data_5MWF
# 
_entry.id   5MWF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MWF         
WWPDB D_1200003120 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MWF 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Suckling, R.J.' 1 0000-0002-6962-6533 
'Handford, P.A.' 2 ?                   
'Lea, S.M.'      3 0000-0001-9287-8053 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_id_ASTM           EMJODG 
_citation.journal_id_CSD            0897 
_citation.journal_id_ISSN           1460-2075 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            36 
_citation.language                  ? 
_citation.page_first                2204 
_citation.page_last                 2215 
_citation.title                     
'Structural and functional dissection of the interplay between lipid and Notch binding by human Notch ligands.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/embj.201796632 
_citation.pdbx_database_id_PubMed   28572448 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Suckling, R.J.' 1 ? 
primary 'Korona, B.'     2 ? 
primary 'Whiteman, P.'   3 ? 
primary 'Chillakuri, C.' 4 ? 
primary 'Holt, L.'       5 ? 
primary 'Handford, P.A.' 6 ? 
primary 'Lea, S.M.'      7 ? 
# 
_cell.angle_alpha                  71.68 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   83.16 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  82.68 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MWF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     62.628 
_cell.length_a_esd                 ? 
_cell.length_b                     92.929 
_cell.length_b_esd                 ? 
_cell.length_c                     97.004 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MWF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein jagged-2' 32553.395 6   ? ? ? ? 
2 branched    man 
;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
732.682   3   ? ? ? ? 
3 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   3 
? ? ? ? 
4 non-polymer syn 'CALCIUM ION' 40.078    17  ? ? ? ? 
5 non-polymer syn 'CHLORIDE ION' 35.453    2   ? ? ? ? 
6 water       nat water 18.015    232 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hJ2, Jagged-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLP
PAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGH
VAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSY
GWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCDKDLNGSHHHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLP
PAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGH
VAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSY
GWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCDKDLNGSHHHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   TYR n 
1 4   PHE n 
1 5   GLU n 
1 6   LEU n 
1 7   GLN n 
1 8   LEU n 
1 9   SER n 
1 10  ALA n 
1 11  LEU n 
1 12  ARG n 
1 13  ASN n 
1 14  VAL n 
1 15  ASN n 
1 16  GLY n 
1 17  GLU n 
1 18  LEU n 
1 19  LEU n 
1 20  SER n 
1 21  GLY n 
1 22  ALA n 
1 23  CYS n 
1 24  CYS n 
1 25  ASP n 
1 26  GLY n 
1 27  ASP n 
1 28  GLY n 
1 29  ARG n 
1 30  THR n 
1 31  THR n 
1 32  ARG n 
1 33  ALA n 
1 34  GLY n 
1 35  GLY n 
1 36  CYS n 
1 37  GLY n 
1 38  HIS n 
1 39  ASP n 
1 40  GLU n 
1 41  CYS n 
1 42  ASP n 
1 43  THR n 
1 44  TYR n 
1 45  VAL n 
1 46  ARG n 
1 47  VAL n 
1 48  CYS n 
1 49  LEU n 
1 50  LYS n 
1 51  GLU n 
1 52  TYR n 
1 53  GLN n 
1 54  ALA n 
1 55  LYS n 
1 56  VAL n 
1 57  THR n 
1 58  PRO n 
1 59  THR n 
1 60  GLY n 
1 61  PRO n 
1 62  CYS n 
1 63  SER n 
1 64  TYR n 
1 65  GLY n 
1 66  HIS n 
1 67  GLY n 
1 68  ALA n 
1 69  THR n 
1 70  PRO n 
1 71  VAL n 
1 72  LEU n 
1 73  GLY n 
1 74  GLY n 
1 75  ASN n 
1 76  SER n 
1 77  PHE n 
1 78  TYR n 
1 79  LEU n 
1 80  PRO n 
1 81  PRO n 
1 82  ALA n 
1 83  GLY n 
1 84  ALA n 
1 85  ALA n 
1 86  GLY n 
1 87  ASP n 
1 88  ARG n 
1 89  ALA n 
1 90  ARG n 
1 91  ALA n 
1 92  ARG n 
1 93  ALA n 
1 94  ARG n 
1 95  ALA n 
1 96  GLY n 
1 97  GLY n 
1 98  ASP n 
1 99  GLN n 
1 100 ASP n 
1 101 PRO n 
1 102 GLY n 
1 103 LEU n 
1 104 VAL n 
1 105 VAL n 
1 106 ILE n 
1 107 PRO n 
1 108 PHE n 
1 109 GLN n 
1 110 PHE n 
1 111 ALA n 
1 112 TRP n 
1 113 PRO n 
1 114 ARG n 
1 115 SER n 
1 116 PHE n 
1 117 THR n 
1 118 LEU n 
1 119 ILE n 
1 120 VAL n 
1 121 GLU n 
1 122 ALA n 
1 123 TRP n 
1 124 ASP n 
1 125 TRP n 
1 126 ASP n 
1 127 ASN n 
1 128 ASP n 
1 129 THR n 
1 130 THR n 
1 131 PRO n 
1 132 ASN n 
1 133 GLU n 
1 134 GLU n 
1 135 LEU n 
1 136 LEU n 
1 137 ILE n 
1 138 GLU n 
1 139 ARG n 
1 140 VAL n 
1 141 SER n 
1 142 HIS n 
1 143 ALA n 
1 144 GLY n 
1 145 MET n 
1 146 ILE n 
1 147 ASN n 
1 148 PRO n 
1 149 GLU n 
1 150 ASP n 
1 151 ARG n 
1 152 TRP n 
1 153 LYS n 
1 154 SER n 
1 155 LEU n 
1 156 HIS n 
1 157 PHE n 
1 158 SER n 
1 159 GLY n 
1 160 HIS n 
1 161 VAL n 
1 162 ALA n 
1 163 HIS n 
1 164 LEU n 
1 165 GLU n 
1 166 LEU n 
1 167 GLN n 
1 168 ILE n 
1 169 ARG n 
1 170 VAL n 
1 171 ARG n 
1 172 CYS n 
1 173 ASP n 
1 174 GLU n 
1 175 ASN n 
1 176 TYR n 
1 177 TYR n 
1 178 SER n 
1 179 ALA n 
1 180 THR n 
1 181 CYS n 
1 182 ASN n 
1 183 LYS n 
1 184 PHE n 
1 185 CYS n 
1 186 ARG n 
1 187 PRO n 
1 188 ARG n 
1 189 ASN n 
1 190 ASP n 
1 191 PHE n 
1 192 PHE n 
1 193 GLY n 
1 194 HIS n 
1 195 TYR n 
1 196 THR n 
1 197 CYS n 
1 198 ASP n 
1 199 GLN n 
1 200 TYR n 
1 201 GLY n 
1 202 ASN n 
1 203 LYS n 
1 204 ALA n 
1 205 CYS n 
1 206 MET n 
1 207 ASP n 
1 208 GLY n 
1 209 TRP n 
1 210 MET n 
1 211 GLY n 
1 212 LYS n 
1 213 GLU n 
1 214 CYS n 
1 215 LYS n 
1 216 GLU n 
1 217 ALA n 
1 218 VAL n 
1 219 CYS n 
1 220 LYS n 
1 221 GLN n 
1 222 GLY n 
1 223 CYS n 
1 224 ASN n 
1 225 LEU n 
1 226 LEU n 
1 227 HIS n 
1 228 GLY n 
1 229 GLY n 
1 230 CYS n 
1 231 THR n 
1 232 VAL n 
1 233 PRO n 
1 234 GLY n 
1 235 GLU n 
1 236 CYS n 
1 237 ARG n 
1 238 CYS n 
1 239 SER n 
1 240 TYR n 
1 241 GLY n 
1 242 TRP n 
1 243 GLN n 
1 244 GLY n 
1 245 ARG n 
1 246 PHE n 
1 247 CYS n 
1 248 ASP n 
1 249 GLU n 
1 250 CYS n 
1 251 VAL n 
1 252 PRO n 
1 253 TYR n 
1 254 PRO n 
1 255 GLY n 
1 256 CYS n 
1 257 VAL n 
1 258 HIS n 
1 259 GLY n 
1 260 SER n 
1 261 CYS n 
1 262 VAL n 
1 263 GLU n 
1 264 PRO n 
1 265 TRP n 
1 266 GLN n 
1 267 CYS n 
1 268 ASN n 
1 269 CYS n 
1 270 GLU n 
1 271 THR n 
1 272 ASN n 
1 273 TRP n 
1 274 GLY n 
1 275 GLY n 
1 276 LEU n 
1 277 LEU n 
1 278 CYS n 
1 279 ASP n 
1 280 LYS n 
1 281 ASP n 
1 282 LEU n 
1 283 ASN n 
1 284 GLY n 
1 285 SER n 
1 286 HIS n 
1 287 HIS n 
1 288 HIS n 
1 289 HIS n 
1 290 HIS n 
1 291 HIS n 
1 292 HIS n 
1 293 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   293 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 JAG2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Fruit fly' 
_entity_src_gen.pdbx_host_org_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'Schneider 2' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pEXS2-2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    JAG2_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y219 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLP
PAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGH
VAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSY
GWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCDKDLN
;
_struct_ref.pdbx_align_begin           27 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5MWF A 1 ? 283 ? Q9Y219 27 ? 309 ? 27 309 
2 1 5MWF B 1 ? 283 ? Q9Y219 27 ? 309 ? 27 309 
3 1 5MWF C 1 ? 283 ? Q9Y219 27 ? 309 ? 27 309 
4 1 5MWF D 1 ? 283 ? Q9Y219 27 ? 309 ? 27 309 
5 1 5MWF E 1 ? 283 ? Q9Y219 27 ? 309 ? 27 309 
6 1 5MWF F 1 ? 283 ? Q9Y219 27 ? 309 ? 27 309 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5MWF GLY A 284 ? UNP Q9Y219 ? ? 'expression tag' 310 1  
1 5MWF SER A 285 ? UNP Q9Y219 ? ? 'expression tag' 311 2  
1 5MWF HIS A 286 ? UNP Q9Y219 ? ? 'expression tag' 312 3  
1 5MWF HIS A 287 ? UNP Q9Y219 ? ? 'expression tag' 313 4  
1 5MWF HIS A 288 ? UNP Q9Y219 ? ? 'expression tag' 314 5  
1 5MWF HIS A 289 ? UNP Q9Y219 ? ? 'expression tag' 315 6  
1 5MWF HIS A 290 ? UNP Q9Y219 ? ? 'expression tag' 316 7  
1 5MWF HIS A 291 ? UNP Q9Y219 ? ? 'expression tag' 317 8  
1 5MWF HIS A 292 ? UNP Q9Y219 ? ? 'expression tag' 318 9  
1 5MWF HIS A 293 ? UNP Q9Y219 ? ? 'expression tag' 319 10 
2 5MWF GLY B 284 ? UNP Q9Y219 ? ? 'expression tag' 310 11 
2 5MWF SER B 285 ? UNP Q9Y219 ? ? 'expression tag' 311 12 
2 5MWF HIS B 286 ? UNP Q9Y219 ? ? 'expression tag' 312 13 
2 5MWF HIS B 287 ? UNP Q9Y219 ? ? 'expression tag' 313 14 
2 5MWF HIS B 288 ? UNP Q9Y219 ? ? 'expression tag' 314 15 
2 5MWF HIS B 289 ? UNP Q9Y219 ? ? 'expression tag' 315 16 
2 5MWF HIS B 290 ? UNP Q9Y219 ? ? 'expression tag' 316 17 
2 5MWF HIS B 291 ? UNP Q9Y219 ? ? 'expression tag' 317 18 
2 5MWF HIS B 292 ? UNP Q9Y219 ? ? 'expression tag' 318 19 
2 5MWF HIS B 293 ? UNP Q9Y219 ? ? 'expression tag' 319 20 
3 5MWF GLY C 284 ? UNP Q9Y219 ? ? 'expression tag' 310 21 
3 5MWF SER C 285 ? UNP Q9Y219 ? ? 'expression tag' 311 22 
3 5MWF HIS C 286 ? UNP Q9Y219 ? ? 'expression tag' 312 23 
3 5MWF HIS C 287 ? UNP Q9Y219 ? ? 'expression tag' 313 24 
3 5MWF HIS C 288 ? UNP Q9Y219 ? ? 'expression tag' 314 25 
3 5MWF HIS C 289 ? UNP Q9Y219 ? ? 'expression tag' 315 26 
3 5MWF HIS C 290 ? UNP Q9Y219 ? ? 'expression tag' 316 27 
3 5MWF HIS C 291 ? UNP Q9Y219 ? ? 'expression tag' 317 28 
3 5MWF HIS C 292 ? UNP Q9Y219 ? ? 'expression tag' 318 29 
3 5MWF HIS C 293 ? UNP Q9Y219 ? ? 'expression tag' 319 30 
4 5MWF GLY D 284 ? UNP Q9Y219 ? ? 'expression tag' 310 31 
4 5MWF SER D 285 ? UNP Q9Y219 ? ? 'expression tag' 311 32 
4 5MWF HIS D 286 ? UNP Q9Y219 ? ? 'expression tag' 312 33 
4 5MWF HIS D 287 ? UNP Q9Y219 ? ? 'expression tag' 313 34 
4 5MWF HIS D 288 ? UNP Q9Y219 ? ? 'expression tag' 314 35 
4 5MWF HIS D 289 ? UNP Q9Y219 ? ? 'expression tag' 315 36 
4 5MWF HIS D 290 ? UNP Q9Y219 ? ? 'expression tag' 316 37 
4 5MWF HIS D 291 ? UNP Q9Y219 ? ? 'expression tag' 317 38 
4 5MWF HIS D 292 ? UNP Q9Y219 ? ? 'expression tag' 318 39 
4 5MWF HIS D 293 ? UNP Q9Y219 ? ? 'expression tag' 319 40 
5 5MWF GLY E 284 ? UNP Q9Y219 ? ? 'expression tag' 310 41 
5 5MWF SER E 285 ? UNP Q9Y219 ? ? 'expression tag' 311 42 
5 5MWF HIS E 286 ? UNP Q9Y219 ? ? 'expression tag' 312 43 
5 5MWF HIS E 287 ? UNP Q9Y219 ? ? 'expression tag' 313 44 
5 5MWF HIS E 288 ? UNP Q9Y219 ? ? 'expression tag' 314 45 
5 5MWF HIS E 289 ? UNP Q9Y219 ? ? 'expression tag' 315 46 
5 5MWF HIS E 290 ? UNP Q9Y219 ? ? 'expression tag' 316 47 
5 5MWF HIS E 291 ? UNP Q9Y219 ? ? 'expression tag' 317 48 
5 5MWF HIS E 292 ? UNP Q9Y219 ? ? 'expression tag' 318 49 
5 5MWF HIS E 293 ? UNP Q9Y219 ? ? 'expression tag' 319 50 
6 5MWF GLY F 284 ? UNP Q9Y219 ? ? 'expression tag' 310 51 
6 5MWF SER F 285 ? UNP Q9Y219 ? ? 'expression tag' 311 52 
6 5MWF HIS F 286 ? UNP Q9Y219 ? ? 'expression tag' 312 53 
6 5MWF HIS F 287 ? UNP Q9Y219 ? ? 'expression tag' 313 54 
6 5MWF HIS F 288 ? UNP Q9Y219 ? ? 'expression tag' 314 55 
6 5MWF HIS F 289 ? UNP Q9Y219 ? ? 'expression tag' 315 56 
6 5MWF HIS F 290 ? UNP Q9Y219 ? ? 'expression tag' 316 57 
6 5MWF HIS F 291 ? UNP Q9Y219 ? ? 'expression tag' 317 58 
6 5MWF HIS F 292 ? UNP Q9Y219 ? ? 'expression tag' 318 59 
6 5MWF HIS F 293 ? UNP Q9Y219 ? ? 'expression tag' 319 60 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CL  non-polymer                   . 'CHLORIDE ION'                           ? 'Cl -1'          35.453  
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MWF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.71 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.65 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 8000, Ammonium sulphate, Sodium cacodylate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-07-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.93 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.93 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5MWF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 38.009 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       49334 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.2 
_reflns.pdbx_Rmerge_I_obs                0.103 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.99 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.89 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.685 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.58 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MWF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             38.009 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     49334 
_refine.ls_number_reflns_R_free                  2392 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.65 
_refine.ls_percent_reflns_R_free                 4.85 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2200 
_refine.ls_R_factor_R_free                       0.2751 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2172 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.97 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5MW5 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.66 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.49 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12370 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         280 
_refine_hist.number_atoms_solvent             232 
_refine_hist.number_atoms_total               12882 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        38.009 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.013  ? 13164 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.755  ? 17765 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.463 ? 7734  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.048  ? 1809  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 2315  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8000 2.8572  . . 147 2765 98.00 . . . 0.4540 . 0.3707 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8572 2.9193  . . 136 2747 97.00 . . . 0.4348 . 0.3428 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9193 2.9872  . . 156 2755 97.00 . . . 0.3966 . 0.3132 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9872 3.0618  . . 159 2693 98.00 . . . 0.3522 . 0.2771 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0618 3.1446  . . 148 2769 97.00 . . . 0.2931 . 0.2691 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1446 3.2371  . . 136 2778 98.00 . . . 0.3472 . 0.2590 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2371 3.3415  . . 140 2797 98.00 . . . 0.3474 . 0.2640 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3415 3.4608  . . 154 2776 98.00 . . . 0.3217 . 0.2519 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4608 3.5993  . . 131 2721 97.00 . . . 0.2738 . 0.2429 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5993 3.7630  . . 145 2742 97.00 . . . 0.3150 . 0.2130 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7630 3.9612  . . 128 2776 98.00 . . . 0.2815 . 0.2029 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9612 4.2091  . . 132 2800 98.00 . . . 0.2438 . 0.1830 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2091 4.5336  . . 127 2762 98.00 . . . 0.2003 . 0.1652 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5336 4.9889  . . 139 2758 98.00 . . . 0.2215 . 0.1616 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9889 5.7087  . . 124 2794 97.00 . . . 0.2125 . 0.1788 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7087 7.1844  . . 148 2759 98.00 . . . 0.2441 . 0.2034 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.1844 38.0124 . . 142 2750 97.00 . . . 0.2127 . 0.1940 . . . . . . . . . . 
# 
_struct.entry_id                     5MWF 
_struct.title                        'Human Jagged2 C2-EGF2' 
_struct.pdbx_descriptor              'Protein jagged-2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MWF 
_struct_keywords.text            'C2, EGF, Notch, signaling protein' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 6 ? 
GA N N 6 ? 
HA N N 6 ? 
IA N N 6 ? 
JA N N 6 ? 
KA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 83  ? ALA A 91  ? GLY A 109 ALA A 117 1 ? 9  
HELX_P HELX_P2 AA2 ASN A 132 ? GLU A 134 ? ASN A 158 GLU A 160 5 ? 3  
HELX_P HELX_P3 AA3 GLY B 83  ? ARG B 92  ? GLY B 109 ARG B 118 1 ? 10 
HELX_P HELX_P4 AA4 ASN B 132 ? GLU B 134 ? ASN B 158 GLU B 160 5 ? 3  
HELX_P HELX_P5 AA5 ASN C 132 ? GLU C 134 ? ASN C 158 GLU C 160 5 ? 3  
HELX_P HELX_P6 AA6 ASN D 132 ? GLU D 134 ? ASN D 158 GLU D 160 5 ? 3  
HELX_P HELX_P7 AA7 ASN D 147 ? ARG D 151 ? ASN D 173 ARG D 177 5 ? 5  
HELX_P HELX_P8 AA8 ASN F 132 ? LEU F 136 ? ASN F 158 LEU F 162 5 ? 5  
HELX_P HELX_P9 AA9 ASN F 147 ? ARG F 151 ? ASN F 173 ARG F 177 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 23  SG  ? ? ? 1_555 A  CYS 36  SG ? ? A CYS 49  A CYS 62  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf2  disulf ?    ? A CYS 24  SG  ? ? ? 1_555 A  CYS 41  SG ? ? A CYS 50  A CYS 67  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf3  disulf ?    ? A CYS 48  SG  ? ? ? 1_555 A  CYS 62  SG ? ? A CYS 74  A CYS 88  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf4  disulf ?    ? A CYS 172 SG  ? ? ? 1_555 A  CYS 181 SG ? ? A CYS 198 A CYS 207 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf5  disulf ?    ? A CYS 185 SG  ? ? ? 1_555 A  CYS 197 SG ? ? A CYS 211 A CYS 223 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf6  disulf ?    ? A CYS 205 SG  ? ? ? 1_555 A  CYS 214 SG ? ? A CYS 231 A CYS 240 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf7  disulf ?    ? A CYS 219 SG  ? ? ? 1_555 A  CYS 230 SG ? ? A CYS 245 A CYS 256 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf8  disulf ?    ? A CYS 223 SG  ? ? ? 1_555 A  CYS 236 SG ? ? A CYS 249 A CYS 262 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf9  disulf ?    ? A CYS 238 SG  ? ? ? 1_555 A  CYS 247 SG ? ? A CYS 264 A CYS 273 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf10 disulf ?    ? A CYS 250 SG  ? ? ? 1_555 A  CYS 261 SG ? ? A CYS 276 A CYS 287 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf11 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A  CYS 267 SG ? ? A CYS 282 A CYS 293 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf12 disulf ?    ? A CYS 269 SG  ? ? ? 1_555 A  CYS 278 SG ? ? A CYS 295 A CYS 304 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf13 disulf ?    ? B CYS 23  SG  ? ? ? 1_555 B  CYS 36  SG ? ? B CYS 49  B CYS 62  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf14 disulf ?    ? B CYS 24  SG  ? ? ? 1_555 B  CYS 41  SG ? ? B CYS 50  B CYS 67  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf15 disulf ?    ? B CYS 48  SG  ? ? ? 1_555 B  CYS 62  SG ? ? B CYS 74  B CYS 88  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf16 disulf ?    ? B CYS 172 SG  ? ? ? 1_555 B  CYS 181 SG ? ? B CYS 198 B CYS 207 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf17 disulf ?    ? B CYS 185 SG  ? ? ? 1_555 B  CYS 197 SG ? ? B CYS 211 B CYS 223 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf18 disulf ?    ? B CYS 205 SG  ? ? ? 1_555 B  CYS 214 SG ? ? B CYS 231 B CYS 240 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf19 disulf ?    ? B CYS 219 SG  ? ? ? 1_555 B  CYS 230 SG ? ? B CYS 245 B CYS 256 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf20 disulf ?    ? B CYS 223 SG  ? ? ? 1_555 B  CYS 236 SG ? ? B CYS 249 B CYS 262 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf21 disulf ?    ? B CYS 238 SG  ? ? ? 1_555 B  CYS 247 SG ? ? B CYS 264 B CYS 273 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf22 disulf ?    ? B CYS 250 SG  ? ? ? 1_555 B  CYS 261 SG ? ? B CYS 276 B CYS 287 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf23 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B  CYS 267 SG ? ? B CYS 282 B CYS 293 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf24 disulf ?    ? B CYS 269 SG  ? ? ? 1_555 B  CYS 278 SG ? ? B CYS 295 B CYS 304 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf25 disulf ?    ? C CYS 23  SG  ? ? ? 1_555 C  CYS 36  SG ? ? C CYS 49  C CYS 62  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf26 disulf ?    ? C CYS 24  SG  ? ? ? 1_555 C  CYS 41  SG ? ? C CYS 50  C CYS 67  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf27 disulf ?    ? C CYS 48  SG  ? ? ? 1_555 C  CYS 62  SG ? ? C CYS 74  C CYS 88  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf28 disulf ?    ? C CYS 172 SG  ? ? ? 1_555 C  CYS 181 SG ? ? C CYS 198 C CYS 207 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf29 disulf ?    ? C CYS 185 SG  ? ? ? 1_555 C  CYS 197 SG ? ? C CYS 211 C CYS 223 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf30 disulf ?    ? C CYS 205 SG  ? ? ? 1_555 C  CYS 214 SG ? ? C CYS 231 C CYS 240 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf31 disulf ?    ? C CYS 219 SG  ? ? ? 1_555 C  CYS 230 SG ? ? C CYS 245 C CYS 256 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf32 disulf ?    ? C CYS 223 SG  ? ? ? 1_555 C  CYS 236 SG ? ? C CYS 249 C CYS 262 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf33 disulf ?    ? C CYS 238 SG  ? ? ? 1_555 C  CYS 247 SG ? ? C CYS 264 C CYS 273 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf34 disulf ?    ? C CYS 250 SG  ? ? ? 1_555 C  CYS 261 SG ? ? C CYS 276 C CYS 287 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf35 disulf ?    ? C CYS 256 SG  ? ? ? 1_555 C  CYS 267 SG ? ? C CYS 282 C CYS 293 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf36 disulf ?    ? C CYS 269 SG  ? ? ? 1_555 C  CYS 278 SG ? ? C CYS 295 C CYS 304 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf37 disulf ?    ? D CYS 23  SG  ? ? ? 1_555 D  CYS 36  SG ? ? D CYS 49  D CYS 62  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf38 disulf ?    ? D CYS 24  SG  ? ? ? 1_555 D  CYS 41  SG ? ? D CYS 50  D CYS 67  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf39 disulf ?    ? D CYS 48  SG  ? ? ? 1_555 D  CYS 62  SG ? ? D CYS 74  D CYS 88  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf40 disulf ?    ? D CYS 172 SG  ? ? ? 1_555 D  CYS 181 SG ? ? D CYS 198 D CYS 207 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf41 disulf ?    ? D CYS 185 SG  ? ? ? 1_555 D  CYS 197 SG ? ? D CYS 211 D CYS 223 1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf42 disulf ?    ? D CYS 205 SG  ? ? ? 1_555 D  CYS 214 SG ? ? D CYS 231 D CYS 240 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf43 disulf ?    ? D CYS 219 SG  ? ? ? 1_555 D  CYS 230 SG ? ? D CYS 245 D CYS 256 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf44 disulf ?    ? D CYS 223 SG  ? ? ? 1_555 D  CYS 236 SG ? ? D CYS 249 D CYS 262 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf45 disulf ?    ? D CYS 238 SG  ? ? ? 1_555 D  CYS 247 SG ? ? D CYS 264 D CYS 273 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf46 disulf ?    ? D CYS 250 SG  ? ? ? 1_555 D  CYS 261 SG ? ? D CYS 276 D CYS 287 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf47 disulf ?    ? D CYS 256 SG  ? ? ? 1_555 D  CYS 267 SG ? ? D CYS 282 D CYS 293 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf48 disulf ?    ? D CYS 269 SG  ? ? ? 1_555 D  CYS 278 SG ? ? D CYS 295 D CYS 304 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf49 disulf ?    ? E CYS 23  SG  ? ? ? 1_555 E  CYS 36  SG ? ? E CYS 49  E CYS 62  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf50 disulf ?    ? E CYS 48  SG  ? ? ? 1_555 E  CYS 62  SG ? ? E CYS 74  E CYS 88  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf51 disulf ?    ? E CYS 172 SG  ? ? ? 1_555 E  CYS 181 SG ? ? E CYS 198 E CYS 207 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf52 disulf ?    ? E CYS 185 SG  ? ? ? 1_555 E  CYS 197 SG ? ? E CYS 211 E CYS 223 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf53 disulf ?    ? E CYS 205 SG  ? ? ? 1_555 E  CYS 214 SG ? ? E CYS 231 E CYS 240 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf54 disulf ?    ? E CYS 219 SG  ? ? ? 1_555 E  CYS 230 SG ? ? E CYS 245 E CYS 256 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf55 disulf ?    ? E CYS 223 SG  ? ? ? 1_555 E  CYS 236 SG ? ? E CYS 249 E CYS 262 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf56 disulf ?    ? E CYS 238 SG  ? ? ? 1_555 E  CYS 247 SG ? ? E CYS 264 E CYS 273 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf57 disulf ?    ? E CYS 250 SG  ? ? ? 1_555 E  CYS 261 SG ? ? E CYS 276 E CYS 287 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf58 disulf ?    ? E CYS 256 SG  ? ? ? 1_555 E  CYS 267 SG ? ? E CYS 282 E CYS 293 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf59 disulf ?    ? E CYS 269 SG  ? ? ? 1_555 E  CYS 278 SG ? ? E CYS 295 E CYS 304 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf60 disulf ?    ? F CYS 23  SG  ? ? ? 1_555 F  CYS 36  SG ? ? F CYS 49  F CYS 62  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf61 disulf ?    ? F CYS 24  SG  ? ? ? 1_555 F  CYS 41  SG ? ? F CYS 50  F CYS 67  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf62 disulf ?    ? F CYS 48  SG  ? ? ? 1_555 F  CYS 62  SG ? ? F CYS 74  F CYS 88  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf63 disulf ?    ? F CYS 172 SG  ? ? ? 1_555 F  CYS 181 SG ? ? F CYS 198 F CYS 207 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf64 disulf ?    ? F CYS 185 SG  ? ? ? 1_555 F  CYS 197 SG ? ? F CYS 211 F CYS 223 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf65 disulf ?    ? F CYS 205 SG  ? ? ? 1_555 F  CYS 214 SG ? ? F CYS 231 F CYS 240 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf66 disulf ?    ? F CYS 219 SG  ? ? ? 1_555 F  CYS 230 SG ? ? F CYS 245 F CYS 256 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf67 disulf ?    ? F CYS 223 SG  ? ? ? 1_555 F  CYS 236 SG ? ? F CYS 249 F CYS 262 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf68 disulf ?    ? F CYS 238 SG  ? ? ? 1_555 F  CYS 247 SG ? ? F CYS 264 F CYS 273 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf69 disulf ?    ? F CYS 250 SG  ? ? ? 1_555 F  CYS 261 SG ? ? F CYS 276 F CYS 287 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf70 disulf ?    ? F CYS 256 SG  ? ? ? 1_555 F  CYS 267 SG ? ? F CYS 282 F CYS 293 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf71 disulf ?    ? F CYS 269 SG  ? ? ? 1_555 F  CYS 278 SG ? ? F CYS 295 F CYS 304 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1  covale one  ? A ASN 127 ND2 ? ? ? 1_555 G  NAG .   C1 ? ? A ASN 153 G NAG 1   1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale2  covale one  ? B ASN 127 ND2 ? ? ? 1_555 H  NAG .   C1 ? ? B ASN 153 H NAG 1   1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale3  covale one  ? C ASN 127 ND2 ? ? ? 1_555 I  NAG .   C1 ? ? C ASN 153 I NAG 1   1_555 ? ? ? ? ? ? ? 1.504 ? N-Glycosylation 
covale4  covale one  ? E ASN 127 ND2 ? ? ? 1_555 K  NAG .   C1 ? ? E ASN 153 K NAG 1   1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale5  covale one  ? F ASN 127 ND2 ? ? ? 1_555 L  NAG .   C1 ? ? F ASN 153 L NAG 1   1_555 ? ? ? ? ? ? ? 1.501 ? N-Glycosylation 
covale6  covale both ? G NAG .   O4  ? ? ? 1_555 G  NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.434 ? ?               
covale7  covale one  ? G NAG .   O6  ? ? ? 1_555 G  FUC .   C1 ? ? G NAG 1   G FUC 4   1_555 ? ? ? ? ? ? ? 1.413 ? ?               
covale8  covale both ? G NAG .   O4  ? ? ? 1_555 G  BMA .   C1 ? ? G NAG 2   G BMA 3   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale9  covale both ? H NAG .   O4  ? ? ? 1_555 H  NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.431 ? ?               
covale10 covale one  ? H NAG .   O6  ? ? ? 1_555 H  FUC .   C1 ? ? H NAG 1   H FUC 4   1_555 ? ? ? ? ? ? ? 1.421 ? ?               
covale11 covale both ? H NAG .   O4  ? ? ? 1_555 H  BMA .   C1 ? ? H NAG 2   H BMA 3   1_555 ? ? ? ? ? ? ? 1.442 ? ?               
covale12 covale both ? I NAG .   O4  ? ? ? 1_555 I  NAG .   C1 ? ? I NAG 1   I NAG 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale13 covale one  ? I NAG .   O6  ? ? ? 1_555 I  FUC .   C1 ? ? I NAG 1   I FUC 4   1_555 ? ? ? ? ? ? ? 1.463 ? ?               
covale14 covale both ? I NAG .   O4  ? ? ? 1_555 I  BMA .   C1 ? ? I NAG 2   I BMA 3   1_555 ? ? ? ? ? ? ? 1.491 ? ?               
covale15 covale both ? J NAG .   O4  ? ? ? 1_555 J  NAG .   C1 ? ? J NAG 1   J NAG 2   1_555 ? ? ? ? ? ? ? 1.475 ? ?               
covale16 covale one  ? J NAG .   O6  ? ? ? 1_555 J  FUC .   C1 ? ? J NAG 1   J FUC 3   1_555 ? ? ? ? ? ? ? 1.448 ? ?               
covale17 covale both ? K NAG .   O4  ? ? ? 1_555 K  NAG .   C1 ? ? K NAG 1   K NAG 2   1_555 ? ? ? ? ? ? ? 1.426 ? ?               
covale18 covale one  ? K NAG .   O6  ? ? ? 1_555 K  FUC .   C1 ? ? K NAG 1   K FUC 3   1_555 ? ? ? ? ? ? ? 1.480 ? ?               
covale19 covale both ? L NAG .   O4  ? ? ? 1_555 L  NAG .   C1 ? ? L NAG 1   L NAG 2   1_555 ? ? ? ? ? ? ? 1.442 ? ?               
covale20 covale one  ? L NAG .   O6  ? ? ? 1_555 L  FUC .   C1 ? ? L NAG 1   L FUC 3   1_555 ? ? ? ? ? ? ? 1.460 ? ?               
metalc1  metalc ?    ? A CYS 24  O   ? ? ? 1_555 O  CA  .   CA ? ? A CYS 50  A CA  407 1_555 ? ? ? ? ? ? ? 2.740 ? ?               
metalc2  metalc ?    ? A ASP 25  OD2 ? ? ? 1_555 M  CA  .   CA ? ? A ASP 51  A CA  405 1_555 ? ? ? ? ? ? ? 2.339 ? ?               
metalc3  metalc ?    ? A ASP 25  OD1 ? ? ? 1_555 N  CA  .   CA ? ? A ASP 51  A CA  406 1_555 ? ? ? ? ? ? ? 2.472 ? ?               
metalc4  metalc ?    ? A ASP 25  OD2 ? ? ? 1_555 N  CA  .   CA ? ? A ASP 51  A CA  406 1_555 ? ? ? ? ? ? ? 2.462 ? ?               
metalc5  metalc ?    ? A ASP 25  OD1 ? ? ? 1_555 O  CA  .   CA ? ? A ASP 51  A CA  407 1_555 ? ? ? ? ? ? ? 2.363 ? ?               
metalc6  metalc ?    ? A ASP 39  OD1 ? ? ? 1_555 M  CA  .   CA ? ? A ASP 65  A CA  405 1_555 ? ? ? ? ? ? ? 2.318 ? ?               
metalc7  metalc ?    ? A GLU 40  O   ? ? ? 1_555 M  CA  .   CA ? ? A GLU 66  A CA  405 1_555 ? ? ? ? ? ? ? 2.375 ? ?               
metalc8  metalc ?    ? A ASP 42  OD1 ? ? ? 1_555 M  CA  .   CA ? ? A ASP 68  A CA  405 1_555 ? ? ? ? ? ? ? 2.407 ? ?               
metalc9  metalc ?    ? A ASP 42  OD2 ? ? ? 1_555 M  CA  .   CA ? ? A ASP 68  A CA  405 1_555 ? ? ? ? ? ? ? 2.560 ? ?               
metalc10 metalc ?    ? A ASP 42  OD2 ? ? ? 1_555 N  CA  .   CA ? ? A ASP 68  A CA  406 1_555 ? ? ? ? ? ? ? 2.511 ? ?               
metalc11 metalc ?    ? A ASP 124 OD1 ? ? ? 1_555 N  CA  .   CA ? ? A ASP 150 A CA  406 1_555 ? ? ? ? ? ? ? 2.508 ? ?               
metalc12 metalc ?    ? A ASP 124 OD2 ? ? ? 1_555 N  CA  .   CA ? ? A ASP 150 A CA  406 1_555 ? ? ? ? ? ? ? 3.003 ? ?               
metalc13 metalc ?    ? A ASP 124 OD2 ? ? ? 1_555 O  CA  .   CA ? ? A ASP 150 A CA  407 1_555 ? ? ? ? ? ? ? 2.500 ? ?               
metalc14 metalc ?    ? A TRP 125 O   ? ? ? 1_555 N  CA  .   CA ? ? A TRP 151 A CA  406 1_555 ? ? ? ? ? ? ? 2.414 ? ?               
metalc15 metalc ?    ? A ASP 126 OD1 ? ? ? 1_555 N  CA  .   CA ? ? A ASP 152 A CA  406 1_555 ? ? ? ? ? ? ? 2.184 ? ?               
metalc16 metalc ?    ? A ASP 126 OD1 ? ? ? 1_555 O  CA  .   CA ? ? A ASP 152 A CA  407 1_555 ? ? ? ? ? ? ? 2.490 ? ?               
metalc17 metalc ?    ? A ASP 126 OD2 ? ? ? 1_555 O  CA  .   CA ? ? A ASP 152 A CA  407 1_555 ? ? ? ? ? ? ? 2.385 ? ?               
metalc18 metalc ?    ? B CYS 24  O   ? ? ? 1_555 S  CA  .   CA ? ? B CYS 50  B CA  407 1_555 ? ? ? ? ? ? ? 2.788 ? ?               
metalc19 metalc ?    ? B ASP 25  OD2 ? ? ? 1_555 Q  CA  .   CA ? ? B ASP 51  B CA  405 1_555 ? ? ? ? ? ? ? 2.518 ? ?               
metalc20 metalc ?    ? B ASP 25  OD1 ? ? ? 1_555 R  CA  .   CA ? ? B ASP 51  B CA  406 1_555 ? ? ? ? ? ? ? 2.763 ? ?               
metalc21 metalc ?    ? B ASP 25  OD2 ? ? ? 1_555 R  CA  .   CA ? ? B ASP 51  B CA  406 1_555 ? ? ? ? ? ? ? 2.455 ? ?               
metalc22 metalc ?    ? B ASP 25  OD1 ? ? ? 1_555 S  CA  .   CA ? ? B ASP 51  B CA  407 1_555 ? ? ? ? ? ? ? 2.399 ? ?               
metalc23 metalc ?    ? B ASP 39  OD1 ? ? ? 1_555 Q  CA  .   CA ? ? B ASP 65  B CA  405 1_555 ? ? ? ? ? ? ? 2.348 ? ?               
metalc24 metalc ?    ? B GLU 40  O   ? ? ? 1_555 Q  CA  .   CA ? ? B GLU 66  B CA  405 1_555 ? ? ? ? ? ? ? 2.504 ? ?               
metalc25 metalc ?    ? B ASP 42  OD1 ? ? ? 1_555 Q  CA  .   CA ? ? B ASP 68  B CA  405 1_555 ? ? ? ? ? ? ? 2.490 ? ?               
metalc26 metalc ?    ? B ASP 42  OD2 ? ? ? 1_555 Q  CA  .   CA ? ? B ASP 68  B CA  405 1_555 ? ? ? ? ? ? ? 2.492 ? ?               
metalc27 metalc ?    ? B ASP 42  OD2 ? ? ? 1_555 R  CA  .   CA ? ? B ASP 68  B CA  406 1_555 ? ? ? ? ? ? ? 3.114 ? ?               
metalc28 metalc ?    ? B ASP 124 OD1 ? ? ? 1_555 R  CA  .   CA ? ? B ASP 150 B CA  406 1_555 ? ? ? ? ? ? ? 2.479 ? ?               
metalc29 metalc ?    ? B ASP 124 OD2 ? ? ? 1_555 R  CA  .   CA ? ? B ASP 150 B CA  406 1_555 ? ? ? ? ? ? ? 2.871 ? ?               
metalc30 metalc ?    ? B ASP 124 OD2 ? ? ? 1_555 S  CA  .   CA ? ? B ASP 150 B CA  407 1_555 ? ? ? ? ? ? ? 3.048 ? ?               
metalc31 metalc ?    ? B TRP 125 O   ? ? ? 1_555 R  CA  .   CA ? ? B TRP 151 B CA  406 1_555 ? ? ? ? ? ? ? 2.467 ? ?               
metalc32 metalc ?    ? B ASP 126 OD1 ? ? ? 1_555 R  CA  .   CA ? ? B ASP 152 B CA  406 1_555 ? ? ? ? ? ? ? 2.234 ? ?               
metalc33 metalc ?    ? B ASP 126 OD1 ? ? ? 1_555 S  CA  .   CA ? ? B ASP 152 B CA  407 1_555 ? ? ? ? ? ? ? 2.779 ? ?               
metalc34 metalc ?    ? B ASP 126 OD2 ? ? ? 1_555 S  CA  .   CA ? ? B ASP 152 B CA  407 1_555 ? ? ? ? ? ? ? 2.493 ? ?               
metalc35 metalc ?    ? R CA  .   CA  ? ? ? 1_555 GA HOH .   O  ? ? B CA  406 B HOH 502 1_555 ? ? ? ? ? ? ? 2.316 ? ?               
metalc36 metalc ?    ? C CYS 24  O   ? ? ? 1_555 W  CA  .   CA ? ? C CYS 50  C CA  407 1_555 ? ? ? ? ? ? ? 2.242 ? ?               
metalc37 metalc ?    ? C ASP 25  OD1 ? ? ? 1_555 U  CA  .   CA ? ? C ASP 51  C CA  405 1_555 ? ? ? ? ? ? ? 2.367 ? ?               
metalc38 metalc ?    ? C ASP 25  OD1 ? ? ? 1_555 V  CA  .   CA ? ? C ASP 51  C CA  406 1_555 ? ? ? ? ? ? ? 2.440 ? ?               
metalc39 metalc ?    ? C ASP 25  OD2 ? ? ? 1_555 V  CA  .   CA ? ? C ASP 51  C CA  406 1_555 ? ? ? ? ? ? ? 2.450 ? ?               
metalc40 metalc ?    ? C ASP 25  OD2 ? ? ? 1_555 W  CA  .   CA ? ? C ASP 51  C CA  407 1_555 ? ? ? ? ? ? ? 2.394 ? ?               
metalc41 metalc ?    ? C ASP 39  OD1 ? ? ? 1_555 U  CA  .   CA ? ? C ASP 65  C CA  405 1_555 ? ? ? ? ? ? ? 2.337 ? ?               
metalc42 metalc ?    ? C GLU 40  O   ? ? ? 1_555 U  CA  .   CA ? ? C GLU 66  C CA  405 1_555 ? ? ? ? ? ? ? 2.380 ? ?               
metalc43 metalc ?    ? C ASP 42  OD1 ? ? ? 1_555 U  CA  .   CA ? ? C ASP 68  C CA  405 1_555 ? ? ? ? ? ? ? 2.493 ? ?               
metalc44 metalc ?    ? C ASP 42  OD2 ? ? ? 1_555 U  CA  .   CA ? ? C ASP 68  C CA  405 1_555 ? ? ? ? ? ? ? 2.562 ? ?               
metalc45 metalc ?    ? C ASP 42  OD2 ? ? ? 1_555 V  CA  .   CA ? ? C ASP 68  C CA  406 1_555 ? ? ? ? ? ? ? 2.422 ? ?               
metalc46 metalc ?    ? C ASP 124 OD1 ? ? ? 1_555 V  CA  .   CA ? ? C ASP 150 C CA  406 1_555 ? ? ? ? ? ? ? 2.510 ? ?               
metalc47 metalc ?    ? C ASP 124 OD2 ? ? ? 1_555 W  CA  .   CA ? ? C ASP 150 C CA  407 1_555 ? ? ? ? ? ? ? 2.524 ? ?               
metalc48 metalc ?    ? C TRP 125 O   ? ? ? 1_555 V  CA  .   CA ? ? C TRP 151 C CA  406 1_555 ? ? ? ? ? ? ? 2.626 ? ?               
metalc49 metalc ?    ? C ASP 126 OD1 ? ? ? 1_555 V  CA  .   CA ? ? C ASP 152 C CA  406 1_555 ? ? ? ? ? ? ? 2.338 ? ?               
metalc50 metalc ?    ? C ASP 126 OD1 ? ? ? 1_555 W  CA  .   CA ? ? C ASP 152 C CA  407 1_555 ? ? ? ? ? ? ? 3.160 ? ?               
metalc51 metalc ?    ? C ASP 126 OD2 ? ? ? 1_555 W  CA  .   CA ? ? C ASP 152 C CA  407 1_555 ? ? ? ? ? ? ? 2.394 ? ?               
metalc52 metalc ?    ? U CA  .   CA  ? ? ? 1_555 HA HOH .   O  ? ? C CA  405 C HOH 513 1_555 ? ? ? ? ? ? ? 2.442 ? ?               
metalc53 metalc ?    ? D ASP 25  OD2 ? ? ? 1_555 X  CA  .   CA ? ? D ASP 51  D CA  404 1_555 ? ? ? ? ? ? ? 2.364 ? ?               
metalc54 metalc ?    ? D ASP 25  OD1 ? ? ? 1_555 Y  CA  .   CA ? ? D ASP 51  D CA  405 1_555 ? ? ? ? ? ? ? 2.376 ? ?               
metalc55 metalc ?    ? D ASP 25  OD2 ? ? ? 1_555 Y  CA  .   CA ? ? D ASP 51  D CA  405 1_555 ? ? ? ? ? ? ? 2.408 ? ?               
metalc56 metalc ?    ? D ASP 25  OD1 ? ? ? 1_555 Z  CA  .   CA ? ? D ASP 51  D CA  406 1_555 ? ? ? ? ? ? ? 2.401 ? ?               
metalc57 metalc ?    ? D ASP 39  OD1 ? ? ? 1_555 X  CA  .   CA ? ? D ASP 65  D CA  404 1_555 ? ? ? ? ? ? ? 2.811 ? ?               
metalc58 metalc ?    ? D ASP 39  OD2 ? ? ? 1_555 X  CA  .   CA ? ? D ASP 65  D CA  404 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
metalc59 metalc ?    ? D GLU 40  O   ? ? ? 1_555 X  CA  .   CA ? ? D GLU 66  D CA  404 1_555 ? ? ? ? ? ? ? 2.628 ? ?               
metalc60 metalc ?    ? D ASP 42  OD1 ? ? ? 1_555 X  CA  .   CA ? ? D ASP 68  D CA  404 1_555 ? ? ? ? ? ? ? 2.726 ? ?               
metalc61 metalc ?    ? D ASP 42  OD2 ? ? ? 1_555 X  CA  .   CA ? ? D ASP 68  D CA  404 1_555 ? ? ? ? ? ? ? 2.589 ? ?               
metalc62 metalc ?    ? D ASP 42  OD2 ? ? ? 1_555 Y  CA  .   CA ? ? D ASP 68  D CA  405 1_555 ? ? ? ? ? ? ? 2.391 ? ?               
metalc63 metalc ?    ? D ASP 124 OD1 ? ? ? 1_555 Y  CA  .   CA ? ? D ASP 150 D CA  405 1_555 ? ? ? ? ? ? ? 2.454 ? ?               
metalc64 metalc ?    ? D ASP 124 OD2 ? ? ? 1_555 Z  CA  .   CA ? ? D ASP 150 D CA  406 1_555 ? ? ? ? ? ? ? 2.371 ? ?               
metalc65 metalc ?    ? D TRP 125 O   ? ? ? 1_555 Y  CA  .   CA ? ? D TRP 151 D CA  405 1_555 ? ? ? ? ? ? ? 2.343 ? ?               
metalc66 metalc ?    ? D ASP 126 OD1 ? ? ? 1_555 Y  CA  .   CA ? ? D ASP 152 D CA  405 1_555 ? ? ? ? ? ? ? 2.979 ? ?               
metalc67 metalc ?    ? D ASP 126 OD1 ? ? ? 1_555 Z  CA  .   CA ? ? D ASP 152 D CA  406 1_555 ? ? ? ? ? ? ? 2.339 ? ?               
metalc68 metalc ?    ? D ASP 126 OD2 ? ? ? 1_555 Z  CA  .   CA ? ? D ASP 152 D CA  406 1_555 ? ? ? ? ? ? ? 2.393 ? ?               
metalc69 metalc ?    ? E CYS 24  O   ? ? ? 1_555 CA CA  .   CA ? ? E CYS 50  E CA  406 1_555 ? ? ? ? ? ? ? 2.188 ? ?               
metalc70 metalc ?    ? E ASP 25  OD2 ? ? ? 1_555 AA CA  .   CA ? ? E ASP 51  E CA  404 1_555 ? ? ? ? ? ? ? 2.934 ? ?               
metalc71 metalc ?    ? E ASP 25  OD1 ? ? ? 1_555 BA CA  .   CA ? ? E ASP 51  E CA  405 1_555 ? ? ? ? ? ? ? 2.358 ? ?               
metalc72 metalc ?    ? E ASP 25  OD2 ? ? ? 1_555 BA CA  .   CA ? ? E ASP 51  E CA  405 1_555 ? ? ? ? ? ? ? 2.351 ? ?               
metalc73 metalc ?    ? E ASP 25  OD1 ? ? ? 1_555 CA CA  .   CA ? ? E ASP 51  E CA  406 1_555 ? ? ? ? ? ? ? 2.405 ? ?               
metalc74 metalc ?    ? E ASP 39  OD1 ? ? ? 1_555 AA CA  .   CA ? ? E ASP 65  E CA  404 1_555 ? ? ? ? ? ? ? 2.358 ? ?               
metalc75 metalc ?    ? E GLU 40  O   ? ? ? 1_555 AA CA  .   CA ? ? E GLU 66  E CA  404 1_555 ? ? ? ? ? ? ? 2.464 ? ?               
metalc76 metalc ?    ? E ASP 42  OD1 ? ? ? 1_555 AA CA  .   CA ? ? E ASP 68  E CA  404 1_555 ? ? ? ? ? ? ? 2.509 ? ?               
metalc77 metalc ?    ? E ASP 42  OD2 ? ? ? 1_555 AA CA  .   CA ? ? E ASP 68  E CA  404 1_555 ? ? ? ? ? ? ? 2.391 ? ?               
metalc78 metalc ?    ? E ASP 124 OD1 ? ? ? 1_555 BA CA  .   CA ? ? E ASP 150 E CA  405 1_555 ? ? ? ? ? ? ? 2.394 ? ?               
metalc79 metalc ?    ? E ASP 124 OD2 ? ? ? 1_555 CA CA  .   CA ? ? E ASP 150 E CA  406 1_555 ? ? ? ? ? ? ? 2.825 ? ?               
metalc80 metalc ?    ? E TRP 125 O   ? ? ? 1_555 BA CA  .   CA ? ? E TRP 151 E CA  405 1_555 ? ? ? ? ? ? ? 2.342 ? ?               
metalc81 metalc ?    ? E ASP 126 OD1 ? ? ? 1_555 BA CA  .   CA ? ? E ASP 152 E CA  405 1_555 ? ? ? ? ? ? ? 2.357 ? ?               
metalc82 metalc ?    ? E ASP 126 OD1 ? ? ? 1_555 CA CA  .   CA ? ? E ASP 152 E CA  406 1_555 ? ? ? ? ? ? ? 2.334 ? ?               
metalc83 metalc ?    ? E ASP 126 OD2 ? ? ? 1_555 CA CA  .   CA ? ? E ASP 152 E CA  406 1_555 ? ? ? ? ? ? ? 2.389 ? ?               
metalc84 metalc ?    ? F ASP 25  OD2 ? ? ? 1_555 DA CA  .   CA ? ? F ASP 51  F CA  404 1_555 ? ? ? ? ? ? ? 2.510 ? ?               
metalc85 metalc ?    ? F ASP 25  OD1 ? ? ? 1_555 EA CA  .   CA ? ? F ASP 51  F CA  405 1_555 ? ? ? ? ? ? ? 2.325 ? ?               
metalc86 metalc ?    ? F ASP 25  OD2 ? ? ? 1_555 EA CA  .   CA ? ? F ASP 51  F CA  405 1_555 ? ? ? ? ? ? ? 2.282 ? ?               
metalc87 metalc ?    ? F ASP 39  OD1 ? ? ? 1_555 DA CA  .   CA ? ? F ASP 65  F CA  404 1_555 ? ? ? ? ? ? ? 2.446 ? ?               
metalc88 metalc ?    ? F GLU 40  O   ? ? ? 1_555 DA CA  .   CA ? ? F GLU 66  F CA  404 1_555 ? ? ? ? ? ? ? 2.467 ? ?               
metalc89 metalc ?    ? F ASP 42  OD1 ? ? ? 1_555 DA CA  .   CA ? ? F ASP 68  F CA  404 1_555 ? ? ? ? ? ? ? 2.544 ? ?               
metalc90 metalc ?    ? F ASP 42  OD2 ? ? ? 1_555 DA CA  .   CA ? ? F ASP 68  F CA  404 1_555 ? ? ? ? ? ? ? 2.348 ? ?               
metalc91 metalc ?    ? F ASP 42  OD2 ? ? ? 1_555 EA CA  .   CA ? ? F ASP 68  F CA  405 1_555 ? ? ? ? ? ? ? 2.437 ? ?               
metalc92 metalc ?    ? F ASP 124 OD1 ? ? ? 1_555 EA CA  .   CA ? ? F ASP 150 F CA  405 1_555 ? ? ? ? ? ? ? 2.440 ? ?               
metalc93 metalc ?    ? F ASP 124 OD2 ? ? ? 1_555 EA CA  .   CA ? ? F ASP 150 F CA  405 1_555 ? ? ? ? ? ? ? 2.580 ? ?               
metalc94 metalc ?    ? F TRP 125 O   ? ? ? 1_555 EA CA  .   CA ? ? F TRP 151 F CA  405 1_555 ? ? ? ? ? ? ? 2.476 ? ?               
metalc95 metalc ?    ? F ASP 126 OD1 ? ? ? 1_555 EA CA  .   CA ? ? F ASP 152 F CA  405 1_555 ? ? ? ? ? ? ? 2.350 ? ?               
metalc96 metalc ?    ? F ASP 126 OD2 ? ? ? 1_555 EA CA  .   CA ? ? F ASP 152 F CA  405 1_555 ? ? ? ? ? ? ? 3.140 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 60 A . ? GLY 86 A PRO 61 A ? PRO 87 A 1 -3.43 
2 GLY 60 B . ? GLY 86 B PRO 61 B ? PRO 87 B 1 -2.81 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 3 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 4 ? 
AC5 ? 4 ? 
AC6 ? 2 ? 
AC7 ? 3 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 4 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 3 ? 
AD9 ? 2 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 3 ? 
AE6 ? 4 ? 
AE7 ? 4 ? 
AE8 ? 2 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
AF6 ? 3 ? 
AF7 ? 4 ? 
AF8 ? 4 ? 
AF9 ? 2 ? 
AG1 ? 3 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 2 ? 
AG5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 77  ? TYR A 78  ? PHE A 103 TYR A 104 
AA1 2 GLY A 2   ? ARG A 12  ? GLY A 28  ARG A 38  
AA1 3 LEU A 103 ? PHE A 108 ? LEU A 129 PHE A 134 
AA2 1 PHE A 77  ? TYR A 78  ? PHE A 103 TYR A 104 
AA2 2 GLY A 2   ? ARG A 12  ? GLY A 28  ARG A 38  
AA2 3 HIS A 163 ? CYS A 172 ? HIS A 189 CYS A 198 
AA2 4 LYS A 153 ? SER A 158 ? LYS A 179 SER A 184 
AA3 1 GLY A 65  ? ALA A 68  ? GLY A 91  ALA A 94  
AA3 2 THR A 43  ? LYS A 50  ? THR A 69  LYS A 76  
AA3 3 SER A 115 ? ASP A 124 ? SER A 141 ASP A 150 
AA3 4 LEU A 136 ? MET A 145 ? LEU A 162 MET A 171 
AA4 1 TYR A 176 ? TYR A 177 ? TYR A 202 TYR A 203 
AA4 2 LYS A 183 ? PHE A 184 ? LYS A 209 PHE A 210 
AA5 1 ARG A 188 ? ASP A 190 ? ARG A 214 ASP A 216 
AA5 2 GLY A 193 ? CYS A 197 ? GLY A 219 CYS A 223 
AA5 3 LYS A 203 ? CYS A 205 ? LYS A 229 CYS A 231 
AA6 1 TRP A 209 ? MET A 210 ? TRP A 235 MET A 236 
AA6 2 GLU A 216 ? ALA A 217 ? GLU A 242 ALA A 243 
AA7 1 GLY A 228 ? GLY A 229 ? GLY A 254 GLY A 255 
AA7 2 ARG A 237 ? CYS A 238 ? ARG A 263 CYS A 264 
AA8 1 TRP A 242 ? GLN A 243 ? TRP A 268 GLN A 269 
AA8 2 GLU A 249 ? CYS A 250 ? GLU A 275 CYS A 276 
AA9 1 GLY A 259 ? SER A 260 ? GLY A 285 SER A 286 
AA9 2 ASN A 268 ? CYS A 269 ? ASN A 294 CYS A 295 
AB1 1 TRP A 273 ? GLY A 274 ? TRP A 299 GLY A 300 
AB1 2 LYS A 280 ? ASP A 281 ? LYS A 306 ASP A 307 
AB2 1 PHE B 77  ? TYR B 78  ? PHE B 103 TYR B 104 
AB2 2 GLY B 2   ? ARG B 12  ? GLY B 28  ARG B 38  
AB2 3 LEU B 103 ? PHE B 108 ? LEU B 129 PHE B 134 
AB3 1 PHE B 77  ? TYR B 78  ? PHE B 103 TYR B 104 
AB3 2 GLY B 2   ? ARG B 12  ? GLY B 28  ARG B 38  
AB3 3 HIS B 163 ? CYS B 172 ? HIS B 189 CYS B 198 
AB3 4 LYS B 153 ? SER B 158 ? LYS B 179 SER B 184 
AB4 1 GLY B 65  ? ALA B 68  ? GLY B 91  ALA B 94  
AB4 2 THR B 43  ? LYS B 50  ? THR B 69  LYS B 76  
AB4 3 SER B 115 ? ASP B 124 ? SER B 141 ASP B 150 
AB4 4 LEU B 136 ? MET B 145 ? LEU B 162 MET B 171 
AB5 1 TYR B 176 ? TYR B 177 ? TYR B 202 TYR B 203 
AB5 2 LYS B 183 ? PHE B 184 ? LYS B 209 PHE B 210 
AB6 1 ARG B 188 ? ASP B 190 ? ARG B 214 ASP B 216 
AB6 2 GLY B 193 ? CYS B 197 ? GLY B 219 CYS B 223 
AB6 3 LYS B 203 ? CYS B 205 ? LYS B 229 CYS B 231 
AB7 1 TRP B 209 ? MET B 210 ? TRP B 235 MET B 236 
AB7 2 GLU B 216 ? ALA B 217 ? GLU B 242 ALA B 243 
AB8 1 GLY B 228 ? GLY B 229 ? GLY B 254 GLY B 255 
AB8 2 ARG B 237 ? CYS B 238 ? ARG B 263 CYS B 264 
AB9 1 TRP B 242 ? GLN B 243 ? TRP B 268 GLN B 269 
AB9 2 GLU B 249 ? CYS B 250 ? GLU B 275 CYS B 276 
AC1 1 GLY B 259 ? SER B 260 ? GLY B 285 SER B 286 
AC1 2 ASN B 268 ? CYS B 269 ? ASN B 294 CYS B 295 
AC2 1 TRP B 273 ? GLY B 274 ? TRP B 299 GLY B 300 
AC2 2 LYS B 280 ? ASP B 281 ? LYS B 306 ASP B 307 
AC3 1 PHE C 77  ? TYR C 78  ? PHE C 103 TYR C 104 
AC3 2 GLY C 2   ? ASN C 13  ? GLY C 28  ASN C 39  
AC3 3 LEU C 103 ? PHE C 108 ? LEU C 129 PHE C 134 
AC4 1 PHE C 77  ? TYR C 78  ? PHE C 103 TYR C 104 
AC4 2 GLY C 2   ? ASN C 13  ? GLY C 28  ASN C 39  
AC4 3 ALA C 162 ? CYS C 172 ? ALA C 188 CYS C 198 
AC4 4 LYS C 153 ? SER C 158 ? LYS C 179 SER C 184 
AC5 1 GLY C 65  ? ALA C 68  ? GLY C 91  ALA C 94  
AC5 2 THR C 43  ? LYS C 50  ? THR C 69  LYS C 76  
AC5 3 SER C 115 ? ASP C 124 ? SER C 141 ASP C 150 
AC5 4 LEU C 136 ? MET C 145 ? LEU C 162 MET C 171 
AC6 1 TYR C 176 ? TYR C 177 ? TYR C 202 TYR C 203 
AC6 2 LYS C 183 ? PHE C 184 ? LYS C 209 PHE C 210 
AC7 1 ARG C 188 ? ASP C 190 ? ARG C 214 ASP C 216 
AC7 2 GLY C 193 ? CYS C 197 ? GLY C 219 CYS C 223 
AC7 3 LYS C 203 ? CYS C 205 ? LYS C 229 CYS C 231 
AC8 1 TRP C 209 ? MET C 210 ? TRP C 235 MET C 236 
AC8 2 GLU C 216 ? ALA C 217 ? GLU C 242 ALA C 243 
AC9 1 GLY C 228 ? GLY C 229 ? GLY C 254 GLY C 255 
AC9 2 ARG C 237 ? CYS C 238 ? ARG C 263 CYS C 264 
AD1 1 TRP C 242 ? GLN C 243 ? TRP C 268 GLN C 269 
AD1 2 GLU C 249 ? CYS C 250 ? GLU C 275 CYS C 276 
AD2 1 GLY C 259 ? SER C 260 ? GLY C 285 SER C 286 
AD2 2 ASN C 268 ? CYS C 269 ? ASN C 294 CYS C 295 
AD3 1 TRP C 273 ? GLY C 274 ? TRP C 299 GLY C 300 
AD3 2 LYS C 280 ? ASP C 281 ? LYS C 306 ASP C 307 
AD4 1 PHE D 77  ? TYR D 78  ? PHE D 103 TYR D 104 
AD4 2 GLY D 2   ? ARG D 12  ? GLY D 28  ARG D 38  
AD4 3 LEU D 103 ? PHE D 108 ? LEU D 129 PHE D 134 
AD5 1 PHE D 77  ? TYR D 78  ? PHE D 103 TYR D 104 
AD5 2 GLY D 2   ? ARG D 12  ? GLY D 28  ARG D 38  
AD5 3 HIS D 163 ? CYS D 172 ? HIS D 189 CYS D 198 
AD5 4 LYS D 153 ? SER D 158 ? LYS D 179 SER D 184 
AD6 1 GLY D 65  ? ALA D 68  ? GLY D 91  ALA D 94  
AD6 2 THR D 43  ? LYS D 50  ? THR D 69  LYS D 76  
AD6 3 THR D 117 ? ASP D 124 ? THR D 143 ASP D 150 
AD6 4 LEU D 136 ? HIS D 142 ? LEU D 162 HIS D 168 
AD7 1 TYR D 176 ? TYR D 177 ? TYR D 202 TYR D 203 
AD7 2 LYS D 183 ? PHE D 184 ? LYS D 209 PHE D 210 
AD8 1 ARG D 188 ? ASP D 190 ? ARG D 214 ASP D 216 
AD8 2 GLY D 193 ? CYS D 197 ? GLY D 219 CYS D 223 
AD8 3 LYS D 203 ? CYS D 205 ? LYS D 229 CYS D 231 
AD9 1 TRP D 209 ? MET D 210 ? TRP D 235 MET D 236 
AD9 2 GLU D 216 ? ALA D 217 ? GLU D 242 ALA D 243 
AE1 1 GLY D 228 ? GLY D 229 ? GLY D 254 GLY D 255 
AE1 2 ARG D 237 ? CYS D 238 ? ARG D 263 CYS D 264 
AE2 1 TRP D 242 ? GLN D 243 ? TRP D 268 GLN D 269 
AE2 2 GLU D 249 ? CYS D 250 ? GLU D 275 CYS D 276 
AE3 1 GLY D 259 ? SER D 260 ? GLY D 285 SER D 286 
AE3 2 ASN D 268 ? CYS D 269 ? ASN D 294 CYS D 295 
AE4 1 TRP D 273 ? GLY D 274 ? TRP D 299 GLY D 300 
AE4 2 LYS D 280 ? ASP D 281 ? LYS D 306 ASP D 307 
AE5 1 SER E 76  ? TYR E 78  ? SER E 102 TYR E 104 
AE5 2 GLY E 2   ? ASN E 13  ? GLY E 28  ASN E 39  
AE5 3 LEU E 103 ? PHE E 108 ? LEU E 129 PHE E 134 
AE6 1 SER E 76  ? TYR E 78  ? SER E 102 TYR E 104 
AE6 2 GLY E 2   ? ASN E 13  ? GLY E 28  ASN E 39  
AE6 3 ALA E 162 ? CYS E 172 ? ALA E 188 CYS E 198 
AE6 4 LYS E 153 ? SER E 158 ? LYS E 179 SER E 184 
AE7 1 GLY E 65  ? ALA E 68  ? GLY E 91  ALA E 94  
AE7 2 THR E 43  ? LYS E 50  ? THR E 69  LYS E 76  
AE7 3 SER E 115 ? ASP E 124 ? SER E 141 ASP E 150 
AE7 4 LEU E 136 ? MET E 145 ? LEU E 162 MET E 171 
AE8 1 TYR E 176 ? TYR E 177 ? TYR E 202 TYR E 203 
AE8 2 LYS E 183 ? PHE E 184 ? LYS E 209 PHE E 210 
AE9 1 ARG E 188 ? ASP E 190 ? ARG E 214 ASP E 216 
AE9 2 GLY E 193 ? CYS E 197 ? GLY E 219 CYS E 223 
AE9 3 LYS E 203 ? CYS E 205 ? LYS E 229 CYS E 231 
AF1 1 TRP E 209 ? MET E 210 ? TRP E 235 MET E 236 
AF1 2 GLU E 216 ? ALA E 217 ? GLU E 242 ALA E 243 
AF2 1 GLY E 228 ? GLY E 229 ? GLY E 254 GLY E 255 
AF2 2 ARG E 237 ? CYS E 238 ? ARG E 263 CYS E 264 
AF3 1 TRP E 242 ? GLN E 243 ? TRP E 268 GLN E 269 
AF3 2 GLU E 249 ? CYS E 250 ? GLU E 275 CYS E 276 
AF4 1 GLY E 259 ? SER E 260 ? GLY E 285 SER E 286 
AF4 2 ASN E 268 ? CYS E 269 ? ASN E 294 CYS E 295 
AF5 1 TRP E 273 ? GLY E 274 ? TRP E 299 GLY E 300 
AF5 2 LYS E 280 ? ASP E 281 ? LYS E 306 ASP E 307 
AF6 1 SER F 76  ? TYR F 78  ? SER F 102 TYR F 104 
AF6 2 GLY F 2   ? ARG F 12  ? GLY F 28  ARG F 38  
AF6 3 LEU F 103 ? PHE F 108 ? LEU F 129 PHE F 134 
AF7 1 SER F 76  ? TYR F 78  ? SER F 102 TYR F 104 
AF7 2 GLY F 2   ? ARG F 12  ? GLY F 28  ARG F 38  
AF7 3 HIS F 163 ? CYS F 172 ? HIS F 189 CYS F 198 
AF7 4 LYS F 153 ? SER F 158 ? LYS F 179 SER F 184 
AF8 1 GLY F 65  ? ALA F 68  ? GLY F 91  ALA F 94  
AF8 2 ASP F 42  ? LYS F 50  ? ASP F 68  LYS F 76  
AF8 3 SER F 115 ? TRP F 125 ? SER F 141 TRP F 151 
AF8 4 GLU F 138 ? MET F 145 ? GLU F 164 MET F 171 
AF9 1 TYR F 176 ? TYR F 177 ? TYR F 202 TYR F 203 
AF9 2 LYS F 183 ? PHE F 184 ? LYS F 209 PHE F 210 
AG1 1 ARG F 188 ? ASP F 190 ? ARG F 214 ASP F 216 
AG1 2 GLY F 193 ? CYS F 197 ? GLY F 219 CYS F 223 
AG1 3 LYS F 203 ? CYS F 205 ? LYS F 229 CYS F 231 
AG2 1 TRP F 209 ? MET F 210 ? TRP F 235 MET F 236 
AG2 2 GLU F 216 ? ALA F 217 ? GLU F 242 ALA F 243 
AG3 1 GLY F 228 ? GLY F 229 ? GLY F 254 GLY F 255 
AG3 2 ARG F 237 ? CYS F 238 ? ARG F 263 CYS F 264 
AG4 1 TRP F 242 ? GLN F 243 ? TRP F 268 GLN F 269 
AG4 2 GLU F 249 ? CYS F 250 ? GLU F 275 CYS F 276 
AG5 1 GLY F 259 ? SER F 260 ? GLY F 285 SER F 286 
AG5 2 ASN F 268 ? CYS F 269 ? ASN F 294 CYS F 295 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 77  ? O PHE A 103 N LEU A 11  ? N LEU A 37  
AA1 2 3 N PHE A 4   ? N PHE A 30  O ILE A 106 ? O ILE A 132 
AA2 1 2 O PHE A 77  ? O PHE A 103 N LEU A 11  ? N LEU A 37  
AA2 2 3 N GLN A 7   ? N GLN A 33  O GLN A 167 ? O GLN A 193 
AA2 3 4 O LEU A 166 ? O LEU A 192 N LEU A 155 ? N LEU A 181 
AA3 1 2 O GLY A 67  ? O GLY A 93  N VAL A 47  ? N VAL A 73  
AA3 2 3 N CYS A 48  ? N CYS A 74  O ILE A 119 ? O ILE A 145 
AA3 3 4 N LEU A 118 ? N LEU A 144 O HIS A 142 ? O HIS A 168 
AA4 1 2 N TYR A 177 ? N TYR A 203 O LYS A 183 ? O LYS A 209 
AA5 1 2 N ASP A 190 ? N ASP A 216 O GLY A 193 ? O GLY A 219 
AA5 2 3 N THR A 196 ? N THR A 222 O ALA A 204 ? O ALA A 230 
AA6 1 2 N MET A 210 ? N MET A 236 O GLU A 216 ? O GLU A 242 
AA7 1 2 N GLY A 229 ? N GLY A 255 O ARG A 237 ? O ARG A 263 
AA8 1 2 N GLN A 243 ? N GLN A 269 O GLU A 249 ? O GLU A 275 
AA9 1 2 N SER A 260 ? N SER A 286 O ASN A 268 ? O ASN A 294 
AB1 1 2 N GLY A 274 ? N GLY A 300 O LYS A 280 ? O LYS A 306 
AB2 1 2 O PHE B 77  ? O PHE B 103 N LEU B 11  ? N LEU B 37  
AB2 2 3 N LEU B 6   ? N LEU B 32  O VAL B 104 ? O VAL B 130 
AB3 1 2 O PHE B 77  ? O PHE B 103 N LEU B 11  ? N LEU B 37  
AB3 2 3 N GLN B 7   ? N GLN B 33  O GLN B 167 ? O GLN B 193 
AB3 3 4 O LEU B 164 ? O LEU B 190 N PHE B 157 ? N PHE B 183 
AB4 1 2 O GLY B 67  ? O GLY B 93  N VAL B 47  ? N VAL B 73  
AB4 2 3 N CYS B 48  ? N CYS B 74  O ILE B 119 ? O ILE B 145 
AB4 3 4 N ALA B 122 ? N ALA B 148 O ILE B 137 ? O ILE B 163 
AB5 1 2 N TYR B 177 ? N TYR B 203 O LYS B 183 ? O LYS B 209 
AB6 1 2 N ASP B 190 ? N ASP B 216 O GLY B 193 ? O GLY B 219 
AB6 2 3 N THR B 196 ? N THR B 222 O ALA B 204 ? O ALA B 230 
AB7 1 2 N MET B 210 ? N MET B 236 O GLU B 216 ? O GLU B 242 
AB8 1 2 N GLY B 229 ? N GLY B 255 O ARG B 237 ? O ARG B 263 
AB9 1 2 N GLN B 243 ? N GLN B 269 O GLU B 249 ? O GLU B 275 
AC1 1 2 N SER B 260 ? N SER B 286 O ASN B 268 ? O ASN B 294 
AC2 1 2 N GLY B 274 ? N GLY B 300 O LYS B 280 ? O LYS B 306 
AC3 1 2 O PHE C 77  ? O PHE C 103 N LEU C 11  ? N LEU C 37  
AC3 2 3 N PHE C 4   ? N PHE C 30  O ILE C 106 ? O ILE C 132 
AC4 1 2 O PHE C 77  ? O PHE C 103 N LEU C 11  ? N LEU C 37  
AC4 2 3 N GLN C 7   ? N GLN C 33  O GLN C 167 ? O GLN C 193 
AC4 3 4 O ILE C 168 ? O ILE C 194 N LYS C 153 ? N LYS C 179 
AC5 1 2 O GLY C 65  ? O GLY C 91  N LEU C 49  ? N LEU C 75  
AC5 2 3 N TYR C 44  ? N TYR C 70  O TRP C 123 ? O TRP C 149 
AC5 3 4 N LEU C 118 ? N LEU C 144 O HIS C 142 ? O HIS C 168 
AC6 1 2 N TYR C 177 ? N TYR C 203 O LYS C 183 ? O LYS C 209 
AC7 1 2 N ASP C 190 ? N ASP C 216 O GLY C 193 ? O GLY C 219 
AC7 2 3 N THR C 196 ? N THR C 222 O ALA C 204 ? O ALA C 230 
AC8 1 2 N MET C 210 ? N MET C 236 O GLU C 216 ? O GLU C 242 
AC9 1 2 N GLY C 229 ? N GLY C 255 O ARG C 237 ? O ARG C 263 
AD1 1 2 N GLN C 243 ? N GLN C 269 O GLU C 249 ? O GLU C 275 
AD2 1 2 N SER C 260 ? N SER C 286 O ASN C 268 ? O ASN C 294 
AD3 1 2 N GLY C 274 ? N GLY C 300 O LYS C 280 ? O LYS C 306 
AD4 1 2 O PHE D 77  ? O PHE D 103 N LEU D 11  ? N LEU D 37  
AD4 2 3 N PHE D 4   ? N PHE D 30  O ILE D 106 ? O ILE D 132 
AD5 1 2 O PHE D 77  ? O PHE D 103 N LEU D 11  ? N LEU D 37  
AD5 2 3 N GLN D 7   ? N GLN D 33  O GLN D 167 ? O GLN D 193 
AD5 3 4 O LEU D 166 ? O LEU D 192 N LEU D 155 ? N LEU D 181 
AD6 1 2 O GLY D 67  ? O GLY D 93  N VAL D 47  ? N VAL D 73  
AD6 2 3 N CYS D 48  ? N CYS D 74  O ILE D 119 ? O ILE D 145 
AD6 3 4 N LEU D 118 ? N LEU D 144 O HIS D 142 ? O HIS D 168 
AD7 1 2 N TYR D 177 ? N TYR D 203 O LYS D 183 ? O LYS D 209 
AD8 1 2 N ARG D 188 ? N ARG D 214 O TYR D 195 ? O TYR D 221 
AD8 2 3 N THR D 196 ? N THR D 222 O ALA D 204 ? O ALA D 230 
AD9 1 2 N MET D 210 ? N MET D 236 O GLU D 216 ? O GLU D 242 
AE1 1 2 N GLY D 229 ? N GLY D 255 O ARG D 237 ? O ARG D 263 
AE2 1 2 N GLN D 243 ? N GLN D 269 O GLU D 249 ? O GLU D 275 
AE3 1 2 N SER D 260 ? N SER D 286 O ASN D 268 ? O ASN D 294 
AE4 1 2 N GLY D 274 ? N GLY D 300 O LYS D 280 ? O LYS D 306 
AE5 1 2 O PHE E 77  ? O PHE E 103 N LEU E 11  ? N LEU E 37  
AE5 2 3 N PHE E 4   ? N PHE E 30  O ILE E 106 ? O ILE E 132 
AE6 1 2 O PHE E 77  ? O PHE E 103 N LEU E 11  ? N LEU E 37  
AE6 2 3 N GLN E 7   ? N GLN E 33  O GLN E 167 ? O GLN E 193 
AE6 3 4 O LEU E 164 ? O LEU E 190 N PHE E 157 ? N PHE E 183 
AE7 1 2 O GLY E 67  ? O GLY E 93  N VAL E 47  ? N VAL E 73  
AE7 2 3 N TYR E 44  ? N TYR E 70  O TRP E 123 ? O TRP E 149 
AE7 3 4 N LEU E 118 ? N LEU E 144 O HIS E 142 ? O HIS E 168 
AE8 1 2 N TYR E 177 ? N TYR E 203 O LYS E 183 ? O LYS E 209 
AE9 1 2 N ASP E 190 ? N ASP E 216 O GLY E 193 ? O GLY E 219 
AE9 2 3 N THR E 196 ? N THR E 222 O ALA E 204 ? O ALA E 230 
AF1 1 2 N MET E 210 ? N MET E 236 O GLU E 216 ? O GLU E 242 
AF2 1 2 N GLY E 229 ? N GLY E 255 O ARG E 237 ? O ARG E 263 
AF3 1 2 N GLN E 243 ? N GLN E 269 O GLU E 249 ? O GLU E 275 
AF4 1 2 N SER E 260 ? N SER E 286 O ASN E 268 ? O ASN E 294 
AF5 1 2 N GLY E 274 ? N GLY E 300 O LYS E 280 ? O LYS E 306 
AF6 1 2 O PHE F 77  ? O PHE F 103 N LEU F 11  ? N LEU F 37  
AF6 2 3 N PHE F 4   ? N PHE F 30  O ILE F 106 ? O ILE F 132 
AF7 1 2 O PHE F 77  ? O PHE F 103 N LEU F 11  ? N LEU F 37  
AF7 2 3 N SER F 9   ? N SER F 35  O GLU F 165 ? O GLU F 191 
AF7 3 4 O LEU F 164 ? O LEU F 190 N PHE F 157 ? N PHE F 183 
AF8 1 2 O GLY F 67  ? O GLY F 93  N VAL F 47  ? N VAL F 73  
AF8 2 3 N ASP F 42  ? N ASP F 68  O TRP F 125 ? O TRP F 151 
AF8 3 4 N LEU F 118 ? N LEU F 144 O HIS F 142 ? O HIS F 168 
AF9 1 2 N TYR F 177 ? N TYR F 203 O LYS F 183 ? O LYS F 209 
AG1 1 2 N ASP F 190 ? N ASP F 216 O GLY F 193 ? O GLY F 219 
AG1 2 3 N THR F 196 ? N THR F 222 O ALA F 204 ? O ALA F 230 
AG2 1 2 N MET F 210 ? N MET F 236 O GLU F 216 ? O GLU F 242 
AG3 1 2 N GLY F 229 ? N GLY F 255 O ARG F 237 ? O ARG F 263 
AG4 1 2 N GLN F 243 ? N GLN F 269 O GLU F 249 ? O GLU F 275 
AG5 1 2 N SER F 260 ? N SER F 286 O ASN F 268 ? O ASN F 294 
# 
_atom_sites.entry_id                    5MWF 
_atom_sites.fract_transf_matrix[1][1]   0.015967 
_atom_sites.fract_transf_matrix[1][2]   -0.002052 
_atom_sites.fract_transf_matrix[1][3]   -0.001356 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010849 
_atom_sites.fract_transf_matrix[2][3]   -0.003458 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010898 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A  1 1   ? 16.294  3.068   4.029    1.00 37.88  ? 27  MET A N   1 
ATOM   2     C  CA  . MET A  1 1   ? 15.491  3.499   5.168    1.00 40.40  ? 27  MET A CA  1 
ATOM   3     C  C   . MET A  1 1   ? 14.251  2.634   5.348    1.00 37.30  ? 27  MET A C   1 
ATOM   4     O  O   . MET A  1 1   ? 13.568  2.306   4.377    1.00 32.87  ? 27  MET A O   1 
ATOM   5     C  CB  . MET A  1 1   ? 15.091  4.966   5.008    1.00 35.67  ? 27  MET A CB  1 
ATOM   6     C  CG  . MET A  1 1   ? 16.278  5.908   5.052    1.00 33.69  ? 27  MET A CG  1 
ATOM   7     S  SD  . MET A  1 1   ? 15.817  7.623   5.304    1.00 43.96  ? 27  MET A SD  1 
ATOM   8     C  CE  . MET A  1 1   ? 14.575  7.460   6.578    1.00 43.87  ? 27  MET A CE  1 
ATOM   9     N  N   . GLY A  1 2   ? 13.959  2.277   6.593    1.00 41.40  ? 28  GLY A N   1 
ATOM   10    C  CA  . GLY A  1 2   ? 12.814  1.448   6.887    1.00 36.41  ? 28  GLY A CA  1 
ATOM   11    C  C   . GLY A  1 2   ? 12.379  1.561   8.328    1.00 34.68  ? 28  GLY A C   1 
ATOM   12    O  O   . GLY A  1 2   ? 12.773  2.484   9.043    1.00 32.27  ? 28  GLY A O   1 
ATOM   13    N  N   . TYR A  1 3   ? 11.544  0.607   8.744    1.00 41.10  ? 29  TYR A N   1 
ATOM   14    C  CA  . TYR A  1 3   ? 11.000  0.555   10.095   1.00 34.23  ? 29  TYR A CA  1 
ATOM   15    C  C   . TYR A  1 3   ? 10.997  -0.881  10.591   1.00 30.89  ? 29  TYR A C   1 
ATOM   16    O  O   . TYR A  1 3   ? 10.856  -1.823  9.806    1.00 29.24  ? 29  TYR A O   1 
ATOM   17    C  CB  . TYR A  1 3   ? 9.568   1.118   10.166   1.00 29.12  ? 29  TYR A CB  1 
ATOM   18    C  CG  . TYR A  1 3   ? 9.433   2.504   9.586    1.00 39.83  ? 29  TYR A CG  1 
ATOM   19    C  CD1 . TYR A  1 3   ? 9.874   3.614   10.293   1.00 36.61  ? 29  TYR A CD1 1 
ATOM   20    C  CD2 . TYR A  1 3   ? 8.879   2.705   8.327    1.00 42.51  ? 29  TYR A CD2 1 
ATOM   21    C  CE1 . TYR A  1 3   ? 9.767   4.888   9.769    1.00 41.02  ? 29  TYR A CE1 1 
ATOM   22    C  CE2 . TYR A  1 3   ? 8.767   3.978   7.792    1.00 41.20  ? 29  TYR A CE2 1 
ATOM   23    C  CZ  . TYR A  1 3   ? 9.214   5.067   8.521    1.00 44.25  ? 29  TYR A CZ  1 
ATOM   24    O  OH  . TYR A  1 3   ? 9.111   6.341   8.007    1.00 51.66  ? 29  TYR A OH  1 
ATOM   25    N  N   . PHE A  1 4   ? 11.171  -1.033  11.905   1.00 32.22  ? 30  PHE A N   1 
ATOM   26    C  CA  . PHE A  1 4   ? 10.947  -2.286  12.622   1.00 25.82  ? 30  PHE A CA  1 
ATOM   27    C  C   . PHE A  1 4   ? 9.720   -2.112  13.505   1.00 26.56  ? 30  PHE A C   1 
ATOM   28    O  O   . PHE A  1 4   ? 9.662   -1.177  14.311   1.00 28.94  ? 30  PHE A O   1 
ATOM   29    C  CB  . PHE A  1 4   ? 12.160  -2.681  13.468   1.00 21.97  ? 30  PHE A CB  1 
ATOM   30    C  CG  . PHE A  1 4   ? 12.003  -4.009  14.176   1.00 23.52  ? 30  PHE A CG  1 
ATOM   31    C  CD1 . PHE A  1 4   ? 11.360  -4.090  15.409   1.00 24.42  ? 30  PHE A CD1 1 
ATOM   32    C  CD2 . PHE A  1 4   ? 12.497  -5.173  13.612   1.00 22.89  ? 30  PHE A CD2 1 
ATOM   33    C  CE1 . PHE A  1 4   ? 11.209  -5.306  16.061   1.00 19.82  ? 30  PHE A CE1 1 
ATOM   34    C  CE2 . PHE A  1 4   ? 12.351  -6.394  14.259   1.00 24.71  ? 30  PHE A CE2 1 
ATOM   35    C  CZ  . PHE A  1 4   ? 11.706  -6.459  15.485   1.00 24.04  ? 30  PHE A CZ  1 
ATOM   36    N  N   . GLU A  1 5   ? 8.737   -2.995  13.347   1.00 24.87  ? 31  GLU A N   1 
ATOM   37    C  CA  . GLU A  1 5   ? 7.491   -2.904  14.093   1.00 28.79  ? 31  GLU A CA  1 
ATOM   38    C  C   . GLU A  1 5   ? 7.304   -4.133  14.975   1.00 29.82  ? 31  GLU A C   1 
ATOM   39    O  O   . GLU A  1 5   ? 7.576   -5.261  14.551   1.00 27.45  ? 31  GLU A O   1 
ATOM   40    C  CB  . GLU A  1 5   ? 6.296   -2.763  13.156   1.00 29.64  ? 31  GLU A CB  1 
ATOM   41    C  CG  . GLU A  1 5   ? 6.304   -1.518  12.293   1.00 32.12  ? 31  GLU A CG  1 
ATOM   42    C  CD  . GLU A  1 5   ? 5.082   -1.453  11.398   1.00 44.96  ? 31  GLU A CD  1 
ATOM   43    O  OE1 . GLU A  1 5   ? 4.216   -0.582  11.638   1.00 51.37  ? 31  GLU A OE1 1 
ATOM   44    O  OE2 . GLU A  1 5   ? 4.977   -2.289  10.470   1.00 33.72  ? 31  GLU A OE2 1 
ATOM   45    N  N   . LEU A  1 6   ? 6.827   -3.907  16.197   1.00 24.80  ? 32  LEU A N   1 
ATOM   46    C  CA  . LEU A  1 6   ? 6.537   -4.972  17.146   1.00 21.86  ? 32  LEU A CA  1 
ATOM   47    C  C   . LEU A  1 6   ? 5.178   -4.710  17.775   1.00 30.09  ? 32  LEU A C   1 
ATOM   48    O  O   . LEU A  1 6   ? 4.902   -3.590  18.217   1.00 30.19  ? 32  LEU A O   1 
ATOM   49    C  CB  . LEU A  1 6   ? 7.623   -5.066  18.222   1.00 24.47  ? 32  LEU A CB  1 
ATOM   50    C  CG  . LEU A  1 6   ? 7.477   -6.132  19.305   1.00 22.22  ? 32  LEU A CG  1 
ATOM   51    C  CD1 . LEU A  1 6   ? 8.838   -6.673  19.684   1.00 25.98  ? 32  LEU A CD1 1 
ATOM   52    C  CD2 . LEU A  1 6   ? 6.797   -5.539  20.519   1.00 21.43  ? 32  LEU A CD2 1 
ATOM   53    N  N   . GLN A  1 7   ? 4.336   -5.741  17.816   1.00 31.10  ? 33  GLN A N   1 
ATOM   54    C  CA  . GLN A  1 7   ? 2.985   -5.646  18.358   1.00 32.04  ? 33  GLN A CA  1 
ATOM   55    C  C   . GLN A  1 7   ? 2.814   -6.643  19.498   1.00 29.91  ? 33  GLN A C   1 
ATOM   56    O  O   . GLN A  1 7   ? 2.904   -7.857  19.282   1.00 31.00  ? 33  GLN A O   1 
ATOM   57    C  CB  . GLN A  1 7   ? 1.945   -5.894  17.264   1.00 28.70  ? 33  GLN A CB  1 
ATOM   58    C  CG  . GLN A  1 7   ? 0.519   -5.913  17.767   1.00 31.05  ? 33  GLN A CG  1 
ATOM   59    C  CD  . GLN A  1 7   ? 0.077   -4.563  18.283   1.00 36.76  ? 33  GLN A CD  1 
ATOM   60    O  OE1 . GLN A  1 7   ? 0.288   -3.535  17.632   1.00 28.47  ? 33  GLN A OE1 1 
ATOM   61    N  NE2 . GLN A  1 7   ? -0.541  -4.555  19.462   1.00 36.97  ? 33  GLN A NE2 1 
ATOM   62    N  N   . LEU A  1 8   ? 2.577   -6.136  20.707   1.00 27.41  ? 34  LEU A N   1 
ATOM   63    C  CA  . LEU A  1 8   ? 2.311   -6.985  21.863   1.00 29.97  ? 34  LEU A CA  1 
ATOM   64    C  C   . LEU A  1 8   ? 0.809   -7.184  22.037   1.00 32.37  ? 34  LEU A C   1 
ATOM   65    O  O   . LEU A  1 8   ? 0.048   -6.213  22.078   1.00 38.61  ? 34  LEU A O   1 
ATOM   66    C  CB  . LEU A  1 8   ? 2.896   -6.377  23.138   1.00 29.85  ? 34  LEU A CB  1 
ATOM   67    C  CG  . LEU A  1 8   ? 2.786   -7.289  24.363   1.00 25.12  ? 34  LEU A CG  1 
ATOM   68    C  CD1 . LEU A  1 8   ? 3.955   -8.254  24.420   1.00 23.46  ? 34  LEU A CD1 1 
ATOM   69    C  CD2 . LEU A  1 8   ? 2.700   -6.481  25.635   1.00 31.49  ? 34  LEU A CD2 1 
ATOM   70    N  N   . SER A  1 9   ? 0.386   -8.444  22.158   1.00 23.22  ? 35  SER A N   1 
ATOM   71    C  CA  . SER A  1 9   ? -1.031  -8.757  22.271   1.00 24.01  ? 35  SER A CA  1 
ATOM   72    C  C   . SER A  1 9   ? -1.395  -9.602  23.489   1.00 28.87  ? 35  SER A C   1 
ATOM   73    O  O   . SER A  1 9   ? -2.588  -9.731  23.787   1.00 28.49  ? 35  SER A O   1 
ATOM   74    C  CB  . SER A  1 9   ? -1.531  -9.465  20.998   1.00 22.99  ? 35  SER A CB  1 
ATOM   75    O  OG  . SER A  1 9   ? -0.913  -10.726 20.807   1.00 23.84  ? 35  SER A OG  1 
ATOM   76    N  N   . ALA A  1 10  ? -0.429  -10.171 24.205   1.00 23.05  ? 36  ALA A N   1 
ATOM   77    C  CA  . ALA A  1 10  ? -0.779  -11.000 25.347   1.00 25.13  ? 36  ALA A CA  1 
ATOM   78    C  C   . ALA A  1 10  ? 0.384   -11.055 26.329   1.00 26.72  ? 36  ALA A C   1 
ATOM   79    O  O   . ALA A  1 10  ? 1.542   -11.197 25.929   1.00 27.30  ? 36  ALA A O   1 
ATOM   80    C  CB  . ALA A  1 10  ? -1.168  -12.417 24.909   1.00 22.12  ? 36  ALA A CB  1 
ATOM   81    N  N   . LEU A  1 11  ? 0.052   -10.964 27.614   1.00 20.50  ? 37  LEU A N   1 
ATOM   82    C  CA  . LEU A  1 11  ? 1.009   -11.151 28.692   1.00 22.97  ? 37  LEU A CA  1 
ATOM   83    C  C   . LEU A  1 11  ? 0.266   -11.779 29.864   1.00 25.10  ? 37  LEU A C   1 
ATOM   84    O  O   . LEU A  1 11  ? -0.837  -11.339 30.200   1.00 31.23  ? 37  LEU A O   1 
ATOM   85    C  CB  . LEU A  1 11  ? 1.651   -9.819  29.104   1.00 27.60  ? 37  LEU A CB  1 
ATOM   86    C  CG  . LEU A  1 11  ? 2.896   -9.901  29.999   1.00 31.28  ? 37  LEU A CG  1 
ATOM   87    C  CD1 . LEU A  1 11  ? 3.923   -8.840  29.624   1.00 24.01  ? 37  LEU A CD1 1 
ATOM   88    C  CD2 . LEU A  1 11  ? 2.537   -9.810  31.475   1.00 21.31  ? 37  LEU A CD2 1 
ATOM   89    N  N   . ARG A  1 12  ? 0.854   -12.811 30.466   1.00 26.63  ? 38  ARG A N   1 
ATOM   90    C  CA  . ARG A  1 12  ? 0.236   -13.539 31.574   1.00 25.37  ? 38  ARG A CA  1 
ATOM   91    C  C   . ARG A  1 12  ? 1.226   -13.645 32.723   1.00 29.00  ? 38  ARG A C   1 
ATOM   92    O  O   . ARG A  1 12  ? 2.318   -14.196 32.553   1.00 29.00  ? 38  ARG A O   1 
ATOM   93    C  CB  . ARG A  1 12  ? -0.211  -14.934 31.137   1.00 24.69  ? 38  ARG A CB  1 
ATOM   94    C  CG  . ARG A  1 12  ? -0.943  -15.728 32.199   1.00 27.45  ? 38  ARG A CG  1 
ATOM   95    C  CD  . ARG A  1 12  ? -1.113  -17.169 31.740   1.00 30.73  ? 38  ARG A CD  1 
ATOM   96    N  NE  . ARG A  1 12  ? -1.578  -18.077 32.788   1.00 33.57  ? 38  ARG A NE  1 
ATOM   97    C  CZ  . ARG A  1 12  ? -2.828  -18.126 33.243   1.00 40.40  ? 38  ARG A CZ  1 
ATOM   98    N  NH1 . ARG A  1 12  ? -3.156  -18.999 34.187   1.00 40.07  ? 38  ARG A NH1 1 
ATOM   99    N  NH2 . ARG A  1 12  ? -3.750  -17.300 32.762   1.00 33.72  ? 38  ARG A NH2 1 
ATOM   100   N  N   . ASN A  1 13  ? 0.833   -13.139 33.894   1.00 28.52  ? 39  ASN A N   1 
ATOM   101   C  CA  . ASN A  1 13  ? 1.652   -13.179 35.112   1.00 28.36  ? 39  ASN A CA  1 
ATOM   102   C  C   . ASN A  1 13  ? 0.705   -13.482 36.274   1.00 29.56  ? 39  ASN A C   1 
ATOM   103   O  O   . ASN A  1 13  ? 0.236   -12.569 36.955   1.00 30.05  ? 39  ASN A O   1 
ATOM   104   C  CB  . ASN A  1 13  ? 2.401   -11.865 35.305   1.00 31.00  ? 39  ASN A CB  1 
ATOM   105   C  CG  . ASN A  1 13  ? 3.261   -11.854 36.554   1.00 32.23  ? 39  ASN A CG  1 
ATOM   106   O  OD1 . ASN A  1 13  ? 3.521   -12.895 37.157   1.00 34.20  ? 39  ASN A OD1 1 
ATOM   107   N  ND2 . ASN A  1 13  ? 3.716   -10.669 36.944   1.00 28.59  ? 39  ASN A ND2 1 
ATOM   108   N  N   . VAL A  1 14  ? 0.450   -14.774 36.503   1.00 30.47  ? 40  VAL A N   1 
ATOM   109   C  CA  . VAL A  1 14  ? -0.583  -15.186 37.456   1.00 31.97  ? 40  VAL A CA  1 
ATOM   110   C  C   . VAL A  1 14  ? -0.271  -14.668 38.853   1.00 32.57  ? 40  VAL A C   1 
ATOM   111   O  O   . VAL A  1 14  ? -1.125  -14.070 39.517   1.00 34.32  ? 40  VAL A O   1 
ATOM   112   C  CB  . VAL A  1 14  ? -0.747  -16.717 37.451   1.00 37.89  ? 40  VAL A CB  1 
ATOM   113   C  CG1 . VAL A  1 14  ? -1.601  -17.144 36.284   1.00 40.65  ? 40  VAL A CG1 1 
ATOM   114   C  CG2 . VAL A  1 14  ? 0.609   -17.418 37.403   1.00 33.34  ? 40  VAL A CG2 1 
ATOM   115   N  N   . ASN A  1 15  ? 0.957   -14.895 39.324   1.00 35.81  ? 41  ASN A N   1 
ATOM   116   C  CA  . ASN A  1 15  ? 1.290   -14.553 40.702   1.00 37.00  ? 41  ASN A CA  1 
ATOM   117   C  C   . ASN A  1 15  ? 1.429   -13.047 40.902   1.00 38.94  ? 41  ASN A C   1 
ATOM   118   O  O   . ASN A  1 15  ? 1.227   -12.554 42.017   1.00 43.20  ? 41  ASN A O   1 
ATOM   119   C  CB  . ASN A  1 15  ? 2.574   -15.271 41.118   1.00 35.55  ? 41  ASN A CB  1 
ATOM   120   C  CG  . ASN A  1 15  ? 2.442   -16.780 41.060   1.00 31.89  ? 41  ASN A CG  1 
ATOM   121   O  OD1 . ASN A  1 15  ? 1.339   -17.319 41.156   1.00 32.05  ? 41  ASN A OD1 1 
ATOM   122   N  ND2 . ASN A  1 15  ? 3.567   -17.470 40.906   1.00 25.51  ? 41  ASN A ND2 1 
ATOM   123   N  N   . GLY A  1 16  ? 1.759   -12.305 39.851   1.00 36.27  ? 42  GLY A N   1 
ATOM   124   C  CA  . GLY A  1 16  ? 1.934   -10.869 39.985   1.00 35.57  ? 42  GLY A CA  1 
ATOM   125   C  C   . GLY A  1 16  ? 3.222   -10.477 40.677   1.00 39.79  ? 42  GLY A C   1 
ATOM   126   O  O   . GLY A  1 16  ? 3.234   -9.520  41.463   1.00 36.44  ? 42  GLY A O   1 
ATOM   127   N  N   . GLU A  1 17  ? 4.313   -11.181 40.389   1.00 38.34  ? 43  GLU A N   1 
ATOM   128   C  CA  . GLU A  1 17  ? 5.590   -10.940 41.031   1.00 38.20  ? 43  GLU A CA  1 
ATOM   129   C  C   . GLU A  1 17  ? 6.522   -10.168 40.109   1.00 39.43  ? 43  GLU A C   1 
ATOM   130   O  O   . GLU A  1 17  ? 6.128   -9.660  39.056   1.00 38.09  ? 43  GLU A O   1 
ATOM   131   C  CB  . GLU A  1 17  ? 6.266   -12.258 41.411   1.00 43.37  ? 43  GLU A CB  1 
ATOM   132   C  CG  . GLU A  1 17  ? 5.364   -13.338 41.941   1.00 49.51  ? 43  GLU A CG  1 
ATOM   133   C  CD  . GLU A  1 17  ? 6.023   -14.705 41.854   1.00 59.22  ? 43  GLU A CD  1 
ATOM   134   O  OE1 . GLU A  1 17  ? 6.374   -15.121 40.724   1.00 61.45  ? 43  GLU A OE1 1 
ATOM   135   O  OE2 . GLU A  1 17  ? 6.197   -15.368 42.905   1.00 57.36  ? 43  GLU A OE2 1 
ATOM   136   N  N   . LEU A  1 18  ? 7.785   -10.104 40.511   1.00 39.17  ? 44  LEU A N   1 
ATOM   137   C  CA  . LEU A  1 18  ? 8.886   -9.615  39.707   1.00 30.95  ? 44  LEU A CA  1 
ATOM   138   C  C   . LEU A  1 18  ? 9.841   -10.777 39.489   1.00 33.33  ? 44  LEU A C   1 
ATOM   139   O  O   . LEU A  1 18  ? 9.670   -11.860 40.052   1.00 43.52  ? 44  LEU A O   1 
ATOM   140   C  CB  . LEU A  1 18  ? 9.598   -8.443  40.394   1.00 40.92  ? 44  LEU A CB  1 
ATOM   141   C  CG  . LEU A  1 18  ? 8.727   -7.244  40.783   1.00 42.68  ? 44  LEU A CG  1 
ATOM   142   C  CD1 . LEU A  1 18  ? 9.395   -6.421  41.874   1.00 39.28  ? 44  LEU A CD1 1 
ATOM   143   C  CD2 . LEU A  1 18  ? 8.424   -6.380  39.576   1.00 32.27  ? 44  LEU A CD2 1 
ATOM   144   N  N   . LEU A  1 19  ? 10.862  -10.552 38.665   1.00 39.13  ? 45  LEU A N   1 
ATOM   145   C  CA  . LEU A  1 19  ? 11.828  -11.615 38.415   1.00 40.90  ? 45  LEU A CA  1 
ATOM   146   C  C   . LEU A  1 19  ? 12.585  -11.986 39.684   1.00 36.89  ? 45  LEU A C   1 
ATOM   147   O  O   . LEU A  1 19  ? 13.034  -13.130 39.826   1.00 39.77  ? 45  LEU A O   1 
ATOM   148   C  CB  . LEU A  1 19  ? 12.797  -11.195 37.308   1.00 37.24  ? 45  LEU A CB  1 
ATOM   149   C  CG  . LEU A  1 19  ? 13.702  -12.297 36.757   1.00 33.68  ? 45  LEU A CG  1 
ATOM   150   C  CD1 . LEU A  1 19  ? 12.871  -13.454 36.226   1.00 42.27  ? 45  LEU A CD1 1 
ATOM   151   C  CD2 . LEU A  1 19  ? 14.581  -11.737 35.659   1.00 36.65  ? 45  LEU A CD2 1 
ATOM   152   N  N   . SER A  1 20  ? 12.716  -11.042 40.620   1.00 34.43  ? 46  SER A N   1 
ATOM   153   C  CA  . SER A  1 20  ? 13.400  -11.317 41.883   1.00 37.56  ? 46  SER A CA  1 
ATOM   154   C  C   . SER A  1 20  ? 12.616  -12.306 42.741   1.00 40.54  ? 46  SER A C   1 
ATOM   155   O  O   . SER A  1 20  ? 13.186  -13.249 43.301   1.00 45.94  ? 46  SER A O   1 
ATOM   156   C  CB  . SER A  1 20  ? 13.639  -10.009 42.640   1.00 33.55  ? 46  SER A CB  1 
ATOM   157   O  OG  . SER A  1 20  ? 12.421  -9.373  42.987   1.00 29.55  ? 46  SER A OG  1 
ATOM   158   N  N   . GLY A  1 21  ? 11.311  -12.104 42.862   1.00 42.57  ? 47  GLY A N   1 
ATOM   159   C  CA  . GLY A  1 21  ? 10.487  -12.993 43.652   1.00 37.67  ? 47  GLY A CA  1 
ATOM   160   C  C   . GLY A  1 21  ? 9.443   -12.221 44.426   1.00 42.72  ? 47  GLY A C   1 
ATOM   161   O  O   . GLY A  1 21  ? 8.399   -12.764 44.798   1.00 46.38  ? 47  GLY A O   1 
ATOM   162   N  N   . ALA A  1 22  ? 9.719   -10.943 44.666   1.00 39.27  ? 48  ALA A N   1 
ATOM   163   C  CA  . ALA A  1 22  ? 8.815   -10.100 45.426   1.00 43.74  ? 48  ALA A CA  1 
ATOM   164   C  C   . ALA A  1 22  ? 7.586   -9.727  44.600   1.00 43.46  ? 48  ALA A C   1 
ATOM   165   O  O   . ALA A  1 22  ? 7.535   -9.914  43.383   1.00 46.28  ? 48  ALA A O   1 
ATOM   166   C  CB  . ALA A  1 22  ? 9.536   -8.840  45.897   1.00 49.83  ? 48  ALA A CB  1 
ATOM   167   N  N   . CYS A  1 23  ? 6.584   -9.185  45.284   1.00 43.14  ? 49  CYS A N   1 
ATOM   168   C  CA  . CYS A  1 23  ? 5.407   -8.674  44.603   1.00 46.89  ? 49  CYS A CA  1 
ATOM   169   C  C   . CYS A  1 23  ? 5.716   -7.309  43.996   1.00 46.45  ? 49  CYS A C   1 
ATOM   170   O  O   . CYS A  1 23  ? 6.579   -6.573  44.481   1.00 50.82  ? 49  CYS A O   1 
ATOM   171   C  CB  . CYS A  1 23  ? 4.223   -8.566  45.568   1.00 55.89  ? 49  CYS A CB  1 
ATOM   172   S  SG  . CYS A  1 23  ? 3.686   -10.119 46.357   1.00 57.22  ? 49  CYS A SG  1 
ATOM   173   N  N   . CYS A  1 24  ? 5.004   -6.981  42.916   1.00 41.72  ? 50  CYS A N   1 
ATOM   174   C  CA  . CYS A  1 24  ? 5.290   -5.758  42.169   1.00 47.14  ? 50  CYS A CA  1 
ATOM   175   C  C   . CYS A  1 24  ? 5.145   -4.524  43.049   1.00 55.62  ? 50  CYS A C   1 
ATOM   176   O  O   . CYS A  1 24  ? 6.078   -3.720  43.182   1.00 51.75  ? 50  CYS A O   1 
ATOM   177   C  CB  . CYS A  1 24  ? 4.366   -5.658  40.951   1.00 39.85  ? 50  CYS A CB  1 
ATOM   178   S  SG  . CYS A  1 24  ? 4.841   -6.666  39.537   1.00 35.15  ? 50  CYS A SG  1 
ATOM   179   N  N   . ASP A  1 25  ? 3.973   -4.356  43.655   1.00 51.07  ? 51  ASP A N   1 
ATOM   180   C  CA  . ASP A  1 25  ? 3.672   -3.192  44.479   1.00 51.96  ? 51  ASP A CA  1 
ATOM   181   C  C   . ASP A  1 25  ? 3.254   -3.683  45.857   1.00 57.41  ? 51  ASP A C   1 
ATOM   182   O  O   . ASP A  1 25  ? 2.146   -4.203  46.029   1.00 64.85  ? 51  ASP A O   1 
ATOM   183   C  CB  . ASP A  1 25  ? 2.580   -2.333  43.843   1.00 41.77  ? 51  ASP A CB  1 
ATOM   184   C  CG  . ASP A  1 25  ? 3.046   -1.639  42.580   1.00 40.87  ? 51  ASP A CG  1 
ATOM   185   O  OD1 . ASP A  1 25  ? 4.267   -1.456  42.409   1.00 43.37  ? 51  ASP A OD1 1 
ATOM   186   O  OD2 . ASP A  1 25  ? 2.191   -1.264  41.753   1.00 48.77  ? 51  ASP A OD2 1 
ATOM   187   N  N   . GLY A  1 26  ? 4.139   -3.519  46.832   1.00 54.86  ? 52  GLY A N   1 
ATOM   188   C  CA  . GLY A  1 26  ? 3.835   -3.925  48.184   1.00 56.19  ? 52  GLY A CA  1 
ATOM   189   C  C   . GLY A  1 26  ? 4.932   -4.738  48.832   1.00 63.49  ? 52  GLY A C   1 
ATOM   190   O  O   . GLY A  1 26  ? 5.476   -5.665  48.223   1.00 70.72  ? 52  GLY A O   1 
ATOM   191   N  N   . ASP A  1 27  ? 5.270   -4.371  50.069   1.00 61.07  ? 53  ASP A N   1 
ATOM   192   C  CA  . ASP A  1 27  ? 6.206   -5.107  50.910   1.00 60.61  ? 53  ASP A CA  1 
ATOM   193   C  C   . ASP A  1 27  ? 7.612   -5.120  50.319   1.00 66.07  ? 53  ASP A C   1 
ATOM   194   O  O   . ASP A  1 27  ? 8.309   -4.100  50.319   1.00 70.95  ? 53  ASP A O   1 
ATOM   195   C  CB  . ASP A  1 27  ? 5.705   -6.538  51.128   1.00 64.37  ? 53  ASP A CB  1 
ATOM   196   C  CG  . ASP A  1 27  ? 6.324   -7.191  52.342   1.00 61.26  ? 53  ASP A CG  1 
ATOM   197   O  OD1 . ASP A  1 27  ? 5.829   -8.256  52.765   1.00 56.66  ? 53  ASP A OD1 1 
ATOM   198   O  OD2 . ASP A  1 27  ? 7.300   -6.632  52.879   1.00 72.79  ? 53  ASP A OD2 1 
ATOM   199   N  N   . GLY A  1 28  ? 8.029   -6.277  49.814   1.00 65.01  ? 54  GLY A N   1 
ATOM   200   C  CA  . GLY A  1 28  ? 9.377   -6.492  49.328   1.00 61.51  ? 54  GLY A CA  1 
ATOM   201   C  C   . GLY A  1 28  ? 9.773   -7.924  49.615   1.00 70.70  ? 54  GLY A C   1 
ATOM   202   O  O   . GLY A  1 28  ? 10.958  -8.264  49.693   1.00 68.93  ? 54  GLY A O   1 
ATOM   203   N  N   . ARG A  1 29  ? 8.760   -8.777  49.752   1.00 75.70  ? 55  ARG A N   1 
ATOM   204   C  CA  . ARG A  1 29  ? 8.916   -10.112 50.311   1.00 80.40  ? 55  ARG A CA  1 
ATOM   205   C  C   . ARG A  1 29  ? 9.134   -11.151 49.218   1.00 71.67  ? 55  ARG A C   1 
ATOM   206   O  O   . ARG A  1 29  ? 8.392   -11.190 48.231   1.00 62.60  ? 55  ARG A O   1 
ATOM   207   C  CB  . ARG A  1 29  ? 7.683   -10.480 51.139   1.00 83.12  ? 55  ARG A CB  1 
ATOM   208   C  CG  . ARG A  1 29  ? 6.362   -10.332 50.382   1.00 80.32  ? 55  ARG A CG  1 
ATOM   209   C  CD  . ARG A  1 29  ? 5.429   -11.498 50.666   1.00 77.75  ? 55  ARG A CD  1 
ATOM   210   N  NE  . ARG A  1 29  ? 4.105   -11.305 50.082   1.00 75.06  ? 55  ARG A NE  1 
ATOM   211   C  CZ  . ARG A  1 29  ? 3.340   -12.292 49.628   1.00 76.59  ? 55  ARG A CZ  1 
ATOM   212   N  NH1 . ARG A  1 29  ? 3.768   -13.547 49.680   1.00 73.24  ? 55  ARG A NH1 1 
ATOM   213   N  NH2 . ARG A  1 29  ? 2.146   -12.026 49.115   1.00 75.29  ? 55  ARG A NH2 1 
ATOM   214   N  N   . THR A  1 30  ? 10.133  -12.008 49.416   1.00 72.82  ? 56  THR A N   1 
ATOM   215   C  CA  . THR A  1 30  ? 10.396  -13.122 48.509   1.00 64.87  ? 56  THR A CA  1 
ATOM   216   C  C   . THR A  1 30  ? 10.046  -14.459 49.160   1.00 71.98  ? 56  THR A C   1 
ATOM   217   O  O   . THR A  1 30  ? 8.872   -14.784 49.354   1.00 79.96  ? 56  THR A O   1 
ATOM   218   C  CB  . THR A  1 30  ? 11.869  -13.149 48.065   1.00 65.69  ? 56  THR A CB  1 
ATOM   219   O  OG1 . THR A  1 30  ? 12.195  -11.918 47.406   1.00 64.59  ? 56  THR A OG1 1 
ATOM   220   C  CG2 . THR A  1 30  ? 12.127  -14.325 47.123   1.00 57.41  ? 56  THR A CG2 1 
ATOM   221   N  N   . GLY A  1 34  ? -1.916  -16.834 50.484   1.00 90.54  ? 60  GLY A N   1 
ATOM   222   C  CA  . GLY A  1 34  ? -2.516  -15.760 49.710   1.00 96.76  ? 60  GLY A CA  1 
ATOM   223   C  C   . GLY A  1 34  ? -1.677  -15.309 48.528   1.00 93.18  ? 60  GLY A C   1 
ATOM   224   O  O   . GLY A  1 34  ? -0.514  -15.697 48.395   1.00 95.78  ? 60  GLY A O   1 
ATOM   225   N  N   . GLY A  1 35  ? -2.264  -14.485 47.663   1.00 80.95  ? 61  GLY A N   1 
ATOM   226   C  CA  . GLY A  1 35  ? -1.544  -13.989 46.508   1.00 75.65  ? 61  GLY A CA  1 
ATOM   227   C  C   . GLY A  1 35  ? -0.699  -12.775 46.831   1.00 73.53  ? 61  GLY A C   1 
ATOM   228   O  O   . GLY A  1 35  ? -0.042  -12.736 47.876   1.00 69.53  ? 61  GLY A O   1 
ATOM   229   N  N   . CYS A  1 36  ? -0.706  -11.776 45.948   1.00 65.30  ? 62  CYS A N   1 
ATOM   230   C  CA  . CYS A  1 36  ? 0.072   -10.561 46.145   1.00 55.03  ? 62  CYS A CA  1 
ATOM   231   C  C   . CYS A  1 36  ? -0.793  -9.340  46.433   1.00 58.62  ? 62  CYS A C   1 
ATOM   232   O  O   . CYS A  1 36  ? -0.250  -8.251  46.650   1.00 64.88  ? 62  CYS A O   1 
ATOM   233   C  CB  . CYS A  1 36  ? 0.953   -10.291 44.919   1.00 48.63  ? 62  CYS A CB  1 
ATOM   234   S  SG  . CYS A  1 36  ? 2.594   -11.072 44.931   1.00 49.49  ? 62  CYS A SG  1 
ATOM   235   N  N   . GLY A  1 37  ? -2.112  -9.479  46.428   1.00 48.77  ? 63  GLY A N   1 
ATOM   236   C  CA  . GLY A  1 37  ? -3.000  -8.391  46.775   1.00 52.75  ? 63  GLY A CA  1 
ATOM   237   C  C   . GLY A  1 37  ? -3.764  -7.848  45.585   1.00 50.04  ? 63  GLY A C   1 
ATOM   238   O  O   . GLY A  1 37  ? -3.909  -8.494  44.545   1.00 60.42  ? 63  GLY A O   1 
ATOM   239   N  N   . HIS A  1 38  ? -4.261  -6.621  45.751   1.00 53.04  ? 64  HIS A N   1 
ATOM   240   C  CA  . HIS A  1 38  ? -5.039  -5.958  44.714   1.00 51.78  ? 64  HIS A CA  1 
ATOM   241   C  C   . HIS A  1 38  ? -4.275  -4.865  43.989   1.00 51.80  ? 64  HIS A C   1 
ATOM   242   O  O   . HIS A  1 38  ? -4.693  -4.467  42.896   1.00 54.75  ? 64  HIS A O   1 
ATOM   243   C  CB  . HIS A  1 38  ? -6.325  -5.347  45.286   1.00 57.50  ? 64  HIS A CB  1 
ATOM   244   C  CG  . HIS A  1 38  ? -7.347  -6.355  45.714   1.00 70.95  ? 64  HIS A CG  1 
ATOM   245   N  ND1 . HIS A  1 38  ? -8.632  -6.001  46.068   1.00 73.98  ? 64  HIS A ND1 1 
ATOM   246   C  CD2 . HIS A  1 38  ? -7.288  -7.704  45.817   1.00 76.54  ? 64  HIS A CD2 1 
ATOM   247   C  CE1 . HIS A  1 38  ? -9.315  -7.086  46.385   1.00 73.61  ? 64  HIS A CE1 1 
ATOM   248   N  NE2 . HIS A  1 38  ? -8.522  -8.133  46.242   1.00 75.23  ? 64  HIS A NE2 1 
ATOM   249   N  N   . ASP A  1 39  ? -3.180  -4.367  44.556   1.00 45.39  ? 65  ASP A N   1 
ATOM   250   C  CA  . ASP A  1 39  ? -2.303  -3.469  43.810   1.00 46.66  ? 65  ASP A CA  1 
ATOM   251   C  C   . ASP A  1 39  ? -1.461  -4.337  42.883   1.00 46.94  ? 65  ASP A C   1 
ATOM   252   O  O   . ASP A  1 39  ? -0.476  -4.950  43.305   1.00 46.31  ? 65  ASP A O   1 
ATOM   253   C  CB  . ASP A  1 39  ? -1.441  -2.635  44.749   1.00 42.22  ? 65  ASP A CB  1 
ATOM   254   C  CG  . ASP A  1 39  ? -0.836  -1.429  44.062   1.00 47.58  ? 65  ASP A CG  1 
ATOM   255   O  OD1 . ASP A  1 39  ? -0.704  -1.455  42.819   1.00 51.97  ? 65  ASP A OD1 1 
ATOM   256   O  OD2 . ASP A  1 39  ? -0.499  -0.451  44.760   1.00 48.10  ? 65  ASP A OD2 1 
ATOM   257   N  N   . GLU A  1 40  ? -1.853  -4.390  41.613   1.00 46.05  ? 66  GLU A N   1 
ATOM   258   C  CA  . GLU A  1 40  ? -1.225  -5.254  40.626   1.00 44.31  ? 66  GLU A CA  1 
ATOM   259   C  C   . GLU A  1 40  ? -0.002  -4.581  40.004   1.00 41.85  ? 66  GLU A C   1 
ATOM   260   O  O   . GLU A  1 40  ? 0.314   -3.418  40.272   1.00 37.02  ? 66  GLU A O   1 
ATOM   261   C  CB  . GLU A  1 40  ? -2.226  -5.637  39.532   1.00 37.32  ? 66  GLU A CB  1 
ATOM   262   C  CG  . GLU A  1 40  ? -3.480  -6.328  40.038   1.00 43.02  ? 66  GLU A CG  1 
ATOM   263   C  CD  . GLU A  1 40  ? -4.412  -6.754  38.916   1.00 38.73  ? 66  GLU A CD  1 
ATOM   264   O  OE1 . GLU A  1 40  ? -4.949  -7.878  38.978   1.00 36.33  ? 66  GLU A OE1 1 
ATOM   265   O  OE2 . GLU A  1 40  ? -4.608  -5.965  37.970   1.00 43.63  ? 66  GLU A OE2 1 
ATOM   266   N  N   . CYS A  1 41  ? 0.704   -5.350  39.178   1.00 37.51  ? 67  CYS A N   1 
ATOM   267   C  CA  . CYS A  1 41  ? 1.815   -4.806  38.414   1.00 36.80  ? 67  CYS A CA  1 
ATOM   268   C  C   . CYS A  1 41  ? 1.309   -3.786  37.406   1.00 31.76  ? 67  CYS A C   1 
ATOM   269   O  O   . CYS A  1 41  ? 0.270   -3.980  36.772   1.00 32.82  ? 67  CYS A O   1 
ATOM   270   C  CB  . CYS A  1 41  ? 2.568   -5.920  37.690   1.00 32.15  ? 67  CYS A CB  1 
ATOM   271   S  SG  . CYS A  1 41  ? 3.071   -7.281  38.753   1.00 36.73  ? 67  CYS A SG  1 
ATOM   272   N  N   . ASP A  1 42  ? 2.030   -2.675  37.290   1.00 34.33  ? 68  ASP A N   1 
ATOM   273   C  CA  . ASP A  1 42  ? 1.734   -1.629  36.310   1.00 37.06  ? 68  ASP A CA  1 
ATOM   274   C  C   . ASP A  1 42  ? 2.677   -1.851  35.130   1.00 34.31  ? 68  ASP A C   1 
ATOM   275   O  O   . ASP A  1 42  ? 3.755   -1.263  35.053   1.00 37.55  ? 68  ASP A O   1 
ATOM   276   C  CB  . ASP A  1 42  ? 1.895   -0.259  36.958   1.00 38.64  ? 68  ASP A CB  1 
ATOM   277   C  CG  . ASP A  1 42  ? 1.126   -0.151  38.270   1.00 42.65  ? 68  ASP A CG  1 
ATOM   278   O  OD1 . ASP A  1 42  ? -0.015  -0.655  38.319   1.00 41.18  ? 68  ASP A OD1 1 
ATOM   279   O  OD2 . ASP A  1 42  ? 1.673   0.375   39.268   1.00 48.13  ? 68  ASP A OD2 1 
ATOM   280   N  N   . THR A  1 43  ? 2.257   -2.704  34.197   1.00 27.67  ? 69  THR A N   1 
ATOM   281   C  CA  . THR A  1 43  ? 3.174   -3.332  33.253   1.00 26.50  ? 69  THR A CA  1 
ATOM   282   C  C   . THR A  1 43  ? 3.334   -2.507  31.982   1.00 31.88  ? 69  THR A C   1 
ATOM   283   O  O   . THR A  1 43  ? 2.342   -2.146  31.339   1.00 32.17  ? 69  THR A O   1 
ATOM   284   C  CB  . THR A  1 43  ? 2.684   -4.734  32.888   1.00 23.61  ? 69  THR A CB  1 
ATOM   285   O  OG1 . THR A  1 43  ? 2.535   -5.518  34.075   1.00 25.90  ? 69  THR A OG1 1 
ATOM   286   C  CG2 . THR A  1 43  ? 3.672   -5.418  31.962   1.00 20.45  ? 69  THR A CG2 1 
ATOM   287   N  N   . TYR A  1 44  ? 4.587   -2.235  31.612   1.00 30.46  ? 70  TYR A N   1 
ATOM   288   C  CA  . TYR A  1 44  ? 4.930   -1.685  30.309   1.00 27.63  ? 70  TYR A CA  1 
ATOM   289   C  C   . TYR A  1 44  ? 6.106   -2.469  29.743   1.00 21.60  ? 70  TYR A C   1 
ATOM   290   O  O   . TYR A  1 44  ? 6.709   -3.302  30.421   1.00 23.95  ? 70  TYR A O   1 
ATOM   291   C  CB  . TYR A  1 44  ? 5.252   -0.185  30.381   1.00 30.76  ? 70  TYR A CB  1 
ATOM   292   C  CG  . TYR A  1 44  ? 6.503   0.181   31.152   1.00 33.69  ? 70  TYR A CG  1 
ATOM   293   C  CD1 . TYR A  1 44  ? 6.519   0.175   32.544   1.00 34.12  ? 70  TYR A CD1 1 
ATOM   294   C  CD2 . TYR A  1 44  ? 7.659   0.567   30.486   1.00 30.59  ? 70  TYR A CD2 1 
ATOM   295   C  CE1 . TYR A  1 44  ? 7.659   0.524   33.246   1.00 35.48  ? 70  TYR A CE1 1 
ATOM   296   C  CE2 . TYR A  1 44  ? 8.800   0.914   31.176   1.00 28.79  ? 70  TYR A CE2 1 
ATOM   297   C  CZ  . TYR A  1 44  ? 8.797   0.895   32.552   1.00 34.82  ? 70  TYR A CZ  1 
ATOM   298   O  OH  . TYR A  1 44  ? 9.943   1.249   33.228   1.00 35.44  ? 70  TYR A OH  1 
ATOM   299   N  N   . VAL A  1 45  ? 6.452   -2.183  28.495   1.00 25.14  ? 71  VAL A N   1 
ATOM   300   C  CA  . VAL A  1 45  ? 7.380   -3.014  27.739   1.00 29.44  ? 71  VAL A CA  1 
ATOM   301   C  C   . VAL A  1 45  ? 8.495   -2.147  27.162   1.00 30.68  ? 71  VAL A C   1 
ATOM   302   O  O   . VAL A  1 45  ? 8.256   -1.012  26.732   1.00 30.03  ? 71  VAL A O   1 
ATOM   303   C  CB  . VAL A  1 45  ? 6.636   -3.791  26.629   1.00 21.96  ? 71  VAL A CB  1 
ATOM   304   C  CG1 . VAL A  1 45  ? 7.553   -4.125  25.466   1.00 25.09  ? 71  VAL A CG1 1 
ATOM   305   C  CG2 . VAL A  1 45  ? 6.026   -5.060  27.205   1.00 20.84  ? 71  VAL A CG2 1 
ATOM   306   N  N   . ARG A  1 46  ? 9.720   -2.676  27.187   1.00 23.61  ? 72  ARG A N   1 
ATOM   307   C  CA  . ARG A  1 46  ? 10.883  -2.056  26.571   1.00 26.99  ? 72  ARG A CA  1 
ATOM   308   C  C   . ARG A  1 46  ? 11.458  -2.993  25.517   1.00 30.08  ? 72  ARG A C   1 
ATOM   309   O  O   . ARG A  1 46  ? 11.568  -4.202  25.744   1.00 27.00  ? 72  ARG A O   1 
ATOM   310   C  CB  . ARG A  1 46  ? 11.954  -1.715  27.617   1.00 35.34  ? 72  ARG A CB  1 
ATOM   311   C  CG  . ARG A  1 46  ? 11.540  -0.620  28.593   1.00 37.03  ? 72  ARG A CG  1 
ATOM   312   C  CD  . ARG A  1 46  ? 12.727  -0.082  29.384   1.00 32.90  ? 72  ARG A CD  1 
ATOM   313   N  NE  . ARG A  1 46  ? 12.494  1.298   29.805   1.00 40.56  ? 72  ARG A NE  1 
ATOM   314   C  CZ  . ARG A  1 46  ? 12.950  2.365   29.155   1.00 51.19  ? 72  ARG A CZ  1 
ATOM   315   N  NH1 . ARG A  1 46  ? 13.681  2.219   28.055   1.00 46.17  ? 72  ARG A NH1 1 
ATOM   316   N  NH2 . ARG A  1 46  ? 12.677  3.582   29.605   1.00 56.31  ? 72  ARG A NH2 1 
ATOM   317   N  N   . VAL A  1 47  ? 11.832  -2.427  24.367   1.00 31.28  ? 73  VAL A N   1 
ATOM   318   C  CA  . VAL A  1 47  ? 12.279  -3.190  23.204   1.00 28.26  ? 73  VAL A CA  1 
ATOM   319   C  C   . VAL A  1 47  ? 13.707  -2.792  22.862   1.00 25.96  ? 73  VAL A C   1 
ATOM   320   O  O   . VAL A  1 47  ? 14.003  -1.604  22.700   1.00 29.53  ? 73  VAL A O   1 
ATOM   321   C  CB  . VAL A  1 47  ? 11.355  -2.966  21.994   1.00 25.54  ? 73  VAL A CB  1 
ATOM   322   C  CG1 . VAL A  1 47  ? 11.807  -3.814  20.813   1.00 18.31  ? 73  VAL A CG1 1 
ATOM   323   C  CG2 . VAL A  1 47  ? 9.921   -3.283  22.369   1.00 25.91  ? 73  VAL A CG2 1 
ATOM   324   N  N   . CYS A  1 48  ? 14.577  -3.790  22.720   1.00 25.60  ? 74  CYS A N   1 
ATOM   325   C  CA  . CYS A  1 48  ? 15.970  -3.600  22.336   1.00 25.89  ? 74  CYS A CA  1 
ATOM   326   C  C   . CYS A  1 48  ? 16.242  -4.362  21.050   1.00 30.56  ? 74  CYS A C   1 
ATOM   327   O  O   . CYS A  1 48  ? 15.866  -5.532  20.923   1.00 29.27  ? 74  CYS A O   1 
ATOM   328   C  CB  . CYS A  1 48  ? 16.916  -4.092  23.432   1.00 33.79  ? 74  CYS A CB  1 
ATOM   329   S  SG  . CYS A  1 48  ? 18.682  -3.754  23.173   1.00 45.24  ? 74  CYS A SG  1 
ATOM   330   N  N   . LEU A  1 49  ? 16.908  -3.703  20.106   1.00 28.26  ? 75  LEU A N   1 
ATOM   331   C  CA  . LEU A  1 49  ? 17.221  -4.286  18.811   1.00 26.16  ? 75  LEU A CA  1 
ATOM   332   C  C   . LEU A  1 49  ? 18.707  -4.103  18.547   1.00 24.58  ? 75  LEU A C   1 
ATOM   333   O  O   . LEU A  1 49  ? 19.212  -2.979  18.620   1.00 27.32  ? 75  LEU A O   1 
ATOM   334   C  CB  . LEU A  1 49  ? 16.384  -3.621  17.713   1.00 28.63  ? 75  LEU A CB  1 
ATOM   335   C  CG  . LEU A  1 49  ? 16.217  -4.326  16.368   1.00 25.22  ? 75  LEU A CG  1 
ATOM   336   C  CD1 . LEU A  1 49  ? 15.421  -5.611  16.516   1.00 21.23  ? 75  LEU A CD1 1 
ATOM   337   C  CD2 . LEU A  1 49  ? 15.567  -3.384  15.373   1.00 25.79  ? 75  LEU A CD2 1 
ATOM   338   N  N   . LYS A  1 50  ? 19.410  -5.193  18.247   1.00 23.81  ? 76  LYS A N   1 
ATOM   339   C  CA  . LYS A  1 50  ? 20.860  -5.118  18.081   1.00 33.52  ? 76  LYS A CA  1 
ATOM   340   C  C   . LYS A  1 50  ? 21.315  -6.196  17.100   1.00 36.89  ? 76  LYS A C   1 
ATOM   341   O  O   . LYS A  1 50  ? 20.499  -6.878  16.471   1.00 37.79  ? 76  LYS A O   1 
ATOM   342   C  CB  . LYS A  1 50  ? 21.578  -5.248  19.431   1.00 30.01  ? 76  LYS A CB  1 
ATOM   343   C  CG  . LYS A  1 50  ? 21.416  -6.594  20.106   1.00 28.34  ? 76  LYS A CG  1 
ATOM   344   C  CD  . LYS A  1 50  ? 22.015  -6.565  21.498   1.00 36.02  ? 76  LYS A CD  1 
ATOM   345   C  CE  . LYS A  1 50  ? 22.003  -7.941  22.138   1.00 40.26  ? 76  LYS A CE  1 
ATOM   346   N  NZ  . LYS A  1 50  ? 22.580  -7.903  23.508   1.00 43.11  ? 76  LYS A NZ  1 
ATOM   347   N  N   . GLU A  1 51  ? 22.632  -6.348  16.976   1.00 33.53  ? 77  GLU A N   1 
ATOM   348   C  CA  . GLU A  1 51  ? 23.212  -7.245  15.990   1.00 36.11  ? 77  GLU A CA  1 
ATOM   349   C  C   . GLU A  1 51  ? 23.019  -8.703  16.395   1.00 36.07  ? 77  GLU A C   1 
ATOM   350   O  O   . GLU A  1 51  ? 22.777  -9.029  17.560   1.00 39.38  ? 77  GLU A O   1 
ATOM   351   C  CB  . GLU A  1 51  ? 24.705  -6.961  15.812   1.00 39.88  ? 77  GLU A CB  1 
ATOM   352   C  CG  . GLU A  1 51  ? 25.547  -7.278  17.040   1.00 35.09  ? 77  GLU A CG  1 
ATOM   353   C  CD  . GLU A  1 51  ? 25.470  -6.208  18.117   1.00 40.85  ? 77  GLU A CD  1 
ATOM   354   O  OE1 . GLU A  1 51  ? 25.046  -5.075  17.806   1.00 38.46  ? 77  GLU A OE1 1 
ATOM   355   O  OE2 . GLU A  1 51  ? 25.827  -6.505  19.279   1.00 40.57  ? 77  GLU A OE2 1 
ATOM   356   N  N   . TYR A  1 52  ? 23.132  -9.585  15.405   1.00 39.17  ? 78  TYR A N   1 
ATOM   357   C  CA  . TYR A  1 52  ? 22.958  -11.011 15.645   1.00 41.68  ? 78  TYR A CA  1 
ATOM   358   C  C   . TYR A  1 52  ? 24.038  -11.534 16.588   1.00 38.64  ? 78  TYR A C   1 
ATOM   359   O  O   . TYR A  1 52  ? 25.169  -11.042 16.612   1.00 37.16  ? 78  TYR A O   1 
ATOM   360   C  CB  . TYR A  1 52  ? 22.987  -11.785 14.322   1.00 42.78  ? 78  TYR A CB  1 
ATOM   361   C  CG  . TYR A  1 52  ? 22.663  -13.254 14.483   1.00 48.23  ? 78  TYR A CG  1 
ATOM   362   C  CD1 . TYR A  1 52  ? 21.345  -13.695 14.511   1.00 48.05  ? 78  TYR A CD1 1 
ATOM   363   C  CD2 . TYR A  1 52  ? 23.674  -14.200 14.618   1.00 53.40  ? 78  TYR A CD2 1 
ATOM   364   C  CE1 . TYR A  1 52  ? 21.041  -15.036 14.668   1.00 54.95  ? 78  TYR A CE1 1 
ATOM   365   C  CE2 . TYR A  1 52  ? 23.381  -15.545 14.777   1.00 58.09  ? 78  TYR A CE2 1 
ATOM   366   C  CZ  . TYR A  1 52  ? 22.062  -15.959 14.801   1.00 61.71  ? 78  TYR A CZ  1 
ATOM   367   O  OH  . TYR A  1 52  ? 21.761  -17.295 14.957   1.00 52.58  ? 78  TYR A OH  1 
ATOM   368   N  N   . GLN A  1 53  ? 23.679  -12.562 17.356   1.00 41.78  ? 79  GLN A N   1 
ATOM   369   C  CA  . GLN A  1 53  ? 24.580  -13.185 18.321   1.00 51.81  ? 79  GLN A CA  1 
ATOM   370   C  C   . GLN A  1 53  ? 24.319  -14.683 18.329   1.00 52.64  ? 79  GLN A C   1 
ATOM   371   O  O   . GLN A  1 53  ? 23.197  -15.111 18.617   1.00 55.27  ? 79  GLN A O   1 
ATOM   372   C  CB  . GLN A  1 53  ? 24.387  -12.606 19.728   1.00 45.81  ? 79  GLN A CB  1 
ATOM   373   C  CG  . GLN A  1 53  ? 24.999  -11.231 19.928   1.00 46.79  ? 79  GLN A CG  1 
ATOM   374   C  CD  . GLN A  1 53  ? 24.684  -10.637 21.289   1.00 53.44  ? 79  GLN A CD  1 
ATOM   375   O  OE1 . GLN A  1 53  ? 24.065  -11.283 22.137   1.00 46.66  ? 79  GLN A OE1 1 
ATOM   376   N  NE2 . GLN A  1 53  ? 25.112  -9.397  21.504   1.00 55.95  ? 79  GLN A NE2 1 
ATOM   377   N  N   . ALA A  1 54  ? 25.351  -15.473 18.018   1.00 49.84  ? 80  ALA A N   1 
ATOM   378   C  CA  . ALA A  1 54  ? 25.206  -16.926 18.058   1.00 47.15  ? 80  ALA A CA  1 
ATOM   379   C  C   . ALA A  1 54  ? 24.808  -17.400 19.449   1.00 53.02  ? 80  ALA A C   1 
ATOM   380   O  O   . ALA A  1 54  ? 24.002  -18.327 19.591   1.00 48.68  ? 80  ALA A O   1 
ATOM   381   C  CB  . ALA A  1 54  ? 26.504  -17.598 17.612   1.00 48.00  ? 80  ALA A CB  1 
ATOM   382   N  N   . LYS A  1 55  ? 25.357  -16.773 20.487   1.00 62.36  ? 81  LYS A N   1 
ATOM   383   C  CA  . LYS A  1 55  ? 24.937  -17.000 21.865   1.00 57.34  ? 81  LYS A CA  1 
ATOM   384   C  C   . LYS A  1 55  ? 24.450  -15.663 22.407   1.00 55.41  ? 81  LYS A C   1 
ATOM   385   O  O   . LYS A  1 55  ? 25.256  -14.763 22.671   1.00 58.00  ? 81  LYS A O   1 
ATOM   386   C  CB  . LYS A  1 55  ? 26.073  -17.570 22.712   1.00 60.22  ? 81  LYS A CB  1 
ATOM   387   C  CG  . LYS A  1 55  ? 25.707  -17.754 24.175   1.00 60.12  ? 81  LYS A CG  1 
ATOM   388   C  CD  . LYS A  1 55  ? 26.678  -18.680 24.881   1.00 62.06  ? 81  LYS A CD  1 
ATOM   389   C  CE  . LYS A  1 55  ? 26.312  -18.834 26.346   1.00 67.57  ? 81  LYS A CE  1 
ATOM   390   N  NZ  . LYS A  1 55  ? 27.385  -19.528 27.108   1.00 68.34  ? 81  LYS A NZ  1 
ATOM   391   N  N   . VAL A  1 56  ? 23.133  -15.530 22.555   1.00 55.40  ? 82  VAL A N   1 
ATOM   392   C  CA  . VAL A  1 56  ? 22.536  -14.242 22.881   1.00 54.16  ? 82  VAL A CA  1 
ATOM   393   C  C   . VAL A  1 56  ? 22.878  -13.855 24.311   1.00 49.35  ? 82  VAL A C   1 
ATOM   394   O  O   . VAL A  1 56  ? 22.758  -14.663 25.241   1.00 50.33  ? 82  VAL A O   1 
ATOM   395   C  CB  . VAL A  1 56  ? 21.015  -14.286 22.670   1.00 48.23  ? 82  VAL A CB  1 
ATOM   396   C  CG1 . VAL A  1 56  ? 20.389  -12.943 23.008   1.00 38.98  ? 82  VAL A CG1 1 
ATOM   397   C  CG2 . VAL A  1 56  ? 20.698  -14.678 21.247   1.00 46.55  ? 82  VAL A CG2 1 
ATOM   398   N  N   . THR A  1 57  ? 23.311  -12.625 24.490   1.00 49.96  ? 83  THR A N   1 
ATOM   399   C  CA  . THR A  1 57  ? 23.538  -12.081 25.812   1.00 52.01  ? 83  THR A CA  1 
ATOM   400   C  C   . THR A  1 57  ? 22.440  -11.082 26.156   1.00 56.14  ? 83  THR A C   1 
ATOM   401   O  O   . THR A  1 57  ? 22.029  -10.296 25.294   1.00 56.08  ? 83  THR A O   1 
ATOM   402   C  CB  . THR A  1 57  ? 24.902  -11.388 25.905   1.00 53.59  ? 83  THR A CB  1 
ATOM   403   O  OG1 . THR A  1 57  ? 25.012  -10.407 24.866   1.00 57.65  ? 83  THR A OG1 1 
ATOM   404   C  CG2 . THR A  1 57  ? 26.026  -12.405 25.770   1.00 51.96  ? 83  THR A CG2 1 
ATOM   405   N  N   . PRO A  1 58  ? 21.937  -11.090 27.394   1.00 57.52  ? 84  PRO A N   1 
ATOM   406   C  CA  . PRO A  1 58  ? 20.898  -10.127 27.803   1.00 55.03  ? 84  PRO A CA  1 
ATOM   407   C  C   . PRO A  1 58  ? 21.486  -8.758  28.132   1.00 56.83  ? 84  PRO A C   1 
ATOM   408   O  O   . PRO A  1 58  ? 21.317  -8.216  29.228   1.00 65.03  ? 84  PRO A O   1 
ATOM   409   C  CB  . PRO A  1 58  ? 20.270  -10.818 29.022   1.00 60.28  ? 84  PRO A CB  1 
ATOM   410   C  CG  . PRO A  1 58  ? 21.312  -11.784 29.533   1.00 60.45  ? 84  PRO A CG  1 
ATOM   411   C  CD  . PRO A  1 58  ? 22.416  -11.904 28.523   1.00 57.17  ? 84  PRO A CD  1 
ATOM   412   N  N   . THR A  1 59  ? 22.199  -8.190  27.165   1.00 57.42  ? 85  THR A N   1 
ATOM   413   C  CA  . THR A  1 59  ? 23.002  -6.992  27.348   1.00 52.74  ? 85  THR A CA  1 
ATOM   414   C  C   . THR A  1 59  ? 22.546  -5.888  26.401   1.00 52.97  ? 85  THR A C   1 
ATOM   415   O  O   . THR A  1 59  ? 21.700  -6.087  25.523   1.00 52.88  ? 85  THR A O   1 
ATOM   416   C  CB  . THR A  1 59  ? 24.486  -7.288  27.092   1.00 60.28  ? 85  THR A CB  1 
ATOM   417   O  OG1 . THR A  1 59  ? 24.659  -7.718  25.734   1.00 62.51  ? 85  THR A OG1 1 
ATOM   418   C  CG2 . THR A  1 59  ? 24.988  -8.377  28.032   1.00 59.79  ? 85  THR A CG2 1 
ATOM   419   N  N   . GLY A  1 60  ? 23.108  -4.702  26.614   1.00 45.82  ? 86  GLY A N   1 
ATOM   420   C  CA  . GLY A  1 60  ? 23.096  -3.657  25.610   1.00 44.64  ? 86  GLY A CA  1 
ATOM   421   C  C   . GLY A  1 60  ? 24.466  -3.611  24.962   1.00 44.10  ? 86  GLY A C   1 
ATOM   422   O  O   . GLY A  1 60  ? 25.294  -4.488  25.211   1.00 41.47  ? 86  GLY A O   1 
ATOM   423   N  N   . PRO A  1 61  ? 24.719  -2.595  24.125   1.00 39.22  ? 87  PRO A N   1 
ATOM   424   C  CA  . PRO A  1 61  ? 23.753  -1.564  23.731   1.00 44.55  ? 87  PRO A CA  1 
ATOM   425   C  C   . PRO A  1 61  ? 22.790  -2.054  22.646   1.00 39.12  ? 87  PRO A C   1 
ATOM   426   O  O   . PRO A  1 61  ? 23.025  -3.099  22.036   1.00 35.43  ? 87  PRO A O   1 
ATOM   427   C  CB  . PRO A  1 61  ? 24.644  -0.434  23.188   1.00 40.61  ? 87  PRO A CB  1 
ATOM   428   C  CG  . PRO A  1 61  ? 26.056  -0.816  23.549   1.00 30.86  ? 87  PRO A CG  1 
ATOM   429   C  CD  . PRO A  1 61  ? 26.064  -2.299  23.611   1.00 27.88  ? 87  PRO A CD  1 
ATOM   430   N  N   . CYS A  1 62  ? 21.711  -1.304  22.421   1.00 36.20  ? 88  CYS A N   1 
ATOM   431   C  CA  . CYS A  1 62  ? 20.754  -1.609  21.358   1.00 32.38  ? 88  CYS A CA  1 
ATOM   432   C  C   . CYS A  1 62  ? 21.253  -0.923  20.096   1.00 33.41  ? 88  CYS A C   1 
ATOM   433   O  O   . CYS A  1 62  ? 20.903  0.221   19.802   1.00 33.50  ? 88  CYS A O   1 
ATOM   434   C  CB  . CYS A  1 62  ? 19.351  -1.160  21.745   1.00 33.78  ? 88  CYS A CB  1 
ATOM   435   S  SG  . CYS A  1 62  ? 18.883  -1.738  23.388   1.00 44.51  ? 88  CYS A SG  1 
ATOM   436   N  N   . SER A  1 63  ? 22.082  -1.650  19.340   1.00 37.10  ? 89  SER A N   1 
ATOM   437   C  CA  . SER A  1 63  ? 22.802  -1.062  18.212   1.00 33.50  ? 89  SER A CA  1 
ATOM   438   C  C   . SER A  1 63  ? 21.853  -0.583  17.119   1.00 35.91  ? 89  SER A C   1 
ATOM   439   O  O   . SER A  1 63  ? 22.120  0.429   16.459   1.00 39.32  ? 89  SER A O   1 
ATOM   440   C  CB  . SER A  1 63  ? 23.792  -2.078  17.643   1.00 32.90  ? 89  SER A CB  1 
ATOM   441   O  OG  . SER A  1 63  ? 24.681  -2.547  18.643   1.00 32.44  ? 89  SER A OG  1 
ATOM   442   N  N   . TYR A  1 64  ? 20.744  -1.299  16.904   1.00 31.10  ? 90  TYR A N   1 
ATOM   443   C  CA  . TYR A  1 64  ? 19.833  -0.985  15.810   1.00 26.11  ? 90  TYR A CA  1 
ATOM   444   C  C   . TYR A  1 64  ? 18.689  -0.062  16.211   1.00 26.37  ? 90  TYR A C   1 
ATOM   445   O  O   . TYR A  1 64  ? 18.037  0.506   15.327   1.00 34.66  ? 90  TYR A O   1 
ATOM   446   C  CB  . TYR A  1 64  ? 19.253  -2.270  15.216   1.00 28.02  ? 90  TYR A CB  1 
ATOM   447   C  CG  . TYR A  1 64  ? 20.279  -3.171  14.568   1.00 28.23  ? 90  TYR A CG  1 
ATOM   448   C  CD1 . TYR A  1 64  ? 21.523  -2.688  14.199   1.00 27.79  ? 90  TYR A CD1 1 
ATOM   449   C  CD2 . TYR A  1 64  ? 19.999  -4.507  14.321   1.00 28.37  ? 90  TYR A CD2 1 
ATOM   450   C  CE1 . TYR A  1 64  ? 22.461  -3.510  13.611   1.00 26.73  ? 90  TYR A CE1 1 
ATOM   451   C  CE2 . TYR A  1 64  ? 20.931  -5.334  13.733   1.00 31.65  ? 90  TYR A CE2 1 
ATOM   452   C  CZ  . TYR A  1 64  ? 22.160  -4.830  13.382   1.00 29.12  ? 90  TYR A CZ  1 
ATOM   453   O  OH  . TYR A  1 64  ? 23.092  -5.654  12.797   1.00 34.44  ? 90  TYR A OH  1 
ATOM   454   N  N   . GLY A  1 65  ? 18.423  0.100   17.506   1.00 23.76  ? 91  GLY A N   1 
ATOM   455   C  CA  . GLY A  1 65  ? 17.352  0.976   17.948   1.00 23.75  ? 91  GLY A CA  1 
ATOM   456   C  C   . GLY A  1 65  ? 16.614  0.484   19.179   1.00 30.14  ? 91  GLY A C   1 
ATOM   457   O  O   . GLY A  1 65  ? 16.859  -0.629  19.655   1.00 25.66  ? 91  GLY A O   1 
ATOM   458   N  N   . HIS A  1 66  ? 15.703  1.303   19.704   1.00 30.90  ? 92  HIS A N   1 
ATOM   459   C  CA  . HIS A  1 66  ? 14.953  0.927   20.894   1.00 28.19  ? 92  HIS A CA  1 
ATOM   460   C  C   . HIS A  1 66  ? 13.654  1.720   20.956   1.00 28.73  ? 92  HIS A C   1 
ATOM   461   O  O   . HIS A  1 66  ? 13.522  2.785   20.346   1.00 24.71  ? 92  HIS A O   1 
ATOM   462   C  CB  . HIS A  1 66  ? 15.782  1.150   22.165   1.00 23.01  ? 92  HIS A CB  1 
ATOM   463   C  CG  . HIS A  1 66  ? 16.206  2.573   22.371   1.00 30.90  ? 92  HIS A CG  1 
ATOM   464   N  ND1 . HIS A  1 66  ? 15.353  3.544   22.851   1.00 37.72  ? 92  HIS A ND1 1 
ATOM   465   C  CD2 . HIS A  1 66  ? 17.394  3.189   22.158   1.00 28.23  ? 92  HIS A CD2 1 
ATOM   466   C  CE1 . HIS A  1 66  ? 15.996  4.695   22.928   1.00 31.23  ? 92  HIS A CE1 1 
ATOM   467   N  NE2 . HIS A  1 66  ? 17.236  4.507   22.512   1.00 34.71  ? 92  HIS A NE2 1 
ATOM   468   N  N   . GLY A  1 67  ? 12.706  1.190   21.730   1.00 26.87  ? 93  GLY A N   1 
ATOM   469   C  CA  . GLY A  1 67  ? 11.421  1.827   21.957   1.00 26.05  ? 93  GLY A CA  1 
ATOM   470   C  C   . GLY A  1 67  ? 10.763  1.252   23.192   1.00 24.97  ? 93  GLY A C   1 
ATOM   471   O  O   . GLY A  1 67  ? 11.227  0.266   23.769   1.00 23.28  ? 93  GLY A O   1 
ATOM   472   N  N   . ALA A  1 68  ? 9.651   1.872   23.585   1.00 23.15  ? 94  ALA A N   1 
ATOM   473   C  CA  . ALA A  1 68  ? 8.938   1.438   24.778   1.00 24.96  ? 94  ALA A CA  1 
ATOM   474   C  C   . ALA A  1 68  ? 7.491   1.908   24.710   1.00 25.02  ? 94  ALA A C   1 
ATOM   475   O  O   . ALA A  1 68  ? 7.160   2.853   23.990   1.00 31.98  ? 94  ALA A O   1 
ATOM   476   C  CB  . ALA A  1 68  ? 9.618   1.962   26.047   1.00 31.67  ? 94  ALA A CB  1 
ATOM   477   N  N   . THR A  1 69  ? 6.636   1.244   25.485   1.00 23.33  ? 95  THR A N   1 
ATOM   478   C  CA  . THR A  1 69  ? 5.217   1.560   25.584   1.00 29.89  ? 95  THR A CA  1 
ATOM   479   C  C   . THR A  1 69  ? 4.891   2.170   26.942   1.00 30.28  ? 95  THR A C   1 
ATOM   480   O  O   . THR A  1 69  ? 5.698   2.105   27.876   1.00 29.02  ? 95  THR A O   1 
ATOM   481   C  CB  . THR A  1 69  ? 4.340   0.311   25.387   1.00 27.38  ? 95  THR A CB  1 
ATOM   482   O  OG1 . THR A  1 69  ? 4.537   -0.599  26.476   1.00 27.06  ? 95  THR A OG1 1 
ATOM   483   C  CG2 . THR A  1 69  ? 4.675   -0.389  24.089   1.00 30.13  ? 95  THR A CG2 1 
ATOM   484   N  N   . PRO A  1 70  ? 3.715   2.800   27.080   1.00 26.44  ? 96  PRO A N   1 
ATOM   485   C  CA  . PRO A  1 70  ? 3.222   3.145   28.419   1.00 31.67  ? 96  PRO A CA  1 
ATOM   486   C  C   . PRO A  1 70  ? 2.636   1.933   29.127   1.00 34.18  ? 96  PRO A C   1 
ATOM   487   O  O   . PRO A  1 70  ? 2.745   0.806   28.633   1.00 33.26  ? 96  PRO A O   1 
ATOM   488   C  CB  . PRO A  1 70  ? 2.159   4.213   28.138   1.00 35.12  ? 96  PRO A CB  1 
ATOM   489   C  CG  . PRO A  1 70  ? 1.686   3.908   26.768   1.00 27.53  ? 96  PRO A CG  1 
ATOM   490   C  CD  . PRO A  1 70  ? 2.886   3.403   26.022   1.00 30.33  ? 96  PRO A CD  1 
ATOM   491   N  N   . VAL A  1 71  ? 2.023   2.144   30.290   1.00 33.50  ? 97  VAL A N   1 
ATOM   492   C  CA  . VAL A  1 71  ? 1.435   1.030   31.025   1.00 35.16  ? 97  VAL A CA  1 
ATOM   493   C  C   . VAL A  1 71  ? 0.275   0.462   30.216   1.00 36.21  ? 97  VAL A C   1 
ATOM   494   O  O   . VAL A  1 71  ? -0.693  1.167   29.911   1.00 39.34  ? 97  VAL A O   1 
ATOM   495   C  CB  . VAL A  1 71  ? 0.984   1.467   32.424   1.00 33.39  ? 97  VAL A CB  1 
ATOM   496   C  CG1 . VAL A  1 71  ? 0.217   0.343   33.105   1.00 32.78  ? 97  VAL A CG1 1 
ATOM   497   C  CG2 . VAL A  1 71  ? 2.184   1.870   33.259   1.00 36.42  ? 97  VAL A CG2 1 
ATOM   498   N  N   . LEU A  1 72  ? 0.371   -0.822  29.868   1.00 36.51  ? 98  LEU A N   1 
ATOM   499   C  CA  . LEU A  1 72  ? -0.637  -1.486  29.052   1.00 31.49  ? 98  LEU A CA  1 
ATOM   500   C  C   . LEU A  1 72  ? -1.719  -2.166  29.877   1.00 35.42  ? 98  LEU A C   1 
ATOM   501   O  O   . LEU A  1 72  ? -2.840  -2.337  29.384   1.00 37.97  ? 98  LEU A O   1 
ATOM   502   C  CB  . LEU A  1 72  ? 0.025   -2.522  28.145   1.00 26.17  ? 98  LEU A CB  1 
ATOM   503   C  CG  . LEU A  1 72  ? 1.085   -1.959  27.207   1.00 28.79  ? 98  LEU A CG  1 
ATOM   504   C  CD1 . LEU A  1 72  ? 1.731   -3.079  26.416   1.00 29.83  ? 98  LEU A CD1 1 
ATOM   505   C  CD2 . LEU A  1 72  ? 0.457   -0.932  26.280   1.00 30.68  ? 98  LEU A CD2 1 
ATOM   506   N  N   . GLY A  1 73  ? -1.417  -2.564  31.106   1.00 29.25  ? 99  GLY A N   1 
ATOM   507   C  CA  . GLY A  1 73  ? -2.417  -3.221  31.924   1.00 30.52  ? 99  GLY A CA  1 
ATOM   508   C  C   . GLY A  1 73  ? -1.869  -3.646  33.267   1.00 32.56  ? 99  GLY A C   1 
ATOM   509   O  O   . GLY A  1 73  ? -0.891  -3.087  33.766   1.00 37.48  ? 99  GLY A O   1 
ATOM   510   N  N   . GLY A  1 74  ? -2.522  -4.647  33.851   1.00 24.39  ? 100 GLY A N   1 
ATOM   511   C  CA  . GLY A  1 74  ? -2.152  -5.137  35.162   1.00 25.62  ? 100 GLY A CA  1 
ATOM   512   C  C   . GLY A  1 74  ? -1.264  -6.362  35.123   1.00 26.92  ? 100 GLY A C   1 
ATOM   513   O  O   . GLY A  1 74  ? -0.295  -6.410  34.363   1.00 25.51  ? 100 GLY A O   1 
ATOM   514   N  N   . ASN A  1 75  ? -1.593  -7.370  35.933   1.00 27.59  ? 101 ASN A N   1 
ATOM   515   C  CA  . ASN A  1 75  ? -0.778  -8.579  35.968   1.00 30.04  ? 101 ASN A CA  1 
ATOM   516   C  C   . ASN A  1 75  ? -0.907  -9.381  34.681   1.00 29.23  ? 101 ASN A C   1 
ATOM   517   O  O   . ASN A  1 75  ? 0.077   -9.951  34.200   1.00 30.34  ? 101 ASN A O   1 
ATOM   518   C  CB  . ASN A  1 75  ? -1.169  -9.442  37.163   1.00 38.59  ? 101 ASN A CB  1 
ATOM   519   C  CG  . ASN A  1 75  ? -0.932  -8.747  38.480   1.00 41.56  ? 101 ASN A CG  1 
ATOM   520   O  OD1 . ASN A  1 75  ? -0.100  -7.843  38.576   1.00 42.41  ? 101 ASN A OD1 1 
ATOM   521   N  ND2 . ASN A  1 75  ? -1.657  -9.170  39.509   1.00 35.87  ? 101 ASN A ND2 1 
ATOM   522   N  N   . SER A  1 76  ? -2.112  -9.455  34.120   1.00 31.39  ? 102 SER A N   1 
ATOM   523   C  CA  . SER A  1 76  ? -2.350  -10.169 32.875   1.00 24.06  ? 102 SER A CA  1 
ATOM   524   C  C   . SER A  1 76  ? -3.379  -9.407  32.057   1.00 24.43  ? 102 SER A C   1 
ATOM   525   O  O   . SER A  1 76  ? -4.312  -8.816  32.607   1.00 32.12  ? 102 SER A O   1 
ATOM   526   C  CB  . SER A  1 76  ? -2.833  -11.600 33.131   1.00 26.14  ? 102 SER A CB  1 
ATOM   527   O  OG  . SER A  1 76  ? -1.916  -12.310 33.946   1.00 26.61  ? 102 SER A OG  1 
ATOM   528   N  N   . PHE A  1 77  ? -3.210  -9.433  30.738   1.00 24.10  ? 103 PHE A N   1 
ATOM   529   C  CA  . PHE A  1 77  ? -4.093  -8.687  29.852   1.00 24.70  ? 103 PHE A CA  1 
ATOM   530   C  C   . PHE A  1 77  ? -3.945  -9.208  28.429   1.00 27.42  ? 103 PHE A C   1 
ATOM   531   O  O   . PHE A  1 77  ? -2.965  -9.880  28.089   1.00 23.04  ? 103 PHE A O   1 
ATOM   532   C  CB  . PHE A  1 77  ? -3.803  -7.181  29.904   1.00 18.43  ? 103 PHE A CB  1 
ATOM   533   C  CG  . PHE A  1 77  ? -2.357  -6.834  29.710   1.00 24.53  ? 103 PHE A CG  1 
ATOM   534   C  CD1 . PHE A  1 77  ? -1.505  -6.712  30.802   1.00 27.33  ? 103 PHE A CD1 1 
ATOM   535   C  CD2 . PHE A  1 77  ? -1.846  -6.621  28.440   1.00 21.48  ? 103 PHE A CD2 1 
ATOM   536   C  CE1 . PHE A  1 77  ? -0.172  -6.393  30.634   1.00 17.57  ? 103 PHE A CE1 1 
ATOM   537   C  CE2 . PHE A  1 77  ? -0.512  -6.300  28.264   1.00 27.78  ? 103 PHE A CE2 1 
ATOM   538   C  CZ  . PHE A  1 77  ? 0.327   -6.186  29.367   1.00 26.06  ? 103 PHE A CZ  1 
ATOM   539   N  N   . TYR A  1 78  ? -4.943  -8.885  27.603   1.00 21.59  ? 104 TYR A N   1 
ATOM   540   C  CA  . TYR A  1 78  ? -4.969  -9.236  26.191   1.00 21.05  ? 104 TYR A CA  1 
ATOM   541   C  C   . TYR A  1 78  ? -5.201  -7.984  25.356   1.00 23.75  ? 104 TYR A C   1 
ATOM   542   O  O   . TYR A  1 78  ? -6.012  -7.127  25.718   1.00 27.42  ? 104 TYR A O   1 
ATOM   543   C  CB  . TYR A  1 78  ? -6.065  -10.257 25.888   1.00 18.48  ? 104 TYR A CB  1 
ATOM   544   C  CG  . TYR A  1 78  ? -5.892  -11.603 26.552   1.00 21.16  ? 104 TYR A CG  1 
ATOM   545   C  CD1 . TYR A  1 78  ? -6.302  -11.815 27.862   1.00 19.07  ? 104 TYR A CD1 1 
ATOM   546   C  CD2 . TYR A  1 78  ? -5.334  -12.672 25.860   1.00 22.39  ? 104 TYR A CD2 1 
ATOM   547   C  CE1 . TYR A  1 78  ? -6.154  -13.054 28.463   1.00 19.28  ? 104 TYR A CE1 1 
ATOM   548   C  CE2 . TYR A  1 78  ? -5.181  -13.911 26.454   1.00 16.73  ? 104 TYR A CE2 1 
ATOM   549   C  CZ  . TYR A  1 78  ? -5.594  -14.097 27.751   1.00 19.29  ? 104 TYR A CZ  1 
ATOM   550   O  OH  . TYR A  1 78  ? -5.440  -15.332 28.339   1.00 24.57  ? 104 TYR A OH  1 
ATOM   551   N  N   . LEU A  1 79  ? -4.508  -7.892  24.231   1.00 24.64  ? 105 LEU A N   1 
ATOM   552   C  CA  . LEU A  1 79  ? -4.559  -6.747  23.337   1.00 22.18  ? 105 LEU A CA  1 
ATOM   553   C  C   . LEU A  1 79  ? -4.836  -7.228  21.921   1.00 23.90  ? 105 LEU A C   1 
ATOM   554   O  O   . LEU A  1 79  ? -4.697  -8.420  21.626   1.00 22.50  ? 105 LEU A O   1 
ATOM   555   C  CB  . LEU A  1 79  ? -3.237  -5.966  23.391   1.00 23.26  ? 105 LEU A CB  1 
ATOM   556   C  CG  . LEU A  1 79  ? -2.856  -5.435  24.778   1.00 25.44  ? 105 LEU A CG  1 
ATOM   557   C  CD1 . LEU A  1 79  ? -1.521  -4.707  24.748   1.00 25.35  ? 105 LEU A CD1 1 
ATOM   558   C  CD2 . LEU A  1 79  ? -3.943  -4.530  25.322   1.00 17.53  ? 105 LEU A CD2 1 
ATOM   559   N  N   . PRO A  1 80  ? -5.244  -6.329  21.022   1.00 25.17  ? 106 PRO A N   1 
ATOM   560   C  CA  . PRO A  1 80  ? -5.518  -6.727  19.629   1.00 22.24  ? 106 PRO A CA  1 
ATOM   561   C  C   . PRO A  1 80  ? -4.260  -7.203  18.926   1.00 26.15  ? 106 PRO A C   1 
ATOM   562   O  O   . PRO A  1 80  ? -3.253  -6.478  18.873   1.00 27.79  ? 106 PRO A O   1 
ATOM   563   C  CB  . PRO A  1 80  ? -6.043  -5.433  18.990   1.00 20.31  ? 106 PRO A CB  1 
ATOM   564   C  CG  . PRO A  1 80  ? -6.567  -4.645  20.122   1.00 20.30  ? 106 PRO A CG  1 
ATOM   565   C  CD  . PRO A  1 80  ? -5.666  -4.941  21.278   1.00 26.66  ? 106 PRO A CD  1 
ATOM   566   N  N   . PRO A  1 81  ? -4.279  -8.409  18.364   1.00 22.29  ? 107 PRO A N   1 
ATOM   567   C  CA  . PRO A  1 81  ? -3.116  -8.891  17.614   1.00 23.66  ? 107 PRO A CA  1 
ATOM   568   C  C   . PRO A  1 81  ? -2.972  -8.157  16.290   1.00 27.49  ? 107 PRO A C   1 
ATOM   569   O  O   . PRO A  1 81  ? -3.818  -7.361  15.881   1.00 27.34  ? 107 PRO A O   1 
ATOM   570   C  CB  . PRO A  1 81  ? -3.415  -10.377 17.405   1.00 22.90  ? 107 PRO A CB  1 
ATOM   571   C  CG  . PRO A  1 81  ? -4.893  -10.482 17.509   1.00 22.99  ? 107 PRO A CG  1 
ATOM   572   C  CD  . PRO A  1 81  ? -5.321  -9.439  18.495   1.00 20.91  ? 107 PRO A CD  1 
ATOM   573   N  N   . ALA A  1 82  ? -1.873  -8.452  15.608   1.00 29.53  ? 108 ALA A N   1 
ATOM   574   C  CA  . ALA A  1 82  ? -1.553  -7.818  14.342   1.00 28.82  ? 108 ALA A CA  1 
ATOM   575   C  C   . ALA A  1 82  ? -1.816  -8.775  13.188   1.00 28.75  ? 108 ALA A C   1 
ATOM   576   O  O   . ALA A  1 82  ? -1.798  -9.998  13.342   1.00 22.70  ? 108 ALA A O   1 
ATOM   577   C  CB  . ALA A  1 82  ? -0.093  -7.353  14.315   1.00 30.51  ? 108 ALA A CB  1 
ATOM   578   N  N   . GLY A  1 83  ? -2.038  -8.191  12.020   1.00 38.89  ? 109 GLY A N   1 
ATOM   579   C  CA  . GLY A  1 83  ? -2.346  -8.965  10.836   1.00 41.34  ? 109 GLY A CA  1 
ATOM   580   C  C   . GLY A  1 83  ? -2.884  -8.061  9.750    1.00 55.37  ? 109 GLY A C   1 
ATOM   581   O  O   . GLY A  1 83  ? -2.966  -6.837  9.909    1.00 52.23  ? 109 GLY A O   1 
ATOM   582   N  N   . ALA A  1 84  ? -3.240  -8.690  8.626    1.00 56.73  ? 110 ALA A N   1 
ATOM   583   C  CA  . ALA A  1 84  ? -3.769  -7.930  7.498    1.00 50.12  ? 110 ALA A CA  1 
ATOM   584   C  C   . ALA A  1 84  ? -5.103  -7.284  7.851    1.00 50.63  ? 110 ALA A C   1 
ATOM   585   O  O   . ALA A  1 84  ? -5.379  -6.146  7.450    1.00 44.85  ? 110 ALA A O   1 
ATOM   586   C  CB  . ALA A  1 84  ? -3.907  -8.832  6.272    1.00 48.69  ? 110 ALA A CB  1 
ATOM   587   N  N   . ALA A  1 85  ? -5.940  -7.996  8.613    1.00 51.19  ? 111 ALA A N   1 
ATOM   588   C  CA  . ALA A  1 85  ? -7.201  -7.420  9.067    1.00 46.97  ? 111 ALA A CA  1 
ATOM   589   C  C   . ALA A  1 85  ? -6.962  -6.231  9.989    1.00 56.37  ? 111 ALA A C   1 
ATOM   590   O  O   . ALA A  1 85  ? -7.649  -5.207  9.883    1.00 54.55  ? 111 ALA A O   1 
ATOM   591   C  CB  . ALA A  1 85  ? -8.038  -8.484  9.774    1.00 49.23  ? 111 ALA A CB  1 
ATOM   592   N  N   . GLY A  1 86  ? -5.975  -6.338  10.887   1.00 52.72  ? 112 GLY A N   1 
ATOM   593   C  CA  . GLY A  1 86  ? -5.671  -5.240  11.786   1.00 43.89  ? 112 GLY A CA  1 
ATOM   594   C  C   . GLY A  1 86  ? -4.930  -4.093  11.138   1.00 52.66  ? 112 GLY A C   1 
ATOM   595   O  O   . GLY A  1 86  ? -4.986  -2.968  11.646   1.00 51.73  ? 112 GLY A O   1 
ATOM   596   N  N   . ASP A  1 87  ? -4.246  -4.349  10.020   1.00 60.41  ? 113 ASP A N   1 
ATOM   597   C  CA  . ASP A  1 87  ? -3.542  -3.277  9.323    1.00 59.02  ? 113 ASP A CA  1 
ATOM   598   C  C   . ASP A  1 87  ? -4.524  -2.278  8.729    1.00 55.46  ? 113 ASP A C   1 
ATOM   599   O  O   . ASP A  1 87  ? -4.290  -1.065  8.771    1.00 54.44  ? 113 ASP A O   1 
ATOM   600   C  CB  . ASP A  1 87  ? -2.648  -3.862  8.227    1.00 51.90  ? 113 ASP A CB  1 
ATOM   601   C  CG  . ASP A  1 87  ? -1.377  -4.485  8.775    1.00 51.00  ? 113 ASP A CG  1 
ATOM   602   O  OD1 . ASP A  1 87  ? -0.478  -4.798  7.967    1.00 51.08  ? 113 ASP A OD1 1 
ATOM   603   O  OD2 . ASP A  1 87  ? -1.275  -4.666  10.008   1.00 52.00  ? 113 ASP A OD2 1 
ATOM   604   N  N   . ARG A  1 88  ? -5.639  -2.770  8.185    1.00 62.97  ? 114 ARG A N   1 
ATOM   605   C  CA  . ARG A  1 88  ? -6.649  -1.873  7.640    1.00 62.20  ? 114 ARG A CA  1 
ATOM   606   C  C   . ARG A  1 88  ? -7.412  -1.151  8.743    1.00 64.88  ? 114 ARG A C   1 
ATOM   607   O  O   . ARG A  1 88  ? -7.794  0.011   8.569    1.00 69.68  ? 114 ARG A O   1 
ATOM   608   C  CB  . ARG A  1 88  ? -7.613  -2.659  6.749    1.00 59.17  ? 114 ARG A CB  1 
ATOM   609   C  CG  . ARG A  1 88  ? -6.942  -3.418  5.611    1.00 54.63  ? 114 ARG A CG  1 
ATOM   610   C  CD  . ARG A  1 88  ? -7.965  -4.194  4.788    1.00 52.49  ? 114 ARG A CD  1 
ATOM   611   N  NE  . ARG A  1 88  ? -8.565  -5.296  5.540    1.00 51.41  ? 114 ARG A NE  1 
ATOM   612   C  CZ  . ARG A  1 88  ? -8.219  -6.573  5.401    1.00 51.09  ? 114 ARG A CZ  1 
ATOM   613   N  NH1 . ARG A  1 88  ? -7.276  -6.913  4.532    1.00 51.22  ? 114 ARG A NH1 1 
ATOM   614   N  NH2 . ARG A  1 88  ? -8.816  -7.513  6.126    1.00 40.12  ? 114 ARG A NH2 1 
ATOM   615   N  N   . ALA A  1 89  ? -7.619  -1.806  9.889    1.00 69.90  ? 115 ALA A N   1 
ATOM   616   C  CA  . ALA A  1 89  ? -8.289  -1.160  11.011   1.00 64.17  ? 115 ALA A CA  1 
ATOM   617   C  C   . ALA A  1 89  ? -7.481  -0.004  11.584   1.00 67.89  ? 115 ALA A C   1 
ATOM   618   O  O   . ALA A  1 89  ? -8.063  0.905   12.187   1.00 68.11  ? 115 ALA A O   1 
ATOM   619   C  CB  . ALA A  1 89  ? -8.583  -2.186  12.106   1.00 53.73  ? 115 ALA A CB  1 
ATOM   620   N  N   . ARG A  1 90  ? -6.160  -0.010  11.401   1.00 67.37  ? 116 ARG A N   1 
ATOM   621   C  CA  . ARG A  1 90  ? -5.338  1.105   11.854   1.00 70.63  ? 116 ARG A CA  1 
ATOM   622   C  C   . ARG A  1 90  ? -5.307  2.237   10.833   1.00 81.68  ? 116 ARG A C   1 
ATOM   623   O  O   . ARG A  1 90  ? -5.216  3.410   11.215   1.00 83.42  ? 116 ARG A O   1 
ATOM   624   C  CB  . ARG A  1 90  ? -3.925  0.610   12.166   1.00 67.96  ? 116 ARG A CB  1 
ATOM   625   C  CG  . ARG A  1 90  ? -2.849  1.608   12.009   1.00 78.98  ? 116 ARG A CG  1 
ATOM   626   C  CD  . ARG A  1 90  ? -1.590  1.221   12.752   1.00 78.84  ? 116 ARG A CD  1 
ATOM   627   N  NE  . ARG A  1 90  ? -1.405  1.982   13.921   1.00 79.88  ? 116 ARG A NE  1 
ATOM   628   C  CZ  . ARG A  1 90  ? -1.615  1.560   15.104   1.00 79.89  ? 116 ARG A CZ  1 
ATOM   629   N  NH1 . ARG A  1 90  ? -1.411  2.335   16.096   1.00 70.01  ? 116 ARG A NH1 1 
ATOM   630   N  NH2 . ARG A  1 90  ? -2.021  0.368   15.298   1.00 74.51  ? 116 ARG A NH2 1 
ATOM   631   N  N   . ALA A  1 91  ? -5.406  1.911   9.541    1.00 80.62  ? 117 ALA A N   1 
ATOM   632   C  CA  . ALA A  1 91  ? -5.433  2.933   8.502    1.00 79.81  ? 117 ALA A CA  1 
ATOM   633   C  C   . ALA A  1 91  ? -6.651  3.843   8.603    1.00 85.77  ? 117 ALA A C   1 
ATOM   634   O  O   . ALA A  1 91  ? -6.691  4.872   7.920    1.00 90.96  ? 117 ALA A O   1 
ATOM   635   C  CB  . ALA A  1 91  ? -5.393  2.278   7.118    1.00 75.84  ? 117 ALA A CB  1 
ATOM   636   N  N   . ARG A  1 92  ? -7.642  3.491   9.421    1.00 78.51  ? 118 ARG A N   1 
ATOM   637   C  CA  . ARG A  1 92  ? -8.804  4.339   9.642    1.00 77.47  ? 118 ARG A CA  1 
ATOM   638   C  C   . ARG A  1 92  ? -8.683  5.164   10.915   1.00 80.18  ? 118 ARG A C   1 
ATOM   639   O  O   . ARG A  1 92  ? -9.632  5.864   11.278   1.00 87.20  ? 118 ARG A O   1 
ATOM   640   C  CB  . ARG A  1 92  ? -10.085 3.498   9.695    1.00 78.39  ? 118 ARG A CB  1 
ATOM   641   C  CG  . ARG A  1 92  ? -10.059 2.227   8.861    1.00 78.54  ? 118 ARG A CG  1 
ATOM   642   C  CD  . ARG A  1 92  ? -11.361 1.445   8.992    1.00 70.98  ? 118 ARG A CD  1 
ATOM   643   N  NE  . ARG A  1 92  ? -11.691 1.125   10.392   1.00 77.25  ? 118 ARG A NE  1 
ATOM   644   C  CZ  . ARG A  1 92  ? -11.867 -0.105  10.874   1.00 78.76  ? 118 ARG A CZ  1 
ATOM   645   N  NH1 . ARG A  1 92  ? -11.731 -1.149  10.071   1.00 73.18  ? 118 ARG A NH1 1 
ATOM   646   N  NH2 . ARG A  1 92  ? -12.179 -0.278  12.155   1.00 59.09  ? 118 ARG A NH2 1 
ATOM   647   N  N   . ALA A  1 93  ? -7.548  5.092   11.603   1.00 82.91  ? 119 ALA A N   1 
ATOM   648   C  CA  . ALA A  1 93  ? -7.365  5.826   12.851   1.00 78.47  ? 119 ALA A CA  1 
ATOM   649   C  C   . ALA A  1 93  ? -5.926  6.311   12.992   1.00 75.03  ? 119 ALA A C   1 
ATOM   650   O  O   . ALA A  1 93  ? -5.682  7.491   13.241   1.00 75.95  ? 119 ALA A O   1 
ATOM   651   C  CB  . ALA A  1 93  ? -7.755  4.959   14.035   1.00 67.12  ? 119 ALA A CB  1 
ATOM   652   N  N   . ASP A  1 98  ? -6.109  8.586   18.393   1.00 92.32  ? 124 ASP A N   1 
ATOM   653   C  CA  . ASP A  1 98  ? -4.802  8.188   18.903   1.00 90.95  ? 124 ASP A CA  1 
ATOM   654   C  C   . ASP A  1 98  ? -4.413  6.844   18.281   1.00 90.33  ? 124 ASP A C   1 
ATOM   655   O  O   . ASP A  1 98  ? -5.222  6.209   17.601   1.00 80.41  ? 124 ASP A O   1 
ATOM   656   C  CB  . ASP A  1 98  ? -4.822  8.122   20.442   1.00 86.73  ? 124 ASP A CB  1 
ATOM   657   C  CG  . ASP A  1 98  ? -3.520  7.593   21.034   1.00 96.11  ? 124 ASP A CG  1 
ATOM   658   O  OD1 . ASP A  1 98  ? -3.556  7.001   22.134   1.00 93.28  ? 124 ASP A OD1 1 
ATOM   659   O  OD2 . ASP A  1 98  ? -2.463  7.757   20.386   1.00 98.54  ? 124 ASP A OD2 1 
ATOM   660   N  N   . GLN A  1 99  ? -3.169  6.427   18.500   1.00 90.69  ? 125 GLN A N   1 
ATOM   661   C  CA  . GLN A  1 99  ? -2.629  5.195   17.953   1.00 84.66  ? 125 GLN A CA  1 
ATOM   662   C  C   . GLN A  1 99  ? -2.344  4.190   19.064   1.00 79.92  ? 125 GLN A C   1 
ATOM   663   O  O   . GLN A  1 99  ? -2.071  4.560   20.211   1.00 75.34  ? 125 GLN A O   1 
ATOM   664   C  CB  . GLN A  1 99  ? -1.358  5.480   17.146   1.00 80.29  ? 125 GLN A CB  1 
ATOM   665   C  CG  . GLN A  1 99  ? -1.632  6.265   15.865   1.00 89.48  ? 125 GLN A CG  1 
ATOM   666   C  CD  . GLN A  1 99  ? -0.461  7.125   15.429   1.00 91.67  ? 125 GLN A CD  1 
ATOM   667   O  OE1 . GLN A  1 99  ? 0.680   6.898   15.834   1.00 91.21  ? 125 GLN A OE1 1 
ATOM   668   N  NE2 . GLN A  1 99  ? -0.742  8.130   14.604   1.00 82.89  ? 125 GLN A NE2 1 
ATOM   669   N  N   . ASP A  1 100 ? -2.423  2.911   18.696   1.00 68.29  ? 126 ASP A N   1 
ATOM   670   C  CA  . ASP A  1 100 ? -2.268  1.724   19.527   1.00 52.91  ? 126 ASP A CA  1 
ATOM   671   C  C   . ASP A  1 100 ? -1.169  1.881   20.569   1.00 53.72  ? 126 ASP A C   1 
ATOM   672   O  O   . ASP A  1 100 ? -0.043  2.266   20.230   1.00 52.83  ? 126 ASP A O   1 
ATOM   673   C  CB  . ASP A  1 100 ? -1.963  0.525   18.629   1.00 50.51  ? 126 ASP A CB  1 
ATOM   674   C  CG  . ASP A  1 100 ? -2.379  -0.787  19.242   1.00 57.21  ? 126 ASP A CG  1 
ATOM   675   O  OD1 . ASP A  1 100 ? -2.158  -0.991  20.456   1.00 52.88  ? 126 ASP A OD1 1 
ATOM   676   O  OD2 . ASP A  1 100 ? -2.933  -1.619  18.494   1.00 66.69  ? 126 ASP A OD2 1 
ATOM   677   N  N   . PRO A  1 101 ? -1.457  1.591   21.844   1.00 57.56  ? 127 PRO A N   1 
ATOM   678   C  CA  . PRO A  1 101 ? -0.391  1.660   22.859   1.00 55.30  ? 127 PRO A CA  1 
