH HOH G . 
O 3 HOH 177 577 361 HOH HOH G . 
O 3 HOH 178 578 764 HOH HOH G . 
O 3 HOH 179 579 931 HOH HOH G . 
O 3 HOH 180 580 704 HOH HOH G . 
O 3 HOH 181 581 347 HOH HOH G . 
O 3 HOH 182 582 27  HOH HOH G . 
O 3 HOH 183 583 126 HOH HOH G . 
O 3 HOH 184 584 18  HOH HOH G . 
O 3 HOH 185 585 9   HOH HOH G . 
O 3 HOH 186 586 785 HOH HOH G . 
O 3 HOH 187 587 596 HOH HOH G . 
O 3 HOH 188 588 458 HOH HOH G . 
O 3 HOH 189 589 79  HOH HOH G . 
O 3 HOH 190 590 939 HOH HOH G . 
O 3 HOH 191 591 14  HOH HOH G . 
O 3 HOH 192 592 554 HOH HOH G . 
O 3 HOH 193 593 292 HOH HOH G . 
O 3 HOH 194 594 19  HOH HOH G . 
O 3 HOH 195 595 594 HOH HOH G . 
O 3 HOH 196 596 232 HOH HOH G . 
O 3 HOH 197 597 490 HOH HOH G . 
O 3 HOH 198 598 97  HOH HOH G . 
O 3 HOH 199 599 265 HOH HOH G . 
O 3 HOH 200 600 68  HOH HOH G . 
O 3 HOH 201 601 457 HOH HOH G . 
O 3 HOH 202 602 686 HOH HOH G . 
O 3 HOH 203 603 393 HOH HOH G . 
O 3 HOH 204 604 10  HOH HOH G . 
O 3 HOH 205 605 225 HOH HOH G . 
O 3 HOH 206 606 267 HOH HOH G . 
O 3 HOH 207 607 22  HOH HOH G . 
O 3 HOH 208 608 170 HOH HOH G . 
O 3 HOH 209 609 374 HOH HOH G . 
O 3 HOH 210 610 108 HOH HOH G . 
O 3 HOH 211 611 727 HOH HOH G . 
O 3 HOH 212 612 392 HOH HOH G . 
O 3 HOH 213 613 221 HOH HOH G . 
O 3 HOH 214 614 873 HOH HOH G . 
O 3 HOH 215 615 100 HOH HOH G . 
O 3 HOH 216 616 486 HOH HOH G . 
O 3 HOH 217 617 224 HOH HOH G . 
O 3 HOH 218 618 109 HOH HOH G . 
O 3 HOH 219 619 432 HOH HOH G . 
O 3 HOH 220 620 253 HOH HOH G . 
O 3 HOH 221 621 259 HOH HOH G . 
O 3 HOH 222 622 293 HOH HOH G . 
O 3 HOH 223 623 117 HOH HOH G . 
O 3 HOH 224 624 925 HOH HOH G . 
O 3 HOH 225 625 219 HOH HOH G . 
O 3 HOH 226 626 494 HOH HOH G . 
O 3 HOH 227 627 188 HOH HOH G . 
O 3 HOH 228 628 734 HOH HOH G . 
O 3 HOH 229 629 395 HOH HOH G . 
O 3 HOH 230 630 353 HOH HOH G . 
O 3 HOH 231 631 33  HOH HOH G . 
O 3 HOH 232 632 414 HOH HOH G . 
O 3 HOH 233 633 640 HOH HOH G . 
O 3 HOH 234 634 162 HOH HOH G . 
O 3 HOH 235 635 568 HOH HOH G . 
O 3 HOH 236 636 150 HOH HOH G . 
O 3 HOH 237 637 29  HOH HOH G . 
O 3 HOH 238 638 148 HOH HOH G . 
O 3 HOH 239 639 452 HOH HOH G . 
O 3 HOH 240 640 715 HOH HOH G . 
O 3 HOH 241 641 154 HOH HOH G . 
O 3 HOH 242 642 368 HOH HOH G . 
O 3 HOH 243 643 648 HOH HOH G . 
O 3 HOH 244 644 59  HOH HOH G . 
O 3 HOH 245 645 947 HOH HOH G . 
O 3 HOH 246 646 326 HOH HOH G . 
O 3 HOH 247 647 228 HOH HOH G . 
O 3 HOH 248 648 7   HOH HOH G . 
O 3 HOH 249 649 91  HOH HOH G . 
O 3 HOH 250 650 811 HOH HOH G . 
O 3 HOH 251 651 35  HOH HOH G . 
O 3 HOH 252 652 199 HOH HOH G . 
O 3 HOH 253 653 468 HOH HOH G . 
O 3 HOH 254 654 619 HOH HOH G . 
O 3 HOH 255 655 304 HOH HOH G . 
O 3 HOH 256 656 842 HOH HOH G . 
O 3 HOH 257 657 676 HOH HOH G . 
O 3 HOH 258 658 118 HOH HOH G . 
O 3 HOH 259 659 618 HOH HOH G . 
O 3 HOH 260 660 104 HOH HOH G . 
O 3 HOH 261 661 911 HOH HOH G . 
O 3 HOH 262 662 266 HOH HOH G . 
O 3 HOH 263 663 51  HOH HOH G . 
O 3 HOH 264 664 279 HOH HOH G . 
O 3 HOH 265 665 219 HOH HOH G . 
O 3 HOH 266 666 86  HOH HOH G . 
O 3 HOH 267 667 588 HOH HOH G . 
O 3 HOH 268 668 499 HOH HOH G . 
O 3 HOH 269 669 228 HOH HOH G . 
O 3 HOH 270 670 96  HOH HOH G . 
O 3 HOH 271 671 332 HOH HOH G . 
O 3 HOH 272 672 409 HOH HOH G . 
O 3 HOH 273 673 179 HOH HOH G . 
O 3 HOH 274 674 821 HOH HOH G . 
O 3 HOH 275 675 274 HOH HOH G . 
O 3 HOH 276 676 662 HOH HOH G . 
O 3 HOH 277 677 236 HOH HOH G . 
O 3 HOH 278 678 293 HOH HOH G . 
O 3 HOH 279 679 206 HOH HOH G . 
O 3 HOH 280 680 411 HOH HOH G . 
O 3 HOH 281 681 155 HOH HOH G . 
O 3 HOH 282 682 44  HOH HOH G . 
O 3 HOH 283 683 78  HOH HOH G . 