ATOM   679   C  C   . PRO A  1 101 ? 0.617   0.532   22.749   1.00 47.05  ? 127 PRO A C   1 
ATOM   680   O  O   . PRO A  1 101 ? 1.819   0.764   22.936   1.00 42.71  ? 127 PRO A O   1 
ATOM   681   C  CB  . PRO A  1 101 ? -1.169  1.607   24.181   1.00 51.91  ? 127 PRO A CB  1 
ATOM   682   C  CG  . PRO A  1 101 ? -2.427  0.886   23.839   1.00 41.65  ? 127 PRO A CG  1 
ATOM   683   C  CD  . PRO A  1 101 ? -2.773  1.313   22.445   1.00 49.98  ? 127 PRO A CD  1 
ATOM   684   N  N   . GLY A  1 102 ? 0.162   -0.685  22.441   1.00 41.08  ? 128 GLY A N   1 
ATOM   685   C  CA  . GLY A  1 102 ? 1.008   -1.856  22.361   1.00 35.88  ? 128 GLY A CA  1 
ATOM   686   C  C   . GLY A  1 102 ? 1.819   -2.008  21.097   1.00 35.93  ? 128 GLY A C   1 
ATOM   687   O  O   . GLY A  1 102 ? 2.423   -3.065  20.894   1.00 26.81  ? 128 GLY A O   1 
ATOM   688   N  N   . LEU A  1 103 ? 1.863   -0.981  20.247   1.00 37.19  ? 129 LEU A N   1 
ATOM   689   C  CA  . LEU A  1 103 ? 2.668   -0.983  19.032   1.00 30.79  ? 129 LEU A CA  1 
ATOM   690   C  C   . LEU A  1 103 ? 3.953   -0.200  19.271   1.00 33.41  ? 129 LEU A C   1 
ATOM   691   O  O   . LEU A  1 103 ? 3.918   0.897   19.836   1.00 38.65  ? 129 LEU A O   1 
ATOM   692   C  CB  . LEU A  1 103 ? 1.899   -0.368  17.863   1.00 39.26  ? 129 LEU A CB  1 
ATOM   693   C  CG  . LEU A  1 103 ? 2.667   -0.265  16.540   1.00 36.99  ? 129 LEU A CG  1 
ATOM   694   C  CD1 . LEU A  1 103 ? 2.839   -1.634  15.891   1.00 29.59  ? 129 LEU A CD1 1 
ATOM   695   C  CD2 . LEU A  1 103 ? 1.989   0.711   15.593   1.00 29.26  ? 129 LEU A CD2 1 
ATOM   696   N  N   . VAL A  1 104 ? 5.080   -0.765  18.839   1.00 33.52  ? 130 VAL A N   1 
ATOM   697   C  CA  . VAL A  1 104 ? 6.390   -0.132  18.947   1.00 26.15  ? 130 VAL A CA  1 
ATOM   698   C  C   . VAL A  1 104 ? 6.988   -0.028  17.552   1.00 28.67  ? 130 VAL A C   1 
ATOM   699   O  O   . VAL A  1 104 ? 7.041   -1.024  16.820   1.00 28.85  ? 130 VAL A O   1 
ATOM   700   C  CB  . VAL A  1 104 ? 7.322   -0.922  19.885   1.00 25.62  ? 130 VAL A CB  1 
ATOM   701   C  CG1 . VAL A  1 104 ? 8.702   -0.274  19.958   1.00 28.03  ? 130 VAL A CG1 1 
ATOM   702   C  CG2 . VAL A  1 104 ? 6.714   -1.010  21.263   1.00 22.54  ? 130 VAL A CG2 1 
ATOM   703   N  N   . VAL A  1 105 ? 7.456   1.167   17.193   1.00 24.53  ? 131 VAL A N   1 
ATOM   704   C  CA  . VAL A  1 105 ? 8.055   1.425   15.889   1.00 28.90  ? 131 VAL A CA  1 
ATOM   705   C  C   . VAL A  1 105 ? 9.482   1.918   16.092   1.00 31.42  ? 131 VAL A C   1 
ATOM   706   O  O   . VAL A  1 105 ? 9.707   2.904   16.804   1.00 29.90  ? 131 VAL A O   1 
ATOM   707   C  CB  . VAL A  1 105 ? 7.233   2.445   15.079   1.00 24.20  ? 131 VAL A CB  1 
ATOM   708   C  CG1 . VAL A  1 105 ? 7.974   2.841   13.819   1.00 24.12  ? 131 VAL A CG1 1 
ATOM   709   C  CG2 . VAL A  1 105 ? 5.871   1.872   14.740   1.00 23.97  ? 131 VAL A CG2 1 
ATOM   710   N  N   . ILE A  1 106 ? 10.432  1.252   15.447   1.00 29.03  ? 132 ILE A N   1 
ATOM   711   C  CA  . ILE A  1 106 ? 11.845  1.599   15.509   1.00 24.83  ? 132 ILE A CA  1 
ATOM   712   C  C   . ILE A  1 106 ? 12.336  1.875   14.091   1.00 28.47  ? 132 ILE A C   1 
ATOM   713   O  O   . ILE A  1 106 ? 12.656  0.951   13.342   1.00 29.80  ? 132 ILE A O   1 
ATOM   714   C  CB  . ILE A  1 106 ? 12.670  0.486   16.179   1.00 24.74  ? 132 ILE A CB  1 
ATOM   715   C  CG1 . ILE A  1 106 ? 12.150  0.210   17.594   1.00 31.79  ? 132 ILE A CG1 1 
ATOM   716   C  CG2 . ILE A  1 106 ? 14.146  0.853   16.221   1.00 23.23  ? 132 ILE A CG2 1 
ATOM   717   C  CD1 . ILE A  1 106 ? 12.873  -0.926  18.311   1.00 23.44  ? 132 ILE A CD1 1 
ATOM   718   N  N   . PRO A  1 107 ? 12.405  3.138   13.685   1.00 27.61  ? 133 PRO A N   1 
ATOM   719   C  CA  . PRO A  1 107 ? 12.918  3.461   12.349   1.00 29.53  ? 133 PRO A CA  1 
ATOM   720   C  C   . PRO A  1 107 ? 14.431  3.315   12.271   1.00 32.70  ? 133 PRO A C   1 
ATOM   721   O  O   . PRO A  1 107 ? 15.148  3.414   13.270   1.00 32.06  ? 133 PRO A O   1 
ATOM   722   C  CB  . PRO A  1 107 ? 12.495  4.921   12.153   1.00 30.54  ? 133 PRO A CB  1 
ATOM   723   C  CG  . PRO A  1 107 ? 12.397  5.467   13.543   1.00 27.81  ? 133 PRO A CG  1 
ATOM   724   C  CD  . PRO A  1 107 ? 11.919  4.331   14.402   1.00 23.95  ? 133 PRO A CD  1 
ATOM   725   N  N   . PHE A  1 108 ? 14.916  3.083   11.049   1.00 31.67  ? 134 PHE A N   1 
ATOM   726   C  CA  . PHE A  1 108 ? 16.346  2.950   10.810   1.00 31.05  ? 134 PHE A CA  1 
ATOM   727   C  C   . PHE A  1 108 ? 16.693  3.503   9.435    1.00 36.20  ? 134 PHE A C   1 
ATOM   728   O  O   . PHE A  1 108 ? 15.869  3.496   8.516    1.00 34.55  ? 134 PHE A O   1 
ATOM   729   C  CB  . PHE A  1 108 ? 16.823  1.492   10.932   1.00 29.47  ? 134 PHE A CB  1 
ATOM   730   C  CG  . PHE A  1 108 ? 16.109  0.532   10.021   1.00 34.25  ? 134 PHE A CG  1 
ATOM   731   C  CD1 . PHE A  1 108 ? 16.567  0.302   8.730    1.00 38.59  ? 134 PHE A CD1 1 
ATOM   732   C  CD2 . PHE A  1 108 ? 14.991  -0.156  10.460   1.00 34.91  ? 134 PHE A CD2 1 
ATOM   733   C  CE1 . PHE A  1 108 ? 15.912  -0.583  7.888    1.00 29.90  ? 134 PHE A CE1 1 
ATOM   734   C  CE2 . PHE A  1 108 ? 14.332  -1.042  9.624    1.00 36.84  ? 134 PHE A CE2 1 
ATOM   735   C  CZ  . PHE A  1 108 ? 14.796  -1.255  8.335    1.00 35.65  ? 134 PHE A CZ  1 
ATOM   736   N  N   . GLN A  1 109 ? 17.930  3.995   9.311    1.00 38.57  ? 135 GLN A N   1 
ATOM   737   C  CA  . GLN A  1 109 ? 18.438  4.529   8.056    1.00 33.76  ? 135 GLN A CA  1 
ATOM   738   C  C   . GLN A  1 109 ? 19.501  3.654   7.406    1.00 32.36  ? 135 GLN A C   1 
ATOM   739   O  O   . GLN A  1 109 ? 19.706  3.764   6.193    1.00 36.43  ? 135 GLN A O   1 
ATOM   740   C  CB  . GLN A  1 109 ? 19.022  5.935   8.272    1.00 31.44  ? 135 GLN A CB  1 
ATOM   741   C  CG  . GLN A  1 109 ? 20.168  5.964   9.264    1.00 29.82  ? 135 GLN A CG  1 
ATOM   742   C  CD  . GLN A  1 109 ? 20.534  7.362   9.714    1.00 27.12  ? 135 GLN A CD  1 
ATOM   743   O  OE1 . GLN A  1 109 ? 19.797  8.317   9.486    1.00 30.12  ? 135 GLN A OE1 1 
ATOM   744   N  NE2 . GLN A  1 109 ? 21.679  7.486   10.366   1.00 25.93  ? 135 GLN A NE2 1 
ATOM   745   N  N   . PHE A  1 110 ? 20.168  2.791   8.169    1.00 25.57  ? 136 PHE A N   1 
ATOM   746   C  CA  . PHE A  1 110 ? 21.215  1.944   7.619    1.00 29.27  ? 136 PHE A CA  1 
ATOM   747   C  C   . PHE A  1 110 ? 20.614  0.820   6.770    1.00 34.67  ? 136 PHE A C   1 
ATOM   748   O  O   . PHE A  1 110 ? 19.398  0.613   6.728    1.00 35.25  ? 136 PHE A O   1 
ATOM   749   C  CB  . PHE A  1 110 ? 22.073  1.366   8.743    1.00 30.77  ? 136 PHE A CB  1 
ATOM   750   C  CG  . PHE A  1 110 ? 21.281  0.672   9.819    1.00 32.71  ? 136 PHE A CG  1 
ATOM   751   C  CD1 . PHE A  1 110 ? 20.851  -0.637  9.653    1.00 30.99  ? 136 PHE A CD1 1 
ATOM   752   C  CD2 . PHE A  1 110 ? 20.967  1.331   11.001   1.00 36.23  ? 136 PHE A CD2 1 
ATOM   753   C  CE1 . PHE A  1 110 ? 20.119  -1.275  10.643   1.00 33.79  ? 136 PHE A CE1 1 
ATOM   754   C  CE2 . PHE A  1 110 ? 20.235  0.699   11.997   1.00 34.70  ? 136 PHE A CE2 1 
ATOM   755   C  CZ  . PHE A  1 110 ? 19.810  -0.606  11.817   1.00 33.05  ? 136 PHE A CZ  1 
ATOM   756   N  N   . ALA A  1 111 ? 21.491  0.080   6.092    1.00 33.75  ? 137 ALA A N   1 
ATOM   757   C  CA  . ALA A  1 111 ? 21.053  -1.073  5.317    1.00 34.61  ? 137 ALA A CA  1 
ATOM   758   C  C   . ALA A  1 111 ? 20.637  -2.200  6.252    1.00 34.70  ? 137 ALA A C   1 
ATOM   759   O  O   . ALA A  1 111 ? 21.401  -2.596  7.137    1.00 37.75  ? 137 ALA A O   1 
ATOM   760   C  CB  . ALA A  1 111 ? 22.163  -1.547  4.384    1.00 30.26  ? 137 ALA A CB  1 
ATOM   761   N  N   . TRP A  1 112 ? 19.430  -2.710  6.059    1.00 27.70  ? 138 TRP A N   1 
ATOM   762   C  CA  . TRP A  1 112 ? 18.907  -3.747  6.939    1.00 29.58  ? 138 TRP A CA  1 
ATOM   763   C  C   . TRP A  1 112 ? 19.733  -5.019  6.787    1.00 31.53  ? 138 TRP A C   1 
ATOM   764   O  O   . TRP A  1 112 ? 19.823  -5.557  5.676    1.00 33.06  ? 138 TRP A O   1 
ATOM   765   C  CB  . TRP A  1 112 ? 17.435  -4.017  6.629    1.00 32.02  ? 138 TRP A CB  1 
ATOM   766   C  CG  . TRP A  1 112 ? 16.825  -5.068  7.512    1.00 28.76  ? 138 TRP A CG  1 
ATOM   767   C  CD1 . TRP A  1 112 ? 16.366  -6.295  7.133    1.00 32.26  ? 138 TRP A CD1 1 
ATOM   768   C  CD2 . TRP A  1 112 ? 16.617  -4.982  8.926    1.00 27.00  ? 138 TRP A CD2 1 
ATOM   769   N  NE1 . TRP A  1 112 ? 15.886  -6.980  8.221    1.00 32.79  ? 138 TRP A NE1 1 
ATOM   770   C  CE2 . TRP A  1 112 ? 16.029  -6.196  9.336    1.00 34.85  ? 138 TRP A CE2 1 
ATOM   771   C  CE3 . TRP A  1 112 ? 16.869  -3.997  9.886    1.00 27.57  ? 138 TRP A CE3 1 
ATOM   772   C  CZ2 . TRP A  1 112 ? 15.691  -6.453  10.667   1.00 32.44  ? 138 TRP A CZ2 1 
ATOM   773   C  CZ3 . TRP A  1 112 ? 16.534  -4.253  11.206   1.00 32.40  ? 138 TRP A CZ3 1 
ATOM   774   C  CH2 . TRP A  1 112 ? 15.952  -5.472  11.585   1.00 28.82  ? 138 TRP A CH2 1 
ATOM   775   N  N   . PRO A  1 113 ? 20.355  -5.527  7.852    1.00 35.08  ? 139 PRO A N   1 
ATOM   776   C  CA  . PRO A  1 113 ? 21.226  -6.701  7.728    1.00 35.62  ? 139 PRO A CA  1 
ATOM   777   C  C   . PRO A  1 113 ? 20.508  -8.042  7.759    1.00 36.49  ? 139 PRO A C   1 
ATOM   778   O  O   . PRO A  1 113 ? 21.184  -9.071  7.847    1.00 34.96  ? 139 PRO A O   1 
ATOM   779   C  CB  . PRO A  1 113 ? 22.149  -6.554  8.946    1.00 34.19  ? 139 PRO A CB  1 
ATOM   780   C  CG  . PRO A  1 113 ? 21.290  -5.897  9.969    1.00 34.48  ? 139 PRO A CG  1 
ATOM   781   C  CD  . PRO A  1 113 ? 20.380  -4.958  9.213    1.00 33.72  ? 139 PRO A CD  1 
ATOM   782   N  N   . ARG A  1 114 ? 19.171  -8.059  7.703    1.00 33.52  ? 140 ARG A N   1 
ATOM   783   C  CA  . ARG A  1 114 ? 18.360  -9.278  7.685    1.00 32.90  ? 140 ARG A CA  1 
ATOM   784   C  C   . ARG A  1 114 ? 18.439  -10.054 9.001    1.00 38.15  ? 140 ARG A C   1 
ATOM   785   O  O   . ARG A  1 114 ? 17.417  -10.519 9.514    1.00 34.10  ? 140 ARG A O   1 
ATOM   786   C  CB  . ARG A  1 114 ? 18.759  -10.186 6.513    1.00 37.85  ? 140 ARG A CB  1 
ATOM   787   C  CG  . ARG A  1 114 ? 18.434  -9.631  5.114    1.00 46.80  ? 140 ARG A CG  1 
ATOM   788   C  CD  . ARG A  1 114 ? 19.555  -8.754  4.541    1.00 41.20  ? 140 ARG A CD  1 
ATOM   789   N  NE  . ARG A  1 114 ? 20.771  -9.514  4.241    1.00 59.72  ? 140 ARG A NE  1 
ATOM   790   C  CZ  . ARG A  1 114 ? 21.921  -8.978  3.824    1.00 60.95  ? 140 ARG A CZ  1 
ATOM   791   N  NH1 . ARG A  1 114 ? 22.965  -9.759  3.579    1.00 51.30  ? 140 ARG A NH1 1 
ATOM   792   N  NH2 . ARG A  1 114 ? 22.035  -7.665  3.655    1.00 52.91  ? 140 ARG A NH2 1 
ATOM   793   N  N   . SER A  1 115 ? 19.640  -10.205 9.553    1.00 44.03  ? 141 SER A N   1 
ATOM   794   C  CA  . SER A  1 115 ? 19.850  -10.896 10.818   1.00 37.32  ? 141 SER A CA  1 
ATOM   795   C  C   . SER A  1 115 ? 19.870  -9.890  11.962   1.00 36.96  ? 141 SER A C   1 
ATOM   796   O  O   . SER A  1 115 ? 20.367  -8.770  11.809   1.00 33.84  ? 141 SER A O   1 
ATOM   797   C  CB  . SER A  1 115 ? 21.159  -11.684 10.797   1.00 36.69  ? 141 SER A CB  1 
ATOM   798   O  OG  . SER A  1 115 ? 22.271  -10.807 10.742   1.00 50.49  ? 141 SER A OG  1 
ATOM   799   N  N   . PHE A  1 116 ? 19.342  -10.301 13.113   1.00 34.36  ? 142 PHE A N   1 
ATOM   800   C  CA  . PHE A  1 116 ? 19.159  -9.389  14.233   1.00 33.22  ? 142 PHE A CA  1 
ATOM   801   C  C   . PHE A  1 116 ? 19.013  -10.194 15.518   1.00 36.94  ? 142 PHE A C   1 
ATOM   802   O  O   . PHE A  1 116 ? 18.892  -11.421 15.499   1.00 37.64  ? 142 PHE A O   1 
ATOM   803   C  CB  . PHE A  1 116 ? 17.925  -8.507  14.031   1.00 31.15  ? 142 PHE A CB  1 
ATOM   804   C  CG  . PHE A  1 116 ? 16.624  -9.264  14.112   1.00 34.59  ? 142 PHE A CG  1 
ATOM   805   C  CD1 . PHE A  1 116 ? 16.180  -10.027 13.045   1.00 36.80  ? 142 PHE A CD1 1 
ATOM   806   C  CD2 . PHE A  1 116 ? 15.859  -9.231  15.268   1.00 32.46  ? 142 PHE A CD2 1 
ATOM   807   C  CE1 . PHE A  1 116 ? 14.993  -10.728 13.122   1.00 34.57  ? 142 PHE A CE1 1 
ATOM   808   C  CE2 . PHE A  1 116 ? 14.672  -9.932  15.354   1.00 33.11  ? 142 PHE A CE2 1 
ATOM   809   C  CZ  . PHE A  1 116 ? 14.239  -10.681 14.280   1.00 40.65  ? 142 PHE A CZ  1 
ATOM   810   N  N   . THR A  1 117 ? 19.014  -9.475  16.640   1.00 32.86  ? 143 THR A N   1 
ATOM   811   C  CA  . THR A  1 117 ? 18.688  -10.035 17.946   1.00 30.34  ? 143 THR A CA  1 
ATOM   812   C  C   . THR A  1 117 ? 17.687  -9.112  18.625   1.00 32.89  ? 143 THR A C   1 
ATOM   813   O  O   . THR A  1 117 ? 17.949  -7.914  18.776   1.00 33.21  ? 143 THR A O   1 
ATOM   814   C  CB  . THR A  1 117 ? 19.936  -10.204 18.814   1.00 34.53  ? 143 THR A CB  1 
ATOM   815   O  OG1 . THR A  1 117 ? 20.833  -11.129 18.190   1.00 43.05  ? 143 THR A OG1 1 
ATOM   816   C  CG2 . THR A  1 117 ? 19.555  -10.736 20.187   1.00 33.20  ? 143 THR A CG2 1 
ATOM   817   N  N   . LEU A  1 118 ? 16.540  -9.661  19.017   1.00 29.75  ? 144 LEU A N   1 
ATOM   818   C  CA  . LEU A  1 118 ? 15.476  -8.903  19.660   1.00 25.28  ? 144 LEU A CA  1 
ATOM   819   C  C   . LEU A  1 118 ? 15.410  -9.259  21.139   1.00 27.48  ? 144 LEU A C   1 
ATOM   820   O  O   . LEU A  1 118 ? 15.376  -10.442 21.494   1.00 26.70  ? 144 LEU A O   1 
ATOM   821   C  CB  . LEU A  1 118 ? 14.129  -9.183  18.990   1.00 23.99  ? 144 LEU A CB  1 
ATOM   822   C  CG  . LEU A  1 118 ? 12.877  -8.666  19.703   1.00 20.97  ? 144 LEU A CG  1 
ATOM   823   C  CD1 . LEU A  1 118 ? 12.867  -7.151  19.741   1.00 20.32  ? 144 LEU A CD1 1 
ATOM   824   C  CD2 . LEU A  1 118 ? 11.622  -9.197  19.029   1.00 25.52  ? 144 LEU A CD2 1 
ATOM   825   N  N   . ILE A  1 119 ? 15.390  -8.239  21.993   1.00 25.52  ? 145 ILE A N   1 
ATOM   826   C  CA  . ILE A  1 119 ? 15.245  -8.406  23.435   1.00 24.84  ? 145 ILE A CA  1 
ATOM   827   C  C   . ILE A  1 119 ? 14.017  -7.628  23.888   1.00 25.47  ? 145 ILE A C   1 
ATOM   828   O  O   . ILE A  1 119 ? 13.907  -6.425  23.621   1.00 27.03  ? 145 ILE A O   1 
ATOM   829   C  CB  . ILE A  1 119 ? 16.501  -7.937  24.191   1.00 33.08  ? 145 ILE A CB  1 
ATOM   830   C  CG1 . ILE A  1 119 ? 17.746  -8.622  23.623   1.00 34.35  ? 145 ILE A CG1 1 
ATOM   831   C  CG2 . ILE A  1 119 ? 16.365  -8.229  25.684   1.00 24.56  ? 145 ILE A CG2 1 
ATOM   832   C  CD1 . ILE A  1 119 ? 19.020  -8.299  24.376   1.00 36.79  ? 145 ILE A CD1 1 
ATOM   833   N  N   . VAL A  1 120 ? 13.101  -8.307  24.577   1.00 22.06  ? 146 VAL A N   1 
ATOM   834   C  CA  . VAL A  1 120 ? 11.877  -7.697  25.088   1.00 22.42  ? 146 VAL A CA  1 
ATOM   835   C  C   . VAL A  1 120 ? 11.880  -7.795  26.607   1.00 23.25  ? 146 VAL A C   1 
ATOM   836   O  O   . VAL A  1 120 ? 12.207  -8.848  27.166   1.00 24.21  ? 146 VAL A O   1 
ATOM   837   C  CB  . VAL A  1 120 ? 10.617  -8.364  24.505   1.00 23.68  ? 146 VAL A CB  1 
ATOM   838   C  CG1 . VAL A  1 120 ? 9.360   -7.631  24.973   1.00 22.85  ? 146 VAL A CG1 1 
ATOM   839   C  CG2 . VAL A  1 120 ? 10.685  -8.408  22.985   1.00 19.80  ? 146 VAL A CG2 1 
ATOM   840   N  N   . GLU A  1 121 ? 11.526  -6.696  27.272   1.00 27.26  ? 147 GLU A N   1 
ATOM   841   C  CA  . GLU A  1 121 ? 11.513  -6.624  28.727   1.00 27.45  ? 147 GLU A CA  1 
ATOM   842   C  C   . GLU A  1 121 ? 10.162  -6.112  29.203   1.00 29.22  ? 147 GLU A C   1 
ATOM   843   O  O   . GLU A  1 121 ? 9.573   -5.224  28.581   1.00 29.06  ? 147 GLU A O   1 
ATOM   844   C  CB  . GLU A  1 121 ? 12.620  -5.700  29.246   1.00 26.71  ? 147 GLU A CB  1 
ATOM   845   C  CG  . GLU A  1 121 ? 14.032  -6.191  28.982   1.00 26.84  ? 147 GLU A CG  1 
ATOM   846   C  CD  . GLU A  1 121 ? 15.088  -5.207  29.453   1.00 32.83  ? 147 GLU A CD  1 
ATOM   847   O  OE1 . GLU A  1 121 ? 14.756  -4.017  29.644   1.00 31.04  ? 147 GLU A OE1 1 
ATOM   848   O  OE2 . GLU A  1 121 ? 16.252  -5.624  29.630   1.00 34.80  ? 147 GLU A OE2 1 
ATOM   849   N  N   . ALA A  1 122 ? 9.682   -6.666  30.315   1.00 33.16  ? 148 ALA A N   1 
ATOM   850   C  CA  . ALA A  1 122 ? 8.467   -6.204  30.975   1.00 30.52  ? 148 ALA A CA  1 
ATOM   851   C  C   . ALA A  1 122 ? 8.830   -5.596  32.324   1.00 30.82  ? 148 ALA A C   1 
ATOM   852   O  O   . ALA A  1 122 ? 9.557   -6.213  33.111   1.00 29.89  ? 148 ALA A O   1 
ATOM   853   C  CB  . ALA A  1 122 ? 7.465   -7.346  31.151   1.00 24.99  ? 148 ALA A CB  1 
ATOM   854   N  N   . TRP A  1 123 ? 8.327   -4.389  32.586   1.00 28.79  ? 149 TRP A N   1 
ATOM   855   C  CA  . TRP A  1 123 ? 8.711   -3.619  33.759   1.00 29.98  ? 149 TRP A CA  1 
ATOM   856   C  C   . TRP A  1 123 ? 7.483   -3.153  34.530   1.00 31.31  ? 149 TRP A C   1 
ATOM   857   O  O   . TRP A  1 123 ? 6.419   -2.910  33.952   1.00 29.25  ? 149 TRP A O   1 
ATOM   858   C  CB  . TRP A  1 123 ? 9.546   -2.391  33.372   1.00 31.68  ? 149 TRP A CB  1 
ATOM   859   C  CG  . TRP A  1 123 ? 10.907  -2.694  32.820   1.00 32.58  ? 149 TRP A CG  1 
ATOM   860   C  CD1 . TRP A  1 123 ? 11.221  -3.009  31.526   1.00 31.00  ? 149 TRP A CD1 1 
ATOM   861   C  CD2 . TRP A  1 123 ? 12.142  -2.696  33.544   1.00 35.36  ? 149 TRP A CD2 1 
ATOM   862   N  NE1 . TRP A  1 123 ? 12.576  -3.209  31.403   1.00 31.54  ? 149 TRP A NE1 1 
ATOM   863   C  CE2 . TRP A  1 123 ? 13.164  -3.024  32.627   1.00 36.22  ? 149 TRP A CE2 1 
ATOM   864   C  CE3 . TRP A  1 123 ? 12.483  -2.455  34.877   1.00 29.92  ? 149 TRP A CE3 1 
ATOM   865   C  CZ2 . TRP A  1 123 ? 14.500  -3.118  33.005   1.00 33.83  ? 149 TRP A CZ2 1 
ATOM   866   C  CZ3 . TRP A  1 123 ? 13.811  -2.546  35.248   1.00 34.08  ? 149 TRP A CZ3 1 
ATOM   867   C  CH2 . TRP A  1 123 ? 14.803  -2.876  34.317   1.00 32.45  ? 149 TRP A CH2 1 
ATOM   868   N  N   . ASP A  1 124 ? 7.651   -3.016  35.847   1.00 36.68  ? 150 ASP A N   1 
ATOM   869   C  CA  . ASP A  1 124 ? 6.650   -2.403  36.712   1.00 32.36  ? 150 ASP A CA  1 
ATOM   870   C  C   . ASP A  1 124 ? 6.918   -0.908  36.820   1.00 36.39  ? 150 ASP A C   1 
ATOM   871   O  O   . ASP A  1 124 ? 8.068   -0.474  36.938   1.00 37.84  ? 150 ASP A O   1 
ATOM   872   C  CB  . ASP A  1 124 ? 6.663   -3.041  38.106   1.00 34.56  ? 150 ASP A CB  1 
ATOM   873   C  CG  . ASP A  1 124 ? 5.700   -2.362  39.082   1.00 38.73  ? 150 ASP A CG  1 
ATOM   874   O  OD1 . ASP A  1 124 ? 4.618   -1.903  38.655   1.00 37.83  ? 150 ASP A OD1 1 
ATOM   875   O  OD2 . ASP A  1 124 ? 6.029   -2.282  40.289   1.00 37.16  ? 150 ASP A OD2 1 
ATOM   876   N  N   . TRP A  1 125 ? 5.844   -0.126  36.783   1.00 37.78  ? 151 TRP A N   1 
ATOM   877   C  CA  . TRP A  1 125 ? 5.905   1.329   36.780   1.00 34.78  ? 151 TRP A CA  1 
ATOM   878   C  C   . TRP A  1 125 ? 5.457   1.852   38.136   1.00 35.67  ? 151 TRP A C   1 
ATOM   879   O  O   . TRP A  1 125 ? 4.395   1.464   38.637   1.00 34.57  ? 151 TRP A O   1 
ATOM   880   C  CB  . TRP A  1 125 ? 5.028   1.899   35.659   1.00 33.48  ? 151 TRP A CB  1 
ATOM   881   C  CG  . TRP A  1 125 ? 5.013   3.393   35.558   1.00 30.33  ? 151 TRP A CG  1 
ATOM   882   C  CD1 . TRP A  1 125 ? 3.955   4.215   35.805   1.00 34.19  ? 151 TRP A CD1 1 
ATOM   883   C  CD2 . TRP A  1 125 ? 6.104   4.244   35.192   1.00 38.17  ? 151 TRP A CD2 1 
ATOM   884   N  NE1 . TRP A  1 125 ? 4.314   5.524   35.610   1.00 35.00  ? 151 TRP A NE1 1 
ATOM   885   C  CE2 . TRP A  1 125 ? 5.631   5.570   35.234   1.00 38.96  ? 151 TRP A CE2 1 
ATOM   886   C  CE3 . TRP A  1 125 ? 7.436   4.014   34.828   1.00 33.62  ? 151 TRP A CE3 1 
ATOM   887   C  CZ2 . TRP A  1 125 ? 6.441   6.661   34.930   1.00 37.60  ? 151 TRP A CZ2 1 
ATOM   888   C  CZ3 . TRP A  1 125 ? 8.237   5.097   34.529   1.00 26.82  ? 151 TRP A CZ3 1 
ATOM   889   C  CH2 . TRP A  1 125 ? 7.738   6.404   34.582   1.00 31.69  ? 151 TRP A CH2 1 
ATOM   890   N  N   . ASP A  1 126 ? 6.277   2.721   38.731   1.00 39.35  ? 152 ASP A N   1 
ATOM   891   C  CA  . ASP A  1 126 ? 5.948   3.372   39.994   1.00 37.66  ? 152 ASP A CA  1 
ATOM   892   C  C   . ASP A  1 126 ? 6.064   4.889   39.880   1.00 39.39  ? 152 ASP A C   1 
ATOM   893   O  O   . ASP A  1 126 ? 6.430   5.561   40.847   1.00 43.60  ? 152 ASP A O   1 
ATOM   894   C  CB  . ASP A  1 126 ? 6.828   2.854   41.135   1.00 33.48  ? 152 ASP A CB  1 
ATOM   895   C  CG  . ASP A  1 126 ? 6.800   1.336   41.270   1.00 42.80  ? 152 ASP A CG  1 
ATOM   896   O  OD1 . ASP A  1 126 ? 5.730   0.730   41.043   1.00 40.55  ? 152 ASP A OD1 1 
ATOM   897   O  OD2 . ASP A  1 126 ? 7.838   0.748   41.650   1.00 36.28  ? 152 ASP A OD2 1 
ATOM   898   N  N   . ASN A  1 127 ? 5.732   5.438   38.710   1.00 40.41  ? 153 ASN A N   1 
ATOM   899   C  CA  . ASN A  1 127 ? 5.690   6.885   38.488   1.00 43.07  ? 153 ASN A CA  1 
ATOM   900   C  C   . ASN A  1 127 ? 7.003   7.551   38.894   1.00 43.54  ? 153 ASN A C   1 
ATOM   901   O  O   . ASN A  1 127 ? 7.025   8.600   39.538   1.00 46.99  ? 153 ASN A O   1 
ATOM   902   C  CB  . ASN A  1 127 ? 4.498   7.512   39.210   1.00 40.48  ? 153 ASN A CB  1 
ATOM   903   C  CG  . ASN A  1 127 ? 3.173   7.050   38.640   1.00 41.13  ? 153 ASN A CG  1 
ATOM   904   O  OD1 . ASN A  1 127 ? 2.606   6.060   39.095   1.00 41.19  ? 153 ASN A OD1 1 
ATOM   905   N  ND2 . ASN A  1 127 ? 2.677   7.758   37.633   1.00 45.52  ? 153 ASN A ND2 1 
ATOM   906   N  N   . ASP A  1 128 ? 8.114   6.923   38.514   1.00 39.31  ? 154 ASP A N   1 
ATOM   907   C  CA  . ASP A  1 128 ? 9.437   7.466   38.787   1.00 43.34  ? 154 ASP A CA  1 
ATOM   908   C  C   . ASP A  1 128 ? 10.375  6.998   37.684   1.00 47.89  ? 154 ASP A C   1 
ATOM   909   O  O   . ASP A  1 128 ? 10.520  5.793   37.452   1.00 41.70  ? 154 ASP A O   1 
ATOM   910   C  CB  . ASP A  1 128 ? 9.933   7.008   40.169   1.00 47.98  ? 154 ASP A CB  1 
ATOM   911   C  CG  . ASP A  1 128 ? 11.211  7.714   40.618   1.00 46.26  ? 154 ASP A CG  1 
ATOM   912   O  OD1 . ASP A  1 128 ? 11.567  7.570   41.808   1.00 46.63  ? 154 ASP A OD1 1 
ATOM   913   O  OD2 . ASP A  1 128 ? 11.844  8.423   39.808   1.00 45.89  ? 154 ASP A OD2 1 
ATOM   914   N  N   . THR A  1 129 ? 10.997  7.968   37.006   1.00 47.60  ? 155 THR A N   1 
ATOM   915   C  CA  . THR A  1 129 ? 11.917  7.748   35.892   1.00 48.16  ? 155 THR A CA  1 
ATOM   916   C  C   . THR A  1 129 ? 13.234  7.088   36.298   1.00 49.25  ? 155 THR A C   1 
ATOM   917   O  O   . THR A  1 129 ? 13.926  6.560   35.419   1.00 47.22  ? 155 THR A O   1 
ATOM   918   C  CB  . THR A  1 129 ? 12.163  9.064   35.146   1.00 48.02  ? 155 THR A CB  1 
ATOM   919   O  OG1 . THR A  1 129 ? 12.325  10.134  36.083   1.00 60.54  ? 155 THR A OG1 1 
ATOM   920   C  CG2 . THR A  1 129 ? 10.999  9.377   34.209   1.00 37.15  ? 155 THR A CG2 1 
ATOM   921   N  N   . THR A  1 130 ? 13.627  7.172   37.571   1.00 48.55  ? 156 THR A N   1 
ATOM   922   C  CA  . THR A  1 130 ? 14.919  6.653   38.013   1.00 44.39  ? 156 THR A CA  1 
ATOM   923   C  C   . THR A  1 130 ? 15.081  5.188   37.605   1.00 46.31  ? 156 THR A C   1 
ATOM   924   O  O   . THR A  1 130 ? 14.222  4.358   37.938   1.00 38.60  ? 156 THR A O   1 
ATOM   925   C  CB  . THR A  1 130 ? 15.040  6.769   39.532   1.00 50.33  ? 156 THR A CB  1 
ATOM   926   O  OG1 . THR A  1 130 ? 14.607  8.068   39.956   1.00 56.48  ? 156 THR A OG1 1 
ATOM   927   C  CG2 . THR A  1 130 ? 16.479  6.538   39.977   1.00 50.23  ? 156 THR A CG2 1 
ATOM   928   N  N   . PRO A  1 131 ? 16.145  4.836   36.882   1.00 52.35  ? 157 PRO A N   1 
ATOM   929   C  CA  . PRO A  1 131 ? 16.465  3.417   36.645   1.00 52.80  ? 157 PRO A CA  1 
ATOM   930   C  C   . PRO A  1 131 ? 16.522  2.609   37.938   1.00 45.47  ? 157 PRO A C   1 
ATOM   931   O  O   . PRO A  1 131 ? 17.231  2.963   38.884   1.00 49.18  ? 157 PRO A O   1 
ATOM   932   C  CB  . PRO A  1 131 ? 17.830  3.471   35.944   1.00 48.24  ? 157 PRO A CB  1 
ATOM   933   C  CG  . PRO A  1 131 ? 18.381  4.822   36.255   1.00 52.14  ? 157 PRO A CG  1 
ATOM   934   C  CD  . PRO A  1 131 ? 17.195  5.733   36.373   1.00 48.08  ? 157 PRO A CD  1 
ATOM   935   N  N   . ASN A  1 132 ? 15.767  1.507   37.968   1.00 39.95  ? 158 ASN A N   1 
ATOM   936   C  CA  . ASN A  1 132 ? 15.734  0.619   39.132   1.00 34.44  ? 158 ASN A CA  1 
ATOM   937   C  C   . ASN A  1 132 ? 15.599  -0.811  38.616   1.00 40.73  ? 158 ASN A C   1 
ATOM   938   O  O   . ASN A  1 132 ? 14.493  -1.257  38.298   1.00 47.03  ? 158 ASN A O   1 
ATOM   939   C  CB  . ASN A  1 132 ? 14.588  0.987   40.064   1.00 29.41  ? 158 ASN A CB  1 
ATOM   940   C  CG  . ASN A  1 132 ? 14.621  0.219   41.375   1.00 40.47  ? 158 ASN A CG  1 
ATOM   941   O  OD1 . ASN A  1 132 ? 15.331  -0.779  41.514   1.00 38.67  ? 158 ASN A OD1 1 
ATOM   942   N  ND2 . ASN A  1 132 ? 13.826  0.670   42.339   1.00 40.26  ? 158 ASN A ND2 1 
ATOM   943   N  N   . GLU A  1 133 ? 16.723  -1.530  38.565   1.00 38.74  ? 159 GLU A N   1 
ATOM   944   C  CA  . GLU A  1 133 ? 16.771  -2.863  37.975   1.00 34.49  ? 159 GLU A CA  1 
ATOM   945   C  C   . GLU A  1 133 ? 15.936  -3.885  38.734   1.00 40.91  ? 159 GLU A C   1 
ATOM   946   O  O   . GLU A  1 133 ? 15.717  -4.988  38.222   1.00 39.88  ? 159 GLU A O   1 
ATOM   947   C  CB  . GLU A  1 133 ? 18.222  -3.345  37.897   1.00 41.89  ? 159 GLU A CB  1 
ATOM   948   C  CG  . GLU A  1 133 ? 19.137  -2.489  37.014   1.00 60.78  ? 159 GLU A CG  1 
ATOM   949   C  CD  . GLU A  1 133 ? 19.633  -1.215  37.696   1.00 62.65  ? 159 GLU A CD  1 
ATOM   950   O  OE1 . GLU A  1 133 ? 19.106  -0.853  38.773   1.00 60.73  ? 159 GLU A OE1 1 
ATOM   951   O  OE2 . GLU A  1 133 ? 20.556  -0.572  37.150   1.00 61.24  ? 159 GLU A OE2 1 
ATOM   952   N  N   . GLU A  1 134 ? 15.469  -3.551  39.930   1.00 44.45  ? 160 GLU A N   1 
ATOM   953   C  CA  . GLU A  1 134 ? 14.672  -4.468  40.732   1.00 42.40  ? 160 GLU A CA  1 
ATOM   954   C  C   . GLU A  1 134 ? 13.200  -4.449  40.359   1.00 37.25  ? 160 GLU A C   1 
ATOM   955   O  O   . GLU A  1 134 ? 12.418  -5.200  40.954   1.00 31.76  ? 160 GLU A O   1 
ATOM   956   C  CB  . GLU A  1 134 ? 14.848  -4.150  42.215   1.00 45.27  ? 160 GLU A CB  1 
ATOM   957   C  CG  . GLU A  1 134 ? 16.302  -4.195  42.646   1.00 48.27  ? 160 GLU A CG  1 
ATOM   958   C  CD  . GLU A  1 134 ? 16.479  -4.711  44.051   1.00 57.76  ? 160 GLU A CD  1 
ATOM   959   O  OE1 . GLU A  1 134 ? 16.979  -3.945  44.903   1.00 64.62  ? 160 GLU A OE1 1 
ATOM   960   O  OE2 . GLU A  1 134 ? 16.113  -5.882  44.298   1.00 52.12  ? 160 GLU A OE2 1 
ATOM   961   N  N   . LEU A  1 135 ? 12.802  -3.600  39.410   1.00 34.93  ? 161 LEU A N   1 
ATOM   962   C  CA  . LEU A  1 135 ? 11.430  -3.559  38.925   1.00 41.25  ? 161 LEU A CA  1 
ATOM   963   C  C   . LEU A  1 135 ? 11.229  -4.387  37.657   1.00 38.28  ? 161 LEU A C   1 
ATOM   964   O  O   . LEU A  1 135 ? 10.206  -4.238  36.979   1.00 31.23  ? 161 LEU A O   1 
ATOM   965   C  CB  . LEU A  1 135 ? 11.005  -2.110  38.684   1.00 37.93  ? 161 LEU A CB  1 
ATOM   966   C  CG  . LEU A  1 135 ? 11.240  -1.131  39.839   1.00 36.88  ? 161 LEU A CG  1 
ATOM   967   C  CD1 . LEU A  1 135 ? 11.131  0.301   39.344   1.00 37.63  ? 161 LEU A CD1 1 
ATOM   968   C  CD2 . LEU A  1 135 ? 10.257  -1.389  40.973   1.00 31.63  ? 161 LEU A CD2 1 
ATOM   969   N  N   . LEU A  1 136 ? 12.155  -5.297  37.362   1.00 38.89  ? 162 LEU A N   1 
ATOM   970   C  CA  . LEU A  1 136 ? 12.081  -6.117  36.160   1.00 35.31  ? 162 LEU A CA  1 
ATOM   971   C  C   . LEU A  1 136 ? 11.154  -7.307  36.382   1.00 36.63  ? 162 LEU A C   1 
ATOM   972   O  O   . LEU A  1 136 ? 11.398  -8.135  37.268   1.00 29.97  ? 162 LEU A O   1 
ATOM   973   C  CB  . LEU A  1 136 ? 13.473  -6.603  35.768   1.00 30.64  ? 162 LEU A CB  1 
ATOM   974   C  CG  . LEU A  1 136 ? 13.529  -7.472  34.511   1.00 30.45  ? 162 LEU A CG  1 
ATOM   975   C  CD1 . LEU A  1 136 ? 13.045  -6.703  33.283   1.00 28.38  ? 162 LEU A CD1 1 
ATOM   976   C  CD2 . LEU A  1 136 ? 14.929  -8.032  34.316   1.00 28.10  ? 162 LEU A CD2 1 
ATOM   977   N  N   . ILE A  1 137 ? 10.109  -7.407  35.558   1.00 32.49  ? 163 ILE A N   1 
ATOM   978   C  CA  . ILE A  1 137 ? 9.198   -8.542  35.644   1.00 27.52  ? 163 ILE A CA  1 
ATOM   979   C  C   . ILE A  1 137 ? 9.747   -9.728  34.863   1.00 30.15  ? 163 ILE A C   1 
ATOM   980   O  O   . ILE A  1 137 ? 9.877   -10.835 35.395   1.00 36.61  ? 163 ILE A O   1 
ATOM   981   C  CB  . ILE A  1 137 ? 7.797   -8.146  35.141   1.00 29.51  ? 163 ILE A CB  1 
ATOM   982   C  CG1 . ILE A  1 137 ? 7.209   -7.023  35.991   1.00 26.93  ? 163 ILE A CG1 1 
ATOM   983   C  CG2 . ILE A  1 137 ? 6.876   -9.350  35.144   1.00 28.84  ? 163 ILE A CG2 1 
ATOM   984   C  CD1 . ILE A  1 137 ? 5.846   -6.570  35.527   1.00 20.82  ? 163 ILE A CD1 1 
ATOM   985   N  N   . GLU A  1 138 ? 10.086  -9.517  33.593   1.00 33.58  ? 164 GLU A N   1 
ATOM   986   C  CA  . GLU A  1 138 ? 10.539  -10.606 32.738   1.00 33.91  ? 164 GLU A CA  1 
ATOM   987   C  C   . GLU A  1 138 ? 11.386  -10.042 31.606   1.00 31.97  ? 164 GLU A C   1 
ATOM   988   O  O   . GLU A  1 138 ? 11.158  -8.923  31.137   1.00 32.77  ? 164 GLU A O   1 
ATOM   989   C  CB  . GLU A  1 138 ? 9.358   -11.401 32.171   1.00 31.60  ? 164 GLU A CB  1 
ATOM   990   C  CG  . GLU A  1 138 ? 9.747   -12.622 31.345   1.00 33.33  ? 164 GLU A CG  1 
ATOM   991   C  CD  . GLU A  1 138 ? 10.403  -13.716 32.173   1.00 37.59  ? 164 GLU A CD  1 
ATOM   992   O  OE1 . GLU A  1 138 ? 11.619  -13.624 32.450   1.00 43.52  ? 164 GLU A OE1 1 
ATOM   993   O  OE2 . GLU A  1 138 ? 9.693   -14.667 32.556   1.00 34.69  ? 164 GLU A OE2 1 
ATOM   994   N  N   . ARG A  1 139 ? 12.369  -10.829 31.180   1.00 26.07  ? 165 ARG A N   1 
ATOM   995   C  CA  . ARG A  1 139 ? 13.187  -10.509 30.023   1.00 25.67  ? 165 ARG A CA  1 
ATOM   996   C  C   . ARG A  1 139 ? 13.258  -11.735 29.125   1.00 30.71  ? 165 ARG A C   1 
ATOM   997   O  O   . ARG A  1 139 ? 13.579  -12.832 29.594   1.00 34.89  ? 165 ARG A O   1 
ATOM   998   C  CB  . ARG A  1 139 ? 14.597  -10.067 30.434   1.00 25.47  ? 165 ARG A CB  1 
ATOM   999   C  CG  . ARG A  1 139 ? 15.511  -9.795  29.245   1.00 31.38  ? 165 ARG A CG  1 
ATOM   1000  C  CD  . ARG A  1 139 ? 16.936  -9.435  29.646   1.00 31.60  ? 165 ARG A CD  1 
ATOM   1001  N  NE  . ARG A  1 139 ? 17.014  -8.141  30.313   1.00 29.96  ? 165 ARG A NE  1 
ATOM   1002  C  CZ  . ARG A  1 139 ? 17.372  -7.978  31.581   1.00 28.04  ? 165 ARG A CZ  1 
ATOM   1003  N  NH1 . ARG A  1 139 ? 17.697  -9.033  32.318   1.00 34.18  ? 165 ARG A NH1 1 
ATOM   1004  N  NH2 . ARG A  1 139 ? 17.406  -6.764  32.112   1.00 22.72  ? 165 ARG A NH2 1 
ATOM   1005  N  N   . VAL A  1 140 ? 12.942  -11.550 27.840   1.00 24.73  ? 166 VAL A N   1 
ATOM   1006  C  CA  . VAL A  1 140 ? 13.007  -12.609 26.842   1.00 26.92  ? 166 VAL A CA  1 
ATOM   1007  C  C   . VAL A  1 140 ? 13.820  -12.117 25.650   1.00 26.24  ? 166 VAL A C   1 
ATOM   1008  O  O   . VAL A  1 140 ? 13.935  -10.915 25.397   1.00 28.17  ? 166 VAL A O   1 
ATOM   1009  C  CB  . VAL A  1 140 ? 11.606  -13.074 26.388   1.00 27.64  ? 166 VAL A CB  1 
ATOM   1010  C  CG1 . VAL A  1 140 ? 10.875  -13.737 27.542   1.00 23.65  ? 166 VAL A CG1 1 
ATOM   1011  C  CG2 . VAL A  1 140 ? 10.805  -11.899 25.852   1.00 21.33  ? 166 VAL A CG2 1 
ATOM   1012  N  N   . SER A  1 141 ? 14.386  -13.067 24.911   1.00 21.00  ? 167 SER A N   1 
ATOM   1013  C  CA  . SER A  1 141 ? 15.266  -12.733 23.800   1.00 27.36  ? 167 SER A CA  1 
ATOM   1014  C  C   . SER A  1 141 ? 15.044  -13.693 22.640   1.00 28.10  ? 167 SER A C   1 
ATOM   1015  O  O   . SER A  1 141 ? 14.662  -14.851 22.827   1.00 26.41  ? 167 SER A O   1 
ATOM   1016  C  CB  . SER A  1 141 ? 16.741  -12.758 24.225   1.00 28.24  ? 167 SER A CB  1 
ATOM   1017  O  OG  . SER A  1 141 ? 17.112  -14.046 24.681   1.00 29.51  ? 167 SER A OG  1 
ATOM   1018  N  N   . HIS A  1 142 ? 15.308  -13.200 21.435   1.00 26.31  ? 168 HIS A N   1 
ATOM   1019  C  CA  . HIS A  1 142 ? 15.127  -13.994 20.227   1.00 29.98  ? 168 HIS A CA  1 
ATOM   1020  C  C   . HIS A  1 142 ? 16.153  -13.561 19.195   1.00 30.69  ? 168 HIS A C   1 
ATOM   1021  O  O   . HIS A  1 142 ? 16.238  -12.376 18.865   1.00 30.57  ? 168 HIS A O   1 
ATOM   1022  C  CB  . HIS A  1 142 ? 13.710  -13.834 19.675   1.00 31.22  ? 168 HIS A CB  1 
ATOM   1023  C  CG  . HIS A  1 142 ? 13.533  -14.388 18.296   1.00 33.97  ? 168 HIS A CG  1 
ATOM   1024  N  ND1 . HIS A  1 142 ? 13.368  -15.734 18.048   1.00 39.48  ? 168 HIS A ND1 1 
ATOM   1025  C  CD2 . HIS A  1 142 ? 13.498  -13.776 17.088   1.00 34.17  ? 168 HIS A CD2 1 
ATOM   1026  C  CE1 . HIS A  1 142 ? 13.239  -15.927 16.747   1.00 39.00  ? 168 HIS A CE1 1 
ATOM   1027  N  NE2 . HIS A  1 142 ? 13.316  -14.755 16.142   1.00 33.71  ? 168 HIS A NE2 1 
ATOM   1028  N  N   . ALA A  1 143 ? 16.934  -14.516 18.700   1.00 32.65  ? 169 ALA A N   1 
ATOM   1029  C  CA  . ALA A  1 143 ? 17.911  -14.271 17.648   1.00 36.54  ? 169 ALA A CA  1 
ATOM   1030  C  C   . ALA A  1 143 ? 17.405  -14.951 16.388   1.00 35.51  ? 169 ALA A C   1 
ATOM   1031  O  O   . ALA A  1 143 ? 17.154  -16.161 16.392   1.00 40.06  ? 169 ALA A O   1 
ATOM   1032  C  CB  . ALA A  1 143 ? 19.293  -14.804 18.023   1.00 41.51  ? 169 ALA A CB  1 
ATOM   1033  N  N   . GLY A  1 144 ? 17.259  -14.186 15.323   1.00 38.22  ? 170 GLY A N   1 
ATOM   1034  C  CA  . GLY A  1 144 ? 16.700  -14.736 14.114   1.00 47.42  ? 170 GLY A CA  1 
ATOM   1035  C  C   . GLY A  1 144 ? 16.939  -13.890 12.886   1.00 43.25  ? 170 GLY A C   1 
ATOM   1036  O  O   . GLY A  1 144 ? 17.855  -13.065 12.839   1.00 32.01  ? 170 GLY A O   1 
ATOM   1037  N  N   . MET A  1 145 ? 16.085  -14.109 11.889   1.00 42.84  ? 171 MET A N   1 
ATOM   1038  C  CA  . MET A  1 145 ? 16.273  -13.566 10.556   1.00 37.88  ? 171 MET A CA  1 
ATOM   1039  C  C   . MET A  1 145 ? 14.916  -13.181 9.986    1.00 37.92  ? 171 MET A C   1 
ATOM   1040  O  O   . MET A  1 145 ? 13.935  -13.903 10.181   1.00 40.48  ? 171 MET A O   1 
ATOM   1041  C  CB  . MET A  1 145 ? 16.963  -14.606 9.673    1.00 42.53  ? 171 MET A CB  1 
ATOM   1042  C  CG  . MET A  1 145 ? 17.747  -14.048 8.525    1.00 46.42  ? 171 MET A CG  1 
ATOM   1043  S  SD  . MET A  1 145 ? 17.508  -15.026 7.035    1.00 97.91  ? 171 MET A SD  1 
ATOM   1044  C  CE  . MET A  1 145 ? 16.074  -14.209 6.335    1.00 66.81  ? 171 MET A CE  1 
ATOM   1045  N  N   . ILE A  1 146 ? 14.854  -12.039 9.297    1.00 33.25  ? 172 ILE A N   1 
ATOM   1046  C  CA  . ILE A  1 146 ? 13.599  -11.566 8.719    1.00 34.77  ? 172 ILE A CA  1 
ATOM   1047  C  C   . ILE A  1 146 ? 13.898  -10.663 7.526    1.00 38.62  ? 172 ILE A C   1 
ATOM   1048  O  O   . ILE A  1 146 ? 14.926  -9.984  7.480    1.00 36.61  ? 172 ILE A O   1 
ATOM   1049  C  CB  . ILE A  1 146 ? 12.735  -10.847 9.786    1.00 34.92  ? 172 ILE A CB  1 
ATOM   1050  C  CG1 . ILE A  1 146 ? 11.315  -10.601 9.268    1.00 31.96  ? 172 ILE A CG1 1 
ATOM   1051  C  CG2 . ILE A  1 146 ? 13.394  -9.553  10.238   1.00 34.92  ? 172 ILE A CG2 1 
ATOM   1052  C  CD1 . ILE A  1 146 ? 10.381  -10.021 10.304   1.00 30.07  ? 172 ILE A CD1 1 
ATOM   1053  N  N   . ASN A  1 147 ? 12.975  -10.652 6.557    1.00 40.03  ? 173 ASN A N   1 
ATOM   1054  C  CA  . ASN A  1 147 ? 13.027  -9.857  5.337    1.00 35.23  ? 173 ASN A CA  1 
ATOM   1055  C  C   . ASN A  1 147 ? 11.895  -8.830  5.309    1.00 39.48  ? 173 ASN A C   1 
ATOM   1056  O  O   . ASN A  1 147 ? 10.845  -9.042  5.923    1.00 43.49  ? 173 ASN A O   1 
ATOM   1057  C  CB  . ASN A  1 147 ? 12.935  -10.749 4.090    1.00 44.48  ? 173 ASN A CB  1 
ATOM   1058  C  CG  . ASN A  1 147 ? 14.244  -11.459 3.772    1.00 43.20  ? 173 ASN A CG  1 
ATOM   1059  O  OD1 . ASN A  1 147 ? 15.328  -10.953 4.063    1.00 40.92  ? 173 ASN A OD1 1 
ATOM   1060  N  ND2 . ASN A  1 147 ? 14.145  -12.640 3.173    1.00 44.81  ? 173 ASN A ND2 1 
ATOM   1061  N  N   . PRO A  1 148 ? 12.083  -7.707  4.611    1.00 39.52  ? 174 PRO A N   1 
ATOM   1062  C  CA  . PRO A  1 148 ? 11.028  -6.679  4.536    1.00 36.81  ? 174 PRO A CA  1 
ATOM   1063  C  C   . PRO A  1 148 ? 9.792   -7.155  3.787    1.00 40.56  ? 174 PRO A C   1 
ATOM   1064  O  O   . PRO A  1 148 ? 9.855   -7.463  2.596    1.00 48.05  ? 174 PRO A O   1 
ATOM   1065  C  CB  . PRO A  1 148 ? 11.715  -5.522  3.798    1.00 33.24  ? 174 PRO A CB  1 
ATOM   1066  C  CG  . PRO A  1 148 ? 13.173  -5.754  3.981    1.00 33.67  ? 174 PRO A CG  1 
ATOM   1067  C  CD  . PRO A  1 148 ? 13.339  -7.243  3.999    1.00 40.71  ? 174 PRO A CD  1 
ATOM   1068  N  N   . GLU A  1 149 ? 8.666   -7.220  4.498    1.00 46.88  ? 175 GLU A N   1 
ATOM   1069  C  CA  . GLU A  1 149 ? 7.367   -7.558  3.926    1.00 47.21  ? 175 GLU A CA  1 
ATOM   1070  C  C   . GLU A  1 149 ? 6.283   -7.038  4.862    1.00 46.77  ? 175 GLU A C   1 
ATOM   1071  O  O   . GLU A  1 149 ? 6.540   -6.765  6.037    1.00 52.12  ? 175 GLU A O   1 
ATOM   1072  C  CB  . GLU A  1 149 ? 7.220   -9.063  3.690    1.00 52.53  ? 175 GLU A CB  1 
ATOM   1073  C  CG  . GLU A  1 149 ? 7.801   -9.927  4.783    1.00 50.37  ? 175 GLU A CG  1 
ATOM   1074  C  CD  . GLU A  1 149 ? 7.755   -11.391 4.421    1.00 55.08  ? 175 GLU A CD  1 
ATOM   1075  O  OE1 . GLU A  1 149 ? 6.901   -11.763 3.587    1.00 57.23  ? 175 GLU A OE1 1 
ATOM   1076  O  OE2 . GLU A  1 149 ? 8.577   -12.164 4.956    1.00 61.16  ? 175 GLU A OE2 1 
ATOM   1077  N  N   . ASP A  1 150 ? 5.062   -6.907  4.337    1.00 48.01  ? 176 ASP A N   1 
ATOM   1078  C  CA  . ASP A  1 150 ? 3.935   -6.447  5.144    1.00 56.15  ? 176 ASP A CA  1 
ATOM   1079  C  C   . ASP A  1 150 ? 3.186   -7.580  5.844    1.00 51.67  ? 176 ASP A C   1 
ATOM   1080  O  O   . ASP A  1 150 ? 2.035   -7.384  6.254    1.00 46.99  ? 176 ASP A O   1 
ATOM   1081  C  CB  . ASP A  1 150 ? 2.951   -5.623  4.303    1.00 44.65  ? 176 ASP A CB  1 
ATOM   1082  C  CG  . ASP A  1 150 ? 3.635   -4.582  3.454    1.00 54.42  ? 176 ASP A CG  1 
ATOM   1083  O  OD1 . ASP A  1 150 ? 4.572   -3.926  3.964    1.00 58.64  ? 176 ASP A OD1 1 
ATOM   1084  O  OD2 . ASP A  1 150 ? 3.227   -4.409  2.285    1.00 61.17  ? 176 ASP A OD2 1 
ATOM   1085  N  N   . ARG A  1 151 ? 3.804   -8.748  6.006    1.00 46.08  ? 177 ARG A N   1 
ATOM   1086  C  CA  . ARG A  1 151 ? 3.192   -9.840  6.751    1.00 38.28  ? 177 ARG A CA  1 
ATOM   1087  C  C   . ARG A  1 151 ? 3.818   -9.917  8.137    1.00 35.28  ? 177 ARG A C   1 
ATOM   1088  O  O   . ARG A  1 151 ? 5.045   -9.906  8.270    1.00 41.56  ? 177 ARG A O   1 
ATOM   1089  C  CB  . ARG A  1 151 ? 3.365   -11.167 6.009    1.00 43.07  ? 177 ARG A CB  1 
ATOM   1090  C  CG  . ARG A  1 151 ? 2.720   -12.355 6.701    1.00 50.98  ? 177 ARG A CG  1 
ATOM   1091  C  CD  . ARG A  1 151 ? 2.637   -13.569 5.783    1.00 61.65  ? 177 ARG A CD  1 
ATOM   1092  N  NE  . ARG A  1 151 ? 1.553   -13.453 4.808    1.00 74.71  ? 177 ARG A NE  1 
ATOM   1093  C  CZ  . ARG A  1 151 ? 1.261   -14.379 3.898    1.00 79.80  ? 177 ARG A CZ  1 
ATOM   1094  N  NH1 . ARG A  1 151 ? 1.973   -15.496 3.832    1.00 85.24  ? 177 ARG A NH1 1 
ATOM   1095  N  NH2 . ARG A  1 151 ? 0.255   -14.188 3.054    1.00 78.84  ? 177 ARG A NH2 1 
ATOM   1096  N  N   . TRP A  1 152 ? 2.978   -9.989  9.163    1.00 35.78  ? 178 TRP A N   1 
ATOM   1097  C  CA  . TRP A  1 152 ? 3.481   -10.121 10.521   1.00 35.22  ? 178 TRP A CA  1 
ATOM   1098  C  C   . TRP A  1 152 ? 3.901   -11.559 10.798   1.00 33.45  ? 178 TRP A C   1 
ATOM   1099  O  O   . TRP A  1 152 ? 3.378   -12.507 10.207   1.00 33.60  ? 178 TRP A O   1 
ATOM   1100  C  CB  . TRP A  1 152 ? 2.432   -9.672  11.537   1.00 28.79  ? 178 TRP A CB  1 
ATOM   1101  C  CG  . TRP A  1 152 ? 2.114   -8.207  11.451   1.00 33.75  ? 178 TRP A CG  1 
ATOM   1102  C  CD1 . TRP A  1 152 ? 1.202   -7.616  10.628   1.00 30.53  ? 178 TRP A CD1 1 
ATOM   1103  C  CD2 . TRP A  1 152 ? 2.723   -7.145  12.203   1.00 35.92  ? 178 TRP A CD2 1 
ATOM   1104  N  NE1 . TRP A  1 152 ? 1.195   -6.258  10.829   1.00 36.11  ? 178 TRP A NE1 1 
ATOM   1105  C  CE2 . TRP A  1 152 ? 2.119   -5.943  11.790   1.00 33.97  ? 178 TRP A CE2 1 
ATOM   1106  C  CE3 . TRP A  1 152 ? 3.716   -7.096  13.189   1.00 32.62  ? 178 TRP A CE3 1 
ATOM   1107  C  CZ2 . TRP A  1 152 ? 2.472   -4.707  12.329   1.00 28.22  ? 178 TRP A CZ2 1 
ATOM   1108  C  CZ3 . TRP A  1 152 ? 4.065   -5.865  13.720   1.00 25.79  ? 178 TRP A CZ3 1 
ATOM   1109  C  CH2 . TRP A  1 152 ? 3.444   -4.691  13.290   1.00 25.55  ? 178 TRP A CH2 1 
ATOM   1110  N  N   . LYS A  1 153 ? 4.857   -11.712 11.709   1.00 33.93  ? 179 LYS A N   1 
ATOM   1111  C  CA  . LYS A  1 153 ? 5.363   -13.018 12.111   1.00 36.59  ? 179 LYS A CA  1 
ATOM   1112  C  C   . LYS A  1 153 ? 5.221   -13.169 13.621   1.00 34.84  ? 179 LYS A C   1 
ATOM   1113  O  O   . LYS A  1 153 ? 5.647   -12.292 14.379   1.00 31.17  ? 179 LYS A O   1 
ATOM   1114  C  CB  . LYS A  1 153 ? 6.817   -13.192 11.665   1.00 31.34  ? 179 LYS A CB  1 
ATOM   1115  C  CG  . LYS A  1 153 ? 7.444   -14.519 12.041   1.00 32.23  ? 179 LYS A CG  1 
ATOM   1116  C  CD  . LYS A  1 153 ? 8.527   -14.300 13.068   1.00 41.90  ? 179 LYS A CD  1 
ATOM   1117  C  CE  . LYS A  1 153 ? 9.519   -15.445 13.093   1.00 50.78  ? 179 LYS A CE  1 
ATOM   1118  N  NZ  . LYS A  1 153 ? 10.867  -14.958 13.512   1.00 42.81  ? 179 LYS A NZ  1 
ATOM   1119  N  N   . SER A  1 154 ? 4.629   -14.278 14.055   1.00 31.78  ? 180 SER A N   1 
ATOM   1120  C  CA  . SER A  1 154 ? 4.290   -14.470 15.459   1.00 32.25  ? 180 SER A CA  1 
ATOM   1121  C  C   . SER A  1 154 ? 5.436   -15.119 16.227   1.00 33.59  ? 180 SER A C   1 
ATOM   1122  O  O   . SER A  1 154 ? 6.115   -16.017 15.721   1.00 34.70  ? 180 SER A O   1 
ATOM   1123  C  CB  . SER A  1 154 ? 3.033   -15.329 15.592   1.00 29.28  ? 180 SER A CB  1 
ATOM   1124  O  OG  . SER A  1 154 ? 1.985   -14.809 14.795   1.00 43.31  ? 180 SER A OG  1 
ATOM   1125  N  N   . LEU A  1 155 ? 5.650   -14.645 17.452   1.00 30.29  ? 181 LEU A N   1 
ATOM   1126  C  CA  . LEU A  1 155 ? 6.663   -15.178 18.350   1.00 33.23  ? 181 LEU A CA  1 
ATOM   1127  C  C   . LEU A  1 155 ? 6.017   -15.509 19.688   1.00 31.12  ? 181 LEU A C   1 
ATOM   1128  O  O   . LEU A  1 155 ? 5.111   -14.803 20.141   1.00 30.31  ? 181 LEU A O   1 
ATOM   1129  C  CB  . LEU A  1 155 ? 7.811   -14.181 18.549   1.00 29.91  ? 181 LEU A CB  1 
ATOM   1130  C  CG  . LEU A  1 155 ? 8.631   -13.817 17.311   1.00 30.09  ? 181 LEU A CG  1 
ATOM   1131  C  CD1 . LEU A  1 155 ? 9.561   -12.655 17.613   1.00 31.71  ? 181 LEU A CD1 1 
ATOM   1132  C  CD2 . LEU A  1 155 ? 9.422   -15.019 16.825   1.00 23.47  ? 181 LEU A CD2 1 
ATOM   1133  N  N   . HIS A  1 156 ? 6.487   -16.583 20.319   1.00 34.10  ? 182 HIS A N   1 
ATOM   1134  C  CA  . HIS A  1 156 ? 5.928   -17.063 21.579   1.00 37.36  ? 182 HIS A CA  1 
ATOM   1135  C  C   . HIS A  1 156 ? 7.045   -17.223 22.598   1.00 32.13  ? 182 HIS A C   1 
ATOM   1136  O  O   . HIS A  1 156 ? 8.038   -17.908 22.332   1.00 33.43  ? 182 HIS A O   1 
ATOM   1137  C  CB  . HIS A  1 156 ? 5.190   -18.390 21.382   1.00 33.54  ? 182 HIS A CB  1 
ATOM   1138  C  CG  . HIS A  1 156 ? 4.358   -18.436 20.139   1.00 40.48  ? 182 HIS A CG  1 
ATOM   1139  N  ND1 . HIS A  1 156 ? 3.067   -17.957 20.088   1.00 42.63  ? 182 HIS A ND1 1 
ATOM   1140  C  CD2 . HIS A  1 156 ? 4.637   -18.896 18.897   1.00 42.53  ? 182 HIS A CD2 1 
ATOM   1141  C  CE1 . HIS A  1 156 ? 2.584   -18.125 18.870   1.00 36.89  ? 182 HIS A CE1 1 
ATOM   1142  N  NE2 . HIS A  1 156 ? 3.517   -18.694 18.128   1.00 37.24  ? 182 HIS A NE2 1 
ATOM   1143  N  N   . PHE A  1 157 ? 6.878   -16.603 23.764   1.00 28.46  ? 183 PHE A N   1 
ATOM   1144  C  CA  . PHE A  1 157 ? 7.896   -16.598 24.805   1.00 24.86  ? 183 PHE A CA  1 
ATOM   1145  C  C   . PHE A  1 157 ? 7.298   -17.056 26.126   1.00 27.84  ? 183 PHE A C   1 
ATOM   1146  O  O   . PHE A  1 157 ? 6.172   -16.689 26.474   1.00 27.63  ? 183 PHE A O   1 
ATOM   1147  C  CB  . PHE A  1 157 ? 8.503   -15.207 24.973   1.00 25.46  ? 183 PHE A CB  1 
ATOM   1148  C  CG  . PHE A  1 157 ? 9.096   -14.649 23.716   1.00 27.67  ? 183 PHE A CG  1 
ATOM   1149  C  CD1 . PHE A  1 157 ? 10.384  -14.988 23.335   1.00 28.61  ? 183 PHE A CD1 1 
ATOM   1150  C  CD2 . PHE A  1 157 ? 8.370   -13.781 22.916   1.00 26.69  ? 183 PHE A CD2 1 
ATOM   1151  C  CE1 . PHE A  1 157 ? 10.938  -14.472 22.176   1.00 30.75  ? 183 PHE A CE1 1 
ATOM   1152  C  CE2 . PHE A  1 157 ? 8.917   -13.260 21.757   1.00 26.60  ? 183 PHE A CE2 1 
ATOM   1153  C  CZ  . PHE A  1 157 ? 10.203  -13.605 21.385   1.00 28.05  ? 183 PHE A CZ  1 
ATOM   1154  N  N   . SER A  1 158 ? 8.063   -17.853 26.870   1.00 34.89  ? 184 SER A N   1 
ATOM   1155  C  CA  . SER A  1 158 ? 7.633   -18.345 28.185   1.00 39.77  ? 184 SER A CA  1 
ATOM   1156  C  C   . SER A  1 158 ? 8.858   -18.345 29.094   1.00 31.58  ? 184 SER A C   1 
ATOM   1157  O  O   . SER A  1 158 ? 9.600   -19.327 29.153   1.00 47.00  ? 184 SER A O   1 
ATOM   1158  C  CB  . SER A  1 158 ? 7.000   -19.728 28.093   1.00 32.60  ? 184 SER A CB  1 
ATOM   1159  O  OG  . SER A  1 158 ? 5.834   -19.696 27.287   1.00 49.83  ? 184 SER A OG  1 
ATOM   1160  N  N   . GLY A  1 159 ? 9.067   -17.237 29.793   1.00 31.12  ? 185 GLY A N   1 
ATOM   1161  C  CA  . GLY A  1 159 ? 10.208  -17.096 30.670   1.00 36.15  ? 185 GLY A CA  1 
ATOM   1162  C  C   . GLY A  1 159 ? 9.962   -17.715 32.032   1.00 39.90  ? 185 GLY A C   1 
ATOM   1163  O  O   . GLY A  1 159 ? 9.120   -18.600 32.207   1.00 40.18  ? 185 GLY A O   1 
ATOM   1164  N  N   . HIS A  1 160 ? 10.704  -17.217 33.020   1.00 41.02  ? 186 HIS A N   1 
ATOM   1165  C  CA  . HIS A  1 160 ? 10.595  -17.749 34.371   1.00 44.94  ? 186 HIS A CA  1 
ATOM   1166  C  C   . HIS A  1 160 ? 9.371   -17.217 35.111   1.00 45.60  ? 186 HIS A C   1 
ATOM   1167  O  O   . HIS A  1 160 ? 8.876   -17.886 36.025   1.00 45.65  ? 186 HIS A O   1 
ATOM   1168  C  CB  . HIS A  1 160 ? 11.880  -17.441 35.154   1.00 45.49  ? 186 HIS A CB  1 
ATOM   1169  C  CG  . HIS A  1 160 ? 11.795  -17.754 36.618   1.00 57.62  ? 186 HIS A CG  1 
ATOM   1170  N  ND1 . HIS A  1 160 ? 11.587  -16.785 37.578   1.00 62.90  ? 186 HIS A ND1 1 
ATOM   1171  C  CD2 . HIS A  1 160 ? 11.889  -18.929 37.287   1.00 60.22  ? 186 HIS A CD2 1 
ATOM   1172  C  CE1 . HIS A  1 160 ? 11.554  -17.351 38.773   1.00 61.83  ? 186 HIS A CE1 1 
ATOM   1173  N  NE2 . HIS A  1 160 ? 11.735  -18.651 38.624   1.00 57.10  ? 186 HIS A NE2 1 
ATOM   1174  N  N   . VAL A  1 161 ? 8.850   -16.051 34.720   1.00 38.85  ? 187 VAL A N   1 
ATOM   1175  C  CA  . VAL A  1 161 ? 7.747   -15.401 35.417   1.00 37.93  ? 187 VAL A CA  1 
ATOM   1176  C  C   . VAL A  1 161 ? 6.515   -15.272 34.523   1.00 35.77  ? 187 VAL A C   1 
ATOM   1177  O  O   . VAL A  1 161 ? 5.397   -15.585 34.940   1.00 36.86  ? 187 VAL A O   1 
ATOM   1178  C  CB  . VAL A  1 161 ? 8.167   -14.018 35.970   1.00 42.57  ? 187 VAL A CB  1 
ATOM   1179  C  CG1 . VAL A  1 161 ? 6.948   -13.215 36.437   1.00 35.50  ? 187 VAL A CG1 1 
ATOM   1180  C  CG2 . VAL A  1 161 ? 9.187   -14.171 37.083   1.00 45.11  ? 187 VAL A CG2 1 
ATOM   1181  N  N   . ALA A  1 162 ? 6.700   -14.804 33.290   1.00 35.61  ? 188 ALA A N   1 
ATOM   1182  C  CA  . ALA A  1 162 ? 5.581   -14.403 32.450   1.00 35.39  ? 188 ALA A CA  1 
ATOM   1183  C  C   . ALA A  1 162 ? 5.635   -15.072 31.081   1.00 32.37  ? 188 ALA A C   1 
ATOM   1184  O  O   . ALA A  1 162 ? 6.700   -15.447 30.585   1.00 28.97  ? 188 ALA A O   1 
ATOM   1185  C  CB  . ALA A  1 162 ? 5.551   -12.877 32.274   1.00 27.88  ? 188 ALA A CB  1 
ATOM   1186  N  N   . HIS A  1 163 ? 4.454   -15.207 30.474   1.00 28.66  ? 189 HIS A N   1 
ATOM   1187  C  CA  . HIS A  1 163 ? 4.304   -15.623 29.085   1.00 28.40  ? 189 HIS A CA  1 
ATOM   1188  C  C   . HIS A  1 163 ? 3.989   -14.407 28.226   1.00 27.00  ? 189 HIS A C   1 
ATOM   1189  O  O   . HIS A  1 163 ? 3.196   -13.550 28.622   1.00 25.82  ? 189 HIS A O   1 
ATOM   1190  C  CB  . HIS A  1 163 ? 3.182   -16.652 28.921   1.00 29.91  ? 189 HIS A CB  1 
ATOM   1191  C  CG  . HIS A  1 163 ? 3.418   -17.936 29.648   1.00 41.44  ? 189 HIS A CG  1 
ATOM   1192  N  ND1 . HIS A  1 163 ? 3.843   -19.082 29.012   1.00 45.46  ? 189 HIS A ND1 1 
ATOM   1193  C  CD2 . HIS A  1 163 ? 3.269   -18.262 30.954   1.00 47.20  ? 189 HIS A CD2 1 
ATOM   1194  C  CE1 . HIS A  1 163 ? 3.959   -20.056 29.898   1.00 47.55  ? 189 HIS A CE1 1 
ATOM   1195  N  NE2 . HIS A  1 163 ? 3.615   -19.585 31.083   1.00 46.98  ? 189 HIS A NE2 1 
ATOM   1196  N  N   . LEU A  1 164 ? 4.594   -14.346 27.042   1.00 26.90  ? 190 LEU A N   1 
ATOM   1197  C  CA  . LEU A  1 164 ? 4.388   -13.239 26.119   1.00 28.17  ? 190 LEU A CA  1 
ATOM   1198  C  C   . LEU A  1 164 ? 3.989   -13.750 24.742   1.00 25.49  ? 190 LEU A C   1 
ATOM   1199  O  O   . LEU A  1 164 ? 4.404   -14.829 24.312   1.00 26.43  ? 190 LEU A O   1 
ATOM   1200  C  CB  . LEU A  1 164 ? 5.646   -12.362 25.982   1.00 27.11  ? 190 LEU A CB  1 
ATOM   1201  C  CG  . LEU A  1 164 ? 5.875   -11.290 27.047   1.00 28.47  ? 190 LEU A CG  1 
ATOM   1202  C  CD1 . LEU A  1 164 ? 6.356   -11.909 28.346   1.00 24.11  ? 190 LEU A CD1 1 
ATOM   1203  C  CD2 . LEU A  1 164 ? 6.859   -10.244 26.543   1.00 25.90  ? 190 LEU A CD2 1 
ATOM   1204  N  N   . GLU A  1 165 ? 3.171   -12.955 24.058   1.00 26.47  ? 191 GLU A N   1 
ATOM   1205  C  CA  . GLU A  1 165 ? 2.797   -13.193 22.668   1.00 27.04  ? 191 GLU A CA  1 
ATOM   1206  C  C   . GLU A  1 165 ? 2.940   -11.883 21.909   1.00 25.82  ? 191 GLU A C   1 
ATOM   1207  O  O   . GLU A  1 165 ? 2.381   -10.862 22.324   1.00 26.63  ? 191 GLU A O   1 
ATOM   1208  C  CB  . GLU A  1 165 ? 1.361   -13.715 22.552   1.00 27.55  ? 191 GLU A CB  1 
ATOM   1209  C  CG  . GLU A  1 165 ? 1.122   -15.065 23.211   1.00 32.13  ? 191 GLU A CG  1 
ATOM   1210  C  CD  . GLU A  1 165 ? 1.556   -16.230 22.346   1.00 41.43  ? 191 GLU A CD  1 
ATOM   1211  O  OE1 . GLU A  1 165 ? 1.516   -16.093 21.103   1.00 47.08  ? 191 GLU A OE1 1 
ATOM   1212  O  OE2 . GLU A  1 165 ? 1.945   -17.278 22.912   1.00 42.90  ? 191 GLU A OE2 1 
ATOM   1213  N  N   . LEU A  1 166 ? 3.691   -11.901 20.811   1.00 23.87  ? 192 LEU A N   1 
ATOM   1214  C  CA  . LEU A  1 166 ? 3.925   -10.674 20.065   1.00 25.93  ? 192 LEU A CA  1 
ATOM   1215  C  C   . LEU A  1 166 ? 4.202   -11.004 18.606   1.00 25.53  ? 192 LEU A C   1 
ATOM   1216  O  O   . LEU A  1 166 ? 4.595   -12.122 18.267   1.00 30.32  ? 192 LEU A O   1 
ATOM   1217  C  CB  . LEU A  1 166 ? 5.077   -9.869  20.678   1.00 27.22  ? 192 LEU A CB  1 
ATOM   1218  C  CG  . LEU A  1 166 ? 6.394   -10.599 20.938   1.00 24.77  ? 192 LEU A CG  1 
ATOM   1219  C  CD1 . LEU A  1 166 ? 7.327   -10.524 19.726   1.00 22.55  ? 192 LEU A CD1 1 
ATOM   1220  C  CD2 . LEU A  1 166 ? 7.055   -10.045 22.186   1.00 20.13  ? 192 LEU A CD2 1 
ATOM   1221  N  N   . GLN A  1 167 ? 3.979   -10.014 17.741   1.00 20.47  ? 193 GLN A N   1 
ATOM   1222  C  CA  . GLN A  1 167 ? 4.232   -10.142 16.311   1.00 28.89  ? 193 GLN A CA  1 
ATOM   1223  C  C   . GLN A  1 167 ? 5.145   -9.013  15.849   1.00 31.59  ? 193 GLN A C   1 
ATOM   1224  O  O   . GLN A  1 167 ? 5.049   -7.886  16.345   1.00 31.04  ? 193 GLN A O   1 
ATOM   1225  C  CB  . GLN A  1 167 ? 2.927   -10.117 15.491   1.00 31.01  ? 193 GLN A CB  1 
ATOM   1226  C  CG  . GLN A  1 167 ? 1.901   -11.177 15.868   1.00 27.59  ? 193 GLN A CG  1 
ATOM   1227  C  CD  . GLN A  1 167 ? 0.906   -10.680 16.899   1.00 34.50  ? 193 GLN A CD  1 
ATOM   1228  O  OE1 . GLN A  1 167 ? 0.314   -9.612  16.738   1.00 32.98  ? 193 GLN A OE1 1 
ATOM   1229  N  NE2 . GLN A  1 167 ? 0.721   -11.450 17.970   1.00 31.63  ? 193 GLN A NE2 1 
ATOM   1230  N  N   . ILE A  1 168 ? 6.030   -9.321  14.894   1.00 30.41  ? 194 ILE A N   1 
ATOM   1231  C  CA  . ILE A  1 168 ? 7.010   -8.370  14.383   1.00 25.12  ? 194 ILE A CA  1 
ATOM   1232  C  C   . ILE A  1 168 ? 7.028   -8.424  12.859   1.00 31.41  ? 194 ILE A C   1 
ATOM   1233  O  O   . ILE A  1 168 ? 6.599   -9.403  12.244   1.00 38.24  ? 194 ILE A O   1 
ATOM   1234  C  CB  . ILE A  1 168 ? 8.428   -8.642  14.930   1.00 22.79  ? 194 ILE A CB  1 
ATOM   1235  C  CG1 . ILE A  1 168 ? 8.936   -9.995  14.431   1.00 22.82  ? 194 ILE A CG1 1 
ATOM   1236  C  CG2 . ILE A  1 168 ? 8.445   -8.597  16.447   1.00 26.34  ? 194 ILE A CG2 1 
ATOM   1237  C  CD1 . ILE A  1 168 ? 10.392  -10.251 14.727   1.00 23.53  ? 194 ILE A CD1 1 
ATOM   1238  N  N   . ARG A  1 169 ? 7.559   -7.359  12.254   1.00 27.06  ? 195 ARG A N   1 
ATOM   1239  C  CA  . ARG A  1 169 ? 7.733   -7.262  10.807   1.00 25.59  ? 195 ARG A CA  1 
ATOM   1240  C  C   . ARG A  1 169 ? 8.620   -6.063  10.497   1.00 28.10  ? 195 ARG A C   1 
ATOM   1241  O  O   . ARG A  1 169 ? 8.813   -5.176  11.334   1.00 27.07  ? 195 ARG A O   1 
ATOM   1242  C  CB  . ARG A  1 169 ? 6.397   -7.128  10.068   1.00 29.56  ? 195 ARG A CB  1 
ATOM   1243  C  CG  . ARG A  1 169 ? 5.806   -5.737  10.130   1.00 30.83  ? 195 ARG A CG  1 
ATOM   1244  C  CD  . ARG A  1 169 ? 4.577   -5.617  9.261    1.00 36.05  ? 195 ARG A CD  1 
ATOM   1245  N  NE  . ARG A  1 169 ? 3.936   -4.314  9.413    1.00 37.48  ? 195 ARG A NE  1 
ATOM   1246  C  CZ  . ARG A  1 169 ? 2.840   -3.945  8.759    1.00 41.26  ? 195 ARG A CZ  1 
ATOM   1247  N  NH1 . ARG A  1 169 ? 2.264   -4.784  7.910    1.00 37.61  ? 195 ARG A NH1 1 
ATOM   1248  N  NH2 . ARG A  1 169 ? 2.319   -2.743  8.956    1.00 46.11  ? 195 ARG A NH2 1 
ATOM   1249  N  N   . VAL A  1 170 ? 9.140   -6.040  9.271    1.00 32.04  ? 196 VAL A N   1 
ATOM   1250  C  CA  . VAL A  1 170 ? 9.976   -4.951  8.780    1.00 34.53  ? 196 VAL A CA  1 
ATOM   1251  C  C   . VAL A  1 170 ? 9.390   -4.438  7.470    1.00 31.84  ? 196 VAL A C   1 
ATOM   1252  O  O   . VAL A  1 170 ? 8.994   -5.225  6.604    1.00 31.77  ? 196 VAL A O   1 
ATOM   1253  C  CB  . VAL A  1 170 ? 11.442  -5.402  8.585    1.00 34.72  ? 196 VAL A CB  1 
ATOM   1254  C  CG1 . VAL A  1 170 ? 12.295  -4.256  8.041    1.00 29.60  ? 196 VAL A CG1 1 
ATOM   1255  C  CG2 . VAL A  1 170 ? 12.020  -5.931  9.893    1.00 27.92  ? 196 VAL A CG2 1 
ATOM   1256  N  N   . ARG A  1 171 ? 9.332   -3.117  7.326    1.00 31.09  ? 197 ARG A N   1 
ATOM   1257  C  CA  . ARG A  1 171 ? 8.831   -2.479  6.118    1.00 35.07  ? 197 ARG A CA  1 
ATOM   1258  C  C   . ARG A  1 171 ? 9.802   -1.403  5.660    1.00 33.67  ? 197 ARG A C   1 
ATOM   1259  O  O   . ARG A  1 171 ? 10.401  -0.708  6.486    1.00 35.78  ? 197 ARG A O   1 
ATOM   1260  C  CB  . ARG A  1 171 ? 7.465   -1.827  6.342    1.00 36.20  ? 197 ARG A CB  1 
ATOM   1261  C  CG  . ARG A  1 171 ? 6.335   -2.752  6.739    1.00 39.27  ? 197 ARG A CG  1 
ATOM   1262  C  CD  . ARG A  1 171 ? 5.102   -1.929  7.108    1.00 45.78  ? 197 ARG A CD  1 
ATOM   1263  N  NE  . ARG A  1 171 ? 5.398   -0.966  8.171    1.00 56.04  ? 197 ARG A NE  1 
ATOM   1264  C  CZ  . ARG A  1 171 ? 5.572   0.342   7.988    1.00 49.69  ? 197 ARG A CZ  1 
ATOM   1265  N  NH1 . ARG A  1 171 ? 5.473   0.867   6.775    1.00 47.91  ? 197 ARG A NH1 1 
ATOM   1266  N  NH2 . ARG A  1 171 ? 5.850   1.124   9.023    1.00 43.86  ? 197 ARG A NH2 1 
ATOM   1267  N  N   . CYS A  1 172 ? 9.949   -1.261  4.345    1.00 39.51  ? 198 CYS A N   1 
ATOM   1268  C  CA  . CYS A  1 172 ? 10.757  -0.170  3.824    1.00 42.69  ? 198 CYS A CA  1 
ATOM   1269  C  C   . CYS A  1 172 ? 9.957   1.132   3.824    1.00 33.83  ? 198 CYS A C   1 
ATOM   1270  O  O   . CYS A  1 172 ? 8.722   1.138   3.818    1.00 31.17  ? 198 CYS A O   1 
ATOM   1271  C  CB  . CYS A  1 172 ? 11.252  -0.464  2.404    1.00 31.78  ? 198 CYS A CB  1 
ATOM   1272  S  SG  . CYS A  1 172 ? 12.228  -1.971  2.201    1.00 44.20  ? 198 CYS A SG  1 
ATOM   1273  N  N   . ASP A  1 173 ? 10.684  2.247   3.834    1.00 33.37  ? 199 ASP A N   1 
ATOM   1274  C  CA  . ASP A  1 173 ? 10.068  3.548   3.618    1.00 40.90  ? 199 ASP A CA  1 
ATOM   1275  C  C   . ASP A  1 173 ? 9.527   3.636   2.191    1.00 40.88  ? 199 ASP A C   1 
ATOM   1276  O  O   . ASP A  1 173 ? 9.717   2.743   1.358    1.00 35.95  ? 199 ASP A O   1 
ATOM   1277  C  CB  . ASP A  1 173 ? 11.067  4.674   3.884    1.00 40.63  ? 199 ASP A CB  1 
ATOM   1278  C  CG  . ASP A  1 173 ? 11.100  5.103   5.343    1.00 42.06  ? 199 ASP A CG  1 
ATOM   1279  O  OD1 . ASP A  1 173 ? 10.275  5.956   5.740    1.00 39.18  ? 199 ASP A OD1 1 
ATOM   1280  O  OD2 . ASP A  1 173 ? 11.964  4.600   6.091    1.00 47.24  ? 199 ASP A OD2 1 
ATOM   1281  N  N   . GLU A  1 174 ? 8.852   4.741   1.900    1.00 40.66  ? 200 GLU A N   1 
ATOM   1282  C  CA  . GLU A  1 174 ? 8.354   4.965   0.553    1.00 46.42  ? 200 GLU A CA  1 
ATOM   1283  C  C   . GLU A  1 174 ? 9.502   5.355   -0.367   1.00 45.08  ? 200 GLU A C   1 
ATOM   1284  O  O   . GLU A  1 174 ? 10.414  6.088   0.033    1.00 45.91  ? 200 GLU A O   1 
ATOM   1285  C  CB  . GLU A  1 174 ? 7.285   6.058   0.561    1.00 47.94  ? 200 GLU A CB  1 
ATOM   1286  C  CG  . GLU A  1 174 ? 6.550   6.225   -0.756   1.00 54.10  ? 200 GLU A CG  1 
ATOM   1287  C  CD  . GLU A  1 174 ? 5.486   7.304   -0.693   1.00 59.99  ? 200 GLU A CD  1 
ATOM   1288  O  OE1 . GLU A  1 174 ? 5.470   8.071   0.294    1.00 65.60  ? 200 GLU A OE1 1 
ATOM   1289  O  OE2 . GLU A  1 174 ? 4.662   7.383   -1.628   1.00 66.95  ? 200 GLU A OE2 1 
ATOM   1290  N  N   . ASN A  1 175 ? 9.455   4.843   -1.600   1.00 36.36  ? 201 ASN A N   1 
ATOM   1291  C  CA  . ASN A  1 175 ? 10.501  5.013   -2.606   1.00 42.19  ? 201 ASN A CA  1 
ATOM   1292  C  C   . ASN A  1 175 ? 11.779  4.264   -2.258   1.00 39.97  ? 201 ASN A C   1 
ATOM   1293  O  O   . ASN A  1 175 ? 12.858  4.625   -2.739   1.00 40.84  ? 201 ASN A O   1 
ATOM   1294  C  CB  . ASN A  1 175 ? 10.813  6.495   -2.858   1.00 40.67  ? 201 ASN A CB  1 
ATOM   1295  C  CG  . ASN A  1 175 ? 9.567   7.307   -3.156   1.00 42.20  ? 201 ASN A CG  1 
ATOM   1296  O  OD1 . ASN A  1 175 ? 8.678   6.861   -3.883   1.00 44.39  ? 201 ASN A OD1 1 
ATOM   1297  N  ND2 . ASN A  1 175 ? 9.488   8.498   -2.578   1.00 42.80  ? 201 ASN A ND2 1 
ATOM   1298  N  N   . TYR A  1 176 ? 11.687  3.231   -1.422   1.00 41.79  ? 202 TYR A N   1 
ATOM   1299  C  CA  . TYR A  1 176 ? 12.835  2.415   -1.049   1.00 39.01  ? 202 TYR A CA  1 
ATOM   1300  C  C   . TYR A  1 176 ? 12.485  0.949   -1.231   1.00 35.93  ? 202 TYR A C   1 
ATOM   1301  O  O   . TYR A  1 176 ? 11.406  0.508   -0.825   1.00 40.21  ? 202 TYR A O   1 
ATOM   1302  C  CB  . TYR A  1 176 ? 13.280  2.692   0.396    1.00 40.60  ? 202 TYR A CB  1 
ATOM   1303  C  CG  . TYR A  1 176 ? 14.143  3.931   0.536    1.00 36.27  ? 202 TYR A CG  1 
ATOM   1304  C  CD1 . TYR A  1 176 ? 15.526  3.852   0.418    1.00 33.80  ? 202 TYR A CD1 1 
ATOM   1305  C  CD2 . TYR A  1 176 ? 13.575  5.179   0.770    1.00 32.17  ? 202 TYR A CD2 1 
ATOM   1306  C  CE1 . TYR A  1 176 ? 16.320  4.977   0.532    1.00 32.85  ? 202 TYR A CE1 1 
ATOM   1307  C  CE2 . TYR A  1 176 ? 14.360  6.311   0.886    1.00 30.40  ? 202 TYR A CE2 1 
ATOM   1308  C  CZ  . TYR A  1 176 ? 15.733  6.205   0.768    1.00 34.08  ? 202 TYR A CZ  1 
ATOM   1309  O  OH  . TYR A  1 176 ? 16.525  7.325   0.886    1.00 26.24  ? 202 TYR A OH  1 
ATOM   1310  N  N   . TYR A  1 177 ? 13.400  0.202   -1.845   1.00 42.37  ? 203 TYR A N   1 
ATOM   1311  C  CA  . TYR A  1 177 ? 13.141  -1.176  -2.247   1.00 47.10  ? 203 TYR A CA  1 
ATOM   1312  C  C   . TYR A  1 177 ? 14.321  -2.061  -1.872   1.00 40.54  ? 203 TYR A C   1 
ATOM   1313  O  O   . TYR A  1 177 ? 15.206  -1.624  -1.130   1.00 38.17  ? 203 TYR A O   1 
ATOM   1314  C  CB  . TYR A  1 177 ? 12.864  -1.253  -3.753   1.00 47.60  ? 203 TYR A CB  1 
ATOM   1315  C  CG  . TYR A  1 177 ? 11.753  -0.339  -4.222   1.00 44.84  ? 203 TYR A CG  1 
ATOM   1316  C  CD1 . TYR A  1 177 ? 12.008  0.983   -4.563   1.00 46.89  ? 203 TYR A CD1 1 
ATOM   1317  C  CD2 . TYR A  1 177 ? 10.445  -0.798  -4.318   1.00 46.26  ? 203 TYR A CD2 1 
ATOM   1318  C  CE1 . TYR A  1 177 ? 10.991  1.824   -4.988   1.00 49.56  ? 203 TYR A CE1 1 
ATOM   1319  C  CE2 . TYR A  1 177 ? 9.423   0.036   -4.742   1.00 50.34  ? 203 TYR A CE2 1 
ATOM   1320  C  CZ  . TYR A  1 177 ? 9.702   1.344   -5.077   1.00 44.71  ? 203 TYR A CZ  1 
ATOM   1321  O  OH  . TYR A  1 177 ? 8.690   2.175   -5.495   1.00 46.68  ? 203 TYR A OH  1 
ATOM   1322  N  N   . SER A  1 178 ? 14.333  -3.300  -2.380   1.00 41.30  ? 204 SER A N   1 
ATOM   1323  C  CA  . SER A  1 178 ? 15.361  -4.304  -2.105   1.00 35.49  ? 204 SER A CA  1 
ATOM   1324  C  C   . SER A  1 178 ? 15.240  -4.863  -0.690   1.00 38.61  ? 204 SER A C   1 
ATOM   1325  O  O   . SER A  1 178 ? 14.593  -4.262  0.175    1.00 41.15  ? 204 SER A O   1 
ATOM   1326  C  CB  . SER A  1 178 ? 16.764  -3.730  -2.336   1.00 39.89  ? 204 SER A CB  1 
ATOM   1327  O  OG  . SER A  1 178 ? 17.766  -4.593  -1.835   1.00 48.76  ? 204 SER A OG  1 
ATOM   1328  N  N   . ALA A  1 179 ? 15.861  -6.020  -0.445   1.00 34.18  ? 205 ALA A N   1 
ATOM   1329  C  CA  . ALA A  1 179 ? 15.762  -6.679  0.853    1.00 37.37  ? 205 ALA A CA  1 
ATOM   1330  C  C   . ALA A  1 179 ? 16.488  -5.934  1.965    1.00 38.20  ? 205 ALA A C   1 
ATOM   1331  O  O   . ALA A  1 179 ? 16.309  -6.284  3.139    1.00 34.84  ? 205 ALA A O   1 
ATOM   1332  C  CB  . ALA A  1 179 ? 16.301  -8.108  0.754    1.00 38.33  ? 205 ALA A CB  1 
ATOM   1333  N  N   . THR A  1 180 ? 17.305  -4.937  1.630    1.00 37.02  ? 206 THR A N   1 
ATOM   1334  C  CA  . THR A  1 180 ? 17.980  -4.101  2.612    1.00 30.71  ? 206 THR A CA  1 
ATOM   1335  C  C   . THR A  1 180 ? 17.254  -2.790  2.861    1.00 34.39  ? 206 THR A C   1 
ATOM   1336  O  O   . THR A  1 180 ? 17.610  -2.073  3.803    1.00 40.81  ? 206 THR A O   1 
ATOM   1337  C  CB  . THR A  1 180 ? 19.420  -3.805  2.174    1.00 33.71  ? 206 THR A CB  1 
ATOM   1338  O  OG1 . THR A  1 180 ? 19.413  -3.066  0.947    1.00 40.63  ? 206 THR A OG1 1 
ATOM   1339  C  CG2 . THR A  1 180 ? 20.190  -5.097  1.973    1.00 39.99  ? 206 THR A CG2 1 
ATOM   1340  N  N   . CYS A  1 181 ? 16.263  -2.458  2.032    1.00 31.68  ? 207 CYS A N   1 
ATOM   1341  C  CA  . CYS A  1 181 ? 15.563  -1.178  2.059    1.00 35.45  ? 207 CYS A CA  1 
ATOM   1342  C  C   . CYS A  1 181 ? 16.496  -0.018  1.726    1.00 33.42  ? 207 CYS A C   1 
ATOM   1343  O  O   . CYS A  1 181 ? 16.183  1.140   2.022    1.00 36.48  ? 207 CYS A O   1 
ATOM   1344  C  CB  . CYS A  1 181 ? 14.876  -0.935  3.413    1.00 40.44  ? 207 CYS A CB  1 
ATOM   1345  S  SG  . CYS A  1 181 ? 13.456  -2.011  3.828    1.00 39.14  ? 207 CYS A SG  1 
ATOM   1346  N  N   . ASN A  1 182 ? 17.623  -0.302  1.071    1.00 34.11  ? 208 ASN A N   1 
ATOM   1347  C  CA  . ASN A  1 182 ? 18.651  0.699   0.811    1.00 37.76  ? 208 ASN A CA  1 
ATOM   1348  C  C   . ASN A  1 182 ? 18.743  1.091   -0.661   1.00 37.12  ? 208 ASN A C   1 
ATOM   1349  O  O   . ASN A  1 182 ? 19.645  1.848   -1.032   1.00 38.13  ? 208 ASN A O   1 
ATOM   1350  C  CB  . ASN A  1 182 ? 20.009  0.192   1.305    1.00 34.79  ? 208 ASN A CB  1 
ATOM   1351  C  CG  . ASN A  1 182 ? 20.971  1.321   1.634    1.00 41.72  ? 208 ASN A CG  1 
ATOM   1352  O  OD1 . ASN A  1 182 ? 20.556  2.399   2.059    1.00 37.24  ? 208 ASN A OD1 1 
ATOM   1353  N  ND2 . ASN A  1 182 ? 22.266  1.072   1.453    1.00 47.69  ? 208 ASN A ND2 1 
ATOM   1354  N  N   . LYS A  1 183 ? 17.836  0.605   -1.505   1.00 36.76  ? 209 LYS A N   1 
ATOM   1355  C  CA  . LYS A  1 183 ? 17.810  0.960   -2.919   1.00 38.53  ? 209 LYS A CA  1 
ATOM   1356  C  C   . LYS A  1 183 ? 16.694  1.969   -3.168   1.00 39.91  ? 209 LYS A C   1 
ATOM   1357  O  O   . LYS A  1 183 ? 15.525  1.695   -2.875   1.00 40.05  ? 209 LYS A O   1 
ATOM   1358  C  CB  . LYS A  1 183 ? 17.629  -0.278  -3.793   1.00 42.66  ? 209 LYS A CB  1 
ATOM   1359  C  CG  . LYS A  1 183 ? 17.774  0.011   -5.272   1.00 53.37  ? 209 LYS A CG  1 
ATOM   1360  C  CD  . LYS A  1 183 ? 17.870  -1.273  -6.068   1.00 61.17  ? 209 LYS A CD  1 
ATOM   1361  C  CE  . LYS A  1 183 ? 18.109  -0.994  -7.542   1.00 59.99  ? 209 LYS A CE  1 
ATOM   1362  N  NZ  . LYS A  1 183 ? 18.176  -2.260  -8.331   1.00 61.41  ? 209 LYS A NZ  1 
ATOM   1363  N  N   . PHE A  1 184 ? 17.055  3.128   -3.706   1.00 38.93  ? 210 PHE A N   1 
ATOM   1364  C  CA  . PHE A  1 184 ? 16.136  4.249   -3.843   1.00 40.35  ? 210 PHE A CA  1 
ATOM   1365  C  C   . PHE A  1 184 ? 15.615  4.338   -5.272   1.00 50.21  ? 210 PHE A C   1 
ATOM   1366  O  O   . PHE A  1 184 ? 16.391  4.249   -6.230   1.00 52.59  ? 210 PHE A O   1 
ATOM   1367  C  CB  . PHE A  1 184 ? 16.826  5.557   -3.454   1.00 29.99  ? 210 PHE A CB  1 
ATOM   1368  C  CG  . PHE A  1 184 ? 15.941  6.763   -3.558   1.00 37.80  ? 210 PHE A CG  1 
ATOM   1369  C  CD1 . PHE A  1 184 ? 15.081  7.099   -2.527   1.00 33.01  ? 210 PHE A CD1 1 
ATOM   1370  C  CD2 . PHE A  1 184 ? 15.965  7.561   -4.695   1.00 41.73  ? 210 PHE A CD2 1 
ATOM   1371  C  CE1 . PHE A  1 184 ? 14.263  8.214   -2.624   1.00 40.78  ? 210 PHE A CE1 1 
ATOM   1372  C  CE2 . PHE A  1 184 ? 15.153  8.676   -4.798   1.00 38.22  ? 210 PHE A CE2 1 
ATOM   1373  C  CZ  . PHE A  1 184 ? 14.300  9.004   -3.761   1.00 42.52  ? 210 PHE A CZ  1 
ATOM   1374  N  N   . CYS A  1 185 ? 14.302  4.520   -5.406   1.00 48.96  ? 211 CYS A N   1 
ATOM   1375  C  CA  . CYS A  1 185 ? 13.666  4.702   -6.709   1.00 45.30  ? 211 CYS A CA  1 
ATOM   1376  C  C   . CYS A  1 185 ? 12.372  5.466   -6.489   1.00 48.08  ? 211 CYS A C   1 
ATOM   1377  O  O   . CYS A  1 185 ? 11.523  5.026   -5.708   1.00 46.49  ? 211 CYS A O   1 
ATOM   1378  C  CB  . CYS A  1 185 ? 13.392  3.358   -7.387   1.00 44.30  ? 211 CYS A CB  1 
ATOM   1379  S  SG  . CYS A  1 185 ? 12.640  3.482   -9.037   1.00 55.10  ? 211 CYS A SG  1 
ATOM   1380  N  N   . ARG A  1 186 ? 12.220  6.603   -7.168   1.00 50.31  ? 212 ARG A N   1 
ATOM   1381  C  CA  . ARG A  1 186 ? 11.024  7.422   -7.055   1.00 42.40  ? 212 ARG A CA  1 
ATOM   1382  C  C   . ARG A  1 186 ? 10.471  7.712   -8.444   1.00 54.07  ? 212 ARG A C   1 
ATOM   1383  O  O   . ARG A  1 186 ? 11.221  8.160   -9.331   1.00 57.47  ? 212 ARG A O   1 
ATOM   1384  C  CB  . ARG A  1 186 ? 11.349  8.710   -6.289   1.00 45.65  ? 212 ARG A CB  1 
ATOM   1385  C  CG  . ARG A  1 186 ? 10.154  9.485   -5.761   1.00 51.54  ? 212 ARG A CG  1 
ATOM   1386  C  CD  . ARG A  1 186 ? 10.642  10.752  -5.059   1.00 57.65  ? 212 ARG A CD  1 
ATOM   1387  N  NE  . ARG A  1 186 ? 10.077  12.007  -5.548   1.00 77.95  ? 212 ARG A NE  1 
ATOM   1388  C  CZ  . ARG A  1 186 ? 8.826   12.412  -5.342   1.00 80.34  ? 212 ARG A CZ  1 
ATOM   1389  N  NH1 . ARG A  1 186 ? 7.974   11.658  -4.657   1.00 75.55  ? 212 ARG A NH1 1 
ATOM   1390  N  NH2 . ARG A  1 186 ? 8.431   13.584  -5.822   1.00 73.17  ? 212 ARG A NH2 1 
ATOM   1391  N  N   . PRO A  1 187 ? 9.181   7.464   -8.681   1.00 56.90  ? 213 PRO A N   1 
ATOM   1392  C  CA  . PRO A  1 187 ? 8.610   7.717   -10.010  1.00 53.14  ? 213 PRO A CA  1 
ATOM   1393  C  C   . PRO A  1 187 ? 8.550   9.201   -10.328  1.00 53.49  ? 213 PRO A C   1 
ATOM   1394  O  O   . PRO A  1 187 ? 8.282   10.033  -9.457   1.00 52.61  ? 213 PRO A O   1 
ATOM   1395  C  CB  . PRO A  1 187 ? 7.202   7.114   -9.913   1.00 49.35  ? 213 PRO A CB  1 
ATOM   1396  C  CG  . PRO A  1 187 ? 7.248   6.189   -8.738   1.00 50.23  ? 213 PRO A CG  1 
ATOM   1397  C  CD  . PRO A  1 187 ? 8.217   6.811   -7.782   1.00 58.03  ? 213 PRO A CD  1 
ATOM   1398  N  N   . ARG A  1 188 ? 8.781   9.525   -11.598  1.00 55.48  ? 214 ARG A N   1 
ATOM   1399  C  CA  . ARG A  1 188 ? 8.769   10.910  -12.043  1.00 51.84  ? 214 ARG A CA  1 
ATOM   1400  C  C   . ARG A  1 188 ? 8.306   10.964  -13.490  1.00 54.99  ? 214 ARG A C   1 
ATOM   1401  O  O   . ARG A  1 188 ? 8.227   9.944   -14.181  1.00 56.66  ? 214 ARG A O   1 
ATOM   1402  C  CB  . ARG A  1 188 ? 10.148  11.558  -11.890  1.00 53.65  ? 214 ARG A CB  1 
ATOM   1403  C  CG  . ARG A  1 188 ? 11.199  11.002  -12.831  1.00 55.72  ? 214 ARG A CG  1 
ATOM   1404  C  CD  . ARG A  1 188 ? 12.572  11.547  -12.483  1.00 64.83  ? 214 ARG A CD  1 
ATOM   1405  N  NE  . ARG A  1 188 ? 12.513  12.941  -12.055  1.00 69.54  ? 214 ARG A NE  1 
ATOM   1406  C  CZ  . ARG A  1 188 ? 13.527  13.593  -11.496  1.00 71.21  ? 214 ARG A CZ  1 
ATOM   1407  N  NH1 . ARG A  1 188 ? 14.685  12.976  -11.294  1.00 70.66  ? 214 ARG A NH1 1 
ATOM   1408  N  NH2 . ARG A  1 188 ? 13.384  14.862  -11.136  1.00 66.09  ? 214 ARG A NH2 1 
ATOM   1409  N  N   . ASN A  1 189 ? 7.999   12.187  -13.944  1.00 59.86  ? 215 ASN A N   1 
ATOM   1410  C  CA  . ASN A  1 189 ? 7.598   12.466  -15.325  1.00 61.67  ? 215 ASN A CA  1 
ATOM   1411  C  C   . ASN A  1 189 ? 7.967   13.925  -15.606  1.00 61.51  ? 215 ASN A C   1 
ATOM   1412  O  O   . ASN A  1 189 ? 7.147   14.841  -15.496  1.00 54.80  ? 215 ASN A O   1 
ATOM   1413  C  CB  . ASN A  1 189 ? 6.111   12.200  -15.562  1.00 66.09  ? 215 ASN A CB  1 
ATOM   1414  C  CG  . ASN A  1 189 ? 5.669   12.512  -16.988  1.00 70.87  ? 215 ASN A CG  1 
ATOM   1415  O  OD1 . ASN A  1 189 ? 6.270   13.326  -17.690  1.00 72.24  ? 215 ASN A OD1 1 
ATOM   1416  N  ND2 . ASN A  1 189 ? 4.616   11.837  -17.428  1.00 73.60  ? 215 ASN A ND2 1 
ATOM   1417  N  N   . ASP A  1 190 ? 9.224   14.129  -15.980  1.00 61.81  ? 216 ASP A N   1 
ATOM   1418  C  CA  . ASP A  1 190 ? 9.731   15.438  -16.369  1.00 61.13  ? 216 ASP A CA  1 
ATOM   1419  C  C   . ASP A  1 190 ? 10.857  15.209  -17.371  1.00 61.50  ? 216 ASP A C   1 
ATOM   1420  O  O   . ASP A  1 190 ? 10.960  14.131  -17.966  1.00 57.05  ? 216 ASP A O   1 
ATOM   1421  C  CB  . ASP A  1 190 ? 10.154  16.250  -15.128  1.00 68.27  ? 216 ASP A CB  1 
ATOM   1422  C  CG  . ASP A  1 190 ? 11.111  15.493  -14.211  1.00 69.98  ? 216 ASP A CG  1 
ATOM   1423  O  OD1 . ASP A  1 190 ? 11.028  15.705  -12.983  1.00 75.36  ? 216 ASP A OD1 1 
ATOM   1424  O  OD2 . ASP A  1 190 ? 11.942  14.696  -14.700  1.00 65.10  ? 216 ASP A OD2 1 
ATOM   1425  N  N   . PHE A  1 191 ? 11.713  16.217  -17.551  1.00 61.35  ? 217 PHE A N   1 
ATOM   1426  C  CA  . PHE A  1 191 ? 12.780  16.109  -18.539  1.00 65.67  ? 217 PHE A CA  1 
ATOM   1427  C  C   . PHE A  1 191 ? 13.774  15.008  -18.192  1.00 67.52  ? 217 PHE A C   1 
ATOM   1428  O  O   . PHE A  1 191 ? 14.460  14.501  -19.088  1.00 58.57  ? 217 PHE A O   1 
ATOM   1429  C  CB  . PHE A  1 191 ? 13.509  17.450  -18.669  1.00 70.26  ? 217 PHE A CB  1 
ATOM   1430  C  CG  . PHE A  1 191 ? 14.661  17.425  -19.637  1.00 77.19  ? 217 PHE A CG  1 
ATOM   1431  C  CD1 . PHE A  1 191 ? 14.437  17.540  -21.002  1.00 73.53  ? 217 PHE A CD1 1 
ATOM   1432  C  CD2 . PHE A  1 191 ? 15.966  17.281  -19.186  1.00 72.79  ? 217 PHE A CD2 1 
ATOM   1433  C  CE1 . PHE A  1 191 ? 15.491  17.516  -21.897  1.00 75.52  ? 217 PHE A CE1 1 
ATOM   1434  C  CE2 . PHE A  1 191 ? 17.025  17.258  -20.077  1.00 75.81  ? 217 PHE A CE2 1 
ATOM   1435  C  CZ  . PHE A  1 191 ? 16.787  17.375  -21.434  1.00 77.32  ? 217 PHE A CZ  1 
ATOM   1436  N  N   . PHE A  1 192 ? 13.855  14.620  -16.920  1.00 69.59  ? 218 PHE A N   1 
ATOM   1437  C  CA  . PHE A  1 192 ? 14.811  13.622  -16.460  1.00 69.49  ? 218 PHE A CA  1 
ATOM   1438  C  C   . PHE A  1 192 ? 14.302  12.189  -16.578  1.00 68.82  ? 218 PHE A C   1 
ATOM   1439  O  O   . PHE A  1 192 ? 15.017  11.264  -16.176  1.00 72.88  ? 218 PHE A O   1 
ATOM   1440  C  CB  . PHE A  1 192 ? 15.202  13.908  -15.005  1.00 73.01  ? 218 PHE A CB  1 
ATOM   1441  C  CG  . PHE A  1 192 ? 16.017  15.159  -14.831  1.00 71.07  ? 218 PHE A CG  1 
ATOM   1442  C  CD1 . PHE A  1 192 ? 17.350  15.190  -15.202  1.00 67.81  ? 218 PHE A CD1 1 
ATOM   1443  C  CD2 . PHE A  1 192 ? 15.448  16.305  -14.299  1.00 73.28  ? 218 PHE A CD2 1 
ATOM   1444  C  CE1 . PHE A  1 192 ? 18.103  16.339  -15.046  1.00 64.84  ? 218 PHE A CE1 1 
ATOM   1445  C  CE2 . PHE A  1 192 ? 16.196  17.459  -14.140  1.00 74.19  ? 218 PHE A CE2 1 
ATOM   1446  C  CZ  . PHE A  1 192 ? 17.525  17.475  -14.514  1.00 68.61  ? 218 PHE A CZ  1 
ATOM   1447  N  N   . GLY A  1 193 ? 13.111  11.973  -17.111  1.00 56.53  ? 219 GLY A N   1 
ATOM   1448  C  CA  . GLY A  1 193 ? 12.627  10.619  -17.297  1.00 54.65  ? 219 GLY A CA  1 
ATOM   1449  C  C   . GLY A  1 193 ? 11.123  10.532  -17.152  1.00 55.36  ? 219 GLY A C   1 
ATOM   1450  O  O   . GLY A  1 193 ? 10.455  11.458  -16.695  1.00 50.45  ? 219 GLY A O   1 
ATOM   1451  N  N   . HIS A  1 194 ? 10.587  9.373   -17.589  1.00 52.24  ? 220 HIS A N   1 
ATOM   1452  C  CA  . HIS A  1 194 ? 9.159   9.045   -17.502  1.00 55.01  ? 220 HIS A CA  1 
ATOM   1453  C  C   . HIS A  1 194 ? 9.060   7.559   -17.130  1.00 56.07  ? 220 HIS A C   1 
ATOM   1454  O  O   . HIS A  1 194 ? 8.895   6.690   -17.990  1.00 51.59  ? 220 HIS A O   1 
ATOM   1455  C  CB  . HIS A  1 194 ? 8.434   9.349   -18.813  1.00 55.48  ? 220 HIS A CB  1 
ATOM   1456  C  CG  . HIS A  1 194 ? 8.714   10.715  -19.357  1.00 57.26  ? 220 HIS A CG  1 
ATOM   1457  N  ND1 . HIS A  1 194 ? 7.863   11.783  -19.171  1.00 54.09  ? 220 HIS A ND1 1 
ATOM   1458  C  CD2 . HIS A  1 194 ? 9.753   11.187  -20.088  1.00 55.56  ? 220 HIS A CD2 1 
ATOM   1459  C  CE1 . HIS A  1 194 ? 8.366   12.853  -19.759  1.00 52.87  ? 220 HIS A CE1 1 
ATOM   1460  N  NE2 . HIS A  1 194 ? 9.513   12.519  -20.323  1.00 54.26  ? 220 HIS A NE2 1 
ATOM   1461  N  N   . TYR A  1 195 ? 9.160   7.261   -15.834  1.00 58.90  ? 221 TYR A N   1 
ATOM   1462  C  CA  . TYR A  1 195 ? 9.250   5.878   -15.386  1.00 55.16  ? 221 TYR A CA  1 
ATOM   1463  C  C   . TYR A  1 195 ? 8.500   5.677   -14.077  1.00 52.13  ? 221 TYR A C   1 
ATOM   1464  O  O   . TYR A  1 195 ? 8.143   6.629   -13.379  1.00 55.94  ? 221 TYR A O   1 
ATOM   1465  C  CB  . TYR A  1 195 ? 10.713  5.433   -15.218  1.00 53.77  ? 221 TYR A CB  1 
ATOM   1466  C  CG  . TYR A  1 195 ? 11.528  6.273   -14.252  1.00 60.14  ? 221 TYR A CG  1 
ATOM   1467  C  CD1 . TYR A  1 195 ? 11.552  5.986   -12.891  1.00 61.95  ? 221 TYR A CD1 1 
ATOM   1468  C  CD2 . TYR A  1 195 ? 12.284  7.347   -14.707  1.00 56.56  ? 221 TYR A CD2 1 
ATOM   1469  C  CE1 . TYR A  1 195 ? 12.301  6.750   -12.011  1.00 55.77  ? 221 TYR A CE1 1 
ATOM   1470  C  CE2 . TYR A  1 195 ? 13.036  8.114   -13.836  1.00 60.65  ? 221 TYR A CE2 1 
ATOM   1471  C  CZ  . TYR A  1 195 ? 13.041  7.812   -12.490  1.00 56.69  ? 221 TYR A CZ  1 
ATOM   1472  O  OH  . TYR A  1 195 ? 13.786  8.578   -11.625  1.00 56.04  ? 221 TYR A OH  1 
ATOM   1473  N  N   . THR A  1 196 ? 8.262   4.404   -13.766  1.00 55.47  ? 222 THR A N   1 
ATOM   1474  C  CA  . THR A  1 196 ? 7.760   3.951   -12.477  1.00 59.30  ? 222 THR A CA  1 
ATOM   1475  C  C   . THR A  1 196 ? 8.716   2.895   -11.931  1.00 53.67  ? 222 THR A C   1 
ATOM   1476  O  O   . THR A  1 196 ? 9.572   2.370   -12.648  1.00 50.45  ? 222 THR A O   1 
ATOM   1477  C  CB  . THR A  1 196 ? 6.332   3.392   -12.590  1.00 59.87  ? 222 THR A CB  1 
ATOM   1478  O  OG1 . THR A  1 196 ? 6.297   2.351   -13.575  1.00 61.55  ? 222 THR A OG1 1 
ATOM   1479  C  CG2 . THR A  1 196 ? 5.357   4.489   -12.987  1.00 47.22  ? 222 THR A CG2 1 
ATOM   1480  N  N   . CYS A  1 197 ? 8.577   2.587   -10.645  1.00 57.18  ? 223 CYS A N   1 
ATOM   1481  C  CA  . CYS A  1 197 ? 9.470   1.653   -9.971   1.00 52.96  ? 223 CYS A CA  1 
ATOM   1482  C  C   . CYS A  1 197 ? 8.799   0.300   -9.779   1.00 53.37  ? 223 CYS A C   1 
ATOM   1483  O  O   . CYS A  1 197 ? 7.590   0.223   -9.538   1.00 55.25  ? 223 CYS A O   1 
ATOM   1484  C  CB  . CYS A  1 197 ? 9.906   2.207   -8.615   1.00 52.49  ? 223 CYS A CB  1 
ATOM   1485  S  SG  . CYS A  1 197 ? 10.667  3.840   -8.696   1.00 48.47  ? 223 CYS A SG  1 
ATOM   1486  N  N   . ASP A  1 198 ? 9.586   -0.770  -9.904   1.00 54.00  ? 224 ASP A N   1 
ATOM   1487  C  CA  . ASP A  1 198 ? 9.083   -2.111  -9.626   1.00 63.03  ? 224 ASP A CA  1 
ATOM   1488  C  C   . ASP A  1 198 ? 9.419   -2.532  -8.195   1.00 63.83  ? 224 ASP A C   1 
ATOM   1489  O  O   . ASP A  1 198 ? 9.496   -1.688  -7.296   1.00 61.54  ? 224 ASP A O   1 
ATOM   1490  C  CB  . ASP A  1 198 ? 9.626   -3.124  -10.644  1.00 62.25  ? 224 ASP A CB  1 
ATOM   1491  C  CG  . ASP A  1 198 ? 11.147  -3.198  -10.667  1.00 65.13  ? 224 ASP A CG  1 
ATOM   1492  O  OD1 . ASP A  1 198 ? 11.806  -2.588  -9.798   1.00 70.15  ? 224 ASP A OD1 1 
ATOM   1493  O  OD2 . ASP A  1 198 ? 11.686  -3.892  -11.556  1.00 60.34  ? 224 ASP A OD2 1 
ATOM   1494  N  N   . GLN A  1 199 ? 9.630   -3.833  -7.978   1.00 64.93  ? 225 GLN A N   1 
ATOM   1495  C  CA  . GLN A  1 199 ? 9.860   -4.356  -6.635   1.00 52.68  ? 225 GLN A CA  1 
ATOM   1496  C  C   . GLN A  1 199 ? 11.317  -4.252  -6.220   1.00 62.63  ? 225 GLN A C   1 
ATOM   1497  O  O   . GLN A  1 199 ? 11.611  -4.085  -5.030   1.00 66.45  ? 225 GLN A O   1 
ATOM   1498  C  CB  . GLN A  1 199 ? 9.410   -5.814  -6.553   1.00 59.22  ? 225 GLN A CB  1 
ATOM   1499  C  CG  . GLN A  1 199 ? 7.912   -6.006  -6.383   1.00 75.93  ? 225 GLN A CG  1 
ATOM   1500  C  CD  . GLN A  1 199 ? 7.093   -5.138  -7.319   1.00 81.55  ? 225 GLN A CD  1 
ATOM   1501  O  OE1 . GLN A  1 199 ? 7.360   -5.072  -8.520   1.00 82.81  ? 225 GLN A OE1 1 
ATOM   1502  N  NE2 . GLN A  1 199 ? 6.098   -4.453  -6.769   1.00 75.34  ? 225 GLN A NE2 1 
ATOM   1503  N  N   . TYR A  1 200 ? 12.235  -4.363  -7.174   1.00 61.86  ? 226 TYR A N   1 
ATOM   1504  C  CA  . TYR A  1 200 ? 13.660  -4.259  -6.912   1.00 55.54  ? 226 TYR A CA  1 
ATOM   1505  C  C   . TYR A  1 200 ? 14.188  -2.851  -7.149   1.00 59.61  ? 226 TYR A C   1 
ATOM   1506  O  O   . TYR A  1 200 ? 15.394  -2.678  -7.356   1.00 62.66  ? 226 TYR A O   1 
ATOM   1507  C  CB  . TYR A  1 200 ? 14.413  -5.271  -7.777   1.00 59.02  ? 226 TYR A CB  1 
ATOM   1508  C  CG  . TYR A  1 200 ? 13.688  -6.594  -7.900   1.00 59.63  ? 226 TYR A CG  1 
ATOM   1509  C  CD1 . TYR A  1 200 ? 12.866  -6.859  -8.985   1.00 59.95  ? 226 TYR A CD1 1 
ATOM   1510  C  CD2 . TYR A  1 200 ? 13.799  -7.564  -6.912   1.00 70.99  ? 226 TYR A CD2 1 
ATOM   1511  C  CE1 . TYR A  1 200 ? 12.191  -8.059  -9.094   1.00 64.48  ? 226 TYR A CE1 1 
ATOM   1512  C  CE2 . TYR A  1 200 ? 13.130  -8.769  -7.012   1.00 63.47  ? 226 TYR A CE2 1 
ATOM   1513  C  CZ  . TYR A  1 200 ? 12.326  -9.011  -8.105   1.00 68.42  ? 226 TYR A CZ  1 
ATOM   1514  O  OH  . TYR A  1 200 ? 11.656  -10.210 -8.211   1.00 67.11  ? 226 TYR A OH  1 
ATOM   1515  N  N   . GLY A  1 201 ? 13.313  -1.847  -7.123   1.00 54.62  ? 227 GLY A N   1 
ATOM   1516  C  CA  . GLY A  1 201 ? 13.743  -0.476  -7.320   1.00 55.66  ? 227 GLY A CA  1 
ATOM   1517  C  C   . GLY A  1 201 ? 14.255  -0.192  -8.710   1.00 58.23  ? 227 GLY A C   1 
ATOM   1518  O  O   . GLY A  1 201 ? 15.088  0.703   -8.888   1.00 61.42  ? 227 GLY A O   1 
ATOM   1519  N  N   . ASN A  1 202 ? 13.779  -0.935  -9.702   1.00 59.45  ? 228 ASN A N   1 
ATOM   1520  C  CA  . ASN A  1 202 ? 14.180  -0.739  -11.084  1.00 56.91  ? 228 ASN A CA  1 
ATOM   1521  C  C   . ASN A  1 202 ? 13.192  0.171   -11.798  1.00 58.99  ? 228 ASN A C   1 
ATOM   1522  O  O   . ASN A  1 202 ? 12.000  0.207   -11.477  1.00 54.48  ? 228 ASN A O   1 
ATOM   1523  C  CB  . ASN A  1 202 ? 14.273  -2.081  -11.809  1.00 58.84  ? 228 ASN A CB  1 
ATOM   1524  C  CG  . ASN A  1 202 ? 15.353  -2.976  -11.238  1.00 58.94  ? 228 ASN A CG  1 
ATOM   1525  O  OD1 . ASN A  1 202 ? 16.372  -2.497  -10.738  1.00 57.53  ? 228 ASN A OD1 1 
ATOM   1526  N  ND2 . ASN A  1 202 ? 15.129  -4.284  -11.296  1.00 54.03  ? 228 ASN A ND2 1 
ATOM   1527  N  N   . LYS A  1 203 ? 13.705  0.900   -12.786  1.00 57.22  ? 229 LYS A N   1 
ATOM   1528  C  CA  . LYS A  1 203 ? 12.909  1.861   -13.537  1.00 55.78  ? 229 LYS A CA  1 
ATOM   1529  C  C   . LYS A  1 203 ? 12.062  1.130   -14.571  1.00 47.24  ? 229 LYS A C   1 
ATOM   1530  O  O   . LYS A  1 203 ? 12.588  0.363   -15.384  1.00 48.46  ? 229 LYS A O   1 
ATOM   1531  C  CB  . LYS A  1 203 ? 13.827  2.878   -14.209  1.00 55.37  ? 229 LYS A CB  1 
ATOM   1532  C  CG  . LYS A  1 203 ? 14.938  3.366   -13.300  1.00 55.38  ? 229 LYS A CG  1 
ATOM   1533  C  CD  . LYS A  1 203 ? 15.496  4.699   -13.751  1.00 62.82  ? 229 LYS A CD  1 
ATOM   1534  C  CE  . LYS A  1 203 ? 16.871  4.930   -13.147  1.00 71.90  ? 229 LYS A CE  1 
ATOM   1535  N  NZ  . LYS A  1 203 ? 17.607  6.035   -13.816  1.00 62.84  ? 229 LYS A NZ  1 
ATOM   1536  N  N   . ALA A  1 204 ? 10.752  1.347   -14.526  1.00 44.83  ? 230 ALA A N   1 
ATOM   1537  C  CA  . ALA A  1 204 ? 9.817   0.777   -15.489  1.00 47.05  ? 230 ALA A CA  1 
ATOM   1538  C  C   . ALA A  1 204 ? 9.201   1.924   -16.282  1.00 56.76  ? 230 ALA A C   1 
ATOM   1539  O  O   . ALA A  1 204 ? 8.392   2.689   -15.743  1.00 52.12  ? 230 ALA A O   1 
ATOM   1540  C  CB  . ALA A  1 204 ? 8.746   -0.050  -14.782  1.00 41.45  ? 230 ALA A CB  1 
ATOM   1541  N  N   . CYS A  1 205 ? 9.584   2.039   -17.558  1.00 54.28  ? 231 CYS A N   1 
ATOM   1542  C  CA  . CYS A  1 205 ? 9.109   3.136   -18.397  1.00 53.70  ? 231 CYS A CA  1 
ATOM   1543  C  C   . CYS A  1 205 ? 7.587   3.148   -18.473  1.00 49.39  ? 231 CYS A C   1 
ATOM   1544  O  O   . CYS A  1 205 ? 6.943   2.097   -18.506  1.00 47.24  ? 231 CYS A O   1 
ATOM   1545  C  CB  . CYS A  1 205 ? 9.691   3.026   -19.811  1.00 47.49  ? 231 CYS A CB  1 
ATOM   1546  S  SG  . CYS A  1 205 ? 11.490  3.174   -19.949  1.00 60.23  ? 231 CYS A SG  1 
ATOM   1547  N  N   . MET A  1 206 ? 7.011   4.349   -18.486  1.00 45.20  ? 232 MET A N   1 
ATOM   1548  C  CA  . MET A  1 206 ? 5.575   4.480   -18.671  1.00 48.48  ? 232 MET A CA  1 
ATOM   1549  C  C   . MET A  1 206 ? 5.198   4.146   -20.115  1.00 60.39  ? 232 MET A C   1 
ATOM   1550  O  O   . MET A  1 206 ? 6.046   4.076   -21.011  1.00 64.03  ? 232 MET A O   1 
ATOM   1551  C  CB  . MET A  1 206 ? 5.106   5.883   -18.294  1.00 52.24  ? 232 MET A CB  1 
ATOM   1552  C  CG  . MET A  1 206 ? 5.666   6.384   -16.977  1.00 49.14  ? 232 MET A CG  1 
ATOM   1553  S  SD  . MET A  1 206 ? 5.322   8.129   -16.682  1.00 64.83  ? 232 MET A SD  1 
ATOM   1554  C  CE  . MET A  1 206 ? 3.544   8.093   -16.464  1.00 48.02  ? 232 MET A CE  1 
ATOM   1555  N  N   . ASP A  1 207 ? 3.903   3.935   -20.336  1.00 62.57  ? 233 ASP A N   1 
ATOM   1556  C  CA  . ASP A  1 207 ? 3.422   3.491   -21.641  1.00 64.74  ? 233 ASP A CA  1 
ATOM   1557  C  C   . ASP A  1 207 ? 3.661   4.565   -22.697  1.00 61.24  ? 233 ASP A C   1 
ATOM   1558  O  O   . ASP A  1 207 ? 3.185   5.698   -22.563  1.00 55.17  ? 233 ASP A O   1 
ATOM   1559  C  CB  . ASP A  1 207 ? 1.940   3.132   -21.560  1.00 61.54  ? 233 ASP A CB  1 
ATOM   1560  C  CG  . ASP A  1 207 ? 1.647   2.122   -20.468  1.00 73.27  ? 233 ASP A CG  1 
ATOM   1561  O  OD1 . ASP A  1 207 ? 2.133   2.317   -19.333  1.00 72.50  ? 233 ASP A OD1 1 
ATOM   1562  O  OD2 . ASP A  1 207 ? 0.939   1.130   -20.747  1.00 84.65  ? 233 ASP A OD2 1 
ATOM   1563  N  N   . GLY A  1 208 ? 4.407   4.209   -23.740  1.00 53.63  ? 234 GLY A N   1 
ATOM   1564  C  CA  . GLY A  1 208 ? 4.743   5.132   -24.803  1.00 53.93  ? 234 GLY A CA  1 
ATOM   1565  C  C   . GLY A  1 208 ? 6.149   5.687   -24.777  1.00 58.48  ? 234 GLY A C   1 
ATOM   1566  O  O   . GLY A  1 208 ? 6.435   6.627   -25.527  1.00 59.27  ? 234 GLY A O   1 
ATOM   1567  N  N   . TRP A  1 209 ? 7.038   5.132   -23.956  1.00 54.20  ? 235 TRP A N   1 
ATOM   1568  C  CA  . TRP A  1 209 ? 8.400   5.626   -23.828  1.00 51.95  ? 235 TRP A CA  1 
ATOM   1569  C  C   . TRP A  1 209 ? 9.389   4.467   -23.883  1.00 47.56  ? 235 TRP A C   1 
ATOM   1570  O  O   . TRP A  1 209 ? 9.035   3.309   -23.652  1.00 50.86  ? 235 TRP A O   1 
ATOM   1571  C  CB  . TRP A  1 209 ? 8.599   6.407   -22.516  1.00 53.79  ? 235 TRP A CB  1 
ATOM   1572  C  CG  . TRP A  1 209 ? 7.764   7.652   -22.379  1.00 53.90  ? 235 TRP A CG  1 
ATOM   1573  C  CD1 . TRP A  1 209 ? 6.503   7.742   -21.862  1.00 49.11  ? 235 TRP A CD1 1 
ATOM   1574  C  CD2 . TRP A  1 209 ? 8.138   8.986   -22.756  1.00 54.67  ? 235 TRP A CD2 1 
ATOM   1575  N  NE1 . TRP A  1 209 ? 6.068   9.048   -21.896  1.00 47.06  ? 235 TRP A NE1 1 
ATOM   1576  C  CE2 . TRP A  1 209 ? 7.052   9.830   -22.440  1.00 48.88  ? 235 TRP A CE2 1 
ATOM   1577  C  CE3 . TRP A  1 209 ? 9.284   9.548   -23.331  1.00 52.98  ? 235 TRP A CE3 1 
ATOM   1578  C  CZ2 . TRP A  1 209 ? 7.079   11.205  -22.679  1.00 46.18  ? 235 TRP A CZ2 1 
ATOM   1579  C  CZ3 . TRP A  1 209 ? 9.308   10.914  -23.569  1.00 51.28  ? 235 TRP A CZ3 1 
ATOM   1580  C  CH2 . TRP A  1 209 ? 8.213   11.726  -23.242  1.00 47.01  ? 235 TRP A CH2 1 
ATOM   1581  N  N   . MET A  1 210 ? 10.644  4.794   -24.190  1.00 52.23  ? 236 MET A N   1 
ATOM   1582  C  CA  . MET A  1 210 ? 11.744  3.832   -24.181  1.00 49.92  ? 236 MET A CA  1 
ATOM   1583  C  C   . MET A  1 210 ? 13.039  4.596   -23.890  1.00 54.37  ? 236 MET A C   1 
ATOM   1584  O  O   . MET A  1 210 ? 13.012  5.798   -23.608  1.00 56.15  ? 236 MET A O   1 
ATOM   1585  C  CB  . MET A  1 210 ? 11.759  3.028   -25.491  1.00 57.00  ? 236 MET A CB  1 
ATOM   1586  C  CG  . MET A  1 210 ? 12.049  3.820   -26.762  1.00 67.21  ? 236 MET A CG  1 
ATOM   1587  S  SD  . MET A  1 210 ? 11.702  2.835   -28.241  1.00 78.80  ? 236 MET A SD  1 
ATOM   1588  C  CE  . MET A  1 210 ? 11.441  4.105   -29.473  1.00 69.59  ? 236 MET A CE  1 
ATOM   1589  N  N   . GLY A  1 211 ? 14.180  3.900   -23.963  1.00 52.68  ? 237 GLY A N   1 
ATOM   1590  C  CA  . GLY A  1 211 ? 15.478  4.460   -23.609  1.00 68.05  ? 237 GLY A CA  1 
ATOM   1591  C  C   . GLY A  1 211 ? 15.964  3.973   -22.249  1.00 80.63  ? 237 GLY A C   1 
ATOM   1592  O  O   . GLY A  1 211 ? 15.332  3.147   -21.579  1.00 85.38  ? 237 GLY A O   1 
ATOM   1593  N  N   . LYS A  1 212 ? 17.139  4.466   -21.842  1.00 80.26  ? 238 LYS A N   1 
ATOM   1594  C  CA  . LYS A  1 212 ? 17.603  4.104   -20.504  1.00 82.69  ? 238 LYS A CA  1 
ATOM   1595  C  C   . LYS A  1 212 ? 16.744  4.736   -19.422  1.00 82.50  ? 238 LYS A C   1 
ATOM   1596  O  O   . LYS A  1 212 ? 16.092  4.040   -18.634  1.00 85.12  ? 238 LYS A O   1 
ATOM   1597  C  CB  . LYS A  1 212 ? 19.043  4.532   -20.260  1.00 83.35  ? 238 LYS A CB  1 
ATOM   1598  C  CG  . LYS A  1 212 ? 19.907  3.438   -19.778  1.00 93.95  ? 238 LYS A CG  1 
ATOM   1599  C  CD  . LYS A  1 212 ? 20.400  2.492   -20.842  1.00 100.24 ? 238 LYS A CD  1 
ATOM   1600  C  CE  . LYS A  1 212 ? 21.267  1.497   -20.270  1.00 97.08  ? 238 LYS A CE  1 
ATOM   1601  N  NZ  . LYS A  1 212 ? 21.220  0.075   -20.747  1.00 94.08  ? 238 LYS A NZ  1 
ATOM   1602  N  N   . GLU A  1 213 ? 16.802  6.063   -19.320  1.00 72.74  ? 239 GLU A N   1 
ATOM   1603  C  CA  . GLU A  1 213 ? 16.056  6.806   -18.316  1.00 67.09  ? 239 GLU A CA  1 
ATOM   1604  C  C   . GLU A  1 213 ? 14.630  7.096   -18.763  1.00 66.27  ? 239 GLU A C   1 
ATOM   1605  O  O   . GLU A  1 213 ? 13.988  8.007   -18.226  1.00 60.27  ? 239 GLU A O   1 
ATOM   1606  C  CB  . GLU A  1 213 ? 16.796  8.102   -17.972  1.00 67.83  ? 239 GLU A CB  1 
ATOM   1607  C  CG  . GLU A  1 213 ? 18.305  7.888   -17.792  1.00 79.40  ? 239 GLU A CG  1 
ATOM   1608  C  CD  . GLU A  1 213 ? 18.679  7.395   -16.399  1.00 88.63  ? 239 GLU A CD  1 
ATOM   1609  O  OE1 . GLU A  1 213 ? 19.376  8.136   -15.671  1.00 84.54  ? 239 GLU A OE1 1 
ATOM   1610  O  OE2 . GLU A  1 213 ? 18.267  6.275   -16.026  1.00 94.12  ? 239 GLU A OE2 1 
ATOM   1611  N  N   . CYS A  1 214 ? 14.129  6.337   -19.739  1.00 68.98  ? 240 CYS A N   1 
ATOM   1612  C  CA  . CYS A  1 214 ? 12.791  6.524   -20.291  1.00 61.93  ? 240 CYS A CA  1 
ATOM   1613  C  C   . CYS A  1 214 ? 12.603  7.955   -20.782  1.00 63.71  ? 240 CYS A C   1 
ATOM   1614  O  O   . CYS A  1 214 ? 11.591  8.609   -20.520  1.00 61.74  ? 240 CYS A O   1 
ATOM   1615  C  CB  . CYS A  1 214 ? 11.722  6.137   -19.270  1.00 61.97  ? 240 CYS A CB  1 
ATOM   1616  S  SG  . CYS A  1 214 ? 11.994  4.519   -18.504  1.00 73.18  ? 240 CYS A SG  1 
ATOM   1617  N  N   . LYS A  1 215 ? 13.612  8.441   -21.505  1.00 68.15  ? 241 LYS A N   1 
ATOM   1618  C  CA  . LYS A  1 215 ? 13.623  9.801   -22.022  1.00 65.02  ? 241 LYS A CA  1 
ATOM   1619  C  C   . LYS A  1 215 ? 13.190  9.898   -23.479  1.00 65.08  ? 241 LYS A C   1 
ATOM   1620  O  O   . LYS A  1 215 ? 12.793  10.983  -23.919  1.00 67.95  ? 241 LYS A O   1 
ATOM   1621  C  CB  . LYS A  1 215 ? 15.025  10.401  -21.863  1.00 61.90  ? 241 LYS A CB  1 
ATOM   1622  C  CG  . LYS A  1 215 ? 15.450  10.591  -20.414  1.00 67.39  ? 241 LYS A CG  1 
ATOM   1623  C  CD  . LYS A  1 215 ? 16.774  11.333  -20.313  1.00 70.33  ? 241 LYS A CD  1 
ATOM   1624  C  CE  . LYS A  1 215 ? 16.666  12.753  -20.840  1.00 69.12  ? 241 LYS A CE  1 
ATOM   1625  N  NZ  . LYS A  1 215 ? 17.982  13.441  -20.783  1.00 72.07  ? 241 LYS A NZ  1 
ATOM   1626  N  N   . GLU A  1 216 ? 13.241  8.800   -24.226  1.00 59.49  ? 242 GLU A N   1 
ATOM   1627  C  CA  . GLU A  1 216 ? 12.814  8.790   -25.615  1.00 60.84  ? 242 GLU A CA  1 
ATOM   1628  C  C   . GLU A  1 216 ? 11.372  8.308   -25.723  1.00 61.61  ? 242 GLU A C   1 
ATOM   1629  O  O   . GLU A  1 216 ? 10.929  7.441   -24.966  1.00 64.95  ? 242 GLU A O   1 
ATOM   1630  C  CB  . GLU A  1 216 ? 13.748  7.890   -26.429  1.00 58.40  ? 242 GLU A CB  1 
ATOM   1631  C  CG  . GLU A  1 216 ? 13.249  7.466   -27.791  1.00 62.93  ? 242 GLU A CG  1 
ATOM   1632  C  CD  . GLU A  1 216 ? 14.294  6.674   -28.550  1.00 79.14  ? 242 GLU A CD  1 
ATOM   1633  O  OE1 . GLU A  1 216 ? 15.471  6.692   -28.127  1.00 82.71  ? 242 GLU A OE1 1 
ATOM   1634  O  OE2 . GLU A  1 216 ? 13.944  6.032   -29.563  1.00 77.59  ? 242 GLU A OE2 1 
ATOM   1635  N  N   . ALA A  1 217 ? 10.640  8.882   -26.675  1.00 59.96  ? 243 ALA A N   1 
ATOM   1636  C  CA  . ALA A  1 217 ? 9.225   8.596   -26.854  1.00 63.56  ? 243 ALA A CA  1 
ATOM   1637  C  C   . ALA A  1 217 ? 9.005   7.819   -28.144  1.00 68.72  ? 243 ALA A C   1 
ATOM   1638  O  O   . ALA A  1 217 ? 9.747   7.976   -29.118  1.00 66.06  ? 243 ALA A O   1 
ATOM   1639  C  CB  . ALA A  1 217 ? 8.396   9.885   -26.889  1.00 51.54  ? 243 ALA A CB  1 
ATOM   1640  N  N   . VAL A  1 218 ? 7.973   6.981   -28.145  1.00 65.80  ? 244 VAL A N   1 
ATOM   1641  C  CA  . VAL A  1 218 ? 7.575   6.257   -29.346  1.00 63.41  ? 244 VAL A CA  1 
ATOM   1642  C  C   . VAL A  1 218 ? 6.608   7.145   -30.119  1.00 61.15  ? 244 VAL A C   1 
ATOM   1643  O  O   . VAL A  1 218 ? 5.629   7.659   -29.564  1.00 59.39  ? 244 VAL A O   1 
ATOM   1644  C  CB  . VAL A  1 218 ? 6.972   4.878   -29.017  1.00 60.72  ? 244 VAL A CB  1 
ATOM   1645  C  CG1 . VAL A  1 218 ? 7.885   4.126   -28.050  1.00 65.70  ? 244 VAL A CG1 1 
ATOM   1646  C  CG2 . VAL A  1 218 ? 5.548   4.970   -28.459  1.00 60.79  ? 244 VAL A CG2 1 
ATOM   1647  N  N   . CYS A  1 219 ? 6.923   7.388   -31.384  1.00 56.50  ? 245 CYS A N   1 
ATOM   1648  C  CA  . CYS A  1 219 ? 6.044   8.169   -32.234  1.00 57.21  ? 245 CYS A CA  1 
ATOM   1649  C  C   . CYS A  1 219 ? 4.878   7.312   -32.711  1.00 55.10  ? 245 CYS A C   1 
ATOM   1650  O  O   . CYS A  1 219 ? 4.933   6.079   -32.690  1.00 50.51  ? 245 CYS A O   1 
ATOM   1651  C  CB  . CYS A  1 219 ? 6.825   8.734   -33.417  1.00 54.37  ? 245 CYS A CB  1 
ATOM   1652  S  SG  . CYS A  1 219 ? 8.317   9.640   -32.927  1.00 55.12  ? 245 CYS A SG  1 
ATOM   1653  N  N   . LYS A  1 220 ? 3.803   7.987   -33.121  1.00 59.18  ? 246 LYS A N   1 
ATOM   1654  C  CA  . LYS A  1 220 ? 2.624   7.298   -33.629  1.00 57.89  ? 246 LYS A CA  1 
ATOM   1655  C  C   . LYS A  1 220 ? 3.023   6.266   -34.676  1.00 56.64  ? 246 LYS A C   1 
ATOM   1656  O  O   . LYS A  1 220 ? 3.921   6.496   -35.492  1.00 49.78  ? 246 LYS A O   1 
ATOM   1657  C  CB  . LYS A  1 220 ? 1.628   8.304   -34.216  1.00 54.94  ? 246 LYS A CB  1 
ATOM   1658  C  CG  . LYS A  1 220 ? 1.433   8.222   -35.724  1.00 52.79  ? 246 LYS A CG  1 
ATOM   1659  C  CD  . LYS A  1 220 ? 0.837   9.508   -36.269  1.00 54.80  ? 246 LYS A CD  1 
ATOM   1660  C  CE  . LYS A  1 220 ? -0.542  9.785   -35.690  1.00 59.59  ? 246 LYS A CE  1 
ATOM   1661  N  NZ  . LYS A  1 220 ? -1.091  11.077  -36.194  1.00 63.77  ? 246 LYS A NZ  1 
ATOM   1662  N  N   . GLN A  1 221 ? 2.374   5.107   -34.615  1.00 54.82  ? 247 GLN A N   1 
ATOM   1663  C  CA  . GLN A  1 221 ? 2.703   4.023   -35.527  1.00 55.44  ? 247 GLN A CA  1 
ATOM   1664  C  C   . GLN A  1 221 ? 2.429   4.455   -36.962  1.00 52.37  ? 247 GLN A C   1 
ATOM   1665  O  O   . GLN A  1 221 ? 1.331   4.919   -37.288  1.00 51.08  ? 247 GLN A O   1 
ATOM   1666  C  CB  . GLN A  1 221 ? 1.891   2.775   -35.169  1.00 53.04  ? 247 GLN A CB  1 
ATOM   1667  C  CG  . GLN A  1 221 ? 2.673   1.469   -35.247  1.00 57.07  ? 247 GLN A CG  1 
ATOM   1668  C  CD  . GLN A  1 221 ? 3.065   1.094   -36.669  1.00 65.37  ? 247 GLN A CD  1 
ATOM   1669  O  OE1 . GLN A  1 221 ? 2.207   0.855   -37.521  1.00 64.05  ? 247 GLN A OE1 1 
ATOM   1670  N  NE2 . GLN A  1 221 ? 4.369   1.036   -36.929  1.00 61.38  ? 247 GLN A NE2 1 
ATOM   1671  N  N   . GLY A  1 222 ? 3.442   4.327   -37.815  1.00 45.11  ? 248 GLY A N   1 
ATOM   1672  C  CA  . GLY A  1 222 ? 3.345   4.792   -39.181  1.00 43.77  ? 248 GLY A CA  1 
ATOM   1673  C  C   . GLY A  1 222 ? 3.984   6.135   -39.463  1.00 43.12  ? 248 GLY A C   1 
ATOM   1674  O  O   . GLY A  1 222 ? 3.922   6.593   -40.608  1.00 46.70  ? 248 GLY A O   1 
ATOM   1675  N  N   . CYS A  1 223 ? 4.570   6.790   -38.466  1.00 45.43  ? 249 CYS A N   1 
ATOM   1676  C  CA  . CYS A  1 223 ? 5.233   8.068   -38.692  1.00 37.62  ? 249 CYS A CA  1 
ATOM   1677  C  C   . CYS A  1 223 ? 6.501   7.886   -39.522  1.00 36.59  ? 249 CYS A C   1 
ATOM   1678  O  O   . CYS A  1 223 ? 7.342   7.035   -39.216  1.00 40.03  ? 249 CYS A O   1 
ATOM   1679  C  CB  . CYS A  1 223 ? 5.565   8.729   -37.356  1.00 45.45  ? 249 CYS A CB  1 
ATOM   1680  S  SG  . CYS A  1 223 ? 6.210   10.420  -37.455  1.00 45.66  ? 249 CYS A SG  1 
ATOM   1681  N  N   . ASN A  1 224 ? 6.621   8.672   -40.591  1.00 34.85  ? 250 ASN A N   1 
ATOM   1682  C  CA  . ASN A  1 224 ? 7.808   8.681   -41.448  1.00 38.22  ? 250 ASN A CA  1 
ATOM   1683  C  C   . ASN A  1 224 ? 8.939   9.396   -40.715  1.00 43.25  ? 250 ASN A C   1 
ATOM   1684  O  O   . ASN A  1 224 ? 9.013   10.626  -40.706  1.00 39.18  ? 250 ASN A O   1 
ATOM   1685  C  CB  . ASN A  1 224 ? 7.490   9.349   -42.781  1.00 34.79  ? 250 ASN A CB  1 
ATOM   1686  C  CG  . ASN A  1 224 ? 8.597   9.181   -43.803  1.00 35.80  ? 250 ASN A CG  1 
ATOM   1687  O  OD1 . ASN A  1 224 ? 9.758   8.970   -43.457  1.00 38.28  ? 250 ASN A OD1 1 
ATOM   1688  N  ND2 . ASN A  1 224 ? 8.235   9.257   -45.076  1.00 30.41  ? 250 ASN A ND2 1 
ATOM   1689  N  N   . LEU A  1 225 ? 9.832   8.622   -40.099  1.00 46.97  ? 251 LEU A N   1 
ATOM   1690  C  CA  . LEU A  1 225 ? 10.881  9.165   -39.244  1.00 44.28  ? 251 LEU A CA  1 
ATOM   1691  C  C   . LEU A  1 225 ? 12.060  9.766   -40.016  1.00 42.37  ? 251 LEU A C   1 
ATOM   1692  O  O   . LEU A  1 225 ? 13.027  10.206  -39.382  1.00 51.24  ? 251 LEU A O   1 
ATOM   1693  C  CB  . LEU A  1 225 ? 11.386  8.069   -38.298  1.00 44.02  ? 251 LEU A CB  1 
ATOM   1694  C  CG  . LEU A  1 225 ? 10.358  7.500   -37.318  1.00 43.75  ? 251 LEU A CG  1 
ATOM   1695  C  CD1 . LEU A  1 225 ? 10.908  6.269   -36.611  1.00 41.80  ? 251 LEU A CD1 1 
ATOM   1696  C  CD2 . LEU A  1 225 ? 9.908   8.553   -36.322  1.00 46.23  ? 251 LEU A CD2 1 
ATOM   1697  N  N   . LEU A  1 226 ? 11.993  9.841   -41.347  1.00 40.64  ? 252 LEU A N   1 
ATOM   1698  C  CA  . LEU A  1 226 ? 12.900  10.677  -42.126  1.00 38.73  ? 252 LEU A CA  1 
ATOM   1699  C  C   . LEU A  1 226 ? 12.365  12.081  -42.363  1.00 42.17  ? 252 LEU A C   1 
ATOM   1700  O  O   . LEU A  1 226 ? 13.141  12.973  -42.719  1.00 46.36  ? 252 LEU A O   1 
ATOM   1701  C  CB  . LEU A  1 226 ? 13.196  10.029  -43.485  1.00 36.67  ? 252 LEU A CB  1 
ATOM   1702  C  CG  . LEU A  1 226 ? 14.391  10.557  -44.294  1.00 38.76  ? 252 LEU A CG  1 
ATOM   1703  C  CD1 . LEU A  1 226 ? 15.717  10.347  -43.586  1.00 43.79  ? 252 LEU A CD1 1 
ATOM   1704  C  CD2 . LEU A  1 226 ? 14.422  9.945   -45.691  1.00 34.45  ? 252 LEU A CD2 1 
ATOM   1705  N  N   . HIS A  1 227 ? 11.078  12.312  -42.125  1.00 44.69  ? 253 HIS A N   1 
ATOM   1706  C  CA  . HIS A  1 227 ? 10.487  13.618  -42.341  1.00 39.91  ? 253 HIS A CA  1 
ATOM   1707  C  C   . HIS A  1 227 ? 9.812   14.168  -41.095  1.00 40.79  ? 253 HIS A C   1 
ATOM   1708  O  O   . HIS A  1 227 ? 9.259   15.271  -41.148  1.00 46.12  ? 253 HIS A O   1 
ATOM   1709  C  CB  . HIS A  1 227 ? 9.466   13.558  -43.490  1.00 35.24  ? 253 HIS A CB  1 
ATOM   1710  C  CG  . HIS A  1 227 ? 10.012  12.989  -44.766  1.00 37.27  ? 253 HIS A CG  1 
ATOM   1711  N  ND1 . HIS A  1 227 ? 9.260   12.198  -45.608  1.00 36.70  ? 253 HIS A ND1 1 
ATOM   1712  C  CD2 . HIS A  1 227 ? 11.227  13.110  -45.353  1.00 40.12  ? 253 HIS A CD2 1 
ATOM   1713  C  CE1 . HIS A  1 227 ? 9.990   11.848  -46.653  1.00 34.12  ? 253 HIS A CE1 1 
ATOM   1714  N  NE2 . HIS A  1 227 ? 11.187  12.389  -46.524  1.00 36.40  ? 253 HIS A NE2 1 
ATOM   1715  N  N   . GLY A  1 228 ? 9.841   13.441  -39.982  1.00 36.47  ? 254 GLY A N   1 
ATOM   1716  C  CA  . GLY A  1 228 ? 9.218   13.924  -38.766  1.00 42.26  ? 254 GLY A CA  1 
ATOM   1717  C  C   . GLY A  1 228 ? 9.710   13.176  -37.546  1.00 45.38  ? 254 GLY A C   1 
ATOM   1718  O  O   . GLY A  1 228 ? 10.550  12.277  -37.629  1.00 47.03  ? 254 GLY A O   1 
ATOM   1719  N  N   . GLY A  1 229 ? 9.168   13.566  -36.405  1.00 43.96  ? 255 GLY A N   1 
ATOM   1720  C  CA  . GLY A  1 229 ? 9.496   12.937  -35.149  1.00 39.77  ? 255 GLY A CA  1 
ATOM   1721  C  C   . GLY A  1 229 ? 8.390   13.161  -34.153  1.00 39.34  ? 255 GLY A C   1 
ATOM   1722  O  O   . GLY A  1 229 ? 7.243   13.418  -34.521  1.00 51.77  ? 255 GLY A O   1 
ATOM   1723  N  N   . CYS A  1 230 ? 8.744   13.072  -32.874  1.00 40.49  ? 256 CYS A N   1 
ATOM   1724  C  CA  . CYS A  1 230 ? 7.768   13.259  -31.810  1.00 49.52  ? 256 CYS A CA  1 
ATOM   1725  C  C   . CYS A  1 230 ? 8.488   13.615  -30.519  1.00 58.77  ? 256 CYS A C   1 
ATOM   1726  O  O   . CYS A  1 230 ? 9.578   13.105  -30.244  1.00 50.94  ? 256 CYS A O   1 
ATOM   1727  C  CB  . CYS A  1 230 ? 6.912   12.002  -31.604  1.00 52.88  ? 256 CYS A CB  1 
ATOM   1728  S  SG  . CYS A  1 230 ? 7.819   10.495  -31.146  1.00 50.54  ? 256 CYS A SG  1 
ATOM   1729  N  N   . THR A  1 231 ? 7.871   14.504  -29.739  1.00 59.86  ? 257 THR A N   1 
ATOM   1730  C  CA  . THR A  1 231 ? 8.282   14.767  -28.367  1.00 56.24  ? 257 THR A CA  1 
ATOM   1731  C  C   . THR A  1 231 ? 7.312   14.203  -27.343  1.00 60.47  ? 257 THR A C   1 
ATOM   1732  O  O   . THR A  1 231 ? 7.715   13.921  -26.213  1.00 56.15  ? 257 THR A O   1 
ATOM   1733  C  CB  . THR A  1 231 ? 8.429   16.275  -28.132  1.00 48.09  ? 257 THR A CB  1 
ATOM   1734  O  OG1 . THR A  1 231 ? 7.323   16.960  -28.728  1.00 60.06  ? 257 THR A OG1 1 
ATOM   1735  C  CG2 . THR A  1 231 ? 9.714   16.782  -28.765  1.00 44.43  ? 257 THR A CG2 1 
ATOM   1736  N  N   . VAL A  1 232 ? 6.047   14.041  -27.717  1.00 63.85  ? 258 VAL A N   1 
ATOM   1737  C  CA  . VAL A  1 232 ? 5.031   13.386  -26.899  1.00 54.20  ? 258 VAL A CA  1 
ATOM   1738  C  C   . VAL A  1 232 ? 4.760   12.036  -27.553  1.00 56.80  ? 258 VAL A C   1 
ATOM   1739  O  O   . VAL A  1 232 ? 4.754   11.948  -28.789  1.00 60.49  ? 258 VAL A O   1 
ATOM   1740  C  CB  . VAL A  1 232 ? 3.760   14.246  -26.796  1.00 54.21  ? 258 VAL A CB  1 
ATOM   1741  C  CG1 . VAL A  1 232 ? 2.647   13.505  -26.070  1.00 56.91  ? 258 VAL A CG1 1 
ATOM   1742  C  CG2 . VAL A  1 232 ? 4.073   15.561  -26.099  1.00 59.89  ? 258 VAL A CG2 1 
ATOM   1743  N  N   . PRO A  1 233 ? 4.569   10.962  -26.789  1.00 60.26  ? 259 PRO A N   1 
ATOM   1744  C  CA  . PRO A  1 233 ? 4.279   9.668   -27.415  1.00 60.39  ? 259 PRO A CA  1 
ATOM   1745  C  C   . PRO A  1 233 ? 3.007   9.714   -28.248  1.00 53.98  ? 259 PRO A C   1 
ATOM   1746  O  O   . PRO A  1 233 ? 2.044   10.411  -27.921  1.00 54.29  ? 259 PRO A O   1 
ATOM   1747  C  CB  . PRO A  1 233 ? 4.128   8.719   -26.220  1.00 58.08  ? 259 PRO A CB  1 
ATOM   1748  C  CG  . PRO A  1 233 ? 4.902   9.358   -25.131  1.00 52.26  ? 259 PRO A CG  1 
ATOM   1749  C  CD  . PRO A  1 233 ? 4.789   10.839  -25.338  1.00 53.98  ? 259 PRO A CD  1 
ATOM   1750  N  N   . GLY A  1 234 ? 3.026   8.963   -29.348  1.00 55.07  ? 260 GLY A N   1 
ATOM   1751  C  CA  . GLY A  1 234 ? 1.865   8.796   -30.199  1.00 57.31  ? 260 GLY A CA  1 
ATOM   1752  C  C   . GLY A  1 234 ? 1.561   9.933   -31.146  1.00 57.60  ? 260 GLY A C   1 
ATOM   1753  O  O   . GLY A  1 234 ? 0.459   9.971   -31.704  1.00 66.04  ? 260 GLY A O   1 
ATOM   1754  N  N   . GLU A  1 235 ? 2.490   10.857  -31.355  1.00 52.36  ? 261 GLU A N   1 
ATOM   1755  C  CA  . GLU A  1 235 ? 2.286   11.950  -32.290  1.00 47.93  ? 261 GLU A CA  1 
ATOM   1756  C  C   . GLU A  1 235 ? 3.348   11.882  -33.379  1.00 55.84  ? 261 GLU A C   1 
ATOM   1757  O  O   . GLU A  1 235 ? 4.346   11.164  -33.268  1.00 51.37  ? 261 GLU A O   1 
ATOM   1758  C  CB  . GLU A  1 235 ? 2.318   13.314  -31.587  1.00 45.04  ? 261 GLU A CB  1 
ATOM   1759  C  CG  . GLU A  1 235 ? 3.708   13.877  -31.351  1.00 54.40  ? 261 GLU A CG  1 
ATOM   1760  C  CD  . GLU A  1 235 ? 3.676   15.326  -30.880  1.00 63.75  ? 261 GLU A CD  1 
ATOM   1761  O  OE1 . GLU A  1 235 ? 2.563   15.863  -30.684  1.00 63.54  ? 261 GLU A OE1 1 
ATOM   1762  O  OE2 . GLU A  1 235 ? 4.761   15.931  -30.718  1.00 58.91  ? 261 GLU A OE2 1 
ATOM   1763  N  N   . CYS A  1 236 ? 3.118   12.644  -34.449  1.00 54.64  ? 262 CYS A N   1 
ATOM   1764  C  CA  . CYS A  1 236 ? 4.015   12.668  -35.605  1.00 44.38  ? 262 CYS A CA  1 
ATOM   1765  C  C   . CYS A  1 236 ? 4.031   14.093  -36.153  1.00 47.63  ? 262 CYS A C   1 
ATOM   1766  O  O   . CYS A  1 236 ? 3.193   14.458  -36.982  1.00 51.44  ? 262 CYS A O   1 
ATOM   1767  C  CB  . CYS A  1 236 ? 3.563   11.661  -36.650  1.00 41.22  ? 262 CYS A CB  1 
ATOM   1768  S  SG  . CYS A  1 236 ? 4.611   11.491  -38.100  1.00 41.53  ? 262 CYS A SG  1 
ATOM   1769  N  N   . ARG A  1 237 ? 4.987   14.889  -35.682  1.00 44.80  ? 263 ARG A N   1 
ATOM   1770  C  CA  . ARG A  1 237 ? 5.163   16.262  -36.135  1.00 50.69  ? 263 ARG A CA  1 
ATOM   1771  C  C   . ARG A  1 237 ? 6.236   16.310  -37.214  1.00 52.34  ? 263 ARG A C   1 
ATOM   1772  O  O   . ARG A  1 237 ? 7.332   15.769  -37.031  1.00 45.57  ? 263 ARG A O   1 
ATOM   1773  C  CB  . ARG A  1 237 ? 5.535   17.178  -34.970  1.00 52.13  ? 263 ARG A CB  1 
ATOM   1774  C  CG  . ARG A  1 237 ? 4.331   17.742  -34.234  1.00 66.28  ? 263 ARG A CG  1 
ATOM   1775  C  CD  . ARG A  1 237 ? 4.310   19.262  -34.312  1.00 72.11  ? 263 ARG A CD  1 
ATOM   1776  N  NE  . ARG A  1 237 ? 3.086   19.831  -33.754  1.00 78.75  ? 263 ARG A NE  1 
ATOM   1777  C  CZ  . ARG A  1 237 ? 3.016   21.028  -33.179  1.00 82.89  ? 263 ARG A CZ  1 
ATOM   1778  N  NH1 . ARG A  1 237 ? 4.105   21.781  -33.077  1.00 80.11  ? 263 ARG A NH1 1 
ATOM   1779  N  NH2 . ARG A  1 237 ? 1.862   21.471  -32.698  1.00 73.13  ? 263 ARG A NH2 1 
ATOM   1780  N  N   . CYS A  1 238 ? 5.921   16.968  -38.328  1.00 44.63  ? 264 CYS A N   1 
ATOM   1781  C  CA  . CYS A  1 238 ? 6.760   16.930  -39.516  1.00 38.37  ? 264 CYS A CA  1 
ATOM   1782  C  C   . CYS A  1 238 ? 7.850   17.991  -39.466  1.00 37.52  ? 264 CYS A C   1 
ATOM   1783  O  O   . CYS A  1 238 ? 7.658   19.086  -38.931  1.00 35.03  ? 264 CYS A O   1 
ATOM   1784  C  CB  . CYS A  1 238 ? 5.918   17.132  -40.777  1.00 39.30  ? 264 CYS A CB  1 
ATOM   1785  S  SG  . CYS A  1 238 ? 4.363   16.217  -40.816  1.00 41.93  ? 264 CYS A SG  1 
ATOM   1786  N  N   . SER A  1 239 ? 8.999   17.657  -40.048  1.00 34.94  ? 265 SER A N   1 
ATOM   1787  C  CA  . SER A  1 239 ? 10.031  18.647  -40.297  1.00 36.99  ? 265 SER A CA  1 
ATOM   1788  C  C   . SER A  1 239 ? 9.540   19.656  -41.331  1.00 36.93  ? 265 SER A C   1 
ATOM   1789  O  O   . SER A  1 239 ? 8.502   19.473  -41.972  1.00 42.39  ? 265 SER A O   1 
ATOM   1790  C  CB  . SER A  1 239 ? 11.317  17.979  -40.786  1.00 43.74  ? 265 SER A CB  1 
ATOM   1791  O  OG  . SER A  1 239 ? 11.611  16.807  -40.048  1.00 47.92  ? 265 SER A OG  1 
ATOM   1792  N  N   . TYR A  1 240 ? 10.300  20.735  -41.495  1.00 34.78  ? 266 TYR A N   1 
ATOM   1793  C  CA  . TYR A  1 240 ? 9.918   21.757  -42.460  1.00 43.35  ? 266 TYR A CA  1 
ATOM   1794  C  C   . TYR A  1 240 ? 9.988   21.197  -43.874  1.00 42.11  ? 266 TYR A C   1 
ATOM   1795  O  O   . TYR A  1 240 ? 11.007  20.635  -44.283  1.00 45.00  ? 266 TYR A O   1 
ATOM   1796  C  CB  . TYR A  1 240 ? 10.811  22.990  -42.334  1.00 46.48  ? 266 TYR A CB  1 
ATOM   1797  C  CG  . TYR A  1 240 ? 10.406  24.102  -43.270  1.00 41.84  ? 266 TYR A CG  1 
ATOM   1798  C  CD1 . TYR A  1 240 ? 9.371   24.969  -42.941  1.00 39.16  ? 266 TYR A CD1 1 
ATOM   1799  C  CD2 . TYR A  1 240 ? 11.052  24.280  -44.488  1.00 45.49  ? 266 TYR A CD2 1 
ATOM   1800  C  CE1 . TYR A  1 240 ? 8.991   25.985  -43.800  1.00 45.46  ? 266 TYR A CE1 1 
ATOM   1801  C  CE2 . TYR A  1 240 ? 10.681  25.292  -45.353  1.00 44.38  ? 266 TYR A CE2 1 
ATOM   1802  C  CZ  . TYR A  1 240 ? 9.650   26.142  -45.007  1.00 51.71  ? 266 TYR A CZ  1 
ATOM   1803  O  OH  . TYR A  1 240 ? 9.280   27.151  -45.869  1.00 57.56  ? 266 TYR A OH  1 
ATOM   1804  N  N   . GLY A  1 241 ? 8.890   21.336  -44.614  1.00 43.71  ? 267 GLY A N   1 
ATOM   1805  C  CA  . GLY A  1 241 ? 8.805   20.844  -45.973  1.00 39.49  ? 267 GLY A CA  1 
ATOM   1806  C  C   . GLY A  1 241 ? 7.910   19.640  -46.157  1.00 36.19  ? 267 GLY A C   1 
ATOM   1807  O  O   . GLY A  1 241 ? 7.786   19.156  -47.288  1.00 38.39  ? 267 GLY A O   1 
ATOM   1808  N  N   . TRP A  1 242 ? 7.282   19.137  -45.094  1.00 32.85  ? 268 TRP A N   1 
ATOM   1809  C  CA  . TRP A  1 242 ? 6.448   17.948  -45.186  1.00 35.39  ? 268 TRP A CA  1 
ATOM   1810  C  C   . TRP A  1 242 ? 5.181   18.132  -44.359  1.00 37.00  ? 268 TRP A C   1 
ATOM   1811  O  O   . TRP A  1 242 ? 5.122   18.953  -43.440  1.00 36.23  ? 268 TRP A O   1 
ATOM   1812  C  CB  . TRP A  1 242 ? 7.215   16.693  -44.735  1.00 36.10  ? 268 TRP A CB  1 
ATOM   1813  C  CG  . TRP A  1 242 ? 8.399   16.368  -45.607  1.00 34.69  ? 268 TRP A CG  1 
ATOM   1814  C  CD1 . TRP A  1 242 ? 9.685   16.784  -45.430  1.00 36.57  ? 268 TRP A CD1 1 
ATOM   1815  C  CD2 . TRP A  1 242 ? 8.402   15.551  -46.786  1.00 32.35  ? 268 TRP A CD2 1 
ATOM   1816  N  NE1 . TRP A  1 242 ? 10.486  16.283  -46.427  1.00 34.83  ? 268 TRP A NE1 1 
ATOM   1817  C  CE2 . TRP A  1 242 ? 9.722   15.523  -47.271  1.00 30.95  ? 268 TRP A CE2 1 
ATOM   1818  C  CE3 . TRP A  1 242 ? 7.415   14.846  -47.480  1.00 38.53  ? 268 TRP A CE3 1 
ATOM   1819  C  CZ2 . TRP A  1 242 ? 10.080  14.817  -48.415  1.00 38.09  ? 268 TRP A CZ2 1 
ATOM   1820  C  CZ3 . TRP A  1 242 ? 7.773   14.146  -48.617  1.00 34.60  ? 268 TRP A CZ3 1 
ATOM   1821  C  CH2 . TRP A  1 242 ? 9.092   14.137  -49.072  1.00 36.93  ? 268 TRP A CH2 1 
ATOM   1822  N  N   . GLN A  1 243 ? 4.163   17.343  -44.700  1.00 33.47  ? 269 GLN A N   1 
ATOM   1823  C  CA  . GLN A  1 243 ? 2.855   17.441  -44.070  1.00 33.85  ? 269 GLN A CA  1 
ATOM   1824  C  C   . GLN A  1 243 ? 2.169   16.083  -44.131  1.00 34.03  ? 269 GLN A C   1 
ATOM   1825  O  O   . GLN A  1 243 ? 2.662   15.141  -44.755  1.00 37.03  ? 269 GLN A O   1 
ATOM   1826  C  CB  . GLN A  1 243 ? 1.997   18.509  -44.754  1.00 35.02  ? 269 GLN A CB  1 
ATOM   1827  C  CG  . GLN A  1 243 ? 1.927   18.335  -46.268  1.00 42.57  ? 269 GLN A CG  1 
ATOM   1828  C  CD  . GLN A  1 243 ? 0.958   19.292  -46.938  1.00 36.43  ? 269 GLN A CD  1 
ATOM   1829  O  OE1 . GLN A  1 243 ? 0.151   19.947  -46.279  1.00 31.15  ? 269 GLN A OE1 1 
ATOM   1830  N  NE2 . GLN A  1 243 ? 1.040   19.380  -48.259  1.00 36.78  ? 269 GLN A NE2 1 
ATOM   1831  N  N   . GLY A  1 244 ? 1.018   15.995  -43.482  1.00 31.46  ? 270 GLY A N   1 
ATOM   1832  C  CA  . GLY A  1 244 ? 0.204   14.797  -43.481  1.00 39.30  ? 270 GLY A CA  1 
ATOM   1833  C  C   . GLY A  1 244 ? 0.173   14.123  -42.117  1.00 35.61  ? 270 GLY A C   1 
ATOM   1834  O  O   . GLY A  1 244 ? 0.927   14.452  -41.201  1.00 34.40  ? 270 GLY A O   1 
ATOM   1835  N  N   . ARG A  1 245 ? -0.731  13.144  -42.007  1.00 42.76  ? 271 ARG A N   1 
ATOM   1836  C  CA  . ARG A  1 245 ? -0.853  12.373  -40.771  1.00 42.06  ? 271 ARG A CA  1 
ATOM   1837  C  C   . ARG A  1 245 ? 0.431   11.617  -40.460  1.00 40.65  ? 271 ARG A C   1 
ATOM   1838  O  O   . ARG A  1 245 ? 0.819   11.491  -39.292  1.00 47.28  ? 271 ARG A O   1 
ATOM   1839  C  CB  . ARG A  1 245 ? -2.024  11.394  -40.860  1.00 38.81  ? 271 ARG A CB  1 
ATOM   1840  C  CG  . ARG A  1 245 ? -3.381  12.053  -41.021  1.00 46.97  ? 271 ARG A CG  1 
ATOM   1841  C  CD  . ARG A  1 245 ? -4.504  11.067  -40.749  1.00 57.37  ? 271 ARG A CD  1 
ATOM   1842  N  NE  . ARG A  1 245 ? -4.275  9.783   -41.407  1.00 65.62  ? 271 ARG A NE  1 
ATOM   1843  C  CZ  . ARG A  1 245 ? -5.163  8.794   -41.449  1.00 68.38  ? 271 ARG A CZ  1 
ATOM   1844  N  NH1 . ARG A  1 245 ? -4.866  7.658   -42.070  1.00 56.76  ? 271 ARG A NH1 1 
ATOM   1845  N  NH2 . ARG A  1 245 ? -6.350  8.940   -40.874  1.00 68.81  ? 271 ARG A NH2 1 
ATOM   1846  N  N   . PHE A  1 246 ? 1.101   11.101  -41.490  1.00 31.11  ? 272 PHE A N   1 
ATOM   1847  C  CA  . PHE A  1 246 ? 2.350   10.372  -41.326  1.00 31.91  ? 272 PHE A CA  1 
ATOM   1848  C  C   . PHE A  1 246 ? 3.546   11.161  -41.836  1.00 35.45  ? 272 PHE A C   1 
ATOM   1849  O  O   . PHE A  1 246 ? 4.640   10.601  -41.958  1.00 33.75  ? 272 PHE A O   1 
ATOM   1850  C  CB  . PHE A  1 246 ? 2.269   9.024   -42.041  1.00 32.19  ? 272 PHE A CB  1 
ATOM   1851  C  CG  . PHE A  1 246 ? 1.029   8.242   -41.719  1.00 41.25  ? 272 PHE A CG  1 
ATOM   1852  C  CD1 . PHE A  1 246 ? 0.938   7.513   -40.542  1.00 44.72  ? 272 PHE A CD1 1 
ATOM   1853  C  CD2 . PHE A  1 246 ? -0.046  8.233   -42.594  1.00 33.99  ? 272 PHE A CD2 1 
ATOM   1854  C  CE1 . PHE A  1 246 ? -0.204  6.789   -40.245  1.00 41.94  ? 272 PHE A CE1 1 
ATOM   1855  C  CE2 . PHE A  1 246 ? -1.188  7.514   -42.304  1.00 34.24  ? 272 PHE A CE2 1 
ATOM   1856  C  CZ  . PHE A  1 246 ? -1.269  6.792   -41.127  1.00 42.51  ? 272 PHE A CZ  1 
ATOM   1857  N  N   . CYS A  1 247 ? 3.355   12.442  -42.155  1.00 36.53  ? 273 CYS A N   1 
ATOM   1858  C  CA  . CYS A  1 247 ? 4.416   13.297  -42.682  1.00 34.17  ? 273 CYS A CA  1 
ATOM   1859  C  C   . CYS A  1 247 ? 5.000   12.712  -43.966  1.00 35.28  ? 273 CYS A C   1 
ATOM   1860  O  O   . CYS A  1 247 ? 6.216   12.651  -44.158  1.00 38.46  ? 273 CYS A O   1 
ATOM   1861  C  CB  . CYS A  1 247 ? 5.498   13.538  -41.630  1.00 35.69  ? 273 CYS A CB  1 
ATOM   1862  S  SG  . CYS A  1 247 ? 4.876   14.374  -40.156  1.00 38.41  ? 273 CYS A SG  1 
ATOM   1863  N  N   . ASP A  1 248 ? 4.107   12.284  -44.859  1.00 36.48  ? 274 ASP A N   1 
ATOM   1864  C  CA  . ASP A  1 248 ? 4.500   11.646  -46.105  1.00 37.99  ? 274 ASP A CA  1 
ATOM   1865  C  C   . ASP A  1 248 ? 4.296   12.517  -47.337  1.00 35.09  ? 274 ASP A C   1 
ATOM   1866  O  O   . ASP A  1 248 ? 4.751   12.136  -48.420  1.00 37.75  ? 274 ASP A O   1 
ATOM   1867  C  CB  . ASP A  1 248 ? 3.718   10.338  -46.289  1.00 32.88  ? 274 ASP A CB  1 
ATOM   1868  C  CG  . ASP A  1 248 ? 4.519   9.127   -45.896  1.00 40.08  ? 274 ASP A CG  1 
ATOM   1869  O  OD1 . ASP A  1 248 ? 5.757   9.249   -45.779  1.00 47.06  ? 274 ASP A OD1 1 
ATOM   1870  O  OD2 . ASP A  1 248 ? 3.913   8.054   -45.697  1.00 46.13  ? 274 ASP A OD2 1 
ATOM   1871  N  N   . GLU A  1 249 ? 3.654   13.674  -47.204  1.00 39.29  ? 275 GLU A N   1 
ATOM   1872  C  CA  . GLU A  1 249 ? 3.318   14.523  -48.337  1.00 41.74  ? 275 GLU A CA  1 
ATOM   1873  C  C   . GLU A  1 249 ? 4.196   15.765  -48.349  1.00 36.00  ? 275 GLU A C   1 
ATOM   1874  O  O   . GLU A  1 249 ? 4.377   16.416  -47.317  1.00 35.34  ? 275 GLU A O   1 
ATOM   1875  C  CB  . GLU A  1 249 ? 1.847   14.939  -48.292  1.00 40.91  ? 275 GLU A CB  1 
ATOM   1876  C  CG  . GLU A  1 249 ? 0.920   13.893  -47.706  1.00 46.58  ? 275 GLU A CG  1 
ATOM   1877  C  CD  . GLU A  1 249 ? -0.526  14.359  -47.661  1.00 65.41  ? 275 GLU A CD  1 
ATOM   1878  O  OE1 . GLU A  1 249 ? -0.778  15.560  -47.913  1.00 59.51  ? 275 GLU A OE1 1 
ATOM   1879  O  OE2 . GLU A  1 249 ? -1.412  13.525  -47.375  1.00 73.09  ? 275 GLU A OE2 1 
ATOM   1880  N  N   . CYS A  1 250 ? 4.716   16.098  -49.526  1.00 34.86  ? 276 CYS A N   1 
ATOM   1881  C  CA  . CYS A  1 250 ? 5.505   17.308  -49.696  1.00 37.36  ? 276 CYS A CA  1 
ATOM   1882  C  C   . CYS A  1 250 ? 4.647   18.549  -49.465  1.00 36.25  ? 276 CYS A C   1 
ATOM   1883  O  O   . CYS A  1 250 ? 3.417   18.516  -49.552  1.00 37.10  ? 276 CYS A O   1 
ATOM   1884  C  CB  . CYS A  1 250 ? 6.115   17.357  -51.097  1.00 41.59  ? 276 CYS A CB  1 
ATOM   1885  S  SG  . CYS A  1 250 ? 4.894   17.176  -52.416  1.00 46.89  ? 276 CYS A SG  1 
ATOM   1886  N  N   . VAL A  1 251 ? 5.314   19.650  -49.150  1.00 32.10  ? 277 VAL A N   1 
ATOM   1887  C  CA  . VAL A  1 251 ? 4.683   20.962  -49.063  1.00 31.65  ? 277 VAL A CA  1 
ATOM   1888  C  C   . VAL A  1 251 ? 5.134   21.768  -50.275  1.00 37.73  ? 277 VAL A C   1 
ATOM   1889  O  O   . VAL A  1 251 ? 6.343   21.937  -50.480  1.00 41.19  ? 277 VAL A O   1 
ATOM   1890  C  CB  . VAL A  1 251 ? 5.039   21.681  -47.753  1.00 30.19  ? 277 VAL A CB  1 
ATOM   1891  C  CG1 . VAL A  1 251 ? 4.509   23.101  -47.774  1.00 30.55  ? 277 VAL A CG1 1 
ATOM   1892  C  CG2 . VAL A  1 251 ? 4.466   20.925  -46.572  1.00 30.28  ? 277 VAL A CG2 1 
ATOM   1893  N  N   . PRO A  1 252 ? 4.219   22.262  -51.107  1.00 41.33  ? 278 PRO A N   1 
ATOM   1894  C  CA  . PRO A  1 252 ? 4.631   22.983  -52.316  1.00 41.97  ? 278 PRO A CA  1 
ATOM   1895  C  C   . PRO A  1 252 ? 5.248   24.331  -51.977  1.00 37.74  ? 278 PRO A C   1 
ATOM   1896  O  O   . PRO A  1 252 ? 5.213   24.798  -50.837  1.00 40.05  ? 278 PRO A O   1 
ATOM   1897  C  CB  . PRO A  1 252 ? 3.323   23.146  -53.093  1.00 38.46  ? 278 PRO A CB  1 
ATOM   1898  C  CG  . PRO A  1 252 ? 2.271   23.131  -52.042  1.00 33.13  ? 278 PRO A CG  1 
ATOM   1899  C  CD  . PRO A  1 252 ? 2.754   22.179  -50.985  1.00 36.95  ? 278 PRO A CD  1 
ATOM   1900  N  N   . TYR A  1 253 ? 5.805   24.962  -53.008  1.00 44.33  ? 279 TYR A N   1 
ATOM   1901  C  CA  . TYR A  1 253 ? 6.416   26.277  -52.866  1.00 42.73  ? 279 TYR A CA  1 
ATOM   1902  C  C   . TYR A  1 253 ? 5.438   27.238  -52.190  1.00 45.42  ? 279 TYR A C   1 
ATOM   1903  O  O   . TYR A  1 253 ? 4.242   27.229  -52.511  1.00 44.80  ? 279 TYR A O   1 
ATOM   1904  C  CB  . TYR A  1 253 ? 6.822   26.813  -54.241  1.00 42.28  ? 279 TYR A CB  1 
ATOM   1905  C  CG  . TYR A  1 253 ? 7.731   28.027  -54.232  1.00 45.79  ? 279 TYR A CG  1 
ATOM   1906  C  CD1 . TYR A  1 253 ? 7.212   29.314  -54.118  1.00 47.63  ? 279 TYR A CD1 1 
ATOM   1907  C  CD2 . TYR A  1 253 ? 9.107   27.887  -54.378  1.00 48.75  ? 279 TYR A CD2 1 
ATOM   1908  C  CE1 . TYR A  1 253 ? 8.041   30.425  -54.122  1.00 47.51  ? 279 TYR A CE1 1 
ATOM   1909  C  CE2 . TYR A  1 253 ? 9.943   28.991  -54.389  1.00 51.08  ? 279 TYR A CE2 1 
ATOM   1910  C  CZ  . TYR A  1 253 ? 9.406   30.257  -54.262  1.00 54.74  ? 279 TYR A CZ  1 
ATOM   1911  O  OH  . TYR A  1 253 ? 10.242  31.354  -54.269  1.00 54.86  ? 279 TYR A OH  1 
ATOM   1912  N  N   . PRO A  1 254 ? 5.902   28.065  -51.253  1.00 46.38  ? 280 PRO A N   1 
ATOM   1913  C  CA  . PRO A  1 254 ? 4.986   28.943  -50.504  1.00 44.12  ? 280 PRO A CA  1 
ATOM   1914  C  C   . PRO A  1 254 ? 4.230   29.886  -51.427  1.00 49.80  ? 280 PRO A C   1 
ATOM   1915  O  O   . PRO A  1 254 ? 4.821   30.743  -52.092  1.00 49.91  ? 280 PRO A O   1 
ATOM   1916  C  CB  . PRO A  1 254 ? 5.922   29.712  -49.563  1.00 40.11  ? 280 PRO A CB  1 
ATOM   1917  C  CG  . PRO A  1 254 ? 7.172   28.906  -49.502  1.00 46.74  ? 280 PRO A CG  1 
ATOM   1918  C  CD  . PRO A  1 254 ? 7.301   28.214  -50.819  1.00 45.96  ? 280 PRO A CD  1 
ATOM   1919  N  N   . GLY A  1 255 ? 2.910   29.715  -51.470  1.00 51.41  ? 281 GLY A N   1 
ATOM   1920  C  CA  . GLY A  1 255 ? 2.046   30.501  -52.326  1.00 44.89  ? 281 GLY A CA  1 
ATOM   1921  C  C   . GLY A  1 255 ? 1.483   29.743  -53.507  1.00 50.39  ? 281 GLY A C   1 
ATOM   1922  O  O   . GLY A  1 255 ? 0.642   30.294  -54.227  1.00 57.94  ? 281 GLY A O   1 
ATOM   1923  N  N   . CYS A  1 256 ? 1.922   28.504  -53.731  1.00 48.55  ? 282 CYS A N   1 
ATOM   1924  C  CA  . CYS A  1 256 ? 1.455   27.726  -54.871  1.00 54.50  ? 282 CYS A CA  1 
ATOM   1925  C  C   . CYS A  1 256 ? -0.061  27.588  -54.840  1.00 50.60  ? 282 CYS A C   1 
ATOM   1926  O  O   . CYS A  1 256 ? -0.658  27.349  -53.788  1.00 53.52  ? 282 CYS A O   1 
ATOM   1927  C  CB  . CYS A  1 256 ? 2.115   26.344  -54.865  1.00 52.67  ? 282 CYS A CB  1 
ATOM   1928  S  SG  . CYS A  1 256 ? 2.099   25.473  -56.445  1.00 48.41  ? 282 CYS A SG  1 
ATOM   1929  N  N   . VAL A  1 257 ? -0.686  27.756  -56.004  1.00 53.09  ? 283 VAL A N   1 
ATOM   1930  C  CA  . VAL A  1 257 ? -2.142  27.732  -56.097  1.00 47.43  ? 283 VAL A CA  1 
ATOM   1931  C  C   . VAL A  1 257 ? -2.576  26.550  -56.950  1.00 45.27  ? 283 VAL A C   1 
ATOM   1932  O  O   . VAL A  1 257 ? -3.042  25.531  -56.428  1.00 55.36  ? 283 VAL A O   1 
ATOM   1933  C  CB  . VAL A  1 257 ? -2.690  29.048  -56.674  1.00 42.15  ? 283 VAL A CB  1 
ATOM   1934  C  CG1 . VAL A  1 257 ? -4.205  29.070  -56.580  1.00 43.47  ? 283 VAL A CG1 1 
ATOM   1935  C  CG2 . VAL A  1 257 ? -2.086  30.236  -55.947  1.00 42.33  ? 283 VAL A CG2 1 
ATOM   1936  N  N   . HIS A  1 258 ? -2.426  26.677  -58.262  1.00 49.18  ? 284 HIS A N   1 
ATOM   1937  C  CA  . HIS A  1 258 ? -2.782  25.604  -59.190  1.00 53.03  ? 284 HIS A CA  1 
ATOM   1938  C  C   . HIS A  1 258 ? -1.529  24.861  -59.648  1.00 51.18  ? 284 HIS A C   1 
ATOM   1939  O  O   . HIS A  1 258 ? -1.206  24.771  -60.833  1.00 50.65  ? 284 HIS A O   1 
ATOM   1940  C  CB  . HIS A  1 258 ? -3.575  26.160  -60.369  1.00 46.15  ? 284 HIS A CB  1 
ATOM   1941  C  CG  . HIS A  1 258 ? -4.906  26.725  -59.982  1.00 44.28  ? 284 HIS A CG  1 
ATOM   1942  N  ND1 . HIS A  1 258 ? -5.074  28.034  -59.587  1.00 43.33  ? 284 HIS A ND1 1 
ATOM   1943  C  CD2 . HIS A  1 258 ? -6.131  26.152  -59.915  1.00 47.26  ? 284 HIS A CD2 1 
ATOM   1944  C  CE1 . HIS A  1 258 ? -6.346  28.246  -59.299  1.00 44.63  ? 284 HIS A CE1 1 
ATOM   1945  N  NE2 . HIS A  1 258 ? -7.009  27.119  -59.490  1.00 48.73  ? 284 HIS A NE2 1 
ATOM   1946  N  N   . GLY A  1 259 ? -0.818  24.323  -58.657  1.00 48.68  ? 285 GLY A N   1 
ATOM   1947  C  CA  . GLY A  1 259 ? 0.383   23.552  -58.896  1.00 40.37  ? 285 GLY A CA  1 
ATOM   1948  C  C   . GLY A  1 259 ? 0.478   22.432  -57.884  1.00 45.91  ? 285 GLY A C   1 
ATOM   1949  O  O   . GLY A  1 259 ? -0.284  22.371  -56.915  1.00 42.76  ? 285 GLY A O   1 
ATOM   1950  N  N   . SER A  1 260 ? 1.429   21.532  -58.126  1.00 43.08  ? 286 SER A N   1 
ATOM   1951  C  CA  . SER A  1 260 ? 1.622   20.357  -57.290  1.00 37.66  ? 286 SER A CA  1 
ATOM   1952  C  C   . SER A  1 260 ? 3.109   20.179  -57.013  1.00 42.12  ? 286 SER A C   1 
ATOM   1953  O  O   . SER A  1 260 ? 3.961   20.796  -57.659  1.00 39.07  ? 286 SER A O   1 
ATOM   1954  C  CB  . SER A  1 260 ? 1.047   19.101  -57.951  1.00 34.69  ? 286 SER A CB  1 
ATOM   1955  O  OG  . SER A  1 260 ? 1.798   18.765  -59.107  1.00 38.47  ? 286 SER A OG  1 
ATOM   1956  N  N   . CYS A  1 261 ? 3.415   19.328  -56.032  1.00 35.94  ? 287 CYS A N   1 
ATOM   1957  C  CA  . CYS A  1 261 ? 4.784   18.943  -55.723  1.00 35.12  ? 287 CYS A CA  1 
ATOM   1958  C  C   . CYS A  1 261 ? 4.883   17.426  -55.680  1.00 35.83  ? 287 CYS A C   1 
ATOM   1959  O  O   . CYS A  1 261 ? 3.880   16.723  -55.536  1.00 33.03  ? 287 CYS A O   1 
ATOM   1960  C  CB  . CYS A  1 261 ? 5.268   19.545  -54.386  1.00 37.90  ? 287 CYS A CB  1 
ATOM   1961  S  SG  . CYS A  1 261 ? 4.324   19.082  -52.892  1.00 46.68  ? 287 CYS A SG  1 