O 3 HOH 284 684 191 HOH HOH G . 
O 3 HOH 285 685 317 HOH HOH G . 
O 3 HOH 286 686 389 HOH HOH G . 
O 3 HOH 287 687 376 HOH HOH G . 
O 3 HOH 288 688 23  HOH HOH G . 
O 3 HOH 289 689 141 HOH HOH G . 
P 3 HOH 1   401 826 HOH HOH H . 
P 3 HOH 2   402 860 HOH HOH H . 
P 3 HOH 3   403 256 HOH HOH H . 
P 3 HOH 4   404 70  HOH HOH H . 
P 3 HOH 5   405 165 HOH HOH H . 
P 3 HOH 6   406 77  HOH HOH H . 
P 3 HOH 7   407 657 HOH HOH H . 
P 3 HOH 8   408 238 HOH HOH H . 
P 3 HOH 9   409 57  HOH HOH H . 
P 3 HOH 10  410 69  HOH HOH H . 
P 3 HOH 11  411 257 HOH HOH H . 
P 3 HOH 12  412 251 HOH HOH H . 
P 3 HOH 13  413 412 HOH HOH H . 
P 3 HOH 14  414 621 HOH HOH H . 
P 3 HOH 15  415 275 HOH HOH H . 
P 3 HOH 16  416 47  HOH HOH H . 
P 3 HOH 17  417 189 HOH HOH H . 
P 3 HOH 18  418 48  HOH HOH H . 
P 3 HOH 19  419 36  HOH HOH H . 
P 3 HOH 20  420 172 HOH HOH H . 
P 3 HOH 21  421 678 HOH HOH H . 
P 3 HOH 22  422 580 HOH HOH H . 
P 3 HOH 23  423 264 HOH HOH H . 
P 3 HOH 24  424 192 HOH HOH H . 
P 3 HOH 25  425 65  HOH HOH H . 
P 3 HOH 26  426 620 HOH HOH H . 
P 3 HOH 27  427 504 HOH HOH H . 
P 3 HOH 28  428 9   HOH HOH H . 
P 3 HOH 29  429 144 HOH HOH H . 
P 3 HOH 30  430 210 HOH HOH H . 
P 3 HOH 31  431 683 HOH HOH H . 
P 3 HOH 32  432 924 HOH HOH H . 
P 3 HOH 33  433 358 HOH HOH H . 
P 3 HOH 34  434 760 HOH HOH H . 
P 3 HOH 35  435 276 HOH HOH H . 
P 3 HOH 36  436 99  HOH HOH H . 
P 3 HOH 37  437 356 HOH HOH H . 
P 3 HOH 38  438 685 HOH HOH H . 
P 3 HOH 39  439 315 HOH HOH H . 
P 3 HOH 40  440 644 HOH HOH H . 
P 3 HOH 41  441 523 HOH HOH H . 
P 3 HOH 42  442 305 HOH HOH H . 
P 3 HOH 43  443 184 HOH HOH H . 
P 3 HOH 44  444 110 HOH HOH H . 
P 3 HOH 45  445 712 HOH HOH H . 
P 3 HOH 46  446 787 HOH HOH H . 
P 3 HOH 47  447 885 HOH HOH H . 
P 3 HOH 48  448 581 HOH HOH H . 
P 3 HOH 49  449 113 HOH HOH H . 
P 3 HOH 50  450 41  HOH HOH H . 
P 3 HOH 51  451 538 HOH HOH H . 
P 3 HOH 52  452 233 HOH HOH H . 
P 3 HOH 53  453 400 HOH HOH H . 
P 3 HOH 54  454 257 HOH HOH H . 
P 3 HOH 55  455 866 HOH HOH H . 
P 3 HOH 56  456 341 HOH HOH H . 
P 3 HOH 57  457 281 HOH HOH H . 
P 3 HOH 58  458 466 HOH HOH H . 
P 3 HOH 59  459 289 HOH HOH H . 
P 3 HOH 60  460 255 HOH HOH H . 
P 3 HOH 61  461 45  HOH HOH H . 
P 3 HOH 62  462 789 HOH HOH H . 
P 3 HOH 63  463 163 HOH HOH H . 
P 3 HOH 64  464 587 HOH HOH H . 
P 3 HOH 65  465 371 HOH HOH H . 
P 3 HOH 66  466 227 HOH HOH H . 
P 3 HOH 67  467 311 HOH HOH H . 
P 3 HOH 68  468 301 HOH HOH H . 
P 3 HOH 69  469 518 HOH HOH H . 
P 3 HOH 70  470 398 HOH HOH H . 
P 3 HOH 71  471 101 HOH HOH H . 
P 3 HOH 72  472 321 HOH HOH H . 
P 3 HOH 73  473 292 HOH HOH H . 
P 3 HOH 74  474 812 HOH HOH H . 
P 3 HOH 75  475 197 HOH HOH H . 
P 3 HOH 76  476 32  HOH HOH H . 
P 3 HOH 77  477 709 HOH HOH H . 
P 3 HOH 78  478 817 HOH HOH H . 
P 3 HOH 79  479 346 HOH HOH H . 
P 3 HOH 80  480 244 HOH HOH H . 
P 3 HOH 81  481 249 HOH HOH H . 
P 3 HOH 82  482 26  HOH HOH H . 
P 3 HOH 83  483 224 HOH HOH H . 
P 3 HOH 84  484 383 HOH HOH H . 
P 3 HOH 85  485 544 HOH HOH H . 
P 3 HOH 86  486 15  HOH HOH H . 
P 3 HOH 87  487 142 HOH HOH H . 
P 3 HOH 88  488 309 HOH HOH H . 
P 3 HOH 89  489 240 HOH HOH H . 
P 3 HOH 90  490 20  HOH HOH H . 
P 3 HOH 91  491 95  HOH HOH H . 
P 3 HOH 92  492 872 HOH HOH H . 
P 3 HOH 93  493 296 HOH HOH H . 
P 3 HOH 94  494 221 HOH HOH H . 
P 3 HOH 95  495 204 HOH HOH H . 
P 3 HOH 96  496 220 HOH HOH H . 
P 3 HOH 97  497 409 HOH HOH H . 
P 3 HOH 98  498 310 HOH HOH H . 
P 3 HOH 99  499 261 HOH HOH H . 
P 3 HOH 100 500 396 HOH HOH H . 
P 3 HOH 101 501 615 HOH HOH H . 
P 3 HOH 102 502 822 HOH HOH H . 