ATOM   1962  N  N   . VAL A  1 262 ? 6.109   16.924  -55.832  1.00 41.29  ? 288 VAL A N   1 
ATOM   1963  C  CA  . VAL A  1 262 ? 6.426   15.555  -55.435  1.00 43.32  ? 288 VAL A CA  1 
ATOM   1964  C  C   . VAL A  1 262 ? 7.569   15.607  -54.430  1.00 40.27  ? 288 VAL A C   1 
ATOM   1965  O  O   . VAL A  1 262 ? 7.625   14.807  -53.489  1.00 48.63  ? 288 VAL A O   1 
ATOM   1966  C  CB  . VAL A  1 262 ? 6.775   14.665  -56.644  1.00 38.99  ? 288 VAL A CB  1 
ATOM   1967  C  CG1 . VAL A  1 262 ? 5.532   14.386  -57.468  1.00 28.71  ? 288 VAL A CG1 1 
ATOM   1968  C  CG2 . VAL A  1 262 ? 7.842   15.315  -57.504  1.00 46.49  ? 288 VAL A CG2 1 
ATOM   1969  N  N   . GLU A  1 263 ? 8.476   16.553  -54.620  1.00 41.13  ? 289 GLU A N   1 
ATOM   1970  C  CA  . GLU A  1 263 ? 9.497   16.916  -53.657  1.00 42.39  ? 289 GLU A CA  1 
ATOM   1971  C  C   . GLU A  1 263 ? 9.192   18.288  -53.069  1.00 43.58  ? 289 GLU A C   1 
ATOM   1972  O  O   . GLU A  1 263 ? 8.480   19.090  -53.682  1.00 47.22  ? 289 GLU A O   1 
ATOM   1973  C  CB  . GLU A  1 263 ? 10.879  16.916  -54.326  1.00 50.21  ? 289 GLU A CB  1 
ATOM   1974  C  CG  . GLU A  1 263 ? 11.265  15.566  -54.930  1.00 56.00  ? 289 GLU A CG  1 
ATOM   1975  C  CD  . GLU A  1 263 ? 12.527  15.630  -55.778  1.00 74.44  ? 289 GLU A CD  1 
ATOM   1976  O  OE1 . GLU A  1 263 ? 13.391  16.492  -55.509  1.00 77.90  ? 289 GLU A OE1 1 
ATOM   1977  O  OE2 . GLU A  1 263 ? 12.650  14.818  -56.722  1.00 77.11  ? 289 GLU A OE2 1 
ATOM   1978  N  N   . PRO A  1 264 ? 9.691   18.585  -51.867  1.00 47.46  ? 290 PRO A N   1 
ATOM   1979  C  CA  . PRO A  1 264 ? 9.321   19.843  -51.206  1.00 44.86  ? 290 PRO A CA  1 
ATOM   1980  C  C   . PRO A  1 264 ? 9.682   21.073  -52.029  1.00 45.90  ? 290 PRO A C   1 
ATOM   1981  O  O   . PRO A  1 264 ? 10.642  21.079  -52.806  1.00 40.84  ? 290 PRO A O   1 
ATOM   1982  C  CB  . PRO A  1 264 ? 10.116  19.800  -49.897  1.00 43.54  ? 290 PRO A CB  1 
ATOM   1983  C  CG  . PRO A  1 264 ? 10.279  18.350  -49.620  1.00 43.35  ? 290 PRO A CG  1 
ATOM   1984  C  CD  . PRO A  1 264 ? 10.446  17.697  -50.965  1.00 47.19  ? 290 PRO A CD  1 
ATOM   1985  N  N   . TRP A  1 265 ? 8.869   22.117  -51.857  1.00 45.27  ? 291 TRP A N   1 
ATOM   1986  C  CA  . TRP A  1 265 ? 9.079   23.439  -52.445  1.00 44.06  ? 291 TRP A CA  1 
ATOM   1987  C  C   . TRP A  1 265 ? 9.018   23.431  -53.970  1.00 40.79  ? 291 TRP A C   1 
ATOM   1988  O  O   . TRP A  1 265 ? 9.548   24.336  -54.621  1.00 42.85  ? 291 TRP A O   1 
ATOM   1989  C  CB  . TRP A  1 265 ? 10.394  24.063  -51.965  1.00 47.26  ? 291 TRP A CB  1 
ATOM   1990  C  CG  . TRP A  1 265 ? 10.219  24.898  -50.736  1.00 44.05  ? 291 TRP A CG  1 
ATOM   1991  C  CD1 . TRP A  1 265 ? 9.293   24.720  -49.748  1.00 43.83  ? 291 TRP A CD1 1 
ATOM   1992  C  CD2 . TRP A  1 265 ? 10.963  26.069  -50.383  1.00 47.57  ? 291 TRP A CD2 1 
ATOM   1993  N  NE1 . TRP A  1 265 ? 9.427   25.699  -48.792  1.00 47.09  ? 291 TRP A NE1 1 
ATOM   1994  C  CE2 . TRP A  1 265 ? 10.445  26.541  -49.158  1.00 50.71  ? 291 TRP A CE2 1 
ATOM   1995  C  CE3 . TRP A  1 265 ? 12.025  26.759  -50.977  1.00 50.35  ? 291 TRP A CE3 1 
ATOM   1996  C  CZ2 . TRP A  1 265 ? 10.951  27.673  -48.519  1.00 44.32  ? 291 TRP A CZ2 1 
ATOM   1997  C  CZ3 . TRP A  1 265 ? 12.527  27.881  -50.341  1.00 52.46  ? 291 TRP A CZ3 1 
ATOM   1998  C  CH2 . TRP A  1 265 ? 11.990  28.327  -49.124  1.00 51.94  ? 291 TRP A CH2 1 
ATOM   1999  N  N   . GLN A  1 266 ? 8.385   22.430  -54.561  1.00 43.76  ? 292 GLN A N   1 
ATOM   2000  C  CA  . GLN A  1 266 ? 8.080   22.468  -55.981  1.00 40.95  ? 292 GLN A CA  1 
ATOM   2001  C  C   . GLN A  1 266 ? 6.702   23.086  -56.198  1.00 44.71  ? 292 GLN A C   1 
ATOM   2002  O  O   . GLN A  1 266 ? 5.890   23.191  -55.274  1.00 39.63  ? 292 GLN A O   1 
ATOM   2003  C  CB  . GLN A  1 266 ? 8.134   21.065  -56.577  1.00 38.95  ? 292 GLN A CB  1 
ATOM   2004  C  CG  . GLN A  1 266 ? 9.519   20.454  -56.562  1.00 39.97  ? 292 GLN A CG  1 
ATOM   2005  C  CD  . GLN A  1 266 ? 9.545   19.053  -57.137  1.00 44.75  ? 292 GLN A CD  1 
ATOM   2006  O  OE1 . GLN A  1 266 ? 8.501   18.433  -57.347  1.00 36.77  ? 292 GLN A OE1 1 
ATOM   2007  N  NE2 . GLN A  1 266 ? 10.744  18.544  -57.396  1.00 51.51  ? 292 GLN A NE2 1 
ATOM   2008  N  N   . CYS A  1 267 ? 6.444   23.495  -57.441  1.00 45.17  ? 293 CYS A N   1 
ATOM   2009  C  CA  . CYS A  1 267 ? 5.156   24.081  -57.798  1.00 43.72  ? 293 CYS A CA  1 
ATOM   2010  C  C   . CYS A  1 267 ? 4.939   23.956  -59.302  1.00 42.22  ? 293 CYS A C   1 
ATOM   2011  O  O   . CYS A  1 267 ? 5.004   24.948  -60.035  1.00 40.62  ? 293 CYS A O   1 
ATOM   2012  C  CB  . CYS A  1 267 ? 5.085   25.541  -57.330  1.00 39.81  ? 293 CYS A CB  1 
ATOM   2013  S  SG  . CYS A  1 267 ? 3.504   26.427  -57.566  1.00 43.48  ? 293 CYS A SG  1 
ATOM   2014  N  N   . ASN A  1 268 ? 4.697   22.726  -59.761  1.00 42.82  ? 294 ASN A N   1 
ATOM   2015  C  CA  . ASN A  1 268 ? 4.488   22.435  -61.177  1.00 44.91  ? 294 ASN A CA  1 
ATOM   2016  C  C   . ASN A  1 268 ? 3.077   22.844  -61.589  1.00 46.47  ? 294 ASN A C   1 
ATOM   2017  O  O   . ASN A  1 268 ? 2.092   22.279  -61.100  1.00 38.65  ? 294 ASN A O   1 
ATOM   2018  C  CB  . ASN A  1 268 ? 4.725   20.950  -61.455  1.00 40.21  ? 294 ASN A CB  1 
ATOM   2019  C  CG  . ASN A  1 268 ? 6.031   20.443  -60.867  1.00 41.82  ? 294 ASN A CG  1 
ATOM   2020  O  OD1 . ASN A  1 268 ? 7.021   21.173  -60.789  1.00 47.57  ? 294 ASN A OD1 1 
ATOM   2021  N  ND2 . ASN A  1 268 ? 6.036   19.184  -60.446  1.00 49.27  ? 294 ASN A ND2 1 
ATOM   2022  N  N   . CYS A  1 269 ? 2.981   23.803  -62.507  1.00 51.27  ? 295 CYS A N   1 
ATOM   2023  C  CA  . CYS A  1 269 ? 1.687   24.359  -62.879  1.00 47.53  ? 295 CYS A CA  1 
ATOM   2024  C  C   . CYS A  1 269 ? 0.855   23.363  -63.674  1.00 46.23  ? 295 CYS A C   1 
ATOM   2025  O  O   . CYS A  1 269 ? 1.380   22.569  -64.461  1.00 44.74  ? 295 CYS A O   1 
ATOM   2026  C  CB  . CYS A  1 269 ? 1.873   25.639  -63.694  1.00 42.12  ? 295 CYS A CB  1 
ATOM   2027  S  SG  . CYS A  1 269 ? 2.752   26.946  -62.816  1.00 55.20  ? 295 CYS A SG  1 
ATOM   2028  N  N   . GLU A  1 270 ? -0.455  23.400  -63.445  1.00 45.32  ? 296 GLU A N   1 
ATOM   2029  C  CA  . GLU A  1 270 ? -1.398  22.700  -64.299  1.00 46.84  ? 296 GLU A CA  1 
ATOM   2030  C  C   . GLU A  1 270 ? -1.466  23.390  -65.662  1.00 53.69  ? 296 GLU A C   1 
ATOM   2031  O  O   . GLU A  1 270 ? -0.895  24.464  -65.876  1.00 56.52  ? 296 GLU A O   1 
ATOM   2032  C  CB  . GLU A  1 270 ? -2.778  22.650  -63.647  1.00 44.29  ? 296 GLU A CB  1 
ATOM   2033  C  CG  . GLU A  1 270 ? -2.768  22.121  -62.228  1.00 44.56  ? 296 GLU A CG  1 
ATOM   2034  C  CD  . GLU A  1 270 ? -4.080  22.357  -61.508  1.00 50.52  ? 296 GLU A CD  1 
ATOM   2035  O  OE1 . GLU A  1 270 ? -4.998  22.938  -62.119  1.00 62.32  ? 296 GLU A OE1 1 
ATOM   2036  O  OE2 . GLU A  1 270 ? -4.193  21.967  -60.328  1.00 52.20  ? 296 GLU A OE2 1 
ATOM   2037  N  N   . THR A  1 271 ? -2.182  22.764  -66.592  1.00 52.02  ? 297 THR A N   1 
ATOM   2038  C  CA  . THR A  1 271 ? -2.295  23.327  -67.929  1.00 58.24  ? 297 THR A CA  1 
ATOM   2039  C  C   . THR A  1 271 ? -3.114  24.610  -67.917  1.00 61.03  ? 297 THR A C   1 
ATOM   2040  O  O   . THR A  1 271 ? -4.114  24.724  -67.198  1.00 53.29  ? 297 THR A O   1 
ATOM   2041  C  CB  . THR A  1 271 ? -2.943  22.322  -68.878  1.00 57.86  ? 297 THR A CB  1 
ATOM   2042  O  OG1 . THR A  1 271 ? -3.992  21.626  -68.193  1.00 63.08  ? 297 THR A OG1 1 
ATOM   2043  C  CG2 . THR A  1 271 ? -1.920  21.336  -69.388  1.00 49.42  ? 297 THR A CG2 1 
ATOM   2044  N  N   . ASN A  1 272 ? -2.656  25.589  -68.704  1.00 51.81  ? 298 ASN A N   1 
ATOM   2045  C  CA  . ASN A  1 272 ? -3.307  26.893  -68.841  1.00 54.62  ? 298 ASN A CA  1 
ATOM   2046  C  C   . ASN A  1 272 ? -3.271  27.684  -67.535  1.00 54.93  ? 298 ASN A C   1 
ATOM   2047  O  O   . ASN A  1 272 ? -4.186  28.454  -67.227  1.00 48.02  ? 298 ASN A O   1 
ATOM   2048  C  CB  . ASN A  1 272 ? -4.732  26.745  -69.382  1.00 55.93  ? 298 ASN A CB  1 
ATOM   2049  C  CG  . ASN A  1 272 ? -4.748  26.237  -70.820  1.00 63.77  ? 298 ASN A CG  1 
ATOM   2050  O  OD1 . ASN A  1 272 ? -3.762  26.380  -71.551  1.00 54.91  ? 298 ASN A OD1 1 
ATOM   2051  N  ND2 . ASN A  1 272 ? -5.862  25.638  -71.229  1.00 62.94  ? 298 ASN A ND2 1 
ATOM   2052  N  N   . TRP A  1 273 ? -2.194  27.494  -66.773  1.00 55.60  ? 299 TRP A N   1 
ATOM   2053  C  CA  . TRP A  1 273 ? -1.899  28.259  -65.570  1.00 43.94  ? 299 TRP A CA  1 
ATOM   2054  C  C   . TRP A  1 273 ? -0.413  28.565  -65.601  1.00 41.02  ? 299 TRP A C   1 
ATOM   2055  O  O   . TRP A  1 273 ? 0.395   27.674  -65.877  1.00 43.77  ? 299 TRP A O   1 
ATOM   2056  C  CB  . TRP A  1 273 ? -2.236  27.485  -64.292  1.00 36.44  ? 299 TRP A CB  1 
ATOM   2057  C  CG  . TRP A  1 273 ? -3.688  27.328  -64.005  1.00 39.87  ? 299 TRP A CG  1 
ATOM   2058  C  CD1 . TRP A  1 273 ? -4.449  26.214  -64.212  1.00 44.69  ? 299 TRP A CD1 1 
ATOM   2059  C  CD2 . TRP A  1 273 ? -4.561  28.314  -63.449  1.00 40.52  ? 299 TRP A CD2 1 
ATOM   2060  N  NE1 . TRP A  1 273 ? -5.744  26.445  -63.813  1.00 41.96  ? 299 TRP A NE1 1 
ATOM   2061  C  CE2 . TRP A  1 273 ? -5.840  27.728  -63.344  1.00 36.77  ? 299 TRP A CE2 1 
ATOM   2062  C  CE3 . TRP A  1 273 ? -4.388  29.637  -63.030  1.00 41.35  ? 299 TRP A CE3 1 
ATOM   2063  C  CZ2 . TRP A  1 273 ? -6.937  28.419  -62.840  1.00 33.00  ? 299 TRP A CZ2 1 
ATOM   2064  C  CZ3 . TRP A  1 273 ? -5.479  30.322  -62.531  1.00 41.04  ? 299 TRP A CZ3 1 
ATOM   2065  C  CH2 . TRP A  1 273 ? -6.738  29.712  -62.440  1.00 42.90  ? 299 TRP A CH2 1 
ATOM   2066  N  N   . GLY A  1 274 ? -0.052  29.816  -65.325  1.00 38.25  ? 300 GLY A N   1 
ATOM   2067  C  CA  . GLY A  1 274 ? 1.324   30.252  -65.419  1.00 39.35  ? 300 GLY A CA  1 
ATOM   2068  C  C   . GLY A  1 274 ? 1.757   31.018  -64.184  1.00 41.72  ? 300 GLY A C   1 
ATOM   2069  O  O   . GLY A  1 274 ? 0.997   31.183  -63.227  1.00 39.77  ? 300 GLY A O   1 
ATOM   2070  N  N   . GLY A  1 275 ? 3.001   31.484  -64.234  1.00 44.28  ? 301 GLY A N   1 
ATOM   2071  C  CA  . GLY A  1 275 ? 3.587   32.226  -63.142  1.00 50.69  ? 301 GLY A CA  1 
ATOM   2072  C  C   . GLY A  1 275 ? 4.347   31.336  -62.177  1.00 49.37  ? 301 GLY A C   1 
ATOM   2073  O  O   . GLY A  1 275 ? 4.277   30.105  -62.212  1.00 49.09  ? 301 GLY A O   1 
ATOM   2074  N  N   . LEU A  1 276 ? 5.102   31.989  -61.296  1.00 47.97  ? 302 LEU A N   1 
ATOM   2075  C  CA  . LEU A  1 276 ? 5.885   31.251  -60.311  1.00 47.81  ? 302 LEU A CA  1 
ATOM   2076  C  C   . LEU A  1 276 ? 4.977   30.462  -59.375  1.00 46.69  ? 302 LEU A C   1 
ATOM   2077  O  O   . LEU A  1 276 ? 5.302   29.333  -58.985  1.00 42.19  ? 302 LEU A O   1 
ATOM   2078  C  CB  . LEU A  1 276 ? 6.773   32.222  -59.532  1.00 42.61  ? 302 LEU A CB  1 
ATOM   2079  C  CG  . LEU A  1 276 ? 8.050   31.718  -58.844  1.00 52.72  ? 302 LEU A CG  1 
ATOM   2080  C  CD1 . LEU A  1 276 ? 7.767   30.873  -57.603  1.00 61.75  ? 302 LEU A CD1 1 
ATOM   2081  C  CD2 . LEU A  1 276 ? 8.912   30.951  -59.846  1.00 54.82  ? 302 LEU A CD2 1 
ATOM   2082  N  N   . LEU A  1 277 ? 3.820   31.027  -59.029  1.00 43.45  ? 303 LEU A N   1 
ATOM   2083  C  CA  . LEU A  1 277 ? 2.884   30.412  -58.099  1.00 42.53  ? 303 LEU A CA  1 
ATOM   2084  C  C   . LEU A  1 277 ? 1.746   29.687  -58.794  1.00 42.31  ? 303 LEU A C   1 
ATOM   2085  O  O   . LEU A  1 277 ? 0.819   29.231  -58.116  1.00 44.57  ? 303 LEU A O   1 
ATOM   2086  C  CB  . LEU A  1 277 ? 2.300   31.463  -57.150  1.00 43.76  ? 303 LEU A CB  1 
ATOM   2087  C  CG  . LEU A  1 277 ? 3.219   32.480  -56.455  1.00 45.48  ? 303 LEU A CG  1 
ATOM   2088  C  CD1 . LEU A  1 277 ? 2.433   33.264  -55.407  1.00 43.35  ? 303 LEU A CD1 1 
ATOM   2089  C  CD2 . LEU A  1 277 ? 4.426   31.795  -55.828  1.00 46.15  ? 303 LEU A CD2 1 
ATOM   2090  N  N   . CYS A  1 278 ? 1.792   29.571  -60.121  1.00 38.93  ? 304 CYS A N   1 
ATOM   2091  C  CA  . CYS A  1 278 ? 0.714   28.958  -60.900  1.00 41.10  ? 304 CYS A CA  1 
ATOM   2092  C  C   . CYS A  1 278 ? -0.629  29.611  -60.574  1.00 42.61  ? 304 CYS A C   1 
ATOM   2093  O  O   . CYS A  1 278 ? -1.635  28.943  -60.317  1.00 44.33  ? 304 CYS A O   1 
ATOM   2094  C  CB  . CYS A  1 278 ? 0.661   27.447  -60.675  1.00 40.16  ? 304 CYS A CB  1 
ATOM   2095  S  SG  . CYS A  1 278 ? 2.251   26.628  -60.869  1.00 44.82  ? 304 CYS A SG  1 
ATOM   2096  N  N   . ASP A  1 279 ? -0.634  30.943  -60.577  1.00 42.86  ? 305 ASP A N   1 
ATOM   2097  C  CA  . ASP A  1 279 ? -1.823  31.713  -60.248  1.00 44.85  ? 305 ASP A CA  1 
ATOM   2098  C  C   . ASP A  1 279 ? -2.346  32.563  -61.398  1.00 43.92  ? 305 ASP A C   1 
ATOM   2099  O  O   . ASP A  1 279 ? -3.353  33.256  -61.220  1.00 42.42  ? 305 ASP A O   1 
ATOM   2100  C  CB  . ASP A  1 279 ? -1.551  32.604  -59.028  1.00 39.97  ? 305 ASP A CB  1 
ATOM   2101  C  CG  . ASP A  1 279 ? -0.334  33.495  -59.208  1.00 40.36  ? 305 ASP A CG  1 
ATOM   2102  O  OD1 . ASP A  1 279 ? 0.506   33.215  -60.089  1.00 45.96  ? 305 ASP A OD1 1 
ATOM   2103  O  OD2 . ASP A  1 279 ? -0.215  34.483  -58.460  1.00 40.15  ? 305 ASP A OD2 1 
ATOM   2104  N  N   . LYS A  1 280 ? -1.731  32.495  -62.578  1.00 43.39  ? 306 LYS A N   1 
ATOM   2105  C  CA  . LYS A  1 280 ? -2.155  33.292  -63.723  1.00 42.82  ? 306 LYS A CA  1 
ATOM   2106  C  C   . LYS A  1 280 ? -3.075  32.483  -64.621  1.00 43.61  ? 306 LYS A C   1 
ATOM   2107  O  O   . LYS A  1 280 ? -2.707  31.395  -65.074  1.00 43.14  ? 306 LYS A O   1 
ATOM   2108  C  CB  . LYS A  1 280 ? -0.960  33.751  -64.558  1.00 48.73  ? 306 LYS A CB  1 
ATOM   2109  C  CG  . LYS A  1 280 ? -0.594  35.223  -64.478  1.00 54.29  ? 306 LYS A CG  1 
ATOM   2110  C  CD  . LYS A  1 280 ? 0.490   35.514  -65.514  1.00 66.06  ? 306 LYS A CD  1 
ATOM   2111  C  CE  . LYS A  1 280 ? 0.462   36.943  -66.039  1.00 60.06  ? 306 LYS A CE  1 
ATOM   2112  N  NZ  . LYS A  1 280 ? 1.403   37.817  -65.280  1.00 56.54  ? 306 LYS A NZ  1 
ATOM   2113  N  N   . ASP A  1 281 ? -4.259  33.028  -64.896  1.00 43.94  ? 307 ASP A N   1 
ATOM   2114  C  CA  . ASP A  1 281 ? -5.171  32.429  -65.863  1.00 46.83  ? 307 ASP A CA  1 
ATOM   2115  C  C   . ASP A  1 281 ? -4.651  32.762  -67.255  1.00 48.91  ? 307 ASP A C   1 
ATOM   2116  O  O   . ASP A  1 281 ? -4.464  33.937  -67.587  1.00 53.76  ? 307 ASP A O   1 
ATOM   2117  C  CB  . ASP A  1 281 ? -6.593  32.957  -65.664  1.00 41.33  ? 307 ASP A CB  1 
ATOM   2118  C  CG  . ASP A  1 281 ? -7.645  32.161  -66.439  1.00 51.02  ? 307 ASP A CG  1 
ATOM   2119  O  OD1 . ASP A  1 281 ? -7.285  31.447  -67.400  1.00 47.71  ? 307 ASP A OD1 1 
ATOM   2120  O  OD2 . ASP A  1 281 ? -8.843  32.265  -66.091  1.00 52.87  ? 307 ASP A OD2 1 
ATOM   2121  N  N   . LEU A  1 282 ? -4.411  31.739  -68.070  1.00 47.57  ? 308 LEU A N   1 
ATOM   2122  C  CA  . LEU A  1 282 ? -3.807  31.946  -69.379  1.00 54.32  ? 308 LEU A CA  1 
ATOM   2123  C  C   . LEU A  1 282 ? -4.793  31.724  -70.514  1.00 61.23  ? 308 LEU A C   1 
ATOM   2124  O  O   . LEU A  1 282 ? -4.380  31.568  -71.669  1.00 66.28  ? 308 LEU A O   1 
ATOM   2125  C  CB  . LEU A  1 282 ? -2.601  31.024  -69.549  1.00 52.15  ? 308 LEU A CB  1 
ATOM   2126  C  CG  . LEU A  1 282 ? -1.459  31.228  -68.551  1.00 47.00  ? 308 LEU A CG  1 
ATOM   2127  C  CD1 . LEU A  1 282 ? -0.285  30.329  -68.897  1.00 42.52  ? 308 LEU A CD1 1 
ATOM   2128  C  CD2 . LEU A  1 282 ? -1.033  32.691  -68.486  1.00 46.29  ? 308 LEU A CD2 1 
ATOM   2129  N  N   . ASN A  1 283 ? -6.083  31.738  -70.214  1.00 58.93  ? 309 ASN A N   1 
ATOM   2130  C  CA  . ASN A  1 283 ? -7.116  31.612  -71.221  1.00 61.13  ? 309 ASN A CA  1 
ATOM   2131  C  C   . ASN A  1 283 ? -7.557  32.981  -71.737  1.00 62.52  ? 309 ASN A C   1 
ATOM   2132  O  O   . ASN A  1 283 ? -7.962  33.850  -70.959  1.00 53.25  ? 309 ASN A O   1 
ATOM   2133  C  CB  . ASN A  1 283 ? -8.291  30.838  -70.631  1.00 67.38  ? 309 ASN A CB  1 
ATOM   2134  C  CG  . ASN A  1 283 ? -7.929  29.396  -70.332  1.00 67.20  ? 309 ASN A CG  1 
ATOM   2135  O  OD1 . ASN A  1 283 ? -7.270  29.108  -69.329  1.00 64.53  ? 309 ASN A OD1 1 
ATOM   2136  N  ND2 . ASN A  1 283 ? -8.333  28.486  -71.208  1.00 70.63  ? 309 ASN A ND2 1 
ATOM   2137  N  N   . MET B  1 1   ? 32.784  36.713  31.337   1.00 33.61  ? 27  MET B N   1 
ATOM   2138  C  CA  . MET B  1 1   ? 33.466  35.425  31.377   1.00 31.11  ? 27  MET B CA  1 
ATOM   2139  C  C   . MET B  1 1   ? 34.747  35.509  32.181   1.00 32.78  ? 27  MET B C   1 
ATOM   2140  O  O   . MET B  1 1   ? 35.489  36.487  32.072   1.00 32.07  ? 27  MET B O   1 
ATOM   2141  C  CB  . MET B  1 1   ? 33.776  34.930  29.969   1.00 33.70  ? 27  MET B CB  1 
ATOM   2142  C  CG  . MET B  1 1   ? 32.547  34.633  29.170   1.00 30.09  ? 27  MET B CG  1 
ATOM   2143  S  SD  . MET B  1 1   ? 32.931  33.634  27.742   1.00 33.01  ? 27  MET B SD  1 
ATOM   2144  C  CE  . MET B  1 1   ? 31.272  33.412  27.098   1.00 39.31  ? 27  MET B CE  1 
ATOM   2145  N  N   . GLY B  1 2   ? 34.987  34.489  32.994   1.00 31.79  ? 28  GLY B N   1 
ATOM   2146  C  CA  . GLY B  1 2   ? 36.158  34.445  33.836   1.00 30.62  ? 28  GLY B CA  1 
ATOM   2147  C  C   . GLY B  1 2   ? 36.457  33.040  34.306   1.00 32.48  ? 28  GLY B C   1 
ATOM   2148  O  O   . GLY B  1 2   ? 35.929  32.061  33.775   1.00 30.95  ? 28  GLY B O   1 
ATOM   2149  N  N   . TYR B  1 3   ? 37.305  32.953  35.332   1.00 32.25  ? 29  TYR B N   1 
ATOM   2150  C  CA  . TYR B  1 3   ? 37.728  31.677  35.889   1.00 28.47  ? 29  TYR B CA  1 
ATOM   2151  C  C   . TYR B  1 3   ? 37.729  31.753  37.408   1.00 27.29  ? 29  TYR B C   1 
ATOM   2152  O  O   . TYR B  1 3   ? 37.980  32.809  37.994   1.00 25.15  ? 29  TYR B O   1 
ATOM   2153  C  CB  . TYR B  1 3   ? 39.136  31.280  35.423   1.00 30.18  ? 29  TYR B CB  1 
ATOM   2154  C  CG  . TYR B  1 3   ? 39.338  31.343  33.934   1.00 35.91  ? 29  TYR B CG  1 
ATOM   2155  C  CD1 . TYR B  1 3   ? 40.073  32.373  33.361   1.00 37.69  ? 29  TYR B CD1 1 
ATOM   2156  C  CD2 . TYR B  1 3   ? 38.806  30.371  33.097   1.00 41.34  ? 29  TYR B CD2 1 
ATOM   2157  C  CE1 . TYR B  1 3   ? 40.270  32.435  31.996   1.00 39.56  ? 29  TYR B CE1 1 
ATOM   2158  C  CE2 . TYR B  1 3   ? 38.988  30.428  31.723   1.00 39.72  ? 29  TYR B CE2 1 
ATOM   2159  C  CZ  . TYR B  1 3   ? 39.719  31.463  31.178   1.00 43.63  ? 29  TYR B CZ  1 
ATOM   2160  O  OH  . TYR B  1 3   ? 39.907  31.522  29.814   1.00 48.45  ? 29  TYR B OH  1 
ATOM   2161  N  N   . PHE B  1 4   ? 37.464  30.610  38.035   1.00 31.79  ? 30  PHE B N   1 
ATOM   2162  C  CA  . PHE B  1 4   ? 37.658  30.417  39.467   1.00 25.97  ? 30  PHE B CA  1 
ATOM   2163  C  C   . PHE B  1 4   ? 38.850  29.484  39.637   1.00 22.70  ? 30  PHE B C   1 
ATOM   2164  O  O   . PHE B  1 4   ? 38.839  28.362  39.121   1.00 24.69  ? 30  PHE B O   1 
ATOM   2165  C  CB  . PHE B  1 4   ? 36.404  29.828  40.113   1.00 22.78  ? 30  PHE B CB  1 
ATOM   2166  C  CG  . PHE B  1 4   ? 36.489  29.703  41.607   1.00 24.93  ? 30  PHE B CG  1 
ATOM   2167  C  CD1 . PHE B  1 4   ? 37.089  28.596  42.194   1.00 20.72  ? 30  PHE B CD1 1 
ATOM   2168  C  CD2 . PHE B  1 4   ? 35.952  30.684  42.425   1.00 21.36  ? 30  PHE B CD2 1 
ATOM   2169  C  CE1 . PHE B  1 4   ? 37.172  28.478  43.557   1.00 17.58  ? 30  PHE B CE1 1 
ATOM   2170  C  CE2 . PHE B  1 4   ? 36.028  30.572  43.796   1.00 24.85  ? 30  PHE B CE2 1 
ATOM   2171  C  CZ  . PHE B  1 4   ? 36.640  29.464  44.365   1.00 27.91  ? 30  PHE B CZ  1 
ATOM   2172  N  N   . GLU B  1 5   ? 39.869  29.939  40.357   1.00 22.59  ? 31  GLU B N   1 
ATOM   2173  C  CA  . GLU B  1 5   ? 41.107  29.188  40.509   1.00 26.60  ? 31  GLU B CA  1 
ATOM   2174  C  C   . GLU B  1 5   ? 41.333  28.817  41.965   1.00 28.21  ? 31  GLU B C   1 
ATOM   2175  O  O   . GLU B  1 5   ? 41.120  29.632  42.868   1.00 26.71  ? 31  GLU B O   1 
ATOM   2176  C  CB  . GLU B  1 5   ? 42.308  29.980  39.992   1.00 28.85  ? 31  GLU B CB  1 
ATOM   2177  C  CG  . GLU B  1 5   ? 42.246  30.291  38.506   1.00 36.84  ? 31  GLU B CG  1 
ATOM   2178  C  CD  . GLU B  1 5   ? 43.449  31.073  38.034   1.00 38.20  ? 31  GLU B CD  1 
ATOM   2179  O  OE1 . GLU B  1 5   ? 44.276  30.507  37.290   1.00 46.70  ? 31  GLU B OE1 1 
ATOM   2180  O  OE2 . GLU B  1 5   ? 43.575  32.252  38.422   1.00 39.60  ? 31  GLU B OE2 1 
ATOM   2181  N  N   . LEU B  1 6   ? 41.797  27.591  42.180   1.00 25.93  ? 32  LEU B N   1 
ATOM   2182  C  CA  . LEU B  1 6   ? 42.082  27.082  43.511   1.00 24.22  ? 32  LEU B CA  1 
ATOM   2183  C  C   . LEU B  1 6   ? 43.456  26.436  43.489   1.00 27.27  ? 32  LEU B C   1 
ATOM   2184  O  O   . LEU B  1 6   ? 43.753  25.629  42.602   1.00 29.32  ? 32  LEU B O   1 
ATOM   2185  C  CB  . LEU B  1 6   ? 41.008  26.080  43.954   1.00 21.36  ? 32  LEU B CB  1 
ATOM   2186  C  CG  . LEU B  1 6   ? 41.109  25.440  45.341   1.00 22.39  ? 32  LEU B CG  1 
ATOM   2187  C  CD1 . LEU B  1 6   ? 39.721  25.239  45.926   1.00 19.38  ? 32  LEU B CD1 1 
ATOM   2188  C  CD2 . LEU B  1 6   ? 41.845  24.121  45.269   1.00 21.45  ? 32  LEU B CD2 1 
ATOM   2189  N  N   . GLN B  1 7   ? 44.290  26.793  44.461   1.00 25.96  ? 33  GLN B N   1 
ATOM   2190  C  CA  . GLN B  1 7   ? 45.652  26.282  44.570   1.00 29.12  ? 33  GLN B CA  1 
ATOM   2191  C  C   . GLN B  1 7   ? 45.782  25.573  45.913   1.00 32.36  ? 33  GLN B C   1 
ATOM   2192  O  O   . GLN B  1 7   ? 45.687  26.211  46.967   1.00 30.41  ? 33  GLN B O   1 
ATOM   2193  C  CB  . GLN B  1 7   ? 46.666  27.418  44.445   1.00 27.13  ? 33  GLN B CB  1 
ATOM   2194  C  CG  . GLN B  1 7   ? 48.111  26.999  44.636   1.00 34.54  ? 33  GLN B CG  1 
ATOM   2195  C  CD  . GLN B  1 7   ? 48.618  26.102  43.518   1.00 44.28  ? 33  GLN B CD  1 
ATOM   2196  O  OE1 . GLN B  1 7   ? 48.426  26.396  42.334   1.00 39.83  ? 33  GLN B OE1 1 
ATOM   2197  N  NE2 . GLN B  1 7   ? 49.275  25.003  43.891   1.00 42.83  ? 33  GLN B NE2 1 
ATOM   2198  N  N   . LEU B  1 8   ? 45.991  24.260  45.880   1.00 29.96  ? 34  LEU B N   1 
ATOM   2199  C  CA  . LEU B  1 8   ? 46.204  23.492  47.100   1.00 32.01  ? 34  LEU B CA  1 
ATOM   2200  C  C   . LEU B  1 8   ? 47.698  23.381  47.376   1.00 32.79  ? 34  LEU B C   1 
ATOM   2201  O  O   . LEU B  1 8   ? 48.467  22.973  46.499   1.00 34.77  ? 34  LEU B O   1 
ATOM   2202  C  CB  . LEU B  1 8   ? 45.582  22.101  46.987   1.00 27.09  ? 34  LEU B CB  1 
ATOM   2203  C  CG  . LEU B  1 8   ? 45.632  21.315  48.299   1.00 26.04  ? 34  LEU B CG  1 
ATOM   2204  C  CD1 . LEU B  1 8   ? 44.448  21.678  49.174   1.00 25.66  ? 34  LEU B CD1 1 
ATOM   2205  C  CD2 . LEU B  1 8   ? 45.669  19.822  48.043   1.00 29.08  ? 34  LEU B CD2 1 
ATOM   2206  N  N   . SER B  1 9   ? 48.106  23.729  48.603   1.00 27.19  ? 35  SER B N   1 
ATOM   2207  C  CA  . SER B  1 9   ? 49.521  23.746  48.953   1.00 27.92  ? 35  SER B CA  1 
ATOM   2208  C  C   . SER B  1 9   ? 49.885  22.911  50.174   1.00 24.69  ? 35  SER B C   1 
ATOM   2209  O  O   . SER B  1 9   ? 51.078  22.690  50.403   1.00 26.83  ? 35  SER B O   1 
ATOM   2210  C  CB  . SER B  1 9   ? 50.008  25.188  49.187   1.00 28.45  ? 35  SER B CB  1 
ATOM   2211  O  OG  . SER B  1 9   ? 49.382  25.791  50.308   1.00 25.88  ? 35  SER B OG  1 
ATOM   2212  N  N   . ALA B  1 10  ? 48.920  22.437  50.955   1.00 24.55  ? 36  ALA B N   1 
ATOM   2213  C  CA  . ALA B  1 10  ? 49.258  21.654  52.136   1.00 30.68  ? 36  ALA B CA  1 
ATOM   2214  C  C   . ALA B  1 10  ? 48.085  20.766  52.520   1.00 28.72  ? 36  ALA B C   1 
ATOM   2215  O  O   . ALA B  1 10  ? 46.928  21.193  52.475   1.00 27.86  ? 36  ALA B O   1 
ATOM   2216  C  CB  . ALA B  1 10  ? 49.651  22.548  53.321   1.00 24.51  ? 36  ALA B CB  1 
ATOM   2217  N  N   . LEU B  1 11  ? 48.401  19.531  52.895   1.00 30.18  ? 37  LEU B N   1 
ATOM   2218  C  CA  . LEU B  1 11  ? 47.419  18.606  53.440   1.00 33.60  ? 37  LEU B CA  1 
ATOM   2219  C  C   . LEU B  1 11  ? 48.137  17.703  54.431   1.00 28.22  ? 37  LEU B C   1 
ATOM   2220  O  O   . LEU B  1 11  ? 49.214  17.185  54.126   1.00 34.86  ? 37  LEU B O   1 
ATOM   2221  C  CB  . LEU B  1 11  ? 46.749  17.786  52.328   1.00 30.17  ? 37  LEU B CB  1 
ATOM   2222  C  CG  . LEU B  1 11  ? 45.488  17.001  52.698   1.00 31.99  ? 37  LEU B CG  1 
ATOM   2223  C  CD1 . LEU B  1 11  ? 44.473  17.075  51.572   1.00 36.98  ? 37  LEU B CD1 1 
ATOM   2224  C  CD2 . LEU B  1 11  ? 45.812  15.551  53.021   1.00 27.21  ? 37  LEU B CD2 1 
ATOM   2225  N  N   . ARG B  1 12  ? 47.548  17.517  55.608   1.00 31.78  ? 38  ARG B N   1 
ATOM   2226  C  CA  . ARG B  1 12  ? 48.156  16.722  56.672   1.00 33.52  ? 38  ARG B CA  1 
ATOM   2227  C  C   . ARG B  1 12  ? 47.149  15.695  57.157   1.00 35.90  ? 38  ARG B C   1 
ATOM   2228  O  O   . ARG B  1 12  ? 46.036  16.055  57.552   1.00 37.72  ? 38  ARG B O   1 
ATOM   2229  C  CB  . ARG B  1 12  ? 48.614  17.609  57.833   1.00 32.38  ? 38  ARG B CB  1 
ATOM   2230  C  CG  . ARG B  1 12  ? 49.349  16.885  58.948   1.00 34.52  ? 38  ARG B CG  1 
ATOM   2231  C  CD  . ARG B  1 12  ? 49.519  17.820  60.145   1.00 44.32  ? 38  ARG B CD  1 
ATOM   2232  N  NE  . ARG B  1 12  ? 49.995  17.158  61.361   1.00 49.13  ? 38  ARG B NE  1 
ATOM   2233  C  CZ  . ARG B  1 12  ? 51.250  16.762  61.563   1.00 51.60  ? 38  ARG B CZ  1 
ATOM   2234  N  NH1 . ARG B  1 12  ? 51.585  16.180  62.708   1.00 48.13  ? 38  ARG B NH1 1 
ATOM   2235  N  NH2 . ARG B  1 12  ? 52.172  16.948  60.625   1.00 46.47  ? 38  ARG B NH2 1 
ATOM   2236  N  N   . ASN B  1 13  ? 47.536  14.420  57.116   1.00 38.39  ? 39  ASN B N   1 
ATOM   2237  C  CA  . ASN B  1 13  ? 46.700  13.312  57.590   1.00 39.53  ? 39  ASN B CA  1 
ATOM   2238  C  C   . ASN B  1 13  ? 47.621  12.332  58.318   1.00 38.40  ? 39  ASN B C   1 
ATOM   2239  O  O   . ASN B  1 13  ? 48.108  11.368  57.723   1.00 37.30  ? 39  ASN B O   1 
ATOM   2240  C  CB  . ASN B  1 13  ? 45.954  12.646  56.442   1.00 36.61  ? 39  ASN B CB  1 
ATOM   2241  C  CG  . ASN B  1 13  ? 45.086  11.491  56.904   1.00 41.67  ? 39  ASN B CG  1 
ATOM   2242  O  OD1 . ASN B  1 13  ? 44.822  11.333  58.098   1.00 43.04  ? 39  ASN B OD1 1 
ATOM   2243  N  ND2 . ASN B  1 13  ? 44.639  10.675  55.959   1.00 42.34  ? 39  ASN B ND2 1 
ATOM   2244  N  N   . VAL B  1 14  ? 47.839  12.586  59.613   1.00 36.02  ? 40  VAL B N   1 
ATOM   2245  C  CA  . VAL B  1 14  ? 48.836  11.836  60.378   1.00 43.65  ? 40  VAL B CA  1 
ATOM   2246  C  C   . VAL B  1 14  ? 48.500  10.348  60.407   1.00 46.83  ? 40  VAL B C   1 
ATOM   2247  O  O   . VAL B  1 14  ? 49.342  9.499   60.091   1.00 41.77  ? 40  VAL B O   1 
ATOM   2248  C  CB  . VAL B  1 14  ? 48.967  12.410  61.801   1.00 45.12  ? 40  VAL B CB  1 
ATOM   2249  C  CG1 . VAL B  1 14  ? 49.849  13.631  61.788   1.00 49.64  ? 40  VAL B CG1 1 
ATOM   2250  C  CG2 . VAL B  1 14  ? 47.596  12.764  62.369   1.00 46.15  ? 40  VAL B CG2 1 
ATOM   2251  N  N   . ASN B  1 15  ? 47.263  10.008  60.783   1.00 43.49  ? 41  ASN B N   1 
ATOM   2252  C  CA  . ASN B  1 15  ? 46.917  8.604   60.978   1.00 45.87  ? 41  ASN B CA  1 
ATOM   2253  C  C   . ASN B  1 15  ? 46.772  7.859   59.657   1.00 50.69  ? 41  ASN B C   1 
ATOM   2254  O  O   . ASN B  1 15  ? 46.955  6.637   59.616   1.00 55.47  ? 41  ASN B O   1 
ATOM   2255  C  CB  . ASN B  1 15  ? 45.635  8.486   61.801   1.00 45.98  ? 41  ASN B CB  1 
ATOM   2256  C  CG  . ASN B  1 15  ? 45.771  9.098   63.181   1.00 48.31  ? 41  ASN B CG  1 
ATOM   2257  O  OD1 . ASN B  1 15  ? 46.875  9.209   63.715   1.00 49.45  ? 41  ASN B OD1 1 
ATOM   2258  N  ND2 . ASN B  1 15  ? 44.647  9.492   63.770   1.00 47.45  ? 41  ASN B ND2 1 
ATOM   2259  N  N   . GLY B  1 16  ? 46.448  8.563   58.578   1.00 46.21  ? 42  GLY B N   1 
ATOM   2260  C  CA  . GLY B  1 16  ? 46.267  7.921   57.287   1.00 44.64  ? 42  GLY B CA  1 
ATOM   2261  C  C   . GLY B  1 16  ? 44.979  7.133   57.156   1.00 50.60  ? 42  GLY B C   1 
ATOM   2262  O  O   . GLY B  1 16  ? 44.970  6.068   56.523   1.00 44.00  ? 42  GLY B O   1 
ATOM   2263  N  N   . GLU B  1 17  ? 43.886  7.637   57.728   1.00 51.30  ? 43  GLU B N   1 
ATOM   2264  C  CA  . GLU B  1 17  ? 42.601  6.962   57.693   1.00 48.91  ? 43  GLU B CA  1 
ATOM   2265  C  C   . GLU B  1 17  ? 41.676  7.630   56.682   1.00 49.73  ? 43  GLU B C   1 
ATOM   2266  O  O   . GLU B  1 17  ? 42.092  8.450   55.860   1.00 55.47  ? 43  GLU B O   1 
ATOM   2267  C  CB  . GLU B  1 17  ? 41.956  6.940   59.081   1.00 55.97  ? 43  GLU B CB  1 
ATOM   2268  C  CG  . GLU B  1 17  ? 42.899  6.655   60.235   1.00 58.50  ? 43  GLU B CG  1 
ATOM   2269  C  CD  . GLU B  1 17  ? 42.295  7.031   61.580   1.00 63.72  ? 43  GLU B CD  1 
ATOM   2270  O  OE1 . GLU B  1 17  ? 41.949  8.216   61.773   1.00 69.23  ? 43  GLU B OE1 1 
ATOM   2271  O  OE2 . GLU B  1 17  ? 42.152  6.134   62.439   1.00 63.02  ? 43  GLU B OE2 1 
ATOM   2272  N  N   . LEU B  1 18  ? 40.399  7.272   56.745   1.00 51.89  ? 44  LEU B N   1 
ATOM   2273  C  CA  . LEU B  1 18  ? 39.335  7.916   55.995   1.00 49.88  ? 44  LEU B CA  1 
ATOM   2274  C  C   . LEU B  1 18  ? 38.372  8.572   56.975   1.00 53.94  ? 44  LEU B C   1 
ATOM   2275  O  O   . LEU B  1 18  ? 38.506  8.436   58.194   1.00 59.24  ? 44  LEU B O   1 
ATOM   2276  C  CB  . LEU B  1 18  ? 38.605  6.904   55.108   1.00 53.52  ? 44  LEU B CB  1 
ATOM   2277  C  CG  . LEU B  1 18  ? 39.513  6.147   54.140   1.00 49.51  ? 44  LEU B CG  1 
ATOM   2278  C  CD1 . LEU B  1 18  ? 38.869  4.845   53.705   1.00 49.50  ? 44  LEU B CD1 1 
ATOM   2279  C  CD2 . LEU B  1 18  ? 39.816  7.017   52.935   1.00 47.85  ? 44  LEU B CD2 1 
ATOM   2280  N  N   . LEU B  1 19  ? 37.393  9.301   56.436   1.00 50.80  ? 45  LEU B N   1 
ATOM   2281  C  CA  . LEU B  1 19  ? 36.428  9.960   57.310   1.00 51.19  ? 45  LEU B CA  1 
ATOM   2282  C  C   . LEU B  1 19  ? 35.606  8.948   58.099   1.00 52.33  ? 45  LEU B C   1 
ATOM   2283  O  O   . LEU B  1 19  ? 35.147  9.251   59.207   1.00 53.24  ? 45  LEU B O   1 
ATOM   2284  C  CB  . LEU B  1 19  ? 35.514  10.876  56.497   1.00 49.77  ? 45  LEU B CB  1 
ATOM   2285  C  CG  . LEU B  1 19  ? 34.628  11.814  57.318   1.00 48.30  ? 45  LEU B CG  1 
ATOM   2286  C  CD1 . LEU B  1 19  ? 35.475  12.710  58.215   1.00 53.68  ? 45  LEU B CD1 1 
ATOM   2287  C  CD2 . LEU B  1 19  ? 33.734  12.637  56.413   1.00 45.30  ? 45  LEU B CD2 1 
ATOM   2288  N  N   . SER B  1 20  ? 35.425  7.740   57.556   1.00 54.48  ? 46  SER B N   1 
ATOM   2289  C  CA  . SER B  1 20  ? 34.697  6.699   58.277   1.00 51.77  ? 46  SER B CA  1 
ATOM   2290  C  C   . SER B  1 20  ? 35.471  6.248   59.509   1.00 56.30  ? 46  SER B C   1 
ATOM   2291  O  O   . SER B  1 20  ? 34.903  6.108   60.598   1.00 63.98  ? 46  SER B O   1 
ATOM   2292  C  CB  . SER B  1 20  ? 34.424  5.510   57.357   1.00 49.02  ? 46  SER B CB  1 
ATOM   2293  O  OG  . SER B  1 20  ? 35.635  4.902   56.938   1.00 52.15  ? 46  SER B OG  1 
ATOM   2294  N  N   . GLY B  1 21  ? 36.769  6.009   59.353   1.00 51.16  ? 47  GLY B N   1 
ATOM   2295  C  CA  . GLY B  1 21  ? 37.600  5.592   60.463   1.00 51.63  ? 47  GLY B CA  1 
ATOM   2296  C  C   . GLY B  1 21  ? 38.617  4.544   60.065   1.00 51.45  ? 47  GLY B C   1 
ATOM   2297  O  O   . GLY B  1 21  ? 39.659  4.402   60.713   1.00 51.75  ? 47  GLY B O   1 
ATOM   2298  N  N   . ALA B  1 22  ? 38.326  3.804   58.998   1.00 42.01  ? 48  ALA B N   1 
ATOM   2299  C  CA  . ALA B  1 22  ? 39.235  2.767   58.543   1.00 46.06  ? 48  ALA B CA  1 
ATOM   2300  C  C   . ALA B  1 22  ? 40.454  3.392   57.868   1.00 50.86  ? 48  ALA B C   1 
ATOM   2301  O  O   . ALA B  1 22  ? 40.479  4.579   57.538   1.00 56.49  ? 48  ALA B O   1 
ATOM   2302  C  CB  . ALA B  1 22  ? 38.521  1.816   57.585   1.00 48.41  ? 48  ALA B CB  1 
ATOM   2303  N  N   . CYS B  1 23  ? 41.480  2.573   57.664   1.00 48.58  ? 49  CYS B N   1 
ATOM   2304  C  CA  . CYS B  1 23  ? 42.664  3.020   56.949   1.00 51.27  ? 49  CYS B CA  1 
ATOM   2305  C  C   . CYS B  1 23  ? 42.418  2.989   55.446   1.00 50.75  ? 49  CYS B C   1 
ATOM   2306  O  O   . CYS B  1 23  ? 41.607  2.205   54.946   1.00 53.85  ? 49  CYS B O   1 
ATOM   2307  C  CB  . CYS B  1 23  ? 43.867  2.153   57.312   1.00 60.91  ? 49  CYS B CB  1 
ATOM   2308  S  SG  . CYS B  1 23  ? 44.250  2.168   59.079   1.00 60.44  ? 49  CYS B SG  1 
ATOM   2309  N  N   . CYS B  1 24  ? 43.144  3.850   54.727   1.00 52.35  ? 50  CYS B N   1 
ATOM   2310  C  CA  . CYS B  1 24  ? 42.906  4.045   53.297   1.00 53.03  ? 50  CYS B CA  1 
ATOM   2311  C  C   . CYS B  1 24  ? 43.071  2.746   52.515   1.00 51.33  ? 50  CYS B C   1 
ATOM   2312  O  O   . CYS B  1 24  ? 42.158  2.313   51.803   1.00 56.19  ? 50  CYS B O   1 
ATOM   2313  C  CB  . CYS B  1 24  ? 43.853  5.120   52.757   1.00 49.03  ? 50  CYS B CB  1 
ATOM   2314  S  SG  . CYS B  1 24  ? 43.384  6.828   53.132   1.00 49.11  ? 50  CYS B SG  1 
ATOM   2315  N  N   . ASP B  1 25  ? 44.244  2.123   52.612   1.00 49.88  ? 51  ASP B N   1 
ATOM   2316  C  CA  . ASP B  1 25  ? 44.542  0.895   51.876   1.00 53.24  ? 51  ASP B CA  1 
ATOM   2317  C  C   . ASP B  1 25  ? 45.008  -0.164  52.871   1.00 62.10  ? 51  ASP B C   1 
ATOM   2318  O  O   . ASP B  1 25  ? 46.137  -0.109  53.372   1.00 65.47  ? 51  ASP B O   1 
ATOM   2319  C  CB  . ASP B  1 25  ? 45.578  1.145   50.780   1.00 51.08  ? 51  ASP B CB  1 
ATOM   2320  C  CG  . ASP B  1 25  ? 45.027  1.987   49.640   1.00 45.11  ? 51  ASP B CG  1 
ATOM   2321  O  OD1 . ASP B  1 25  ? 43.787  2.006   49.486   1.00 45.47  ? 51  ASP B OD1 1 
ATOM   2322  O  OD2 . ASP B  1 25  ? 45.822  2.616   48.900   1.00 45.54  ? 51  ASP B OD2 1 
ATOM   2323  N  N   . GLY B  1 26  ? 44.131  -1.123  53.159   1.00 54.04  ? 52  GLY B N   1 
ATOM   2324  C  CA  . GLY B  1 26  ? 44.469  -2.188  54.074   1.00 53.07  ? 52  GLY B CA  1 
ATOM   2325  C  C   . GLY B  1 26  ? 44.371  -1.734  55.519   1.00 64.78  ? 52  GLY B C   1 
ATOM   2326  O  O   . GLY B  1 26  ? 43.678  -0.771  55.864   1.00 65.92  ? 52  GLY B O   1 
ATOM   2327  N  N   . ASP B  1 27  ? 45.080  -2.463  56.378   1.00 73.25  ? 53  ASP B N   1 
ATOM   2328  C  CA  . ASP B  1 27  ? 45.256  -2.064  57.767   1.00 66.24  ? 53  ASP B CA  1 
ATOM   2329  C  C   . ASP B  1 27  ? 46.684  -2.272  58.251   1.00 70.75  ? 53  ASP B C   1 
ATOM   2330  O  O   . ASP B  1 27  ? 47.000  -1.873  59.377   1.00 70.42  ? 53  ASP B O   1 
ATOM   2331  C  CB  . ASP B  1 27  ? 44.286  -2.830  58.685   1.00 59.96  ? 53  ASP B CB  1 
ATOM   2332  C  CG  . ASP B  1 27  ? 44.709  -4.274  58.915   1.00 76.49  ? 53  ASP B CG  1 
ATOM   2333  O  OD1 . ASP B  1 27  ? 44.797  -4.690  60.092   1.00 72.35  ? 53  ASP B OD1 1 
ATOM   2334  O  OD2 . ASP B  1 27  ? 44.949  -4.994  57.921   1.00 80.18  ? 53  ASP B OD2 1 
ATOM   2335  N  N   . GLY B  1 28  ? 47.551  -2.865  57.440   1.00 70.24  ? 54  GLY B N   1 
ATOM   2336  C  CA  . GLY B  1 28  ? 48.901  -3.179  57.874   1.00 72.20  ? 54  GLY B CA  1 
ATOM   2337  C  C   . GLY B  1 28  ? 48.986  -4.599  58.394   1.00 75.78  ? 54  GLY B C   1 
ATOM   2338  O  O   . GLY B  1 28  ? 48.609  -5.545  57.699   1.00 73.17  ? 54  GLY B O   1 
ATOM   2339  N  N   . ARG B  1 29  ? 49.473  -4.746  59.621   1.00 79.29  ? 55  ARG B N   1 
ATOM   2340  C  CA  . ARG B  1 29  ? 49.698  -6.059  60.214   1.00 67.78  ? 55  ARG B CA  1 
ATOM   2341  C  C   . ARG B  1 29  ? 49.322  -6.077  61.693   1.00 62.48  ? 55  ARG B C   1 
ATOM   2342  O  O   . ARG B  1 29  ? 48.150  -5.983  62.050   1.00 67.39  ? 55  ARG B O   1 
ATOM   2343  C  CB  . ARG B  1 29  ? 51.162  -6.474  60.051   1.00 76.06  ? 55  ARG B CB  1 
ATOM   2344  C  CG  . ARG B  1 29  ? 51.655  -6.574  58.613   1.00 72.79  ? 55  ARG B CG  1 
ATOM   2345  C  CD  . ARG B  1 29  ? 53.154  -6.326  58.555   1.00 78.72  ? 55  ARG B CD  1 
ATOM   2346  N  NE  . ARG B  1 29  ? 53.866  -7.340  57.782   1.00 87.90  ? 55  ARG B NE  1 
ATOM   2347  C  CZ  . ARG B  1 29  ? 54.774  -7.067  56.851   1.00 87.09  ? 55  ARG B CZ  1 
ATOM   2348  N  NH1 . ARG B  1 29  ? 55.080  -5.807  56.573   1.00 87.58  ? 55  ARG B NH1 1 
ATOM   2349  N  NH2 . ARG B  1 29  ? 55.377  -8.050  56.197   1.00 78.35  ? 55  ARG B NH2 1 
ATOM   2350  N  N   . GLY B  1 34  ? 49.554  0.558   67.045   1.00 66.19  ? 60  GLY B N   1 
ATOM   2351  C  CA  . GLY B  1 34  ? 50.103  0.853   65.733   1.00 85.61  ? 60  GLY B CA  1 
ATOM   2352  C  C   . GLY B  1 34  ? 49.265  1.813   64.905   1.00 91.77  ? 60  GLY B C   1 
ATOM   2353  O  O   . GLY B  1 34  ? 48.125  2.121   65.255   1.00 83.10  ? 60  GLY B O   1 
ATOM   2354  N  N   . GLY B  1 35  ? 49.841  2.286   63.799   1.00 95.92  ? 61  GLY B N   1 
ATOM   2355  C  CA  . GLY B  1 35  ? 49.168  3.209   62.902   1.00 85.30  ? 61  GLY B CA  1 
ATOM   2356  C  C   . GLY B  1 35  ? 48.277  2.540   61.873   1.00 85.23  ? 61  GLY B C   1 
ATOM   2357  O  O   . GLY B  1 35  ? 47.516  1.623   62.199   1.00 81.25  ? 61  GLY B O   1 
ATOM   2358  N  N   . CYS B  1 36  ? 48.364  2.995   60.621   1.00 74.44  ? 62  CYS B N   1 
ATOM   2359  C  CA  . CYS B  1 36  ? 47.569  2.455   59.525   1.00 62.02  ? 62  CYS B CA  1 
ATOM   2360  C  C   . CYS B  1 36  ? 48.373  1.632   58.534   1.00 65.88  ? 62  CYS B C   1 
ATOM   2361  O  O   . CYS B  1 36  ? 47.795  1.112   57.573   1.00 74.96  ? 62  CYS B O   1 
ATOM   2362  C  CB  . CYS B  1 36  ? 46.858  3.583   58.771   1.00 64.99  ? 62  CYS B CB  1 
ATOM   2363  S  SG  . CYS B  1 36  ? 45.202  3.936   59.358   1.00 61.74  ? 62  CYS B SG  1 
ATOM   2364  N  N   . GLY B  1 37  ? 49.673  1.506   58.725   1.00 59.56  ? 63  GLY B N   1 
ATOM   2365  C  CA  . GLY B  1 37  ? 50.491  0.688   57.866   1.00 64.86  ? 63  GLY B CA  1 
ATOM   2366  C  C   . GLY B  1 37  ? 51.420  1.507   56.995   1.00 64.76  ? 63  GLY B C   1 
ATOM   2367  O  O   . GLY B  1 37  ? 51.702  2.680   57.254   1.00 68.50  ? 63  GLY B O   1 
ATOM   2368  N  N   . HIS B  1 38  ? 51.911  0.862   55.936   1.00 60.69  ? 64  HIS B N   1 
ATOM   2369  C  CA  . HIS B  1 38  ? 52.877  1.478   55.043   1.00 57.05  ? 64  HIS B CA  1 
ATOM   2370  C  C   . HIS B  1 38  ? 52.310  1.831   53.676   1.00 57.83  ? 64  HIS B C   1 
ATOM   2371  O  O   . HIS B  1 38  ? 52.910  2.649   52.971   1.00 48.32  ? 64  HIS B O   1 
ATOM   2372  C  CB  . HIS B  1 38  ? 54.086  0.549   54.878   1.00 66.38  ? 64  HIS B CB  1 
ATOM   2373  C  CG  . HIS B  1 38  ? 54.817  0.295   56.160   1.00 80.54  ? 64  HIS B CG  1 
ATOM   2374  N  ND1 . HIS B  1 38  ? 55.127  1.298   57.054   1.00 79.76  ? 64  HIS B ND1 1 
ATOM   2375  C  CD2 . HIS B  1 38  ? 55.282  -0.851  56.712   1.00 88.39  ? 64  HIS B CD2 1 
ATOM   2376  C  CE1 . HIS B  1 38  ? 55.761  0.785   58.095   1.00 81.83  ? 64  HIS B CE1 1 
ATOM   2377  N  NE2 . HIS B  1 38  ? 55.868  -0.519  57.912   1.00 89.42  ? 64  HIS B NE2 1 
ATOM   2378  N  N   . ASP B  1 39  ? 51.187  1.235   53.286   1.00 58.30  ? 65  ASP B N   1 
ATOM   2379  C  CA  . ASP B  1 39  ? 50.450  1.650   52.096   1.00 52.75  ? 65  ASP B CA  1 
ATOM   2380  C  C   . ASP B  1 39  ? 49.650  2.892   52.461   1.00 48.43  ? 65  ASP B C   1 
ATOM   2381  O  O   . ASP B  1 39  ? 48.602  2.803   53.107   1.00 47.46  ? 65  ASP B O   1 
ATOM   2382  C  CB  . ASP B  1 39  ? 49.544  0.529   51.602   1.00 55.13  ? 65  ASP B CB  1 
ATOM   2383  C  CG  . ASP B  1 39  ? 49.064  0.744   50.179   1.00 51.38  ? 65  ASP B CG  1 
ATOM   2384  O  OD1 . ASP B  1 39  ? 49.035  1.905   49.712   1.00 58.17  ? 65  ASP B OD1 1 
ATOM   2385  O  OD2 . ASP B  1 39  ? 48.719  -0.263  49.527   1.00 42.49  ? 65  ASP B OD2 1 
ATOM   2386  N  N   . GLU B  1 40  ? 50.143  4.057   52.049   1.00 50.09  ? 66  GLU B N   1 
ATOM   2387  C  CA  . GLU B  1 40  ? 49.515  5.309   52.430   1.00 46.14  ? 66  GLU B CA  1 
ATOM   2388  C  C   . GLU B  1 40  ? 48.363  5.645   51.487   1.00 43.43  ? 66  GLU B C   1 
ATOM   2389  O  O   . GLU B  1 40  ? 48.164  5.010   50.443   1.00 44.37  ? 66  GLU B O   1 
ATOM   2390  C  CB  . GLU B  1 40  ? 50.540  6.443   52.431   1.00 44.73  ? 66  GLU B CB  1 
ATOM   2391  C  CG  . GLU B  1 40  ? 51.732  6.217   53.349   1.00 48.79  ? 66  GLU B CG  1 
ATOM   2392  C  CD  . GLU B  1 40  ? 52.684  7.400   53.370   1.00 47.47  ? 66  GLU B CD  1 
ATOM   2393  O  OE1 . GLU B  1 40  ? 53.135  7.786   54.467   1.00 45.09  ? 66  GLU B OE1 1 
ATOM   2394  O  OE2 . GLU B  1 40  ? 52.972  7.955   52.289   1.00 55.50  ? 66  GLU B OE2 1 
ATOM   2395  N  N   . CYS B  1 41  ? 47.609  6.675   51.866   1.00 39.40  ? 67  CYS B N   1 
ATOM   2396  C  CA  . CYS B  1 41  ? 46.525  7.167   51.029   1.00 42.42  ? 67  CYS B CA  1 
ATOM   2397  C  C   . CYS B  1 41  ? 47.082  7.761   49.744   1.00 37.64  ? 67  CYS B C   1 
ATOM   2398  O  O   . CYS B  1 41  ? 48.083  8.481   49.757   1.00 39.71  ? 67  CYS B O   1 
ATOM   2399  C  CB  . CYS B  1 41  ? 45.712  8.228   51.770   1.00 43.58  ? 67  CYS B CB  1 
ATOM   2400  S  SG  . CYS B  1 41  ? 45.161  7.760   53.427   1.00 49.74  ? 67  CYS B SG  1 
ATOM   2401  N  N   . ASP B  1 42  ? 46.429  7.453   48.630   1.00 38.51  ? 68  ASP B N   1 
ATOM   2402  C  CA  . ASP B  1 42  ? 46.791  8.011   47.327   1.00 42.90  ? 68  ASP B CA  1 
ATOM   2403  C  C   . ASP B  1 42  ? 45.843  9.184   47.077   1.00 36.11  ? 68  ASP B C   1 
ATOM   2404  O  O   . ASP B  1 42  ? 44.780  9.033   46.478   1.00 38.71  ? 68  ASP B O   1 
ATOM   2405  C  CB  . ASP B  1 42  ? 46.728  6.932   46.251   1.00 41.51  ? 68  ASP B CB  1 
ATOM   2406  C  CG  . ASP B  1 42  ? 47.492  5.663   46.653   1.00 40.58  ? 68  ASP B CG  1 
ATOM   2407  O  OD1 . ASP B  1 42  ? 48.559  5.776   47.287   1.00 46.04  ? 68  ASP B OD1 1 
ATOM   2408  O  OD2 . ASP B  1 42  ? 47.047  4.547   46.328   1.00 43.76  ? 68  ASP B OD2 1 
ATOM   2409  N  N   . THR B  1 43  ? 46.250  10.368  47.543   1.00 36.68  ? 69  THR B N   1 
ATOM   2410  C  CA  . THR B  1 43  ? 45.340  11.482  47.793   1.00 34.92  ? 69  THR B CA  1 
ATOM   2411  C  C   . THR B  1 43  ? 45.171  12.380  46.572   1.00 35.85  ? 69  THR B C   1 
ATOM   2412  O  O   . THR B  1 43  ? 46.157  12.836  45.984   1.00 35.60  ? 69  THR B O   1 
ATOM   2413  C  CB  . THR B  1 43  ? 45.850  12.323  48.965   1.00 35.27  ? 69  THR B CB  1 
ATOM   2414  O  OG1 . THR B  1 43  ? 46.032  11.490  50.114   1.00 32.53  ? 69  THR B OG1 1 
ATOM   2415  C  CG2 . THR B  1 43  ? 44.852  13.424  49.305   1.00 33.67  ? 69  THR B CG2 1 
ATOM   2416  N  N   . TYR B  1 44  ? 43.916  12.647  46.212   1.00 40.39  ? 70  TYR B N   1 
ATOM   2417  C  CA  . TYR B  1 44  ? 43.551  13.665  45.236   1.00 34.28  ? 70  TYR B CA  1 
ATOM   2418  C  C   . TYR B  1 44  ? 42.395  14.488  45.789   1.00 32.14  ? 70  TYR B C   1 
ATOM   2419  O  O   . TYR B  1 44  ? 41.849  14.196  46.856   1.00 29.60  ? 70  TYR B O   1 
ATOM   2420  C  CB  . TYR B  1 44  ? 43.183  13.054  43.878   1.00 33.09  ? 70  TYR B CB  1 
ATOM   2421  C  CG  . TYR B  1 44  ? 41.942  12.195  43.888   1.00 37.36  ? 70  TYR B CG  1 
ATOM   2422  C  CD1 . TYR B  1 44  ? 41.972  10.907  44.407   1.00 40.62  ? 70  TYR B CD1 1 
ATOM   2423  C  CD2 . TYR B  1 44  ? 40.746  12.661  43.357   1.00 38.66  ? 70  TYR B CD2 1 
ATOM   2424  C  CE1 . TYR B  1 44  ? 40.846  10.113  44.411   1.00 42.25  ? 70  TYR B CE1 1 
ATOM   2425  C  CE2 . TYR B  1 44  ? 39.612  11.873  43.356   1.00 39.09  ? 70  TYR B CE2 1 
ATOM   2426  C  CZ  . TYR B  1 44  ? 39.669  10.598  43.882   1.00 46.31  ? 70  TYR B CZ  1 
ATOM   2427  O  OH  . TYR B  1 44  ? 38.546  9.801   43.890   1.00 55.52  ? 70  TYR B OH  1 
ATOM   2428  N  N   . VAL B  1 45  ? 42.033  15.538  45.057   1.00 30.31  ? 71  VAL B N   1 
ATOM   2429  C  CA  . VAL B  1 45  ? 41.112  16.554  45.551   1.00 33.83  ? 71  VAL B CA  1 
ATOM   2430  C  C   . VAL B  1 45  ? 40.009  16.799  44.528   1.00 33.03  ? 71  VAL B C   1 
ATOM   2431  O  O   . VAL B  1 45  ? 40.261  16.796  43.317   1.00 35.33  ? 71  VAL B O   1 
ATOM   2432  C  CB  . VAL B  1 45  ? 41.876  17.853  45.886   1.00 30.80  ? 71  VAL B CB  1 
ATOM   2433  C  CG1 . VAL B  1 45  ? 40.982  19.079  45.773   1.00 35.69  ? 71  VAL B CG1 1 
ATOM   2434  C  CG2 . VAL B  1 45  ? 42.468  17.751  47.278   1.00 27.25  ? 71  VAL B CG2 1 
ATOM   2435  N  N   . ARG B  1 46  ? 38.779  16.991  45.017   1.00 27.41  ? 72  ARG B N   1 
ATOM   2436  C  CA  A ARG B  1 46  ? 37.640  17.348  44.183   0.47 36.07  ? 72  ARG B CA  1 
ATOM   2437  C  CA  B ARG B  1 46  ? 37.635  17.345  44.187   0.53 35.56  ? 72  ARG B CA  1 
ATOM   2438  C  C   . ARG B  1 46  ? 37.059  18.675  44.652   1.00 31.81  ? 72  ARG B C   1 
ATOM   2439  O  O   . ARG B  1 46  ? 36.899  18.904  45.854   1.00 30.77  ? 72  ARG B O   1 
ATOM   2440  C  CB  A ARG B  1 46  ? 36.558  16.260  44.209   0.47 38.34  ? 72  ARG B CB  1 
ATOM   2441  C  CB  B ARG B  1 46  ? 36.554  16.259  44.233   0.53 38.11  ? 72  ARG B CB  1 
ATOM   2442  C  CG  A ARG B  1 46  ? 37.017  14.922  43.649   0.47 40.41  ? 72  ARG B CG  1 
ATOM   2443  C  CG  B ARG B  1 46  ? 36.918  15.000  43.466   0.53 39.52  ? 72  ARG B CG  1 
ATOM   2444  C  CD  A ARG B  1 46  ? 35.843  14.085  43.154   0.47 42.20  ? 72  ARG B CD  1 
ATOM   2445  C  CD  B ARG B  1 46  ? 35.778  13.994  43.454   0.53 42.42  ? 72  ARG B CD  1 
ATOM   2446  N  NE  A ARG B  1 46  ? 35.275  14.607  41.913   0.47 44.29  ? 72  ARG B NE  1 
ATOM   2447  N  NE  B ARG B  1 46  ? 36.195  12.716  42.882   0.53 47.30  ? 72  ARG B NE  1 
ATOM   2448  C  CZ  A ARG B  1 46  ? 35.609  14.181  40.698   0.47 46.33  ? 72  ARG B CZ  1 
ATOM   2449  C  CZ  B ARG B  1 46  ? 35.563  11.563  43.080   0.53 46.33  ? 72  ARG B CZ  1 
ATOM   2450  N  NH1 A ARG B  1 46  ? 36.510  13.220  40.552   0.47 42.57  ? 72  ARG B NH1 1 
ATOM   2451  N  NH1 B ARG B  1 46  ? 34.480  11.520  43.842   0.53 42.80  ? 72  ARG B NH1 1 
ATOM   2452  N  NH2 A ARG B  1 46  ? 35.039  14.716  39.626   0.47 42.61  ? 72  ARG B NH2 1 
ATOM   2453  N  NH2 B ARG B  1 46  ? 36.018  10.452  42.519   0.53 42.61  ? 72  ARG B NH2 1 
ATOM   2454  N  N   . VAL B  1 47  ? 36.745  19.549  43.692   1.00 32.72  ? 73  VAL B N   1 
ATOM   2455  C  CA  . VAL B  1 47  ? 36.256  20.900  43.960   1.00 31.02  ? 73  VAL B CA  1 
ATOM   2456  C  C   . VAL B  1 47  ? 34.823  21.023  43.452   1.00 34.60  ? 73  VAL B C   1 
ATOM   2457  O  O   . VAL B  1 47  ? 34.538  20.695  42.294   1.00 34.60  ? 73  VAL B O   1 
ATOM   2458  C  CB  . VAL B  1 47  ? 37.153  21.964  43.299   1.00 24.52  ? 73  VAL B CB  1 
ATOM   2459  C  CG1 . VAL B  1 47  ? 36.682  23.370  43.658   1.00 17.87  ? 73  VAL B CG1 1 
ATOM   2460  C  CG2 . VAL B  1 47  ? 38.605  21.752  43.684   1.00 26.24  ? 73  VAL B CG2 1 
ATOM   2461  N  N   . CYS B  1 48  ? 33.930  21.505  44.318   1.00 32.37  ? 74  CYS B N   1 
ATOM   2462  C  CA  . CYS B  1 48  ? 32.534  21.766  43.984   1.00 30.65  ? 74  CYS B CA  1 
ATOM   2463  C  C   . CYS B  1 48  ? 32.232  23.235  44.244   1.00 29.19  ? 74  CYS B C   1 
ATOM   2464  O  O   . CYS B  1 48  ? 32.589  23.766  45.301   1.00 32.50  ? 74  CYS B O   1 
ATOM   2465  C  CB  . CYS B  1 48  ? 31.594  20.884  44.812   1.00 33.40  ? 74  CYS B CB  1 
ATOM   2466  S  SG  . CYS B  1 48  ? 29.821  20.946  44.387   1.00 30.35  ? 74  CYS B SG  1 
ATOM   2467  N  N   . LEU B  1 49  ? 31.565  23.884  43.295   1.00 26.58  ? 75  LEU B N   1 
ATOM   2468  C  CA  . LEU B  1 49  ? 31.238  25.301  43.395   1.00 30.88  ? 75  LEU B CA  1 
ATOM   2469  C  C   . LEU B  1 49  ? 29.748  25.483  43.137   1.00 31.11  ? 75  LEU B C   1 
ATOM   2470  O  O   . LEU B  1 49  ? 29.230  24.999  42.125   1.00 33.23  ? 75  LEU B O   1 
ATOM   2471  C  CB  . LEU B  1 49  ? 32.069  26.124  42.400   1.00 32.22  ? 75  LEU B CB  1 
ATOM   2472  C  CG  . LEU B  1 49  ? 32.194  27.630  42.644   1.00 35.12  ? 75  LEU B CG  1 
ATOM   2473  C  CD1 . LEU B  1 49  ? 32.965  27.909  43.933   1.00 24.98  ? 75  LEU B CD1 1 
ATOM   2474  C  CD2 . LEU B  1 49  ? 32.856  28.312  41.458   1.00 26.59  ? 75  LEU B CD2 1 
ATOM   2475  N  N   . LYS B  1 50  ? 29.057  26.159  44.052   1.00 25.87  ? 76  LYS B N   1 
ATOM   2476  C  CA  . LYS B  1 50  ? 27.606  26.305  43.943   1.00 33.03  ? 76  LYS B CA  1 
ATOM   2477  C  C   . LYS B  1 50  ? 27.178  27.605  44.621   1.00 32.24  ? 76  LYS B C   1 
ATOM   2478  O  O   . LYS B  1 50  ? 28.010  28.416  45.039   1.00 32.32  ? 76  LYS B O   1 
ATOM   2479  C  CB  . LYS B  1 50  ? 26.907  25.069  44.528   1.00 31.29  ? 76  LYS B CB  1 
ATOM   2480  C  CG  . LYS B  1 50  ? 27.138  24.872  46.015   1.00 28.40  ? 76  LYS B CG  1 
ATOM   2481  C  CD  . LYS B  1 50  ? 26.611  23.528  46.472   1.00 29.27  ? 76  LYS B CD  1 
ATOM   2482  C  CE  . LYS B  1 50  ? 26.720  23.377  47.978   1.00 36.76  ? 76  LYS B CE  1 
ATOM   2483  N  NZ  . LYS B  1 50  ? 26.235  22.047  48.438   1.00 36.86  ? 76  LYS B NZ  1 
ATOM   2484  N  N   . GLU B  1 51  ? 25.864  27.795  44.730   1.00 30.21  ? 77  GLU B N   1 
ATOM   2485  C  CA  . GLU B  1 51  ? 25.299  29.038  45.235   1.00 30.02  ? 77  GLU B CA  1 
ATOM   2486  C  C   . GLU B  1 51  ? 25.485  29.169  46.748   1.00 31.27  ? 77  GLU B C   1 
ATOM   2487  O  O   . GLU B  1 51  ? 25.685  28.189  47.473   1.00 30.06  ? 77  GLU B O   1 
ATOM   2488  C  CB  . GLU B  1 51  ? 23.814  29.130  44.880   1.00 27.44  ? 77  GLU B CB  1 
ATOM   2489  C  CG  . GLU B  1 51  ? 22.936  28.081  45.545   1.00 30.31  ? 77  GLU B CG  1 
ATOM   2490  C  CD  . GLU B  1 51  ? 23.025  26.725  44.866   1.00 32.12  ? 77  GLU B CD  1 
ATOM   2491  O  OE1 . GLU B  1 51  ? 23.509  26.672  43.716   1.00 30.79  ? 77  GLU B OE1 1 
ATOM   2492  O  OE2 . GLU B  1 51  ? 22.604  25.716  45.475   1.00 34.66  ? 77  GLU B OE2 1 
ATOM   2493  N  N   . TYR B  1 52  ? 25.373  30.409  47.220   1.00 30.59  ? 78  TYR B N   1 
ATOM   2494  C  CA  . TYR B  1 52  ? 25.584  30.713  48.628   1.00 34.92  ? 78  TYR B CA  1 
ATOM   2495  C  C   . TYR B  1 52  ? 24.579  29.976  49.505   1.00 32.85  ? 78  TYR B C   1 
ATOM   2496  O  O   . TYR B  1 52  ? 23.461  29.668  49.086   1.00 35.92  ? 78  TYR B O   1 
ATOM   2497  C  CB  . TYR B  1 52  ? 25.476  32.222  48.862   1.00 34.21  ? 78  TYR B CB  1 
ATOM   2498  C  CG  . TYR B  1 52  ? 25.839  32.656  50.267   1.00 42.27  ? 78  TYR B CG  1 
ATOM   2499  C  CD1 . TYR B  1 52  ? 27.162  32.888  50.620   1.00 41.69  ? 78  TYR B CD1 1 
ATOM   2500  C  CD2 . TYR B  1 52  ? 24.862  32.838  51.238   1.00 46.46  ? 78  TYR B CD2 1 
ATOM   2501  C  CE1 . TYR B  1 52  ? 27.504  33.285  51.901   1.00 46.85  ? 78  TYR B CE1 1 
ATOM   2502  C  CE2 . TYR B  1 52  ? 25.195  33.235  52.526   1.00 49.58  ? 78  TYR B CE2 1 
ATOM   2503  C  CZ  . TYR B  1 52  ? 26.520  33.458  52.850   1.00 49.01  ? 78  TYR B CZ  1 
ATOM   2504  O  OH  . TYR B  1 52  ? 26.870  33.853  54.123   1.00 44.43  ? 78  TYR B OH  1 
ATOM   2505  N  N   . GLN B  1 53  ? 25.000  29.675  50.732   1.00 37.67  ? 79  GLN B N   1 
ATOM   2506  C  CA  . GLN B  1 53  ? 24.158  28.984  51.705   1.00 46.80  ? 79  GLN B CA  1 
ATOM   2507  C  C   . GLN B  1 53  ? 24.461  29.531  53.091   1.00 44.20  ? 79  GLN B C   1 
ATOM   2508  O  O   . GLN B  1 53  ? 25.598  29.430  53.561   1.00 44.79  ? 79  GLN B O   1 
ATOM   2509  C  CB  . GLN B  1 53  ? 24.389  27.467  51.665   1.00 39.59  ? 79  GLN B CB  1 
ATOM   2510  C  CG  . GLN B  1 53  ? 23.720  26.761  50.489   1.00 44.65  ? 79  GLN B CG  1 
ATOM   2511  C  CD  . GLN B  1 53  ? 24.100  25.295  50.387   1.00 46.06  ? 79  GLN B CD  1 
ATOM   2512  O  OE1 . GLN B  1 53  ? 24.819  24.770  51.237   1.00 45.97  ? 79  GLN B OE1 1 
ATOM   2513  N  NE2 . GLN B  1 53  ? 23.615  24.625  49.344   1.00 44.10  ? 79  GLN B NE2 1 
ATOM   2514  N  N   . ALA B  1 54  ? 23.445  30.114  53.737   1.00 46.11  ? 80  ALA B N   1 
ATOM   2515  C  CA  . ALA B  1 54  ? 23.606  30.572  55.115   1.00 46.02  ? 80  ALA B CA  1 
ATOM   2516  C  C   . ALA B  1 54  ? 23.957  29.410  56.033   1.00 51.27  ? 80  ALA B C   1 
ATOM   2517  O  O   . ALA B  1 54  ? 24.746  29.563  56.975   1.00 55.43  ? 80  ALA B O   1 
ATOM   2518  C  CB  . ALA B  1 54  ? 22.332  31.269  55.593   1.00 44.75  ? 80  ALA B CB  1 
ATOM   2519  N  N   . LYS B  1 55  ? 23.373  28.242  55.774   1.00 58.08  ? 81  LYS B N   1 
ATOM   2520  C  CA  . LYS B  1 55  ? 23.723  26.993  56.440   1.00 57.61  ? 81  LYS B CA  1 
ATOM   2521  C  C   . LYS B  1 55  ? 24.208  26.034  55.363   1.00 51.07  ? 81  LYS B C   1 
ATOM   2522  O  O   . LYS B  1 55  ? 23.406  25.527  54.573   1.00 51.47  ? 81  LYS B O   1 
ATOM   2523  C  CB  . LYS B  1 55  ? 22.531  26.422  57.208   1.00 60.83  ? 81  LYS B CB  1 
ATOM   2524  C  CG  . LYS B  1 55  ? 22.791  25.062  57.836   1.00 69.27  ? 81  LYS B CG  1 
ATOM   2525  C  CD  . LYS B  1 55  ? 21.767  24.736  58.910   1.00 68.15  ? 81  LYS B CD  1 
ATOM   2526  C  CE  . LYS B  1 55  ? 22.016  23.356  59.490   1.00 68.22  ? 81  LYS B CE  1 
ATOM   2527  N  NZ  . LYS B  1 55  ? 23.460  23.133  59.742   1.00 69.21  ? 81  LYS B NZ  1 
ATOM   2528  N  N   . VAL B  1 56  ? 25.519  25.796  55.325   1.00 55.83  ? 82  VAL B N   1 
ATOM   2529  C  CA  . VAL B  1 56  ? 26.112  25.046  54.225   1.00 52.54  ? 82  VAL B CA  1 
ATOM   2530  C  C   . VAL B  1 56  ? 25.684  23.589  54.309   1.00 43.96  ? 82  VAL B C   1 
ATOM   2531  O  O   . VAL B  1 56  ? 25.760  22.961  55.372   1.00 53.55  ? 82  VAL B O   1 
ATOM   2532  C  CB  . VAL B  1 56  ? 27.642  25.178  54.245   1.00 52.81  ? 82  VAL B CB  1 
ATOM   2533  C  CG1 . VAL B  1 56  ? 28.253  24.389  53.101   1.00 42.30  ? 82  VAL B CG1 1 
ATOM   2534  C  CG2 . VAL B  1 56  ? 28.048  26.642  54.158   1.00 50.00  ? 82  VAL B CG2 1 
ATOM   2535  N  N   . THR B  1 57  ? 25.247  23.040  53.183   1.00 41.81  ? 83  THR B N   1 
ATOM   2536  C  CA  . THR B  1 57  ? 24.890  21.636  53.109   1.00 45.36  ? 83  THR B CA  1 
ATOM   2537  C  C   . THR B  1 57  ? 25.971  20.855  52.372   1.00 47.43  ? 83  THR B C   1 
ATOM   2538  O  O   . THR B  1 57  ? 26.507  21.338  51.369   1.00 43.66  ? 83  THR B O   1 
ATOM   2539  C  CB  . THR B  1 57  ? 23.551  21.438  52.390   1.00 45.02  ? 83  THR B CB  1 
ATOM   2540  O  OG1 . THR B  1 57  ? 23.602  22.062  51.101   1.00 48.51  ? 83  THR B OG1 1 
ATOM   2541  C  CG2 . THR B  1 57  ? 22.419  22.054  53.197   1.00 43.87  ? 83  THR B CG2 1 
ATOM   2542  N  N   . PRO B  1 58  ? 26.327  19.651  52.854   1.00 50.95  ? 84  PRO B N   1 
ATOM   2543  C  CA  . PRO B  1 58  ? 27.340  18.819  52.190   1.00 47.92  ? 84  PRO B CA  1 
ATOM   2544  C  C   . PRO B  1 58  ? 26.796  18.036  50.996   1.00 43.23  ? 84  PRO B C   1 
ATOM   2545  O  O   . PRO B  1 58  ? 26.954  16.819  50.902   1.00 52.46  ? 84  PRO B O   1 
ATOM   2546  C  CB  . PRO B  1 58  ? 27.802  17.887  53.314   1.00 52.41  ? 84  PRO B CB  1 
ATOM   2547  C  CG  . PRO B  1 58  ? 26.679  17.872  54.326   1.00 41.95  ? 84  PRO B CG  1 
ATOM   2548  C  CD  . PRO B  1 58  ? 25.700  18.959  53.992   1.00 44.45  ? 84  PRO B CD  1 
ATOM   2549  N  N   . THR B  1 59  ? 26.145  18.741  50.080   1.00 48.69  ? 85  THR B N   1 
ATOM   2550  C  CA  . THR B  1 59  ? 25.430  18.124  48.974   1.00 51.68  ? 85  THR B CA  1 
ATOM   2551  C  C   . THR B  1 59  ? 25.930  18.680  47.647   1.00 53.57  ? 85  THR B C   1 
ATOM   2552  O  O   . THR B  1 59  ? 26.722  19.628  47.592   1.00 53.77  ? 85  THR B O   1 
ATOM   2553  C  CB  . THR B  1 59  ? 23.917  18.355  49.086   1.00 51.93  ? 85  THR B CB  1 
ATOM   2554  O  OG1 . THR B  1 59  ? 23.637  19.754  48.951   1.00 50.61  ? 85  THR B OG1 1 
ATOM   2555  C  CG2 . THR B  1 59  ? 23.401  17.869  50.437   1.00 53.90  ? 85  THR B CG2 1 
ATOM   2556  N  N   . GLY B  1 60  ? 25.450  18.071  46.570   1.00 47.90  ? 86  GLY B N   1 
ATOM   2557  C  CA  . GLY B  1 60  ? 25.512  18.677  45.255   1.00 42.10  ? 86  GLY B CA  1 
ATOM   2558  C  C   . GLY B  1 60  ? 24.142  19.250  44.964   1.00 44.69  ? 86  GLY B C   1 
ATOM   2559  O  O   . GLY B  1 60  ? 23.305  19.316  45.862   1.00 46.58  ? 86  GLY B O   1 
ATOM   2560  N  N   . PRO B  1 61  ? 23.897  19.670  43.715   1.00 43.71  ? 87  PRO B N   1 
ATOM   2561  C  CA  . PRO B  1 61  ? 24.847  19.685  42.601   1.00 44.27  ? 87  PRO B CA  1 
ATOM   2562  C  C   . PRO B  1 61  ? 25.794  20.881  42.644   1.00 38.41  ? 87  PRO B C   1 
ATOM   2563  O  O   . PRO B  1 61  ? 25.560  21.838  43.386   1.00 35.55  ? 87  PRO B O   1 
ATOM   2564  C  CB  . PRO B  1 61  ? 23.939  19.766  41.363   1.00 39.28  ? 87  PRO B CB  1 
ATOM   2565  C  CG  . PRO B  1 61  ? 22.542  19.540  41.863   1.00 28.39  ? 87  PRO B CG  1 
ATOM   2566  C  CD  . PRO B  1 61  ? 22.542  20.019  43.267   1.00 31.16  ? 87  PRO B CD  1 
ATOM   2567  N  N   . CYS B  1 62  ? 26.857  20.817  41.844   1.00 35.61  ? 88  CYS B N   1 
ATOM   2568  C  CA  . CYS B  1 62  ? 27.814  21.914  41.722   1.00 37.10  ? 88  CYS B CA  1 
ATOM   2569  C  C   . CYS B  1 62  ? 27.303  22.848  40.633   1.00 32.77  ? 88  CYS B C   1 
ATOM   2570  O  O   . CYS B  1 62  ? 27.637  22.711  39.455   1.00 29.29  ? 88  CYS B O   1 
ATOM   2571  C  CB  . CYS B  1 62  ? 29.205  21.369  41.428   1.00 36.08  ? 88  CYS B CB  1 
ATOM   2572  S  SG  . CYS B  1 62  ? 29.667  20.036  42.569   1.00 40.33  ? 88  CYS B SG  1 
ATOM   2573  N  N   . SER B  1 63  ? 26.480  23.816  41.049   1.00 31.21  ? 89  SER B N   1 
ATOM   2574  C  CA  . SER B  1 63  ? 25.751  24.660  40.106   1.00 30.09  ? 89  SER B CA  1 
ATOM   2575  C  C   . SER B  1 63  ? 26.686  25.521  39.267   1.00 34.83  ? 89  SER B C   1 
ATOM   2576  O  O   . SER B  1 63  ? 26.414  25.768  38.086   1.00 30.20  ? 89  SER B O   1 
ATOM   2577  C  CB  . SER B  1 63  ? 24.761  25.549  40.859   1.00 30.95  ? 89  SER B CB  1 
ATOM   2578  O  OG  . SER B  1 63  ? 23.867  24.785  41.648   1.00 33.11  ? 89  SER B OG  1 
ATOM   2579  N  N   . TYR B  1 64  ? 27.787  25.996  39.858   1.00 35.46  ? 90  TYR B N   1 
ATOM   2580  C  CA  . TYR B  1 64  ? 28.676  26.932  39.178   1.00 31.38  ? 90  TYR B CA  1 
ATOM   2581  C  C   . TYR B  1 64  ? 29.833  26.259  38.455   1.00 33.15  ? 90  TYR B C   1 
ATOM   2582  O  O   . TYR B  1 64  ? 30.476  26.903  37.618   1.00 32.46  ? 90  TYR B O   1 
ATOM   2583  C  CB  . TYR B  1 64  ? 29.253  27.944  40.171   1.00 36.23  ? 90  TYR B CB  1 
ATOM   2584  C  CG  . TYR B  1 64  ? 28.231  28.842  40.828   1.00 37.29  ? 90  TYR B CG  1 
ATOM   2585  C  CD1 . TYR B  1 64  ? 26.956  28.992  40.294   1.00 29.44  ? 90  TYR B CD1 1 
ATOM   2586  C  CD2 . TYR B  1 64  ? 28.551  29.557  41.977   1.00 32.86  ? 90  TYR B CD2 1 
ATOM   2587  C  CE1 . TYR B  1 64  ? 26.025  29.814  40.899   1.00 26.56  ? 90  TYR B CE1 1 
ATOM   2588  C  CE2 . TYR B  1 64  ? 27.629  30.384  42.583   1.00 33.00  ? 90  TYR B CE2 1 
ATOM   2589  C  CZ  . TYR B  1 64  ? 26.369  30.508  42.042   1.00 30.91  ? 90  TYR B CZ  1 
ATOM   2590  O  OH  . TYR B  1 64  ? 25.455  31.332  42.652   1.00 32.35  ? 90  TYR B OH  1 
ATOM   2591  N  N   . GLY B  1 65  ? 30.120  24.996  38.762   1.00 30.34  ? 91  GLY B N   1 
ATOM   2592  C  CA  . GLY B  1 65  ? 31.215  24.287  38.125   1.00 28.94  ? 91  GLY B CA  1 
ATOM   2593  C  C   . GLY B  1 65  ? 31.914  23.316  39.056   1.00 32.04  ? 91  GLY B C   1 
ATOM   2594  O  O   . GLY B  1 65  ? 31.618  23.276  40.255   1.00 33.05  ? 91  GLY B O   1 
ATOM   2595  N  N   . HIS B  1 66  ? 32.842  22.525  38.521   1.00 31.95  ? 92  HIS B N   1 
ATOM   2596  C  CA  . HIS B  1 66  ? 33.557  21.544  39.326   1.00 33.63  ? 92  HIS B CA  1 
ATOM   2597  C  C   . HIS B  1 66  ? 34.877  21.205  38.646   1.00 34.94  ? 92  HIS B C   1 
ATOM   2598  O  O   . HIS B  1 66  ? 35.068  21.459  37.453   1.00 35.99  ? 92  HIS B O   1 
ATOM   2599  C  CB  . HIS B  1 66  ? 32.716  20.280  39.549   1.00 31.97  ? 92  HIS B CB  1 
ATOM   2600  C  CG  . HIS B  1 66  ? 32.319  19.586  38.283   1.00 37.12  ? 92  HIS B CG  1 
ATOM   2601  N  ND1 . HIS B  1 66  ? 33.192  18.805  37.555   1.00 41.77  ? 92  HIS B ND1 1 
ATOM   2602  C  CD2 . HIS B  1 66  ? 31.140  19.549  37.619   1.00 35.28  ? 92  HIS B CD2 1 
ATOM   2603  C  CE1 . HIS B  1 66  ? 32.569  18.319  36.497   1.00 36.41  ? 92  HIS B CE1 1 
ATOM   2604  N  NE2 . HIS B  1 66  ? 31.322  18.754  36.513   1.00 41.57  ? 92  HIS B NE2 1 
ATOM   2605  N  N   . GLY B  1 67  ? 35.789  20.636  39.430   1.00 29.12  ? 93  GLY B N   1 
ATOM   2606  C  CA  . GLY B  1 67  ? 37.082  20.215  38.923   1.00 25.42  ? 93  GLY B CA  1 
ATOM   2607  C  C   . GLY B  1 67  ? 37.706  19.233  39.885   1.00 28.39  ? 93  GLY B C   1 
ATOM   2608  O  O   . GLY B  1 67  ? 37.175  18.971  40.967   1.00 32.00  ? 93  GLY B O   1 
ATOM   2609  N  N   . ALA B  1 68  ? 38.844  18.678  39.472   1.00 29.74  ? 94  ALA B N   1 
ATOM   2610  C  CA  . ALA B  1 68  ? 39.554  17.707  40.297   1.00 31.42  ? 94  ALA B CA  1 
ATOM   2611  C  C   . ALA B  1 68  ? 41.013  17.644  39.869   1.00 31.95  ? 94  ALA B C   1 
ATOM   2612  O  O   . ALA B  1 68  ? 41.372  18.035  38.756   1.00 37.28  ? 94  ALA B O   1 
ATOM   2613  C  CB  . ALA B  1 68  ? 38.911  16.319  40.210   1.00 31.17  ? 94  ALA B CB  1 
ATOM   2614  N  N   . THR B  1 69  ? 41.850  17.144  40.770   1.00 31.56  ? 95  THR B N   1 
ATOM   2615  C  CA  . THR B  1 69  ? 43.273  16.964  40.522   1.00 34.40  ? 95  THR B CA  1 
ATOM   2616  C  C   . THR B  1 69  ? 43.607  15.485  40.402   1.00 34.91  ? 95  THR B C   1 
ATOM   2617  O  O   . THR B  1 69  ? 42.806  14.623  40.782   1.00 30.58  ? 95  THR B O   1 
ATOM   2618  C  CB  . THR B  1 69  ? 44.124  17.563  41.652   1.00 29.46  ? 95  THR B CB  1 
ATOM   2619  O  OG1 . THR B  1 69  ? 43.900  16.823  42.854   1.00 37.52  ? 95  THR B OG1 1 
ATOM   2620  C  CG2 . THR B  1 69  ? 43.781  19.016  41.891   1.00 30.04  ? 95  THR B CG2 1 
ATOM   2621  N  N   . PRO B  1 70  ? 44.782  15.148  39.867   1.00 29.64  ? 96  PRO B N   1 
ATOM   2622  C  CA  . PRO B  1 70  ? 45.267  13.770  39.996   1.00 33.70  ? 96  PRO B CA  1 
ATOM   2623  C  C   . PRO B  1 70  ? 45.821  13.524  41.390   1.00 30.15  ? 96  PRO B C   1 
ATOM   2624  O  O   . PRO B  1 70  ? 45.703  14.388  42.264   1.00 33.47  ? 96  PRO B O   1 
ATOM   2625  C  CB  . PRO B  1 70  ? 46.353  13.677  38.918   1.00 32.88  ? 96  PRO B CB  1 
ATOM   2626  C  CG  . PRO B  1 70  ? 46.831  15.069  38.761   1.00 28.50  ? 96  PRO B CG  1 
ATOM   2627  C  CD  . PRO B  1 70  ? 45.631  15.945  38.965   1.00 29.04  ? 96  PRO B CD  1 
ATOM   2628  N  N   . VAL B  1 71  ? 46.419  12.358  41.621   1.00 29.09  ? 97  VAL B N   1 
ATOM   2629  C  CA  . VAL B  1 71  ? 46.993  12.076  42.932   1.00 36.53  ? 97  VAL B CA  1 
ATOM   2630  C  C   . VAL B  1 71  ? 48.148  13.038  43.174   1.00 35.04  ? 97  VAL B C   1 
ATOM   2631  O  O   . VAL B  1 71  ? 49.098  13.106  42.384   1.00 28.70  ? 97  VAL B O   1 
ATOM   2632  C  CB  . VAL B  1 71  ? 47.445  10.614  43.041   1.00 36.65  ? 97  VAL B CB  1 
ATOM   2633  C  CG1 . VAL B  1 71  ? 48.207  10.396  44.337   1.00 32.68  ? 97  VAL B CG1 1 
ATOM   2634  C  CG2 . VAL B  1 71  ? 46.246  9.682   42.976   1.00 33.45  ? 97  VAL B CG2 1 
ATOM   2635  N  N   . LEU B  1 72  ? 48.052  13.813  44.255   1.00 35.36  ? 98  LEU B N   1 
ATOM   2636  C  CA  . LEU B  1 72  ? 49.060  14.815  44.576   1.00 33.96  ? 98  LEU B CA  1 
ATOM   2637  C  C   . LEU B  1 72  ? 50.154  14.288  45.489   1.00 26.52  ? 98  LEU B C   1 
ATOM   2638  O  O   . LEU B  1 72  ? 51.275  14.802  45.448   1.00 28.50  ? 98  LEU B O   1 
ATOM   2639  C  CB  . LEU B  1 72  ? 48.406  16.032  45.234   1.00 34.68  ? 98  LEU B CB  1 
ATOM   2640  C  CG  . LEU B  1 72  ? 47.324  16.734  44.406   1.00 35.65  ? 98  LEU B CG  1 
ATOM   2641  C  CD1 . LEU B  1 72  ? 46.734  17.899  45.183   1.00 35.55  ? 98  LEU B CD1 1 
ATOM   2642  C  CD2 . LEU B  1 72  ? 47.887  17.199  43.076   1.00 30.45  ? 98  LEU B CD2 1 
ATOM   2643  N  N   . GLY B  1 73  ? 49.860  13.280  46.299   1.00 31.90  ? 99  GLY B N   1 
ATOM   2644  C  CA  . GLY B  1 73  ? 50.858  12.745  47.204   1.00 27.68  ? 99  GLY B CA  1 
ATOM   2645  C  C   . GLY B  1 73  ? 50.280  11.650  48.070   1.00 35.33  ? 99  GLY B C   1 
ATOM   2646  O  O   . GLY B  1 73  ? 49.299  10.998  47.705   1.00 35.21  ? 99  GLY B O   1 
ATOM   2647  N  N   . GLY B  1 74  ? 50.907  11.452  49.229   1.00 34.55  ? 100 GLY B N   1 
ATOM   2648  C  CA  . GLY B  1 74  ? 50.500  10.408  50.149   1.00 30.65  ? 100 GLY B CA  1 
ATOM   2649  C  C   . GLY B  1 74  ? 49.591  10.909  51.250   1.00 31.25  ? 100 GLY B C   1 
ATOM   2650  O  O   . GLY B  1 74  ? 48.643  11.652  50.986   1.00 33.41  ? 100 GLY B O   1 
ATOM   2651  N  N   . ASN B  1 75  ? 49.877  10.516  52.494   1.00 35.37  ? 101 ASN B N   1 
ATOM   2652  C  CA  . ASN B  1 75  ? 49.055  10.950  53.620   1.00 31.54  ? 101 ASN B CA  1 
ATOM   2653  C  C   . ASN B  1 75  ? 49.230  12.436  53.899   1.00 33.13  ? 101 ASN B C   1 
ATOM   2654  O  O   . ASN B  1 75  ? 48.262  13.126  54.237   1.00 34.64  ? 101 ASN B O   1 
ATOM   2655  C  CB  . ASN B  1 75  ? 49.396  10.132  54.862   1.00 36.92  ? 101 ASN B CB  1 
ATOM   2656  C  CG  . ASN B  1 75  ? 49.094  8.661   54.689   1.00 44.57  ? 101 ASN B CG  1 
ATOM   2657  O  OD1 . ASN B  1 75  ? 48.241  8.281   53.883   1.00 43.79  ? 101 ASN B OD1 1 
ATOM   2658  N  ND2 . ASN B  1 75  ? 49.801  7.820   55.439   1.00 40.05  ? 101 ASN B ND2 1 
ATOM   2659  N  N   . SER B  1 76  ? 50.455  12.944  53.766   1.00 34.12  ? 102 SER B N   1 
ATOM   2660  C  CA  . SER B  1 76  ? 50.745  14.354  53.976   1.00 32.71  ? 102 SER B CA  1 
ATOM   2661  C  C   . SER B  1 76  ? 51.762  14.820  52.944   1.00 34.50  ? 102 SER B C   1 
ATOM   2662  O  O   . SER B  1 76  ? 52.638  14.059  52.527   1.00 35.70  ? 102 SER B O   1 
ATOM   2663  C  CB  . SER B  1 76  ? 51.266  14.621  55.390   1.00 25.63  ? 102 SER B CB  1 
ATOM   2664  O  OG  . SER B  1 76  ? 50.343  14.167  56.360   1.00 34.05  ? 102 SER B OG  1 
ATOM   2665  N  N   . PHE B  1 77  ? 51.625  16.075  52.520   1.00 30.60  ? 103 PHE B N   1 
ATOM   2666  C  CA  . PHE B  1 77  ? 52.501  16.620  51.493   1.00 33.97  ? 103 PHE B CA  1 
ATOM   2667  C  C   . PHE B  1 77  ? 52.402  18.140  51.492   1.00 34.34  ? 103 PHE B C   1 
ATOM   2668  O  O   . PHE B  1 77  ? 51.436  18.719  51.996   1.00 31.20  ? 103 PHE B O   1 
ATOM   2669  C  CB  . PHE B  1 77  ? 52.156  16.054  50.108   1.00 28.73  ? 103 PHE B CB  1 
ATOM   2670  C  CG  . PHE B  1 77  ? 50.700  16.153  49.758   1.00 28.96  ? 103 PHE B CG  1 
ATOM   2671  C  CD1 . PHE B  1 77  ? 49.827  15.117  50.063   1.00 36.49  ? 103 PHE B CD1 1 
ATOM   2672  C  CD2 . PHE B  1 77  ? 50.202  17.276  49.123   1.00 25.10  ? 103 PHE B CD2 1 
ATOM   2673  C  CE1 . PHE B  1 77  ? 48.479  15.201  49.744   1.00 30.37  ? 103 PHE B CE1 1 
ATOM   2674  C  CE2 . PHE B  1 77  ? 48.860  17.364  48.799   1.00 35.14  ? 103 PHE B CE2 1 
ATOM   2675  C  CZ  . PHE B  1 77  ? 47.996  16.323  49.114   1.00 31.48  ? 103 PHE B CZ  1 
ATOM   2676  N  N   . TYR B  1 78  ? 53.416  18.774  50.898   1.00 28.64  ? 104 TYR B N   1 
ATOM   2677  C  CA  . TYR B  1 78  ? 53.481  20.221  50.739   1.00 23.80  ? 104 TYR B CA  1 
ATOM   2678  C  C   . TYR B  1 78  ? 53.719  20.549  49.272   1.00 27.66  ? 104 TYR B C   1 
ATOM   2679  O  O   . TYR B  1 78  ? 54.500  19.874  48.596   1.00 32.70  ? 104 TYR B O   1 
ATOM   2680  C  CB  . TYR B  1 78  ? 54.597  20.829  51.592   1.00 26.00  ? 104 TYR B CB  1 
ATOM   2681  C  CG  . TYR B  1 78  ? 54.422  20.667  53.088   1.00 25.55  ? 104 TYR B CG  1 
ATOM   2682  C  CD1 . TYR B  1 78  ? 54.794  19.493  53.725   1.00 24.53  ? 104 TYR B CD1 1 
ATOM   2683  C  CD2 . TYR B  1 78  ? 53.906  21.696  53.865   1.00 23.88  ? 104 TYR B CD2 1 
ATOM   2684  C  CE1 . TYR B  1 78  ? 54.646  19.340  55.089   1.00 26.09  ? 104 TYR B CE1 1 
ATOM   2685  C  CE2 . TYR B  1 78  ? 53.752  21.553  55.233   1.00 26.56  ? 104 TYR B CE2 1 
ATOM   2686  C  CZ  . TYR B  1 78  ? 54.126  20.368  55.844   1.00 29.91  ? 104 TYR B CZ  1 
ATOM   2687  O  OH  . TYR B  1 78  ? 53.986  20.202  57.211   1.00 21.46  ? 104 TYR B OH  1 
ATOM   2688  N  N   . LEU B  1 79  ? 53.052  21.584  48.787   1.00 27.88  ? 105 LEU B N   1 
ATOM   2689  C  CA  . LEU B  1 79  ? 53.113  21.998  47.395   1.00 20.58  ? 105 LEU B CA  1 
ATOM   2690  C  C   . LEU B  1 79  ? 53.412  23.488  47.313   1.00 22.58  ? 105 LEU B C   1 
ATOM   2691  O  O   . LEU B  1 79  ? 53.303  24.204  48.312   1.00 26.18  ? 105 LEU B O   1 
ATOM   2692  C  CB  . LEU B  1 79  ? 51.790  21.677  46.686   1.00 24.16  ? 105 LEU B CB  1 
ATOM   2693  C  CG  . LEU B  1 79  ? 51.402  20.199  46.687   1.00 23.19  ? 105 LEU B CG  1 
ATOM   2694  C  CD1 . LEU B  1 79  ? 50.073  19.998  45.981   1.00 29.24  ? 105 LEU B CD1 1 
ATOM   2695  C  CD2 . LEU B  1 79  ? 52.490  19.369  46.037   1.00 20.51  ? 105 LEU B CD2 1 
ATOM   2696  N  N   . PRO B  1 80  ? 53.811  23.982  46.141   1.00 23.61  ? 106 PRO B N   1 
ATOM   2697  C  CA  . PRO B  1 80  ? 54.086  25.416  45.993   1.00 21.03  ? 106 PRO B CA  1 
ATOM   2698  C  C   . PRO B  1 80  ? 52.832  26.249  46.191   1.00 28.34  ? 106 PRO B C   1 
ATOM   2699  O  O   . PRO B  1 80  ? 51.801  26.012  45.540   1.00 26.38  ? 106 PRO B O   1 
ATOM   2700  C  CB  . PRO B  1 80  ? 54.599  25.527  44.552   1.00 17.86  ? 106 PRO B CB  1 
ATOM   2701  C  CG  . PRO B  1 80  ? 55.123  24.197  44.242   1.00 17.27  ? 106 PRO B CG  1 
ATOM   2702  C  CD  . PRO B  1 80  ? 54.233  23.231  44.947   1.00 24.99  ? 106 PRO B CD  1 
ATOM   2703  N  N   . PRO B  1 81  ? 52.875  27.229  47.093   1.00 23.52  ? 107 PRO B N   1 
ATOM   2704  C  CA  . PRO B  1 81  ? 51.719  28.116  47.277   1.00 27.03  ? 107 PRO B CA  1 
ATOM   2705  C  C   . PRO B  1 81  ? 51.537  29.085  46.120   1.00 31.82  ? 107 PRO B C   1 
ATOM   2706  O  O   . PRO B  1 81  ? 52.369  29.149  45.208   1.00 30.67  ? 107 PRO B O   1 
ATOM   2707  C  CB  . PRO B  1 81  ? 52.051  28.861  48.579   1.00 27.34  ? 107 PRO B CB  1 
ATOM   2708  C  CG  . PRO B  1 81  ? 53.161  28.070  49.220   1.00 27.05  ? 107 PRO B CG  1 
ATOM   2709  C  CD  . PRO B  1 81  ? 53.931  27.498  48.078   1.00 24.09  ? 107 PRO B CD  1 
ATOM   2710  N  N   . ALA B  1 82  ? 50.459  29.856  46.157   1.00 30.40  ? 108 ALA B N   1 
ATOM   2711  C  CA  . ALA B  1 82  ? 50.159  30.819  45.112   1.00 31.68  ? 108 ALA B CA  1 
ATOM   2712  C  C   . ALA B  1 82  ? 50.466  32.232  45.590   1.00 39.74  ? 108 ALA B C   1 
ATOM   2713  O  O   . ALA B  1 82  ? 50.477  32.525  46.789   1.00 35.56  ? 108 ALA B O   1 
ATOM   2714  C  CB  . ALA B  1 82  ? 48.695  30.718  44.677   1.00 30.69  ? 108 ALA B CB  1 
ATOM   2715  N  N   . GLY B  1 83  ? 50.708  33.110  44.630   1.00 43.48  ? 109 GLY B N   1 
ATOM   2716  C  CA  . GLY B  1 83  ? 51.055  34.481  44.935   1.00 40.82  ? 109 GLY B CA  1 
ATOM   2717  C  C   . GLY B  1 83  ? 51.616  35.171  43.712   1.00 53.29  ? 109 GLY B C   1 
ATOM   2718  O  O   . GLY B  1 83  ? 51.692  34.601  42.622   1.00 53.03  ? 109 GLY B O   1 
ATOM   2719  N  N   . ALA B  1 84  ? 52.005  36.430  43.920   1.00 54.79  ? 110 ALA B N   1 
ATOM   2720  C  CA  . ALA B  1 84  ? 52.559  37.214  42.824   1.00 48.35  ? 110 ALA B CA  1 
ATOM   2721  C  C   . ALA B  1 84  ? 53.874  36.622  42.337   1.00 52.66  ? 110 ALA B C   1 
ATOM   2722  O  O   . ALA B  1 84  ? 54.143  36.599  41.130   1.00 58.56  ? 110 ALA B O   1 
ATOM   2723  C  CB  . ALA B  1 84  ? 52.746  38.667  43.260   1.00 47.91  ? 110 ALA B CB  1 
ATOM   2724  N  N   . ALA B  1 85  ? 54.701  36.120  43.258   1.00 57.27  ? 111 ALA B N   1 
ATOM   2725  C  CA  . ALA B  1 85  ? 55.950  35.482  42.855   1.00 55.13  ? 111 ALA B CA  1 
ATOM   2726  C  C   . ALA B  1 85  ? 55.686  34.229  42.027   1.00 57.54  ? 111 ALA B C   1 
ATOM   2727  O  O   . ALA B  1 85  ? 56.384  33.968  41.041   1.00 59.20  ? 111 ALA B O   1 
ATOM   2728  C  CB  . ALA B  1 85  ? 56.793  35.150  44.086   1.00 48.95  ? 111 ALA B CB  1 
ATOM   2729  N  N   . GLY B  1 86  ? 54.678  33.442  42.411   1.00 52.25  ? 112 GLY B N   1 
ATOM   2730  C  CA  . GLY B  1 86  ? 54.347  32.245  41.663   1.00 47.06  ? 112 GLY B CA  1 
ATOM   2731  C  C   . GLY B  1 86  ? 53.599  32.491  40.371   1.00 58.71  ? 112 GLY B C   1 
ATOM   2732  O  O   . GLY B  1 86  ? 53.618  31.629  39.486   1.00 63.23  ? 112 GLY B O   1 
ATOM   2733  N  N   . ASP B  1 87  ? 52.933  33.643  40.239   1.00 58.56  ? 113 ASP B N   1 
ATOM   2734  C  CA  . ASP B  1 87  ? 52.216  33.930  39.000   1.00 59.34  ? 113 ASP B CA  1 
ATOM   2735  C  C   . ASP B  1 87  ? 53.177  34.130  37.835   1.00 58.70  ? 113 ASP B C   1 
ATOM   2736  O  O   . ASP B  1 87  ? 52.911  33.664  36.721   1.00 63.89  ? 113 ASP B O   1 
ATOM   2737  C  CB  . ASP B  1 87  ? 51.315  35.153  39.171   1.00 61.79  ? 113 ASP B CB  1 
ATOM   2738  C  CG  . ASP B  1 87  ? 50.038  34.835  39.926   1.00 53.94  ? 113 ASP B CG  1 
ATOM   2739  O  OD1 . ASP B  1 87  ? 49.108  35.670  39.907   1.00 44.95  ? 113 ASP B OD1 1 
ATOM   2740  O  OD2 . ASP B  1 87  ? 49.957  33.739  40.517   1.00 56.96  ? 113 ASP B OD2 1 
ATOM   2741  N  N   . ARG B  1 88  ? 54.307  34.798  38.071   1.00 57.99  ? 114 ARG B N   1 
ATOM   2742  C  CA  . ARG B  1 88  ? 55.285  34.952  37.000   1.00 64.62  ? 114 ARG B CA  1 
ATOM   2743  C  C   . ARG B  1 88  ? 55.980  33.631  36.695   1.00 67.48  ? 114 ARG B C   1 
ATOM   2744  O  O   . ARG B  1 88  ? 56.370  33.388  35.547   1.00 68.20  ? 114 ARG B O   1 
ATOM   2745  C  CB  . ARG B  1 88  ? 56.303  36.040  37.353   1.00 64.63  ? 114 ARG B CB  1 
ATOM   2746  C  CG  . ARG B  1 88  ? 56.450  36.340  38.837   1.00 62.75  ? 114 ARG B CG  1 
ATOM   2747  C  CD  . ARG B  1 88  ? 57.343  37.557  39.043   1.00 61.09  ? 114 ARG B CD  1 
ATOM   2748  N  NE  . ARG B  1 88  ? 57.488  37.927  40.449   1.00 66.58  ? 114 ARG B NE  1 
ATOM   2749  C  CZ  . ARG B  1 88  ? 56.751  38.849  41.062   1.00 67.27  ? 114 ARG B CZ  1 
ATOM   2750  N  NH1 . ARG B  1 88  ? 55.809  39.502  40.392   1.00 57.92  ? 114 ARG B NH1 1 
ATOM   2751  N  NH2 . ARG B  1 88  ? 56.959  39.125  42.346   1.00 63.75  ? 114 ARG B NH2 1 
ATOM   2752  N  N   . ALA B  1 89  ? 56.137  32.767  37.700   1.00 73.47  ? 115 ALA B N   1 
ATOM   2753  C  CA  . ALA B  1 89  ? 56.701  31.444  37.465   1.00 69.84  ? 115 ALA B CA  1 
ATOM   2754  C  C   . ALA B  1 89  ? 55.804  30.592  36.577   1.00 71.27  ? 115 ALA B C   1 
ATOM   2755  O  O   . ALA B  1 89  ? 56.295  29.654  35.938   1.00 72.86  ? 115 ALA B O   1 
ATOM   2756  C  CB  . ALA B  1 89  ? 56.947  30.733  38.798   1.00 63.41  ? 115 ALA B CB  1 
ATOM   2757  N  N   . ARG B  1 90  ? 54.503  30.894  36.524   1.00 74.50  ? 116 ARG B N   1 
ATOM   2758  C  CA  . ARG B  1 90  ? 53.599  30.178  35.630   1.00 78.50  ? 116 ARG B CA  1 
ATOM   2759  C  C   . ARG B  1 90  ? 53.609  30.754  34.220   1.00 78.73  ? 116 ARG B C   1 
ATOM   2760  O  O   . ARG B  1 90  ? 53.403  30.011  33.253   1.00 78.65  ? 116 ARG B O   1 
ATOM   2761  C  CB  . ARG B  1 90  ? 52.172  30.205  36.178   1.00 74.96  ? 116 ARG B CB  1 
ATOM   2762  C  CG  . ARG B  1 90  ? 51.794  29.007  37.028   1.00 78.18  ? 116 ARG B CG  1 
ATOM   2763  C  CD  . ARG B  1 90  ? 50.310  28.702  36.876   1.00 85.92  ? 116 ARG B CD  1 
ATOM   2764  N  NE  . ARG B  1 90  ? 50.042  27.889  35.691   1.00 85.44  ? 116 ARG B NE  1 
ATOM   2765  C  CZ  . ARG B  1 90  ? 48.941  27.980  34.950   1.00 81.80  ? 116 ARG B CZ  1 
ATOM   2766  N  NH1 . ARG B  1 90  ? 47.997  28.860  35.263   1.00 72.12  ? 116 ARG B NH1 1 
ATOM   2767  N  NH2 . ARG B  1 90  ? 48.788  27.196  33.889   1.00 77.17  ? 116 ARG B NH2 1 
ATOM   2768  N  N   . ALA B  1 91  ? 53.836  32.064  34.083   1.00 76.54  ? 117 ALA B N   1 
ATOM   2769  C  CA  . ALA B  1 91  ? 53.881  32.685  32.764   1.00 73.57  ? 117 ALA B CA  1 
ATOM   2770  C  C   . ALA B  1 91  ? 55.025  32.150  31.914   1.00 81.92  ? 117 ALA B C   1 
ATOM   2771  O  O   . ALA B  1 91  ? 54.954  32.220  30.682   1.00 87.40  ? 117 ALA B O   1 
ATOM   2772  C  CB  . ALA B  1 91  ? 53.997  34.204  32.901   1.00 73.85  ? 117 ALA B CB  1 
ATOM   2773  N  N   . ARG B  1 92  ? 56.073  31.622  32.540   1.00 80.01  ? 118 ARG B N   1 
ATOM   2774  C  CA  . ARG B  1 92  ? 57.197  31.015  31.838   1.00 77.95  ? 118 ARG B CA  1 
ATOM   2775  C  C   . ARG B  1 92  ? 57.212  29.501  32.022   1.00 80.40  ? 118 ARG B C   1 
ATOM   2776  O  O   . ARG B  1 92  ? 58.273  28.884  32.133   1.00 84.78  ? 118 ARG B O   1 
ATOM   2777  C  CB  . ARG B  1 92  ? 58.517  31.627  32.302   1.00 74.44  ? 118 ARG B CB  1 
ATOM   2778  C  CG  . ARG B  1 92  ? 58.604  31.855  33.801   1.00 77.01  ? 118 ARG B CG  1 
ATOM   2779  C  CD  . ARG B  1 92  ? 59.980  32.365  34.202   1.00 71.62  ? 118 ARG B CD  1 
ATOM   2780  N  NE  . ARG B  1 92  ? 59.975  32.994  35.521   1.00 76.48  ? 118 ARG B NE  1 
ATOM   2781  C  CZ  . ARG B  1 92  ? 59.932  34.309  35.721   1.00 71.83  ? 118 ARG B CZ  1 
ATOM   2782  N  NH1 . ARG B  1 92  ? 59.890  35.138  34.686   1.00 65.20  ? 118 ARG B NH1 1 
ATOM   2783  N  NH2 . ARG B  1 92  ? 59.933  34.797  36.955   1.00 71.23  ? 118 ARG B NH2 1 
ATOM   2784  N  N   . ALA B  1 93  ? 56.033  28.886  32.055   1.00 78.18  ? 119 ALA B N   1 
ATOM   2785  C  CA  . ALA B  1 93  ? 55.930  27.437  32.203   1.00 76.28  ? 119 ALA B CA  1 
ATOM   2786  C  C   . ALA B  1 93  ? 55.454  26.781  30.909   1.00 76.22  ? 119 ALA B C   1 
ATOM   2787  O  O   . ALA B  1 93  ? 55.075  27.462  29.955   1.00 74.21  ? 119 ALA B O   1 
ATOM   2788  C  CB  . ALA B  1 93  ? 54.995  27.085  33.349   1.00 80.01  ? 119 ALA B CB  1 
ATOM   2789  N  N   . GLN B  1 99  ? 51.635  21.840  33.705   1.00 74.72  ? 125 GLN B N   1 
ATOM   2790  C  CA  . GLN B  1 99  ? 50.528  22.301  34.538   1.00 75.71  ? 125 GLN B CA  1 
ATOM   2791  C  C   . GLN B  1 99  ? 50.720  21.900  36.006   1.00 77.37  ? 125 GLN B C   1 
ATOM   2792  O  O   . GLN B  1 99  ? 51.113  20.767  36.300   1.00 71.00  ? 125 GLN B O   1 
ATOM   2793  C  CB  . GLN B  1 99  ? 49.200  21.752  34.000   1.00 69.79  ? 125 GLN B CB  1 
ATOM   2794  C  CG  . GLN B  1 99  ? 48.011  21.884  34.954   1.00 82.06  ? 125 GLN B CG  1 
ATOM   2795  C  CD  . GLN B  1 99  ? 47.433  23.291  35.013   1.00 79.49  ? 125 GLN B CD  1 
ATOM   2796  O  OE1 . GLN B  1 99  ? 48.159  24.284  34.936   1.00 80.59  ? 125 GLN B OE1 1 
ATOM   2797  N  NE2 . GLN B  1 99  ? 46.114  23.378  35.155   1.00 74.99  ? 125 GLN B NE2 1 
ATOM   2798  N  N   . ASP B  1 100 ? 50.457  22.844  36.915   1.00 69.91  ? 126 ASP B N   1 
ATOM   2799  C  CA  . ASP B  1 100 ? 50.523  22.558  38.343   1.00 50.82  ? 126 ASP B CA  1 
ATOM   2800  C  C   . ASP B  1 100 ? 49.570  21.416  38.674   1.00 54.40  ? 126 ASP B C   1 
ATOM   2801  O  O   . ASP B  1 100 ? 48.406  21.446  38.249   1.00 55.74  ? 126 ASP B O   1 
ATOM   2802  C  CB  . ASP B  1 100 ? 50.145  23.783  39.176   1.00 55.06  ? 126 ASP B CB  1 
ATOM   2803  C  CG  . ASP B  1 100 ? 50.904  25.031  38.776   1.00 65.35  ? 126 ASP B CG  1 
ATOM   2804  O  OD1 . ASP B  1 100 ? 50.959  25.335  37.565   1.00 67.89  ? 126 ASP B OD1 1 
ATOM   2805  O  OD2 . ASP B  1 100 ? 51.430  25.717  39.678   1.00 72.21  ? 126 ASP B OD2 1 
ATOM   2806  N  N   . PRO B  1 101 ? 50.010  20.397  39.415   1.00 51.55  ? 127 PRO B N   1 
ATOM   2807  C  CA  . PRO B  1 101 ? 49.064  19.330  39.772   1.00 43.18  ? 127 PRO B CA  1 
ATOM   2808  C  C   . PRO B  1 101 ? 48.020  19.801  40.765   1.00 41.20  ? 127 PRO B C   1 
ATOM   2809  O  O   . PRO B  1 101 ? 46.845  19.435  40.639   1.00 43.07  ? 127 PRO B O   1 
ATOM   2810  C  CB  . PRO B  1 101 ? 49.969  18.231  40.353   1.00 38.66  ? 127 PRO B CB  1 
ATOM   2811  C  CG  . PRO B  1 101 ? 51.375  18.629  39.990   1.00 37.16  ? 127 PRO B CG  1 
ATOM   2812  C  CD  . PRO B  1 101 ? 51.361  20.123  39.923   1.00 47.59  ? 127 PRO B CD  1 
ATOM   2813  N  N   . GLY B  1 102 ? 48.415  20.615  41.746   1.00 37.59  ? 128 GLY B N   1 
ATOM   2814  C  CA  . GLY B  1 102 ? 47.530  21.132  42.769   1.00 36.87  ? 128 GLY B CA  1 
ATOM   2815  C  C   . GLY B  1 102 ? 46.706  22.344  42.398   1.00 34.84  ? 128 GLY B C   1 
ATOM   2816  O  O   . GLY B  1 102 ? 46.059  22.922  43.275   1.00 31.55  ? 128 GLY B O   1 
ATOM   2817  N  N   . LEU B  1 103 ? 46.702  22.748  41.130   1.00 34.72  ? 129 LEU B N   1 
ATOM   2818  C  CA  . LEU B  1 103 ? 45.904  23.873  40.661   1.00 35.10  ? 129 LEU B CA  1 
ATOM   2819  C  C   . LEU B  1 103 ? 44.645  23.361  39.968   1.00 33.54  ? 129 LEU B C   1 
ATOM   2820  O  O   . LEU B  1 103 ? 44.716  22.444  39.143   1.00 33.57  ? 129 LEU B O   1 
ATOM   2821  C  CB  . LEU B  1 103 ? 46.711  24.752  39.701   1.00 43.67  ? 129 LEU B CB  1 
ATOM   2822  C  CG  . LEU B  1 103 ? 46.007  25.965  39.079   1.00 41.07  ? 129 LEU B CG  1 
ATOM   2823  C  CD1 . LEU B  1 103 ? 45.809  27.063  40.111   1.00 36.65  ? 129 LEU B CD1 1 
ATOM   2824  C  CD2 . LEU B  1 103 ? 46.770  26.490  37.878   1.00 40.48  ? 129 LEU B CD2 1 
ATOM   2825  N  N   . VAL B  1 104 ? 43.503  23.965  40.297   1.00 28.92  ? 130 VAL B N   1 
ATOM   2826  C  CA  . VAL B  1 104 ? 42.211  23.638  39.702   1.00 27.22  ? 130 VAL B CA  1 
ATOM   2827  C  C   . VAL B  1 104 ? 41.644  24.899  39.066   1.00 34.52  ? 130 VAL B C   1 
ATOM   2828  O  O   . VAL B  1 104 ? 41.615  25.959  39.701   1.00 39.46  ? 130 VAL B O   1 
ATOM   2829  C  CB  . VAL B  1 104 ? 41.226  23.078  40.744   1.00 24.51  ? 130 VAL B CB  1 
ATOM   2830  C  CG1 . VAL B  1 104 ? 39.870  22.771  40.102   1.00 29.40  ? 130 VAL B CG1 1 
ATOM   2831  C  CG2 . VAL B  1 104 ? 41.795  21.846  41.390   1.00 29.58  ? 130 VAL B CG2 1 
ATOM   2832  N  N   . VAL B  1 105 ? 41.191  24.785  37.820   1.00 25.10  ? 131 VAL B N   1 
ATOM   2833  C  CA  . VAL B  1 105 ? 40.607  25.903  37.090   1.00 32.03  ? 131 VAL B CA  1 
ATOM   2834  C  C   . VAL B  1 105 ? 39.176  25.543  36.716   1.00 35.81  ? 131 VAL B C   1 
ATOM   2835  O  O   . VAL B  1 105 ? 38.934  24.493  36.106   1.00 37.06  ? 131 VAL B O   1 
ATOM   2836  C  CB  . VAL B  1 105 ? 41.429  26.256  35.836   1.00 29.42  ? 131 VAL B CB  1 
ATOM   2837  C  CG1 . VAL B  1 105 ? 40.697  27.284  34.994   1.00 25.78  ? 131 VAL B CG1 1 
ATOM   2838  C  CG2 . VAL B  1 105 ? 42.802  26.772  36.233   1.00 38.54  ? 131 VAL B CG2 1 
ATOM   2839  N  N   . ILE B  1 106 ? 38.236  26.406  37.083   1.00 29.69  ? 132 ILE B N   1 
ATOM   2840  C  CA  . ILE B  1 106 ? 36.825  26.234  36.767   1.00 33.45  ? 132 ILE B CA  1 
ATOM   2841  C  C   . ILE B  1 106 ? 36.355  27.460  35.989   1.00 29.92  ? 132 ILE B C   1 
ATOM   2842  O  O   . ILE B  1 106 ? 36.027  28.492  36.575   1.00 27.53  ? 132 ILE B O   1 
ATOM   2843  C  CB  . ILE B  1 106 ? 35.980  26.029  38.037   1.00 27.32  ? 132 ILE B CB  1 
ATOM   2844  C  CG1 . ILE B  1 106 ? 36.485  24.831  38.838   1.00 30.49  ? 132 ILE B CG1 1 
ATOM   2845  C  CG2 . ILE B  1 106 ? 34.517  25.830  37.669   1.00 21.38  ? 132 ILE B CG2 1 
ATOM   2846  C  CD1 . ILE B  1 106 ? 35.745  24.620  40.142   1.00 21.35  ? 132 ILE B CD1 1 
ATOM   2847  N  N   . PRO B  1 107 ? 36.312  27.384  34.663   1.00 26.57  ? 133 PRO B N   1 
ATOM   2848  C  CA  . PRO B  1 107 ? 35.808  28.511  33.870   1.00 29.32  ? 133 PRO B CA  1 
ATOM   2849  C  C   . PRO B  1 107 ? 34.290  28.621  33.932   1.00 30.41  ? 133 PRO B C   1 
ATOM   2850  O  O   . PRO B  1 107 ? 33.569  27.647  34.161   1.00 24.99  ? 133 PRO B O   1 
ATOM   2851  C  CB  . PRO B  1 107 ? 36.275  28.177  32.448   1.00 30.59  ? 133 PRO B CB  1 
ATOM   2852  C  CG  . PRO B  1 107 ? 36.392  26.692  32.438   1.00 34.44  ? 133 PRO B CG  1 
ATOM   2853  C  CD  . PRO B  1 107 ? 36.837  26.297  33.820   1.00 24.94  ? 133 PRO B CD  1 
ATOM   2854  N  N   . PHE B  1 108 ? 33.807  29.841  33.704   1.00 27.04  ? 134 PHE B N   1 
ATOM   2855  C  CA  . PHE B  1 108 ? 32.371  30.078  33.713   1.00 27.70  ? 134 PHE B CA  1 
ATOM   2856  C  C   . PHE B  1 108 ? 32.015  31.158  32.700   1.00 28.60  ? 134 PHE B C   1 
ATOM   2857  O  O   . PHE B  1 108 ? 32.815  32.053  32.412   1.00 32.12  ? 134 PHE B O   1 
ATOM   2858  C  CB  . PHE B  1 108 ? 31.877  30.456  35.117   1.00 25.61  ? 134 PHE B CB  1 
ATOM   2859  C  CG  . PHE B  1 108 ? 32.565  31.651  35.710   1.00 25.45  ? 134 PHE B CG  1 
ATOM   2860  C  CD1 . PHE B  1 108 ? 32.083  32.931  35.482   1.00 29.46  ? 134 PHE B CD1 1 
ATOM   2861  C  CD2 . PHE B  1 108 ? 33.681  31.495  36.514   1.00 27.62  ? 134 PHE B CD2 1 
ATOM   2862  C  CE1 . PHE B  1 108 ? 32.710  34.037  36.031   1.00 26.44  ? 134 PHE B CE1 1 
ATOM   2863  C  CE2 . PHE B  1 108 ? 34.314  32.597  37.067   1.00 31.36  ? 134 PHE B CE2 1 
ATOM   2864  C  CZ  . PHE B  1 108 ? 33.826  33.871  36.823   1.00 27.47  ? 134 PHE B CZ  1 
ATOM   2865  N  N   . GLN B  1 109 ? 30.794  31.061  32.163   1.00 31.33  ? 135 GLN B N   1 
ATOM   2866  C  CA  . GLN B  1 109 ? 30.281  32.018  31.188   1.00 31.98  ? 135 GLN B CA  1 
ATOM   2867  C  C   . GLN B  1 109 ? 29.191  32.929  31.739   1.00 28.94  ? 135 GLN B C   1 
ATOM   2868  O  O   . GLN B  1 109 ? 28.940  33.984  31.149   1.00 28.89  ? 135 GLN B O   1 
ATOM   2869  C  CB  . GLN B  1 109 ? 29.739  31.280  29.955   1.00 21.19  ? 135 GLN B CB  1 
ATOM   2870  C  CG  . GLN B  1 109 ? 28.616  30.323  30.281   1.00 33.80  ? 135 GLN B CG  1 
ATOM   2871  C  CD  . GLN B  1 109 ? 28.316  29.354  29.160   1.00 30.64  ? 135 GLN B CD  1 
ATOM   2872  O  OE1 . GLN B  1 109 ? 29.094  29.213  28.221   1.00 30.71  ? 135 GLN B OE1 1 
ATOM   2873  N  NE2 . GLN B  1 109 ? 27.190  28.664  29.263   1.00 34.61  ? 135 GLN B NE2 1 
ATOM   2874  N  N   . PHE B  1 110 ? 28.532  32.546  32.831   1.00 30.33  ? 136 PHE B N   1 
ATOM   2875  C  CA  . PHE B  1 110 ? 27.484  33.367  33.417   1.00 31.63  ? 136 PHE B CA  1 
ATOM   2876  C  C   . PHE B  1 110 ? 28.082  34.568  34.151   1.00 29.15  ? 136 PHE B C   1 
ATOM   2877  O  O   . PHE B  1 110 ? 29.296  34.686  34.329   1.00 27.14  ? 136 PHE B O   1 
ATOM   2878  C  CB  . PHE B  1 110 ? 26.627  32.542  34.378   1.00 27.35  ? 136 PHE B CB  1 
ATOM   2879  C  CG  . PHE B  1 110 ? 27.420  31.813  35.425   1.00 29.29  ? 136 PHE B CG  1 
ATOM   2880  C  CD1 . PHE B  1 110 ? 27.858  32.466  36.568   1.00 29.30  ? 136 PHE B CD1 1 
ATOM   2881  C  CD2 . PHE B  1 110 ? 27.723  30.471  35.271   1.00 28.53  ? 136 PHE B CD2 1 
ATOM   2882  C  CE1 . PHE B  1 110 ? 28.590  31.796  37.532   1.00 31.05  ? 136 PHE B CE1 1 
ATOM   2883  C  CE2 . PHE B  1 110 ? 28.453  29.793  36.232   1.00 29.20  ? 136 PHE B CE2 1 
ATOM   2884  C  CZ  . PHE B  1 110 ? 28.887  30.455  37.364   1.00 32.71  ? 136 PHE B CZ  1 
ATOM   2885  N  N   . ALA B  1 111 ? 27.200  35.460  34.595   1.00 34.06  ? 137 ALA B N   1 
ATOM   2886  C  CA  . ALA B  1 111 ? 27.617  36.602  35.398   1.00 33.99  ? 137 ALA B CA  1 
ATOM   2887  C  C   . ALA B  1 111 ? 28.027  36.141  36.792   1.00 31.05  ? 137 ALA B C   1 
ATOM   2888  O  O   . ALA B  1 111 ? 27.263  35.457  37.479   1.00 34.22  ? 137 ALA B O   1 
ATOM   2889  C  CB  . ALA B  1 111 ? 26.487  37.625  35.488   1.00 22.33  ? 137 ALA B CB  1 
ATOM   2890  N  N   . TRP B  1 112 ? 29.228  36.522  37.211   1.00 25.79  ? 138 TRP B N   1 
ATOM   2891  C  CA  . TRP B  1 112 ? 29.757  36.084  38.499   1.00 26.95  ? 138 TRP B CA  1 
ATOM   2892  C  C   . TRP B  1 112 ? 28.921  36.646  39.644   1.00 27.99  ? 138 TRP B C   1 
ATOM   2893  O  O   . TRP B  1 112 ? 28.800  37.872  39.771   1.00 26.87  ? 138 TRP B O   1 
ATOM   2894  C  CB  . TRP B  1 112 ? 31.222  36.502  38.636   1.00 22.89  ? 138 TRP B CB  1 
ATOM   2895  C  CG  . TRP B  1 112 ? 31.822  36.114  39.953   1.00 27.97  ? 138 TRP B CG  1 
ATOM   2896  C  CD1 . TRP B  1 112 ? 32.272  36.958  40.927   1.00 29.56  ? 138 TRP B CD1 1 
ATOM   2897  C  CD2 . TRP B  1 112 ? 32.008  34.787  40.458   1.00 28.72  ? 138 TRP B CD2 1 
ATOM   2898  N  NE1 . TRP B  1 112 ? 32.738  36.241  41.997   1.00 25.40  ? 138 TRP B NE1 1 
ATOM   2899  C  CE2 . TRP B  1 112 ? 32.586  34.905  41.738   1.00 28.95  ? 138 TRP B CE2 1 
ATOM   2900  C  CE3 . TRP B  1 112 ? 31.747  33.510  39.951   1.00 32.15  ? 138 TRP B CE3 1 
ATOM   2901  C  CZ2 . TRP B  1 112 ? 32.904  33.795  42.520   1.00 31.26  ? 138 TRP B CZ2 1 
ATOM   2902  C  CZ3 . TRP B  1 112 ? 32.064  32.410  40.728   1.00 33.24  ? 138 TRP B CZ3 1 
ATOM   2903  C  CH2 . TRP B  1 112 ? 32.635  32.559  42.000   1.00 32.10  ? 138 TRP B CH2 1 
ATOM   2904  N  N   . PRO B  1 113 ? 28.330  35.802  40.493   1.00 30.07  ? 139 PRO B N   1 
ATOM   2905  C  CA  . PRO B  1 113 ? 27.434  36.299  41.544   1.00 30.92  ? 139 PRO B CA  1 
ATOM   2906  C  C   . PRO B  1 113 ? 28.136  36.776  42.805   1.00 34.51  ? 139 PRO B C   1 
ATOM   2907  O  O   . PRO B  1 113 ? 27.447  37.126  43.769   1.00 38.74  ? 139 PRO B O   1 
ATOM   2908  C  CB  . PRO B  1 113 ? 26.548  35.076  41.850   1.00 33.71  ? 139 PRO B CB  1 
ATOM   2909  C  CG  . PRO B  1 113 ? 26.906  34.023  40.806   1.00 34.29  ? 139 PRO B CG  1 
ATOM   2910  C  CD  . PRO B  1 113 ? 28.305  34.335  40.404   1.00 32.75  ? 139 PRO B CD  1 
ATOM   2911  N  N   . ARG B  1 114 ? 29.471  36.781  42.835   1.00 32.58  ? 140 ARG B N   1 
ATOM   2912  C  CA  . ARG B  1 114 ? 30.258  37.259  43.971   1.00 32.16  ? 140 ARG B CA  1 
ATOM   2913  C  C   . ARG B  1 114 ? 30.082  36.399  45.221   1.00 34.78  ? 140 ARG B C   1 
ATOM   2914  O  O   . ARG B  1 114 ? 31.068  36.050  45.877   1.00 34.77  ? 140 ARG B O   1 
ATOM   2915  C  CB  . ARG B  1 114 ? 29.923  38.718  44.291   1.00 35.69  ? 140 ARG B CB  1 
ATOM   2916  C  CG  . ARG B  1 114 ? 30.132  39.676  43.129   1.00 42.03  ? 140 ARG B CG  1 
ATOM   2917  C  CD  . ARG B  1 114 ? 30.248  41.107  43.626   1.00 49.11  ? 140 ARG B CD  1 
ATOM   2918  N  NE  . ARG B  1 114 ? 29.055  41.545  44.346   1.00 58.63  ? 140 ARG B NE  1 
ATOM   2919  C  CZ  . ARG B  1 114 ? 29.047  42.512  45.259   1.00 61.85  ? 140 ARG B CZ  1 
ATOM   2920  N  NH1 . ARG B  1 114 ? 30.175  43.135  45.577   1.00 63.02  ? 140 ARG B NH1 1 
ATOM   2921  N  NH2 . ARG B  1 114 ? 27.912  42.849  45.863   1.00 61.53  ? 140 ARG B NH2 1 
ATOM   2922  N  N   . SER B  1 115 ? 28.844  36.067  45.576   1.00 35.53  ? 141 SER B N   1 
ATOM   2923  C  CA  . SER B  1 115 ? 28.579  35.161  46.684   1.00 32.46  ? 141 SER B CA  1 
ATOM   2924  C  C   . SER B  1 115 ? 28.556  33.726  46.178   1.00 30.62  ? 141 SER B C   1 
ATOM   2925  O  O   . SER B  1 115 ? 28.072  33.451  45.076   1.00 32.14  ? 141 SER B O   1 
ATOM   2926  C  CB  . SER B  1 115 ? 27.248  35.502  47.360   1.00 35.71  ? 141 SER B CB  1 
ATOM   2927  O  OG  . SER B  1 115 ? 26.146  35.246  46.505   1.00 35.49  ? 141 SER B OG  1 
ATOM   2928  N  N   . PHE B  1 116 ? 29.073  32.809  46.990   1.00 32.20  ? 142 PHE B N   1 
ATOM   2929  C  CA  . PHE B  1 116 ? 29.241  31.432  46.545   1.00 34.87  ? 142 PHE B CA  1 
ATOM   2930  C  C   . PHE B  1 116 ? 29.411  30.519  47.754   1.00 31.68  ? 142 PHE B C   1 
ATOM   2931  O  O   . PHE B  1 116 ? 29.554  30.972  48.892   1.00 28.16  ? 142 PHE B O   1 
ATOM   2932  C  CB  . PHE B  1 116 ? 30.439  31.316  45.598   1.00 27.67  ? 142 PHE B CB  1 
ATOM   2933  C  CG  . PHE B  1 116 ? 31.755  31.550  46.268   1.00 24.29  ? 142 PHE B CG  1 
ATOM   2934  C  CD1 . PHE B  1 116 ? 32.169  32.832  46.574   1.00 27.50  ? 142 PHE B CD1 1 
ATOM   2935  C  CD2 . PHE B  1 116 ? 32.579  30.490  46.594   1.00 31.99  ? 142 PHE B CD2 1 
ATOM   2936  C  CE1 . PHE B  1 116 ? 33.378  33.055  47.199   1.00 29.21  ? 142 PHE B CE1 1 
ATOM   2937  C  CE2 . PHE B  1 116 ? 33.797  30.705  47.216   1.00 32.67  ? 142 PHE B CE2 1 
ATOM   2938  C  CZ  . PHE B  1 116 ? 34.196  31.991  47.517   1.00 31.58  ? 142 PHE B CZ  1 
ATOM   2939  N  N   . THR B  1 117 ? 29.402  29.216  47.482   1.00 33.14  ? 143 THR B N   1 
ATOM   2940  C  CA  . THR B  1 117 ? 29.733  28.194  48.468   1.00 31.26  ? 143 THR B CA  1 
ATOM   2941  C  C   . THR B  1 117 ? 30.738  27.238  47.845   1.00 29.45  ? 143 THR B C   1 
ATOM   2942  O  O   . THR B  1 117 ? 30.481  26.676  46.775   1.00 32.15  ? 143 THR B O   1 
ATOM   2943  C  CB  . THR B  1 117 ? 28.488  27.437  48.936   1.00 30.75  ? 143 THR B CB  1 
ATOM   2944  O  OG1 . THR B  1 117 ? 27.597  28.346  49.592   1.00 38.13  ? 143 THR B OG1 1 
ATOM   2945  C  CG2 . THR B  1 117 ? 28.868  26.327  49.904   1.00 31.46  ? 143 THR B CG2 1 
ATOM   2946  N  N   . LEU B  1 118 ? 31.880  27.067  48.504   1.00 24.74  ? 144 LEU B N   1 
ATOM   2947  C  CA  . LEU B  1 118 ? 32.955  26.207  48.032   1.00 24.93  ? 144 LEU B CA  1 
ATOM   2948  C  C   . LEU B  1 118 ? 33.006  24.936  48.869   1.00 31.81  ? 144 LEU B C   1 
ATOM   2949  O  O   . LEU B  1 118 ? 33.016  24.998  50.105   1.00 27.12  ? 144 LEU B O   1 
ATOM   2950  C  CB  . LEU B  1 118 ? 34.303  26.927  48.104   1.00 30.55  ? 144 LEU B CB  1 
ATOM   2951  C  CG  . LEU B  1 118 ? 35.534  26.040  47.900   1.00 25.75  ? 144 LEU B CG  1 
ATOM   2952  C  CD1 . LEU B  1 118 ? 35.558  25.481  46.488   1.00 30.49  ? 144 LEU B CD1 1 
ATOM   2953  C  CD2 . LEU B  1 118 ? 36.820  26.795  48.211   1.00 24.28  ? 144 LEU B CD2 1 
ATOM   2954  N  N   . ILE B  1 119 ? 33.053  23.792  48.192   1.00 32.26  ? 145 ILE B N   1 
ATOM   2955  C  CA  . ILE B  1 119 ? 33.180  22.486  48.829   1.00 29.75  ? 145 ILE B CA  1 
ATOM   2956  C  C   . ILE B  1 119 ? 34.452  21.848  48.299   1.00 32.56  ? 145 ILE B C   1 
ATOM   2957  O  O   . ILE B  1 119 ? 34.622  21.709  47.081   1.00 36.28  ? 145 ILE B O   1 
ATOM   2958  C  CB  . ILE B  1 119 ? 31.972  21.581  48.542   1.00 34.83  ? 145 ILE B CB  1 
ATOM   2959  C  CG1 . ILE B  1 119 ? 30.657  22.279  48.912   1.00 34.32  ? 145 ILE B CG1 1 
ATOM   2960  C  CG2 . ILE B  1 119 ? 32.128  20.241  49.268   1.00 31.14  ? 145 ILE B CG2 1 
ATOM   2961  C  CD1 . ILE B  1 119 ? 30.238  22.099  50.355   1.00 31.66  ? 145 ILE B CD1 1 
ATOM   2962  N  N   . VAL B  1 120 ? 35.346  21.468  49.207   1.00 27.52  ? 146 VAL B N   1 
ATOM   2963  C  CA  . VAL B  1 120 ? 36.597  20.809  48.858   1.00 28.22  ? 146 VAL B CA  1 
ATOM   2964  C  C   . VAL B  1 120 ? 36.611  19.445  49.531   1.00 34.51  ? 146 VAL B C   1 
ATOM   2965  O  O   . VAL B  1 120 ? 36.306  19.334  50.725   1.00 32.13  ? 146 VAL B O   1 
ATOM   2966  C  CB  . VAL B  1 120 ? 37.817  21.651  49.276   1.00 31.24  ? 146 VAL B CB  1 
ATOM   2967  C  CG1 . VAL B  1 120 ? 39.111  20.988  48.816   1.00 29.05  ? 146 VAL B CG1 1 
ATOM   2968  C  CG2 . VAL B  1 120 ? 37.701  23.057  48.704   1.00 24.30  ? 146 VAL B CG2 1 
ATOM   2969  N  N   . GLU B  1 121 ? 36.974  18.414  48.769   1.00 33.59  ? 147 GLU B N   1 
ATOM   2970  C  CA  . GLU B  1 121 ? 36.989  17.045  49.264   1.00 34.41  ? 147 GLU B CA  1 
ATOM   2971  C  C   . GLU B  1 121 ? 38.340  16.399  49.000   1.00 36.38  ? 147 GLU B C   1 
ATOM   2972  O  O   . GLU B  1 121 ? 38.972  16.659  47.972   1.00 36.80  ? 147 GLU B O   1 
ATOM   2973  C  CB  . GLU B  1 121 ? 35.889  16.202  48.615   1.00 28.88  ? 147 GLU B CB  1 
ATOM   2974  C  CG  . GLU B  1 121 ? 34.478  16.604  48.982   1.00 31.88  ? 147 GLU B CG  1 
ATOM   2975  C  CD  . GLU B  1 121 ? 33.444  15.759  48.265   1.00 47.77  ? 147 GLU B CD  1 
ATOM   2976  O  OE1 . GLU B  1 121 ? 33.800  15.142  47.236   1.00 44.40  ? 147 GLU B OE1 1 
ATOM   2977  O  OE2 . GLU B  1 121 ? 32.284  15.700  48.731   1.00 52.27  ? 147 GLU B OE2 1 
ATOM   2978  N  N   . ALA B  1 122 ? 38.778  15.562  49.938   1.00 35.25  ? 148 ALA B N   1 
ATOM   2979  C  CA  . ALA B  1 122 ? 39.975  14.749  49.778   1.00 37.81  ? 148 ALA B CA  1 
ATOM   2980  C  C   . ALA B  1 122 ? 39.554  13.289  49.674   1.00 40.28  ? 148 ALA B C   1 
ATOM   2981  O  O   . ALA B  1 122 ? 38.779  12.804  50.504   1.00 40.21  ? 148 ALA B O   1 
ATOM   2982  C  CB  . ALA B  1 122 ? 40.947  14.951  50.943   1.00 25.31  ? 148 ALA B CB  1 
ATOM   2983  N  N   . TRP B  1 123 ? 40.048  12.602  48.645   1.00 37.88  ? 149 TRP B N   1 
ATOM   2984  C  CA  . TRP B  1 123 ? 39.628  11.245  48.327   1.00 36.46  ? 149 TRP B CA  1 
ATOM   2985  C  C   . TRP B  1 123 ? 40.837  10.334  48.173   1.00 42.27  ? 149 TRP B C   1 
ATOM   2986  O  O   . TRP B  1 123 ? 41.917  10.771  47.764   1.00 38.28  ? 149 TRP B O   1 
ATOM   2987  C  CB  . TRP B  1 123 ? 38.814  11.204  47.036   1.00 40.15  ? 149 TRP B CB  1 
ATOM   2988  C  CG  . TRP B  1 123 ? 37.467  11.834  47.117   1.00 44.31  ? 149 TRP B CG  1 
ATOM   2989  C  CD1 . TRP B  1 123 ? 37.170  13.159  46.994   1.00 40.50  ? 149 TRP B CD1 1 
ATOM   2990  C  CD2 . TRP B  1 123 ? 36.220  11.156  47.293   1.00 49.46  ? 149 TRP B CD2 1 
ATOM   2991  N  NE1 . TRP B  1 123 ? 35.814  13.350  47.102   1.00 40.13  ? 149 TRP B NE1 1 
ATOM   2992  C  CE2 . TRP B  1 123 ? 35.208  12.135  47.286   1.00 46.32  ? 149 TRP B CE2 1 
ATOM   2993  C  CE3 . TRP B  1 123 ? 35.861  9.815   47.468   1.00 46.42  ? 149 TRP B CE3 1 
ATOM   2994  C  CZ2 . TRP B  1 123 ? 33.863  11.818  47.449   1.00 52.54  ? 149 TRP B CZ2 1 
ATOM   2995  C  CZ3 . TRP B  1 123 ? 34.527  9.502   47.627   1.00 47.56  ? 149 TRP B CZ3 1 
ATOM   2996  C  CH2 . TRP B  1 123 ? 33.543  10.498  47.618   1.00 53.76  ? 149 TRP B CH2 1 
ATOM   2997  N  N   . ASP B  1 124 ? 40.642  9.055   48.502   1.00 44.59  ? 150 ASP B N   1 
ATOM   2998  C  CA  . ASP B  1 124 ? 41.636  8.021   48.247   1.00 38.34  ? 150 ASP B CA  1 
ATOM   2999  C  C   . ASP B  1 124 ? 41.376  7.382   46.888   1.00 41.06  ? 150 ASP B C   1 
ATOM   3000  O  O   . ASP B  1 124 ? 40.227  7.121   46.520   1.00 48.73  ? 150 ASP B O   1 
ATOM   3001  C  CB  . ASP B  1 124 ? 41.608  6.956   49.345   1.00 39.20  ? 150 ASP B CB  1 
ATOM   3002  C  CG  . ASP B  1 124 ? 42.580  5.816   49.082   1.00 43.26  ? 150 ASP B CG  1 
ATOM   3003  O  OD1 . ASP B  1 124 ? 43.671  6.070   48.525   1.00 39.81  ? 150 ASP B OD1 1 
ATOM   3004  O  OD2 . ASP B  1 124 ? 42.249  4.660   49.422   1.00 41.35  ? 150 ASP B OD2 1 
ATOM   3005  N  N   . TRP B  1 125 ? 42.449  7.121   46.147   1.00 40.08  ? 151 TRP B N   1 
ATOM   3006  C  CA  . TRP B  1 125 ? 42.361  6.613   44.785   1.00 38.99  ? 151 TRP B CA  1 
ATOM   3007  C  C   . TRP B  1 125 ? 42.779  5.149   44.754   1.00 43.79  ? 151 TRP B C   1 
ATOM   3008  O  O   . TRP B  1 125 ? 43.854  4.797   45.252   1.00 49.46  ? 151 TRP B O   1 
ATOM   3009  C  CB  . TRP B  1 125 ? 43.245  7.442   43.851   1.00 38.00  ? 151 TRP B CB  1 
ATOM   3010  C  CG  . TRP B  1 125 ? 43.189  7.047   42.403   1.00 43.85  ? 151 TRP B CG  1 
ATOM   3011  C  CD1 . TRP B  1 125 ? 44.189  6.479   41.668   1.00 45.96  ? 151 TRP B CD1 1 
ATOM   3012  C  CD2 . TRP B  1 125 ? 42.081  7.217   41.508   1.00 46.16  ? 151 TRP B CD2 1 
ATOM   3013  N  NE1 . TRP B  1 125 ? 43.771  6.277   40.375   1.00 43.41  ? 151 TRP B NE1 1 
ATOM   3014  C  CE2 . TRP B  1 125 ? 42.481  6.722   40.250   1.00 46.11  ? 151 TRP B CE2 1 
ATOM   3015  C  CE3 . TRP B  1 125 ? 40.789  7.736   41.649   1.00 44.85  ? 151 TRP B CE3 1 
ATOM   3016  C  CZ2 . TRP B  1 125 ? 41.635  6.731   39.141   1.00 49.19  ? 151 TRP B CZ2 1 
ATOM   3017  C  CZ3 . TRP B  1 125 ? 39.951  7.744   40.548   1.00 45.76  ? 151 TRP B CZ3 1 
ATOM   3018  C  CH2 . TRP B  1 125 ? 40.377  7.244   39.310   1.00 46.61  ? 151 TRP B CH2 1 
ATOM   3019  N  N   . ASP B  1 126 ? 41.939  4.302   44.153   1.00 43.07  ? 152 ASP B N   1 
ATOM   3020  C  CA  . ASP B  1 126 ? 42.257  2.888   43.982   1.00 44.80  ? 152 ASP B CA  1 
ATOM   3021  C  C   . ASP B  1 126 ? 42.163  2.484   42.519   1.00 49.91  ? 152 ASP B C   1 
ATOM   3022  O  O   . ASP B  1 126 ? 41.783  1.351   42.207   1.00 58.91  ? 152 ASP B O   1 
ATOM   3023  C  CB  . ASP B  1 126 ? 41.347  1.999   44.832   1.00 44.34  ? 152 ASP B CB  1 
ATOM   3024  C  CG  . ASP B  1 126 ? 41.392  2.345   46.307   1.00 41.88  ? 152 ASP B CG  1 
ATOM   3025  O  OD1 . ASP B  1 126 ? 42.475  2.718   46.799   1.00 39.78  ? 152 ASP B OD1 1 
ATOM   3026  O  OD2 . ASP B  1 126 ? 40.348  2.225   46.981   1.00 36.34  ? 152 ASP B OD2 1 
ATOM   3027  N  N   . ASN B  1 127 ? 42.523  3.400   41.618   1.00 47.06  ? 153 ASN B N   1 
ATOM   3028  C  CA  . ASN B  1 127 ? 42.575  3.122   40.186   1.00 50.71  ? 153 ASN B CA  1 
ATOM   3029  C  C   . ASN B  1 127 ? 41.267  2.504   39.710   1.00 59.26  ? 153 ASN B C   1 
ATOM   3030  O  O   . ASN B  1 127 ? 41.246  1.574   38.901   1.00 60.82  ? 153 ASN B O   1 
ATOM   3031  C  CB  . ASN B  1 127 ? 43.769  2.231   39.849   1.00 51.99  ? 153 ASN B CB  1 
ATOM   3032  C  CG  . ASN B  1 127 ? 45.086  2.927   40.092   1.00 51.02  ? 153 ASN B CG  1 
ATOM   3033  O  OD1 . ASN B  1 127 ? 45.646  2.851   41.186   1.00 52.02  ? 153 ASN B OD1 1 
ATOM   3034  N  ND2 . ASN B  1 127 ? 45.592  3.612   39.074   1.00 49.98  ? 153 ASN B ND2 1 
ATOM   3035  N  N   . ASP B  1 128 ? 40.156  3.029   40.222   1.00 65.64  ? 154 ASP B N   1 
ATOM   3036  C  CA  . ASP B  1 128 ? 38.857  2.525   39.806   1.00 76.50  ? 154 ASP B CA  1 
ATOM   3037  C  C   . ASP B  1 128 ? 37.816  3.624   39.916   1.00 79.93  ? 154 ASP B C   1 
ATOM   3038  O  O   . ASP B  1 128 ? 37.664  4.268   40.957   1.00 78.48  ? 154 ASP B O   1 
ATOM   3039  C  CB  . ASP B  1 128 ? 38.427  1.295   40.615   1.00 75.03  ? 154 ASP B CB  1 
ATOM   3040  C  CG  . ASP B  1 128 ? 37.192  0.603   40.029   1.00 85.98  ? 154 ASP B CG  1 
ATOM   3041  O  OD1 . ASP B  1 128 ? 36.541  1.166   39.114   1.00 87.48  ? 154 ASP B OD1 1 
ATOM   3042  O  OD2 . ASP B  1 128 ? 36.890  -0.529  40.460   1.00 78.49  ? 154 ASP B OD2 1 
ATOM   3043  N  N   . THR B  1 129 ? 37.101  3.796   38.810   1.00 81.74  ? 155 THR B N   1 
ATOM   3044  C  CA  . THR B  1 129 ? 36.044  4.785   38.592   1.00 88.40  ? 155 THR B CA  1 
ATOM   3045  C  C   . THR B  1 129 ? 34.796  4.682   39.465   1.00 88.89  ? 155 THR B C   1 
ATOM   3046  O  O   . THR B  1 129 ? 34.140  5.712   39.675   1.00 80.45  ? 155 THR B O   1 
ATOM   3047  C  CB  . THR B  1 129 ? 35.695  4.765   37.092   1.00 93.30  ? 155 THR B CB  1 
ATOM   3048  O  OG1 . THR B  1 129 ? 34.676  3.797   36.744   1.00 93.51  ? 155 THR B OG1 1 
ATOM   3049  C  CG2 . THR B  1 129 ? 36.933  5.050   36.101   1.00 90.64  ? 155 THR B CG2 1 
ATOM   3050  N  N   . THR B  1 130 ? 34.449  3.511   39.989   1.00 87.55  ? 156 THR B N   1 
ATOM   3051  C  CA  . THR B  1 130 ? 33.175  3.369   40.692   1.00 87.47  ? 156 THR B CA  1 
ATOM   3052  C  C   . THR B  1 130 ? 33.016  4.393   41.827   1.00 86.97  ? 156 THR B C   1 
ATOM   3053  O  O   . THR B  1 130 ? 33.930  4.543   42.639   1.00 89.44  ? 156 THR B O   1 
ATOM   3054  C  CB  . THR B  1 130 ? 33.014  1.947   41.229   1.00 88.43  ? 156 THR B CB  1 
ATOM   3055  O  OG1 . THR B  1 130 ? 31.902  1.896   42.122   1.00 90.42  ? 156 THR B OG1 1 
ATOM   3056  C  CG2 . THR B  1 130 ? 34.270  1.499   41.938   1.00 84.71  ? 156 THR B CG2 1 
ATOM   3057  N  N   . PRO B  1 131 ? 31.924  5.158   41.854   1.00 88.97  ? 157 PRO B N   1 
ATOM   3058  C  CA  . PRO B  1 131 ? 31.620  5.962   43.044   1.00 80.69  ? 157 PRO B CA  1 
ATOM   3059  C  C   . PRO B  1 131 ? 31.735  5.113   44.301   1.00 83.41  ? 157 PRO B C   1 
ATOM   3060  O  O   . PRO B  1 131 ? 31.133  4.038   44.407   1.00 86.09  ? 157 PRO B O   1 
ATOM   3061  C  CB  . PRO B  1 131 ? 30.180  6.418   42.807   1.00 84.96  ? 157 PRO B CB  1 
ATOM   3062  C  CG  . PRO B  1 131 ? 29.997  6.411   41.303   1.00 83.95  ? 157 PRO B CG  1 
ATOM   3063  C  CD  . PRO B  1 131 ? 31.149  5.607   40.683   1.00 90.74  ? 157 PRO B CD  1 
ATOM   3064  N  N   . ASN B  1 132 ? 32.548  5.589   45.249   1.00 78.94  ? 158 ASN B N   1 
ATOM   3065  C  CA  . ASN B  1 132 ? 32.696  4.859   46.505   1.00 65.90  ? 158 ASN B CA  1 
ATOM   3066  C  C   . ASN B  1 132 ? 32.924  5.904   47.597   1.00 59.17  ? 158 ASN B C   1 
ATOM   3067  O  O   . ASN B  1 132 ? 34.065  6.225   47.933   1.00 61.69  ? 158 ASN B O   1 
ATOM   3068  C  CB  . ASN B  1 132 ? 33.827  3.842   46.444   1.00 54.78  ? 158 ASN B CB  1 
ATOM   3069  C  CG  . ASN B  1 132 ? 33.820  2.903   47.632   1.00 64.73  ? 158 ASN B CG  1 
ATOM   3070  O  OD1 . ASN B  1 132 ? 33.146  3.155   48.625   1.00 65.91  ? 158 ASN B OD1 1 
ATOM   3071  N  ND2 . ASN B  1 132 ? 34.560  1.800   47.527   1.00 59.54  ? 158 ASN B ND2 1 
ATOM   3072  N  N   . GLU B  1 133 ? 31.827  6.421   48.150   1.00 55.28  ? 159 GLU B N   1 
ATOM   3073  C  CA  . GLU B  1 133 ? 31.937  7.426   49.200   1.00 58.17  ? 159 GLU B CA  1 
ATOM   3074  C  C   . GLU B  1 133 ? 32.546  6.869   50.479   1.00 56.89  ? 159 GLU B C   1 
ATOM   3075  O  O   . GLU B  1 133 ? 32.691  7.616   51.453   1.00 53.59  ? 159 GLU B O   1 
ATOM   3076  C  CB  . GLU B  1 133 ? 30.567  8.050   49.483   1.00 62.66  ? 159 GLU B CB  1 
ATOM   3077  C  CG  . GLU B  1 133 ? 30.637  9.422   50.114   1.00 67.78  ? 159 GLU B CG  1 
ATOM   3078  C  CD  . GLU B  1 133 ? 29.773  10.426  49.442   1.00 78.72  ? 159 GLU B CD  1 
ATOM   3079  O  OE1 . GLU B  1 133 ? 29.002  10.067  48.627   1.00 85.56  ? 159 GLU B OE1 1 
ATOM   3080  O  OE2 . GLU B  1 133 ? 29.874  11.583  49.707   1.00 82.31  ? 159 GLU B OE2 1 
ATOM   3081  N  N   . GLU B  1 134 ? 32.918  5.588   50.499   1.00 60.53  ? 160 GLU B N   1 
ATOM   3082  C  CA  . GLU B  1 134 ? 33.759  5.069   51.567   1.00 62.71  ? 160 GLU B CA  1 
ATOM   3083  C  C   . GLU B  1 134 ? 35.234  5.393   51.367   1.00 60.32  ? 160 GLU B C   1 
ATOM   3084  O  O   . GLU B  1 134 ? 36.032  5.124   52.271   1.00 55.30  ? 160 GLU B O   1 
ATOM   3085  C  CB  . GLU B  1 134 ? 33.592  3.552   51.687   1.00 69.50  ? 160 GLU B CB  1 
ATOM   3086  C  CG  . GLU B  1 134 ? 32.172  3.082   51.940   1.00 73.68  ? 160 GLU B CG  1 
ATOM   3087  C  CD  . GLU B  1 134 ? 32.128  1.837   52.803   1.00 81.22  ? 160 GLU B CD  1 
ATOM   3088  O  OE1 . GLU B  1 134 ? 31.655  0.791   52.309   1.00 85.85  ? 160 GLU B OE1 1 
ATOM   3089  O  OE2 . GLU B  1 134 ? 32.586  1.897   53.965   1.00 80.82  ? 160 GLU B OE2 1 
ATOM   3090  N  N   . LEU B  1 135 ? 35.614  5.964   50.220   1.00 53.61  ? 161 LEU B N   1 
ATOM   3091  C  CA  . LEU B  1 135 ? 36.981  6.409   49.982   1.00 49.71  ? 161 LEU B CA  1 
ATOM   3092  C  C   . LEU B  1 135 ? 37.154  7.897   50.254   1.00 47.51  ? 161 LEU B C   1 
ATOM   3093  O  O   . LEU B  1 135 ? 38.130  8.500   49.795   1.00 41.03  ? 161 LEU B O   1 
ATOM   3094  C  CB  . LEU B  1 135 ? 37.417  6.079   48.555   1.00 41.77  ? 161 LEU B CB  1 
ATOM   3095  C  CG  . LEU B  1 135 ? 37.233  4.632   48.106   1.00 42.32  ? 161 LEU B CG  1 
ATOM   3096  C  CD1 . LEU B  1 135 ? 37.434  4.505   46.610   1.00 43.29  ? 161 LEU B CD1 1 
ATOM   3097  C  CD2 . LEU B  1 135 ? 38.190  3.727   48.851   1.00 50.89  ? 161 LEU B CD2 1 
ATOM   3098  N  N   . LEU B  1 136 ? 36.224  8.492   50.992   1.00 51.17  ? 162 LEU B N   1 
ATOM   3099  C  CA  . LEU B  1 136 ? 36.270  9.911   51.308   1.00 45.38  ? 162 LEU B CA  1 
ATOM   3100  C  C   . LEU B  1 136 ? 37.180  10.136  52.512   1.00 49.38  ? 162 LEU B C   1 
ATOM   3101  O  O   . LEU B  1 136 ? 36.946  9.575   53.591   1.00 46.86  ? 162 LEU B O   1 
ATOM   3102  C  CB  . LEU B  1 136 ? 34.857  10.420  51.577   1.00 41.96  ? 162 LEU B CB  1 
ATOM   3103  C  CG  . LEU B  1 136 ? 34.669  11.903  51.894   1.00 46.11  ? 162 LEU B CG  1 
ATOM   3104  C  CD1 . LEU B  1 136 ? 35.136  12.769  50.735   1.00 39.44  ? 162 LEU B CD1 1 
ATOM   3105  C  CD2 . LEU B  1 136 ? 33.212  12.171  52.228   1.00 49.59  ? 162 LEU B CD2 1 
ATOM   3106  N  N   . ILE B  1 137 ? 38.223  10.945  52.322   1.00 46.88  ? 163 ILE B N   1 
ATOM   3107  C  CA  . ILE B  1 137 ? 39.133  11.269  53.415   1.00 40.73  ? 163 ILE B CA  1 
ATOM   3108  C  C   . ILE B  1 137 ? 38.597  12.435  54.236   1.00 41.48  ? 163 ILE B C   1 
ATOM   3109  O  O   . ILE B  1 137 ? 38.488  12.353  55.464   1.00 48.42  ? 163 ILE B O   1 
ATOM   3110  C  CB  . ILE B  1 137 ? 40.543  11.563  52.870   1.00 33.21  ? 163 ILE B CB  1 
ATOM   3111  C  CG1 . ILE B  1 137 ? 41.111  10.343  52.149   1.00 33.52  ? 163 ILE B CG1 1 
ATOM   3112  C  CG2 . ILE B  1 137 ? 41.466  11.981  53.991   1.00 37.22  ? 163 ILE B CG2 1 
ATOM   3113  C  CD1 . ILE B  1 137 ? 42.487  10.578  51.555   1.00 33.82  ? 163 ILE B CD1 1 
ATOM   3114  N  N   . GLU B  1 138 ? 38.252  13.536  53.573   1.00 41.57  ? 164 GLU B N   1 
ATOM   3115  C  CA  . GLU B  1 138 ? 37.829  14.737  54.277   1.00 39.49  ? 164 GLU B CA  1 
ATOM   3116  C  C   . GLU B  1 138 ? 36.960  15.576  53.352   1.00 37.76  ? 164 GLU B C   1 
ATOM   3117  O  O   . GLU B  1 138 ? 37.138  15.564  52.131   1.00 35.09  ? 164 GLU B O   1 
ATOM   3118  C  CB  . GLU B  1 138 ? 39.037  15.552  54.753   1.00 36.64  ? 164 GLU B CB  1 
ATOM   3119  C  CG  . GLU B  1 138 ? 38.708  16.780  55.591   1.00 38.37  ? 164 GLU B CG  1 
ATOM   3120  C  CD  . GLU B  1 138 ? 38.115  16.429  56.941   1.00 45.56  ? 164 GLU B CD  1 
ATOM   3121  O  OE1 . GLU B  1 138 ? 36.896  16.157  57.008   1.00 51.77  ? 164 GLU B OE1 1 
ATOM   3122  O  OE2 . GLU B  1 138 ? 38.877  16.409  57.934   1.00 38.93  ? 164 GLU B OE2 1 
ATOM   3123  N  N   . ARG B  1 139 ? 36.001  16.280  53.949   1.00 33.88  ? 165 ARG B N   1 
ATOM   3124  C  CA  . ARG B  1 139 ? 35.183  17.259  53.247   1.00 34.94  ? 165 ARG B CA  1 
ATOM   3125  C  C   . ARG B  1 139 ? 35.145  18.541  54.063   1.00 36.05  ? 165 ARG B C   1 
ATOM   3126  O  O   . ARG B  1 139 ? 34.815  18.511  55.252   1.00 38.04  ? 165 ARG B O   1 
ATOM   3127  C  CB  . ARG B  1 139 ? 33.760  16.743  53.004   1.00 39.18  ? 165 ARG B CB  1 
ATOM   3128  C  CG  . ARG B  1 139 ? 32.849  17.781  52.364   1.00 38.21  ? 165 ARG B CG  1 
ATOM   3129  C  CD  . ARG B  1 139 ? 31.418  17.288  52.191   1.00 41.65  ? 165 ARG B CD  1 
ATOM   3130  N  NE  . ARG B  1 139 ? 31.315  16.235  51.187   1.00 39.92  ? 165 ARG B NE  1 
ATOM   3131  C  CZ  . ARG B  1 139 ? 30.968  14.982  51.453   1.00 45.05  ? 165 ARG B CZ  1 
ATOM   3132  N  NH1 . ARG B  1 139 ? 30.681  14.623  52.697   1.00 51.27  ? 165 ARG B NH1 1 
ATOM   3133  N  NH2 . ARG B  1 139 ? 30.904  14.089  50.473   1.00 47.93  ? 165 ARG B NH2 1 
ATOM   3134  N  N   . VAL B  1 140 ? 35.479  19.665  53.424   1.00 37.32  ? 166 VAL B N   1 
ATOM   3135  C  CA  . VAL B  1 140 ? 35.450  20.973  54.063   1.00 35.65  ? 166 VAL B CA  1 
ATOM   3136  C  C   . VAL B  1 140 ? 34.647  21.926  53.191   1.00 29.87  ? 166 VAL B C   1 
ATOM   3137  O  O   . VAL B  1 140 ? 34.494  21.726  51.984   1.00 29.63  ? 166 VAL B O   1 
ATOM   3138  C  CB  . VAL B  1 140 ? 36.866  21.536  54.320   1.00 34.11  ? 166 VAL B CB  1 
ATOM   3139  C  CG1 . VAL B  1 140 ? 37.597  20.661  55.319   1.00 30.09  ? 166 VAL B CG1 1 
ATOM   3140  C  CG2 . VAL B  1 140 ? 37.646  21.648  53.017   1.00 33.53  ? 166 VAL B CG2 1 
ATOM   3141  N  N   . SER B  1 141 ? 34.111  22.967  53.824   1.00 30.24  ? 167 SER B N   1 
ATOM   3142  C  CA  . SER B  1 141 ? 33.253  23.916  53.132   1.00 37.40  ? 167 SER B CA  1 
ATOM   3143  C  C   . SER B  1 141 ? 33.500  25.326  53.652   1.00 31.07  ? 167 SER B C   1 
ATOM   3144  O  O   . SER B  1 141 ? 33.868  25.523  54.814   1.00 28.40  ? 167 SER B O   1 
ATOM   3145  C  CB  . SER B  1 141 ? 31.773  23.539  53.291   1.00 31.51  ? 167 SER B CB  1 
ATOM   3146  O  OG  . SER B  1 141 ? 31.394  23.537  54.656   1.00 41.94  ? 167 SER B OG  1 
ATOM   3147  N  N   . HIS B  1 142 ? 33.280  26.307  52.778   1.00 27.84  ? 168 HIS B N   1 
ATOM   3148  C  CA  . HIS B  1 142 ? 33.479  27.712  53.128   1.00 35.09  ? 168 HIS B CA  1 
ATOM   3149  C  C   . HIS B  1 142 ? 32.506  28.555  52.317   1.00 32.64  ? 168 HIS B C   1 
ATOM   3150  O  O   . HIS B  1 142 ? 32.500  28.481  51.085   1.00 34.18  ? 168 HIS B O   1 
ATOM   3151  C  CB  . HIS B  1 142 ? 34.923  28.144  52.863   1.00 30.13  ? 168 HIS B CB  1 
ATOM   3152  C  CG  . HIS B  1 142 ? 35.139  29.619  52.967   1.00 32.01  ? 168 HIS B CG  1 
ATOM   3153  N  ND1 . HIS B  1 142 ? 35.281  30.266  54.175   1.00 32.76  ? 168 HIS B ND1 1 
ATOM   3154  C  CD2 . HIS B  1 142 ? 35.225  30.578  52.014   1.00 34.51  ? 168 HIS B CD2 1 
ATOM   3155  C  CE1 . HIS B  1 142 ? 35.452  31.559  53.962   1.00 35.73  ? 168 HIS B CE1 1 
ATOM   3156  N  NE2 . HIS B  1 142 ? 35.422  31.775  52.660   1.00 31.69  ? 168 HIS B NE2 1 
ATOM   3157  N  N   . ALA B  1 143 ? 31.691  29.354  53.001   1.00 25.54  ? 169 ALA B N   1 
ATOM   3158  C  CA  . ALA B  1 143 ? 30.722  30.234  52.364   1.00 27.68  ? 169 ALA B CA  1 
ATOM   3159  C  C   . ALA B  1 143 ? 31.145  31.684  52.547   1.00 31.23  ? 169 ALA B C   1 
ATOM   3160  O  O   . ALA B  1 143 ? 31.356  32.138  53.676   1.00 29.89  ? 169 ALA B O   1 
ATOM   3161  C  CB  . ALA B  1 143 ? 29.322  30.014  52.938   1.00 33.87  ? 169 ALA B CB  1 
ATOM   3162  N  N   . GLY B  1 144 ? 31.269  32.404  51.443   1.00 27.75  ? 170 GLY B N   1 
ATOM   3163  C  CA  . GLY B  1 144 ? 31.737  33.767  51.524   1.00 38.20  ? 170 GLY B CA  1 
ATOM   3164  C  C   . GLY B  1 144 ? 31.483  34.545  50.255   1.00 34.82  ? 170 GLY B C   1 
ATOM   3165  O  O   . GLY B  1 144 ? 30.599  34.211  49.464   1.00 33.60  ? 170 GLY B O   1 
ATOM   3166  N  N   . MET B  1 145 ? 32.296  35.585  50.077   1.00 35.08  ? 171 MET B N   1 
ATOM   3167  C  CA  . MET B  1 145 ? 32.140  36.580  49.027   1.00 36.01  ? 171 MET B CA  1 
ATOM   3168  C  C   . MET B  1 145 ? 33.514  36.950  48.490   1.00 38.50  ? 171 MET B C   1 
ATOM   3169  O  O   . MET B  1 145 ? 34.463  37.115  49.261   1.00 40.55  ? 171 MET B O   1 
ATOM   3170  C  CB  . MET B  1 145 ? 31.425  37.828  49.562   1.00 31.79  ? 171 MET B CB  1 
ATOM   3171  C  CG  . MET B  1 145 ? 30.808  38.711  48.497   1.00 52.82  ? 171 MET B CG  1 
ATOM   3172  S  SD  . MET B  1 145 ? 31.867  40.125  48.114   1.00 74.87  ? 171 MET B SD  1 
ATOM   3173  C  CE  . MET B  1 145 ? 32.057  40.831  49.750   1.00 49.87  ? 171 MET B CE  1 
ATOM   3174  N  N   . ILE B  1 146 ? 33.618  37.101  47.170   1.00 33.95  ? 172 ILE B N   1 
ATOM   3175  C  CA  . ILE B  1 146 ? 34.896  37.426  46.548   1.00 42.10  ? 172 ILE B CA  1 
ATOM   3176  C  C   . ILE B  1 146 ? 34.637  38.193  45.261   1.00 36.12  ? 172 ILE B C   1 
ATOM   3177  O  O   . ILE B  1 146 ? 33.610  38.011  44.603   1.00 37.04  ? 172 ILE B O   1 
ATOM   3178  C  CB  . ILE B  1 146 ? 35.738  36.153  46.284   1.00 45.17  ? 172 ILE B CB  1 
ATOM   3179  C  CG1 . ILE B  1 146 ? 37.175  36.525  45.909   1.00 40.84  ? 172 ILE B CG1 1 
ATOM   3180  C  CG2 . ILE B  1 146 ? 35.096  35.297  45.197   1.00 35.33  ? 172 ILE B CG2 1 
ATOM   3181  C  CD1 . ILE B  1 146 ? 38.096  35.335  45.759   1.00 38.64  ? 172 ILE B CD1 1 
ATOM   3182  N  N   . ASN B  1 147 ? 35.579  39.067  44.914   1.00 35.90  ? 173 ASN B N   1 
ATOM   3183  C  CA  . ASN B  1 147 ? 35.535  39.899  43.723   1.00 41.48  ? 173 ASN B CA  1 
ATOM   3184  C  C   . ASN B  1 147 ? 36.683  39.553  42.780   1.00 39.00  ? 173 ASN B C   1 
ATOM   3185  O  O   . ASN B  1 147 ? 37.724  39.056  43.224   1.00 41.75  ? 173 ASN B O   1 
ATOM   3186  C  CB  . ASN B  1 147 ? 35.622  41.386  44.094   1.00 41.84  ? 173 ASN B CB  1 
ATOM   3187  C  CG  . ASN B  1 147 ? 34.332  41.916  44.678   1.00 44.15  ? 173 ASN B CG  1 
ATOM   3188  O  OD1 . ASN B  1 147 ? 33.249  41.423  44.365   1.00 41.12  ? 173 ASN B OD1 1 
ATOM   3189  N  ND2 . ASN B  1 147 ? 34.441  42.930  45.532   1.00 50.17  ? 173 ASN B ND2 1 
ATOM   3190  N  N   . PRO B  1 148 ? 36.527  39.802  41.478   1.00 31.62  ? 174 PRO B N   1 
ATOM   3191  C  CA  . PRO B  1 148 ? 37.642  39.569  40.547   1.00 31.63  ? 174 PRO B CA  1 
ATOM   3192  C  C   . PRO B  1 148 ? 38.807  40.476  40.910   1.00 40.48  ? 174 PRO B C   1 
ATOM   3193  O  O   . PRO B  1 148 ? 38.690  41.704  40.897   1.00 43.55  ? 174 PRO B O   1 
ATOM   3194  C  CB  . PRO B  1 148 ? 37.045  39.916  39.178   1.00 29.75  ? 174 PRO B CB  1 
ATOM   3195  C  CG  . PRO B  1 148 ? 35.576  39.786  39.358   1.00 34.41  ? 174 PRO B CG  1 
ATOM   3196  C  CD  . PRO B  1 148 ? 35.302  40.209  40.771   1.00 36.76  ? 174 PRO B CD  1 
ATOM   3197  N  N   . GLU B  1 149 ? 39.939  39.859  41.239   1.00 42.09  ? 175 GLU B N   1 
ATOM   3198  C  CA  . GLU B  1 149 ? 41.097  40.606  41.696   1.00 44.05  ? 175 GLU B CA  1 
ATOM   3199  C  C   . GLU B  1 149 ? 42.364  39.835  41.359   1.00 50.21  ? 175 GLU B C   1 
ATOM   3200  O  O   . GLU B  1 149 ? 42.334  38.628  41.101   1.00 48.37  ? 175 GLU B O   1 
ATOM   3201  C  CB  . GLU B  1 149 ? 40.998  40.866  43.204   1.00 48.91  ? 175 GLU B CB  1 
ATOM   3202  C  CG  . GLU B  1 149 ? 41.972  41.880  43.756   1.00 56.67  ? 175 GLU B CG  1 
ATOM   3203  C  CD  . GLU B  1 149 ? 41.758  42.118  45.230   1.00 59.52  ? 175 GLU B CD  1 
ATOM   3204  O  OE1 . GLU B  1 149 ? 40.741  41.621  45.761   1.00 54.24  ? 175 GLU B OE1 1 
ATOM   3205  O  OE2 . GLU B  1 149 ? 42.600  42.800  45.853   1.00 68.16  ? 175 GLU B OE2 1 
ATOM   3206  N  N   . ASP B  1 150 ? 43.485  40.561  41.358   1.00 56.51  ? 176 ASP B N   1 
ATOM   3207  C  CA  . ASP B  1 150 ? 44.775  39.963  41.037   1.00 56.37  ? 176 ASP B CA  1 
ATOM   3208  C  C   . ASP B  1 150 ? 45.264  39.040  42.145   1.00 51.24  ? 176 ASP B C   1 
ATOM   3209  O  O   . ASP B  1 150 ? 45.914  38.025  41.867   1.00 48.08  ? 176 ASP B O   1 
ATOM   3210  C  CB  . ASP B  1 150 ? 45.809  41.064  40.803   1.00 59.19  ? 176 ASP B CB  1 
ATOM   3211  C  CG  . ASP B  1 150 ? 45.244  42.236  40.039   1.00 62.30  ? 176 ASP B CG  1 
ATOM   3212  O  OD1 . ASP B  1 150 ? 45.585  42.397  38.845   1.00 73.88  ? 176 ASP B OD1 1 
ATOM   3213  O  OD2 . ASP B  1 150 ? 44.455  43.007  40.636   1.00 61.68  ? 176 ASP B OD2 1 
ATOM   3214  N  N   . ARG B  1 151 ? 44.971  39.379  43.396   1.00 47.45  ? 177 ARG B N   1 
ATOM   3215  C  CA  . ARG B  1 151 ? 45.627  38.774  44.545   1.00 51.84  ? 177 ARG B CA  1 
ATOM   3216  C  C   . ARG B  1 151 ? 44.874  37.557  45.066   1.00 42.70  ? 177 ARG B C   1 
ATOM   3217  O  O   . ARG B  1 151 ? 43.645  37.565  45.179   1.00 47.08  ? 177 ARG B O   1 
ATOM   3218  C  CB  . ARG B  1 151 ? 45.801  39.801  45.665   1.00 58.66  ? 177 ARG B CB  1 
ATOM   3219  C  CG  . ARG B  1 151 ? 47.084  40.607  45.535   1.00 67.54  ? 177 ARG B CG  1 
ATOM   3220  C  CD  . ARG B  1 151 ? 47.642  40.975  46.895   1.00 74.35  ? 177 ARG B CD  1 
ATOM   3221  N  NE  . ARG B  1 151 ? 49.102  40.911  46.914   1.00 90.79  ? 177 ARG B NE  1 
ATOM   3222  C  CZ  . ARG B  1 151 ? 49.817  40.510  47.962   1.00 95.53  ? 177 ARG B CZ  1 
ATOM   3223  N  NH1 . ARG B  1 151 ? 49.205  40.135  49.078   1.00 84.89  ? 177 ARG B NH1 1 
ATOM   3224  N  NH2 . ARG B  1 151 ? 51.142  40.479  47.895   1.00 89.25  ? 177 ARG B NH2 1 
ATOM   3225  N  N   . TRP B  1 152 ? 45.632  36.513  45.388   1.00 37.74  ? 178 TRP B N   1 
ATOM   3226  C  CA  . TRP B  1 152 ? 45.073  35.292  45.937   1.00 36.38  ? 178 TRP B CA  1 
ATOM   3227  C  C   . TRP B  1 152 ? 44.632  35.509  47.379   1.00 35.86  ? 178 TRP B C   1 
ATOM   3228  O  O   . TRP B  1 152 ? 45.126  36.393  48.084   1.00 34.60  ? 178 TRP B O   1 
ATOM   3229  C  CB  . TRP B  1 152 ? 46.100  34.161  45.882   1.00 32.11  ? 178 TRP B CB  1 
ATOM   3230  C  CG  . TRP B  1 152 ? 46.453  33.723  44.497   1.00 37.77  ? 178 TRP B CG  1 
ATOM   3231  C  CD1 . TRP B  1 152 ? 47.374  34.289  43.666   1.00 34.99  ? 178 TRP B CD1 1 
ATOM   3232  C  CD2 . TRP B  1 152 ? 45.918  32.595  43.794   1.00 35.55  ? 178 TRP B CD2 1 
ATOM   3233  N  NE1 . TRP B  1 152 ? 47.428  33.600  42.481   1.00 32.18  ? 178 TRP B NE1 1 
ATOM   3234  C  CE2 . TRP B  1 152 ? 46.547  32.553  42.536   1.00 33.65  ? 178 TRP B CE2 1 
ATOM   3235  C  CE3 . TRP B  1 152 ? 44.964  31.623  44.103   1.00 26.77  ? 178 TRP B CE3 1 
ATOM   3236  C  CZ2 . TRP B  1 152 ? 46.252  31.579  41.589   1.00 30.50  ? 178 TRP B CZ2 1 
ATOM   3237  C  CZ3 . TRP B  1 152 ? 44.674  30.659  43.161   1.00 27.58  ? 178 TRP B CZ3 1 
ATOM   3238  C  CH2 . TRP B  1 152 ? 45.316  30.644  41.920   1.00 27.97  ? 178 TRP B CH2 1 
ATOM   3239  N  N   . LYS B  1 153 ? 43.676  34.691  47.809   1.00 33.06  ? 179 LYS B N   1 
ATOM   3240  C  CA  . LYS B  1 153 ? 43.146  34.739  49.164   1.00 32.19  ? 179 LYS B CA  1 
ATOM   3241  C  C   . LYS B  1 153 ? 43.368  33.389  49.829   1.00 31.18  ? 179 LYS B C   1 
ATOM   3242  O  O   . LYS B  1 153 ? 42.956  32.353  49.296   1.00 31.49  ? 179 LYS B O   1 
ATOM   3243  C  CB  . LYS B  1 153 ? 41.659  35.088  49.157   1.00 34.40  ? 179 LYS B CB  1 
ATOM   3244  C  CG  . LYS B  1 153 ? 41.024  35.164  50.535   1.00 37.06  ? 179 LYS B CG  1 
ATOM   3245  C  CD  . LYS B  1 153 ? 39.631  34.539  50.502   1.00 54.27  ? 179 LYS B CD  1 
ATOM   3246  C  CE  . LYS B  1 153 ? 38.569  35.421  51.161   1.00 59.98  ? 179 LYS B CE  1 
ATOM   3247  N  NZ  . LYS B  1 153 ? 37.200  34.804  51.116   1.00 38.81  ? 179 LYS B NZ  1 
ATOM   3248  N  N   . SER B  1 154 ? 44.001  33.407  50.996   1.00 28.74  ? 180 SER B N   1 
ATOM   3249  C  CA  . SER B  1 154 ? 44.404  32.180  51.662   1.00 32.42  ? 180 SER B CA  1 
ATOM   3250  C  C   . SER B  1 154 ? 43.307  31.709  52.608   1.00 35.95  ? 180 SER B C   1 
ATOM   3251  O  O   . SER B  1 154 ? 42.702  32.509  53.327   1.00 35.80  ? 180 SER B O   1 
ATOM   3252  C  CB  . SER B  1 154 ? 45.713  32.392  52.421   1.00 27.80  ? 180 SER B CB  1 
ATOM   3253  O  OG  . SER B  1 154 ? 46.328  31.152  52.710   1.00 37.74  ? 180 SER B OG  1 
ATOM   3254  N  N   . LEU B  1 155 ? 43.066  30.399  52.607   1.00 32.33  ? 181 LEU B N   1 
ATOM   3255  C  CA  . LEU B  1 155 ? 42.062  29.773  53.452   1.00 34.51  ? 181 LEU B CA  1 
ATOM   3256  C  C   . LEU B  1 155 ? 42.696  28.625  54.225   1.00 30.47  ? 181 LEU B C   1 
ATOM   3257  O  O   . LEU B  1 155 ? 43.583  27.932  53.720   1.00 30.96  ? 181 LEU B O   1 
ATOM   3258  C  CB  . LEU B  1 155 ? 40.878  29.257  52.620   1.00 34.23  ? 181 LEU B CB  1 
ATOM   3259  C  CG  . LEU B  1 155 ? 40.091  30.315  51.845   1.00 33.43  ? 181 LEU B CG  1 
ATOM   3260  C  CD1 . LEU B  1 155 ? 39.088  29.668  50.901   1.00 36.27  ? 181 LEU B CD1 1 
ATOM   3261  C  CD2 . LEU B  1 155 ? 39.399  31.274  52.794   1.00 34.81  ? 181 LEU B CD2 1 
ATOM   3262  N  N   . HIS B  1 156 ? 42.231  28.427  55.456   1.00 31.85  ? 182 HIS B N   1 
ATOM   3263  C  CA  . HIS B  1 156 ? 42.789  27.420  56.350   1.00 35.85  ? 182 HIS B CA  1 
ATOM   3264  C  C   . HIS B  1 156 ? 41.670  26.529  56.874   1.00 34.37  ? 182 HIS B C   1 
ATOM   3265  O  O   . HIS B  1 156 ? 40.680  27.027  57.417   1.00 37.96  ? 182 HIS B O   1 
ATOM   3266  C  CB  . HIS B  1 156 ? 43.535  28.092  57.504   1.00 34.64  ? 182 HIS B CB  1 
ATOM   3267  C  CG  . HIS B  1 156 ? 44.342  29.281  57.078   1.00 38.11  ? 182 HIS B CG  1 
ATOM   3268  N  ND1 . HIS B  1 156 ? 45.621  29.175  56.574   1.00 32.66  ? 182 HIS B ND1 1 
ATOM   3269  C  CD2 . HIS B  1 156 ? 44.045  30.603  57.072   1.00 35.47  ? 182 HIS B CD2 1 
ATOM   3270  C  CE1 . HIS B  1 156 ? 46.078  30.379  56.280   1.00 35.10  ? 182 HIS B CE1 1 
ATOM   3271  N  NE2 . HIS B  1 156 ? 45.142  31.264  56.574   1.00 33.50  ? 182 HIS B NE2 1 
ATOM   3272  N  N   . PHE B  1 157 ? 41.826  25.216  56.703   1.00 31.39  ? 183 PHE B N   1 
ATOM   3273  C  CA  . PHE B  1 157 ? 40.810  24.241  57.081   1.00 31.82  ? 183 PHE B CA  1 
ATOM   3274  C  C   . PHE B  1 157 ? 41.428  23.153  57.947   1.00 33.86  ? 183 PHE B C   1 
ATOM   3275  O  O   . PHE B  1 157 ? 42.531  22.677  57.665   1.00 36.86  ? 183 PHE B O   1 
ATOM   3276  C  CB  . PHE B  1 157 ? 40.169  23.607  55.840   1.00 34.89  ? 183 PHE B CB  1 
ATOM   3277  C  CG  . PHE B  1 157 ? 39.568  24.602  54.894   1.00 31.03  ? 183 PHE B CG  1 
ATOM   3278  C  CD1 . PHE B  1 157 ? 38.287  25.087  55.100   1.00 32.88  ? 183 PHE B CD1 1 
ATOM   3279  C  CD2 . PHE B  1 157 ? 40.287  25.059  53.801   1.00 32.59  ? 183 PHE B CD2 1 
ATOM   3280  C  CE1 . PHE B  1 157 ? 37.729  26.005  54.231   1.00 35.22  ? 183 PHE B CE1 1 
ATOM   3281  C  CE2 . PHE B  1 157 ? 39.740  25.977  52.928   1.00 35.86  ? 183 PHE B CE2 1 
ATOM   3282  C  CZ  . PHE B  1 157 ? 38.457  26.452  53.142   1.00 41.12  ? 183 PHE B CZ  1 
ATOM   3283  N  N   . SER B  1 158 ? 40.706  22.746  58.993   1.00 43.56  ? 184 SER B N   1 
ATOM   3284  C  CA  . SER B  1 158 ? 41.165  21.683  59.899   1.00 46.91  ? 184 SER B CA  1 
ATOM   3285  C  C   . SER B  1 158 ? 39.943  20.871  60.319   1.00 41.88  ? 184 SER B C   1 
ATOM   3286  O  O   . SER B  1 158 ? 39.298  21.175  61.325   1.00 54.79  ? 184 SER B O   1 
ATOM   3287  C  CB  . SER B  1 158 ? 41.901  22.256  61.103   1.00 46.22  ? 184 SER B CB  1 
ATOM   3288  O  OG  . SER B  1 158 ? 40.991  22.751  62.068   1.00 58.18  ? 184 SER B OG  1 
ATOM   3289  N  N   . GLY B  1 159 ? 39.639  19.831  59.552   1.00 45.20  ? 185 GLY B N   1 
ATOM   3290  C  CA  . GLY B  1 159 ? 38.473  19.005  59.798   1.00 47.61  ? 185 GLY B CA  1 
ATOM   3291  C  C   . GLY B  1 159 ? 38.698  17.931  60.840   1.00 51.95  ? 185 GLY B C   1 
ATOM   3292  O  O   . GLY B  1 159 ? 39.539  18.059  61.738   1.00 55.02  ? 185 GLY B O   1 
ATOM   3293  N  N   . HIS B  1 160 ? 37.921  16.854  60.724   1.00 49.59  ? 186 HIS B N   1 
ATOM   3294  C  CA  . HIS B  1 160 ? 38.019  15.743  61.659   1.00 44.91  ? 186 HIS B CA  1 
ATOM   3295  C  C   . HIS B  1 160 ? 39.212  14.840  61.376   1.00 48.34  ? 186 HIS B C   1 
ATOM   3296  O  O   . HIS B  1 160 ? 39.704  14.183  62.299   1.00 52.08  ? 186 HIS B O   1 
ATOM   3297  C  CB  . HIS B  1 160 ? 36.727  14.920  61.627   1.00 54.96  ? 186 HIS B CB  1 
ATOM   3298  C  CG  . HIS B  1 160 ? 36.828  13.601  62.332   1.00 68.80  ? 186 HIS B CG  1 
ATOM   3299  N  ND1 . HIS B  1 160 ? 36.995  12.410  61.657   1.00 68.04  ? 186 HIS B ND1 1 
ATOM   3300  C  CD2 . HIS B  1 160 ? 36.806  13.286  63.649   1.00 67.57  ? 186 HIS B CD2 1 
ATOM   3301  C  CE1 . HIS B  1 160 ? 37.062  11.418  62.528   1.00 66.67  ? 186 HIS B CE1 1 
ATOM   3302  N  NE2 . HIS B  1 160 ? 36.951  11.923  63.744   1.00 61.18  ? 186 HIS B NE2 1 
ATOM   3303  N  N   . VAL B  1 161 ? 39.706  14.808  60.139   1.00 47.04  ? 187 VAL B N   1 
ATOM   3304  C  CA  . VAL B  1 161 ? 40.782  13.910  59.738   1.00 42.12  ? 187 VAL B CA  1 
ATOM   3305  C  C   . VAL B  1 161 ? 42.020  14.678  59.292   1.00 41.25  ? 187 VAL B C   1 
ATOM   3306  O  O   . VAL B  1 161 ? 43.134  14.388  59.735   1.00 41.66  ? 187 VAL B O   1 
ATOM   3307  C  CB  . VAL B  1 161 ? 40.317  12.936  58.633   1.00 45.60  ? 187 VAL B CB  1 
ATOM   3308  C  CG1 . VAL B  1 161 ? 41.513  12.264  57.971   1.00 43.88  ? 187 VAL B CG1 1 
ATOM   3309  C  CG2 . VAL B  1 161 ? 39.370  11.897  59.207   1.00 49.20  ? 187 VAL B CG2 1 
ATOM   3310  N  N   . ALA B  1 162 ? 41.845  15.673  58.423   1.00 42.22  ? 188 ALA B N   1 
ATOM   3311  C  CA  . ALA B  1 162 ? 42.968  16.299  57.742   1.00 34.11  ? 188 ALA B CA  1 
ATOM   3312  C  C   . ALA B  1 162 ? 42.943  17.812  57.890   1.00 38.40  ? 188 ALA B C   1 
ATOM   3313  O  O   . ALA B  1 162 ? 41.888  18.422  58.079   1.00 48.15  ? 188 ALA B O   1 
ATOM   3314  C  CB  . ALA B  1 162 ? 42.975  15.937  56.255   1.00 38.41  ? 188 ALA B CB  1 
ATOM   3315  N  N   . HIS B  1 163 ? 44.127  18.411  57.783   1.00 36.38  ? 189 HIS B N   1 
ATOM   3316  C  CA  . HIS B  1 163 ? 44.284  19.855  57.690   1.00 34.26  ? 189 HIS B CA  1 
ATOM   3317  C  C   . HIS B  1 163 ? 44.563  20.228  56.241   1.00 30.58  ? 189 HIS B C   1 
ATOM   3318  O  O   . HIS B  1 163 ? 45.324  19.543  55.555   1.00 33.15  ? 189 HIS B O   1 
ATOM   3319  C  CB  . HIS B  1 163 ? 45.434  20.343  58.573   1.00 34.43  ? 189 HIS B CB  1 
ATOM   3320  C  CG  . HIS B  1 163 ? 45.230  20.086  60.030   1.00 43.72  ? 189 HIS B CG  1 
ATOM   3321  N  ND1 . HIS B  1 163 ? 44.849  21.073  60.914   1.00 48.13  ? 189 HIS B ND1 1 
ATOM   3322  C  CD2 . HIS B  1 163 ? 45.348  18.951  60.761   1.00 50.39  ? 189 HIS B CD2 1 
ATOM   3323  C  CE1 . HIS B  1 163 ? 44.744  20.558  62.127   1.00 55.06  ? 189 HIS B CE1 1 
ATOM   3324  N  NE2 . HIS B  1 163 ? 45.041  19.272  62.061   1.00 52.20  ? 189 HIS B NE2 1 
ATOM   3325  N  N   . LEU B  1 164 ? 43.950  21.312  55.776   1.00 26.84  ? 190 LEU B N   1 
ATOM   3326  C  CA  . LEU B  1 164 ? 44.136  21.758  54.404   1.00 28.01  ? 190 LEU B CA  1 
ATOM   3327  C  C   . LEU B  1 164 ? 44.531  23.229  54.361   1.00 28.41  ? 190 LEU B C   1 
ATOM   3328  O  O   . LEU B  1 164 ? 44.078  24.041  55.172   1.00 25.10  ? 190 LEU B O   1 
ATOM   3329  C  CB  . LEU B  1 164 ? 42.868  21.542  53.563   1.00 30.12  ? 190 LEU B CB  1 
ATOM   3330  C  CG  . LEU B  1 164 ? 42.623  20.152  52.968   1.00 31.70  ? 190 LEU B CG  1 
ATOM   3331  C  CD1 . LEU B  1 164 ? 42.144  19.140  54.009   1.00 26.13  ? 190 LEU B CD1 1 
ATOM   3332  C  CD2 . LEU B  1 164 ? 41.648  20.253  51.807   1.00 30.03  ? 190 LEU B CD2 1 
ATOM   3333  N  N   . GLU B  1 165 ? 45.361  23.568  53.377   1.00 26.68  ? 191 GLU B N   1 
ATOM   3334  C  CA  . GLU B  1 165 ? 45.753  24.944  53.106   1.00 28.49  ? 191 GLU B CA  1 
ATOM   3335  C  C   . GLU B  1 165 ? 45.607  25.199  51.616   1.00 27.34  ? 191 GLU B C   1 
ATOM   3336  O  O   . GLU B  1 165 ? 46.152  24.447  50.802   1.00 29.89  ? 191 GLU B O   1 
ATOM   3337  C  CB  . GLU B  1 165 ? 47.195  25.216  53.549   1.00 28.94  ? 191 GLU B CB  1 
ATOM   3338  C  CG  . GLU B  1 165 ? 47.436  25.084  55.047   1.00 30.65  ? 191 GLU B CG  1 
ATOM   3339  C  CD  . GLU B  1 165 ? 47.014  26.320  55.814   1.00 36.03  ? 191 GLU B CD  1 
ATOM   3340  O  OE1 . GLU B  1 165 ? 47.053  27.426  55.234   1.00 44.26  ? 191 GLU B OE1 1 
ATOM   3341  O  OE2 . GLU B  1 165 ? 46.641  26.190  56.996   1.00 41.97  ? 191 GLU B OE2 1 
ATOM   3342  N  N   . LEU B  1 166 ? 44.872  26.247  51.256   1.00 25.65  ? 192 LEU B N   1 
ATOM   3343  C  CA  . LEU B  1 166 ? 44.632  26.518  49.846   1.00 30.21  ? 192 LEU B CA  1 
ATOM   3344  C  C   . LEU B  1 166 ? 44.376  28.003  49.638   1.00 28.76  ? 192 LEU B C   1 
ATOM   3345  O  O   . LEU B  1 166 ? 43.995  28.724  50.563   1.00 35.06  ? 192 LEU B O   1 
ATOM   3346  C  CB  . LEU B  1 166 ? 43.457  25.689  49.309   1.00 30.91  ? 192 LEU B CB  1 
ATOM   3347  C  CG  . LEU B  1 166 ? 42.137  25.721  50.082   1.00 32.41  ? 192 LEU B CG  1 
ATOM   3348  C  CD1 . LEU B  1 166 ? 41.233  26.858  49.608   1.00 26.67  ? 192 LEU B CD1 1 
ATOM   3349  C  CD2 . LEU B  1 166 ? 41.433  24.383  49.949   1.00 30.51  ? 192 LEU B CD2 1 
ATOM   3350  N  N   . GLN B  1 167 ? 44.594  28.452  48.405   1.00 22.91  ? 193 GLN B N   1 
ATOM   3351  C  CA  . GLN B  1 167 ? 44.337  29.833  48.019   1.00 25.36  ? 193 GLN B CA  1 
ATOM   3352  C  C   . GLN B  1 167 ? 43.413  29.849  46.813   1.00 26.45  ? 193 GLN B C   1 
ATOM   3353  O  O   . GLN B  1 167 ? 43.508  28.983  45.938   1.00 27.04  ? 193 GLN B O   1 
ATOM   3354  C  CB  . GLN B  1 167 ? 45.637  30.591  47.692   1.00 30.89  ? 193 GLN B CB  1 
ATOM   3355  C  CG  . GLN B  1 167 ? 46.659  30.616  48.818   1.00 27.33  ? 193 GLN B CG  1 
ATOM   3356  C  CD  . GLN B  1 167 ? 47.650  29.471  48.731   1.00 29.75  ? 193 GLN B CD  1 
ATOM   3357  O  OE1 . GLN B  1 167 ? 48.249  29.236  47.683   1.00 29.58  ? 193 GLN B OE1 1 
ATOM   3358  N  NE2 . GLN B  1 167 ? 47.818  28.742  49.832   1.00 26.30  ? 193 GLN B NE2 1 
ATOM   3359  N  N   . ILE B  1 168 ? 42.516  30.838  46.769   1.00 27.34  ? 194 ILE B N   1 
ATOM   3360  C  CA  . ILE B  1 168 ? 41.531  30.958  45.702   1.00 25.71  ? 194 ILE B CA  1 
ATOM   3361  C  C   . ILE B  1 168 ? 41.507  32.396  45.194   1.00 32.21  ? 194 ILE B C   1 
ATOM   3362  O  O   . ILE B  1 168 ? 41.964  33.329  45.862   1.00 33.00  ? 194 ILE B O   1 
ATOM   3363  C  CB  . ILE B  1 168 ? 40.113  30.538  46.148   1.00 21.78  ? 194 ILE B CB  1 
ATOM   3364  C  CG1 . ILE B  1 168 ? 39.579  31.491  47.217   1.00 24.68  ? 194 ILE B CG1 1 
ATOM   3365  C  CG2 . ILE B  1 168 ? 40.108  29.109  46.662   1.00 24.84  ? 194 ILE B CG2 1 
ATOM   3366  C  CD1 . ILE B  1 168 ? 38.111  31.286  47.540   1.00 21.39  ? 194 ILE B CD1 1 
ATOM   3367  N  N   . ARG B  1 169 ? 40.966  32.561  43.988   1.00 23.29  ? 195 ARG B N   1 
ATOM   3368  C  CA  . ARG B  1 169 ? 40.803  33.873  43.375   1.00 27.63  ? 195 ARG B CA  1 
ATOM   3369  C  C   . ARG B  1 169 ? 39.930  33.735  42.137   1.00 29.13  ? 195 ARG B C   1 
ATOM   3370  O  O   . ARG B  1 169 ? 39.735  32.635  41.611   1.00 27.21  ? 195 ARG B O   1 
ATOM   3371  C  CB  . ARG B  1 169 ? 42.151  34.505  42.999   1.00 31.19  ? 195 ARG B CB  1 
ATOM   3372  C  CG  . ARG B  1 169 ? 42.764  33.923  41.736   1.00 32.06  ? 195 ARG B CG  1 
ATOM   3373  C  CD  . ARG B  1 169 ? 43.997  34.682  41.294   1.00 35.58  ? 195 ARG B CD  1 
ATOM   3374  N  NE  . ARG B  1 169 ? 44.633  34.036  40.149   1.00 42.29  ? 195 ARG B NE  1 
ATOM   3375  C  CZ  . ARG B  1 169 ? 45.718  34.499  39.533   1.00 43.21  ? 195 ARG B CZ  1 
ATOM   3376  N  NH1 . ARG B  1 169 ? 46.293  35.620  39.949   1.00 37.54  ? 195 ARG B NH1 1 
ATOM   3377  N  NH2 . ARG B  1 169 ? 46.227  33.842  38.501   1.00 39.50  ? 195 ARG B NH2 1 
ATOM   3378  N  N   . VAL B  1 170 ? 39.418  34.872  41.671   1.00 23.29  ? 196 VAL B N   1 
ATOM   3379  C  CA  . VAL B  1 170 ? 38.628  34.946  40.450   1.00 30.29  ? 196 VAL B CA  1 
ATOM   3380  C  C   . VAL B  1 170 ? 39.241  36.012  39.553   1.00 30.66  ? 196 VAL B C   1 
ATOM   3381  O  O   . VAL B  1 170 ? 39.603  37.095  40.023   1.00 33.85  ? 196 VAL B O   1 
ATOM   3382  C  CB  . VAL B  1 170 ? 37.144  35.267  40.740   1.00 30.69  ? 196 VAL B CB  1 
ATOM   3383  C  CG1 . VAL B  1 170 ? 36.355  35.383  39.439   1.00 24.12  ? 196 VAL B CG1 1 
ATOM   3384  C  CG2 . VAL B  1 170 ? 36.535  34.204  41.630   1.00 27.15  ? 196 VAL B CG2 1 
ATOM   3385  N  N   . ARG B  1 171 ? 39.380  35.702  38.268   1.00 27.92  ? 197 ARG B N   1 
ATOM   3386  C  CA  . ARG B  1 171 ? 39.888  36.666  37.303   1.00 36.50  ? 197 ARG B CA  1 
ATOM   3387  C  C   . ARG B  1 171 ? 38.996  36.661  36.071   1.00 31.24  ? 197 ARG B C   1 
ATOM   3388  O  O   . ARG B  1 171 ? 38.509  35.607  35.654   1.00 31.18  ? 197 ARG B O   1 
ATOM   3389  C  CB  . ARG B  1 171 ? 41.347  36.366  36.923   1.00 37.30  ? 197 ARG B CB  1 
ATOM   3390  C  CG  . ARG B  1 171 ? 41.607  34.932  36.508   1.00 43.68  ? 197 ARG B CG  1 
ATOM   3391  C  CD  . ARG B  1 171 ? 43.078  34.703  36.171   1.00 46.98  ? 197 ARG B CD  1 
ATOM   3392  N  NE  . ARG B  1 171 ? 43.312  33.335  35.718   1.00 50.10  ? 197 ARG B NE  1 
ATOM   3393  C  CZ  . ARG B  1 171 ? 43.231  32.943  34.451   1.00 53.03  ? 197 ARG B CZ  1 
ATOM   3394  N  NH1 . ARG B  1 171 ? 42.926  33.820  33.503   1.00 46.58  ? 197 ARG B NH1 1 
ATOM   3395  N  NH2 . ARG B  1 171 ? 43.456  31.674  34.131   1.00 60.86  ? 197 ARG B NH2 1 
ATOM   3396  N  N   . CYS B  1 172 ? 38.783  37.840  35.490   1.00 32.51  ? 198 CYS B N   1 
ATOM   3397  C  CA  . CYS B  1 172 ? 38.012  37.919  34.259   1.00 35.02  ? 198 CYS B CA  1 
ATOM   3398  C  C   . CYS B  1 172 ? 38.876  37.524  33.064   1.00 29.48  ? 198 CYS B C   1 
ATOM   3399  O  O   . CYS B  1 172 ? 40.108  37.574  33.109   1.00 29.97  ? 198 CYS B O   1 
ATOM   3400  C  CB  . CYS B  1 172 ? 37.454  39.331  34.031   1.00 29.16  ? 198 CYS B CB  1 
ATOM   3401  S  SG  . CYS B  1 172 ? 36.385  40.033  35.335   1.00 40.68  ? 198 CYS B SG  1 
ATOM   3402  N  N   . ASP B  1 173 ? 38.209  37.104  31.991   1.00 32.13  ? 199 ASP B N   1 
ATOM   3403  C  CA  . ASP B  1 173 ? 38.892  36.910  30.721   1.00 38.55  ? 199 ASP B CA  1 
ATOM   3404  C  C   . ASP B  1 173 ? 39.364  38.254  30.170   1.00 40.42  ? 199 ASP B C   1 
ATOM   3405  O  O   . ASP B  1 173 ? 39.032  39.325  30.689   1.00 38.86  ? 199 ASP B O   1 
ATOM   3406  C  CB  . ASP B  1 173 ? 37.970  36.235  29.704   1.00 34.71  ? 199 ASP B CB  1 
ATOM   3407  C  CG  . ASP B  1 173 ? 37.993  34.725  29.804   1.00 39.75  ? 199 ASP B CG  1 
ATOM   3408  O  OD1 . ASP B  1 173 ? 37.756  34.046  28.782   1.00 40.63  ? 199 ASP B OD1 1 
ATOM   3409  O  OD2 . ASP B  1 173 ? 38.236  34.214  30.913   1.00 40.84  ? 199 ASP B OD2 1 
ATOM   3410  N  N   . GLU B  1 174 ? 40.139  38.197  29.094   1.00 39.65  ? 200 GLU B N   1 
ATOM   3411  C  CA  . GLU B  1 174 ? 40.533  39.425  28.427   1.00 43.50  ? 200 GLU B CA  1 
ATOM   3412  C  C   . GLU B  1 174 ? 39.361  39.929  27.601   1.00 42.36  ? 200 GLU B C   1 
ATOM   3413  O  O   . GLU B  1 174 ? 38.601  39.138  27.032   1.00 36.32  ? 200 GLU B O   1 
ATOM   3414  C  CB  . GLU B  1 174 ? 41.773  39.221  27.561   1.00 44.85  ? 200 GLU B CB  1 
ATOM   3415  C  CG  . GLU B  1 174 ? 41.623  38.230  26.438   1.00 61.88  ? 200 GLU B CG  1 
ATOM   3416  C  CD  . GLU B  1 174 ? 42.800  38.282  25.489   1.00 76.18  ? 200 GLU B CD  1 
ATOM   3417  O  OE1 . GLU B  1 174 ? 42.837  37.477  24.535   1.00 76.58  ? 200 GLU B OE1 1 
ATOM   3418  O  OE2 . GLU B  1 174 ? 43.691  39.135  25.702   1.00 82.48  ? 200 GLU B OE2 1 
ATOM   3419  N  N   . ASN B  1 175 ? 39.217  41.254  27.558   1.00 44.12  ? 201 ASN B N   1 
ATOM   3420  C  CA  . ASN B  1 175 ? 38.085  41.966  26.973   1.00 39.61  ? 201 ASN B CA  1 
ATOM   3421  C  C   . ASN B  1 175 ? 36.817  41.823  27.807   1.00 36.46  ? 201 ASN B C   1 
ATOM   3422  O  O   . ASN B  1 175 ? 35.714  42.063  27.304   1.00 36.77  ? 201 ASN B O   1 
ATOM   3423  C  CB  . ASN B  1 175 ? 37.815  41.523  25.528   1.00 41.76  ? 201 ASN B CB  1 
ATOM   3424  C  CG  . ASN B  1 175 ? 39.064  41.562  24.665   1.00 48.52  ? 201 ASN B CG  1 
ATOM   3425  O  OD1 . ASN B  1 175 ? 39.871  42.486  24.763   1.00 49.05  ? 201 ASN B OD1 1 
ATOM   3426  N  ND2 . ASN B  1 175 ? 39.229  40.554  23.814   1.00 46.01  ? 201 ASN B ND2 1 
ATOM   3427  N  N   . TYR B  1 176 ? 36.956  41.457  29.081   1.00 36.58  ? 202 TYR B N   1 
ATOM   3428  C  CA  . TYR B  1 176 ? 35.839  41.354  30.013   1.00 36.23  ? 202 TYR B CA  1 
ATOM   3429  C  C   . TYR B  1 176 ? 36.209  42.064  31.306   1.00 35.71  ? 202 TYR B C   1 
ATOM   3430  O  O   . TYR B  1 176 ? 37.312  41.871  31.826   1.00 36.92  ? 202 TYR B O   1 
ATOM   3431  C  CB  . TYR B  1 176 ? 35.476  39.894  30.281   1.00 35.22  ? 202 TYR B CB  1 
ATOM   3432  C  CG  . TYR B  1 176 ? 34.627  39.275  29.194   1.00 35.49  ? 202 TYR B CG  1 
ATOM   3433  C  CD1 . TYR B  1 176 ? 33.239  39.350  29.247   1.00 31.18  ? 202 TYR B CD1 1 
ATOM   3434  C  CD2 . TYR B  1 176 ? 35.209  38.614  28.119   1.00 29.15  ? 202 TYR B CD2 1 
ATOM   3435  C  CE1 . TYR B  1 176 ? 32.457  38.786  28.265   1.00 31.64  ? 202 TYR B CE1 1 
ATOM   3436  C  CE2 . TYR B  1 176 ? 34.431  38.048  27.127   1.00 28.99  ? 202 TYR B CE2 1 
ATOM   3437  C  CZ  . TYR B  1 176 ? 33.055  38.134  27.208   1.00 33.01  ? 202 TYR B CZ  1 
ATOM   3438  O  OH  . TYR B  1 176 ? 32.267  37.570  26.231   1.00 38.17  ? 202 TYR B OH  1 
ATOM   3439  N  N   . TYR B  1 177 ? 35.299  42.893  31.816   1.00 38.10  ? 203 TYR B N   1 
ATOM   3440  C  CA  . TYR B  1 177 ? 35.607  43.769  32.941   1.00 42.58  ? 203 TYR B CA  1 
ATOM   3441  C  C   . TYR B  1 177 ? 34.438  43.749  33.923   1.00 41.56  ? 203 TYR B C   1 
ATOM   3442  O  O   . TYR B  1 177 ? 33.508  42.945  33.791   1.00 40.44  ? 203 TYR B O   1 
ATOM   3443  C  CB  . TYR B  1 177 ? 35.921  45.183  32.434   1.00 47.01  ? 203 TYR B CB  1 
ATOM   3444  C  CG  . TYR B  1 177 ? 37.005  45.221  31.378   1.00 47.85  ? 203 TYR B CG  1 
ATOM   3445  C  CD1 . TYR B  1 177 ? 38.333  45.433  31.725   1.00 49.76  ? 203 TYR B CD1 1 
ATOM   3446  C  CD2 . TYR B  1 177 ? 36.700  45.037  30.033   1.00 44.50  ? 203 TYR B CD2 1 
ATOM   3447  C  CE1 . TYR B  1 177 ? 39.327  45.467  30.761   1.00 49.96  ? 203 TYR B CE1 1 
ATOM   3448  C  CE2 . TYR B  1 177 ? 37.685  45.067  29.065   1.00 45.47  ? 203 TYR B CE2 1 
ATOM   3449  C  CZ  . TYR B  1 177 ? 38.995  45.283  29.433   1.00 45.99  ? 203 TYR B CZ  1 
ATOM   3450  O  OH  . TYR B  1 177 ? 39.973  45.311  28.466   1.00 44.66  ? 203 TYR B OH  1 
ATOM   3451  N  N   . SER B  1 178 ? 34.493  44.660  34.904   1.00 38.72  ? 204 SER B N   1 
ATOM   3452  C  CA  . SER B  1 178 ? 33.496  44.808  35.965   1.00 37.42  ? 204 SER B CA  1 
ATOM   3453  C  C   . SER B  1 178 ? 33.573  43.671  36.980   1.00 39.79  ? 204 SER B C   1 
ATOM   3454  O  O   . SER B  1 178 ? 34.176  42.627  36.710   1.00 43.61  ? 204 SER B O   1 
ATOM   3455  C  CB  . SER B  1 178 ? 32.086  44.906  35.373   1.00 38.42  ? 204 SER B CB  1 
ATOM   3456  O  OG  . SER B  1 178 ? 31.096  44.797  36.376   1.00 49.97  ? 204 SER B OG  1 
ATOM   3457  N  N   . ALA B  1 179 ? 32.973  43.865  38.159   1.00 38.63  ? 205 ALA B N   1 
ATOM   3458  C  CA  . ALA B  1 179 ? 33.016  42.848  39.206   1.00 40.25  ? 205 ALA B CA  1 
ATOM   3459  C  C   . ALA B  1 179 ? 32.217  41.605  38.845   1.00 39.29  ? 205 ALA B C   1 
ATOM   3460  O  O   . ALA B  1 179 ? 32.279  40.610  39.576   1.00 37.73  ? 205 ALA B O   1 
ATOM   3461  C  CB  . ALA B  1 179 ? 32.503  43.416  40.532   1.00 32.35  ? 205 ALA B CB  1 
ATOM   3462  N  N   . THR B  1 180 ? 31.448  41.655  37.763   1.00 37.05  ? 206 THR B N   1 
ATOM   3463  C  CA  . THR B  1 180 ? 30.699  40.514  37.266   1.00 34.91  ? 206 THR B CA  1 
ATOM   3464  C  C   . THR B  1 180 ? 31.412  39.778  36.141   1.00 35.40  ? 206 THR B C   1 
ATOM   3465  O  O   . THR B  1 180 ? 31.001  38.664  35.799   1.00 34.17  ? 206 THR B O   1 
ATOM   3466  C  CB  . THR B  1 180 ? 29.319  40.976  36.783   1.00 40.01  ? 206 THR B CB  1 
ATOM   3467  O  OG1 . THR B  1 180 ? 28.520  39.838  36.440   1.00 42.55  ? 206 THR B OG1 1 
ATOM   3468  C  CG2 . THR B  1 180 ? 29.452  41.914  35.580   1.00 41.98  ? 206 THR B CG2 1 
ATOM   3469  N  N   . CYS B  1 181 ? 32.456  40.377  35.561   1.00 35.05  ? 207 CYS B N   1 
ATOM   3470  C  CA  . CYS B  1 181 ? 33.170  39.849  34.400   1.00 32.50  ? 207 CYS B CA  1 
ATOM   3471  C  C   . CYS B  1 181 ? 32.271  39.752  33.168   1.00 34.06  ? 207 CYS B C   1 
ATOM   3472  O  O   . CYS B  1 181 ? 32.569  39.000  32.235   1.00 34.03  ? 207 CYS B O   1 
ATOM   3473  C  CB  . CYS B  1 181 ? 33.801  38.482  34.705   1.00 32.82  ? 207 CYS B CB  1 
ATOM   3474  S  SG  . CYS B  1 181 ? 35.169  38.491  35.898   1.00 40.73  ? 207 CYS B SG  1 
ATOM   3475  N  N   . ASN B  1 182 ? 31.167  40.501  33.143   1.00 35.62  ? 208 ASN B N   1 
ATOM   3476  C  CA  . ASN B  1 182 ? 30.177  40.402  32.077   1.00 37.66  ? 208 ASN B CA  1 
ATOM   3477  C  C   . ASN B  1 182 ? 30.120  41.636  31.182   1.00 40.30  ? 208 ASN B C   1 
ATOM   3478  O  O   . ASN B  1 182 ? 29.236  41.721  30.324   1.00 37.73  ? 208 ASN B O   1 
ATOM   3479  C  CB  . ASN B  1 182 ? 28.793  40.118  32.662   1.00 31.95  ? 208 ASN B CB  1 
ATOM   3480  C  CG  . ASN B  1 182 ? 27.864  39.450  31.661   1.00 42.31  ? 208 ASN B CG  1 
ATOM   3481  O  OD1 . ASN B  1 182 ? 28.304  38.689  30.799   1.00 40.64  ? 208 ASN B OD1 1 
ATOM   3482  N  ND2 . ASN B  1 182 ? 26.569  39.734  31.772   1.00 44.39  ? 208 ASN B ND2 1 
ATOM   3483  N  N   . LYS B  1 183 ? 31.035  42.588  31.347   1.00 39.59  ? 209 LYS B N   1 
ATOM   3484  C  CA  . LYS B  1 183 ? 31.074  43.777  30.505   1.00 42.58  ? 209 LYS B CA  1 
ATOM   3485  C  C   . LYS B  1 183 ? 32.170  43.601  29.462   1.00 41.98  ? 209 LYS B C   1 
ATOM   3486  O  O   . LYS B  1 183 ? 33.342  43.428  29.810   1.00 41.48  ? 209 LYS B O   1 
ATOM   3487  C  CB  . LYS B  1 183 ? 31.315  45.036  31.334   1.00 42.49  ? 209 LYS B CB  1 
ATOM   3488  C  CG  . LYS B  1 183 ? 31.187  46.321  30.534   1.00 48.29  ? 209 LYS B CG  1 
ATOM   3489  C  CD  . LYS B  1 183 ? 31.162  47.529  31.449   1.00 57.60  ? 209 LYS B CD  1 
ATOM   3490  C  CE  . LYS B  1 183 ? 30.936  48.810  30.671   1.00 59.91  ? 209 LYS B CE  1 
ATOM   3491  N  NZ  . LYS B  1 183 ? 30.940  49.996  31.573   1.00 63.95  ? 209 LYS B NZ  1 
ATOM   3492  N  N   . PHE B  1 184 ? 31.787  43.658  28.190   1.00 39.63  ? 210 PHE B N   1 
ATOM   3493  C  CA  . PHE B  1 184 ? 32.680  43.327  27.090   1.00 40.49  ? 210 PHE B CA  1 
ATOM   3494  C  C   . PHE B  1 184 ? 33.223  44.600  26.452   1.00 48.33  ? 210 PHE B C   1 
ATOM   3495  O  O   . PHE B  1 184 ? 32.465  45.535  26.173   1.00 44.93  ? 210 PHE B O   1 
ATOM   3496  C  CB  . PHE B  1 184 ? 31.952  42.474  26.049   1.00 33.37  ? 210 PHE B CB  1 
ATOM   3497  C  CG  . PHE B  1 184 ? 32.811  42.072  24.888   1.00 40.86  ? 210 PHE B CG  1 
ATOM   3498  C  CD1 . PHE B  1 184 ? 33.651  40.974  24.979   1.00 40.19  ? 210 PHE B CD1 1 
ATOM   3499  C  CD2 . PHE B  1 184 ? 32.780  42.792  23.703   1.00 40.61  ? 210 PHE B CD2 1 
ATOM   3500  C  CE1 . PHE B  1 184 ? 34.444  40.602  23.908   1.00 46.25  ? 210 PHE B CE1 1 
ATOM   3501  C  CE2 . PHE B  1 184 ? 33.571  42.426  22.629   1.00 34.56  ? 210 PHE B CE2 1 
ATOM   3502  C  CZ  . PHE B  1 184 ? 34.402  41.332  22.729   1.00 43.94  ? 210 PHE B CZ  1 
ATOM   3503  N  N   . CYS B  1 185 ? 34.535  44.621  26.216   1.00 47.93  ? 211 CYS B N   1 
ATOM   3504  C  CA  . CYS B  1 185 ? 35.203  45.736  25.553   1.00 47.57  ? 211 CYS B CA  1 
ATOM   3505  C  C   . CYS B  1 185 ? 36.466  45.205  24.896   1.00 47.05  ? 211 CYS B C   1 
ATOM   3506  O  O   . CYS B  1 185 ? 37.322  44.640  25.578   1.00 44.15  ? 211 CYS B O   1 
ATOM   3507  C  CB  . CYS B  1 185 ? 35.543  46.852  26.545   1.00 45.05  ? 211 CYS B CB  1 
ATOM   3508  S  SG  . CYS B  1 185 ? 36.364  48.300  25.815   1.00 54.38  ? 211 CYS B SG  1 
ATOM   3509  N  N   . ARG B  1 186 ? 36.600  45.414  23.586   1.00 56.83  ? 212 ARG B N   1 
ATOM   3510  C  CA  . ARG B  1 186 ? 37.766  44.945  22.852   1.00 58.17  ? 212 ARG B CA  1 
ATOM   3511  C  C   . ARG B  1 186 ? 38.407  46.114  22.114   1.00 59.25  ? 212 ARG B C   1 
ATOM   3512  O  O   . ARG B  1 186 ? 37.709  46.845  21.390   1.00 58.42  ? 212 ARG B O   1 
ATOM   3513  C  CB  . ARG B  1 186 ? 37.416  43.856  21.834   1.00 53.96  ? 212 ARG B CB  1 
ATOM   3514  C  CG  . ARG B  1 186 ? 38.617  43.033  21.408   1.00 57.09  ? 212 ARG B CG  1 
ATOM   3515  C  CD  . ARG B  1 186 ? 38.390  42.401  20.047   1.00 70.94  ? 212 ARG B CD  1 
ATOM   3516  N  NE  . ARG B  1 186 ? 38.747  40.984  19.988   1.00 84.56  ? 212 ARG B NE  1 
ATOM   3517  C  CZ  . ARG B  1 186 ? 39.981  40.518  19.813   1.00 82.41  ? 212 ARG B CZ  1 
ATOM   3518  N  NH1 . ARG B  1 186 ? 41.002  41.358  19.697   1.00 76.14  ? 212 ARG B NH1 1 
ATOM   3519  N  NH2 . ARG B  1 186 ? 40.189  39.207  19.765   1.00 78.86  ? 212 ARG B NH2 1 
ATOM   3520  N  N   . PRO B  1 187 ? 39.718  46.311  22.253   1.00 61.27  ? 213 PRO B N   1 
ATOM   3521  C  CA  . PRO B  1 187 ? 40.383  47.397  21.519   1.00 57.84  ? 213 PRO B CA  1 
ATOM   3522  C  C   . PRO B  1 187 ? 40.408  47.120  20.021   1.00 60.15  ? 213 PRO B C   1 
ATOM   3523  O  O   . PRO B  1 187 ? 40.545  45.976  19.583   1.00 65.28  ? 213 PRO B O   1 
ATOM   3524  C  CB  . PRO B  1 187 ? 41.801  47.408  22.107   1.00 57.75  ? 213 PRO B CB  1 
ATOM   3525  C  CG  . PRO B  1 187 ? 41.694  46.656  23.408   1.00 56.68  ? 213 PRO B CG  1 
ATOM   3526  C  CD  . PRO B  1 187 ? 40.631  45.630  23.184   1.00 50.44  ? 213 PRO B CD  1 
ATOM   3527  N  N   . ARG B  1 188 ? 40.280  48.188  19.235   1.00 58.11  ? 214 ARG B N   1 
ATOM   3528  C  CA  . ARG B  1 188 ? 40.273  48.081  17.783   1.00 62.76  ? 214 ARG B CA  1 
ATOM   3529  C  C   . ARG B  1 188 ? 40.863  49.360  17.196   1.00 71.98  ? 214 ARG B C   1 
ATOM   3530  O  O   . ARG B  1 188 ? 41.044  50.359  17.897   1.00 67.97  ? 214 ARG B O   1 
ATOM   3531  C  CB  . ARG B  1 188 ? 38.850  47.825  17.259   1.00 63.42  ? 214 ARG B CB  1 
ATOM   3532  C  CG  . ARG B  1 188 ? 37.891  48.994  17.451   1.00 68.13  ? 214 ARG B CG  1 
ATOM   3533  C  CD  . ARG B  1 188 ? 36.467  48.609  17.083   1.00 66.95  ? 214 ARG B CD  1 
ATOM   3534  N  NE  . ARG B  1 188 ? 36.440  47.716  15.930   1.00 66.55  ? 214 ARG B NE  1 
ATOM   3535  C  CZ  . ARG B  1 188 ? 35.362  47.061  15.514   1.00 66.52  ? 214 ARG B CZ  1 
ATOM   3536  N  NH1 . ARG B  1 188 ? 34.210  47.195  16.158   1.00 72.15  ? 214 ARG B NH1 1 
ATOM   3537  N  NH2 . ARG B  1 188 ? 35.438  46.270  14.454   1.00 70.07  ? 214 ARG B NH2 1 
ATOM   3538  N  N   . ASN B  1 189 ? 41.152  49.329  15.879   1.00 76.79  ? 215 ASN B N   1 
ATOM   3539  C  CA  . ASN B  1 189 ? 41.607  50.542  15.178   1.00 70.57  ? 215 ASN B CA  1 
ATOM   3540  C  C   . ASN B  1 189 ? 41.143  50.461  13.721   1.00 72.70  ? 215 ASN B C   1 
ATOM   3541  O  O   . ASN B  1 189 ? 41.867  50.177  12.776   1.00 73.14  ? 215 ASN B O   1 
ATOM   3542  C  CB  . ASN B  1 189 ? 43.113  50.807  15.349   1.00 77.04  ? 215 ASN B CB  1 
ATOM   3543  C  CG  . ASN B  1 189 ? 44.064  49.919  14.486   1.00 82.96  ? 215 ASN B CG  1 
ATOM   3544  O  OD1 . ASN B  1 189 ? 43.680  48.992  13.775   1.00 85.31  ? 215 ASN B OD1 1 
ATOM   3545  N  ND2 . ASN B  1 189 ? 45.358  50.237  14.588   1.00 73.31  ? 215 ASN B ND2 1 
ATOM   3546  N  N   . ASP B  1 190 ? 39.880  50.803  13.509   1.00 74.35  ? 216 ASP B N   1 
ATOM   3547  C  CA  . ASP B  1 190 ? 39.358  50.794  12.154   1.00 73.37  ? 216 ASP B CA  1 
ATOM   3548  C  C   . ASP B  1 190 ? 38.245  51.828  12.042   1.00 73.96  ? 216 ASP B C   1 
ATOM   3549  O  O   . ASP B  1 190 ? 38.134  52.741  12.867   1.00 74.40  ? 216 ASP B O   1 
ATOM   3550  C  CB  . ASP B  1 190 ? 38.897  49.378  11.761   1.00 72.39  ? 216 ASP B CB  1 
ATOM   3551  C  CG  . ASP B  1 190 ? 37.936  48.760  12.766   1.00 70.22  ? 216 ASP B CG  1 
ATOM   3552  O  OD1 . ASP B  1 190 ? 37.134  49.489  13.382   1.00 71.90  ? 216 ASP B OD1 1 
ATOM   3553  O  OD2 . ASP B  1 190 ? 37.985  47.520  12.930   1.00 75.85  ? 216 ASP B OD2 1 
ATOM   3554  N  N   . PHE B  1 191 ? 37.420  51.683  11.007   1.00 76.65  ? 217 PHE B N   1 
ATOM   3555  C  CA  . PHE B  1 191 ? 36.376  52.662  10.765   1.00 77.40  ? 217 PHE B CA  1 
ATOM   3556  C  C   . PHE B  1 191 ? 35.336  52.685  11.873   1.00 75.72  ? 217 PHE B C   1 
ATOM   3557  O  O   . PHE B  1 191 ? 34.631  53.679  12.003   1.00 72.71  ? 217 PHE B O   1 
ATOM   3558  C  CB  . PHE B  1 191 ? 35.707  52.415  9.411    1.00 82.15  ? 217 PHE B CB  1 
ATOM   3559  C  CG  . PHE B  1 191 ? 34.572  53.353  9.127    1.00 85.57  ? 217 PHE B CG  1 
ATOM   3560  C  CD1 . PHE B  1 191 ? 34.812  54.640  8.673    1.00 85.44  ? 217 PHE B CD1 1 
ATOM   3561  C  CD2 . PHE B  1 191 ? 33.263  52.952  9.332    1.00 86.07  ? 217 PHE B CD2 1 
ATOM   3562  C  CE1 . PHE B  1 191 ? 33.764  55.506  8.424    1.00 83.37  ? 217 PHE B CE1 1 
ATOM   3563  C  CE2 . PHE B  1 191 ? 32.212  53.813  9.085    1.00 85.49  ? 217 PHE B CE2 1 
ATOM   3564  C  CZ  . PHE B  1 191 ? 32.462  55.090  8.629    1.00 83.24  ? 217 PHE B CZ  1 
ATOM   3565  N  N   . PHE B  1 192 ? 35.201  51.622  12.660   1.00 78.01  ? 218 PHE B N   1 
ATOM   3566  C  CA  . PHE B  1 192 ? 34.180  51.603  13.702   1.00 76.56  ? 218 PHE B CA  1 
ATOM   3567  C  C   . PHE B  1 192 ? 34.649  52.201  15.024   1.00 74.01  ? 218 PHE B C   1 
ATOM   3568  O  O   . PHE B  1 192 ? 33.878  52.202  15.989   1.00 76.99  ? 218 PHE B O   1 
ATOM   3569  C  CB  . PHE B  1 192 ? 33.663  50.177  13.923   1.00 70.93  ? 218 PHE B CB  1 
ATOM   3570  C  CG  . PHE B  1 192 ? 32.840  49.658  12.779   1.00 79.20  ? 218 PHE B CG  1 
ATOM   3571  C  CD1 . PHE B  1 192 ? 31.544  50.114  12.572   1.00 82.16  ? 218 PHE B CD1 1 
ATOM   3572  C  CD2 . PHE B  1 192 ? 33.366  48.729  11.899   1.00 79.22  ? 218 PHE B CD2 1 
ATOM   3573  C  CE1 . PHE B  1 192 ? 30.786  49.641  11.510   1.00 69.44  ? 218 PHE B CE1 1 
ATOM   3574  C  CE2 . PHE B  1 192 ? 32.616  48.255  10.837   1.00 75.76  ? 218 PHE B CE2 1 
ATOM   3575  C  CZ  . PHE B  1 192 ? 31.324  48.711  10.643   1.00 69.70  ? 218 PHE B CZ  1 
ATOM   3576  N  N   . GLY B  1 193 ? 35.861  52.722  15.085   1.00 72.00  ? 219 GLY B N   1 
ATOM   3577  C  CA  . GLY B  1 193 ? 36.372  53.375  16.274   1.00 72.45  ? 219 GLY B CA  1 
ATOM   3578  C  C   . GLY B  1 193 ? 37.869  53.182  16.395   1.00 73.77  ? 219 GLY B C   1 
ATOM   3579  O  O   . GLY B  1 193 ? 38.477  52.320  15.761   1.00 64.00  ? 219 GLY B O   1 
ATOM   3580  N  N   . HIS B  1 194 ? 38.482  54.011  17.259   1.00 73.71  ? 220 HIS B N   1 
ATOM   3581  C  CA  . HIS B  1 194 ? 39.923  53.978  17.539   1.00 73.91  ? 220 HIS B CA  1 
ATOM   3582  C  C   . HIS B  1 194 ? 40.075  54.185  19.044   1.00 71.42  ? 220 HIS B C   1 
ATOM   3583  O  O   . HIS B  1 194 ? 40.321  55.296  19.520   1.00 65.75  ? 220 HIS B O   1 
ATOM   3584  C  CB  . HIS B  1 194 ? 40.683  55.043  16.746   1.00 72.34  ? 220 HIS B CB  1 
ATOM   3585  C  CG  . HIS B  1 194 ? 40.372  55.049  15.282   1.00 72.95  ? 220 HIS B CG  1 
ATOM   3586  N  ND1 . HIS B  1 194 ? 41.181  54.441  14.347   1.00 72.89  ? 220 HIS B ND1 1 
ATOM   3587  C  CD2 . HIS B  1 194 ? 39.339  55.590  14.592   1.00 72.13  ? 220 HIS B CD2 1 
ATOM   3588  C  CE1 . HIS B  1 194 ? 40.662  54.608  13.144   1.00 75.70  ? 220 HIS B CE1 1 
ATOM   3589  N  NE2 . HIS B  1 194 ? 39.544  55.301  13.265   1.00 74.22  ? 220 HIS B NE2 1 
ATOM   3590  N  N   . TYR B  1 195 ? 39.939  53.100  19.802   1.00 74.97  ? 221 TYR B N   1 
ATOM   3591  C  CA  . TYR B  1 195 ? 39.875  53.199  21.251   1.00 68.70  ? 221 TYR B CA  1 
ATOM   3592  C  C   . TYR B  1 195 ? 40.607  52.033  21.896   1.00 64.88  ? 221 TYR B C   1 
ATOM   3593  O  O   . TYR B  1 195 ? 40.932  51.030  21.256   1.00 68.37  ? 221 TYR B O   1 
ATOM   3594  C  CB  . TYR B  1 195 ? 38.422  53.239  21.750   1.00 65.30  ? 221 TYR B CB  1 
ATOM   3595  C  CG  . TYR B  1 195 ? 37.587  52.034  21.365   1.00 72.64  ? 221 TYR B CG  1 
ATOM   3596  C  CD1 . TYR B  1 195 ? 37.563  50.894  22.163   1.00 69.75  ? 221 TYR B CD1 1 
ATOM   3597  C  CD2 . TYR B  1 195 ? 36.814  52.039  20.209   1.00 73.38  ? 221 TYR B CD2 1 
ATOM   3598  C  CE1 . TYR B  1 195 ? 36.801  49.795  21.818   1.00 64.13  ? 221 TYR B CE1 1 
ATOM   3599  C  CE2 . TYR B  1 195 ? 36.047  50.942  19.856   1.00 74.71  ? 221 TYR B CE2 1 
ATOM   3600  C  CZ  . TYR B  1 195 ? 36.046  49.823  20.665   1.00 74.66  ? 221 TYR B CZ  1 
ATOM   3601  O  OH  . TYR B  1 195 ? 35.286  48.728  20.320   1.00 84.13  ? 221 TYR B OH  1 
ATOM   3602  N  N   . THR B  1 196 ? 40.871  52.197  23.187   1.00 64.32  ? 222 THR B N   1 
ATOM   3603  C  CA  . THR B  1 196 ? 41.354  51.144  24.061   1.00 59.94  ? 222 THR B CA  1 
ATOM   3604  C  C   . THR B  1 196 ? 40.406  51.051  25.249   1.00 55.90  ? 222 THR B C   1 
ATOM   3605  O  O   . THR B  1 196 ? 39.594  51.948  25.492   1.00 54.58  ? 222 THR B O   1 
ATOM   3606  C  CB  . THR B  1 196 ? 42.789  51.418  24.529   1.00 58.69  ? 222 THR B CB  1 
ATOM   3607  O  OG1 . THR B  1 196 ? 42.845  52.705  25.156   1.00 63.68  ? 222 THR B OG1 1 
ATOM   3608  C  CG2 . THR B  1 196 ? 43.741  51.400  23.348   1.00 59.10  ? 222 THR B CG2 1 
ATOM   3609  N  N   . CYS B  1 197 ? 40.511  49.961  25.998   1.00 62.99  ? 223 CYS B N   1 
ATOM   3610  C  CA  . CYS B  1 197 ? 39.626  49.721  27.128   1.00 53.56  ? 223 CYS B CA  1 
ATOM   3611  C  C   . CYS B  1 197 ? 40.352  50.048  28.426   1.00 55.04  ? 223 CYS B C   1 
ATOM   3612  O  O   . CYS B  1 197 ? 41.558  49.815  28.552   1.00 50.31  ? 223 CYS B O   1 
ATOM   3613  C  CB  . CYS B  1 197 ? 39.134  48.274  27.137   1.00 49.13  ? 223 CYS B CB  1 
ATOM   3614  S  SG  . CYS B  1 197 ? 38.321  47.767  25.598   1.00 51.77  ? 223 CYS B SG  1 
ATOM   3615  N  N   . ASP B  1 198 ? 39.610  50.601  29.388   1.00 59.28  ? 224 ASP B N   1 
ATOM   3616  C  CA  . ASP B  1 198 ? 40.174  50.910  30.697   1.00 62.03  ? 224 ASP B CA  1 
ATOM   3617  C  C   . ASP B  1 198 ? 39.948  49.755  31.664   1.00 64.20  ? 224 ASP B C   1 
ATOM   3618  O  O   . ASP B  1 198 ? 39.954  48.589  31.256   1.00 61.60  ? 224 ASP B O   1 
ATOM   3619  C  CB  . ASP B  1 198 ? 39.578  52.210  31.256   1.00 60.29  ? 224 ASP B CB  1 
ATOM   3620  C  CG  . ASP B  1 198 ? 38.062  52.157  31.414   1.00 65.99  ? 224 ASP B CG  1 
ATOM   3621  O  OD1 . ASP B  1 198 ? 37.464  51.073  31.242   1.00 72.99  ? 224 ASP B OD1 1 
ATOM   3622  O  OD2 . ASP B  1 198 ? 37.466  53.209  31.734   1.00 64.48  ? 224 ASP B OD2 1 
ATOM   3623  N  N   . GLN B  1 199 ? 39.744  50.062  32.945   1.00 68.66  ? 225 GLN B N   1 
ATOM   3624  C  CA  . GLN B  1 199 ? 39.555  49.009  33.933   1.00 67.34  ? 225 GLN B CA  1 
ATOM   3625  C  C   . GLN B  1 199 ? 38.100  48.582  34.078   1.00 63.18  ? 225 GLN B C   1 
ATOM   3626  O  O   . GLN B  1 199 ? 37.837  47.424  34.420   1.00 63.13  ? 225 GLN B O   1 
ATOM   3627  C  CB  . GLN B  1 199 ? 40.102  49.449  35.295   1.00 64.91  ? 225 GLN B CB  1 
ATOM   3628  C  CG  . GLN B  1 199 ? 41.638  49.432  35.441   1.00 80.58  ? 225 GLN B CG  1 
ATOM   3629  C  CD  . GLN B  1 199 ? 42.339  48.148  34.968   1.00 90.76  ? 225 GLN B CD  1 
ATOM   3630  O  OE1 . GLN B  1 199 ? 41.711  47.172  34.554   1.00 90.06  ? 225 GLN B OE1 1 
ATOM   3631  N  NE2 . GLN B  1 199 ? 43.665  48.153  35.053   1.00 95.68  ? 225 GLN B NE2 1 
ATOM   3632  N  N   . TYR B  1 200 ? 37.148  49.478  33.820   1.00 58.60  ? 226 TYR B N   1 
ATOM   3633  C  CA  . TYR B  1 200 ? 35.734  49.138  33.876   1.00 57.97  ? 226 TYR B CA  1 
ATOM   3634  C  C   . TYR B  1 200 ? 35.156  48.859  32.493   1.00 61.40  ? 226 TYR B C   1 
ATOM   3635  O  O   . TYR B  1 200 ? 33.936  48.922  32.308   1.00 58.27  ? 226 TYR B O   1 
ATOM   3636  C  CB  . TYR B  1 200 ? 34.951  50.253  34.575   1.00 64.05  ? 226 TYR B CB  1 
ATOM   3637  C  CG  . TYR B  1 200 ? 35.706  50.869  35.733   1.00 70.55  ? 226 TYR B CG  1 
ATOM   3638  C  CD1 . TYR B  1 200 ? 36.396  52.067  35.579   1.00 71.25  ? 226 TYR B CD1 1 
ATOM   3639  C  CD2 . TYR B  1 200 ? 35.735  50.250  36.980   1.00 73.99  ? 226 TYR B CD2 1 
ATOM   3640  C  CE1 . TYR B  1 200 ? 37.096  52.634  36.635   1.00 76.39  ? 226 TYR B CE1 1 
ATOM   3641  C  CE2 . TYR B  1 200 ? 36.437  50.807  38.041   1.00 73.23  ? 226 TYR B CE2 1 
ATOM   3642  C  CZ  . TYR B  1 200 ? 37.112  51.999  37.863   1.00 76.26  ? 226 TYR B CZ  1 
ATOM   3643  O  OH  . TYR B  1 200 ? 37.806  52.555  38.916   1.00 73.29  ? 226 TYR B OH  1 
ATOM   3644  N  N   . GLY B  1 201 ? 36.005  48.528  31.524   1.00 57.68  ? 227 GLY B N   1 
ATOM   3645  C  CA  . GLY B  1 201 ? 35.523  48.234  30.190   1.00 58.95  ? 227 GLY B CA  1 
ATOM   3646  C  C   . GLY B  1 201 ? 34.951  49.417  29.445   1.00 59.25  ? 227 GLY B C   1 
ATOM   3647  O  O   . GLY B  1 201 ? 34.079  49.238  28.589   1.00 58.53  ? 227 GLY B O   1 
ATOM   3648  N  N   . ASN B  1 202 ? 35.404  50.627  29.756   1.00 59.04  ? 228 ASN B N   1 
ATOM   3649  C  CA  . ASN B  1 202 ? 34.971  51.812  29.036   1.00 64.41  ? 228 ASN B CA  1 
ATOM   3650  C  C   . ASN B  1 202 ? 35.965  52.127  27.928   1.00 64.28  ? 228 ASN B C   1 
ATOM   3651  O  O   . ASN B  1 202 ? 37.159  51.836  28.038   1.00 61.66  ? 228 ASN B O   1 
ATOM   3652  C  CB  . ASN B  1 202 ? 34.840  53.015  29.971   1.00 64.12  ? 228 ASN B CB  1 
ATOM   3653  C  CG  . ASN B  1 202 ? 33.750  52.837  31.006   1.00 62.54  ? 228 ASN B CG  1 
ATOM   3654  O  OD1 . ASN B  1 202 ? 32.747  52.162  30.764   1.00 60.59  ? 228 ASN B OD1 1 
ATOM   3655  N  ND2 . ASN B  1 202 ? 33.938  53.451  32.168   1.00 61.01  ? 228 ASN B ND2 1 
ATOM   3656  N  N   . LYS B  1 203 ? 35.460  52.729  26.854   1.00 67.49  ? 229 LYS B N   1 
ATOM   3657  C  CA  . LYS B  1 203 ? 36.294  53.047  25.703   1.00 62.63  ? 229 LYS B CA  1 
ATOM   3658  C  C   . LYS B  1 203 ? 37.095  54.312  25.985   1.00 57.75  ? 229 LYS B C   1 
ATOM   3659  O  O   . LYS B  1 203 ? 36.525  55.357  26.317   1.00 61.49  ? 229 LYS B O   1 
ATOM   3660  C  CB  . LYS B  1 203 ? 35.438  53.202  24.449   1.00 63.23  ? 229 LYS B CB  1 
ATOM   3661  C  CG  . LYS B  1 203 ? 34.392  52.111  24.302   1.00 66.21  ? 229 LYS B CG  1 
ATOM   3662  C  CD  . LYS B  1 203 ? 33.955  51.924  22.859   1.00 69.68  ? 229 LYS B CD  1 
ATOM   3663  C  CE  . LYS B  1 203 ? 32.629  51.186  22.791   1.00 81.71  ? 229 LYS B CE  1 
ATOM   3664  N  NZ  . LYS B  1 203 ? 32.001  51.264  21.448   1.00 78.84  ? 229 LYS B NZ  1 
ATOM   3665  N  N   . ALA B  1 204 ? 38.414  54.210  25.867   1.00 56.61  ? 230 ALA B N   1 
ATOM   3666  C  CA  . ALA B  1 204 ? 39.329  55.330  26.050   1.00 64.66  ? 230 ALA B CA  1 
ATOM   3667  C  C   . ALA B  1 204 ? 39.996  55.610  24.709   1.00 64.82  ? 230 ALA B C   1 
ATOM   3668  O  O   . ALA B  1 204 ? 40.815  54.809  24.243   1.00 57.73  ? 230 ALA B O   1 
ATOM   3669  C  CB  . ALA B  1 204 ? 40.363  55.021  27.132   1.00 54.74  ? 230 ALA B CB  1 
ATOM   3670  N  N   . CYS B  1 205 ? 39.647  56.744  24.098   1.00 62.75  ? 231 CYS B N   1 
ATOM   3671  C  CA  . CYS B  1 205 ? 40.155  57.073  22.771   1.00 65.56  ? 231 CYS B CA  1 
ATOM   3672  C  C   . CYS B  1 205 ? 41.677  57.070  22.751   1.00 63.02  ? 231 CYS B C   1 
ATOM   3673  O  O   . CYS B  1 205 ? 42.333  57.471  23.716   1.00 63.09  ? 231 CYS B O   1 
ATOM   3674  C  CB  . CYS B  1 205 ? 39.636  58.440  22.319   1.00 55.85  ? 231 CYS B CB  1 
ATOM   3675  S  SG  . CYS B  1 205 ? 37.849  58.518  22.139   1.00 77.65  ? 231 CYS B SG  1 
ATOM   3676  N  N   . MET B  1 206 ? 42.235  56.603  21.641   1.00 59.96  ? 232 MET B N   1 
ATOM   3677  C  CA  . MET B  1 206 ? 43.675  56.626  21.465   1.00 68.90  ? 232 MET B CA  1 
ATOM   3678  C  C   . MET B  1 206 ? 44.150  58.063  21.286   1.00 75.57  ? 232 MET B C   1 
ATOM   3679  O  O   . MET B  1 206 ? 43.362  58.977  21.025   1.00 80.38  ? 232 MET B O   1 
ATOM   3680  C  CB  . MET B  1 206 ? 44.073  55.781  20.257   1.00 70.92  ? 232 MET B CB  1 
ATOM   3681  C  CG  . MET B  1 206 ? 43.370  54.436  20.210   1.00 68.79  ? 232 MET B CG  1 
ATOM   3682  S  SD  . MET B  1 206 ? 43.593  53.574  18.647   1.00 75.51  ? 232 MET B SD  1 
ATOM   3683  C  CE  . MET B  1 206 ? 45.343  53.197  18.718   1.00 67.61  ? 232 MET B CE  1 
ATOM   3684  N  N   . ASP B  1 207 ? 45.454  58.261  21.445   1.00 77.66  ? 233 ASP B N   1 
ATOM   3685  C  CA  . ASP B  1 207 ? 46.005  59.608  21.382   1.00 79.92  ? 233 ASP B CA  1 
ATOM   3686  C  C   . ASP B  1 207 ? 45.840  60.152  19.966   1.00 83.81  ? 233 ASP B C   1 
ATOM   3687  O  O   . ASP B  1 207 ? 46.347  59.569  19.002   1.00 74.49  ? 233 ASP B O   1 
ATOM   3688  C  CB  . ASP B  1 207 ? 47.470  59.603  21.807   1.00 81.13  ? 233 ASP B CB  1 
ATOM   3689  C  CG  . ASP B  1 207 ? 47.860  60.857  22.570   1.00 93.83  ? 233 ASP B CG  1 
ATOM   3690  O  OD1 . ASP B  1 207 ? 49.071  61.060  22.802   1.00 97.96  ? 233 ASP B OD1 1 
ATOM   3691  O  OD2 . ASP B  1 207 ? 46.955  61.640  22.936   1.00 86.83  ? 233 ASP B OD2 1 
ATOM   3692  N  N   . GLY B  1 208 ? 45.122  61.263  19.844   1.00 81.85  ? 234 GLY B N   1 
ATOM   3693  C  CA  . GLY B  1 208 ? 44.829  61.851  18.557   1.00 72.46  ? 234 GLY B CA  1 
ATOM   3694  C  C   . GLY B  1 208 ? 43.427  61.617  18.043   1.00 75.06  ? 234 GLY B C   1 
ATOM   3695  O  O   . GLY B  1 208 ? 43.167  61.895  16.866   1.00 80.37  ? 234 GLY B O   1 
ATOM   3696  N  N   . TRP B  1 209 ? 42.521  61.108  18.875   1.00 66.04  ? 235 TRP B N   1 
ATOM   3697  C  CA  . TRP B  1 209 ? 41.154  60.838  18.463   1.00 66.57  ? 235 TRP B CA  1 
ATOM   3698  C  C   . TRP B  1 209 ? 40.188  61.352  19.521   1.00 64.97  ? 235 TRP B C   1 
ATOM   3699  O  O   . TRP B  1 209 ? 40.546  61.528  20.688   1.00 67.07  ? 235 TRP B O   1 
ATOM   3700  C  CB  . TRP B  1 209 ? 40.933  59.340  18.216   1.00 65.82  ? 235 TRP B CB  1 
ATOM   3701  C  CG  . TRP B  1 209 ? 41.763  58.796  17.094   1.00 68.39  ? 235 TRP B CG  1 
ATOM   3702  C  CD1 . TRP B  1 209 ? 43.034  58.306  17.177   1.00 70.84  ? 235 TRP B CD1 1 
ATOM   3703  C  CD2 . TRP B  1 209 ? 41.378  58.681  15.719   1.00 69.77  ? 235 TRP B CD2 1 
ATOM   3704  N  NE1 . TRP B  1 209 ? 43.466  57.895  15.938   1.00 68.17  ? 235 TRP B NE1 1 
ATOM   3705  C  CE2 . TRP B  1 209 ? 42.467  58.113  15.026   1.00 72.90  ? 235 TRP B CE2 1 
ATOM   3706  C  CE3 . TRP B  1 209 ? 40.218  59.002  15.007   1.00 70.49  ? 235 TRP B CE3 1 
ATOM   3707  C  CZ2 . TRP B  1 209 ? 42.430  57.861  13.654   1.00 68.94  ? 235 TRP B CZ2 1 
ATOM   3708  C  CZ3 . TRP B  1 209 ? 40.183  58.750  13.646   1.00 72.88  ? 235 TRP B CZ3 1 
ATOM   3709  C  CH2 . TRP B  1 209 ? 41.284  58.186  12.984   1.00 67.97  ? 235 TRP B CH2 1 
ATOM   3710  N  N   . MET B  1 210 ? 38.956  61.603  19.093   1.00 65.47  ? 236 MET B N   1 
ATOM   3711  C  CA  . MET B  1 210 ? 37.884  62.046  19.978   1.00 64.06  ? 236 MET B CA  1 
ATOM   3712  C  C   . MET B  1 210 ? 36.554  61.682  19.330   1.00 68.42  ? 236 MET B C   1 
ATOM   3713  O  O   . MET B  1 210 ? 36.509  60.947  18.338   1.00 75.69  ? 236 MET B O   1 
ATOM   3714  C  CB  . MET B  1 210 ? 37.991  63.550  20.253   1.00 78.28  ? 236 MET B CB  1 
ATOM   3715  C  CG  . MET B  1 210 ? 37.735  64.433  19.034   1.00 80.04  ? 236 MET B CG  1 
ATOM   3716  S  SD  . MET B  1 210 ? 38.225  66.153  19.289   1.00 80.35  ? 236 MET B SD  1 
ATOM   3717  C  CE  . MET B  1 210 ? 37.533  66.473  20.911   1.00 72.99  ? 236 MET B CE  1 
ATOM   3718  N  N   . GLY B  1 211 ? 35.468  62.191  19.895   1.00 69.26  ? 237 GLY B N   1 
ATOM   3719  C  CA  . GLY B  1 211 ? 34.145  61.941  19.368   1.00 78.94  ? 237 GLY B CA  1 
ATOM   3720  C  C   . GLY B  1 211 ? 33.335  60.927  20.151   1.00 82.37  ? 237 GLY B C   1 
ATOM   3721  O  O   . GLY B  1 211 ? 33.600  60.612  21.312   1.00 87.16  ? 237 GLY B O   1 
ATOM   3722  N  N   . LYS B  1 212 ? 32.312  60.409  19.472   1.00 89.49  ? 238 LYS B N   1 
ATOM   3723  C  CA  . LYS B  1 212 ? 31.322  59.510  20.052   1.00 83.12  ? 238 LYS B CA  1 
ATOM   3724  C  C   . LYS B  1 212 ? 31.937  58.165  20.424   1.00 83.22  ? 238 LYS B C   1 
ATOM   3725  O  O   . LYS B  1 212 ? 32.020  57.828  21.610   1.00 80.80  ? 238 LYS B O   1 
ATOM   3726  C  CB  . LYS B  1 212 ? 30.158  59.363  19.065   1.00 85.64  ? 238 LYS B CB  1 
ATOM   3727  C  CG  . LYS B  1 212 ? 29.323  58.095  19.125   1.00 83.49  ? 238 LYS B CG  1 
ATOM   3728  C  CD  . LYS B  1 212 ? 28.900  57.729  17.703   1.00 88.01  ? 238 LYS B CD  1 
ATOM   3729  C  CE  . LYS B  1 212 ? 28.592  56.254  17.538   1.00 86.03  ? 238 LYS B CE  1 
ATOM   3730  N  NZ  . LYS B  1 212 ? 28.480  55.851  16.109   1.00 73.46  ? 238 LYS B NZ  1 
ATOM   3731  N  N   . GLU B  1 213 ? 32.375  57.393  19.432   1.00 80.89  ? 239 GLU B N   1 
ATOM   3732  C  CA  . GLU B  1 213 ? 33.081  56.138  19.662   1.00 82.45  ? 239 GLU B CA  1 
ATOM   3733  C  C   . GLU B  1 213 ? 34.537  56.250  19.229   1.00 79.60  ? 239 GLU B C   1 
ATOM   3734  O  O   . GLU B  1 213 ? 35.086  55.333  18.614   1.00 79.67  ? 239 GLU B O   1 
ATOM   3735  C  CB  . GLU B  1 213 ? 32.404  54.981  18.931   1.00 79.04  ? 239 GLU B CB  1 
ATOM   3736  C  CG  . GLU B  1 213 ? 30.956  54.739  19.315   1.00 89.93  ? 239 GLU B CG  1 
ATOM   3737  C  CD  . GLU B  1 213 ? 30.785  53.839  20.523   1.00 97.26  ? 239 GLU B CD  1 
ATOM   3738  O  OE1 . GLU B  1 213 ? 30.088  52.808  20.391   1.00 95.67  ? 239 GLU B OE1 1 
ATOM   3739  O  OE2 . GLU B  1 213 ? 31.331  54.156  21.602   1.00 92.41  ? 239 GLU B OE2 1 
ATOM   3740  N  N   . CYS B  1 214 ? 35.174  57.379  19.555   1.00 69.03  ? 240 CYS B N   1 
ATOM   3741  C  CA  . CYS B  1 214 ? 36.515  57.687  19.062   1.00 74.03  ? 240 CYS B CA  1 
ATOM   3742  C  C   . CYS B  1 214 ? 36.525  57.602  17.541   1.00 75.02  ? 240 CYS B C   1 
ATOM   3743  O  O   . CYS B  1 214 ? 37.396  56.986  16.922   1.00 73.29  ? 240 CYS B O   1 
ATOM   3744  C  CB  . CYS B  1 214 ? 37.560  56.768  19.690   1.00 68.73  ? 240 CYS B CB  1 
ATOM   3745  S  SG  . CYS B  1 214 ? 37.354  56.667  21.466   1.00 73.08  ? 240 CYS B SG  1 
ATOM   3746  N  N   . LYS B  1 215 ? 35.514  58.226  16.946   1.00 79.68  ? 241 LYS B N   1 
ATOM   3747  C  CA  . LYS B  1 215 ? 35.281  58.174  15.514   1.00 80.65  ? 241 LYS B CA  1 
ATOM   3748  C  C   . LYS B  1 215 ? 35.826  59.370  14.757   1.00 78.87  ? 241 LYS B C   1 
ATOM   3749  O  O   . LYS B  1 215 ? 36.110  59.258  13.558   1.00 78.54  ? 241 LYS B O   1 
ATOM   3750  C  CB  . LYS B  1 215 ? 33.777  58.094  15.257   1.00 79.52  ? 241 LYS B CB  1 
ATOM   3751  C  CG  . LYS B  1 215 ? 33.152  56.812  15.715   1.00 79.80  ? 241 LYS B CG  1 
ATOM   3752  C  CD  . LYS B  1 215 ? 32.578  56.163  14.497   1.00 77.76  ? 241 LYS B CD  1 
ATOM   3753  C  CE  . LYS B  1 215 ? 33.726  55.826  13.580   1.00 86.64  ? 241 LYS B CE  1 
ATOM   3754  N  NZ  . LYS B  1 215 ? 33.287  55.311  12.259   1.00 83.45  ? 241 LYS B NZ  1 
ATOM   3755  N  N   . GLU B  1 216 ? 35.977  60.503  15.428   1.00 74.02  ? 242 GLU B N   1 
ATOM   3756  C  CA  . GLU B  1 216 ? 36.511  61.712  14.830   1.00 72.01  ? 242 GLU B CA  1 
ATOM   3757  C  C   . GLU B  1 216 ? 37.990  61.862  15.168   1.00 72.21  ? 242 GLU B C   1 
ATOM   3758  O  O   . GLU B  1 216 ? 38.456  61.427  16.224   1.00 76.64  ? 242 GLU B O   1 
ATOM   3759  C  CB  . GLU B  1 216 ? 35.710  62.930  15.294   1.00 80.18  ? 242 GLU B CB  1 
ATOM   3760  C  CG  . GLU B  1 216 ? 34.272  62.922  14.770   1.00 87.24  ? 242 GLU B CG  1 
ATOM   3761  C  CD  . GLU B  1 216 ? 33.326  63.787  15.583   1.00 96.31  ? 242 GLU B CD  1 
ATOM   3762  O  OE1 . GLU B  1 216 ? 33.599  64.996  15.730   1.00 93.01  ? 242 GLU B OE1 1 
ATOM   3763  O  OE2 . GLU B  1 216 ? 32.305  63.256  16.074   1.00 98.85  ? 242 GLU B OE2 1 
ATOM   3764  N  N   . ALA B  1 217 ? 38.723  62.488  14.258   1.00 71.59  ? 243 ALA B N   1 
ATOM   3765  C  CA  . ALA B  1 217 ? 40.166  62.618  14.369   1.00 79.51  ? 243 ALA B CA  1 
ATOM   3766  C  C   . ALA B  1 217 ? 40.534  64.052  14.720   1.00 77.36  ? 243 ALA B C   1 
ATOM   3767  O  O   . ALA B  1 217 ? 39.804  64.994  14.397   1.00 73.47  ? 243 ALA B O   1 
ATOM   3768  C  CB  . ALA B  1 217 ? 40.857  62.205  13.065   1.00 76.16  ? 243 ALA B CB  1 
ATOM   3769  N  N   . VAL B  1 218 ? 41.668  64.212  15.395   1.00 73.03  ? 244 VAL B N   1 
ATOM   3770  C  CA  . VAL B  1 218 ? 42.147  65.547  15.735   1.00 73.14  ? 244 VAL B CA  1 
ATOM   3771  C  C   . VAL B  1 218 ? 42.949  66.091  14.559   1.00 79.34  ? 244 VAL B C   1 
ATOM   3772  O  O   . VAL B  1 218 ? 43.882  65.447  14.065   1.00 76.34  ? 244 VAL B O   1 
ATOM   3773  C  CB  . VAL B  1 218 ? 42.967  65.537  17.040   1.00 81.20  ? 244 VAL B CB  1 
ATOM   3774  C  CG1 . VAL B  1 218 ? 44.412  65.060  16.838   1.00 79.22  ? 244 VAL B CG1 1 
ATOM   3775  C  CG2 . VAL B  1 218 ? 42.947  66.915  17.682   1.00 76.37  ? 244 VAL B CG2 1 
ATOM   3776  N  N   . CYS B  1 219 ? 42.525  67.241  14.047   1.00 81.03  ? 245 CYS B N   1 
ATOM   3777  C  CA  . CYS B  1 219 ? 43.300  67.904  13.019   1.00 68.35  ? 245 CYS B CA  1 
ATOM   3778  C  C   . CYS B  1 219 ? 44.424  68.698  13.667   1.00 67.82  ? 245 CYS B C   1 
ATOM   3779  O  O   . CYS B  1 219 ? 44.371  69.041  14.852   1.00 79.07  ? 245 CYS B O   1 
ATOM   3780  C  CB  . CYS B  1 219 ? 42.417  68.816  12.171   1.00 66.28  ? 245 CYS B CB  1 
ATOM   3781  S  SG  . CYS B  1 219 ? 40.953  67.993  11.527   1.00 78.43  ? 245 CYS B SG  1 
ATOM   3782  N  N   . LYS B  1 220 ? 45.457  68.971  12.877   1.00 67.09  ? 246 LYS B N   1 
ATOM   3783  C  CA  . LYS B  1 220 ? 46.566  69.784  13.352   1.00 66.24  ? 246 LYS B CA  1 
ATOM   3784  C  C   . LYS B  1 220 ? 46.054  71.080  13.971   1.00 68.65  ? 246 LYS B C   1 
ATOM   3785  O  O   . LYS B  1 220 ? 45.130  71.714  13.455   1.00 65.87  ? 246 LYS B O   1 
ATOM   3786  C  CB  . LYS B  1 220 ? 47.520  70.085  12.195   1.00 65.62  ? 246 LYS B CB  1 
ATOM   3787  C  CG  . LYS B  1 220 ? 48.336  71.355  12.352   1.00 62.87  ? 246 LYS B CG  1 
ATOM   3788  C  CD  . LYS B  1 220 ? 48.799  71.849  10.995   1.00 60.31  ? 246 LYS B CD  1 
ATOM   3789  C  CE  . LYS B  1 220 ? 49.532  70.750  10.240   1.00 65.32  ? 246 LYS B CE  1 
ATOM   3790  N  NZ  . LYS B  1 220 ? 49.573  71.000  8.770    1.00 69.68  ? 246 LYS B NZ  1 
ATOM   3791  N  N   . GLN B  1 221 ? 46.646  71.447  15.104   1.00 69.42  ? 247 GLN B N   1 
ATOM   3792  C  CA  . GLN B  1 221 ? 46.264  72.661  15.808   1.00 60.42  ? 247 GLN B CA  1 
ATOM   3793  C  C   . GLN B  1 221 ? 46.589  73.881  14.954   1.00 55.89  ? 247 GLN B C   1 
ATOM   3794  O  O   . GLN B  1 221 ? 47.715  74.036  14.465   1.00 49.46  ? 247 GLN B O   1 
ATOM   3795  C  CB  . GLN B  1 221 ? 46.977  72.730  17.161   1.00 69.18  ? 247 GLN B CB  1 
ATOM   3796  C  CG  . GLN B  1 221 ? 48.513  72.811  17.123   1.00 79.69  ? 247 GLN B CG  1 
ATOM   3797  C  CD  . GLN B  1 221 ? 49.214  71.617  16.462   1.00 84.20  ? 247 GLN B CD  1 
ATOM   3798  O  OE1 . GLN B  1 221 ? 48.584  70.752  15.849   1.00 84.42  ? 247 GLN B OE1 1 
ATOM   3799  N  NE2 . GLN B  1 221 ? 50.536  71.581  16.586   1.00 78.83  ? 247 GLN B NE2 1 
ATOM   3800  N  N   . GLY B  1 222 ? 45.592  74.736  14.749   1.00 53.47  ? 248 GLY B N   1 
ATOM   3801  C  CA  . GLY B  1 222 ? 45.731  75.872  13.865   1.00 44.17  ? 248 GLY B CA  1 
ATOM   3802  C  C   . GLY B  1 222 ? 45.180  75.650  12.477   1.00 38.55  ? 248 GLY B C   1 
ATOM   3803  O  O   . GLY B  1 222 ? 45.195  76.579  11.667   1.00 40.46  ? 248 GLY B O   1 
ATOM   3804  N  N   . CYS B  1 223 ? 44.685  74.453  12.184   1.00 46.87  ? 249 CYS B N   1 
ATOM   3805  C  CA  . CYS B  1 223 ? 44.094  74.177  10.886   1.00 41.79  ? 249 CYS B CA  1 
ATOM   3806  C  C   . CYS B  1 223 ? 42.810  74.978  10.743   1.00 37.93  ? 249 CYS B C   1 
ATOM   3807  O  O   . CYS B  1 223 ? 41.935  74.930  11.612   1.00 38.41  ? 249 CYS B O   1 
ATOM   3808  C  CB  . CYS B  1 223 ? 43.808  72.682  10.746   1.00 46.53  ? 249 CYS B CB  1 
ATOM   3809  S  SG  . CYS B  1 223 ? 43.244  72.118  9.120    1.00 47.96  ? 249 CYS B SG  1 
ATOM   3810  N  N   . ASN B  1 224 ? 42.700  75.728  9.653    1.00 42.33  ? 250 ASN B N   1 
ATOM   3811  C  CA  . ASN B  1 224 ? 41.492  76.502  9.393    1.00 42.41  ? 250 ASN B CA  1 
ATOM   3812  C  C   . ASN B  1 224 ? 40.389  75.535  8.991    1.00 47.21  ? 250 ASN B C   1 
ATOM   3813  O  O   . ASN B  1 224 ? 40.271  75.158  7.823    1.00 42.67  ? 250 ASN B O   1 
ATOM   3814  C  CB  . ASN B  1 224 ? 41.741  77.537  8.303    1.00 35.42  ? 250 ASN B CB  1 
ATOM   3815  C  CG  . ASN B  1 224 ? 40.608  78.532  8.179    1.00 41.75  ? 250 ASN B CG  1 
ATOM   3816  O  OD1 . ASN B  1 224 ? 39.478  78.260  8.584    1.00 45.53  ? 250 ASN B OD1 1 
ATOM   3817  N  ND2 . ASN B  1 224 ? 40.901  79.694  7.604    1.00 43.80  ? 250 ASN B ND2 1 
ATOM   3818  N  N   . LEU B  1 225 ? 39.558  75.152  9.955    1.00 48.71  ? 251 LEU B N   1 
ATOM   3819  C  CA  . LEU B  1 225 ? 38.531  74.144  9.737    1.00 49.28  ? 251 LEU B CA  1 
ATOM   3820  C  C   . LEU B  1 225 ? 37.328  74.677  8.958    1.00 47.67  ? 251 LEU B C   1 
ATOM   3821  O  O   . LEU B  1 225 ? 36.328  73.965  8.834    1.00 51.97  ? 251 LEU B O   1 
ATOM   3822  C  CB  . LEU B  1 225 ? 38.087  73.556  11.079   1.00 49.37  ? 251 LEU B CB  1 
ATOM   3823  C  CG  . LEU B  1 225 ? 39.214  72.795  11.776   1.00 50.62  ? 251 LEU B CG  1 
ATOM   3824  C  CD1 . LEU B  1 225 ? 38.872  72.431  13.217   1.00 49.40  ? 251 LEU B CD1 1 
ATOM   3825  C  CD2 . LEU B  1 225 ? 39.552  71.551  10.976   1.00 49.42  ? 251 LEU B CD2 1 
ATOM   3826  N  N   . LEU B  1 226 ? 37.403  75.902  8.436    1.00 45.27  ? 252 LEU B N   1 
ATOM   3827  C  CA  . LEU B  1 226 ? 36.493  76.354  7.389    1.00 45.20  ? 252 LEU B CA  1 
ATOM   3828  C  C   . LEU B  1 226 ? 37.016  76.081  5.988    1.00 41.68  ? 252 LEU B C   1 
ATOM   3829  O  O   . LEU B  1 226 ? 36.234  76.130  5.035    1.00 54.71  ? 252 LEU B O   1 
ATOM   3830  C  CB  . LEU B  1 226 ? 36.225  77.858  7.546    1.00 47.47  ? 252 LEU B CB  1 
ATOM   3831  C  CG  . LEU B  1 226 ? 34.888  78.521  7.178    1.00 58.07  ? 252 LEU B CG  1 
ATOM   3832  C  CD1 . LEU B  1 226 ? 34.663  78.662  5.679    1.00 60.45  ? 252 LEU B CD1 1 
ATOM   3833  C  CD2 . LEU B  1 226 ? 33.701  77.850  7.857    1.00 52.69  ? 252 LEU B CD2 1 
ATOM   3834  N  N   . HIS B  1 227 ? 38.303  75.755  5.846    1.00 39.56  ? 253 HIS B N   1 
ATOM   3835  C  CA  . HIS B  1 227 ? 38.911  75.492  4.549    1.00 35.76  ? 253 HIS B CA  1 
ATOM   3836  C  C   . HIS B  1 227 ? 39.593  74.135  4.475    1.00 37.53  ? 253 HIS B C   1 
ATOM   3837  O  O   . HIS B  1 227 ? 40.157  73.797  3.428    1.00 41.31  ? 253 HIS B O   1 
ATOM   3838  C  CB  . HIS B  1 227 ? 39.921  76.600  4.207    1.00 38.26  ? 253 HIS B CB  1 
ATOM   3839  C  CG  . HIS B  1 227 ? 39.340  77.980  4.288    1.00 39.46  ? 253 HIS B CG  1 
ATOM   3840  N  ND1 . HIS B  1 227 ? 40.061  79.070  4.725    1.00 35.39  ? 253 HIS B ND1 1 
ATOM   3841  C  CD2 . HIS B  1 227 ? 38.098  78.442  4.003    1.00 34.56  ? 253 HIS B CD2 1 
ATOM   3842  C  CE1 . HIS B  1 227 ? 39.292  80.144  4.698    1.00 36.83  ? 253 HIS B CE1 1 
ATOM   3843  N  NE2 . HIS B  1 227 ? 38.095  79.790  4.265    1.00 33.41  ? 253 HIS B NE2 1 
ATOM   3844  N  N   . GLY B  1 228 ? 39.562  73.350  5.548    1.00 37.97  ? 254 GLY B N   1 
ATOM   3845  C  CA  . GLY B  1 228 ? 40.180  72.041  5.534    1.00 38.92  ? 254 GLY B CA  1 
ATOM   3846  C  C   . GLY B  1 228 ? 39.659  71.176  6.660    1.00 48.32  ? 254 GLY B C   1 
ATOM   3847  O  O   . GLY B  1 228 ? 38.827  71.593  7.470    1.00 47.76  ? 254 GLY B O   1 
ATOM   3848  N  N   . GLY B  1 229 ? 40.168  69.958  6.697    1.00 42.13  ? 255 GLY B N   1 
ATOM   3849  C  CA  . GLY B  1 229 ? 39.802  69.004  7.715    1.00 48.01  ? 255 GLY B CA  1 
ATOM   3850  C  C   . GLY B  1 229 ? 40.883  67.965  7.825    1.00 56.04  ? 255 GLY B C   1 
ATOM   3851  O  O   . GLY B  1 229 ? 42.030  68.199  7.440    1.00 55.27  ? 255 GLY B O   1 
ATOM   3852  N  N   . CYS B  1 230 ? 40.511  66.797  8.343    1.00 58.85  ? 256 CYS B N   1 
ATOM   3853  C  CA  . CYS B  1 230 ? 41.495  65.736  8.490    1.00 63.20  ? 256 CYS B CA  1 
ATOM   3854  C  C   . CYS B  1 230 ? 40.795  64.392  8.629    1.00 69.46  ? 256 CYS B C   1 
ATOM   3855  O  O   . CYS B  1 230 ? 39.725  64.302  9.237    1.00 67.41  ? 256 CYS B O   1 
ATOM   3856  C  CB  . CYS B  1 230 ? 42.400  65.988  9.702    1.00 66.58  ? 256 CYS B CB  1 
ATOM   3857  S  SG  . CYS B  1 230 ? 41.536  66.059  11.291   1.00 75.00  ? 256 CYS B SG  1 
ATOM   3858  N  N   . THR B  1 231 ? 41.403  63.359  8.036    1.00 72.92  ? 257 THR B N   1 
ATOM   3859  C  CA  . THR B  1 231 ? 41.051  61.970  8.296    1.00 68.73  ? 257 THR B CA  1 
ATOM   3860  C  C   . THR B  1 231 ? 42.109  61.238  9.109    1.00 69.77  ? 257 THR B C   1 
ATOM   3861  O  O   . THR B  1 231 ? 41.783  60.251  9.776    1.00 70.09  ? 257 THR B O   1 
ATOM   3862  C  CB  . THR B  1 231 ? 40.819  61.207  6.981    1.00 61.29  ? 257 THR B CB  1 
ATOM   3863  O  OG1 . THR B  1 231 ? 41.826  61.570  6.029    1.00 77.67  ? 257 THR B OG1 1 
ATOM   3864  C  CG2 . THR B  1 231 ? 39.446  61.531  6.409    1.00 52.50  ? 257 THR B CG2 1 
ATOM   3865  N  N   . VAL B  1 232 ? 43.356  61.697  9.066    1.00 70.02  ? 258 VAL B N   1 
ATOM   3866  C  CA  . VAL B  1 232 ? 44.452  61.172  9.878    1.00 64.29  ? 258 VAL B CA  1 
ATOM   3867  C  C   . VAL B  1 232 ? 44.751  62.195  10.968   1.00 70.57  ? 258 VAL B C   1 
ATOM   3868  O  O   . VAL B  1 232 ? 44.695  63.404  10.703   1.00 76.31  ? 258 VAL B O   1 
ATOM   3869  C  CB  . VAL B  1 232 ? 45.691  60.894  9.010    1.00 63.89  ? 258 VAL B CB  1 
ATOM   3870  C  CG1 . VAL B  1 232 ? 46.887  60.489  9.862    1.00 60.10  ? 258 VAL B CG1 1 
ATOM   3871  C  CG2 . VAL B  1 232 ? 45.381  59.832  7.965    1.00 68.39  ? 258 VAL B CG2 1 
ATOM   3872  N  N   . PRO B  1 233 ? 45.030  61.777  12.204   1.00 75.06  ? 259 PRO B N   1 
ATOM   3873  C  CA  . PRO B  1 233 ? 45.365  62.753  13.249   1.00 70.30  ? 259 PRO B CA  1 
ATOM   3874  C  C   . PRO B  1 233 ? 46.616  63.548  12.900   1.00 66.33  ? 259 PRO B C   1 
ATOM   3875  O  O   . PRO B  1 233 ? 47.550  63.036  12.279   1.00 59.70  ? 259 PRO B O   1 
ATOM   3876  C  CB  . PRO B  1 233 ? 45.578  61.885  14.493   1.00 68.83  ? 259 PRO B CB  1 
ATOM   3877  C  CG  . PRO B  1 233 ? 44.800  60.650  14.232   1.00 73.04  ? 259 PRO B CG  1 
ATOM   3878  C  CD  . PRO B  1 233 ? 44.849  60.421  12.749   1.00 74.78  ? 259 PRO B CD  1 
ATOM   3879  N  N   . GLY B  1 234 ? 46.618  64.820  13.298   1.00 72.11  ? 260 GLY B N   1 
ATOM   3880  C  CA  . GLY B  1 234 ? 47.777  65.674  13.134   1.00 69.88  ? 260 GLY B CA  1 
ATOM   3881  C  C   . GLY B  1 234 ? 48.002  66.214  11.741   1.00 72.45  ? 260 GLY B C   1 
ATOM   3882  O  O   . GLY B  1 234 ? 49.095  66.722  11.462   1.00 69.33  ? 260 GLY B O   1 
ATOM   3883  N  N   . GLU B  1 235 ? 47.011  66.130  10.859   1.00 69.91  ? 261 GLU B N   1 
ATOM   3884  C  CA  . GLU B  1 235 ? 47.129  66.625  9.498    1.00 62.65  ? 261 GLU B CA  1 
ATOM   3885  C  C   . GLU B  1 235 ? 46.094  67.712  9.240    1.00 66.55  ? 261 GLU B C   1 
ATOM   3886  O  O   . GLU B  1 235 ? 45.140  67.898  10.001   1.00 66.27  ? 261 GLU B O   1 
ATOM   3887  C  CB  . GLU B  1 235 ? 46.966  65.488  8.481    1.00 60.06  ? 261 GLU B CB  1 
ATOM   3888  C  CG  . GLU B  1 235 ? 45.515  65.134  8.193    1.00 67.58  ? 261 GLU B CG  1 
ATOM   3889  C  CD  . GLU B  1 235 ? 45.355  64.170  7.031    1.00 69.97  ? 261 GLU B CD  1 
ATOM   3890  O  OE1 . GLU B  1 235 ? 46.381  63.729  6.469    1.00 67.66  ? 261 GLU B OE1 1 
ATOM   3891  O  OE2 . GLU B  1 235 ? 44.198  63.853  6.684    1.00 69.13  ? 261 GLU B OE2 1 
ATOM   3892  N  N   . CYS B  1 236 ? 46.304  68.434  8.138    1.00 65.04  ? 262 CYS B N   1 
ATOM   3893  C  CA  . CYS B  1 236 ? 45.420  69.527  7.737    1.00 56.76  ? 262 CYS B CA  1 
ATOM   3894  C  C   . CYS B  1 236 ? 45.379  69.524  6.211    1.00 57.98  ? 262 CYS B C   1 
ATOM   3895  O  O   . CYS B  1 236 ? 46.327  69.978  5.564    1.00 62.35  ? 262 CYS B O   1 
ATOM   3896  C  CB  . CYS B  1 236 ? 45.911  70.858  8.294    1.00 54.78  ? 262 CYS B CB  1 
ATOM   3897  S  SG  . CYS B  1 236 ? 44.874  72.296  7.926    1.00 46.43  ? 262 CYS B SG  1 
ATOM   3898  N  N   . ARG B  1 237 ? 44.295  68.993  5.650    1.00 56.42  ? 263 ARG B N   1 
ATOM   3899  C  CA  . ARG B  1 237 ? 44.107  68.909  4.207    1.00 51.70  ? 263 ARG B CA  1 
ATOM   3900  C  C   . ARG B  1 237 ? 42.993  69.854  3.779    1.00 48.72  ? 263 ARG B C   1 
ATOM   3901  O  O   . ARG B  1 237 ? 41.895  69.822  4.343    1.00 44.76  ? 263 ARG B O   1 
ATOM   3902  C  CB  . ARG B  1 237 ? 43.789  67.478  3.764    1.00 56.28  ? 263 ARG B CB  1 
ATOM   3903  C  CG  . ARG B  1 237 ? 45.018  66.618  3.478    1.00 64.84  ? 263 ARG B CG  1 
ATOM   3904  C  CD  . ARG B  1 237 ? 46.155  67.392  2.783    1.00 69.74  ? 263 ARG B CD  1 
ATOM   3905  N  NE  . ARG B  1 237 ? 45.705  68.209  1.645    1.00 76.55  ? 263 ARG B NE  1 
ATOM   3906  C  CZ  . ARG B  1 237 ? 46.346  69.284  1.187    1.00 68.35  ? 263 ARG B CZ  1 
ATOM   3907  N  NH1 . ARG B  1 237 ? 47.470  69.687  1.766    1.00 71.48  ? 263 ARG B NH1 1 
ATOM   3908  N  NH2 . ARG B  1 237 ? 45.850  69.952  0.157    1.00 57.85  ? 263 ARG B NH2 1 
ATOM   3909  N  N   . CYS B  1 238 ? 43.271  70.669  2.767    1.00 52.56  ? 264 CYS B N   1 
ATOM   3910  C  CA  . CYS B  1 238 ? 42.419  71.791  2.398    1.00 41.86  ? 264 CYS B CA  1 
ATOM   3911  C  C   . CYS B  1 238 ? 41.327  71.378  1.417    1.00 32.92  ? 264 CYS B C   1 
ATOM   3912  O  O   . CYS B  1 238 ? 41.509  70.476  0.596    1.00 35.15  ? 264 CYS B O   1 
ATOM   3913  C  CB  . CYS B  1 238 ? 43.257  72.911  1.778    1.00 34.27  ? 264 CYS B CB  1 
ATOM   3914  S  SG  . CYS B  1 238 ? 44.814  73.259  2.623    1.00 39.13  ? 264 CYS B SG  1 
ATOM   3915  N  N   . SER B  1 239 ? 40.178  72.046  1.518    1.00 29.86  ? 265 SER B N   1 
ATOM   3916  C  CA  . SER B  1 239 ? 39.149  71.943  0.492    1.00 32.65  ? 265 SER B CA  1 
ATOM   3917  C  C   . SER B  1 239 ? 39.645  72.575  -0.808   1.00 36.59  ? 265 SER B C   1 
ATOM   3918  O  O   . SER B  1 239 ? 40.672  73.259  -0.844   1.00 39.69  ? 265 SER B O   1 
ATOM   3919  C  CB  . SER B  1 239 ? 37.859  72.632  0.939    1.00 36.71  ? 265 SER B CB  1 
ATOM   3920  O  OG  . SER B  1 239 ? 37.559  72.351  2.293    1.00 46.75  ? 265 SER B OG  1 
ATOM   3921  N  N   . TYR B  1 240 ? 38.899  72.354  -1.889   1.00 29.68  ? 266 TYR B N   1 
ATOM   3922  C  CA  . TYR B  1 240 ? 39.298  72.919  -3.170   1.00 31.96  ? 266 TYR B CA  1 
ATOM   3923  C  C   . TYR B  1 240 ? 39.203  74.440  -3.117   1.00 36.34  ? 266 TYR B C   1 
ATOM   3924  O  O   . TYR B  1 240 ? 38.170  74.997  -2.733   1.00 39.64  ? 266 TYR B O   1 
ATOM   3925  C  CB  . TYR B  1 240 ? 38.441  72.371  -4.312   1.00 34.64  ? 266 TYR B CB  1 
ATOM   3926  C  CG  . TYR B  1 240 ? 38.900  72.877  -5.663   1.00 35.37  ? 266 TYR B CG  1 
ATOM   3927  C  CD1 . TYR B  1 240 ? 39.958  72.268  -6.328   1.00 38.40  ? 266 TYR B CD1 1 
ATOM   3928  C  CD2 . TYR B  1 240 ? 38.305  73.984  -6.254   1.00 32.62  ? 266 TYR B CD2 1 
ATOM   3929  C  CE1 . TYR B  1 240 ? 40.399  72.733  -7.553   1.00 33.90  ? 266 TYR B CE1 1 
ATOM   3930  C  CE2 . TYR B  1 240 ? 38.740  74.459  -7.477   1.00 38.25  ? 266 TYR B CE2 1 
ATOM   3931  C  CZ  . TYR B  1 240 ? 39.787  73.830  -8.123   1.00 43.65  ? 266 TYR B CZ  1 
ATOM   3932  O  OH  . TYR B  1 240 ? 40.222  74.300  -9.343   1.00 46.13  ? 266 TYR B OH  1 
ATOM   3933  N  N   . GLY B  1 241 ? 40.296  75.110  -3.480   1.00 34.22  ? 267 GLY B N   1 
ATOM   3934  C  CA  . GLY B  1 241 ? 40.365  76.557  -3.470   1.00 33.91  ? 267 GLY B CA  1 
ATOM   3935  C  C   . GLY B  1 241 ? 41.247  77.152  -2.391   1.00 34.15  ? 267 GLY B C   1 
ATOM   3936  O  O   . GLY B  1 241 ? 41.368  78.381  -2.331   1.00 34.83  ? 267 GLY B O   1 
ATOM   3937  N  N   . TRP B  1 242 ? 41.872  76.334  -1.544   1.00 32.05  ? 268 TRP B N   1 
ATOM   3938  C  CA  . TRP B  1 242 ? 42.707  76.837  -0.463   1.00 30.66  ? 268 TRP B CA  1 
ATOM   3939  C  C   . TRP B  1 242 ? 43.964  75.985  -0.357   1.00 31.11  ? 268 TRP B C   1 
ATOM   3940  O  O   . TRP B  1 242 ? 43.998  74.830  -0.790   1.00 31.53  ? 268 TRP B O   1 
ATOM   3941  C  CB  . TRP B  1 242 ? 41.951  76.857  0.876    1.00 33.24  ? 268 TRP B CB  1 
ATOM   3942  C  CG  . TRP B  1 242 ? 40.756  77.765  0.867    1.00 33.16  ? 268 TRP B CG  1 
ATOM   3943  C  CD1 . TRP B  1 242 ? 39.474  77.423  0.565    1.00 34.43  ? 268 TRP B CD1 1 
ATOM   3944  C  CD2 . TRP B  1 242 ? 40.739  79.172  1.149    1.00 32.32  ? 268 TRP B CD2 1 
ATOM   3945  N  NE1 . TRP B  1 242 ? 38.657  78.525  0.644    1.00 32.97  ? 268 TRP B NE1 1 
ATOM   3946  C  CE2 . TRP B  1 242 ? 39.410  79.611  1.003    1.00 30.76  ? 268 TRP B CE2 1 
ATOM   3947  C  CE3 . TRP B  1 242 ? 41.719  80.100  1.511    1.00 34.77  ? 268 TRP B CE3 1 
ATOM   3948  C  CZ2 . TRP B  1 242 ? 39.034  80.933  1.211    1.00 37.12  ? 268 TRP B CZ2 1 
ATOM   3949  C  CZ3 . TRP B  1 242 ? 41.344  81.416  1.714    1.00 33.61  ? 268 TRP B CZ3 1 
ATOM   3950  C  CH2 . TRP B  1 242 ? 40.014  81.820  1.563    1.00 37.70  ? 268 TRP B CH2 1 
ATOM   3951  N  N   . GLN B  1 243 ? 45.001  76.569  0.237    1.00 27.61  ? 269 GLN B N   1 
ATOM   3952  C  CA  . GLN B  1 243 ? 46.300  75.921  0.347    1.00 34.42  ? 269 GLN B CA  1 
ATOM   3953  C  C   . GLN B  1 243 ? 47.014  76.461  1.581    1.00 35.46  ? 269 GLN B C   1 
ATOM   3954  O  O   . GLN B  1 243 ? 46.522  77.364  2.263    1.00 34.07  ? 269 GLN B O   1 
ATOM   3955  C  CB  . GLN B  1 243 ? 47.140  76.147  -0.910   1.00 28.08  ? 269 GLN B CB  1 
ATOM   3956  C  CG  . GLN B  1 243 ? 47.249  77.607  -1.301   1.00 31.28  ? 269 GLN B CG  1 
ATOM   3957  C  CD  . GLN B  1 243 ? 48.216  77.833  -2.440   1.00 31.96  ? 269 GLN B CD  1 
ATOM   3958  O  OE1 . GLN B  1 243 ? 48.987  76.945  -2.796   1.00 38.68  ? 269 GLN B OE1 1 
ATOM   3959  N  NE2 . GLN B  1 243 ? 48.173  79.022  -3.027   1.00 31.95  ? 269 GLN B NE2 1 
ATOM   3960  N  N   . GLY B  1 244 ? 48.180  75.900  1.864    1.00 28.25  ? 270 GLY B N   1 
ATOM   3961  C  CA  . GLY B  1 244 ? 49.006  76.350  2.964    1.00 37.44  ? 270 GLY B CA  1 
ATOM   3962  C  C   . GLY B  1 244 ? 49.096  75.320  4.079    1.00 40.91  ? 270 GLY B C   1 
ATOM   3963  O  O   . GLY B  1 244 ? 48.394  74.308  4.105    1.00 36.79  ? 270 GLY B O   1 
ATOM   3964  N  N   . ARG B  1 245 ? 49.998  75.616  5.019    1.00 39.75  ? 271 ARG B N   1 
ATOM   3965  C  CA  . ARG B  1 245 ? 50.194  74.743  6.170    1.00 35.38  ? 271 ARG B CA  1 
ATOM   3966  C  C   . ARG B  1 245 ? 48.920  74.631  7.000    1.00 44.97  ? 271 ARG B C   1 
ATOM   3967  O  O   . ARG B  1 245 ? 48.597  73.551  7.512    1.00 51.66  ? 271 ARG B O   1 
ATOM   3968  C  CB  . ARG B  1 245 ? 51.355  75.265  7.019    1.00 35.77  ? 271 ARG B CB  1 
ATOM   3969  C  CG  . ARG B  1 245 ? 51.739  74.386  8.198    1.00 49.71  ? 271 ARG B CG  1 
ATOM   3970  C  CD  . ARG B  1 245 ? 53.181  74.646  8.634    1.00 49.16  ? 271 ARG B CD  1 
ATOM   3971  N  NE  . ARG B  1 245 ? 53.372  75.981  9.198    1.00 52.46  ? 271 ARG B NE  1 
ATOM   3972  C  CZ  . ARG B  1 245 ? 53.601  76.227  10.487   1.00 60.75  ? 271 ARG B CZ  1 
ATOM   3973  N  NH1 . ARG B  1 245 ? 53.674  75.229  11.360   1.00 51.48  ? 271 ARG B NH1 1 
ATOM   3974  N  NH2 . ARG B  1 245 ? 53.762  77.476  10.908   1.00 55.47  ? 271 ARG B NH2 1 
ATOM   3975  N  N   . PHE B  1 246 ? 48.180  75.731  7.138    1.00 36.55  ? 272 PHE B N   1 
ATOM   3976  C  CA  . PHE B  1 246 ? 46.931  75.753  7.888    1.00 35.43  ? 272 PHE B CA  1 
ATOM   3977  C  C   . PHE B  1 246 ? 45.710  75.931  6.999    1.00 41.99  ? 272 PHE B C   1 
ATOM   3978  O  O   . PHE B  1 246 ? 44.609  76.157  7.518    1.00 39.07  ? 272 PHE B O   1 
ATOM   3979  C  CB  . PHE B  1 246 ? 46.961  76.861  8.937    1.00 33.13  ? 272 PHE B CB  1 
ATOM   3980  C  CG  . PHE B  1 246 ? 48.186  76.847  9.794    1.00 39.23  ? 272 PHE B CG  1 
ATOM   3981  C  CD1 . PHE B  1 246 ? 48.286  75.972  10.860   1.00 39.47  ? 272 PHE B CD1 1 
ATOM   3982  C  CD2 . PHE B  1 246 ? 49.238  77.710  9.539    1.00 39.29  ? 272 PHE B CD2 1 
ATOM   3983  C  CE1 . PHE B  1 246 ? 49.408  75.958  11.655   1.00 41.37  ? 272 PHE B CE1 1 
ATOM   3984  C  CE2 . PHE B  1 246 ? 50.364  77.698  10.331   1.00 37.54  ? 272 PHE B CE2 1 
ATOM   3985  C  CZ  . PHE B  1 246 ? 50.449  76.822  11.391   1.00 37.09  ? 272 PHE B CZ  1 
ATOM   3986  N  N   . CYS B  1 247 ? 45.880  75.832  5.679    1.00 37.18  ? 273 CYS B N   1 
ATOM   3987  C  CA  . CYS B  1 247 ? 44.797  76.038  4.717    1.00 35.31  ? 273 CYS B CA  1 
ATOM   3988  C  C   . CYS B  1 247 ? 44.209  77.445  4.836    1.00 32.73  ? 273 CYS B C   1 
ATOM   3989  O  O   . CYS B  1 247 ? 42.993  77.643  4.823    1.00 33.84  ? 273 CYS B O   1 
ATOM   3990  C  CB  . CYS B  1 247 ? 43.714  74.968  4.875    1.00 29.41  ? 273 CYS B CB  1 
ATOM   3991  S  SG  . CYS B  1 247 ? 44.309  73.292  4.593    1.00 41.90  ? 273 CYS B SG  1 
ATOM   3992  N  N   . ASP B  1 248 ? 45.094  78.437  4.928    1.00 33.79  ? 274 ASP B N   1 
ATOM   3993  C  CA  . ASP B  1 248 ? 44.684  79.825  5.086    1.00 39.10  ? 274 ASP B CA  1 
ATOM   3994  C  C   . ASP B  1 248 ? 44.885  80.681  3.843    1.00 31.75  ? 274 ASP B C   1 
ATOM   3995  O  O   . ASP B  1 248 ? 44.437  81.832  3.835    1.00 31.46  ? 274 ASP B O   1 
ATOM   3996  C  CB  . ASP B  1 248 ? 45.436  80.480  6.254    1.00 35.47  ? 274 ASP B CB  1 
ATOM   3997  C  CG  . ASP B  1 248 ? 44.601  80.559  7.505    1.00 38.61  ? 274 ASP B CG  1 
ATOM   3998  O  OD1 . ASP B  1 248 ? 43.369  80.385  7.406    1.00 42.67  ? 274 ASP B OD1 1 
ATOM   3999  O  OD2 . ASP B  1 248 ? 45.171  80.822  8.581    1.00 41.86  ? 274 ASP B OD2 1 
ATOM   4000  N  N   . GLU B  1 249 ? 45.522  80.161  2.798    1.00 33.43  ? 275 GLU B N   1 
ATOM   4001  C  CA  . GLU B  1 249 ? 45.860  80.940  1.615    1.00 36.05  ? 275 GLU B CA  1 
ATOM   4002  C  C   . GLU B  1 249 ? 44.955  80.554  0.451    1.00 29.44  ? 275 GLU B C   1 
ATOM   4003  O  O   . GLU B  1 249 ? 44.722  79.368  0.199    1.00 28.34  ? 275 GLU B O   1 
ATOM   4004  C  CB  . GLU B  1 249 ? 47.322  80.723  1.211    1.00 32.09  ? 275 GLU B CB  1 
ATOM   4005  C  CG  . GLU B  1 249 ? 48.270  80.477  2.369    1.00 41.78  ? 275 GLU B CG  1 
ATOM   4006  C  CD  . GLU B  1 249 ? 49.701  80.232  1.910    1.00 53.54  ? 275 GLU B CD  1 
ATOM   4007  O  OE1 . GLU B  1 249 ? 49.918  80.078  0.687    1.00 46.38  ? 275 GLU B OE1 1 
ATOM   4008  O  OE2 . GLU B  1 249 ? 50.604  80.175  2.775    1.00 54.48  ? 275 GLU B OE2 1 
ATOM   4009  N  N   . CYS B  1 250 ? 44.460  81.560  -0.265   1.00 26.47  ? 276 CYS B N   1 
ATOM   4010  C  CA  . CYS B  1 250 ? 43.658  81.301  -1.450   1.00 32.55  ? 276 CYS B CA  1 
ATOM   4011  C  C   . CYS B  1 250 ? 44.496  80.607  -2.517   1.00 31.51  ? 276 CYS B C   1 
ATOM   4012  O  O   . CYS B  1 250 ? 45.728  80.680  -2.531   1.00 32.31  ? 276 CYS B O   1 
ATOM   4013  C  CB  . CYS B  1 250 ? 43.085  82.606  -2.007   1.00 33.40  ? 276 CYS B CB  1 
ATOM   4014  S  SG  . CYS B  1 250 ? 44.332  83.879  -2.327   1.00 42.38  ? 276 CYS B SG  1 
ATOM   4015  N  N   . VAL B  1 251 ? 43.809  79.920  -3.419   1.00 30.86  ? 277 VAL B N   1 
ATOM   4016  C  CA  . VAL B  1 251 ? 44.423  79.335  -4.602   1.00 32.70  ? 277 VAL B CA  1 
ATOM   4017  C  C   . VAL B  1 251 ? 44.003  80.193  -5.799   1.00 34.74  ? 277 VAL B C   1 
ATOM   4018  O  O   . VAL B  1 251 ? 42.802  80.359  -6.037   1.00 32.01  ? 277 VAL B O   1 
ATOM   4019  C  CB  . VAL B  1 251 ? 44.008  77.870  -4.805   1.00 34.88  ? 277 VAL B CB  1 
ATOM   4020  C  CG1 . VAL B  1 251 ? 44.522  77.356  -6.145   1.00 32.34  ? 277 VAL B CG1 1 
ATOM   4021  C  CG2 . VAL B  1 251 ? 44.526  77.010  -3.662   1.00 23.61  ? 277 VAL B CG2 1 
ATOM   4022  N  N   . PRO B  1 252 ? 44.944  80.755  -6.546   1.00 36.63  ? 278 PRO B N   1 
ATOM   4023  C  CA  . PRO B  1 252 ? 44.566  81.633  -7.662   1.00 41.85  ? 278 PRO B CA  1 
ATOM   4024  C  C   . PRO B  1 252 ? 43.923  80.844  -8.793   1.00 34.94  ? 278 PRO B C   1 
ATOM   4025  O  O   . PRO B  1 252 ? 43.870  79.613  -8.786   1.00 33.38  ? 278 PRO B O   1 
ATOM   4026  C  CB  . PRO B  1 252 ? 45.900  82.254  -8.088   1.00 36.19  ? 278 PRO B CB  1 
ATOM   4027  C  CG  . PRO B  1 252 ? 46.923  81.251  -7.669   1.00 37.94  ? 278 PRO B CG  1 
ATOM   4028  C  CD  . PRO B  1 252 ? 46.402  80.637  -6.398   1.00 30.88  ? 278 PRO B CD  1 
ATOM   4029  N  N   . TYR B  1 253 ? 43.401  81.592  -9.762   1.00 37.37  ? 279 TYR B N   1 
ATOM   4030  C  CA  . TYR B  1 253 ? 42.787  80.998  -10.939  1.00 37.65  ? 279 TYR B CA  1 
ATOM   4031  C  C   . TYR B  1 253 ? 43.761  80.020  -11.597  1.00 37.92  ? 279 TYR B C   1 
ATOM   4032  O  O   . TYR B  1 253 ? 44.952  80.332  -11.728  1.00 36.38  ? 279 TYR B O   1 
ATOM   4033  C  CB  . TYR B  1 253 ? 42.387  82.103  -11.920  1.00 37.89  ? 279 TYR B CB  1 
ATOM   4034  C  CG  . TYR B  1 253 ? 41.458  81.676  -13.036  1.00 39.03  ? 279 TYR B CG  1 
ATOM   4035  C  CD1 . TYR B  1 253 ? 41.953  81.108  -14.203  1.00 37.36  ? 279 TYR B CD1 1 
ATOM   4036  C  CD2 . TYR B  1 253 ? 40.086  81.874  -12.934  1.00 42.08  ? 279 TYR B CD2 1 
ATOM   4037  C  CE1 . TYR B  1 253 ? 41.103  80.727  -15.229  1.00 51.27  ? 279 TYR B CE1 1 
ATOM   4038  C  CE2 . TYR B  1 253 ? 39.229  81.503  -13.953  1.00 43.91  ? 279 TYR B CE2 1 
ATOM   4039  C  CZ  . TYR B  1 253 ? 39.740  80.929  -15.099  1.00 51.54  ? 279 TYR B CZ  1 
ATOM   4040  O  OH  . TYR B  1 253 ? 38.888  80.556  -16.114  1.00 45.81  ? 279 TYR B OH  1 
ATOM   4041  N  N   . PRO B  1 254 ? 43.303  78.837  -12.014  1.00 34.94  ? 280 PRO B N   1 
ATOM   4042  C  CA  . PRO B  1 254 ? 44.227  77.833  -12.572  1.00 34.10  ? 280 PRO B CA  1 
ATOM   4043  C  C   . PRO B  1 254 ? 44.930  78.352  -13.819  1.00 48.27  ? 280 PRO B C   1 
ATOM   4044  O  O   . PRO B  1 254 ? 44.302  78.604  -14.852  1.00 40.64  ? 280 PRO B O   1 
ATOM   4045  C  CB  . PRO B  1 254 ? 43.313  76.645  -12.889  1.00 31.40  ? 280 PRO B CB  1 
ATOM   4046  C  CG  . PRO B  1 254 ? 42.085  76.862  -12.076  1.00 38.64  ? 280 PRO B CG  1 
ATOM   4047  C  CD  . PRO B  1 254 ? 41.919  78.342  -11.940  1.00 36.83  ? 280 PRO B CD  1 
ATOM   4048  N  N   . GLY B  1 255 ? 46.251  78.494  -13.716  1.00 51.37  ? 281 GLY B N   1 
ATOM   4049  C  CA  . GLY B  1 255 ? 47.075  79.033  -14.780  1.00 42.04  ? 281 GLY B CA  1 
ATOM   4050  C  C   . GLY B  1 255 ? 47.635  80.409  -14.497  1.00 45.79  ? 281 GLY B C   1 
ATOM   4051  O  O   . GLY B  1 255 ? 48.453  80.897  -15.287  1.00 51.71  ? 281 GLY B O   1 
ATOM   4052  N  N   . CYS B  1 256 ? 47.220  81.049  -13.404  1.00 50.27  ? 282 CYS B N   1 
ATOM   4053  C  CA  . CYS B  1 256 ? 47.716  82.376  -13.057  1.00 51.07  ? 282 CYS B CA  1 
ATOM   4054  C  C   . CYS B  1 256 ? 49.232  82.347  -12.911  1.00 47.30  ? 282 CYS B C   1 
ATOM   4055  O  O   . CYS B  1 256 ? 49.795  81.426  -12.314  1.00 49.31  ? 282 CYS B O   1 
ATOM   4056  C  CB  . CYS B  1 256 ? 47.064  82.854  -11.752  1.00 47.45  ? 282 CYS B CB  1 
ATOM   4057  S  SG  . CYS B  1 256 ? 47.114  84.643  -11.424  1.00 45.20  ? 282 CYS B SG  1 
ATOM   4058  N  N   . VAL B  1 257 ? 49.897  83.359  -13.468  1.00 50.17  ? 283 VAL B N   1 
ATOM   4059  C  CA  . VAL B  1 257 ? 51.357  83.396  -13.465  1.00 49.99  ? 283 VAL B CA  1 
ATOM   4060  C  C   . VAL B  1 257 ? 51.844  84.590  -12.655  1.00 51.20  ? 283 VAL B C   1 
ATOM   4061  O  O   . VAL B  1 257 ? 52.341  84.433  -11.533  1.00 57.29  ? 283 VAL B O   1 
ATOM   4062  C  CB  . VAL B  1 257 ? 51.926  83.436  -14.894  1.00 46.46  ? 283 VAL B CB  1 
ATOM   4063  C  CG1 . VAL B  1 257 ? 53.439  83.270  -14.857  1.00 47.43  ? 283 VAL B CG1 1 
ATOM   4064  C  CG2 . VAL B  1 257 ? 51.289  82.362  -15.754  1.00 43.07  ? 283 VAL B CG2 1 
ATOM   4065  N  N   . HIS B  1 258 ? 51.728  85.786  -13.225  1.00 49.94  ? 284 HIS B N   1 
ATOM   4066  C  CA  . HIS B  1 258 ? 52.149  87.014  -12.549  1.00 50.90  ? 284 HIS B CA  1 
ATOM   4067  C  C   . HIS B  1 258 ? 50.936  87.750  -11.982  1.00 50.03  ? 284 HIS B C   1 
ATOM   4068  O  O   . HIS B  1 258 ? 50.661  88.909  -12.297  1.00 52.04  ? 284 HIS B O   1 
ATOM   4069  C  CB  . HIS B  1 258 ? 52.939  87.897  -13.510  1.00 48.38  ? 284 HIS B CB  1 
ATOM   4070  C  CG  . HIS B  1 258 ? 54.210  87.272  -13.990  1.00 47.92  ? 284 HIS B CG  1 
ATOM   4071  N  ND1 . HIS B  1 258 ? 55.353  87.224  -13.223  1.00 54.07  ? 284 HIS B ND1 1 
ATOM   4072  C  CD2 . HIS B  1 258 ? 54.516  86.662  -15.160  1.00 51.14  ? 284 HIS B CD2 1 
ATOM   4073  C  CE1 . HIS B  1 258 ? 56.311  86.616  -13.900  1.00 55.51  ? 284 HIS B CE1 1 
ATOM   4074  N  NE2 . HIS B  1 258 ? 55.829  86.265  -15.079  1.00 54.06  ? 284 HIS B NE2 1 
ATOM   4075  N  N   . GLY B  1 259 ? 50.199  87.041  -11.126  1.00 51.13  ? 285 GLY B N   1 
ATOM   4076  C  CA  . GLY B  1 259 ? 49.016  87.593  -10.498  1.00 47.47  ? 285 GLY B CA  1 
ATOM   4077  C  C   . GLY B  1 259 ? 48.853  87.058  -9.092   1.00 48.64  ? 285 GLY B C   1 
ATOM   4078  O  O   . GLY B  1 259 ? 49.542  86.124  -8.674   1.00 48.31  ? 285 GLY B O   1 
ATOM   4079  N  N   . SER B  1 260 ? 47.912  87.656  -8.366   1.00 44.90  ? 286 SER B N   1 
ATOM   4080  C  CA  . SER B  1 260 ? 47.679  87.309  -6.974   1.00 44.41  ? 286 SER B CA  1 
ATOM   4081  C  C   . SER B  1 260 ? 46.188  87.147  -6.714   1.00 48.78  ? 286 SER B C   1 
ATOM   4082  O  O   . SER B  1 260 ? 45.344  87.595  -7.496   1.00 42.01  ? 286 SER B O   1 
ATOM   4083  C  CB  . SER B  1 260 ? 48.249  88.378  -6.032   1.00 49.25  ? 286 SER B CB  1 
ATOM   4084  O  OG  . SER B  1 260 ? 47.522  89.592  -6.153   1.00 46.37  ? 286 SER B OG  1 
ATOM   4085  N  N   . CYS B  1 261 ? 45.876  86.510  -5.584   1.00 46.35  ? 287 CYS B N   1 
ATOM   4086  C  CA  . CYS B  1 261 ? 44.509  86.375  -5.104   1.00 43.00  ? 287 CYS B CA  1 
ATOM   4087  C  C   . CYS B  1 261 ? 44.438  86.820  -3.652   1.00 43.68  ? 287 CYS B C   1 
ATOM   4088  O  O   . CYS B  1 261 ? 45.446  86.855  -2.939   1.00 41.33  ? 287 CYS B O   1 
ATOM   4089  C  CB  . CYS B  1 261 ? 43.987  84.926  -5.226   1.00 36.79  ? 287 CYS B CB  1 
ATOM   4090  S  SG  . CYS B  1 261 ? 44.905  83.659  -4.281   1.00 36.99  ? 287 CYS B SG  1 
ATOM   4091  N  N   . VAL B  1 262 ? 43.224  87.172  -3.223   1.00 42.85  ? 288 VAL B N   1 
ATOM   4092  C  CA  . VAL B  1 262 ? 42.871  87.229  -1.812   1.00 47.26  ? 288 VAL B CA  1 
ATOM   4093  C  C   . VAL B  1 262 ? 41.687  86.323  -1.501   1.00 48.22  ? 288 VAL B C   1 
ATOM   4094  O  O   . VAL B  1 262 ? 41.634  85.701  -0.434   1.00 49.48  ? 288 VAL B O   1 
ATOM   4095  C  CB  . VAL B  1 262 ? 42.580  88.674  -1.351   1.00 42.07  ? 288 VAL B CB  1 
ATOM   4096  C  CG1 . VAL B  1 262 ? 42.559  88.744  0.169    1.00 51.01  ? 288 VAL B CG1 1 
ATOM   4097  C  CG2 . VAL B  1 262 ? 43.609  89.634  -1.911   1.00 42.62  ? 288 VAL B CG2 1 
ATOM   4098  N  N   . GLU B  1 263 ? 40.747  86.212  -2.430   1.00 47.93  ? 289 GLU B N   1 
ATOM   4099  C  CA  . GLU B  1 263 ? 39.698  85.211  -2.419   1.00 46.02  ? 289 GLU B CA  1 
ATOM   4100  C  C   . GLU B  1 263 ? 39.973  84.176  -3.503   1.00 41.65  ? 289 GLU B C   1 
ATOM   4101  O  O   . GLU B  1 263 ? 40.681  84.459  -4.476   1.00 37.80  ? 289 GLU B O   1 
ATOM   4102  C  CB  . GLU B  1 263 ? 38.326  85.863  -2.641   1.00 54.26  ? 289 GLU B CB  1 
ATOM   4103  C  CG  . GLU B  1 263 ? 37.957  86.901  -1.585   1.00 68.35  ? 289 GLU B CG  1 
ATOM   4104  C  CD  . GLU B  1 263 ? 36.699  87.683  -1.936   1.00 79.52  ? 289 GLU B CD  1 
ATOM   4105  O  OE1 . GLU B  1 263 ? 35.831  87.134  -2.652   1.00 81.36  ? 289 GLU B OE1 1 
ATOM   4106  O  OE2 . GLU B  1 263 ? 36.577  88.845  -1.491   1.00 71.61  ? 289 GLU B OE2 1 
ATOM   4107  N  N   . PRO B  1 264 ? 39.451  82.955  -3.358   1.00 47.48  ? 290 PRO B N   1 
ATOM   4108  C  CA  . PRO B  1 264 ? 39.812  81.884  -4.296   1.00 39.67  ? 290 PRO B CA  1 
ATOM   4109  C  C   . PRO B  1 264 ? 39.490  82.216  -5.747   1.00 37.64  ? 290 PRO B C   1 
ATOM   4110  O  O   . PRO B  1 264 ? 38.541  82.941  -6.056   1.00 37.95  ? 290 PRO B O   1 
ATOM   4111  C  CB  . PRO B  1 264 ? 38.982  80.692  -3.803   1.00 34.03  ? 290 PRO B CB  1 
ATOM   4112  C  CG  . PRO B  1 264 ? 38.814  80.944  -2.351   1.00 32.96  ? 290 PRO B CG  1 
ATOM   4113  C  CD  . PRO B  1 264 ? 38.684  82.438  -2.209   1.00 43.02  ? 290 PRO B CD  1 
ATOM   4114  N  N   . TRP B  1 265 ? 40.323  81.673  -6.637   1.00 39.90  ? 291 TRP B N   1 
ATOM   4115  C  CA  . TRP B  1 265 ? 40.166  81.733  -8.090   1.00 39.43  ? 291 TRP B CA  1 
ATOM   4116  C  C   . TRP B  1 265 ? 40.251  83.149  -8.648   1.00 35.86  ? 291 TRP B C   1 
ATOM   4117  O  O   . TRP B  1 265 ? 39.786  83.403  -9.761   1.00 37.21  ? 291 TRP B O   1 
ATOM   4118  C  CB  . TRP B  1 265 ? 38.863  81.064  -8.535   1.00 42.43  ? 291 TRP B CB  1 
ATOM   4119  C  CG  . TRP B  1 265 ? 39.045  79.608  -8.825   1.00 44.41  ? 291 TRP B CG  1 
ATOM   4120  C  CD1 . TRP B  1 265 ? 39.949  78.764  -8.246   1.00 37.05  ? 291 TRP B CD1 1 
ATOM   4121  C  CD2 . TRP B  1 265 ? 38.320  78.827  -9.781   1.00 43.06  ? 291 TRP B CD2 1 
ATOM   4122  N  NE1 . TRP B  1 265 ? 39.826  77.504  -8.775   1.00 40.43  ? 291 TRP B NE1 1 
ATOM   4123  C  CE2 . TRP B  1 265 ? 38.832  77.515  -9.720   1.00 47.28  ? 291 TRP B CE2 1 
ATOM   4124  C  CE3 . TRP B  1 265 ? 37.284  79.107  -10.676  1.00 36.38  ? 291 TRP B CE3 1 
ATOM   4125  C  CZ2 . TRP B  1 265 ? 38.342  76.484  -10.523  1.00 41.80  ? 291 TRP B CZ2 1 
ATOM   4126  C  CZ3 . TRP B  1 265 ? 36.800  78.085  -11.471  1.00 41.42  ? 291 TRP B CZ3 1 
ATOM   4127  C  CH2 . TRP B  1 265 ? 37.330  76.789  -11.389  1.00 41.55  ? 291 TRP B CH2 1 
ATOM   4128  N  N   . GLN B  1 266 ? 40.858  84.074  -7.912   1.00 33.40  ? 292 GLN B N   1 
ATOM   4129  C  CA  . GLN B  1 266 ? 41.188  85.380  -8.458   1.00 39.81  ? 292 GLN B CA  1 
ATOM   4130  C  C   . GLN B  1 266 ? 42.576  85.356  -9.091   1.00 46.04  ? 292 GLN B C   1 
ATOM   4131  O  O   . GLN B  1 266 ? 43.372  84.438  -8.876   1.00 41.58  ? 292 GLN B O   1 
ATOM   4132  C  CB  . GLN B  1 266 ? 41.123  86.467  -7.383   1.00 39.90  ? 292 GLN B CB  1 
ATOM   4133  C  CG  . GLN B  1 266 ? 39.730  86.745  -6.855   1.00 40.02  ? 292 GLN B CG  1 
ATOM   4134  C  CD  . GLN B  1 266 ? 39.719  87.832  -5.796   1.00 47.33  ? 292 GLN B CD  1 
ATOM   4135  O  OE1 . GLN B  1 266 ? 40.766  88.228  -5.282   1.00 41.85  ? 292 GLN B OE1 1 
ATOM   4136  N  NE2 . GLN B  1 266 ? 38.530  88.325  -5.469   1.00 55.15  ? 292 GLN B NE2 1 
ATOM   4137  N  N   . CYS B  1 267 ? 42.854  86.385  -9.894   1.00 46.38  ? 293 CYS B N   1 
ATOM   4138  C  CA  . CYS B  1 267 ? 44.140  86.501  -10.569  1.00 44.14  ? 293 CYS B CA  1 
ATOM   4139  C  C   . CYS B  1 267 ? 44.386  87.953  -10.970  1.00 49.21  ? 293 CYS B C   1 
ATOM   4140  O  O   . CYS B  1 267 ? 44.289  88.307  -12.150  1.00 53.41  ? 293 CYS B O   1 
ATOM   4141  C  CB  . CYS B  1 267 ? 44.180  85.553  -11.775  1.00 41.75  ? 293 CYS B CB  1 
ATOM   4142  S  SG  . CYS B  1 267 ? 45.740  85.448  -12.688  1.00 47.61  ? 293 CYS B SG  1 
ATOM   4143  N  N   . ASN B  1 268 ? 44.677  88.806  -9.986   1.00 50.19  ? 294 ASN B N   1 
ATOM   4144  C  CA  . ASN B  1 268 ? 44.912  90.225  -10.232  1.00 44.81  ? 294 ASN B CA  1 
ATOM   4145  C  C   . ASN B  1 268 ? 46.297  90.412  -10.834  1.00 51.15  ? 294 ASN B C   1 
ATOM   4146  O  O   . ASN B  1 268 ? 47.304  90.125  -10.178  1.00 46.65  ? 294 ASN B O   1 
ATOM   4147  C  CB  . ASN B  1 268 ? 44.804  91.023  -8.935   1.00 40.51  ? 294 ASN B CB  1 
ATOM   4148  C  CG  . ASN B  1 268 ? 43.560  90.686  -8.139   1.00 51.23  ? 294 ASN B CG  1 
ATOM   4149  O  OD1 . ASN B  1 268 ? 43.636  90.415  -6.937   1.00 60.32  ? 294 ASN B OD1 1 
ATOM   4150  N  ND2 . ASN B  1 268 ? 42.405  90.701  -8.800   1.00 41.25  ? 294 ASN B ND2 1 
ATOM   4151  N  N   . CYS B  1 269 ? 46.353  90.906  -12.068  1.00 55.38  ? 295 CYS B N   1 
ATOM   4152  C  CA  . CYS B  1 269 ? 47.635  91.036  -12.747  1.00 53.78  ? 295 CYS B CA  1 
ATOM   4153  C  C   . CYS B  1 269 ? 48.462  92.149  -12.120  1.00 51.11  ? 295 CYS B C   1 
ATOM   4154  O  O   . CYS B  1 269 ? 47.930  93.174  -11.682  1.00 51.85  ? 295 CYS B O   1 
ATOM   4155  C  CB  . CYS B  1 269 ? 47.438  91.316  -14.238  1.00 49.64  ? 295 CYS B CB  1 
ATOM   4156  S  SG  . CYS B  1 269 ? 46.559  90.031  -15.127  1.00 51.44  ? 295 CYS B SG  1 
ATOM   4157  N  N   . GLU B  1 270 ? 49.773  91.941  -12.075  1.00 51.41  ? 296 GLU B N   1 
ATOM   4158  C  CA  . GLU B  1 270 ? 50.664  93.031  -11.729  1.00 54.83  ? 296 GLU B CA  1 
ATOM   4159  C  C   . GLU B  1 270 ? 50.670  94.058  -12.861  1.00 61.61  ? 296 GLU B C   1 
ATOM   4160  O  O   . GLU B  1 270 ? 50.128  93.829  -13.948  1.00 60.44  ? 296 GLU B O   1 
ATOM   4161  C  CB  . GLU B  1 270 ? 52.076  92.501  -11.484  1.00 46.44  ? 296 GLU B CB  1 
ATOM   4162  C  CG  . GLU B  1 270 ? 52.140  91.331  -10.516  1.00 47.02  ? 296 GLU B CG  1 
ATOM   4163  C  CD  . GLU B  1 270 ? 53.486  90.623  -10.536  1.00 55.60  ? 296 GLU B CD  1 
ATOM   4164  O  OE1 . GLU B  1 270 ? 53.656  89.636  -9.786   1.00 48.93  ? 296 GLU B OE1 1 
ATOM   4165  O  OE2 . GLU B  1 270 ? 54.371  91.045  -11.311  1.00 58.36  ? 296 GLU B OE2 1 
ATOM   4166  N  N   . THR B  1 271 ? 51.287  95.206  -12.604  1.00 63.98  ? 297 THR B N   1 
ATOM   4167  C  CA  . THR B  1 271 ? 51.391  96.218  -13.644  1.00 66.10  ? 297 THR B CA  1 
ATOM   4168  C  C   . THR B  1 271 ? 52.351  95.732  -14.724  1.00 63.66  ? 297 THR B C   1 
ATOM   4169  O  O   . THR B  1 271 ? 53.357  95.077  -14.432  1.00 60.88  ? 297 THR B O   1 
ATOM   4170  C  CB  . THR B  1 271 ? 51.849  97.560  -13.067  1.00 62.45  ? 297 THR B CB  1 
ATOM   4171  O  OG1 . THR B  1 271 ? 52.840  97.341  -12.055  1.00 64.19  ? 297 THR B OG1 1 
ATOM   4172  C  CG2 . THR B  1 271 ? 50.674  98.317  -12.479  1.00 48.97  ? 297 THR B CG2 1 
ATOM   4173  N  N   . ASN B  1 272 ? 52.011  96.040  -15.979  1.00 58.15  ? 298 ASN B N   1 
ATOM   4174  C  CA  . ASN B  1 272 ? 52.743  95.592  -17.165  1.00 62.44  ? 298 ASN B CA  1 
ATOM   4175  C  C   . ASN B  1 272 ? 52.592  94.089  -17.388  1.00 59.48  ? 298 ASN B C   1 
ATOM   4176  O  O   . ASN B  1 272 ? 53.504  93.429  -17.895  1.00 53.40  ? 298 ASN B O   1 
ATOM   4177  C  CB  . ASN B  1 272 ? 54.226  95.976  -17.098  1.00 61.18  ? 298 ASN B CB  1 
ATOM   4178  C  CG  . ASN B  1 272 ? 54.445  97.475  -17.183  1.00 66.00  ? 298 ASN B CG  1 
ATOM   4179  O  OD1 . ASN B  1 272 ? 55.487  97.984  -16.764  1.00 71.54  ? 298 ASN B OD1 1 
ATOM   4180  N  ND2 . ASN B  1 272 ? 53.454  98.193  -17.710  1.00 56.44  ? 298 ASN B ND2 1 
ATOM   4181  N  N   . TRP B  1 273 ? 51.444  93.540  -16.994  1.00 55.02  ? 299 TRP B N   1 
ATOM   4182  C  CA  . TRP B  1 273 ? 51.082  92.159  -17.283  1.00 48.33  ? 299 TRP B CA  1 
ATOM   4183  C  C   . TRP B  1 273 ? 49.593  92.104  -17.577  1.00 47.89  ? 299 TRP B C   1 
ATOM   4184  O  O   . TRP B  1 273 ? 48.795  92.718  -16.862  1.00 50.77  ? 299 TRP B O   1 
ATOM   4185  C  CB  . TRP B  1 273 ? 51.445  91.227  -16.124  1.00 46.57  ? 299 TRP B CB  1 
ATOM   4186  C  CG  . TRP B  1 273 ? 52.918  90.984  -16.019  1.00 51.09  ? 299 TRP B CG  1 
ATOM   4187  C  CD1 . TRP B  1 273 ? 53.788  91.579  -15.151  1.00 56.57  ? 299 TRP B CD1 1 
ATOM   4188  C  CD2 . TRP B  1 273 ? 53.700  90.085  -16.816  1.00 53.46  ? 299 TRP B CD2 1 
ATOM   4189  N  NE1 . TRP B  1 273 ? 55.062  91.102  -15.354  1.00 49.61  ? 299 TRP B NE1 1 
ATOM   4190  C  CE2 . TRP B  1 273 ? 55.035  90.185  -16.372  1.00 57.07  ? 299 TRP B CE2 1 
ATOM   4191  C  CE3 . TRP B  1 273 ? 53.401  89.201  -17.860  1.00 48.72  ? 299 TRP B CE3 1 
ATOM   4192  C  CZ2 . TRP B  1 273 ? 56.071  89.437  -16.938  1.00 54.30  ? 299 TRP B CZ2 1 
ATOM   4193  C  CZ3 . TRP B  1 273 ? 54.432  88.459  -18.422  1.00 46.40  ? 299 TRP B CZ3 1 
ATOM   4194  C  CH2 . TRP B  1 273 ? 55.750  88.584  -17.960  1.00 48.70  ? 299 TRP B CH2 1 
ATOM   4195  N  N   . GLY B  1 274 ? 49.225  91.388  -18.640  1.00 44.18  ? 300 GLY B N   1 
ATOM   4196  C  CA  . GLY B  1 274 ? 47.848  91.317  -19.078  1.00 40.31  ? 300 GLY B CA  1 
ATOM   4197  C  C   . GLY B  1 274 ? 47.414  89.886  -19.347  1.00 40.73  ? 300 GLY B C   1 
ATOM   4198  O  O   . GLY B  1 274 ? 48.177  88.933  -19.169  1.00 39.25  ? 300 GLY B O   1 
ATOM   4199  N  N   . GLY B  1 275 ? 46.167  89.766  -19.786  1.00 39.14  ? 301 GLY B N   1 
ATOM   4200  C  CA  . GLY B  1 275 ? 45.583  88.480  -20.088  1.00 49.62  ? 301 GLY B CA  1 
ATOM   4201  C  C   . GLY B  1 275 ? 44.843  87.884  -18.906  1.00 47.59  ? 301 GLY B C   1 
ATOM   4202  O  O   . GLY B  1 275 ? 44.948  88.334  -17.763  1.00 50.06  ? 301 GLY B O   1 
ATOM   4203  N  N   . LEU B  1 276 ? 44.079  86.832  -19.203  1.00 50.11  ? 302 LEU B N   1 
ATOM   4204  C  CA  . LEU B  1 276 ? 43.297  86.173  -18.163  1.00 51.96  ? 302 LEU B CA  1 
ATOM   4205  C  C   . LEU B  1 276 ? 44.197  85.572  -17.093  1.00 42.48  ? 302 LEU B C   1 
ATOM   4206  O  O   . LEU B  1 276 ? 43.867  85.608  -15.902  1.00 42.58  ? 302 LEU B O   1 
ATOM   4207  C  CB  . LEU B  1 276 ? 42.413  85.089  -18.780  1.00 46.42  ? 302 LEU B CB  1 
ATOM   4208  C  CG  . LEU B  1 276 ? 41.192  84.656  -17.970  1.00 44.37  ? 302 LEU B CG  1 
ATOM   4209  C  CD1 . LEU B  1 276 ? 40.013  85.577  -18.260  1.00 44.56  ? 302 LEU B CD1 1 
ATOM   4210  C  CD2 . LEU B  1 276 ? 40.845  83.202  -18.253  1.00 41.29  ? 302 LEU B CD2 1 
ATOM   4211  N  N   . LEU B  1 277 ? 45.341  85.025  -17.495  1.00 38.35  ? 303 LEU B N   1 
ATOM   4212  C  CA  . LEU B  1 277 ? 46.252  84.363  -16.574  1.00 45.89  ? 303 LEU B CA  1 
ATOM   4213  C  C   . LEU B  1 277 ? 47.433  85.242  -16.174  1.00 46.05  ? 303 LEU B C   1 
ATOM   4214  O  O   . LEU B  1 277 ? 48.338  84.762  -15.483  1.00 49.32  ? 303 LEU B O   1 
ATOM   4215  C  CB  . LEU B  1 277 ? 46.756  83.054  -17.187  1.00 47.04  ? 303 LEU B CB  1 
ATOM   4216  C  CG  . LEU B  1 277 ? 45.730  82.150  -17.882  1.00 49.12  ? 303 LEU B CG  1 
ATOM   4217  C  CD1 . LEU B  1 277 ? 46.367  80.815  -18.251  1.00 45.34  ? 303 LEU B CD1 1 
ATOM   4218  C  CD2 . LEU B  1 277 ? 44.482  81.934  -17.035  1.00 44.20  ? 303 LEU B CD2 1 
ATOM   4219  N  N   . CYS B  1 278 ? 47.433  86.513  -16.580  1.00 44.65  ? 304 CYS B N   1 
ATOM   4220  C  CA  . CYS B  1 278 ? 48.540  87.439  -16.327  1.00 48.05  ? 304 CYS B CA  1 
ATOM   4221  C  C   . CYS B  1 278 ? 49.864  86.860  -16.823  1.00 48.35  ? 304 CYS B C   1 
ATOM   4222  O  O   . CYS B  1 278 ? 50.873  86.837  -16.112  1.00 44.41  ? 304 CYS B O   1 
ATOM   4223  C  CB  . CYS B  1 278 ? 48.627  87.815  -14.847  1.00 46.07  ? 304 CYS B CB  1 
ATOM   4224  S  SG  . CYS B  1 278 ? 47.066  88.337  -14.134  1.00 53.23  ? 304 CYS B SG  1 
ATOM   4225  N  N   . ASP B  1 279 ? 49.849  86.372  -18.063  1.00 43.65  ? 305 ASP B N   1 
ATOM   4226  C  CA  . ASP B  1 279 ? 51.032  85.793  -18.680  1.00 45.50  ? 305 ASP B CA  1 
ATOM   4227  C  C   . ASP B  1 279 ? 51.510  86.572  -19.898  1.00 44.48  ? 305 ASP B C   1 
ATOM   4228  O  O   . ASP B  1 279 ? 52.501  86.168  -20.521  1.00 37.80  ? 305 ASP B O   1 
ATOM   4229  C  CB  . ASP B  1 279 ? 50.774  84.330  -19.075  1.00 42.02  ? 305 ASP B CB  1 
ATOM   4230  C  CG  . ASP B  1 279 ? 49.556  84.167  -19.971  1.00 42.21  ? 305 ASP B CG  1 
ATOM   4231  O  OD1 . ASP B  1 279 ? 48.708  85.085  -20.008  1.00 45.06  ? 305 ASP B OD1 1 
ATOM   4232  O  OD2 . ASP B  1 279 ? 49.450  83.118  -20.639  1.00 39.26  ? 305 ASP B OD2 1 
ATOM   4233  N  N   . LYS B  1 280 ? 50.864  87.684  -20.237  1.00 37.56  ? 306 LYS B N   1 
ATOM   4234  C  CA  . LYS B  1 280 ? 51.224  88.469  -21.409  1.00 42.39  ? 306 LYS B CA  1 
ATOM   4235  C  C   . LYS B  1 280 ? 52.110  89.629  -20.975  1.00 43.71  ? 306 LYS B C   1 
ATOM   4236  O  O   . LYS B  1 280 ? 51.721  90.424  -20.113  1.00 41.60  ? 306 LYS B O   1 
ATOM   4237  C  CB  . LYS B  1 280 ? 49.970  88.980  -22.118  1.00 42.23  ? 306 LYS B CB  1 
ATOM   4238  C  CG  . LYS B  1 280 ? 50.233  89.783  -23.380  1.00 37.92  ? 306 LYS B CG  1 
ATOM   4239  C  CD  . LYS B  1 280 ? 48.925  90.100  -24.091  1.00 52.25  ? 306 LYS B CD  1 
ATOM   4240  C  CE  . LYS B  1 280 ? 49.155  90.794  -25.425  1.00 58.30  ? 306 LYS B CE  1 
ATOM   4241  N  NZ  . LYS B  1 280 ? 49.773  92.141  -25.267  1.00 54.61  ? 306 LYS B NZ  1 
ATOM   4242  N  N   . ASP B  1 281 ? 53.286  89.734  -21.593  1.00 44.90  ? 307 ASP B N   1 
ATOM   4243  C  CA  . ASP B  1 281 ? 54.207  90.835  -21.334  1.00 47.51  ? 307 ASP B CA  1 
ATOM   4244  C  C   . ASP B  1 281 ? 53.712  92.091  -22.039  1.00 47.29  ? 307 ASP B C   1 
ATOM   4245  O  O   . ASP B  1 281 ? 53.528  92.091  -23.260  1.00 50.70  ? 307 ASP B O   1 
ATOM   4246  C  CB  . ASP B  1 281 ? 55.610  90.465  -21.809  1.00 46.35  ? 307 ASP B CB  1 
ATOM   4247  C  CG  . ASP B  1 281 ? 56.673  91.428  -21.314  1.00 53.49  ? 307 ASP B CG  1 
ATOM   4248  O  OD1 . ASP B  1 281 ? 56.331  92.562  -20.912  1.00 50.95  ? 307 ASP B OD1 1 
ATOM   4249  O  OD2 . ASP B  1 281 ? 57.865  91.048  -21.344  1.00 51.94  ? 307 ASP B OD2 1 
ATOM   4250  N  N   . LEU B  1 282 ? 53.525  93.171  -21.281  1.00 48.93  ? 308 LEU B N   1 
ATOM   4251  C  CA  . LEU B  1 282 ? 52.962  94.402  -21.817  1.00 51.55  ? 308 LEU B CA  1 
ATOM   4252  C  C   . LEU B  1 282 ? 53.998  95.515  -21.933  1.00 62.26  ? 308 LEU B C   1 
ATOM   4253  O  O   . LEU B  1 282 ? 53.632  96.693  -22.016  1.00 66.26  ? 308 LEU B O   1 
ATOM   4254  C  CB  . LEU B  1 282 ? 51.767  94.860  -20.978  1.00 51.39  ? 308 LEU B CB  1 
ATOM   4255  C  CG  . LEU B  1 282 ? 50.551  93.926  -20.979  1.00 48.64  ? 308 LEU B CG  1 
ATOM   4256  C  CD1 . LEU B  1 282 ? 49.375  94.557  -20.254  1.00 41.12  ? 308 LEU B CD1 1 
ATOM   4257  C  CD2 . LEU B  1 282 ? 50.161  93.542  -22.395  1.00 45.84  ? 308 LEU B CD2 1 
ATOM   4258  N  N   . ASN B  1 283 ? 55.283  95.167  -21.957  1.00 65.97  ? 309 ASN B N   1 
ATOM   4259  C  CA  . ASN B  1 283 ? 56.336  96.137  -22.228  1.00 71.90  ? 309 ASN B CA  1 
ATOM   4260  C  C   . ASN B  1 283 ? 56.543  96.237  -23.732  1.00 73.61  ? 309 ASN B C   1 
ATOM   4261  O  O   . ASN B  1 283 ? 56.636  95.217  -24.424  1.00 71.63  ? 309 ASN B O   1 
ATOM   4262  C  CB  . ASN B  1 283 ? 57.649  95.748  -21.545  1.00 68.95  ? 309 ASN B CB  1 
ATOM   4263  C  CG  . ASN B  1 283 ? 57.654  96.052  -20.057  1.00 80.36  ? 309 ASN B CG  1 
ATOM   4264  O  OD1 . ASN B  1 283 ? 56.602  96.113  -19.417  1.00 77.21  ? 309 ASN B OD1 1 
ATOM   4265  N  ND2 . ASN B  1 283 ? 58.846  96.240  -19.497  1.00 72.33  ? 309 ASN B ND2 1 
ATOM   4266  N  N   . GLY B  1 284 ? 56.601  97.465  -24.235  1.00 72.31  ? 310 GLY B N   1 
ATOM   4267  C  CA  . GLY B  1 284 ? 56.791  97.698  -25.654  1.00 66.32  ? 310 GLY B CA  1 
ATOM   4268  C  C   . GLY B  1 284 ? 55.511  97.545  -26.452  1.00 64.69  ? 310 GLY B C   1 
ATOM   4269  O  O   . GLY B  1 284 ? 54.520  98.228  -26.191  1.00 59.01  ? 310 GLY B O   1 
ATOM   4270  N  N   . MET C  1 1   ? 17.288  51.952  2.390    1.00 43.68  ? 27  MET C N   1 
ATOM   4271  C  CA  . MET C  1 1   ? 16.896  53.323  2.094    1.00 48.64  ? 27  MET C CA  1 
ATOM   4272  C  C   . MET C  1 1   ? 18.005  54.306  2.441    1.00 48.32  ? 27  MET C C   1 
ATOM   4273  O  O   . MET C  1 1   ? 18.608  54.216  3.509    1.00 51.93  ? 27  MET C O   1 
ATOM   4274  C  CB  . MET C  1 1   ? 15.618  53.687  2.849    1.00 46.52  ? 27  MET C CB  1 
ATOM   4275  C  CG  . MET C  1 1   ? 14.373  53.018  2.303    1.00 54.93  ? 27  MET C CG  1 
ATOM   4276  S  SD  . MET C  1 1   ? 12.881  53.575  3.141    1.00 75.35  ? 27  MET C SD  1 
ATOM   4277  C  CE  . MET C  1 1   ? 13.096  55.352  3.062    1.00 53.56  ? 27  MET C CE  1 
ATOM   4278  N  N   . GLY C  1 2   ? 18.267  55.238  1.538    1.00 43.56  ? 28  GLY C N   1 
ATOM   4279  C  CA  . GLY C  1 2   ? 19.284  56.238  1.760    1.00 46.52  ? 28  GLY C CA  1 
ATOM   4280  C  C   . GLY C  1 2   ? 19.124  57.404  0.814    1.00 43.15  ? 28  GLY C C   1 
ATOM   4281  O  O   . GLY C  1 2   ? 18.034  57.664  0.301    1.00 45.11  ? 28  GLY C O   1 
ATOM   4282  N  N   . TYR C  1 3   ? 20.227  58.116  0.589    1.00 40.28  ? 29  TYR C N   1 
ATOM   4283  C  CA  . TYR C  1 3   ? 20.218  59.219  -0.363   1.00 39.87  ? 29  TYR C CA  1 
ATOM   4284  C  C   . TYR C  1 3   ? 21.623  59.436  -0.908   1.00 36.85  ? 29  TYR C C   1 
ATOM   4285  O  O   . TYR C  1 3   ? 22.611  59.268  -0.188   1.00 36.99  ? 29  TYR C O   1 
ATOM   4286  C  CB  . TYR C  1 3   ? 19.671  60.512  0.262    1.00 37.88  ? 29  TYR C CB  1 
ATOM   4287  C  CG  . TYR C  1 3   ? 20.393  60.974  1.508    1.00 51.38  ? 29  TYR C CG  1 
ATOM   4288  C  CD1 . TYR C  1 3   ? 21.430  61.898  1.430    1.00 53.37  ? 29  TYR C CD1 1 
ATOM   4289  C  CD2 . TYR C  1 3   ? 20.031  60.496  2.764    1.00 54.18  ? 29  TYR C CD2 1 
ATOM   4290  C  CE1 . TYR C  1 3   ? 22.096  62.330  2.567    1.00 51.42  ? 29  TYR C CE1 1 
ATOM   4291  C  CE2 . TYR C  1 3   ? 20.691  60.921  3.909    1.00 58.18  ? 29  TYR C CE2 1 
ATOM   4292  C  CZ  . TYR C  1 3   ? 21.722  61.839  3.803    1.00 61.62  ? 29  TYR C CZ  1 
ATOM   4293  O  OH  . TYR C  1 3   ? 22.383  62.264  4.933    1.00 64.33  ? 29  TYR C OH  1 
ATOM   4294  N  N   . PHE C  1 4   ? 21.691  59.787  -2.190   1.00 37.49  ? 30  PHE C N   1 
ATOM   4295  C  CA  . PHE C  1 4   ? 22.933  60.065  -2.896   1.00 31.19  ? 30  PHE C CA  1 
ATOM   4296  C  C   . PHE C  1 4   ? 23.125  61.573  -2.955   1.00 32.43  ? 30  PHE C C   1 
ATOM   4297  O  O   . PHE C  1 4   ? 22.237  62.296  -3.416   1.00 34.41  ? 30  PHE C O   1 
ATOM   4298  C  CB  . PHE C  1 4   ? 22.889  59.471  -4.308   1.00 33.13  ? 30  PHE C CB  1 
ATOM   4299  C  CG  . PHE C  1 4   ? 24.133  59.718  -5.123   1.00 30.18  ? 30  PHE C CG  1 
ATOM   4300  C  CD1 . PHE C  1 4   ? 24.280  60.884  -5.859   1.00 26.58  ? 30  PHE C CD1 1 
ATOM   4301  C  CD2 . PHE C  1 4   ? 25.146  58.773  -5.169   1.00 33.67  ? 30  PHE C CD2 1 
ATOM   4302  C  CE1 . PHE C  1 4   ? 25.421  61.111  -6.607   1.00 29.71  ? 30  PHE C CE1 1 
ATOM   4303  C  CE2 . PHE C  1 4   ? 26.291  58.994  -5.916   1.00 29.90  ? 30  PHE C CE2 1 
ATOM   4304  C  CZ  . PHE C  1 4   ? 26.425  60.163  -6.639   1.00 31.70  ? 30  PHE C CZ  1 
ATOM   4305  N  N   . GLU C  1 5   ? 24.277  62.044  -2.493   1.00 29.90  ? 31  GLU C N   1 
ATOM   4306  C  CA  . GLU C  1 5   ? 24.569  63.468  -2.442   1.00 34.44  ? 31  GLU C CA  1 
ATOM   4307  C  C   . GLU C  1 5   ? 25.689  63.829  -3.410   1.00 36.84  ? 31  GLU C C   1 
ATOM   4308  O  O   . GLU C  1 5   ? 26.591  63.028  -3.673   1.00 41.28  ? 31  GLU C O   1 
ATOM   4309  C  CB  . GLU C  1 5   ? 24.956  63.898  -1.026   1.00 41.37  ? 31  GLU C CB  1 
ATOM   4310  C  CG  . GLU C  1 5   ? 23.779  64.212  -0.128   1.00 41.63  ? 31  GLU C CG  1 
ATOM   4311  C  CD  . GLU C  1 5   ? 24.219  64.640  1.253    1.00 57.53  ? 31  GLU C CD  1 
ATOM   4312  O  OE1 . GLU C  1 5   ? 25.136  63.994  1.807    1.00 56.59  ? 31  GLU C OE1 1 
ATOM   4313  O  OE2 . GLU C  1 5   ? 23.663  65.630  1.777    1.00 63.64  ? 31  GLU C OE2 1 
ATOM   4314  N  N   . LEU C  1 6   ? 25.619  65.052  -3.935   1.00 35.09  ? 32  LEU C N   1 
ATOM   4315  C  CA  . LEU C  1 6   ? 26.633  65.579  -4.841   1.00 34.89  ? 32  LEU C CA  1 
ATOM   4316  C  C   . LEU C  1 6   ? 26.762  67.074  -4.593   1.00 38.33  ? 32  LEU C C   1 
ATOM   4317  O  O   . LEU C  1 6   ? 25.766  67.803  -4.649   1.00 36.90  ? 32  LEU C O   1 
ATOM   4318  C  CB  . LEU C  1 6   ? 26.275  65.298  -6.308   1.00 28.74  ? 32  LEU C CB  1 
ATOM   4319  C  CG  . LEU C  1 6   ? 27.230  65.759  -7.420   1.00 36.50  ? 32  LEU C CG  1 
ATOM   4320  C  CD1 . LEU C  1 6   ? 27.182  64.798  -8.600   1.00 38.45  ? 32  LEU C CD1 1 
ATOM   4321  C  CD2 . LEU C  1 6   ? 26.922  67.178  -7.903   1.00 30.58  ? 32  LEU C CD2 1 
ATOM   4322  N  N   . GLN C  1 7   ? 27.983  67.525  -4.320   1.00 35.11  ? 33  GLN C N   1 
ATOM   4323  C  CA  . GLN C  1 7   ? 28.257  68.928  -4.037   1.00 38.61  ? 33  GLN C CA  1 
ATOM   4324  C  C   . GLN C  1 7   ? 29.197  69.485  -5.096   1.00 40.95  ? 33  GLN C C   1 
ATOM   4325  O  O   . GLN C  1 7   ? 30.335  69.024  -5.225   1.00 37.58  ? 33  GLN C O   1 
ATOM   4326  C  CB  . GLN C  1 7   ? 28.862  69.102  -2.642   1.00 39.22  ? 33  GLN C CB  1 
ATOM   4327  C  CG  . GLN C  1 7   ? 29.353  70.514  -2.357   1.00 39.17  ? 33  GLN C CG  1 
ATOM   4328  C  CD  . GLN C  1 7   ? 28.237  71.547  -2.359   1.00 42.74  ? 33  GLN C CD  1 
ATOM   4329  O  OE1 . GLN C  1 7   ? 27.193  71.358  -1.731   1.00 43.18  ? 33  GLN C OE1 1 
ATOM   4330  N  NE2 . GLN C  1 7   ? 28.458  72.652  -3.066   1.00 42.63  ? 33  GLN C NE2 1 
ATOM   4331  N  N   . LEU C  1 8   ? 28.719  70.472  -5.848   1.00 42.75  ? 34  LEU C N   1 
ATOM   4332  C  CA  . LEU C  1 8   ? 29.564  71.190  -6.787   1.00 35.25  ? 34  LEU C CA  1 
ATOM   4333  C  C   . LEU C  1 8   ? 30.304  72.308  -6.066   1.00 37.58  ? 34  LEU C C   1 
ATOM   4334  O  O   . LEU C  1 8   ? 29.724  73.031  -5.252   1.00 40.38  ? 34  LEU C O   1 
ATOM   4335  C  CB  . LEU C  1 8   ? 28.720  71.762  -7.925   1.00 41.09  ? 34  LEU C CB  1 
ATOM   4336  C  CG  . LEU C  1 8   ? 29.437  72.694  -8.911   1.00 51.35  ? 34  LEU C CG  1 
ATOM   4337  C  CD1 . LEU C  1 8   ? 30.573  71.953  -9.608   1.00 48.99  ? 34  LEU C CD1 1 
ATOM   4338  C  CD2 . LEU C  1 8   ? 28.459  73.278  -9.923   1.00 44.72  ? 34  LEU C CD2 1 
ATOM   4339  N  N   . SER C  1 9   ? 31.599  72.442  -6.360   1.00 38.60  ? 35  SER C N   1 
ATOM   4340  C  CA  . SER C  1 9   ? 32.418  73.472  -5.740   1.00 38.96  ? 35  SER C CA  1 
ATOM   4341  C  C   . SER C  1 9   ? 33.058  74.451  -6.720   1.00 41.43  ? 35  SER C C   1 
ATOM   4342  O  O   . SER C  1 9   ? 33.364  75.578  -6.314   1.00 41.61  ? 35  SER C O   1 
ATOM   4343  C  CB  . SER C  1 9   ? 33.524  72.837  -4.878   1.00 35.94  ? 35  SER C CB  1 
ATOM   4344  O  OG  . SER C  1 9   ? 34.401  72.037  -5.650   1.00 42.03  ? 35  SER C OG  1 
ATOM   4345  N  N   . ALA C  1 10  ? 33.257  74.075  -7.983   1.00 40.03  ? 36  ALA C N   1 
ATOM   4346  C  CA  . ALA C  1 10  ? 33.872  74.990  -8.935   1.00 40.49  ? 36  ALA C CA  1 
ATOM   4347  C  C   . ALA C  1 10  ? 33.534  74.575  -10.360  1.00 38.61  ? 36  ALA C C   1 
ATOM   4348  O  O   . ALA C  1 10  ? 33.303  73.397  -10.644  1.00 40.55  ? 36  ALA C O   1 
ATOM   4349  C  CB  . ALA C  1 10  ? 35.392  75.045  -8.753   1.00 43.09  ? 36  ALA C CB  1 
ATOM   4350  N  N   . LEU C  1 11  ? 33.517  75.566  -11.250  1.00 38.22  ? 37  LEU C N   1 
ATOM   4351  C  CA  . LEU C  1 11  ? 33.348  75.342  -12.680  1.00 44.30  ? 37  LEU C CA  1 
ATOM   4352  C  C   . LEU C  1 11  ? 34.041  76.478  -13.421  1.00 43.68  ? 37  LEU C C   1 
ATOM   4353  O  O   . LEU C  1 11  ? 33.994  77.633  -12.986  1.00 38.45  ? 37  LEU C O   1 
ATOM   4354  C  CB  . LEU C  1 11  ? 31.865  75.253  -13.071  1.00 44.86  ? 37  LEU C CB  1 
ATOM   4355  C  CG  . LEU C  1 11  ? 31.493  74.796  -14.488  1.00 43.00  ? 37  LEU C CG  1 
ATOM   4356  C  CD1 . LEU C  1 11  ? 30.159  74.081  -14.471  1.00 43.44  ? 37  LEU C CD1 1 
ATOM   4357  C  CD2 . LEU C  1 11  ? 31.438  75.965  -15.465  1.00 43.94  ? 37  LEU C CD2 1 
ATOM   4358  N  N   . ARG C  1 12  ? 34.678  76.143  -14.542  1.00 47.35  ? 38  ARG C N   1 
ATOM   4359  C  CA  . ARG C  1 12  ? 35.512  77.085  -15.283  1.00 53.54  ? 38  ARG C CA  1 
ATOM   4360  C  C   . ARG C  1 12  ? 35.244  76.930  -16.773  1.00 56.51  ? 38  ARG C C   1 
ATOM   4361  O  O   . ARG C  1 12  ? 35.384  75.831  -17.315  1.00 58.87  ? 38  ARG C O   1 
ATOM   4362  C  CB  . ARG C  1 12  ? 36.995  76.850  -14.971  1.00 51.34  ? 38  ARG C CB  1 
ATOM   4363  C  CG  . ARG C  1 12  ? 37.965  77.462  -15.965  1.00 58.90  ? 38  ARG C CG  1 
ATOM   4364  C  CD  . ARG C  1 12  ? 39.390  77.473  -15.414  1.00 52.52  ? 38  ARG C CD  1 
ATOM   4365  N  NE  . ARG C  1 12  ? 39.858  76.140  -15.048  1.00 60.74  ? 38  ARG C NE  1 
ATOM   4366  C  CZ  . ARG C  1 12  ? 40.704  75.415  -15.775  1.00 65.20  ? 38  ARG C CZ  1 
ATOM   4367  N  NH1 . ARG C  1 12  ? 41.185  75.900  -16.915  1.00 50.45  ? 38  ARG C NH1 1 
ATOM   4368  N  NH2 . ARG C  1 12  ? 41.072  74.206  -15.360  1.00 56.13  ? 38  ARG C NH2 1 
ATOM   4369  N  N   . ASN C  1 13  ? 34.859  78.026  -17.431  1.00 56.30  ? 39  ASN C N   1 
ATOM   4370  C  CA  . ASN C  1 13  ? 34.603  78.035  -18.875  1.00 58.00  ? 39  ASN C CA  1 
ATOM   4371  C  C   . ASN C  1 13  ? 35.257  79.290  -19.449  1.00 66.18  ? 39  ASN C C   1 
ATOM   4372  O  O   . ASN C  1 13  ? 34.700  80.389  -19.347  1.00 62.08  ? 39  ASN C O   1 
ATOM   4373  C  CB  . ASN C  1 13  ? 33.110  77.988  -19.178  1.00 52.83  ? 39  ASN C CB  1 
ATOM   4374  C  CG  . ASN C  1 13  ? 32.810  78.021  -20.669  1.00 60.92  ? 39  ASN C CG  1 
ATOM   4375  O  OD1 . ASN C  1 13  ? 33.688  77.786  -21.503  1.00 66.20  ? 39  ASN C OD1 1 
ATOM   4376  N  ND2 . ASN C  1 13  ? 31.560  78.307  -21.011  1.00 52.37  ? 39  ASN C ND2 1 
ATOM   4377  N  N   . VAL C  1 14  ? 36.423  79.110  -20.075  1.00 69.67  ? 40  VAL C N   1 
ATOM   4378  C  CA  . VAL C  1 14  ? 37.317  80.212  -20.428  1.00 73.08  ? 40  VAL C CA  1 
ATOM   4379  C  C   . VAL C  1 14  ? 36.653  81.208  -21.385  1.00 74.71  ? 40  VAL C C   1 
ATOM   4380  O  O   . VAL C  1 14  ? 36.369  82.345  -20.987  1.00 74.54  ? 40  VAL C O   1 
ATOM   4381  C  CB  . VAL C  1 14  ? 38.665  79.668  -20.961  1.00 75.61  ? 40  VAL C CB  1 
ATOM   4382  C  CG1 . VAL C  1 14  ? 39.267  78.706  -19.952  1.00 79.92  ? 40  VAL C CG1 1 
ATOM   4383  C  CG2 . VAL C  1 14  ? 38.526  78.935  -22.292  1.00 77.45  ? 40  VAL C CG2 1 
ATOM   4384  N  N   . ASN C  1 15  ? 36.364  80.800  -22.627  1.00 73.94  ? 41  ASN C N   1 
ATOM   4385  C  CA  . ASN C  1 15  ? 35.819  81.701  -23.637  1.00 74.63  ? 41  ASN C CA  1 
ATOM   4386  C  C   . ASN C  1 15  ? 34.317  81.903  -23.487  1.00 71.14  ? 41  ASN C C   1 
ATOM   4387  O  O   . ASN C  1 15  ? 33.725  82.651  -24.269  1.00 71.03  ? 41  ASN C O   1 
ATOM   4388  C  CB  . ASN C  1 15  ? 36.081  81.165  -25.047  1.00 77.14  ? 41  ASN C CB  1 
ATOM   4389  C  CG  . ASN C  1 15  ? 37.515  80.719  -25.270  1.00 76.12  ? 41  ASN C CG  1 
ATOM   4390  O  OD1 . ASN C  1 15  ? 38.442  81.531  -25.323  1.00 78.05  ? 41  ASN C OD1 1 
ATOM   4391  N  ND2 . ASN C  1 15  ? 37.702  79.404  -25.397  1.00 69.89  ? 41  ASN C ND2 1 
ATOM   4392  N  N   . GLY C  1 16  ? 33.680  81.244  -22.522  1.00 67.91  ? 42  GLY C N   1 
ATOM   4393  C  CA  . GLY C  1 16  ? 32.231  81.237  -22.460  1.00 67.00  ? 42  GLY C CA  1 
ATOM   4394  C  C   . GLY C  1 16  ? 31.614  80.642  -23.708  1.00 67.21  ? 42  GLY C C   1 
ATOM   4395  O  O   . GLY C  1 16  ? 30.884  81.328  -24.428  1.00 61.73  ? 42  GLY C O   1 
ATOM   4396  N  N   . GLU C  1 17  ? 31.887  79.362  -23.960  1.00 72.48  ? 43  GLU C N   1 
ATOM   4397  C  CA  . GLU C  1 17  ? 31.390  78.662  -25.133  1.00 72.73  ? 43  GLU C CA  1 
ATOM   4398  C  C   . GLU C  1 17  ? 30.199  77.767  -24.804  1.00 72.98  ? 43  GLU C C   1 
ATOM   4399  O  O   . GLU C  1 17  ? 29.786  77.601  -23.653  1.00 77.11  ? 43  GLU C O   1 
ATOM   4400  C  CB  . GLU C  1 17  ? 32.468  77.779  -25.759  1.00 73.06  ? 43  GLU C CB  1 
ATOM   4401  C  CG  . GLU C  1 17  ? 33.433  78.409  -26.729  1.00 77.33  ? 43  GLU C CG  1 
ATOM   4402  C  CD  . GLU C  1 17  ? 34.850  78.031  -26.389  1.00 77.04  ? 43  GLU C CD  1 
ATOM   4403  O  OE1 . GLU C  1 17  ? 35.026  77.005  -25.708  1.00 81.93  ? 43  GLU C OE1 1 
ATOM   4404  O  OE2 . GLU C  1 17  ? 35.803  78.683  -26.869  1.00 83.79  ? 43  GLU C OE2 1 
ATOM   4405  N  N   . LEU C  1 18  ? 29.656  77.173  -25.859  1.00 70.25  ? 44  LEU C N   1 
ATOM   4406  C  CA  . LEU C  1 18  ? 28.900  75.934  -25.806  1.00 70.39  ? 44  LEU C CA  1 
ATOM   4407  C  C   . LEU C  1 18  ? 29.732  74.832  -26.456  1.00 66.62  ? 44  LEU C C   1 
ATOM   4408  O  O   . LEU C  1 18  ? 30.737  75.094  -27.124  1.00 66.64  ? 44  LEU C O   1 
ATOM   4409  C  CB  . LEU C  1 18  ? 27.546  76.092  -26.507  1.00 64.73  ? 44  LEU C CB  1 
ATOM   4410  C  CG  . LEU C  1 18  ? 26.704  77.268  -26.008  1.00 62.90  ? 44  LEU C CG  1 
ATOM   4411  C  CD1 . LEU C  1 18  ? 25.503  77.496  -26.906  1.00 64.78  ? 44  LEU C CD1 1 
ATOM   4412  C  CD2 . LEU C  1 18  ? 26.261  77.042  -24.573  1.00 56.38  ? 44  LEU C CD2 1 
ATOM   4413  N  N   . LEU C  1 19  ? 29.315  73.580  -26.250  1.00 69.08  ? 45  LEU C N   1 
ATOM   4414  C  CA  . LEU C  1 19  ? 30.063  72.468  -26.833  1.00 72.47  ? 45  LEU C CA  1 
ATOM   4415  C  C   . LEU C  1 19  ? 29.990  72.487  -28.357  1.00 72.96  ? 45  LEU C C   1 
ATOM   4416  O  O   . LEU C  1 19  ? 30.896  71.977  -29.026  1.00 63.67  ? 45  LEU C O   1 
ATOM   4417  C  CB  . LEU C  1 19  ? 29.550  71.134  -26.276  1.00 63.99  ? 45  LEU C CB  1 
ATOM   4418  C  CG  . LEU C  1 19  ? 30.560  69.984  -26.166  1.00 61.56  ? 45  LEU C CG  1 
ATOM   4419  C  CD1 . LEU C  1 19  ? 30.158  69.009  -25.074  1.00 57.25  ? 45  LEU C CD1 1 
ATOM   4420  C  CD2 . LEU C  1 19  ? 30.717  69.243  -27.484  1.00 69.48  ? 45  LEU C CD2 1 
ATOM   4421  N  N   . SER C  1 20  ? 28.933  73.083  -28.918  1.00 74.81  ? 46  SER C N   1 
ATOM   4422  C  CA  . SER C  1 20  ? 28.811  73.176  -30.370  1.00 77.04  ? 46  SER C CA  1 
ATOM   4423  C  C   . SER C  1 20  ? 29.930  74.022  -30.966  1.00 78.17  ? 46  SER C C   1 
ATOM   4424  O  O   . SER C  1 20  ? 30.436  73.721  -32.054  1.00 78.75  ? 46  SER C O   1 
ATOM   4425  C  CB  . SER C  1 20  ? 27.444  73.751  -30.746  1.00 75.20  ? 46  SER C CB  1 
ATOM   4426  O  OG  . SER C  1 20  ? 27.278  75.068  -30.248  1.00 62.29  ? 46  SER C OG  1 
ATOM   4427  N  N   . GLY C  1 21  ? 30.333  75.080  -30.270  1.00 76.44  ? 47  GLY C N   1 
ATOM   4428  C  CA  . GLY C  1 21  ? 31.398  75.934  -30.755  1.00 82.53  ? 47  GLY C CA  1 
ATOM   4429  C  C   . GLY C  1 21  ? 31.059  77.404  -30.643  1.00 85.19  ? 47  GLY C C   1 
ATOM   4430  O  O   . GLY C  1 21  ? 31.952  78.248  -30.518  1.00 93.76  ? 47  GLY C O   1 
ATOM   4431  N  N   . ALA C  1 22  ? 29.767  77.719  -30.681  1.00 74.61  ? 48  ALA C N   1 
ATOM   4432  C  CA  . ALA C  1 22  ? 29.320  79.100  -30.598  1.00 85.64  ? 48  ALA C CA  1 
ATOM   4433  C  C   . ALA C  1 22  ? 29.469  79.621  -29.169  1.00 82.32  ? 48  ALA C C   1 
ATOM   4434  O  O   . ALA C  1 22  ? 29.971  78.938  -28.270  1.00 79.37  ? 48  ALA C O   1 
ATOM   4435  C  CB  . ALA C  1 22  ? 27.874  79.217  -31.076  1.00 87.55  ? 48  ALA C CB  1 
ATOM   4436  N  N   . CYS C  1 23  ? 29.026  80.857  -28.960  1.00 81.89  ? 49  CYS C N   1 
ATOM   4437  C  CA  . CYS C  1 23  ? 29.054  81.484  -27.649  1.00 79.69  ? 49  CYS C CA  1 
ATOM   4438  C  C   . CYS C  1 23  ? 27.658  81.493  -27.041  1.00 76.05  ? 49  CYS C C   1 
ATOM   4439  O  O   . CYS C  1 23  ? 26.650  81.519  -27.752  1.00 79.37  ? 49  CYS C O   1 
ATOM   4440  C  CB  . CYS C  1 23  ? 29.611  82.906  -27.738  1.00 75.39  ? 49  CYS C CB  1 
ATOM   4441  S  SG  . CYS C  1 23  ? 31.335  82.948  -28.290  1.00 91.03  ? 49  CYS C SG  1 
ATOM   4442  N  N   . CYS C  1 24  ? 27.615  81.458  -25.708  1.00 68.96  ? 50  CYS C N   1 
ATOM   4443  C  CA  . CYS C  1 24  ? 26.367  81.354  -24.959  1.00 68.49  ? 50  CYS C CA  1 
ATOM   4444  C  C   . CYS C  1 24  ? 25.377  82.436  -25.361  1.00 69.53  ? 50  CYS C C   1 
ATOM   4445  O  O   . CYS C  1 24  ? 24.355  82.146  -25.993  1.00 70.79  ? 50  CYS C O   1 
ATOM   4446  C  CB  . CYS C  1 24  ? 26.647  81.424  -23.456  1.00 73.25  ? 50  CYS C CB  1 
ATOM   4447  S  SG  . CYS C  1 24  ? 27.382  79.921  -22.751  1.00 55.10  ? 50  CYS C SG  1 
ATOM   4448  N  N   . ASP C  1 25  ? 25.669  83.681  -24.996  1.00 73.32  ? 51  ASP C N   1 
ATOM   4449  C  CA  . ASP C  1 25  ? 24.848  84.826  -25.361  1.00 77.08  ? 51  ASP C CA  1 
ATOM   4450  C  C   . ASP C  1 25  ? 25.691  85.786  -26.185  1.00 77.47  ? 51  ASP C C   1 
ATOM   4451  O  O   . ASP C  1 25  ? 26.811  86.130  -25.791  1.00 72.14  ? 51  ASP C O   1 
ATOM   4452  C  CB  . ASP C  1 25  ? 24.287  85.529  -24.122  1.00 69.49  ? 51  ASP C CB  1 
ATOM   4453  C  CG  . ASP C  1 25  ? 23.473  84.602  -23.236  1.00 71.52  ? 51  ASP C CG  1 
ATOM   4454  O  OD1 . ASP C  1 25  ? 23.535  84.760  -21.998  1.00 69.10  ? 51  ASP C OD1 1 
ATOM   4455  O  OD2 . ASP C  1 25  ? 22.768  83.717  -23.769  1.00 77.71  ? 51  ASP C OD2 1 
ATOM   4456  N  N   . GLY C  1 26  ? 25.154  86.214  -27.325  1.00 83.50  ? 52  GLY C N   1 
ATOM   4457  C  CA  . GLY C  1 26  ? 25.896  87.056  -28.242  1.00 79.02  ? 52  GLY C CA  1 
ATOM   4458  C  C   . GLY C  1 26  ? 26.075  86.399  -29.594  1.00 81.01  ? 52  GLY C C   1 
ATOM   4459  O  O   . GLY C  1 26  ? 25.100  86.234  -30.332  1.00 87.90  ? 52  GLY C O   1 
ATOM   4460  N  N   . ASP C  1 27  ? 27.313  86.012  -29.915  1.00 84.24  ? 53  ASP C N   1 
ATOM   4461  C  CA  . ASP C  1 27  ? 27.668  85.382  -31.185  1.00 90.54  ? 53  ASP C CA  1 
ATOM   4462  C  C   . ASP C  1 27  ? 27.482  86.362  -32.341  1.00 80.08  ? 53  ASP C C   1 
ATOM   4463  O  O   . ASP C  1 27  ? 26.609  86.170  -33.195  1.00 70.57  ? 53  ASP C O   1 
ATOM   4464  C  CB  . ASP C  1 27  ? 26.846  84.106  -31.415  1.00 82.63  ? 53  ASP C CB  1 
ATOM   4465  C  CG  . ASP C  1 27  ? 27.618  83.037  -32.169  1.00 82.40  ? 53  ASP C CG  1 
ATOM   4466  O  OD1 . ASP C  1 27  ? 28.741  82.693  -31.738  1.00 79.53  ? 53  ASP C OD1 1 
ATOM   4467  O  OD2 . ASP C  1 27  ? 27.100  82.541  -33.193  1.00 79.28  ? 53  ASP C OD2 1 
ATOM   4468  N  N   . GLY C  1 28  ? 28.304  87.409  -32.376  1.00 76.16  ? 54  GLY C N   1 
ATOM   4469  C  CA  . GLY C  1 28  ? 28.180  88.446  -33.381  1.00 72.93  ? 54  GLY C CA  1 
ATOM   4470  C  C   . GLY C  1 28  ? 27.943  89.816  -32.776  1.00 85.83  ? 54  GLY C C   1 
ATOM   4471  O  O   . GLY C  1 28  ? 28.676  90.765  -33.074  1.00 89.68  ? 54  GLY C O   1 
ATOM   4472  N  N   . ARG C  1 29  ? 26.922  89.919  -31.922  1.00 87.52  ? 55  ARG C N   1 
ATOM   4473  C  CA  . ARG C  1 29  ? 26.550  91.162  -31.234  1.00 90.64  ? 55  ARG C CA  1 
ATOM   4474  C  C   . ARG C  1 29  ? 27.754  91.908  -30.651  1.00 94.35  ? 55  ARG C C   1 
ATOM   4475  O  O   . ARG C  1 29  ? 28.198  92.923  -31.194  1.00 86.26  ? 55  ARG C O   1 
ATOM   4476  C  CB  . ARG C  1 29  ? 25.550  90.865  -30.107  1.00 83.32  ? 55  ARG C CB  1 
ATOM   4477  C  CG  . ARG C  1 29  ? 24.126  90.541  -30.554  1.00 77.94  ? 55  ARG C CG  1 
ATOM   4478  C  CD  . ARG C  1 29  ? 23.276  90.093  -29.362  1.00 76.22  ? 55  ARG C CD  1 
ATOM   4479  N  NE  . ARG C  1 29  ? 22.584  88.827  -29.611  1.00 81.85  ? 55  ARG C NE  1 
ATOM   4480  C  CZ  . ARG C  1 29  ? 22.182  87.987  -28.660  1.00 74.31  ? 55  ARG C CZ  1 
ATOM   4481  N  NH1 . ARG C  1 29  ? 21.560  86.861  -28.984  1.00 56.80  ? 55  ARG C NH1 1 
ATOM   4482  N  NH2 . ARG C  1 29  ? 22.413  88.266  -27.383  1.00 72.93  ? 55  ARG C NH2 1 
ATOM   4483  N  N   . CYS C  1 36  ? 34.200  85.624  -24.510  1.00 88.43  ? 62  CYS C N   1 
ATOM   4484  C  CA  . CYS C  1 36  ? 33.461  85.928  -25.732  1.00 92.25  ? 62  CYS C CA  1 
ATOM   4485  C  C   . CYS C  1 36  ? 32.498  87.094  -25.519  1.00 86.53  ? 62  CYS C C   1 
ATOM   4486  O  O   . CYS C  1 36  ? 31.310  86.999  -25.827  1.00 83.69  ? 62  CYS C O   1 
ATOM   4487  C  CB  . CYS C  1 36  ? 32.694  84.693  -26.217  1.00 87.78  ? 62  CYS C CB  1 
ATOM   4488  S  SG  . CYS C  1 36  ? 31.959  84.829  -27.861  1.00 111.28 ? 62  CYS C SG  1 
ATOM   4489  N  N   . GLY C  1 37  ? 33.017  88.192  -24.980  1.00 83.13  ? 63  GLY C N   1 
ATOM   4490  C  CA  . GLY C  1 37  ? 32.227  89.394  -24.846  1.00 82.64  ? 63  GLY C CA  1 
ATOM   4491  C  C   . GLY C  1 37  ? 31.730  89.674  -23.449  1.00 84.73  ? 63  GLY C C   1 
ATOM   4492  O  O   . GLY C  1 37  ? 32.430  89.453  -22.459  1.00 75.91  ? 63  GLY C O   1 
ATOM   4493  N  N   . HIS C  1 38  ? 30.506  90.168  -23.361  1.00 87.99  ? 64  HIS C N   1 
ATOM   4494  C  CA  . HIS C  1 38  ? 29.986  90.706  -22.119  1.00 84.66  ? 64  HIS C CA  1 
ATOM   4495  C  C   . HIS C  1 38  ? 28.966  89.787  -21.473  1.00 80.34  ? 64  HIS C C   1 
ATOM   4496  O  O   . HIS C  1 38  ? 29.132  89.417  -20.314  1.00 77.00  ? 64  HIS C O   1 
ATOM   4497  C  CB  . HIS C  1 38  ? 29.319  92.063  -22.379  1.00 85.09  ? 64  HIS C CB  1 
ATOM   4498  C  CG  . HIS C  1 38  ? 30.222  93.097  -23.006  1.00 92.91  ? 64  HIS C CG  1 
ATOM   4499  N  ND1 . HIS C  1 38  ? 29.837  94.403  -23.194  1.00 94.74  ? 64  HIS C ND1 1 
ATOM   4500  C  CD2 . HIS C  1 38  ? 31.453  92.988  -23.578  1.00 100.96 ? 64  HIS C CD2 1 
ATOM   4501  C  CE1 . HIS C  1 38  ? 30.816  95.063  -23.802  1.00 97.72  ? 64  HIS C CE1 1 
ATOM   4502  N  NE2 . HIS C  1 38  ? 31.817  94.234  -24.028  1.00 106.07 ? 64  HIS C NE2 1 
ATOM   4503  N  N   . ASP C  1 39  ? 27.931  89.413  -22.213  1.00 77.73  ? 65  ASP C N   1 
ATOM   4504  C  CA  . ASP C  1 39  ? 26.886  88.543  -21.691  1.00 77.68  ? 65  ASP C CA  1 
ATOM   4505  C  C   . ASP C  1 39  ? 27.459  87.149  -21.460  1.00 78.38  ? 65  ASP C C   1 
ATOM   4506  O  O   . ASP C  1 39  ? 27.774  86.428  -22.415  1.00 72.07  ? 65  ASP C O   1 
ATOM   4507  C  CB  . ASP C  1 39  ? 25.703  88.493  -22.655  1.00 67.42  ? 65  ASP C CB  1 
ATOM   4508  C  CG  . ASP C  1 39  ? 24.399  88.081  -21.979  1.00 70.94  ? 65  ASP C CG  1 
ATOM   4509  O  OD1 . ASP C  1 39  ? 24.437  87.294  -21.021  1.00 75.64  ? 65  ASP C OD1 1 
ATOM   4510  O  OD2 . ASP C  1 39  ? 23.328  88.567  -22.417  1.00 65.14  ? 65  ASP C OD2 1 
ATOM   4511  N  N   . GLU C  1 40  ? 27.617  86.778  -20.191  1.00 75.76  ? 66  GLU C N   1 
ATOM   4512  C  CA  . GLU C  1 40  ? 28.195  85.498  -19.821  1.00 64.43  ? 66  GLU C CA  1 
ATOM   4513  C  C   . GLU C  1 40  ? 27.128  84.407  -19.818  1.00 62.86  ? 66  GLU C C   1 
ATOM   4514  O  O   . GLU C  1 40  ? 25.925  84.671  -19.905  1.00 64.72  ? 66  GLU C O   1 
ATOM   4515  C  CB  . GLU C  1 40  ? 28.869  85.602  -18.455  1.00 60.54  ? 66  GLU C CB  1 
ATOM   4516  C  CG  . GLU C  1 40  ? 30.119  86.468  -18.450  1.00 63.44  ? 66  GLU C CG  1 
ATOM   4517  C  CD  . GLU C  1 40  ? 30.741  86.602  -17.072  1.00 72.50  ? 66  GLU C CD  1 
ATOM   4518  O  OE1 . GLU C  1 40  ? 30.641  87.698  -16.479  1.00 69.21  ? 66  GLU C OE1 1 
ATOM   4519  O  OE2 . GLU C  1 40  ? 31.326  85.611  -16.581  1.00 68.33  ? 66  GLU C OE2 1 
ATOM   4520  N  N   . CYS C  1 41  ? 27.591  83.161  -19.724  1.00 58.76  ? 67  CYS C N   1 
ATOM   4521  C  CA  . CYS C  1 41  ? 26.682  82.023  -19.676  1.00 60.67  ? 67  CYS C CA  1 
ATOM   4522  C  C   . CYS C  1 41  ? 25.896  82.024  -18.371  1.00 55.45  ? 67  CYS C C   1 
ATOM   4523  O  O   . CYS C  1 41  ? 26.424  82.360  -17.310  1.00 55.16  ? 67  CYS C O   1 
ATOM   4524  C  CB  . CYS C  1 41  ? 27.454  80.709  -19.813  1.00 57.51  ? 67  CYS C CB  1 
ATOM   4525  S  SG  . CYS C  1 41  ? 28.557  80.613  -21.247  1.00 59.45  ? 67  CYS C SG  1 
ATOM   4526  N  N   . ASP C  1 42  ? 24.622  81.650  -18.453  1.00 54.71  ? 68  ASP C N   1 
ATOM   4527  C  CA  . ASP C  1 42  ? 23.767  81.546  -17.272  1.00 58.22  ? 68  ASP C CA  1 
ATOM   4528  C  C   . ASP C  1 42  ? 23.742  80.077  -16.854  1.00 54.11  ? 68  ASP C C   1 