P 3 HOH 103 503 837 HOH HOH H . 
P 3 HOH 104 504 421 HOH HOH H . 
P 3 HOH 105 505 6   HOH HOH H . 
P 3 HOH 106 506 479 HOH HOH H . 
P 3 HOH 107 507 480 HOH HOH H . 
P 3 HOH 108 508 914 HOH HOH H . 
P 3 HOH 109 509 595 HOH HOH H . 
P 3 HOH 110 510 357 HOH HOH H . 
P 3 HOH 111 511 838 HOH HOH H . 
P 3 HOH 112 512 58  HOH HOH H . 
P 3 HOH 113 513 94  HOH HOH H . 
P 3 HOH 114 514 174 HOH HOH H . 
P 3 HOH 115 515 167 HOH HOH H . 
P 3 HOH 116 516 2   HOH HOH H . 
P 3 HOH 117 517 557 HOH HOH H . 
P 3 HOH 118 518 650 HOH HOH H . 
P 3 HOH 119 519 739 HOH HOH H . 
P 3 HOH 120 520 116 HOH HOH H . 
P 3 HOH 121 521 269 HOH HOH H . 
P 3 HOH 122 522 361 HOH HOH H . 
P 3 HOH 123 523 824 HOH HOH H . 
P 3 HOH 124 524 298 HOH HOH H . 
P 3 HOH 125 525 284 HOH HOH H . 
P 3 HOH 126 526 455 HOH HOH H . 
P 3 HOH 127 527 674 HOH HOH H . 
P 3 HOH 128 528 157 HOH HOH H . 
P 3 HOH 129 529 462 HOH HOH H . 
P 3 HOH 130 530 180 HOH HOH H . 
P 3 HOH 131 531 176 HOH HOH H . 
P 3 HOH 132 532 407 HOH HOH H . 
P 3 HOH 133 533 46  HOH HOH H . 
P 3 HOH 134 534 287 HOH HOH H . 
P 3 HOH 135 535 341 HOH HOH H . 
P 3 HOH 136 536 38  HOH HOH H . 
P 3 HOH 137 537 599 HOH HOH H . 
P 3 HOH 138 538 325 HOH HOH H . 
P 3 HOH 139 539 139 HOH HOH H . 
P 3 HOH 140 540 286 HOH HOH H . 
P 3 HOH 141 541 825 HOH HOH H . 
P 3 HOH 142 542 406 HOH HOH H . 
P 3 HOH 143 543 282 HOH HOH H . 
P 3 HOH 144 544 524 HOH HOH H . 
P 3 HOH 145 545 348 HOH HOH H . 
P 3 HOH 146 546 603 HOH HOH H . 
P 3 HOH 147 547 187 HOH HOH H . 
P 3 HOH 148 548 714 HOH HOH H . 
P 3 HOH 149 549 345 HOH HOH H . 
P 3 HOH 150 550 118 HOH HOH H . 
P 3 HOH 151 551 159 HOH HOH H . 
P 3 HOH 152 552 102 HOH HOH H . 
P 3 HOH 153 553 263 HOH HOH H . 
P 3 HOH 154 554 249 HOH HOH H . 
P 3 HOH 155 555 324 HOH HOH H . 
P 3 HOH 156 556 173 HOH HOH H . 
P 3 HOH 157 557 113 HOH HOH H . 
P 3 HOH 158 558 111 HOH HOH H . 
P 3 HOH 159 559 281 HOH HOH H . 
P 3 HOH 160 560 52  HOH HOH H . 
P 3 HOH 161 561 896 HOH HOH H . 
P 3 HOH 162 562 190 HOH HOH H . 
P 3 HOH 163 563 308 HOH HOH H . 
P 3 HOH 164 564 75  HOH HOH H . 
P 3 HOH 165 565 177 HOH HOH H . 
P 3 HOH 166 566 127 HOH HOH H . 
P 3 HOH 167 567 92  HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
4 author_and_software_defined_assembly PISA dimeric 2 
5 author_and_software_defined_assembly PISA dimeric 2 
6 author_and_software_defined_assembly PISA dimeric 2 
7 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,F,I,N 
2 1 A,F,I,N 
3 1 B,G,J,O 
4 1 B,G,J,O 
5 1 C,E,K,M 
6 1 C,E,K,M 
7 1 D,H,L,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 1150  ? 
2 MORE         -3    ? 
2 'SSA (A^2)'  13720 ? 
4 'ABSA (A^2)' 1200  ? 
4 MORE         -2    ? 
4 'SSA (A^2)'  13860 ? 
6 'ABSA (A^2)' 1060  ? 
6 MORE         -2    ? 
6 'SSA (A^2)'  13950 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2017-03-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER  ? ? ? 2.10.2 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS   ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .      4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C E PRO 186 ? ? N E TYR 187 ? ? CA E TYR 187 ? ? 138.24 121.70 16.54 2.50 Y 
2 1 C G PRO 186 ? ? N G TYR 187 ? ? CA G TYR 187 ? ? 136.76 121.70 15.06 2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 706 ? ? 89.00   -28.52  
2  1 MET D 705 ? ? 70.65   -32.37  
3  1 GLU D 706 ? ? -113.50 74.30   
4  1 GLN E 138 ? ? 27.40   -118.54 
5  1 GLU E 139 ? ? -175.26 102.20  
6  1 PRO E 141 ? ? -73.58  -93.00  
7  1 VAL E 152 ? ? -117.47 -75.97  
8  1 VAL E 165 ? ? -59.09  101.74  
9  1 CYS E 178 ? ? -117.77 -115.97 
10 1 TYR E 187 ? ? -34.30  123.29  
11 1 VAL F 137 ? ? -93.63  -60.81  
12 1 GLU F 142 ? ? -143.78 55.33   
13 1 VAL F 152 ? ? -118.67 -77.24  
14 1 CYS F 178 ? ? -116.89 -115.82 
15 1 TYR F 187 ? ? -8.42   127.61  
16 1 ALA F 235 ? ? 81.56   33.59   
17 1 HIS F 353 ? ? -73.59  45.84   
18 1 ALA F 354 ? ? -141.05 47.38   
19 1 VAL G 152 ? ? -114.44 -75.95  
20 1 CYS G 178 ? ? -117.94 -116.49 
21 1 TYR G 187 ? ? -35.55  118.56  
22 1 ALA G 235 ? ? 71.35   32.89   
23 1 GLN H 138 ? ? 71.51   101.34  
24 1 VAL H 152 ? ? -116.75 -77.84  
25 1 CYS H 178 ? ? -116.98 -117.52 
26 1 TYR H 187 ? ? -38.28  121.21  
27 1 ALA H 235 ? ? 71.01   33.17   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1   1 O ? A HOH 811 ? 6.60  . 
2   1 O ? A HOH 812 ? 7.04  . 
3   1 O ? B HOH 817 ? 5.90  . 
4   1 O ? B HOH 818 ? 6.60  . 
5   1 O ? B HOH 819 ? 7.22  . 
6   1 O ? B HOH 820 ? 7.32  . 
7   1 O ? B HOH 821 ? 10.02 . 
8   1 O ? B HOH 822 ? 10.60 . 
9   1 O ? B HOH 823 ? 11.17 . 
10  1 O ? B HOH 824 ? 13.47 . 
11  1 O ? C HOH 820 ? 5.84  . 
12  1 O ? E HOH 698 ? 5.81  . 
13  1 O ? E HOH 699 ? 5.95  . 
14  1 O ? E HOH 700 ? 6.05  . 
15  1 O ? E HOH 701 ? 6.10  . 
16  1 O ? E HOH 702 ? 6.40  . 
17  1 O ? E HOH 703 ? 6.45  . 
18  1 O ? E HOH 704 ? 6.46  . 
19  1 O ? E HOH 705 ? 6.52  . 
20  1 O ? E HOH 706 ? 6.67  . 
21  1 O ? E HOH 707 ? 6.73  . 
22  1 O ? E HOH 708 ? 6.77  . 
23  1 O ? E HOH 709 ? 6.89  . 
24  1 O ? E HOH 710 ? 6.95  . 
25  1 O ? E HOH 711 ? 7.05  . 
26  1 O ? E HOH 712 ? 7.11  . 
27  1 O ? E HOH 713 ? 7.34  . 
28  1 O ? E HOH 714 ? 7.35  . 
29  1 O ? E HOH 715 ? 7.44  . 
30  1 O ? E HOH 716 ? 7.61  . 
31  1 O ? E HOH 717 ? 7.79  . 
32  1 O ? E HOH 718 ? 8.52  . 
33  1 O ? E HOH 719 ? 8.59  . 
34  1 O ? E HOH 720 ? 8.98  . 
35  1 O ? E HOH 721 ? 9.33  . 
36  1 O ? E HOH 722 ? 9.69  . 
37  1 O ? E HOH 723 ? 10.27 . 
38  1 O ? E HOH 724 ? 10.79 . 
39  1 O ? E HOH 725 ? 11.24 . 
40  1 O ? E HOH 726 ? 11.37 . 
41  1 O ? E HOH 727 ? 13.39 . 
42  1 O ? E HOH 728 ? 13.89 . 
43  1 O ? E HOH 729 ? 14.35 . 
44  1 O ? E HOH 730 ? 15.26 . 
45  1 O ? E HOH 731 ? 17.28 . 
46  1 O ? E HOH 732 ? 17.73 . 
47  1 O ? F HOH 592 ? 6.03  . 
48  1 O ? F HOH 593 ? 6.03  . 
49  1 O ? F HOH 594 ? 6.08  . 
50  1 O ? F HOH 595 ? 6.39  . 
51  1 O ? F HOH 596 ? 6.43  . 
52  1 O ? F HOH 597 ? 7.46  . 
53  1 O ? F HOH 598 ? 7.75  . 
54  1 O ? F HOH 599 ? 7.85  . 
55  1 O ? F HOH 600 ? 8.08  . 
56  1 O ? F HOH 601 ? 8.30  . 
57  1 O ? F HOH 602 ? 8.61  . 
58  1 O ? F HOH 603 ? 9.30  . 
59  1 O ? F HOH 604 ? 9.50  . 
60  1 O ? F HOH 605 ? 9.54  . 
61  1 O ? F HOH 606 ? 10.35 . 
62  1 O ? F HOH 607 ? 10.49 . 
63  1 O ? F HOH 608 ? 12.75 . 
64  1 O ? F HOH 609 ? 13.82 . 
65  1 O ? F HOH 610 ? 14.75 . 
66  1 O ? F HOH 611 ? 17.65 . 
67  1 O ? G HOH 666 ? 5.81  . 
68  1 O ? G HOH 667 ? 5.97  . 
69  1 O ? G HOH 668 ? 5.98  . 
70  1 O ? G HOH 669 ? 6.20  . 
71  1 O ? G HOH 670 ? 6.23  . 
72  1 O ? G HOH 671 ? 6.28  . 
73  1 O ? G HOH 672 ? 6.34  . 
74  1 O ? G HOH 673 ? 6.36  . 
75  1 O ? G HOH 674 ? 6.37  . 
76  1 O ? G HOH 675 ? 6.47  . 
77  1 O ? G HOH 676 ? 6.87  . 
78  1 O ? G HOH 677 ? 7.19  . 
79  1 O ? G HOH 678 ? 8.77  . 
80  1 O ? G HOH 679 ? 8.86  . 
81  1 O ? G HOH 680 ? 9.26  . 
82  1 O ? G HOH 681 ? 9.49  . 
83  1 O ? G HOH 682 ? 10.26 . 
84  1 O ? G HOH 683 ? 10.37 . 
85  1 O ? G HOH 684 ? 11.78 . 
86  1 O ? G HOH 685 ? 13.63 . 
87  1 O ? G HOH 686 ? 14.59 . 
88  1 O ? G HOH 687 ? 16.17 . 
89  1 O ? G HOH 688 ? 16.50 . 
90  1 O ? G HOH 689 ? 16.74 . 
91  1 O ? H HOH 539 ? 5.82  . 
92  1 O ? H HOH 540 ? 5.83  . 
93  1 O ? H HOH 541 ? 6.24  . 
94  1 O ? H HOH 542 ? 6.46  . 
95  1 O ? H HOH 543 ? 6.62  . 
96  1 O ? H HOH 544 ? 6.73  . 
97  1 O ? H HOH 545 ? 6.95  . 
98  1 O ? H HOH 546 ? 6.96  . 
99  1 O ? H HOH 547 ? 7.18  . 
100 1 O ? H HOH 548 ? 7.39  . 
101 1 O ? H HOH 549 ? 7.39  . 
102 1 O ? H HOH 550 ? 7.59  . 
103 1 O ? H HOH 551 ? 7.67  . 
104 1 O ? H HOH 552 ? 7.84  . 