ATOM   4529  O  O   . ASP C  1 42  ? 22.796  79.334  -17.117  1.00 55.11  ? 68  ASP C O   1 
ATOM   4530  C  CB  . ASP C  1 42  ? 22.385  82.106  -17.580  1.00 62.55  ? 68  ASP C CB  1 
ATOM   4531  C  CG  . ASP C  1 42  ? 22.456  83.491  -18.203  1.00 62.49  ? 68  ASP C CG  1 
ATOM   4532  O  OD1 . ASP C  1 42  ? 23.093  84.377  -17.596  1.00 67.68  ? 68  ASP C OD1 1 
ATOM   4533  O  OD2 . ASP C  1 42  ? 21.912  83.692  -19.310  1.00 65.11  ? 68  ASP C OD2 1 
ATOM   4534  N  N   . THR C  1 43  ? 24.814  79.669  -16.176  1.00 44.99  ? 69  THR C N   1 
ATOM   4535  C  CA  . THR C  1 43  ? 25.155  78.259  -16.032  1.00 49.60  ? 69  THR C CA  1 
ATOM   4536  C  C   . THR C  1 43  ? 24.326  77.587  -14.945  1.00 47.42  ? 69  THR C C   1 
ATOM   4537  O  O   . THR C  1 43  ? 24.196  78.115  -13.837  1.00 46.86  ? 69  THR C O   1 
ATOM   4538  C  CB  . THR C  1 43  ? 26.642  78.110  -15.710  1.00 52.71  ? 69  THR C CB  1 
ATOM   4539  O  OG1 . THR C  1 43  ? 27.418  78.865  -16.649  1.00 49.33  ? 69  THR C OG1 1 
ATOM   4540  C  CG2 . THR C  1 43  ? 27.064  76.645  -15.776  1.00 47.33  ? 69  THR C CG2 1 
ATOM   4541  N  N   . TYR C  1 44  ? 23.781  76.410  -15.263  1.00 48.54  ? 70  TYR C N   1 
ATOM   4542  C  CA  . TYR C  1 44  ? 23.130  75.550  -14.283  1.00 50.54  ? 70  TYR C CA  1 
ATOM   4543  C  C   . TYR C  1 44  ? 23.503  74.100  -14.574  1.00 45.03  ? 70  TYR C C   1 
ATOM   4544  O  O   . TYR C  1 44  ? 24.036  73.775  -15.639  1.00 40.71  ? 70  TYR C O   1 
ATOM   4545  C  CB  . TYR C  1 44  ? 21.607  75.752  -14.264  1.00 52.50  ? 70  TYR C CB  1 
ATOM   4546  C  CG  . TYR C  1 44  ? 20.872  75.385  -15.535  1.00 55.82  ? 70  TYR C CG  1 
ATOM   4547  C  CD1 . TYR C  1 44  ? 20.840  76.252  -16.623  1.00 55.75  ? 70  TYR C CD1 1 
ATOM   4548  C  CD2 . TYR C  1 44  ? 20.176  74.188  -15.631  1.00 50.68  ? 70  TYR C CD2 1 
ATOM   4549  C  CE1 . TYR C  1 44  ? 20.152  75.921  -17.779  1.00 59.50  ? 70  TYR C CE1 1 
ATOM   4550  C  CE2 . TYR C  1 44  ? 19.489  73.849  -16.780  1.00 58.52  ? 70  TYR C CE2 1 
ATOM   4551  C  CZ  . TYR C  1 44  ? 19.476  74.716  -17.848  1.00 57.46  ? 70  TYR C CZ  1 
ATOM   4552  O  OH  . TYR C  1 44  ? 18.790  74.367  -18.985  1.00 45.22  ? 70  TYR C OH  1 
ATOM   4553  N  N   . VAL C  1 45  ? 23.225  73.225  -13.601  1.00 44.73  ? 71  VAL C N   1 
ATOM   4554  C  CA  . VAL C  1 45  ? 23.742  71.860  -13.579  1.00 41.12  ? 71  VAL C CA  1 
ATOM   4555  C  C   . VAL C  1 45  ? 22.589  70.864  -13.534  1.00 39.98  ? 71  VAL C C   1 
ATOM   4556  O  O   . VAL C  1 45  ? 21.544  71.122  -12.929  1.00 38.94  ? 71  VAL C O   1 
ATOM   4557  C  CB  . VAL C  1 45  ? 24.690  71.652  -12.375  1.00 32.51  ? 71  VAL C CB  1 
ATOM   4558  C  CG1 . VAL C  1 45  ? 25.306  70.262  -12.392  1.00 33.79  ? 71  VAL C CG1 1 
ATOM   4559  C  CG2 . VAL C  1 45  ? 25.769  72.711  -12.363  1.00 38.30  ? 71  VAL C CG2 1 
ATOM   4560  N  N   . ARG C  1 46  ? 22.787  69.715  -14.186  1.00 39.79  ? 72  ARG C N   1 
ATOM   4561  C  CA  . ARG C  1 46  ? 21.879  68.577  -14.103  1.00 38.14  ? 72  ARG C CA  1 
ATOM   4562  C  C   . ARG C  1 46  ? 22.684  67.318  -13.812  1.00 35.95  ? 72  ARG C C   1 
ATOM   4563  O  O   . ARG C  1 46  ? 23.765  67.124  -14.377  1.00 37.66  ? 72  ARG C O   1 
ATOM   4564  C  CB  . ARG C  1 46  ? 21.072  68.396  -15.399  1.00 40.25  ? 72  ARG C CB  1 
ATOM   4565  C  CG  . ARG C  1 46  ? 20.154  69.562  -15.731  1.00 48.28  ? 72  ARG C CG  1 
ATOM   4566  C  CD  . ARG C  1 46  ? 19.357  69.331  -17.016  1.00 55.44  ? 72  ARG C CD  1 
ATOM   4567  N  NE  . ARG C  1 46  ? 18.326  68.304  -16.865  1.00 70.27  ? 72  ARG C NE  1 
ATOM   4568  C  CZ  . ARG C  1 46  ? 18.242  67.202  -17.608  1.00 70.91  ? 72  ARG C CZ  1 
ATOM   4569  N  NH1 . ARG C  1 46  ? 17.269  66.328  -17.389  1.00 63.56  ? 72  ARG C NH1 1 
ATOM   4570  N  NH2 . ARG C  1 46  ? 19.122  66.975  -18.575  1.00 63.60  ? 72  ARG C NH2 1 
ATOM   4571  N  N   . VAL C  1 47  ? 22.153  66.465  -12.931  1.00 32.15  ? 73  VAL C N   1 
ATOM   4572  C  CA  . VAL C  1 47  ? 22.818  65.239  -12.495  1.00 34.02  ? 73  VAL C CA  1 
ATOM   4573  C  C   . VAL C  1 47  ? 21.942  64.041  -12.844  1.00 31.17  ? 73  VAL C C   1 
ATOM   4574  O  O   . VAL C  1 47  ? 20.727  64.062  -12.625  1.00 31.13  ? 73  VAL C O   1 
ATOM   4575  C  CB  . VAL C  1 47  ? 23.130  65.268  -10.983  1.00 32.81  ? 73  VAL C CB  1 
ATOM   4576  C  CG1 . VAL C  1 47  ? 23.646  63.916  -10.503  1.00 25.57  ? 73  VAL C CG1 1 
ATOM   4577  C  CG2 . VAL C  1 47  ? 24.142  66.361  -10.672  1.00 31.85  ? 73  VAL C CG2 1 
ATOM   4578  N  N   . CYS C  1 48  ? 22.564  62.995  -13.385  1.00 28.79  ? 74  CYS C N   1 
ATOM   4579  C  CA  . CYS C  1 48  ? 21.866  61.792  -13.823  1.00 26.32  ? 74  CYS C CA  1 
ATOM   4580  C  C   . CYS C  1 48  ? 22.599  60.581  -13.271  1.00 30.07  ? 74  CYS C C   1 
ATOM   4581  O  O   . CYS C  1 48  ? 23.792  60.400  -13.534  1.00 35.93  ? 74  CYS C O   1 
ATOM   4582  C  CB  . CYS C  1 48  ? 21.790  61.725  -15.351  1.00 32.91  ? 74  CYS C CB  1 
ATOM   4583  S  SG  . CYS C  1 48  ? 21.112  60.195  -16.050  1.00 46.58  ? 74  CYS C SG  1 
ATOM   4584  N  N   . LEU C  1 49  ? 21.885  59.757  -12.515  1.00 29.75  ? 75  LEU C N   1 
ATOM   4585  C  CA  . LEU C  1 49  ? 22.448  58.602  -11.833  1.00 27.75  ? 75  LEU C CA  1 
ATOM   4586  C  C   . LEU C  1 49  ? 21.754  57.348  -12.345  1.00 31.59  ? 75  LEU C C   1 
ATOM   4587  O  O   . LEU C  1 49  ? 20.520  57.276  -12.343  1.00 33.97  ? 75  LEU C O   1 
ATOM   4588  C  CB  . LEU C  1 49  ? 22.272  58.749  -10.318  1.00 30.64  ? 75  LEU C CB  1 
ATOM   4589  C  CG  . LEU C  1 49  ? 23.016  57.810  -9.369   1.00 30.98  ? 75  LEU C CG  1 
ATOM   4590  C  CD1 . LEU C  1 49  ? 24.521  57.938  -9.555   1.00 29.42  ? 75  LEU C CD1 1 
ATOM   4591  C  CD2 . LEU C  1 49  ? 22.620  58.121  -7.935   1.00 26.65  ? 75  LEU C CD2 1 
ATOM   4592  N  N   . LYS C  1 50  ? 22.538  56.370  -12.793  1.00 25.92  ? 76  LYS C N   1 
ATOM   4593  C  CA  . LYS C  1 50  ? 21.974  55.153  -13.367  1.00 27.00  ? 76  LYS C CA  1 
ATOM   4594  C  C   . LYS C  1 50  ? 22.922  53.994  -13.088  1.00 27.87  ? 76  LYS C C   1 
ATOM   4595  O  O   . LYS C  1 50  ? 23.899  54.131  -12.346  1.00 31.60  ? 76  LYS C O   1 
ATOM   4596  C  CB  . LYS C  1 50  ? 21.706  55.330  -14.867  1.00 33.21  ? 76  LYS C CB  1 
ATOM   4597  C  CG  . LYS C  1 50  ? 22.937  55.642  -15.701  1.00 31.13  ? 76  LYS C CG  1 
ATOM   4598  C  CD  . LYS C  1 50  ? 22.546  55.903  -17.145  1.00 35.65  ? 76  LYS C CD  1 
ATOM   4599  C  CE  . LYS C  1 50  ? 23.748  56.251  -18.007  1.00 35.24  ? 76  LYS C CE  1 
ATOM   4600  N  NZ  . LYS C  1 50  ? 23.355  56.451  -19.424  1.00 33.65  ? 76  LYS C NZ  1 
ATOM   4601  N  N   . GLU C  1 51  ? 22.634  52.846  -13.694  1.00 29.64  ? 77  GLU C N   1 
ATOM   4602  C  CA  . GLU C  1 51  ? 23.401  51.641  -13.422  1.00 31.39  ? 77  GLU C CA  1 
ATOM   4603  C  C   . GLU C  1 51  ? 24.778  51.718  -14.069  1.00 36.22  ? 77  GLU C C   1 
ATOM   4604  O  O   . GLU C  1 51  ? 25.016  52.491  -15.002  1.00 36.85  ? 77  GLU C O   1 
ATOM   4605  C  CB  . GLU C  1 51  ? 22.663  50.401  -13.928  1.00 30.71  ? 77  GLU C CB  1 
ATOM   4606  C  CG  . GLU C  1 51  ? 22.562  50.304  -15.445  1.00 39.71  ? 77  GLU C CG  1 
ATOM   4607  C  CD  . GLU C  1 51  ? 21.474  51.191  -16.029  1.00 35.96  ? 77  GLU C CD  1 
ATOM   4608  O  OE1 . GLU C  1 51  ? 20.566  51.609  -15.274  1.00 33.29  ? 77  GLU C OE1 1 
ATOM   4609  O  OE2 . GLU C  1 51  ? 21.532  51.474  -17.244  1.00 31.67  ? 77  GLU C OE2 1 
ATOM   4610  N  N   . TYR C  1 52  ? 25.690  50.890  -13.562  1.00 40.49  ? 78  TYR C N   1 
ATOM   4611  C  CA  . TYR C  1 52  ? 27.061  50.895  -14.049  1.00 42.46  ? 78  TYR C CA  1 
ATOM   4612  C  C   . TYR C  1 52  ? 27.114  50.518  -15.526  1.00 45.74  ? 78  TYR C C   1 
ATOM   4613  O  O   . TYR C  1 52  ? 26.326  49.705  -16.016  1.00 47.81  ? 78  TYR C O   1 
ATOM   4614  C  CB  . TYR C  1 52  ? 27.926  49.930  -13.235  1.00 44.85  ? 78  TYR C CB  1 
ATOM   4615  C  CG  . TYR C  1 52  ? 29.364  49.866  -13.704  1.00 49.23  ? 78  TYR C CG  1 
ATOM   4616  C  CD1 . TYR C  1 52  ? 30.294  50.809  -13.288  1.00 43.07  ? 78  TYR C CD1 1 
ATOM   4617  C  CD2 . TYR C  1 52  ? 29.790  48.866  -14.571  1.00 55.31  ? 78  TYR C CD2 1 
ATOM   4618  C  CE1 . TYR C  1 52  ? 31.604  50.757  -13.716  1.00 42.87  ? 78  TYR C CE1 1 
ATOM   4619  C  CE2 . TYR C  1 52  ? 31.101  48.805  -15.006  1.00 51.75  ? 78  TYR C CE2 1 
ATOM   4620  C  CZ  . TYR C  1 52  ? 32.003  49.753  -14.576  1.00 52.59  ? 78  TYR C CZ  1 
ATOM   4621  O  OH  . TYR C  1 52  ? 33.309  49.695  -15.009  1.00 53.81  ? 78  TYR C OH  1 
ATOM   4622  N  N   . GLN C  1 53  ? 28.057  51.131  -16.238  1.00 48.89  ? 79  GLN C N   1 
ATOM   4623  C  CA  . GLN C  1 53  ? 28.310  50.830  -17.641  1.00 53.58  ? 79  GLN C CA  1 
ATOM   4624  C  C   . GLN C  1 53  ? 29.804  50.619  -17.827  1.00 56.16  ? 79  GLN C C   1 
ATOM   4625  O  O   . GLN C  1 53  ? 30.603  51.490  -17.467  1.00 52.88  ? 79  GLN C O   1 
ATOM   4626  C  CB  . GLN C  1 53  ? 27.811  51.953  -18.555  1.00 45.95  ? 79  GLN C CB  1 
ATOM   4627  C  CG  . GLN C  1 53  ? 26.303  52.007  -18.717  1.00 45.20  ? 79  GLN C CG  1 
ATOM   4628  C  CD  . GLN C  1 53  ? 25.865  53.034  -19.745  1.00 51.93  ? 79  GLN C CD  1 
ATOM   4629  O  OE1 . GLN C  1 53  ? 26.622  53.385  -20.651  1.00 50.62  ? 79  GLN C OE1 1 
ATOM   4630  N  NE2 . GLN C  1 53  ? 24.636  53.522  -19.610  1.00 53.38  ? 79  GLN C NE2 1 
ATOM   4631  N  N   . ALA C  1 54  ? 30.177  49.458  -18.375  1.00 63.69  ? 80  ALA C N   1 
ATOM   4632  C  CA  . ALA C  1 54  ? 31.574  49.226  -18.728  1.00 58.93  ? 80  ALA C CA  1 
ATOM   4633  C  C   . ALA C  1 54  ? 32.083  50.320  -19.655  1.00 55.64  ? 80  ALA C C   1 
ATOM   4634  O  O   . ALA C  1 54  ? 33.227  50.772  -19.529  1.00 62.78  ? 80  ALA C O   1 
ATOM   4635  C  CB  . ALA C  1 54  ? 31.732  47.851  -19.376  1.00 56.92  ? 80  ALA C CB  1 
ATOM   4636  N  N   . LYS C  1 55  ? 31.241  50.761  -20.586  1.00 52.66  ? 81  LYS C N   1 
ATOM   4637  C  CA  . LYS C  1 55  ? 31.496  51.936  -21.405  1.00 54.55  ? 81  LYS C CA  1 
ATOM   4638  C  C   . LYS C  1 55  ? 30.268  52.832  -21.330  1.00 53.93  ? 81  LYS C C   1 
ATOM   4639  O  O   . LYS C  1 55  ? 29.141  52.361  -21.516  1.00 52.00  ? 81  LYS C O   1 
ATOM   4640  C  CB  . LYS C  1 55  ? 31.821  51.544  -22.853  1.00 50.03  ? 81  LYS C CB  1 
ATOM   4641  C  CG  . LYS C  1 55  ? 31.506  52.602  -23.900  1.00 54.51  ? 81  LYS C CG  1 
ATOM   4642  C  CD  . LYS C  1 55  ? 30.138  52.363  -24.544  1.00 58.84  ? 81  LYS C CD  1 
ATOM   4643  C  CE  . LYS C  1 55  ? 29.756  53.491  -25.494  1.00 51.60  ? 81  LYS C CE  1 
ATOM   4644  N  NZ  . LYS C  1 55  ? 28.554  53.156  -26.305  1.00 43.72  ? 81  LYS C NZ  1 
ATOM   4645  N  N   . VAL C  1 56  ? 30.487  54.114  -21.061  1.00 55.00  ? 82  VAL C N   1 
ATOM   4646  C  CA  . VAL C  1 56  ? 29.400  55.037  -20.754  1.00 53.22  ? 82  VAL C CA  1 
ATOM   4647  C  C   . VAL C  1 56  ? 28.709  55.476  -22.037  1.00 47.24  ? 82  VAL C C   1 
ATOM   4648  O  O   . VAL C  1 56  ? 29.347  55.647  -23.083  1.00 48.97  ? 82  VAL C O   1 
ATOM   4649  C  CB  . VAL C  1 56  ? 29.931  56.251  -19.969  1.00 54.09  ? 82  VAL C CB  1 
ATOM   4650  C  CG1 . VAL C  1 56  ? 28.778  57.042  -19.355  1.00 41.80  ? 82  VAL C CG1 1 
ATOM   4651  C  CG2 . VAL C  1 56  ? 30.926  55.804  -18.901  1.00 50.52  ? 82  VAL C CG2 1 
ATOM   4652  N  N   . THR C  1 57  ? 27.385  55.667  -21.953  1.00 45.46  ? 83  THR C N   1 
ATOM   4653  C  CA  . THR C  1 57  ? 26.564  56.255  -22.998  1.00 46.50  ? 83  THR C CA  1 
ATOM   4654  C  C   . THR C  1 57  ? 26.016  57.601  -22.533  1.00 46.24  ? 83  THR C C   1 
ATOM   4655  O  O   . THR C  1 57  ? 25.572  57.723  -21.386  1.00 38.53  ? 83  THR C O   1 
ATOM   4656  C  CB  . THR C  1 57  ? 25.395  55.338  -23.386  1.00 46.45  ? 83  THR C CB  1 
ATOM   4657  O  OG1 . THR C  1 57  ? 24.639  54.993  -22.220  1.00 44.31  ? 83  THR C OG1 1 
ATOM   4658  C  CG2 . THR C  1 57  ? 25.906  54.068  -24.049  1.00 47.33  ? 83  THR C CG2 1 
ATOM   4659  N  N   . PRO C  1 58  ? 26.023  58.620  -23.399  1.00 44.59  ? 84  PRO C N   1 
ATOM   4660  C  CA  . PRO C  1 58  ? 25.669  59.973  -22.936  1.00 48.26  ? 84  PRO C CA  1 
ATOM   4661  C  C   . PRO C  1 58  ? 24.217  60.131  -22.504  1.00 46.72  ? 84  PRO C C   1 
ATOM   4662  O  O   . PRO C  1 58  ? 23.934  60.981  -21.650  1.00 52.05  ? 84  PRO C O   1 
ATOM   4663  C  CB  . PRO C  1 58  ? 25.991  60.852  -24.153  1.00 50.25  ? 84  PRO C CB  1 
ATOM   4664  C  CG  . PRO C  1 58  ? 25.893  59.927  -25.318  1.00 48.28  ? 84  PRO C CG  1 
ATOM   4665  C  CD  . PRO C  1 58  ? 26.380  58.596  -24.826  1.00 40.31  ? 84  PRO C CD  1 
ATOM   4666  N  N   . THR C  1 59  ? 23.285  59.360  -23.061  1.00 44.86  ? 85  THR C N   1 
ATOM   4667  C  CA  . THR C  1 59  ? 21.888  59.504  -22.666  1.00 43.49  ? 85  THR C CA  1 
ATOM   4668  C  C   . THR C  1 59  ? 21.243  58.156  -22.364  1.00 42.09  ? 85  THR C C   1 
ATOM   4669  O  O   . THR C  1 59  ? 21.916  57.120  -22.374  1.00 41.19  ? 85  THR C O   1 
ATOM   4670  C  CB  . THR C  1 59  ? 21.095  60.241  -23.749  1.00 59.08  ? 85  THR C CB  1 
ATOM   4671  O  OG1 . THR C  1 59  ? 21.403  59.683  -25.034  1.00 61.03  ? 85  THR C OG1 1 
ATOM   4672  C  CG2 . THR C  1 59  ? 21.430  61.734  -23.742  1.00 47.33  ? 85  THR C CG2 1 
ATOM   4673  N  N   . GLY C  1 60  ? 19.936  58.165  -22.105  1.00 43.43  ? 86  GLY C N   1 
ATOM   4674  C  CA  . GLY C  1 60  ? 19.231  57.004  -21.611  1.00 36.78  ? 86  GLY C CA  1 
ATOM   4675  C  C   . GLY C  1 60  ? 18.489  57.332  -20.328  1.00 43.59  ? 86  GLY C C   1 
ATOM   4676  O  O   . GLY C  1 60  ? 18.488  58.478  -19.865  1.00 46.87  ? 86  GLY C O   1 
ATOM   4677  N  N   . PRO C  1 61  ? 17.834  56.340  -19.729  1.00 44.84  ? 87  PRO C N   1 
ATOM   4678  C  CA  . PRO C  1 61  ? 17.095  56.598  -18.486  1.00 42.78  ? 87  PRO C CA  1 
ATOM   4679  C  C   . PRO C  1 61  ? 18.024  56.710  -17.286  1.00 35.86  ? 87  PRO C C   1 
ATOM   4680  O  O   . PRO C  1 61  ? 18.943  55.906  -17.105  1.00 35.19  ? 87  PRO C O   1 
ATOM   4681  C  CB  . PRO C  1 61  ? 16.170  55.376  -18.359  1.00 37.01  ? 87  PRO C CB  1 
ATOM   4682  C  CG  . PRO C  1 61  ? 16.217  54.687  -19.693  1.00 31.16  ? 87  PRO C CG  1 
ATOM   4683  C  CD  . PRO C  1 61  ? 17.573  54.990  -20.249  1.00 42.92  ? 87  PRO C CD  1 
ATOM   4684  N  N   . CYS C  1 62  ? 17.774  57.728  -16.462  1.00 31.79  ? 88  CYS C N   1 
ATOM   4685  C  CA  . CYS C  1 62  ? 18.498  57.920  -15.205  1.00 33.78  ? 88  CYS C CA  1 
ATOM   4686  C  C   . CYS C  1 62  ? 17.870  56.998  -14.162  1.00 35.73  ? 88  CYS C C   1 
ATOM   4687  O  O   . CYS C  1 62  ? 17.020  57.390  -13.358  1.00 36.86  ? 88  CYS C O   1 
ATOM   4688  C  CB  . CYS C  1 62  ? 18.459  59.384  -14.785  1.00 33.58  ? 88  CYS C CB  1 
ATOM   4689  S  SG  . CYS C  1 62  ? 19.089  60.481  -16.084  1.00 39.50  ? 88  CYS C SG  1 
ATOM   4690  N  N   . SER C  1 63  ? 18.319  55.739  -14.181  1.00 31.48  ? 89  SER C N   1 
ATOM   4691  C  CA  . SER C  1 63  ? 17.605  54.671  -13.489  1.00 30.98  ? 89  SER C CA  1 
ATOM   4692  C  C   . SER C  1 63  ? 17.572  54.874  -11.981  1.00 31.32  ? 89  SER C C   1 
ATOM   4693  O  O   . SER C  1 63  ? 16.623  54.437  -11.320  1.00 33.65  ? 89  SER C O   1 
ATOM   4694  C  CB  . SER C  1 63  ? 18.242  53.323  -13.821  1.00 28.05  ? 89  SER C CB  1 
ATOM   4695  O  OG  . SER C  1 63  ? 18.362  53.156  -15.218  1.00 26.25  ? 89  SER C OG  1 
ATOM   4696  N  N   . TYR C  1 64  ? 18.589  55.522  -11.415  1.00 28.87  ? 90  TYR C N   1 
ATOM   4697  C  CA  . TYR C  1 64  ? 18.676  55.673  -9.970   1.00 24.93  ? 90  TYR C CA  1 
ATOM   4698  C  C   . TYR C  1 64  ? 18.201  57.033  -9.482   1.00 28.13  ? 90  TYR C C   1 
ATOM   4699  O  O   . TYR C  1 64  ? 18.072  57.225  -8.267   1.00 36.29  ? 90  TYR C O   1 
ATOM   4700  C  CB  . TYR C  1 64  ? 20.114  55.431  -9.488   1.00 25.47  ? 90  TYR C CB  1 
ATOM   4701  C  CG  . TYR C  1 64  ? 20.661  54.047  -9.792   1.00 30.97  ? 90  TYR C CG  1 
ATOM   4702  C  CD1 . TYR C  1 64  ? 19.820  53.004  -10.167  1.00 28.40  ? 90  TYR C CD1 1 
ATOM   4703  C  CD2 . TYR C  1 64  ? 22.022  53.784  -9.699   1.00 30.72  ? 90  TYR C CD2 1 
ATOM   4704  C  CE1 . TYR C  1 64  ? 20.320  51.742  -10.449  1.00 23.92  ? 90  TYR C CE1 1 
ATOM   4705  C  CE2 . TYR C  1 64  ? 22.530  52.522  -9.977   1.00 31.29  ? 90  TYR C CE2 1 
ATOM   4706  C  CZ  . TYR C  1 64  ? 21.675  51.507  -10.352  1.00 29.22  ? 90  TYR C CZ  1 
ATOM   4707  O  OH  . TYR C  1 64  ? 22.182  50.257  -10.630  1.00 29.45  ? 90  TYR C OH  1 
ATOM   4708  N  N   . GLY C  1 65  ? 17.933  57.972  -10.384  1.00 23.42  ? 91  GLY C N   1 
ATOM   4709  C  CA  . GLY C  1 65  ? 17.431  59.272  -9.982   1.00 24.84  ? 91  GLY C CA  1 
ATOM   4710  C  C   . GLY C  1 65  ? 18.098  60.417  -10.713  1.00 29.81  ? 91  GLY C C   1 
ATOM   4711  O  O   . GLY C  1 65  ? 18.994  60.191  -11.532  1.00 32.54  ? 91  GLY C O   1 
ATOM   4712  N  N   . HIS C  1 66  ? 17.674  61.648  -10.429  1.00 27.78  ? 92  HIS C N   1 
ATOM   4713  C  CA  . HIS C  1 66  ? 18.209  62.813  -11.120  1.00 28.90  ? 92  HIS C CA  1 
ATOM   4714  C  C   . HIS C  1 66  ? 17.846  64.070  -10.344  1.00 33.05  ? 92  HIS C C   1 
ATOM   4715  O  O   . HIS C  1 66  ? 16.964  64.059  -9.483   1.00 38.08  ? 92  HIS C O   1 
ATOM   4716  C  CB  . HIS C  1 66  ? 17.694  62.903  -12.564  1.00 30.57  ? 92  HIS C CB  1 
ATOM   4717  C  CG  . HIS C  1 66  ? 16.202  62.991  -12.679  1.00 36.33  ? 92  HIS C CG  1 
ATOM   4718  N  ND1 . HIS C  1 66  ? 15.499  64.145  -12.406  1.00 42.08  ? 92  HIS C ND1 1 
ATOM   4719  C  CD2 . HIS C  1 66  ? 15.282  62.070  -13.053  1.00 36.70  ? 92  HIS C CD2 1 
ATOM   4720  C  CE1 . HIS C  1 66  ? 14.210  63.930  -12.599  1.00 38.66  ? 92  HIS C CE1 1 
ATOM   4721  N  NE2 . HIS C  1 66  ? 14.051  62.679  -12.992  1.00 40.55  ? 92  HIS C NE2 1 
ATOM   4722  N  N   . GLY C  1 67  ? 18.543  65.156  -10.666  1.00 31.54  ? 93  GLY C N   1 
ATOM   4723  C  CA  . GLY C  1 67  ? 18.294  66.435  -10.031  1.00 37.01  ? 93  GLY C CA  1 
ATOM   4724  C  C   . GLY C  1 67  ? 18.825  67.560  -10.894  1.00 41.52  ? 93  GLY C C   1 
ATOM   4725  O  O   . GLY C  1 67  ? 19.454  67.334  -11.930  1.00 43.17  ? 93  GLY C O   1 
ATOM   4726  N  N   . ALA C  1 68  ? 18.564  68.788  -10.450  1.00 40.22  ? 94  ALA C N   1 
ATOM   4727  C  CA  . ALA C  1 68  ? 18.997  69.962  -11.195  1.00 41.92  ? 94  ALA C CA  1 
ATOM   4728  C  C   . ALA C  1 68  ? 19.109  71.150  -10.249  1.00 43.03  ? 94  ALA C C   1 
ATOM   4729  O  O   . ALA C  1 68  ? 18.411  71.224  -9.236   1.00 44.98  ? 94  ALA C O   1 
ATOM   4730  C  CB  . ALA C  1 68  ? 18.038  70.282  -12.347  1.00 34.19  ? 94  ALA C CB  1 
ATOM   4731  N  N   . THR C  1 69  ? 19.993  72.076  -10.598  1.00 43.66  ? 95  THR C N   1 
ATOM   4732  C  CA  . THR C  1 69  ? 20.257  73.271  -9.816   1.00 45.47  ? 95  THR C CA  1 
ATOM   4733  C  C   . THR C  1 69  ? 19.709  74.506  -10.520  1.00 51.24  ? 95  THR C C   1 
ATOM   4734  O  O   . THR C  1 69  ? 19.479  74.492  -11.734  1.00 48.15  ? 95  THR C O   1 
ATOM   4735  C  CB  . THR C  1 69  ? 21.768  73.451  -9.589   1.00 42.77  ? 95  THR C CB  1 
ATOM   4736  O  OG1 . THR C  1 69  ? 22.404  73.779  -10.829  1.00 47.32  ? 95  THR C OG1 1 
ATOM   4737  C  CG2 . THR C  1 69  ? 22.381  72.177  -9.050   1.00 34.35  ? 95  THR C CG2 1 
ATOM   4738  N  N   . PRO C  1 70  ? 19.479  75.600  -9.784   1.00 53.77  ? 96  PRO C N   1 
ATOM   4739  C  CA  . PRO C  1 70  ? 19.230  76.886  -10.451  1.00 53.48  ? 96  PRO C CA  1 
ATOM   4740  C  C   . PRO C  1 70  ? 20.493  77.405  -11.120  1.00 54.64  ? 96  PRO C C   1 
ATOM   4741  O  O   . PRO C  1 70  ? 21.471  76.663  -11.257  1.00 52.52  ? 96  PRO C O   1 
ATOM   4742  C  CB  . PRO C  1 70  ? 18.777  77.798  -9.304   1.00 52.26  ? 96  PRO C CB  1 
ATOM   4743  C  CG  . PRO C  1 70  ? 19.377  77.181  -8.078   1.00 50.96  ? 96  PRO C CG  1 
ATOM   4744  C  CD  . PRO C  1 70  ? 19.349  75.701  -8.319   1.00 43.75  ? 96  PRO C CD  1 
ATOM   4745  N  N   . VAL C  1 71  ? 20.499  78.664  -11.538  1.00 53.12  ? 97  VAL C N   1 
ATOM   4746  C  CA  . VAL C  1 71  ? 21.714  79.265  -12.077  1.00 53.94  ? 97  VAL C CA  1 
ATOM   4747  C  C   . VAL C  1 71  ? 22.645  79.608  -10.921  1.00 52.01  ? 97  VAL C C   1 
ATOM   4748  O  O   . VAL C  1 71  ? 22.215  80.177  -9.910   1.00 54.62  ? 97  VAL C O   1 
ATOM   4749  C  CB  . VAL C  1 71  ? 21.384  80.504  -12.925  1.00 51.98  ? 97  VAL C CB  1 
ATOM   4750  C  CG1 . VAL C  1 71  ? 22.659  81.213  -13.351  1.00 45.82  ? 97  VAL C CG1 1 
ATOM   4751  C  CG2 . VAL C  1 71  ? 20.575  80.102  -14.148  1.00 53.68  ? 97  VAL C CG2 1 
ATOM   4752  N  N   . LEU C  1 72  ? 23.926  79.253  -11.061  1.00 46.83  ? 98  LEU C N   1 
ATOM   4753  C  CA  . LEU C  1 72  ? 24.900  79.462  -10.000  1.00 52.65  ? 98  LEU C CA  1 
ATOM   4754  C  C   . LEU C  1 72  ? 25.955  80.516  -10.312  1.00 57.56  ? 98  LEU C C   1 
ATOM   4755  O  O   . LEU C  1 72  ? 26.584  81.023  -9.378   1.00 62.85  ? 98  LEU C O   1 
ATOM   4756  C  CB  . LEU C  1 72  ? 25.616  78.144  -9.663   1.00 56.60  ? 98  LEU C CB  1 
ATOM   4757  C  CG  . LEU C  1 72  ? 24.755  76.949  -9.252   1.00 54.12  ? 98  LEU C CG  1 
ATOM   4758  C  CD1 . LEU C  1 72  ? 24.449  76.095  -10.461  1.00 55.19  ? 98  LEU C CD1 1 
ATOM   4759  C  CD2 . LEU C  1 72  ? 25.438  76.121  -8.178   1.00 52.99  ? 98  LEU C CD2 1 
ATOM   4760  N  N   . GLY C  1 73  ? 26.176  80.848  -11.575  1.00 55.76  ? 99  GLY C N   1 
ATOM   4761  C  CA  . GLY C  1 73  ? 27.194  81.823  -11.898  1.00 51.43  ? 99  GLY C CA  1 
ATOM   4762  C  C   . GLY C  1 73  ? 27.198  82.186  -13.364  1.00 54.03  ? 99  GLY C C   1 
ATOM   4763  O  O   . GLY C  1 73  ? 26.196  82.028  -14.065  1.00 50.80  ? 99  GLY C O   1 
ATOM   4764  N  N   . GLY C  1 74  ? 28.349  82.686  -13.815  1.00 54.75  ? 100 GLY C N   1 
ATOM   4765  C  CA  . GLY C  1 74  ? 28.533  83.085  -15.197  1.00 49.29  ? 100 GLY C CA  1 
ATOM   4766  C  C   . GLY C  1 74  ? 29.339  82.084  -15.999  1.00 47.90  ? 100 GLY C C   1 
ATOM   4767  O  O   . GLY C  1 74  ? 29.010  80.894  -16.028  1.00 50.02  ? 100 GLY C O   1 
ATOM   4768  N  N   . ASN C  1 75  ? 30.398  82.552  -16.660  1.00 48.32  ? 101 ASN C N   1 
ATOM   4769  C  CA  . ASN C  1 75  ? 31.286  81.639  -17.374  1.00 55.43  ? 101 ASN C CA  1 
ATOM   4770  C  C   . ASN C  1 75  ? 32.056  80.758  -16.399  1.00 54.52  ? 101 ASN C C   1 
ATOM   4771  O  O   . ASN C  1 75  ? 32.167  79.541  -16.593  1.00 54.10  ? 101 ASN C O   1 
ATOM   4772  C  CB  . ASN C  1 75  ? 32.249  82.426  -18.266  1.00 55.72  ? 101 ASN C CB  1 
ATOM   4773  C  CG  . ASN C  1 75  ? 31.560  83.051  -19.468  1.00 61.36  ? 101 ASN C CG  1 
ATOM   4774  O  OD1 . ASN C  1 75  ? 30.345  82.937  -19.639  1.00 60.03  ? 101 ASN C OD1 1 
ATOM   4775  N  ND2 . ASN C  1 75  ? 32.339  83.725  -20.305  1.00 70.41  ? 101 ASN C ND2 1 
ATOM   4776  N  N   . SER C  1 76  ? 32.597  81.358  -15.345  1.00 48.65  ? 102 SER C N   1 
ATOM   4777  C  CA  . SER C  1 76  ? 33.280  80.627  -14.293  1.00 50.22  ? 102 SER C CA  1 
ATOM   4778  C  C   . SER C  1 76  ? 32.787  81.124  -12.943  1.00 49.51  ? 102 SER C C   1 
ATOM   4779  O  O   . SER C  1 76  ? 32.395  82.285  -12.795  1.00 46.60  ? 102 SER C O   1 
ATOM   4780  C  CB  . SER C  1 76  ? 34.798  80.779  -14.401  1.00 51.50  ? 102 SER C CB  1 
ATOM   4781  O  OG  . SER C  1 76  ? 35.256  80.314  -15.658  1.00 55.07  ? 102 SER C OG  1 
ATOM   4782  N  N   . PHE C  1 77  ? 32.792  80.224  -11.963  1.00 43.63  ? 103 PHE C N   1 
ATOM   4783  C  CA  . PHE C  1 77  ? 32.322  80.566  -10.629  1.00 46.12  ? 103 PHE C CA  1 
ATOM   4784  C  C   . PHE C  1 77  ? 32.871  79.555  -9.636   1.00 44.01  ? 103 PHE C C   1 
ATOM   4785  O  O   . PHE C  1 77  ? 33.111  78.392  -9.973   1.00 43.18  ? 103 PHE C O   1 
ATOM   4786  C  CB  . PHE C  1 77  ? 30.787  80.616  -10.557  1.00 48.79  ? 103 PHE C CB  1 
ATOM   4787  C  CG  . PHE C  1 77  ? 30.113  79.352  -11.012  1.00 52.65  ? 103 PHE C CG  1 
ATOM   4788  C  CD1 . PHE C  1 77  ? 29.737  79.191  -12.338  1.00 52.39  ? 103 PHE C CD1 1 
ATOM   4789  C  CD2 . PHE C  1 77  ? 29.851  78.327  -10.115  1.00 50.77  ? 103 PHE C CD2 1 
ATOM   4790  C  CE1 . PHE C  1 77  ? 29.119  78.026  -12.761  1.00 55.00  ? 103 PHE C CE1 1 
ATOM   4791  C  CE2 . PHE C  1 77  ? 29.235  77.162  -10.530  1.00 50.13  ? 103 PHE C CE2 1 
ATOM   4792  C  CZ  . PHE C  1 77  ? 28.867  77.010  -11.855  1.00 51.58  ? 103 PHE C CZ  1 
ATOM   4793  N  N   . TYR C  1 78  ? 33.069  80.024  -8.409   1.00 47.85  ? 104 TYR C N   1 
ATOM   4794  C  CA  . TYR C  1 78  ? 33.559  79.219  -7.301   1.00 44.44  ? 104 TYR C CA  1 
ATOM   4795  C  C   . TYR C  1 78  ? 32.563  79.326  -6.159   1.00 44.01  ? 104 TYR C C   1 
ATOM   4796  O  O   . TYR C  1 78  ? 32.134  80.430  -5.809   1.00 45.13  ? 104 TYR C O   1 
ATOM   4797  C  CB  . TYR C  1 78  ? 34.942  79.697  -6.853   1.00 37.80  ? 104 TYR C CB  1 
ATOM   4798  C  CG  . TYR C  1 78  ? 35.424  79.100  -5.554   1.00 41.77  ? 104 TYR C CG  1 
ATOM   4799  C  CD1 . TYR C  1 78  ? 36.028  77.851  -5.527   1.00 46.11  ? 104 TYR C CD1 1 
ATOM   4800  C  CD2 . TYR C  1 78  ? 35.290  79.792  -4.354   1.00 44.80  ? 104 TYR C CD2 1 
ATOM   4801  C  CE1 . TYR C  1 78  ? 36.482  77.301  -4.342   1.00 40.25  ? 104 TYR C CE1 1 
ATOM   4802  C  CE2 . TYR C  1 78  ? 35.736  79.247  -3.161   1.00 40.71  ? 104 TYR C CE2 1 
ATOM   4803  C  CZ  . TYR C  1 78  ? 36.331  78.001  -3.163   1.00 41.19  ? 104 TYR C CZ  1 
ATOM   4804  O  OH  . TYR C  1 78  ? 36.781  77.444  -1.989   1.00 39.03  ? 104 TYR C OH  1 
ATOM   4805  N  N   . LEU C  1 79  ? 32.183  78.189  -5.594   1.00 49.39  ? 105 LEU C N   1 
ATOM   4806  C  CA  . LEU C  1 79  ? 31.272  78.217  -4.465   1.00 50.70  ? 105 LEU C CA  1 
ATOM   4807  C  C   . LEU C  1 79  ? 32.019  77.855  -3.195   1.00 47.90  ? 105 LEU C C   1 
ATOM   4808  O  O   . LEU C  1 79  ? 32.802  76.895  -3.190   1.00 41.93  ? 105 LEU C O   1 
ATOM   4809  C  CB  . LEU C  1 79  ? 30.096  77.256  -4.675   1.00 46.82  ? 105 LEU C CB  1 
ATOM   4810  C  CG  . LEU C  1 79  ? 29.447  77.207  -6.069   1.00 54.92  ? 105 LEU C CG  1 
ATOM   4811  C  CD1 . LEU C  1 79  ? 28.585  75.953  -6.202   1.00 44.91  ? 105 LEU C CD1 1 
ATOM   4812  C  CD2 . LEU C  1 79  ? 28.629  78.468  -6.365   1.00 61.19  ? 105 LEU C CD2 1 
ATOM   4813  N  N   . PRO C  1 80  ? 31.819  78.602  -2.116   1.00 53.11  ? 106 PRO C N   1 
ATOM   4814  C  CA  . PRO C  1 80  ? 32.533  78.320  -0.870   1.00 56.37  ? 106 PRO C CA  1 
ATOM   4815  C  C   . PRO C  1 80  ? 31.947  77.108  -0.170   1.00 60.10  ? 106 PRO C C   1 
ATOM   4816  O  O   . PRO C  1 80  ? 30.755  76.802  -0.328   1.00 55.78  ? 106 PRO C O   1 
ATOM   4817  C  CB  . PRO C  1 80  ? 32.321  79.600  -0.049   1.00 56.71  ? 106 PRO C CB  1 
ATOM   4818  C  CG  . PRO C  1 80  ? 31.011  80.126  -0.531   1.00 58.49  ? 106 PRO C CG  1 
ATOM   4819  C  CD  . PRO C  1 80  ? 30.932  79.773  -1.997   1.00 56.44  ? 106 PRO C CD  1 
ATOM   4820  N  N   . PRO C  1 81  ? 32.761  76.375  0.596    1.00 63.54  ? 107 PRO C N   1 
ATOM   4821  C  CA  . PRO C  1 81  ? 32.240  75.213  1.322    1.00 74.16  ? 107 PRO C CA  1 
ATOM   4822  C  C   . PRO C  1 81  ? 32.283  75.380  2.834    1.00 75.22  ? 107 PRO C C   1 
ATOM   4823  O  O   . PRO C  1 81  ? 32.202  76.500  3.351    1.00 69.82  ? 107 PRO C O   1 
ATOM   4824  C  CB  . PRO C  1 81  ? 33.171  74.088  0.858    1.00 68.55  ? 107 PRO C CB  1 
ATOM   4825  C  CG  . PRO C  1 81  ? 34.498  74.818  0.508    1.00 65.83  ? 107 PRO C CG  1 
ATOM   4826  C  CD  . PRO C  1 81  ? 34.227  76.318  0.508    1.00 56.25  ? 107 PRO C CD  1 
ATOM   4827  N  N   . ALA C  1 82  ? 32.427  74.265  3.548    1.00 76.58  ? 108 ALA C N   1 
ATOM   4828  C  CA  . ALA C  1 82  ? 32.370  74.244  5.004    1.00 69.68  ? 108 ALA C CA  1 
ATOM   4829  C  C   . ALA C  1 82  ? 33.408  73.249  5.519    1.00 74.15  ? 108 ALA C C   1 
ATOM   4830  O  O   . ALA C  1 82  ? 34.311  72.826  4.790    1.00 73.38  ? 108 ALA C O   1 
ATOM   4831  C  CB  . ALA C  1 82  ? 30.950  73.904  5.476    1.00 70.54  ? 108 ALA C CB  1 
ATOM   4832  N  N   . GLY C  1 83  ? 33.276  72.874  6.790    1.00 69.54  ? 109 GLY C N   1 
ATOM   4833  C  CA  . GLY C  1 83  ? 34.164  71.907  7.411    1.00 64.53  ? 109 GLY C CA  1 
ATOM   4834  C  C   . GLY C  1 83  ? 33.623  71.344  8.714    1.00 67.67  ? 109 GLY C C   1 
ATOM   4835  O  O   . GLY C  1 83  ? 33.191  72.088  9.597    1.00 60.92  ? 109 GLY C O   1 
ATOM   4836  N  N   . ASP C  1 100 ? 21.860  75.134  0.506    1.00 79.42  ? 126 ASP C N   1 
ATOM   4837  C  CA  . ASP C  1 100 ? 23.019  75.398  -0.340   1.00 79.72  ? 126 ASP C CA  1 
ATOM   4838  C  C   . ASP C  1 100 ? 22.625  75.378  -1.818   1.00 71.95  ? 126 ASP C C   1 
ATOM   4839  O  O   . ASP C  1 100 ? 21.680  74.688  -2.203   1.00 67.57  ? 126 ASP C O   1 
ATOM   4840  C  CB  . ASP C  1 100 ? 24.129  74.379  -0.057   1.00 74.94  ? 126 ASP C CB  1 
ATOM   4841  C  CG  . ASP C  1 100 ? 24.757  74.567  1.319    1.00 93.72  ? 126 ASP C CG  1 
ATOM   4842  O  OD1 . ASP C  1 100 ? 24.488  75.606  1.968    1.00 87.78  ? 126 ASP C OD1 1 
ATOM   4843  O  OD2 . ASP C  1 100 ? 25.528  73.680  1.754    1.00 94.29  ? 126 ASP C OD2 1 
ATOM   4844  N  N   . PRO C  1 101 ? 23.340  76.146  -2.645   1.00 67.11  ? 127 PRO C N   1 
ATOM   4845  C  CA  . PRO C  1 101 ? 22.956  76.257  -4.058   1.00 74.16  ? 127 PRO C CA  1 
ATOM   4846  C  C   . PRO C  1 101 ? 23.607  75.214  -4.957   1.00 65.88  ? 127 PRO C C   1 
ATOM   4847  O  O   . PRO C  1 101 ? 23.041  74.849  -5.994   1.00 54.67  ? 127 PRO C O   1 
ATOM   4848  C  CB  . PRO C  1 101 ? 23.407  77.676  -4.427   1.00 71.36  ? 127 PRO C CB  1 
ATOM   4849  C  CG  . PRO C  1 101 ? 24.483  78.034  -3.418   1.00 62.77  ? 127 PRO C CG  1 
ATOM   4850  C  CD  . PRO C  1 101 ? 24.494  77.002  -2.321   1.00 66.93  ? 127 PRO C CD  1 
ATOM   4851  N  N   . GLY C  1 102 ? 24.786  74.729  -4.576   1.00 57.86  ? 128 GLY C N   1 
ATOM   4852  C  CA  . GLY C  1 102 ? 25.514  73.750  -5.355   1.00 55.06  ? 128 GLY C CA  1 
ATOM   4853  C  C   . GLY C  1 102 ? 25.330  72.308  -4.936   1.00 50.32  ? 128 GLY C C   1 
ATOM   4854  O  O   . GLY C  1 102 ? 26.059  71.438  -5.429   1.00 41.69  ? 128 GLY C O   1 
ATOM   4855  N  N   . LEU C  1 103 ? 24.381  72.022  -4.050   1.00 48.00  ? 129 LEU C N   1 
ATOM   4856  C  CA  . LEU C  1 103 ? 24.150  70.678  -3.545   1.00 38.55  ? 129 LEU C CA  1 
ATOM   4857  C  C   . LEU C  1 103 ? 22.961  70.046  -4.254   1.00 36.60  ? 129 LEU C C   1 
ATOM   4858  O  O   . LEU C  1 103 ? 21.973  70.720  -4.557   1.00 43.93  ? 129 LEU C O   1 
ATOM   4859  C  CB  . LEU C  1 103 ? 23.906  70.709  -2.036   1.00 46.41  ? 129 LEU C CB  1 
ATOM   4860  C  CG  . LEU C  1 103 ? 23.535  69.399  -1.347   1.00 36.55  ? 129 LEU C CG  1 
ATOM   4861  C  CD1 . LEU C  1 103 ? 24.640  68.372  -1.511   1.00 35.07  ? 129 LEU C CD1 1 
ATOM   4862  C  CD2 . LEU C  1 103 ? 23.248  69.660  0.117    1.00 44.31  ? 129 LEU C CD2 1 
ATOM   4863  N  N   . VAL C  1 104 ? 23.067  68.748  -4.524   1.00 33.88  ? 130 VAL C N   1 
ATOM   4864  C  CA  . VAL C  1 104 ? 22.008  67.975  -5.159   1.00 35.77  ? 130 VAL C CA  1 
ATOM   4865  C  C   . VAL C  1 104 ? 21.866  66.666  -4.398   1.00 32.70  ? 130 VAL C C   1 
ATOM   4866  O  O   . VAL C  1 104 ? 22.862  65.978  -4.152   1.00 31.39  ? 130 VAL C O   1 
ATOM   4867  C  CB  . VAL C  1 104 ? 22.303  67.715  -6.650   1.00 37.62  ? 130 VAL C CB  1 
ATOM   4868  C  CG1 . VAL C  1 104 ? 21.337  66.689  -7.227   1.00 31.04  ? 130 VAL C CG1 1 
ATOM   4869  C  CG2 . VAL C  1 104 ? 22.221  69.007  -7.427   1.00 31.71  ? 130 VAL C CG2 1 
ATOM   4870  N  N   . VAL C  1 105 ? 20.635  66.331  -4.020   1.00 33.00  ? 131 VAL C N   1 
ATOM   4871  C  CA  . VAL C  1 105 ? 20.338  65.142  -3.231   1.00 35.46  ? 131 VAL C CA  1 
ATOM   4872  C  C   . VAL C  1 105 ? 19.379  64.263  -4.022   1.00 35.51  ? 131 VAL C C   1 
ATOM   4873  O  O   . VAL C  1 105 ? 18.350  64.744  -4.513   1.00 30.92  ? 131 VAL C O   1 
ATOM   4874  C  CB  . VAL C  1 105 ? 19.740  65.503  -1.859   1.00 37.99  ? 131 VAL C CB  1 
ATOM   4875  C  CG1 . VAL C  1 105 ? 19.414  64.242  -1.073   1.00 34.82  ? 131 VAL C CG1 1 
ATOM   4876  C  CG2 . VAL C  1 105 ? 20.695  66.405  -1.076   1.00 35.12  ? 131 VAL C CG2 1 
ATOM   4877  N  N   . ILE C  1 106 ? 19.718  62.981  -4.138   1.00 34.22  ? 132 ILE C N   1 
ATOM   4878  C  CA  . ILE C  1 106 ? 18.905  61.998  -4.851   1.00 33.98  ? 132 ILE C CA  1 
ATOM   4879  C  C   . ILE C  1 106 ? 18.611  60.834  -3.910   1.00 33.02  ? 132 ILE C C   1 
ATOM   4880  O  O   . ILE C  1 106 ? 19.439  59.921  -3.775   1.00 32.35  ? 132 ILE C O   1 
ATOM   4881  C  CB  . ILE C  1 106 ? 19.608  61.509  -6.129   1.00 32.67  ? 132 ILE C CB  1 
ATOM   4882  C  CG1 . ILE C  1 106 ? 19.882  62.679  -7.078   1.00 31.66  ? 132 ILE C CG1 1 
ATOM   4883  C  CG2 . ILE C  1 106 ? 18.787  60.428  -6.820   1.00 20.88  ? 132 ILE C CG2 1 
ATOM   4884  C  CD1 . ILE C  1 106 ? 20.663  62.289  -8.317   1.00 26.73  ? 132 ILE C CD1 1 
ATOM   4885  N  N   . PRO C  1 107 ? 17.465  60.823  -3.239   1.00 32.89  ? 133 PRO C N   1 
ATOM   4886  C  CA  . PRO C  1 107 ? 17.139  59.699  -2.358   1.00 34.48  ? 133 PRO C CA  1 
ATOM   4887  C  C   . PRO C  1 107 ? 16.752  58.462  -3.154   1.00 33.10  ? 133 PRO C C   1 
ATOM   4888  O  O   . PRO C  1 107 ? 16.347  58.536  -4.316   1.00 37.01  ? 133 PRO C O   1 
ATOM   4889  C  CB  . PRO C  1 107 ? 15.957  60.225  -1.540   1.00 33.67  ? 133 PRO C CB  1 
ATOM   4890  C  CG  . PRO C  1 107 ? 15.325  61.240  -2.426   1.00 35.64  ? 133 PRO C CG  1 
ATOM   4891  C  CD  . PRO C  1 107 ? 16.449  61.887  -3.184   1.00 31.20  ? 133 PRO C CD  1 
ATOM   4892  N  N   . PHE C  1 108 ? 16.886  57.306  -2.504   1.00 35.17  ? 134 PHE C N   1 
ATOM   4893  C  CA  . PHE C  1 108 ? 16.545  56.031  -3.119   1.00 38.13  ? 134 PHE C CA  1 
ATOM   4894  C  C   . PHE C  1 108 ? 15.952  55.087  -2.080   1.00 42.21  ? 134 PHE C C   1 
ATOM   4895  O  O   . PHE C  1 108 ? 16.330  55.108  -0.905   1.00 44.80  ? 134 PHE C O   1 
ATOM   4896  C  CB  . PHE C  1 108 ? 17.764  55.377  -3.791   1.00 38.44  ? 134 PHE C CB  1 
ATOM   4897  C  CG  . PHE C  1 108 ? 18.957  55.219  -2.887   1.00 38.16  ? 134 PHE C CG  1 
ATOM   4898  C  CD1 . PHE C  1 108 ? 19.101  54.092  -2.091   1.00 40.72  ? 134 PHE C CD1 1 
ATOM   4899  C  CD2 . PHE C  1 108 ? 19.946  56.187  -2.852   1.00 37.34  ? 134 PHE C CD2 1 
ATOM   4900  C  CE1 . PHE C  1 108 ? 20.203  53.942  -1.267   1.00 40.79  ? 134 PHE C CE1 1 
ATOM   4901  C  CE2 . PHE C  1 108 ? 21.052  56.040  -2.031   1.00 41.36  ? 134 PHE C CE2 1 
ATOM   4902  C  CZ  . PHE C  1 108 ? 21.181  54.918  -1.239   1.00 38.65  ? 134 PHE C CZ  1 
ATOM   4903  N  N   . GLN C  1 109 ? 15.015  54.255  -2.530   1.00 42.72  ? 135 GLN C N   1 
ATOM   4904  C  CA  . GLN C  1 109 ? 14.369  53.265  -1.677   1.00 48.19  ? 135 GLN C CA  1 
ATOM   4905  C  C   . GLN C  1 109 ? 14.984  51.880  -1.802   1.00 45.89  ? 135 GLN C C   1 
ATOM   4906  O  O   . GLN C  1 109 ? 14.972  51.116  -0.833   1.00 46.27  ? 135 GLN C O   1 
ATOM   4907  C  CB  . GLN C  1 109 ? 12.874  53.169  -2.007   1.00 48.35  ? 135 GLN C CB  1 
ATOM   4908  C  CG  . GLN C  1 109 ? 12.140  54.505  -2.043   1.00 63.57  ? 135 GLN C CG  1 
ATOM   4909  C  CD  . GLN C  1 109 ? 11.209  54.702  -0.855   1.00 76.84  ? 135 GLN C CD  1 
ATOM   4910  O  OE1 . GLN C  1 109 ? 11.600  54.501  0.295    1.00 74.11  ? 135 GLN C OE1 1 
ATOM   4911  N  NE2 . GLN C  1 109 ? 9.968   55.093  -1.132   1.00 79.51  ? 135 GLN C NE2 1 
ATOM   4912  N  N   . PHE C  1 110 ? 15.518  51.545  -2.972   1.00 40.53  ? 136 PHE C N   1 
ATOM   4913  C  CA  . PHE C  1 110 ? 16.072  50.227  -3.226   1.00 41.15  ? 136 PHE C CA  1 
ATOM   4914  C  C   . PHE C  1 110 ? 17.426  50.059  -2.532   1.00 44.71  ? 136 PHE C C   1 
ATOM   4915  O  O   . PHE C  1 110 ? 18.019  51.008  -2.010   1.00 44.32  ? 136 PHE C O   1 
ATOM   4916  C  CB  . PHE C  1 110 ? 16.217  50.003  -4.731   1.00 36.97  ? 136 PHE C CB  1 
ATOM   4917  C  CG  . PHE C  1 110 ? 16.974  51.097  -5.437   1.00 43.06  ? 136 PHE C CG  1 
ATOM   4918  C  CD1 . PHE C  1 110 ? 18.342  50.999  -5.631   1.00 39.17  ? 136 PHE C CD1 1 
ATOM   4919  C  CD2 . PHE C  1 110 ? 16.316  52.227  -5.906   1.00 45.72  ? 136 PHE C CD2 1 
ATOM   4920  C  CE1 . PHE C  1 110 ? 19.039  52.006  -6.279   1.00 38.50  ? 136 PHE C CE1 1 
ATOM   4921  C  CE2 . PHE C  1 110 ? 17.009  53.235  -6.555   1.00 37.49  ? 136 PHE C CE2 1 
ATOM   4922  C  CZ  . PHE C  1 110 ? 18.371  53.124  -6.742   1.00 36.12  ? 136 PHE C CZ  1 
ATOM   4923  N  N   . ALA C  1 111 ? 17.914  48.820  -2.539   1.00 38.15  ? 137 ALA C N   1 
ATOM   4924  C  CA  . ALA C  1 111 ? 19.242  48.529  -2.019   1.00 36.71  ? 137 ALA C CA  1 
ATOM   4925  C  C   . ALA C  1 111 ? 20.310  49.112  -2.939   1.00 39.25  ? 137 ALA C C   1 
ATOM   4926  O  O   . ALA C  1 111 ? 20.284  48.893  -4.153   1.00 41.71  ? 137 ALA C O   1 
ATOM   4927  C  CB  . ALA C  1 111 ? 19.431  47.020  -1.872   1.00 33.26  ? 137 ALA C CB  1 
ATOM   4928  N  N   . TRP C  1 112 ? 21.253  49.845  -2.357   1.00 38.09  ? 138 TRP C N   1 
ATOM   4929  C  CA  . TRP C  1 112 ? 22.289  50.503  -3.144   1.00 39.67  ? 138 TRP C CA  1 
ATOM   4930  C  C   . TRP C  1 112 ? 23.189  49.468  -3.817   1.00 44.69  ? 138 TRP C C   1 
ATOM   4931  O  O   . TRP C  1 112 ? 23.626  48.511  -3.164   1.00 38.08  ? 138 TRP C O   1 
ATOM   4932  C  CB  . TRP C  1 112 ? 23.114  51.440  -2.259   1.00 40.35  ? 138 TRP C CB  1 
ATOM   4933  C  CG  . TRP C  1 112 ? 24.208  52.147  -2.999   1.00 39.65  ? 138 TRP C CG  1 
ATOM   4934  C  CD1 . TRP C  1 112 ? 25.547  51.917  -2.898   1.00 41.51  ? 138 TRP C CD1 1 
ATOM   4935  C  CD2 . TRP C  1 112 ? 24.051  53.189  -3.969   1.00 34.38  ? 138 TRP C CD2 1 
ATOM   4936  N  NE1 . TRP C  1 112 ? 26.237  52.758  -3.738   1.00 42.97  ? 138 TRP C NE1 1 
ATOM   4937  C  CE2 . TRP C  1 112 ? 25.340  53.546  -4.410   1.00 40.92  ? 138 TRP C CE2 1 
ATOM   4938  C  CE3 . TRP C  1 112 ? 22.947  53.854  -4.508   1.00 35.89  ? 138 TRP C CE3 1 
ATOM   4939  C  CZ2 . TRP C  1 112 ? 25.555  54.539  -5.365   1.00 45.91  ? 138 TRP C CZ2 1 
ATOM   4940  C  CZ3 . TRP C  1 112 ? 23.160  54.838  -5.454   1.00 37.87  ? 138 TRP C CZ3 1 
ATOM   4941  C  CH2 . TRP C  1 112 ? 24.455  55.174  -5.872   1.00 43.37  ? 138 TRP C CH2 1 
ATOM   4942  N  N   . PRO C  1 113 ? 23.478  49.615  -5.110   1.00 45.61  ? 139 PRO C N   1 
ATOM   4943  C  CA  . PRO C  1 113 ? 24.270  48.613  -5.839   1.00 46.11  ? 139 PRO C CA  1 
ATOM   4944  C  C   . PRO C  1 113 ? 25.782  48.801  -5.800   1.00 43.71  ? 139 PRO C C   1 
ATOM   4945  O  O   . PRO C  1 113 ? 26.489  48.011  -6.437   1.00 40.69  ? 139 PRO C O   1 
ATOM   4946  C  CB  . PRO C  1 113 ? 23.755  48.770  -7.285   1.00 40.26  ? 139 PRO C CB  1 
ATOM   4947  C  CG  . PRO C  1 113 ? 22.533  49.666  -7.199   1.00 33.54  ? 139 PRO C CG  1 
ATOM   4948  C  CD  . PRO C  1 113 ? 22.781  50.532  -6.024   1.00 33.81  ? 139 PRO C CD  1 
ATOM   4949  N  N   . ARG C  1 114 ? 26.290  49.818  -5.098   1.00 42.42  ? 140 ARG C N   1 
ATOM   4950  C  CA  . ARG C  1 114 ? 27.723  50.094  -4.976   1.00 46.49  ? 140 ARG C CA  1 
ATOM   4951  C  C   . ARG C  1 114 ? 28.347  50.519  -6.305   1.00 44.15  ? 140 ARG C C   1 
ATOM   4952  O  O   . ARG C  1 114 ? 29.049  51.534  -6.363   1.00 44.80  ? 140 ARG C O   1 
ATOM   4953  C  CB  . ARG C  1 114 ? 28.463  48.882  -4.398   1.00 56.28  ? 140 ARG C CB  1 
ATOM   4954  C  CG  . ARG C  1 114 ? 27.969  48.457  -3.017   1.00 62.59  ? 140 ARG C CG  1 
ATOM   4955  C  CD  . ARG C  1 114 ? 28.462  47.061  -2.649   1.00 71.98  ? 140 ARG C CD  1 
ATOM   4956  N  NE  . ARG C  1 114 ? 29.920  46.958  -2.667   1.00 78.88  ? 140 ARG C NE  1 
ATOM   4957  C  CZ  . ARG C  1 114 ? 30.650  46.508  -1.652   1.00 75.41  ? 140 ARG C CZ  1 
ATOM   4958  N  NH1 . ARG C  1 114 ? 30.059  46.110  -0.533   1.00 71.47  ? 140 ARG C NH1 1 
ATOM   4959  N  NH2 . ARG C  1 114 ? 31.972  46.450  -1.757   1.00 78.75  ? 140 ARG C NH2 1 
ATOM   4960  N  N   . SER C  1 115 ? 28.118  49.758  -7.371   1.00 39.77  ? 141 SER C N   1 
ATOM   4961  C  CA  . SER C  1 115 ? 28.530  50.189  -8.701   1.00 42.60  ? 141 SER C CA  1 
ATOM   4962  C  C   . SER C  1 115 ? 27.475  51.117  -9.292   1.00 37.04  ? 141 SER C C   1 
ATOM   4963  O  O   . SER C  1 115 ? 26.275  50.926  -9.079   1.00 42.34  ? 141 SER C O   1 
ATOM   4964  C  CB  . SER C  1 115 ? 28.753  48.983  -9.615   1.00 45.79  ? 141 SER C CB  1 
ATOM   4965  O  OG  . SER C  1 115 ? 27.744  48.003  -9.434   1.00 46.50  ? 141 SER C OG  1 
ATOM   4966  N  N   . PHE C  1 116 ? 27.925  52.131  -10.030  1.00 34.89  ? 142 PHE C N   1 
ATOM   4967  C  CA  . PHE C  1 116 ? 27.006  53.133  -10.555  1.00 36.67  ? 142 PHE C CA  1 
ATOM   4968  C  C   . PHE C  1 116 ? 27.647  53.846  -11.737  1.00 40.90  ? 142 PHE C C   1 
ATOM   4969  O  O   . PHE C  1 116 ? 28.834  53.674  -12.027  1.00 39.11  ? 142 PHE C O   1 
ATOM   4970  C  CB  . PHE C  1 116 ? 26.603  54.144  -9.474   1.00 33.83  ? 142 PHE C CB  1 
ATOM   4971  C  CG  . PHE C  1 116 ? 27.708  55.083  -9.071   1.00 33.10  ? 142 PHE C CG  1 
ATOM   4972  C  CD1 . PHE C  1 116 ? 28.707  54.670  -8.203   1.00 38.02  ? 142 PHE C CD1 1 
ATOM   4973  C  CD2 . PHE C  1 116 ? 27.739  56.385  -9.548   1.00 36.84  ? 142 PHE C CD2 1 
ATOM   4974  C  CE1 . PHE C  1 116 ? 29.726  55.535  -7.827   1.00 40.89  ? 142 PHE C CE1 1 
ATOM   4975  C  CE2 . PHE C  1 116 ? 28.755  57.260  -9.174   1.00 38.71  ? 142 PHE C CE2 1 
ATOM   4976  C  CZ  . PHE C  1 116 ? 29.750  56.833  -8.311   1.00 39.92  ? 142 PHE C CZ  1 
ATOM   4977  N  N   . THR C  1 117 ? 26.832  54.653  -12.417  1.00 34.18  ? 143 THR C N   1 
ATOM   4978  C  CA  . THR C  1 117 ? 27.281  55.547  -13.477  1.00 30.53  ? 143 THR C CA  1 
ATOM   4979  C  C   . THR C  1 117 ? 26.739  56.937  -13.187  1.00 33.31  ? 143 THR C C   1 
ATOM   4980  O  O   . THR C  1 117 ? 25.536  57.101  -12.959  1.00 34.92  ? 143 THR C O   1 
ATOM   4981  C  CB  . THR C  1 117 ? 26.807  55.085  -14.860  1.00 31.96  ? 143 THR C CB  1 
ATOM   4982  O  OG1 . THR C  1 117 ? 27.442  53.848  -15.203  1.00 32.67  ? 143 THR C OG1 1 
ATOM   4983  C  CG2 . THR C  1 117 ? 27.134  56.131  -15.915  1.00 28.61  ? 143 THR C CG2 1 
ATOM   4984  N  N   . LEU C  1 118 ? 27.623  57.928  -13.190  1.00 32.49  ? 144 LEU C N   1 
ATOM   4985  C  CA  . LEU C  1 118 ? 27.252  59.314  -12.949  1.00 32.47  ? 144 LEU C CA  1 
ATOM   4986  C  C   . LEU C  1 118 ? 27.430  60.119  -14.227  1.00 34.27  ? 144 LEU C C   1 
ATOM   4987  O  O   . LEU C  1 118 ? 28.423  59.953  -14.942  1.00 33.99  ? 144 LEU C O   1 
ATOM   4988  C  CB  . LEU C  1 118 ? 28.098  59.922  -11.824  1.00 27.60  ? 144 LEU C CB  1 
ATOM   4989  C  CG  . LEU C  1 118 ? 27.904  61.413  -11.547  1.00 24.55  ? 144 LEU C CG  1 
ATOM   4990  C  CD1 . LEU C  1 118 ? 26.475  61.707  -11.143  1.00 27.65  ? 144 LEU C CD1 1 
ATOM   4991  C  CD2 . LEU C  1 118 ? 28.863  61.887  -10.479  1.00 28.16  ? 144 LEU C CD2 1 
ATOM   4992  N  N   . ILE C  1 119 ? 26.462  60.983  -14.519  1.00 33.24  ? 145 ILE C N   1 
ATOM   4993  C  CA  . ILE C  1 119 ? 26.550  61.910  -15.639  1.00 32.10  ? 145 ILE C CA  1 
ATOM   4994  C  C   . ILE C  1 119 ? 26.183  63.298  -15.137  1.00 38.41  ? 145 ILE C C   1 
ATOM   4995  O  O   . ILE C  1 119 ? 25.122  63.481  -14.527  1.00 32.88  ? 145 ILE C O   1 
ATOM   4996  C  CB  . ILE C  1 119 ? 25.641  61.492  -16.808  1.00 35.33  ? 145 ILE C CB  1 
ATOM   4997  C  CG1 . ILE C  1 119 ? 26.107  60.157  -17.392  1.00 37.81  ? 145 ILE C CG1 1 
ATOM   4998  C  CG2 . ILE C  1 119 ? 25.640  62.561  -17.887  1.00 39.79  ? 145 ILE C CG2 1 
ATOM   4999  C  CD1 . ILE C  1 119 ? 25.346  59.740  -18.629  1.00 34.77  ? 145 ILE C CD1 1 
ATOM   5000  N  N   . VAL C  1 120 ? 27.067  64.266  -15.377  1.00 39.51  ? 146 VAL C N   1 
ATOM   5001  C  CA  . VAL C  1 120 ? 26.883  65.651  -14.955  1.00 37.71  ? 146 VAL C CA  1 
ATOM   5002  C  C   . VAL C  1 120 ? 27.009  66.537  -16.185  1.00 33.77  ? 146 VAL C C   1 
ATOM   5003  O  O   . VAL C  1 120 ? 27.940  66.368  -16.981  1.00 37.10  ? 146 VAL C O   1 
ATOM   5004  C  CB  . VAL C  1 120 ? 27.912  66.057  -13.881  1.00 38.07  ? 146 VAL C CB  1 
ATOM   5005  C  CG1 . VAL C  1 120 ? 27.581  67.427  -13.294  1.00 27.61  ? 146 VAL C CG1 1 
ATOM   5006  C  CG2 . VAL C  1 120 ? 27.989  65.000  -12.787  1.00 35.89  ? 146 VAL C CG2 1 
ATOM   5007  N  N   . GLU C  1 121 ? 26.080  67.478  -16.340  1.00 35.52  ? 147 GLU C N   1 
ATOM   5008  C  CA  . GLU C  1 121 ? 26.055  68.357  -17.501  1.00 37.16  ? 147 GLU C CA  1 
ATOM   5009  C  C   . GLU C  1 121 ? 25.830  69.800  -17.074  1.00 40.77  ? 147 GLU C C   1 
ATOM   5010  O  O   . GLU C  1 121 ? 25.180  70.075  -16.060  1.00 41.48  ? 147 GLU C O   1 
ATOM   5011  C  CB  . GLU C  1 121 ? 24.973  67.926  -18.507  1.00 39.79  ? 147 GLU C CB  1 
ATOM   5012  C  CG  . GLU C  1 121 ? 23.653  67.522  -17.868  1.00 48.71  ? 147 GLU C CG  1 
ATOM   5013  C  CD  . GLU C  1 121 ? 22.762  66.719  -18.802  1.00 49.53  ? 147 GLU C CD  1 
ATOM   5014  O  OE1 . GLU C  1 121 ? 21.538  66.673  -18.553  1.00 53.22  ? 147 GLU C OE1 1 
ATOM   5015  O  OE2 . GLU C  1 121 ? 23.283  66.133  -19.780  1.00 39.22  ? 147 GLU C OE2 1 
ATOM   5016  N  N   . ALA C  1 122 ? 26.381  70.720  -17.863  1.00 39.25  ? 148 ALA C N   1 
ATOM   5017  C  CA  . ALA C  1 122 ? 26.283  72.152  -17.621  1.00 40.51  ? 148 ALA C CA  1 
ATOM   5018  C  C   . ALA C  1 122 ? 25.541  72.813  -18.772  1.00 45.77  ? 148 ALA C C   1 
ATOM   5019  O  O   . ALA C  1 122 ? 25.819  72.533  -19.942  1.00 43.76  ? 148 ALA C O   1 
ATOM   5020  C  CB  . ALA C  1 122 ? 27.669  72.783  -17.463  1.00 40.98  ? 148 ALA C CB  1 
ATOM   5021  N  N   . TRP C  1 123 ? 24.609  73.704  -18.442  1.00 45.17  ? 149 TRP C N   1 
ATOM   5022  C  CA  . TRP C  1 123 ? 23.713  74.279  -19.432  1.00 46.90  ? 149 TRP C CA  1 
ATOM   5023  C  C   . TRP C  1 123 ? 23.660  75.795  -19.304  1.00 54.34  ? 149 TRP C C   1 
ATOM   5024  O  O   . TRP C  1 123 ? 23.668  76.334  -18.194  1.00 49.62  ? 149 TRP C O   1 
ATOM   5025  C  CB  . TRP C  1 123 ? 22.300  73.700  -19.287  1.00 46.90  ? 149 TRP C CB  1 
ATOM   5026  C  CG  . TRP C  1 123 ? 22.184  72.267  -19.695  1.00 49.76  ? 149 TRP C CG  1 
ATOM   5027  C  CD1 . TRP C  1 123 ? 22.481  71.172  -18.938  1.00 49.50  ? 149 TRP C CD1 1 
ATOM   5028  C  CD2 . TRP C  1 123 ? 21.734  71.771  -20.961  1.00 54.18  ? 149 TRP C CD2 1 
ATOM   5029  N  NE1 . TRP C  1 123 ? 22.245  70.022  -19.655  1.00 46.95  ? 149 TRP C NE1 1 
ATOM   5030  C  CE2 . TRP C  1 123 ? 21.785  70.363  -20.899  1.00 51.57  ? 149 TRP C CE2 1 
ATOM   5031  C  CE3 . TRP C  1 123 ? 21.288  72.381  -22.139  1.00 52.12  ? 149 TRP C CE3 1 
ATOM   5032  C  CZ2 . TRP C  1 123 ? 21.414  69.556  -21.973  1.00 59.01  ? 149 TRP C CZ2 1 
ATOM   5033  C  CZ3 . TRP C  1 123 ? 20.920  71.579  -23.204  1.00 52.59  ? 149 TRP C CZ3 1 
ATOM   5034  C  CH2 . TRP C  1 123 ? 20.985  70.181  -23.115  1.00 57.32  ? 149 TRP C CH2 1 
ATOM   5035  N  N   . ASP C  1 124 ? 23.603  76.472  -20.453  1.00 57.30  ? 150 ASP C N   1 
ATOM   5036  C  CA  . ASP C  1 124 ? 23.305  77.898  -20.503  1.00 54.92  ? 150 ASP C CA  1 
ATOM   5037  C  C   . ASP C  1 124 ? 21.795  78.109  -20.477  1.00 58.47  ? 150 ASP C C   1 
ATOM   5038  O  O   . ASP C  1 124 ? 21.044  77.424  -21.176  1.00 55.33  ? 150 ASP C O   1 
ATOM   5039  C  CB  . ASP C  1 124 ? 23.908  78.531  -21.762  1.00 60.77  ? 150 ASP C CB  1 
ATOM   5040  C  CG  . ASP C  1 124 ? 23.408  79.954  -22.017  1.00 60.11  ? 150 ASP C CG  1 
ATOM   5041  O  OD1 . ASP C  1 124 ? 23.221  80.722  -21.048  1.00 62.45  ? 150 ASP C OD1 1 
ATOM   5042  O  OD2 . ASP C  1 124 ? 23.204  80.308  -23.200  1.00 61.72  ? 150 ASP C OD2 1 
ATOM   5043  N  N   . TRP C  1 125 ? 21.354  79.057  -19.658  1.00 60.01  ? 151 TRP C N   1 
ATOM   5044  C  CA  . TRP C  1 125 ? 19.940  79.336  -19.462  1.00 57.93  ? 151 TRP C CA  1 
ATOM   5045  C  C   . TRP C  1 125 ? 19.571  80.642  -20.152  1.00 60.36  ? 151 TRP C C   1 
ATOM   5046  O  O   . TRP C  1 125 ? 20.303  81.634  -20.060  1.00 58.86  ? 151 TRP C O   1 
ATOM   5047  C  CB  . TRP C  1 125 ? 19.606  79.407  -17.969  1.00 55.33  ? 151 TRP C CB  1 
ATOM   5048  C  CG  . TRP C  1 125 ? 18.158  79.623  -17.658  1.00 55.81  ? 151 TRP C CG  1 
ATOM   5049  C  CD1 . TRP C  1 125 ? 17.606  80.713  -17.053  1.00 59.37  ? 151 TRP C CD1 1 
ATOM   5050  C  CD2 . TRP C  1 125 ? 17.076  78.723  -17.926  1.00 60.61  ? 151 TRP C CD2 1 
ATOM   5051  N  NE1 . TRP C  1 125 ? 16.248  80.549  -16.927  1.00 58.78  ? 151 TRP C NE1 1 
ATOM   5052  C  CE2 . TRP C  1 125 ? 15.897  79.336  -17.456  1.00 63.40  ? 151 TRP C CE2 1 
ATOM   5053  C  CE3 . TRP C  1 125 ? 16.988  77.459  -18.518  1.00 59.18  ? 151 TRP C CE3 1 
ATOM   5054  C  CZ2 . TRP C  1 125 ? 14.648  78.730  -17.561  1.00 65.89  ? 151 TRP C CZ2 1 
ATOM   5055  C  CZ3 . TRP C  1 125 ? 15.747  76.859  -18.619  1.00 62.70  ? 151 TRP C CZ3 1 
ATOM   5056  C  CH2 . TRP C  1 125 ? 14.594  77.494  -18.144  1.00 64.92  ? 151 TRP C CH2 1 
ATOM   5057  N  N   . ASP C  1 126 ? 18.434  80.634  -20.852  1.00 64.12  ? 152 ASP C N   1 
ATOM   5058  C  CA  . ASP C  1 126 ? 17.956  81.804  -21.581  1.00 66.62  ? 152 ASP C CA  1 
ATOM   5059  C  C   . ASP C  1 126 ? 16.485  82.078  -21.282  1.00 71.14  ? 152 ASP C C   1 
ATOM   5060  O  O   . ASP C  1 126 ? 15.764  82.610  -22.131  1.00 71.77  ? 152 ASP C O   1 
ATOM   5061  C  CB  . ASP C  1 126 ? 18.182  81.637  -23.085  1.00 54.88  ? 152 ASP C CB  1 
ATOM   5062  C  CG  . ASP C  1 126 ? 19.658  81.605  -23.452  1.00 62.16  ? 152 ASP C CG  1 
ATOM   5063  O  OD1 . ASP C  1 126 ? 20.491  81.412  -22.543  1.00 72.09  ? 152 ASP C OD1 1 
ATOM   5064  O  OD2 . ASP C  1 126 ? 19.991  81.770  -24.643  1.00 59.53  ? 152 ASP C OD2 1 
ATOM   5065  N  N   . ASN C  1 127 ? 16.038  81.730  -20.072  1.00 66.80  ? 153 ASN C N   1 
ATOM   5066  C  CA  . ASN C  1 127 ? 14.652  81.914  -19.633  1.00 69.47  ? 153 ASN C CA  1 
ATOM   5067  C  C   . ASN C  1 127 ? 13.666  81.334  -20.647  1.00 75.34  ? 153 ASN C C   1 
ATOM   5068  O  O   . ASN C  1 127 ? 12.662  81.955  -21.000  1.00 75.79  ? 153 ASN C O   1 
ATOM   5069  C  CB  . ASN C  1 127 ? 14.342  83.391  -19.363  1.00 71.03  ? 153 ASN C CB  1 
ATOM   5070  C  CG  . ASN C  1 127 ? 15.295  84.032  -18.362  1.00 71.06  ? 153 ASN C CG  1 
ATOM   5071  O  OD1 . ASN C  1 127 ? 15.997  84.988  -18.693  1.00 75.42  ? 153 ASN C OD1 1 
ATOM   5072  N  ND2 . ASN C  1 127 ? 15.300  83.533  -17.129  1.00 73.16  ? 153 ASN C ND2 1 
ATOM   5073  N  N   . ASP C  1 128 ? 13.962  80.126  -21.124  1.00 81.48  ? 154 ASP C N   1 
ATOM   5074  C  CA  . ASP C  1 128 ? 13.106  79.445  -22.093  1.00 85.85  ? 154 ASP C CA  1 
ATOM   5075  C  C   . ASP C  1 128 ? 12.958  77.988  -21.679  1.00 86.97  ? 154 ASP C C   1 
ATOM   5076  O  O   . ASP C  1 128 ? 13.951  77.259  -21.600  1.00 84.74  ? 154 ASP C O   1 
ATOM   5077  C  CB  . ASP C  1 128 ? 13.675  79.551  -23.513  1.00 76.01  ? 154 ASP C CB  1 
ATOM   5078  C  CG  . ASP C  1 128 ? 12.617  79.339  -24.583  1.00 88.87  ? 154 ASP C CG  1 
ATOM   5079  O  OD1 . ASP C  1 128 ? 12.769  79.895  -25.694  1.00 92.64  ? 154 ASP C OD1 1 
ATOM   5080  O  OD2 . ASP C  1 128 ? 11.628  78.625  -24.309  1.00 87.41  ? 154 ASP C OD2 1 
ATOM   5081  N  N   . THR C  1 129 ? 11.719  77.568  -21.421  1.00 87.99  ? 155 THR C N   1 
ATOM   5082  C  CA  . THR C  1 129 ? 11.416  76.210  -20.986  1.00 80.96  ? 155 THR C CA  1 
ATOM   5083  C  C   . THR C  1 129 ? 11.280  75.226  -22.145  1.00 86.95  ? 155 THR C C   1 
ATOM   5084  O  O   . THR C  1 129 ? 10.755  74.123  -21.948  1.00 84.74  ? 155 THR C O   1 
ATOM   5085  C  CB  . THR C  1 129 ? 10.134  76.202  -20.150  1.00 73.00  ? 155 THR C CB  1 
ATOM   5086  O  OG1 . THR C  1 129 ? 9.771   74.851  -19.843  1.00 89.01  ? 155 THR C OG1 1 
ATOM   5087  C  CG2 . THR C  1 129 ? 8.996   76.864  -20.912  1.00 72.87  ? 155 THR C CG2 1 
ATOM   5088  N  N   . THR C  1 130 ? 11.742  75.598  -23.348  1.00 87.55  ? 156 THR C N   1 
ATOM   5089  C  CA  . THR C  1 130 ? 11.622  74.787  -24.551  1.00 82.54  ? 156 THR C CA  1 
ATOM   5090  C  C   . THR C  1 130 ? 12.830  73.866  -24.700  1.00 81.55  ? 156 THR C C   1 
ATOM   5091  O  O   . THR C  1 130 ? 13.966  74.292  -24.476  1.00 81.59  ? 156 THR C O   1 
ATOM   5092  C  CB  . THR C  1 130 ? 11.500  75.673  -25.787  1.00 83.23  ? 156 THR C CB  1 
ATOM   5093  O  OG1 . THR C  1 130 ? 10.304  76.457  -25.694  1.00 90.39  ? 156 THR C OG1 1 
ATOM   5094  C  CG2 . THR C  1 130 ? 11.459  74.833  -27.060  1.00 79.06  ? 156 THR C CG2 1 
ATOM   5095  N  N   . PRO C  1 131 ? 12.594  72.601  -25.041  1.00 84.81  ? 157 PRO C N   1 
ATOM   5096  C  CA  . PRO C  1 131 ? 13.708  71.695  -25.345  1.00 78.72  ? 157 PRO C CA  1 
ATOM   5097  C  C   . PRO C  1 131 ? 14.636  72.282  -26.403  1.00 75.96  ? 157 PRO C C   1 
ATOM   5098  O  O   . PRO C  1 131 ? 14.188  72.875  -27.389  1.00 79.23  ? 157 PRO C O   1 
ATOM   5099  C  CB  . PRO C  1 131 ? 13.007  70.434  -25.860  1.00 75.35  ? 157 PRO C CB  1 
ATOM   5100  C  CG  . PRO C  1 131 ? 11.583  70.514  -25.377  1.00 74.92  ? 157 PRO C CG  1 
ATOM   5101  C  CD  . PRO C  1 131 ? 11.326  71.886  -24.817  1.00 85.88  ? 157 PRO C CD  1 
ATOM   5102  N  N   . ASN C  1 132 ? 15.943  72.112  -26.183  1.00 68.93  ? 158 ASN C N   1 
ATOM   5103  C  CA  . ASN C  1 132 ? 16.962  72.529  -27.141  1.00 70.24  ? 158 ASN C CA  1 
ATOM   5104  C  C   . ASN C  1 132 ? 18.327  72.017  -26.697  1.00 55.98  ? 158 ASN C C   1 
ATOM   5105  O  O   . ASN C  1 132 ? 18.912  72.537  -25.743  1.00 54.55  ? 158 ASN C O   1 
ATOM   5106  C  CB  . ASN C  1 132 ? 16.969  74.056  -27.297  1.00 69.34  ? 158 ASN C CB  1 
ATOM   5107  C  CG  . ASN C  1 132 ? 18.185  74.572  -28.053  1.00 57.81  ? 158 ASN C CG  1 
ATOM   5108  O  OD1 . ASN C  1 132 ? 18.854  73.829  -28.776  1.00 60.88  ? 158 ASN C OD1 1 
ATOM   5109  N  ND2 . ASN C  1 132 ? 18.462  75.864  -27.901  1.00 51.19  ? 158 ASN C ND2 1 
ATOM   5110  N  N   . GLU C  1 133 ? 18.847  71.006  -27.398  1.00 51.17  ? 159 GLU C N   1 
ATOM   5111  C  CA  . GLU C  1 133 ? 20.105  70.359  -27.040  1.00 61.07  ? 159 GLU C CA  1 
ATOM   5112  C  C   . GLU C  1 133 ? 21.343  71.195  -27.370  1.00 61.89  ? 159 GLU C C   1 
ATOM   5113  O  O   . GLU C  1 133 ? 22.458  70.749  -27.073  1.00 58.01  ? 159 GLU C O   1 
ATOM   5114  C  CB  . GLU C  1 133 ? 20.204  68.998  -27.735  1.00 58.38  ? 159 GLU C CB  1 
ATOM   5115  C  CG  . GLU C  1 133 ? 19.199  67.961  -27.244  1.00 64.21  ? 159 GLU C CG  1 
ATOM   5116  C  CD  . GLU C  1 133 ? 19.572  67.363  -25.892  1.00 73.92  ? 159 GLU C CD  1 
ATOM   5117  O  OE1 . GLU C  1 133 ? 18.948  67.740  -24.877  1.00 70.24  ? 159 GLU C OE1 1 
ATOM   5118  O  OE2 . GLU C  1 133 ? 20.490  66.514  -25.846  1.00 77.12  ? 159 GLU C OE2 1 
ATOM   5119  N  N   . GLU C  1 134 ? 21.196  72.377  -27.966  1.00 62.19  ? 160 GLU C N   1 
ATOM   5120  C  CA  . GLU C  1 134 ? 22.355  73.186  -28.325  1.00 61.75  ? 160 GLU C CA  1 
ATOM   5121  C  C   . GLU C  1 134 ? 22.803  74.118  -27.207  1.00 66.36  ? 160 GLU C C   1 
ATOM   5122  O  O   . GLU C  1 134 ? 23.865  74.741  -27.329  1.00 66.60  ? 160 GLU C O   1 
ATOM   5123  C  CB  . GLU C  1 134 ? 22.065  74.003  -29.593  1.00 67.98  ? 160 GLU C CB  1 
ATOM   5124  C  CG  . GLU C  1 134 ? 21.487  75.391  -29.343  1.00 73.89  ? 160 GLU C CG  1 
ATOM   5125  C  CD  . GLU C  1 134 ? 21.181  76.136  -30.632  1.00 76.38  ? 160 GLU C CD  1 
ATOM   5126  O  OE1 . GLU C  1 134 ? 21.528  75.614  -31.714  1.00 74.99  ? 160 GLU C OE1 1 
ATOM   5127  O  OE2 . GLU C  1 134 ? 20.592  77.239  -30.564  1.00 70.98  ? 160 GLU C OE2 1 
ATOM   5128  N  N   . LEU C  1 135 ? 22.033  74.222  -26.125  1.00 64.73  ? 161 LEU C N   1 
ATOM   5129  C  CA  . LEU C  1 135 ? 22.374  75.065  -24.987  1.00 58.56  ? 161 LEU C CA  1 
ATOM   5130  C  C   . LEU C  1 135 ? 23.256  74.358  -23.964  1.00 57.95  ? 161 LEU C C   1 
ATOM   5131  O  O   . LEU C  1 135 ? 23.449  74.886  -22.864  1.00 55.41  ? 161 LEU C O   1 
ATOM   5132  C  CB  . LEU C  1 135 ? 21.099  75.561  -24.304  1.00 51.97  ? 161 LEU C CB  1 
ATOM   5133  C  CG  . LEU C  1 135 ? 20.244  76.560  -25.082  1.00 53.10  ? 161 LEU C CG  1 
ATOM   5134  C  CD1 . LEU C  1 135 ? 19.027  76.956  -24.250  1.00 54.41  ? 161 LEU C CD1 1 
ATOM   5135  C  CD2 . LEU C  1 135 ? 21.067  77.781  -25.475  1.00 45.33  ? 161 LEU C CD2 1 
ATOM   5136  N  N   . LEU C  1 136 ? 23.791  73.187  -24.295  1.00 53.62  ? 162 LEU C N   1 
ATOM   5137  C  CA  . LEU C  1 136 ? 24.577  72.400  -23.357  1.00 48.25  ? 162 LEU C CA  1 
ATOM   5138  C  C   . LEU C  1 136 ? 26.030  72.858  -23.387  1.00 48.74  ? 162 LEU C C   1 
ATOM   5139  O  O   . LEU C  1 136 ? 26.684  72.810  -24.434  1.00 56.05  ? 162 LEU C O   1 
ATOM   5140  C  CB  . LEU C  1 136 ? 24.481  70.913  -23.686  1.00 48.31  ? 162 LEU C CB  1 
ATOM   5141  C  CG  . LEU C  1 136 ? 25.528  70.052  -22.972  1.00 49.27  ? 162 LEU C CG  1 
ATOM   5142  C  CD1 . LEU C  1 136 ? 25.130  69.846  -21.520  1.00 48.75  ? 162 LEU C CD1 1 
ATOM   5143  C  CD2 . LEU C  1 136 ? 25.699  68.722  -23.675  1.00 50.22  ? 162 LEU C CD2 1 
ATOM   5144  N  N   . ILE C  1 137 ? 26.536  73.283  -22.232  1.00 46.73  ? 163 ILE C N   1 
ATOM   5145  C  CA  . ILE C  1 137 ? 27.909  73.767  -22.155  1.00 51.88  ? 163 ILE C CA  1 
ATOM   5146  C  C   . ILE C  1 137 ? 28.900  72.606  -22.111  1.00 52.97  ? 163 ILE C C   1 
ATOM   5147  O  O   . ILE C  1 137 ? 29.946  72.648  -22.767  1.00 56.65  ? 163 ILE C O   1 
ATOM   5148  C  CB  . ILE C  1 137 ? 28.061  74.703  -20.943  1.00 51.45  ? 163 ILE C CB  1 
ATOM   5149  C  CG1 . ILE C  1 137 ? 27.150  75.922  -21.111  1.00 44.77  ? 163 ILE C CG1 1 
ATOM   5150  C  CG2 . ILE C  1 137 ? 29.516  75.115  -20.757  1.00 49.12  ? 163 ILE C CG2 1 
ATOM   5151  C  CD1 . ILE C  1 137 ? 27.081  76.820  -19.898  1.00 44.16  ? 163 ILE C CD1 1 
ATOM   5152  N  N   . GLU C  1 138 ? 28.591  71.551  -21.358  1.00 51.52  ? 164 GLU C N   1 
ATOM   5153  C  CA  . GLU C  1 138 ? 29.521  70.441  -21.186  1.00 50.10  ? 164 GLU C CA  1 
ATOM   5154  C  C   . GLU C  1 138 ? 28.774  69.247  -20.612  1.00 44.28  ? 164 GLU C C   1 
ATOM   5155  O  O   . GLU C  1 138 ? 27.842  69.411  -19.822  1.00 44.95  ? 164 GLU C O   1 
ATOM   5156  C  CB  . GLU C  1 138 ? 30.684  70.830  -20.262  1.00 48.88  ? 164 GLU C CB  1 
ATOM   5157  C  CG  . GLU C  1 138 ? 31.772  69.775  -20.115  1.00 51.49  ? 164 GLU C CG  1 
ATOM   5158  C  CD  . GLU C  1 138 ? 32.544  69.545  -21.403  1.00 60.70  ? 164 GLU C CD  1 
ATOM   5159  O  OE1 . GLU C  1 138 ? 32.031  68.824  -22.287  1.00 60.52  ? 164 GLU C OE1 1 
ATOM   5160  O  OE2 . GLU C  1 138 ? 33.661  70.092  -21.535  1.00 57.29  ? 164 GLU C OE2 1 
ATOM   5161  N  N   . ARG C  1 139 ? 29.197  68.048  -21.009  1.00 43.99  ? 165 ARG C N   1 
ATOM   5162  C  CA  . ARG C  1 139 ? 28.692  66.807  -20.433  1.00 47.24  ? 165 ARG C CA  1 
ATOM   5163  C  C   . ARG C  1 139 ? 29.869  65.920  -20.050  1.00 40.34  ? 165 ARG C C   1 
ATOM   5164  O  O   . ARG C  1 139 ? 30.747  65.656  -20.878  1.00 45.93  ? 165 ARG C O   1 
ATOM   5165  C  CB  . ARG C  1 139 ? 27.762  66.065  -21.406  1.00 44.77  ? 165 ARG C CB  1 
ATOM   5166  C  CG  . ARG C  1 139 ? 27.342  64.687  -20.910  1.00 44.17  ? 165 ARG C CG  1 
ATOM   5167  C  CD  . ARG C  1 139 ? 26.411  63.969  -21.875  1.00 45.40  ? 165 ARG C CD  1 
ATOM   5168  N  NE  . ARG C  1 139 ? 25.125  64.648  -22.027  1.00 50.55  ? 165 ARG C NE  1 
ATOM   5169  C  CZ  . ARG C  1 139 ? 24.631  65.064  -23.189  1.00 47.26  ? 165 ARG C CZ  1 
ATOM   5170  N  NH1 . ARG C  1 139 ? 25.307  64.861  -24.312  1.00 39.73  ? 165 ARG C NH1 1 
ATOM   5171  N  NH2 . ARG C  1 139 ? 23.452  65.672  -23.231  1.00 41.24  ? 165 ARG C NH2 1 
ATOM   5172  N  N   . VAL C  1 140 ? 29.892  65.467  -18.799  1.00 28.92  ? 166 VAL C N   1 
ATOM   5173  C  CA  . VAL C  1 140 ? 30.959  64.603  -18.309  1.00 38.87  ? 166 VAL C CA  1 
ATOM   5174  C  C   . VAL C  1 140 ? 30.340  63.403  -17.607  1.00 37.71  ? 166 VAL C C   1 
ATOM   5175  O  O   . VAL C  1 140 ? 29.222  63.470  -17.087  1.00 38.25  ? 166 VAL C O   1 
ATOM   5176  C  CB  . VAL C  1 140 ? 31.932  65.352  -17.368  1.00 40.46  ? 166 VAL C CB  1 
ATOM   5177  C  CG1 . VAL C  1 140 ? 32.689  66.424  -18.133  1.00 46.06  ? 166 VAL C CG1 1 
ATOM   5178  C  CG2 . VAL C  1 140 ? 31.185  65.967  -16.196  1.00 39.29  ? 166 VAL C CG2 1 
ATOM   5179  N  N   . SER C  1 141 ? 31.076  62.296  -17.593  1.00 34.22  ? 167 SER C N   1 
ATOM   5180  C  CA  . SER C  1 141 ? 30.578  61.046  -17.045  1.00 35.54  ? 167 SER C CA  1 
ATOM   5181  C  C   . SER C  1 141 ? 31.625  60.408  -16.139  1.00 37.20  ? 167 SER C C   1 
ATOM   5182  O  O   . SER C  1 141 ? 32.807  60.758  -16.175  1.00 44.27  ? 167 SER C O   1 
ATOM   5183  C  CB  . SER C  1 141 ? 30.187  60.075  -18.163  1.00 39.03  ? 167 SER C CB  1 
ATOM   5184  O  OG  . SER C  1 141 ? 31.287  59.809  -19.016  1.00 42.91  ? 167 SER C OG  1 
ATOM   5185  N  N   . HIS C  1 142 ? 31.171  59.461  -15.318  1.00 35.17  ? 168 HIS C N   1 
ATOM   5186  C  CA  . HIS C  1 142 ? 32.062  58.716  -14.427  1.00 39.42  ? 168 HIS C CA  1 
ATOM   5187  C  C   . HIS C  1 142 ? 31.382  57.420  -14.022  1.00 36.25  ? 168 HIS C C   1 
ATOM   5188  O  O   . HIS C  1 142 ? 30.278  57.448  -13.468  1.00 37.23  ? 168 HIS C O   1 
ATOM   5189  C  CB  . HIS C  1 142 ? 32.426  59.532  -13.185  1.00 36.61  ? 168 HIS C CB  1 
ATOM   5190  C  CG  . HIS C  1 142 ? 33.077  58.724  -12.103  1.00 43.05  ? 168 HIS C CG  1 
ATOM   5191  N  ND1 . HIS C  1 142 ? 34.312  58.129  -12.257  1.00 45.74  ? 168 HIS C ND1 1 
ATOM   5192  C  CD2 . HIS C  1 142 ? 32.664  58.411  -10.852  1.00 36.74  ? 168 HIS C CD2 1 
ATOM   5193  C  CE1 . HIS C  1 142 ? 34.630  57.486  -11.147  1.00 34.80  ? 168 HIS C CE1 1 
ATOM   5194  N  NE2 . HIS C  1 142 ? 33.647  57.641  -10.279  1.00 32.66  ? 168 HIS C NE2 1 
ATOM   5195  N  N   . ALA C  1 143 ? 32.040  56.294  -14.280  1.00 33.03  ? 169 ALA C N   1 
ATOM   5196  C  CA  . ALA C  1 143 ? 31.544  54.983  -13.884  1.00 36.09  ? 169 ALA C CA  1 
ATOM   5197  C  C   . ALA C  1 143 ? 32.510  54.383  -12.874  1.00 41.44  ? 169 ALA C C   1 
ATOM   5198  O  O   . ALA C  1 143 ? 33.686  54.167  -13.185  1.00 42.87  ? 169 ALA C O   1 
ATOM   5199  C  CB  . ALA C  1 143 ? 31.386  54.062  -15.095  1.00 38.89  ? 169 ALA C CB  1 
ATOM   5200  N  N   . GLY C  1 144 ? 32.020  54.119  -11.677  1.00 36.76  ? 170 GLY C N   1 
ATOM   5201  C  CA  . GLY C  1 144 ? 32.854  53.564  -10.642  1.00 36.45  ? 170 GLY C CA  1 
ATOM   5202  C  C   . GLY C  1 144 ? 32.033  52.916  -9.561   1.00 41.37  ? 170 GLY C C   1 
ATOM   5203  O  O   . GLY C  1 144 ? 30.859  52.596  -9.756   1.00 37.51  ? 170 GLY C O   1 
ATOM   5204  N  N   . MET C  1 145 ? 32.673  52.728  -8.408   1.00 45.65  ? 171 MET C N   1 
ATOM   5205  C  CA  . MET C  1 145 ? 32.064  52.107  -7.242   1.00 43.66  ? 171 MET C CA  1 
ATOM   5206  C  C   . MET C  1 145 ? 32.194  53.037  -6.047   1.00 45.64  ? 171 MET C C   1 
ATOM   5207  O  O   . MET C  1 145 ? 33.254  53.630  -5.824   1.00 47.61  ? 171 MET C O   1 
ATOM   5208  C  CB  . MET C  1 145 ? 32.720  50.758  -6.927   1.00 46.29  ? 171 MET C CB  1 
ATOM   5209  C  CG  . MET C  1 145 ? 32.142  50.058  -5.710   1.00 60.31  ? 171 MET C CG  1 
ATOM   5210  S  SD  . MET C  1 145 ? 33.119  48.638  -5.179   1.00 101.66 ? 171 MET C SD  1 
ATOM   5211  C  CE  . MET C  1 145 ? 34.678  49.425  -4.775   1.00 80.82  ? 171 MET C CE  1 
ATOM   5212  N  N   . ILE C  1 146 ? 31.110  53.168  -5.282   1.00 45.34  ? 172 ILE C N   1 
ATOM   5213  C  CA  . ILE C  1 146 ? 31.109  53.967  -4.064   1.00 47.46  ? 172 ILE C CA  1 
ATOM   5214  C  C   . ILE C  1 146 ? 30.337  53.218  -2.988   1.00 50.81  ? 172 ILE C C   1 
ATOM   5215  O  O   . ILE C  1 146 ? 29.380  52.490  -3.270   1.00 52.42  ? 172 ILE C O   1 
ATOM   5216  C  CB  . ILE C  1 146 ? 30.515  55.378  -4.285   1.00 43.08  ? 172 ILE C CB  1 
ATOM   5217  C  CG1 . ILE C  1 146 ? 30.857  56.294  -3.110   1.00 43.67  ? 172 ILE C CG1 1 
ATOM   5218  C  CG2 . ILE C  1 146 ? 29.010  55.314  -4.461   1.00 48.08  ? 172 ILE C CG2 1 
ATOM   5219  C  CD1 . ILE C  1 146 ? 30.460  57.734  -3.322   1.00 40.37  ? 172 ILE C CD1 1 
ATOM   5220  N  N   . ASN C  1 147 ? 30.772  53.392  -1.746   1.00 59.48  ? 173 ASN C N   1 
ATOM   5221  C  CA  . ASN C  1 147 ? 30.168  52.770  -0.581   1.00 63.22  ? 173 ASN C CA  1 
ATOM   5222  C  C   . ASN C  1 147 ? 29.892  53.832  0.474    1.00 68.10  ? 173 ASN C C   1 
ATOM   5223  O  O   . ASN C  1 147 ? 30.602  54.842  0.540    1.00 71.43  ? 173 ASN C O   1 
ATOM   5224  C  CB  . ASN C  1 147 ? 31.090  51.685  -0.002   1.00 61.94  ? 173 ASN C CB  1 
ATOM   5225  C  CG  . ASN C  1 147 ? 31.105  50.420  -0.830   1.00 67.23  ? 173 ASN C CG  1 
ATOM   5226  O  OD1 . ASN C  1 147 ? 30.201  50.170  -1.625   1.00 69.88  ? 173 ASN C OD1 1 
ATOM   5227  N  ND2 . ASN C  1 147 ? 32.137  49.607  -0.640   1.00 73.72  ? 173 ASN C ND2 1 
ATOM   5228  N  N   . PRO C  1 148 ? 28.867  53.634  1.322    1.00 66.64  ? 174 PRO C N   1 
ATOM   5229  C  CA  . PRO C  1 148 ? 28.550  54.645  2.347    1.00 67.40  ? 174 PRO C CA  1 
ATOM   5230  C  C   . PRO C  1 148 ? 29.597  54.787  3.449    1.00 79.53  ? 174 PRO C C   1 
ATOM   5231  O  O   . PRO C  1 148 ? 29.284  55.262  4.547    1.00 75.92  ? 174 PRO C O   1 
ATOM   5232  C  CB  . PRO C  1 148 ? 27.210  54.156  2.915    1.00 53.25  ? 174 PRO C CB  1 
ATOM   5233  C  CG  . PRO C  1 148 ? 27.177  52.698  2.619    1.00 55.45  ? 174 PRO C CG  1 
ATOM   5234  C  CD  . PRO C  1 148 ? 27.882  52.538  1.305    1.00 60.61  ? 174 PRO C CD  1 
ATOM   5235  N  N   . GLU C  1 149 ? 30.843  54.382  3.170    1.00 81.17  ? 175 GLU C N   1 
ATOM   5236  C  CA  . GLU C  1 149 ? 31.950  54.535  4.105    1.00 76.51  ? 175 GLU C CA  1 
ATOM   5237  C  C   . GLU C  1 149 ? 33.079  55.402  3.575    1.00 71.91  ? 175 GLU C C   1 
ATOM   5238  O  O   . GLU C  1 149 ? 33.866  55.909  4.379    1.00 75.83  ? 175 GLU C O   1 
ATOM   5239  C  CB  . GLU C  1 149 ? 32.544  53.166  4.496    1.00 79.97  ? 175 GLU C CB  1 
ATOM   5240  C  CG  . GLU C  1 149 ? 31.552  52.087  4.976    1.00 94.96  ? 175 GLU C CG  1 
ATOM   5241  C  CD  . GLU C  1 149 ? 30.727  51.471  3.860    1.00 104.29 ? 175 GLU C CD  1 
ATOM   5242  O  OE1 . GLU C  1 149 ? 30.629  52.096  2.790    1.00 110.62 ? 175 GLU C OE1 1 
ATOM   5243  O  OE2 . GLU C  1 149 ? 30.181  50.355  4.039    1.00 97.60  ? 175 GLU C OE2 1 
ATOM   5244  N  N   . ASP C  1 150 ? 33.186  55.579  2.255    1.00 75.42  ? 176 ASP C N   1 
ATOM   5245  C  CA  . ASP C  1 150 ? 34.247  56.397  1.677    1.00 73.04  ? 176 ASP C CA  1 
ATOM   5246  C  C   . ASP C  1 150 ? 34.023  57.883  1.917    1.00 72.42  ? 176 ASP C C   1 
ATOM   5247  O  O   . ASP C  1 150 ? 34.973  58.667  1.801    1.00 76.05  ? 176 ASP C O   1 
ATOM   5248  C  CB  . ASP C  1 150 ? 34.360  56.132  0.172    1.00 72.20  ? 176 ASP C CB  1 
ATOM   5249  C  CG  . ASP C  1 150 ? 34.406  54.694  -0.172   1.00 73.81  ? 176 ASP C CG  1 
ATOM   5250  O  OD1 . ASP C  1 150 ? 34.362  53.889  0.710    1.00 82.34  ? 176 ASP C OD1 1 
ATOM   5251  O  OD2 . ASP C  1 150 ? 34.487  54.361  -1.332   1.00 72.10  ? 176 ASP C OD2 1 
ATOM   5252  N  N   . ARG C  1 151 ? 32.801  58.277  2.267    1.00 72.02  ? 177 ARG C N   1 
ATOM   5253  C  CA  . ARG C  1 151 ? 32.412  59.667  2.544    1.00 67.48  ? 177 ARG C CA  1 
ATOM   5254  C  C   . ARG C  1 151 ? 32.657  60.490  1.280    1.00 62.58  ? 177 ARG C C   1 
ATOM   5255  O  O   . ARG C  1 151 ? 32.617  59.960  0.161    1.00 65.62  ? 177 ARG C O   1 
ATOM   5256  C  CB  . ARG C  1 151 ? 33.130  60.183  3.776    1.00 64.42  ? 177 ARG C CB  1 
ATOM   5257  C  CG  . ARG C  1 151 ? 33.495  59.110  4.771    1.00 73.82  ? 177 ARG C CG  1 
ATOM   5258  C  CD  . ARG C  1 151 ? 32.306  58.651  5.583    1.00 81.52  ? 177 ARG C CD  1 
ATOM   5259  N  NE  . ARG C  1 151 ? 32.132  59.496  6.757    1.00 83.95  ? 177 ARG C NE  1 
ATOM   5260  C  CZ  . ARG C  1 151 ? 32.992  59.554  7.770    1.00 84.40  ? 177 ARG C CZ  1 
ATOM   5261  N  NH1 . ARG C  1 151 ? 34.093  58.812  7.767    1.00 80.21  ? 177 ARG C NH1 1 
ATOM   5262  N  NH2 . ARG C  1 151 ? 32.751  60.358  8.794    1.00 89.12  ? 177 ARG C NH2 1 
ATOM   5263  N  N   . TRP C  1 152 ? 32.922  61.780  1.449    1.00 49.24  ? 178 TRP C N   1 
ATOM   5264  C  CA  . TRP C  1 152 ? 33.076  62.663  0.305    1.00 48.17  ? 178 TRP C CA  1 
ATOM   5265  C  C   . TRP C  1 152 ? 34.264  62.232  -0.546   1.00 49.72  ? 178 TRP C C   1 
ATOM   5266  O  O   . TRP C  1 152 ? 35.406  62.224  -0.080   1.00 54.58  ? 178 TRP C O   1 
ATOM   5267  C  CB  . TRP C  1 152 ? 33.236  64.104  0.784    1.00 50.46  ? 178 TRP C CB  1 
ATOM   5268  C  CG  . TRP C  1 152 ? 31.998  64.655  1.441    1.00 49.04  ? 178 TRP C CG  1 
ATOM   5269  C  CD1 . TRP C  1 152 ? 31.815  64.905  2.768    1.00 43.98  ? 178 TRP C CD1 1 
ATOM   5270  C  CD2 . TRP C  1 152 ? 30.772  65.018  0.792    1.00 47.99  ? 178 TRP C CD2 1 
ATOM   5271  N  NE1 . TRP C  1 152 ? 30.553  65.406  2.987    1.00 41.97  ? 178 TRP C NE1 1 
ATOM   5272  C  CE2 . TRP C  1 152 ? 29.893  65.485  1.790    1.00 44.02  ? 178 TRP C CE2 1 
ATOM   5273  C  CE3 . TRP C  1 152 ? 30.334  64.995  -0.535   1.00 40.07  ? 178 TRP C CE3 1 
ATOM   5274  C  CZ2 . TRP C  1 152 ? 28.604  65.925  1.504    1.00 43.30  ? 178 TRP C CZ2 1 
ATOM   5275  C  CZ3 . TRP C  1 152 ? 29.055  65.433  -0.817   1.00 44.70  ? 178 TRP C CZ3 1 
ATOM   5276  C  CH2 . TRP C  1 152 ? 28.204  65.892  0.198    1.00 44.68  ? 178 TRP C CH2 1 
ATOM   5277  N  N   . LYS C  1 153 ? 33.983  61.848  -1.788   1.00 59.51  ? 179 LYS C N   1 
ATOM   5278  C  CA  . LYS C  1 153 ? 35.002  61.501  -2.769   1.00 54.82  ? 179 LYS C CA  1 
ATOM   5279  C  C   . LYS C  1 153 ? 35.107  62.628  -3.784   1.00 44.83  ? 179 LYS C C   1 
ATOM   5280  O  O   . LYS C  1 153 ? 34.093  63.060  -4.342   1.00 42.15  ? 179 LYS C O   1 
ATOM   5281  C  CB  . LYS C  1 153 ? 34.669  60.180  -3.469   1.00 47.93  ? 179 LYS C CB  1 
ATOM   5282  C  CG  . LYS C  1 153 ? 35.750  59.123  -3.329   1.00 57.79  ? 179 LYS C CG  1 
ATOM   5283  C  CD  . LYS C  1 153 ? 36.090  58.890  -1.861   1.00 65.93  ? 179 LYS C CD  1 
ATOM   5284  C  CE  . LYS C  1 153 ? 37.288  57.965  -1.698   1.00 66.56  ? 179 LYS C CE  1 
ATOM   5285  N  NZ  . LYS C  1 153 ? 37.757  57.912  -0.283   1.00 69.98  ? 179 LYS C NZ  1 
ATOM   5286  N  N   . SER C  1 154 ? 36.326  63.108  -4.011   1.00 46.45  ? 180 SER C N   1 
ATOM   5287  C  CA  . SER C  1 154 ? 36.553  64.217  -4.926   1.00 44.25  ? 180 SER C CA  1 
ATOM   5288  C  C   . SER C  1 154 ? 36.652  63.721  -6.363   1.00 47.74  ? 180 SER C C   1 
ATOM   5289  O  O   . SER C  1 154 ? 37.261  62.681  -6.636   1.00 47.97  ? 180 SER C O   1 
ATOM   5290  C  CB  . SER C  1 154 ? 37.830  64.970  -4.547   1.00 41.55  ? 180 SER C CB  1 
ATOM   5291  O  OG  . SER C  1 154 ? 37.750  65.497  -3.234   1.00 41.87  ? 180 SER C OG  1 
ATOM   5292  N  N   . LEU C  1 155 ? 36.053  64.476  -7.284   1.00 42.55  ? 181 LEU C N   1 
ATOM   5293  C  CA  . LEU C  1 155 ? 36.080  64.151  -8.704   1.00 45.09  ? 181 LEU C CA  1 
ATOM   5294  C  C   . LEU C  1 155 ? 36.492  65.387  -9.493   1.00 45.81  ? 181 LEU C C   1 
ATOM   5295  O  O   . LEU C  1 155 ? 35.964  66.481  -9.266   1.00 39.84  ? 181 LEU C O   1 
ATOM   5296  C  CB  . LEU C  1 155 ? 34.717  63.635  -9.183   1.00 39.22  ? 181 LEU C CB  1 
ATOM   5297  C  CG  . LEU C  1 155 ? 34.238  62.288  -8.634   1.00 33.49  ? 181 LEU C CG  1 
ATOM   5298  C  CD1 . LEU C  1 155 ? 32.854  61.939  -9.172   1.00 31.40  ? 181 LEU C CD1 1 
ATOM   5299  C  CD2 . LEU C  1 155 ? 35.229  61.192  -8.966   1.00 30.12  ? 181 LEU C CD2 1 
ATOM   5300  N  N   . HIS C  1 156 ? 37.439  65.207  -10.413  1.00 48.87  ? 182 HIS C N   1 
ATOM   5301  C  CA  . HIS C  1 156 ? 37.981  66.288  -11.228  1.00 53.45  ? 182 HIS C CA  1 
ATOM   5302  C  C   . HIS C  1 156 ? 37.707  65.963  -12.685  1.00 51.36  ? 182 HIS C C   1 
ATOM   5303  O  O   . HIS C  1 156 ? 38.188  64.947  -13.194  1.00 52.92  ? 182 HIS C O   1 
ATOM   5304  C  CB  . HIS C  1 156 ? 39.487  66.461  -10.998  1.00 56.49  ? 182 HIS C CB  1 
ATOM   5305  C  CG  . HIS C  1 156 ? 39.929  66.140  -9.603   1.00 59.41  ? 182 HIS C CG  1 
ATOM   5306  N  ND1 . HIS C  1 156 ? 39.835  67.043  -8.566   1.00 59.40  ? 182 HIS C ND1 1 
ATOM   5307  C  CD2 . HIS C  1 156 ? 40.469  65.016  -9.074   1.00 60.16  ? 182 HIS C CD2 1 
ATOM   5308  C  CE1 . HIS C  1 156 ? 40.295  66.489  -7.458   1.00 56.50  ? 182 HIS C CE1 1 
ATOM   5309  N  NE2 . HIS C  1 156 ? 40.686  65.259  -7.739   1.00 55.36  ? 182 HIS C NE2 1 
ATOM   5310  N  N   . PHE C  1 157 ? 36.949  66.821  -13.357  1.00 50.60  ? 183 PHE C N   1 
ATOM   5311  C  CA  . PHE C  1 157 ? 36.542  66.585  -14.736  1.00 55.28  ? 183 PHE C CA  1 
ATOM   5312  C  C   . PHE C  1 157 ? 37.143  67.662  -15.627  1.00 59.37  ? 183 PHE C C   1 
ATOM   5313  O  O   . PHE C  1 157 ? 36.914  68.855  -15.403  1.00 58.22  ? 183 PHE C O   1 
ATOM   5314  C  CB  . PHE C  1 157 ? 35.017  66.569  -14.861  1.00 49.95  ? 183 PHE C CB  1 
ATOM   5315  C  CG  . PHE C  1 157 ? 34.355  65.436  -14.124  1.00 51.44  ? 183 PHE C CG  1 
ATOM   5316  C  CD1 . PHE C  1 157 ? 34.277  64.170  -14.687  1.00 51.33  ? 183 PHE C CD1 1 
ATOM   5317  C  CD2 . PHE C  1 157 ? 33.812  65.637  -12.864  1.00 49.38  ? 183 PHE C CD2 1 
ATOM   5318  C  CE1 . PHE C  1 157 ? 33.656  63.130  -14.013  1.00 47.34  ? 183 PHE C CE1 1 
ATOM   5319  C  CE2 . PHE C  1 157 ? 33.200  64.600  -12.183  1.00 47.50  ? 183 PHE C CE2 1 
ATOM   5320  C  CZ  . PHE C  1 157 ? 33.127  63.343  -12.756  1.00 47.76  ? 183 PHE C CZ  1 
ATOM   5321  N  N   . SER C  1 158 ? 37.903  67.240  -16.635  1.00 64.89  ? 184 SER C N   1 
ATOM   5322  C  CA  . SER C  1 158 ? 38.518  68.141  -17.609  1.00 63.97  ? 184 SER C CA  1 
ATOM   5323  C  C   . SER C  1 158 ? 37.912  67.841  -18.975  1.00 63.31  ? 184 SER C C   1 
ATOM   5324  O  O   . SER C  1 158 ? 38.280  66.857  -19.623  1.00 74.41  ? 184 SER C O   1 
ATOM   5325  C  CB  . SER C  1 158 ? 40.035  67.982  -17.623  1.00 67.52  ? 184 SER C CB  1 
ATOM   5326  O  OG  . SER C  1 158 ? 40.617  68.567  -16.470  1.00 75.09  ? 184 SER C OG  1 
ATOM   5327  N  N   . GLY C  1 159 ? 36.986  68.693  -19.415  1.00 62.99  ? 185 GLY C N   1 
ATOM   5328  C  CA  . GLY C  1 159 ? 36.283  68.491  -20.661  1.00 65.49  ? 185 GLY C CA  1 
ATOM   5329  C  C   . GLY C  1 159 ? 36.828  69.346  -21.797  1.00 66.35  ? 185 GLY C C   1 
ATOM   5330  O  O   . GLY C  1 159 ? 37.794  70.094  -21.660  1.00 67.42  ? 185 GLY C O   1 
ATOM   5331  N  N   . HIS C  1 160 ? 36.170  69.210  -22.951  1.00 63.52  ? 186 HIS C N   1 
ATOM   5332  C  CA  . HIS C  1 160 ? 36.556  69.983  -24.126  1.00 61.56  ? 186 HIS C CA  1 
ATOM   5333  C  C   . HIS C  1 160 ? 36.315  71.473  -23.917  1.00 61.54  ? 186 HIS C C   1 
ATOM   5334  O  O   . HIS C  1 160 ? 37.095  72.301  -24.399  1.00 58.70  ? 186 HIS C O   1 
ATOM   5335  C  CB  . HIS C  1 160 ? 35.792  69.472  -25.349  1.00 60.36  ? 186 HIS C CB  1 
ATOM   5336  C  CG  . HIS C  1 160 ? 36.081  70.225  -26.609  1.00 71.59  ? 186 HIS C CG  1 
ATOM   5337  N  ND1 . HIS C  1 160 ? 37.357  70.589  -26.985  1.00 73.02  ? 186 HIS C ND1 1 
ATOM   5338  C  CD2 . HIS C  1 160 ? 35.259  70.677  -27.586  1.00 68.05  ? 186 HIS C CD2 1 
ATOM   5339  C  CE1 . HIS C  1 160 ? 37.307  71.237  -28.135  1.00 74.60  ? 186 HIS C CE1 1 
ATOM   5340  N  NE2 . HIS C  1 160 ? 36.046  71.304  -28.522  1.00 72.47  ? 186 HIS C NE2 1 
ATOM   5341  N  N   . VAL C  1 161 ? 35.261  71.828  -23.188  1.00 61.76  ? 187 VAL C N   1 
ATOM   5342  C  CA  . VAL C  1 161 ? 34.898  73.221  -22.939  1.00 59.98  ? 187 VAL C CA  1 
ATOM   5343  C  C   . VAL C  1 161 ? 35.220  73.631  -21.504  1.00 60.87  ? 187 VAL C C   1 
ATOM   5344  O  O   . VAL C  1 161 ? 35.991  74.564  -21.273  1.00 58.07  ? 187 VAL C O   1 
ATOM   5345  C  CB  . VAL C  1 161 ? 33.410  73.472  -23.272  1.00 51.82  ? 187 VAL C CB  1 
ATOM   5346  C  CG1 . VAL C  1 161 ? 32.953  74.820  -22.737  1.00 51.86  ? 187 VAL C CG1 1 
ATOM   5347  C  CG2 . VAL C  1 161 ? 33.188  73.383  -24.770  1.00 64.27  ? 187 VAL C CG2 1 
ATOM   5348  N  N   . ALA C  1 162 ? 34.646  72.940  -20.527  1.00 58.89  ? 188 ALA C N   1 
ATOM   5349  C  CA  . ALA C  1 162 ? 34.712  73.368  -19.141  1.00 51.94  ? 188 ALA C CA  1 
ATOM   5350  C  C   . ALA C  1 162 ? 35.425  72.330  -18.287  1.00 55.54  ? 188 ALA C C   1 
ATOM   5351  O  O   . ALA C  1 162 ? 35.647  71.188  -18.698  1.00 60.96  ? 188 ALA C O   1 
ATOM   5352  C  CB  . ALA C  1 162 ? 33.308  73.635  -18.586  1.00 48.58  ? 188 ALA C CB  1 
ATOM   5353  N  N   . HIS C  1 163 ? 35.797  72.760  -17.084  1.00 53.35  ? 189 HIS C N   1 
ATOM   5354  C  CA  . HIS C  1 163 ? 36.318  71.891  -16.041  1.00 55.74  ? 189 HIS C CA  1 
ATOM   5355  C  C   . HIS C  1 163 ? 35.436  72.026  -14.806  1.00 52.30  ? 189 HIS C C   1 
ATOM   5356  O  O   . HIS C  1 163 ? 34.897  73.101  -14.526  1.00 46.82  ? 189 HIS C O   1 
ATOM   5357  C  CB  . HIS C  1 163 ? 37.775  72.235  -15.683  1.00 61.81  ? 189 HIS C CB  1 
ATOM   5358  C  CG  . HIS C  1 163 ? 38.735  72.088  -16.824  1.00 70.96  ? 189 HIS C CG  1 
ATOM   5359  N  ND1 . HIS C  1 163 ? 39.759  71.164  -16.824  1.00 71.43  ? 189 HIS C ND1 1 
ATOM   5360  C  CD2 . HIS C  1 163 ? 38.830  72.753  -18.001  1.00 70.57  ? 189 HIS C CD2 1 
ATOM   5361  C  CE1 . HIS C  1 163 ? 40.441  71.266  -17.951  1.00 69.67  ? 189 HIS C CE1 1 
ATOM   5362  N  NE2 . HIS C  1 163 ? 39.897  72.221  -18.683  1.00 66.75  ? 189 HIS C NE2 1 
ATOM   5363  N  N   . LEU C  1 164 ? 35.283  70.927  -14.068  1.00 46.81  ? 190 LEU C N   1 
ATOM   5364  C  CA  . LEU C  1 164 ? 34.436  70.909  -12.886  1.00 39.95  ? 190 LEU C CA  1 
ATOM   5365  C  C   . LEU C  1 164 ? 35.145  70.222  -11.731  1.00 39.88  ? 190 LEU C C   1 
ATOM   5366  O  O   . LEU C  1 164 ? 35.910  69.271  -11.922  1.00 37.66  ? 190 LEU C O   1 
ATOM   5367  C  CB  . LEU C  1 164 ? 33.099  70.203  -13.147  1.00 45.45  ? 190 LEU C CB  1 
ATOM   5368  C  CG  . LEU C  1 164 ? 32.189  70.784  -14.234  1.00 43.86  ? 190 LEU C CG  1 
ATOM   5369  C  CD1 . LEU C  1 164 ? 32.522  70.176  -15.582  1.00 49.94  ? 190 LEU C CD1 1 
ATOM   5370  C  CD2 . LEU C  1 164 ? 30.730  70.559  -13.886  1.00 35.48  ? 190 LEU C CD2 1 
ATOM   5371  N  N   . GLU C  1 165 ? 34.870  70.719  -10.527  1.00 39.89  ? 191 GLU C N   1 
ATOM   5372  C  CA  . GLU C  1 165 ? 35.358  70.139  -9.283   1.00 40.54  ? 191 GLU C CA  1 
ATOM   5373  C  C   . GLU C  1 165 ? 34.159  69.890  -8.382   1.00 38.83  ? 191 GLU C C   1 
ATOM   5374  O  O   . GLU C  1 165 ? 33.421  70.828  -8.065   1.00 39.63  ? 191 GLU C O   1 
ATOM   5375  C  CB  . GLU C  1 165 ? 36.367  71.068  -8.597   1.00 41.36  ? 191 GLU C CB  1 
ATOM   5376  C  CG  . GLU C  1 165 ? 37.709  71.182  -9.308   1.00 38.01  ? 191 GLU C CG  1 
ATOM   5377  C  CD  . GLU C  1 165 ? 38.602  69.977  -9.067   1.00 42.40  ? 191 GLU C CD  1 
ATOM   5378  O  OE1 . GLU C  1 165 ? 38.275  69.158  -8.180   1.00 40.32  ? 191 GLU C OE1 1 
ATOM   5379  O  OE2 . GLU C  1 165 ? 39.634  69.848  -9.761   1.00 49.64  ? 191 GLU C OE2 1 
ATOM   5380  N  N   . LEU C  1 166 ? 33.960  68.636  -7.977   1.00 33.96  ? 192 LEU C N   1 
ATOM   5381  C  CA  . LEU C  1 166 ? 32.798  68.281  -7.175   1.00 34.02  ? 192 LEU C CA  1 
ATOM   5382  C  C   . LEU C  1 166 ? 33.136  67.102  -6.275   1.00 37.48  ? 192 LEU C C   1 
ATOM   5383  O  O   . LEU C  1 166 ? 34.199  66.488  -6.388   1.00 40.02  ? 192 LEU C O   1 
ATOM   5384  C  CB  . LEU C  1 166 ? 31.586  67.959  -8.061   1.00 41.76  ? 192 LEU C CB  1 
ATOM   5385  C  CG  . LEU C  1 166 ? 31.713  66.838  -9.098   1.00 38.66  ? 192 LEU C CG  1 
ATOM   5386  C  CD1 . LEU C  1 166 ? 31.226  65.506  -8.544   1.00 28.68  ? 192 LEU C CD1 1 
ATOM   5387  C  CD2 . LEU C  1 166 ? 30.970  67.202  -10.380  1.00 35.69  ? 192 LEU C CD2 1 
ATOM   5388  N  N   . GLN C  1 167 ? 32.203  66.791  -5.375   1.00 42.89  ? 193 GLN C N   1 
ATOM   5389  C  CA  . GLN C  1 167 ? 32.329  65.670  -4.454   1.00 40.28  ? 193 GLN C CA  1 
ATOM   5390  C  C   . GLN C  1 167 ? 31.011  64.908  -4.403   1.00 38.97  ? 193 GLN C C   1 
ATOM   5391  O  O   . GLN C  1 167 ? 29.940  65.477  -4.628   1.00 37.04  ? 193 GLN C O   1 
ATOM   5392  C  CB  . GLN C  1 167 ? 32.712  66.137  -3.046   1.00 39.38  ? 193 GLN C CB  1 
ATOM   5393  C  CG  . GLN C  1 167 ? 33.986  66.955  -2.985   1.00 42.08  ? 193 GLN C CG  1 
ATOM   5394  C  CD  . GLN C  1 167 ? 34.118  67.720  -1.682   1.00 51.18  ? 193 GLN C CD  1 
ATOM   5395  O  OE1 . GLN C  1 167 ? 33.131  67.954  -0.982   1.00 54.67  ? 193 GLN C OE1 1 
ATOM   5396  N  NE2 . GLN C  1 167 ? 35.342  68.114  -1.349   1.00 58.55  ? 193 GLN C NE2 1 
ATOM   5397  N  N   . ILE C  1 168 ? 31.098  63.610  -4.102   1.00 43.59  ? 194 ILE C N   1 
ATOM   5398  C  CA  . ILE C  1 168 ? 29.926  62.752  -3.966   1.00 38.59  ? 194 ILE C CA  1 
ATOM   5399  C  C   . ILE C  1 168 ? 30.095  61.866  -2.739   1.00 45.83  ? 194 ILE C C   1 
ATOM   5400  O  O   . ILE C  1 168 ? 31.207  61.625  -2.264   1.00 43.83  ? 194 ILE C O   1 
ATOM   5401  C  CB  . ILE C  1 168 ? 29.683  61.866  -5.210   1.00 32.19  ? 194 ILE C CB  1 
ATOM   5402  C  CG1 . ILE C  1 168 ? 30.838  60.882  -5.395   1.00 37.05  ? 194 ILE C CG1 1 
ATOM   5403  C  CG2 . ILE C  1 168 ? 29.492  62.712  -6.460   1.00 37.77  ? 194 ILE C CG2 1 
ATOM   5404  C  CD1 . ILE C  1 168 ? 30.626  59.887  -6.516   1.00 35.41  ? 194 ILE C CD1 1 
ATOM   5405  N  N   . ARG C  1 169 ? 28.967  61.371  -2.235   1.00 47.26  ? 195 ARG C N   1 
ATOM   5406  C  CA  . ARG C  1 169 ? 28.951  60.375  -1.170   1.00 43.91  ? 195 ARG C CA  1 
ATOM   5407  C  C   . ARG C  1 169 ? 27.562  59.750  -1.126   1.00 44.16  ? 195 ARG C C   1 
ATOM   5408  O  O   . ARG C  1 169 ? 26.631  60.207  -1.796   1.00 33.43  ? 195 ARG C O   1 
ATOM   5409  C  CB  . ARG C  1 169 ? 29.325  60.979  0.187    1.00 44.50  ? 195 ARG C CB  1 
ATOM   5410  C  CG  . ARG C  1 169 ? 28.253  61.860  0.790    1.00 49.76  ? 195 ARG C CG  1 
ATOM   5411  C  CD  . ARG C  1 169 ? 28.609  62.259  2.209    1.00 52.03  ? 195 ARG C CD  1 
ATOM   5412  N  NE  . ARG C  1 169 ? 27.534  63.016  2.843    1.00 57.44  ? 195 ARG C NE  1 
ATOM   5413  C  CZ  . ARG C  1 169 ? 27.578  63.475  4.089    1.00 57.11  ? 195 ARG C CZ  1 
ATOM   5414  N  NH1 . ARG C  1 169 ? 28.648  63.255  4.842    1.00 56.29  ? 195 ARG C NH1 1 
ATOM   5415  N  NH2 . ARG C  1 169 ? 26.552  64.154  4.582    1.00 57.35  ? 195 ARG C NH2 1 
ATOM   5416  N  N   . VAL C  1 170 ? 27.438  58.687  -0.329   1.00 49.81  ? 196 VAL C N   1 
ATOM   5417  C  CA  . VAL C  1 170 ? 26.183  57.967  -0.143   1.00 46.42  ? 196 VAL C CA  1 
ATOM   5418  C  C   . VAL C  1 170 ? 25.950  57.779  1.348    1.00 46.08  ? 196 VAL C C   1 
ATOM   5419  O  O   . VAL C  1 170 ? 26.849  57.335  2.070    1.00 50.77  ? 196 VAL C O   1 
ATOM   5420  C  CB  . VAL C  1 170 ? 26.187  56.604  -0.860   1.00 43.52  ? 196 VAL C CB  1 
ATOM   5421  C  CG1 . VAL C  1 170 ? 24.900  55.854  -0.566   1.00 44.70  ? 196 VAL C CG1 1 
ATOM   5422  C  CG2 . VAL C  1 170 ? 26.356  56.797  -2.356   1.00 42.80  ? 196 VAL C CG2 1 
ATOM   5423  N  N   . ARG C  1 171 ? 24.746  58.109  1.806    1.00 45.57  ? 197 ARG C N   1 
ATOM   5424  C  CA  . ARG C  1 171 ? 24.372  57.990  3.208    1.00 49.78  ? 197 ARG C CA  1 
ATOM   5425  C  C   . ARG C  1 171 ? 23.119  57.134  3.339    1.00 50.52  ? 197 ARG C C   1 
ATOM   5426  O  O   . ARG C  1 171 ? 22.194  57.245  2.528    1.00 47.19  ? 197 ARG C O   1 
ATOM   5427  C  CB  . ARG C  1 171 ? 24.127  59.372  3.833    1.00 52.15  ? 197 ARG C CB  1 
ATOM   5428  C  CG  . ARG C  1 171 ? 25.386  60.198  4.066    1.00 57.20  ? 197 ARG C CG  1 
ATOM   5429  C  CD  . ARG C  1 171 ? 25.676  60.341  5.551    1.00 61.67  ? 197 ARG C CD  1 
ATOM   5430  N  NE  . ARG C  1 171 ? 25.865  59.041  6.191    1.00 74.07  ? 197 ARG C NE  1 
ATOM   5431  C  CZ  . ARG C  1 171 ? 25.818  58.837  7.504    1.00 74.61  ? 197 ARG C CZ  1 
ATOM   5432  N  NH1 . ARG C  1 171 ? 25.581  59.850  8.328    1.00 69.62  ? 197 ARG C NH1 1 
ATOM   5433  N  NH2 . ARG C  1 171 ? 26.000  57.617  7.993    1.00 73.27  ? 197 ARG C NH2 1 
ATOM   5434  N  N   . CYS C  1 172 ? 23.095  56.278  4.361    1.00 54.70  ? 198 CYS C N   1 
ATOM   5435  C  CA  . CYS C  1 172 ? 21.907  55.506  4.695    1.00 46.82  ? 198 CYS C CA  1 
ATOM   5436  C  C   . CYS C  1 172 ? 20.965  56.341  5.554    1.00 43.66  ? 198 CYS C C   1 
ATOM   5437  O  O   . CYS C  1 172 ? 21.385  57.262  6.261    1.00 41.45  ? 198 CYS C O   1 
ATOM   5438  C  CB  . CYS C  1 172 ? 22.258  54.213  5.445    1.00 37.68  ? 198 CYS C CB  1 
ATOM   5439  S  SG  . CYS C  1 172 ? 23.353  53.025  4.605    1.00 50.97  ? 198 CYS C SG  1 
ATOM   5440  N  N   . ASP C  1 173 ? 19.679  56.008  5.485    1.00 46.50  ? 199 ASP C N   1 
ATOM   5441  C  CA  . ASP C  1 173 ? 18.695  56.630  6.354    1.00 45.67  ? 199 ASP C CA  1 
ATOM   5442  C  C   . ASP C  1 173 ? 18.846  56.108  7.782    1.00 53.77  ? 199 ASP C C   1 
ATOM   5443  O  O   . ASP C  1 173 ? 19.593  55.162  8.059    1.00 53.27  ? 199 ASP C O   1 
ATOM   5444  C  CB  . ASP C  1 173 ? 17.280  56.367  5.842    1.00 44.92  ? 199 ASP C CB  1 
ATOM   5445  C  CG  . ASP C  1 173 ? 16.924  57.226  4.649    1.00 52.11  ? 199 ASP C CG  1 
ATOM   5446  O  OD1 . ASP C  1 173 ? 17.281  58.423  4.651    1.00 56.76  ? 199 ASP C OD1 1 
ATOM   5447  O  OD2 . ASP C  1 173 ? 16.289  56.706  3.707    1.00 53.08  ? 199 ASP C OD2 1 
ATOM   5448  N  N   . GLU C  1 174 ? 18.120  56.742  8.699    1.00 52.38  ? 200 GLU C N   1 
ATOM   5449  C  CA  . GLU C  1 174 ? 18.156  56.327  10.093   1.00 50.19  ? 200 GLU C CA  1 
ATOM   5450  C  C   . GLU C  1 174 ? 17.593  54.918  10.242   1.00 50.20  ? 200 GLU C C   1 
ATOM   5451  O  O   . GLU C  1 174 ? 16.631  54.542  9.566    1.00 49.80  ? 200 GLU C O   1 
ATOM   5452  C  CB  . GLU C  1 174 ? 17.369  57.316  10.949   1.00 51.62  ? 200 GLU C CB  1 
ATOM   5453  C  CG  . GLU C  1 174 ? 17.436  57.046  12.439   1.00 65.47  ? 200 GLU C CG  1 
ATOM   5454  C  CD  . GLU C  1 174 ? 17.206  58.299  13.266   1.00 74.78  ? 200 GLU C CD  1 
ATOM   5455  O  OE1 . GLU C  1 174 ? 18.039  58.586  14.153   1.00 73.56  ? 200 GLU C OE1 1 
ATOM   5456  O  OE2 . GLU C  1 174 ? 16.201  59.003  13.021   1.00 70.41  ? 200 GLU C OE2 1 
ATOM   5457  N  N   . ASN C  1 175 ? 18.218  54.134  11.122   1.00 45.01  ? 201 ASN C N   1 
ATOM   5458  C  CA  . ASN C  1 175 ? 17.855  52.747  11.403   1.00 48.02  ? 201 ASN C CA  1 
ATOM   5459  C  C   . ASN C  1 175 ? 18.151  51.809  10.240   1.00 47.64  ? 201 ASN C C   1 
ATOM   5460  O  O   . ASN C  1 175 ? 17.638  50.687  10.207   1.00 48.60  ? 201 ASN C O   1 
ATOM   5461  C  CB  . ASN C  1 175 ? 16.379  52.610  11.811   1.00 49.55  ? 201 ASN C CB  1 
ATOM   5462  C  CG  . ASN C  1 175 ? 16.056  53.344  13.098   1.00 52.18  ? 201 ASN C CG  1 
ATOM   5463  O  OD1 . ASN C  1 175 ? 16.914  53.504  13.970   1.00 47.91  ? 201 ASN C OD1 1 
ATOM   5464  N  ND2 . ASN C  1 175 ? 14.812  53.795  13.226   1.00 45.10  ? 201 ASN C ND2 1 
ATOM   5465  N  N   . TYR C  1 176 ? 18.972  52.234  9.282    1.00 48.96  ? 202 TYR C N   1 
ATOM   5466  C  CA  . TYR C  1 176 ? 19.356  51.396  8.156    1.00 41.46  ? 202 TYR C CA  1 
ATOM   5467  C  C   . TYR C  1 176 ? 20.859  51.163  8.179    1.00 39.00  ? 202 TYR C C   1 
ATOM   5468  O  O   . TYR C  1 176 ? 21.632  52.058  8.534    1.00 43.89  ? 202 TYR C O   1 
ATOM   5469  C  CB  . TYR C  1 176 ? 18.925  52.020  6.827    1.00 43.47  ? 202 TYR C CB  1 
ATOM   5470  C  CG  . TYR C  1 176 ? 17.437  51.914  6.580    1.00 46.42  ? 202 TYR C CG  1 
ATOM   5471  C  CD1 . TYR C  1 176 ? 16.883  50.763  6.026    1.00 44.28  ? 202 TYR C CD1 1 
ATOM   5472  C  CD2 . TYR C  1 176 ? 16.582  52.956  6.910    1.00 47.37  ? 202 TYR C CD2 1 
ATOM   5473  C  CE1 . TYR C  1 176 ? 15.520  50.658  5.803    1.00 37.42  ? 202 TYR C CE1 1 
ATOM   5474  C  CE2 . TYR C  1 176 ? 15.218  52.861  6.690    1.00 46.77  ? 202 TYR C CE2 1 
ATOM   5475  C  CZ  . TYR C  1 176 ? 14.693  51.713  6.136    1.00 42.12  ? 202 TYR C CZ  1 
ATOM   5476  O  OH  . TYR C  1 176 ? 13.337  51.624  5.919    1.00 43.35  ? 202 TYR C OH  1 
ATOM   5477  N  N   . TYR C  1 177 ? 21.265  49.949  7.810    1.00 37.95  ? 203 TYR C N   1 
ATOM   5478  C  CA  . TYR C  1 177 ? 22.658  49.535  7.935    1.00 47.17  ? 203 TYR C CA  1 
ATOM   5479  C  C   . TYR C  1 177 ? 23.124  48.812  6.678    1.00 45.19  ? 203 TYR C C   1 
ATOM   5480  O  O   . TYR C  1 177 ? 22.410  48.793  5.671    1.00 45.80  ? 203 TYR C O   1 
ATOM   5481  C  CB  . TYR C  1 177 ? 22.844  48.635  9.165    1.00 48.91  ? 203 TYR C CB  1 
ATOM   5482  C  CG  . TYR C  1 177 ? 22.487  49.295  10.481   1.00 45.54  ? 203 TYR C CG  1 
ATOM   5483  C  CD1 . TYR C  1 177 ? 23.470  49.844  11.296   1.00 46.95  ? 203 TYR C CD1 1 
ATOM   5484  C  CD2 . TYR C  1 177 ? 21.168  49.370  10.907   1.00 43.32  ? 203 TYR C CD2 1 
ATOM   5485  C  CE1 . TYR C  1 177 ? 23.148  50.450  12.496   1.00 41.65  ? 203 TYR C CE1 1 
ATOM   5486  C  CE2 . TYR C  1 177 ? 20.838  49.974  12.104   1.00 51.51  ? 203 TYR C CE2 1 
ATOM   5487  C  CZ  . TYR C  1 177 ? 21.832  50.511  12.895   1.00 46.85  ? 203 TYR C CZ  1 
ATOM   5488  O  OH  . TYR C  1 177 ? 21.500  51.109  14.089   1.00 47.78  ? 203 TYR C OH  1 
ATOM   5489  N  N   . SER C  1 178 ? 24.324  48.224  6.736    1.00 47.20  ? 204 SER C N   1 
ATOM   5490  C  CA  . SER C  1 178 ? 24.928  47.481  5.633    1.00 45.22  ? 204 SER C CA  1 
ATOM   5491  C  C   . SER C  1 178 ? 25.342  48.403  4.490    1.00 50.54  ? 204 SER C C   1 
ATOM   5492  O  O   . SER C  1 178 ? 24.939  49.569  4.437    1.00 46.00  ? 204 SER C O   1 
ATOM   5493  C  CB  . SER C  1 178 ? 23.977  46.390  5.127    1.00 45.07  ? 204 SER C CB  1 
ATOM   5494  O  OG  . SER C  1 178 ? 24.499  45.740  3.981    1.00 56.05  ? 204 SER C OG  1 
ATOM   5495  N  N   . ALA C  1 179 ? 26.161  47.885  3.572    1.00 51.91  ? 205 ALA C N   1 
ATOM   5496  C  CA  . ALA C  1 179 ? 26.620  48.682  2.442    1.00 47.63  ? 205 ALA C CA  1 
ATOM   5497  C  C   . ALA C  1 179 ? 25.506  48.970  1.445    1.00 44.63  ? 205 ALA C C   1 
ATOM   5498  O  O   . ALA C  1 179 ? 25.635  49.897  0.638    1.00 46.19  ? 205 ALA C O   1 
ATOM   5499  C  CB  . ALA C  1 179 ? 27.781  47.973  1.741    1.00 52.36  ? 205 ALA C CB  1 
ATOM   5500  N  N   . THR C  1 180 ? 24.425  48.200  1.481    1.00 42.57  ? 206 THR C N   1 
ATOM   5501  C  CA  . THR C  1 180 ? 23.281  48.414  0.607    1.00 42.18  ? 206 THR C CA  1 
ATOM   5502  C  C   . THR C  1 180 ? 22.235  49.330  1.225    1.00 44.20  ? 206 THR C C   1 
ATOM   5503  O  O   . THR C  1 180 ? 21.233  49.630  0.568    1.00 40.21  ? 206 THR C O   1 
ATOM   5504  C  CB  . THR C  1 180 ? 22.634  47.072  0.250    1.00 44.32  ? 206 THR C CB  1 
ATOM   5505  O  OG1 . THR C  1 180 ? 22.071  46.481  1.429    1.00 43.18  ? 206 THR C OG1 1 
ATOM   5506  C  CG2 . THR C  1 180 ? 23.671  46.121  -0.334   1.00 43.91  ? 206 THR C CG2 1 
ATOM   5507  N  N   . CYS C  1 181 ? 22.443  49.773  2.468    1.00 45.64  ? 207 CYS C N   1 
ATOM   5508  C  CA  . CYS C  1 181 ? 21.472  50.597  3.191    1.00 44.08  ? 207 CYS C CA  1 
ATOM   5509  C  C   . CYS C  1 181 ? 20.115  49.907  3.286    1.00 41.30  ? 207 CYS C C   1 
ATOM   5510  O  O   . CYS C  1 181 ? 19.079  50.563  3.417    1.00 44.00  ? 207 CYS C O   1 
ATOM   5511  C  CB  . CYS C  1 181 ? 21.325  51.983  2.553    1.00 45.14  ? 207 CYS C CB  1 
ATOM   5512  S  SG  . CYS C  1 181 ? 22.792  53.043  2.639    1.00 52.59  ? 207 CYS C SG  1 
ATOM   5513  N  N   . ASN C  1 182 ? 20.113  48.573  3.233    1.00 39.79  ? 208 ASN C N   1 
ATOM   5514  C  CA  . ASN C  1 182 ? 18.881  47.797  3.145    1.00 42.78  ? 208 ASN C CA  1 
ATOM   5515  C  C   . ASN C  1 182 ? 18.708  46.841  4.322    1.00 49.98  ? 208 ASN C C   1 
ATOM   5516  O  O   . ASN C  1 182 ? 17.901  45.907  4.243    1.00 53.65  ? 208 ASN C O   1 
ATOM   5517  C  CB  . ASN C  1 182 ? 18.837  47.025  1.824    1.00 41.77  ? 208 ASN C CB  1 
ATOM   5518  C  CG  . ASN C  1 182 ? 17.421  46.722  1.369    1.00 41.54  ? 208 ASN C CG  1 
ATOM   5519  O  OD1 . ASN C  1 182 ? 16.550  47.597  1.376    1.00 35.82  ? 208 ASN C OD1 1 
ATOM   5520  N  ND2 . ASN C  1 182 ? 17.183  45.475  0.975    1.00 37.58  ? 208 ASN C ND2 1 
ATOM   5521  N  N   . LYS C  1 183 ? 19.446  47.049  5.411    1.00 45.50  ? 209 LYS C N   1 
ATOM   5522  C  CA  . LYS C  1 183 ? 19.316  46.251  6.626    1.00 35.78  ? 209 LYS C CA  1 
ATOM   5523  C  C   . LYS C  1 183 ? 18.743  47.147  7.719    1.00 39.32  ? 209 LYS C C   1 
ATOM   5524  O  O   . LYS C  1 183 ? 19.410  48.079  8.179    1.00 47.58  ? 209 LYS C O   1 
ATOM   5525  C  CB  . LYS C  1 183 ? 20.662  45.660  7.034    1.00 40.99  ? 209 LYS C CB  1 
ATOM   5526  C  CG  . LYS C  1 183 ? 20.581  44.645  8.165    1.00 47.82  ? 209 LYS C CG  1 
ATOM   5527  C  CD  . LYS C  1 183 ? 21.919  43.947  8.371    1.00 50.65  ? 209 LYS C CD  1 
ATOM   5528  C  CE  . LYS C  1 183 ? 21.834  42.871  9.441    1.00 44.81  ? 209 LYS C CE  1 
ATOM   5529  N  NZ  . LYS C  1 183 ? 23.121  42.131  9.578    1.00 43.28  ? 209 LYS C NZ  1 
ATOM   5530  N  N   . PHE C  1 184 ? 17.514  46.862  8.135    1.00 40.06  ? 210 PHE C N   1 
ATOM   5531  C  CA  . PHE C  1 184 ? 16.767  47.726  9.041    1.00 42.28  ? 210 PHE C CA  1 
ATOM   5532  C  C   . PHE C  1 184 ? 16.806  47.179  10.465   1.00 42.87  ? 210 PHE C C   1 
ATOM   5533  O  O   . PHE C  1 184 ? 16.588  45.983  10.687   1.00 34.83  ? 210 PHE C O   1 
ATOM   5534  C  CB  . PHE C  1 184 ? 15.318  47.866  8.569    1.00 34.89  ? 210 PHE C CB  1 
ATOM   5535  C  CG  . PHE C  1 184 ? 14.476  48.749  9.441    1.00 38.76  ? 210 PHE C CG  1 
ATOM   5536  C  CD1 . PHE C  1 184 ? 14.533  50.127  9.314    1.00 39.97  ? 210 PHE C CD1 1 
ATOM   5537  C  CD2 . PHE C  1 184 ? 13.620  48.202  10.382   1.00 37.64  ? 210 PHE C CD2 1 
ATOM   5538  C  CE1 . PHE C  1 184 ? 13.754  50.946  10.113   1.00 38.81  ? 210 PHE C CE1 1 
ATOM   5539  C  CE2 . PHE C  1 184 ? 12.839  49.013  11.183   1.00 36.19  ? 210 PHE C CE2 1 
ATOM   5540  C  CZ  . PHE C  1 184 ? 12.906  50.388  11.046   1.00 41.66  ? 210 PHE C CZ  1 
ATOM   5541  N  N   . CYS C  1 185 ? 17.080  48.063  11.424   1.00 40.26  ? 211 CYS C N   1 
ATOM   5542  C  CA  . CYS C  1 185 ? 17.063  47.712  12.837   1.00 40.63  ? 211 CYS C CA  1 
ATOM   5543  C  C   . CYS C  1 185 ? 16.661  48.940  13.634   1.00 45.37  ? 211 CYS C C   1 
ATOM   5544  O  O   . CYS C  1 185 ? 17.246  50.012  13.454   1.00 45.50  ? 211 CYS C O   1 
ATOM   5545  C  CB  . CYS C  1 185 ? 18.428  47.206  13.315   1.00 39.28  ? 211 CYS C CB  1 
ATOM   5546  S  SG  . CYS C  1 185 ? 18.403  46.489  14.989   1.00 48.54  ? 211 CYS C SG  1 
ATOM   5547  N  N   . ARG C  1 186 ? 15.676  48.778  14.520   1.00 45.41  ? 212 ARG C N   1 
ATOM   5548  C  CA  . ARG C  1 186 ? 15.286  49.844  15.424   1.00 43.85  ? 212 ARG C CA  1 
ATOM   5549  C  C   . ARG C  1 186 ? 15.121  49.266  16.826   1.00 47.13  ? 212 ARG C C   1 
ATOM   5550  O  O   . ARG C  1 186 ? 14.396  48.270  17.001   1.00 52.86  ? 212 ARG C O   1 
ATOM   5551  C  CB  . ARG C  1 186 ? 13.995  50.529  14.982   1.00 44.87  ? 212 ARG C CB  1 
ATOM   5552  C  CG  . ARG C  1 186 ? 13.594  51.645  15.919   1.00 53.74  ? 212 ARG C CG  1 
ATOM   5553  C  CD  . ARG C  1 186 ? 12.315  52.333  15.493   1.00 60.64  ? 212 ARG C CD  1 
ATOM   5554  N  NE  . ARG C  1 186 ? 12.307  53.720  15.950   1.00 80.07  ? 212 ARG C NE  1 
ATOM   5555  C  CZ  . ARG C  1 186 ? 11.211  54.451  16.121   1.00 79.47  ? 212 ARG C CZ  1 
ATOM   5556  N  NH1 . ARG C  1 186 ? 10.017  53.926  15.882   1.00 75.23  ? 212 ARG C NH1 1 
ATOM   5557  N  NH2 . ARG C  1 186 ? 11.313  55.706  16.540   1.00 74.85  ? 212 ARG C NH2 1 
ATOM   5558  N  N   . PRO C  1 187 ? 15.763  49.855  17.835   1.00 49.32  ? 213 PRO C N   1 
ATOM   5559  C  CA  . PRO C  1 187 ? 15.644  49.315  19.194   1.00 45.73  ? 213 PRO C CA  1 
ATOM   5560  C  C   . PRO C  1 187 ? 14.220  49.436  19.716   1.00 45.58  ? 213 PRO C C   1 
ATOM   5561  O  O   . PRO C  1 187 ? 13.453  50.309  19.304   1.00 46.35  ? 213 PRO C O   1 
ATOM   5562  C  CB  . PRO C  1 187 ? 16.616  50.179  20.009   1.00 41.64  ? 213 PRO C CB  1 
ATOM   5563  C  CG  . PRO C  1 187 ? 17.535  50.789  19.003   1.00 46.27  ? 213 PRO C CG  1 
ATOM   5564  C  CD  . PRO C  1 187 ? 16.698  50.990  17.775   1.00 47.45  ? 213 PRO C CD  1 
ATOM   5565  N  N   . ARG C  1 188 ? 13.875  48.541  20.641   1.00 53.01  ? 214 ARG C N   1 
ATOM   5566  C  CA  . ARG C  1 188 ? 12.520  48.459  21.167   1.00 52.13  ? 214 ARG C CA  1 
ATOM   5567  C  C   . ARG C  1 188 ? 12.564  47.915  22.587   1.00 45.39  ? 214 ARG C C   1 
ATOM   5568  O  O   . ARG C  1 188 ? 13.498  47.202  22.966   1.00 40.71  ? 214 ARG C O   1 
ATOM   5569  C  CB  . ARG C  1 188 ? 11.635  47.578  20.272   1.00 50.48  ? 214 ARG C CB  1 
ATOM   5570  C  CG  . ARG C  1 188 ? 10.188  47.498  20.701   1.00 49.43  ? 214 ARG C CG  1 
ATOM   5571  C  CD  . ARG C  1 188 ? 9.253   47.493  19.507   1.00 66.91  ? 214 ARG C CD  1 
ATOM   5572  N  NE  . ARG C  1 188 ? 9.562   46.414  18.576   1.00 76.48  ? 214 ARG C NE  1 
ATOM   5573  C  CZ  . ARG C  1 188 ? 8.707   45.940  17.676   1.00 72.73  ? 214 ARG C CZ  1 
ATOM   5574  N  NH1 . ARG C  1 188 ? 7.483   46.446  17.596   1.00 69.18  ? 214 ARG C NH1 1 
ATOM   5575  N  NH2 . ARG C  1 188 ? 9.073   44.954  16.866   1.00 69.96  ? 214 ARG C NH2 1 
ATOM   5576  N  N   . ASN C  1 189 ? 11.540  48.270  23.375   1.00 50.54  ? 215 ASN C N   1 
ATOM   5577  C  CA  . ASN C  1 189 ? 11.371  47.846  24.762   1.00 42.80  ? 215 ASN C CA  1 
ATOM   5578  C  C   . ASN C  1 189 ? 9.869   47.747  25.050   1.00 42.44  ? 215 ASN C C   1 
ATOM   5579  O  O   . ASN C  1 189 ? 9.289   48.513  25.815   1.00 48.91  ? 215 ASN C O   1 
ATOM   5580  C  CB  . ASN C  1 189 ? 12.064  48.807  25.732   1.00 46.43  ? 215 ASN C CB  1 
ATOM   5581  C  CG  . ASN C  1 189 ? 12.230  48.219  27.118   1.00 44.70  ? 215 ASN C CG  1 
ATOM   5582  O  OD1 . ASN C  1 189 ? 11.647  47.185  27.443   1.00 43.92  ? 215 ASN C OD1 1 
ATOM   5583  N  ND2 . ASN C  1 189 ? 13.028  48.881  27.947   1.00 46.13  ? 215 ASN C ND2 1 
ATOM   5584  N  N   . ASP C  1 190 ? 9.216   46.786  24.405   1.00 46.62  ? 216 ASP C N   1 
ATOM   5585  C  CA  . ASP C  1 190 ? 7.832   46.426  24.704   1.00 44.24  ? 216 ASP C CA  1 
ATOM   5586  C  C   . ASP C  1 190 ? 7.667   44.938  24.421   1.00 51.05  ? 216 ASP C C   1 
ATOM   5587  O  O   . ASP C  1 190 ? 8.643   44.227  24.162   1.00 49.58  ? 216 ASP C O   1 
ATOM   5588  C  CB  . ASP C  1 190 ? 6.837   47.280  23.906   1.00 48.82  ? 216 ASP C CB  1 
ATOM   5589  C  CG  . ASP C  1 190 ? 7.123   47.279  22.416   1.00 51.22  ? 216 ASP C CG  1 
ATOM   5590  O  OD1 . ASP C  1 190 ? 7.074   46.203  21.784   1.00 49.85  ? 216 ASP C OD1 1 
ATOM   5591  O  OD2 . ASP C  1 190 ? 7.378   48.371  21.873   1.00 57.70  ? 216 ASP C OD2 1 
ATOM   5592  N  N   . PHE C  1 191 ? 6.427   44.458  24.452   1.00 52.97  ? 217 PHE C N   1 
ATOM   5593  C  CA  . PHE C  1 191 ? 6.202   43.024  24.338   1.00 60.13  ? 217 PHE C CA  1 
ATOM   5594  C  C   . PHE C  1 191 ? 6.229   42.522  22.900   1.00 56.29  ? 217 PHE C C   1 
ATOM   5595  O  O   . PHE C  1 191 ? 5.747   41.417  22.632   1.00 63.97  ? 217 PHE C O   1 
ATOM   5596  C  CB  . PHE C  1 191 ? 4.893   42.635  25.030   1.00 67.91  ? 217 PHE C CB  1 
ATOM   5597  C  CG  . PHE C  1 191 ? 5.038   42.447  26.519   1.00 74.48  ? 217 PHE C CG  1 
ATOM   5598  C  CD1 . PHE C  1 191 ? 3.943   42.135  27.309   1.00 69.57  ? 217 PHE C CD1 1 
ATOM   5599  C  CD2 . PHE C  1 191 ? 6.281   42.585  27.128   1.00 70.30  ? 217 PHE C CD2 1 
ATOM   5600  C  CE1 . PHE C  1 191 ? 4.084   41.963  28.679   1.00 82.40  ? 217 PHE C CE1 1 
ATOM   5601  C  CE2 . PHE C  1 191 ? 6.430   42.417  28.494   1.00 71.45  ? 217 PHE C CE2 1 
ATOM   5602  C  CZ  . PHE C  1 191 ? 5.331   42.105  29.272   1.00 87.61  ? 217 PHE C CZ  1 
ATOM   5603  N  N   . PHE C  1 192 ? 6.789   43.297  21.977   1.00 49.66  ? 218 PHE C N   1 
ATOM   5604  C  CA  . PHE C  1 192 ? 7.190   42.783  20.678   1.00 53.23  ? 218 PHE C CA  1 
ATOM   5605  C  C   . PHE C  1 192 ? 8.680   42.469  20.621   1.00 58.78  ? 218 PHE C C   1 
ATOM   5606  O  O   . PHE C  1 192 ? 9.162   41.990  19.589   1.00 58.88  ? 218 PHE C O   1 
ATOM   5607  C  CB  . PHE C  1 192 ? 6.821   43.779  19.573   1.00 65.74  ? 218 PHE C CB  1 
ATOM   5608  C  CG  . PHE C  1 192 ? 5.345   43.842  19.277   1.00 71.19  ? 218 PHE C CG  1 
ATOM   5609  C  CD1 . PHE C  1 192 ? 4.767   42.958  18.376   1.00 67.30  ? 218 PHE C CD1 1 
ATOM   5610  C  CD2 . PHE C  1 192 ? 4.537   44.786  19.896   1.00 64.10  ? 218 PHE C CD2 1 
ATOM   5611  C  CE1 . PHE C  1 192 ? 3.411   43.012  18.098   1.00 62.00  ? 218 PHE C CE1 1 
ATOM   5612  C  CE2 . PHE C  1 192 ? 3.179   44.845  19.623   1.00 63.61  ? 218 PHE C CE2 1 
ATOM   5613  C  CZ  . PHE C  1 192 ? 2.616   43.956  18.723   1.00 66.10  ? 218 PHE C CZ  1 
ATOM   5614  N  N   . GLY C  1 193 ? 9.409   42.721  21.698   1.00 51.96  ? 219 GLY C N   1 
ATOM   5615  C  CA  . GLY C  1 193 ? 10.837  42.475  21.768   1.00 44.90  ? 219 GLY C CA  1 
ATOM   5616  C  C   . GLY C  1 193 ? 11.520  43.442  22.716   1.00 41.72  ? 219 GLY C C   1 
ATOM   5617  O  O   . GLY C  1 193 ? 11.032  44.529  23.018   1.00 39.15  ? 219 GLY C O   1 
ATOM   5618  N  N   . HIS C  1 194 ? 12.705  43.027  23.201   1.00 38.55  ? 220 HIS C N   1 
ATOM   5619  C  CA  . HIS C  1 194 ? 13.522  43.818  24.132   1.00 42.13  ? 220 HIS C CA  1 
ATOM   5620  C  C   . HIS C  1 194 ? 14.975  43.691  23.669   1.00 48.87  ? 220 HIS C C   1 
ATOM   5621  O  O   . HIS C  1 194 ? 15.747  42.870  24.176   1.00 44.64  ? 220 HIS C O   1 
ATOM   5622  C  CB  . HIS C  1 194 ? 13.353  43.350  25.580   1.00 39.87  ? 220 HIS C CB  1 
ATOM   5623  C  CG  . HIS C  1 194 ? 11.930  43.288  26.040   1.00 35.92  ? 220 HIS C CG  1 
ATOM   5624  N  ND1 . HIS C  1 194 ? 11.354  44.271  26.816   1.00 32.22  ? 220 HIS C ND1 1 
ATOM   5625  C  CD2 . HIS C  1 194 ? 10.970  42.355  25.841   1.00 33.01  ? 220 HIS C CD2 1 
ATOM   5626  C  CE1 . HIS C  1 194 ? 10.098  43.951  27.067   1.00 33.28  ? 220 HIS C CE1 1 
ATOM   5627  N  NE2 . HIS C  1 194 ? 9.839   42.794  26.485   1.00 36.69  ? 220 HIS C NE2 1 
ATOM   5628  N  N   . TYR C  1 195 ? 15.356  44.513  22.693   1.00 50.99  ? 221 TYR C N   1 
ATOM   5629  C  CA  . TYR C  1 195 ? 16.671  44.396  22.086   1.00 42.84  ? 221 TYR C CA  1 
ATOM   5630  C  C   . TYR C  1 195 ? 17.217  45.770  21.738   1.00 44.26  ? 221 TYR C C   1 
ATOM   5631  O  O   . TYR C  1 195 ? 16.487  46.763  21.676   1.00 40.32  ? 221 TYR C O   1 
ATOM   5632  C  CB  . TYR C  1 195 ? 16.637  43.520  20.829   1.00 40.84  ? 221 TYR C CB  1 
ATOM   5633  C  CG  . TYR C  1 195 ? 15.648  43.982  19.783   1.00 47.44  ? 221 TYR C CG  1 
ATOM   5634  C  CD1 . TYR C  1 195 ? 16.024  44.878  18.787   1.00 51.82  ? 221 TYR C CD1 1 
ATOM   5635  C  CD2 . TYR C  1 195 ? 14.340  43.517  19.787   1.00 44.98  ? 221 TYR C CD2 1 
ATOM   5636  C  CE1 . TYR C  1 195 ? 15.122  45.300  17.827   1.00 50.65  ? 221 TYR C CE1 1 
ATOM   5637  C  CE2 . TYR C  1 195 ? 13.430  43.933  18.832   1.00 57.19  ? 221 TYR C CE2 1 
ATOM   5638  C  CZ  . TYR C  1 195 ? 13.827  44.824  17.853   1.00 59.83  ? 221 TYR C CZ  1 
ATOM   5639  O  OH  . TYR C  1 195 ? 12.924  45.239  16.900   1.00 49.20  ? 221 TYR C OH  1 
ATOM   5640  N  N   . THR C  1 196 ? 18.525  45.800  21.519   1.00 52.47  ? 222 THR C N   1 
ATOM   5641  C  CA  . THR C  1 196 ? 19.260  46.945  21.009   1.00 49.62  ? 222 THR C CA  1 
ATOM   5642  C  C   . THR C  1 196 ? 19.706  46.642  19.580   1.00 43.09  ? 222 THR C C   1 
ATOM   5643  O  O   . THR C  1 196 ? 19.514  45.538  19.066   1.00 42.18  ? 222 THR C O   1 
ATOM   5644  C  CB  . THR C  1 196 ? 20.455  47.260  21.916   1.00 41.47  ? 222 THR C CB  1 
ATOM   5645  O  OG1 . THR C  1 196 ? 20.962  48.562  21.610   1.00 54.41  ? 222 THR C OG1 1 
ATOM   5646  C  CG2 . THR C  1 196 ? 21.568  46.238  21.713   1.00 42.43  ? 222 THR C CG2 1 
ATOM   5647  N  N   . CYS C  1 197 ? 20.297  47.638  18.928   1.00 47.68  ? 223 CYS C N   1 
ATOM   5648  C  CA  . CYS C  1 197 ? 20.926  47.450  17.628   1.00 45.07  ? 223 CYS C CA  1 
ATOM   5649  C  C   . CYS C  1 197 ? 22.409  47.756  17.767   1.00 47.35  ? 223 CYS C C   1 
ATOM   5650  O  O   . CYS C  1 197 ? 22.780  48.773  18.364   1.00 39.50  ? 223 CYS C O   1 
ATOM   5651  C  CB  . CYS C  1 197 ? 20.291  48.343  16.556   1.00 40.51  ? 223 CYS C CB  1 
ATOM   5652  S  SG  . CYS C  1 197 ? 18.520  48.067  16.275   1.00 42.62  ? 223 CYS C SG  1 
ATOM   5653  N  N   . ASP C  1 198 ? 23.252  46.866  17.245   1.00 50.43  ? 224 ASP C N   1 
ATOM   5654  C  CA  . ASP C  1 198 ? 24.687  47.106  17.222   1.00 57.00  ? 224 ASP C CA  1 
ATOM   5655  C  C   . ASP C  1 198 ? 25.047  47.875  15.949   1.00 58.57  ? 224 ASP C C   1 
ATOM   5656  O  O   . ASP C  1 198 ? 24.179  48.407  15.251   1.00 56.89  ? 224 ASP C O   1 
ATOM   5657  C  CB  . ASP C  1 198 ? 25.463  45.792  17.354   1.00 49.00  ? 224 ASP C CB  1 
ATOM   5658  C  CG  . ASP C  1 198 ? 25.096  44.769  16.288   1.00 58.03  ? 224 ASP C CG  1 
ATOM   5659  O  OD1 . ASP C  1 198 ? 24.417  45.124  15.300   1.00 58.81  ? 224 ASP C OD1 1 
ATOM   5660  O  OD2 . ASP C  1 198 ? 25.504  43.596  16.440   1.00 54.40  ? 224 ASP C OD2 1 
ATOM   5661  N  N   . GLN C  1 199 ? 26.338  47.938  15.629   1.00 58.53  ? 225 GLN C N   1 
ATOM   5662  C  CA  . GLN C  1 199 ? 26.782  48.736  14.495   1.00 58.17  ? 225 GLN C CA  1 
ATOM   5663  C  C   . GLN C  1 199 ? 26.664  47.994  13.169   1.00 55.60  ? 225 GLN C C   1 
ATOM   5664  O  O   . GLN C  1 199 ? 26.692  48.637  12.114   1.00 58.41  ? 225 GLN C O   1 
ATOM   5665  C  CB  . GLN C  1 199 ? 28.220  49.201  14.727   1.00 70.67  ? 225 GLN C CB  1 
ATOM   5666  C  CG  . GLN C  1 199 ? 28.467  49.673  16.157   1.00 72.67  ? 225 GLN C CG  1 
ATOM   5667  C  CD  . GLN C  1 199 ? 29.459  50.818  16.247   1.00 81.51  ? 225 GLN C CD  1 
ATOM   5668  O  OE1 . GLN C  1 199 ? 30.012  51.258  15.238   1.00 80.37  ? 225 GLN C OE1 1 
ATOM   5669  N  NE2 . GLN C  1 199 ? 29.683  51.311  17.462   1.00 79.12  ? 225 GLN C NE2 1 
ATOM   5670  N  N   . TYR C  1 200 ? 26.519  46.671  13.194   1.00 54.83  ? 226 TYR C N   1 
ATOM   5671  C  CA  . TYR C  1 200 ? 26.296  45.885  11.987   1.00 51.99  ? 226 TYR C CA  1 
ATOM   5672  C  C   . TYR C  1 200 ? 24.816  45.676  11.686   1.00 55.68  ? 226 TYR C C   1 
ATOM   5673  O  O   . TYR C  1 200 ? 24.482  44.847  10.832   1.00 52.84  ? 226 TYR C O   1 
ATOM   5674  C  CB  . TYR C  1 200 ? 26.992  44.526  12.099   1.00 50.82  ? 226 TYR C CB  1 
ATOM   5675  C  CG  . TYR C  1 200 ? 28.483  44.621  12.311   1.00 58.23  ? 226 TYR C CG  1 
ATOM   5676  C  CD1 . TYR C  1 200 ? 29.354  44.694  11.234   1.00 55.58  ? 226 TYR C CD1 1 
ATOM   5677  C  CD2 . TYR C  1 200 ? 29.022  44.640  13.593   1.00 64.17  ? 226 TYR C CD2 1 
ATOM   5678  C  CE1 . TYR C  1 200 ? 30.721  44.784  11.425   1.00 61.17  ? 226 TYR C CE1 1 
ATOM   5679  C  CE2 . TYR C  1 200 ? 30.387  44.729  13.794   1.00 63.55  ? 226 TYR C CE2 1 
ATOM   5680  C  CZ  . TYR C  1 200 ? 31.232  44.801  12.708   1.00 63.58  ? 226 TYR C CZ  1 
ATOM   5681  O  OH  . TYR C  1 200 ? 32.590  44.889  12.908   1.00 58.02  ? 226 TYR C OH  1 
ATOM   5682  N  N   . GLY C  1 201 ? 23.928  46.399  12.368   1.00 54.30  ? 227 GLY C N   1 
ATOM   5683  C  CA  . GLY C  1 201 ? 22.506  46.263  12.127   1.00 49.86  ? 227 GLY C CA  1 
ATOM   5684  C  C   . GLY C  1 201 ? 21.882  44.997  12.663   1.00 50.59  ? 227 GLY C C   1 
ATOM   5685  O  O   . GLY C  1 201 ? 20.804  44.610  12.205   1.00 46.25  ? 227 GLY C O   1 
ATOM   5686  N  N   . ASN C  1 202 ? 22.531  44.338  13.619   1.00 54.91  ? 228 ASN C N   1 
ATOM   5687  C  CA  . ASN C  1 202 ? 22.018  43.125  14.239   1.00 50.66  ? 228 ASN C CA  1 
ATOM   5688  C  C   . ASN C  1 202 ? 21.406  43.443  15.598   1.00 50.62  ? 228 ASN C C   1 
ATOM   5689  O  O   . ASN C  1 202 ? 21.749  44.436  16.244   1.00 48.21  ? 228 ASN C O   1 
ATOM   5690  C  CB  . ASN C  1 202 ? 23.130  42.083  14.392   1.00 50.84  ? 228 ASN C CB  1 
ATOM   5691  C  CG  . ASN C  1 202 ? 23.543  41.468  13.065   1.00 48.99  ? 228 ASN C CG  1 
ATOM   5692  O  OD1 . ASN C  1 202 ? 22.705  41.214  12.198   1.00 44.99  ? 228 ASN C OD1 1 
ATOM   5693  N  ND2 . ASN C  1 202 ? 24.840  41.223  12.902   1.00 41.19  ? 228 ASN C ND2 1 
ATOM   5694  N  N   . LYS C  1 203 ? 20.481  42.582  16.024   1.00 56.70  ? 229 LYS C N   1 
ATOM   5695  C  CA  . LYS C  1 203 ? 19.809  42.741  17.308   1.00 51.32  ? 229 LYS C CA  1 
ATOM   5696  C  C   . LYS C  1 203 ? 20.602  42.059  18.413   1.00 48.14  ? 229 LYS C C   1 
ATOM   5697  O  O   . LYS C  1 203 ? 21.194  40.996  18.206   1.00 59.35  ? 229 LYS C O   1 
ATOM   5698  C  CB  . LYS C  1 203 ? 18.394  42.162  17.264   1.00 43.44  ? 229 LYS C CB  1 
ATOM   5699  C  CG  . LYS C  1 203 ? 17.495  42.762  16.199   1.00 48.21  ? 229 LYS C CG  1 
ATOM   5700  C  CD  . LYS C  1 203 ? 16.116  42.122  16.243   1.00 56.90  ? 229 LYS C CD  1 
ATOM   5701  C  CE  . LYS C  1 203 ? 15.239  42.607  15.106   1.00 56.54  ? 229 LYS C CE  1 
ATOM   5702  N  NZ  . LYS C  1 203 ? 13.910  41.945  15.130   1.00 54.58  ? 229 LYS C NZ  1 
ATOM   5703  N  N   . ALA C  1 204 ? 20.614  42.682  19.589   1.00 48.94  ? 230 ALA C N   1 
ATOM   5704  C  CA  . ALA C  1 204 ? 21.231  42.114  20.782   1.00 53.21  ? 230 ALA C CA  1 
ATOM   5705  C  C   . ALA C  1 204 ? 20.267  42.303  21.940   1.00 49.24  ? 230 ALA C C   1 
ATOM   5706  O  O   . ALA C  1 204 ? 19.946  43.442  22.296   1.00 43.33  ? 230 ALA C O   1 
ATOM   5707  C  CB  . ALA C  1 204 ? 22.580  42.771  21.090   1.00 44.66  ? 230 ALA C CB  1 
ATOM   5708  N  N   . CYS C  1 205 ? 19.801  41.193  22.514   1.00 47.32  ? 231 CYS C N   1 
ATOM   5709  C  CA  . CYS C  1 205 ? 18.809  41.266  23.578   1.00 39.87  ? 231 CYS C CA  1 
ATOM   5710  C  C   . CYS C  1 205 ? 19.336  42.092  24.743   1.00 37.88  ? 231 CYS C C   1 
ATOM   5711  O  O   . CYS C  1 205 ? 20.520  42.034  25.085   1.00 41.20  ? 231 CYS C O   1 
ATOM   5712  C  CB  . CYS C  1 205 ? 18.430  39.867  24.068   1.00 43.77  ? 231 CYS C CB  1 
ATOM   5713  S  SG  . CYS C  1 205 ? 17.789  38.699  22.830   1.00 63.18  ? 231 CYS C SG  1 
ATOM   5714  N  N   . MET C  1 206 ? 18.449  42.875  25.347   1.00 40.09  ? 232 MET C N   1 
ATOM   5715  C  CA  . MET C  1 206 ? 18.804  43.612  26.548   1.00 41.50  ? 232 MET C CA  1 
ATOM   5716  C  C   . MET C  1 206 ? 19.067  42.641  27.702   1.00 41.38  ? 232 MET C C   1 
ATOM   5717  O  O   . MET C  1 206 ? 18.734  41.453  27.643   1.00 38.36  ? 232 MET C O   1 
ATOM   5718  C  CB  . MET C  1 206 ? 17.694  44.595  26.913   1.00 35.99  ? 232 MET C CB  1 
ATOM   5719  C  CG  . MET C  1 206 ? 17.213  45.441  25.751   1.00 32.77  ? 232 MET C CG  1 
ATOM   5720  S  SD  . MET C  1 206 ? 15.771  46.437  26.173   1.00 36.39  ? 232 MET C SD  1 
ATOM   5721  C  CE  . MET C  1 206 ? 16.392  47.329  27.592   1.00 28.30  ? 232 MET C CE  1 
ATOM   5722  N  N   . ASP C  1 207 ? 19.677  43.165  28.765   1.00 41.87  ? 233 ASP C N   1 
ATOM   5723  C  CA  . ASP C  1 207 ? 19.995  42.348  29.930   1.00 45.14  ? 233 ASP C CA  1 
ATOM   5724  C  C   . ASP C  1 207 ? 18.739  41.702  30.503   1.00 42.46  ? 233 ASP C C   1 
ATOM   5725  O  O   . ASP C  1 207 ? 17.708  42.359  30.673   1.00 39.73  ? 233 ASP C O   1 
ATOM   5726  C  CB  . ASP C  1 207 ? 20.681  43.197  31.000   1.00 46.06  ? 233 ASP C CB  1 
ATOM   5727  C  CG  . ASP C  1 207 ? 22.194  43.125  30.917   1.00 60.91  ? 233 ASP C CG  1 
ATOM   5728  O  OD1 . ASP C  1 207 ? 22.758  42.052  31.225   1.00 56.35  ? 233 ASP C OD1 1 
ATOM   5729  O  OD2 . ASP C  1 207 ? 22.818  44.143  30.552   1.00 74.18  ? 233 ASP C OD2 1 
ATOM   5730  N  N   . GLY C  1 208 ? 18.830  40.405  30.796   1.00 31.14  ? 234 GLY C N   1 
ATOM   5731  C  CA  . GLY C  1 208 ? 17.719  39.675  31.361   1.00 29.70  ? 234 GLY C CA  1 
ATOM   5732  C  C   . GLY C  1 208 ? 16.731  39.114  30.363   1.00 37.60  ? 234 GLY C C   1 
ATOM   5733  O  O   . GLY C  1 208 ? 15.719  38.534  30.781   1.00 34.41  ? 234 GLY C O   1 
ATOM   5734  N  N   . TRP C  1 209 ? 16.980  39.270  29.064   1.00 40.81  ? 235 TRP C N   1 
ATOM   5735  C  CA  . TRP C  1 209 ? 16.120  38.728  28.024   1.00 37.02  ? 235 TRP C CA  1 
ATOM   5736  C  C   . TRP C  1 209 ? 16.928  37.815  27.112   1.00 42.08  ? 235 TRP C C   1 
ATOM   5737  O  O   . TRP C  1 209 ? 18.129  38.020  26.910   1.00 44.66  ? 235 TRP C O   1 
ATOM   5738  C  CB  . TRP C  1 209 ? 15.470  39.840  27.194   1.00 37.70  ? 235 TRP C CB  1 
ATOM   5739  C  CG  . TRP C  1 209 ? 14.593  40.769  27.985   1.00 38.01  ? 235 TRP C CG  1 
ATOM   5740  C  CD1 . TRP C  1 209 ? 14.959  41.955  28.555   1.00 37.56  ? 235 TRP C CD1 1 
ATOM   5741  C  CD2 . TRP C  1 209 ? 13.201  40.594  28.283   1.00 36.47  ? 235 TRP C CD2 1 
ATOM   5742  N  NE1 . TRP C  1 209 ? 13.883  42.527  29.190   1.00 34.28  ? 235 TRP C NE1 1 
ATOM   5743  C  CE2 . TRP C  1 209 ? 12.792  41.712  29.038   1.00 30.79  ? 235 TRP C CE2 1 
ATOM   5744  C  CE3 . TRP C  1 209 ? 12.260  39.603  27.984   1.00 39.02  ? 235 TRP C CE3 1 
ATOM   5745  C  CZ2 . TRP C  1 209 ? 11.484  41.866  29.498   1.00 29.69  ? 235 TRP C CZ2 1 
ATOM   5746  C  CZ3 . TRP C  1 209 ? 10.959  39.758  28.445   1.00 33.17  ? 235 TRP C CZ3 1 
ATOM   5747  C  CH2 . TRP C  1 209 ? 10.586  40.880  29.193   1.00 31.48  ? 235 TRP C CH2 1 
ATOM   5748  N  N   . MET C  1 210 ? 16.257  36.803  26.565   1.00 48.31  ? 236 MET C N   1 
ATOM   5749  C  CA  . MET C  1 210 ? 16.882  35.858  25.649   1.00 45.55  ? 236 MET C CA  1 
ATOM   5750  C  C   . MET C  1 210 ? 15.836  35.375  24.652   1.00 48.54  ? 236 MET C C   1 
ATOM   5751  O  O   . MET C  1 210 ? 14.659  35.739  24.729   1.00 45.76  ? 236 MET C O   1 
ATOM   5752  C  CB  . MET C  1 210 ? 17.510  34.687  26.408   1.00 46.88  ? 236 MET C CB  1 
ATOM   5753  C  CG  . MET C  1 210 ? 16.505  33.786  27.117   1.00 50.48  ? 236 MET C CG  1 
ATOM   5754  S  SD  . MET C  1 210 ? 17.297  32.357  27.885   1.00 65.55  ? 236 MET C SD  1 
ATOM   5755  C  CE  . MET C  1 210 ? 15.877  31.418  28.447   1.00 57.73  ? 236 MET C CE  1 
ATOM   5756  N  N   . GLY C  1 211 ? 16.273  34.555  23.709   1.00 45.72  ? 237 GLY C N   1 
ATOM   5757  C  CA  . GLY C  1 211 ? 15.382  33.951  22.740   1.00 63.26  ? 237 GLY C CA  1 
ATOM   5758  C  C   . GLY C  1 211 ? 15.649  34.438  21.326   1.00 71.58  ? 237 GLY C C   1 
ATOM   5759  O  O   . GLY C  1 211 ? 16.604  35.171  21.050   1.00 60.75  ? 237 GLY C O   1 
ATOM   5760  N  N   . LYS C  1 212 ? 14.772  34.006  20.417   1.00 85.03  ? 238 LYS C N   1 
ATOM   5761  C  CA  . LYS C  1 212 ? 14.898  34.377  19.011   1.00 82.54  ? 238 LYS C CA  1 
ATOM   5762  C  C   . LYS C  1 212 ? 14.724  35.878  18.826   1.00 81.74  ? 238 LYS C C   1 
ATOM   5763  O  O   . LYS C  1 212 ? 15.610  36.564  18.302   1.00 80.90  ? 238 LYS C O   1 
ATOM   5764  C  CB  . LYS C  1 212 ? 13.871  33.612  18.170   1.00 90.54  ? 238 LYS C CB  1 
ATOM   5765  C  CG  . LYS C  1 212 ? 13.941  32.096  18.288   1.00 93.32  ? 238 LYS C CG  1 
ATOM   5766  C  CD  . LYS C  1 212 ? 12.862  31.437  17.441   1.00 98.09  ? 238 LYS C CD  1 
ATOM   5767  C  CE  . LYS C  1 212 ? 12.859  29.927  17.614   1.00 109.33 ? 238 LYS C CE  1 
ATOM   5768  N  NZ  . LYS C  1 212 ? 11.790  29.283  16.801   1.00 113.05 ? 238 LYS C NZ  1 
ATOM   5769  N  N   . GLU C  1 213 ? 13.578  36.407  19.257   1.00 80.46  ? 239 GLU C N   1 
ATOM   5770  C  CA  . GLU C  1 213 ? 13.257  37.821  19.116   1.00 76.48  ? 239 GLU C CA  1 
ATOM   5771  C  C   . GLU C  1 213 ? 13.229  38.551  20.457   1.00 70.92  ? 239 GLU C C   1 
ATOM   5772  O  O   . GLU C  1 213 ? 12.599  39.608  20.569   1.00 67.27  ? 239 GLU C O   1 
ATOM   5773  C  CB  . GLU C  1 213 ? 11.923  37.984  18.390   1.00 76.78  ? 239 GLU C CB  1 
ATOM   5774  C  CG  . GLU C  1 213 ? 12.007  37.867  16.879   1.00 83.52  ? 239 GLU C CG  1 
ATOM   5775  C  CD  . GLU C  1 213 ? 12.607  39.104  16.237   1.00 82.78  ? 239 GLU C CD  1 
ATOM   5776  O  OE1 . GLU C  1 213 ? 13.735  39.017  15.703   1.00 78.04  ? 239 GLU C OE1 1 
ATOM   5777  O  OE2 . GLU C  1 213 ? 11.952  40.167  16.281   1.00 85.60  ? 239 GLU C OE2 1 
ATOM   5778  N  N   . CYS C  1 214 ? 13.895  38.000  21.476   1.00 67.28  ? 240 CYS C N   1 
ATOM   5779  C  CA  . CYS C  1 214 ? 14.098  38.643  22.778   1.00 57.19  ? 240 CYS C CA  1 
ATOM   5780  C  C   . CYS C  1 214 ? 12.762  38.993  23.447   1.00 53.10  ? 240 CYS C C   1 
ATOM   5781  O  O   . CYS C  1 214 ? 12.428  40.159  23.659   1.00 49.32  ? 240 CYS C O   1 
ATOM   5782  C  CB  . CYS C  1 214 ? 14.970  39.901  22.651   1.00 52.24  ? 240 CYS C CB  1 
ATOM   5783  S  SG  . CYS C  1 214 ? 16.494  39.769  21.678   1.00 54.35  ? 240 CYS C SG  1 
ATOM   5784  N  N   . LYS C  1 215 ? 12.011  37.946  23.798   1.00 53.38  ? 241 LYS C N   1 
ATOM   5785  C  CA  . LYS C  1 215 ? 10.739  38.123  24.495   1.00 54.08  ? 241 LYS C CA  1 
ATOM   5786  C  C   . LYS C  1 215 ? 10.574  37.278  25.746   1.00 48.90  ? 241 LYS C C   1 
ATOM   5787  O  O   . LYS C  1 215 ? 9.737   37.626  26.587   1.00 54.85  ? 241 LYS C O   1 
ATOM   5788  C  CB  . LYS C  1 215 ? 9.555   37.826  23.566   1.00 59.36  ? 241 LYS C CB  1 
ATOM   5789  C  CG  . LYS C  1 215 ? 9.473   38.699  22.337   1.00 62.92  ? 241 LYS C CG  1 
ATOM   5790  C  CD  . LYS C  1 215 ? 8.453   38.128  21.376   1.00 65.35  ? 241 LYS C CD  1 
ATOM   5791  C  CE  . LYS C  1 215 ? 8.920   38.272  19.945   1.00 73.84  ? 241 LYS C CE  1 
ATOM   5792  N  NZ  . LYS C  1 215 ? 8.212   37.355  19.010   1.00 80.42  ? 241 LYS C NZ  1 
ATOM   5793  N  N   . GLU C  1 216 ? 11.306  36.181  25.895   1.00 49.92  ? 242 GLU C N   1 
ATOM   5794  C  CA  . GLU C  1 216 ? 11.204  35.359  27.092   1.00 47.10  ? 242 GLU C CA  1 
ATOM   5795  C  C   . GLU C  1 216 ? 12.147  35.897  28.161   1.00 47.29  ? 242 GLU C C   1 
ATOM   5796  O  O   . GLU C  1 216 ? 13.348  36.062  27.918   1.00 42.91  ? 242 GLU C O   1 
ATOM   5797  C  CB  . GLU C  1 216 ? 11.514  33.895  26.777   1.00 57.71  ? 242 GLU C CB  1 
ATOM   5798  C  CG  . GLU C  1 216 ? 12.540  33.685  25.677   1.00 62.88  ? 242 GLU C CG  1 
ATOM   5799  C  CD  . GLU C  1 216 ? 12.973  32.233  25.553   1.00 76.65  ? 242 GLU C CD  1 
ATOM   5800  O  OE1 . GLU C  1 216 ? 13.316  31.625  26.592   1.00 78.83  ? 242 GLU C OE1 1 
ATOM   5801  O  OE2 . GLU C  1 216 ? 12.964  31.696  24.422   1.00 73.64  ? 242 GLU C OE2 1 
ATOM   5802  N  N   . ALA C  1 217 ? 11.595  36.177  29.336   1.00 44.40  ? 243 ALA C N   1 
ATOM   5803  C  CA  . ALA C  1 217 ? 12.343  36.776  30.428   1.00 30.94  ? 243 ALA C CA  1 
ATOM   5804  C  C   . ALA C  1 217 ? 13.075  35.711  31.232   1.00 32.89  ? 243 ALA C C   1 
ATOM   5805  O  O   . ALA C  1 217 ? 12.585  34.593  31.413   1.00 39.25  ? 243 ALA C O   1 
ATOM   5806  C  CB  . ALA C  1 217 ? 11.412  37.571  31.343   1.00 28.03  ? 243 ALA C CB  1 
ATOM   5807  N  N   . VAL C  1 218 ? 14.262  36.074  31.710   1.00 31.69  ? 244 VAL C N   1 
ATOM   5808  C  CA  . VAL C  1 218 ? 15.062  35.209  32.569   1.00 35.13  ? 244 VAL C CA  1 
ATOM   5809  C  C   . VAL C  1 218 ? 14.609  35.439  34.006   1.00 31.76  ? 244 VAL C C   1 
ATOM   5810  O  O   . VAL C  1 218 ? 14.789  36.530  34.555   1.00 25.48  ? 244 VAL C O   1 
ATOM   5811  C  CB  . VAL C  1 218 ? 16.561  35.484  32.408   1.00 32.46  ? 244 VAL C CB  1 
ATOM   5812  C  CG1 . VAL C  1 218 ? 17.358  34.662  33.413   1.00 28.87  ? 244 VAL C CG1 1 