105 1 O ? H HOH 553 ? 7.92  . 
106 1 O ? H HOH 554 ? 8.46  . 
107 1 O ? H HOH 555 ? 8.82  . 
108 1 O ? H HOH 556 ? 8.89  . 
109 1 O ? H HOH 557 ? 9.27  . 
110 1 O ? H HOH 558 ? 11.25 . 
111 1 O ? H HOH 559 ? 11.80 . 
112 1 O ? H HOH 560 ? 12.06 . 
113 1 O ? H HOH 561 ? 12.14 . 
114 1 O ? H HOH 562 ? 12.30 . 
115 1 O ? H HOH 563 ? 12.43 . 
116 1 O ? H HOH 564 ? 12.57 . 
117 1 O ? H HOH 565 ? 12.65 . 
118 1 O ? H HOH 566 ? 13.12 . 
119 1 O ? H HOH 567 ? 13.41 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 704 ? CG  ? A GLU 3   CG  
2   1 Y 1 A GLU 704 ? CD  ? A GLU 3   CD  
3   1 Y 1 A GLU 704 ? OE1 ? A GLU 3   OE1 
4   1 Y 1 A GLU 704 ? OE2 ? A GLU 3   OE2 
5   1 Y 1 C GLU 704 ? N   ? C GLU 3   N   
6   1 Y 1 D GLU 704 ? CG  ? D GLU 3   CG  
7   1 Y 1 D GLU 704 ? CD  ? D GLU 3   CD  
8   1 Y 1 D GLU 704 ? OE1 ? D GLU 3   OE1 
9   1 Y 1 D GLU 704 ? OE2 ? D GLU 3   OE2 
10  1 Y 1 E GLN 138 ? CG  ? E GLN 48  CG  
11  1 Y 1 E GLN 138 ? CD  ? E GLN 48  CD  
12  1 Y 1 E GLN 138 ? OE1 ? E GLN 48  OE1 
13  1 Y 1 E GLN 138 ? NE2 ? E GLN 48  NE2 
14  1 Y 1 E GLU 139 ? CG  ? E GLU 49  CG  
15  1 Y 1 E GLU 139 ? CD  ? E GLU 49  CD  
16  1 Y 1 E GLU 139 ? OE1 ? E GLU 49  OE1 
17  1 Y 1 E GLU 139 ? OE2 ? E GLU 49  OE2 
18  1 Y 1 E GLU 140 ? CG  ? E GLU 50  CG  
19  1 Y 1 E GLU 140 ? CD  ? E GLU 50  CD  
20  1 Y 1 E GLU 140 ? OE1 ? E GLU 50  OE1 
21  1 Y 1 E GLU 140 ? OE2 ? E GLU 50  OE2 
22  1 Y 1 E GLU 142 ? CD  ? E GLU 52  CD  
23  1 Y 1 E GLU 142 ? OE1 ? E GLU 52  OE1 
24  1 Y 1 E GLU 142 ? OE2 ? E GLU 52  OE2 
25  1 Y 1 E ARG 184 ? CG  ? E ARG 94  CG  
26  1 Y 1 E ARG 184 ? CD  ? E ARG 94  CD  
27  1 Y 1 E ARG 184 ? NE  ? E ARG 94  NE  
28  1 Y 1 E ARG 184 ? CZ  ? E ARG 94  CZ  
29  1 Y 1 E ARG 184 ? NH1 ? E ARG 94  NH1 
30  1 Y 1 E ARG 184 ? NH2 ? E ARG 94  NH2 
31  1 Y 1 E GLN 215 ? CD  ? E GLN 125 CD  
32  1 Y 1 E GLN 215 ? OE1 ? E GLN 125 OE1 
33  1 Y 1 E GLN 215 ? NE2 ? E GLN 125 NE2 
34  1 Y 1 E GLN 356 ? CG  ? E GLN 266 CG  
35  1 Y 1 E GLN 356 ? CD  ? E GLN 266 CD  
36  1 Y 1 E GLN 356 ? OE1 ? E GLN 266 OE1 
37  1 Y 1 E GLN 356 ? NE2 ? E GLN 266 NE2 
38  1 Y 1 F GLU 91  ? CG  ? F GLU 1   CG  
39  1 Y 1 F GLU 91  ? CD  ? F GLU 1   CD  
40  1 Y 1 F GLU 91  ? OE1 ? F GLU 1   OE1 
41  1 Y 1 F GLU 91  ? OE2 ? F GLU 1   OE2 
42  1 Y 1 F GLU 92  ? CG  ? F GLU 2   CG  
43  1 Y 1 F GLU 92  ? CD  ? F GLU 2   CD  
44  1 Y 1 F GLU 92  ? OE1 ? F GLU 2   OE1 
45  1 Y 1 F GLU 92  ? OE2 ? F GLU 2   OE2 
46  1 Y 1 F LEU 131 ? CG  ? F LEU 41  CG  
47  1 Y 1 F LEU 131 ? CD1 ? F LEU 41  CD1 
48  1 Y 1 F LEU 131 ? CD2 ? F LEU 41  CD2 
49  1 Y 1 F GLN 138 ? CG  ? F GLN 48  CG  
50  1 Y 1 F GLN 138 ? CD  ? F GLN 48  CD  
51  1 Y 1 F GLN 138 ? OE1 ? F GLN 48  OE1 
52  1 Y 1 F GLN 138 ? NE2 ? F GLN 48  NE2 
53  1 Y 1 F GLU 139 ? CG  ? F GLU 49  CG  
54  1 Y 1 F GLU 139 ? CD  ? F GLU 49  CD  
55  1 Y 1 F GLU 139 ? OE1 ? F GLU 49  OE1 
56  1 Y 1 F GLU 139 ? OE2 ? F GLU 49  OE2 
57  1 Y 0 F MET 170 ? CE  ? F MET 80  CE  
58  1 Y 1 F GLN 182 ? CG  ? F GLN 92  CG  
59  1 Y 1 F GLN 182 ? CD  ? F GLN 92  CD  
60  1 Y 1 F GLN 182 ? OE1 ? F GLN 92  OE1 
61  1 Y 1 F GLN 182 ? NE2 ? F GLN 92  NE2 
62  1 Y 1 F ARG 184 ? CG  ? F ARG 94  CG  
63  1 Y 1 F ARG 184 ? CD  ? F ARG 94  CD  
64  1 Y 1 F ARG 184 ? NE  ? F ARG 94  NE  
65  1 Y 1 F ARG 184 ? CZ  ? F ARG 94  CZ  
66  1 Y 1 F ARG 184 ? NH1 ? F ARG 94  NH1 
67  1 Y 1 F ARG 184 ? NH2 ? F ARG 94  NH2 
68  1 Y 1 F SER 185 ? OG  ? F SER 95  OG  
69  1 Y 0 F GLN 269 ? OE1 ? F GLN 179 OE1 
70  1 Y 0 F ARG 293 ? NH1 ? F ARG 203 NH1 
71  1 Y 1 F LYS 334 ? CD  ? F LYS 244 CD  
72  1 Y 1 F LYS 334 ? CE  ? F LYS 244 CE  
73  1 Y 1 F LYS 334 ? NZ  ? F LYS 244 NZ  
74  1 Y 1 F LYS 340 ? CE  ? F LYS 250 CE  
75  1 Y 1 F LYS 340 ? NZ  ? F LYS 250 NZ  
76  1 Y 1 F LYS 351 ? CD  ? F LYS 261 CD  
77  1 Y 1 F LYS 351 ? CE  ? F LYS 261 CE  
78  1 Y 1 F LYS 351 ? NZ  ? F LYS 261 NZ  
79  1 Y 1 G ARG 136 ? NE  ? G ARG 46  NE  
80  1 Y 1 G ARG 136 ? CZ  ? G ARG 46  CZ  
81  1 Y 1 G ARG 136 ? NH1 ? G ARG 46  NH1 
82  1 Y 1 G ARG 136 ? NH2 ? G ARG 46  NH2 
83  1 Y 1 G GLU 142 ? CD  ? G GLU 52  CD  
84  1 Y 1 G GLU 142 ? OE1 ? G GLU 52  OE1 
85  1 Y 1 G GLU 142 ? OE2 ? G GLU 52  OE2 
86  1 Y 1 G ARG 184 ? NE  ? G ARG 94  NE  
87  1 Y 1 G ARG 184 ? CZ  ? G ARG 94  CZ  
88  1 Y 1 G ARG 184 ? NH1 ? G ARG 94  NH1 
89  1 Y 1 G ARG 184 ? NH2 ? G ARG 94  NH2 
90  1 Y 1 G GLN 233 ? CG  ? G GLN 143 CG  
91  1 Y 1 G GLN 233 ? CD  ? G GLN 143 CD  
92  1 Y 1 G GLN 233 ? OE1 ? G GLN 143 OE1 
93  1 Y 1 G GLN 233 ? NE2 ? G GLN 143 NE2 
94  1 Y 1 G LYS 256 ? CE  ? G LYS 166 CE  
95  1 Y 1 G LYS 256 ? NZ  ? G LYS 166 NZ  
96  1 Y 1 G ARG 289 ? NE  ? G ARG 199 NE  
97  1 Y 1 G ARG 289 ? CZ  ? G ARG 199 CZ  
98  1 Y 1 G ARG 289 ? NH1 ? G ARG 199 NH1 
99  1 Y 1 G ARG 289 ? NH2 ? G ARG 199 NH2 
100 1 Y 1 G LYS 334 ? CE  ? G LYS 244 CE  
101 1 Y 1 G LYS 334 ? NZ  ? G LYS 244 NZ  
102 1 Y 1 G GLN 356 ? CG  ? G GLN 266 CG  
103 1 Y 1 G GLN 356 ? CD  ? G GLN 266 CD  
104 1 Y 1 G GLN 356 ? OE1 ? G GLN 266 OE1 
105 1 Y 1 G GLN 356 ? NE2 ? G GLN 266 NE2 
106 1 Y 1 H GLU 91  ? CG  ? H GLU 1   CG  
107 1 Y 1 H GLU 91  ? CD  ? H GLU 1   CD  
108 1 Y 1 H GLU 91  ? OE1 ? H GLU 1   OE1 
109 1 Y 1 H GLU 91  ? OE2 ? H GLU 1   OE2 
110 1 Y 1 H GLU 92  ? CG  ? H GLU 2   CG  
111 1 Y 1 H GLU 92  ? CD  ? H GLU 2   CD  
112 1 Y 1 H GLU 92  ? OE1 ? H GLU 2   OE1 
113 1 Y 1 H GLU 92  ? OE2 ? H GLU 2   OE2 
114 1 Y 1 H LYS 105 ? CD  ? H LYS 15  CD  
115 1 Y 1 H LYS 105 ? CE  ? H LYS 15  CE  
116 1 Y 1 H LYS 105 ? NZ  ? H LYS 15  NZ  
117 1 Y 1 H GLN 138 ? CG  ? H GLN 48  CG  
118 1 Y 1 H GLN 138 ? CD  ? H GLN 48  CD  
119 1 Y 1 H GLN 138 ? OE1 ? H GLN 48  OE1 
120 1 Y 1 H GLN 138 ? NE2 ? H GLN 48  NE2 
121 1 Y 1 H GLU 140 ? CG  ? H GLU 50  CG  
122 1 Y 1 H GLU 140 ? CD  ? H GLU 50  CD  
123 1 Y 1 H GLU 140 ? OE1 ? H GLU 50  OE1 
124 1 Y 1 H GLU 140 ? OE2 ? H GLU 50  OE2 
125 1 Y 1 H GLN 154 ? CD  ? H GLN 64  CD  
126 1 Y 1 H GLN 154 ? OE1 ? H GLN 64  OE1 
127 1 Y 1 H GLN 154 ? NE2 ? H GLN 64  NE2 
128 1 Y 1 H LYS 176 ? CE  ? H LYS 86  CE  
129 1 Y 1 H LYS 176 ? NZ  ? H LYS 86  NZ  
130 1 Y 1 H ARG 184 ? NE  ? H ARG 94  NE  
131 1 Y 1 H ARG 184 ? CZ  ? H ARG 94  CZ  
132 1 Y 1 H ARG 184 ? NH1 ? H ARG 94  NH1 
133 1 Y 1 H ARG 184 ? NH2 ? H ARG 94  NH2 
134 1 Y 0 H GLU 197 ? CG  ? H GLU 107 CG  
135 1 Y 1 H ASP 208 ? CG  ? H ASP 118 CG  
136 1 Y 1 H ASP 208 ? OD1 ? H ASP 118 OD1 
137 1 Y 1 H ASP 208 ? OD2 ? H ASP 118 OD2 
138 1 Y 1 H LYS 224 ? CG  ? H LYS 134 CG  
139 1 Y 1 H LYS 224 ? CD  ? H LYS 134 CD  
140 1 Y 1 H LYS 224 ? CE  ? H LYS 134 CE  
141 1 Y 1 H LYS 224 ? NZ  ? H LYS 134 NZ  