ATOM   5813  C  CG2 . VAL C  1 218 ? 16.999  35.178  30.981   1.00 31.77  ? 244 VAL C CG2 1 
ATOM   5814  N  N   . CYS C  1 219 ? 14.025  34.408  34.615   1.00 27.33  ? 245 CYS C N   1 
ATOM   5815  C  CA  . CYS C  1 219 ? 13.476  34.541  35.954   1.00 29.00  ? 245 CYS C CA  1 
ATOM   5816  C  C   . CYS C  1 219 ? 14.587  34.593  37.003   1.00 28.76  ? 245 CYS C C   1 
ATOM   5817  O  O   . CYS C  1 219 ? 15.769  34.369  36.723   1.00 30.17  ? 245 CYS C O   1 
ATOM   5818  C  CB  . CYS C  1 219 ? 12.526  33.385  36.263   1.00 28.98  ? 245 CYS C CB  1 
ATOM   5819  S  SG  . CYS C  1 219 ? 11.206  33.167  35.066   1.00 31.96  ? 245 CYS C SG  1 
ATOM   5820  N  N   . LYS C  1 220 ? 14.178  34.897  38.232   1.00 26.86  ? 246 LYS C N   1 
ATOM   5821  C  CA  . LYS C  1 220 ? 15.102  34.936  39.355   1.00 26.92  ? 246 LYS C CA  1 
ATOM   5822  C  C   . LYS C  1 220 ? 15.818  33.601  39.499   1.00 32.52  ? 246 LYS C C   1 
ATOM   5823  O  O   . LYS C  1 220 ? 15.186  32.541  39.498   1.00 32.20  ? 246 LYS C O   1 
ATOM   5824  C  CB  . LYS C  1 220 ? 14.340  35.269  40.636   1.00 31.10  ? 246 LYS C CB  1 
ATOM   5825  C  CG  . LYS C  1 220 ? 15.170  35.174  41.900   1.00 31.82  ? 246 LYS C CG  1 
ATOM   5826  C  CD  . LYS C  1 220 ? 14.320  35.431  43.130   1.00 27.87  ? 246 LYS C CD  1 
ATOM   5827  C  CE  . LYS C  1 220 ? 13.626  36.777  43.048   1.00 28.83  ? 246 LYS C CE  1 
ATOM   5828  N  NZ  . LYS C  1 220 ? 12.738  37.005  44.221   1.00 39.31  ? 246 LYS C NZ  1 
ATOM   5829  N  N   . GLN C  1 221 ? 17.143  33.657  39.612   1.00 29.34  ? 247 GLN C N   1 
ATOM   5830  C  CA  . GLN C  1 221 ? 17.928  32.444  39.794   1.00 31.66  ? 247 GLN C CA  1 
ATOM   5831  C  C   . GLN C  1 221 ? 17.524  31.746  41.089   1.00 38.43  ? 247 GLN C C   1 
ATOM   5832  O  O   . GLN C  1 221 ? 17.589  32.337  42.173   1.00 35.17  ? 247 GLN C O   1 
ATOM   5833  C  CB  . GLN C  1 221 ? 19.418  32.781  39.801   1.00 36.23  ? 247 GLN C CB  1 
ATOM   5834  C  CG  . GLN C  1 221 ? 19.900  33.471  38.533   1.00 43.73  ? 247 GLN C CG  1 
ATOM   5835  C  CD  . GLN C  1 221 ? 19.764  32.592  37.300   1.00 53.92  ? 247 GLN C CD  1 
ATOM   5836  O  OE1 . GLN C  1 221 ? 19.802  31.363  37.391   1.00 59.70  ? 247 GLN C OE1 1 
ATOM   5837  N  NE2 . GLN C  1 221 ? 19.596  33.221  36.140   1.00 50.17  ? 247 GLN C NE2 1 
ATOM   5838  N  N   . GLY C  1 222 ? 17.099  30.490  40.970   1.00 33.21  ? 248 GLY C N   1 
ATOM   5839  C  CA  . GLY C  1 222 ? 16.583  29.720  42.084   1.00 31.77  ? 248 GLY C CA  1 
ATOM   5840  C  C   . GLY C  1 222 ? 15.081  29.547  42.074   1.00 33.75  ? 248 GLY C C   1 
ATOM   5841  O  O   . GLY C  1 222 ? 14.557  28.773  42.887   1.00 35.90  ? 248 GLY C O   1 
ATOM   5842  N  N   . CYS C  1 223 ? 14.376  30.241  41.185   1.00 27.13  ? 249 CYS C N   1 
ATOM   5843  C  CA  . CYS C  1 223 ? 12.923  30.172  41.135   1.00 23.51  ? 249 CYS C CA  1 
ATOM   5844  C  C   . CYS C  1 223 ? 12.472  28.800  40.653   1.00 25.69  ? 249 CYS C C   1 
ATOM   5845  O  O   . CYS C  1 223 ? 12.954  28.296  39.634   1.00 29.73  ? 249 CYS C O   1 
ATOM   5846  C  CB  . CYS C  1 223 ? 12.389  31.263  40.208   1.00 24.24  ? 249 CYS C CB  1 
ATOM   5847  S  SG  . CYS C  1 223 ? 10.592  31.367  40.029   1.00 25.98  ? 249 CYS C SG  1 
ATOM   5848  N  N   . ASN C  1 224 ? 11.547  28.192  41.388   1.00 23.54  ? 250 ASN C N   1 
ATOM   5849  C  CA  . ASN C  1 224 ? 10.980  26.912  40.980   1.00 23.64  ? 250 ASN C CA  1 
ATOM   5850  C  C   . ASN C  1 224 ? 10.065  27.132  39.781   1.00 23.26  ? 250 ASN C C   1 
ATOM   5851  O  O   . ASN C  1 224 ? 8.971   27.690  39.922   1.00 23.20  ? 250 ASN C O   1 
ATOM   5852  C  CB  . ASN C  1 224 ? 10.228  26.279  42.147   1.00 20.32  ? 250 ASN C CB  1 
ATOM   5853  C  CG  . ASN C  1 224 ? 9.781   24.861  41.858   1.00 22.27  ? 250 ASN C CG  1 
ATOM   5854  O  OD1 . ASN C  1 224 ? 9.209   24.575  40.808   1.00 23.22  ? 250 ASN C OD1 1 
ATOM   5855  N  ND2 . ASN C  1 224 ? 10.047  23.961  42.792   1.00 23.80  ? 250 ASN C ND2 1 
ATOM   5856  N  N   . LEU C  1 225 ? 10.505  26.690  38.601   1.00 20.60  ? 251 LEU C N   1 
ATOM   5857  C  CA  . LEU C  1 225 ? 9.745   26.915  37.374   1.00 25.85  ? 251 LEU C CA  1 
ATOM   5858  C  C   . LEU C  1 225 ? 8.634   25.899  37.153   1.00 24.35  ? 251 LEU C C   1 
ATOM   5859  O  O   . LEU C  1 225 ? 7.851   26.063  36.213   1.00 22.89  ? 251 LEU C O   1 
ATOM   5860  C  CB  . LEU C  1 225 ? 10.675  26.914  36.159   1.00 20.03  ? 251 LEU C CB  1 
ATOM   5861  C  CG  . LEU C  1 225 ? 11.890  27.843  36.285   1.00 21.56  ? 251 LEU C CG  1 
ATOM   5862  C  CD1 . LEU C  1 225 ? 12.850  27.625  35.129   1.00 15.64  ? 251 LEU C CD1 1 
ATOM   5863  C  CD2 . LEU C  1 225 ? 11.445  29.293  36.358   1.00 20.28  ? 251 LEU C CD2 1 
ATOM   5864  N  N   . LEU C  1 226 ? 8.545   24.860  37.983   1.00 26.52  ? 252 LEU C N   1 
ATOM   5865  C  CA  . LEU C  1 226 ? 7.406   23.953  37.913   1.00 23.74  ? 252 LEU C CA  1 
ATOM   5866  C  C   . LEU C  1 226 ? 6.166   24.555  38.566   1.00 25.11  ? 252 LEU C C   1 
ATOM   5867  O  O   . LEU C  1 226 ? 5.041   24.230  38.169   1.00 26.09  ? 252 LEU C O   1 
ATOM   5868  C  CB  . LEU C  1 226 ? 7.754   22.620  38.575   1.00 23.83  ? 252 LEU C CB  1 
ATOM   5869  C  CG  . LEU C  1 226 ? 6.680   21.537  38.484   1.00 29.82  ? 252 LEU C CG  1 
ATOM   5870  C  CD1 . LEU C  1 226 ? 6.530   21.063  37.044   1.00 25.18  ? 252 LEU C CD1 1 
ATOM   5871  C  CD2 . LEU C  1 226 ? 6.976   20.372  39.426   1.00 24.52  ? 252 LEU C CD2 1 
ATOM   5872  N  N   . HIS C  1 227 ? 6.351   25.429  39.557   1.00 25.68  ? 253 HIS C N   1 
ATOM   5873  C  CA  . HIS C  1 227 ? 5.254   26.106  40.234   1.00 21.88  ? 253 HIS C CA  1 
ATOM   5874  C  C   . HIS C  1 227 ? 5.289   27.618  40.073   1.00 23.42  ? 253 HIS C C   1 
ATOM   5875  O  O   . HIS C  1 227 ? 4.393   28.298  40.584   1.00 21.76  ? 253 HIS C O   1 
ATOM   5876  C  CB  . HIS C  1 227 ? 5.254   25.768  41.732   1.00 20.49  ? 253 HIS C CB  1 
ATOM   5877  C  CG  . HIS C  1 227 ? 5.202   24.300  42.022   1.00 26.97  ? 253 HIS C CG  1 
ATOM   5878  N  ND1 . HIS C  1 227 ? 4.323   23.446  41.390   1.00 27.26  ? 253 HIS C ND1 1 
ATOM   5879  C  CD2 . HIS C  1 227 ? 5.908   23.537  42.889   1.00 24.64  ? 253 HIS C CD2 1 
ATOM   5880  C  CE1 . HIS C  1 227 ? 4.498   22.220  41.847   1.00 23.01  ? 253 HIS C CE1 1 
ATOM   5881  N  NE2 . HIS C  1 227 ? 5.454   22.248  42.758   1.00 24.47  ? 253 HIS C NE2 1 
ATOM   5882  N  N   . GLY C  1 228 ? 6.297   28.167  39.385   1.00 25.13  ? 254 GLY C N   1 
ATOM   5883  C  CA  . GLY C  1 228 ? 6.434   29.602  39.264   1.00 24.95  ? 254 GLY C CA  1 
ATOM   5884  C  C   . GLY C  1 228 ? 7.021   29.995  37.922   1.00 25.46  ? 254 GLY C C   1 
ATOM   5885  O  O   . GLY C  1 228 ? 7.405   29.149  37.111   1.00 27.93  ? 254 GLY C O   1 
ATOM   5886  N  N   . GLY C  1 229 ? 7.087   31.302  37.709   1.00 23.54  ? 255 GLY C N   1 
ATOM   5887  C  CA  . GLY C  1 229 ? 7.525   31.838  36.438   1.00 21.02  ? 255 GLY C CA  1 
ATOM   5888  C  C   . GLY C  1 229 ? 7.703   33.336  36.535   1.00 21.55  ? 255 GLY C C   1 
ATOM   5889  O  O   . GLY C  1 229 ? 7.656   33.913  37.621   1.00 23.83  ? 255 GLY C O   1 
ATOM   5890  N  N   . CYS C  1 230 ? 7.902   33.966  35.380   1.00 23.24  ? 256 CYS C N   1 
ATOM   5891  C  CA  . CYS C  1 230 ? 8.126   35.406  35.364   1.00 23.49  ? 256 CYS C CA  1 
ATOM   5892  C  C   . CYS C  1 230 ? 7.690   35.980  34.023   1.00 24.71  ? 256 CYS C C   1 
ATOM   5893  O  O   . CYS C  1 230 ? 7.694   35.285  33.005   1.00 22.79  ? 256 CYS C O   1 
ATOM   5894  C  CB  . CYS C  1 230 ? 9.598   35.737  35.637   1.00 23.35  ? 256 CYS C CB  1 
ATOM   5895  S  SG  . CYS C  1 230 ? 10.778  35.062  34.428   1.00 22.03  ? 256 CYS C SG  1 
ATOM   5896  N  N   . THR C  1 231 ? 7.295   37.256  34.041   1.00 29.90  ? 257 THR C N   1 
ATOM   5897  C  CA  . THR C  1 231 ? 7.085   38.018  32.817   1.00 27.76  ? 257 THR C CA  1 
ATOM   5898  C  C   . THR C  1 231 ? 8.063   39.172  32.659   1.00 35.85  ? 257 THR C C   1 
ATOM   5899  O  O   . THR C  1 231 ? 8.186   39.708  31.553   1.00 41.73  ? 257 THR C O   1 
ATOM   5900  C  CB  . THR C  1 231 ? 5.654   38.578  32.750   1.00 30.39  ? 257 THR C CB  1 
ATOM   5901  O  OG1 . THR C  1 231 ? 5.431   39.470  33.848   1.00 28.19  ? 257 THR C OG1 1 
ATOM   5902  C  CG2 . THR C  1 231 ? 4.624   37.453  32.783   1.00 25.79  ? 257 THR C CG2 1 
ATOM   5903  N  N   . VAL C  1 232 ? 8.745   39.568  33.732   1.00 37.85  ? 258 VAL C N   1 
ATOM   5904  C  CA  . VAL C  1 232 ? 9.829   40.547  33.681   1.00 34.64  ? 258 VAL C CA  1 
ATOM   5905  C  C   . VAL C  1 232 ? 11.053  39.914  34.335   1.00 32.72  ? 258 VAL C C   1 
ATOM   5906  O  O   . VAL C  1 232 ? 10.908  39.005  35.165   1.00 30.94  ? 258 VAL C O   1 
ATOM   5907  C  CB  . VAL C  1 232 ? 9.432   41.867  34.363   1.00 34.42  ? 258 VAL C CB  1 
ATOM   5908  C  CG1 . VAL C  1 232 ? 8.153   42.419  33.744   1.00 37.19  ? 258 VAL C CG1 1 
ATOM   5909  C  CG2 . VAL C  1 232 ? 9.267   41.671  35.856   1.00 36.13  ? 258 VAL C CG2 1 
ATOM   5910  N  N   . PRO C  1 233 ? 12.266  40.340  33.991   1.00 37.61  ? 259 PRO C N   1 
ATOM   5911  C  CA  . PRO C  1 233 ? 13.459  39.646  34.490   1.00 29.97  ? 259 PRO C CA  1 
ATOM   5912  C  C   . PRO C  1 233 ? 13.643  39.778  35.997   1.00 34.60  ? 259 PRO C C   1 
ATOM   5913  O  O   . PRO C  1 233 ? 13.272  40.780  36.614   1.00 36.31  ? 259 PRO C O   1 
ATOM   5914  C  CB  . PRO C  1 233 ? 14.604  40.330  33.734   1.00 32.80  ? 259 PRO C CB  1 
ATOM   5915  C  CG  . PRO C  1 233 ? 13.959  40.911  32.514   1.00 31.98  ? 259 PRO C CG  1 
ATOM   5916  C  CD  . PRO C  1 233 ? 12.599  41.336  32.957   1.00 34.20  ? 259 PRO C CD  1 
ATOM   5917  N  N   . GLY C  1 234 ? 14.231  38.736  36.585   1.00 33.44  ? 260 GLY C N   1 
ATOM   5918  C  CA  . GLY C  1 234 ? 14.556  38.716  37.998   1.00 32.59  ? 260 GLY C CA  1 
ATOM   5919  C  C   . GLY C  1 234 ? 13.402  38.444  38.936   1.00 31.74  ? 260 GLY C C   1 
ATOM   5920  O  O   . GLY C  1 234 ? 13.572  38.567  40.155   1.00 31.60  ? 260 GLY C O   1 
ATOM   5921  N  N   . GLU C  1 235 ? 12.244  38.060  38.415   1.00 30.57  ? 261 GLU C N   1 
ATOM   5922  C  CA  . GLU C  1 235 ? 11.018  37.936  39.184   1.00 25.67  ? 261 GLU C CA  1 
ATOM   5923  C  C   . GLU C  1 235 ? 10.618  36.465  39.291   1.00 32.26  ? 261 GLU C C   1 
ATOM   5924  O  O   . GLU C  1 235 ? 11.021  35.631  38.474   1.00 29.48  ? 261 GLU C O   1 
ATOM   5925  C  CB  . GLU C  1 235 ? 9.928   38.793  38.523   1.00 27.72  ? 261 GLU C CB  1 
ATOM   5926  C  CG  . GLU C  1 235 ? 8.492   38.514  38.897   1.00 38.09  ? 261 GLU C CG  1 
ATOM   5927  C  CD  . GLU C  1 235 ? 7.527   39.395  38.119   1.00 45.25  ? 261 GLU C CD  1 
ATOM   5928  O  OE1 . GLU C  1 235 ? 7.385   40.583  38.489   1.00 49.41  ? 261 GLU C OE1 1 
ATOM   5929  O  OE2 . GLU C  1 235 ? 6.934   38.908  37.125   1.00 37.06  ? 261 GLU C OE2 1 
ATOM   5930  N  N   . CYS C  1 236 ? 9.852   36.137  40.340   1.00 26.63  ? 262 CYS C N   1 
ATOM   5931  C  CA  . CYS C  1 236 ? 9.377   34.766  40.562   1.00 23.82  ? 262 CYS C CA  1 
ATOM   5932  C  C   . CYS C  1 236 ? 7.930   34.837  41.055   1.00 28.52  ? 262 CYS C C   1 
ATOM   5933  O  O   . CYS C  1 236 ? 7.675   34.886  42.261   1.00 32.60  ? 262 CYS C O   1 
ATOM   5934  C  CB  . CYS C  1 236 ? 10.278  34.026  41.546   1.00 27.76  ? 262 CYS C CB  1 
ATOM   5935  S  SG  . CYS C  1 236 ? 9.949   32.239  41.758   1.00 31.72  ? 262 CYS C SG  1 
ATOM   5936  N  N   . ARG C  1 237 ? 6.986   34.830  40.113   1.00 28.73  ? 263 ARG C N   1 
ATOM   5937  C  CA  . ARG C  1 237 ? 5.563   34.884  40.430   1.00 30.76  ? 263 ARG C CA  1 
ATOM   5938  C  C   . ARG C  1 237 ? 5.001   33.474  40.555   1.00 30.51  ? 263 ARG C C   1 
ATOM   5939  O  O   . ARG C  1 237 ? 5.212   32.634  39.674   1.00 30.04  ? 263 ARG C O   1 
ATOM   5940  C  CB  . ARG C  1 237 ? 4.796   35.663  39.360   1.00 29.12  ? 263 ARG C CB  1 
ATOM   5941  C  CG  . ARG C  1 237 ? 5.109   37.145  39.330   1.00 34.49  ? 263 ARG C CG  1 
ATOM   5942  C  CD  . ARG C  1 237 ? 3.867   37.984  39.615   1.00 51.00  ? 263 ARG C CD  1 
ATOM   5943  N  NE  . ARG C  1 237 ? 2.767   37.658  38.708   1.00 72.39  ? 263 ARG C NE  1 
ATOM   5944  C  CZ  . ARG C  1 237 ? 1.601   38.299  38.675   1.00 69.68  ? 263 ARG C CZ  1 
ATOM   5945  N  NH1 . ARG C  1 237 ? 1.372   39.312  39.499   1.00 67.05  ? 263 ARG C NH1 1 
ATOM   5946  N  NH2 . ARG C  1 237 ? 0.663   37.926  37.813   1.00 68.53  ? 263 ARG C NH2 1 
ATOM   5947  N  N   . CYS C  1 238 ? 4.267   33.224  41.633   1.00 27.78  ? 264 CYS C N   1 
ATOM   5948  C  CA  . CYS C  1 238 ? 3.881   31.865  41.982   1.00 30.09  ? 264 CYS C CA  1 
ATOM   5949  C  C   . CYS C  1 238 ? 2.524   31.493  41.396   1.00 30.08  ? 264 CYS C C   1 
ATOM   5950  O  O   . CYS C  1 238 ? 1.627   32.329  41.259   1.00 29.06  ? 264 CYS C O   1 
ATOM   5951  C  CB  . CYS C  1 238 ? 3.850   31.694  43.499   1.00 22.60  ? 264 CYS C CB  1 
ATOM   5952  S  SG  . CYS C  1 238 ? 5.354   32.232  44.309   1.00 31.01  ? 264 CYS C SG  1 
ATOM   5953  N  N   . SER C  1 239 ? 2.386   30.218  41.046   1.00 24.33  ? 265 SER C N   1 
ATOM   5954  C  CA  . SER C  1 239 ? 1.087   29.717  40.644   1.00 25.48  ? 265 SER C CA  1 
ATOM   5955  C  C   . SER C  1 239 ? 0.136   29.749  41.834   1.00 31.96  ? 265 SER C C   1 
ATOM   5956  O  O   . SER C  1 239 ? 0.554   29.854  42.991   1.00 29.63  ? 265 SER C O   1 
ATOM   5957  C  CB  . SER C  1 239 ? 1.196   28.297  40.090   1.00 29.78  ? 265 SER C CB  1 
ATOM   5958  O  OG  . SER C  1 239 ? 2.035   28.250  38.949   1.00 29.07  ? 265 SER C OG  1 
ATOM   5959  N  N   . TYR C  1 240 ? -1.161  29.673  41.535   1.00 30.63  ? 266 TYR C N   1 
ATOM   5960  C  CA  . TYR C  1 240 ? -2.172  29.700  42.583   1.00 28.87  ? 266 TYR C CA  1 
ATOM   5961  C  C   . TYR C  1 240 ? -2.043  28.448  43.441   1.00 25.16  ? 266 TYR C C   1 
ATOM   5962  O  O   . TYR C  1 240 ? -2.109  27.327  42.930   1.00 25.59  ? 266 TYR C O   1 
ATOM   5963  C  CB  . TYR C  1 240 ? -3.569  29.805  41.975   1.00 27.20  ? 266 TYR C CB  1 
ATOM   5964  C  CG  . TYR C  1 240 ? -4.669  29.949  43.005   1.00 31.42  ? 266 TYR C CG  1 
ATOM   5965  C  CD1 . TYR C  1 240 ? -4.706  31.044  43.859   1.00 26.68  ? 266 TYR C CD1 1 
ATOM   5966  C  CD2 . TYR C  1 240 ? -5.672  28.995  43.121   1.00 33.07  ? 266 TYR C CD2 1 
ATOM   5967  C  CE1 . TYR C  1 240 ? -5.707  31.185  44.799   1.00 23.29  ? 266 TYR C CE1 1 
ATOM   5968  C  CE2 . TYR C  1 240 ? -6.682  29.127  44.059   1.00 28.69  ? 266 TYR C CE2 1 
ATOM   5969  C  CZ  . TYR C  1 240 ? -6.691  30.226  44.896   1.00 29.14  ? 266 TYR C CZ  1 
ATOM   5970  O  OH  . TYR C  1 240 ? -7.690  30.369  45.833   1.00 32.43  ? 266 TYR C OH  1 
ATOM   5971  N  N   . GLY C  1 241 ? -1.845  28.640  44.742   1.00 23.98  ? 267 GLY C N   1 
ATOM   5972  C  CA  . GLY C  1 241 ? -1.591  27.545  45.656   1.00 28.20  ? 267 GLY C CA  1 
ATOM   5973  C  C   . GLY C  1 241 ? -0.158  27.440  46.129   1.00 31.10  ? 267 GLY C C   1 
ATOM   5974  O  O   . GLY C  1 241 ? 0.141   26.562  46.950   1.00 30.20  ? 267 GLY C O   1 
ATOM   5975  N  N   . TRP C  1 242 ? 0.736   28.299  45.643   1.00 23.23  ? 268 TRP C N   1 
ATOM   5976  C  CA  . TRP C  1 242 ? 2.134   28.289  46.037   1.00 23.85  ? 268 TRP C CA  1 
ATOM   5977  C  C   . TRP C  1 242 ? 2.544   29.693  46.449   1.00 26.71  ? 268 TRP C C   1 
ATOM   5978  O  O   . TRP C  1 242 ? 1.870   30.677  46.135   1.00 30.46  ? 268 TRP C O   1 
ATOM   5979  C  CB  . TRP C  1 242 ? 3.037   27.775  44.910   1.00 22.86  ? 268 TRP C CB  1 
ATOM   5980  C  CG  . TRP C  1 242 ? 2.781   26.339  44.570   1.00 24.16  ? 268 TRP C CG  1 
ATOM   5981  C  CD1 . TRP C  1 242 ? 1.991   25.863  43.569   1.00 23.77  ? 268 TRP C CD1 1 
ATOM   5982  C  CD2 . TRP C  1 242 ? 3.309   25.189  45.246   1.00 29.05  ? 268 TRP C CD2 1 
ATOM   5983  N  NE1 . TRP C  1 242 ? 1.995   24.489  43.574   1.00 22.43  ? 268 TRP C NE1 1 
ATOM   5984  C  CE2 . TRP C  1 242 ? 2.798   24.051  44.593   1.00 24.17  ? 268 TRP C CE2 1 
ATOM   5985  C  CE3 . TRP C  1 242 ? 4.168   25.013  46.337   1.00 27.08  ? 268 TRP C CE3 1 
ATOM   5986  C  CZ2 . TRP C  1 242 ? 3.116   22.755  44.993   1.00 26.58  ? 268 TRP C CZ2 1 
ATOM   5987  C  CZ3 . TRP C  1 242 ? 4.483   23.727  46.731   1.00 26.27  ? 268 TRP C CZ3 1 
ATOM   5988  C  CH2 . TRP C  1 242 ? 3.958   22.614  46.061   1.00 26.53  ? 268 TRP C CH2 1 
ATOM   5989  N  N   . GLN C  1 243 ? 3.657   29.773  47.168   1.00 25.14  ? 269 GLN C N   1 
ATOM   5990  C  CA  . GLN C  1 243 ? 4.110   31.031  47.746   1.00 25.94  ? 269 GLN C CA  1 
ATOM   5991  C  C   . GLN C  1 243 ? 5.603   30.923  48.016   1.00 29.14  ? 269 GLN C C   1 
ATOM   5992  O  O   . GLN C  1 243 ? 6.236   29.903  47.732   1.00 28.40  ? 269 GLN C O   1 
ATOM   5993  C  CB  . GLN C  1 243 ? 3.343   31.359  49.030   1.00 24.59  ? 269 GLN C CB  1 
ATOM   5994  C  CG  . GLN C  1 243 ? 3.538   30.322  50.131   1.00 34.91  ? 269 GLN C CG  1 
ATOM   5995  C  CD  . GLN C  1 243 ? 2.859   30.701  51.438   1.00 32.56  ? 269 GLN C CD  1 
ATOM   5996  O  OE1 . GLN C  1 243 ? 2.248   31.763  51.550   1.00 29.92  ? 269 GLN C OE1 1 
ATOM   5997  N  NE2 . GLN C  1 243 ? 2.965   29.826  52.433   1.00 22.96  ? 269 GLN C NE2 1 
ATOM   5998  N  N   . GLY C  1 244 ? 6.160   31.986  48.581   1.00 32.14  ? 270 GLY C N   1 
ATOM   5999  C  CA  . GLY C  1 244 ? 7.552   31.994  48.983   1.00 33.06  ? 270 GLY C CA  1 
ATOM   6000  C  C   . GLY C  1 244 ? 8.432   32.741  48.001   1.00 36.52  ? 270 GLY C C   1 
ATOM   6001  O  O   . GLY C  1 244 ? 8.015   33.167  46.918   1.00 39.08  ? 270 GLY C O   1 
ATOM   6002  N  N   . ARG C  1 245 ? 9.692   32.885  48.409   1.00 30.59  ? 271 ARG C N   1 
ATOM   6003  C  CA  . ARG C  1 245 ? 10.661  33.598  47.588   1.00 29.24  ? 271 ARG C CA  1 
ATOM   6004  C  C   . ARG C  1 245 ? 10.899  32.886  46.261   1.00 30.16  ? 271 ARG C C   1 
ATOM   6005  O  O   . ARG C  1 245 ? 11.030  33.537  45.216   1.00 33.59  ? 271 ARG C O   1 
ATOM   6006  C  CB  . ARG C  1 245 ? 11.965  33.761  48.367   1.00 30.79  ? 271 ARG C CB  1 
ATOM   6007  C  CG  . ARG C  1 245 ? 13.151  34.161  47.527   1.00 34.56  ? 271 ARG C CG  1 
ATOM   6008  C  CD  . ARG C  1 245 ? 14.280  34.663  48.399   1.00 36.49  ? 271 ARG C CD  1 
ATOM   6009  N  NE  . ARG C  1 245 ? 15.575  34.538  47.740   1.00 37.99  ? 271 ARG C NE  1 
ATOM   6010  C  CZ  . ARG C  1 245 ? 16.740  34.621  48.371   1.00 39.80  ? 271 ARG C CZ  1 
ATOM   6011  N  NH1 . ARG C  1 245 ? 17.878  34.492  47.705   1.00 42.76  ? 271 ARG C NH1 1 
ATOM   6012  N  NH2 . ARG C  1 245 ? 16.768  34.822  49.676   1.00 46.04  ? 271 ARG C NH2 1 
ATOM   6013  N  N   . PHE C  1 246 ? 10.944  31.554  46.274   1.00 26.52  ? 272 PHE C N   1 
ATOM   6014  C  CA  . PHE C  1 246 ? 11.176  30.773  45.064   1.00 28.40  ? 272 PHE C CA  1 
ATOM   6015  C  C   . PHE C  1 246 ? 9.954   29.979  44.632   1.00 28.68  ? 272 PHE C C   1 
ATOM   6016  O  O   . PHE C  1 246 ? 10.087  29.067  43.810   1.00 29.05  ? 272 PHE C O   1 
ATOM   6017  C  CB  . PHE C  1 246 ? 12.357  29.822  45.254   1.00 32.03  ? 272 PHE C CB  1 
ATOM   6018  C  CG  . PHE C  1 246 ? 13.641  30.511  45.595   1.00 31.38  ? 272 PHE C CG  1 
ATOM   6019  C  CD1 . PHE C  1 246 ? 14.255  31.348  44.682   1.00 31.91  ? 272 PHE C CD1 1 
ATOM   6020  C  CD2 . PHE C  1 246 ? 14.238  30.315  46.825   1.00 26.14  ? 272 PHE C CD2 1 
ATOM   6021  C  CE1 . PHE C  1 246 ? 15.440  31.978  44.993   1.00 36.60  ? 272 PHE C CE1 1 
ATOM   6022  C  CE2 . PHE C  1 246 ? 15.417  30.941  47.140   1.00 28.64  ? 272 PHE C CE2 1 
ATOM   6023  C  CZ  . PHE C  1 246 ? 16.022  31.772  46.225   1.00 30.71  ? 272 PHE C CZ  1 
ATOM   6024  N  N   . CYS C  1 247 ? 8.774   30.298  45.169   1.00 28.28  ? 273 CYS C N   1 
ATOM   6025  C  CA  . CYS C  1 247 ? 7.528   29.600  44.842   1.00 24.57  ? 273 CYS C CA  1 
ATOM   6026  C  C   . CYS C  1 247 ? 7.642   28.094  45.079   1.00 26.76  ? 273 CYS C C   1 
ATOM   6027  O  O   . CYS C  1 247 ? 7.125   27.286  44.306   1.00 34.54  ? 273 CYS C O   1 
ATOM   6028  C  CB  . CYS C  1 247 ? 7.091   29.891  43.405   1.00 27.89  ? 273 CYS C CB  1 
ATOM   6029  S  SG  . CYS C  1 247 ? 6.835   31.640  43.046   1.00 24.44  ? 273 CYS C SG  1 
ATOM   6030  N  N   . ASP C  1 248 ? 8.316   27.708  46.164   1.00 28.28  ? 274 ASP C N   1 
ATOM   6031  C  CA  . ASP C  1 248 ? 8.477   26.304  46.525   1.00 25.63  ? 274 ASP C CA  1 
ATOM   6032  C  C   . ASP C  1 248 ? 7.844   25.974  47.875   1.00 26.37  ? 274 ASP C C   1 
ATOM   6033  O  O   . ASP C  1 248 ? 8.202   24.966  48.493   1.00 27.73  ? 274 ASP C O   1 
ATOM   6034  C  CB  . ASP C  1 248 ? 9.958   25.917  46.525   1.00 29.10  ? 274 ASP C CB  1 
ATOM   6035  C  CG  . ASP C  1 248 ? 10.836  26.967  47.182   1.00 39.34  ? 274 ASP C CG  1 
ATOM   6036  O  OD1 . ASP C  1 248 ? 10.286  27.913  47.794   1.00 45.71  ? 274 ASP C OD1 1 
ATOM   6037  O  OD2 . ASP C  1 248 ? 12.082  26.850  47.093   1.00 42.58  ? 274 ASP C OD2 1 
ATOM   6038  N  N   . GLU C  1 249 ? 6.911   26.796  48.346   1.00 25.96  ? 275 GLU C N   1 
ATOM   6039  C  CA  . GLU C  1 249 ? 6.201   26.555  49.596   1.00 30.05  ? 275 GLU C CA  1 
ATOM   6040  C  C   . GLU C  1 249 ? 4.702   26.524  49.326   1.00 33.47  ? 275 GLU C C   1 
ATOM   6041  O  O   . GLU C  1 249 ? 4.172   27.405  48.639   1.00 28.67  ? 275 GLU C O   1 
ATOM   6042  C  CB  . GLU C  1 249 ? 6.533   27.631  50.631   1.00 25.52  ? 275 GLU C CB  1 
ATOM   6043  C  CG  . GLU C  1 249 ? 8.021   27.822  50.873   1.00 28.30  ? 275 GLU C CG  1 
ATOM   6044  C  CD  . GLU C  1 249 ? 8.321   29.040  51.732   1.00 36.77  ? 275 GLU C CD  1 
ATOM   6045  O  OE1 . GLU C  1 249 ? 7.420   29.487  52.476   1.00 36.30  ? 275 GLU C OE1 1 
ATOM   6046  O  OE2 . GLU C  1 249 ? 9.457   29.558  51.654   1.00 40.81  ? 275 GLU C OE2 1 
ATOM   6047  N  N   . CYS C  1 250 ? 4.022   25.514  49.864   1.00 29.28  ? 276 CYS C N   1 
ATOM   6048  C  CA  . CYS C  1 250 ? 2.582   25.420  49.674   1.00 33.55  ? 276 CYS C CA  1 
ATOM   6049  C  C   . CYS C  1 250 ? 1.859   26.469  50.520   1.00 31.84  ? 276 CYS C C   1 
ATOM   6050  O  O   . CYS C  1 250 ? 2.385   26.985  51.511   1.00 27.30  ? 276 CYS C O   1 
ATOM   6051  C  CB  . CYS C  1 250 ? 2.079   24.015  50.022   1.00 30.13  ? 276 CYS C CB  1 
ATOM   6052  S  SG  . CYS C  1 250 ? 2.604   23.412  51.636   1.00 42.50  ? 276 CYS C SG  1 
ATOM   6053  N  N   . VAL C  1 251 ? 0.638   26.787  50.110   1.00 27.53  ? 277 VAL C N   1 
ATOM   6054  C  CA  . VAL C  1 251 ? -0.228  27.706  50.843   1.00 27.48  ? 277 VAL C CA  1 
ATOM   6055  C  C   . VAL C  1 251 ? -1.206  26.872  51.662   1.00 31.66  ? 277 VAL C C   1 
ATOM   6056  O  O   . VAL C  1 251 ? -2.022  26.147  51.071   1.00 32.98  ? 277 VAL C O   1 
ATOM   6057  C  CB  . VAL C  1 251 ? -0.976  28.656  49.900   1.00 26.53  ? 277 VAL C CB  1 
ATOM   6058  C  CG1 . VAL C  1 251 ? -1.951  29.520  50.685   1.00 21.21  ? 277 VAL C CG1 1 
ATOM   6059  C  CG2 . VAL C  1 251 ? 0.012   29.518  49.135   1.00 27.42  ? 277 VAL C CG2 1 
ATOM   6060  N  N   . PRO C  1 252 ? -1.165  26.934  52.992   1.00 34.49  ? 278 PRO C N   1 
ATOM   6061  C  CA  . PRO C  1 252 ? -2.128  26.175  53.795   1.00 31.70  ? 278 PRO C CA  1 
ATOM   6062  C  C   . PRO C  1 252 ? -3.533  26.733  53.633   1.00 30.06  ? 278 PRO C C   1 
ATOM   6063  O  O   . PRO C  1 252 ? -3.735  27.860  53.176   1.00 37.70  ? 278 PRO C O   1 
ATOM   6064  C  CB  . PRO C  1 252 ? -1.619  26.358  55.227   1.00 27.22  ? 278 PRO C CB  1 
ATOM   6065  C  CG  . PRO C  1 252 ? -0.929  27.670  55.194   1.00 27.53  ? 278 PRO C CG  1 
ATOM   6066  C  CD  . PRO C  1 252 ? -0.283  27.761  53.831   1.00 30.24  ? 278 PRO C CD  1 
ATOM   6067  N  N   . TYR C  1 253 ? -4.512  25.918  54.015   1.00 31.39  ? 279 TYR C N   1 
ATOM   6068  C  CA  . TYR C  1 253 ? -5.905  26.308  53.849   1.00 32.38  ? 279 TYR C CA  1 
ATOM   6069  C  C   . TYR C  1 253 ? -6.205  27.549  54.686   1.00 30.76  ? 279 TYR C C   1 
ATOM   6070  O  O   . TYR C  1 253 ? -5.768  27.639  55.840   1.00 34.99  ? 279 TYR C O   1 
ATOM   6071  C  CB  . TYR C  1 253 ? -6.841  25.172  54.255   1.00 31.93  ? 279 TYR C CB  1 
ATOM   6072  C  CG  . TYR C  1 253 ? -8.287  25.420  53.895   1.00 30.41  ? 279 TYR C CG  1 
ATOM   6073  C  CD1 . TYR C  1 253 ? -8.783  25.065  52.647   1.00 29.66  ? 279 TYR C CD1 1 
ATOM   6074  C  CD2 . TYR C  1 253 ? -9.156  26.012  54.800   1.00 29.60  ? 279 TYR C CD2 1 
ATOM   6075  C  CE1 . TYR C  1 253 ? -10.109 25.289  52.311   1.00 28.96  ? 279 TYR C CE1 1 
ATOM   6076  C  CE2 . TYR C  1 253 ? -10.483 26.241  54.472   1.00 29.46  ? 279 TYR C CE2 1 
ATOM   6077  C  CZ  . TYR C  1 253 ? -10.953 25.878  53.229   1.00 25.52  ? 279 TYR C CZ  1 
ATOM   6078  O  OH  . TYR C  1 253 ? -12.268 26.107  52.907   1.00 25.23  ? 279 TYR C OH  1 
ATOM   6079  N  N   . PRO C  1 254 ? -6.944  28.515  54.143   1.00 28.66  ? 280 PRO C N   1 
ATOM   6080  C  CA  . PRO C  1 254 ? -7.196  29.770  54.870   1.00 29.99  ? 280 PRO C CA  1 
ATOM   6081  C  C   . PRO C  1 254 ? -7.817  29.525  56.238   1.00 36.56  ? 280 PRO C C   1 
ATOM   6082  O  O   . PRO C  1 254 ? -8.918  28.977  56.358   1.00 30.60  ? 280 PRO C O   1 
ATOM   6083  C  CB  . PRO C  1 254 ? -8.150  30.523  53.939   1.00 24.88  ? 280 PRO C CB  1 
ATOM   6084  C  CG  . PRO C  1 254 ? -7.826  29.995  52.581   1.00 34.32  ? 280 PRO C CG  1 
ATOM   6085  C  CD  . PRO C  1 254 ? -7.505  28.543  52.783   1.00 32.98  ? 280 PRO C CD  1 
ATOM   6086  N  N   . GLY C  1 255 ? -7.093  29.940  57.279   1.00 29.67  ? 281 GLY C N   1 
ATOM   6087  C  CA  . GLY C  1 255 ? -7.531  29.779  58.647   1.00 31.57  ? 281 GLY C CA  1 
ATOM   6088  C  C   . GLY C  1 255 ? -6.855  28.664  59.414   1.00 34.48  ? 281 GLY C C   1 
ATOM   6089  O  O   . GLY C  1 255 ? -7.133  28.504  60.609   1.00 32.31  ? 281 GLY C O   1 
ATOM   6090  N  N   . CYS C  1 256 ? -5.987  27.888  58.768   1.00 32.13  ? 282 CYS C N   1 
ATOM   6091  C  CA  . CYS C  1 256 ? -5.296  26.802  59.446   1.00 29.52  ? 282 CYS C CA  1 
ATOM   6092  C  C   . CYS C  1 256 ? -4.509  27.353  60.631   1.00 36.53  ? 282 CYS C C   1 
ATOM   6093  O  O   . CYS C  1 256 ? -3.776  28.336  60.503   1.00 37.84  ? 282 CYS C O   1 
ATOM   6094  C  CB  . CYS C  1 256 ? -4.374  26.083  58.458   1.00 27.06  ? 282 CYS C CB  1 
ATOM   6095  S  SG  . CYS C  1 256 ? -3.762  24.447  58.955   1.00 40.51  ? 282 CYS C SG  1 
ATOM   6096  N  N   . VAL C  1 257 ? -4.689  26.737  61.797   1.00 39.77  ? 283 VAL C N   1 
ATOM   6097  C  CA  . VAL C  1 257 ? -4.041  27.217  63.012   1.00 38.40  ? 283 VAL C CA  1 
ATOM   6098  C  C   . VAL C  1 257 ? -2.850  26.327  63.340   1.00 39.70  ? 283 VAL C C   1 
ATOM   6099  O  O   . VAL C  1 257 ? -1.732  26.576  62.877   1.00 47.25  ? 283 VAL C O   1 
ATOM   6100  C  CB  . VAL C  1 257 ? -5.030  27.275  64.188   1.00 33.19  ? 283 VAL C CB  1 
ATOM   6101  C  CG1 . VAL C  1 257 ? -4.418  28.032  65.352   1.00 33.60  ? 283 VAL C CG1 1 
ATOM   6102  C  CG2 . VAL C  1 257 ? -6.332  27.925  63.748   1.00 29.80  ? 283 VAL C CG2 1 
ATOM   6103  N  N   . HIS C  1 258 ? -3.080  25.284  64.135   1.00 39.51  ? 284 HIS C N   1 
ATOM   6104  C  CA  . HIS C  1 258 ? -2.013  24.369  64.541   1.00 40.36  ? 284 HIS C CA  1 
ATOM   6105  C  C   . HIS C  1 258 ? -1.881  23.218  63.541   1.00 43.20  ? 284 HIS C C   1 
ATOM   6106  O  O   . HIS C  1 258 ? -2.052  22.041  63.860   1.00 42.61  ? 284 HIS C O   1 
ATOM   6107  C  CB  . HIS C  1 258 ? -2.269  23.858  65.953   1.00 40.53  ? 284 HIS C CB  1 
ATOM   6108  C  CG  . HIS C  1 258 ? -2.353  24.946  66.978   1.00 41.59  ? 284 HIS C CG  1 
ATOM   6109  N  ND1 . HIS C  1 258 ? -3.543  25.536  67.342   1.00 45.04  ? 284 HIS C ND1 1 
ATOM   6110  C  CD2 . HIS C  1 258 ? -1.390  25.558  67.708   1.00 41.40  ? 284 HIS C CD2 1 
ATOM   6111  C  CE1 . HIS C  1 258 ? -3.313  26.460  68.258   1.00 47.48  ? 284 HIS C CE1 1 
ATOM   6112  N  NE2 . HIS C  1 258 ? -2.014  26.495  68.496   1.00 46.49  ? 284 HIS C NE2 1 
ATOM   6113  N  N   . GLY C  1 259 ? -1.564  23.591  62.303   1.00 45.81  ? 285 GLY C N   1 
ATOM   6114  C  CA  . GLY C  1 259 ? -1.389  22.638  61.229   1.00 40.87  ? 285 GLY C CA  1 
ATOM   6115  C  C   . GLY C  1 259 ? -0.429  23.176  60.190   1.00 41.74  ? 285 GLY C C   1 
ATOM   6116  O  O   . GLY C  1 259 ? 0.071   24.297  60.298   1.00 43.75  ? 285 GLY C O   1 
ATOM   6117  N  N   . SER C  1 260 ? -0.176  22.360  59.167   1.00 33.46  ? 286 SER C N   1 
ATOM   6118  C  CA  . SER C  1 260 ? 0.766   22.703  58.114   1.00 31.15  ? 286 SER C CA  1 
ATOM   6119  C  C   . SER C  1 260 ? 0.252   22.144  56.792   1.00 36.69  ? 286 SER C C   1 
ATOM   6120  O  O   . SER C  1 260 ? -0.785  21.475  56.739   1.00 38.29  ? 286 SER C O   1 
ATOM   6121  C  CB  . SER C  1 260 ? 2.166   22.163  58.432   1.00 30.80  ? 286 SER C CB  1 
ATOM   6122  O  OG  . SER C  1 260 ? 2.194   20.747  58.359   1.00 30.74  ? 286 SER C OG  1 
ATOM   6123  N  N   . CYS C  1 261 ? 0.984   22.420  55.713   1.00 31.27  ? 287 CYS C N   1 
ATOM   6124  C  CA  . CYS C  1 261 ? 0.687   21.851  54.406   1.00 34.19  ? 287 CYS C CA  1 
ATOM   6125  C  C   . CYS C  1 261 ? 1.941   21.197  53.843   1.00 37.05  ? 287 CYS C C   1 
ATOM   6126  O  O   . CYS C  1 261 ? 3.058   21.405  54.328   1.00 34.71  ? 287 CYS C O   1 
ATOM   6127  C  CB  . CYS C  1 261 ? 0.148   22.905  53.419   1.00 32.13  ? 287 CYS C CB  1 
ATOM   6128  S  SG  . CYS C  1 261 ? 1.301   24.239  52.969   1.00 39.92  ? 287 CYS C SG  1 
ATOM   6129  N  N   . VAL C  1 262 ? 1.734   20.388  52.806   1.00 34.08  ? 288 VAL C N   1 
ATOM   6130  C  CA  . VAL C  1 262 ? 2.816   19.850  51.991   1.00 34.43  ? 288 VAL C CA  1 
ATOM   6131  C  C   . VAL C  1 262 ? 2.416   20.043  50.535   1.00 42.77  ? 288 VAL C C   1 
ATOM   6132  O  O   . VAL C  1 262 ? 3.182   20.588  49.732   1.00 43.16  ? 288 VAL C O   1 
ATOM   6133  C  CB  . VAL C  1 262 ? 3.097   18.374  52.322   1.00 32.56  ? 288 VAL C CB  1 
ATOM   6134  C  CG1 . VAL C  1 262 ? 3.840   17.704  51.179   1.00 38.30  ? 288 VAL C CG1 1 
ATOM   6135  C  CG2 . VAL C  1 262 ? 3.899   18.278  53.610   1.00 31.23  ? 288 VAL C CG2 1 
ATOM   6136  N  N   . GLU C  1 263 ? 1.203   19.601  50.195   1.00 40.49  ? 289 GLU C N   1 
ATOM   6137  C  CA  . GLU C  1 263 ? 0.515   19.978  48.972   1.00 36.39  ? 289 GLU C CA  1 
ATOM   6138  C  C   . GLU C  1 263 ? -0.353  21.203  49.224   1.00 37.43  ? 289 GLU C C   1 
ATOM   6139  O  O   . GLU C  1 263 ? -0.724  21.491  50.367   1.00 41.73  ? 289 GLU C O   1 
ATOM   6140  C  CB  . GLU C  1 263 ? -0.339  18.817  48.472   1.00 40.83  ? 289 GLU C CB  1 
ATOM   6141  C  CG  . GLU C  1 263 ? 0.451   17.742  47.754   1.00 50.62  ? 289 GLU C CG  1 
ATOM   6142  C  CD  . GLU C  1 263 ? -0.436  16.649  47.191   1.00 61.46  ? 289 GLU C CD  1 
ATOM   6143  O  OE1 . GLU C  1 263 ? -1.603  16.542  47.631   1.00 61.29  ? 289 GLU C OE1 1 
ATOM   6144  O  OE2 . GLU C  1 263 ? 0.032   15.900  46.305   1.00 66.07  ? 289 GLU C OE2 1 
ATOM   6145  N  N   . PRO C  1 264 ? -0.682  21.960  48.177   1.00 30.63  ? 290 PRO C N   1 
ATOM   6146  C  CA  . PRO C  1 264 ? -1.442  23.201  48.374   1.00 31.80  ? 290 PRO C CA  1 
ATOM   6147  C  C   . PRO C  1 264 ? -2.774  22.971  49.077   1.00 32.65  ? 290 PRO C C   1 
ATOM   6148  O  O   . PRO C  1 264 ? -3.436  21.949  48.885   1.00 34.43  ? 290 PRO C O   1 
ATOM   6149  C  CB  . PRO C  1 264 ? -1.648  23.716  46.946   1.00 27.59  ? 290 PRO C CB  1 
ATOM   6150  C  CG  . PRO C  1 264 ? -0.501  23.163  46.192   1.00 30.67  ? 290 PRO C CG  1 
ATOM   6151  C  CD  . PRO C  1 264 ? -0.217  21.817  46.786   1.00 28.44  ? 290 PRO C CD  1 
ATOM   6152  N  N   . TRP C  1 265 ? -3.147  23.940  49.913   1.00 30.95  ? 291 TRP C N   1 
ATOM   6153  C  CA  . TRP C  1 265 ? -4.448  24.054  50.569   1.00 30.11  ? 291 TRP C CA  1 
ATOM   6154  C  C   . TRP C  1 265 ? -4.686  22.999  51.644   1.00 31.96  ? 291 TRP C C   1 
ATOM   6155  O  O   . TRP C  1 265 ? -5.809  22.888  52.148   1.00 28.99  ? 291 TRP C O   1 
ATOM   6156  C  CB  . TRP C  1 265 ? -5.590  24.027  49.547   1.00 24.29  ? 291 TRP C CB  1 
ATOM   6157  C  CG  . TRP C  1 265 ? -5.373  25.001  48.432   1.00 27.61  ? 291 TRP C CG  1 
ATOM   6158  C  CD1 . TRP C  1 265 ? -5.211  24.712  47.108   1.00 25.36  ? 291 TRP C CD1 1 
ATOM   6159  C  CD2 . TRP C  1 265 ? -5.258  26.425  48.548   1.00 25.78  ? 291 TRP C CD2 1 
ATOM   6160  N  NE1 . TRP C  1 265 ? -5.021  25.866  46.392   1.00 24.85  ? 291 TRP C NE1 1 
ATOM   6161  C  CE2 . TRP C  1 265 ? -5.040  26.932  47.253   1.00 22.23  ? 291 TRP C CE2 1 
ATOM   6162  C  CE3 . TRP C  1 265 ? -5.324  27.320  49.620   1.00 29.12  ? 291 TRP C CE3 1 
ATOM   6163  C  CZ2 . TRP C  1 265 ? -4.890  28.292  47.000   1.00 23.05  ? 291 TRP C CZ2 1 
ATOM   6164  C  CZ3 . TRP C  1 265 ? -5.173  28.671  49.366   1.00 30.11  ? 291 TRP C CZ3 1 
ATOM   6165  C  CH2 . TRP C  1 265 ? -4.960  29.144  48.065   1.00 22.89  ? 291 TRP C CH2 1 
ATOM   6166  N  N   . GLN C  1 266 ? -3.666  22.242  52.034   1.00 29.31  ? 292 GLN C N   1 
ATOM   6167  C  CA  . GLN C  1 266 ? -3.829  21.276  53.107   1.00 31.84  ? 292 GLN C CA  1 
ATOM   6168  C  C   . GLN C  1 266 ? -3.897  21.977  54.463   1.00 34.19  ? 292 GLN C C   1 
ATOM   6169  O  O   . GLN C  1 266 ? -3.746  23.198  54.577   1.00 31.79  ? 292 GLN C O   1 
ATOM   6170  C  CB  . GLN C  1 266 ? -2.692  20.262  53.086   1.00 32.49  ? 292 GLN C CB  1 
ATOM   6171  C  CG  . GLN C  1 266 ? -2.850  19.184  52.048   1.00 33.30  ? 292 GLN C CG  1 
ATOM   6172  C  CD  . GLN C  1 266 ? -1.631  18.299  51.965   1.00 36.30  ? 292 GLN C CD  1 
ATOM   6173  O  OE1 . GLN C  1 266 ? -0.607  18.576  52.591   1.00 35.61  ? 292 GLN C OE1 1 
ATOM   6174  N  NE2 . GLN C  1 266 ? -1.730  17.228  51.187   1.00 35.66  ? 292 GLN C NE2 1 
ATOM   6175  N  N   . CYS C  1 267 ? -4.139  21.182  55.506   1.00 30.52  ? 293 CYS C N   1 
ATOM   6176  C  CA  . CYS C  1 267 ? -4.101  21.648  56.887   1.00 32.34  ? 293 CYS C CA  1 
ATOM   6177  C  C   . CYS C  1 267 ? -3.891  20.448  57.804   1.00 36.46  ? 293 CYS C C   1 
ATOM   6178  O  O   . CYS C  1 267 ? -4.760  20.106  58.611   1.00 34.10  ? 293 CYS C O   1 
ATOM   6179  C  CB  . CYS C  1 267 ? -5.380  22.412  57.250   1.00 28.33  ? 293 CYS C CB  1 
ATOM   6180  S  SG  . CYS C  1 267 ? -5.393  23.221  58.893   1.00 35.91  ? 293 CYS C SG  1 
ATOM   6181  N  N   . ASN C  1 268 ? -2.740  19.795  57.667   1.00 39.23  ? 294 ASN C N   1 
ATOM   6182  C  CA  . ASN C  1 268 ? -2.407  18.622  58.468   1.00 35.28  ? 294 ASN C CA  1 
ATOM   6183  C  C   . ASN C  1 268 ? -2.152  19.050  59.904   1.00 38.28  ? 294 ASN C C   1 
ATOM   6184  O  O   . ASN C  1 268 ? -1.177  19.754  60.180   1.00 39.39  ? 294 ASN C O   1 
ATOM   6185  C  CB  . ASN C  1 268 ? -1.180  17.932  57.888   1.00 38.11  ? 294 ASN C CB  1 
ATOM   6186  C  CG  . ASN C  1 268 ? -1.182  17.931  56.379   1.00 35.98  ? 294 ASN C CG  1 
ATOM   6187  O  OD1 . ASN C  1 268 ? -2.200  17.649  55.751   1.00 35.67  ? 294 ASN C OD1 1 
ATOM   6188  N  ND2 . ASN C  1 268 ? -0.044  18.265  55.785   1.00 34.23  ? 294 ASN C ND2 1 
ATOM   6189  N  N   . CYS C  1 269 ? -3.015  18.617  60.820   1.00 45.80  ? 295 CYS C N   1 
ATOM   6190  C  CA  . CYS C  1 269 ? -2.894  19.032  62.211   1.00 49.57  ? 295 CYS C CA  1 
ATOM   6191  C  C   . CYS C  1 269 ? -1.671  18.404  62.862   1.00 46.95  ? 295 CYS C C   1 
ATOM   6192  O  O   . CYS C  1 269 ? -1.307  17.262  62.567   1.00 45.90  ? 295 CYS C O   1 
ATOM   6193  C  CB  . CYS C  1 269 ? -4.141  18.646  63.006   1.00 46.75  ? 295 CYS C CB  1 
ATOM   6194  S  SG  . CYS C  1 269 ? -5.679  19.277  62.349   1.00 39.40  ? 295 CYS C SG  1 
ATOM   6195  N  N   . GLU C  1 270 ? -1.040  19.161  63.755   1.00 46.01  ? 296 GLU C N   1 
ATOM   6196  C  CA  . GLU C  1 270 ? -0.012  18.611  64.622   1.00 46.97  ? 296 GLU C CA  1 
ATOM   6197  C  C   . GLU C  1 270 ? -0.636  17.607  65.593   1.00 54.77  ? 296 GLU C C   1 
ATOM   6198  O  O   . GLU C  1 270 ? -1.859  17.438  65.659   1.00 55.28  ? 296 GLU C O   1 
ATOM   6199  C  CB  . GLU C  1 270 ? 0.687   19.730  65.394   1.00 41.98  ? 296 GLU C CB  1 
ATOM   6200  C  CG  . GLU C  1 270 ? 0.994   20.963  64.559   1.00 50.95  ? 296 GLU C CG  1 
ATOM   6201  C  CD  . GLU C  1 270 ? 1.253   22.201  65.403   1.00 54.35  ? 296 GLU C CD  1 
ATOM   6202  O  OE1 . GLU C  1 270 ? 1.056   22.137  66.637   1.00 57.83  ? 296 GLU C OE1 1 
ATOM   6203  O  OE2 . GLU C  1 270 ? 1.646   23.243  64.831   1.00 58.43  ? 296 GLU C OE2 1 
ATOM   6204  N  N   . THR C  1 271 ? 0.218   16.930  66.356   1.00 57.12  ? 297 THR C N   1 
ATOM   6205  C  CA  . THR C  1 271 ? -0.281  16.060  67.412   1.00 64.78  ? 297 THR C CA  1 
ATOM   6206  C  C   . THR C  1 271 ? -0.909  16.897  68.524   1.00 60.71  ? 297 THR C C   1 
ATOM   6207  O  O   . THR C  1 271 ? -0.476  18.020  68.802   1.00 54.05  ? 297 THR C O   1 
ATOM   6208  C  CB  . THR C  1 271 ? 0.841   15.183  67.975   1.00 59.66  ? 297 THR C CB  1 
ATOM   6209  O  OG1 . THR C  1 271 ? 1.796   16.003  68.659   1.00 63.43  ? 297 THR C OG1 1 
ATOM   6210  C  CG2 . THR C  1 271 ? 1.544   14.421  66.856   1.00 56.92  ? 297 THR C CG2 1 
ATOM   6211  N  N   . ASN C  1 272 ? -1.955  16.342  69.143   1.00 54.95  ? 298 ASN C N   1 
ATOM   6212  C  CA  . ASN C  1 272 ? -2.798  16.932  70.180   1.00 58.34  ? 298 ASN C CA  1 
ATOM   6213  C  C   . ASN C  1 272 ? -3.875  17.849  69.583   1.00 63.34  ? 298 ASN C C   1 
ATOM   6214  O  O   . ASN C  1 272 ? -4.755  18.298  70.320   1.00 62.80  ? 298 ASN C O   1 
ATOM   6215  C  CB  . ASN C  1 272 ? -1.993  17.709  71.248   1.00 69.18  ? 298 ASN C CB  1 
ATOM   6216  C  CG  . ASN C  1 272 ? -2.829  18.114  72.451   1.00 70.21  ? 298 ASN C CG  1 
ATOM   6217  O  OD1 . ASN C  1 272 ? -3.197  17.274  73.275   1.00 67.05  ? 298 ASN C OD1 1 
ATOM   6218  N  ND2 . ASN C  1 272 ? -3.109  19.413  72.572   1.00 55.05  ? 298 ASN C ND2 1 
ATOM   6219  N  N   . TRP C  1 273 ? -3.859  18.119  68.279   1.00 58.02  ? 299 TRP C N   1 
ATOM   6220  C  CA  . TRP C  1 273 ? -4.807  19.037  67.669   1.00 42.73  ? 299 TRP C CA  1 
ATOM   6221  C  C   . TRP C  1 273 ? -5.584  18.352  66.554   1.00 47.94  ? 299 TRP C C   1 
ATOM   6222  O  O   . TRP C  1 273 ? -5.127  17.377  65.950   1.00 49.33  ? 299 TRP C O   1 
ATOM   6223  C  CB  . TRP C  1 273 ? -4.099  20.278  67.116   1.00 46.45  ? 299 TRP C CB  1 
ATOM   6224  C  CG  . TRP C  1 273 ? -3.521  21.161  68.174   1.00 50.67  ? 299 TRP C CG  1 
ATOM   6225  C  CD1 . TRP C  1 273 ? -2.240  21.147  68.647   1.00 49.02  ? 299 TRP C CD1 1 
ATOM   6226  C  CD2 . TRP C  1 273 ? -4.204  22.194  68.895   1.00 46.13  ? 299 TRP C CD2 1 
ATOM   6227  N  NE1 . TRP C  1 273 ? -2.084  22.108  69.618   1.00 46.68  ? 299 TRP C NE1 1 
ATOM   6228  C  CE2 . TRP C  1 273 ? -3.275  22.763  69.789   1.00 44.72  ? 299 TRP C CE2 1 
ATOM   6229  C  CE3 . TRP C  1 273 ? -5.510  22.693  68.871   1.00 40.55  ? 299 TRP C CE3 1 
ATOM   6230  C  CZ2 . TRP C  1 273 ? -3.610  23.806  70.648   1.00 44.21  ? 299 TRP C CZ2 1 
ATOM   6231  C  CZ3 . TRP C  1 273 ? -5.841  23.728  69.725   1.00 42.87  ? 299 TRP C CZ3 1 
ATOM   6232  C  CH2 . TRP C  1 273 ? -4.894  24.272  70.602   1.00 44.99  ? 299 TRP C CH2 1 
ATOM   6233  N  N   . GLY C  1 274 ? -6.765  18.892  66.282   1.00 46.70  ? 300 GLY C N   1 
ATOM   6234  C  CA  . GLY C  1 274 ? -7.625  18.356  65.249   1.00 40.40  ? 300 GLY C CA  1 
ATOM   6235  C  C   . GLY C  1 274 ? -8.701  19.351  64.876   1.00 40.92  ? 300 GLY C C   1 
ATOM   6236  O  O   . GLY C  1 274 ? -8.681  20.508  65.302   1.00 40.10  ? 300 GLY C O   1 
ATOM   6237  N  N   . GLY C  1 275 ? -9.655  18.879  64.082   1.00 41.95  ? 301 GLY C N   1 
ATOM   6238  C  CA  . GLY C  1 275 ? -10.649 19.745  63.490   1.00 40.00  ? 301 GLY C CA  1 
ATOM   6239  C  C   . GLY C  1 275 ? -10.250 20.185  62.092   1.00 40.28  ? 301 GLY C C   1 
ATOM   6240  O  O   . GLY C  1 275 ? -9.132  19.960  61.622   1.00 41.40  ? 301 GLY C O   1 
ATOM   6241  N  N   . LEU C  1 276 ? -11.197 20.835  61.413   1.00 32.41  ? 302 LEU C N   1 
ATOM   6242  C  CA  . LEU C  1 276 ? -10.961 21.223  60.026   1.00 29.57  ? 302 LEU C CA  1 
ATOM   6243  C  C   . LEU C  1 276 ? -9.888  22.299  59.915   1.00 36.56  ? 302 LEU C C   1 
ATOM   6244  O  O   . LEU C  1 276 ? -9.107  22.299  58.953   1.00 30.51  ? 302 LEU C O   1 
ATOM   6245  C  CB  . LEU C  1 276 ? -12.268 21.691  59.394   1.00 28.77  ? 302 LEU C CB  1 
ATOM   6246  C  CG  . LEU C  1 276 ? -12.224 22.251  57.979   1.00 28.68  ? 302 LEU C CG  1 
ATOM   6247  C  CD1 . LEU C  1 276 ? -13.220 21.523  57.105   1.00 30.95  ? 302 LEU C CD1 1 
ATOM   6248  C  CD2 . LEU C  1 276 ? -12.534 23.734  58.012   1.00 36.14  ? 302 LEU C CD2 1 
ATOM   6249  N  N   . LEU C  1 277 ? -9.822  23.210  60.885   1.00 35.33  ? 303 LEU C N   1 
ATOM   6250  C  CA  . LEU C  1 277 ? -8.793  24.241  60.924   1.00 34.73  ? 303 LEU C CA  1 
ATOM   6251  C  C   . LEU C  1 277 ? -7.726  23.968  61.976   1.00 37.34  ? 303 LEU C C   1 
ATOM   6252  O  O   . LEU C  1 277 ? -6.954  24.877  62.304   1.00 33.80  ? 303 LEU C O   1 
ATOM   6253  C  CB  . LEU C  1 277 ? -9.422  25.610  61.171   1.00 28.73  ? 303 LEU C CB  1 
ATOM   6254  C  CG  . LEU C  1 277 ? -10.269 26.147  60.023   1.00 31.35  ? 303 LEU C CG  1 
ATOM   6255  C  CD1 . LEU C  1 277 ? -10.818 27.517  60.373   1.00 31.32  ? 303 LEU C CD1 1 
ATOM   6256  C  CD2 . LEU C  1 277 ? -9.456  26.195  58.742   1.00 27.92  ? 303 LEU C CD2 1 
ATOM   6257  N  N   . CYS C  1 278 ? -7.673  22.745  62.515   1.00 31.24  ? 304 CYS C N   1 
ATOM   6258  C  CA  . CYS C  1 278 ? -6.680  22.352  63.519   1.00 37.15  ? 304 CYS C CA  1 
ATOM   6259  C  C   . CYS C  1 278 ? -6.667  23.311  64.706   1.00 32.63  ? 304 CYS C C   1 
ATOM   6260  O  O   . CYS C  1 278 ? -5.607  23.723  65.180   1.00 33.01  ? 304 CYS C O   1 
ATOM   6261  C  CB  . CYS C  1 278 ? -5.284  22.238  62.907   1.00 37.45  ? 304 CYS C CB  1 
ATOM   6262  S  SG  . CYS C  1 278 ? -5.172  21.070  61.543   1.00 33.89  ? 304 CYS C SG  1 
ATOM   6263  N  N   . ASP C  1 279 ? -7.857  23.675  65.184   1.00 34.35  ? 305 ASP C N   1 
ATOM   6264  C  CA  . ASP C  1 279 ? -8.003  24.542  66.345   1.00 38.51  ? 305 ASP C CA  1 
ATOM   6265  C  C   . ASP C  1 279 ? -8.652  23.845  67.536   1.00 46.39  ? 305 ASP C C   1 
ATOM   6266  O  O   . ASP C  1 279 ? -8.813  24.475  68.590   1.00 46.62  ? 305 ASP C O   1 
ATOM   6267  C  CB  . ASP C  1 279 ? -8.807  25.798  65.976   1.00 24.37  ? 305 ASP C CB  1 
ATOM   6268  C  CG  . ASP C  1 279 ? -10.134 25.469  65.311   1.00 34.56  ? 305 ASP C CG  1 
ATOM   6269  O  OD1 . ASP C  1 279 ? -10.267 24.360  64.751   1.00 34.83  ? 305 ASP C OD1 1 
ATOM   6270  O  OD2 . ASP C  1 279 ? -11.047 26.321  65.337   1.00 32.40  ? 305 ASP C OD2 1 
ATOM   6271  N  N   . LYS C  1 280 ? -9.025  22.571  67.406   1.00 43.56  ? 306 LYS C N   1 
ATOM   6272  C  CA  . LYS C  1 280 ? -9.610  21.816  68.506   1.00 44.36  ? 306 LYS C CA  1 
ATOM   6273  C  C   . LYS C  1 280 ? -8.522  21.087  69.283   1.00 43.55  ? 306 LYS C C   1 
ATOM   6274  O  O   . LYS C  1 280 ? -7.673  20.411  68.692   1.00 45.59  ? 306 LYS C O   1 
ATOM   6275  C  CB  . LYS C  1 280 ? -10.643 20.808  67.996   1.00 42.53  ? 306 LYS C CB  1 
ATOM   6276  C  CG  . LYS C  1 280 ? -11.967 21.420  67.562   1.00 55.12  ? 306 LYS C CG  1 
ATOM   6277  C  CD  . LYS C  1 280 ? -12.986 20.340  67.218   1.00 57.88  ? 306 LYS C CD  1 
ATOM   6278  C  CE  . LYS C  1 280 ? -14.270 20.942  66.661   1.00 68.56  ? 306 LYS C CE  1 
ATOM   6279  N  NZ  . LYS C  1 280 ? -15.206 19.894  66.150   1.00 71.96  ? 306 LYS C NZ  1 
ATOM   6280  N  N   . ASP C  1 281 ? -8.548  21.239  70.604   1.00 42.83  ? 307 ASP C N   1 
ATOM   6281  C  CA  . ASP C  1 281 ? -7.715  20.439  71.493   1.00 45.89  ? 307 ASP C CA  1 
ATOM   6282  C  C   . ASP C  1 281 ? -8.411  19.107  71.744   1.00 48.36  ? 307 ASP C C   1 
ATOM   6283  O  O   . ASP C  1 281 ? -9.585  19.075  72.126   1.00 47.59  ? 307 ASP C O   1 
ATOM   6284  C  CB  . ASP C  1 281 ? -7.482  21.190  72.807   1.00 47.05  ? 307 ASP C CB  1 
ATOM   6285  C  CG  . ASP C  1 281 ? -6.394  20.568  73.667   1.00 54.72  ? 307 ASP C CG  1 
ATOM   6286  O  OD1 . ASP C  1 281 ? -6.194  19.335  73.610   1.00 62.07  ? 307 ASP C OD1 1 
ATOM   6287  O  OD2 . ASP C  1 281 ? -5.743  21.323  74.419   1.00 47.73  ? 307 ASP C OD2 1 
ATOM   6288  N  N   . LEU C  1 282 ? -7.695  18.005  71.524   1.00 50.22  ? 308 LEU C N   1 
ATOM   6289  C  CA  . LEU C  1 282 ? -8.321  16.691  71.583   1.00 57.94  ? 308 LEU C CA  1 
ATOM   6290  C  C   . LEU C  1 282 ? -7.985  15.899  72.837   1.00 65.28  ? 308 LEU C C   1 
ATOM   6291  O  O   . LEU C  1 282 ? -8.604  14.854  73.066   1.00 66.40  ? 308 LEU C O   1 
ATOM   6292  C  CB  . LEU C  1 282 ? -7.946  15.858  70.352   1.00 55.06  ? 308 LEU C CB  1 
ATOM   6293  C  CG  . LEU C  1 282 ? -8.816  16.131  69.128   1.00 55.13  ? 308 LEU C CG  1 
ATOM   6294  C  CD1 . LEU C  1 282 ? -8.309  17.347  68.435   1.00 55.67  ? 308 LEU C CD1 1 
ATOM   6295  C  CD2 . LEU C  1 282 ? -8.857  14.942  68.178   1.00 56.39  ? 308 LEU C CD2 1 
ATOM   6296  N  N   . ASN C  1 283 ? -7.038  16.351  73.650   1.00 67.96  ? 309 ASN C N   1 
ATOM   6297  C  CA  . ASN C  1 283 ? -6.672  15.644  74.870   1.00 76.15  ? 309 ASN C CA  1 
ATOM   6298  C  C   . ASN C  1 283 ? -7.137  16.458  76.070   1.00 75.90  ? 309 ASN C C   1 
ATOM   6299  O  O   . ASN C  1 283 ? -6.757  17.625  76.217   1.00 78.46  ? 309 ASN C O   1 
ATOM   6300  C  CB  . ASN C  1 283 ? -5.167  15.388  74.933   1.00 71.09  ? 309 ASN C CB  1 
ATOM   6301  C  CG  . ASN C  1 283 ? -4.844  13.962  75.325   1.00 72.26  ? 309 ASN C CG  1 
ATOM   6302  O  OD1 . ASN C  1 283 ? -5.625  13.305  76.012   1.00 78.06  ? 309 ASN C OD1 1 
ATOM   6303  N  ND2 . ASN C  1 283 ? -3.694  13.469  74.879   1.00 71.13  ? 309 ASN C ND2 1 
ATOM   6304  N  N   . GLY C  1 284 ? -7.961  15.843  76.913   1.00 71.01  ? 310 GLY C N   1 
ATOM   6305  C  CA  . GLY C  1 284 ? -8.473  16.502  78.100   1.00 72.17  ? 310 GLY C CA  1 
ATOM   6306  C  C   . GLY C  1 284 ? -7.759  16.082  79.370   1.00 77.30  ? 310 GLY C C   1 
ATOM   6307  O  O   . GLY C  1 284 ? -6.984  16.849  79.941   1.00 77.89  ? 310 GLY C O   1 
ATOM   6308  N  N   . MET D  1 1   ? 10.710  63.229  -25.663  1.00 42.73  ? 27  MET D N   1 
ATOM   6309  C  CA  . MET D  1 1   ? 10.041  63.239  -24.367  1.00 47.75  ? 27  MET D CA  1 
ATOM   6310  C  C   . MET D  1 1   ? 8.540   62.984  -24.478  1.00 48.99  ? 27  MET D C   1 
ATOM   6311  O  O   . MET D  1 1   ? 7.890   63.413  -25.430  1.00 47.65  ? 27  MET D O   1 
ATOM   6312  C  CB  . MET D  1 1   ? 10.285  64.570  -23.663  1.00 52.86  ? 27  MET D CB  1 
ATOM   6313  C  CG  . MET D  1 1   ? 11.735  65.001  -23.684  1.00 50.14  ? 27  MET D CG  1 
ATOM   6314  S  SD  . MET D  1 1   ? 12.043  66.463  -22.681  1.00 49.74  ? 27  MET D SD  1 
ATOM   6315  C  CE  . MET D  1 1   ? 10.727  67.543  -23.237  1.00 56.23  ? 27  MET D CE  1 
ATOM   6316  N  N   . GLY D  1 2   ? 8.004   62.284  -23.495  1.00 46.22  ? 28  GLY D N   1 
ATOM   6317  C  CA  . GLY D  1 2   ? 6.591   62.008  -23.437  1.00 45.42  ? 28  GLY D CA  1 
ATOM   6318  C  C   . GLY D  1 2   ? 6.186   61.694  -22.018  1.00 50.01  ? 28  GLY D C   1 
ATOM   6319  O  O   . GLY D  1 2   ? 6.835   62.108  -21.055  1.00 44.44  ? 28  GLY D O   1 
ATOM   6320  N  N   . TYR D  1 3   ? 5.082   60.967  -21.884  1.00 51.05  ? 29  TYR D N   1 
ATOM   6321  C  CA  . TYR D  1 3   ? 4.598   60.587  -20.565  1.00 45.72  ? 29  TYR D CA  1 
ATOM   6322  C  C   . TYR D  1 3   ? 3.941   59.217  -20.654  1.00 41.20  ? 29  TYR D C   1 
ATOM   6323  O  O   . TYR D  1 3   ? 3.465   58.799  -21.713  1.00 42.29  ? 29  TYR D O   1 
ATOM   6324  C  CB  . TYR D  1 3   ? 3.556   61.566  -19.997  1.00 47.12  ? 29  TYR D CB  1 
ATOM   6325  C  CG  . TYR D  1 3   ? 3.861   63.024  -19.811  1.00 56.02  ? 29  TYR D CG  1 
ATOM   6326  C  CD1 . TYR D  1 3   ? 3.804   63.613  -18.601  1.00 66.39  ? 29  TYR D CD1 1 
ATOM   6327  C  CD2 . TYR D  1 3   ? 4.189   63.813  -20.851  1.00 63.47  ? 29  TYR D CD2 1 
ATOM   6328  C  CE1 . TYR D  1 3   ? 4.037   64.959  -18.448  1.00 70.01  ? 29  TYR D CE1 1 
ATOM   6329  C  CE2 . TYR D  1 3   ? 4.419   65.144  -20.719  1.00 68.34  ? 29  TYR D CE2 1 
ATOM   6330  C  CZ  . TYR D  1 3   ? 4.356   65.712  -19.516  1.00 62.98  ? 29  TYR D CZ  1 
ATOM   6331  O  OH  . TYR D  1 3   ? 4.604   67.027  -19.375  1.00 64.13  ? 29  TYR D OH  1 
ATOM   6332  N  N   . PHE D  1 4   ? 3.888   58.542  -19.509  1.00 41.15  ? 30  PHE D N   1 
ATOM   6333  C  CA  . PHE D  1 4   ? 3.181   57.281  -19.330  1.00 37.32  ? 30  PHE D CA  1 
ATOM   6334  C  C   . PHE D  1 4   ? 1.985   57.536  -18.426  1.00 39.65  ? 30  PHE D C   1 
ATOM   6335  O  O   . PHE D  1 4   ? 2.128   58.166  -17.374  1.00 49.14  ? 30  PHE D O   1 
ATOM   6336  C  CB  . PHE D  1 4   ? 4.115   56.236  -18.716  1.00 38.57  ? 30  PHE D CB  1 
ATOM   6337  C  CG  . PHE D  1 4   ? 3.527   54.854  -18.612  1.00 36.58  ? 30  PHE D CG  1 
ATOM   6338  C  CD1 . PHE D  1 4   ? 2.795   54.475  -17.499  1.00 36.93  ? 30  PHE D CD1 1 
ATOM   6339  C  CD2 . PHE D  1 4   ? 3.744   53.920  -19.610  1.00 39.30  ? 30  PHE D CD2 1 
ATOM   6340  C  CE1 . PHE D  1 4   ? 2.267   53.199  -17.398  1.00 38.11  ? 30  PHE D CE1 1 
ATOM   6341  C  CE2 . PHE D  1 4   ? 3.218   52.642  -19.514  1.00 39.51  ? 30  PHE D CE2 1 
ATOM   6342  C  CZ  . PHE D  1 4   ? 2.481   52.283  -18.407  1.00 39.03  ? 30  PHE D CZ  1 
ATOM   6343  N  N   . GLU D  1 5   ? 0.812   57.061  -18.834  1.00 39.64  ? 31  GLU D N   1 
ATOM   6344  C  CA  . GLU D  1 5   ? -0.419  57.314  -18.100  1.00 42.80  ? 31  GLU D CA  1 
ATOM   6345  C  C   . GLU D  1 5   ? -1.062  56.008  -17.650  1.00 41.62  ? 31  GLU D C   1 
ATOM   6346  O  O   . GLU D  1 5   ? -1.002  54.994  -18.348  1.00 43.93  ? 31  GLU D O   1 
ATOM   6347  C  CB  . GLU D  1 5   ? -1.418  58.113  -18.943  1.00 39.69  ? 31  GLU D CB  1 
ATOM   6348  C  CG  . GLU D  1 5   ? -0.964  59.524  -19.258  1.00 47.33  ? 31  GLU D CG  1 
ATOM   6349  C  CD  . GLU D  1 5   ? -2.031  60.344  -19.965  1.00 56.18  ? 31  GLU D CD  1 
ATOM   6350  O  OE1 . GLU D  1 5   ? -3.210  59.923  -19.974  1.00 51.61  ? 31  GLU D OE1 1 
ATOM   6351  O  OE2 . GLU D  1 5   ? -1.686  61.410  -20.519  1.00 58.07  ? 31  GLU D OE2 1 
ATOM   6352  N  N   . LEU D  1 6   ? -1.678  56.048  -16.469  1.00 41.20  ? 32  LEU D N   1 
ATOM   6353  C  CA  . LEU D  1 6   ? -2.399  54.911  -15.909  1.00 42.63  ? 32  LEU D CA  1 
ATOM   6354  C  C   . LEU D  1 6   ? -3.719  55.408  -15.343  1.00 42.51  ? 32  LEU D C   1 
ATOM   6355  O  O   . LEU D  1 6   ? -3.739  56.376  -14.576  1.00 41.61  ? 32  LEU D O   1 
ATOM   6356  C  CB  . LEU D  1 6   ? -1.579  54.209  -14.817  1.00 43.01  ? 32  LEU D CB  1 
ATOM   6357  C  CG  . LEU D  1 6   ? -2.064  52.853  -14.295  1.00 40.48  ? 32  LEU D CG  1 
ATOM   6358  C  CD1 . LEU D  1 6   ? -0.887  52.035  -13.784  1.00 39.60  ? 32  LEU D CD1 1 
ATOM   6359  C  CD2 . LEU D  1 6   ? -3.110  53.005  -13.203  1.00 40.95  ? 32  LEU D CD2 1 
ATOM   6360  N  N   . GLN D  1 7   ? -4.812  54.741  -15.712  1.00 46.64  ? 33  GLN D N   1 
ATOM   6361  C  CA  . GLN D  1 7   ? -6.163  55.121  -15.297  1.00 48.88  ? 33  GLN D CA  1 
ATOM   6362  C  C   . GLN D  1 7   ? -6.804  53.956  -14.546  1.00 52.35  ? 33  GLN D C   1 
ATOM   6363  O  O   . GLN D  1 7   ? -7.239  52.978  -15.161  1.00 52.63  ? 33  GLN D O   1 
ATOM   6364  C  CB  . GLN D  1 7   ? -7.007  55.524  -16.502  1.00 46.21  ? 33  GLN D CB  1 
ATOM   6365  C  CG  . GLN D  1 7   ? -8.436  55.891  -16.148  1.00 51.14  ? 33  GLN D CG  1 
ATOM   6366  C  CD  . GLN D  1 7   ? -8.506  57.037  -15.159  1.00 52.04  ? 33  GLN D CD  1 
ATOM   6367  O  OE1 . GLN D  1 7   ? -8.232  58.187  -15.503  1.00 51.64  ? 33  GLN D OE1 1 
ATOM   6368  N  NE2 . GLN D  1 7   ? -8.869  56.728  -13.921  1.00 49.10  ? 33  GLN D NE2 1 
ATOM   6369  N  N   . LEU D  1 8   ? -6.876  54.065  -13.222  1.00 50.70  ? 34  LEU D N   1 
ATOM   6370  C  CA  . LEU D  1 8   ? -7.542  53.052  -12.413  1.00 51.58  ? 34  LEU D CA  1 
ATOM   6371  C  C   . LEU D  1 8   ? -9.054  53.215  -12.519  1.00 53.87  ? 34  LEU D C   1 
ATOM   6372  O  O   . LEU D  1 8   ? -9.589  54.298  -12.262  1.00 55.17  ? 34  LEU D O   1 
ATOM   6373  C  CB  . LEU D  1 8   ? -7.096  53.157  -10.955  1.00 50.41  ? 34  LEU D CB  1 
ATOM   6374  C  CG  . LEU D  1 8   ? -7.827  52.259  -9.950   1.00 57.26  ? 34  LEU D CG  1 
ATOM   6375  C  CD1 . LEU D  1 8   ? -7.654  50.790  -10.300  1.00 54.73  ? 34  LEU D CD1 1 
ATOM   6376  C  CD2 . LEU D  1 8   ? -7.349  52.531  -8.533   1.00 56.58  ? 34  LEU D CD2 1 
ATOM   6377  N  N   . SER D  1 9   ? -9.743  52.138  -12.892  1.00 52.32  ? 35  SER D N   1 
ATOM   6378  C  CA  . SER D  1 9   ? -11.186 52.183  -13.087  1.00 56.54  ? 35  SER D CA  1 
ATOM   6379  C  C   . SER D  1 9   ? -11.980 51.389  -12.059  1.00 61.41  ? 35  SER D C   1 
ATOM   6380  O  O   . SER D  1 9   ? -13.118 51.760  -11.763  1.00 56.50  ? 35  SER D O   1 
ATOM   6381  C  CB  . SER D  1 9   ? -11.549 51.675  -14.487  1.00 51.50  ? 35  SER D CB  1 
ATOM   6382  O  OG  . SER D  1 9   ? -11.192 50.313  -14.628  1.00 60.47  ? 35  SER D OG  1 
ATOM   6383  N  N   . ALA D  1 10  ? -11.417 50.314  -11.505  1.00 60.74  ? 36  ALA D N   1 
ATOM   6384  C  CA  . ALA D  1 10  ? -12.166 49.468  -10.584  1.00 61.34  ? 36  ALA D CA  1 
ATOM   6385  C  C   . ALA D  1 10  ? -11.209 48.742  -9.649   1.00 55.94  ? 36  ALA D C   1 
ATOM   6386  O  O   . ALA D  1 10  ? -10.220 48.157  -10.101  1.00 51.74  ? 36  ALA D O   1 
ATOM   6387  C  CB  . ALA D  1 10  ? -13.029 48.458  -11.349  1.00 55.74  ? 36  ALA D CB  1 
ATOM   6388  N  N   . LEU D  1 11  ? -11.515 48.779  -8.353   1.00 53.17  ? 37  LEU D N   1 
ATOM   6389  C  CA  . LEU D  1 11  ? -10.798 48.011  -7.340   1.00 59.58  ? 37  LEU D CA  1 
ATOM   6390  C  C   . LEU D  1 11  ? -11.826 47.460  -6.365   1.00 61.20  ? 37  LEU D C   1 
ATOM   6391  O  O   . LEU D  1 11  ? -12.580 48.230  -5.763   1.00 59.72  ? 37  LEU D O   1 
ATOM   6392  C  CB  . LEU D  1 11  ? -9.763  48.878  -6.607   1.00 61.78  ? 37  LEU D CB  1 
ATOM   6393  C  CG  . LEU D  1 11  ? -8.980  48.306  -5.416   1.00 56.93  ? 37  LEU D CG  1 
ATOM   6394  C  CD1 . LEU D  1 11  ? -7.582  48.900  -5.348   1.00 54.95  ? 37  LEU D CD1 1 
ATOM   6395  C  CD2 . LEU D  1 11  ? -9.703  48.565  -4.106   1.00 64.64  ? 37  LEU D CD2 1 
ATOM   6396  N  N   . ARG D  1 12  ? -11.855 46.140  -6.205   1.00 63.62  ? 38  ARG D N   1 
ATOM   6397  C  CA  . ARG D  1 12  ? -12.793 45.476  -5.309   1.00 72.60  ? 38  ARG D CA  1 
ATOM   6398  C  C   . ARG D  1 12  ? -12.036 44.743  -4.208   1.00 68.20  ? 38  ARG D C   1 
ATOM   6399  O  O   . ARG D  1 12  ? -11.036 44.068  -4.471   1.00 62.91  ? 38  ARG D O   1 
ATOM   6400  C  CB  . ARG D  1 12  ? -13.698 44.497  -6.077   1.00 69.19  ? 38  ARG D CB  1 
ATOM   6401  C  CG  . ARG D  1 12  ? -14.173 43.312  -5.250   1.00 72.34  ? 38  ARG D CG  1 
ATOM   6402  C  CD  . ARG D  1 12  ? -15.354 42.592  -5.884   1.00 75.98  ? 38  ARG D CD  1 
ATOM   6403  N  NE  . ARG D  1 12  ? -15.183 42.370  -7.317   1.00 72.62  ? 38  ARG D NE  1 
ATOM   6404  C  CZ  . ARG D  1 12  ? -15.973 42.892  -8.250   1.00 75.84  ? 38  ARG D CZ  1 
ATOM   6405  N  NH1 . ARG D  1 12  ? -16.995 43.662  -7.899   1.00 70.24  ? 38  ARG D NH1 1 
ATOM   6406  N  NH2 . ARG D  1 12  ? -15.748 42.638  -9.533   1.00 78.42  ? 38  ARG D NH2 1 
ATOM   6407  N  N   . ASN D  1 13  ? -12.521 44.883  -2.971   1.00 74.49  ? 39  ASN D N   1 
ATOM   6408  C  CA  . ASN D  1 13  ? -11.926 44.236  -1.796   1.00 79.31  ? 39  ASN D CA  1 
ATOM   6409  C  C   . ASN D  1 13  ? -13.079 43.763  -0.910   1.00 81.29  ? 39  ASN D C   1 
ATOM   6410  O  O   . ASN D  1 13  ? -13.567 44.511  -0.058   1.00 83.75  ? 39  ASN D O   1 
ATOM   6411  C  CB  . ASN D  1 13  ? -10.992 45.191  -1.061   1.00 79.38  ? 39  ASN D CB  1 
ATOM   6412  C  CG  . ASN D  1 13  ? -10.119 44.487  -0.041   1.00 84.62  ? 39  ASN D CG  1 
ATOM   6413  O  OD1 . ASN D  1 13  ? -10.065 43.258  0.008    1.00 86.47  ? 39  ASN D OD1 1 
ATOM   6414  N  ND2 . ASN D  1 13  ? -9.419  45.268  0.775    1.00 80.00  ? 39  ASN D ND2 1 
ATOM   6415  N  N   . VAL D  1 14  ? -13.505 42.513  -1.114   1.00 82.26  ? 40  VAL D N   1 
ATOM   6416  C  CA  . VAL D  1 14  ? -14.695 42.003  -0.434   1.00 81.38  ? 40  VAL D CA  1 
ATOM   6417  C  C   . VAL D  1 14  ? -14.460 41.906  1.070    1.00 80.98  ? 40  VAL D C   1 
ATOM   6418  O  O   . VAL D  1 14  ? -15.229 42.450  1.871    1.00 81.13  ? 40  VAL D O   1 
ATOM   6419  C  CB  . VAL D  1 14  ? -15.113 40.645  -1.031   1.00 73.41  ? 40  VAL D CB  1 
ATOM   6420  C  CG1 . VAL D  1 14  ? -15.888 39.818  -0.011   1.00 73.00  ? 40  VAL D CG1 1 
ATOM   6421  C  CG2 . VAL D  1 14  ? -15.941 40.854  -2.292   1.00 73.61  ? 40  VAL D CG2 1 
ATOM   6422  N  N   . ASN D  1 15  ? -13.397 41.213  1.478    1.00 81.31  ? 41  ASN D N   1 
ATOM   6423  C  CA  . ASN D  1 15  ? -13.187 40.945  2.893    1.00 80.36  ? 41  ASN D CA  1 
ATOM   6424  C  C   . ASN D  1 15  ? -12.544 42.106  3.635    1.00 79.21  ? 41  ASN D C   1 
ATOM   6425  O  O   . ASN D  1 15  ? -12.479 42.062  4.865    1.00 83.26  ? 41  ASN D O   1 
ATOM   6426  C  CB  . ASN D  1 15  ? -12.333 39.687  3.070    1.00 76.93  ? 41  ASN D CB  1 
ATOM   6427  C  CG  . ASN D  1 15  ? -12.901 38.490  2.331    1.00 78.72  ? 41  ASN D CG  1 
ATOM   6428  O  OD1 . ASN D  1 15  ? -13.859 37.864  2.783    1.00 77.44  ? 41  ASN D OD1 1 
ATOM   6429  N  ND2 . ASN D  1 15  ? -12.308 38.165  1.189    1.00 82.22  ? 41  ASN D ND2 1 
ATOM   6430  N  N   . GLY D  1 16  ? -12.080 43.136  2.932    1.00 76.20  ? 42  GLY D N   1 
ATOM   6431  C  CA  . GLY D  1 16  ? -11.442 44.260  3.598    1.00 79.78  ? 42  GLY D CA  1 
ATOM   6432  C  C   . GLY D  1 16  ? -10.173 43.900  4.338    1.00 81.08  ? 42  GLY D C   1 
ATOM   6433  O  O   . GLY D  1 16  ? -9.879  44.498  5.379    1.00 70.81  ? 42  GLY D O   1 
ATOM   6434  N  N   . GLU D  1 17  ? -9.411  42.937  3.829    1.00 86.42  ? 43  GLU D N   1 
ATOM   6435  C  CA  . GLU D  1 17  ? -8.188  42.470  4.457    1.00 84.55  ? 43  GLU D CA  1 
ATOM   6436  C  C   . GLU D  1 17  ? -6.968  43.065  3.752    1.00 83.93  ? 43  GLU D C   1 
ATOM   6437  O  O   . GLU D  1 17  ? -7.082  43.917  2.865    1.00 78.99  ? 43  GLU D O   1 
ATOM   6438  C  CB  . GLU D  1 17  ? -8.142  40.941  4.435    1.00 84.45  ? 43  GLU D CB  1 
ATOM   6439  C  CG  . GLU D  1 17  ? -9.312  40.259  5.120    1.00 89.88  ? 43  GLU D CG  1 
ATOM   6440  C  CD  . GLU D  1 17  ? -9.330  38.761  4.874    1.00 96.84  ? 43  GLU D CD  1 
ATOM   6441  O  OE1 . GLU D  1 17  ? -8.649  38.308  3.928    1.00 91.50  ? 43  GLU D OE1 1 
ATOM   6442  O  OE2 . GLU D  1 17  ? -10.021 38.037  5.626    1.00 96.05  ? 43  GLU D OE2 1 
ATOM   6443  N  N   . LEU D  1 18  ? -5.786  42.615  4.157    1.00 80.99  ? 44  LEU D N   1 
ATOM   6444  C  CA  . LEU D  1 18  ? -4.520  42.907  3.496    1.00 70.36  ? 44  LEU D CA  1 
ATOM   6445  C  C   . LEU D  1 18  ? -3.888  41.597  3.043    1.00 68.12  ? 44  LEU D C   1 
ATOM   6446  O  O   . LEU D  1 18  ? -4.413  40.510  3.293    1.00 68.00  ? 44  LEU D O   1 
ATOM   6447  C  CB  . LEU D  1 18  ? -3.568  43.667  4.423    1.00 71.44  ? 44  LEU D CB  1 
ATOM   6448  C  CG  . LEU D  1 18  ? -4.144  44.762  5.328    1.00 76.62  ? 44  LEU D CG  1 
ATOM   6449  C  CD1 . LEU D  1 18  ? -3.186  45.054  6.471    1.00 76.54  ? 44  LEU D CD1 1 
ATOM   6450  C  CD2 . LEU D  1 18  ? -4.392  46.019  4.539    1.00 79.51  ? 44  LEU D CD2 1 
ATOM   6451  N  N   . LEU D  1 19  ? -2.737  41.707  2.376    1.00 68.72  ? 45  LEU D N   1 
ATOM   6452  C  CA  . LEU D  1 19  ? -2.083  40.513  1.856    1.00 64.82  ? 45  LEU D CA  1 
ATOM   6453  C  C   . LEU D  1 19  ? -1.560  39.629  2.979    1.00 63.70  ? 45  LEU D C   1 
ATOM   6454  O  O   . LEU D  1 19  ? -1.427  38.413  2.797    1.00 64.64  ? 45  LEU D O   1 
ATOM   6455  C  CB  . LEU D  1 19  ? -0.952  40.905  0.906    1.00 61.53  ? 45  LEU D CB  1 
ATOM   6456  C  CG  . LEU D  1 19  ? -0.398  39.768  0.038    1.00 71.54  ? 45  LEU D CG  1 
ATOM   6457  C  CD1 . LEU D  1 19  ? -1.434  39.325  -0.996   1.00 71.92  ? 45  LEU D CD1 1 
ATOM   6458  C  CD2 . LEU D  1 19  ? 0.903   40.178  -0.634   1.00 69.77  ? 45  LEU D CD2 1 
ATOM   6459  N  N   . SER D  1 20  ? -1.268  40.215  4.144    1.00 66.86  ? 46  SER D N   1 
ATOM   6460  C  CA  . SER D  1 20  ? -0.797  39.421  5.274    1.00 71.74  ? 46  SER D CA  1 
ATOM   6461  C  C   . SER D  1 20  ? -1.896  38.523  5.825    1.00 73.88  ? 46  SER D C   1 
ATOM   6462  O  O   . SER D  1 20  ? -1.609  37.440  6.347    1.00 77.72  ? 46  SER D O   1 
ATOM   6463  C  CB  . SER D  1 20  ? -0.261  40.337  6.376    1.00 74.79  ? 46  SER D CB  1 
ATOM   6464  O  OG  . SER D  1 20  ? -1.288  41.157  6.907    1.00 73.82  ? 46  SER D OG  1 
ATOM   6465  N  N   . GLY D  1 21  ? -3.156  38.949  5.708    1.00 74.69  ? 47  GLY D N   1 
ATOM   6466  C  CA  . GLY D  1 21  ? -4.301  38.204  6.204    1.00 74.47  ? 47  GLY D CA  1 
ATOM   6467  C  C   . GLY D  1 21  ? -5.097  38.956  7.251    1.00 82.70  ? 47  GLY D C   1 
ATOM   6468  O  O   . GLY D  1 21  ? -6.312  38.760  7.360    1.00 78.97  ? 47  GLY D O   1 
ATOM   6469  N  N   . ALA D  1 22  ? -4.433  39.815  8.023    1.00 85.73  ? 48  ALA D N   1 
ATOM   6470  C  CA  . ALA D  1 22  ? -5.118  40.604  9.032    1.00 87.04  ? 48  ALA D CA  1 
ATOM   6471  C  C   . ALA D  1 22  ? -6.100  41.568  8.376    1.00 89.27  ? 48  ALA D C   1 
ATOM   6472  O  O   . ALA D  1 22  ? -5.974  41.926  7.202    1.00 90.50  ? 48  ALA D O   1 
ATOM   6473  C  CB  . ALA D  1 22  ? -4.112  41.378  9.883    1.00 78.84  ? 48  ALA D CB  1 
ATOM   6474  N  N   . CYS D  1 23  ? -7.100  41.982  9.150    1.00 91.65  ? 49  CYS D N   1 
ATOM   6475  C  CA  . CYS D  1 23  ? -8.045  42.969  8.656    1.00 89.86  ? 49  CYS D CA  1 
ATOM   6476  C  C   . CYS D  1 23  ? -7.378  44.341  8.586    1.00 88.78  ? 49  CYS D C   1 
ATOM   6477  O  O   . CYS D  1 23  ? -6.332  44.586  9.193    1.00 91.04  ? 49  CYS D O   1 
ATOM   6478  C  CB  . CYS D  1 23  ? -9.299  43.001  9.536    1.00 90.22  ? 49  CYS D CB  1 
ATOM   6479  S  SG  . CYS D  1 23  ? -10.495 41.700  9.105    1.00 98.99  ? 49  CYS D SG  1 
ATOM   6480  N  N   . CYS D  1 24  ? -7.996  45.235  7.815    1.00 93.46  ? 50  CYS D N   1 
ATOM   6481  C  CA  . CYS D  1 24  ? -7.412  46.527  7.470    1.00 90.29  ? 50  CYS D CA  1 
ATOM   6482  C  C   . CYS D  1 24  ? -7.267  47.452  8.668    1.00 91.21  ? 50  CYS D C   1 
ATOM   6483  O  O   . CYS D  1 24  ? -6.467  47.198  9.573    1.00 96.75  ? 50  CYS D O   1 
ATOM   6484  C  CB  . CYS D  1 24  ? -8.265  47.217  6.407    1.00 95.96  ? 50  CYS D CB  1 
ATOM   6485  S  SG  . CYS D  1 24  ? -7.499  47.363  4.793    1.00 86.58  ? 50  CYS D SG  1 
ATOM   6486  N  N   . ASP D  1 25  ? -8.026  48.542  8.665    1.00 95.82  ? 51  ASP D N   1 
ATOM   6487  C  CA  . ASP D  1 25  ? -8.002  49.504  9.758    1.00 101.03 ? 51  ASP D CA  1 
ATOM   6488  C  C   . ASP D  1 25  ? -8.477  48.858  11.055   1.00 99.34  ? 51  ASP D C   1 
ATOM   6489  O  O   . ASP D  1 25  ? -9.060  47.773  11.043   1.00 91.91  ? 51  ASP D O   1 
ATOM   6490  C  CB  . ASP D  1 25  ? -8.871  50.720  9.422    1.00 100.35 ? 51  ASP D CB  1 
ATOM   6491  C  CG  . ASP D  1 25  ? -8.114  51.786  8.650    1.00 99.19  ? 51  ASP D CG  1 
ATOM   6492  O  OD1 . ASP D  1 25  ? -6.867  51.715  8.599    1.00 99.66  ? 51  ASP D OD1 1 
ATOM   6493  O  OD2 . ASP D  1 25  ? -8.766  52.699  8.098    1.00 94.95  ? 51  ASP D OD2 1 
ATOM   6494  N  N   . GLY D  1 35  ? -15.739 38.049  10.829   1.00 98.92  ? 61  GLY D N   1 
ATOM   6495  C  CA  . GLY D  1 35  ? -15.899 39.480  11.009   1.00 105.49 ? 61  GLY D CA  1 
ATOM   6496  C  C   . GLY D  1 35  ? -14.613 40.267  10.837   1.00 111.78 ? 61  GLY D C   1 
ATOM   6497  O  O   . GLY D  1 35  ? -13.554 39.858  11.317   1.00 108.15 ? 61  GLY D O   1 
ATOM   6498  N  N   . CYS D  1 36  ? -14.709 41.410  10.154   1.00 111.24 ? 62  CYS D N   1 
ATOM   6499  C  CA  . CYS D  1 36  ? -13.549 42.249  9.868    1.00 107.29 ? 62  CYS D CA  1 
ATOM   6500  C  C   . CYS D  1 36  ? -13.653 43.608  10.546   1.00 108.31 ? 62  CYS D C   1 
ATOM   6501  O  O   . CYS D  1 36  ? -12.798 43.952  11.369   1.00 109.00 ? 62  CYS D O   1 
ATOM   6502  C  CB  . CYS D  1 36  ? -13.398 42.420  8.353    1.00 92.31  ? 62  CYS D CB  1 
ATOM   6503  S  SG  . CYS D  1 36  ? -11.704 42.570  7.728    1.00 98.19  ? 62  CYS D SG  1 
ATOM   6504  N  N   . GLY D  1 37  ? -14.671 44.387  10.222   1.00 99.37  ? 63  GLY D N   1 
ATOM   6505  C  CA  . GLY D  1 37  ? -14.840 45.699  10.809   1.00 95.48  ? 63  GLY D CA  1 
ATOM   6506  C  C   . GLY D  1 37  ? -15.812 46.514  9.986    1.00 93.72  ? 63  GLY D C   1 
ATOM   6507  O  O   . GLY D  1 37  ? -16.400 46.035  9.017    1.00 95.66  ? 63  GLY D O   1 
ATOM   6508  N  N   . HIS D  1 38  ? -15.973 47.768  10.402   1.00 96.89  ? 64  HIS D N   1 
ATOM   6509  C  CA  . HIS D  1 38  ? -16.810 48.713  9.676    1.00 102.59 ? 64  HIS D CA  1 
ATOM   6510  C  C   . HIS D  1 38  ? -16.061 49.938  9.166    1.00 109.08 ? 64  HIS D C   1 
ATOM   6511  O  O   . HIS D  1 38  ? -16.447 50.476  8.125    1.00 107.60 ? 64  HIS D O   1 
ATOM   6512  C  CB  . HIS D  1 38  ? -17.993 49.173  10.545   1.00 99.45  ? 64  HIS D CB  1 
ATOM   6513  C  CG  . HIS D  1 38  ? -19.246 48.380  10.329   1.00 101.26 ? 64  HIS D CG  1 
ATOM   6514  N  ND1 . HIS D  1 38  ? -20.032 48.520  9.204    1.00 100.42 ? 64  HIS D ND1 1 
ATOM   6515  C  CD2 . HIS D  1 38  ? -19.852 47.442  11.095   1.00 103.20 ? 64  HIS D CD2 1 
ATOM   6516  C  CE1 . HIS D  1 38  ? -21.066 47.702  9.287    1.00 100.13 ? 64  HIS D CE1 1 
ATOM   6517  N  NE2 . HIS D  1 38  ? -20.980 47.036  10.424   1.00 99.73  ? 64  HIS D NE2 1 
ATOM   6518  N  N   . ASP D  1 39  ? -15.015 50.401  9.858    1.00 103.05 ? 65  ASP D N   1 
ATOM   6519  C  CA  . ASP D  1 39  ? -14.149 51.436  9.290    1.00 104.93 ? 65  ASP D CA  1 
ATOM   6520  C  C   . ASP D  1 39  ? -13.240 50.760  8.276    1.00 105.39 ? 65  ASP D C   1 
ATOM   6521  O  O   . ASP D  1 39  ? -12.263 50.098  8.637    1.00 101.17 ? 65  ASP D O   1 
ATOM   6522  C  CB  . ASP D  1 39  ? -13.326 52.165  10.348   1.00 104.18 ? 65  ASP D CB  1 
ATOM   6523  C  CG  . ASP D  1 39  ? -12.488 53.292  9.742    1.00 114.78 ? 65  ASP D CG  1 
ATOM   6524  O  OD1 . ASP D  1 39  ? -11.660 53.916  10.438   1.00 111.47 ? 65  ASP D OD1 1 
ATOM   6525  O  OD2 . ASP D  1 39  ? -12.667 53.570  8.537    1.00 117.64 ? 65  ASP D OD2 1 
ATOM   6526  N  N   . GLU D  1 40  ? -13.550 50.956  6.999    1.00 103.04 ? 66  GLU D N   1 
ATOM   6527  C  CA  . GLU D  1 40  ? -12.919 50.211  5.924    1.00 99.22  ? 66  GLU D CA  1 
ATOM   6528  C  C   . GLU D  1 40  ? -11.486 50.689  5.697    1.00 99.38  ? 66  GLU D C   1 
ATOM   6529  O  O   . GLU D  1 40  ? -10.995 51.635  6.331    1.00 98.28  ? 66  GLU D O   1 
ATOM   6530  C  CB  . GLU D  1 40  ? -13.734 50.356  4.642    1.00 93.27  ? 66  GLU D CB  1 
ATOM   6531  C  CG  . GLU D  1 40  ? -15.156 49.834  4.737    1.00 92.99  ? 66  GLU D CG  1 
ATOM   6532  C  CD  . GLU D  1 40  ? -16.067 50.466  3.702    1.00 94.68  ? 66  GLU D CD  1 
ATOM   6533  O  OE1 . GLU D  1 40  ? -15.772 51.599  3.263    1.00 91.57  ? 66  GLU D OE1 1 
ATOM   6534  O  OE2 . GLU D  1 40  ? -17.072 49.830  3.321    1.00 95.37  ? 66  GLU D OE2 1 
ATOM   6535  N  N   . CYS D  1 41  ? -10.812 50.008  4.772    1.00 96.84  ? 67  CYS D N   1 
ATOM   6536  C  CA  . CYS D  1 41  ? -9.542  50.496  4.262    1.00 93.56  ? 67  CYS D CA  1 
ATOM   6537  C  C   . CYS D  1 41  ? -9.749  51.848  3.596    1.00 96.37  ? 67  CYS D C   1 
ATOM   6538  O  O   . CYS D  1 41  ? -10.788 52.105  2.980    1.00 93.16  ? 67  CYS D O   1 
ATOM   6539  C  CB  . CYS D  1 41  ? -8.948  49.523  3.242    1.00 93.25  ? 67  CYS D CB  1 
ATOM   6540  S  SG  . CYS D  1 41  ? -9.077  47.764  3.588    1.00 96.95  ? 67  CYS D SG  1 
ATOM   6541  N  N   . ASP D  1 42  ? -8.752  52.709  3.715    1.00 91.37  ? 68  ASP D N   1 
ATOM   6542  C  CA  . ASP D  1 42  ? -8.731  53.994  3.028    1.00 91.61  ? 68  ASP D CA  1 
ATOM   6543  C  C   . ASP D  1 42  ? -7.581  53.898  2.024    1.00 87.21  ? 68  ASP D C   1 
ATOM   6544  O  O   . ASP D  1 42  ? -6.439  54.255  2.323    1.00 80.77  ? 68  ASP D O   1 
ATOM   6545  C  CB  . ASP D  1 42  ? -8.577  55.138  4.032    1.00 93.89  ? 68  ASP D CB  1 
ATOM   6546  C  CG  . ASP D  1 42  ? -9.379  54.898  5.319    1.00 100.32 ? 68  ASP D CG  1 
ATOM   6547  O  OD1 . ASP D  1 42  ? -10.625 54.985  5.295    1.00 93.11  ? 68  ASP D OD1 1 
ATOM   6548  O  OD2 . ASP D  1 42  ? -8.769  54.612  6.372    1.00 107.87 ? 68  ASP D OD2 1 
ATOM   6549  N  N   . THR D  1 43  ? -7.896  53.399  0.826    1.00 80.95  ? 69  THR D N   1 
ATOM   6550  C  CA  . THR D  1 43  ? -6.889  52.877  -0.089   1.00 76.25  ? 69  THR D CA  1 
ATOM   6551  C  C   . THR D  1 43  ? -6.428  53.913  -1.106   1.00 77.20  ? 69  THR D C   1 
ATOM   6552  O  O   . THR D  1 43  ? -7.229  54.681  -1.648   1.00 70.24  ? 69  THR D O   1 
ATOM   6553  C  CB  . THR D  1 43  ? -7.421  51.654  -0.839   1.00 68.03  ? 69  THR D CB  1 
ATOM   6554  O  OG1 . THR D  1 43  ? -8.182  52.087  -1.970   1.00 74.87  ? 69  THR D OG1 1 
ATOM   6555  C  CG2 . THR D  1 43  ? -8.307  50.822  0.056    1.00 72.45  ? 69  THR D CG2 1 
ATOM   6556  N  N   . TYR D  1 44  ? -5.121  53.908  -1.364   1.00 76.21  ? 70  TYR D N   1 
ATOM   6557  C  CA  . TYR D  1 44  ? -4.481  54.630  -2.453   1.00 65.19  ? 70  TYR D CA  1 
ATOM   6558  C  C   . TYR D  1 44  ? -3.568  53.649  -3.181   1.00 62.27  ? 70  TYR D C   1 
ATOM   6559  O  O   . TYR D  1 44  ? -3.346  52.527  -2.720   1.00 58.58  ? 70  TYR D O   1 
ATOM   6560  C  CB  . TYR D  1 44  ? -3.689  55.839  -1.937   1.00 60.76  ? 70  TYR D CB  1 
ATOM   6561  C  CG  . TYR D  1 44  ? -2.519  55.457  -1.060   1.00 70.49  ? 70  TYR D CG  1 
ATOM   6562  C  CD1 . TYR D  1 44  ? -2.703  55.129  0.280    1.00 73.48  ? 70  TYR D CD1 1 
ATOM   6563  C  CD2 . TYR D  1 44  ? -1.229  55.417  -1.572   1.00 68.07  ? 70  TYR D CD2 1 
ATOM   6564  C  CE1 . TYR D  1 44  ? -1.633  54.773  1.081    1.00 72.52  ? 70  TYR D CE1 1 
ATOM   6565  C  CE2 . TYR D  1 44  ? -0.155  55.063  -0.778   1.00 70.44  ? 70  TYR D CE2 1 
ATOM   6566  C  CZ  . TYR D  1 44  ? -0.361  54.743  0.546    1.00 68.68  ? 70  TYR D CZ  1 
ATOM   6567  O  OH  . TYR D  1 44  ? 0.712   54.392  1.329    1.00 71.90  ? 70  TYR D OH  1 
ATOM   6568  N  N   . VAL D  1 45  ? -3.039  54.061  -4.334   1.00 66.75  ? 71  VAL D N   1 
ATOM   6569  C  CA  . VAL D  1 45  ? -2.183  53.185  -5.128   1.00 61.08  ? 71  VAL D CA  1 
ATOM   6570  C  C   . VAL D  1 45  ? -0.916  53.922  -5.541   1.00 54.76  ? 71  VAL D C   1 
ATOM   6571  O  O   . VAL D  1 45  ? -0.895  55.152  -5.655   1.00 58.74  ? 71  VAL D O   1 
ATOM   6572  C  CB  . VAL D  1 45  ? -2.904  52.622  -6.378   1.00 55.65  ? 71  VAL D CB  1 
ATOM   6573  C  CG1 . VAL D  1 45  ? -4.264  52.041  -6.010   1.00 63.48  ? 71  VAL D CG1 1 
ATOM   6574  C  CG2 . VAL D  1 45  ? -3.040  53.687  -7.450   1.00 54.17  ? 71  VAL D CG2 1 
ATOM   6575  N  N   . ARG D  1 46  ? 0.152   53.151  -5.760   1.00 47.12  ? 72  ARG D N   1 
ATOM   6576  C  CA  . ARG D  1 46  ? 1.415   53.666  -6.272   1.00 49.00  ? 72  ARG D CA  1 
ATOM   6577  C  C   . ARG D  1 46  ? 1.851   52.840  -7.475   1.00 49.84  ? 72  ARG D C   1 
ATOM   6578  O  O   . ARG D  1 46  ? 1.659   51.619  -7.504   1.00 41.10  ? 72  ARG D O   1 
ATOM   6579  C  CB  . ARG D  1 46  ? 2.518   53.639  -5.210   1.00 59.27  ? 72  ARG D CB  1 
ATOM   6580  C  CG  . ARG D  1 46  ? 2.030   53.540  -3.778   1.00 62.97  ? 72  ARG D CG  1 
ATOM   6581  C  CD  . ARG D  1 46  ? 3.170   53.810  -2.810   1.00 60.07  ? 72  ARG D CD  1 
ATOM   6582  N  NE  . ARG D  1 46  ? 3.598   55.206  -2.863   1.00 66.02  ? 72  ARG D NE  1 
ATOM   6583  C  CZ  . ARG D  1 46  ? 4.773   55.648  -2.426   1.00 72.89  ? 72  ARG D CZ  1 
ATOM   6584  N  NH1 . ARG D  1 46  ? 5.652   54.802  -1.906   1.00 78.53  ? 72  ARG D NH1 1 
ATOM   6585  N  NH2 . ARG D  1 46  ? 5.074   56.938  -2.515   1.00 71.93  ? 72  ARG D NH2 1 
ATOM   6586  N  N   . VAL D  1 47  ? 2.456   53.510  -8.456   1.00 48.26  ? 73  VAL D N   1 
ATOM   6587  C  CA  . VAL D  1 47  ? 2.838   52.903  -9.726   1.00 44.06  ? 73  VAL D CA  1 
ATOM   6588  C  C   . VAL D  1 47  ? 4.356   52.909  -9.840   1.00 41.23  ? 73  VAL D C   1 
ATOM   6589  O  O   . VAL D  1 47  ? 5.006   53.903  -9.501   1.00 38.87  ? 73  VAL D O   1 
ATOM   6590  C  CB  . VAL D  1 47  ? 2.196   53.649  -10.917  1.00 42.88  ? 73  VAL D CB  1 
ATOM   6591  C  CG1 . VAL D  1 47  ? 2.586   53.003  -12.233  1.00 38.57  ? 73  VAL D CG1 1 
ATOM   6592  C  CG2 . VAL D  1 47  ? 0.682   53.694  -10.769  1.00 42.43  ? 73  VAL D CG2 1 
ATOM   6593  N  N   . CYS D  1 48  ? 4.920   51.796  -10.315  1.00 41.95  ? 74  CYS D N   1 
ATOM   6594  C  CA  . CYS D  1 48  ? 6.358   51.658  -10.518  1.00 42.81  ? 74  CYS D CA  1 
ATOM   6595  C  C   . CYS D  1 48  ? 6.629   51.222  -11.950  1.00 42.48  ? 74  CYS D C   1 
ATOM   6596  O  O   . CYS D  1 48  ? 6.095   50.205  -12.402  1.00 44.88  ? 74  CYS D O   1 
ATOM   6597  C  CB  . CYS D  1 48  ? 6.967   50.644  -9.547   1.00 42.43  ? 74  CYS D CB  1 
ATOM   6598  S  SG  . CYS D  1 48  ? 8.717   50.254  -9.842   1.00 45.49  ? 74  CYS D SG  1 
ATOM   6599  N  N   . LEU D  1 49  ? 7.472   51.975  -12.652  1.00 44.75  ? 75  LEU D N   1 
ATOM   6600  C  CA  . LEU D  1 49  ? 7.769   51.728  -14.058  1.00 43.49  ? 75  LEU D CA  1 
ATOM   6601  C  C   . LEU D  1 49  ? 9.267   51.503  -14.221  1.00 36.68  ? 75  LEU D C   1 
ATOM   6602  O  O   . LEU D  1 49  ? 10.073  52.359  -13.838  1.00 33.54  ? 75  LEU D O   1 
ATOM   6603  C  CB  . LEU D  1 49  ? 7.294   52.899  -14.922  1.00 38.00  ? 75  LEU D CB  1 
ATOM   6604  C  CG  . LEU D  1 49  ? 7.218   52.685  -16.434  1.00 40.17  ? 75  LEU D CG  1 
ATOM   6605  C  CD1 . LEU D  1 49  ? 6.233   51.574  -16.771  1.00 38.12  ? 75  LEU D CD1 1 
ATOM   6606  C  CD2 . LEU D  1 49  ? 6.837   53.981  -17.139  1.00 37.80  ? 75  LEU D CD2 1 
ATOM   6607  N  N   . LYS D  1 50  ? 9.637   50.357  -14.788  1.00 31.10  ? 76  LYS D N   1 
ATOM   6608  C  CA  . LYS D  1 50  ? 11.036  50.010  -15.000  1.00 32.18  ? 76  LYS D CA  1 
ATOM   6609  C  C   . LYS D  1 50  ? 11.144  49.229  -16.306  1.00 33.98  ? 76  LYS D C   1 
ATOM   6610  O  O   . LYS D  1 50  ? 10.181  49.117  -17.068  1.00 38.58  ? 76  LYS D O   1 
ATOM   6611  C  CB  . LYS D  1 50  ? 11.592  49.224  -13.806  1.00 35.33  ? 76  LYS D CB  1 
ATOM   6612  C  CG  . LYS D  1 50  ? 10.939  47.866  -13.593  1.00 36.68  ? 76  LYS D CG  1 
ATOM   6613  C  CD  . LYS D  1 50  ? 11.494  47.179  -12.360  1.00 35.92  ? 76  LYS D CD  1 
ATOM   6614  C  CE  . LYS D  1 50  ? 10.806  45.850  -12.106  1.00 42.01  ? 76  LYS D CE  1 
ATOM   6615  N  NZ  . LYS D  1 50  ? 11.320  45.191  -10.878  1.00 41.42  ? 76  LYS D NZ  1 
ATOM   6616  N  N   . GLU D  1 51  ? 12.328  48.678  -16.560  1.00 33.60  ? 77  GLU D N   1 
ATOM   6617  C  CA  . GLU D  1 51  ? 12.608  47.999  -17.816  1.00 37.34  ? 77  GLU D CA  1 
ATOM   6618  C  C   . GLU D  1 51  ? 11.894  46.648  -17.884  1.00 38.99  ? 77  GLU D C   1 
ATOM   6619  O  O   . GLU D  1 51  ? 11.424  46.105  -16.881  1.00 43.27  ? 77  GLU D O   1 
ATOM   6620  C  CB  . GLU D  1 51  ? 14.114  47.802  -17.996  1.00 36.05  ? 77  GLU D CB  1 
ATOM   6621  C  CG  . GLU D  1 51  ? 14.757  46.879  -16.970  1.00 33.96  ? 77  GLU D CG  1 
ATOM   6622  C  CD  . GLU D  1 51  ? 15.048  47.573  -15.649  1.00 42.99  ? 77  GLU D CD  1 
ATOM   6623  O  OE1 . GLU D  1 51  ? 15.334  48.792  -15.658  1.00 45.47  ? 77  GLU D OE1 1 
ATOM   6624  O  OE2 . GLU D  1 51  ? 14.987  46.900  -14.598  1.00 43.25  ? 77  GLU D OE2 1 
ATOM   6625  N  N   . TYR D  1 52  ? 11.831  46.102  -19.098  1.00 41.51  ? 78  TYR D N   1 
ATOM   6626  C  CA  . TYR D  1 52  ? 11.191  44.812  -19.321  1.00 46.49  ? 78  TYR D CA  1 
ATOM   6627  C  C   . TYR D  1 52  ? 11.980  43.698  -18.643  1.00 46.38  ? 78  TYR D C   1 
ATOM   6628  O  O   . TYR D  1 52  ? 13.213  43.678  -18.676  1.00 46.49  ? 78  TYR D O   1 
ATOM   6629  C  CB  . TYR D  1 52  ? 11.074  44.534  -20.821  1.00 45.68  ? 78  TYR D CB  1 
ATOM   6630  C  CG  . TYR D  1 52  ? 10.376  43.235  -21.185  1.00 48.99  ? 78  TYR D CG  1 
ATOM   6631  C  CD1 . TYR D  1 52  ? 9.003   43.197  -21.401  1.00 48.33  ? 78  TYR D CD1 1 
ATOM   6632  C  CD2 . TYR D  1 52  ? 11.093  42.051  -21.332  1.00 51.29  ? 78  TYR D CD2 1 
ATOM   6633  C  CE1 . TYR D  1 52  ? 8.362   42.015  -21.742  1.00 45.02  ? 78  TYR D CE1 1 
ATOM   6634  C  CE2 . TYR D  1 52  ? 10.460  40.864  -21.672  1.00 49.00  ? 78  TYR D CE2 1 
ATOM   6635  C  CZ  . TYR D  1 52  ? 9.094   40.855  -21.877  1.00 47.09  ? 78  TYR D CZ  1 
ATOM   6636  O  OH  . TYR D  1 52  ? 8.458   39.685  -22.216  1.00 44.70  ? 78  TYR D OH  1 
ATOM   6637  N  N   . GLN D  1 53  ? 11.256  42.763  -18.029  1.00 46.64  ? 79  GLN D N   1 
ATOM   6638  C  CA  . GLN D  1 53  ? 11.854  41.628  -17.337  1.00 48.77  ? 79  GLN D CA  1 
ATOM   6639  C  C   . GLN D  1 53  ? 11.135  40.354  -17.751  1.00 48.13  ? 79  GLN D C   1 
ATOM   6640  O  O   . GLN D  1 53  ? 9.901   40.301  -17.732  1.00 45.57  ? 79  GLN D O   1 
ATOM   6641  C  CB  . GLN D  1 53  ? 11.784  41.798  -15.812  1.00 50.89  ? 79  GLN D CB  1 
ATOM   6642  C  CG  . GLN D  1 53  ? 12.677  42.896  -15.243  1.00 48.63  ? 79  GLN D CG  1 
ATOM   6643  C  CD  . GLN D  1 53  ? 12.609  42.978  -13.723  1.00 51.39  ? 79  GLN D CD  1 
ATOM   6644  O  OE1 . GLN D  1 53  ? 11.776  42.329  -13.092  1.00 47.45  ? 79  GLN D OE1 1 
ATOM   6645  N  NE2 . GLN D  1 53  ? 13.492  43.775  -13.131  1.00 53.52  ? 79  GLN D NE2 1 
ATOM   6646  N  N   . ALA D  1 54  ? 11.907  39.331  -18.126  1.00 54.50  ? 80  ALA D N   1 
ATOM   6647  C  CA  . ALA D  1 54  ? 11.307  38.043  -18.457  1.00 53.66  ? 80  ALA D CA  1 
ATOM   6648  C  C   . ALA D  1 54  ? 10.582  37.447  -17.260  1.00 58.72  ? 80  ALA D C   1 
ATOM   6649  O  O   . ALA D  1 54  ? 9.568   36.759  -17.424  1.00 59.57  ? 80  ALA D O   1 
ATOM   6650  C  CB  . ALA D  1 54  ? 12.377  37.078  -18.969  1.00 58.95  ? 80  ALA D CB  1 
ATOM   6651  N  N   . LYS D  1 55  ? 11.083  37.703  -16.053  1.00 60.36  ? 81  LYS D N   1 
ATOM   6652  C  CA  . LYS D  1 55  ? 10.402  37.336  -14.818  1.00 58.85  ? 81  LYS D CA  1 
ATOM   6653  C  C   . LYS D  1 55  ? 10.406  38.549  -13.898  1.00 55.28  ? 81  LYS D C   1 
ATOM   6654  O  O   . LYS D  1 55  ? 11.474  39.078  -13.569  1.00 47.96  ? 81  LYS D O   1 
ATOM   6655  C  CB  . LYS D  1 55  ? 11.075  36.133  -14.149  1.00 63.85  ? 81  LYS D CB  1 
ATOM   6656  C  CG  . LYS D  1 55  ? 10.505  35.782  -12.784  1.00 56.55  ? 81  LYS D CG  1 
ATOM   6657  C  CD  . LYS D  1 55  ? 11.579  35.876  -11.713  1.00 53.16  ? 81  LYS D CD  1 
ATOM   6658  C  CE  . LYS D  1 55  ? 12.792  35.024  -12.081  1.00 58.57  ? 81  LYS D CE  1 
ATOM   6659  N  NZ  . LYS D  1 55  ? 13.860  35.083  -11.040  1.00 60.69  ? 81  LYS D NZ  1 
ATOM   6660  N  N   . VAL D  1 56  ? 9.214   38.989  -13.492  1.00 53.92  ? 82  VAL D N   1 
ATOM   6661  C  CA  . VAL D  1 56  ? 9.084   40.211  -12.708  1.00 46.25  ? 82  VAL D CA  1 
ATOM   6662  C  C   . VAL D  1 56  ? 9.658   40.007  -11.310  1.00 48.48  ? 82  VAL D C   1 
ATOM   6663  O  O   . VAL D  1 56  ? 9.606   38.910  -10.738  1.00 61.93  ? 82  VAL D O   1 
ATOM   6664  C  CB  . VAL D  1 56  ? 7.609   40.646  -12.642  1.00 38.41  ? 82  VAL D CB  1 
ATOM   6665  C  CG1 . VAL D  1 56  ? 7.498   42.088  -12.180  1.00 32.40  ? 82  VAL D CG1 1 
ATOM   6666  C  CG2 . VAL D  1 56  ? 6.940   40.449  -13.994  1.00 48.10  ? 82  VAL D CG2 1 
ATOM   6667  N  N   . THR D  1 57  ? 10.219  41.077  -10.756  1.00 39.77  ? 83  THR D N   1 
ATOM   6668  C  CA  . THR D  1 57  ? 10.688  41.103  -9.387   1.00 43.43  ? 83  THR D CA  1 
ATOM   6669  C  C   . THR D  1 57  ? 9.955   42.207  -8.636   1.00 44.42  ? 83  THR D C   1 
ATOM   6670  O  O   . THR D  1 57  ? 9.813   43.319  -9.165   1.00 42.44  ? 83  THR D O   1 
ATOM   6671  C  CB  . THR D  1 57  ? 12.213  41.339  -9.322   1.00 48.09  ? 83  THR D CB  1 
ATOM   6672  O  OG1 . THR D  1 57  ? 12.531  42.630  -9.857   1.00 49.36  ? 83  THR D OG1 1 
ATOM   6673  C  CG2 . THR D  1 57  ? 12.958  40.270  -10.116  1.00 45.15  ? 83  THR D CG2 1 
ATOM   6674  N  N   . PRO D  1 58  ? 9.466   41.951  -7.419   1.00 44.75  ? 84  PRO D N   1 
ATOM   6675  C  CA  . PRO D  1 58  ? 8.740   42.998  -6.685   1.00 44.53  ? 84  PRO D CA  1 
ATOM   6676  C  C   . PRO D  1 58  ? 9.636   44.108  -6.175   1.00 50.78  ? 84  PRO D C   1 
ATOM   6677  O  O   . PRO D  1 58  ? 9.124   45.109  -5.656   1.00 50.96  ? 84  PRO D O   1 
ATOM   6678  C  CB  . PRO D  1 58  ? 8.102   42.228  -5.524   1.00 42.95  ? 84  PRO D CB  1 
ATOM   6679  C  CG  . PRO D  1 58  ? 9.052   41.103  -5.281   1.00 42.11  ? 84  PRO D CG  1 
ATOM   6680  C  CD  . PRO D  1 58  ? 9.597   40.711  -6.633   1.00 36.84  ? 84  PRO D CD  1 
ATOM   6681  N  N   . THR D  1 59  ? 10.948  43.962  -6.304   1.00 52.69  ? 85  THR D N   1 
ATOM   6682  C  CA  . THR D  1 59  ? 11.916  44.913  -5.790   1.00 52.16  ? 85  THR D CA  1 
ATOM   6683  C  C   . THR D  1 59  ? 12.771  45.444  -6.932   1.00 50.82  ? 85  THR D C   1 
ATOM   6684  O  O   . THR D  1 59  ? 12.727  44.946  -8.061   1.00 44.81  ? 85  THR D O   1 
ATOM   6685  C  CB  . THR D  1 59  ? 12.800  44.264  -4.718   1.00 57.26  ? 85  THR D CB  1 
ATOM   6686  O  OG1 . THR D  1 59  ? 13.398  43.074  -5.251   1.00 53.93  ? 85  THR D OG1 1 
ATOM   6687  C  CG2 . THR D  1 59  ? 11.970  43.905  -3.493   1.00 55.51  ? 85  THR D CG2 1 
ATOM   6688  N  N   . GLY D  1 60  ? 13.562  46.466  -6.616   1.00 48.50  ? 86  GLY D N   1 
ATOM   6689  C  CA  . GLY D  1 60  ? 14.434  47.086  -7.583   1.00 38.19  ? 86  GLY D CA  1 
ATOM   6690  C  C   . GLY D  1 60  ? 14.046  48.524  -7.846   1.00 39.90  ? 86  GLY D C   1 
ATOM   6691  O  O   . GLY D  1 60  ? 12.960  48.980  -7.471   1.00 46.71  ? 86  GLY D O   1 
ATOM   6692  N  N   . PRO D  1 61  ? 14.934  49.273  -8.494   1.00 35.94  ? 87  PRO D N   1 
ATOM   6693  C  CA  . PRO D  1 61  ? 14.620  50.670  -8.810   1.00 40.32  ? 87  PRO D CA  1 
ATOM   6694  C  C   . PRO D  1 61  ? 13.554  50.770  -9.890   1.00 41.22  ? 87  PRO D C   1 
ATOM   6695  O  O   . PRO D  1 61  ? 13.523  49.981  -10.838  1.00 39.79  ? 87  PRO D O   1 
ATOM   6696  C  CB  . PRO D  1 61  ? 15.960  51.238  -9.302   1.00 35.89  ? 87  PRO D CB  1 
ATOM   6697  C  CG  . PRO D  1 61  ? 16.996  50.242  -8.898   1.00 35.20  ? 87  PRO D CG  1 
ATOM   6698  C  CD  . PRO D  1 61  ? 16.308  48.914  -8.877   1.00 36.84  ? 87  PRO D CD  1 
ATOM   6699  N  N   . CYS D  1 62  ? 12.676  51.759  -9.740   1.00 34.07  ? 88  CYS D N   1 
ATOM   6700  C  CA  . CYS D  1 62  ? 11.702  52.086  -10.778  1.00 39.78  ? 88  CYS D CA  1 
ATOM   6701  C  C   . CYS D  1 62  ? 12.410  52.983  -11.789  1.00 41.04  ? 88  CYS D C   1 
ATOM   6702  O  O   . CYS D  1 62  ? 12.367  54.213  -11.710  1.00 39.90  ? 88  CYS D O   1 
ATOM   6703  C  CB  . CYS D  1 62  ? 10.469  52.740  -10.168  1.00 40.52  ? 88  CYS D CB  1 
ATOM   6704  S  SG  . CYS D  1 62  ? 9.739   51.719  -8.855   1.00 48.04  ? 88  CYS D SG  1 
ATOM   6705  N  N   . SER D  1 63  ? 13.070  52.342  -12.758  1.00 33.12  ? 89  SER D N   1 
ATOM   6706  C  CA  . SER D  1 63  ? 14.039  53.035  -13.602  1.00 32.19  ? 89  SER D CA  1 
ATOM   6707  C  C   . SER D  1 63  ? 13.386  54.120  -14.452  1.00 40.72  ? 89  SER D C   1 
ATOM   6708  O  O   . SER D  1 63  ? 13.993  55.170  -14.699  1.00 35.24  ? 89  SER D O   1 
ATOM   6709  C  CB  . SER D  1 63  ? 14.757  52.025  -14.494  1.00 31.36  ? 89  SER D CB  1 
ATOM   6710  O  OG  . SER D  1 63  ? 15.005  50.822  -13.795  1.00 27.92  ? 89  SER D OG  1 
ATOM   6711  N  N   . TYR D  1 64  ? 12.158  53.887  -14.915  1.00 42.80  ? 90  TYR D N   1 
ATOM   6712  C  CA  . TYR D  1 64  ? 11.508  54.800  -15.848  1.00 37.27  ? 90  TYR D CA  1 
ATOM   6713  C  C   . TYR D  1 64  ? 10.668  55.869  -15.159  1.00 34.08  ? 90  TYR D C   1 
ATOM   6714  O  O   . TYR D  1 64  ? 10.273  56.839  -15.817  1.00 38.06  ? 90  TYR D O   1 
ATOM   6715  C  CB  . TYR D  1 64  ? 10.627  54.016  -16.829  1.00 38.27  ? 90  TYR D CB  1 
ATOM   6716  C  CG  . TYR D  1 64  ? 11.369  53.035  -17.721  1.00 35.47  ? 90  TYR D CG  1 
ATOM   6717  C  CD1 . TYR D  1 64  ? 12.753  53.076  -17.845  1.00 32.94  ? 90  TYR D CD1 1 
ATOM   6718  C  CD2 . TYR D  1 64  ? 10.677  52.074  -18.450  1.00 36.20  ? 90  TYR D CD2 1 
ATOM   6719  C  CE1 . TYR D  1 64  ? 13.427  52.179  -18.666  1.00 33.02  ? 90  TYR D CE1 1 
ATOM   6720  C  CE2 . TYR D  1 64  ? 11.340  51.178  -19.274  1.00 35.90  ? 90  TYR D CE2 1 
ATOM   6721  C  CZ  . TYR D  1 64  ? 12.714  51.234  -19.379  1.00 34.37  ? 90  TYR D CZ  1 
ATOM   6722  O  OH  . TYR D  1 64  ? 13.367  50.337  -20.199  1.00 27.69  ? 90  TYR D OH  1 
ATOM   6723  N  N   . GLY D  1 65  ? 10.387  55.723  -13.866  1.00 34.48  ? 91  GLY D N   1 
ATOM   6724  C  CA  . GLY D  1 65  ? 9.584   56.694  -13.143  1.00 34.20  ? 91  GLY D CA  1 
ATOM   6725  C  C   . GLY D  1 65  ? 8.578   56.055  -12.206  1.00 40.32  ? 91  GLY D C   1 
ATOM   6726  O  O   . GLY D  1 65  ? 8.435   54.827  -12.190  1.00 40.22  ? 91  GLY D O   1 
ATOM   6727  N  N   . HIS D  1 66  ? 7.876   56.866  -11.418  1.00 37.55  ? 92  HIS D N   1 
ATOM   6728  C  CA  . HIS D  1 66  ? 6.867   56.341  -10.506  1.00 38.89  ? 92  HIS D CA  1 
ATOM   6729  C  C   . HIS D  1 66  ? 5.849   57.436  -10.208  1.00 41.07  ? 92  HIS D C   1 
ATOM   6730  O  O   . HIS D  1 66  ? 5.945   58.557  -10.714  1.00 45.85  ? 92  HIS D O   1 
ATOM   6731  C  CB  . HIS D  1 66  ? 7.504   55.793  -9.223   1.00 37.06  ? 92  HIS D CB  1 
ATOM   6732  C  CG  . HIS D  1 66  ? 8.396   56.768  -8.521   1.00 45.04  ? 92  HIS D CG  1 
ATOM   6733  N  ND1 . HIS D  1 66  ? 7.973   58.019  -8.126   1.00 37.60  ? 92  HIS D ND1 1 
ATOM   6734  C  CD2 . HIS D  1 66  ? 9.691   56.671  -8.136   1.00 48.86  ? 92  HIS D CD2 1 
ATOM   6735  C  CE1 . HIS D  1 66  ? 8.969   58.652  -7.533   1.00 42.28  ? 92  HIS D CE1 1 
ATOM   6736  N  NE2 . HIS D  1 66  ? 10.023  57.855  -7.526   1.00 48.15  ? 92  HIS D NE2 1 
ATOM   6737  N  N   . GLY D  1 67  ? 4.867   57.093  -9.381   1.00 43.43  ? 93  GLY D N   1 
ATOM   6738  C  CA  . GLY D  1 67  ? 3.832   58.036  -8.989   1.00 45.81  ? 93  GLY D CA  1 
ATOM   6739  C  C   . GLY D  1 67  ? 2.870   57.374  -8.026   1.00 45.46  ? 93  GLY D C   1 
ATOM   6740  O  O   . GLY D  1 67  ? 2.922   56.162  -7.792   1.00 47.35  ? 93  GLY D O   1 
ATOM   6741  N  N   . ALA D  1 68  ? 1.980   58.194  -7.468   1.00 50.48  ? 94  ALA D N   1 
ATOM   6742  C  CA  . ALA D  1 68  ? 1.003   57.707  -6.503   1.00 55.01  ? 94  ALA D CA  1 
ATOM   6743  C  C   . ALA D  1 68  ? -0.223  58.611  -6.511   1.00 60.93  ? 94  ALA D C   1 
ATOM   6744  O  O   . ALA D  1 68  ? -0.209  59.716  -7.062   1.00 58.96  ? 94  ALA D O   1 
ATOM   6745  C  CB  . ALA D  1 68  ? 1.600   57.618  -5.095   1.00 55.92  ? 94  ALA D CB  1 
ATOM   6746  N  N   . THR D  1 69  ? -1.286  58.126  -5.877   1.00 59.00  ? 95  THR D N   1 
ATOM   6747  C  CA  . THR D  1 69  ? -2.587  58.772  -5.827   1.00 66.03  ? 95  THR D CA  1 
ATOM   6748  C  C   . THR D  1 69  ? -2.973  59.122  -4.394   1.00 65.06  ? 95  THR D C   1 
ATOM   6749  O  O   . THR D  1 69  ? -2.388  58.603  -3.436   1.00 62.58  ? 95  THR D O   1 
ATOM   6750  C  CB  . THR D  1 69  ? -3.671  57.862  -6.428   1.00 64.22  ? 95  THR D CB  1 
ATOM   6751  O  OG1 . THR D  1 69  ? -3.525  56.532  -5.915   1.00 61.45  ? 95  THR D OG1 1 
ATOM   6752  C  CG2 . THR D  1 69  ? -3.569  57.833  -7.933   1.00 61.79  ? 95  THR D CG2 1 
ATOM   6753  N  N   . PRO D  1 70  ? -3.954  60.018  -4.210   1.00 72.23  ? 96  PRO D N   1 
ATOM   6754  C  CA  . PRO D  1 70  ? -4.581  60.160  -2.888   1.00 76.10  ? 96  PRO D CA  1 
ATOM   6755  C  C   . PRO D  1 70  ? -5.521  59.003  -2.582   1.00 73.59  ? 96  PRO D C   1 
ATOM   6756  O  O   . PRO D  1 70  ? -5.665  58.084  -3.397   1.00 72.90  ? 96  PRO D O   1 
ATOM   6757  C  CB  . PRO D  1 70  ? -5.339  61.489  -2.997   1.00 72.36  ? 96  PRO D CB  1 
ATOM   6758  C  CG  . PRO D  1 70  ? -5.602  61.649  -4.456   1.00 74.40  ? 96  PRO D CG  1 
ATOM   6759  C  CD  . PRO D  1 70  ? -4.401  61.065  -5.146   1.00 74.50  ? 96  PRO D CD  1 
ATOM   6760  N  N   . VAL D  1 71  ? -6.163  59.031  -1.414   1.00 68.95  ? 97  VAL D N   1 
ATOM   6761  C  CA  . VAL D  1 71  ? -7.112  57.981  -1.067   1.00 71.37  ? 97  VAL D CA  1 
ATOM   6762  C  C   . VAL D  1 71  ? -8.337  58.102  -1.962   1.00 72.79  ? 97  VAL D C   1 
ATOM   6763  O  O   . VAL D  1 71  ? -8.948  59.174  -2.071   1.00 65.37  ? 97  VAL D O   1 
ATOM   6764  C  CB  . VAL D  1 71  ? -7.489  58.056  0.420    1.00 75.22  ? 97  VAL D CB  1 
ATOM   6765  C  CG1 . VAL D  1 71  ? -8.599  57.062  0.736    1.00 72.29  ? 97  VAL D CG1 1 
ATOM   6766  C  CG2 . VAL D  1 71  ? -6.267  57.787  1.286    1.00 76.57  ? 97  VAL D CG2 1 
ATOM   6767  N  N   . LEU D  1 72  ? -8.697  56.998  -2.616   1.00 75.27  ? 98  LEU D N   1 
ATOM   6768  C  CA  . LEU D  1 72  ? -9.734  57.016  -3.636   1.00 73.35  ? 98  LEU D CA  1 
ATOM   6769  C  C   . LEU D  1 72  ? -11.074 56.481  -3.153   1.00 71.90  ? 98  LEU D C   1 
ATOM   6770  O  O   . LEU D  1 72  ? -12.095 56.754  -3.794   1.00 79.64  ? 98  LEU D O   1 
ATOM   6771  C  CB  . LEU D  1 72  ? -9.277  56.213  -4.862   1.00 76.21  ? 98  LEU D CB  1 
ATOM   6772  C  CG  . LEU D  1 72  ? -7.903  56.574  -5.443   1.00 70.18  ? 98  LEU D CG  1 
ATOM   6773  C  CD1 . LEU D  1 72  ? -7.474  55.561  -6.489   1.00 60.95  ? 98  LEU D CD1 1 
ATOM   6774  C  CD2 . LEU D  1 72  ? -7.901  57.981  -6.027   1.00 67.19  ? 98  LEU D CD2 1 
ATOM   6775  N  N   . GLY D  1 73  ? -11.103 55.740  -2.050   1.00 73.35  ? 99  GLY D N   1 
ATOM   6776  C  CA  . GLY D  1 73  ? -12.362 55.223  -1.546   1.00 74.14  ? 99  GLY D CA  1 
ATOM   6777  C  C   . GLY D  1 73  ? -12.138 54.235  -0.419   1.00 72.79  ? 99  GLY D C   1 
ATOM   6778  O  O   . GLY D  1 73  ? -11.098 54.246  0.241    1.00 75.75  ? 99  GLY D O   1 
ATOM   6779  N  N   . GLY D  1 74  ? -13.137 53.382  -0.213   1.00 74.98  ? 100 GLY D N   1 
ATOM   6780  C  CA  . GLY D  1 74  ? -13.080 52.397  0.847    1.00 84.78  ? 100 GLY D CA  1 
ATOM   6781  C  C   . GLY D  1 74  ? -12.525 51.066  0.390    1.00 83.20  ? 100 GLY D C   1 
ATOM   6782  O  O   . GLY D  1 74  ? -11.506 51.019  -0.305   1.00 81.23  ? 100 GLY D O   1 
ATOM   6783  N  N   . ASN D  1 75  ? -13.186 49.973  0.779    1.00 85.06  ? 101 ASN D N   1 
ATOM   6784  C  CA  . ASN D  1 75  ? -12.760 48.650  0.332    1.00 83.53  ? 101 ASN D CA  1 
ATOM   6785  C  C   . ASN D  1 75  ? -12.939 48.498  -1.172   1.00 76.46  ? 101 ASN D C   1 
ATOM   6786  O  O   . ASN D  1 75  ? -12.012 48.092  -1.881   1.00 76.36  ? 101 ASN D O   1 
ATOM   6787  C  CB  . ASN D  1 75  ? -13.537 47.563  1.075    1.00 81.62  ? 101 ASN D CB  1 
ATOM   6788  C  CG  . ASN D  1 75  ? -13.127 47.442  2.527    1.00 88.05  ? 101 ASN D CG  1 
ATOM   6789  O  OD1 . ASN D  1 75  ? -12.024 47.828  2.904    1.00 89.95  ? 101 ASN D OD1 1 
ATOM   6790  N  ND2 . ASN D  1 75  ? -14.014 46.897  3.350    1.00 87.05  ? 101 ASN D ND2 1 
ATOM   6791  N  N   . SER D  1 76  ? -14.128 48.812  -1.675   1.00 67.14  ? 102 SER D N   1 
ATOM   6792  C  CA  . SER D  1 76  ? -14.401 48.795  -3.101   1.00 72.19  ? 102 SER D CA  1 
ATOM   6793  C  C   . SER D  1 76  ? -14.843 50.179  -3.550   1.00 71.79  ? 102 SER D C   1 
ATOM   6794  O  O   . SER D  1 76  ? -15.473 50.925  -2.792   1.00 74.32  ? 102 SER D O   1 
ATOM   6795  C  CB  . SER D  1 76  ? -15.470 47.756  -3.459   1.00 72.33  ? 102 SER D CB  1 
ATOM   6796  O  OG  . SER D  1 76  ? -15.042 46.449  -3.113   1.00 72.15  ? 102 SER D OG  1 
ATOM   6797  N  N   . PHE D  1 77  ? -14.489 50.520  -4.785   1.00 70.06  ? 103 PHE D N   1 
ATOM   6798  C  CA  . PHE D  1 77  ? -14.841 51.803  -5.379   1.00 73.18  ? 103 PHE D CA  1 
ATOM   6799  C  C   . PHE D  1 77  ? -14.593 51.713  -6.878   1.00 64.39  ? 103 PHE D C   1 
ATOM   6800  O  O   . PHE D  1 77  ? -13.797 50.893  -7.346   1.00 65.09  ? 103 PHE D O   1 
ATOM   6801  C  CB  . PHE D  1 77  ? -14.041 52.957  -4.766   1.00 71.31  ? 103 PHE D CB  1 
ATOM   6802  C  CG  . PHE D  1 77  ? -12.568 52.837  -4.974   1.00 70.75  ? 103 PHE D CG  1 
ATOM   6803  C  CD1 . PHE D  1 77  ? -11.963 53.420  -6.075   1.00 69.39  ? 103 PHE D CD1 1 
ATOM   6804  C  CD2 . PHE D  1 77  ? -11.786 52.126  -4.080   1.00 69.44  ? 103 PHE D CD2 1 
ATOM   6805  C  CE1 . PHE D  1 77  ? -10.607 53.301  -6.280   1.00 67.37  ? 103 PHE D CE1 1 
ATOM   6806  C  CE2 . PHE D  1 77  ? -10.427 52.006  -4.278   1.00 70.91  ? 103 PHE D CE2 1 
ATOM   6807  C  CZ  . PHE D  1 77  ? -9.835  52.595  -5.379   1.00 72.02  ? 103 PHE D CZ  1 
ATOM   6808  N  N   . TYR D  1 78  ? -15.305 52.553  -7.623   1.00 59.78  ? 104 TYR D N   1 
ATOM   6809  C  CA  . TYR D  1 78  ? -15.274 52.550  -9.077   1.00 64.77  ? 104 TYR D CA  1 
ATOM   6810  C  C   . TYR D  1 78  ? -15.235 53.991  -9.558   1.00 65.19  ? 104 TYR D C   1 
ATOM   6811  O  O   . TYR D  1 78  ? -15.979 54.839  -9.062   1.00 71.44  ? 104 TYR D O   1 
ATOM   6812  C  CB  . TYR D  1 78  ? -16.492 51.827  -9.682   1.00 66.36  ? 104 TYR D CB  1 
ATOM   6813  C  CG  . TYR D  1 78  ? -16.623 50.379  -9.261   1.00 70.05  ? 104 TYR D CG  1 
ATOM   6814  C  CD1 . TYR D  1 78  ? -16.470 49.349  -10.183  1.00 67.22  ? 104 TYR D CD1 1 
ATOM   6815  C  CD2 . TYR D  1 78  ? -16.919 50.042  -7.944   1.00 71.85  ? 104 TYR D CD2 1 
ATOM   6816  C  CE1 . TYR D  1 78  ? -16.585 48.028  -9.795   1.00 68.37  ? 104 TYR D CE1 1 
ATOM   6817  C  CE2 . TYR D  1 78  ? -17.026 48.736  -7.545   1.00 74.08  ? 104 TYR D CE2 1 
ATOM   6818  C  CZ  . TYR D  1 78  ? -16.866 47.730  -8.471   1.00 78.40  ? 104 TYR D CZ  1 
ATOM   6819  O  OH  . TYR D  1 78  ? -16.990 46.425  -8.058   1.00 79.37  ? 104 TYR D OH  1 
ATOM   6820  N  N   . LEU D  1 79  ? -14.365 54.267  -10.514  1.00 63.62  ? 105 LEU D N   1 
ATOM   6821  C  CA  . LEU D  1 79  ? -14.171 55.609  -11.044  1.00 67.49  ? 105 LEU D CA  1 
ATOM   6822  C  C   . LEU D  1 79  ? -14.102 55.556  -12.561  1.00 64.47  ? 105 LEU D C   1 
ATOM   6823  O  O   . LEU D  1 79  ? -13.788 54.510  -13.140  1.00 62.89  ? 105 LEU D O   1 
ATOM   6824  C  CB  . LEU D  1 79  ? -12.906 56.258  -10.457  1.00 64.73  ? 105 LEU D CB  1 
ATOM   6825  C  CG  . LEU D  1 79  ? -12.720 56.148  -8.934   1.00 66.36  ? 105 LEU D CG  1 
ATOM   6826  C  CD1 . LEU D  1 79  ? -11.310 56.580  -8.556   1.00 59.27  ? 105 LEU D CD1 1 
ATOM   6827  C  CD2 . LEU D  1 79  ? -13.785 56.939  -8.151   1.00 68.34  ? 105 LEU D CD2 1 
ATOM   6828  N  N   . PRO D  1 80  ? -14.414 56.661  -13.240  1.00 65.52  ? 106 PRO D N   1 
ATOM   6829  C  CA  . PRO D  1 80  ? -14.679 56.600  -14.687  1.00 74.33  ? 106 PRO D CA  1 
ATOM   6830  C  C   . PRO D  1 80  ? -13.470 56.116  -15.468  1.00 73.24  ? 106 PRO D C   1 
ATOM   6831  O  O   . PRO D  1 80  ? -12.356 56.638  -15.307  1.00 72.43  ? 106 PRO D O   1 
ATOM   6832  C  CB  . PRO D  1 80  ? -15.025 58.051  -15.045  1.00 70.27  ? 106 PRO D CB  1 
ATOM   6833  C  CG  . PRO D  1 80  ? -15.500 58.647  -13.767  1.00 73.48  ? 106 PRO D CG  1 
ATOM   6834  C  CD  . PRO D  1 80  ? -14.660 58.013  -12.706  1.00 65.68  ? 106 PRO D CD  1 
ATOM   6835  N  N   . PRO D  1 81  ? -13.663 55.128  -16.346  1.00 75.62  ? 107 PRO D N   1 
ATOM   6836  C  CA  . PRO D  1 81  ? -12.538 54.592  -17.124  1.00 75.87  ? 107 PRO D CA  1 
ATOM   6837  C  C   . PRO D  1 81  ? -12.003 55.580  -18.150  1.00 76.77  ? 107 PRO D C   1 
ATOM   6838  O  O   . PRO D  1 81  ? -12.478 56.717  -18.245  1.00 73.90  ? 107 PRO D O   1 
ATOM   6839  C  CB  . PRO D  1 81  ? -13.142 53.352  -17.797  1.00 70.15  ? 107 PRO D CB  1 
ATOM   6840  C  CG  . PRO D  1 81  ? -14.603 53.652  -17.889  1.00 71.06  ? 107 PRO D CG  1 
ATOM   6841  C  CD  . PRO D  1 81  ? -14.936 54.459  -16.665  1.00 73.70  ? 107 PRO D CD  1 
ATOM   6842  N  N   . ALA D  1 82  ? -11.010 55.150  -18.923  1.00 71.93  ? 108 ALA D N   1 
ATOM   6843  C  CA  . ALA D  1 82  ? -10.350 55.997  -19.902  1.00 62.69  ? 108 ALA D CA  1 
ATOM   6844  C  C   . ALA D  1 82  ? -10.957 55.797  -21.286  1.00 69.96  ? 108 ALA D C   1 
ATOM   6845  O  O   . ALA D  1 82  ? -11.523 54.743  -21.593  1.00 69.56  ? 108 ALA D O   1 
ATOM   6846  C  CB  . ALA D  1 82  ? -8.849  55.707  -19.945  1.00 52.78  ? 108 ALA D CB  1 
ATOM   6847  N  N   . GLY D  1 83  ? -10.836 56.826  -22.116  1.00 63.18  ? 109 GLY D N   1 
ATOM   6848  C  CA  . GLY D  1 83  ? -11.321 56.762  -23.478  1.00 66.23  ? 109 GLY D CA  1 
ATOM   6849  C  C   . GLY D  1 83  ? -12.767 57.200  -23.611  1.00 75.37  ? 109 GLY D C   1 
ATOM   6850  O  O   . GLY D  1 83  ? -13.335 57.890  -22.758  1.00 68.16  ? 109 GLY D O   1 
ATOM   6851  N  N   . ALA D  1 84  ? -13.371 56.783  -24.726  1.00 83.07  ? 110 ALA D N   1 
ATOM   6852  C  CA  . ALA D  1 84  ? -14.775 57.072  -24.985  1.00 75.65  ? 110 ALA D CA  1 
ATOM   6853  C  C   . ALA D  1 84  ? -15.713 56.279  -24.086  1.00 71.99  ? 110 ALA D C   1 
ATOM   6854  O  O   . ALA D  1 84  ? -16.908 56.585  -24.050  1.00 75.20  ? 110 ALA D O   1 
ATOM   6855  C  CB  . ALA D  1 84  ? -15.106 56.794  -26.453  1.00 74.79  ? 110 ALA D CB  1 
ATOM   6856  N  N   . ALA D  1 85  ? -15.207 55.275  -23.365  1.00 74.95  ? 111 ALA D N   1 
ATOM   6857  C  CA  . ALA D  1 85  ? -16.056 54.530  -22.441  1.00 78.69  ? 111 ALA D CA  1 
ATOM   6858  C  C   . ALA D  1 85  ? -16.422 55.371  -21.224  1.00 76.98  ? 111 ALA D C   1 
ATOM   6859  O  O   . ALA D  1 85  ? -17.579 55.372  -20.787  1.00 73.90  ? 111 ALA D O   1 
ATOM   6860  C  CB  . ALA D  1 85  ? -15.360 53.239  -22.011  1.00 67.72  ? 111 ALA D CB  1 
ATOM   6861  N  N   . GLY D  1 86  ? -15.456 56.091  -20.666  1.00 76.38  ? 112 GLY D N   1 
ATOM   6862  C  CA  . GLY D  1 86  ? -15.679 56.913  -19.498  1.00 77.63  ? 112 GLY D CA  1 
ATOM   6863  C  C   . GLY D  1 86  ? -16.199 58.306  -19.771  1.00 79.71  ? 112 GLY D C   1 
ATOM   6864  O  O   . GLY D  1 86  ? -16.269 59.116  -18.841  1.00 79.88  ? 112 GLY D O   1 
ATOM   6865  N  N   . ASP D  1 87  ? -16.569 58.616  -21.018  1.00 84.03  ? 113 ASP D N   1 
ATOM   6866  C  CA  . ASP D  1 87  ? -17.061 59.955  -21.330  1.00 83.78  ? 113 ASP D CA  1 
ATOM   6867  C  C   . ASP D  1 87  ? -18.410 60.227  -20.673  1.00 90.94  ? 113 ASP D C   1 
ATOM   6868  O  O   . ASP D  1 87  ? -18.700 61.372  -20.306  1.00 88.80  ? 113 ASP D O   1 
ATOM   6869  C  CB  . ASP D  1 87  ? -17.154 60.142  -22.847  1.00 79.87  ? 113 ASP D CB  1 
ATOM   6870  C  CG  . ASP D  1 87  ? -18.314 59.371  -23.469  1.00 93.14  ? 113 ASP D CG  1 
ATOM   6871  O  OD1 . ASP D  1 87  ? -18.821 59.810  -24.525  1.00 91.42  ? 113 ASP D OD1 1 
ATOM   6872  O  OD2 . ASP D  1 87  ? -18.722 58.332  -22.904  1.00 94.81  ? 113 ASP D OD2 1 
ATOM   6873  N  N   . ARG D  1 88  ? -19.243 59.196  -20.514  1.00 92.05  ? 114 ARG D N   1 
ATOM   6874  C  CA  . ARG D  1 88  ? -20.550 59.379  -19.893  1.00 91.41  ? 114 ARG D CA  1 
ATOM   6875  C  C   . ARG D  1 88  ? -20.431 59.484  -18.377  1.00 86.65  ? 114 ARG D C   1 
ATOM   6876  O  O   . ARG D  1 88  ? -20.942 60.434  -17.771  1.00 80.24  ? 114 ARG D O   1 
ATOM   6877  C  CB  . ARG D  1 88  ? -21.483 58.229  -20.281  1.00 91.69  ? 114 ARG D CB  1 
ATOM   6878  C  CG  . ARG D  1 88  ? -22.876 58.329  -19.672  1.00 86.09  ? 114 ARG D CG  1 
ATOM   6879  C  CD  . ARG D  1 88  ? -23.603 59.561  -20.189  1.00 99.41  ? 114 ARG D CD  1 
ATOM   6880  N  NE  . ARG D  1 88  ? -24.156 60.375  -19.109  1.00 106.28 ? 114 ARG D NE  1 
ATOM   6881  C  CZ  . ARG D  1 88  ? -24.479 61.660  -19.234  1.00 107.32 ? 114 ARG D CZ  1 
ATOM   6882  N  NH1 . ARG D  1 88  ? -24.299 62.280  -20.393  1.00 103.20 ? 114 ARG D NH1 1 
ATOM   6883  N  NH2 . ARG D  1 88  ? -24.975 62.328  -18.200  1.00 96.33  ? 114 ARG D NH2 1 
ATOM   6884  N  N   . ALA D  1 89  ? -19.748 58.522  -17.752  1.00 88.47  ? 115 ALA D N   1 
ATOM   6885  C  CA  . ALA D  1 89  ? -19.635 58.480  -16.298  1.00 85.34  ? 115 ALA D CA  1 
ATOM   6886  C  C   . ALA D  1 89  ? -18.855 59.656  -15.724  1.00 83.30  ? 115 ALA D C   1 
ATOM   6887  O  O   . ALA D  1 89  ? -18.814 59.806  -14.497  1.00 79.18  ? 115 ALA D O   1 
ATOM   6888  C  CB  . ALA D  1 89  ? -18.985 57.165  -15.860  1.00 73.82  ? 115 ALA D CB  1 
ATOM   6889  N  N   . ARG D  1 90  ? -18.235 60.485  -16.566  1.00 85.09  ? 116 ARG D N   1 
ATOM   6890  C  CA  . ARG D  1 90  ? -17.567 61.700  -16.116  1.00 84.20  ? 116 ARG D CA  1 
ATOM   6891  C  C   . ARG D  1 90  ? -18.379 62.959  -16.372  1.00 84.70  ? 116 ARG D C   1 
ATOM   6892  O  O   . ARG D  1 90  ? -17.866 64.062  -16.160  1.00 83.25  ? 116 ARG D O   1 
ATOM   6893  C  CB  . ARG D  1 90  ? -16.191 61.845  -16.764  1.00 81.28  ? 116 ARG D CB  1 
ATOM   6894  C  CG  . ARG D  1 90  ? -15.076 61.276  -15.925  1.00 79.32  ? 116 ARG D CG  1 
ATOM   6895  C  CD  . ARG D  1 90  ? -13.723 61.542  -16.530  1.00 84.65  ? 116 ARG D CD  1 
ATOM   6896  N  NE  . ARG D  1 90  ? -13.751 61.411  -17.981  1.00 83.32  ? 116 ARG D NE  1 
ATOM   6897  C  CZ  . ARG D  1 90  ? -13.216 60.399  -18.653  1.00 84.20  ? 116 ARG D CZ  1 
ATOM   6898  N  NH1 . ARG D  1 90  ? -13.290 60.375  -19.978  1.00 77.73  ? 116 ARG D NH1 1 
ATOM   6899  N  NH2 . ARG D  1 90  ? -12.611 59.412  -18.003  1.00 77.62  ? 116 ARG D NH2 1 
ATOM   6900  N  N   . ALA D  1 91  ? -19.638 62.828  -16.792  1.00 87.91  ? 117 ALA D N   1 
ATOM   6901  C  CA  . ALA D  1 91  ? -20.559 63.959  -16.771  1.00 84.04  ? 117 ALA D CA  1 
ATOM   6902  C  C   . ALA D  1 91  ? -20.838 64.362  -15.326  1.00 86.68  ? 117 ALA D C   1 
ATOM   6903  O  O   . ALA D  1 91  ? -21.705 65.202  -15.059  1.00 73.18  ? 117 ALA D O   1 
ATOM   6904  C  CB  . ALA D  1 91  ? -21.864 63.611  -17.491  1.00 84.70  ? 117 ALA D CB  1 
ATOM   6905  N  N   . ARG D  1 92  ? -20.117 63.739  -14.391  1.00 92.92  ? 118 ARG D N   1 
ATOM   6906  C  CA  . ARG D  1 92  ? -20.360 63.841  -12.959  1.00 81.64  ? 118 ARG D CA  1 
ATOM   6907  C  C   . ARG D  1 92  ? -19.087 64.320  -12.262  1.00 74.78  ? 118 ARG D C   1 
ATOM   6908  O  O   . ARG D  1 92  ? -19.063 65.369  -11.621  1.00 72.44  ? 118 ARG D O   1 
ATOM   6909  C  CB  . ARG D  1 92  ? -20.784 62.484  -12.376  1.00 73.78  ? 118 ARG D CB  1 
ATOM   6910  C  CG  . ARG D  1 92  ? -21.541 61.523  -13.319  1.00 82.89  ? 118 ARG D CG  1 
ATOM   6911  C  CD  . ARG D  1 92  ? -22.687 62.170  -14.085  1.00 77.91  ? 118 ARG D CD  1 
ATOM   6912  N  NE  . ARG D  1 92  ? -23.981 61.950  -13.467  1.00 83.11  ? 118 ARG D NE  1 
ATOM   6913  C  CZ  . ARG D  1 92  ? -25.136 62.274  -14.033  1.00 78.48  ? 118 ARG D CZ  1 
ATOM   6914  N  NH1 . ARG D  1 92  ? -25.159 62.852  -15.230  1.00 78.14  ? 118 ARG D NH1 1 
ATOM   6915  N  NH2 . ARG D  1 92  ? -26.266 62.036  -13.388  1.00 71.15  ? 118 ARG D NH2 1 
ATOM   6916  N  N   . ASP D  1 100 ? -8.864  64.839  -12.282  1.00 64.73  ? 126 ASP D N   1 
ATOM   6917  C  CA  . ASP D  1 100 ? -9.538  63.545  -12.230  1.00 69.25  ? 126 ASP D CA  1 
ATOM   6918  C  C   . ASP D  1 100 ? -8.778  62.593  -11.310  1.00 66.37  ? 126 ASP D C   1 
ATOM   6919  O  O   . ASP D  1 100 ? -7.553  62.511  -11.376  1.00 71.09  ? 126 ASP D O   1 
ATOM   6920  C  CB  . ASP D  1 100 ? -9.679  62.962  -13.636  1.00 85.22  ? 126 ASP D CB  1 
ATOM   6921  C  CG  . ASP D  1 100 ? -10.336 63.934  -14.604  1.00 92.80  ? 126 ASP D CG  1 
ATOM   6922  O  OD1 . ASP D  1 100 ? -10.588 63.547  -15.766  1.00 83.56  ? 126 ASP D OD1 1 
ATOM   6923  O  OD2 . ASP D  1 100 ? -10.604 65.086  -14.198  1.00 96.89  ? 126 ASP D OD2 1 
ATOM   6924  N  N   . PRO D  1 101 ? -9.511  61.862  -10.459  1.00 69.86  ? 127 PRO D N   1 
ATOM   6925  C  CA  . PRO D  1 101 ? -8.885  61.241  -9.281   1.00 75.62  ? 127 PRO D CA  1 
ATOM   6926  C  C   . PRO D  1 101 ? -8.135  59.939  -9.535   1.00 69.55  ? 127 PRO D C   1 
ATOM   6927  O  O   . PRO D  1 101 ? -7.218  59.606  -8.778   1.00 73.75  ? 127 PRO D O   1 
ATOM   6928  C  CB  . PRO D  1 101 ? -10.081 61.005  -8.351   1.00 66.86  ? 127 PRO D CB  1 
ATOM   6929  C  CG  . PRO D  1 101 ? -11.211 60.751  -9.290   1.00 66.34  ? 127 PRO D CG  1 
ATOM   6930  C  CD  . PRO D  1 101 ? -10.967 61.636  -10.492  1.00 69.96  ? 127 PRO D CD  1 
ATOM   6931  N  N   . GLY D  1 102 ? -8.506  59.188  -10.568  1.00 59.71  ? 128 GLY D N   1 
ATOM   6932  C  CA  . GLY D  1 102 ? -7.907  57.880  -10.766  1.00 59.11  ? 128 GLY D CA  1 
ATOM   6933  C  C   . GLY D  1 102 ? -6.756  57.834  -11.753  1.00 60.83  ? 128 GLY D C   1 
ATOM   6934  O  O   . GLY D  1 102 ? -6.374  56.752  -12.212  1.00 53.81  ? 128 GLY D O   1 
ATOM   6935  N  N   . LEU D  1 103 ? -6.186  58.990  -12.081  1.00 56.91  ? 129 LEU D N   1 
ATOM   6936  C  CA  . LEU D  1 103 ? -5.160  59.098  -13.107  1.00 50.23  ? 129 LEU D CA  1 
ATOM   6937  C  C   . LEU D  1 103 ? -3.791  59.312  -12.475  1.00 56.45  ? 129 LEU D C   1 
ATOM   6938  O  O   . LEU D  1 103 ? -3.652  60.070  -11.509  1.00 60.35  ? 129 LEU D O   1 
ATOM   6939  C  CB  . LEU D  1 103 ? -5.475  60.248  -14.069  1.00 54.53  ? 129 LEU D CB  1 
ATOM   6940  C  CG  . LEU D  1 103 ? -4.558  60.429  -15.281  1.00 52.06  ? 129 LEU D CG  1 
ATOM   6941  C  CD1 . LEU D  1 103 ? -4.570  59.194  -16.172  1.00 44.21  ? 129 LEU D CD1 1 
ATOM   6942  C  CD2 . LEU D  1 103 ? -4.968  61.659  -16.067  1.00 47.13  ? 129 LEU D CD2 1 
ATOM   6943  N  N   . VAL D  1 104 ? -2.783  58.633  -13.023  1.00 56.45  ? 130 VAL D N   1 
ATOM   6944  C  CA  . VAL D  1 104 ? -1.387  58.811  -12.637  1.00 51.49  ? 130 VAL D CA  1 
ATOM   6945  C  C   . VAL D  1 104 ? -0.596  59.149  -13.894  1.00 54.23  ? 130 VAL D C   1 
ATOM   6946  O  O   . VAL D  1 104 ? -0.775  58.505  -14.934  1.00 49.09  ? 130 VAL D O   1 
ATOM   6947  C  CB  . VAL D  1 104 ? -0.810  57.555  -11.956  1.00 45.76  ? 130 VAL D CB  1 
ATOM   6948  C  CG1 . VAL D  1 104 ? 0.599   57.822  -11.436  1.00 41.05  ? 130 VAL D CG1 1 
ATOM   6949  C  CG2 . VAL D  1 104 ? -1.718  57.092  -10.837  1.00 42.56  ? 130 VAL D CG2 1 
ATOM   6950  N  N   . VAL D  1 105 ? 0.269   60.158  -13.803  1.00 52.87  ? 131 VAL D N   1 
ATOM   6951  C  CA  . VAL D  1 105 ? 1.050   60.638  -14.937  1.00 49.97  ? 131 VAL D CA  1 
ATOM   6952  C  C   . VAL D  1 105 ? 2.527   60.551  -14.578  1.00 47.77  ? 131 VAL D C   1 
ATOM   6953  O  O   . VAL D  1 105 ? 2.949   61.071  -13.539  1.00 57.87  ? 131 VAL D O   1 
ATOM   6954  C  CB  . VAL D  1 105 ? 0.663   62.079  -15.322  1.00 45.12  ? 131 VAL D CB  1 
ATOM   6955  C  CG1 . VAL D  1 105 ? 1.301   62.462  -16.644  1.00 41.06  ? 131 VAL D CG1 1 
ATOM   6956  C  CG2 . VAL D  1 105 ? -0.848  62.226  -15.393  1.00 39.42  ? 131 VAL D CG2 1 
ATOM   6957  N  N   . ILE D  1 106 ? 3.308   59.901  -15.436  1.00 43.99  ? 132 ILE D N   1 
ATOM   6958  C  CA  . ILE D  1 106 ? 4.742   59.729  -15.215  1.00 38.23  ? 132 ILE D CA  1 
ATOM   6959  C  C   . ILE D  1 106 ? 5.507   60.232  -16.435  1.00 43.20  ? 132 ILE D C   1 
ATOM   6960  O  O   . ILE D  1 106 ? 5.643   59.495  -17.423  1.00 41.22  ? 132 ILE D O   1 
ATOM   6961  C  CB  . ILE D  1 106 ? 5.089   58.259  -14.931  1.00 39.20  ? 132 ILE D CB  1 
ATOM   6962  C  CG1 . ILE D  1 106 ? 4.310   57.742  -13.723  1.00 39.53  ? 132 ILE D CG1 1 
ATOM   6963  C  CG2 . ILE D  1 106 ? 6.586   58.090  -14.718  1.00 32.49  ? 132 ILE D CG2 1 
ATOM   6964  C  CD1 . ILE D  1 106 ? 4.586   56.292  -13.414  1.00 35.42  ? 132 ILE D CD1 1 
ATOM   6965  N  N   . PRO D  1 107 ? 6.019   61.461  -16.419  1.00 47.34  ? 133 PRO D N   1 
ATOM   6966  C  CA  . PRO D  1 107 ? 6.806   61.946  -17.559  1.00 40.52  ? 133 PRO D CA  1 
ATOM   6967  C  C   . PRO D  1 107 ? 8.163   61.263  -17.648  1.00 35.08  ? 133 PRO D C   1 
ATOM   6968  O  O   . PRO D  1 107 ? 8.739   60.835  -16.644  1.00 34.36  ? 133 PRO D O   1 
ATOM   6969  C  CB  . PRO D  1 107 ? 6.959   63.444  -17.272  1.00 37.37  ? 133 PRO D CB  1 
ATOM   6970  C  CG  . PRO D  1 107 ? 6.788   63.565  -15.801  1.00 43.19  ? 133 PRO D CG  1 
ATOM   6971  C  CD  . PRO D  1 107 ? 5.793   62.512  -15.414  1.00 46.16  ? 133 PRO D CD  1 
ATOM   6972  N  N   . PHE D  1 108 ? 8.672   61.164  -18.877  1.00 36.09  ? 134 PHE D N   1 
ATOM   6973  C  CA  . PHE D  1 108 ? 9.998   60.616  -19.128  1.00 38.20  ? 134 PHE D CA  1 
ATOM   6974  C  C   . PHE D  1 108 ? 10.711  61.448  -20.187  1.00 41.01  ? 134 PHE D C   1 
ATOM   6975  O  O   . PHE D  1 108 ? 10.083  61.938  -21.130  1.00 41.51  ? 134 PHE D O   1 
ATOM   6976  C  CB  . PHE D  1 108 ? 9.936   59.138  -19.558  1.00 34.86  ? 134 PHE D CB  1 
ATOM   6977  C  CG  . PHE D  1 108 ? 9.053   58.873  -20.752  1.00 42.09  ? 134 PHE D CG  1 
ATOM   6978  C  CD1 . PHE D  1 108 ? 9.568   58.910  -22.039  1.00 46.42  ? 134 PHE D CD1 1 
ATOM   6979  C  CD2 . PHE D  1 108 ? 7.713   58.560  -20.586  1.00 38.03  ? 134 PHE D CD2 1 
ATOM   6980  C  CE1 . PHE D  1 108 ? 8.759   58.655  -23.136  1.00 40.42  ? 134 PHE D CE1 1 
ATOM   6981  C  CE2 . PHE D  1 108 ? 6.905   58.303  -21.676  1.00 36.80  ? 134 PHE D CE2 1 
ATOM   6982  C  CZ  . PHE D  1 108 ? 7.426   58.354  -22.951  1.00 40.76  ? 134 PHE D CZ  1 
ATOM   6983  N  N   . GLN D  1 109 ? 12.027  61.603  -20.019  1.00 40.62  ? 135 GLN D N   1 
ATOM   6984  C  CA  . GLN D  1 109 ? 12.845  62.400  -20.927  1.00 42.40  ? 135 GLN D CA  1 
ATOM   6985  C  C   . GLN D  1 109 ? 13.467  61.578  -22.047  1.00 37.99  ? 135 GLN D C   1 
ATOM   6986  O  O   . GLN D  1 109 ? 13.683  62.100  -23.146  1.00 36.47  ? 135 GLN D O   1 
ATOM   6987  C  CB  . GLN D  1 109 ? 13.967  63.098  -20.153  1.00 46.96  ? 135 GLN D CB  1 
ATOM   6988  C  CG  . GLN D  1 109 ? 13.524  63.778  -18.871  1.00 54.63  ? 135 GLN D CG  1 
ATOM   6989  C  CD  . GLN D  1 109 ? 14.637  64.587  -18.229  1.00 64.93  ? 135 GLN D CD  1 
ATOM   6990  O  OE1 . GLN D  1 109 ? 14.659  65.815  -18.327  1.00 75.38  ? 135 GLN D OE1 1 
ATOM   6991  N  NE2 . GLN D  1 109 ? 15.568  63.901  -17.569  1.00 51.62  ? 135 GLN D NE2 1 
ATOM   6992  N  N   . PHE D  1 110 ? 13.767  60.311  -21.786  1.00 34.40  ? 136 PHE D N   1 
ATOM   6993  C  CA  . PHE D  1 110 ? 14.457  59.457  -22.737  1.00 32.49  ? 136 PHE D CA  1 
ATOM   6994  C  C   . PHE D  1 110 ? 13.529  59.045  -23.878  1.00 39.88  ? 136 PHE D C   1 
ATOM   6995  O  O   . PHE D  1 110 ? 12.324  59.315  -23.876  1.00 42.48  ? 136 PHE D O   1 
ATOM   6996  C  CB  . PHE D  1 110 ? 14.990  58.213  -22.029  1.00 42.42  ? 136 PHE D CB  1 
ATOM   6997  C  CG  . PHE D  1 110 ? 13.992  57.579  -21.096  1.00 45.72  ? 136 PHE D CG  1 
ATOM   6998  C  CD1 . PHE D  1 110 ? 13.101  56.620  -21.557  1.00 41.20  ? 136 PHE D CD1 1 
ATOM   6999  C  CD2 . PHE D  1 110 ? 13.932  57.956  -19.764  1.00 39.18  ? 136 PHE D CD2 1 
ATOM   7000  C  CE1 . PHE D  1 110 ? 12.181  56.046  -20.703  1.00 38.75  ? 136 PHE D CE1 1 
ATOM   7001  C  CE2 . PHE D  1 110 ? 13.015  57.385  -18.909  1.00 40.88  ? 136 PHE D CE2 1 
ATOM   7002  C  CZ  . PHE D  1 110 ? 12.139  56.427  -19.376  1.00 39.04  ? 136 PHE D CZ  1 
ATOM   7003  N  N   . ALA D  1 111 ? 14.115  58.372  -24.865  1.00 41.00  ? 137 ALA D N   1 
ATOM   7004  C  CA  . ALA D  1 111 ? 13.345  57.790  -25.954  1.00 36.39  ? 137 ALA D CA  1 
ATOM   7005  C  C   . ALA D  1 111 ? 12.642  56.527  -25.471  1.00 41.50  ? 137 ALA D C   1 
ATOM   7006  O  O   . ALA D  1 111 ? 13.242  55.686  -24.795  1.00 39.34  ? 137 ALA D O   1 
ATOM   7007  C  CB  . ALA D  1 111 ? 14.256  57.471  -27.138  1.00 33.24  ? 137 ALA D CB  1 
ATOM   7008  N  N   . TRP D  1 112 ? 11.368  56.398  -25.821  1.00 40.32  ? 138 TRP D N   1 
ATOM   7009  C  CA  . TRP D  1 112 ? 10.554  55.304  -25.300  1.00 36.29  ? 138 TRP D CA  1 
ATOM   7010  C  C   . TRP D  1 112 ? 11.074  53.962  -25.795  1.00 39.22  ? 138 TRP D C   1 
ATOM   7011  O  O   . TRP D  1 112 ? 11.121  53.732  -27.012  1.00 37.29  ? 138 TRP D O   1 
ATOM   7012  C  CB  . TRP D  1 112 ? 9.094   55.486  -25.695  1.00 34.74  ? 138 TRP D CB  1 
ATOM   7013  C  CG  . TRP D  1 112 ? 8.191   54.432  -25.117  1.00 41.57  ? 138 TRP D CG  1 
ATOM   7014  C  CD1 . TRP D  1 112 ? 7.437   53.526  -25.808  1.00 39.95  ? 138 TRP D CD1 1 
ATOM   7015  C  CD2 . TRP D  1 112 ? 7.962   54.163  -23.726  1.00 39.71  ? 138 TRP D CD2 1 
ATOM   7016  N  NE1 . TRP D  1 112 ? 6.748   52.719  -24.937  1.00 35.51  ? 138 TRP D NE1 1 
ATOM   7017  C  CE2 . TRP D  1 112 ? 7.052   53.091  -23.653  1.00 40.60  ? 138 TRP D CE2 1 
ATOM   7018  C  CE3 . TRP D  1 112 ? 8.432   54.731  -22.536  1.00 33.36  ? 138 TRP D CE3 1 
ATOM   7019  C  CZ2 . TRP D  1 112 ? 6.606   52.573  -22.436  1.00 42.58  ? 138 TRP D CZ2 1 
ATOM   7020  C  CZ3 . TRP D  1 112 ? 7.990   54.215  -21.333  1.00 37.80  ? 138 TRP D CZ3 1 
ATOM   7021  C  CH2 . TRP D  1 112 ? 7.088   53.147  -21.290  1.00 36.85  ? 138 TRP D CH2 1 
ATOM   7022  N  N   . PRO D  1 113 ? 11.465  53.052  -24.902  1.00 40.61  ? 139 PRO D N   1 
ATOM   7023  C  CA  . PRO D  1 113 ? 12.035  51.775  -25.330  1.00 40.13  ? 139 PRO D CA  1 
ATOM   7024  C  C   . PRO D  1 113 ? 10.998  50.702  -25.604  1.00 39.59  ? 139 PRO D C   1 
ATOM   7025  O  O   . PRO D  1 113 ? 11.366  49.526  -25.684  1.00 39.47  ? 139 PRO D O   1 
ATOM   7026  C  CB  . PRO D  1 113 ? 12.903  51.386  -24.128  1.00 32.51  ? 139 PRO D CB  1 
ATOM   7027  C  CG  . PRO D  1 113 ? 12.156  51.955  -22.951  1.00 28.92  ? 139 PRO D CG  1 
ATOM   7028  C  CD  . PRO D  1 113 ? 11.321  53.118  -23.439  1.00 32.63  ? 139 PRO D CD  1 
ATOM   7029  N  N   . ARG D  1 114 ? 9.724   51.094  -25.693  1.00 39.72  ? 140 ARG D N   1 
ATOM   7030  C  CA  . ARG D  1 114 ? 8.656   50.207  -26.123  1.00 40.30  ? 140 ARG D CA  1 
ATOM   7031  C  C   . ARG D  1 114 ? 8.276   49.194  -25.054  1.00 40.93  ? 140 ARG D C   1 
ATOM   7032  O  O   . ARG D  1 114 ? 7.146   49.200  -24.557  1.00 39.28  ? 140 ARG D O   1 
ATOM   7033  C  CB  . ARG D  1 114 ? 9.086   49.474  -27.375  1.00 50.25  ? 140 ARG D CB  1 
ATOM   7034  C  CG  . ARG D  1 114 ? 8.034   48.668  -27.986  1.00 56.53  ? 140 ARG D CG  1 
ATOM   7035  C  CD  . ARG D  1 114 ? 7.846   49.133  -29.375  1.00 54.46  ? 140 ARG D CD  1 
ATOM   7036  N  NE  . ARG D  1 114 ? 6.749   48.387  -29.984  1.00 66.73  ? 140 ARG D NE  1 
ATOM   7037  C  CZ  . ARG D  1 114 ? 6.780   47.085  -30.256  1.00 68.05  ? 140 ARG D CZ  1 
ATOM   7038  N  NH1 . ARG D  1 114 ? 7.872   46.375  -30.006  1.00 69.80  ? 140 ARG D NH1 1 
ATOM   7039  N  NH2 . ARG D  1 114 ? 5.715   46.515  -30.797  1.00 61.49  ? 140 ARG D NH2 1 
ATOM   7040  N  N   . SER D  1 115 ? 9.206   48.298  -24.731  1.00 44.55  ? 141 SER D N   1 
ATOM   7041  C  CA  . SER D  1 115 ? 9.012   47.291  -23.700  1.00 44.58  ? 141 SER D CA  1 
ATOM   7042  C  C   . SER D  1 115 ? 9.220   47.893  -22.316  1.00 39.25  ? 141 SER D C   1 
ATOM   7043  O  O   . SER D  1 115 ? 9.986   48.843  -22.137  1.00 41.13  ? 141 SER D O   1 
ATOM   7044  C  CB  . SER D  1 115 ? 9.981   46.131  -23.917  1.00 45.48  ? 141 SER D CB  1 
ATOM   7045  O  OG  . SER D  1 115 ? 11.312  46.602  -23.909  1.00 41.05  ? 141 SER D OG  1 
ATOM   7046  N  N   . PHE D  1 116 ? 8.545   47.315  -21.328  1.00 37.06  ? 142 PHE D N   1 
ATOM   7047  C  CA  . PHE D  1 116 ? 8.493   47.902  -19.996  1.00 36.55  ? 142 PHE D CA  1 
ATOM   7048  C  C   . PHE D  1 116 ? 8.014   46.841  -19.012  1.00 40.39  ? 142 PHE D C   1 
ATOM   7049  O  O   . PHE D  1 116 ? 7.675   45.718  -19.394  1.00 41.93  ? 142 PHE D O   1 
ATOM   7050  C  CB  . PHE D  1 116 ? 7.572   49.124  -19.977  1.00 34.00  ? 142 PHE D CB  1 
ATOM   7051  C  CG  . PHE D  1 116 ? 6.126   48.791  -20.221  1.00 37.83  ? 142 PHE D CG  1 
ATOM   7052  C  CD1 . PHE D  1 116 ? 5.650   48.595  -21.511  1.00 37.53  ? 142 PHE D CD1 1 
ATOM   7053  C  CD2 . PHE D  1 116 ? 5.245   48.662  -19.160  1.00 34.32  ? 142 PHE D CD2 1 
ATOM   7054  C  CE1 . PHE D  1 116 ? 4.322   48.282  -21.738  1.00 37.08  ? 142 PHE D CE1 1 
ATOM   7055  C  CE2 . PHE D  1 116 ? 3.915   48.349  -19.378  1.00 39.12  ? 142 PHE D CE2 1 
ATOM   7056  C  CZ  . PHE D  1 116 ? 3.452   48.160  -20.672  1.00 45.99  ? 142 PHE D CZ  1 
ATOM   7057  N  N   . THR D  1 117 ? 7.983   47.214  -17.732  1.00 37.68  ? 143 THR D N   1 
ATOM   7058  C  CA  . THR D  1 117 ? 7.401   46.392  -16.677  1.00 35.93  ? 143 THR D CA  1 
ATOM   7059  C  C   . THR D  1 117 ? 6.577   47.300  -15.777  1.00 39.00  ? 143 THR D C   1 
ATOM   7060  O  O   . THR D  1 117 ? 7.112   48.257  -15.209  1.00 40.21  ? 143 THR D O   1 
ATOM   7061  C  CB  . THR D  1 117 ? 8.479   45.667  -15.863  1.00 36.18  ? 143 THR D CB  1 
ATOM   7062  O  OG1 . THR D  1 117 ? 9.226   44.788  -16.716  1.00 38.98  ? 143 THR D OG1 1 
ATOM   7063  C  CG2 . THR D  1 117 ? 7.848   44.856  -14.746  1.00 34.43  ? 143 THR D CG2 1 
ATOM   7064  N  N   . LEU D  1 118 ? 5.285   47.008  -15.654  1.00 37.31  ? 144 LEU D N   1 
ATOM   7065  C  CA  . LEU D  1 118 ? 4.387   47.776  -14.803  1.00 30.66  ? 144 LEU D CA  1 
ATOM   7066  C  C   . LEU D  1 118 ? 4.208   47.071  -13.465  1.00 37.16  ? 144 LEU D C   1 
ATOM   7067  O  O   . LEU D  1 118 ? 4.053   45.849  -13.410  1.00 33.94  ? 144 LEU D O   1 
ATOM   7068  C  CB  . LEU D  1 118 ? 3.025   47.970  -15.468  1.00 27.02  ? 144 LEU D CB  1 
ATOM   7069  C  CG  . LEU D  1 118 ? 1.973   48.695  -14.625  1.00 32.18  ? 144 LEU D CG  1 
ATOM   7070  C  CD1 . LEU D  1 118 ? 2.401   50.118  -14.341  1.00 32.20  ? 144 LEU D CD1 1 
ATOM   7071  C  CD2 . LEU D  1 118 ? 0.612   48.671  -15.304  1.00 35.20  ? 144 LEU D CD2 1 
ATOM   7072  N  N   . ILE D  1 119 ? 4.242   47.849  -12.387  1.00 38.43  ? 145 ILE D N   1 
ATOM   7073  C  CA  . ILE D  1 119 ? 4.011   47.344  -11.040  1.00 37.07  ? 145 ILE D CA  1 
ATOM   7074  C  C   . ILE D  1 119 ? 3.074   48.307  -10.326  1.00 44.02  ? 145 ILE D C   1 
ATOM   7075  O  O   . ILE D  1 119 ? 3.413   49.482  -10.132  1.00 40.37  ? 145 ILE D O   1 
ATOM   7076  C  CB  . ILE D  1 119 ? 5.316   47.169  -10.250  1.00 39.73  ? 145 ILE D CB  1 
ATOM   7077  C  CG1 . ILE D  1 119 ? 6.113   45.991  -10.807  1.00 39.17  ? 145 ILE D CG1 1 
ATOM   7078  C  CG2 . ILE D  1 119 ? 5.013   46.943  -8.775   1.00 45.26  ? 145 ILE D CG2 1 
ATOM   7079  C  CD1 . ILE D  1 119 ? 7.357   45.682  -10.019  1.00 42.62  ? 145 ILE D CD1 1 
ATOM   7080  N  N   . VAL D  1 120 ? 1.902   47.808  -9.938   1.00 41.80  ? 146 VAL D N   1 
ATOM   7081  C  CA  . VAL D  1 120 ? 0.876   48.587  -9.259   1.00 42.96  ? 146 VAL D CA  1 
ATOM   7082  C  C   . VAL D  1 120 ? 0.642   47.972  -7.887   1.00 45.21  ? 146 VAL D C   1 
ATOM   7083  O  O   . VAL D  1 120 ? 0.623   46.744  -7.745   1.00 42.14  ? 146 VAL D O   1 
ATOM   7084  C  CB  . VAL D  1 120 ? -0.432  48.625  -10.079  1.00 42.50  ? 146 VAL D CB  1 
ATOM   7085  C  CG1 . VAL D  1 120 ? -1.413  49.638  -9.497   1.00 40.20  ? 146 VAL D CG1 1 
ATOM   7086  C  CG2 . VAL D  1 120 ? -0.130  48.932  -11.534  1.00 44.07  ? 146 VAL D CG2 1 
ATOM   7087  N  N   . GLU D  1 121 ? 0.469   48.827  -6.878   1.00 48.46  ? 147 GLU D N   1 
ATOM   7088  C  CA  . GLU D  1 121 ? 0.309   48.395  -5.495   1.00 49.65  ? 147 GLU D CA  1 
ATOM   7089  C  C   . GLU D  1 121 ? -0.782  49.208  -4.817   1.00 56.65  ? 147 GLU D C   1 
ATOM   7090  O  O   . GLU D  1 121 ? -0.848  50.429  -4.984   1.00 55.39  ? 147 GLU D O   1 
ATOM   7091  C  CB  . GLU D  1 121 ? 1.613   48.546  -4.704   1.00 46.37  ? 147 GLU D CB  1 
ATOM   7092  C  CG  . GLU D  1 121 ? 2.734   47.646  -5.172   1.00 48.33  ? 147 GLU D CG  1 
ATOM   7093  C  CD  . GLU D  1 121 ? 4.050   47.982  -4.509   1.00 54.24  ? 147 GLU D CD  1 
ATOM   7094  O  OE1 . GLU D  1 121 ? 4.163   49.091  -3.942   1.00 50.69  ? 147 GLU D OE1 1 
ATOM   7095  O  OE2 . GLU D  1 121 ? 4.969   47.138  -4.557   1.00 59.55  ? 147 GLU D OE2 1 
ATOM   7096  N  N   . ALA D  1 122 ? -1.622  48.528  -4.039   1.00 62.96  ? 148 ALA D N   1 
ATOM   7097  C  CA  . ALA D  1 122 ? -2.665  49.161  -3.243   1.00 61.01  ? 148 ALA D CA  1 
ATOM   7098  C  C   . ALA D  1 122 ? -2.251  49.149  -1.777   1.00 57.82  ? 148 ALA D C   1 
ATOM   7099  O  O   . ALA D  1 122 ? -1.773  48.127  -1.274   1.00 59.66  ? 148 ALA D O   1 
ATOM   7100  C  CB  . ALA D  1 122 ? -4.005  48.447  -3.426   1.00 56.88  ? 148 ALA D CB  1 
ATOM   7101  N  N   . TRP D  1 123 ? -2.430  50.281  -1.100   1.00 60.48  ? 149 TRP D N   1 
ATOM   7102  C  CA  . TRP D  1 123 ? -1.992  50.452  0.278    1.00 69.77  ? 149 TRP D CA  1 
ATOM   7103  C  C   . TRP D  1 123 ? -3.133  50.999  1.124    1.00 74.62  ? 149 TRP D C   1 
ATOM   7104  O  O   . TRP D  1 123 ? -4.128  51.511  0.608    1.00 70.26  ? 149 TRP D O   1 
ATOM   7105  C  CB  . TRP D  1 123 ? -0.781  51.399  0.378    1.00 66.10  ? 149 TRP D CB  1 
ATOM   7106  C  CG  . TRP D  1 123 ? 0.481   50.857  -0.225   1.00 66.08  ? 149 TRP D CG  1 
ATOM   7107  C  CD1 . TRP D  1 123 ? 0.830   50.867  -1.542   1.00 66.41  ? 149 TRP D CD1 1 
ATOM   7108  C  CD2 . TRP D  1 123 ? 1.566   50.227  0.472    1.00 70.94  ? 149 TRP D CD2 1 
ATOM   7109  N  NE1 . TRP D  1 123 ? 2.062   50.282  -1.712   1.00 65.75  ? 149 TRP D NE1 1 
ATOM   7110  C  CE2 . TRP D  1 123 ? 2.535   49.880  -0.491   1.00 67.85  ? 149 TRP D CE2 1 
ATOM   7111  C  CE3 . TRP D  1 123 ? 1.812   49.924  1.815    1.00 68.29  ? 149 TRP D CE3 1 
ATOM   7112  C  CZ2 . TRP D  1 123 ? 3.729   49.245  -0.153   1.00 68.57  ? 149 TRP D CZ2 1 
ATOM   7113  C  CZ3 . TRP D  1 123 ? 2.998   49.295  2.147    1.00 65.61  ? 149 TRP D CZ3 1 
ATOM   7114  C  CH2 . TRP D  1 123 ? 3.941   48.962  1.168    1.00 68.45  ? 149 TRP D CH2 1 
ATOM   7115  N  N   . ASP D  1 124 ? -2.973  50.880  2.441    1.00 82.20  ? 150 ASP D N   1 
ATOM   7116  C  CA  . ASP D  1 124 ? -3.875  51.489  3.409    1.00 81.56  ? 150 ASP D CA  1 
ATOM   7117  C  C   . ASP D  1 124 ? -3.213  52.724  4.005    1.00 82.22  ? 150 ASP D C   1 
ATOM   7118  O  O   . ASP D  1 124 ? -1.996  52.747  4.216    1.00 82.11  ? 150 ASP D O   1 
ATOM   7119  C  CB  . ASP D  1 124 ? -4.242  50.500  4.519    1.00 82.58  ? 150 ASP D CB  1 
ATOM   7120  C  CG  . ASP D  1 124 ? -5.025  51.150  5.652    1.00 92.24  ? 150 ASP D CG  1 
ATOM   7121  O  OD1 . ASP D  1 124 ? -5.925  51.972  5.372    1.00 96.13  ? 150 ASP D OD1 1 
ATOM   7122  O  OD2 . ASP D  1 124 ? -4.736  50.841  6.828    1.00 93.41  ? 150 ASP D OD2 1 
ATOM   7123  N  N   . TRP D  1 125 ? -4.014  53.750  4.273    1.00 82.03  ? 151 TRP D N   1 
ATOM   7124  C  CA  . TRP D  1 125 ? -3.516  55.022  4.780    1.00 88.21  ? 151 TRP D CA  1 
ATOM   7125  C  C   . TRP D  1 125 ? -3.909  55.173  6.244    1.00 91.25  ? 151 TRP D C   1 
ATOM   7126  O  O   . TRP D  1 125 ? -5.097  55.116  6.581    1.00 92.70  ? 151 TRP D O   1 
ATOM   7127  C  CB  . TRP D  1 125 ? -4.055  56.187  3.949    1.00 87.69  ? 151 TRP D CB  1 
ATOM   7128  C  CG  . TRP D  1 125 ? -3.420  57.512  4.267    1.00 87.88  ? 151 TRP D CG  1 
ATOM   7129  C  CD1 . TRP D  1 125 ? -4.043  58.624  4.758    1.00 88.62  ? 151 TRP D CD1 1 
ATOM   7130  C  CD2 . TRP D  1 125 ? -2.037  57.863  4.116    1.00 89.91  ? 151 TRP D CD2 1 
ATOM   7131  N  NE1 . TRP D  1 125 ? -3.136  59.645  4.917    1.00 87.96  ? 151 TRP D NE1 1 
ATOM   7132  C  CE2 . TRP D  1 125 ? -1.898  59.203  4.532    1.00 88.65  ? 151 TRP D CE2 1 
ATOM   7133  C  CE3 . TRP D  1 125 ? -0.904  57.175  3.669    1.00 86.38  ? 151 TRP D CE3 1 
ATOM   7134  C  CZ2 . TRP D  1 125 ? -0.672  59.868  4.514    1.00 81.10  ? 151 TRP D CZ2 1 
ATOM   7135  C  CZ3 . TRP D  1 125 ? 0.313   57.838  3.653    1.00 80.07  ? 151 TRP D CZ3 1 
ATOM   7136  C  CH2 . TRP D  1 125 ? 0.418   59.169  4.072    1.00 75.68  ? 151 TRP D CH2 1 
ATOM   7137  N  N   . ASP D  1 126 ? -2.907  55.360  7.109    1.00 93.33  ? 152 ASP D N   1 
ATOM   7138  C  CA  . ASP D  1 126 ? -3.121  55.641  8.524    1.00 89.69  ? 152 ASP D CA  1 
ATOM   7139  C  C   . ASP D  1 126 ? -2.572  57.010  8.917    1.00 88.98  ? 152 ASP D C   1 
ATOM   7140  O  O   . ASP D  1 126 ? -2.222  57.226  10.082   1.00 85.18  ? 152 ASP D O   1 
ATOM   7141  C  CB  . ASP D  1 126 ? -2.505  54.541  9.390    1.00 83.72  ? 152 ASP D CB  1 
ATOM   7142  C  CG  . ASP D  1 126 ? -3.255  53.225  9.278    1.00 87.23  ? 152 ASP D CG  1 
ATOM   7143  O  OD1 . ASP D  1 126 ? -4.463  53.258  8.959    1.00 80.96  ? 152 ASP D OD1 1 
ATOM   7144  O  OD2 . ASP D  1 126 ? -2.640  52.162  9.510    1.00 83.58  ? 152 ASP D OD2 1 
ATOM   7145  N  N   . ASN D  1 127 ? -2.467  57.925  7.948    1.00 84.97  ? 153 ASN D N   1 
ATOM   7146  C  CA  . ASN D  1 127 ? -2.142  59.334  8.154    1.00 84.03  ? 153 ASN D CA  1 
ATOM   7147  C  C   . ASN D  1 127 ? -0.720  59.572  8.659    1.00 88.72  ? 153 ASN D C   1 
ATOM   7148  O  O   . ASN D  1 127 ? -0.289  60.726  8.758    1.00 91.24  ? 153 ASN D O   1 
ATOM   7149  C  CB  . ASN D  1 127 ? -3.156  59.980  9.106    1.00 84.91  ? 153 ASN D CB  1 
ATOM   7150  C  CG  . ASN D  1 127 ? -4.527  60.154  8.469    1.00 82.30  ? 153 ASN D CG  1 
ATOM   7151  O  OD1 . ASN D  1 127 ? -5.328  59.220  8.434    1.00 72.29  ? 153 ASN D OD1 1 
ATOM   7152  N  ND2 . ASN D  1 127 ? -4.802  61.354  7.963    1.00 92.02  ? 153 ASN D ND2 1 
ATOM   7153  N  N   . ASP D  1 128 ? 0.022   58.512  8.970    1.00 90.01  ? 154 ASP D N   1 
ATOM   7154  C  CA  . ASP D  1 128 ? 1.424   58.643  9.345    1.00 101.08 ? 154 ASP D CA  1 
ATOM   7155  C  C   . ASP D  1 128 ? 2.312   58.244  8.169    1.00 103.25 ? 154 ASP D C   1 
ATOM   7156  O  O   . ASP D  1 128 ? 1.934   57.417  7.335    1.00 99.87  ? 154 ASP D O   1 
ATOM   7157  C  CB  . ASP D  1 128 ? 1.752   57.800  10.582   1.00 101.58 ? 154 ASP D CB  1 
ATOM   7158  C  CG  . ASP D  1 128 ? 3.246   57.721  10.859   1.00 106.65 ? 154 ASP D CG  1 
ATOM   7159  O  OD1 . ASP D  1 128 ? 3.907   56.818  10.306   1.00 107.01 ? 154 ASP D OD1 1 
ATOM   7160  O  OD2 . ASP D  1 128 ? 3.764   58.574  11.612   1.00 109.51 ? 154 ASP D OD2 1 
ATOM   7161  N  N   . THR D  1 129 ? 3.507   58.836  8.121    1.00 104.78 ? 155 THR D N   1 
ATOM   7162  C  CA  . THR D  1 129 ? 4.319   58.886  6.911    1.00 105.52 ? 155 THR D CA  1 
ATOM   7163  C  C   . THR D  1 129 ? 5.567   58.006  6.956    1.00 105.64 ? 155 THR D C   1 
ATOM   7164  O  O   . THR D  1 129 ? 6.434   58.140  6.086    1.00 103.84 ? 155 THR D O   1 
ATOM   7165  C  CB  . THR D  1 129 ? 4.716   60.338  6.626    1.00 107.17 ? 155 THR D CB  1 
ATOM   7166  O  OG1 . THR D  1 129 ? 5.726   60.375  5.611    1.00 109.80 ? 155 THR D OG1 1 
ATOM   7167  C  CG2 . THR D  1 129 ? 5.238   61.008  7.893    1.00 101.71 ? 155 THR D CG2 1 
ATOM   7168  N  N   . THR D  1 130 ? 5.685   57.110  7.935    1.00 98.84  ? 156 THR D N   1 
ATOM   7169  C  CA  . THR D  1 130 ? 6.835   56.205  7.928    1.00 98.05  ? 156 THR D CA  1 
ATOM   7170  C  C   . THR D  1 130 ? 6.486   54.932  7.164    1.00 99.92  ? 156 THR D C   1 
ATOM   7171  O  O   . THR D  1 130 ? 5.459   54.308  7.456    1.00 102.18 ? 156 THR D O   1 
ATOM   7172  C  CB  . THR D  1 130 ? 7.266   55.860  9.351    1.00 98.02  ? 156 THR D CB  1 
ATOM   7173  O  OG1 . THR D  1 130 ? 8.066   56.925  9.881    1.00 100.38 ? 156 THR D OG1 1 
ATOM   7174  C  CG2 . THR D  1 130 ? 8.072   54.562  9.385    1.00 92.16  ? 156 THR D CG2 1 
ATOM   7175  N  N   . PRO D  1 131 ? 7.295   54.522  6.185    1.00 101.72 ? 157 PRO D N   1 
ATOM   7176  C  CA  . PRO D  1 131 ? 6.941   53.345  5.373    1.00 99.30  ? 157 PRO D CA  1 
ATOM   7177  C  C   . PRO D  1 131 ? 6.878   52.076  6.210    1.00 87.56  ? 157 PRO D C   1 
ATOM   7178  O  O   . PRO D  1 131 ? 7.848   51.691  6.867    1.00 87.66  ? 157 PRO D O   1 
ATOM   7179  C  CB  . PRO D  1 131 ? 8.062   53.284  4.328    1.00 99.65  ? 157 PRO D CB  1 
ATOM   7180  C  CG  . PRO D  1 131 ? 9.196   54.048  4.931    1.00 98.82  ? 157 PRO D CG  1 
ATOM   7181  C  CD  . PRO D  1 131 ? 8.561   55.135  5.748    1.00 103.04 ? 157 PRO D CD  1 
ATOM   7182  N  N   . ASN D  1 132 ? 5.716   51.425  6.176    1.00 84.22  ? 158 ASN D N   1 
ATOM   7183  C  CA  . ASN D  1 132 ? 5.475   50.176  6.890    1.00 77.27  ? 158 ASN D CA  1 
ATOM   7184  C  C   . ASN D  1 132 ? 4.958   49.149  5.894    1.00 70.90  ? 158 ASN D C   1 
ATOM   7185  O  O   . ASN D  1 132 ? 3.900   49.346  5.288    1.00 70.25  ? 158 ASN D O   1 
ATOM   7186  C  CB  . ASN D  1 132 ? 4.478   50.381  8.036    1.00 78.83  ? 158 ASN D CB  1 
ATOM   7187  C  CG  . ASN D  1 132 ? 4.275   49.127  8.873    1.00 78.74  ? 158 ASN D CG  1 
ATOM   7188  O  OD1 . ASN D  1 132 ? 5.028   48.158  8.764    1.00 78.62  ? 158 ASN D OD1 1 
ATOM   7189  N  ND2 . ASN D  1 132 ? 3.252   49.146  9.720    1.00 72.15  ? 158 ASN D ND2 1 
ATOM   7190  N  N   . GLU D  1 133 ? 5.699   48.050  5.737    1.00 66.29  ? 159 GLU D N   1 
ATOM   7191  C  CA  . GLU D  1 133 ? 5.382   47.073  4.701    1.00 67.98  ? 159 GLU D CA  1 
ATOM   7192  C  C   . GLU D  1 133 ? 4.075   46.340  4.986    1.00 74.40  ? 159 GLU D C   1 
ATOM   7193  O  O   . GLU D  1 133 ? 3.319   46.029  4.057    1.00 73.09  ? 159 GLU D O   1 
ATOM   7194  C  CB  . GLU D  1 133 ? 6.538   46.079  4.557    1.00 68.05  ? 159 GLU D CB  1 
ATOM   7195  C  CG  . GLU D  1 133 ? 6.141   44.682  4.077    1.00 63.14  ? 159 GLU D CG  1 
ATOM   7196  C  CD  . GLU D  1 133 ? 5.809   44.620  2.590    1.00 79.54  ? 159 GLU D CD  1 
ATOM   7197  O  OE1 . GLU D  1 133 ? 5.572   43.501  2.085    1.00 68.63  ? 159 GLU D OE1 1 
ATOM   7198  O  OE2 . GLU D  1 133 ? 5.790   45.678  1.923    1.00 84.45  ? 159 GLU D OE2 1 
ATOM   7199  N  N   . GLU D  1 134 ? 3.777   46.070  6.258    1.00 75.35  ? 160 GLU D N   1 
ATOM   7200  C  CA  . GLU D  1 134 ? 2.673   45.176  6.597    1.00 80.17  ? 160 GLU D CA  1 
ATOM   7201  C  C   . GLU D  1 134 ? 1.299   45.807  6.387    1.00 84.36  ? 160 GLU D C   1 
ATOM   7202  O  O   . GLU D  1 134 ? 0.299   45.305  6.913    1.00 81.44  ? 160 GLU D O   1 
ATOM   7203  C  CB  . GLU D  1 134 ? 2.809   44.695  8.043    1.00 81.46  ? 160 GLU D CB  1 
ATOM   7204  C  CG  . GLU D  1 134 ? 4.112   43.967  8.325    1.00 89.75  ? 160 GLU D CG  1 
ATOM   7205  C  CD  . GLU D  1 134 ? 4.018   43.055  9.530    1.00 89.86  ? 160 GLU D CD  1 
ATOM   7206  O  OE1 . GLU D  1 134 ? 4.153   41.825  9.357    1.00 90.22  ? 160 GLU D OE1 1 
ATOM   7207  O  OE2 . GLU D  1 134 ? 3.801   43.569  10.648   1.00 88.17  ? 160 GLU D OE2 1 
ATOM   7208  N  N   . LEU D  1 135 ? 1.234   46.896  5.619    1.00 78.52  ? 161 LEU D N   1 
ATOM   7209  C  CA  . LEU D  1 135 ? -0.029  47.535  5.263    1.00 74.91  ? 161 LEU D CA  1 
ATOM   7210  C  C   . LEU D  1 135 ? -0.317  47.467  3.770    1.00 71.47  ? 161 LEU D C   1 
ATOM   7211  O  O   . LEU D  1 135 ? -1.233  48.149  3.293    1.00 67.25  ? 161 LEU D O   1 
ATOM   7212  C  CB  . LEU D  1 135 ? -0.039  48.994  5.722    1.00 71.08  ? 161 LEU D CB  1 
ATOM   7213  C  CG  . LEU D  1 135 ? 0.580   49.274  7.093    1.00 72.90  ? 161 LEU D CG  1 
ATOM   7214  C  CD1 . LEU D  1 135 ? 0.901   50.758  7.217    1.00 72.35  ? 161 LEU D CD1 1 
ATOM   7215  C  CD2 . LEU D  1 135 ? -0.344  48.811  8.217    1.00 77.97  ? 161 LEU D CD2 1 
ATOM   7216  N  N   . LEU D  1 136 ? 0.443   46.674  3.023    1.00 68.55  ? 162 LEU D N   1 
ATOM   7217  C  CA  . LEU D  1 136 ? 0.220   46.521  1.593    1.00 65.91  ? 162 LEU D CA  1 
ATOM   7218  C  C   . LEU D  1 136 ? -0.991  45.630  1.342    1.00 65.09  ? 162 LEU D C   1 
ATOM   7219  O  O   . LEU D  1 136 ? -1.050  44.496  1.826    1.00 68.11  ? 162 LEU D O   1 
ATOM   7220  C  CB  . LEU D  1 136 ? 1.460   45.926  0.925    1.00 70.49  ? 162 LEU D CB  1 
ATOM   7221  C  CG  . LEU D  1 136 ? 1.309   45.508  -0.538   1.00 66.64  ? 162 LEU D CG  1 
ATOM   7222  C  CD1 . LEU D  1 136 ? 1.283   46.731  -1.448   1.00 60.48  ? 162 LEU D CD1 1 
ATOM   7223  C  CD2 . LEU D  1 136 ? 2.414   44.539  -0.943   1.00 57.87  ? 162 LEU D CD2 1 
ATOM   7224  N  N   . ILE D  1 137 ? -1.953  46.144  0.577    1.00 63.59  ? 163 ILE D N   1 
ATOM   7225  C  CA  . ILE D  1 137 ? -3.162  45.381  0.285    1.00 62.06  ? 163 ILE D CA  1 
ATOM   7226  C  C   . ILE D  1 137 ? -2.919  44.391  -0.846   1.00 57.47  ? 163 ILE D C   1 
ATOM   7227  O  O   . ILE D  1 137 ? -3.225  43.200  -0.722   1.00 64.94  ? 163 ILE D O   1 
ATOM   7228  C  CB  . ILE D  1 137 ? -4.330  46.330  -0.037   1.00 56.13  ? 163 ILE D CB  1 
ATOM   7229  C  CG1 . ILE D  1 137 ? -4.887  46.927  1.252    1.00 58.84  ? 163 ILE D CG1 1 
ATOM   7230  C  CG2 . ILE D  1 137 ? -5.420  45.589  -0.784   1.00 58.10  ? 163 ILE D CG2 1 
ATOM   7231  C  CD1 . ILE D  1 137 ? -5.517  48.284  1.093    1.00 63.98  ? 163 ILE D CD1 1 
ATOM   7232  N  N   . GLU D  1 138 ? -2.368  44.859  -1.962   1.00 55.21  ? 164 GLU D N   1 
ATOM   7233  C  CA  . GLU D  1 138 ? -2.150  43.985  -3.103   1.00 56.23  ? 164 GLU D CA  1 
ATOM   7234  C  C   . GLU D  1 138 ? -1.045  44.561  -3.976   1.00 52.12  ? 164 GLU D C   1 
ATOM   7235  O  O   . GLU D  1 138 ? -0.949  45.779  -4.139   1.00 50.77  ? 164 GLU D O   1 
ATOM   7236  C  CB  . GLU D  1 138 ? -3.441  43.808  -3.913   1.00 56.86  ? 164 GLU D CB  1 
ATOM   7237  C  CG  . GLU D  1 138 ? -3.325  42.871  -5.107   1.00 60.01  ? 164 GLU D CG  1 
ATOM   7238  C  CD  . GLU D  1 138 ? -3.015  41.438  -4.712   1.00 65.59  ? 164 GLU D CD  1 
ATOM   7239  O  OE1 . GLU D  1 138 ? -1.825  41.117  -4.498   1.00 70.67  ? 164 GLU D OE1 1 
ATOM   7240  O  OE2 . GLU D  1 138 ? -3.966  40.633  -4.612   1.00 64.19  ? 164 GLU D OE2 1 
ATOM   7241  N  N   . ARG D  1 139 ? -0.207  43.678  -4.513   1.00 50.66  ? 165 ARG D N   1 
ATOM   7242  C  CA  . ARG D  1 139 ? 0.819   44.034  -5.483   1.00 50.92  ? 165 ARG D CA  1 
ATOM   7243  C  C   . ARG D  1 139 ? 0.534   43.299  -6.783   1.00 51.60  ? 165 ARG D C   1 
ATOM   7244  O  O   . ARG D  1 139 ? 0.170   42.118  -6.774   1.00 57.82  ? 165 ARG D O   1 
ATOM   7245  C  CB  . ARG D  1 139 ? 2.234   43.691  -4.979   1.00 52.19  ? 165 ARG D CB  1 
ATOM   7246  C  CG  . ARG D  1 139 ? 3.345   44.053  -5.970   1.00 51.41  ? 165 ARG D CG  1 
ATOM   7247  C  CD  . ARG D  1 139 ? 4.744   43.716  -5.461   1.00 46.92  ? 165 ARG D CD  1 
ATOM   7248  N  NE  . ARG D  1 139 ? 5.187   44.620  -4.404   1.00 49.76  ? 165 ARG D NE  1 
ATOM   7249  C  CZ  . ARG D  1 139 ? 5.242   44.294  -3.116   1.00 56.58  ? 165 ARG D CZ  1 
ATOM   7250  N  NH1 . ARG D  1 139 ? 4.888   43.078  -2.723   1.00 55.75  ? 165 ARG D NH1 1 
ATOM   7251  N  NH2 . ARG D  1 139 ? 5.655   45.181  -2.220   1.00 56.89  ? 165 ARG D NH2 1 
ATOM   7252  N  N   . VAL D  1 140 ? 0.702   44.000  -7.899   1.00 48.67  ? 166 VAL D N   1 
ATOM   7253  C  CA  . VAL D  1 140 ? 0.332   43.498  -9.216   1.00 44.81  ? 166 VAL D CA  1 
ATOM   7254  C  C   . VAL D  1 140 ? 1.416   43.904  -10.205  1.00 41.15  ? 166 VAL D C   1 
ATOM   7255  O  O   . VAL D  1 140 ? 2.000   44.987  -10.086  1.00 40.38  ? 166 VAL D O   1 
ATOM   7256  C  CB  . VAL D  1 140 ? -1.059  44.034  -9.624   1.00 41.65  ? 166 VAL D CB  1 
ATOM   7257  C  CG1 . VAL D  1 140 ? -1.193  44.138  -11.124  1.00 46.38  ? 166 VAL D CG1 1 
ATOM   7258  C  CG2 . VAL D  1 140 ? -2.148  43.146  -9.046   1.00 43.50  ? 166 VAL D CG2 1 
ATOM   7259  N  N   . SER D  1 141 ? 1.704   43.030  -11.169  1.00 32.00  ? 167 SER D N   1 
ATOM   7260  C  CA  . SER D  1 141 ? 2.751   43.304  -12.141  1.00 40.23  ? 167 SER D CA  1 
ATOM   7261  C  C   . SER D  1 141 ? 2.308   42.864  -13.532  1.00 43.31  ? 167 SER D C   1 
ATOM   7262  O  O   . SER D  1 141 ? 1.440   42.002  -13.687  1.00 41.00  ? 167 SER D O   1 
ATOM   7263  C  CB  . SER D  1 141 ? 4.064   42.610  -11.759  1.00 35.31  ? 167 SER D CB  1 
ATOM   7264  O  OG  . SER D  1 141 ? 4.110   41.287  -12.264  1.00 35.70  ? 167 SER D OG  1 
ATOM   7265  N  N   . HIS D  1 142 ? 2.924   43.480  -14.545  1.00 38.78  ? 168 HIS D N   1 
ATOM   7266  C  CA  . HIS D  1 142 ? 2.720   43.139  -15.948  1.00 37.92  ? 168 HIS D CA  1 
ATOM   7267  C  C   . HIS D  1 142 ? 3.910   43.646  -16.753  1.00 40.33  ? 168 HIS D C   1 
ATOM   7268  O  O   . HIS D  1 142 ? 4.393   44.757  -16.519  1.00 42.12  ? 168 HIS D O   1 
ATOM   7269  C  CB  . HIS D  1 142 ? 1.425   43.743  -16.504  1.00 42.05  ? 168 HIS D CB  1 
ATOM   7270  C  CG  . HIS D  1 142 ? 1.343   43.719  -18.001  1.00 46.14  ? 168 HIS D CG  1 
ATOM   7271  N  ND1 . HIS D  1 142 ? 1.187   42.553  -18.720  1.00 45.05  ? 168 HIS D ND1 1 
ATOM   7272  C  CD2 . HIS D  1 142 ? 1.406   44.718  -18.914  1.00 47.81  ? 168 HIS D CD2 1 
ATOM   7273  C  CE1 . HIS D  1 142 ? 1.153   42.835  -20.010  1.00 44.09  ? 168 HIS D CE1 1 
ATOM   7274  N  NE2 . HIS D  1 142 ? 1.283   44.141  -20.155  1.00 44.47  ? 168 HIS D NE2 1 
ATOM   7275  N  N   . ALA D  1 143 ? 4.367   42.835  -17.706  1.00 34.91  ? 169 ALA D N   1 
ATOM   7276  C  CA  . ALA D  1 143 ? 5.520   43.167  -18.543  1.00 37.35  ? 169 ALA D CA  1 
ATOM   7277  C  C   . ALA D  1 143 ? 5.151   42.953  -20.010  1.00 38.91  ? 169 ALA D C   1 
ATOM   7278  O  O   . ALA D  1 143 ? 5.089   41.815  -20.484  1.00 36.48  ? 169 ALA D O   1 
ATOM   7279  C  CB  . ALA D  1 143 ? 6.734   42.330  -18.152  1.00 30.05  ? 169 ALA D CB  1 
ATOM   7280  N  N   . GLY D  1 144 ? 4.917   44.043  -20.735  1.00 38.39  ? 170 GLY D N   1 
ATOM   7281  C  CA  . GLY D  1 144 ? 4.569   43.937  -22.139  1.00 43.20  ? 170 GLY D CA  1 
ATOM   7282  C  C   . GLY D  1 144 ? 5.162   45.032  -23.001  1.00 38.01  ? 170 GLY D C   1 
ATOM   7283  O  O   . GLY D  1 144 ? 6.187   45.622  -22.651  1.00 38.84  ? 170 GLY D O   1 
ATOM   7284  N  N   . MET D  1 145 ? 4.523   45.314  -24.133  1.00 40.11  ? 171 MET D N   1 
ATOM   7285  C  CA  . MET D  1 145 ? 4.972   46.353  -25.047  1.00 40.30  ? 171 MET D CA  1 
ATOM   7286  C  C   . MET D  1 145 ? 3.815   47.287  -25.371  1.00 33.90  ? 171 MET D C   1 
ATOM   7287  O  O   . MET D  1 145 ? 2.648   46.889  -25.325  1.00 40.70  ? 171 MET D O   1 
ATOM   7288  C  CB  . MET D  1 145 ? 5.544   45.751  -26.337  1.00 41.11  ? 171 MET D CB  1 
ATOM   7289  C  CG  . MET D  1 145 ? 6.762   44.871  -26.108  1.00 47.27  ? 171 MET D CG  1 
ATOM   7290  S  SD  . MET D  1 145 ? 7.559   44.359  -27.640  1.00 78.71  ? 171 MET D SD  1 
ATOM   7291  C  CE  . MET D  1 145 ? 6.265   43.364  -28.381  1.00 58.06  ? 171 MET D CE  1 
ATOM   7292  N  N   . ILE D  1 146 ? 4.142   48.536  -25.693  1.00 30.49  ? 172 ILE D N   1 
ATOM   7293  C  CA  . ILE D  1 146 ? 3.118   49.515  -26.041  1.00 36.98  ? 172 ILE D CA  1 
ATOM   7294  C  C   . ILE D  1 146 ? 3.756   50.620  -26.877  1.00 39.50  ? 172 ILE D C   1 
ATOM   7295  O  O   . ILE D  1 146 ? 4.900   51.019  -26.645  1.00 41.06  ? 172 ILE D O   1 
ATOM   7296  C  CB  . ILE D  1 146 ? 2.423   50.068  -24.772  1.00 30.75  ? 172 ILE D CB  1 
ATOM   7297  C  CG1 . ILE D  1 146 ? 1.229   50.950  -25.140  1.00 33.01  ? 172 ILE D CG1 1 
ATOM   7298  C  CG2 . ILE D  1 146 ? 3.413   50.829  -23.900  1.00 33.81  ? 172 ILE D CG2 1 
ATOM   7299  C  CD1 . ILE D  1 146 ? 0.398   51.383  -23.946  1.00 25.50  ? 172 ILE D CD1 1 
ATOM   7300  N  N   . ASN D  1 147 ? 3.008   51.092  -27.867  1.00 39.99  ? 173 ASN D N   1 
ATOM   7301  C  CA  . ASN D  1 147 ? 3.357   52.212  -28.724  1.00 42.81  ? 173 ASN D CA  1 
ATOM   7302  C  C   . ASN D  1 147 ? 2.359   53.340  -28.520  1.00 44.88  ? 173 ASN D C   1 
ATOM   7303  O  O   . ASN D  1 147 ? 1.239   53.109  -28.050  1.00 44.33  ? 173 ASN D O   1 
ATOM   7304  C  CB  . ASN D  1 147 ? 3.362   51.803  -30.205  1.00 40.89  ? 173 ASN D CB  1 
ATOM   7305  C  CG  . ASN D  1 147 ? 4.615   51.068  -30.593  1.00 43.20  ? 173 ASN D CG  1 
ATOM   7306  O  OD1 . ASN D  1 147 ? 5.494   50.869  -29.764  1.00 55.95  ? 173 ASN D OD1 1 
ATOM   7307  N  ND2 . ASN D  1 147 ? 4.707   50.656  -31.852  1.00 41.67  ? 173 ASN D ND2 1 
ATOM   7308  N  N   . PRO D  1 148 ? 2.735   54.578  -28.847  1.00 46.30  ? 174 PRO D N   1 
ATOM   7309  C  CA  . PRO D  1 148 ? 1.741   55.662  -28.840  1.00 43.55  ? 174 PRO D CA  1 
ATOM   7310  C  C   . PRO D  1 148 ? 0.589   55.417  -29.799  1.00 49.65  ? 174 PRO D C   1 
ATOM   7311  O  O   . PRO D  1 148 ? -0.505  55.953  -29.584  1.00 46.22  ? 174 PRO D O   1 
ATOM   7312  C  CB  . PRO D  1 148 ? 2.562   56.894  -29.245  1.00 34.86  ? 174 PRO D CB  1 
ATOM   7313  C  CG  . PRO D  1 148 ? 3.960   56.557  -28.860  1.00 39.69  ? 174 PRO D CG  1 
ATOM   7314  C  CD  . PRO D  1 148 ? 4.100   55.079  -29.086  1.00 43.55  ? 174 PRO D CD  1 
ATOM   7315  N  N   . GLU D  1 149 ? 0.800   54.612  -30.844  1.00 56.47  ? 175 GLU D N   1 
ATOM   7316  C  CA  . GLU D  1 149 ? -0.278  54.282  -31.769  1.00 50.54  ? 175 GLU D CA  1 
ATOM   7317  C  C   . GLU D  1 149 ? -1.284  53.319  -31.148  1.00 49.45  ? 175 GLU D C   1 
ATOM   7318  O  O   . GLU D  1 149 ? -2.454  53.312  -31.544  1.00 48.27  ? 175 GLU D O   1 
ATOM   7319  C  CB  . GLU D  1 149 ? 0.300   53.681  -33.050  1.00 54.60  ? 175 GLU D CB  1 
ATOM   7320  C  CG  . GLU D  1 149 ? -0.695  53.573  -34.193  1.00 78.41  ? 175 GLU D CG  1 
ATOM   7321  C  CD  . GLU D  1 149 ? -0.542  52.287  -34.989  1.00 86.70  ? 175 GLU D CD  1 
ATOM   7322  O  OE1 . GLU D  1 149 ? -1.431  51.986  -35.825  1.00 78.50  ? 175 GLU D OE1 1 
ATOM   7323  O  OE2 . GLU D  1 149 ? 0.461   51.563  -34.778  1.00 89.09  ? 175 GLU D OE2 1 
ATOM   7324  N  N   . ASP D  1 150 ? -0.855  52.503  -30.178  1.00 49.06  ? 176 ASP D N   1 
ATOM   7325  C  CA  . ASP D  1 150 ? -1.755  51.533  -29.559  1.00 42.27  ? 176 ASP D CA  1 
ATOM   7326  C  C   . ASP D  1 150 ? -2.831  52.191  -28.708  1.00 40.84  ? 176 ASP D C   1 
ATOM   7327  O  O   . ASP D  1 150 ? -3.865  51.566  -28.455  1.00 44.94  ? 176 ASP D O   1 
ATOM   7328  C  CB  . ASP D  1 150 ? -0.967  50.542  -28.699  1.00 41.92  ? 176 ASP D CB  1 
ATOM   7329  C  CG  . ASP D  1 150 ? -0.008  49.696  -29.513  1.00 47.78  ? 176 ASP D CG  1 
ATOM   7330  O  OD1 . ASP D  1 150 ? -0.116  49.700  -30.759  1.00 52.21  ? 176 ASP D OD1 1 
ATOM   7331  O  OD2 . ASP D  1 150 ? 0.847   49.015  -28.904  1.00 44.65  ? 176 ASP D OD2 1 
ATOM   7332  N  N   . ARG D  1 151 ? -2.611  53.423  -28.266  1.00 43.64  ? 177 ARG D N   1 
ATOM   7333  C  CA  . ARG D  1 151 ? -3.567  54.199  -27.452  1.00 43.10  ? 177 ARG D CA  1 
ATOM   7334  C  C   . ARG D  1 151 ? -3.789  53.445  -26.138  1.00 45.55  ? 177 ARG D C   1 
ATOM   7335  O  O   . ARG D  1 151 ? -2.850  52.826  -25.613  1.00 47.47  ? 177 ARG D O   1 
ATOM   7336  C  CB  . ARG D  1 151 ? -4.828  54.470  -28.240  1.00 38.89  ? 177 ARG D CB  1 
ATOM   7337  C  CG  . ARG D  1 151 ? -4.576  54.756  -29.689  1.00 43.87  ? 177 ARG D CG  1 
ATOM   7338  C  CD  . ARG D  1 151 ? -5.315  55.983  -30.115  1.00 52.81  ? 177 ARG D CD  1 
ATOM   7339  N  NE  . ARG D  1 151 ? -4.945  56.346  -31.489  1.00 71.64  ? 177 ARG D NE  1 
ATOM   7340  C  CZ  . ARG D  1 151 ? -5.331  57.463  -32.100  1.00 82.60  ? 177 ARG D CZ  1 
ATOM   7341  N  NH1 . ARG D  1 151 ? -4.937  57.696  -33.342  1.00 83.83  ? 177 ARG D NH1 1 
ATOM   7342  N  NH2 . ARG D  1 151 ? -6.102  58.332  -31.457  1.00 84.40  ? 177 ARG D NH2 1 
ATOM   7343  N  N   . TRP D  1 152 ? -5.007  53.472  -25.599  1.00 41.29  ? 178 TRP D N   1 
ATOM   7344  C  CA  . TRP D  1 152 ? -5.291  52.846  -24.316  1.00 39.04  ? 178 TRP D CA  1 
ATOM   7345  C  C   . TRP D  1 152 ? -5.324  51.330  -24.451  1.00 39.61  ? 178 TRP D C   1 
ATOM   7346  O  O   . TRP D  1 152 ? -5.970  50.787  -25.352  1.00 37.59  ? 178 TRP D O   1 
ATOM   7347  C  CB  . TRP D  1 152 ? -6.625  53.351  -23.765  1.00 37.72  ? 178 TRP D CB  1 
ATOM   7348  C  CG  . TRP D  1 152 ? -6.591  54.770  -23.284  1.00 43.09  ? 178 TRP D CG  1 
ATOM   7349  C  CD1 . TRP D  1 152 ? -7.129  55.863  -23.902  1.00 45.07  ? 178 TRP D CD1 1 
ATOM   7350  C  CD2 . TRP D  1 152 ? -5.982  55.251  -22.079  1.00 48.07  ? 178 TRP D CD2 1 
ATOM   7351  N  NE1 . TRP D  1 152 ? -6.894  56.993  -23.154  1.00 44.80  ? 178 TRP D NE1 1 
ATOM   7352  C  CE2 . TRP D  1 152 ? -6.191  56.643  -22.031  1.00 49.01  ? 178 TRP D CE2 1 
ATOM   7353  C  CE3 . TRP D  1 152 ? -5.279  54.639  -21.038  1.00 39.08  ? 178 TRP D CE3 1 
ATOM   7354  C  CZ2 . TRP D  1 152 ? -5.724  57.430  -20.982  1.00 43.60  ? 178 TRP D CZ2 1 
ATOM   7355  C  CZ3 . TRP D  1 152 ? -4.818  55.422  -20.000  1.00 36.63  ? 178 TRP D CZ3 1 
ATOM   7356  C  CH2 . TRP D  1 152 ? -5.044  56.801  -19.978  1.00 38.58  ? 178 TRP D CH2 1 
ATOM   7357  N  N   . LYS D  1 153 ? -4.620  50.651  -23.549  1.00 34.86  ? 179 LYS D N   1 
ATOM   7358  C  CA  . LYS D  1 153 ? -4.673  49.202  -23.420  1.00 32.82  ? 179 LYS D CA  1 
ATOM   7359  C  C   . LYS D  1 153 ? -5.242  48.868  -22.050  1.00 38.04  ? 179 LYS D C   1 
ATOM   7360  O  O   . LYS D  1 153 ? -4.824  49.454  -21.045  1.00 40.88  ? 179 LYS D O   1 
ATOM   7361  C  CB  . LYS D  1 153 ? -3.285  48.582  -23.607  1.00 34.24  ? 179 LYS D CB  1 
ATOM   7362  C  CG  . LYS D  1 153 ? -2.645  48.939  -24.943  1.00 37.67  ? 179 LYS D CG  1 
ATOM   7363  C  CD  . LYS D  1 153 ? -1.233  48.382  -25.090  1.00 36.50  ? 179 LYS D CD  1 
ATOM   7364  C  CE  . LYS D  1 153 ? -1.229  46.892  -25.359  1.00 40.12  ? 179 LYS D CE  1 
ATOM   7365  N  NZ  . LYS D  1 153 ? 0.054   46.449  -25.975  1.00 37.51  ? 179 LYS D NZ  1 
ATOM   7366  N  N   . SER D  1 154 ? -6.201  47.941  -22.014  1.00 39.26  ? 180 SER D N   1 
ATOM   7367  C  CA  . SER D  1 154 ? -6.935  47.610  -20.798  1.00 39.57  ? 180 SER D CA  1 
ATOM   7368  C  C   . SER D  1 154 ? -6.391  46.338  -20.165  1.00 38.43  ? 180 SER D C   1 
ATOM   7369  O  O   . SER D  1 154 ? -6.162  45.339  -20.852  1.00 40.57  ? 180 SER D O   1 
ATOM   7370  C  CB  . SER D  1 154 ? -8.427  47.435  -21.083  1.00 42.46  ? 180 SER D CB  1 
ATOM   7371  O  OG  . SER D  1 154 ? -9.003  48.627  -21.584  1.00 48.12  ? 180 SER D OG  1 
ATOM   7372  N  N   . LEU D  1 155 ? -6.208  46.380  -18.846  1.00 44.53  ? 181 LEU D N   1 
ATOM   7373  C  CA  . LEU D  1 155 ? -5.645  45.276  -18.081  1.00 46.42  ? 181 LEU D CA  1 
ATOM   7374  C  C   . LEU D  1 155 ? -6.571  44.922  -16.925  1.00 46.36  ? 181 LEU D C   1 
ATOM   7375  O  O   . LEU D  1 155 ? -7.170  45.804  -16.302  1.00 44.33  ? 181 LEU D O   1 
ATOM   7376  C  CB  . LEU D  1 155 ? -4.250  45.632  -17.541  1.00 43.96  ? 181 LEU D CB  1 
ATOM   7377  C  CG  . LEU D  1 155 ? -3.203  46.047  -18.577  1.00 39.68  ? 181 LEU D CG  1 
ATOM   7378  C  CD1 . LEU D  1 155 ? -2.500  47.310  -18.130  1.00 38.03  ? 181 LEU D CD1 1 
ATOM   7379  C  CD2 . LEU D  1 155 ? -2.199  44.930  -18.825  1.00 42.06  ? 181 LEU D CD2 1 
ATOM   7380  N  N   . HIS D  1 156 ? -6.682  43.626  -16.642  1.00 48.74  ? 182 HIS D N   1 
ATOM   7381  C  CA  . HIS D  1 156 ? -7.525  43.117  -15.568  1.00 48.65  ? 182 HIS D CA  1 
ATOM   7382  C  C   . HIS D  1 156 ? -6.709  42.145  -14.730  1.00 46.11  ? 182 HIS D C   1 
ATOM   7383  O  O   . HIS D  1 156 ? -6.124  41.199  -15.269  1.00 45.78  ? 182 HIS D O   1 
ATOM   7384  C  CB  . HIS D  1 156 ? -8.777  42.422  -16.123  1.00 52.62  ? 182 HIS D CB  1 
ATOM   7385  C  CG  . HIS D  1 156 ? -9.494  43.211  -17.176  1.00 55.09  ? 182 HIS D CG  1 
ATOM   7386  N  ND1 . HIS D  1 156 ? -10.677 43.876  -16.933  1.00 59.12  ? 182 HIS D ND1 1 
ATOM   7387  C  CD2 . HIS D  1 156 ? -9.194  43.442  -18.477  1.00 52.53  ? 182 HIS D CD2 1 
ATOM   7388  C  CE1 . HIS D  1 156 ? -11.076 44.481  -18.038  1.00 57.38  ? 182 HIS D CE1 1 
ATOM   7389  N  NE2 . HIS D  1 156 ? -10.194 44.234  -18.990  1.00 53.61  ? 182 HIS D NE2 1 
ATOM   7390  N  N   . PHE D  1 157 ? -6.669  42.374  -13.419  1.00 44.11  ? 183 PHE D N   1 
ATOM   7391  C  CA  . PHE D  1 157 ? -5.873  41.558  -12.508  1.00 48.08  ? 183 PHE D CA  1 
ATOM   7392  C  C   . PHE D  1 157 ? -6.765  41.005  -11.407  1.00 52.44  ? 183 PHE D C   1 
ATOM   7393  O  O   . PHE D  1 157 ? -7.429  41.770  -10.700  1.00 52.66  ? 183 PHE D O   1 
ATOM   7394  C  CB  . PHE D  1 157 ? -4.728  42.370  -11.898  1.00 47.73  ? 183 PHE D CB  1 
ATOM   7395  C  CG  . PHE D  1 157 ? -3.840  43.027  -12.912  1.00 44.53  ? 183 PHE D CG  1 
ATOM   7396  C  CD1 . PHE D  1 157 ? -2.827  42.314  -13.532  1.00 43.03  ? 183 PHE D CD1 1 
ATOM   7397  C  CD2 . PHE D  1 157 ? -4.011  44.364  -13.237  1.00 43.05  ? 183 PHE D CD2 1 
ATOM   7398  C  CE1 . PHE D  1 157 ? -2.002  42.922  -14.463  1.00 44.63  ? 183 PHE D CE1 1 
ATOM   7399  C  CE2 . PHE D  1 157 ? -3.192  44.975  -14.166  1.00 42.51  ? 183 PHE D CE2 1 
ATOM   7400  C  CZ  . PHE D  1 157 ? -2.187  44.253  -14.781  1.00 45.08  ? 183 PHE D CZ  1 
ATOM   7401  N  N   . SER D  1 158 ? -6.770  39.683  -11.255  1.00 57.39  ? 184 SER D N   1 
ATOM   7402  C  CA  . SER D  1 158 ? -7.469  39.007  -10.162  1.00 62.46  ? 184 SER D CA  1 
ATOM   7403  C  C   . SER D  1 158 ? -6.410  38.467  -9.205   1.00 57.25  ? 184 SER D C   1 
ATOM   7404  O  O   . SER D  1 158 ? -5.841  37.396  -9.433   1.00 53.22  ? 184 SER D O   1 
ATOM   7405  C  CB  . SER D  1 158 ? -8.372  37.893  -10.687  1.00 60.42  ? 184 SER D CB  1 
ATOM   7406  O  OG  . SER D  1 158 ? -9.399  38.412  -11.515  1.00 60.37  ? 184 SER D OG  1 
ATOM   7407  N  N   . GLY D  1 159 ? -6.147  39.217  -8.136   1.00 57.78  ? 185 GLY D N   1 
ATOM   7408  C  CA  . GLY D  1 159 ? -5.108  38.875  -7.189   1.00 66.09  ? 185 GLY D CA  1 
ATOM   7409  C  C   . GLY D  1 159 ? -5.601  37.968  -6.078   1.00 72.57  ? 185 GLY D C   1 
ATOM   7410  O  O   . GLY D  1 159 ? -6.706  37.422  -6.115   1.00 64.04  ? 185 GLY D O   1 
ATOM   7411  N  N   . HIS D  1 160 ? -4.744  37.808  -5.065   1.00 72.51  ? 186 HIS D N   1 
ATOM   7412  C  CA  . HIS D  1 160 ? -5.101  36.974  -3.923   1.00 72.14  ? 186 HIS D CA  1 
ATOM   7413  C  C   . HIS D  1 160 ? -6.148  37.642  -3.041   1.00 80.24  ? 186 HIS D C   1 
ATOM   7414  O  O   . HIS D  1 160 ? -6.975  36.952  -2.432   1.00 85.49  ? 186 HIS D O   1 
ATOM   7415  C  CB  . HIS D  1 160 ? -3.856  36.644  -3.098   1.00 73.86  ? 186 HIS D CB  1 
ATOM   7416  C  CG  . HIS D  1 160 ? -2.842  35.822  -3.831   1.00 81.58  ? 186 HIS D CG  1 
ATOM   7417  N  ND1 . HIS D  1 160 ? -3.044  34.494  -4.142   1.00 84.48  ? 186 HIS D ND1 1 
ATOM   7418  C  CD2 . HIS D  1 160 ? -1.612  36.136  -4.303   1.00 86.23  ? 186 HIS D CD2 1 
ATOM   7419  C  CE1 . HIS D  1 160 ? -1.985  34.028  -4.780   1.00 88.44  ? 186 HIS D CE1 1 
ATOM   7420  N  NE2 . HIS D  1 160 ? -1.102  35.004  -4.891   1.00 90.18  ? 186 HIS D NE2 1 
ATOM   7421  N  N   . VAL D  1 161 ? -6.133  38.975  -2.962   1.00 70.64  ? 187 VAL D N   1 
ATOM   7422  C  CA  . VAL D  1 161 ? -7.016  39.734  -2.085   1.00 65.16  ? 187 VAL D CA  1 
ATOM   7423  C  C   . VAL D  1 161 ? -7.927  40.666  -2.876   1.00 66.24  ? 187 VAL D C   1 
ATOM   7424  O  O   . VAL D  1 161 ? -9.144  40.689  -2.666   1.00 68.33  ? 187 VAL D O   1 
ATOM   7425  C  CB  . VAL D  1 161 ? -6.211  40.527  -1.028   1.00 68.93  ? 187 VAL D CB  1 
ATOM   7426  C  CG1 . VAL D  1 161 ? -7.003  41.736  -0.538   1.00 73.31  ? 187 VAL D CG1 1 
ATOM   7427  C  CG2 . VAL D  1 161 ? -5.837  39.627  0.137    1.00 72.99  ? 187 VAL D CG2 1 
ATOM   7428  N  N   . ALA D  1 162 ? -7.355  41.443  -3.792   1.00 69.55  ? 188 ALA D N   1 
ATOM   7429  C  CA  . ALA D  1 162 ? -8.096  42.462  -4.517   1.00 67.29  ? 188 ALA D CA  1 
ATOM   7430  C  C   . ALA D  1 162 ? -8.154  42.134  -6.004   1.00 58.75  ? 188 ALA D C   1 
ATOM   7431  O  O   . ALA D  1 162 ? -7.381  41.322  -6.520   1.00 58.78  ? 188 ALA D O   1 
ATOM   7432  C  CB  . ALA D  1 162 ? -7.472  43.849  -4.313   1.00 59.41  ? 188 ALA D CB  1 
ATOM   7433  N  N   . HIS D  1 163 ? -9.096  42.783  -6.686   1.00 57.59  ? 189 HIS D N   1 
ATOM   7434  C  CA  . HIS D  1 163 ? -9.273  42.664  -8.128   1.00 58.62  ? 189 HIS D CA  1 
ATOM   7435  C  C   . HIS D  1 163 ? -9.246  44.060  -8.731   1.00 55.60  ? 189 HIS D C   1 
ATOM   7436  O  O   . HIS D  1 163 ? -9.988  44.941  -8.286   1.00 58.30  ? 189 HIS D O   1 
ATOM   7437  C  CB  . HIS D  1 163 ? -10.588 41.949  -8.464   1.00 56.57  ? 189 HIS D CB  1 
ATOM   7438  C  CG  . HIS D  1 163 ? -11.059 42.172  -9.867   1.00 63.60  ? 189 HIS D CG  1 
ATOM   7439  N  ND1 . HIS D  1 163 ? -11.948 43.171  -10.203  1.00 64.46  ? 189 HIS D ND1 1 
ATOM   7440  C  CD2 . HIS D  1 163 ? -10.768 41.524  -11.021  1.00 60.91  ? 189 HIS D CD2 1 
ATOM   7441  C  CE1 . HIS D  1 163 ? -12.184 43.129  -11.502  1.00 66.10  ? 189 HIS D CE1 1 
ATOM   7442  N  NE2 . HIS D  1 163 ? -11.478 42.141  -12.023  1.00 62.70  ? 189 HIS D NE2 1 
ATOM   7443  N  N   . LEU D  1 164 ? -8.389  44.263  -9.733   1.00 50.74  ? 190 LEU D N   1 
ATOM   7444  C  CA  . LEU D  1 164 ? -8.152  45.581  -10.307  1.00 48.85  ? 190 LEU D CA  1 
ATOM   7445  C  C   . LEU D  1 164 ? -8.423  45.577  -11.802  1.00 45.45  ? 190 LEU D C   1 
ATOM   7446  O  O   . LEU D  1 164 ? -8.217  44.570  -12.484  1.00 49.11  ? 190 LEU D O   1 
ATOM   7447  C  CB  . LEU D  1 164 ? -6.710  46.045  -10.090  1.00 44.68  ? 190 LEU D CB  1 
ATOM   7448  C  CG  . LEU D  1 164 ? -6.032  45.700  -8.765   1.00 52.15  ? 190 LEU D CG  1 
ATOM   7449  C  CD1 . LEU D  1 164 ? -4.527  45.887  -8.895   1.00 53.46  ? 190 LEU D CD1 1 
ATOM   7450  C  CD2 . LEU D  1 164 ? -6.590  46.559  -7.666   1.00 47.97  ? 190 LEU D CD2 1 
ATOM   7451  N  N   . GLU D  1 165 ? -8.873  46.727  -12.304  1.00 45.19  ? 191 GLU D N   1 
ATOM   7452  C  CA  . GLU D  1 165 ? -9.024  46.960  -13.738  1.00 53.30  ? 191 GLU D CA  1 
ATOM   7453  C  C   . GLU D  1 165 ? -8.545  48.372  -14.041  1.00 47.21  ? 191 GLU D C   1 
ATOM   7454  O  O   . GLU D  1 165 ? -9.037  49.335  -13.446  1.00 45.61  ? 191 GLU D O   1 
ATOM   7455  C  CB  . GLU D  1 165 ? -10.477 46.770  -14.192  1.00 56.45  ? 191 GLU D CB  1 
ATOM   7456  C  CG  . GLU D  1 165 ? -11.167 45.578  -13.541  1.00 63.15  ? 191 GLU D CG  1 
ATOM   7457  C  CD  . GLU D  1 165 ? -12.393 45.103  -14.290  1.00 70.55  ? 191 GLU D CD  1 
ATOM   7458  O  OE1 . GLU D  1 165 ? -13.510 45.547  -13.947  1.00 65.37  ? 191 GLU D OE1 1 
ATOM   7459  O  OE2 . GLU D  1 165 ? -12.240 44.273  -15.212  1.00 75.40  ? 191 GLU D OE2 1 
ATOM   7460  N  N   . LEU D  1 166 ? -7.589  48.497  -14.958  1.00 49.24  ? 192 LEU D N   1 
ATOM   7461  C  CA  . LEU D  1 166 ? -7.002  49.793  -15.262  1.00 48.64  ? 192 LEU D CA  1 
ATOM   7462  C  C   . LEU D  1 166 ? -6.599  49.837  -16.730  1.00 41.11  ? 192 LEU D C   1 
ATOM   7463  O  O   . LEU D  1 166 ? -6.545  48.813  -17.415  1.00 39.47  ? 192 LEU D O   1 
ATOM   7464  C  CB  . LEU D  1 166 ? -5.807  50.083  -14.346  1.00 47.92  ? 192 LEU D CB  1 
ATOM   7465  C  CG  . LEU D  1 166 ? -4.739  48.989  -14.252  1.00 48.33  ? 192 LEU D CG  1 
ATOM   7466  C  CD1 . LEU D  1 166 ? -3.621  49.224  -15.259  1.00 51.23  ? 192 LEU D CD1 1 
ATOM   7467  C  CD2 . LEU D  1 166 ? -4.185  48.886  -12.839  1.00 42.97  ? 192 LEU D CD2 1 
ATOM   7468  N  N   . GLN D  1 167 ? -6.316  51.049  -17.205  1.00 46.59  ? 193 GLN D N   1 
ATOM   7469  C  CA  . GLN D  1 167 ? -5.896  51.287  -18.578  1.00 41.35  ? 193 GLN D CA  1 
ATOM   7470  C  C   . GLN D  1 167 ? -4.610  52.102  -18.583  1.00 41.01  ? 193 GLN D C   1 
ATOM   7471  O  O   . GLN D  1 167 ? -4.372  52.922  -17.692  1.00 37.55  ? 193 GLN D O   1 
ATOM   7472  C  CB  . GLN D  1 167 ? -6.975  52.019  -19.386  1.00 39.13  ? 193 GLN D CB  1 
ATOM   7473  C  CG  . GLN D  1 167 ? -8.312  51.296  -19.448  1.00 47.05  ? 193 GLN D CG  1 
ATOM   7474  C  CD  . GLN D  1 167 ? -9.142  51.492  -18.194  1.00 51.32  ? 193 GLN D CD  1 
ATOM   7475  O  OE1 . GLN D  1 167 ? -9.325  52.616  -17.726  1.00 51.18  ? 193 GLN D OE1 1 
ATOM   7476  N  NE2 . GLN D  1 167 ? -9.641  50.393  -17.637  1.00 48.63  ? 193 GLN D NE2 1 
ATOM   7477  N  N   . ILE D  1 168 ? -3.778  51.863  -19.596  1.00 39.40  ? 194 ILE D N   1 
ATOM   7478  C  CA  . ILE D  1 168 ? -2.495  52.538  -19.734  1.00 32.90  ? 194 ILE D CA  1 
ATOM   7479  C  C   . ILE D  1 168 ? -2.319  52.978  -21.181  1.00 35.00  ? 194 ILE D C   1 
ATOM   7480  O  O   . ILE D  1 168 ? -2.894  52.393  -22.104  1.00 34.60  ? 194 ILE D O   1 
ATOM   7481  C  CB  . ILE D  1 168 ? -1.312  51.640  -19.296  1.00 34.48  ? 194 ILE D CB  1 
ATOM   7482  C  CG1 . ILE D  1 168 ? -1.238  50.385  -20.165  1.00 30.50  ? 194 ILE D CG1 1 
ATOM   7483  C  CG2 . ILE D  1 168 ? -1.432  51.256  -17.826  1.00 30.33  ? 194 ILE D CG2 1 
ATOM   7484  C  CD1 . ILE D  1 168 ? -0.038  49.529  -19.878  1.00 29.94  ? 194 ILE D CD1 1 
ATOM   7485  N  N   . ARG D  1 169 ? -1.517  54.022  -21.373  1.00 40.10  ? 195 ARG D N   1 
ATOM   7486  C  CA  . ARG D  1 169 ? -1.187  54.515  -22.705  1.00 45.32  ? 195 ARG D CA  1 
ATOM   7487  C  C   . ARG D  1 169 ? 0.076   55.359  -22.605  1.00 45.19  ? 195 ARG D C   1 
ATOM   7488  O  O   . ARG D  1 169 ? 0.509   55.742  -21.515  1.00 40.96  ? 195 ARG D O   1 
ATOM   7489  C  CB  . ARG D  1 169 ? -2.330  55.335  -23.317  1.00 40.04  ? 195 ARG D CB  1 
ATOM   7490  C  CG  . ARG D  1 169 ? -2.470  56.732  -22.724  1.00 44.75  ? 195 ARG D CG  1 
ATOM   7491  C  CD  . ARG D  1 169 ? -3.341  57.628  -23.591  1.00 50.56  ? 195 ARG D CD  1 
ATOM   7492  N  NE  . ARG D  1 169 ? -3.382  59.003  -23.095  1.00 58.29  ? 195 ARG D NE  1 
ATOM   7493  C  CZ  . ARG D  1 169 ? -4.091  59.981  -23.655  1.00 64.75  ? 195 ARG D CZ  1 
ATOM   7494  N  NH1 . ARG D  1 169 ? -4.824  59.738  -24.735  1.00 68.89  ? 195 ARG D NH1 1 
ATOM   7495  N  NH2 . ARG D  1 169 ? -4.069  61.204  -23.138  1.00 55.73  ? 195 ARG D NH2 1 
ATOM   7496  N  N   . VAL D  1 170 ? 0.658   55.647  -23.766  1.00 42.26  ? 196 VAL D N   1 
ATOM   7497  C  CA  . VAL D  1 170 ? 1.829   56.511  -23.884  1.00 45.05  ? 196 VAL D CA  1 
ATOM   7498  C  C   . VAL D  1 170 ? 1.537   57.544  -24.967  1.00 42.17  ? 196 VAL D C   1 
ATOM   7499  O  O   . VAL D  1 170 ? 1.212   57.179  -26.104  1.00 41.55  ? 196 VAL D O   1 
ATOM   7500  C  CB  . VAL D  1 170 ? 3.103   55.713  -24.220  1.00 41.07  ? 196 VAL D CB  1 
ATOM   7501  C  CG1 . VAL D  1 170 ? 4.118   56.594  -24.931  1.00 44.54  ? 196 VAL D CG1 1 
ATOM   7502  C  CG2 . VAL D  1 170 ? 3.711   55.121  -22.960  1.00 34.49  ? 196 VAL D CG2 1 
ATOM   7503  N  N   . ARG D  1 171 ? 1.627   58.823  -24.617  1.00 37.53  ? 197 ARG D N   1 
ATOM   7504  C  CA  . ARG D  1 171 ? 1.518   59.895  -25.594  1.00 38.87  ? 197 ARG D CA  1 
ATOM   7505  C  C   . ARG D  1 171 ? 2.801   60.719  -25.589  1.00 40.01  ? 197 ARG D C   1 
ATOM   7506  O  O   . ARG D  1 171 ? 3.630   60.628  -24.678  1.00 41.53  ? 197 ARG D O   1 
ATOM   7507  C  CB  . ARG D  1 171 ? 0.271   60.768  -25.347  1.00 40.12  ? 197 ARG D CB  1 
ATOM   7508  C  CG  . ARG D  1 171 ? 0.255   61.570  -24.067  1.00 41.32  ? 197 ARG D CG  1 
ATOM   7509  C  CD  . ARG D  1 171 ? -0.615  62.821  -24.188  1.00 65.38  ? 197 ARG D CD  1 
ATOM   7510  N  NE  . ARG D  1 171 ? -0.487  63.669  -23.009  1.00 68.20  ? 197 ARG D NE  1 
ATOM   7511  C  CZ  . ARG D  1 171 ? 0.684   63.987  -22.476  1.00 71.23  ? 197 ARG D CZ  1 
ATOM   7512  N  NH1 . ARG D  1 171 ? 1.795   63.501  -23.017  1.00 66.64  ? 197 ARG D NH1 1 
ATOM   7513  N  NH2 . ARG D  1 171 ? 0.739   64.769  -21.405  1.00 80.34  ? 197 ARG D NH2 1 
ATOM   7514  N  N   . CYS D  1 172 ? 2.985   61.490  -26.655  1.00 44.47  ? 198 CYS D N   1 
ATOM   7515  C  CA  . CYS D  1 172 ? 4.179   62.302  -26.820  1.00 43.53  ? 198 CYS D CA  1 
ATOM   7516  C  C   . CYS D  1 172 ? 3.961   63.681  -26.222  1.00 43.20  ? 198 CYS D C   1 
ATOM   7517  O  O   . CYS D  1 172 ? 2.852   64.224  -26.246  1.00 36.52  ? 198 CYS D O   1 
ATOM   7518  C  CB  . CYS D  1 172 ? 4.577   62.447  -28.292  1.00 30.80  ? 198 CYS D CB  1 
ATOM   7519  S  SG  . CYS D  1 172 ? 5.263   60.952  -29.037  1.00 43.15  ? 198 CYS D SG  1 
ATOM   7520  N  N   . ASP D  1 173 ? 5.040   64.237  -25.675  1.00 48.97  ? 199 ASP D N   1 
ATOM   7521  C  CA  . ASP D  1 173 ? 5.032   65.625  -25.251  1.00 53.34  ? 199 ASP D CA  1 
ATOM   7522  C  C   . ASP D  1 173 ? 4.631   66.539  -26.406  1.00 51.21  ? 199 ASP D C   1 
ATOM   7523  O  O   . ASP D  1 173 ? 4.533   66.130  -27.554  1.00 50.12  ? 199 ASP D O   1 
ATOM   7524  C  CB  . ASP D  1 173 ? 6.417   66.055  -24.763  1.00 51.57  ? 199 ASP D CB  1 
ATOM   7525  C  CG  . ASP D  1 173 ? 6.528   66.109  -23.263  1.00 63.44  ? 199 ASP D CG  1 
ATOM   7526  O  OD1 . ASP D  1 173 ? 7.080   65.151  -22.687  1.00 67.43  ? 199 ASP D OD1 1 
ATOM   7527  O  OD2 . ASP D  1 173 ? 6.066   67.101  -22.660  1.00 68.11  ? 199 ASP D OD2 1 
ATOM   7528  N  N   . GLU D  1 174 ? 4.437   67.810  -26.083  1.00 55.67  ? 200 GLU D N   1 
ATOM   7529  C  CA  . GLU D  1 174 ? 4.404   68.830  -27.111  1.00 63.19  ? 200 GLU D CA  1 
ATOM   7530  C  C   . GLU D  1 174 ? 5.777   68.903  -27.762  1.00 63.37  ? 200 GLU D C   1 
ATOM   7531  O  O   . GLU D  1 174 ? 6.812   68.741  -27.078  1.00 60.28  ? 200 GLU D O   1 
ATOM   7532  C  CB  . GLU D  1 174 ? 4.030   70.183  -26.516  1.00 69.90  ? 200 GLU D CB  1 
ATOM   7533  C  CG  . GLU D  1 174 ? 3.397   71.090  -27.586  1.00 72.55  ? 200 GLU D CG  1 
ATOM   7534  C  CD  . GLU D  1 174 ? 2.810   72.406  -27.064  1.00 87.37  ? 200 GLU D CD  1 
ATOM   7535  O  OE1 . GLU D  1 174 ? 3.576   73.210  -26.516  1.00 87.02  ? 200 GLU D OE1 1 
ATOM   7536  O  OE2 . GLU D  1 174 ? 1.613   72.675  -27.280  1.00 86.11  ? 200 GLU D OE2 1 
ATOM   7537  N  N   . ASN D  1 175 ? 5.782   69.110  -29.095  1.00 65.99  ? 201 ASN D N   1 
ATOM   7538  C  CA  . ASN D  1 175 ? 7.050   69.202  -29.845  1.00 64.22  ? 201 ASN D CA  1 
ATOM   7539  C  C   . ASN D  1 175 ? 7.726   67.809  -30.093  1.00 65.30  ? 201 ASN D C   1 
ATOM   7540  O  O   . ASN D  1 175 ? 8.914   67.751  -30.459  1.00 73.87  ? 201 ASN D O   1 
ATOM   7541  C  CB  . ASN D  1 175 ? 8.107   70.147  -29.166  1.00 78.59  ? 201 ASN D CB  1 
ATOM   7542  C  CG  . ASN D  1 175 ? 7.674   71.642  -29.036  1.00 74.33  ? 201 ASN D CG  1 
ATOM   7543  O  OD1 . ASN D  1 175 ? 6.777   72.116  -29.706  1.00 68.56  ? 201 ASN D OD1 1 
ATOM   7544  N  ND2 . ASN D  1 175 ? 8.357   72.393  -28.206  1.00 77.86  ? 201 ASN D ND2 1 
ATOM   7545  N  N   . TYR D  1 176 ? 7.030   66.650  -30.032  1.00 56.45  ? 202 TYR D N   1 
ATOM   7546  C  CA  . TYR D  1 176 ? 7.718   65.362  -30.231  1.00 48.01  ? 202 TYR D CA  1 
ATOM   7547  C  C   . TYR D  1 176 ? 6.862   64.400  -31.048  1.00 40.61  ? 202 TYR D C   1 
ATOM   7548  O  O   . TYR D  1 176 ? 5.631   64.408  -30.960  1.00 33.83  ? 202 TYR D O   1 
ATOM   7549  C  CB  . TYR D  1 176 ? 8.137   64.712  -28.885  1.00 46.84  ? 202 TYR D CB  1 
ATOM   7550  C  CG  . TYR D  1 176 ? 9.284   65.433  -28.201  1.00 46.20  ? 202 TYR D CG  1 
ATOM   7551  C  CD1 . TYR D  1 176 ? 10.615  65.056  -28.413  1.00 50.83  ? 202 TYR D CD1 1 
ATOM   7552  C  CD2 . TYR D  1 176 ? 9.041   66.535  -27.403  1.00 47.59  ? 202 TYR D CD2 1 
ATOM   7553  C  CE1 . TYR D  1 176 ? 11.653  65.751  -27.822  1.00 54.45  ? 202 TYR D CE1 1 
ATOM   7554  C  CE2 . TYR D  1 176 ? 10.069  67.237  -26.815  1.00 53.72  ? 202 TYR D CE2 1 
ATOM   7555  C  CZ  . TYR D  1 176 ? 11.377  66.839  -27.027  1.00 58.44  ? 202 TYR D CZ  1 
ATOM   7556  O  OH  . TYR D  1 176 ? 12.433  67.509  -26.454  1.00 55.11  ? 202 TYR D OH  1 
ATOM   7557  N  N   . TYR D  1 177 ? 7.527   63.548  -31.828  1.00 38.73  ? 203 TYR D N   1 
ATOM   7558  C  CA  . TYR D  1 177 ? 6.826   62.687  -32.774  1.00 39.45  ? 203 TYR D CA  1 
ATOM   7559  C  C   . TYR D  1 177 ? 7.472   61.308  -32.757  1.00 40.17  ? 203 TYR D C   1 
ATOM   7560  O  O   . TYR D  1 177 ? 8.366   61.034  -31.951  1.00 43.49  ? 203 TYR D O   1 
ATOM   7561  C  CB  . TYR D  1 177 ? 6.846   63.263  -34.196  1.00 40.24  ? 203 TYR D CB  1 
ATOM   7562  C  CG  . TYR D  1 177 ? 6.184   64.612  -34.358  1.00 38.39  ? 203 TYR D CG  1 
ATOM   7563  C  CD1 . TYR D  1 177 ? 4.837   64.713  -34.678  1.00 40.84  ? 203 TYR D CD1 1 
ATOM   7564  C  CD2 . TYR D  1 177 ? 6.907   65.784  -34.189  1.00 34.81  ? 203 TYR D CD2 1 
ATOM   7565  C  CE1 . TYR D  1 177 ? 4.229   65.938  -34.829  1.00 41.34  ? 203 TYR D CE1 1 
ATOM   7566  C  CE2 . TYR D  1 177 ? 6.307   67.020  -34.342  1.00 42.28  ? 203 TYR D CE2 1 
ATOM   7567  C  CZ  . TYR D  1 177 ? 4.962   67.090  -34.660  1.00 46.29  ? 203 TYR D CZ  1 
ATOM   7568  O  OH  . TYR D  1 177 ? 4.334   68.307  -34.819  1.00 42.97  ? 203 TYR D OH  1 
ATOM   7569  N  N   . SER D  1 178 ? 7.009   60.444  -33.669  1.00 34.17  ? 204 SER D N   1 
ATOM   7570  C  CA  . SER D  1 178 ? 7.557   59.108  -33.888  1.00 41.66  ? 204 SER D CA  1 
ATOM   7571  C  C   . SER D  1 178 ? 7.121   58.149  -32.790  1.00 44.32  ? 204 SER D C   1 
ATOM   7572  O  O   . SER D  1 178 ? 6.455   58.545  -31.828  1.00 41.19  ? 204 SER D O   1 
ATOM   7573  C  CB  . SER D  1 178 ? 9.086   59.146  -33.990  1.00 44.95  ? 204 SER D CB  1 
ATOM   7574  O  OG  . SER D  1 178 ? 9.647   57.875  -33.714  1.00 48.52  ? 204 SER D OG  1 
ATOM   7575  N  N   . ALA D  1 179 ? 7.490   56.880  -32.941  1.00 42.44  ? 205 ALA D N   1 
ATOM   7576  C  CA  . ALA D  1 179 ? 7.106   55.843  -31.998  1.00 34.80  ? 205 ALA D CA  1 
ATOM   7577  C  C   . ALA D  1 179 ? 7.872   55.913  -30.687  1.00 40.53  ? 205 ALA D C   1 
ATOM   7578  O  O   . ALA D  1 179 ? 7.504   55.209  -29.740  1.00 40.23  ? 205 ALA D O   1 
ATOM   7579  C  CB  . ALA D  1 179 ? 7.309   54.466  -32.630  1.00 34.11  ? 205 ALA D CB  1 
ATOM   7580  N  N   . THR D  1 180 ? 8.924   56.726  -30.608  1.00 42.10  ? 206 THR D N   1 
ATOM   7581  C  CA  . THR D  1 180 ? 9.702   56.865  -29.386  1.00 39.84  ? 206 THR D CA  1 
ATOM   7582  C  C   . THR D  1 180 ? 9.532   58.227  -28.730  1.00 41.09  ? 206 THR D C   1 
ATOM   7583  O  O   . THR D  1 180 ? 10.133  58.467  -27.677  1.00 38.94  ? 206 THR D O   1 
ATOM   7584  C  CB  . THR D  1 180 ? 11.187  56.615  -29.666  1.00 35.03  ? 206 THR D CB  1 
ATOM   7585  O  OG1 . THR D  1 180 ? 11.708  57.688  -30.456  1.00 44.00  ? 206 THR D OG1 1 
ATOM   7586  C  CG2 . THR D  1 180 ? 11.371  55.314  -30.423  1.00 37.92  ? 206 THR D CG2 1 
ATOM   7587  N  N   . CYS D  1 181 ? 8.725   59.117  -29.318  1.00 39.83  ? 207 CYS D N   1 
ATOM   7588  C  CA  . CYS D  1 181 ? 8.550   60.488  -28.832  1.00 42.55  ? 207 CYS D CA  1 
ATOM   7589  C  C   . CYS D  1 181 ? 9.876   61.241  -28.757  1.00 45.92  ? 207 CYS D C   1 
ATOM   7590  O  O   . CYS D  1 181 ? 10.027  62.171  -27.964  1.00 51.97  ? 207 CYS D O   1 
ATOM   7591  C  CB  . CYS D  1 181 ? 7.845   60.524  -27.471  1.00 36.84  ? 207 CYS D CB  1 
ATOM   7592  S  SG  . CYS D  1 181 ? 6.141   59.940  -27.489  1.00 46.38  ? 207 CYS D SG  1 
ATOM   7593  N  N   . ASN D  1 182 ? 10.851  60.851  -29.581  1.00 36.72  ? 208 ASN D N   1 
ATOM   7594  C  CA  . ASN D  1 182 ? 12.168  61.466  -29.552  1.00 41.00  ? 208 ASN D CA  1 
ATOM   7595  C  C   . ASN D  1 182 ? 12.441  62.375  -30.741  1.00 51.13  ? 208 ASN D C   1 
ATOM   7596  O  O   . ASN D  1 182 ? 13.358  63.198  -30.668  1.00 58.47  ? 208 ASN D O   1 
ATOM   7597  C  CB  . ASN D  1 182 ? 13.255  60.381  -29.488  1.00 42.73  ? 208 ASN D CB  1 
ATOM   7598  C  CG  . ASN D  1 182 ? 14.543  60.875  -28.854  1.00 47.62  ? 208 ASN D CG  1 
ATOM   7599  O  OD1 . ASN D  1 182 ? 14.563  61.895  -28.159  1.00 46.13  ? 208 ASN D OD1 1 
ATOM   7600  N  ND2 . ASN D  1 182 ? 15.628  60.141  -29.081  1.00 44.87  ? 208 ASN D ND2 1 
ATOM   7601  N  N   . LYS D  1 183 ? 11.677  62.247  -31.822  1.00 45.90  ? 209 LYS D N   1 
ATOM   7602  C  CA  . LYS D  1 183 ? 11.847  63.113  -32.980  1.00 46.38  ? 209 LYS D CA  1 
ATOM   7603  C  C   . LYS D  1 183 ? 11.320  64.508  -32.657  1.00 51.45  ? 209 LYS D C   1 
ATOM   7604  O  O   . LYS D  1 183 ? 10.153  64.671  -32.281  1.00 47.80  ? 209 LYS D O   1 
ATOM   7605  C  CB  . LYS D  1 183 ? 11.122  62.513  -34.184  1.00 46.48  ? 209 LYS D CB  1 
ATOM   7606  C  CG  . LYS D  1 183 ? 11.404  63.177  -35.522  1.00 40.36  ? 209 LYS D CG  1 
ATOM   7607  C  CD  . LYS D  1 183 ? 10.501  62.591  -36.602  1.00 47.00  ? 209 LYS D CD  1 
ATOM   7608  C  CE  . LYS D  1 183 ? 10.746  63.218  -37.972  1.00 50.33  ? 209 LYS D CE  1 
ATOM   7609  N  NZ  . LYS D  1 183 ? 12.083  62.862  -38.531  1.00 60.04  ? 209 LYS D NZ  1 
ATOM   7610  N  N   . PHE D  1 184 ? 12.185  65.509  -32.787  1.00 54.74  ? 210 PHE D N   1 
ATOM   7611  C  CA  . PHE D  1 184 ? 11.849  66.897  -32.509  1.00 55.35  ? 210 PHE D CA  1 
ATOM   7612  C  C   . PHE D  1 184 ? 11.852  67.687  -33.812  1.00 56.89  ? 210 PHE D C   1 
ATOM   7613  O  O   . PHE D  1 184 ? 12.702  67.473  -34.681  1.00 65.27  ? 210 PHE D O   1 
ATOM   7614  C  CB  . PHE D  1 184 ? 12.842  67.502  -31.509  1.00 57.69  ? 210 PHE D CB  1 
ATOM   7615  C  CG  . PHE D  1 184 ? 12.490  68.894  -31.052  1.00 59.21  ? 210 PHE D CG  1 
ATOM   7616  C  CD1 . PHE D  1 184 ? 11.605  69.094  -30.010  1.00 57.57  ? 210 PHE D CD1 1 
ATOM   7617  C  CD2 . PHE D  1 184 ? 13.060  70.001  -31.658  1.00 59.27  ? 210 PHE D CD2 1 
ATOM   7618  C  CE1 . PHE D  1 184 ? 11.296  70.369  -29.584  1.00 62.95  ? 210 PHE D CE1 1 
ATOM   7619  C  CE2 . PHE D  1 184 ? 12.742  71.279  -31.240  1.00 58.84  ? 210 PHE D CE2 1 
ATOM   7620  C  CZ  . PHE D  1 184 ? 11.855  71.461  -30.203  1.00 68.68  ? 210 PHE D CZ  1 
ATOM   7621  N  N   . CYS D  1 185 ? 10.878  68.580  -33.949  1.00 47.29  ? 211 CYS D N   1 
ATOM   7622  C  CA  . CYS D  1 185 ? 10.735  69.496  -35.076  1.00 59.67  ? 211 CYS D CA  1 
ATOM   7623  C  C   . CYS D  1 185 ? 9.675   70.500  -34.707  1.00 59.87  ? 211 CYS D C   1 
ATOM   7624  O  O   . CYS D  1 185 ? 8.530   70.086  -34.519  1.00 52.23  ? 211 CYS D O   1 
ATOM   7625  C  CB  . CYS D  1 185 ? 10.253  68.808  -36.356  1.00 59.91  ? 211 CYS D CB  1 
ATOM   7626  S  SG  . CYS D  1 185 ? 9.530   69.937  -37.696  1.00 56.78  ? 211 CYS D SG  1 
ATOM   7627  N  N   . ARG D  1 186 ? 9.985   71.800  -34.656  1.00 58.04  ? 212 ARG D N   1 
ATOM   7628  C  CA  . ARG D  1 186 ? 8.863   72.747  -34.545  1.00 53.76  ? 212 ARG D CA  1 
ATOM   7629  C  C   . ARG D  1 186 ? 9.104   74.160  -35.092  1.00 52.61  ? 212 ARG D C   1 
ATOM   7630  O  O   . ARG D  1 186 ? 10.251  74.643  -35.142  1.00 56.09  ? 212 ARG D O   1 
ATOM   7631  C  CB  . ARG D  1 186 ? 8.321   72.812  -33.090  1.00 63.48  ? 212 ARG D CB  1 
ATOM   7632  C  CG  . ARG D  1 186 ? 7.546   71.623  -32.507  1.00 75.46  ? 212 ARG D CG  1 
ATOM   7633  C  CD  . ARG D  1 186 ? 6.165   71.627  -33.160  1.00 69.68  ? 212 ARG D CD  1 
ATOM   7634  N  NE  . ARG D  1 186 ? 5.249   70.703  -32.393  1.00 76.87  ? 212 ARG D NE  1 
ATOM   7635  C  CZ  . ARG D  1 186 ? 4.413   71.093  -31.389  1.00 89.23  ? 212 ARG D CZ  1 
ATOM   7636  N  NH1 . ARG D  1 186 ? 4.370   72.377  -31.174  1.00 89.93  ? 212 ARG D NH1 1 
ATOM   7637  N  NH2 . ARG D  1 186 ? 3.635   70.301  -30.732  1.00 90.70  ? 212 ARG D NH2 1 
ATOM   7638  N  N   . PRO D  1 187 ? 8.007   74.796  -35.617  1.00 49.00  ? 213 PRO D N   1 
ATOM   7639  C  CA  . PRO D  1 187 ? 8.101   75.886  -36.605  1.00 43.89  ? 213 PRO D CA  1 
ATOM   7640  C  C   . PRO D  1 187 ? 9.033   77.015  -36.232  1.00 52.65  ? 213 PRO D C   1 
ATOM   7641  O  O   . PRO D  1 187 ? 9.278   77.298  -35.055  1.00 52.18  ? 213 PRO D O   1 
ATOM   7642  C  CB  . PRO D  1 187 ? 6.650   76.385  -36.705  1.00 41.25  ? 213 PRO D CB  1 
ATOM   7643  C  CG  . PRO D  1 187 ? 5.850   75.190  -36.359  1.00 47.16  ? 213 PRO D CG  1 
ATOM   7644  C  CD  . PRO D  1 187 ? 6.611   74.502  -35.278  1.00 46.81  ? 213 PRO D CD  1 
ATOM   7645  N  N   . ARG D  1 188 ? 9.577   77.639  -37.269  1.00 52.83  ? 214 ARG D N   1 
ATOM   7646  C  CA  . ARG D  1 188 ? 10.526  78.725  -37.129  1.00 48.24  ? 214 ARG D CA  1 
ATOM   7647  C  C   . ARG D  1 188 ? 10.410  79.573  -38.382  1.00 49.78  ? 214 ARG D C   1 
ATOM   7648  O  O   . ARG D  1 188 ? 9.853   79.141  -39.396  1.00 50.50  ? 214 ARG D O   1 
ATOM   7649  C  CB  . ARG D  1 188 ? 11.949  78.196  -36.938  1.00 47.79  ? 214 ARG D CB  1 
ATOM   7650  C  CG  . ARG D  1 188 ? 12.720  78.885  -35.842  1.00 57.76  ? 214 ARG D CG  1 
ATOM   7651  C  CD  . ARG D  1 188 ? 13.981  78.113  -35.508  1.00 67.51  ? 214 ARG D CD  1 
ATOM   7652  N  NE  . ARG D  1 188 ? 14.621  78.607  -34.291  1.00 80.47  ? 214 ARG D NE  1 
ATOM   7653  C  CZ  . ARG D  1 188 ? 15.628  77.995  -33.675  1.00 81.77  ? 214 ARG D CZ  1 
ATOM   7654  N  NH1 . ARG D  1 188 ? 16.113  76.859  -34.160  1.00 78.05  ? 214 ARG D NH1 1 
ATOM   7655  N  NH2 . ARG D  1 188 ? 16.150  78.518  -32.572  1.00 76.10  ? 214 ARG D NH2 1 
ATOM   7656  N  N   . ASN D  1 189 ? 10.926  80.793  -38.296  1.00 51.78  ? 215 ASN D N   1 
ATOM   7657  C  CA  . ASN D  1 189 ? 10.931  81.679  -39.450  1.00 43.16  ? 215 ASN D CA  1 
ATOM   7658  C  C   . ASN D  1 189 ? 12.059  82.691  -39.317  1.00 47.88  ? 215 ASN D C   1 
ATOM   7659  O  O   . ASN D  1 189 ? 11.840  83.900  -39.435  1.00 46.03  ? 215 ASN D O   1 
ATOM   7660  C  CB  . ASN D  1 189 ? 9.581   82.382  -39.602  1.00 37.75  ? 215 ASN D CB  1 
ATOM   7661  C  CG  . ASN D  1 189 ? 9.415   83.031  -40.962  1.00 43.69  ? 215 ASN D CG  1 
ATOM   7662  O  OD1 . ASN D  1 189 ? 10.274  82.898  -41.833  1.00 45.37  ? 215 ASN D OD1 1 
ATOM   7663  N  ND2 . ASN D  1 189 ? 8.304   83.730  -41.155  1.00 46.39  ? 215 ASN D ND2 1 
ATOM   7664  N  N   . ASP D  1 190 ? 13.267  82.201  -39.062  1.00 53.69  ? 216 ASP D N   1 
ATOM   7665  C  CA  . ASP D  1 190 ? 14.450  83.047  -38.962  1.00 52.34  ? 216 ASP D CA  1 
ATOM   7666  C  C   . ASP D  1 190 ? 15.541  82.425  -39.830  1.00 49.84  ? 216 ASP D C   1 
ATOM   7667  O  O   . ASP D  1 190 ? 15.278  81.665  -40.770  1.00 48.88  ? 216 ASP D O   1 
ATOM   7668  C  CB  . ASP D  1 190 ? 14.866  83.213  -37.497  1.00 57.32  ? 216 ASP D CB  1 
ATOM   7669  C  CG  . ASP D  1 190 ? 14.885  81.899  -36.744  1.00 61.22  ? 216 ASP D CG  1 
ATOM   7670  O  OD1 . ASP D  1 190 ? 15.490  80.930  -37.250  1.00 59.11  ? 216 ASP D OD1 1 
ATOM   7671  O  OD2 . ASP D  1 190 ? 14.287  81.833  -35.648  1.00 71.64  ? 216 ASP D OD2 1 
ATOM   7672  N  N   . PHE D  1 191 ? 16.799  82.737  -39.516  1.00 53.65  ? 217 PHE D N   1 
ATOM   7673  C  CA  . PHE D  1 191 ? 17.903  82.202  -40.303  1.00 59.28  ? 217 PHE D CA  1 
ATOM   7674  C  C   . PHE D  1 191 ? 18.037  80.691  -40.155  1.00 63.98  ? 217 PHE D C   1 
ATOM   7675  O  O   . PHE D  1 191 ? 18.652  80.051  -41.015  1.00 62.67  ? 217 PHE D O   1 
ATOM   7676  C  CB  . PHE D  1 191 ? 19.215  82.885  -39.906  1.00 61.32  ? 217 PHE D CB  1 
ATOM   7677  C  CG  . PHE D  1 191 ? 19.799  82.374  -38.617  1.00 68.46  ? 217 PHE D CG  1 
ATOM   7678  C  CD1 . PHE D  1 191 ? 19.446  82.951  -37.407  1.00 70.21  ? 217 PHE D CD1 1 
ATOM   7679  C  CD2 . PHE D  1 191 ? 20.710  81.323  -38.614  1.00 64.84  ? 217 PHE D CD2 1 
ATOM   7680  C  CE1 . PHE D  1 191 ? 19.980  82.484  -36.219  1.00 75.40  ? 217 PHE D CE1 1 
ATOM   7681  C  CE2 . PHE D  1 191 ? 21.245  80.853  -37.432  1.00 67.61  ? 217 PHE D CE2 1 
ATOM   7682  C  CZ  . PHE D  1 191 ? 20.881  81.434  -36.233  1.00 76.25  ? 217 PHE D CZ  1 
ATOM   7683  N  N   . PHE D  1 192 ? 17.488  80.112  -39.085  1.00 59.82  ? 218 PHE D N   1 
ATOM   7684  C  CA  . PHE D  1 192 ? 17.579  78.675  -38.856  1.00 64.36  ? 218 PHE D CA  1 
ATOM   7685  C  C   . PHE D  1 192 ? 16.625  77.869  -39.728  1.00 59.22  ? 218 PHE D C   1 
ATOM   7686  O  O   . PHE D  1 192 ? 16.785  76.647  -39.824  1.00 58.53  ? 218 PHE D O   1 
ATOM   7687  C  CB  . PHE D  1 192 ? 17.313  78.355  -37.380  1.00 66.83  ? 218 PHE D CB  1 
ATOM   7688  C  CG  . PHE D  1 192 ? 18.558  78.275  -36.540  1.00 76.74  ? 218 PHE D CG  1 
ATOM   7689  C  CD1 . PHE D  1 192 ? 18.540  78.674  -35.211  1.00 84.72  ? 218 PHE D CD1 1 
ATOM   7690  C  CD2 . PHE D  1 192 ? 19.742  77.786  -37.073  1.00 77.15  ? 218 PHE D CD2 1 
ATOM   7691  C  CE1 . PHE D  1 192 ? 19.682  78.598  -34.430  1.00 83.00  ? 218 PHE D CE1 1 
ATOM   7692  C  CE2 . PHE D  1 192 ? 20.888  77.707  -36.297  1.00 85.64  ? 218 PHE D CE2 1 
ATOM   7693  C  CZ  . PHE D  1 192 ? 20.857  78.114  -34.974  1.00 86.32  ? 218 PHE D CZ  1 
ATOM   7694  N  N   . GLY D  1 193 ? 15.650  78.507  -40.351  1.00 45.87  ? 219 GLY D N   1 
ATOM   7695  C  CA  . GLY D  1 193 ? 14.721  77.819  -41.225  1.00 43.82  ? 219 GLY D CA  1 
ATOM   7696  C  C   . GLY D  1 193 ? 13.405  78.557  -41.320  1.00 38.00  ? 219 GLY D C   1 
ATOM   7697  O  O   . GLY D  1 193 ? 13.080  79.431  -40.520  1.00 41.12  ? 219 GLY D O   1 
ATOM   7698  N  N   . HIS D  1 194 ? 12.624  78.186  -42.334  1.00 29.63  ? 220 HIS D N   1 
ATOM   7699  C  CA  . HIS D  1 194 ? 11.310  78.772  -42.597  1.00 36.13  ? 220 HIS D CA  1 
ATOM   7700  C  C   . HIS D  1 194 ? 10.364  77.612  -42.884  1.00 37.84  ? 220 HIS D C   1 
ATOM   7701  O  O   . HIS D  1 194 ? 10.196  77.213  -44.040  1.00 33.39  ? 220 HIS D O   1 
ATOM   7702  C  CB  . HIS D  1 194 ? 11.367  79.760  -43.762  1.00 36.41  ? 220 HIS D CB  1 
ATOM   7703  C  CG  . HIS D  1 194 ? 12.528  80.702  -43.697  1.00 32.23  ? 220 HIS D CG  1 
ATOM   7704  N  ND1 . HIS D  1 194 ? 12.464  81.918  -43.053  1.00 31.60  ? 220 HIS D ND1 1 
ATOM   7705  C  CD2 . HIS D  1 194 ? 13.786  80.601  -44.187  1.00 27.35  ? 220 HIS D CD2 1 
ATOM   7706  C  CE1 . HIS D  1 194 ? 13.631  82.528  -43.154  1.00 31.89  ? 220 HIS D CE1 1 
ATOM   7707  N  NE2 . HIS D  1 194 ? 14.450  81.750  -43.837  1.00 29.37  ? 220 HIS D NE2 1 
ATOM   7708  N  N   . TYR D  1 195 ? 9.745   77.071  -41.837  1.00 41.57  ? 221 TYR D N   1 
ATOM   7709  C  CA  . TYR D  1 195 ? 8.940   75.870  -42.005  1.00 41.52  ? 221 TYR D CA  1 
ATOM   7710  C  C   . TYR D  1 195 ? 7.910   75.767  -40.889  1.00 42.09  ? 221 TYR D C   1 
ATOM   7711  O  O   . TYR D  1 195 ? 7.971   76.477  -39.883  1.00 47.45  ? 221 TYR D O   1 
ATOM   7712  C  CB  . TYR D  1 195 ? 9.822   74.618  -42.032  1.00 42.36  ? 221 TYR D CB  1 
ATOM   7713  C  CG  . TYR D  1 195 ? 10.606  74.393  -40.757  1.00 47.73  ? 221 TYR D CG  1 
ATOM   7714  C  CD1 . TYR D  1 195 ? 10.103  73.590  -39.739  1.00 47.01  ? 221 TYR D CD1 1 
ATOM   7715  C  CD2 . TYR D  1 195 ? 11.851  74.982  -40.570  1.00 50.39  ? 221 TYR D CD2 1 
ATOM   7716  C  CE1 . TYR D  1 195 ? 10.816  73.381  -38.574  1.00 48.96  ? 221 TYR D CE1 1 
ATOM   7717  C  CE2 . TYR D  1 195 ? 12.571  74.778  -39.405  1.00 51.76  ? 221 TYR D CE2 1 
ATOM   7718  C  CZ  . TYR D  1 195 ? 12.048  73.976  -38.413  1.00 47.21  ? 221 TYR D CZ  1 
ATOM   7719  O  OH  . TYR D  1 195 ? 12.758  73.769  -37.256  1.00 44.15  ? 221 TYR D OH  1 
ATOM   7720  N  N   . THR D  1 196 ? 6.947   74.873  -41.102  1.00 40.52  ? 222 THR D N   1 
ATOM   7721  C  CA  . THR D  1 196 ? 6.072   74.357  -40.061  1.00 40.00  ? 222 THR D CA  1 
ATOM   7722  C  C   . THR D  1 196 ? 6.163   72.839  -40.101  1.00 42.59  ? 222 THR D C   1 
ATOM   7723  O  O   . THR D  1 196 ? 6.567   72.256  -41.111  1.00 43.12  ? 222 THR D O   1 
ATOM   7724  C  CB  . THR D  1 196 ? 4.613   74.806  -40.248  1.00 30.70  ? 222 THR D CB  1 
ATOM   7725  O  OG1 . THR D  1 196 ? 4.145   74.392  -41.533  1.00 24.61  ? 222 THR D OG1 1 
ATOM   7726  C  CG2 . THR D  1 196 ? 4.495   76.311  -40.141  1.00 31.14  ? 222 THR D CG2 1 
ATOM   7727  N  N   . CYS D  1 197 ? 5.798   72.190  -38.999  1.00 40.45  ? 223 CYS D N   1 
ATOM   7728  C  CA  . CYS D  1 197 ? 5.896   70.739  -38.955  1.00 41.37  ? 223 CYS D CA  1 
ATOM   7729  C  C   . CYS D  1 197 ? 4.563   70.097  -39.305  1.00 39.71  ? 223 CYS D C   1 
ATOM   7730  O  O   . CYS D  1 197 ? 3.492   70.663  -39.063  1.00 35.33  ? 223 CYS D O   1 
ATOM   7731  C  CB  . CYS D  1 197 ? 6.375   70.252  -37.588  1.00 48.24  ? 223 CYS D CB  1 
ATOM   7732  S  SG  . CYS D  1 197 ? 7.898   71.041  -37.087  1.00 43.45  ? 223 CYS D SG  1 
ATOM   7733  N  N   . ASP D  1 198 ? 4.647   68.910  -39.903  1.00 43.70  ? 224 ASP D N   1 
ATOM   7734  C  CA  . ASP D  1 198 ? 3.490   68.131  -40.304  1.00 43.75  ? 224 ASP D CA  1 
ATOM   7735  C  C   . ASP D  1 198 ? 3.178   67.088  -39.232  1.00 49.50  ? 224 ASP D C   1 
ATOM   7736  O  O   . ASP D  1 198 ? 3.733   67.105  -38.129  1.00 47.33  ? 224 ASP D O   1 
ATOM   7737  C  CB  . ASP D  1 198 ? 3.721   67.499  -41.684  1.00 47.19  ? 224 ASP D CB  1 
ATOM   7738  C  CG  . ASP D  1 198 ? 4.891   66.510  -41.716  1.00 51.18  ? 224 ASP D CG  1 
ATOM   7739  O  OD1 . ASP D  1 198 ? 5.319   66.007  -40.653  1.00 51.25  ? 224 ASP D OD1 1 
ATOM   7740  O  OD2 . ASP D  1 198 ? 5.380   66.219  -42.831  1.00 44.30  ? 224 ASP D OD2 1 
ATOM   7741  N  N   . GLN D  1 199 ? 2.299   66.149  -39.572  1.00 54.40  ? 225 GLN D N   1 
ATOM   7742  C  CA  . GLN D  1 199 ? 1.792   65.160  -38.630  1.00 47.86  ? 225 GLN D CA  1 
ATOM   7743  C  C   . GLN D  1 199 ? 2.819   64.099  -38.242  1.00 45.43  ? 225 GLN D C   1 
ATOM   7744  O  O   . GLN D  1 199 ? 2.461   63.177  -37.503  1.00 51.64  ? 225 GLN D O   1 
ATOM   7745  C  CB  . GLN D  1 199 ? 0.538   64.506  -39.221  1.00 59.46  ? 225 GLN D CB  1 
ATOM   7746  C  CG  . GLN D  1 199 ? 0.519   64.488  -40.750  1.00 59.49  ? 225 GLN D CG  1 
ATOM   7747  C  CD  . GLN D  1 199 ? -0.519  63.537  -41.325  1.00 64.07  ? 225 GLN D CD  1 
ATOM   7748  O  OE1 . GLN D  1 199 ? -1.166  62.790  -40.588  1.00 60.41  ? 225 GLN D OE1 1 
ATOM   7749  N  NE2 . GLN D  1 199 ? -0.641  63.523  -42.654  1.00 64.39  ? 225 GLN D NE2 1 
ATOM   7750  N  N   . TYR D  1 200 ? 4.074   64.199  -38.696  1.00 50.39  ? 226 TYR D N   1 
ATOM   7751  C  CA  . TYR D  1 200 ? 5.104   63.231  -38.334  1.00 49.15  ? 226 TYR D CA  1 
ATOM   7752  C  C   . TYR D  1 200 ? 6.412   63.861  -37.875  1.00 48.74  ? 226 TYR D C   1 
ATOM   7753  O  O   . TYR D  1 200 ? 7.369   63.125  -37.604  1.00 52.82  ? 226 TYR D O   1 
ATOM   7754  C  CB  . TYR D  1 200 ? 5.409   62.282  -39.506  1.00 49.37  ? 226 TYR D CB  1 
ATOM   7755  C  CG  . TYR D  1 200 ? 4.194   61.670  -40.160  1.00 51.92  ? 226 TYR D CG  1 
ATOM   7756  C  CD1 . TYR D  1 200 ? 3.826   60.355  -39.892  1.00 55.12  ? 226 TYR D CD1 1 
ATOM   7757  C  CD2 . TYR D  1 200 ? 3.440   62.388  -41.076  1.00 52.70  ? 226 TYR D CD2 1 
ATOM   7758  C  CE1 . TYR D  1 200 ? 2.719   59.786  -40.499  1.00 51.76  ? 226 TYR D CE1 1 
ATOM   7759  C  CE2 . TYR D  1 200 ? 2.342   61.829  -41.687  1.00 55.59  ? 226 TYR D CE2 1 
ATOM   7760  C  CZ  . TYR D  1 200 ? 1.981   60.535  -41.395  1.00 55.31  ? 226 TYR D CZ  1 
ATOM   7761  O  OH  . TYR D  1 200 ? 0.879   59.998  -42.015  1.00 61.17  ? 226 TYR D OH  1 
ATOM   7762  N  N   . GLY D  1 201 ? 6.492   65.185  -37.790  1.00 47.34  ? 227 GLY D N   1 
ATOM   7763  C  CA  . GLY D  1 201 ? 7.720   65.836  -37.397  1.00 44.07  ? 227 GLY D CA  1 
ATOM   7764  C  C   . GLY D  1 201 ? 8.644   66.187  -38.531  1.00 42.92  ? 227 GLY D C   1 
ATOM   7765  O  O   . GLY D  1 201 ? 9.815   66.497  -38.285  1.00 47.87  ? 227 GLY D O   1 
ATOM   7766  N  N   . ASN D  1 202 ? 8.167   66.134  -39.763  1.00 44.87  ? 228 ASN D N   1 
ATOM   7767  C  CA  . ASN D  1 202 ? 8.953   66.577  -40.897  1.00 44.41  ? 228 ASN D CA  1 
ATOM   7768  C  C   . ASN D  1 202 ? 8.750   68.072  -41.103  1.00 43.59  ? 228 ASN D C   1 
ATOM   7769  O  O   . ASN D  1 202 ? 7.692   68.625  -40.789  1.00 36.90  ? 228 ASN D O   1 
ATOM   7770  C  CB  . ASN D  1 202 ? 8.567   65.790  -42.147  1.00 44.34  ? 228 ASN D CB  1 
ATOM   7771  C  CG  . ASN D  1 202 ? 8.817   64.300  -41.988  1.00 41.93  ? 228 ASN D CG  1 
ATOM   7772  O  OD1 . ASN D  1 202 ? 9.860   63.887  -41.479  1.00 39.53  ? 228 ASN D OD1 1 
ATOM   7773  N  ND2 . ASN D  1 202 ? 7.854   63.488  -42.407  1.00 43.98  ? 228 ASN D ND2 1 
ATOM   7774  N  N   . LYS D  1 203 ? 9.792   68.731  -41.600  1.00 43.52  ? 229 LYS D N   1 
ATOM   7775  C  CA  . LYS D  1 203 ? 9.739   70.168  -41.832  1.00 43.58  ? 229 LYS D CA  1 
ATOM   7776  C  C   . LYS D  1 203 ? 9.082   70.443  -43.179  1.00 39.65  ? 229 LYS D C   1 
ATOM   7777  O  O   . LYS D  1 203 ? 9.528   69.932  -44.212  1.00 40.19  ? 229 LYS D O   1 
ATOM   7778  C  CB  . LYS D  1 203 ? 11.142  70.765  -41.779  1.00 47.86  ? 229 LYS D CB  1 
ATOM   7779  C  CG  . LYS D  1 203 ? 11.988  70.220  -40.646  1.00 49.41  ? 229 LYS D CG  1 
ATOM   7780  C  CD  . LYS D  1 203 ? 13.197  71.099  -40.369  1.00 50.29  ? 229 LYS D CD  1 
ATOM   7781  C  CE  . LYS D  1 203 ? 14.164  70.405  -39.418  1.00 57.14  ? 229 LYS D CE  1 
ATOM   7782  N  NZ  . LYS D  1 203 ? 13.462  69.750  -38.270  1.00 63.91  ? 229 LYS D NZ  1 
ATOM   7783  N  N   . ALA D  1 204 ? 8.016   71.236  -43.165  1.00 34.49  ? 230 ALA D N   1 
ATOM   7784  C  CA  . ALA D  1 204 ? 7.325   71.657  -44.380  1.00 31.79  ? 230 ALA D CA  1 
ATOM   7785  C  C   . ALA D  1 204 ? 7.709   73.109  -44.647  1.00 32.08  ? 230 ALA D C   1 
ATOM   7786  O  O   . ALA D  1 204 ? 7.219   74.023  -43.980  1.00 34.50  ? 230 ALA D O   1 
ATOM   7787  C  CB  . ALA D  1 204 ? 5.818   71.489  -44.231  1.00 28.77  ? 230 ALA D CB  1 
ATOM   7788  N  N   . CYS D  1 205 ? 8.590   73.317  -45.623  1.00 30.60  ? 231 CYS D N   1 
ATOM   7789  C  CA  . CYS D  1 205 ? 9.117   74.649  -45.889  1.00 32.97  ? 231 CYS D CA  1 
ATOM   7790  C  C   . CYS D  1 205 ? 8.002   75.612  -46.273  1.00 27.73  ? 231 CYS D C   1 
ATOM   7791  O  O   . CYS D  1 205 ? 7.035   75.236  -46.938  1.00 33.63  ? 231 CYS D O   1 
ATOM   7792  C  CB  . CYS D  1 205 ? 10.162  74.598  -47.005  1.00 29.77  ? 231 CYS D CB  1 
ATOM   7793  S  SG  . CYS D  1 205 ? 11.552  73.491  -46.688  1.00 37.34  ? 231 CYS D SG  1 
ATOM   7794  N  N   . MET D  1 206 ? 8.141   76.862  -45.843  1.00 27.49  ? 232 MET D N   1 
ATOM   7795  C  CA  . MET D  1 206 ? 7.190   77.892  -46.224  1.00 26.56  ? 232 MET D CA  1 
ATOM   7796  C  C   . MET D  1 206 ? 7.399   78.284  -47.686  1.00 31.25  ? 232 MET D C   1 
ATOM   7797  O  O   . MET D  1 206 ? 8.359   77.870  -48.341  1.00 32.50  ? 232 MET D O   1 
ATOM   7798  C  CB  . MET D  1 206 ? 7.332   79.107  -45.312  1.00 26.96  ? 232 MET D CB  1 
ATOM   7799  C  CG  . MET D  1 206 ? 7.236   78.771  -43.835  1.00 29.67  ? 232 MET D CG  1 
ATOM   7800  S  SD  . MET D  1 206 ? 7.567   80.189  -42.773  1.00 40.98  ? 232 MET D SD  1 
ATOM   7801  C  CE  . MET D  1 206 ? 6.379   81.362  -43.430  1.00 38.28  ? 232 MET D CE  1 
ATOM   7802  N  N   . ASP D  1 207 ? 6.479   79.096  -48.201  1.00 32.86  ? 233 ASP D N   1 
ATOM   7803  C  CA  . ASP D  1 207 ? 6.522   79.468  -49.609  1.00 33.25  ? 233 ASP D CA  1 
ATOM   7804  C  C   . ASP D  1 207 ? 7.747   80.324  -49.891  1.00 33.71  ? 233 ASP D C   1 
ATOM   7805  O  O   . ASP D  1 207 ? 8.007   81.305  -49.188  1.00 38.25  ? 233 ASP D O   1 
ATOM   7806  C  CB  . ASP D  1 207 ? 5.251   80.216  -50.005  1.00 38.73  ? 233 ASP D CB  1 
ATOM   7807  C  CG  . ASP D  1 207 ? 4.010   79.351  -49.907  1.00 49.44  ? 233 ASP D CG  1 
ATOM   7808  O  OD1 . ASP D  1 207 ? 3.946   78.497  -48.997  1.00 51.26  ? 233 ASP D OD1 1 
ATOM   7809  O  OD2 . ASP D  1 207 ? 3.098   79.527  -50.741  1.00 60.04  ? 233 ASP D OD2 1 
ATOM   7810  N  N   . GLY D  1 208 ? 8.499   79.949  -50.924  1.00 30.50  ? 234 GLY D N   1 
ATOM   7811  C  CA  . GLY D  1 208 ? 9.718   80.651  -51.271  1.00 28.71  ? 234 GLY D CA  1 
ATOM   7812  C  C   . GLY D  1 208 ? 10.977  80.085  -50.660  1.00 29.44  ? 234 GLY D C   1 
ATOM   7813  O  O   . GLY D  1 208 ? 12.008  80.767  -50.657  1.00 26.14  ? 234 GLY D O   1 
ATOM   7814  N  N   . TRP D  1 209 ? 10.930  78.856  -50.146  1.00 31.79  ? 235 TRP D N   1 
ATOM   7815  C  CA  . TRP D  1 209 ? 12.048  78.262  -49.430  1.00 29.63  ? 235 TRP D CA  1 
ATOM   7816  C  C   . TRP D  1 209 ? 12.110  76.774  -49.739  1.00 32.63  ? 235 TRP D C   1 
ATOM   7817  O  O   . TRP D  1 209 ? 11.089  76.144  -50.023  1.00 42.09  ? 235 TRP D O   1 
ATOM   7818  C  CB  . TRP D  1 209 ? 11.922  78.484  -47.917  1.00 31.30  ? 235 TRP D CB  1 
ATOM   7819  C  CG  . TRP D  1 209 ? 11.983  79.932  -47.514  1.00 30.11  ? 235 TRP D CG  1 
ATOM   7820  C  CD1 . TRP D  1 209 ? 10.931  80.742  -47.193  1.00 29.57  ? 235 TRP D CD1 1 
ATOM   7821  C  CD2 . TRP D  1 209 ? 13.160  80.739  -47.398  1.00 28.38  ? 235 TRP D CD2 1 
ATOM   7822  N  NE1 . TRP D  1 209 ? 11.382  82.005  -46.885  1.00 25.62  ? 235 TRP D NE1 1 
ATOM   7823  C  CE2 . TRP D  1 209 ? 12.747  82.027  -47.000  1.00 26.89  ? 235 TRP D CE2 1 
ATOM   7824  C  CE3 . TRP D  1 209 ? 14.525  80.496  -47.587  1.00 24.21  ? 235 TRP D CE3 1 
ATOM   7825  C  CZ2 . TRP D  1 209 ? 13.649  83.064  -46.785  1.00 25.07  ? 235 TRP D CZ2 1 
ATOM   7826  C  CZ3 . TRP D  1 209 ? 15.414  81.528  -47.378  1.00 19.98  ? 235 TRP D CZ3 1 
ATOM   7827  C  CH2 . TRP D  1 209 ? 14.975  82.795  -46.982  1.00 20.14  ? 235 TRP D CH2 1 
ATOM   7828  N  N   . MET D  1 210 ? 13.320  76.218  -49.683  1.00 31.11  ? 236 MET D N   1 
ATOM   7829  C  CA  . MET D  1 210 ? 13.538  74.813  -50.003  1.00 34.94  ? 236 MET D CA  1 
ATOM   7830  C  C   . MET D  1 210 ? 14.784  74.323  -49.278  1.00 36.67  ? 236 MET D C   1 
ATOM   7831  O  O   . MET D  1 210 ? 15.445  75.071  -48.555  1.00 35.10  ? 236 MET D O   1 
ATOM   7832  C  CB  . MET D  1 210 ? 13.671  74.596  -51.513  1.00 40.47  ? 236 MET D CB  1 
ATOM   7833  C  CG  . MET D  1 210 ? 14.780  75.409  -52.152  1.00 39.84  ? 236 MET D CG  1 
ATOM   7834  S  SD  . MET D  1 210 ? 15.101  74.899  -53.844  1.00 41.74  ? 236 MET D SD  1 
ATOM   7835  C  CE  . MET D  1 210 ? 16.053  76.289  -54.445  1.00 42.30  ? 236 MET D CE  1 
ATOM   7836  N  N   . GLY D  1 211 ? 15.106  73.056  -49.492  1.00 39.46  ? 237 GLY D N   1 
ATOM   7837  C  CA  . GLY D  1 211 ? 16.192  72.395  -48.802  1.00 36.66  ? 237 GLY D CA  1 
ATOM   7838  C  C   . GLY D  1 211 ? 15.684  71.482  -47.701  1.00 33.49  ? 237 GLY D C   1 
ATOM   7839  O  O   . GLY D  1 211 ? 14.496  71.436  -47.380  1.00 31.98  ? 237 GLY D O   1 
ATOM   7840  N  N   . LYS D  1 212 ? 16.629  70.741  -47.117  1.00 40.11  ? 238 LYS D N   1 
ATOM   7841  C  CA  . LYS D  1 212 ? 16.291  69.804  -46.049  1.00 48.98  ? 238 LYS D CA  1 
ATOM   7842  C  C   . LYS D  1 212 ? 16.020  70.510  -44.727  1.00 45.64  ? 238 LYS D C   1 
ATOM   7843  O  O   . LYS D  1 212 ? 15.195  70.038  -43.936  1.00 40.58  ? 238 LYS D O   1 
ATOM   7844  C  CB  . LYS D  1 212 ? 17.408  68.770  -45.875  1.00 48.59  ? 238 LYS D CB  1 
ATOM   7845  C  CG  . LYS D  1 212 ? 17.486  67.748  -47.004  1.00 53.36  ? 238 LYS D CG  1 
ATOM   7846  C  CD  . LYS D  1 212 ? 16.144  67.045  -47.213  1.00 53.73  ? 238 LYS D CD  1 
ATOM   7847  C  CE  . LYS D  1 212 ? 15.553  67.361  -48.586  1.00 55.24  ? 238 LYS D CE  1 
ATOM   7848  N  NZ  . LYS D  1 212 ? 14.183  66.800  -48.768  1.00 53.71  ? 238 LYS D NZ  1 
ATOM   7849  N  N   . GLU D  1 213 ? 16.697  71.629  -44.469  1.00 37.61  ? 239 GLU D N   1 
ATOM   7850  C  CA  . GLU D  1 213 ? 16.441  72.441  -43.289  1.00 39.37  ? 239 GLU D CA  1 
ATOM   7851  C  C   . GLU D  1 213 ? 15.666  73.711  -43.619  1.00 40.69  ? 239 GLU D C   1 
ATOM   7852  O  O   . GLU D  1 213 ? 15.564  74.602  -42.769  1.00 40.61  ? 239 GLU D O   1 
ATOM   7853  C  CB  . GLU D  1 213 ? 17.758  72.784  -42.590  1.00 48.46  ? 239 GLU D CB  1 
ATOM   7854  C  CG  . GLU D  1 213 ? 18.579  71.563  -42.177  1.00 54.12  ? 239 GLU D CG  1 
ATOM   7855  C  CD  . GLU D  1 213 ? 17.904  70.734  -41.092  1.00 62.94  ? 239 GLU D CD  1 
ATOM   7856  O  OE1 . GLU D  1 213 ? 17.725  69.514  -41.299  1.00 60.76  ? 239 GLU D OE1 1 
ATOM   7857  O  OE2 . GLU D  1 213 ? 17.550  71.301  -40.034  1.00 64.56  ? 239 GLU D OE2 1 
ATOM   7858  N  N   . CYS D  1 214 ? 15.117  73.807  -44.835  1.00 41.51  ? 240 CYS D N   1 
ATOM   7859  C  CA  . CYS D  1 214 ? 14.327  74.958  -45.283  1.00 35.54  ? 240 CYS D CA  1 
ATOM   7860  C  C   . CYS D  1 214 ? 15.120  76.260  -45.190  1.00 37.53  ? 240 CYS D C   1 
ATOM   7861  O  O   . CYS D  1 214 ? 14.582  77.312  -44.835  1.00 35.69  ? 240 CYS D O   1 
ATOM   7862  C  CB  . CYS D  1 214 ? 13.011  75.070  -44.509  1.00 39.94  ? 240 CYS D CB  1 
ATOM   7863  S  SG  . CYS D  1 214 ? 11.887  73.665  -44.688  1.00 32.99  ? 240 CYS D SG  1 
ATOM   7864  N  N   . LYS D  1 215 ? 16.409  76.195  -45.527  1.00 37.50  ? 241 LYS D N   1 
ATOM   7865  C  CA  . LYS D  1 215 ? 17.280  77.360  -45.464  1.00 37.49  ? 241 LYS D CA  1 
ATOM   7866  C  C   . LYS D  1 215 ? 17.601  77.954  -46.826  1.00 31.07  ? 241 LYS D C   1 
ATOM   7867  O  O   . LYS D  1 215 ? 18.117  79.074  -46.884  1.00 39.92  ? 241 LYS D O   1 
ATOM   7868  C  CB  . LYS D  1 215 ? 18.597  77.008  -44.754  1.00 42.52  ? 241 LYS D CB  1 
ATOM   7869  C  CG  . LYS D  1 215 ? 18.447  76.681  -43.278  1.00 45.33  ? 241 LYS D CG  1 
ATOM   7870  C  CD  . LYS D  1 215 ? 19.799  76.447  -42.622  1.00 54.31  ? 241 LYS D CD  1 
ATOM   7871  C  CE  . LYS D  1 215 ? 19.645  76.178  -41.128  1.00 69.32  ? 241 LYS D CE  1 
ATOM   7872  N  NZ  . LYS D  1 215 ? 20.951  75.954  -40.442  1.00 73.32  ? 241 LYS D NZ  1 
ATOM   7873  N  N   . GLU D  1 216 ? 17.319  77.244  -47.910  1.00 29.04  ? 242 GLU D N   1 
ATOM   7874  C  CA  . GLU D  1 216 ? 17.702  77.674  -49.247  1.00 28.94  ? 242 GLU D CA  1 
ATOM   7875  C  C   . GLU D  1 216 ? 16.545  78.415  -49.906  1.00 31.53  ? 242 GLU D C   1 
ATOM   7876  O  O   . GLU D  1 216 ? 15.416  77.916  -49.933  1.00 36.40  ? 242 GLU D O   1 
ATOM   7877  C  CB  . GLU D  1 216 ? 18.121  76.465  -50.084  1.00 29.81  ? 242 GLU D CB  1 
ATOM   7878  C  CG  . GLU D  1 216 ? 18.295  76.741  -51.560  1.00 40.20  ? 242 GLU D CG  1 
ATOM   7879  C  CD  . GLU D  1 216 ? 18.818  75.531  -52.316  1.00 55.68  ? 242 GLU D CD  1 
ATOM   7880  O  OE1 . GLU D  1 216 ? 19.880  75.644  -52.965  1.00 64.81  ? 242 GLU D OE1 1 
ATOM   7881  O  OE2 . GLU D  1 216 ? 18.173  74.462  -52.251  1.00 58.97  ? 242 GLU D OE2 1 
ATOM   7882  N  N   . ALA D  1 217 ? 16.827  79.604  -50.432  1.00 26.46  ? 243 ALA D N   1 
ATOM   7883  C  CA  . ALA D  1 217 ? 15.785  80.429  -51.022  1.00 27.59  ? 243 ALA D CA  1 
ATOM   7884  C  C   . ALA D  1 217 ? 15.484  79.990  -52.450  1.00 28.35  ? 243 ALA D C   1 
ATOM   7885  O  O   . ALA D  1 217 ? 16.353  79.479  -53.161  1.00 34.97  ? 243 ALA D O   1 
ATOM   7886  C  CB  . ALA D  1 217 ? 16.191  81.903  -51.005  1.00 23.66  ? 243 ALA D CB  1 
ATOM   7887  N  N   . VAL D  1 218 ? 14.234  80.194  -52.862  1.00 26.54  ? 244 VAL D N   1 
ATOM   7888  C  CA  . VAL D  1 218 ? 13.794  79.897  -54.224  1.00 29.97  ? 244 VAL D CA  1 
ATOM   7889  C  C   . VAL D  1 218 ? 13.924  81.167  -55.058  1.00 25.53  ? 244 VAL D C   1 
ATOM   7890  O  O   . VAL D  1 218 ? 13.371  82.213  -54.703  1.00 24.30  ? 244 VAL D O   1 
ATOM   7891  C  CB  . VAL D  1 218 ? 12.349  79.372  -54.243  1.00 23.65  ? 244 VAL D CB  1 
ATOM   7892  C  CG1 . VAL D  1 218 ? 11.917  79.081  -55.658  1.00 16.80  ? 244 VAL D CG1 1 
ATOM   7893  C  CG2 . VAL D  1 218 ? 12.215  78.128  -53.378  1.00 25.79  ? 244 VAL D CG2 1 
ATOM   7894  N  N   . CYS D  1 219 ? 14.645  81.079  -56.171  1.00 28.63  ? 245 CYS D N   1 
ATOM   7895  C  CA  . CYS D  1 219 ? 14.912  82.270  -56.962  1.00 34.44  ? 245 CYS D CA  1 
ATOM   7896  C  C   . CYS D  1 219 ? 13.771  82.549  -57.940  1.00 35.71  ? 245 CYS D C   1 
ATOM   7897  O  O   . CYS D  1 219 ? 12.834  81.759  -58.100  1.00 30.75  ? 245 CYS D O   1 
ATOM   7898  C  CB  . CYS D  1 219 ? 16.230  82.133  -57.723  1.00 32.55  ? 245 CYS D CB  1 
ATOM   7899  S  SG  . CYS D  1 219 ? 17.642  81.669  -56.701  1.00 45.02  ? 245 CYS D SG  1 
ATOM   7900  N  N   . LYS D  1 220 ? 13.864  83.710  -58.590  1.00 35.48  ? 246 LYS D N   1 
ATOM   7901  C  CA  . LYS D  1 220 ? 12.914  84.097  -59.624  1.00 36.05  ? 246 LYS D CA  1 
ATOM   7902  C  C   . LYS D  1 220 ? 12.805  83.004  -60.678  1.00 36.28  ? 246 LYS D C   1 
ATOM   7903  O  O   . LYS D  1 220 ? 13.801  82.379  -61.049  1.00 40.26  ? 246 LYS D O   1 
ATOM   7904  C  CB  . LYS D  1 220 ? 13.357  85.416  -60.267  1.00 34.18  ? 246 LYS D CB  1 
ATOM   7905  C  CG  . LYS D  1 220 ? 12.564  85.830  -61.493  1.00 38.07  ? 246 LYS D CG  1 
ATOM   7906  C  CD  . LYS D  1 220 ? 13.143  87.083  -62.131  1.00 45.53  ? 246 LYS D CD  1 
ATOM   7907  C  CE  . LYS D  1 220 ? 13.164  88.247  -61.148  1.00 58.59  ? 246 LYS D CE  1 
ATOM   7908  N  NZ  . LYS D  1 220 ? 13.764  89.481  -61.740  1.00 64.04  ? 246 LYS D NZ  1 
ATOM   7909  N  N   . GLN D  1 221 ? 11.584  82.764  -61.149  1.00 37.84  ? 247 GLN D N   1 
ATOM   7910  C  CA  . GLN D  1 221 ? 11.354  81.716  -62.135  1.00 37.89  ? 247 GLN D CA  1 
ATOM   7911  C  C   . GLN D  1 221 ? 11.946  82.132  -63.475  1.00 37.59  ? 247 GLN D C   1 
ATOM   7912  O  O   . GLN D  1 221 ? 11.592  83.181  -64.023  1.00 43.14  ? 247 GLN D O   1 
ATOM   7913  C  CB  . GLN D  1 221 ? 9.864   81.430  -62.279  1.00 40.44  ? 247 GLN D CB  1 
ATOM   7914  C  CG  . GLN D  1 221 ? 9.546   80.590  -63.492  1.00 49.06  ? 247 GLN D CG  1 
ATOM   7915  C  CD  . GLN D  1 221 ? 8.138   80.810  -64.009  1.00 62.81  ? 247 GLN D CD  1 
ATOM   7916  O  OE1 . GLN D  1 221 ? 7.626   81.934  -63.995  1.00 70.44  ? 247 GLN D OE1 1 
ATOM   7917  N  NE2 . GLN D  1 221 ? 7.508   79.733  -64.481  1.00 61.02  ? 247 GLN D NE2 1 
ATOM   7918  N  N   . GLY D  1 222 ? 12.833  81.304  -64.011  1.00 35.02  ? 248 GLY D N   1 
ATOM   7919  C  CA  . GLY D  1 222 ? 13.587  81.648  -65.195  1.00 43.58  ? 248 GLY D CA  1 
ATOM   7920  C  C   . GLY D  1 222 ? 15.005  82.097  -64.926  1.00 44.46  ? 248 GLY D C   1 
ATOM   7921  O  O   . GLY D  1 222 ? 15.756  82.323  -65.882  1.00 43.42  ? 248 GLY D O   1 
ATOM   7922  N  N   . CYS D  1 223 ? 15.392  82.228  -63.660  1.00 50.85  ? 249 CYS D N   1 
ATOM   7923  C  CA  . CYS D  1 223 ? 16.742  82.655  -63.322  1.00 43.37  ? 249 CYS D CA  1 
ATOM   7924  C  C   . CYS D  1 223 ? 17.752  81.600  -63.755  1.00 46.89  ? 249 CYS D C   1 
ATOM   7925  O  O   . CYS D  1 223 ? 17.562  80.404  -63.514  1.00 47.87  ? 249 CYS D O   1 
ATOM   7926  C  CB  . CYS D  1 223 ? 16.850  82.911  -61.820  1.00 38.53  ? 249 CYS D CB  1 
ATOM   7927  S  SG  . CYS D  1 223 ? 18.392  83.694  -61.279  1.00 41.39  ? 249 CYS D SG  1 
ATOM   7928  N  N   . ASN D  1 224 ? 18.824  82.049  -64.403  1.00 38.98  ? 250 ASN D N   1 
ATOM   7929  C  CA  . ASN D  1 224 ? 19.903  81.174  -64.856  1.00 41.42  ? 250 ASN D CA  1 
ATOM   7930  C  C   . ASN D  1 224 ? 20.764  80.815  -63.649  1.00 42.70  ? 250 ASN D C   1 
ATOM   7931  O  O   . ASN D  1 224 ? 21.566  81.623  -63.175  1.00 44.88  ? 250 ASN D O   1 
ATOM   7932  C  CB  . ASN D  1 224 ? 20.704  81.870  -65.954  1.00 45.10  ? 250 ASN D CB  1 
ATOM   7933  C  CG  . ASN D  1 224 ? 22.067  81.245  -66.183  1.00 49.38  ? 250 ASN D CG  1 
ATOM   7934  O  OD1 . ASN D  1 224 ? 22.221  80.021  -66.170  1.00 56.22  ? 250 ASN D OD1 1 
ATOM   7935  N  ND2 . ASN D  1 224 ? 23.070  82.094  -66.400  1.00 49.06  ? 250 ASN D ND2 1 
ATOM   7936  N  N   . LEU D  1 225 ? 20.597  79.598  -63.137  1.00 38.66  ? 251 LEU D N   1 
ATOM   7937  C  CA  . LEU D  1 225 ? 21.324  79.227  -61.920  1.00 49.39  ? 251 LEU D CA  1 
ATOM   7938  C  C   . LEU D  1 225 ? 22.810  78.952  -62.160  1.00 51.11  ? 251 LEU D C   1 
ATOM   7939  O  O   . LEU D  1 225 ? 23.492  78.540  -61.209  1.00 46.86  ? 251 LEU D O   1 
ATOM   7940  C  CB  . LEU D  1 225 ? 20.674  78.010  -61.256  1.00 56.03  ? 251 LEU D CB  1 
ATOM   7941  C  CG  . LEU D  1 225 ? 19.573  78.275  -60.218  1.00 57.67  ? 251 LEU D CG  1 
ATOM   7942  C  CD1 . LEU D  1 225 ? 20.045  79.265  -59.156  1.00 52.18  ? 251 LEU D CD1 1 
ATOM   7943  C  CD2 . LEU D  1 225 ? 18.278  78.755  -60.865  1.00 53.77  ? 251 LEU D CD2 1 
ATOM   7944  N  N   . LEU D  1 226 ? 23.336  79.157  -63.368  1.00 50.36  ? 252 LEU D N   1 
ATOM   7945  C  CA  . LEU D  1 226 ? 24.767  79.021  -63.606  1.00 44.84  ? 252 LEU D CA  1 
ATOM   7946  C  C   . LEU D  1 226 ? 25.511  80.339  -63.435  1.00 44.36  ? 252 LEU D C   1 
ATOM   7947  O  O   . LEU D  1 226 ? 26.705  80.332  -63.116  1.00 48.11  ? 252 LEU D O   1 
ATOM   7948  C  CB  . LEU D  1 226 ? 25.014  78.466  -65.011  1.00 45.36  ? 252 LEU D CB  1 
ATOM   7949  C  CG  . LEU D  1 226 ? 26.421  77.952  -65.310  1.00 43.90  ? 252 LEU D CG  1 
ATOM   7950  C  CD1 . LEU D  1 226 ? 26.798  76.853  -64.332  1.00 39.38  ? 252 LEU D CD1 1 
ATOM   7951  C  CD2 . LEU D  1 226 ? 26.505  77.449  -66.740  1.00 42.97  ? 252 LEU D CD2 1 
ATOM   7952  N  N   . HIS D  1 227 ? 24.828  81.469  -63.638  1.00 41.89  ? 253 HIS D N   1 
ATOM   7953  C  CA  . HIS D  1 227 ? 25.400  82.791  -63.410  1.00 41.80  ? 253 HIS D CA  1 
ATOM   7954  C  C   . HIS D  1 227 ? 24.478  83.677  -62.581  1.00 43.39  ? 253 HIS D C   1 
ATOM   7955  O  O   . HIS D  1 227 ? 24.742  84.880  -62.453  1.00 36.77  ? 253 HIS D O   1 
ATOM   7956  C  CB  . HIS D  1 227 ? 25.722  83.476  -64.742  1.00 46.57  ? 253 HIS D CB  1 
ATOM   7957  C  CG  . HIS D  1 227 ? 26.631  82.677  -65.621  1.00 47.70  ? 253 HIS D CG  1 
ATOM   7958  N  ND1 . HIS D  1 227 ? 26.283  82.292  -66.898  1.00 47.05  ? 253 HIS D ND1 1 
ATOM   7959  C  CD2 . HIS D  1 227 ? 27.873  82.183  -65.403  1.00 41.48  ? 253 HIS D CD2 1 
ATOM   7960  C  CE1 . HIS D  1 227 ? 27.271  81.595  -67.429  1.00 48.98  ? 253 HIS D CE1 1 
ATOM   7961  N  NE2 . HIS D  1 227 ? 28.249  81.516  -66.543  1.00 48.51  ? 253 HIS D NE2 1 
ATOM   7962  N  N   . GLY D  1 228 ? 23.402  83.117  -62.028  1.00 43.99  ? 254 GLY D N   1 
ATOM   7963  C  CA  . GLY D  1 228 ? 22.519  83.866  -61.162  1.00 42.08  ? 254 GLY D CA  1 
ATOM   7964  C  C   . GLY D  1 228 ? 22.181  83.066  -59.920  1.00 35.93  ? 254 GLY D C   1 
ATOM   7965  O  O   . GLY D  1 228 ? 22.278  81.836  -59.896  1.00 36.45  ? 254 GLY D O   1 
ATOM   7966  N  N   . GLY D  1 229 ? 21.784  83.792  -58.881  1.00 36.20  ? 255 GLY D N   1 
ATOM   7967  C  CA  . GLY D  1 229 ? 21.418  83.177  -57.619  1.00 37.22  ? 255 GLY D CA  1 
ATOM   7968  C  C   . GLY D  1 229 ? 20.476  84.055  -56.825  1.00 34.27  ? 255 GLY D C   1 
ATOM   7969  O  O   . GLY D  1 229 ? 19.980  85.059  -57.346  1.00 37.46  ? 255 GLY D O   1 
ATOM   7970  N  N   . CYS D  1 230 ? 20.215  83.695  -55.570  1.00 31.90  ? 256 CYS D N   1 
ATOM   7971  C  CA  . CYS D  1 230 ? 19.328  84.500  -54.743  1.00 33.27  ? 256 CYS D CA  1 
ATOM   7972  C  C   . CYS D  1 230 ? 19.601  84.213  -53.275  1.00 30.21  ? 256 CYS D C   1 
ATOM   7973  O  O   . CYS D  1 230 ? 19.789  83.059  -52.882  1.00 26.16  ? 256 CYS D O   1 
ATOM   7974  C  CB  . CYS D  1 230 ? 17.849  84.241  -55.075  1.00 32.93  ? 256 CYS D CB  1 
ATOM   7975  S  SG  . CYS D  1 230 ? 17.280  82.533  -54.888  1.00 27.37  ? 256 CYS D SG  1 
ATOM   7976  N  N   . THR D  1 231 ? 19.638  85.279  -52.478  1.00 28.81  ? 257 THR D N   1 
ATOM   7977  C  CA  . THR D  1 231 ? 19.708  85.184  -51.029  1.00 30.10  ? 257 THR D CA  1 
ATOM   7978  C  C   . THR D  1 231 ? 18.365  85.470  -50.370  1.00 30.30  ? 257 THR D C   1 
ATOM   7979  O  O   . THR D  1 231 ? 18.193  85.180  -49.180  1.00 35.03  ? 257 THR D O   1 
ATOM   7980  C  CB  . THR D  1 231 ? 20.791  86.142  -50.491  1.00 30.48  ? 257 THR D CB  1 
ATOM   7981  O  OG1 . THR D  1 231 ? 20.660  86.294  -49.073  1.00 30.87  ? 257 THR D OG1 1 
ATOM   7982  C  CG2 . THR D  1 231 ? 20.691  87.505  -51.154  1.00 33.95  ? 257 THR D CG2 1 
ATOM   7983  N  N   . VAL D  1 232 ? 17.406  85.994  -51.126  1.00 30.52  ? 258 VAL D N   1 
ATOM   7984  C  CA  . VAL D  1 232 ? 16.061  86.292  -50.643  1.00 29.21  ? 258 VAL D CA  1 
ATOM   7985  C  C   . VAL D  1 232 ? 15.073  85.768  -51.683  1.00 25.43  ? 258 VAL D C   1 
ATOM   7986  O  O   . VAL D  1 232 ? 15.363  85.835  -52.886  1.00 26.26  ? 258 VAL D O   1 
ATOM   7987  C  CB  . VAL D  1 232 ? 15.911  87.798  -50.371  1.00 32.42  ? 258 VAL D CB  1 
ATOM   7988  C  CG1 . VAL D  1 232 ? 14.477  88.254  -50.532  1.00 33.33  ? 258 VAL D CG1 1 
ATOM   7989  C  CG2 . VAL D  1 232 ? 16.424  88.131  -48.970  1.00 25.83  ? 258 VAL D CG2 1 
ATOM   7990  N  N   . PRO D  1 233 ? 13.925  85.216  -51.279  1.00 27.08  ? 259 PRO D N   1 
ATOM   7991  C  CA  . PRO D  1 233 ? 13.017  84.588  -52.254  1.00 27.36  ? 259 PRO D CA  1 
ATOM   7992  C  C   . PRO D  1 233 ? 12.520  85.549  -53.330  1.00 26.87  ? 259 PRO D C   1 
ATOM   7993  O  O   . PRO D  1 233 ? 12.133  86.687  -53.055  1.00 25.09  ? 259 PRO D O   1 
ATOM   7994  C  CB  . PRO D  1 233 ? 11.861  84.082  -51.383  1.00 20.73  ? 259 PRO D CB  1 
ATOM   7995  C  CG  . PRO D  1 233 ? 12.479  83.872  -50.039  1.00 24.30  ? 259 PRO D CG  1 
ATOM   7996  C  CD  . PRO D  1 233 ? 13.511  84.952  -49.888  1.00 25.22  ? 259 PRO D CD  1 
ATOM   7997  N  N   . GLY D  1 234 ? 12.531  85.067  -54.573  1.00 25.44  ? 260 GLY D N   1 
ATOM   7998  C  CA  . GLY D  1 234 ? 11.939  85.770  -55.689  1.00 25.35  ? 260 GLY D CA  1 
ATOM   7999  C  C   . GLY D  1 234 ? 12.888  86.603  -56.519  1.00 29.76  ? 260 GLY D C   1 
ATOM   8000  O  O   . GLY D  1 234 ? 12.458  87.177  -57.528  1.00 30.94  ? 260 GLY D O   1 
ATOM   8001  N  N   . GLU D  1 235 ? 14.154  86.688  -56.140  1.00 30.91  ? 261 GLU D N   1 
ATOM   8002  C  CA  . GLU D  1 235 ? 15.107  87.533  -56.838  1.00 29.96  ? 261 GLU D CA  1 
ATOM   8003  C  C   . GLU D  1 235 ? 16.057  86.684  -57.674  1.00 35.69  ? 261 GLU D C   1 
ATOM   8004  O  O   . GLU D  1 235 ? 16.047  85.448  -57.627  1.00 33.70  ? 261 GLU D O   1 
ATOM   8005  C  CB  . GLU D  1 235 ? 15.885  88.407  -55.852  1.00 29.24  ? 261 GLU D CB  1 
ATOM   8006  C  CG  . GLU D  1 235 ? 16.895  87.661  -55.018  1.00 28.93  ? 261 GLU D CG  1 
ATOM   8007  C  CD  . GLU D  1 235 ? 17.787  88.593  -54.234  1.00 34.84  ? 261 GLU D CD  1 
ATOM   8008  O  OE1 . GLU D  1 235 ? 17.711  89.815  -54.468  1.00 40.18  ? 261 GLU D OE1 1 
ATOM   8009  O  OE2 . GLU D  1 235 ? 18.566  88.109  -53.385  1.00 37.69  ? 261 GLU D OE2 1 
ATOM   8010  N  N   . CYS D  1 236 ? 16.896  87.383  -58.439  1.00 39.82  ? 262 CYS D N   1 
ATOM   8011  C  CA  . CYS D  1 236 ? 17.855  86.765  -59.353  1.00 36.26  ? 262 CYS D CA  1 
ATOM   8012  C  C   . CYS D  1 236 ? 19.017  87.752  -59.506  1.00 33.71  ? 262 CYS D C   1 
ATOM   8013  O  O   . CYS D  1 236 ? 19.007  88.606  -60.393  1.00 39.74  ? 262 CYS D O   1 
ATOM   8014  C  CB  . CYS D  1 236 ? 17.193  86.443  -60.686  1.00 32.36  ? 262 CYS D CB  1 
ATOM   8015  S  SG  . CYS D  1 236 ? 18.216  85.615  -61.929  1.00 39.55  ? 262 CYS D SG  1 
ATOM   8016  N  N   . ARG D  1 237 ? 20.001  87.640  -58.616  1.00 33.48  ? 263 ARG D N   1 
ATOM   8017  C  CA  . ARG D  1 237 ? 21.192  88.479  -58.681  1.00 35.93  ? 263 ARG D CA  1 
ATOM   8018  C  C   . ARG D  1 237 ? 22.288  87.768  -59.463  1.00 35.42  ? 263 ARG D C   1 
ATOM   8019  O  O   . ARG D  1 237 ? 22.468  86.552  -59.339  1.00 34.39  ? 263 ARG D O   1 
ATOM   8020  C  CB  . ARG D  1 237 ? 21.695  88.840  -57.282  1.00 30.94  ? 263 ARG D CB  1 
ATOM   8021  C  CG  . ARG D  1 237 ? 21.832  87.664  -56.345  1.00 33.01  ? 263 ARG D CG  1 
ATOM   8022  C  CD  . ARG D  1 237 ? 22.758  87.986  -55.186  1.00 33.82  ? 263 ARG D CD  1 
ATOM   8023  N  NE  . ARG D  1 237 ? 22.669  86.990  -54.121  1.00 28.82  ? 263 ARG D NE  1 
ATOM   8024  C  CZ  . ARG D  1 237 ? 23.209  85.777  -54.182  1.00 33.51  ? 263 ARG D CZ  1 
ATOM   8025  N  NH1 . ARG D  1 237 ? 23.078  84.939  -53.160  1.00 35.19  ? 263 ARG D NH1 1 
ATOM   8026  N  NH2 . ARG D  1 237 ? 23.874  85.397  -55.266  1.00 36.94  ? 263 ARG D NH2 1 
ATOM   8027  N  N   . CYS D  1 238 ? 23.024  88.537  -60.262  1.00 30.06  ? 264 CYS D N   1 
ATOM   8028  C  CA  . CYS D  1 238 ? 23.956  87.983  -61.232  1.00 34.41  ? 264 CYS D CA  1 
ATOM   8029  C  C   . CYS D  1 238 ? 25.364  87.870  -60.659  1.00 33.88  ? 264 CYS D C   1 
ATOM   8030  O  O   . CYS D  1 238 ? 25.757  88.601  -59.747  1.00 31.14  ? 264 CYS D O   1 
ATOM   8031  C  CB  . CYS D  1 238 ? 23.989  88.841  -62.497  1.00 35.13  ? 264 CYS D CB  1 
ATOM   8032  S  SG  . CYS D  1 238 ? 22.371  89.169  -63.197  1.00 33.42  ? 264 CYS D SG  1 
ATOM   8033  N  N   . SER D  1 239 ? 26.129  86.938  -61.224  1.00 35.22  ? 265 SER D N   1 
ATOM   8034  C  CA  . SER D  1 239 ? 27.533  86.795  -60.880  1.00 34.08  ? 265 SER D CA  1 
ATOM   8035  C  C   . SER D  1 239 ? 28.364  87.863  -61.589  1.00 37.21  ? 265 SER D C   1 
ATOM   8036  O  O   . SER D  1 239 ? 27.875  88.614  -62.439  1.00 34.94  ? 265 SER D O   1 
ATOM   8037  C  CB  . SER D  1 239 ? 28.039  85.400  -61.244  1.00 38.27  ? 265 SER D CB  1 
ATOM   8038  O  OG  . SER D  1 239 ? 27.476  84.410  -60.400  1.00 49.64  ? 265 SER D OG  1 
ATOM   8039  N  N   . TYR D  1 240 ? 29.641  87.924  -61.226  1.00 30.81  ? 266 TYR D N   1 
ATOM   8040  C  CA  . TYR D  1 240 ? 30.534  88.915  -61.808  1.00 28.27  ? 266 TYR D CA  1 
ATOM   8041  C  C   . TYR D  1 240 ? 30.689  88.672  -63.304  1.00 35.59  ? 266 TYR D C   1 
ATOM   8042  O  O   . TYR D  1 240 ? 31.153  87.608  -63.728  1.00 32.23  ? 266 TYR D O   1 
ATOM   8043  C  CB  . TYR D  1 240 ? 31.886  88.865  -61.104  1.00 24.31  ? 266 TYR D CB  1 
ATOM   8044  C  CG  . TYR D  1 240 ? 32.895  89.884  -61.585  1.00 30.03  ? 266 TYR D CG  1 
ATOM   8045  C  CD1 . TYR D  1 240 ? 32.754  91.236  -61.282  1.00 28.70  ? 266 TYR D CD1 1 
ATOM   8046  C  CD2 . TYR D  1 240 ? 34.001  89.491  -62.322  1.00 28.61  ? 266 TYR D CD2 1 
ATOM   8047  C  CE1 . TYR D  1 240 ? 33.684  92.162  -61.711  1.00 28.37  ? 266 TYR D CE1 1 
ATOM   8048  C  CE2 . TYR D  1 240 ? 34.933  90.407  -62.752  1.00 26.69  ? 266 TYR D CE2 1 
ATOM   8049  C  CZ  . TYR D  1 240 ? 34.775  91.737  -62.446  1.00 30.75  ? 266 TYR D CZ  1 
ATOM   8050  O  OH  . TYR D  1 240 ? 35.716  92.639  -62.886  1.00 35.60  ? 266 TYR D OH  1 
ATOM   8051  N  N   . GLY D  1 241 ? 30.279  89.655  -64.103  1.00 34.50  ? 267 GLY D N   1 
ATOM   8052  C  CA  . GLY D  1 241 ? 30.411  89.591  -65.542  1.00 38.64  ? 267 GLY D CA  1 
ATOM   8053  C  C   . GLY D  1 241 ? 29.139  89.276  -66.297  1.00 46.42  ? 267 GLY D C   1 
ATOM   8054  O  O   . GLY D  1 241 ? 29.186  89.150  -67.528  1.00 43.38  ? 267 GLY D O   1 
ATOM   8055  N  N   . TRP D  1 242 ? 28.008  89.150  -65.605  1.00 45.73  ? 268 TRP D N   1 
ATOM   8056  C  CA  . TRP D  1 242 ? 26.742  88.802  -66.230  1.00 40.80  ? 268 TRP D CA  1 
ATOM   8057  C  C   . TRP D  1 242 ? 25.676  89.799  -65.807  1.00 40.18  ? 268 TRP D C   1 
ATOM   8058  O  O   . TRP D  1 242 ? 25.789  90.460  -64.773  1.00 40.27  ? 268 TRP D O   1 
ATOM   8059  C  CB  . TRP D  1 242 ? 26.326  87.372  -65.872  1.00 44.17  ? 268 TRP D CB  1 
ATOM   8060  C  CG  . TRP D  1 242 ? 27.316  86.364  -66.363  1.00 44.95  ? 268 TRP D CG  1 
ATOM   8061  C  CD1 . TRP D  1 242 ? 28.381  85.863  -65.680  1.00 41.07  ? 268 TRP D CD1 1 
ATOM   8062  C  CD2 . TRP D  1 242 ? 27.351  85.759  -67.662  1.00 45.98  ? 268 TRP D CD2 1 
ATOM   8063  N  NE1 . TRP D  1 242 ? 29.071  84.973  -66.466  1.00 43.66  ? 268 TRP D NE1 1 
ATOM   8064  C  CE2 . TRP D  1 242 ? 28.458  84.892  -67.688  1.00 39.20  ? 268 TRP D CE2 1 
ATOM   8065  C  CE3 . TRP D  1 242 ? 26.547  85.861  -68.802  1.00 49.22  ? 268 TRP D CE3 1 
ATOM   8066  C  CZ2 . TRP D  1 242 ? 28.784  84.133  -68.808  1.00 42.14  ? 268 TRP D CZ2 1 
ATOM   8067  C  CZ3 . TRP D  1 242 ? 26.872  85.108  -69.913  1.00 50.63  ? 268 TRP D CZ3 1 
ATOM   8068  C  CH2 . TRP D  1 242 ? 27.980  84.253  -69.907  1.00 43.18  ? 268 TRP D CH2 1 
ATOM   8069  N  N   . GLN D  1 243 ? 24.637  89.909  -66.632  1.00 43.53  ? 269 GLN D N   1 
ATOM   8070  C  CA  . GLN D  1 243 ? 23.590  90.899  -66.428  1.00 39.76  ? 269 GLN D CA  1 
ATOM   8071  C  C   . GLN D  1 243 ? 22.289  90.362  -67.012  1.00 45.55  ? 269 GLN D C   1 
ATOM   8072  O  O   . GLN D  1 243 ? 22.214  89.218  -67.470  1.00 48.81  ? 269 GLN D O   1 
ATOM   8073  C  CB  . GLN D  1 243 ? 23.977  92.242  -67.059  1.00 43.12  ? 269 GLN D CB  1 
ATOM   8074  C  CG  . GLN D  1 243 ? 24.143  92.191  -68.575  1.00 47.13  ? 269 GLN D CG  1 
ATOM   8075  C  CD  . GLN D  1 243 ? 24.599  93.515  -69.165  1.00 50.45  ? 269 GLN D CD  1 
ATOM   8076  O  OE1 . GLN D  1 243 ? 24.616  94.543  -68.485  1.00 50.76  ? 269 GLN D OE1 1 
ATOM   8077  N  NE2 . GLN D  1 243 ? 24.979  93.492  -70.437  1.00 47.72  ? 269 GLN D NE2 1 
ATOM   8078  N  N   . GLY D  1 244 ? 21.260  91.201  -66.996  1.00 46.03  ? 270 GLY D N   1 
ATOM   8079  C  CA  . GLY D  1 244 ? 19.959  90.845  -67.522  1.00 49.47  ? 270 GLY D CA  1 
ATOM   8080  C  C   . GLY D  1 244 ? 18.991  90.429  -66.427  1.00 53.18  ? 270 GLY D C   1 
ATOM   8081  O  O   . GLY D  1 244 ? 19.363  90.150  -65.285  1.00 58.07  ? 270 GLY D O   1 
ATOM   8082  N  N   . ARG D  1 245 ? 17.711  90.385  -66.802  1.00 52.29  ? 271 ARG D N   1 
ATOM   8083  C  CA  . ARG D  1 245 ? 16.679  90.010  -65.843  1.00 51.22  ? 271 ARG D CA  1 
ATOM   8084  C  C   . ARG D  1 245 ? 16.825  88.570  -65.369  1.00 49.44  ? 271 ARG D C   1 
ATOM   8085  O  O   . ARG D  1 245 ? 16.333  88.235  -64.287  1.00 50.29  ? 271 ARG D O   1 
ATOM   8086  C  CB  . ARG D  1 245 ? 15.292  90.228  -66.451  1.00 60.25  ? 271 ARG D CB  1 
ATOM   8087  C  CG  . ARG D  1 245 ? 14.307  90.891  -65.498  1.00 71.08  ? 271 ARG D CG  1 
ATOM   8088  C  CD  . ARG D  1 245 ? 13.016  91.307  -66.197  1.00 76.67  ? 271 ARG D CD  1 
ATOM   8089  N  NE  . ARG D  1 245 ? 12.062  90.208  -66.341  1.00 75.08  ? 271 ARG D NE  1 
ATOM   8090  C  CZ  . ARG D  1 245 ? 11.225  89.812  -65.384  1.00 76.21  ? 271 ARG D CZ  1 
ATOM   8091  N  NH1 . ARG D  1 245 ? 11.230  90.416  -64.201  1.00 79.58  ? 271 ARG D NH1 1 
ATOM   8092  N  NH2 . ARG D  1 245 ? 10.388  88.807  -65.608  1.00 70.62  ? 271 ARG D NH2 1 
ATOM   8093  N  N   . PHE D  1 246 ? 17.500  87.718  -66.143  1.00 45.37  ? 272 PHE D N   1 
ATOM   8094  C  CA  . PHE D  1 246 ? 17.702  86.322  -65.777  1.00 44.97  ? 272 PHE D CA  1 
ATOM   8095  C  C   . PHE D  1 246 ? 19.176  85.956  -65.665  1.00 45.47  ? 272 PHE D C   1 
ATOM   8096  O  O   . PHE D  1 246 ? 19.497  84.764  -65.580  1.00 44.82  ? 272 PHE D O   1 
ATOM   8097  C  CB  . PHE D  1 246 ? 17.013  85.397  -66.786  1.00 49.19  ? 272 PHE D CB  1 
ATOM   8098  C  CG  . PHE D  1 246 ? 15.546  85.674  -66.958  1.00 55.20  ? 272 PHE D CG  1 
ATOM   8099  C  CD1 . PHE D  1 246 ? 14.634  85.278  -65.993  1.00 53.50  ? 272 PHE D CD1 1 
ATOM   8100  C  CD2 . PHE D  1 246 ? 15.080  86.332  -68.084  1.00 56.74  ? 272 PHE D CD2 1 
ATOM   8101  C  CE1 . PHE D  1 246 ? 13.285  85.534  -66.149  1.00 58.02  ? 272 PHE D CE1 1 
ATOM   8102  C  CE2 . PHE D  1 246 ? 13.734  86.590  -68.246  1.00 55.95  ? 272 PHE D CE2 1 
ATOM   8103  C  CZ  . PHE D  1 246 ? 12.835  86.191  -67.279  1.00 58.06  ? 272 PHE D CZ  1 
ATOM   8104  N  N   . CYS D  1 247 ? 20.073  86.945  -65.670  1.00 41.48  ? 273 CYS D N   1 
ATOM   8105  C  CA  . CYS D  1 247 ? 21.512  86.727  -65.509  1.00 39.35  ? 273 CYS D CA  1 
ATOM   8106  C  C   . CYS D  1 247 ? 22.039  85.705  -66.513  1.00 44.71  ? 273 CYS D C   1 
ATOM   8107  O  O   . CYS D  1 247 ? 22.682  84.715  -66.155  1.00 44.90  ? 273 CYS D O   1 
ATOM   8108  C  CB  . CYS D  1 247 ? 21.850  86.301  -64.079  1.00 39.99  ? 273 CYS D CB  1 
ATOM   8109  S  SG  . CYS D  1 247 ? 21.339  87.463  -62.801  1.00 33.46  ? 273 CYS D SG  1 
ATOM   8110  N  N   . ASP D  1 248 ? 21.756  85.953  -67.792  1.00 49.69  ? 274 ASP D N   1 
ATOM   8111  C  CA  . ASP D  1 248 ? 22.217  85.082  -68.866  1.00 57.67  ? 274 ASP D CA  1 
ATOM   8112  C  C   . ASP D  1 248 ? 22.892  85.858  -69.991  1.00 53.33  ? 274 ASP D C   1 
ATOM   8113  O  O   . ASP D  1 248 ? 23.174  85.277  -71.045  1.00 54.58  ? 274 ASP D O   1 
ATOM   8114  C  CB  . ASP D  1 248 ? 21.055  84.250  -69.428  1.00 51.35  ? 274 ASP D CB  1 
ATOM   8115  C  CG  . ASP D  1 248 ? 19.814  85.085  -69.699  1.00 51.52  ? 274 ASP D CG  1 
ATOM   8116  O  OD1 . ASP D  1 248 ? 19.904  86.332  -69.679  1.00 50.72  ? 274 ASP D OD1 1 
ATOM   8117  O  OD2 . ASP D  1 248 ? 18.745  84.490  -69.941  1.00 58.11  ? 274 ASP D OD2 1 
ATOM   8118  N  N   . GLU D  1 249 ? 23.165  87.144  -69.790  1.00 50.92  ? 275 GLU D N   1 
ATOM   8119  C  CA  . GLU D  1 249 ? 23.765  88.001  -70.803  1.00 52.41  ? 275 GLU D CA  1 
ATOM   8120  C  C   . GLU D  1 249 ? 25.117  88.500  -70.312  1.00 55.05  ? 275 GLU D C   1 
ATOM   8121  O  O   . GLU D  1 249 ? 25.215  89.053  -69.211  1.00 55.14  ? 275 GLU D O   1 
ATOM   8122  C  CB  . GLU D  1 249 ? 22.845  89.181  -71.123  1.00 48.13  ? 275 GLU D CB  1 
ATOM   8123  C  CG  . GLU D  1 249 ? 21.411  88.776  -71.409  1.00 51.76  ? 275 GLU D CG  1 
ATOM   8124  C  CD  . GLU D  1 249 ? 20.481  89.966  -71.509  1.00 52.96  ? 275 GLU D CD  1 
ATOM   8125  O  OE1 . GLU D  1 249 ? 20.985  91.110  -71.537  1.00 52.32  ? 275 GLU D OE1 1 
ATOM   8126  O  OE2 . GLU D  1 249 ? 19.249  89.757  -71.553  1.00 46.15  ? 275 GLU D OE2 1 
ATOM   8127  N  N   . CYS D  1 250 ? 26.152  88.304  -71.126  1.00 52.28  ? 276 CYS D N   1 
ATOM   8128  C  CA  . CYS D  1 250 ? 27.481  88.783  -70.778  1.00 48.98  ? 276 CYS D CA  1 
ATOM   8129  C  C   . CYS D  1 250 ? 27.501  90.306  -70.695  1.00 49.53  ? 276 CYS D C   1 
ATOM   8130  O  O   . CYS D  1 250 ? 26.700  90.999  -71.329  1.00 48.93  ? 276 CYS D O   1 
ATOM   8131  C  CB  . CYS D  1 250 ? 28.512  88.307  -71.806  1.00 47.23  ? 276 CYS D CB  1 
ATOM   8132  S  SG  . CYS D  1 250 ? 28.097  88.712  -73.528  1.00 63.40  ? 276 CYS D SG  1 
ATOM   8133  N  N   . VAL D  1 251 ? 28.425  90.822  -69.895  1.00 43.52  ? 277 VAL D N   1 
ATOM   8134  C  CA  . VAL D  1 251 ? 28.695  92.254  -69.818  1.00 41.03  ? 277 VAL D CA  1 
ATOM   8135  C  C   . VAL D  1 251 ? 29.875  92.543  -70.736  1.00 42.77  ? 277 VAL D C   1 
ATOM   8136  O  O   . VAL D  1 251 ? 30.922  91.894  -70.598  1.00 45.14  ? 277 VAL D O   1 
ATOM   8137  C  CB  . VAL D  1 251 ? 28.993  92.701  -68.378  1.00 43.28  ? 277 VAL D CB  1 
ATOM   8138  C  CG1 . VAL D  1 251 ? 29.375  94.174  -68.344  1.00 33.28  ? 277 VAL D CG1 1 
ATOM   8139  C  CG2 . VAL D  1 251 ? 27.793  92.442  -67.484  1.00 40.65  ? 277 VAL D CG2 1 
ATOM   8140  N  N   . PRO D  1 252 ? 29.751  93.462  -71.689  1.00 44.36  ? 278 PRO D N   1 
ATOM   8141  C  CA  . PRO D  1 252 ? 30.886  93.781  -72.558  1.00 47.44  ? 278 PRO D CA  1 
ATOM   8142  C  C   . PRO D  1 252 ? 31.944  94.561  -71.795  1.00 46.46  ? 278 PRO D C   1 
ATOM   8143  O  O   . PRO D  1 252 ? 31.758  94.962  -70.646  1.00 49.46  ? 278 PRO D O   1 
ATOM   8144  C  CB  . PRO D  1 252 ? 30.255  94.624  -73.668  1.00 46.81  ? 278 PRO D CB  1 
ATOM   8145  C  CG  . PRO D  1 252 ? 29.091  95.269  -73.004  1.00 44.39  ? 278 PRO D CG  1 
ATOM   8146  C  CD  . PRO D  1 252 ? 28.554  94.245  -72.041  1.00 45.35  ? 278 PRO D CD  1 
ATOM   8147  N  N   . TYR D  1 253 ? 33.075  94.772  -72.457  1.00 48.10  ? 279 TYR D N   1 
ATOM   8148  C  CA  . TYR D  1 253 ? 34.123  95.587  -71.868  1.00 48.21  ? 279 TYR D CA  1 
ATOM   8149  C  C   . TYR D  1 253 ? 33.600  97.003  -71.637  1.00 50.81  ? 279 TYR D C   1 
ATOM   8150  O  O   . TYR D  1 253 ? 32.875  97.540  -72.483  1.00 43.85  ? 279 TYR D O   1 
ATOM   8151  C  CB  . TYR D  1 253 ? 35.354  95.625  -72.774  1.00 48.90  ? 279 TYR D CB  1 
ATOM   8152  C  CG  . TYR D  1 253 ? 36.587  96.173  -72.096  1.00 49.26  ? 279 TYR D CG  1 
ATOM   8153  C  CD1 . TYR D  1 253 ? 37.447  95.334  -71.401  1.00 51.04  ? 279 TYR D CD1 1 
ATOM   8154  C  CD2 . TYR D  1 253 ? 36.894  97.527  -72.149  1.00 52.24  ? 279 TYR D CD2 1 
ATOM   8155  C  CE1 . TYR D  1 253 ? 38.580  95.824  -70.778  1.00 47.98  ? 279 TYR D CE1 1 
ATOM   8156  C  CE2 . TYR D  1 253 ? 38.028  98.028  -71.528  1.00 55.11  ? 279 TYR D CE2 1 
ATOM   8157  C  CZ  . TYR D  1 253 ? 38.866  97.170  -70.845  1.00 48.19  ? 279 TYR D CZ  1 
ATOM   8158  O  OH  . TYR D  1 253 ? 39.992  97.656  -70.220  1.00 57.73  ? 279 TYR D OH  1 
ATOM   8159  N  N   . PRO D  1 254 ? 33.934  97.630  -70.501  1.00 58.04  ? 280 PRO D N   1 
ATOM   8160  C  CA  . PRO D  1 254 ? 33.435  98.987  -70.225  1.00 59.57  ? 280 PRO D CA  1 
ATOM   8161  C  C   . PRO D  1 254 ? 33.852  99.994  -71.286  1.00 55.22  ? 280 PRO D C   1 
ATOM   8162  O  O   . PRO D  1 254 ? 35.041  100.289 -71.439  1.00 54.99  ? 280 PRO D O   1 
ATOM   8163  C  CB  . PRO D  1 254 ? 34.060  99.319  -68.862  1.00 53.57  ? 280 PRO D CB  1 
ATOM   8164  C  CG  . PRO D  1 254 ? 34.338  97.990  -68.239  1.00 50.78  ? 280 PRO D CG  1 
ATOM   8165  C  CD  . PRO D  1 254 ? 34.713  97.086  -69.376  1.00 51.89  ? 280 PRO D CD  1 
ATOM   8166  N  N   . GLY D  1 255 ? 32.878  100.523 -72.022  1.00 56.94  ? 281 GLY D N   1 
ATOM   8167  C  CA  . GLY D  1 255 ? 33.137  101.453 -73.100  1.00 60.27  ? 281 GLY D CA  1 
ATOM   8168  C  C   . GLY D  1 255 ? 32.929  100.911 -74.502  1.00 61.17  ? 281 GLY D C   1 
ATOM   8169  O  O   . GLY D  1 255 ? 33.221  101.626 -75.468  1.00 70.72  ? 281 GLY D O   1 
ATOM   8170  N  N   . CYS D  1 256 ? 32.433  99.683  -74.648  1.00 60.11  ? 282 CYS D N   1 
ATOM   8171  C  CA  . CYS D  1 256 ? 32.248  99.085  -75.966  1.00 57.45  ? 282 CYS D CA  1 
ATOM   8172  C  C   . CYS D  1 256 ? 31.176  99.847  -76.735  1.00 67.93  ? 282 CYS D C   1 
ATOM   8173  O  O   . CYS D  1 256 ? 30.016  99.897  -76.311  1.00 68.65  ? 282 CYS D O   1 
ATOM   8174  C  CB  . CYS D  1 256 ? 31.870  97.612  -75.828  1.00 57.98  ? 282 CYS D CB  1 
ATOM   8175  S  SG  . CYS D  1 256 ? 32.070  96.618  -77.334  1.00 62.28  ? 282 CYS D SG  1 
ATOM   8176  N  N   . VAL D  1 257 ? 31.562  100.435 -77.868  1.00 73.40  ? 283 VAL D N   1 
ATOM   8177  C  CA  . VAL D  1 257 ? 30.669  101.293 -78.641  1.00 76.13  ? 283 VAL D CA  1 
ATOM   8178  C  C   . VAL D  1 257 ? 29.917  100.465 -79.678  1.00 75.24  ? 283 VAL D C   1 
ATOM   8179  O  O   . VAL D  1 257 ? 28.714  100.217 -79.531  1.00 74.96  ? 283 VAL D O   1 
ATOM   8180  C  CB  . VAL D  1 257 ? 31.451  102.452 -79.294  1.00 74.15  ? 283 VAL D CB  1 
ATOM   8181  C  CG1 . VAL D  1 257 ? 30.667  103.071 -80.446  1.00 74.07  ? 283 VAL D CG1 1 
ATOM   8182  C  CG2 . VAL D  1 257 ? 31.771  103.513 -78.254  1.00 63.59  ? 283 VAL D CG2 1 
ATOM   8183  N  N   . HIS D  1 258 ? 30.613  100.025 -80.727  1.00 73.43  ? 284 HIS D N   1 
ATOM   8184  C  CA  . HIS D  1 258 ? 29.965  99.272  -81.793  1.00 73.24  ? 284 HIS D CA  1 
ATOM   8185  C  C   . HIS D  1 258 ? 30.408  97.818  -81.753  1.00 70.58  ? 284 HIS D C   1 
ATOM   8186  O  O   . HIS D  1 258 ? 30.966  97.300  -82.727  1.00 68.25  ? 284 HIS D O   1 
ATOM   8187  C  CB  . HIS D  1 258 ? 30.268  99.889  -83.161  1.00 74.36  ? 284 HIS D CB  1 
ATOM   8188  C  CG  . HIS D  1 258 ? 29.580  101.198 -83.400  1.00 78.34  ? 284 HIS D CG  1 
ATOM   8189  N  ND1 . HIS D  1 258 ? 30.267  102.371 -83.625  1.00 81.95  ? 284 HIS D ND1 1 
ATOM   8190  C  CD2 . HIS D  1 258 ? 28.265  101.518 -83.446  1.00 81.92  ? 284 HIS D CD2 1 
ATOM   8191  C  CE1 . HIS D  1 258 ? 29.406  103.358 -83.801  1.00 73.03  ? 284 HIS D CE1 1 
ATOM   8192  N  NE2 . HIS D  1 258 ? 28.185  102.867 -83.697  1.00 81.72  ? 284 HIS D NE2 1 
ATOM   8193  N  N   . GLY D  1 259 ? 30.163  97.154  -80.623  1.00 74.30  ? 285 GLY D N   1 
ATOM   8194  C  CA  . GLY D  1 259 ? 30.545  95.767  -80.461  1.00 70.52  ? 285 GLY D CA  1 
ATOM   8195  C  C   . GLY D  1 259 ? 29.603  95.041  -79.525  1.00 63.13  ? 285 GLY D C   1 
ATOM   8196  O  O   . GLY D  1 259 ? 28.697  95.629  -78.928  1.00 64.59  ? 285 GLY D O   1 
ATOM   8197  N  N   . SER D  1 260 ? 29.836  93.738  -79.406  1.00 52.41  ? 286 SER D N   1 
ATOM   8198  C  CA  . SER D  1 260 ? 29.038  92.873  -78.556  1.00 52.82  ? 286 SER D CA  1 
ATOM   8199  C  C   . SER D  1 260 ? 29.960  91.847  -77.917  1.00 50.01  ? 286 SER D C   1 
ATOM   8200  O  O   . SER D  1 260 ? 31.148  91.769  -78.236  1.00 47.15  ? 286 SER D O   1 
ATOM   8201  C  CB  . SER D  1 260 ? 27.920  92.187  -79.350  1.00 55.95  ? 286 SER D CB  1 
ATOM   8202  O  OG  . SER D  1 260 ? 28.451  91.449  -80.437  1.00 53.07  ? 286 SER D OG  1 
ATOM   8203  N  N   . CYS D  1 261 ? 29.403  91.053  -77.005  1.00 48.77  ? 287 CYS D N   1 
ATOM   8204  C  CA  . CYS D  1 261 ? 30.164  90.029  -76.306  1.00 47.07  ? 287 CYS D CA  1 
ATOM   8205  C  C   . CYS D  1 261 ? 29.471  88.681  -76.440  1.00 45.60  ? 287 CYS D C   1 
ATOM   8206  O  O   . CYS D  1 261 ? 28.262  88.593  -76.669  1.00 50.94  ? 287 CYS D O   1 
ATOM   8207  C  CB  . CYS D  1 261 ? 30.354  90.372  -74.814  1.00 48.07  ? 287 CYS D CB  1 
ATOM   8208  S  SG  . CYS D  1 261 ? 28.819  90.593  -73.856  1.00 57.30  ? 287 CYS D SG  1 
ATOM   8209  N  N   . VAL D  1 262 ? 30.265  87.627  -76.303  1.00 41.74  ? 288 VAL D N   1 
ATOM   8210  C  CA  . VAL D  1 262 ? 29.773  86.269  -76.116  1.00 43.84  ? 288 VAL D CA  1 
ATOM   8211  C  C   . VAL D  1 262 ? 30.115  85.760  -74.720  1.00 51.81  ? 288 VAL D C   1 
ATOM   8212  O  O   . VAL D  1 262 ? 29.263  85.221  -74.014  1.00 56.59  ? 288 VAL D O   1 
ATOM   8213  C  CB  . VAL D  1 262 ? 30.331  85.326  -77.206  1.00 39.24  ? 288 VAL D CB  1 
ATOM   8214  C  CG1 . VAL D  1 262 ? 30.157  83.878  -76.805  1.00 37.96  ? 288 VAL D CG1 1 
ATOM   8215  C  CG2 . VAL D  1 262 ? 29.639  85.594  -78.532  1.00 52.48  ? 288 VAL D CG2 1 
ATOM   8216  N  N   . GLU D  1 263 ? 31.353  85.941  -74.310  1.00 48.93  ? 289 GLU D N   1 
ATOM   8217  C  CA  . GLU D  1 263 ? 31.849  85.782  -72.960  1.00 45.27  ? 289 GLU D CA  1 
ATOM   8218  C  C   . GLU D  1 263 ? 32.048  87.150  -72.319  1.00 44.27  ? 289 GLU D C   1 
ATOM   8219  O  O   . GLU D  1 263 ? 32.098  88.168  -73.014  1.00 42.87  ? 289 GLU D O   1 
ATOM   8220  C  CB  . GLU D  1 263 ? 33.164  84.997  -72.975  1.00 47.16  ? 289 GLU D CB  1 
ATOM   8221  C  CG  . GLU D  1 263 ? 32.977  83.517  -73.250  1.00 53.23  ? 289 GLU D CG  1 
ATOM   8222  C  CD  . GLU D  1 263 ? 34.287  82.759  -73.263  1.00 70.08  ? 289 GLU D CD  1 
ATOM   8223  O  OE1 . GLU D  1 263 ? 35.273  83.289  -73.819  1.00 71.92  ? 289 GLU D OE1 1 
ATOM   8224  O  OE2 . GLU D  1 263 ? 34.333  81.638  -72.711  1.00 73.32  ? 289 GLU D OE2 1 
ATOM   8225  N  N   . PRO D  1 264 ? 32.134  87.219  -70.990  1.00 43.84  ? 290 PRO D N   1 
ATOM   8226  C  CA  . PRO D  1 264 ? 32.225  88.528  -70.330  1.00 42.94  ? 290 PRO D CA  1 
ATOM   8227  C  C   . PRO D  1 264 ? 33.437  89.337  -70.775  1.00 39.70  ? 290 PRO D C   1 
ATOM   8228  O  O   . PRO D  1 264 ? 34.483  88.795  -71.138  1.00 45.63  ? 290 PRO D O   1 
ATOM   8229  C  CB  . PRO D  1 264 ? 32.315  88.164  -68.843  1.00 41.61  ? 290 PRO D CB  1 
ATOM   8230  C  CG  . PRO D  1 264 ? 31.616  86.858  -68.745  1.00 42.08  ? 290 PRO D CG  1 
ATOM   8231  C  CD  . PRO D  1 264 ? 31.935  86.129  -70.017  1.00 39.07  ? 290 PRO D CD  1 
ATOM   8232  N  N   . TRP D  1 265 ? 33.269  90.660  -70.751  1.00 34.75  ? 291 TRP D N   1 
ATOM   8233  C  CA  . TRP D  1 265 ? 34.330  91.646  -70.946  1.00 41.27  ? 291 TRP D CA  1 
ATOM   8234  C  C   . TRP D  1 265 ? 34.909  91.639  -72.357  1.00 47.76  ? 291 TRP D C   1 
ATOM   8235  O  O   . TRP D  1 265 ? 35.964  92.236  -72.597  1.00 42.82  ? 291 TRP D O   1 
ATOM   8236  C  CB  . TRP D  1 265 ? 35.452  91.469  -69.916  1.00 36.08  ? 291 TRP D CB  1 
ATOM   8237  C  CG  . TRP D  1 265 ? 34.943  91.217  -68.531  1.00 39.28  ? 291 TRP D CG  1 
ATOM   8238  C  CD1 . TRP D  1 265 ? 35.175  90.114  -67.764  1.00 38.85  ? 291 TRP D CD1 1 
ATOM   8239  C  CD2 . TRP D  1 265 ? 34.090  92.070  -67.757  1.00 37.21  ? 291 TRP D CD2 1 
ATOM   8240  N  NE1 . TRP D  1 265 ? 34.532  90.230  -66.557  1.00 32.30  ? 291 TRP D NE1 1 
ATOM   8241  C  CE2 . TRP D  1 265 ? 33.858  91.422  -66.527  1.00 33.22  ? 291 TRP D CE2 1 
ATOM   8242  C  CE3 . TRP D  1 265 ? 33.504  93.320  -67.982  1.00 37.44  ? 291 TRP D CE3 1 
ATOM   8243  C  CZ2 . TRP D  1 265 ? 33.068  91.981  -65.525  1.00 32.55  ? 291 TRP D CZ2 1 
ATOM   8244  C  CZ3 . TRP D  1 265 ? 32.718  93.873  -66.986  1.00 40.80  ? 291 TRP D CZ3 1 
ATOM   8245  C  CH2 . TRP D  1 265 ? 32.508  93.203  -65.772  1.00 35.62  ? 291 TRP D CH2 1 
ATOM   8246  N  N   . GLN D  1 266 ? 34.241  90.986  -73.303  1.00 47.52  ? 292 GLN D N   1 
ATOM   8247  C  CA  . GLN D  1 266 ? 34.647  91.069  -74.695  1.00 41.18  ? 292 GLN D CA  1 
ATOM   8248  C  C   . GLN D  1 266 ? 34.066  92.321  -75.343  1.00 44.37  ? 292 GLN D C   1 
ATOM   8249  O  O   . GLN D  1 266 ? 33.162  92.971  -74.811  1.00 42.04  ? 292 GLN D O   1 
ATOM   8250  C  CB  . GLN D  1 266 ? 34.196  89.831  -75.463  1.00 41.76  ? 292 GLN D CB  1 
ATOM   8251  C  CG  . GLN D  1 266 ? 34.900  88.559  -75.057  1.00 41.89  ? 292 GLN D CG  1 
ATOM   8252  C  CD  . GLN D  1 266 ? 34.381  87.356  -75.815  1.00 43.10  ? 292 GLN D CD  1 
ATOM   8253  O  OE1 . GLN D  1 266 ? 33.295  87.394  -76.395  1.00 38.19  ? 292 GLN D OE1 1 
ATOM   8254  N  NE2 . GLN D  1 266 ? 35.161  86.283  -75.826  1.00 49.22  ? 292 GLN D NE2 1 
ATOM   8255  N  N   . CYS D  1 267 ? 34.598  92.654  -76.523  1.00 49.90  ? 293 CYS D N   1 
ATOM   8256  C  CA  . CYS D  1 267 ? 34.119  93.779  -77.320  1.00 54.24  ? 293 CYS D CA  1 
ATOM   8257  C  C   . CYS D  1 267 ? 34.453  93.482  -78.786  1.00 52.48  ? 293 CYS D C   1 
ATOM   8258  O  O   . CYS D  1 267 ? 35.289  94.122  -79.424  1.00 50.92  ? 293 CYS D O   1 
ATOM   8259  C  CB  . CYS D  1 267 ? 34.721  95.105  -76.848  1.00 54.39  ? 293 CYS D CB  1 
ATOM   8260  S  SG  . CYS D  1 267 ? 34.080  96.598  -77.664  1.00 54.33  ? 293 CYS D SG  1 
ATOM   8261  N  N   . ASN D  1 268 ? 33.779  92.473  -79.335  1.00 55.07  ? 294 ASN D N   1 
ATOM   8262  C  CA  . ASN D  1 268 ? 33.956  92.092  -80.731  1.00 57.52  ? 294 ASN D CA  1 
ATOM   8263  C  C   . ASN D  1 268 ? 33.255  93.107  -81.627  1.00 61.04  ? 294 ASN D C   1 
ATOM   8264  O  O   . ASN D  1 268 ? 32.030  93.255  -81.568  1.00 55.30  ? 294 ASN D O   1 
ATOM   8265  C  CB  . ASN D  1 268 ? 33.405  90.690  -80.972  1.00 53.20  ? 294 ASN D CB  1 
ATOM   8266  C  CG  . ASN D  1 268 ? 33.522  89.801  -79.751  1.00 50.42  ? 294 ASN D CG  1 
ATOM   8267  O  OD1 . ASN D  1 268 ? 34.621  89.425  -79.343  1.00 45.40  ? 294 ASN D OD1 1 
ATOM   8268  N  ND2 . ASN D  1 268 ? 32.383  89.450  -79.166  1.00 51.40  ? 294 ASN D ND2 1 
ATOM   8269  N  N   . CYS D  1 269 ? 34.029  93.795  -82.462  1.00 69.11  ? 295 CYS D N   1 
ATOM   8270  C  CA  . CYS D  1 269 ? 33.489  94.885  -83.259  1.00 64.24  ? 295 CYS D CA  1 
ATOM   8271  C  C   . CYS D  1 269 ? 32.619  94.366  -84.395  1.00 66.77  ? 295 CYS D C   1 
ATOM   8272  O  O   . CYS D  1 269 ? 32.776  93.237  -84.870  1.00 61.38  ? 295 CYS D O   1 
ATOM   8273  C  CB  . CYS D  1 269 ? 34.617  95.735  -83.835  1.00 66.87  ? 295 CYS D CB  1 
ATOM   8274  S  SG  . CYS D  1 269 ? 35.783  96.313  -82.606  1.00 73.66  ? 295 CYS D SG  1 
ATOM   8275  N  N   . GLU D  1 270 ? 31.700  95.220  -84.838  1.00 75.23  ? 296 GLU D N   1 
ATOM   8276  C  CA  . GLU D  1 270 ? 30.902  94.943  -86.020  1.00 77.16  ? 296 GLU D CA  1 
ATOM   8277  C  C   . GLU D  1 270 ? 31.789  94.953  -87.263  1.00 80.27  ? 296 GLU D C   1 
ATOM   8278  O  O   . GLU D  1 270 ? 32.994  95.219  -87.209  1.00 76.63  ? 296 GLU D O   1 
ATOM   8279  C  CB  . GLU D  1 270 ? 29.781  95.972  -86.156  1.00 77.55  ? 296 GLU D CB  1 
ATOM   8280  C  CG  . GLU D  1 270 ? 28.510  95.627  -85.398  1.00 80.17  ? 296 GLU D CG  1 
ATOM   8281  C  CD  . GLU D  1 270 ? 27.835  96.847  -84.789  1.00 76.53  ? 296 GLU D CD  1 
ATOM   8282  O  OE1 . GLU D  1 270 ? 28.392  97.959  -84.889  1.00 77.97  ? 296 GLU D OE1 1 
ATOM   8283  O  OE2 . GLU D  1 270 ? 26.738  96.693  -84.215  1.00 74.55  ? 296 GLU D OE2 1 
ATOM   8284  N  N   . THR D  1 271 ? 31.179  94.661  -88.404  1.00 86.15  ? 297 THR D N   1 
ATOM   8285  C  CA  . THR D  1 271 ? 31.875  94.788  -89.673  1.00 87.11  ? 297 THR D CA  1 
ATOM   8286  C  C   . THR D  1 271 ? 32.133  96.263  -89.952  1.00 87.21  ? 297 THR D C   1 
ATOM   8287  O  O   . THR D  1 271 ? 31.227  97.095  -89.807  1.00 83.19  ? 297 THR D O   1 
ATOM   8288  C  CB  . THR D  1 271 ? 31.047  94.167  -90.792  1.00 83.84  ? 297 THR D CB  1 
ATOM   8289  O  OG1 . THR D  1 271 ? 30.120  95.135  -91.294  1.00 97.17  ? 297 THR D OG1 1 
ATOM   8290  C  CG2 . THR D  1 271 ? 30.273  92.967  -90.264  1.00 78.36  ? 297 THR D CG2 1 
ATOM   8291  N  N   . ASN D  1 272 ? 33.378  96.576  -90.340  1.00 85.28  ? 298 ASN D N   1 
ATOM   8292  C  CA  . ASN D  1 272 ? 33.871  97.933  -90.585  1.00 86.97  ? 298 ASN D CA  1 
ATOM   8293  C  C   . ASN D  1 272 ? 34.117  98.709  -89.296  1.00 85.11  ? 298 ASN D C   1 
ATOM   8294  O  O   . ASN D  1 272 ? 33.855  99.915  -89.246  1.00 84.92  ? 298 ASN D O   1 
ATOM   8295  C  CB  . ASN D  1 272 ? 32.914  98.732  -91.482  1.00 94.20  ? 298 ASN D CB  1 
ATOM   8296  C  CG  . ASN D  1 272 ? 33.171  98.512  -92.958  1.00 89.00  ? 298 ASN D CG  1 
ATOM   8297  O  OD1 . ASN D  1 272 ? 32.936  97.424  -93.486  1.00 86.21  ? 298 ASN D OD1 1 
ATOM   8298  N  ND2 . ASN D  1 272 ? 33.632  99.555  -93.639  1.00 91.51  ? 298 ASN D ND2 1 
ATOM   8299  N  N   . TRP D  1 273 ? 34.624  98.048  -88.256  1.00 91.25  ? 299 TRP D N   1 
ATOM   8300  C  CA  . TRP D  1 273 ? 34.945  98.739  -87.014  1.00 82.53  ? 299 TRP D CA  1 
ATOM   8301  C  C   . TRP D  1 273 ? 36.127  98.073  -86.331  1.00 78.30  ? 299 TRP D C   1 
ATOM   8302  O  O   . TRP D  1 273 ? 36.255  96.846  -86.343  1.00 82.44  ? 299 TRP D O   1 
ATOM   8303  C  CB  . TRP D  1 273 ? 33.747  98.783  -86.059  1.00 77.26  ? 299 TRP D CB  1 
ATOM   8304  C  CG  . TRP D  1 273 ? 32.949  100.035 -86.210  1.00 83.99  ? 299 TRP D CG  1 
ATOM   8305  C  CD1 . TRP D  1 273 ? 33.259  101.268 -85.715  1.00 79.87  ? 299 TRP D CD1 1 
ATOM   8306  C  CD2 . TRP D  1 273 ? 31.716  100.186 -86.921  1.00 86.15  ? 299 TRP D CD2 1 
ATOM   8307  N  NE1 . TRP D  1 273 ? 32.292  102.177 -86.067  1.00 82.49  ? 299 TRP D NE1 1 
ATOM   8308  C  CE2 . TRP D  1 273 ? 31.333  101.538 -86.808  1.00 83.08  ? 299 TRP D CE2 1 
ATOM   8309  C  CE3 . TRP D  1 273 ? 30.896  99.308  -87.639  1.00 88.27  ? 299 TRP D CE3 1 
ATOM   8310  C  CZ2 . TRP D  1 273 ? 30.167  102.033 -87.386  1.00 86.41  ? 299 TRP D CZ2 1 
ATOM   8311  C  CZ3 . TRP D  1 273 ? 29.738  99.801  -88.212  1.00 89.55  ? 299 TRP D CZ3 1 
ATOM   8312  C  CH2 . TRP D  1 273 ? 29.385  101.151 -88.082  1.00 90.59  ? 299 TRP D CH2 1 
ATOM   8313  N  N   . GLY D  1 274 ? 36.985  98.898  -85.737  1.00 76.44  ? 300 GLY D N   1 
ATOM   8314  C  CA  . GLY D  1 274 ? 38.134  98.417  -84.998  1.00 71.84  ? 300 GLY D CA  1 
ATOM   8315  C  C   . GLY D  1 274 ? 38.391  99.254  -83.764  1.00 71.17  ? 300 GLY D C   1 
ATOM   8316  O  O   . GLY D  1 274 ? 37.588  100.126 -83.422  1.00 75.56  ? 300 GLY D O   1 
ATOM   8317  N  N   . GLY D  1 275 ? 39.506  99.013  -83.097  1.00 67.37  ? 301 GLY D N   1 
ATOM   8318  C  CA  . GLY D  1 275 ? 39.767  99.727  -81.857  1.00 75.94  ? 301 GLY D CA  1 
ATOM   8319  C  C   . GLY D  1 275 ? 39.312  98.943  -80.644  1.00 79.30  ? 301 GLY D C   1 
ATOM   8320  O  O   . GLY D  1 275 ? 38.363  98.159  -80.690  1.00 75.62  ? 301 GLY D O   1 
ATOM   8321  N  N   . LEU D  1 276 ? 40.015  99.165  -79.528  1.00 74.03  ? 302 LEU D N   1 
ATOM   8322  C  CA  . LEU D  1 276 ? 39.740  98.409  -78.309  1.00 66.61  ? 302 LEU D CA  1 
ATOM   8323  C  C   . LEU D  1 276 ? 38.279  98.536  -77.892  1.00 67.07  ? 302 LEU D C   1 
ATOM   8324  O  O   . LEU D  1 276 ? 37.674  97.565  -77.423  1.00 64.24  ? 302 LEU D O   1 
ATOM   8325  C  CB  . LEU D  1 276 ? 40.667  98.875  -77.185  1.00 64.09  ? 302 LEU D CB  1 
ATOM   8326  C  CG  . LEU D  1 276 ? 40.464  98.257  -75.798  1.00 63.77  ? 302 LEU D CG  1 
ATOM   8327  C  CD1 . LEU D  1 276 ? 40.553  96.737  -75.853  1.00 63.72  ? 302 LEU D CD1 1 
ATOM   8328  C  CD2 . LEU D  1 276 ? 41.469  98.817  -74.801  1.00 58.53  ? 302 LEU D CD2 1 
ATOM   8329  N  N   . LEU D  1 277 ? 37.691  99.717  -78.075  1.00 63.49  ? 303 LEU D N   1 
ATOM   8330  C  CA  . LEU D  1 277 ? 36.295  99.956  -77.739  1.00 59.55  ? 303 LEU D CA  1 
ATOM   8331  C  C   . LEU D  1 277 ? 35.384  99.943  -78.959  1.00 66.53  ? 303 LEU D C   1 
ATOM   8332  O  O   . LEU D  1 277 ? 34.213  100.325 -78.847  1.00 65.88  ? 303 LEU D O   1 
ATOM   8333  C  CB  . LEU D  1 277 ? 36.158  101.286 -76.998  1.00 58.28  ? 303 LEU D CB  1 
ATOM   8334  C  CG  . LEU D  1 277 ? 36.966  101.400 -75.705  1.00 66.25  ? 303 LEU D CG  1 
ATOM   8335  C  CD1 . LEU D  1 277 ? 36.752  102.762 -75.060  1.00 60.47  ? 303 LEU D CD1 1 
ATOM   8336  C  CD2 . LEU D  1 277 ? 36.612  100.269 -74.739  1.00 54.62  ? 303 LEU D CD2 1 
ATOM   8337  N  N   . CYS D  1 278 ? 35.890  99.505  -80.114  1.00 67.87  ? 304 CYS D N   1 
ATOM   8338  C  CA  . CYS D  1 278 ? 35.140  99.497  -81.373  1.00 71.36  ? 304 CYS D CA  1 
ATOM   8339  C  C   . CYS D  1 278 ? 34.580  100.882 -81.685  1.00 70.12  ? 304 CYS D C   1 
ATOM   8340  O  O   . CYS D  1 278 ? 33.399  101.051 -81.998  1.00 71.61  ? 304 CYS D O   1 
ATOM   8341  C  CB  . CYS D  1 278 ? 34.025  98.450  -81.351  1.00 67.45  ? 304 CYS D CB  1 
ATOM   8342  S  SG  . CYS D  1 278 ? 34.586  96.770  -81.034  1.00 70.83  ? 304 CYS D SG  1 
ATOM   8343  N  N   . ASP D  1 279 ? 35.452  101.888 -81.592  1.00 71.56  ? 305 ASP D N   1 
ATOM   8344  C  CA  . ASP D  1 279 ? 35.080  103.274 -81.852  1.00 81.96  ? 305 ASP D CA  1 
ATOM   8345  C  C   . ASP D  1 279 ? 35.904  103.891 -82.981  1.00 79.13  ? 305 ASP D C   1 
ATOM   8346  O  O   . ASP D  1 279 ? 35.928  105.117 -83.131  1.00 67.77  ? 305 ASP D O   1 
ATOM   8347  C  CB  . ASP D  1 279 ? 35.206  104.107 -80.573  1.00 74.25  ? 305 ASP D CB  1 
ATOM   8348  C  CG  . ASP D  1 279 ? 36.565  103.967 -79.907  1.00 71.71  ? 305 ASP D CG  1 
ATOM   8349  O  OD1 . ASP D  1 279 ? 37.030  104.954 -79.301  1.00 72.29  ? 305 ASP D OD1 1 
ATOM   8350  O  OD2 . ASP D  1 279 ? 37.168  102.875 -79.984  1.00 72.54  ? 305 ASP D OD2 1 
ATOM   8351  N  N   . LYS D  1 280 ? 36.577  103.065 -83.779  1.00 82.55  ? 306 LYS D N   1 
ATOM   8352  C  CA  . LYS D  1 280 ? 37.369  103.531 -84.909  1.00 85.57  ? 306 LYS D CA  1 
ATOM   8353  C  C   . LYS D  1 280 ? 36.595  103.294 -86.198  1.00 88.05  ? 306 LYS D C   1 
ATOM   8354  O  O   . LYS D  1 280 ? 36.093  102.189 -86.434  1.00 85.35  ? 306 LYS D O   1 
ATOM   8355  C  CB  . LYS D  1 280 ? 38.723  102.818 -84.967  1.00 77.35  ? 306 LYS D CB  1 
ATOM   8356  C  CG  . LYS D  1 280 ? 39.526  102.898 -83.679  1.00 78.91  ? 306 LYS D CG  1 
ATOM   8357  C  CD  . LYS D  1 280 ? 39.819  104.337 -83.293  1.00 75.71  ? 306 LYS D CD  1 
ATOM   8358  C  CE  . LYS D  1 280 ? 39.463  104.594 -81.837  1.00 68.74  ? 306 LYS D CE  1 
ATOM   8359  N  NZ  . LYS D  1 280 ? 39.844  105.964 -81.392  1.00 73.78  ? 306 LYS D NZ  1 
ATOM   8360  N  N   . ASP D  1 281 ? 36.501  104.329 -87.027  1.00 85.90  ? 307 ASP D N   1 
ATOM   8361  C  CA  . ASP D  1 281 ? 35.772  104.246 -88.284  1.00 88.31  ? 307 ASP D CA  1 
ATOM   8362  C  C   . ASP D  1 281 ? 36.699  103.739 -89.382  1.00 88.04  ? 307 ASP D C   1 
ATOM   8363  O  O   . ASP D  1 281 ? 37.813  104.247 -89.548  1.00 87.68  ? 307 ASP D O   1 
ATOM   8364  C  CB  . ASP D  1 281 ? 35.193  105.611 -88.660  1.00 84.93  ? 307 ASP D CB  1 
ATOM   8365  C  CG  . ASP D  1 281 ? 33.924  105.496 -89.479  1.00 85.12  ? 307 ASP D CG  1 
ATOM   8366  O  OD1 . ASP D  1 281 ? 33.756  104.471 -90.175  1.00 86.27  ? 307 ASP D OD1 1 
ATOM   8367  O  OD2 . ASP D  1 281 ? 33.092  106.429 -89.421  1.00 80.64  ? 307 ASP D OD2 1 
ATOM   8368  N  N   . LEU D  1 282 ? 36.238  102.736 -90.123  1.00 91.66  ? 308 LEU D N   1 
ATOM   8369  C  CA  . LEU D  1 282 ? 37.015  102.170 -91.222  1.00 95.33  ? 308 LEU D CA  1 
ATOM   8370  C  C   . LEU D  1 282 ? 36.413  102.550 -92.573  1.00 91.81  ? 308 LEU D C   1 
ATOM   8371  O  O   . LEU D  1 282 ? 37.116  103.016 -93.471  1.00 86.68  ? 308 LEU D O   1 
ATOM   8372  C  CB  . LEU D  1 282 ? 37.099  100.646 -91.094  1.00 91.30  ? 308 LEU D CB  1 
ATOM   8373  C  CG  . LEU D  1 282 ? 37.819  100.090 -89.862  1.00 88.94  ? 308 LEU D CG  1 
ATOM   8374  C  CD1 . LEU D  1 282 ? 37.810  98.569  -89.884  1.00 82.56  ? 308 LEU D CD1 1 
ATOM   8375  C  CD2 . LEU D  1 282 ? 39.247  100.622 -89.768  1.00 85.72  ? 308 LEU D CD2 1 
ATOM   8376  N  N   . MET E  1 1   ? 31.502  23.977  -20.316  1.00 47.43  ? 27  MET E N   1 
ATOM   8377  C  CA  . MET E  1 1   ? 31.800  23.985  -21.743  1.00 47.15  ? 27  MET E CA  1 
ATOM   8378  C  C   . MET E  1 1   ? 30.696  23.318  -22.544  1.00 53.94  ? 27  MET E C   1 
ATOM   8379  O  O   . MET E  1 1   ? 30.202  22.253  -22.175  1.00 56.41  ? 27  MET E O   1 