142 1 Y 0 H ASP 245 ? CG  ? H ASP 155 CG  
143 1 Y 1 H SER 253 ? OG  ? H SER 163 OG  
144 1 Y 1 H SER 254 ? OG  ? H SER 164 OG  
145 1 Y 1 H LYS 256 ? CG  ? H LYS 166 CG  
146 1 Y 1 H LYS 256 ? CD  ? H LYS 166 CD  
147 1 Y 1 H LYS 256 ? CE  ? H LYS 166 CE  
148 1 Y 1 H LYS 256 ? NZ  ? H LYS 166 NZ  
149 1 Y 1 H VAL 257 ? CG1 ? H VAL 167 CG1 
150 1 Y 1 H VAL 257 ? CG2 ? H VAL 167 CG2 
151 1 Y 1 H ASP 258 ? OD1 ? H ASP 168 OD1 
152 1 Y 1 H ASP 258 ? OD2 ? H ASP 168 OD2 
153 1 Y 1 H MET 259 ? CG  ? H MET 169 CG  
154 1 Y 1 H MET 259 ? SD  ? H MET 169 SD  
155 1 Y 1 H MET 259 ? CE  ? H MET 169 CE  
156 1 Y 1 H HIS 287 ? CG  ? H HIS 197 CG  
157 1 Y 1 H HIS 287 ? ND1 ? H HIS 197 ND1 
158 1 Y 1 H HIS 287 ? CD2 ? H HIS 197 CD2 
159 1 Y 1 H HIS 287 ? CE1 ? H HIS 197 CE1 
160 1 Y 1 H HIS 287 ? NE2 ? H HIS 197 NE2 
161 1 Y 1 H ARG 289 ? CG  ? H ARG 199 CG  
162 1 Y 1 H ARG 289 ? CD  ? H ARG 199 CD  
163 1 Y 1 H ARG 289 ? NE  ? H ARG 199 NE  
164 1 Y 1 H ARG 289 ? CZ  ? H ARG 199 CZ  
165 1 Y 1 H ARG 289 ? NH1 ? H ARG 199 NH1 
166 1 Y 1 H ARG 289 ? NH2 ? H ARG 199 NH2 
167 1 Y 1 H ARG 293 ? CD  ? H ARG 203 CD  
168 1 Y 1 H ARG 293 ? NE  ? H ARG 203 NE  
169 1 Y 1 H ARG 293 ? CZ  ? H ARG 203 CZ  
170 1 Y 1 H ARG 293 ? NH1 ? H ARG 203 NH1 
171 1 Y 1 H ARG 293 ? NH2 ? H ARG 203 NH2 
172 1 Y 1 H GLN 319 ? CG  ? H GLN 229 CG  
173 1 Y 1 H GLN 319 ? CD  ? H GLN 229 CD  
174 1 Y 1 H GLN 319 ? OE1 ? H GLN 229 OE1 
175 1 Y 1 H GLN 319 ? NE2 ? H GLN 229 NE2 
176 1 Y 1 H TYR 322 ? CG  ? H TYR 232 CG  
177 1 Y 1 H TYR 322 ? CD1 ? H TYR 232 CD1 
178 1 Y 1 H TYR 322 ? CD2 ? H TYR 232 CD2 
179 1 Y 1 H TYR 322 ? CE1 ? H TYR 232 CE1 
180 1 Y 1 H TYR 322 ? CE2 ? H TYR 232 CE2 
181 1 Y 1 H TYR 322 ? CZ  ? H TYR 232 CZ  
182 1 Y 1 H TYR 322 ? OH  ? H TYR 232 OH  
183 1 Y 1 H SER 323 ? OG  ? H SER 233 OG  
184 1 Y 1 H ILE 326 ? CG2 ? H ILE 236 CG2 
185 1 Y 1 H ARG 330 ? CG  ? H ARG 240 CG  
186 1 Y 1 H ARG 330 ? CD  ? H ARG 240 CD  
187 1 Y 1 H ARG 330 ? NE  ? H ARG 240 NE  
188 1 Y 1 H ARG 330 ? CZ  ? H ARG 240 CZ  
189 1 Y 1 H ARG 330 ? NH1 ? H ARG 240 NH1 
190 1 Y 1 H ARG 330 ? NH2 ? H ARG 240 NH2 
191 1 Y 1 H LYS 334 ? CG  ? H LYS 244 CG  
192 1 Y 1 H LYS 334 ? CD  ? H LYS 244 CD  
193 1 Y 1 H LYS 334 ? CE  ? H LYS 244 CE  
194 1 Y 1 H LYS 334 ? NZ  ? H LYS 244 NZ  
195 1 Y 1 H GLU 336 ? CG  ? H GLU 246 CG  
196 1 Y 1 H GLU 336 ? CD  ? H GLU 246 CD  
197 1 Y 1 H GLU 336 ? OE1 ? H GLU 246 OE1 
198 1 Y 1 H GLU 336 ? OE2 ? H GLU 246 OE2 
199 1 Y 1 H LYS 340 ? CG  ? H LYS 250 CG  
200 1 Y 1 H LYS 340 ? CD  ? H LYS 250 CD  
201 1 Y 1 H LYS 340 ? CE  ? H LYS 250 CE  
202 1 Y 1 H LYS 340 ? NZ  ? H LYS 250 NZ  
203 1 Y 1 H LYS 351 ? CG  ? H LYS 261 CG  
204 1 Y 1 H LYS 351 ? CD  ? H LYS 261 CD  
205 1 Y 1 H LYS 351 ? CE  ? H LYS 261 CE  
206 1 Y 1 H LYS 351 ? NZ  ? H LYS 261 NZ  
207 1 Y 1 H GLN 356 ? CG  ? H GLN 266 CG  
208 1 Y 1 H GLN 356 ? CD  ? H GLN 266 CD  
209 1 Y 1 H GLN 356 ? OE1 ? H GLN 266 OE1 
210 1 Y 1 H GLN 356 ? NE2 ? H GLN 266 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 C ASP 702 ? C ASP 1   
2   1 Y 1 C THR 703 ? C THR 2   
3   1 Y 1 D ASP 702 ? D ASP 1   
4   1 Y 1 D THR 703 ? D THR 2   
5   1 Y 1 D VAL 708 ? D VAL 7   
6   1 Y 1 D ASP 709 ? D ASP 8   
7   1 Y 1 E GLU 91  ? E GLU 1   
8   1 Y 1 E ARG 357 ? E ARG 267 
9   1 Y 1 E SER 358 ? E SER 268 
10  1 Y 1 E THR 359 ? E THR 269 
11  1 Y 1 E GLU 360 ? E GLU 270 
12  1 Y 1 E THR 361 ? E THR 271 
13  1 Y 1 E ALA 362 ? E ALA 272 
14  1 Y 1 E LEU 363 ? E LEU 273 
15  1 Y 1 E TYR 364 ? E TYR 274 
16  1 Y 1 E ARG 365 ? E ARG 275 
17  1 Y 1 E LYS 366 ? E LYS 276 
18  1 Y 1 E MET 367 ? E MET 277 
19  1 Y 1 E LEU 368 ? E LEU 278 
20  1 Y 1 E GLY 369 ? E GLY 279 
21  1 Y 1 E ASN 370 ? E ASN 280 
22  1 Y 1 E PRO 371 ? E PRO 281 
23  1 Y 1 E SER 372 ? E SER 282 
24  1 Y 1 E ARG 373 ? E ARG 283 
25  1 Y 1 E LEU 374 ? E LEU 284 
26  1 Y 1 E PRO 375 ? E PRO 285 
27  1 Y 1 E ALA 376 ? E ALA 286 
28  1 Y 1 E LYS 377 ? E LYS 287 
29  1 Y 1 E CYS 378 ? E CYS 288 
30  1 Y 1 E PRO 379 ? E PRO 289 
31  1 Y 1 E GLY 380 ? E GLY 290 
32  1 Y 1 F GLN 356 ? F GLN 266 
33  1 Y 1 F ARG 357 ? F ARG 267 
34  1 Y 1 F SER 358 ? F SER 268 
35  1 Y 1 F THR 359 ? F THR 269 
36  1 Y 1 F GLU 360 ? F GLU 270 
37  1 Y 1 F THR 361 ? F THR 271 
38  1 Y 1 F ALA 362 ? F ALA 272 
39  1 Y 1 F LEU 363 ? F LEU 273 
40  1 Y 1 F TYR 364 ? F TYR 274 
41  1 Y 1 F ARG 365 ? F ARG 275 
42  1 Y 1 F LYS 366 ? F LYS 276 
43  1 Y 1 F MET 367 ? F MET 277 
44  1 Y 1 F LEU 368 ? F LEU 278 
45  1 Y 1 F GLY 369 ? F GLY 279 
46  1 Y 1 F ASN 370 ? F ASN 280 
47  1 Y 1 F PRO 371 ? F PRO 281 
48  1 Y 1 F SER 372 ? F SER 282 
49  1 Y 1 F ARG 373 ? F ARG 283 
50  1 Y 1 F LEU 374 ? F LEU 284 
51  1 Y 1 F PRO 375 ? F PRO 285 
52  1 Y 1 F ALA 376 ? F ALA 286 
53  1 Y 1 F LYS 377 ? F LYS 287 
54  1 Y 1 F CYS 378 ? F CYS 288 
55  1 Y 1 F PRO 379 ? F PRO 289 
56  1 Y 1 F GLY 380 ? F GLY 290 
57  1 Y 1 G ARG 357 ? G ARG 267 
58  1 Y 1 G SER 358 ? G SER 268 
59  1 Y 1 G THR 359 ? G THR 269 
60  1 Y 1 G GLU 360 ? G GLU 270 
61  1 Y 1 G THR 361 ? G THR 271 
62  1 Y 1 G ALA 362 ? G ALA 272 
63  1 Y 1 G LEU 363 ? G LEU 273 
64  1 Y 1 G TYR 364 ? G TYR 274 
65  1 Y 1 G ARG 365 ? G ARG 275 
66  1 Y 1 G LYS 366 ? G LYS 276 
67  1 Y 1 G MET 367 ? G MET 277 
68  1 Y 1 G LEU 368 ? G LEU 278 
69  1 Y 1 G GLY 369 ? G GLY 279 
70  1 Y 1 G ASN 370 ? G ASN 280 
71  1 Y 1 G PRO 371 ? G PRO 281 
72  1 Y 1 G SER 372 ? G SER 282 
73  1 Y 1 G ARG 373 ? G ARG 283 
74  1 Y 1 G LEU 374 ? G LEU 284 
75  1 Y 1 G PRO 375 ? G PRO 285 
76  1 Y 1 G ALA 376 ? G ALA 286 
77  1 Y 1 G LYS 377 ? G LYS 287 
78  1 Y 1 G CYS 378 ? G CYS 288 
79  1 Y 1 G PRO 379 ? G PRO 289 
80  1 Y 1 G GLY 380 ? G GLY 290 
81  1 Y 1 H ARG 357 ? H ARG 267 
82  1 Y 1 H SER 358 ? H SER 268 
83  1 Y 1 H THR 359 ? H THR 269 
84  1 Y 1 H GLU 360 ? H GLU 270 
85  1 Y 1 H THR 361 ? H THR 271 
86  1 Y 1 H ALA 362 ? H ALA 272 
87  1 Y 1 H LEU 363 ? H LEU 273 
88  1 Y 1 H TYR 364 ? H TYR 274 
89  1 Y 1 H ARG 365 ? H ARG 275 
90  1 Y 1 H LYS 366 ? H LYS 276 
91  1 Y 1 H MET 367 ? H MET 277 
92  1 Y 1 H LEU 368 ? H LEU 278 
93  1 Y 1 H GLY 369 ? H GLY 279 
94  1 Y 1 H ASN 370 ? H ASN 280 
95  1 Y 1 H PRO 371 ? H PRO 281 
96  1 Y 1 H SER 372 ? H SER 282 
97  1 Y 1 H ARG 373 ? H ARG 283 
98  1 Y 1 H LEU 374 ? H LEU 284 
99  1 Y 1 H PRO 375 ? H PRO 285 
100 1 Y 1 H ALA 376 ? H ALA 286 
101 1 Y 1 H LYS 377 ? H LYS 287 
102 1 Y 1 H CYS 378 ? H CYS 288 
103 1 Y 1 H PRO 379 ? H PRO 289 
104 1 Y 1 H GLY 380 ? H GLY 290 
# 
_pdbx_audit_support.funding_organization   ? 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#