ATOM   8380  C  CB  . MET E  1 1   ? 33.129  23.285  -22.024  1.00 46.51  ? 27  MET E CB  1 
ATOM   8381  C  CG  . MET E  1 1   ? 34.334  24.005  -21.468  1.00 49.45  ? 27  MET E CG  1 
ATOM   8382  S  SD  . MET E  1 1   ? 35.865  23.260  -22.047  1.00 65.79  ? 27  MET E SD  1 
ATOM   8383  C  CE  . MET E  1 1   ? 35.586  23.253  -23.816  1.00 65.54  ? 27  MET E CE  1 
ATOM   8384  N  N   . GLY E  1 2   ? 30.317  23.955  -23.645  1.00 49.16  ? 28  GLY E N   1 
ATOM   8385  C  CA  . GLY E  1 2   ? 29.332  23.402  -24.549  1.00 47.98  ? 28  GLY E CA  1 
ATOM   8386  C  C   . GLY E  1 2   ? 29.509  24.020  -25.917  1.00 47.60  ? 28  GLY E C   1 
ATOM   8387  O  O   . GLY E  1 2   ? 30.644  24.126  -26.391  1.00 48.71  ? 28  GLY E O   1 
ATOM   8388  N  N   . TYR E  1 3   ? 28.408  24.446  -26.547  1.00 50.15  ? 29  TYR E N   1 
ATOM   8389  C  CA  . TYR E  1 3   ? 28.438  25.214  -27.797  1.00 54.50  ? 29  TYR E CA  1 
ATOM   8390  C  C   . TYR E  1 3   ? 27.052  25.629  -28.266  1.00 51.13  ? 29  TYR E C   1 
ATOM   8391  O  O   . TYR E  1 3   ? 26.045  25.291  -27.637  1.00 58.02  ? 29  TYR E O   1 
ATOM   8392  C  CB  . TYR E  1 3   ? 29.107  24.440  -28.914  1.00 47.76  ? 29  TYR E CB  1 
ATOM   8393  C  CG  . TYR E  1 3   ? 28.568  23.113  -28.960  1.00 49.44  ? 29  TYR E CG  1 
ATOM   8394  C  CD1 . TYR E  1 3   ? 29.371  21.995  -28.662  1.00 61.20  ? 29  TYR E CD1 1 
ATOM   8395  C  CD2 . TYR E  1 3   ? 27.243  22.895  -29.288  1.00 59.08  ? 29  TYR E CD2 1 
ATOM   8396  C  CE1 . TYR E  1 3   ? 28.837  20.714  -28.709  1.00 72.67  ? 29  TYR E CE1 1 
ATOM   8397  C  CE2 . TYR E  1 3   ? 26.753  21.658  -29.263  1.00 71.13  ? 29  TYR E CE2 1 
ATOM   8398  C  CZ  . TYR E  1 3   ? 27.512  20.524  -29.027  1.00 78.40  ? 29  TYR E CZ  1 
ATOM   8399  O  OH  . TYR E  1 3   ? 26.927  19.291  -29.086  1.00 74.98  ? 29  TYR E OH  1 
ATOM   8400  N  N   . PHE E  1 4   ? 27.006  26.225  -29.450  1.00 42.90  ? 30  PHE E N   1 
ATOM   8401  C  CA  . PHE E  1 4   ? 25.779  26.693  -30.062  1.00 41.09  ? 30  PHE E CA  1 
ATOM   8402  C  C   . PHE E  1 4   ? 25.650  26.076  -31.450  1.00 40.70  ? 30  PHE E C   1 
ATOM   8403  O  O   . PHE E  1 4   ? 26.644  25.945  -32.172  1.00 31.84  ? 30  PHE E O   1 
ATOM   8404  C  CB  . PHE E  1 4   ? 25.782  28.220  -30.134  1.00 33.75  ? 30  PHE E CB  1 
ATOM   8405  C  CG  . PHE E  1 4   ? 24.511  28.805  -30.661  1.00 40.51  ? 30  PHE E CG  1 
ATOM   8406  C  CD1 . PHE E  1 4   ? 24.314  28.953  -32.026  1.00 39.09  ? 30  PHE E CD1 1 
ATOM   8407  C  CD2 . PHE E  1 4   ? 23.514  29.223  -29.795  1.00 38.11  ? 30  PHE E CD2 1 
ATOM   8408  C  CE1 . PHE E  1 4   ? 23.142  29.494  -32.521  1.00 32.08  ? 30  PHE E CE1 1 
ATOM   8409  C  CE2 . PHE E  1 4   ? 22.335  29.766  -30.282  1.00 34.28  ? 30  PHE E CE2 1 
ATOM   8410  C  CZ  . PHE E  1 4   ? 22.151  29.902  -31.647  1.00 34.45  ? 30  PHE E CZ  1 
ATOM   8411  N  N   . GLU E  1 5   ? 24.423  25.681  -31.808  1.00 40.09  ? 31  GLU E N   1 
ATOM   8412  C  CA  . GLU E  1 5   ? 24.127  25.065  -33.097  1.00 45.13  ? 31  GLU E CA  1 
ATOM   8413  C  C   . GLU E  1 5   ? 23.071  25.829  -33.875  1.00 47.58  ? 31  GLU E C   1 
ATOM   8414  O  O   . GLU E  1 5   ? 22.118  26.374  -33.311  1.00 47.03  ? 31  GLU E O   1 
ATOM   8415  C  CB  . GLU E  1 5   ? 23.625  23.634  -32.975  1.00 49.78  ? 31  GLU E CB  1 
ATOM   8416  C  CG  . GLU E  1 5   ? 24.057  22.771  -34.138  1.00 62.74  ? 31  GLU E CG  1 
ATOM   8417  C  CD  . GLU E  1 5   ? 23.694  21.311  -33.960  1.00 73.85  ? 31  GLU E CD  1 
ATOM   8418  O  OE1 . GLU E  1 5   ? 22.927  20.994  -33.023  1.00 61.69  ? 31  GLU E OE1 1 
ATOM   8419  O  OE2 . GLU E  1 5   ? 24.250  20.469  -34.699  1.00 83.48  ? 31  GLU E OE2 1 
ATOM   8420  N  N   . LEU E  1 6   ? 23.215  25.780  -35.195  1.00 41.58  ? 32  LEU E N   1 
ATOM   8421  C  CA  . LEU E  1 6   ? 22.273  26.403  -36.110  1.00 43.57  ? 32  LEU E CA  1 
ATOM   8422  C  C   . LEU E  1 6   ? 22.145  25.519  -37.342  1.00 44.67  ? 32  LEU E C   1 
ATOM   8423  O  O   . LEU E  1 6   ? 23.140  25.253  -38.023  1.00 41.63  ? 32  LEU E O   1 
ATOM   8424  C  CB  . LEU E  1 6   ? 22.744  27.812  -36.475  1.00 38.23  ? 32  LEU E CB  1 
ATOM   8425  C  CG  . LEU E  1 6   ? 21.826  28.668  -37.337  1.00 42.16  ? 32  LEU E CG  1 
ATOM   8426  C  CD1 . LEU E  1 6   ? 21.836  30.104  -36.836  1.00 42.41  ? 32  LEU E CD1 1 
ATOM   8427  C  CD2 . LEU E  1 6   ? 22.261  28.598  -38.792  1.00 37.34  ? 32  LEU E CD2 1 
ATOM   8428  N  N   . GLN E  1 7   ? 20.926  25.052  -37.617  1.00 42.68  ? 33  GLN E N   1 
ATOM   8429  C  CA  . GLN E  1 7   ? 20.638  24.195  -38.763  1.00 39.49  ? 33  GLN E CA  1 
ATOM   8430  C  C   . GLN E  1 7   ? 19.738  24.955  -39.730  1.00 39.17  ? 33  GLN E C   1 
ATOM   8431  O  O   . GLN E  1 7   ? 18.555  25.175  -39.446  1.00 40.22  ? 33  GLN E O   1 
ATOM   8432  C  CB  . GLN E  1 7   ? 19.985  22.888  -38.318  1.00 43.51  ? 33  GLN E CB  1 
ATOM   8433  C  CG  . GLN E  1 7   ? 19.558  21.982  -39.467  1.00 42.20  ? 33  GLN E CG  1 
ATOM   8434  C  CD  . GLN E  1 7   ? 20.725  21.543  -40.335  1.00 48.84  ? 33  GLN E CD  1 
ATOM   8435  O  OE1 . GLN E  1 7   ? 21.599  20.795  -39.892  1.00 44.20  ? 33  GLN E OE1 1 
ATOM   8436  N  NE2 . GLN E  1 7   ? 20.745  22.011  -41.581  1.00 48.51  ? 33  GLN E NE2 1 
ATOM   8437  N  N   . LEU E  1 8   ? 20.302  25.355  -40.868  1.00 45.03  ? 34  LEU E N   1 
ATOM   8438  C  CA  . LEU E  1 8   ? 19.545  26.026  -41.917  1.00 43.56  ? 34  LEU E CA  1 
ATOM   8439  C  C   . LEU E  1 8   ? 18.778  25.003  -42.745  1.00 43.24  ? 34  LEU E C   1 
ATOM   8440  O  O   . LEU E  1 8   ? 19.339  23.983  -43.160  1.00 50.40  ? 34  LEU E O   1 
ATOM   8441  C  CB  . LEU E  1 8   ? 20.488  26.833  -42.810  1.00 46.68  ? 34  LEU E CB  1 
ATOM   8442  C  CG  . LEU E  1 8   ? 19.855  27.454  -44.055  1.00 54.78  ? 34  LEU E CG  1 
ATOM   8443  C  CD1 . LEU E  1 8   ? 18.696  28.306  -43.623  1.00 52.93  ? 34  LEU E CD1 1 
ATOM   8444  C  CD2 . LEU E  1 8   ? 20.859  28.280  -44.845  1.00 43.61  ? 34  LEU E CD2 1 
ATOM   8445  N  N   . SER E  1 9   ? 17.495  25.276  -42.994  1.00 39.23  ? 35  SER E N   1 
ATOM   8446  C  CA  . SER E  1 9   ? 16.641  24.331  -43.701  1.00 48.07  ? 35  SER E CA  1 
ATOM   8447  C  C   . SER E  1 9   ? 16.126  24.827  -45.046  1.00 52.78  ? 35  SER E C   1 
ATOM   8448  O  O   . SER E  1 9   ? 15.801  23.993  -45.900  1.00 49.27  ? 35  SER E O   1 
ATOM   8449  C  CB  . SER E  1 9   ? 15.444  23.936  -42.823  1.00 44.92  ? 35  SER E CB  1 
ATOM   8450  O  OG  . SER E  1 9   ? 14.810  25.080  -42.286  1.00 50.24  ? 35  SER E OG  1 
ATOM   8451  N  N   . ALA E  1 10  ? 16.052  26.142  -45.264  1.00 50.91  ? 36  ALA E N   1 
ATOM   8452  C  CA  . ALA E  1 10  ? 15.584  26.684  -46.534  1.00 46.63  ? 36  ALA E CA  1 
ATOM   8453  C  C   . ALA E  1 10  ? 15.849  28.185  -46.587  1.00 57.24  ? 36  ALA E C   1 
ATOM   8454  O  O   . ALA E  1 10  ? 15.679  28.884  -45.585  1.00 58.58  ? 36  ALA E O   1 
ATOM   8455  C  CB  . ALA E  1 10  ? 14.087  26.408  -46.735  1.00 47.11  ? 36  ALA E CB  1 
ATOM   8456  N  N   . LEU E  1 11  ? 16.274  28.660  -47.760  1.00 55.90  ? 37  LEU E N   1 
ATOM   8457  C  CA  . LEU E  1 11  ? 16.365  30.074  -48.110  1.00 62.46  ? 37  LEU E CA  1 
ATOM   8458  C  C   . LEU E  1 11  ? 15.591  30.303  -49.401  1.00 66.73  ? 37  LEU E C   1 
ATOM   8459  O  O   . LEU E  1 11  ? 15.547  29.428  -50.268  1.00 64.94  ? 37  LEU E O   1 
ATOM   8460  C  CB  . LEU E  1 11  ? 17.836  30.515  -48.303  1.00 63.43  ? 37  LEU E CB  1 
ATOM   8461  C  CG  . LEU E  1 11  ? 18.266  31.953  -48.664  1.00 65.29  ? 37  LEU E CG  1 
ATOM   8462  C  CD1 . LEU E  1 11  ? 18.413  32.923  -47.494  1.00 61.38  ? 37  LEU E CD1 1 
ATOM   8463  C  CD2 . LEU E  1 11  ? 19.546  31.908  -49.498  1.00 70.40  ? 37  LEU E CD2 1 
ATOM   8464  N  N   . ARG E  1 12  ? 14.976  31.478  -49.533  1.00 63.94  ? 38  ARG E N   1 
ATOM   8465  C  CA  . ARG E  1 12  ? 14.327  31.826  -50.793  1.00 63.34  ? 38  ARG E CA  1 
ATOM   8466  C  C   . ARG E  1 12  ? 14.516  33.307  -51.089  1.00 66.48  ? 38  ARG E C   1 
ATOM   8467  O  O   . ARG E  1 12  ? 14.281  34.160  -50.229  1.00 64.42  ? 38  ARG E O   1 
ATOM   8468  C  CB  . ARG E  1 12  ? 12.835  31.442  -50.793  1.00 57.31  ? 38  ARG E CB  1 
ATOM   8469  C  CG  . ARG E  1 12  ? 11.871  32.373  -50.069  1.00 59.90  ? 38  ARG E CG  1 
ATOM   8470  C  CD  . ARG E  1 12  ? 10.510  31.700  -49.897  1.00 60.58  ? 38  ARG E CD  1 
ATOM   8471  N  NE  . ARG E  1 12  ? 9.551   32.054  -50.939  1.00 61.45  ? 38  ARG E NE  1 
ATOM   8472  C  CZ  . ARG E  1 12  ? 8.419   32.719  -50.721  1.00 68.76  ? 38  ARG E CZ  1 
ATOM   8473  N  NH1 . ARG E  1 12  ? 8.095   33.098  -49.490  1.00 69.09  ? 38  ARG E NH1 1 
ATOM   8474  N  NH2 . ARG E  1 12  ? 7.605   32.996  -51.732  1.00 65.06  ? 38  ARG E NH2 1 
ATOM   8475  N  N   . ASN E  1 13  ? 14.972  33.595  -52.306  1.00 73.38  ? 39  ASN E N   1 
ATOM   8476  C  CA  . ASN E  1 13  ? 15.178  34.956  -52.800  1.00 73.12  ? 39  ASN E CA  1 
ATOM   8477  C  C   . ASN E  1 13  ? 14.440  35.033  -54.132  1.00 70.24  ? 39  ASN E C   1 
ATOM   8478  O  O   . ASN E  1 13  ? 14.933  34.539  -55.149  1.00 71.90  ? 39  ASN E O   1 
ATOM   8479  C  CB  . ASN E  1 13  ? 16.665  35.269  -52.953  1.00 73.87  ? 39  ASN E CB  1 
ATOM   8480  C  CG  . ASN E  1 13  ? 16.922  36.694  -53.399  1.00 70.86  ? 39  ASN E CG  1 
ATOM   8481  O  OD1 . ASN E  1 13  ? 16.041  37.552  -53.325  1.00 70.06  ? 39  ASN E OD1 1 
ATOM   8482  N  ND2 . ASN E  1 13  ? 18.139  36.955  -53.864  1.00 65.19  ? 39  ASN E ND2 1 
ATOM   8483  N  N   . VAL E  1 14  ? 13.259  35.653  -54.128  1.00 71.35  ? 40  VAL E N   1 
ATOM   8484  C  CA  . VAL E  1 14  ? 12.329  35.452  -55.235  1.00 80.33  ? 40  VAL E CA  1 
ATOM   8485  C  C   . VAL E  1 14  ? 12.690  36.261  -56.482  1.00 76.44  ? 40  VAL E C   1 
ATOM   8486  O  O   . VAL E  1 14  ? 12.172  35.965  -57.567  1.00 71.08  ? 40  VAL E O   1 
ATOM   8487  C  CB  . VAL E  1 14  ? 10.893  35.732  -54.746  1.00 81.55  ? 40  VAL E CB  1 
ATOM   8488  C  CG1 . VAL E  1 14  ? 10.599  37.223  -54.683  1.00 71.36  ? 40  VAL E CG1 1 
ATOM   8489  C  CG2 . VAL E  1 14  ? 9.866   34.985  -55.601  1.00 63.61  ? 40  VAL E CG2 1 
ATOM   8490  N  N   . ASN E  1 15  ? 13.588  37.249  -56.378  1.00 70.16  ? 41  ASN E N   1 
ATOM   8491  C  CA  . ASN E  1 15  ? 14.053  37.996  -57.543  1.00 69.17  ? 41  ASN E CA  1 
ATOM   8492  C  C   . ASN E  1 15  ? 15.527  37.799  -57.871  1.00 73.12  ? 41  ASN E C   1 
ATOM   8493  O  O   . ASN E  1 15  ? 15.943  38.143  -58.982  1.00 84.39  ? 41  ASN E O   1 
ATOM   8494  C  CB  . ASN E  1 15  ? 13.819  39.505  -57.362  1.00 65.02  ? 41  ASN E CB  1 
ATOM   8495  C  CG  . ASN E  1 15  ? 12.356  39.874  -57.243  1.00 65.34  ? 41  ASN E CG  1 
ATOM   8496  O  OD1 . ASN E  1 15  ? 11.510  39.037  -56.939  1.00 78.40  ? 41  ASN E OD1 1 
ATOM   8497  N  ND2 . ASN E  1 15  ? 12.051  41.144  -57.487  1.00 59.41  ? 41  ASN E ND2 1 
ATOM   8498  N  N   . GLY E  1 16  ? 16.323  37.276  -56.947  1.00 72.83  ? 42  GLY E N   1 
ATOM   8499  C  CA  . GLY E  1 16  ? 17.759  37.229  -57.153  1.00 79.46  ? 42  GLY E CA  1 
ATOM   8500  C  C   . GLY E  1 16  ? 18.440  38.563  -56.940  1.00 85.16  ? 42  GLY E C   1 
ATOM   8501  O  O   . GLY E  1 16  ? 19.335  38.929  -57.711  1.00 88.14  ? 42  GLY E O   1 
ATOM   8502  N  N   . GLU E  1 17  ? 18.044  39.298  -55.903  1.00 84.10  ? 43  GLU E N   1 
ATOM   8503  C  CA  . GLU E  1 17  ? 18.486  40.661  -55.661  1.00 81.82  ? 43  GLU E CA  1 
ATOM   8504  C  C   . GLU E  1 17  ? 19.586  40.704  -54.601  1.00 84.19  ? 43  GLU E C   1 
ATOM   8505  O  O   . GLU E  1 17  ? 20.133  39.678  -54.186  1.00 83.77  ? 43  GLU E O   1 
ATOM   8506  C  CB  . GLU E  1 17  ? 17.296  41.520  -55.234  1.00 79.11  ? 43  GLU E CB  1 
ATOM   8507  C  CG  . GLU E  1 17  ? 16.283  41.780  -56.322  1.00 81.17  ? 43  GLU E CG  1 
ATOM   8508  C  CD  . GLU E  1 17  ? 14.972  42.296  -55.768  1.00 78.51  ? 43  GLU E CD  1 
ATOM   8509  O  OE1 . GLU E  1 17  ? 14.800  42.264  -54.531  1.00 66.68  ? 43  GLU E OE1 1 
ATOM   8510  O  OE2 . GLU E  1 17  ? 14.116  42.732  -56.569  1.00 82.74  ? 43  GLU E OE2 1 
ATOM   8511  N  N   . LEU E  1 18  ? 19.918  41.921  -54.165  1.00 88.05  ? 44  LEU E N   1 
ATOM   8512  C  CA  . LEU E  1 18  ? 20.780  42.166  -53.015  1.00 85.98  ? 44  LEU E CA  1 
ATOM   8513  C  C   . LEU E  1 18  ? 20.048  43.067  -52.030  1.00 91.89  ? 44  LEU E C   1 
ATOM   8514  O  O   . LEU E  1 18  ? 18.865  43.370  -52.223  1.00 90.92  ? 44  LEU E O   1 
ATOM   8515  C  CB  . LEU E  1 18  ? 22.097  42.831  -53.422  1.00 82.70  ? 44  LEU E CB  1 
ATOM   8516  C  CG  . LEU E  1 18  ? 23.127  42.097  -54.278  1.00 85.47  ? 44  LEU E CG  1 
ATOM   8517  C  CD1 . LEU E  1 18  ? 23.490  40.758  -53.663  1.00 82.93  ? 44  LEU E CD1 1 
ATOM   8518  C  CD2 . LEU E  1 18  ? 22.640  41.939  -55.702  1.00 88.55  ? 44  LEU E CD2 1 
ATOM   8519  N  N   . LEU E  1 19  ? 20.741  43.511  -50.979  1.00 89.16  ? 45  LEU E N   1 
ATOM   8520  C  CA  . LEU E  1 19  ? 20.169  44.546  -50.125  1.00 89.86  ? 45  LEU E CA  1 
ATOM   8521  C  C   . LEU E  1 19  ? 20.016  45.859  -50.879  1.00 94.86  ? 45  LEU E C   1 
ATOM   8522  O  O   . LEU E  1 19  ? 19.053  46.599  -50.646  1.00 92.24  ? 45  LEU E O   1 
ATOM   8523  C  CB  . LEU E  1 19  ? 21.028  44.742  -48.877  1.00 84.34  ? 45  LEU E CB  1 
ATOM   8524  C  CG  . LEU E  1 19  ? 20.519  44.052  -47.612  1.00 70.94  ? 45  LEU E CG  1 
ATOM   8525  C  CD1 . LEU E  1 19  ? 21.499  44.248  -46.468  1.00 78.30  ? 45  LEU E CD1 1 
ATOM   8526  C  CD2 . LEU E  1 19  ? 19.140  44.573  -47.240  1.00 61.48  ? 45  LEU E CD2 1 
ATOM   8527  N  N   . SER E  1 20  ? 20.946  46.157  -51.792  1.00 100.93 ? 46  SER E N   1 
ATOM   8528  C  CA  . SER E  1 20  ? 20.848  47.342  -52.635  1.00 97.03  ? 46  SER E CA  1 
ATOM   8529  C  C   . SER E  1 20  ? 19.738  47.238  -53.672  1.00 91.56  ? 46  SER E C   1 
ATOM   8530  O  O   . SER E  1 20  ? 19.408  48.250  -54.301  1.00 96.02  ? 46  SER E O   1 
ATOM   8531  C  CB  . SER E  1 20  ? 22.185  47.597  -53.336  1.00 88.40  ? 46  SER E CB  1 
ATOM   8532  O  OG  . SER E  1 20  ? 22.537  46.505  -54.169  1.00 82.68  ? 46  SER E OG  1 
ATOM   8533  N  N   . GLY E  1 21  ? 19.158  46.054  -53.864  1.00 87.27  ? 47  GLY E N   1 
ATOM   8534  C  CA  . GLY E  1 21  ? 18.110  45.858  -54.842  1.00 89.38  ? 47  GLY E CA  1 
ATOM   8535  C  C   . GLY E  1 21  ? 18.592  45.626  -56.256  1.00 94.76  ? 47  GLY E C   1 
ATOM   8536  O  O   . GLY E  1 21  ? 17.757  45.488  -57.162  1.00 85.93  ? 47  GLY E O   1 
ATOM   8537  N  N   . ALA E  1 22  ? 19.906  45.562  -56.474  1.00 88.78  ? 48  ALA E N   1 
ATOM   8538  C  CA  . ALA E  1 22  ? 20.469  45.440  -57.812  1.00 85.45  ? 48  ALA E CA  1 
ATOM   8539  C  C   . ALA E  1 22  ? 20.474  43.996  -58.302  1.00 95.23  ? 48  ALA E C   1 
ATOM   8540  O  O   . ALA E  1 22  ? 19.606  43.199  -57.932  1.00 88.80  ? 48  ALA E O   1 
ATOM   8541  C  CB  . ALA E  1 22  ? 21.889  46.007  -57.837  1.00 79.96  ? 48  ALA E CB  1 
ATOM   8542  N  N   . CYS E  1 23  ? 21.446  43.662  -59.146  1.00 106.49 ? 49  CYS E N   1 
ATOM   8543  C  CA  . CYS E  1 23  ? 21.631  42.319  -59.668  1.00 100.45 ? 49  CYS E CA  1 
ATOM   8544  C  C   . CYS E  1 23  ? 22.866  41.696  -59.032  1.00 91.36  ? 49  CYS E C   1 
ATOM   8545  O  O   . CYS E  1 23  ? 23.806  42.396  -58.648  1.00 79.86  ? 49  CYS E O   1 
ATOM   8546  C  CB  . CYS E  1 23  ? 21.786  42.337  -61.189  1.00 97.74  ? 49  CYS E CB  1 
ATOM   8547  S  SG  . CYS E  1 23  ? 21.299  40.815  -62.017  1.00 101.79 ? 49  CYS E SG  1 
ATOM   8548  N  N   . CYS E  1 24  ? 22.860  40.371  -58.923  1.00 91.24  ? 50  CYS E N   1 
ATOM   8549  C  CA  . CYS E  1 24  ? 23.934  39.676  -58.221  1.00 92.80  ? 50  CYS E CA  1 
ATOM   8550  C  C   . CYS E  1 24  ? 25.169  39.524  -59.099  1.00 92.66  ? 50  CYS E C   1 
ATOM   8551  O  O   . CYS E  1 24  ? 26.075  40.363  -59.057  1.00 92.52  ? 50  CYS E O   1 
ATOM   8552  C  CB  . CYS E  1 24  ? 23.456  38.313  -57.724  1.00 102.15 ? 50  CYS E CB  1 
ATOM   8553  S  SG  . CYS E  1 24  ? 22.647  38.432  -56.122  1.00 120.71 ? 50  CYS E SG  1 
ATOM   8554  N  N   . ASP E  1 25  ? 25.224  38.461  -59.895  1.00 94.88  ? 51  ASP E N   1 
ATOM   8555  C  CA  . ASP E  1 25  ? 26.374  38.192  -60.750  1.00 99.20  ? 51  ASP E CA  1 
ATOM   8556  C  C   . ASP E  1 25  ? 26.132  38.793  -62.129  1.00 102.15 ? 51  ASP E C   1 
ATOM   8557  O  O   . ASP E  1 25  ? 25.170  38.425  -62.812  1.00 104.87 ? 51  ASP E O   1 
ATOM   8558  C  CB  . ASP E  1 25  ? 26.638  36.691  -60.845  1.00 98.45  ? 51  ASP E CB  1 
ATOM   8559  C  CG  . ASP E  1 25  ? 27.110  36.108  -59.530  1.00 94.85  ? 51  ASP E CG  1 
ATOM   8560  O  OD1 . ASP E  1 25  ? 28.073  36.651  -58.949  1.00 95.99  ? 51  ASP E OD1 1 
ATOM   8561  O  OD2 . ASP E  1 25  ? 26.519  35.113  -59.073  1.00 93.46  ? 51  ASP E OD2 1 
ATOM   8562  N  N   . GLY E  1 26  ? 26.996  39.725  -62.522  1.00 93.15  ? 52  GLY E N   1 
ATOM   8563  C  CA  . GLY E  1 26  ? 26.907  40.361  -63.820  1.00 81.34  ? 52  GLY E CA  1 
ATOM   8564  C  C   . GLY E  1 26  ? 28.226  40.333  -64.563  1.00 72.42  ? 52  GLY E C   1 
ATOM   8565  O  O   . GLY E  1 26  ? 28.256  40.398  -65.791  1.00 71.13  ? 52  GLY E O   1 
ATOM   8566  N  N   . CYS E  1 36  ? 16.411  38.533  -61.807  1.00 93.23  ? 62  CYS E N   1 
ATOM   8567  C  CA  . CYS E  1 36  ? 17.400  39.248  -62.604  1.00 106.29 ? 62  CYS E CA  1 
ATOM   8568  C  C   . CYS E  1 36  ? 18.190  38.288  -63.500  1.00 107.13 ? 62  CYS E C   1 
ATOM   8569  O  O   . CYS E  1 36  ? 19.415  38.197  -63.402  1.00 103.78 ? 62  CYS E O   1 
ATOM   8570  C  CB  . CYS E  1 36  ? 18.354  40.037  -61.696  1.00 97.54  ? 62  CYS E CB  1 
ATOM   8571  S  SG  . CYS E  1 36  ? 19.392  41.201  -62.603  1.00 125.28 ? 62  CYS E SG  1 
ATOM   8572  N  N   . GLY E  1 37  ? 17.485  37.577  -64.376  1.00 100.90 ? 63  GLY E N   1 
ATOM   8573  C  CA  . GLY E  1 37  ? 18.158  36.628  -65.254  1.00 101.31 ? 63  GLY E CA  1 
ATOM   8574  C  C   . GLY E  1 37  ? 18.612  35.406  -64.478  1.00 103.81 ? 63  GLY E C   1 
ATOM   8575  O  O   . GLY E  1 37  ? 17.845  34.821  -63.704  1.00 102.34 ? 63  GLY E O   1 
ATOM   8576  N  N   . HIS E  1 38  ? 19.865  35.006  -64.681  1.00 98.97  ? 64  HIS E N   1 
ATOM   8577  C  CA  . HIS E  1 38  ? 20.452  33.912  -63.912  1.00 101.07 ? 64  HIS E CA  1 
ATOM   8578  C  C   . HIS E  1 38  ? 21.975  34.032  -63.951  1.00 101.93 ? 64  HIS E C   1 
ATOM   8579  O  O   . HIS E  1 38  ? 22.522  35.064  -64.355  1.00 101.40 ? 64  HIS E O   1 
ATOM   8580  C  CB  . HIS E  1 38  ? 19.950  32.551  -64.406  1.00 101.08 ? 64  HIS E CB  1 
ATOM   8581  C  CG  . HIS E  1 38  ? 19.601  32.519  -65.860  1.00 102.27 ? 64  HIS E CG  1 
ATOM   8582  N  ND1 . HIS E  1 38  ? 18.322  32.740  -66.322  1.00 101.89 ? 64  HIS E ND1 1 
ATOM   8583  C  CD2 . HIS E  1 38  ? 20.360  32.273  -66.954  1.00 97.87  ? 64  HIS E CD2 1 
ATOM   8584  C  CE1 . HIS E  1 38  ? 18.308  32.640  -67.639  1.00 98.67  ? 64  HIS E CE1 1 
ATOM   8585  N  NE2 . HIS E  1 38  ? 19.533  32.358  -68.048  1.00 97.67  ? 64  HIS E NE2 1 
ATOM   8586  N  N   . ASP E  1 39  ? 22.654  32.938  -63.584  1.00 106.86 ? 65  ASP E N   1 
ATOM   8587  C  CA  . ASP E  1 39  ? 23.958  32.947  -62.918  1.00 107.13 ? 65  ASP E CA  1 
ATOM   8588  C  C   . ASP E  1 39  ? 23.749  33.587  -61.556  1.00 101.28 ? 65  ASP E C   1 
ATOM   8589  O  O   . ASP E  1 39  ? 24.341  34.623  -61.235  1.00 99.46  ? 65  ASP E O   1 
ATOM   8590  C  CB  . ASP E  1 39  ? 25.046  33.676  -63.713  1.00 100.23 ? 65  ASP E CB  1 
ATOM   8591  C  CG  . ASP E  1 39  ? 26.405  33.624  -63.020  1.00 105.58 ? 65  ASP E CG  1 
ATOM   8592  O  OD1 . ASP E  1 39  ? 26.588  32.780  -62.113  1.00 102.86 ? 65  ASP E OD1 1 
ATOM   8593  O  OD2 . ASP E  1 39  ? 27.289  34.431  -63.377  1.00 103.05 ? 65  ASP E OD2 1 
ATOM   8594  N  N   . GLU E  1 40  ? 22.899  32.959  -60.752  1.00 100.35 ? 66  GLU E N   1 
ATOM   8595  C  CA  . GLU E  1 40  ? 22.358  33.605  -59.573  1.00 101.06 ? 66  GLU E CA  1 
ATOM   8596  C  C   . GLU E  1 40  ? 23.443  33.834  -58.529  1.00 103.83 ? 66  GLU E C   1 
ATOM   8597  O  O   . GLU E  1 40  ? 24.578  33.354  -58.638  1.00 102.54 ? 66  GLU E O   1 
ATOM   8598  C  CB  . GLU E  1 40  ? 21.223  32.772  -58.982  1.00 93.05  ? 66  GLU E CB  1 
ATOM   8599  C  CG  . GLU E  1 40  ? 20.083  32.529  -59.957  1.00 96.22  ? 66  GLU E CG  1 
ATOM   8600  C  CD  . GLU E  1 40  ? 20.088  31.127  -60.532  1.00 94.30  ? 66  GLU E CD  1 
ATOM   8601  O  OE1 . GLU E  1 40  ? 19.000  30.517  -60.615  1.00 85.15  ? 66  GLU E OE1 1 
ATOM   8602  O  OE2 . GLU E  1 40  ? 21.176  30.635  -60.899  1.00 96.55  ? 66  GLU E OE2 1 
ATOM   8603  N  N   . CYS E  1 41  ? 23.074  34.625  -57.522  1.00 106.82 ? 67  CYS E N   1 
ATOM   8604  C  CA  . CYS E  1 41  ? 23.854  34.756  -56.304  1.00 99.56  ? 67  CYS E CA  1 
ATOM   8605  C  C   . CYS E  1 41  ? 24.053  33.354  -55.773  1.00 92.76  ? 67  CYS E C   1 
ATOM   8606  O  O   . CYS E  1 41  ? 23.094  32.750  -55.286  1.00 93.56  ? 67  CYS E O   1 
ATOM   8607  C  CB  . CYS E  1 41  ? 23.118  35.578  -55.249  1.00 99.87  ? 67  CYS E CB  1 
ATOM   8608  S  SG  . CYS E  1 41  ? 22.192  36.953  -55.922  1.00 115.19 ? 67  CYS E SG  1 
ATOM   8609  N  N   . ASP E  1 42  ? 25.257  32.811  -55.877  1.00 90.16  ? 68  ASP E N   1 
ATOM   8610  C  CA  . ASP E  1 42  ? 25.507  31.500  -55.296  1.00 87.73  ? 68  ASP E CA  1 
ATOM   8611  C  C   . ASP E  1 42  ? 25.746  31.719  -53.807  1.00 82.91  ? 68  ASP E C   1 
ATOM   8612  O  O   . ASP E  1 42  ? 26.807  32.182  -53.387  1.00 76.99  ? 68  ASP E O   1 
ATOM   8613  C  CB  . ASP E  1 42  ? 26.648  30.790  -56.016  1.00 88.72  ? 68  ASP E CB  1 
ATOM   8614  C  CG  . ASP E  1 42  ? 26.506  30.859  -57.531  1.00 97.00  ? 68  ASP E CG  1 
ATOM   8615  O  OD1 . ASP E  1 42  ? 25.349  30.929  -58.008  1.00 98.53  ? 68  ASP E OD1 1 
ATOM   8616  O  OD2 . ASP E  1 42  ? 27.524  30.803  -58.260  1.00 100.79 ? 68  ASP E OD2 1 
ATOM   8617  N  N   . THR E  1 43  ? 24.743  31.367  -53.008  1.00 78.70  ? 69  THR E N   1 
ATOM   8618  C  CA  . THR E  1 43  ? 24.567  31.917  -51.673  1.00 75.62  ? 69  THR E CA  1 
ATOM   8619  C  C   . THR E  1 43  ? 25.277  31.073  -50.624  1.00 75.29  ? 69  THR E C   1 
ATOM   8620  O  O   . THR E  1 43  ? 25.201  29.841  -50.648  1.00 73.43  ? 69  THR E O   1 
ATOM   8621  C  CB  . THR E  1 43  ? 23.078  32.010  -51.339  1.00 75.01  ? 69  THR E CB  1 
ATOM   8622  O  OG1 . THR E  1 43  ? 22.399  32.700  -52.396  1.00 80.50  ? 69  THR E OG1 1 
ATOM   8623  C  CG2 . THR E  1 43  ? 22.876  32.755  -50.030  1.00 72.32  ? 69  THR E CG2 1 
ATOM   8624  N  N   . TYR E  1 44  ? 25.966  31.746  -49.706  1.00 71.87  ? 70  TYR E N   1 
ATOM   8625  C  CA  . TYR E  1 44  ? 26.428  31.127  -48.475  1.00 66.38  ? 70  TYR E CA  1 
ATOM   8626  C  C   . TYR E  1 44  ? 26.014  32.012  -47.307  1.00 61.64  ? 70  TYR E C   1 
ATOM   8627  O  O   . TYR E  1 44  ? 25.655  33.180  -47.485  1.00 61.25  ? 70  TYR E O   1 
ATOM   8628  C  CB  . TYR E  1 44  ? 27.944  30.877  -48.488  1.00 73.54  ? 70  TYR E CB  1 
ATOM   8629  C  CG  . TYR E  1 44  ? 28.809  32.116  -48.491  1.00 76.68  ? 70  TYR E CG  1 
ATOM   8630  C  CD1 . TYR E  1 44  ? 28.982  32.864  -49.649  1.00 78.90  ? 70  TYR E CD1 1 
ATOM   8631  C  CD2 . TYR E  1 44  ? 29.483  32.515  -47.343  1.00 71.11  ? 70  TYR E CD2 1 
ATOM   8632  C  CE1 . TYR E  1 44  ? 29.784  33.989  -49.656  1.00 86.11  ? 70  TYR E CE1 1 
ATOM   8633  C  CE2 . TYR E  1 44  ? 30.288  33.637  -47.340  1.00 72.35  ? 70  TYR E CE2 1 
ATOM   8634  C  CZ  . TYR E  1 44  ? 30.436  34.370  -48.498  1.00 82.16  ? 70  TYR E CZ  1 
ATOM   8635  O  OH  . TYR E  1 44  ? 31.238  35.487  -48.494  1.00 76.56  ? 70  TYR E OH  1 
ATOM   8636  N  N   . VAL E  1 45  ? 26.047  31.436  -46.107  1.00 59.85  ? 71  VAL E N   1 
ATOM   8637  C  CA  . VAL E  1 45  ? 25.446  32.040  -44.923  1.00 56.57  ? 71  VAL E CA  1 
ATOM   8638  C  C   . VAL E  1 45  ? 26.510  32.235  -43.851  1.00 49.65  ? 71  VAL E C   1 
ATOM   8639  O  O   . VAL E  1 45  ? 27.313  31.334  -43.588  1.00 47.46  ? 71  VAL E O   1 
ATOM   8640  C  CB  . VAL E  1 45  ? 24.280  31.176  -44.395  1.00 45.72  ? 71  VAL E CB  1 
ATOM   8641  C  CG1 . VAL E  1 45  ? 23.799  31.678  -43.046  1.00 43.18  ? 71  VAL E CG1 1 
ATOM   8642  C  CG2 . VAL E  1 45  ? 23.138  31.181  -45.390  1.00 51.51  ? 71  VAL E CG2 1 
ATOM   8643  N  N   . ARG E  1 46  ? 26.510  33.414  -43.231  1.00 48.61  ? 72  ARG E N   1 
ATOM   8644  C  CA  . ARG E  1 46  ? 27.385  33.719  -42.107  1.00 47.61  ? 72  ARG E CA  1 
ATOM   8645  C  C   . ARG E  1 46  ? 26.550  33.874  -40.842  1.00 46.19  ? 72  ARG E C   1 
ATOM   8646  O  O   . ARG E  1 46  ? 25.452  34.439  -40.880  1.00 46.03  ? 72  ARG E O   1 
ATOM   8647  C  CB  . ARG E  1 46  ? 28.196  34.992  -42.371  1.00 49.47  ? 72  ARG E CB  1 
ATOM   8648  C  CG  . ARG E  1 46  ? 29.146  35.372  -41.247  1.00 57.33  ? 72  ARG E CG  1 
ATOM   8649  C  CD  . ARG E  1 46  ? 30.099  36.486  -41.660  1.00 64.29  ? 72  ARG E CD  1 
ATOM   8650  N  NE  . ARG E  1 46  ? 31.291  35.979  -42.340  1.00 68.93  ? 72  ARG E NE  1 
ATOM   8651  C  CZ  . ARG E  1 46  ? 31.419  35.872  -43.660  1.00 77.11  ? 72  ARG E CZ  1 
ATOM   8652  N  NH1 . ARG E  1 46  ? 30.424  36.234  -44.461  1.00 70.37  ? 72  ARG E NH1 1 
ATOM   8653  N  NH2 . ARG E  1 46  ? 32.545  35.401  -44.183  1.00 72.69  ? 72  ARG E NH2 1 
ATOM   8654  N  N   . VAL E  1 47  ? 27.068  33.360  -39.724  1.00 42.89  ? 73  VAL E N   1 
ATOM   8655  C  CA  . VAL E  1 47  ? 26.365  33.343  -38.443  1.00 33.84  ? 73  VAL E CA  1 
ATOM   8656  C  C   . VAL E  1 47  ? 27.189  34.107  -37.416  1.00 33.54  ? 73  VAL E C   1 
ATOM   8657  O  O   . VAL E  1 47  ? 28.382  33.834  -37.241  1.00 32.76  ? 73  VAL E O   1 
ATOM   8658  C  CB  . VAL E  1 47  ? 26.097  31.906  -37.959  1.00 37.82  ? 73  VAL E CB  1 
ATOM   8659  C  CG1 . VAL E  1 47  ? 25.469  31.912  -36.567  1.00 29.88  ? 73  VAL E CG1 1 
ATOM   8660  C  CG2 . VAL E  1 47  ? 25.207  31.170  -38.950  1.00 43.30  ? 73  VAL E CG2 1 
ATOM   8661  N  N   . CYS E  1 48  ? 26.549  35.053  -36.733  1.00 34.18  ? 74  CYS E N   1 
ATOM   8662  C  CA  . CYS E  1 48  ? 27.178  35.867  -35.703  1.00 30.83  ? 74  CYS E CA  1 
ATOM   8663  C  C   . CYS E  1 48  ? 26.408  35.712  -34.400  1.00 31.56  ? 74  CYS E C   1 
ATOM   8664  O  O   . CYS E  1 48  ? 25.175  35.734  -34.390  1.00 37.55  ? 74  CYS E O   1 
ATOM   8665  C  CB  . CYS E  1 48  ? 27.221  37.344  -36.113  1.00 34.22  ? 74  CYS E CB  1 
ATOM   8666  S  SG  . CYS E  1 48  ? 27.868  38.507  -34.864  1.00 40.91  ? 74  CYS E SG  1 
ATOM   8667  N  N   . LEU E  1 49  ? 27.141  35.570  -33.303  1.00 29.36  ? 75  LEU E N   1 
ATOM   8668  C  CA  . LEU E  1 49  ? 26.554  35.319  -31.995  1.00 34.19  ? 75  LEU E CA  1 
ATOM   8669  C  C   . LEU E  1 49  ? 27.223  36.228  -30.975  1.00 33.49  ? 75  LEU E C   1 
ATOM   8670  O  O   . LEU E  1 49  ? 28.454  36.320  -30.936  1.00 32.63  ? 75  LEU E O   1 
ATOM   8671  C  CB  . LEU E  1 49  ? 26.725  33.846  -31.612  1.00 37.46  ? 75  LEU E CB  1 
ATOM   8672  C  CG  . LEU E  1 49  ? 25.821  33.247  -30.545  1.00 31.45  ? 75  LEU E CG  1 
ATOM   8673  C  CD1 . LEU E  1 49  ? 24.358  33.454  -30.893  1.00 32.77  ? 75  LEU E CD1 1 
ATOM   8674  C  CD2 . LEU E  1 49  ? 26.138  31.780  -30.431  1.00 29.60  ? 75  LEU E CD2 1 
ATOM   8675  N  N   . LYS E  1 50  ? 26.419  36.900  -30.157  1.00 29.77  ? 76  LYS E N   1 
ATOM   8676  C  CA  . LYS E  1 50  ? 26.946  37.876  -29.213  1.00 29.97  ? 76  LYS E CA  1 
ATOM   8677  C  C   . LYS E  1 50  ? 25.960  38.018  -28.061  1.00 29.33  ? 76  LYS E C   1 
ATOM   8678  O  O   . LYS E  1 50  ? 24.968  37.290  -27.979  1.00 36.39  ? 76  LYS E O   1 
ATOM   8679  C  CB  . LYS E  1 50  ? 27.226  39.212  -29.917  1.00 35.24  ? 76  LYS E CB  1 
ATOM   8680  C  CG  . LYS E  1 50  ? 26.015  39.869  -30.547  1.00 26.51  ? 76  LYS E CG  1 
ATOM   8681  C  CD  . LYS E  1 50  ? 26.425  41.096  -31.334  1.00 30.87  ? 76  LYS E CD  1 
ATOM   8682  C  CE  . LYS E  1 50  ? 25.212  41.888  -31.809  1.00 42.05  ? 76  LYS E CE  1 
ATOM   8683  N  NZ  . LYS E  1 50  ? 25.592  43.142  -32.522  1.00 35.98  ? 76  LYS E NZ  1 
ATOM   8684  N  N   . GLU E  1 51  ? 26.234  38.960  -27.165  1.00 31.23  ? 77  GLU E N   1 
ATOM   8685  C  CA  . GLU E  1 51  ? 25.428  39.118  -25.965  1.00 32.92  ? 77  GLU E CA  1 
ATOM   8686  C  C   . GLU E  1 51  ? 24.074  39.741  -26.291  1.00 33.74  ? 77  GLU E C   1 
ATOM   8687  O  O   . GLU E  1 51  ? 23.865  40.323  -27.360  1.00 38.47  ? 77  GLU E O   1 
ATOM   8688  C  CB  . GLU E  1 51  ? 26.157  39.977  -24.929  1.00 34.02  ? 77  GLU E CB  1 
ATOM   8689  C  CG  . GLU E  1 51  ? 26.348  41.439  -25.320  1.00 39.95  ? 77  GLU E CG  1 
ATOM   8690  C  CD  . GLU E  1 51  ? 27.422  41.640  -26.381  1.00 47.16  ? 77  GLU E CD  1 
ATOM   8691  O  OE1 . GLU E  1 51  ? 27.266  42.558  -27.221  1.00 42.70  ? 77  GLU E OE1 1 
ATOM   8692  O  OE2 . GLU E  1 51  ? 28.416  40.876  -26.380  1.00 39.45  ? 77  GLU E OE2 1 
ATOM   8693  N  N   . TYR E  1 52  ? 23.152  39.617  -25.338  1.00 36.85  ? 78  TYR E N   1 
ATOM   8694  C  CA  . TYR E  1 52  ? 21.790  40.097  -25.534  1.00 41.90  ? 78  TYR E CA  1 
ATOM   8695  C  C   . TYR E  1 52  ? 21.767  41.612  -25.695  1.00 44.08  ? 78  TYR E C   1 
ATOM   8696  O  O   . TYR E  1 52  ? 22.481  42.341  -25.001  1.00 46.41  ? 78  TYR E O   1 
ATOM   8697  C  CB  . TYR E  1 52  ? 20.904  39.681  -24.358  1.00 37.58  ? 78  TYR E CB  1 
ATOM   8698  C  CG  . TYR E  1 52  ? 19.451  40.089  -24.497  1.00 43.38  ? 78  TYR E CG  1 
ATOM   8699  C  CD1 . TYR E  1 52  ? 18.525  39.251  -25.111  1.00 44.30  ? 78  TYR E CD1 1 
ATOM   8700  C  CD2 . TYR E  1 52  ? 19.002  41.312  -24.009  1.00 48.40  ? 78  TYR E CD2 1 
ATOM   8701  C  CE1 . TYR E  1 52  ? 17.193  39.623  -25.238  1.00 40.87  ? 78  TYR E CE1 1 
ATOM   8702  C  CE2 . TYR E  1 52  ? 17.676  41.692  -24.133  1.00 48.00  ? 78  TYR E CE2 1 
ATOM   8703  C  CZ  . TYR E  1 52  ? 16.777  40.846  -24.746  1.00 45.04  ? 78  TYR E CZ  1 
ATOM   8704  O  OH  . TYR E  1 52  ? 15.461  41.231  -24.866  1.00 42.54  ? 78  TYR E OH  1 
ATOM   8705  N  N   . GLN E  1 53  ? 20.932  42.081  -26.618  1.00 44.26  ? 79  GLN E N   1 
ATOM   8706  C  CA  . GLN E  1 53  ? 20.783  43.500  -26.901  1.00 45.92  ? 79  GLN E CA  1 
ATOM   8707  C  C   . GLN E  1 53  ? 19.305  43.857  -26.907  1.00 52.70  ? 79  GLN E C   1 
ATOM   8708  O  O   . GLN E  1 53  ? 18.504  43.184  -27.563  1.00 52.48  ? 79  GLN E O   1 
ATOM   8709  C  CB  . GLN E  1 53  ? 21.424  43.867  -28.244  1.00 41.91  ? 79  GLN E CB  1 
ATOM   8710  C  CG  . GLN E  1 53  ? 22.937  43.718  -28.274  1.00 49.82  ? 79  GLN E CG  1 
ATOM   8711  C  CD  . GLN E  1 53  ? 23.544  44.207  -29.579  1.00 54.49  ? 79  GLN E CD  1 
ATOM   8712  O  OE1 . GLN E  1 53  ? 22.842  44.373  -30.576  1.00 45.21  ? 79  GLN E OE1 1 
ATOM   8713  N  NE2 . GLN E  1 53  ? 24.853  44.450  -29.575  1.00 55.00  ? 79  GLN E NE2 1 
ATOM   8714  N  N   . ALA E  1 54  ? 18.945  44.907  -26.165  1.00 58.47  ? 80  ALA E N   1 
ATOM   8715  C  CA  . ALA E  1 54  ? 17.576  45.410  -26.212  1.00 56.18  ? 80  ALA E CA  1 
ATOM   8716  C  C   . ALA E  1 54  ? 17.221  45.876  -27.618  1.00 51.85  ? 80  ALA E C   1 
ATOM   8717  O  O   . ALA E  1 54  ? 16.195  45.475  -28.180  1.00 47.32  ? 80  ALA E O   1 
ATOM   8718  C  CB  . ALA E  1 54  ? 17.401  46.545  -25.204  1.00 61.31  ? 80  ALA E CB  1 
ATOM   8719  N  N   . LYS E  1 55  ? 18.065  46.725  -28.203  1.00 47.54  ? 81  LYS E N   1 
ATOM   8720  C  CA  . LYS E  1 55  ? 17.930  47.160  -29.589  1.00 54.53  ? 81  LYS E CA  1 
ATOM   8721  C  C   . LYS E  1 55  ? 19.120  46.603  -30.360  1.00 50.29  ? 81  LYS E C   1 
ATOM   8722  O  O   . LYS E  1 55  ? 20.266  46.997  -30.113  1.00 52.83  ? 81  LYS E O   1 
ATOM   8723  C  CB  . LYS E  1 55  ? 17.857  48.683  -29.695  1.00 54.42  ? 81  LYS E CB  1 
ATOM   8724  C  CG  . LYS E  1 55  ? 18.296  49.239  -31.044  1.00 62.40  ? 81  LYS E CG  1 
ATOM   8725  C  CD  . LYS E  1 55  ? 17.792  50.656  -31.280  1.00 66.24  ? 81  LYS E CD  1 
ATOM   8726  C  CE  . LYS E  1 55  ? 18.488  51.282  -32.488  1.00 65.17  ? 81  LYS E CE  1 
ATOM   8727  N  NZ  . LYS E  1 55  ? 17.598  51.392  -33.689  1.00 52.33  ? 81  LYS E NZ  1 
ATOM   8728  N  N   . VAL E  1 56  ? 18.848  45.682  -31.283  1.00 45.55  ? 82  VAL E N   1 
ATOM   8729  C  CA  . VAL E  1 56  ? 19.918  44.974  -31.974  1.00 48.43  ? 82  VAL E CA  1 
ATOM   8730  C  C   . VAL E  1 56  ? 20.620  45.921  -32.935  1.00 48.35  ? 82  VAL E C   1 
ATOM   8731  O  O   . VAL E  1 56  ? 19.976  46.697  -33.653  1.00 59.28  ? 82  VAL E O   1 
ATOM   8732  C  CB  . VAL E  1 56  ? 19.362  43.743  -32.705  1.00 43.62  ? 82  VAL E CB  1 
ATOM   8733  C  CG1 . VAL E  1 56  ? 20.434  43.112  -33.590  1.00 33.64  ? 82  VAL E CG1 1 
ATOM   8734  C  CG2 . VAL E  1 56  ? 18.834  42.734  -31.696  1.00 45.19  ? 82  VAL E CG2 1 
ATOM   8735  N  N   . THR E  1 57  ? 21.954  45.870  -32.941  1.00 47.34  ? 83  THR E N   1 
ATOM   8736  C  CA  . THR E  1 57  ? 22.754  46.595  -33.909  1.00 45.45  ? 83  THR E CA  1 
ATOM   8737  C  C   . THR E  1 57  ? 23.319  45.624  -34.936  1.00 45.28  ? 83  THR E C   1 
ATOM   8738  O  O   . THR E  1 57  ? 23.704  44.505  -34.578  1.00 43.47  ? 83  THR E O   1 
ATOM   8739  C  CB  . THR E  1 57  ? 23.905  47.353  -33.235  1.00 48.53  ? 83  THR E CB  1 
ATOM   8740  O  OG1 . THR E  1 57  ? 24.995  46.458  -32.985  1.00 52.21  ? 83  THR E OG1 1 
ATOM   8741  C  CG2 . THR E  1 57  ? 23.441  47.951  -31.913  1.00 45.98  ? 83  THR E CG2 1 
ATOM   8742  N  N   . PRO E  1 58  ? 23.370  46.008  -36.216  1.00 44.91  ? 84  PRO E N   1 
ATOM   8743  C  CA  . PRO E  1 58  ? 23.831  45.074  -37.254  1.00 47.46  ? 84  PRO E CA  1 
ATOM   8744  C  C   . PRO E  1 58  ? 25.336  44.858  -37.289  1.00 48.03  ? 84  PRO E C   1 
ATOM   8745  O  O   . PRO E  1 58  ? 25.788  43.900  -37.931  1.00 49.62  ? 84  PRO E O   1 
ATOM   8746  C  CB  . PRO E  1 58  ? 23.345  45.733  -38.549  1.00 46.93  ? 84  PRO E CB  1 
ATOM   8747  C  CG  . PRO E  1 58  ? 23.321  47.186  -38.228  1.00 47.51  ? 84  PRO E CG  1 
ATOM   8748  C  CD  . PRO E  1 58  ? 22.927  47.293  -36.780  1.00 41.21  ? 84  PRO E CD  1 
ATOM   8749  N  N   . THR E  1 59  ? 26.124  45.701  -36.636  1.00 46.16  ? 85  THR E N   1 
ATOM   8750  C  CA  . THR E  1 59  ? 27.570  45.537  -36.579  1.00 53.96  ? 85  THR E CA  1 
ATOM   8751  C  C   . THR E  1 59  ? 28.000  45.291  -35.136  1.00 50.37  ? 85  THR E C   1 
ATOM   8752  O  O   . THR E  1 59  ? 27.178  45.246  -34.218  1.00 51.50  ? 85  THR E O   1 
ATOM   8753  C  CB  . THR E  1 59  ? 28.279  46.762  -37.162  1.00 61.46  ? 85  THR E CB  1 
ATOM   8754  O  OG1 . THR E  1 59  ? 27.916  47.926  -36.411  1.00 58.41  ? 85  THR E OG1 1 
ATOM   8755  C  CG2 . THR E  1 59  ? 27.882  46.955  -38.617  1.00 51.66  ? 85  THR E CG2 1 
ATOM   8756  N  N   . GLY E  1 60  ? 29.307  45.131  -34.943  1.00 45.93  ? 86  GLY E N   1 
ATOM   8757  C  CA  . GLY E  1 60  ? 29.854  44.888  -33.628  1.00 44.64  ? 86  GLY E CA  1 
ATOM   8758  C  C   . GLY E  1 60  ? 30.485  43.516  -33.512  1.00 42.76  ? 86  GLY E C   1 
ATOM   8759  O  O   . GLY E  1 60  ? 30.306  42.648  -34.373  1.00 44.14  ? 86  GLY E O   1 
ATOM   8760  N  N   . PRO E  1 61  ? 31.245  43.293  -32.444  1.00 41.52  ? 87  PRO E N   1 
ATOM   8761  C  CA  . PRO E  1 61  ? 31.938  42.007  -32.300  1.00 45.00  ? 87  PRO E CA  1 
ATOM   8762  C  C   . PRO E  1 61  ? 30.969  40.881  -31.973  1.00 37.21  ? 87  PRO E C   1 
ATOM   8763  O  O   . PRO E  1 61  ? 30.071  41.029  -31.140  1.00 33.75  ? 87  PRO E O   1 
ATOM   8764  C  CB  . PRO E  1 61  ? 32.919  42.256  -31.144  1.00 37.74  ? 87  PRO E CB  1 
ATOM   8765  C  CG  . PRO E  1 61  ? 32.997  43.742  -31.000  1.00 36.52  ? 87  PRO E CG  1 
ATOM   8766  C  CD  . PRO E  1 61  ? 31.647  44.250  -31.402  1.00 40.22  ? 87  PRO E CD  1 
ATOM   8767  N  N   . CYS E  1 62  ? 31.162  39.746  -32.642  1.00 27.52  ? 88  CYS E N   1 
ATOM   8768  C  CA  . CYS E  1 62  ? 30.419  38.527  -32.325  1.00 34.52  ? 88  CYS E CA  1 
ATOM   8769  C  C   . CYS E  1 62  ? 31.048  37.918  -31.077  1.00 36.27  ? 88  CYS E C   1 
ATOM   8770  O  O   . CYS E  1 62  ? 31.926  37.056  -31.149  1.00 33.12  ? 88  CYS E O   1 
ATOM   8771  C  CB  . CYS E  1 62  ? 30.430  37.568  -33.506  1.00 34.06  ? 88  CYS E CB  1 
ATOM   8772  S  SG  . CYS E  1 62  ? 29.889  38.362  -35.037  1.00 46.15  ? 88  CYS E SG  1 
ATOM   8773  N  N   . SER E  1 63  ? 30.575  38.375  -29.913  1.00 33.29  ? 89  SER E N   1 
ATOM   8774  C  CA  . SER E  1 63  ? 31.273  38.112  -28.658  1.00 34.97  ? 89  SER E CA  1 
ATOM   8775  C  C   . SER E  1 63  ? 31.315  36.629  -28.320  1.00 39.26  ? 89  SER E C   1 
ATOM   8776  O  O   . SER E  1 63  ? 32.283  36.158  -27.711  1.00 44.23  ? 89  SER E O   1 
ATOM   8777  C  CB  . SER E  1 63  ? 30.609  38.885  -27.518  1.00 32.08  ? 89  SER E CB  1 
ATOM   8778  O  OG  . SER E  1 63  ? 30.488  40.262  -27.822  1.00 25.01  ? 89  SER E OG  1 
ATOM   8779  N  N   . TYR E  1 64  ? 30.285  35.879  -28.697  1.00 35.52  ? 90  TYR E N   1 
ATOM   8780  C  CA  . TYR E  1 64  ? 30.206  34.478  -28.314  1.00 31.27  ? 90  TYR E CA  1 
ATOM   8781  C  C   . TYR E  1 64  ? 30.739  33.535  -29.383  1.00 35.31  ? 90  TYR E C   1 
ATOM   8782  O  O   . TYR E  1 64  ? 30.988  32.363  -29.082  1.00 48.11  ? 90  TYR E O   1 
ATOM   8783  C  CB  . TYR E  1 64  ? 28.760  34.108  -27.974  1.00 31.83  ? 90  TYR E CB  1 
ATOM   8784  C  CG  . TYR E  1 64  ? 28.167  34.886  -26.813  1.00 30.17  ? 90  TYR E CG  1 
ATOM   8785  C  CD1 . TYR E  1 64  ? 28.980  35.531  -25.883  1.00 31.35  ? 90  TYR E CD1 1 
ATOM   8786  C  CD2 . TYR E  1 64  ? 26.791  34.972  -26.648  1.00 28.07  ? 90  TYR E CD2 1 
ATOM   8787  C  CE1 . TYR E  1 64  ? 28.434  36.239  -24.822  1.00 28.63  ? 90  TYR E CE1 1 
ATOM   8788  C  CE2 . TYR E  1 64  ? 26.237  35.677  -25.593  1.00 32.34  ? 90  TYR E CE2 1 
ATOM   8789  C  CZ  . TYR E  1 64  ? 27.059  36.308  -24.684  1.00 33.37  ? 90  TYR E CZ  1 
ATOM   8790  O  OH  . TYR E  1 64  ? 26.493  37.004  -23.638  1.00 28.13  ? 90  TYR E OH  1 
ATOM   8791  N  N   . GLY E  1 65  ? 30.930  34.012  -30.612  1.00 28.61  ? 91  GLY E N   1 
ATOM   8792  C  CA  . GLY E  1 65  ? 31.476  33.179  -31.667  1.00 29.35  ? 91  GLY E CA  1 
ATOM   8793  C  C   . GLY E  1 65  ? 30.849  33.435  -33.022  1.00 30.63  ? 91  GLY E C   1 
ATOM   8794  O  O   . GLY E  1 65  ? 29.900  34.217  -33.130  1.00 31.32  ? 91  GLY E O   1 
ATOM   8795  N  N   . HIS E  1 66  ? 31.364  32.782  -34.064  1.00 31.14  ? 92  HIS E N   1 
ATOM   8796  C  CA  . HIS E  1 66  ? 30.841  32.971  -35.411  1.00 33.14  ? 92  HIS E CA  1 
ATOM   8797  C  C   . HIS E  1 66  ? 31.220  31.778  -36.277  1.00 33.50  ? 92  HIS E C   1 
ATOM   8798  O  O   . HIS E  1 66  ? 32.152  31.031  -35.967  1.00 41.95  ? 92  HIS E O   1 
ATOM   8799  C  CB  . HIS E  1 66  ? 31.351  34.279  -36.031  1.00 39.34  ? 92  HIS E CB  1 
ATOM   8800  C  CG  . HIS E  1 66  ? 32.843  34.415  -36.026  1.00 42.21  ? 92  HIS E CG  1 
ATOM   8801  N  ND1 . HIS E  1 66  ? 33.645  33.870  -37.005  1.00 39.59  ? 92  HIS E ND1 1 
ATOM   8802  C  CD2 . HIS E  1 66  ? 33.678  35.033  -35.157  1.00 44.62  ? 92  HIS E CD2 1 
ATOM   8803  C  CE1 . HIS E  1 66  ? 34.909  34.148  -36.743  1.00 44.31  ? 92  HIS E CE1 1 
ATOM   8804  N  NE2 . HIS E  1 66  ? 34.957  34.852  -35.626  1.00 47.83  ? 92  HIS E NE2 1 
ATOM   8805  N  N   . GLY E  1 67  ? 30.479  31.609  -37.369  1.00 33.41  ? 93  GLY E N   1 
ATOM   8806  C  CA  . GLY E  1 67  ? 30.725  30.527  -38.305  1.00 36.22  ? 93  GLY E CA  1 
ATOM   8807  C  C   . GLY E  1 67  ? 30.145  30.863  -39.660  1.00 43.01  ? 93  GLY E C   1 
ATOM   8808  O  O   . GLY E  1 67  ? 29.334  31.780  -39.802  1.00 43.24  ? 93  GLY E O   1 
ATOM   8809  N  N   . ALA E  1 68  ? 30.575  30.103  -40.668  1.00 48.11  ? 94  ALA E N   1 
ATOM   8810  C  CA  . ALA E  1 68  ? 30.161  30.358  -42.041  1.00 48.96  ? 94  ALA E CA  1 
ATOM   8811  C  C   . ALA E  1 68  ? 29.918  29.047  -42.776  1.00 53.93  ? 94  ALA E C   1 
ATOM   8812  O  O   . ALA E  1 68  ? 30.175  27.953  -42.267  1.00 60.61  ? 94  ALA E O   1 
ATOM   8813  C  CB  . ALA E  1 68  ? 31.193  31.197  -42.803  1.00 44.97  ? 94  ALA E CB  1 
ATOM   8814  N  N   . THR E  1 69  ? 29.462  29.189  -44.013  1.00 61.73  ? 95  THR E N   1 
ATOM   8815  C  CA  . THR E  1 69  ? 28.860  28.193  -44.871  1.00 59.30  ? 95  THR E CA  1 
ATOM   8816  C  C   . THR E  1 69  ? 29.571  28.165  -46.225  1.00 64.32  ? 95  THR E C   1 
ATOM   8817  O  O   . THR E  1 69  ? 30.013  29.212  -46.709  1.00 69.77  ? 95  THR E O   1 
ATOM   8818  C  CB  . THR E  1 69  ? 27.375  28.576  -45.015  1.00 57.94  ? 95  THR E CB  1 
ATOM   8819  O  OG1 . THR E  1 69  ? 26.653  28.203  -43.835  1.00 66.91  ? 95  THR E OG1 1 
ATOM   8820  C  CG2 . THR E  1 69  ? 26.714  27.931  -46.142  1.00 57.45  ? 95  THR E CG2 1 
ATOM   8821  N  N   . PRO E  1 70  ? 29.803  26.986  -46.802  1.00 61.59  ? 96  PRO E N   1 
ATOM   8822  C  CA  . PRO E  1 70  ? 30.146  26.915  -48.234  1.00 72.44  ? 96  PRO E CA  1 
ATOM   8823  C  C   . PRO E  1 70  ? 28.930  27.266  -49.081  1.00 68.82  ? 96  PRO E C   1 
ATOM   8824  O  O   . PRO E  1 70  ? 27.815  27.370  -48.587  1.00 68.96  ? 96  PRO E O   1 
ATOM   8825  C  CB  . PRO E  1 70  ? 30.562  25.456  -48.447  1.00 76.99  ? 96  PRO E CB  1 
ATOM   8826  C  CG  . PRO E  1 70  ? 30.698  24.846  -47.090  1.00 71.36  ? 96  PRO E CG  1 
ATOM   8827  C  CD  . PRO E  1 70  ? 30.340  25.851  -46.035  1.00 58.68  ? 96  PRO E CD  1 
ATOM   8828  N  N   . VAL E  1 71  ? 29.113  27.442  -50.383  1.00 65.32  ? 97  VAL E N   1 
ATOM   8829  C  CA  . VAL E  1 71  ? 27.960  27.884  -51.156  1.00 73.54  ? 97  VAL E CA  1 
ATOM   8830  C  C   . VAL E  1 71  ? 26.913  26.779  -51.196  1.00 70.56  ? 97  VAL E C   1 
ATOM   8831  O  O   . VAL E  1 71  ? 27.217  25.619  -51.507  1.00 75.51  ? 97  VAL E O   1 
ATOM   8832  C  CB  . VAL E  1 71  ? 28.373  28.325  -52.561  1.00 74.38  ? 97  VAL E CB  1 
ATOM   8833  C  CG1 . VAL E  1 71  ? 27.166  28.849  -53.260  1.00 69.65  ? 97  VAL E CG1 1 
ATOM   8834  C  CG2 . VAL E  1 71  ? 29.432  29.409  -52.485  1.00 76.40  ? 97  VAL E CG2 1 
ATOM   8835  N  N   . LEU E  1 72  ? 25.670  27.136  -50.864  1.00 71.07  ? 98  LEU E N   1 
ATOM   8836  C  CA  . LEU E  1 72  ? 24.577  26.175  -50.734  1.00 72.65  ? 98  LEU E CA  1 
ATOM   8837  C  C   . LEU E  1 72  ? 23.696  26.072  -51.971  1.00 78.56  ? 98  LEU E C   1 
ATOM   8838  O  O   . LEU E  1 72  ? 23.345  24.960  -52.376  1.00 76.97  ? 98  LEU E O   1 
ATOM   8839  C  CB  . LEU E  1 72  ? 23.694  26.520  -49.530  1.00 70.14  ? 98  LEU E CB  1 
ATOM   8840  C  CG  . LEU E  1 72  ? 24.399  26.567  -48.179  1.00 67.58  ? 98  LEU E CG  1 
ATOM   8841  C  CD1 . LEU E  1 72  ? 23.459  27.045  -47.077  1.00 63.64  ? 98  LEU E CD1 1 
ATOM   8842  C  CD2 . LEU E  1 72  ? 25.016  25.216  -47.822  1.00 63.83  ? 98  LEU E CD2 1 
ATOM   8843  N  N   . GLY E  1 73  ? 23.310  27.195  -52.576  1.00 84.36  ? 99  GLY E N   1 
ATOM   8844  C  CA  . GLY E  1 73  ? 22.434  27.145  -53.733  1.00 75.77  ? 99  GLY E CA  1 
ATOM   8845  C  C   . GLY E  1 73  ? 22.297  28.463  -54.468  1.00 79.69  ? 99  GLY E C   1 
ATOM   8846  O  O   . GLY E  1 73  ? 23.265  29.220  -54.573  1.00 76.68  ? 99  GLY E O   1 
ATOM   8847  N  N   . GLY E  1 74  ? 21.099  28.751  -54.980  1.00 80.35  ? 100 GLY E N   1 
ATOM   8848  C  CA  . GLY E  1 74  ? 20.866  29.978  -55.721  1.00 78.97  ? 100 GLY E CA  1 
ATOM   8849  C  C   . GLY E  1 74  ? 19.779  30.857  -55.133  1.00 75.77  ? 100 GLY E C   1 
ATOM   8850  O  O   . GLY E  1 74  ? 19.865  31.262  -53.968  1.00 75.63  ? 100 GLY E O   1 
ATOM   8851  N  N   . ASN E  1 75  ? 18.760  31.168  -55.939  1.00 76.31  ? 101 ASN E N   1 
ATOM   8852  C  CA  . ASN E  1 75  ? 17.629  31.961  -55.462  1.00 80.19  ? 101 ASN E CA  1 
ATOM   8853  C  C   . ASN E  1 75  ? 16.994  31.322  -54.237  1.00 71.44  ? 101 ASN E C   1 
ATOM   8854  O  O   . ASN E  1 75  ? 16.993  31.894  -53.141  1.00 72.35  ? 101 ASN E O   1 
ATOM   8855  C  CB  . ASN E  1 75  ? 16.579  32.106  -56.568  1.00 86.03  ? 101 ASN E CB  1 
ATOM   8856  C  CG  . ASN E  1 75  ? 17.025  33.018  -57.692  1.00 85.54  ? 101 ASN E CG  1 
ATOM   8857  O  OD1 . ASN E  1 75  ? 16.252  33.308  -58.609  1.00 81.71  ? 101 ASN E OD1 1 
ATOM   8858  N  ND2 . ASN E  1 75  ? 18.266  33.491  -57.620  1.00 88.34  ? 101 ASN E ND2 1 
ATOM   8859  N  N   . SER E  1 76  ? 16.433  30.136  -54.419  1.00 64.76  ? 102 SER E N   1 
ATOM   8860  C  CA  . SER E  1 76  ? 15.770  29.400  -53.361  1.00 66.68  ? 102 SER E CA  1 
ATOM   8861  C  C   . SER E  1 76  ? 16.294  27.973  -53.372  1.00 63.52  ? 102 SER E C   1 
ATOM   8862  O  O   . SER E  1 76  ? 16.493  27.386  -54.440  1.00 68.94  ? 102 SER E O   1 
ATOM   8863  C  CB  . SER E  1 76  ? 14.248  29.423  -53.553  1.00 74.21  ? 102 SER E CB  1 
ATOM   8864  O  OG  . SER E  1 76  ? 13.786  30.752  -53.760  1.00 63.91  ? 102 SER E OG  1 
ATOM   8865  N  N   . PHE E  1 77  ? 16.545  27.427  -52.186  1.00 59.10  ? 103 PHE E N   1 
ATOM   8866  C  CA  . PHE E  1 77  ? 17.007  26.053  -52.072  1.00 57.21  ? 103 PHE E CA  1 
ATOM   8867  C  C   . PHE E  1 77  ? 16.465  25.457  -50.786  1.00 55.72  ? 103 PHE E C   1 
ATOM   8868  O  O   . PHE E  1 77  ? 16.374  26.141  -49.764  1.00 58.65  ? 103 PHE E O   1 
ATOM   8869  C  CB  . PHE E  1 77  ? 18.540  25.956  -52.105  1.00 62.33  ? 103 PHE E CB  1 
ATOM   8870  C  CG  . PHE E  1 77  ? 19.233  26.829  -51.098  1.00 68.98  ? 103 PHE E CG  1 
ATOM   8871  C  CD1 . PHE E  1 77  ? 19.491  26.369  -49.818  1.00 66.20  ? 103 PHE E CD1 1 
ATOM   8872  C  CD2 . PHE E  1 77  ? 19.646  28.104  -51.438  1.00 72.00  ? 103 PHE E CD2 1 
ATOM   8873  C  CE1 . PHE E  1 77  ? 20.133  27.167  -48.890  1.00 62.31  ? 103 PHE E CE1 1 
ATOM   8874  C  CE2 . PHE E  1 77  ? 20.292  28.901  -50.519  1.00 68.22  ? 103 PHE E CE2 1 
ATOM   8875  C  CZ  . PHE E  1 77  ? 20.532  28.435  -49.242  1.00 65.24  ? 103 PHE E CZ  1 
ATOM   8876  N  N   . TYR E  1 78  ? 16.096  24.183  -50.851  1.00 58.87  ? 104 TYR E N   1 
ATOM   8877  C  CA  . TYR E  1 78  ? 15.618  23.432  -49.703  1.00 55.29  ? 104 TYR E CA  1 
ATOM   8878  C  C   . TYR E  1 78  ? 16.590  22.300  -49.408  1.00 52.14  ? 104 TYR E C   1 
ATOM   8879  O  O   . TYR E  1 78  ? 17.071  21.627  -50.325  1.00 54.51  ? 104 TYR E O   1 
ATOM   8880  C  CB  . TYR E  1 78  ? 14.214  22.880  -49.953  1.00 50.02  ? 104 TYR E CB  1 
ATOM   8881  C  CG  . TYR E  1 78  ? 13.762  21.875  -48.924  1.00 50.24  ? 104 TYR E CG  1 
ATOM   8882  C  CD1 . TYR E  1 78  ? 13.293  22.285  -47.685  1.00 50.01  ? 104 TYR E CD1 1 
ATOM   8883  C  CD2 . TYR E  1 78  ? 13.800  20.513  -49.194  1.00 45.66  ? 104 TYR E CD2 1 
ATOM   8884  C  CE1 . TYR E  1 78  ? 12.877  21.368  -46.745  1.00 47.38  ? 104 TYR E CE1 1 
ATOM   8885  C  CE2 . TYR E  1 78  ? 13.389  19.592  -48.263  1.00 44.80  ? 104 TYR E CE2 1 
ATOM   8886  C  CZ  . TYR E  1 78  ? 12.927  20.023  -47.041  1.00 45.10  ? 104 TYR E CZ  1 
ATOM   8887  O  OH  . TYR E  1 78  ? 12.516  19.101  -46.110  1.00 51.81  ? 104 TYR E OH  1 
ATOM   8888  N  N   . LEU E  1 79  ? 16.886  22.098  -48.127  1.00 51.07  ? 105 LEU E N   1 
ATOM   8889  C  CA  . LEU E  1 79  ? 17.862  21.099  -47.720  1.00 49.09  ? 105 LEU E CA  1 
ATOM   8890  C  C   . LEU E  1 79  ? 17.156  19.981  -46.976  1.00 56.20  ? 105 LEU E C   1 
ATOM   8891  O  O   . LEU E  1 79  ? 16.526  20.244  -45.940  1.00 57.71  ? 105 LEU E O   1 
ATOM   8892  C  CB  . LEU E  1 79  ? 18.949  21.725  -46.847  1.00 42.79  ? 105 LEU E CB  1 
ATOM   8893  C  CG  . LEU E  1 79  ? 19.500  23.096  -47.284  1.00 56.57  ? 105 LEU E CG  1 
ATOM   8894  C  CD1 . LEU E  1 79  ? 20.728  23.489  -46.464  1.00 49.84  ? 105 LEU E CD1 1 
ATOM   8895  C  CD2 . LEU E  1 79  ? 19.832  23.123  -48.780  1.00 66.93  ? 105 LEU E CD2 1 
ATOM   8896  N  N   . PRO E  1 80  ? 17.214  18.743  -47.464  1.00 61.50  ? 106 PRO E N   1 
ATOM   8897  C  CA  . PRO E  1 80  ? 16.483  17.646  -46.817  1.00 60.54  ? 106 PRO E CA  1 
ATOM   8898  C  C   . PRO E  1 80  ? 16.905  17.480  -45.370  1.00 58.82  ? 106 PRO E C   1 
ATOM   8899  O  O   . PRO E  1 80  ? 18.084  17.658  -45.030  1.00 57.96  ? 106 PRO E O   1 
ATOM   8900  C  CB  . PRO E  1 80  ? 16.870  16.419  -47.657  1.00 59.54  ? 106 PRO E CB  1 
ATOM   8901  C  CG  . PRO E  1 80  ? 17.234  16.978  -48.992  1.00 56.00  ? 106 PRO E CG  1 
ATOM   8902  C  CD  . PRO E  1 80  ? 17.880  18.307  -48.704  1.00 60.52  ? 106 PRO E CD  1 
ATOM   8903  N  N   . PRO E  1 81  ? 15.963  17.148  -44.483  1.00 63.32  ? 107 PRO E N   1 
ATOM   8904  C  CA  . PRO E  1 81  ? 16.292  17.041  -43.058  1.00 66.20  ? 107 PRO E CA  1 
ATOM   8905  C  C   . PRO E  1 81  ? 16.809  15.661  -42.678  1.00 69.24  ? 107 PRO E C   1 
ATOM   8906  O  O   . PRO E  1 81  ? 17.165  14.858  -43.547  1.00 61.12  ? 107 PRO E O   1 
ATOM   8907  C  CB  . PRO E  1 81  ? 14.951  17.341  -42.381  1.00 65.14  ? 107 PRO E CB  1 
ATOM   8908  C  CG  . PRO E  1 81  ? 13.945  16.765  -43.341  1.00 57.85  ? 107 PRO E CG  1 
ATOM   8909  C  CD  . PRO E  1 81  ? 14.525  16.937  -44.734  1.00 60.80  ? 107 PRO E CD  1 
ATOM   8910  N  N   . ALA E  1 82  ? 16.847  15.380  -41.373  1.00 69.59  ? 108 ALA E N   1 
ATOM   8911  C  CA  . ALA E  1 82  ? 17.258  14.077  -40.865  1.00 56.03  ? 108 ALA E CA  1 
ATOM   8912  C  C   . ALA E  1 82  ? 16.176  13.495  -39.961  1.00 63.44  ? 108 ALA E C   1 
ATOM   8913  O  O   . ALA E  1 82  ? 14.988  13.772  -40.154  1.00 66.37  ? 108 ALA E O   1 
ATOM   8914  C  CB  . ALA E  1 82  ? 18.585  14.191  -40.113  1.00 58.13  ? 108 ALA E CB  1 
ATOM   8915  N  N   . GLY E  1 83  ? 16.574  12.695  -38.974  1.00 74.18  ? 109 GLY E N   1 
ATOM   8916  C  CA  . GLY E  1 83  ? 15.631  12.086  -38.051  1.00 64.51  ? 109 GLY E CA  1 
ATOM   8917  C  C   . GLY E  1 83  ? 16.099  10.753  -37.495  1.00 64.95  ? 109 GLY E C   1 
ATOM   8918  O  O   . GLY E  1 83  ? 17.298  10.530  -37.312  1.00 67.65  ? 109 GLY E O   1 
ATOM   8919  N  N   . GLN E  1 99  ? 29.777  21.290  -40.512  1.00 76.62  ? 125 GLN E N   1 
ATOM   8920  C  CA  . GLN E  1 99  ? 30.421  20.254  -41.312  1.00 86.12  ? 125 GLN E CA  1 
ATOM   8921  C  C   . GLN E  1 99  ? 29.418  19.600  -42.254  1.00 82.73  ? 125 GLN E C   1 
ATOM   8922  O  O   . GLN E  1 99  ? 29.784  19.028  -43.282  1.00 79.30  ? 125 GLN E O   1 
ATOM   8923  C  CB  . GLN E  1 99  ? 31.061  19.197  -40.407  1.00 91.03  ? 125 GLN E CB  1 
ATOM   8924  C  CG  . GLN E  1 99  ? 31.977  19.761  -39.327  1.00 100.68 ? 125 GLN E CG  1 
ATOM   8925  C  CD  . GLN E  1 99  ? 33.132  20.569  -39.893  1.00 102.57 ? 125 GLN E CD  1 
ATOM   8926  O  OE1 . GLN E  1 99  ? 32.992  21.759  -40.181  1.00 101.50 ? 125 GLN E OE1 1 
ATOM   8927  N  NE2 . GLN E  1 99  ? 34.283  19.925  -40.053  1.00 97.88  ? 125 GLN E NE2 1 
ATOM   8928  N  N   . ASP E  1 100 ? 28.148  19.695  -41.887  1.00 78.39  ? 126 ASP E N   1 
ATOM   8929  C  CA  . ASP E  1 100 ? 27.043  19.081  -42.610  1.00 75.07  ? 126 ASP E CA  1 
ATOM   8930  C  C   . ASP E  1 100 ? 26.481  20.113  -43.587  1.00 68.20  ? 126 ASP E C   1 
ATOM   8931  O  O   . ASP E  1 100 ? 27.005  21.234  -43.630  1.00 69.92  ? 126 ASP E O   1 
ATOM   8932  C  CB  . ASP E  1 100 ? 26.016  18.567  -41.596  1.00 74.10  ? 126 ASP E CB  1 
ATOM   8933  C  CG  . ASP E  1 100 ? 26.571  17.447  -40.732  1.00 80.69  ? 126 ASP E CG  1 
ATOM   8934  O  OD1 . ASP E  1 100 ? 25.785  16.821  -39.990  1.00 83.28  ? 126 ASP E OD1 1 
ATOM   8935  O  OD2 . ASP E  1 100 ? 27.793  17.189  -40.802  1.00 84.45  ? 126 ASP E OD2 1 
ATOM   8936  N  N   . PRO E  1 101 ? 25.445  19.788  -44.418  1.00 66.42  ? 127 PRO E N   1 
ATOM   8937  C  CA  . PRO E  1 101 ? 25.021  20.737  -45.464  1.00 66.92  ? 127 PRO E CA  1 
ATOM   8938  C  C   . PRO E  1 101 ? 24.839  22.172  -44.990  1.00 62.97  ? 127 PRO E C   1 
ATOM   8939  O  O   . PRO E  1 101 ? 25.609  23.058  -45.373  1.00 68.45  ? 127 PRO E O   1 
ATOM   8940  C  CB  . PRO E  1 101 ? 23.689  20.149  -45.943  1.00 68.02  ? 127 PRO E CB  1 
ATOM   8941  C  CG  . PRO E  1 101 ? 23.842  18.701  -45.745  1.00 64.32  ? 127 PRO E CG  1 
ATOM   8942  C  CD  . PRO E  1 101 ? 24.693  18.520  -44.517  1.00 62.61  ? 127 PRO E CD  1 
ATOM   8943  N  N   . GLY E  1 102 ? 23.831  22.416  -44.160  1.00 64.09  ? 128 GLY E N   1 
ATOM   8944  C  CA  . GLY E  1 102 ? 23.586  23.758  -43.674  1.00 55.28  ? 128 GLY E CA  1 
ATOM   8945  C  C   . GLY E  1 102 ? 23.684  23.856  -42.170  1.00 43.88  ? 128 GLY E C   1 
ATOM   8946  O  O   . GLY E  1 102 ? 22.912  24.578  -41.535  1.00 42.56  ? 128 GLY E O   1 
ATOM   8947  N  N   . LEU E  1 103 ? 24.636  23.131  -41.592  1.00 51.41  ? 129 LEU E N   1 
ATOM   8948  C  CA  . LEU E  1 103 ? 24.834  23.073  -40.152  1.00 45.51  ? 129 LEU E CA  1 
ATOM   8949  C  C   . LEU E  1 103 ? 26.073  23.872  -39.780  1.00 42.33  ? 129 LEU E C   1 
ATOM   8950  O  O   . LEU E  1 103 ? 27.139  23.677  -40.372  1.00 45.88  ? 129 LEU E O   1 
ATOM   8951  C  CB  . LEU E  1 103 ? 24.984  21.626  -39.684  1.00 44.79  ? 129 LEU E CB  1 
ATOM   8952  C  CG  . LEU E  1 103 ? 25.370  21.478  -38.219  1.00 42.73  ? 129 LEU E CG  1 
ATOM   8953  C  CD1 . LEU E  1 103 ? 24.213  22.003  -37.437  1.00 43.75  ? 129 LEU E CD1 1 
ATOM   8954  C  CD2 . LEU E  1 103 ? 25.654  20.037  -37.862  1.00 41.10  ? 129 LEU E CD2 1 
ATOM   8955  N  N   . VAL E  1 104 ? 25.932  24.762  -38.800  1.00 40.23  ? 130 VAL E N   1 
ATOM   8956  C  CA  . VAL E  1 104 ? 27.030  25.573  -38.286  1.00 41.28  ? 130 VAL E CA  1 
ATOM   8957  C  C   . VAL E  1 104 ? 27.142  25.324  -36.788  1.00 38.76  ? 130 VAL E C   1 
ATOM   8958  O  O   . VAL E  1 104 ? 26.133  25.346  -36.073  1.00 36.59  ? 130 VAL E O   1 
ATOM   8959  C  CB  . VAL E  1 104 ? 26.817  27.070  -38.583  1.00 39.00  ? 130 VAL E CB  1 
ATOM   8960  C  CG1 . VAL E  1 104 ? 27.894  27.910  -37.914  1.00 35.87  ? 130 VAL E CG1 1 
ATOM   8961  C  CG2 . VAL E  1 104 ? 26.802  27.309  -40.086  1.00 35.78  ? 130 VAL E CG2 1 
ATOM   8962  N  N   . VAL E  1 105 ? 28.364  25.081  -36.318  1.00 39.90  ? 131 VAL E N   1 
ATOM   8963  C  CA  . VAL E  1 105 ? 28.632  24.757  -34.921  1.00 37.19  ? 131 VAL E CA  1 
ATOM   8964  C  C   . VAL E  1 105 ? 29.562  25.815  -34.347  1.00 37.69  ? 131 VAL E C   1 
ATOM   8965  O  O   . VAL E  1 105 ? 30.609  26.113  -34.934  1.00 38.41  ? 131 VAL E O   1 
ATOM   8966  C  CB  . VAL E  1 105 ? 29.244  23.352  -34.769  1.00 36.74  ? 131 VAL E CB  1 
ATOM   8967  C  CG1 . VAL E  1 105 ? 29.437  23.013  -33.297  1.00 43.51  ? 131 VAL E CG1 1 
ATOM   8968  C  CG2 . VAL E  1 105 ? 28.369  22.308  -35.452  1.00 37.16  ? 131 VAL E CG2 1 
ATOM   8969  N  N   . ILE E  1 106 ? 29.184  26.373  -33.201  1.00 39.20  ? 132 ILE E N   1 
ATOM   8970  C  CA  . ILE E  1 106 ? 29.970  27.411  -32.539  1.00 37.09  ? 132 ILE E CA  1 
ATOM   8971  C  C   . ILE E  1 106 ? 30.266  26.967  -31.112  1.00 31.51  ? 132 ILE E C   1 
ATOM   8972  O  O   . ILE E  1 106 ? 29.393  27.082  -30.242  1.00 28.72  ? 132 ILE E O   1 
ATOM   8973  C  CB  . ILE E  1 106 ? 29.237  28.763  -32.557  1.00 35.46  ? 132 ILE E CB  1 
ATOM   8974  C  CG1 . ILE E  1 106 ? 28.989  29.221  -33.992  1.00 28.89  ? 132 ILE E CG1 1 
ATOM   8975  C  CG2 . ILE E  1 106 ? 30.023  29.824  -31.795  1.00 29.35  ? 132 ILE E CG2 1 
ATOM   8976  C  CD1 . ILE E  1 106 ? 28.253  30.529  -34.077  1.00 31.11  ? 132 ILE E CD1 1 
ATOM   8977  N  N   . PRO E  1 107 ? 31.461  26.456  -30.829  1.00 36.58  ? 133 PRO E N   1 
ATOM   8978  C  CA  . PRO E  1 107 ? 31.807  26.077  -29.456  1.00 36.21  ? 133 PRO E CA  1 
ATOM   8979  C  C   . PRO E  1 107 ? 32.107  27.279  -28.573  1.00 31.90  ? 133 PRO E C   1 
ATOM   8980  O  O   . PRO E  1 107 ? 32.416  28.374  -29.042  1.00 32.40  ? 133 PRO E O   1 
ATOM   8981  C  CB  . PRO E  1 107 ? 33.045  25.189  -29.630  1.00 34.21  ? 133 PRO E CB  1 
ATOM   8982  C  CG  . PRO E  1 107 ? 33.628  25.600  -30.927  1.00 36.59  ? 133 PRO E CG  1 
ATOM   8983  C  CD  . PRO E  1 107 ? 32.481  26.028  -31.801  1.00 34.65  ? 133 PRO E CD  1 
ATOM   8984  N  N   . PHE E  1 108 ? 31.985  27.056  -27.265  1.00 42.24  ? 134 PHE E N   1 
ATOM   8985  C  CA  . PHE E  1 108 ? 32.332  28.076  -26.284  1.00 48.46  ? 134 PHE E CA  1 
ATOM   8986  C  C   . PHE E  1 108 ? 32.908  27.425  -25.032  1.00 47.26  ? 134 PHE E C   1 
ATOM   8987  O  O   . PHE E  1 108 ? 32.613  26.268  -24.719  1.00 42.60  ? 134 PHE E O   1 
ATOM   8988  C  CB  . PHE E  1 108 ? 31.130  28.964  -25.916  1.00 44.62  ? 134 PHE E CB  1 
ATOM   8989  C  CG  . PHE E  1 108 ? 29.905  28.210  -25.458  1.00 42.55  ? 134 PHE E CG  1 
ATOM   8990  C  CD1 . PHE E  1 108 ? 29.868  27.584  -24.223  1.00 45.51  ? 134 PHE E CD1 1 
ATOM   8991  C  CD2 . PHE E  1 108 ? 28.762  28.187  -26.239  1.00 42.21  ? 134 PHE E CD2 1 
ATOM   8992  C  CE1 . PHE E  1 108 ? 28.731  26.909  -23.798  1.00 49.56  ? 134 PHE E CE1 1 
ATOM   8993  C  CE2 . PHE E  1 108 ? 27.620  27.531  -25.806  1.00 42.34  ? 134 PHE E CE2 1 
ATOM   8994  C  CZ  . PHE E  1 108 ? 27.610  26.878  -24.595  1.00 41.22  ? 134 PHE E CZ  1 
ATOM   8995  N  N   . GLN E  1 109 ? 33.730  28.195  -24.314  1.00 52.91  ? 135 GLN E N   1 
ATOM   8996  C  CA  . GLN E  1 109 ? 34.327  27.763  -23.055  1.00 48.02  ? 135 GLN E CA  1 
ATOM   8997  C  C   . GLN E  1 109 ? 33.675  28.390  -21.831  1.00 45.32  ? 135 GLN E C   1 
ATOM   8998  O  O   . GLN E  1 109 ? 33.658  27.765  -20.766  1.00 48.37  ? 135 GLN E O   1 
ATOM   8999  C  CB  . GLN E  1 109 ? 35.822  28.093  -23.034  1.00 45.84  ? 135 GLN E CB  1 
ATOM   9000  C  CG  . GLN E  1 109 ? 36.651  27.331  -24.051  1.00 64.47  ? 135 GLN E CG  1 
ATOM   9001  C  CD  . GLN E  1 109 ? 38.112  27.746  -24.034  1.00 85.39  ? 135 GLN E CD  1 
ATOM   9002  O  OE1 . GLN E  1 109 ? 38.448  28.862  -23.636  1.00 86.64  ? 135 GLN E OE1 1 
ATOM   9003  N  NE2 . GLN E  1 109 ? 38.990  26.843  -24.462  1.00 82.67  ? 135 GLN E NE2 1 
ATOM   9004  N  N   . PHE E  1 110 ? 33.147  29.604  -21.957  1.00 37.62  ? 136 PHE E N   1 
ATOM   9005  C  CA  . PHE E  1 110 ? 32.564  30.320  -20.833  1.00 39.68  ? 136 PHE E CA  1 
ATOM   9006  C  C   . PHE E  1 110 ? 31.213  29.710  -20.455  1.00 43.13  ? 136 PHE E C   1 
ATOM   9007  O  O   . PHE E  1 110 ? 30.716  28.774  -21.089  1.00 42.50  ? 136 PHE E O   1 
ATOM   9008  C  CB  . PHE E  1 110 ? 32.421  31.804  -21.174  1.00 44.51  ? 136 PHE E CB  1 
ATOM   9009  C  CG  . PHE E  1 110 ? 31.686  32.066  -22.465  1.00 44.67  ? 136 PHE E CG  1 
ATOM   9010  C  CD1 . PHE E  1 110 ? 32.350  32.012  -23.684  1.00 41.55  ? 136 PHE E CD1 1 
ATOM   9011  C  CD2 . PHE E  1 110 ? 30.335  32.372  -22.461  1.00 38.64  ? 136 PHE E CD2 1 
ATOM   9012  C  CE1 . PHE E  1 110 ? 31.680  32.248  -24.866  1.00 38.16  ? 136 PHE E CE1 1 
ATOM   9013  C  CE2 . PHE E  1 110 ? 29.661  32.611  -23.644  1.00 34.66  ? 136 PHE E CE2 1 
ATOM   9014  C  CZ  . PHE E  1 110 ? 30.334  32.548  -24.846  1.00 32.15  ? 136 PHE E CZ  1 
ATOM   9015  N  N   . ALA E  1 111 ? 30.610  30.253  -19.398  1.00 39.23  ? 137 ALA E N   1 
ATOM   9016  C  CA  . ALA E  1 111 ? 29.286  29.820  -18.972  1.00 44.51  ? 137 ALA E CA  1 
ATOM   9017  C  C   . ALA E  1 111 ? 28.219  30.446  -19.864  1.00 43.10  ? 137 ALA E C   1 
ATOM   9018  O  O   . ALA E  1 111 ? 28.230  31.658  -20.101  1.00 47.80  ? 137 ALA E O   1 
ATOM   9019  C  CB  . ALA E  1 111 ? 29.047  30.195  -17.511  1.00 38.56  ? 137 ALA E CB  1 
ATOM   9020  N  N   . TRP E  1 112 ? 27.298  29.620  -20.354  1.00 42.03  ? 138 TRP E N   1 
ATOM   9021  C  CA  . TRP E  1 112 ? 26.274  30.107  -21.268  1.00 39.55  ? 138 TRP E CA  1 
ATOM   9022  C  C   . TRP E  1 112 ? 25.366  31.101  -20.547  1.00 40.90  ? 138 TRP E C   1 
ATOM   9023  O  O   . TRP E  1 112 ? 24.905  30.818  -19.432  1.00 43.00  ? 138 TRP E O   1 
ATOM   9024  C  CB  . TRP E  1 112 ? 25.459  28.944  -21.834  1.00 37.14  ? 138 TRP E CB  1 
ATOM   9025  C  CG  . TRP E  1 112 ? 24.439  29.367  -22.848  1.00 40.49  ? 138 TRP E CG  1 
ATOM   9026  C  CD1 . TRP E  1 112 ? 23.083  29.336  -22.709  1.00 36.70  ? 138 TRP E CD1 1 
ATOM   9027  C  CD2 . TRP E  1 112 ? 24.695  29.899  -24.153  1.00 36.02  ? 138 TRP E CD2 1 
ATOM   9028  N  NE1 . TRP E  1 112 ? 22.480  29.810  -23.845  1.00 42.07  ? 138 TRP E NE1 1 
ATOM   9029  C  CE2 . TRP E  1 112 ? 23.449  30.163  -24.747  1.00 37.95  ? 138 TRP E CE2 1 
ATOM   9030  C  CE3 . TRP E  1 112 ? 25.859  30.179  -24.873  1.00 36.58  ? 138 TRP E CE3 1 
ATOM   9031  C  CZ2 . TRP E  1 112 ? 23.331  30.691  -26.029  1.00 44.25  ? 138 TRP E CZ2 1 
ATOM   9032  C  CZ3 . TRP E  1 112 ? 25.743  30.699  -26.146  1.00 42.72  ? 138 TRP E CZ3 1 
ATOM   9033  C  CH2 . TRP E  1 112 ? 24.487  30.951  -26.712  1.00 49.89  ? 138 TRP E CH2 1 
ATOM   9034  N  N   . PRO E  1 113 ? 25.102  32.268  -21.127  1.00 41.79  ? 139 PRO E N   1 
ATOM   9035  C  CA  . PRO E  1 113 ? 24.414  33.324  -20.370  1.00 39.39  ? 139 PRO E CA  1 
ATOM   9036  C  C   . PRO E  1 113 ? 22.907  33.397  -20.589  1.00 45.32  ? 139 PRO E C   1 
ATOM   9037  O  O   . PRO E  1 113 ? 22.292  34.406  -20.228  1.00 48.07  ? 139 PRO E O   1 
ATOM   9038  C  CB  . PRO E  1 113 ? 25.099  34.608  -20.867  1.00 41.93  ? 139 PRO E CB  1 
ATOM   9039  C  CG  . PRO E  1 113 ? 26.119  34.165  -21.933  1.00 39.46  ? 139 PRO E CG  1 
ATOM   9040  C  CD  . PRO E  1 113 ? 25.726  32.795  -22.350  1.00 37.03  ? 139 PRO E CD  1 
ATOM   9041  N  N   . ARG E  1 114 ? 22.298  32.340  -21.145  1.00 45.57  ? 140 ARG E N   1 
ATOM   9042  C  CA  . ARG E  1 114 ? 20.858  32.270  -21.415  1.00 40.43  ? 140 ARG E CA  1 
ATOM   9043  C  C   . ARG E  1 114 ? 20.418  33.293  -22.454  1.00 47.00  ? 140 ARG E C   1 
ATOM   9044  O  O   . ARG E  1 114 ? 19.915  32.927  -23.522  1.00 46.46  ? 140 ARG E O   1 
ATOM   9045  C  CB  . ARG E  1 114 ? 20.033  32.484  -20.142  1.00 51.25  ? 140 ARG E CB  1 
ATOM   9046  C  CG  . ARG E  1 114 ? 20.663  31.957  -18.875  1.00 61.42  ? 140 ARG E CG  1 
ATOM   9047  C  CD  . ARG E  1 114 ? 19.944  30.751  -18.345  1.00 55.59  ? 140 ARG E CD  1 
ATOM   9048  N  NE  . ARG E  1 114 ? 20.533  30.340  -17.081  1.00 65.55  ? 140 ARG E NE  1 
ATOM   9049  C  CZ  . ARG E  1 114 ? 19.869  29.708  -16.121  1.00 69.10  ? 140 ARG E CZ  1 
ATOM   9050  N  NH1 . ARG E  1 114 ? 18.585  29.419  -16.281  1.00 64.31  ? 140 ARG E NH1 1 
ATOM   9051  N  NH2 . ARG E  1 114 ? 20.490  29.375  -14.998  1.00 60.90  ? 140 ARG E NH2 1 
ATOM   9052  N  N   . SER E  1 115 ? 20.566  34.576  -22.128  1.00 45.96  ? 141 SER E N   1 
ATOM   9053  C  CA  . SER E  1 115 ? 20.236  35.648  -23.054  1.00 42.50  ? 141 SER E CA  1 
ATOM   9054  C  C   . SER E  1 115 ? 21.327  35.775  -24.108  1.00 41.38  ? 141 SER E C   1 
ATOM   9055  O  O   . SER E  1 115 ? 22.514  35.613  -23.811  1.00 44.71  ? 141 SER E O   1 
ATOM   9056  C  CB  . SER E  1 115 ? 20.074  36.969  -22.302  1.00 45.02  ? 141 SER E CB  1 
ATOM   9057  O  OG  . SER E  1 115 ? 21.331  37.487  -21.894  1.00 45.04  ? 141 SER E OG  1 
ATOM   9058  N  N   . PHE E  1 116 ? 20.924  36.065  -25.341  1.00 33.93  ? 142 PHE E N   1 
ATOM   9059  C  CA  . PHE E  1 116 ? 21.871  36.141  -26.446  1.00 34.96  ? 142 PHE E CA  1 
ATOM   9060  C  C   . PHE E  1 116 ? 21.261  36.977  -27.565  1.00 37.44  ? 142 PHE E C   1 
ATOM   9061  O  O   . PHE E  1 116 ? 20.152  37.506  -27.446  1.00 37.85  ? 142 PHE E O   1 
ATOM   9062  C  CB  . PHE E  1 116 ? 22.254  34.742  -26.941  1.00 32.06  ? 142 PHE E CB  1 
ATOM   9063  C  CG  . PHE E  1 116 ? 21.137  34.022  -27.638  1.00 35.87  ? 142 PHE E CG  1 
ATOM   9064  C  CD1 . PHE E  1 116 ? 20.126  33.417  -26.911  1.00 40.62  ? 142 PHE E CD1 1 
ATOM   9065  C  CD2 . PHE E  1 116 ? 21.097  33.948  -29.021  1.00 39.78  ? 142 PHE E CD2 1 
ATOM   9066  C  CE1 . PHE E  1 116 ? 19.090  32.758  -27.549  1.00 40.61  ? 142 PHE E CE1 1 
ATOM   9067  C  CE2 . PHE E  1 116 ? 20.064  33.286  -29.667  1.00 38.84  ? 142 PHE E CE2 1 
ATOM   9068  C  CZ  . PHE E  1 116 ? 19.061  32.690  -28.929  1.00 39.62  ? 142 PHE E CZ  1 
ATOM   9069  N  N   . THR E  1 117 ? 22.005  37.090  -28.662  1.00 29.89  ? 143 THR E N   1 
ATOM   9070  C  CA  . THR E  1 117 ? 21.543  37.799  -29.848  1.00 30.98  ? 143 THR E CA  1 
ATOM   9071  C  C   . THR E  1 117 ? 22.156  37.126  -31.064  1.00 34.93  ? 143 THR E C   1 
ATOM   9072  O  O   . THR E  1 117 ? 23.384  37.064  -31.181  1.00 36.15  ? 143 THR E O   1 
ATOM   9073  C  CB  . THR E  1 117 ? 21.924  39.278  -29.799  1.00 29.71  ? 143 THR E CB  1 
ATOM   9074  O  OG1 . THR E  1 117 ? 21.138  39.940  -28.800  1.00 33.37  ? 143 THR E OG1 1 
ATOM   9075  C  CG2 . THR E  1 117 ? 21.681  39.934  -31.146  1.00 29.15  ? 143 THR E CG2 1 
ATOM   9076  N  N   . LEU E  1 118 ? 21.306  36.620  -31.954  1.00 34.45  ? 144 LEU E N   1 
ATOM   9077  C  CA  . LEU E  1 118 ? 21.730  35.905  -33.149  1.00 32.92  ? 144 LEU E CA  1 
ATOM   9078  C  C   . LEU E  1 118 ? 21.551  36.790  -34.377  1.00 31.78  ? 144 LEU E C   1 
ATOM   9079  O  O   . LEU E  1 118 ? 20.522  37.454  -34.528  1.00 34.58  ? 144 LEU E O   1 
ATOM   9080  C  CB  . LEU E  1 118 ? 20.930  34.609  -33.315  1.00 29.40  ? 144 LEU E CB  1 
ATOM   9081  C  CG  . LEU E  1 118 ? 21.122  33.841  -34.623  1.00 30.61  ? 144 LEU E CG  1 
ATOM   9082  C  CD1 . LEU E  1 118 ? 22.533  33.277  -34.715  1.00 29.76  ? 144 LEU E CD1 1 
ATOM   9083  C  CD2 . LEU E  1 118 ? 20.090  32.736  -34.751  1.00 32.20  ? 144 LEU E CD2 1 
ATOM   9084  N  N   . ILE E  1 119 ? 22.556  36.798  -35.252  1.00 30.05  ? 145 ILE E N   1 
ATOM   9085  C  CA  . ILE E  1 119 ? 22.507  37.547  -36.506  1.00 36.47  ? 145 ILE E CA  1 
ATOM   9086  C  C   . ILE E  1 119 ? 22.909  36.614  -37.643  1.00 38.50  ? 145 ILE E C   1 
ATOM   9087  O  O   . ILE E  1 119 ? 24.020  36.069  -37.641  1.00 38.07  ? 145 ILE E O   1 
ATOM   9088  C  CB  . ILE E  1 119 ? 23.415  38.787  -36.481  1.00 32.01  ? 145 ILE E CB  1 
ATOM   9089  C  CG1 . ILE E  1 119 ? 22.879  39.817  -35.486  1.00 36.65  ? 145 ILE E CG1 1 
ATOM   9090  C  CG2 . ILE E  1 119 ? 23.508  39.403  -37.868  1.00 31.64  ? 145 ILE E CG2 1 
ATOM   9091  C  CD1 . ILE E  1 119 ? 23.718  41.077  -35.404  1.00 40.00  ? 145 ILE E CD1 1 
ATOM   9092  N  N   . VAL E  1 120 ? 22.017  36.442  -38.615  1.00 34.99  ? 146 VAL E N   1 
ATOM   9093  C  CA  . VAL E  1 120 ? 22.236  35.556  -39.751  1.00 39.19  ? 146 VAL E CA  1 
ATOM   9094  C  C   . VAL E  1 120 ? 22.316  36.399  -41.018  1.00 40.95  ? 146 VAL E C   1 
ATOM   9095  O  O   . VAL E  1 120 ? 21.468  37.269  -41.247  1.00 35.68  ? 146 VAL E O   1 
ATOM   9096  C  CB  . VAL E  1 120 ? 21.121  34.503  -39.863  1.00 38.25  ? 146 VAL E CB  1 
ATOM   9097  C  CG1 . VAL E  1 120 ? 21.398  33.552  -41.020  1.00 41.90  ? 146 VAL E CG1 1 
ATOM   9098  C  CG2 . VAL E  1 120 ? 20.987  33.746  -38.556  1.00 35.71  ? 146 VAL E CG2 1 
ATOM   9099  N  N   . GLU E  1 121 ? 23.330  36.135  -41.837  1.00 45.49  ? 147 GLU E N   1 
ATOM   9100  C  CA  . GLU E  1 121 ? 23.567  36.866  -43.071  1.00 51.57  ? 147 GLU E CA  1 
ATOM   9101  C  C   . GLU E  1 121 ? 23.530  35.914  -44.258  1.00 55.33  ? 147 GLU E C   1 
ATOM   9102  O  O   . GLU E  1 121 ? 23.866  34.733  -44.139  1.00 56.18  ? 147 GLU E O   1 
ATOM   9103  C  CB  . GLU E  1 121 ? 24.924  37.592  -43.044  1.00 51.03  ? 147 GLU E CB  1 
ATOM   9104  C  CG  . GLU E  1 121 ? 25.008  38.752  -42.067  1.00 47.69  ? 147 GLU E CG  1 
ATOM   9105  C  CD  . GLU E  1 121 ? 26.407  39.328  -41.973  1.00 54.84  ? 147 GLU E CD  1 
ATOM   9106  O  OE1 . GLU E  1 121 ? 27.372  38.596  -42.279  1.00 56.65  ? 147 GLU E OE1 1 
ATOM   9107  O  OE2 . GLU E  1 121 ? 26.543  40.511  -41.595  1.00 59.17  ? 147 GLU E OE2 1 
ATOM   9108  N  N   . ALA E  1 122 ? 23.121  36.443  -45.410  1.00 56.20  ? 148 ALA E N   1 
ATOM   9109  C  CA  . ALA E  1 122 ? 23.149  35.715  -46.675  1.00 63.14  ? 148 ALA E CA  1 
ATOM   9110  C  C   . ALA E  1 122 ? 24.106  36.444  -47.609  1.00 70.80  ? 148 ALA E C   1 
ATOM   9111  O  O   . ALA E  1 122 ? 23.836  37.579  -48.018  1.00 74.98  ? 148 ALA E O   1 
ATOM   9112  C  CB  . ALA E  1 122 ? 21.751  35.608  -47.281  1.00 64.02  ? 148 ALA E CB  1 
ATOM   9113  N  N   . TRP E  1 123 ? 25.218  35.796  -47.945  1.00 67.94  ? 149 TRP E N   1 
ATOM   9114  C  CA  . TRP E  1 123 ? 26.299  36.415  -48.698  1.00 71.03  ? 149 TRP E CA  1 
ATOM   9115  C  C   . TRP E  1 123 ? 26.390  35.827  -50.099  1.00 83.61  ? 149 TRP E C   1 
ATOM   9116  O  O   . TRP E  1 123 ? 26.325  34.606  -50.278  1.00 78.98  ? 149 TRP E O   1 
ATOM   9117  C  CB  . TRP E  1 123 ? 27.638  36.232  -47.983  1.00 76.84  ? 149 TRP E CB  1 
ATOM   9118  C  CG  . TRP E  1 123 ? 27.851  37.167  -46.838  1.00 77.10  ? 149 TRP E CG  1 
ATOM   9119  C  CD1 . TRP E  1 123 ? 27.323  37.064  -45.585  1.00 69.00  ? 149 TRP E CD1 1 
ATOM   9120  C  CD2 . TRP E  1 123 ? 28.668  38.344  -46.834  1.00 79.11  ? 149 TRP E CD2 1 
ATOM   9121  N  NE1 . TRP E  1 123 ? 27.753  38.108  -44.803  1.00 71.59  ? 149 TRP E NE1 1 
ATOM   9122  C  CE2 . TRP E  1 123 ? 28.581  38.908  -45.547  1.00 73.76  ? 149 TRP E CE2 1 
ATOM   9123  C  CE3 . TRP E  1 123 ? 29.464  38.976  -47.795  1.00 76.35  ? 149 TRP E CE3 1 
ATOM   9124  C  CZ2 . TRP E  1 123 ? 29.257  40.074  -45.196  1.00 79.36  ? 149 TRP E CZ2 1 
ATOM   9125  C  CZ3 . TRP E  1 123 ? 30.132  40.133  -47.446  1.00 71.98  ? 149 TRP E CZ3 1 
ATOM   9126  C  CH2 . TRP E  1 123 ? 30.026  40.670  -46.158  1.00 79.88  ? 149 TRP E CH2 1 
ATOM   9127  N  N   . ASP E  1 124 ? 26.554  36.706  -51.086  1.00 97.12  ? 150 ASP E N   1 
ATOM   9128  C  CA  . ASP E  1 124 ? 26.741  36.314  -52.475  1.00 86.23  ? 150 ASP E CA  1 
ATOM   9129  C  C   . ASP E  1 124 ? 28.218  36.065  -52.738  1.00 89.28  ? 150 ASP E C   1 
ATOM   9130  O  O   . ASP E  1 124 ? 29.095  36.707  -52.153  1.00 84.91  ? 150 ASP E O   1 
ATOM   9131  C  CB  . ASP E  1 124 ? 26.208  37.390  -53.427  1.00 91.18  ? 150 ASP E CB  1 
ATOM   9132  C  CG  . ASP E  1 124 ? 26.445  37.055  -54.892  1.00 97.78  ? 150 ASP E CG  1 
ATOM   9133  O  OD1 . ASP E  1 124 ? 26.651  35.866  -55.213  1.00 97.74  ? 150 ASP E OD1 1 
ATOM   9134  O  OD2 . ASP E  1 124 ? 26.412  37.982  -55.728  1.00 100.40 ? 150 ASP E OD2 1 
ATOM   9135  N  N   . TRP E  1 125 ? 28.485  35.116  -53.627  1.00 90.38  ? 151 TRP E N   1 
ATOM   9136  C  CA  . TRP E  1 125 ? 29.846  34.664  -53.895  1.00 96.14  ? 151 TRP E CA  1 
ATOM   9137  C  C   . TRP E  1 125 ? 30.100  34.752  -55.396  1.00 97.97  ? 151 TRP E C   1 
ATOM   9138  O  O   . TRP E  1 125 ? 29.609  33.924  -56.169  1.00 94.22  ? 151 TRP E O   1 
ATOM   9139  C  CB  . TRP E  1 125 ? 30.051  33.249  -53.368  1.00 92.53  ? 151 TRP E CB  1 
ATOM   9140  C  CG  . TRP E  1 125 ? 31.423  32.724  -53.590  1.00 89.95  ? 151 TRP E CG  1 
ATOM   9141  C  CD1 . TRP E  1 125 ? 31.818  31.856  -54.563  1.00 91.18  ? 151 TRP E CD1 1 
ATOM   9142  C  CD2 . TRP E  1 125 ? 32.594  33.034  -52.827  1.00 89.28  ? 151 TRP E CD2 1 
ATOM   9143  N  NE1 . TRP E  1 125 ? 33.161  31.600  -54.451  1.00 91.51  ? 151 TRP E NE1 1 
ATOM   9144  C  CE2 . TRP E  1 125 ? 33.662  32.312  -53.393  1.00 92.99  ? 151 TRP E CE2 1 
ATOM   9145  C  CE3 . TRP E  1 125 ? 32.843  33.849  -51.718  1.00 88.57  ? 151 TRP E CE3 1 
ATOM   9146  C  CZ2 . TRP E  1 125 ? 34.960  32.381  -52.891  1.00 95.89  ? 151 TRP E CZ2 1 
ATOM   9147  C  CZ3 . TRP E  1 125 ? 34.132  33.914  -51.219  1.00 91.20  ? 151 TRP E CZ3 1 
ATOM   9148  C  CH2 . TRP E  1 125 ? 35.174  33.185  -51.806  1.00 93.38  ? 151 TRP E CH2 1 
ATOM   9149  N  N   . ASP E  1 126 ? 30.857  35.772  -55.803  1.00 101.56 ? 152 ASP E N   1 
ATOM   9150  C  CA  . ASP E  1 126 ? 31.322  35.919  -57.174  1.00 96.64  ? 152 ASP E CA  1 
ATOM   9151  C  C   . ASP E  1 126 ? 32.723  35.351  -57.369  1.00 101.16 ? 152 ASP E C   1 
ATOM   9152  O  O   . ASP E  1 126 ? 33.408  35.725  -58.326  1.00 100.65 ? 152 ASP E O   1 
ATOM   9153  C  CB  . ASP E  1 126 ? 31.288  37.390  -57.592  1.00 90.66  ? 152 ASP E CB  1 
ATOM   9154  C  CG  . ASP E  1 126 ? 29.878  37.933  -57.692  1.00 96.93  ? 152 ASP E CG  1 
ATOM   9155  O  OD1 . ASP E  1 126 ? 28.941  37.122  -57.846  1.00 103.19 ? 152 ASP E OD1 1 
ATOM   9156  O  OD2 . ASP E  1 126 ? 29.707  39.169  -57.627  1.00 90.61  ? 152 ASP E OD2 1 
ATOM   9157  N  N   . ASN E  1 127 ? 33.161  34.468  -56.470  1.00 101.67 ? 153 ASN E N   1 
ATOM   9158  C  CA  . ASN E  1 127 ? 34.466  33.811  -56.498  1.00 103.92 ? 153 ASN E CA  1 
ATOM   9159  C  C   . ASN E  1 127 ? 35.632  34.783  -56.363  1.00 102.61 ? 153 ASN E C   1 
ATOM   9160  O  O   . ASN E  1 127 ? 36.788  34.374  -56.519  1.00 101.37 ? 153 ASN E O   1 
ATOM   9161  C  CB  . ASN E  1 127 ? 34.651  32.967  -57.771  1.00 105.54 ? 153 ASN E CB  1 
ATOM   9162  C  CG  . ASN E  1 127 ? 33.862  31.671  -57.739  1.00 107.84 ? 153 ASN E CG  1 
ATOM   9163  O  OD1 . ASN E  1 127 ? 32.765  31.582  -58.293  1.00 100.93 ? 153 ASN E OD1 1 
ATOM   9164  N  ND2 . ASN E  1 127 ? 34.425  30.651  -57.098  1.00 114.84 ? 153 ASN E ND2 1 
ATOM   9165  N  N   . ASP E  1 128 ? 35.367  36.058  -56.063  1.00 105.41 ? 154 ASP E N   1 
ATOM   9166  C  CA  . ASP E  1 128 ? 36.437  37.052  -56.081  1.00 110.25 ? 154 ASP E CA  1 
ATOM   9167  C  C   . ASP E  1 128 ? 37.428  36.840  -54.943  1.00 109.04 ? 154 ASP E C   1 
ATOM   9168  O  O   . ASP E  1 128 ? 38.597  37.225  -55.065  1.00 105.47 ? 154 ASP E O   1 
ATOM   9169  C  CB  . ASP E  1 128 ? 35.848  38.465  -56.024  1.00 105.97 ? 154 ASP E CB  1 
ATOM   9170  C  CG  . ASP E  1 128 ? 36.689  39.480  -56.785  1.00 108.50 ? 154 ASP E CG  1 
ATOM   9171  O  OD1 . ASP E  1 128 ? 37.925  39.306  -56.849  1.00 114.53 ? 154 ASP E OD1 1 
ATOM   9172  O  OD2 . ASP E  1 128 ? 36.115  40.449  -57.329  1.00 105.54 ? 154 ASP E OD2 1 
ATOM   9173  N  N   . THR E  1 129 ? 36.984  36.221  -53.847  1.00 113.95 ? 155 THR E N   1 
ATOM   9174  C  CA  . THR E  1 129 ? 37.829  35.928  -52.687  1.00 113.10 ? 155 THR E CA  1 
ATOM   9175  C  C   . THR E  1 129 ? 38.569  37.185  -52.228  1.00 112.98 ? 155 THR E C   1 
ATOM   9176  O  O   . THR E  1 129 ? 39.784  37.196  -52.013  1.00 108.11 ? 155 THR E O   1 
ATOM   9177  C  CB  . THR E  1 129 ? 38.792  34.776  -52.988  1.00 116.85 ? 155 THR E CB  1 
ATOM   9178  O  OG1 . THR E  1 129 ? 38.077  33.731  -53.661  1.00 118.01 ? 155 THR E OG1 1 
ATOM   9179  C  CG2 . THR E  1 129 ? 39.372  34.204  -51.697  1.00 109.71 ? 155 THR E CG2 1 
ATOM   9180  N  N   . THR E  1 130 ? 37.810  38.264  -52.106  1.00 115.67 ? 156 THR E N   1 
ATOM   9181  C  CA  . THR E  1 130 ? 38.253  39.534  -51.562  1.00 112.02 ? 156 THR E CA  1 
ATOM   9182  C  C   . THR E  1 130 ? 37.419  39.853  -50.330  1.00 109.37 ? 156 THR E C   1 
ATOM   9183  O  O   . THR E  1 130 ? 36.317  39.316  -50.161  1.00 106.60 ? 156 THR E O   1 
ATOM   9184  C  CB  . THR E  1 130 ? 38.110  40.663  -52.596  1.00 105.06 ? 156 THR E CB  1 
ATOM   9185  O  OG1 . THR E  1 130 ? 36.732  40.816  -52.957  1.00 101.75 ? 156 THR E OG1 1 
ATOM   9186  C  CG2 . THR E  1 130 ? 38.930  40.359  -53.841  1.00 105.00 ? 156 THR E CG2 1 
ATOM   9187  N  N   . PRO E  1 131 ? 37.914  40.709  -49.436  1.00 110.41 ? 157 PRO E N   1 
ATOM   9188  C  CA  . PRO E  1 131 ? 37.080  41.149  -48.312  1.00 106.75 ? 157 PRO E CA  1 
ATOM   9189  C  C   . PRO E  1 131 ? 36.216  42.319  -48.735  1.00 96.42  ? 157 PRO E C   1 
ATOM   9190  O  O   . PRO E  1 131 ? 36.742  43.377  -49.086  1.00 88.21  ? 157 PRO E O   1 
ATOM   9191  C  CB  . PRO E  1 131 ? 38.106  41.543  -47.242  1.00 99.92  ? 157 PRO E CB  1 
ATOM   9192  C  CG  . PRO E  1 131 ? 39.429  41.703  -47.974  1.00 100.38 ? 157 PRO E CG  1 
ATOM   9193  C  CD  . PRO E  1 131 ? 39.227  41.375  -49.426  1.00 105.34 ? 157 PRO E CD  1 
ATOM   9194  N  N   . ASN E  1 132 ? 34.902  42.158  -48.742  1.00 95.95  ? 158 ASN E N   1 
ATOM   9195  C  CA  . ASN E  1 132 ? 34.105  43.096  -49.502  1.00 91.64  ? 158 ASN E CA  1 
ATOM   9196  C  C   . ASN E  1 132 ? 32.715  43.242  -48.903  1.00 92.92  ? 158 ASN E C   1 
ATOM   9197  O  O   . ASN E  1 132 ? 32.194  42.336  -48.244  1.00 93.56  ? 158 ASN E O   1 
ATOM   9198  C  CB  . ASN E  1 132 ? 34.026  42.648  -50.967  1.00 88.39  ? 158 ASN E CB  1 
ATOM   9199  C  CG  . ASN E  1 132 ? 34.259  43.788  -51.925  1.00 94.31  ? 158 ASN E CG  1 
ATOM   9200  O  OD1 . ASN E  1 132 ? 34.222  44.953  -51.538  1.00 100.77 ? 158 ASN E OD1 1 
ATOM   9201  N  ND2 . ASN E  1 132 ? 34.502  43.463  -53.195  1.00 91.54  ? 158 ASN E ND2 1 
ATOM   9202  N  N   . GLU E  1 133 ? 32.115  44.406  -49.156  1.00 90.98  ? 159 GLU E N   1 
ATOM   9203  C  CA  . GLU E  1 133 ? 30.869  44.787  -48.517  1.00 93.18  ? 159 GLU E CA  1 
ATOM   9204  C  C   . GLU E  1 133 ? 29.661  44.798  -49.444  1.00 83.87  ? 159 GLU E C   1 
ATOM   9205  O  O   . GLU E  1 133 ? 28.535  44.809  -48.945  1.00 82.46  ? 159 GLU E O   1 
ATOM   9206  C  CB  . GLU E  1 133 ? 31.013  46.175  -47.869  1.00 88.52  ? 159 GLU E CB  1 
ATOM   9207  C  CG  . GLU E  1 133 ? 32.214  46.308  -46.924  1.00 82.48  ? 159 GLU E CG  1 
ATOM   9208  C  CD  . GLU E  1 133 ? 32.079  47.466  -45.941  1.00 86.86  ? 159 GLU E CD  1 
ATOM   9209  O  OE1 . GLU E  1 133 ? 31.019  48.128  -45.940  1.00 89.95  ? 159 GLU E OE1 1 
ATOM   9210  O  OE2 . GLU E  1 133 ? 33.031  47.709  -45.164  1.00 78.96  ? 159 GLU E OE2 1 
ATOM   9211  N  N   . GLU E  1 134 ? 29.845  44.795  -50.763  1.00 85.93  ? 160 GLU E N   1 
ATOM   9212  C  CA  . GLU E  1 134 ? 28.670  44.854  -51.624  1.00 96.43  ? 160 GLU E CA  1 
ATOM   9213  C  C   . GLU E  1 134 ? 28.053  43.479  -51.873  1.00 93.55  ? 160 GLU E C   1 
ATOM   9214  O  O   . GLU E  1 134 ? 26.934  43.405  -52.394  1.00 83.02  ? 160 GLU E O   1 
ATOM   9215  C  CB  . GLU E  1 134 ? 29.022  45.525  -52.957  1.00 96.29  ? 160 GLU E CB  1 
ATOM   9216  C  CG  . GLU E  1 134 ? 29.874  44.654  -53.882  1.00 99.81  ? 160 GLU E CG  1 
ATOM   9217  C  CD  . GLU E  1 134 ? 31.349  44.628  -53.497  1.00 99.97  ? 160 GLU E CD  1 
ATOM   9218  O  OE1 . GLU E  1 134 ? 31.863  43.518  -53.226  1.00 102.17 ? 160 GLU E OE1 1 
ATOM   9219  O  OE2 . GLU E  1 134 ? 31.993  45.693  -53.471  1.00 99.00  ? 160 GLU E OE2 1 
ATOM   9220  N  N   . LEU E  1 135 ? 28.735  42.398  -51.498  1.00 92.10  ? 161 LEU E N   1 
ATOM   9221  C  CA  . LEU E  1 135 ? 28.278  41.036  -51.793  1.00 88.44  ? 161 LEU E CA  1 
ATOM   9222  C  C   . LEU E  1 135 ? 27.421  40.460  -50.667  1.00 86.72  ? 161 LEU E C   1 
ATOM   9223  O  O   . LEU E  1 135 ? 27.632  39.340  -50.204  1.00 86.38  ? 161 LEU E O   1 
ATOM   9224  C  CB  . LEU E  1 135 ? 29.480  40.144  -52.077  1.00 92.01  ? 161 LEU E CB  1 
ATOM   9225  C  CG  . LEU E  1 135 ? 30.336  40.581  -53.268  1.00 95.67  ? 161 LEU E CG  1 
ATOM   9226  C  CD1 . LEU E  1 135 ? 31.663  39.836  -53.302  1.00 101.18 ? 161 LEU E CD1 1 
ATOM   9227  C  CD2 . LEU E  1 135 ? 29.579  40.393  -54.575  1.00 87.70  ? 161 LEU E CD2 1 
ATOM   9228  N  N   . LEU E  1 136 ? 26.426  41.229  -50.234  1.00 85.19  ? 162 LEU E N   1 
ATOM   9229  C  CA  . LEU E  1 136 ? 25.517  40.829  -49.168  1.00 81.13  ? 162 LEU E CA  1 
ATOM   9230  C  C   . LEU E  1 136 ? 24.085  40.938  -49.670  1.00 80.04  ? 162 LEU E C   1 
ATOM   9231  O  O   . LEU E  1 136 ? 23.716  41.941  -50.290  1.00 82.43  ? 162 LEU E O   1 
ATOM   9232  C  CB  . LEU E  1 136 ? 25.714  41.700  -47.924  1.00 77.94  ? 162 LEU E CB  1 
ATOM   9233  C  CG  . LEU E  1 136 ? 24.902  41.314  -46.688  1.00 73.11  ? 162 LEU E CG  1 
ATOM   9234  C  CD1 . LEU E  1 136 ? 25.302  39.929  -46.210  1.00 68.82  ? 162 LEU E CD1 1 
ATOM   9235  C  CD2 . LEU E  1 136 ? 25.087  42.341  -45.585  1.00 67.52  ? 162 LEU E CD2 1 
ATOM   9236  N  N   . ILE E  1 137 ? 23.286  39.910  -49.404  1.00 71.92  ? 163 ILE E N   1 
ATOM   9237  C  CA  . ILE E  1 137 ? 21.887  39.872  -49.822  1.00 72.56  ? 163 ILE E CA  1 
ATOM   9238  C  C   . ILE E  1 137 ? 20.960  40.303  -48.701  1.00 73.03  ? 163 ILE E C   1 
ATOM   9239  O  O   . ILE E  1 137 ? 20.035  41.087  -48.915  1.00 75.74  ? 163 ILE E O   1 
ATOM   9240  C  CB  . ILE E  1 137 ? 21.503  38.464  -50.329  1.00 76.23  ? 163 ILE E CB  1 
ATOM   9241  C  CG1 . ILE E  1 137 ? 22.311  38.070  -51.558  1.00 79.44  ? 163 ILE E CG1 1 
ATOM   9242  C  CG2 . ILE E  1 137 ? 20.018  38.383  -50.625  1.00 71.50  ? 163 ILE E CG2 1 
ATOM   9243  C  CD1 . ILE E  1 137 ? 23.533  37.320  -51.221  1.00 74.78  ? 163 ILE E CD1 1 
ATOM   9244  N  N   . GLU E  1 138 ? 21.187  39.787  -47.497  1.00 72.08  ? 164 GLU E N   1 
ATOM   9245  C  CA  . GLU E  1 138 ? 20.223  39.946  -46.422  1.00 64.98  ? 164 GLU E CA  1 
ATOM   9246  C  C   . GLU E  1 138 ? 20.917  39.730  -45.087  1.00 57.61  ? 164 GLU E C   1 
ATOM   9247  O  O   . GLU E  1 138 ? 21.802  38.877  -44.971  1.00 56.44  ? 164 GLU E O   1 
ATOM   9248  C  CB  . GLU E  1 138 ? 19.062  38.958  -46.583  1.00 58.08  ? 164 GLU E CB  1 
ATOM   9249  C  CG  . GLU E  1 138 ? 18.041  39.015  -45.468  1.00 59.94  ? 164 GLU E CG  1 
ATOM   9250  C  CD  . GLU E  1 138 ? 17.032  40.127  -45.661  1.00 64.06  ? 164 GLU E CD  1 
ATOM   9251  O  OE1 . GLU E  1 138 ? 15.917  39.831  -46.136  1.00 64.46  ? 164 GLU E OE1 1 
ATOM   9252  O  OE2 . GLU E  1 138 ? 17.353  41.293  -45.347  1.00 65.01  ? 164 GLU E OE2 1 
ATOM   9253  N  N   . ARG E  1 139 ? 20.513  40.514  -44.090  1.00 49.64  ? 165 ARG E N   1 
ATOM   9254  C  CA  . ARG E  1 139 ? 20.945  40.335  -42.711  1.00 45.47  ? 165 ARG E CA  1 
ATOM   9255  C  C   . ARG E  1 139 ? 19.715  40.386  -41.820  1.00 40.97  ? 165 ARG E C   1 
ATOM   9256  O  O   . ARG E  1 139 ? 18.944  41.349  -41.877  1.00 38.94  ? 165 ARG E O   1 
ATOM   9257  C  CB  . ARG E  1 139 ? 21.957  41.406  -42.286  1.00 41.22  ? 165 ARG E CB  1 
ATOM   9258  C  CG  . ARG E  1 139 ? 22.229  41.418  -40.795  1.00 43.71  ? 165 ARG E CG  1 
ATOM   9259  C  CD  . ARG E  1 139 ? 23.141  42.562  -40.376  1.00 50.82  ? 165 ARG E CD  1 
ATOM   9260  N  NE  . ARG E  1 139 ? 24.489  42.427  -40.918  1.00 53.43  ? 165 ARG E NE  1 
ATOM   9261  C  CZ  . ARG E  1 139 ? 24.991  43.211  -41.866  1.00 54.32  ? 165 ARG E CZ  1 
ATOM   9262  N  NH1 . ARG E  1 139 ? 24.256  44.195  -42.367  1.00 48.20  ? 165 ARG E NH1 1 
ATOM   9263  N  NH2 . ARG E  1 139 ? 26.229  43.019  -42.306  1.00 52.38  ? 165 ARG E NH2 1 
ATOM   9264  N  N   . VAL E  1 140 ? 19.523  39.343  -41.017  1.00 35.72  ? 166 VAL E N   1 
ATOM   9265  C  CA  . VAL E  1 140 ? 18.388  39.247  -40.110  1.00 35.28  ? 166 VAL E CA  1 
ATOM   9266  C  C   . VAL E  1 140 ? 18.915  38.968  -38.711  1.00 35.75  ? 166 VAL E C   1 
ATOM   9267  O  O   . VAL E  1 140 ? 19.973  38.355  -38.538  1.00 38.55  ? 166 VAL E O   1 
ATOM   9268  C  CB  . VAL E  1 140 ? 17.384  38.157  -40.552  1.00 41.13  ? 166 VAL E CB  1 
ATOM   9269  C  CG1 . VAL E  1 140 ? 16.741  38.540  -41.874  1.00 41.67  ? 166 VAL E CG1 1 
ATOM   9270  C  CG2 . VAL E  1 140 ? 18.074  36.804  -40.671  1.00 41.13  ? 166 VAL E CG2 1 
ATOM   9271  N  N   . SER E  1 141 ? 18.174  39.425  -37.707  1.00 34.25  ? 167 SER E N   1 
ATOM   9272  C  CA  . SER E  1 141 ? 18.602  39.300  -36.323  1.00 29.73  ? 167 SER E CA  1 
ATOM   9273  C  C   . SER E  1 141 ? 17.488  38.705  -35.476  1.00 31.50  ? 167 SER E C   1 
ATOM   9274  O  O   . SER E  1 141 ? 16.323  38.667  -35.878  1.00 38.79  ? 167 SER E O   1 
ATOM   9275  C  CB  . SER E  1 141 ? 19.014  40.652  -35.738  1.00 32.16  ? 167 SER E CB  1 
ATOM   9276  O  OG  . SER E  1 141 ? 17.873  41.455  -35.489  1.00 38.31  ? 167 SER E OG  1 
ATOM   9277  N  N   . HIS E  1 142 ? 17.868  38.242  -34.288  1.00 33.24  ? 168 HIS E N   1 
ATOM   9278  C  CA  . HIS E  1 142 ? 16.920  37.745  -33.298  1.00 35.67  ? 168 HIS E CA  1 
ATOM   9279  C  C   . HIS E  1 142 ? 17.611  37.731  -31.945  1.00 32.89  ? 168 HIS E C   1 
ATOM   9280  O  O   . HIS E  1 142 ? 18.758  37.288  -31.844  1.00 33.21  ? 168 HIS E O   1 
ATOM   9281  C  CB  . HIS E  1 142 ? 16.418  36.341  -33.650  1.00 40.98  ? 168 HIS E CB  1 
ATOM   9282  C  CG  . HIS E  1 142 ? 15.701  35.656  -32.526  1.00 45.42  ? 168 HIS E CG  1 
ATOM   9283  N  ND1 . HIS E  1 142 ? 14.522  36.134  -31.993  1.00 43.10  ? 168 HIS E ND1 1 
ATOM   9284  C  CD2 . HIS E  1 142 ? 15.999  34.532  -31.831  1.00 41.87  ? 168 HIS E CD2 1 
ATOM   9285  C  CE1 . HIS E  1 142 ? 14.126  35.333  -31.020  1.00 42.64  ? 168 HIS E CE1 1 
ATOM   9286  N  NE2 . HIS E  1 142 ? 15.004  34.354  -30.900  1.00 37.86  ? 168 HIS E NE2 1 
ATOM   9287  N  N   . ALA E  1 143 ? 16.920  38.215  -30.917  1.00 29.59  ? 169 ALA E N   1 
ATOM   9288  C  CA  . ALA E  1 143 ? 17.449  38.237  -29.559  1.00 34.87  ? 169 ALA E CA  1 
ATOM   9289  C  C   . ALA E  1 143 ? 16.446  37.564  -28.637  1.00 36.62  ? 169 ALA E C   1 
ATOM   9290  O  O   . ALA E  1 143 ? 15.286  37.982  -28.569  1.00 39.72  ? 169 ALA E O   1 
ATOM   9291  C  CB  . ALA E  1 143 ? 17.737  39.667  -29.094  1.00 35.36  ? 169 ALA E CB  1 
ATOM   9292  N  N   . GLY E  1 144 ? 16.888  36.539  -27.936  1.00 37.95  ? 170 GLY E N   1 
ATOM   9293  C  CA  . GLY E  1 144 ? 16.013  35.777  -27.067  1.00 44.29  ? 170 GLY E CA  1 
ATOM   9294  C  C   . GLY E  1 144 ? 16.808  34.962  -26.081  1.00 40.13  ? 170 GLY E C   1 
ATOM   9295  O  O   . GLY E  1 144 ? 17.949  35.296  -25.755  1.00 43.52  ? 170 GLY E O   1 
ATOM   9296  N  N   . MET E  1 145 ? 16.200  33.879  -25.600  1.00 42.19  ? 171 MET E N   1 
ATOM   9297  C  CA  . MET E  1 145 ? 16.813  33.011  -24.606  1.00 47.26  ? 171 MET E CA  1 
ATOM   9298  C  C   . MET E  1 145 ? 16.745  31.563  -25.071  1.00 46.08  ? 171 MET E C   1 
ATOM   9299  O  O   . MET E  1 145 ? 15.884  31.183  -25.869  1.00 47.06  ? 171 MET E O   1 
ATOM   9300  C  CB  . MET E  1 145 ? 16.131  33.148  -23.238  1.00 47.59  ? 171 MET E CB  1 
ATOM   9301  C  CG  . MET E  1 145 ? 16.028  34.577  -22.739  1.00 52.64  ? 171 MET E CG  1 
ATOM   9302  S  SD  . MET E  1 145 ? 15.418  34.683  -21.048  1.00 83.23  ? 171 MET E SD  1 
ATOM   9303  C  CE  . MET E  1 145 ? 16.844  35.388  -20.222  1.00 61.93  ? 171 MET E CE  1 
ATOM   9304  N  N   . ILE E  1 146 ? 17.664  30.753  -24.556  1.00 44.58  ? 172 ILE E N   1 
ATOM   9305  C  CA  . ILE E  1 146 ? 17.719  29.340  -24.913  1.00 46.28  ? 172 ILE E CA  1 
ATOM   9306  C  C   . ILE E  1 146 ? 18.469  28.596  -23.814  1.00 45.20  ? 172 ILE E C   1 
ATOM   9307  O  O   . ILE E  1 146 ? 19.469  29.084  -23.281  1.00 46.77  ? 172 ILE E O   1 
ATOM   9308  C  CB  . ILE E  1 146 ? 18.368  29.144  -26.305  1.00 41.48  ? 172 ILE E CB  1 
ATOM   9309  C  CG1 . ILE E  1 146 ? 18.148  27.718  -26.812  1.00 46.39  ? 172 ILE E CG1 1 
ATOM   9310  C  CG2 . ILE E  1 146 ? 19.852  29.489  -26.271  1.00 46.91  ? 172 ILE E CG2 1 
ATOM   9311  C  CD1 . ILE E  1 146 ? 16.701  27.394  -27.116  1.00 50.03  ? 172 ILE E CD1 1 
ATOM   9312  N  N   . ASN E  1 147 ? 17.962  27.420  -23.465  1.00 45.40  ? 173 ASN E N   1 
ATOM   9313  C  CA  . ASN E  1 147 ? 18.557  26.521  -22.490  1.00 46.69  ? 173 ASN E CA  1 
ATOM   9314  C  C   . ASN E  1 147 ? 18.812  25.166  -23.138  1.00 51.48  ? 173 ASN E C   1 
ATOM   9315  O  O   . ASN E  1 147 ? 18.205  24.838  -24.164  1.00 55.29  ? 173 ASN E O   1 
ATOM   9316  C  CB  . ASN E  1 147 ? 17.641  26.342  -21.269  1.00 47.58  ? 173 ASN E CB  1 
ATOM   9317  C  CG  . ASN E  1 147 ? 17.741  27.490  -20.285  1.00 44.92  ? 173 ASN E CG  1 
ATOM   9318  O  OD1 . ASN E  1 147 ? 18.822  28.030  -20.047  1.00 52.06  ? 173 ASN E OD1 1 
ATOM   9319  N  ND2 . ASN E  1 147 ? 16.610  27.870  -19.706  1.00 39.60  ? 173 ASN E ND2 1 
ATOM   9320  N  N   . PRO E  1 148 ? 19.703  24.349  -22.568  1.00 51.22  ? 174 PRO E N   1 
ATOM   9321  C  CA  . PRO E  1 148 ? 19.891  22.989  -23.102  1.00 55.08  ? 174 PRO E CA  1 
ATOM   9322  C  C   . PRO E  1 148 ? 18.648  22.110  -23.000  1.00 63.97  ? 174 PRO E C   1 
ATOM   9323  O  O   . PRO E  1 148 ? 18.629  21.029  -23.604  1.00 61.22  ? 174 PRO E O   1 
ATOM   9324  C  CB  . PRO E  1 148 ? 21.040  22.430  -22.252  1.00 39.61  ? 174 PRO E CB  1 
ATOM   9325  C  CG  . PRO E  1 148 ? 21.746  23.633  -21.729  1.00 41.74  ? 174 PRO E CG  1 
ATOM   9326  C  CD  . PRO E  1 148 ? 20.682  24.663  -21.513  1.00 48.31  ? 174 PRO E CD  1 
ATOM   9327  N  N   . GLU E  1 149 ? 17.612  22.542  -22.273  1.00 64.03  ? 175 GLU E N   1 
ATOM   9328  C  CA  . GLU E  1 149 ? 16.414  21.728  -22.093  1.00 65.81  ? 175 GLU E CA  1 
ATOM   9329  C  C   . GLU E  1 149 ? 15.453  21.840  -23.269  1.00 64.79  ? 175 GLU E C   1 
ATOM   9330  O  O   . GLU E  1 149 ? 14.704  20.895  -23.541  1.00 66.77  ? 175 GLU E O   1 
ATOM   9331  C  CB  . GLU E  1 149 ? 15.690  22.136  -20.809  1.00 67.49  ? 175 GLU E CB  1 
ATOM   9332  C  CG  . GLU E  1 149 ? 16.613  22.489  -19.654  1.00 75.19  ? 175 GLU E CG  1 
ATOM   9333  C  CD  . GLU E  1 149 ? 16.634  21.425  -18.576  1.00 83.33  ? 175 GLU E CD  1 
ATOM   9334  O  OE1 . GLU E  1 149 ? 16.193  20.289  -18.851  1.00 77.91  ? 175 GLU E OE1 1 
ATOM   9335  O  OE2 . GLU E  1 149 ? 17.090  21.725  -17.453  1.00 91.01  ? 175 GLU E OE2 1 
ATOM   9336  N  N   . ASP E  1 150 ? 15.454  22.976  -23.967  1.00 63.43  ? 176 ASP E N   1 
ATOM   9337  C  CA  . ASP E  1 150 ? 14.472  23.246  -25.008  1.00 59.87  ? 176 ASP E CA  1 
ATOM   9338  C  C   . ASP E  1 150 ? 14.733  22.480  -26.297  1.00 61.89  ? 176 ASP E C   1 
ATOM   9339  O  O   . ASP E  1 150 ? 13.834  22.417  -27.145  1.00 69.98  ? 176 ASP E O   1 
ATOM   9340  C  CB  . ASP E  1 150 ? 14.430  24.746  -25.305  1.00 61.68  ? 176 ASP E CB  1 
ATOM   9341  C  CG  . ASP E  1 150 ? 14.163  25.572  -24.066  1.00 62.52  ? 176 ASP E CG  1 
ATOM   9342  O  OD1 . ASP E  1 150 ? 13.904  26.787  -24.195  1.00 59.93  ? 176 ASP E OD1 1 
ATOM   9343  O  OD2 . ASP E  1 150 ? 14.207  25.000  -22.959  1.00 67.34  ? 176 ASP E OD2 1 
ATOM   9344  N  N   . ARG E  1 151 ? 15.920  21.908  -26.459  1.00 61.79  ? 177 ARG E N   1 
ATOM   9345  C  CA  . ARG E  1 151 ? 16.310  21.142  -27.662  1.00 68.12  ? 177 ARG E CA  1 
ATOM   9346  C  C   . ARG E  1 151 ? 16.240  22.095  -28.860  1.00 62.30  ? 177 ARG E C   1 
ATOM   9347  O  O   . ARG E  1 151 ? 16.614  23.271  -28.735  1.00 61.10  ? 177 ARG E O   1 
ATOM   9348  C  CB  . ARG E  1 151 ? 15.459  19.892  -27.787  1.00 65.32  ? 177 ARG E CB  1 
ATOM   9349  C  CG  . ARG E  1 151 ? 15.359  19.093  -26.504  1.00 77.65  ? 177 ARG E CG  1 
ATOM   9350  C  CD  . ARG E  1 151 ? 15.582  17.613  -26.743  1.00 86.21  ? 177 ARG E CD  1 
ATOM   9351  N  NE  . ARG E  1 151 ? 16.331  17.011  -25.646  1.00 92.43  ? 177 ARG E NE  1 
ATOM   9352  C  CZ  . ARG E  1 151 ? 17.464  16.333  -25.797  1.00 89.47  ? 177 ARG E CZ  1 
ATOM   9353  N  NH1 . ARG E  1 151 ? 18.080  15.824  -24.738  1.00 84.08  ? 177 ARG E NH1 1 
ATOM   9354  N  NH2 . ARG E  1 151 ? 17.978  16.157  -27.007  1.00 85.21  ? 177 ARG E NH2 1 
ATOM   9355  N  N   . TRP E  1 152 ? 15.774  21.632  -30.018  1.00 48.67  ? 178 TRP E N   1 
ATOM   9356  C  CA  . TRP E  1 152 ? 15.713  22.477  -31.199  1.00 45.37  ? 178 TRP E CA  1 
ATOM   9357  C  C   . TRP E  1 152 ? 14.536  23.439  -31.106  1.00 51.08  ? 178 TRP E C   1 
ATOM   9358  O  O   . TRP E  1 152 ? 13.411  23.033  -30.794  1.00 54.48  ? 178 TRP E O   1 
ATOM   9359  C  CB  . TRP E  1 152 ? 15.600  21.621  -32.457  1.00 46.28  ? 178 TRP E CB  1 
ATOM   9360  C  CG  . TRP E  1 152 ? 16.853  20.870  -32.801  1.00 49.50  ? 178 TRP E CG  1 
ATOM   9361  C  CD1 . TRP E  1 152 ? 17.106  19.547  -32.578  1.00 51.75  ? 178 TRP E CD1 1 
ATOM   9362  C  CD2 . TRP E  1 152 ? 18.020  21.399  -33.440  1.00 50.19  ? 178 TRP E CD2 1 
ATOM   9363  N  NE1 . TRP E  1 152 ? 18.359  19.220  -33.038  1.00 48.88  ? 178 TRP E NE1 1 
ATOM   9364  C  CE2 . TRP E  1 152 ? 18.940  20.340  -33.571  1.00 49.98  ? 178 TRP E CE2 1 
ATOM   9365  C  CE3 . TRP E  1 152 ? 18.379  22.668  -33.908  1.00 46.12  ? 178 TRP E CE3 1 
ATOM   9366  C  CZ2 . TRP E  1 152 ? 20.191  20.511  -34.154  1.00 45.02  ? 178 TRP E CZ2 1 
ATOM   9367  C  CZ3 . TRP E  1 152 ? 19.621  22.833  -34.486  1.00 44.55  ? 178 TRP E CZ3 1 
ATOM   9368  C  CH2 . TRP E  1 152 ? 20.510  21.762  -34.607  1.00 45.76  ? 178 TRP E CH2 1 
ATOM   9369  N  N   . LYS E  1 153 ? 14.802  24.719  -31.360  1.00 47.75  ? 179 LYS E N   1 
ATOM   9370  C  CA  . LYS E  1 153 ? 13.773  25.746  -31.454  1.00 46.86  ? 179 LYS E CA  1 
ATOM   9371  C  C   . LYS E  1 153 ? 13.769  26.299  -32.871  1.00 43.88  ? 179 LYS E C   1 
ATOM   9372  O  O   . LYS E  1 153 ? 14.826  26.633  -33.413  1.00 42.36  ? 179 LYS E O   1 
ATOM   9373  C  CB  . LYS E  1 153 ? 14.006  26.870  -30.441  1.00 45.75  ? 179 LYS E CB  1 
ATOM   9374  C  CG  . LYS E  1 153 ? 13.412  26.599  -29.073  1.00 54.95  ? 179 LYS E CG  1 
ATOM   9375  C  CD  . LYS E  1 153 ? 11.891  26.626  -29.119  1.00 63.53  ? 179 LYS E CD  1 
ATOM   9376  C  CE  . LYS E  1 153 ? 11.285  26.171  -27.796  1.00 65.00  ? 179 LYS E CE  1 
ATOM   9377  N  NZ  . LYS E  1 153 ? 11.607  24.745  -27.498  1.00 56.25  ? 179 LYS E NZ  1 
ATOM   9378  N  N   . SER E  1 154 ? 12.589  26.389  -33.468  1.00 43.95  ? 180 SER E N   1 
ATOM   9379  C  CA  . SER E  1 154 ? 12.473  26.818  -34.850  1.00 43.99  ? 180 SER E CA  1 
ATOM   9380  C  C   . SER E  1 154 ? 12.379  28.338  -34.926  1.00 43.61  ? 180 SER E C   1 
ATOM   9381  O  O   . SER E  1 154 ? 11.765  28.979  -34.067  1.00 41.56  ? 180 SER E O   1 
ATOM   9382  C  CB  . SER E  1 154 ? 11.253  26.171  -35.506  1.00 42.15  ? 180 SER E CB  1 
ATOM   9383  O  OG  . SER E  1 154 ? 11.324  26.274  -36.918  1.00 58.24  ? 180 SER E OG  1 
ATOM   9384  N  N   . LEU E  1 155 ? 13.010  28.909  -35.953  1.00 38.74  ? 181 LEU E N   1 
ATOM   9385  C  CA  . LEU E  1 155 ? 13.016  30.348  -36.180  1.00 42.61  ? 181 LEU E CA  1 
ATOM   9386  C  C   . LEU E  1 155 ? 12.785  30.644  -37.656  1.00 48.26  ? 181 LEU E C   1 
ATOM   9387  O  O   . LEU E  1 155 ? 13.369  29.997  -38.530  1.00 44.79  ? 181 LEU E O   1 
ATOM   9388  C  CB  . LEU E  1 155 ? 14.338  30.986  -35.730  1.00 36.44  ? 181 LEU E CB  1 
ATOM   9389  C  CG  . LEU E  1 155 ? 14.649  30.956  -34.238  1.00 38.72  ? 181 LEU E CG  1 
ATOM   9390  C  CD1 . LEU E  1 155 ? 16.001  31.599  -33.980  1.00 39.55  ? 181 LEU E CD1 1 
ATOM   9391  C  CD2 . LEU E  1 155 ? 13.554  31.657  -33.453  1.00 37.73  ? 181 LEU E CD2 1 
ATOM   9392  N  N   . HIS E  1 156 ? 11.942  31.640  -37.918  1.00 46.12  ? 182 HIS E N   1 
ATOM   9393  C  CA  . HIS E  1 156 ? 11.504  32.010  -39.257  1.00 49.15  ? 182 HIS E CA  1 
ATOM   9394  C  C   . HIS E  1 156 ? 11.845  33.478  -39.477  1.00 52.50  ? 182 HIS E C   1 
ATOM   9395  O  O   . HIS E  1 156 ? 11.446  34.337  -38.683  1.00 50.50  ? 182 HIS E O   1 
ATOM   9396  C  CB  . HIS E  1 156 ? 9.995   31.754  -39.403  1.00 55.03  ? 182 HIS E CB  1 
ATOM   9397  C  CG  . HIS E  1 156 ? 9.405   32.189  -40.715  1.00 75.73  ? 182 HIS E CG  1 
ATOM   9398  N  ND1 . HIS E  1 156 ? 8.678   31.341  -41.525  1.00 83.34  ? 182 HIS E ND1 1 
ATOM   9399  C  CD2 . HIS E  1 156 ? 9.409   33.389  -41.345  1.00 72.54  ? 182 HIS E CD2 1 
ATOM   9400  C  CE1 . HIS E  1 156 ? 8.248   32.001  -42.588  1.00 79.83  ? 182 HIS E CE1 1 
ATOM   9401  N  NE2 . HIS E  1 156 ? 8.696   33.242  -42.513  1.00 75.49  ? 182 HIS E NE2 1 
ATOM   9402  N  N   . PHE E  1 157 ? 12.584  33.764  -40.547  1.00 53.38  ? 183 PHE E N   1 
ATOM   9403  C  CA  . PHE E  1 157 ? 13.025  35.121  -40.858  1.00 57.35  ? 183 PHE E CA  1 
ATOM   9404  C  C   . PHE E  1 157 ? 12.588  35.467  -42.274  1.00 63.01  ? 183 PHE E C   1 
ATOM   9405  O  O   . PHE E  1 157 ? 13.062  34.860  -43.240  1.00 63.93  ? 183 PHE E O   1 
ATOM   9406  C  CB  . PHE E  1 157 ? 14.542  35.260  -40.710  1.00 50.74  ? 183 PHE E CB  1 
ATOM   9407  C  CG  . PHE E  1 157 ? 15.039  35.023  -39.315  1.00 51.00  ? 183 PHE E CG  1 
ATOM   9408  C  CD1 . PHE E  1 157 ? 15.038  36.049  -38.384  1.00 52.06  ? 183 PHE E CD1 1 
ATOM   9409  C  CD2 . PHE E  1 157 ? 15.507  33.776  -38.931  1.00 50.31  ? 183 PHE E CD2 1 
ATOM   9410  C  CE1 . PHE E  1 157 ? 15.493  35.837  -37.097  1.00 43.92  ? 183 PHE E CE1 1 
ATOM   9411  C  CE2 . PHE E  1 157 ? 15.965  33.558  -37.643  1.00 45.67  ? 183 PHE E CE2 1 
ATOM   9412  C  CZ  . PHE E  1 157 ? 15.957  34.590  -36.726  1.00 40.41  ? 183 PHE E CZ  1 
ATOM   9413  N  N   . SER E  1 158 ? 11.683  36.434  -42.398  1.00 63.72  ? 184 SER E N   1 
ATOM   9414  C  CA  . SER E  1 158 ? 11.278  36.976  -43.689  1.00 66.93  ? 184 SER E CA  1 
ATOM   9415  C  C   . SER E  1 158 ? 11.677  38.443  -43.728  1.00 62.12  ? 184 SER E C   1 
ATOM   9416  O  O   . SER E  1 158 ? 11.171  39.248  -42.939  1.00 64.13  ? 184 SER E O   1 
ATOM   9417  C  CB  . SER E  1 158 ? 9.773   36.811  -43.916  1.00 70.13  ? 184 SER E CB  1 
ATOM   9418  O  OG  . SER E  1 158 ? 9.028   37.556  -42.969  1.00 70.99  ? 184 SER E OG  1 
ATOM   9419  N  N   . GLY E  1 159 ? 12.594  38.786  -44.632  1.00 58.21  ? 185 GLY E N   1 
ATOM   9420  C  CA  . GLY E  1 159 ? 13.128  40.121  -44.724  1.00 58.82  ? 185 GLY E CA  1 
ATOM   9421  C  C   . GLY E  1 159 ? 12.703  40.850  -45.985  1.00 71.23  ? 185 GLY E C   1 
ATOM   9422  O  O   . GLY E  1 159 ? 11.790  40.444  -46.707  1.00 73.89  ? 185 GLY E O   1 
ATOM   9423  N  N   . HIS E  1 160 ? 13.400  41.959  -46.243  1.00 67.81  ? 186 HIS E N   1 
ATOM   9424  C  CA  . HIS E  1 160 ? 13.090  42.787  -47.403  1.00 63.39  ? 186 HIS E CA  1 
ATOM   9425  C  C   . HIS E  1 160 ? 13.453  42.090  -48.709  1.00 74.66  ? 186 HIS E C   1 
ATOM   9426  O  O   . HIS E  1 160 ? 12.856  42.381  -49.752  1.00 79.05  ? 186 HIS E O   1 
ATOM   9427  C  CB  . HIS E  1 160 ? 13.820  44.125  -47.286  1.00 56.52  ? 186 HIS E CB  1 
ATOM   9428  C  CG  . HIS E  1 160 ? 13.459  45.109  -48.354  1.00 67.77  ? 186 HIS E CG  1 
ATOM   9429  N  ND1 . HIS E  1 160 ? 12.154  45.438  -48.652  1.00 69.29  ? 186 HIS E ND1 1 
ATOM   9430  C  CD2 . HIS E  1 160 ? 14.232  45.841  -49.190  1.00 62.51  ? 186 HIS E CD2 1 
ATOM   9431  C  CE1 . HIS E  1 160 ? 12.139  46.328  -49.629  1.00 66.11  ? 186 HIS E CE1 1 
ATOM   9432  N  NE2 . HIS E  1 160 ? 13.388  46.590  -49.973  1.00 58.31  ? 186 HIS E NE2 1 
ATOM   9433  N  N   . VAL E  1 161 ? 14.412  41.166  -48.675  1.00 65.13  ? 187 VAL E N   1 
ATOM   9434  C  CA  . VAL E  1 161 ? 14.874  40.494  -49.884  1.00 64.00  ? 187 VAL E CA  1 
ATOM   9435  C  C   . VAL E  1 161 ? 14.605  39.000  -49.789  1.00 63.58  ? 187 VAL E C   1 
ATOM   9436  O  O   . VAL E  1 161 ? 13.783  38.453  -50.534  1.00 59.13  ? 187 VAL E O   1 
ATOM   9437  C  CB  . VAL E  1 161 ? 16.371  40.760  -50.122  1.00 66.55  ? 187 VAL E CB  1 
ATOM   9438  C  CG1 . VAL E  1 161 ? 16.843  40.053  -51.384  1.00 67.49  ? 187 VAL E CG1 1 
ATOM   9439  C  CG2 . VAL E  1 161 ? 16.634  42.251  -50.198  1.00 68.07  ? 187 VAL E CG2 1 
ATOM   9440  N  N   . ALA E  1 162 ? 15.297  38.331  -48.875  1.00 68.24  ? 188 ALA E N   1 
ATOM   9441  C  CA  . ALA E  1 162 ? 15.254  36.885  -48.773  1.00 61.84  ? 188 ALA E CA  1 
ATOM   9442  C  C   . ALA E  1 162 ? 14.263  36.448  -47.701  1.00 60.83  ? 188 ALA E C   1 
ATOM   9443  O  O   . ALA E  1 162 ? 13.549  37.252  -47.097  1.00 66.78  ? 188 ALA E O   1 
ATOM   9444  C  CB  . ALA E  1 162 ? 16.646  36.328  -48.475  1.00 56.52  ? 188 ALA E CB  1 
ATOM   9445  N  N   . HIS E  1 163 ? 14.234  35.142  -47.464  1.00 61.16  ? 189 HIS E N   1 
ATOM   9446  C  CA  . HIS E  1 163 ? 13.361  34.553  -46.461  1.00 63.49  ? 189 HIS E CA  1 
ATOM   9447  C  C   . HIS E  1 163 ? 13.992  33.258  -45.971  1.00 63.55  ? 189 HIS E C   1 
ATOM   9448  O  O   . HIS E  1 163 ? 14.445  32.446  -46.784  1.00 63.30  ? 189 HIS E O   1 
ATOM   9449  C  CB  . HIS E  1 163 ? 11.969  34.301  -47.034  1.00 64.72  ? 189 HIS E CB  1 
ATOM   9450  C  CG  . HIS E  1 163 ? 11.206  33.262  -46.285  1.00 74.43  ? 189 HIS E CG  1 
ATOM   9451  N  ND1 . HIS E  1 163 ? 11.094  31.963  -46.729  1.00 74.37  ? 189 HIS E ND1 1 
ATOM   9452  C  CD2 . HIS E  1 163 ? 10.551  33.316  -45.101  1.00 70.41  ? 189 HIS E CD2 1 
ATOM   9453  C  CE1 . HIS E  1 163 ? 10.385  31.266  -45.860  1.00 77.08  ? 189 HIS E CE1 1 
ATOM   9454  N  NE2 . HIS E  1 163 ? 10.046  32.063  -44.863  1.00 75.73  ? 189 HIS E NE2 1 
ATOM   9455  N  N   . LEU E  1 164 ? 14.007  33.062  -44.648  1.00 61.73  ? 190 LEU E N   1 
ATOM   9456  C  CA  . LEU E  1 164 ? 14.867  32.068  -44.019  1.00 56.41  ? 190 LEU E CA  1 
ATOM   9457  C  C   . LEU E  1 164 ? 14.130  31.187  -43.017  1.00 55.08  ? 190 LEU E C   1 
ATOM   9458  O  O   . LEU E  1 164 ? 13.314  31.670  -42.225  1.00 51.34  ? 190 LEU E O   1 
ATOM   9459  C  CB  . LEU E  1 164 ? 16.052  32.756  -43.326  1.00 55.38  ? 190 LEU E CB  1 
ATOM   9460  C  CG  . LEU E  1 164 ? 17.251  32.715  -44.256  1.00 57.53  ? 190 LEU E CG  1 
ATOM   9461  C  CD1 . LEU E  1 164 ? 18.520  33.275  -43.655  1.00 59.85  ? 190 LEU E CD1 1 
ATOM   9462  C  CD2 . LEU E  1 164 ? 17.454  31.274  -44.631  1.00 60.52  ? 190 LEU E CD2 1 
ATOM   9463  N  N   . GLU E  1 165 ? 14.456  29.890  -43.047  1.00 51.61  ? 191 GLU E N   1 
ATOM   9464  C  CA  . GLU E  1 165 ? 13.955  28.895  -42.100  1.00 49.34  ? 191 GLU E CA  1 
ATOM   9465  C  C   . GLU E  1 165 ? 15.133  28.172  -41.464  1.00 46.11  ? 191 GLU E C   1 
ATOM   9466  O  O   . GLU E  1 165 ? 15.949  27.572  -42.173  1.00 41.93  ? 191 GLU E O   1 
ATOM   9467  C  CB  . GLU E  1 165 ? 13.048  27.873  -42.786  1.00 48.04  ? 191 GLU E CB  1 
ATOM   9468  C  CG  . GLU E  1 165 ? 11.838  28.447  -43.474  1.00 55.77  ? 191 GLU E CG  1 
ATOM   9469  C  CD  . GLU E  1 165 ? 10.755  28.854  -42.497  1.00 61.50  ? 191 GLU E CD  1 
ATOM   9470  O  OE1 . GLU E  1 165 ? 9.893   29.663  -42.886  1.00 57.57  ? 191 GLU E OE1 1 
ATOM   9471  O  OE2 . GLU E  1 165 ? 10.770  28.374  -41.345  1.00 58.14  ? 191 GLU E OE2 1 
ATOM   9472  N  N   . LEU E  1 166 ? 15.196  28.183  -40.135  1.00 40.88  ? 192 LEU E N   1 
ATOM   9473  C  CA  . LEU E  1 166 ? 16.309  27.541  -39.448  1.00 44.97  ? 192 LEU E CA  1 
ATOM   9474  C  C   . LEU E  1 166 ? 15.887  27.147  -38.040  1.00 45.73  ? 192 LEU E C   1 
ATOM   9475  O  O   . LEU E  1 166 ? 14.836  27.555  -37.540  1.00 43.51  ? 192 LEU E O   1 
ATOM   9476  C  CB  . LEU E  1 166 ? 17.543  28.453  -39.425  1.00 41.15  ? 192 LEU E CB  1 
ATOM   9477  C  CG  . LEU E  1 166 ? 17.366  29.895  -38.937  1.00 44.39  ? 192 LEU E CG  1 
ATOM   9478  C  CD1 . LEU E  1 166 ? 17.524  29.990  -37.428  1.00 44.06  ? 192 LEU E CD1 1 
ATOM   9479  C  CD2 . LEU E  1 166 ? 18.335  30.843  -39.643  1.00 38.79  ? 192 LEU E CD2 1 
ATOM   9480  N  N   . GLN E  1 167 ? 16.732  26.334  -37.408  1.00 43.70  ? 193 GLN E N   1 
ATOM   9481  C  CA  . GLN E  1 167 ? 16.552  25.930  -36.022  1.00 44.64  ? 193 GLN E CA  1 
ATOM   9482  C  C   . GLN E  1 167 ? 17.881  26.059  -35.293  1.00 42.57  ? 193 GLN E C   1 
ATOM   9483  O  O   . GLN E  1 167 ? 18.946  25.822  -35.870  1.00 43.25  ? 193 GLN E O   1 
ATOM   9484  C  CB  . GLN E  1 167 ? 16.043  24.491  -35.912  1.00 45.90  ? 193 GLN E CB  1 
ATOM   9485  C  CG  . GLN E  1 167 ? 15.071  24.081  -36.998  1.00 45.95  ? 193 GLN E CG  1 
ATOM   9486  C  CD  . GLN E  1 167 ? 14.807  22.594  -36.990  1.00 46.58  ? 193 GLN E CD  1 
ATOM   9487  O  OE1 . GLN E  1 167 ? 14.473  22.017  -35.955  1.00 45.36  ? 193 GLN E OE1 1 
ATOM   9488  N  NE2 . GLN E  1 167 ? 14.973  21.958  -38.143  1.00 55.85  ? 193 GLN E NE2 1 
ATOM   9489  N  N   . ILE E  1 168 ? 17.812  26.429  -34.015  1.00 39.55  ? 194 ILE E N   1 
ATOM   9490  C  CA  . ILE E  1 168 ? 18.995  26.591  -33.182  1.00 43.20  ? 194 ILE E CA  1 
ATOM   9491  C  C   . ILE E  1 168 ? 18.877  25.679  -31.961  1.00 49.01  ? 194 ILE E C   1 
ATOM   9492  O  O   . ILE E  1 168 ? 17.806  25.163  -31.641  1.00 44.84  ? 194 ILE E O   1 
ATOM   9493  C  CB  . ILE E  1 168 ? 19.216  28.055  -32.754  1.00 33.75  ? 194 ILE E CB  1 
ATOM   9494  C  CG1 . ILE E  1 168 ? 18.039  28.550  -31.916  1.00 30.10  ? 194 ILE E CG1 1 
ATOM   9495  C  CG2 . ILE E  1 168 ? 19.419  28.938  -33.973  1.00 40.53  ? 194 ILE E CG2 1 
ATOM   9496  C  CD1 . ILE E  1 168 ? 18.232  29.940  -31.367  1.00 28.76  ? 194 ILE E CD1 1 
ATOM   9497  N  N   . ARG E  1 169 ? 20.004  25.500  -31.274  1.00 47.61  ? 195 ARG E N   1 
ATOM   9498  C  CA  . ARG E  1 169 ? 20.102  24.559  -30.165  1.00 44.07  ? 195 ARG E CA  1 
ATOM   9499  C  C   . ARG E  1 169 ? 21.446  24.751  -29.475  1.00 44.55  ? 195 ARG E C   1 
ATOM   9500  O  O   . ARG E  1 169 ? 22.431  25.138  -30.109  1.00 39.33  ? 195 ARG E O   1 
ATOM   9501  C  CB  . ARG E  1 169 ? 19.946  23.113  -30.661  1.00 48.30  ? 195 ARG E CB  1 
ATOM   9502  C  CG  . ARG E  1 169 ? 20.114  22.023  -29.622  1.00 47.57  ? 195 ARG E CG  1 
ATOM   9503  C  CD  . ARG E  1 169 ? 19.463  20.736  -30.110  1.00 58.46  ? 195 ARG E CD  1 
ATOM   9504  N  NE  . ARG E  1 169 ? 20.032  19.546  -29.486  1.00 66.64  ? 195 ARG E NE  1 
ATOM   9505  C  CZ  . ARG E  1 169 ? 20.900  18.733  -30.081  1.00 66.92  ? 195 ARG E CZ  1 
ATOM   9506  N  NH1 . ARG E  1 169 ? 21.370  17.677  -29.432  1.00 73.81  ? 195 ARG E NH1 1 
ATOM   9507  N  NH2 . ARG E  1 169 ? 21.302  18.976  -31.322  1.00 58.05  ? 195 ARG E NH2 1 
ATOM   9508  N  N   . VAL E  1 170 ? 21.465  24.504  -28.167  1.00 46.27  ? 196 VAL E N   1 
ATOM   9509  C  CA  . VAL E  1 170 ? 22.695  24.438  -27.386  1.00 44.47  ? 196 VAL E CA  1 
ATOM   9510  C  C   . VAL E  1 170 ? 22.696  23.125  -26.622  1.00 47.92  ? 196 VAL E C   1 
ATOM   9511  O  O   . VAL E  1 170 ? 21.728  22.802  -25.925  1.00 47.85  ? 196 VAL E O   1 
ATOM   9512  C  CB  . VAL E  1 170 ? 22.848  25.623  -26.414  1.00 41.25  ? 196 VAL E CB  1 
ATOM   9513  C  CG1 . VAL E  1 170 ? 23.171  26.879  -27.176  1.00 41.55  ? 196 VAL E CG1 1 
ATOM   9514  C  CG2 . VAL E  1 170 ? 21.597  25.799  -25.584  1.00 44.96  ? 196 VAL E CG2 1 
ATOM   9515  N  N   . ARG E  1 171 ? 23.764  22.351  -26.775  1.00 51.45  ? 197 ARG E N   1 
ATOM   9516  C  CA  . ARG E  1 171 ? 23.890  21.075  -26.080  1.00 48.29  ? 197 ARG E CA  1 
ATOM   9517  C  C   . ARG E  1 171 ? 25.310  21.042  -25.495  1.00 56.30  ? 197 ARG E C   1 
ATOM   9518  O  O   . ARG E  1 171 ? 26.227  21.658  -26.055  1.00 51.56  ? 197 ARG E O   1 
ATOM   9519  C  CB  . ARG E  1 171 ? 23.408  19.811  -27.027  1.00 54.11  ? 197 ARG E CB  1 
ATOM   9520  C  CG  . ARG E  1 171 ? 24.238  19.179  -28.243  1.00 63.11  ? 197 ARG E CG  1 
ATOM   9521  C  CD  . ARG E  1 171 ? 24.013  19.895  -29.645  1.00 80.78  ? 197 ARG E CD  1 
ATOM   9522  N  NE  . ARG E  1 171 ? 25.064  19.415  -30.609  1.00 95.20  ? 197 ARG E NE  1 
ATOM   9523  C  CZ  . ARG E  1 171 ? 25.665  20.123  -31.596  1.00 86.07  ? 197 ARG E CZ  1 
ATOM   9524  N  NH1 . ARG E  1 171 ? 26.623  19.535  -32.355  1.00 90.34  ? 197 ARG E NH1 1 
ATOM   9525  N  NH2 . ARG E  1 171 ? 25.472  21.440  -31.743  1.00 79.52  ? 197 ARG E NH2 1 
ATOM   9526  N  N   . CYS E  1 172 ? 25.436  20.518  -24.259  1.00 56.42  ? 198 CYS E N   1 
ATOM   9527  C  CA  . CYS E  1 172 ? 26.675  20.608  -23.476  1.00 49.24  ? 198 CYS E CA  1 
ATOM   9528  C  C   . CYS E  1 172 ? 27.676  19.510  -23.837  1.00 44.48  ? 198 CYS E C   1 
ATOM   9529  O  O   . CYS E  1 172 ? 27.304  18.417  -24.272  1.00 45.64  ? 198 CYS E O   1 
ATOM   9530  C  CB  . CYS E  1 172 ? 26.425  20.516  -21.959  1.00 40.71  ? 198 CYS E CB  1 
ATOM   9531  S  SG  . CYS E  1 172 ? 25.381  21.743  -21.089  1.00 42.05  ? 198 CYS E SG  1 
ATOM   9532  N  N   . ASP E  1 173 ? 28.960  19.800  -23.608  1.00 43.64  ? 199 ASP E N   1 
ATOM   9533  C  CA  . ASP E  1 173 ? 29.980  18.760  -23.691  1.00 44.77  ? 199 ASP E CA  1 
ATOM   9534  C  C   . ASP E  1 173 ? 29.755  17.721  -22.596  1.00 48.76  ? 199 ASP E C   1 
ATOM   9535  O  O   . ASP E  1 173 ? 29.149  17.997  -21.557  1.00 49.69  ? 199 ASP E O   1 
ATOM   9536  C  CB  . ASP E  1 173 ? 31.391  19.344  -23.561  1.00 44.51  ? 199 ASP E CB  1 
ATOM   9537  C  CG  . ASP E  1 173 ? 31.806  20.165  -24.768  1.00 59.43  ? 199 ASP E CG  1 
ATOM   9538  O  OD1 . ASP E  1 173 ? 31.319  19.879  -25.885  1.00 63.83  ? 199 ASP E OD1 1 
ATOM   9539  O  OD2 . ASP E  1 173 ? 32.627  21.097  -24.599  1.00 56.27  ? 199 ASP E OD2 1 
ATOM   9540  N  N   . GLU E  1 174 ? 30.245  16.507  -22.839  1.00 46.41  ? 200 GLU E N   1 
ATOM   9541  C  CA  . GLU E  1 174 ? 30.066  15.447  -21.857  1.00 48.07  ? 200 GLU E CA  1 
ATOM   9542  C  C   . GLU E  1 174 ? 30.816  15.786  -20.574  1.00 48.89  ? 200 GLU E C   1 
ATOM   9543  O  O   . GLU E  1 174 ? 31.826  16.498  -20.587  1.00 46.15  ? 200 GLU E O   1 
ATOM   9544  C  CB  . GLU E  1 174 ? 30.533  14.103  -22.417  1.00 48.22  ? 200 GLU E CB  1 
ATOM   9545  C  CG  . GLU E  1 174 ? 32.026  13.870  -22.361  1.00 56.47  ? 200 GLU E CG  1 
ATOM   9546  C  CD  . GLU E  1 174 ? 32.417  12.524  -22.947  1.00 68.55  ? 200 GLU E CD  1 
ATOM   9547  O  OE1 . GLU E  1 174 ? 33.043  12.500  -24.031  1.00 72.36  ? 200 GLU E OE1 1 
ATOM   9548  O  OE2 . GLU E  1 174 ? 32.085  11.488  -22.330  1.00 63.93  ? 200 GLU E OE2 1 
ATOM   9549  N  N   . ASN E  1 175 ? 30.284  15.285  -19.455  1.00 47.56  ? 201 ASN E N   1 
ATOM   9550  C  CA  . ASN E  1 175 ? 30.760  15.557  -18.099  1.00 40.70  ? 201 ASN E CA  1 
ATOM   9551  C  C   . ASN E  1 175 ? 30.526  17.000  -17.672  1.00 41.60  ? 201 ASN E C   1 
ATOM   9552  O  O   . ASN E  1 175 ? 31.147  17.473  -16.715  1.00 39.49  ? 201 ASN E O   1 
ATOM   9553  C  CB  . ASN E  1 175 ? 32.240  15.190  -17.930  1.00 37.17  ? 201 ASN E CB  1 
ATOM   9554  C  CG  . ASN E  1 175 ? 32.511  13.725  -18.210  1.00 42.76  ? 201 ASN E CG  1 
ATOM   9555  O  OD1 . ASN E  1 175 ? 31.652  12.870  -17.991  1.00 42.56  ? 201 ASN E OD1 1 
ATOM   9556  N  ND2 . ASN E  1 175 ? 33.706  13.428  -18.703  1.00 50.96  ? 201 ASN E ND2 1 
ATOM   9557  N  N   . TYR E  1 176 ? 29.635  17.714  -18.358  1.00 44.03  ? 202 TYR E N   1 
ATOM   9558  C  CA  . TYR E  1 176 ? 29.239  19.061  -17.973  1.00 41.85  ? 202 TYR E CA  1 
ATOM   9559  C  C   . TYR E  1 176 ? 27.723  19.108  -17.846  1.00 39.92  ? 202 TYR E C   1 
ATOM   9560  O  O   . TYR E  1 176 ? 27.007  18.458  -18.614  1.00 46.72  ? 202 TYR E O   1 
ATOM   9561  C  CB  . TYR E  1 176 ? 29.733  20.107  -18.983  1.00 42.67  ? 202 TYR E CB  1 
ATOM   9562  C  CG  . TYR E  1 176 ? 31.233  20.316  -18.970  1.00 42.55  ? 202 TYR E CG  1 
ATOM   9563  C  CD1 . TYR E  1 176 ? 31.823  21.221  -18.095  1.00 44.40  ? 202 TYR E CD1 1 
ATOM   9564  C  CD2 . TYR E  1 176 ? 32.059  19.608  -19.832  1.00 43.18  ? 202 TYR E CD2 1 
ATOM   9565  C  CE1 . TYR E  1 176 ? 33.198  21.414  -18.079  1.00 40.37  ? 202 TYR E CE1 1 
ATOM   9566  C  CE2 . TYR E  1 176 ? 33.431  19.794  -19.824  1.00 43.25  ? 202 TYR E CE2 1 
ATOM   9567  C  CZ  . TYR E  1 176 ? 33.996  20.698  -18.948  1.00 41.60  ? 202 TYR E CZ  1 
ATOM   9568  O  OH  . TYR E  1 176 ? 35.363  20.879  -18.947  1.00 40.49  ? 202 TYR E OH  1 
ATOM   9569  N  N   . TYR E  1 177 ? 27.239  19.868  -16.869  1.00 38.79  ? 203 TYR E N   1 
ATOM   9570  C  CA  . TYR E  1 177 ? 25.835  19.831  -16.482  1.00 43.20  ? 203 TYR E CA  1 
ATOM   9571  C  C   . TYR E  1 177 ? 25.355  21.261  -16.261  1.00 43.02  ? 203 TYR E C   1 
ATOM   9572  O  O   . TYR E  1 177 ? 26.084  22.225  -16.516  1.00 46.01  ? 203 TYR E O   1 
ATOM   9573  C  CB  . TYR E  1 177 ? 25.644  18.952  -15.235  1.00 39.36  ? 203 TYR E CB  1 
ATOM   9574  C  CG  . TYR E  1 177 ? 26.068  17.511  -15.424  1.00 31.52  ? 203 TYR E CG  1 
ATOM   9575  C  CD1 . TYR E  1 177 ? 27.393  17.130  -15.272  1.00 34.28  ? 203 TYR E CD1 1 
ATOM   9576  C  CD2 . TYR E  1 177 ? 25.141  16.533  -15.750  1.00 36.93  ? 203 TYR E CD2 1 
ATOM   9577  C  CE1 . TYR E  1 177 ? 27.783  15.814  -15.445  1.00 39.29  ? 203 TYR E CE1 1 
ATOM   9578  C  CE2 . TYR E  1 177 ? 25.518  15.215  -15.922  1.00 36.50  ? 203 TYR E CE2 1 
ATOM   9579  C  CZ  . TYR E  1 177 ? 26.838  14.861  -15.769  1.00 39.17  ? 203 TYR E CZ  1 
ATOM   9580  O  OH  . TYR E  1 177 ? 27.214  13.548  -15.943  1.00 36.92  ? 203 TYR E OH  1 
ATOM   9581  N  N   . SER E  1 178 ? 24.114  21.386  -15.776  1.00 46.83  ? 204 SER E N   1 
ATOM   9582  C  CA  . SER E  1 178 ? 23.433  22.655  -15.514  1.00 44.29  ? 204 SER E CA  1 
ATOM   9583  C  C   . SER E  1 178 ? 23.174  23.435  -16.800  1.00 48.00  ? 204 SER E C   1 
ATOM   9584  O  O   . SER E  1 178 ? 23.786  23.165  -17.839  1.00 50.19  ? 204 SER E O   1 
ATOM   9585  C  CB  . SER E  1 178 ? 24.219  23.514  -14.511  1.00 48.55  ? 204 SER E CB  1 
ATOM   9586  O  OG  . SER E  1 178 ? 25.447  23.981  -15.045  1.00 48.81  ? 204 SER E OG  1 
ATOM   9587  N  N   . ALA E  1 179 ? 22.256  24.404  -16.738  1.00 46.49  ? 205 ALA E N   1 
ATOM   9588  C  CA  . ALA E  1 179 ? 21.879  25.161  -17.927  1.00 45.89  ? 205 ALA E CA  1 
ATOM   9589  C  C   . ALA E  1 179 ? 23.015  26.024  -18.461  1.00 51.35  ? 205 ALA E C   1 
ATOM   9590  O  O   . ALA E  1 179 ? 22.940  26.484  -19.607  1.00 45.42  ? 205 ALA E O   1 
ATOM   9591  C  CB  . ALA E  1 179 ? 20.659  26.033  -17.630  1.00 42.97  ? 205 ALA E CB  1 
ATOM   9592  N  N   . THR E  1 180 ? 24.058  26.255  -17.666  1.00 40.70  ? 206 THR E N   1 
ATOM   9593  C  CA  . THR E  1 180 ? 25.208  27.027  -18.114  1.00 45.28  ? 206 THR E CA  1 
ATOM   9594  C  C   . THR E  1 180 ? 26.326  26.159  -18.678  1.00 50.07  ? 206 THR E C   1 
ATOM   9595  O  O   . THR E  1 180 ? 27.313  26.706  -19.186  1.00 44.89  ? 206 THR E O   1 
ATOM   9596  C  CB  . THR E  1 180 ? 25.761  27.875  -16.963  1.00 46.58  ? 206 THR E CB  1 
ATOM   9597  O  OG1 . THR E  1 180 ? 26.500  27.038  -16.063  1.00 56.45  ? 206 THR E OG1 1 
ATOM   9598  C  CG2 . THR E  1 180 ? 24.624  28.544  -16.204  1.00 45.52  ? 206 THR E CG2 1 
ATOM   9599  N  N   . CYS E  1 181 ? 26.193  24.831  -18.597  1.00 50.02  ? 207 CYS E N   1 
ATOM   9600  C  CA  . CYS E  1 181 ? 27.210  23.867  -19.023  1.00 46.98  ? 207 CYS E CA  1 
ATOM   9601  C  C   . CYS E  1 181 ? 28.524  24.027  -18.261  1.00 44.91  ? 207 CYS E C   1 
ATOM   9602  O  O   . CYS E  1 181 ? 29.554  23.482  -18.673  1.00 44.08  ? 207 CYS E O   1 
ATOM   9603  C  CB  . CYS E  1 181 ? 27.477  23.947  -20.533  1.00 45.12  ? 207 CYS E CB  1 
ATOM   9604  S  SG  . CYS E  1 181 ? 26.073  23.593  -21.618  1.00 53.76  ? 207 CYS E SG  1 
ATOM   9605  N  N   . ASN E  1 182 ? 28.513  24.754  -17.145  1.00 43.44  ? 208 ASN E N   1 
ATOM   9606  C  CA  . ASN E  1 182 ? 29.734  25.106  -16.433  1.00 46.01  ? 208 ASN E CA  1 
ATOM   9607  C  C   . ASN E  1 182 ? 29.961  24.255  -15.185  1.00 46.85  ? 208 ASN E C   1 
ATOM   9608  O  O   . ASN E  1 182 ? 30.912  24.511  -14.440  1.00 49.76  ? 208 ASN E O   1 
ATOM   9609  C  CB  . ASN E  1 182 ? 29.703  26.592  -16.063  1.00 44.11  ? 208 ASN E CB  1 
ATOM   9610  C  CG  . ASN E  1 182 ? 31.089  27.206  -15.975  1.00 45.64  ? 208 ASN E CG  1 
ATOM   9611  O  OD1 . ASN E  1 182 ? 31.998  26.842  -16.727  1.00 40.20  ? 208 ASN E OD1 1 
ATOM   9612  N  ND2 . ASN E  1 182 ? 31.258  28.144  -15.048  1.00 34.63  ? 208 ASN E ND2 1 
ATOM   9613  N  N   . LYS E  1 183 ? 29.118  23.250  -14.944  1.00 41.09  ? 209 LYS E N   1 
ATOM   9614  C  CA  . LYS E  1 183 ? 29.228  22.385  -13.775  1.00 34.64  ? 209 LYS E CA  1 
ATOM   9615  C  C   . LYS E  1 183 ? 29.815  21.046  -14.213  1.00 42.58  ? 209 LYS E C   1 
ATOM   9616  O  O   . LYS E  1 183 ? 29.154  20.268  -14.908  1.00 43.90  ? 209 LYS E O   1 
ATOM   9617  C  CB  . LYS E  1 183 ? 27.864  22.202  -13.112  1.00 42.38  ? 209 LYS E CB  1 
ATOM   9618  C  CG  . LYS E  1 183 ? 27.904  21.459  -11.781  1.00 41.95  ? 209 LYS E CG  1 
ATOM   9619  C  CD  . LYS E  1 183 ? 26.505  21.282  -11.212  1.00 41.31  ? 209 LYS E CD  1 
ATOM   9620  C  CE  . LYS E  1 183 ? 26.533  20.616  -9.848   1.00 40.25  ? 209 LYS E CE  1 
ATOM   9621  N  NZ  . LYS E  1 183 ? 27.258  21.449  -8.850   1.00 50.96  ? 209 LYS E NZ  1 
ATOM   9622  N  N   . PHE E  1 184 ? 31.051  20.776  -13.803  1.00 40.29  ? 210 PHE E N   1 
ATOM   9623  C  CA  . PHE E  1 184 ? 31.781  19.597  -14.245  1.00 35.81  ? 210 PHE E CA  1 
ATOM   9624  C  C   . PHE E  1 184 ? 31.629  18.464  -13.239  1.00 38.34  ? 210 PHE E C   1 
ATOM   9625  O  O   . PHE E  1 184 ? 31.618  18.695  -12.028  1.00 43.39  ? 210 PHE E O   1 
ATOM   9626  C  CB  . PHE E  1 184 ? 33.260  19.927  -14.441  1.00 30.86  ? 210 PHE E CB  1 
ATOM   9627  C  CG  . PHE E  1 184 ? 34.077  18.780  -14.953  1.00 35.89  ? 210 PHE E CG  1 
ATOM   9628  C  CD1 . PHE E  1 184 ? 34.026  18.415  -16.288  1.00 39.68  ? 210 PHE E CD1 1 
ATOM   9629  C  CD2 . PHE E  1 184 ? 34.917  18.079  -14.105  1.00 31.92  ? 210 PHE E CD2 1 
ATOM   9630  C  CE1 . PHE E  1 184 ? 34.785  17.360  -16.765  1.00 39.11  ? 210 PHE E CE1 1 
ATOM   9631  C  CE2 . PHE E  1 184 ? 35.680  17.028  -14.575  1.00 38.39  ? 210 PHE E CE2 1 
ATOM   9632  C  CZ  . PHE E  1 184 ? 35.614  16.666  -15.907  1.00 41.35  ? 210 PHE E CZ  1 
ATOM   9633  N  N   . CYS E  1 185 ? 31.506  17.241  -13.749  1.00 37.84  ? 211 CYS E N   1 
ATOM   9634  C  CA  . CYS E  1 185 ? 31.452  16.051  -12.902  1.00 37.68  ? 211 CYS E CA  1 
ATOM   9635  C  C   . CYS E  1 185 ? 31.817  14.851  -13.754  1.00 41.80  ? 211 CYS E C   1 
ATOM   9636  O  O   . CYS E  1 185 ? 31.160  14.597  -14.768  1.00 43.80  ? 211 CYS E O   1 
ATOM   9637  C  CB  . CYS E  1 185 ? 30.065  15.860  -12.280  1.00 38.89  ? 211 CYS E CB  1 
ATOM   9638  S  SG  . CYS E  1 185 ? 29.986  14.573  -10.977  1.00 51.18  ? 211 CYS E SG  1 
ATOM   9639  N  N   . ARG E  1 186 ? 32.846  14.109  -13.343  1.00 43.43  ? 212 ARG E N   1 
ATOM   9640  C  CA  . ARG E  1 186 ? 33.229  12.887  -14.032  1.00 45.30  ? 212 ARG E CA  1 
ATOM   9641  C  C   . ARG E  1 186 ? 33.434  11.777  -13.008  1.00 48.62  ? 212 ARG E C   1 
ATOM   9642  O  O   . ARG E  1 186 ? 34.174  11.969  -12.027  1.00 48.13  ? 212 ARG E O   1 
ATOM   9643  C  CB  . ARG E  1 186 ? 34.500  13.091  -14.865  1.00 40.34  ? 212 ARG E CB  1 
ATOM   9644  C  CG  . ARG E  1 186 ? 34.733  11.994  -15.887  1.00 42.18  ? 212 ARG E CG  1 
ATOM   9645  C  CD  . ARG E  1 186 ? 36.013  11.226  -15.611  1.00 57.50  ? 212 ARG E CD  1 
ATOM   9646  N  NE  . ARG E  1 186 ? 37.199  12.045  -15.842  1.00 70.29  ? 212 ARG E NE  1 
ATOM   9647  C  CZ  . ARG E  1 186 ? 37.817  12.157  -17.014  1.00 73.89  ? 212 ARG E CZ  1 
ATOM   9648  N  NH1 . ARG E  1 186 ? 37.361  11.500  -18.074  1.00 67.11  ? 212 ARG E NH1 1 
ATOM   9649  N  NH2 . ARG E  1 186 ? 38.891  12.926  -17.128  1.00 74.81  ? 212 ARG E NH2 1 
ATOM   9650  N  N   . PRO E  1 187 ? 32.801  10.616  -13.187  1.00 50.49  ? 213 PRO E N   1 
ATOM   9651  C  CA  . PRO E  1 187 ? 32.981  9.519   -12.228  1.00 44.43  ? 213 PRO E CA  1 
ATOM   9652  C  C   . PRO E  1 187 ? 34.425  9.040   -12.182  1.00 46.66  ? 213 PRO E C   1 
ATOM   9653  O  O   . PRO E  1 187 ? 35.170  9.150   -13.159  1.00 51.25  ? 213 PRO E O   1 
ATOM   9654  C  CB  . PRO E  1 187 ? 32.052  8.422   -12.763  1.00 34.60  ? 213 PRO E CB  1 
ATOM   9655  C  CG  . PRO E  1 187 ? 31.067  9.131   -13.618  1.00 38.68  ? 213 PRO E CG  1 
ATOM   9656  C  CD  . PRO E  1 187 ? 31.805  10.289  -14.221  1.00 44.39  ? 213 PRO E CD  1 
ATOM   9657  N  N   . ARG E  1 188 ? 34.815  8.503   -11.028  1.00 44.79  ? 214 ARG E N   1 
ATOM   9658  C  CA  . ARG E  1 188 ? 36.139  7.910   -10.892  1.00 42.46  ? 214 ARG E CA  1 
ATOM   9659  C  C   . ARG E  1 188 ? 36.143  6.942   -9.719   1.00 41.25  ? 214 ARG E C   1 
ATOM   9660  O  O   . ARG E  1 188 ? 35.306  7.019   -8.818   1.00 36.40  ? 214 ARG E O   1 
ATOM   9661  C  CB  . ARG E  1 188 ? 37.224  8.976   -10.721  1.00 41.35  ? 214 ARG E CB  1 
ATOM   9662  C  CG  . ARG E  1 188 ? 37.145  9.765   -9.434   1.00 45.62  ? 214 ARG E CG  1 
ATOM   9663  C  CD  . ARG E  1 188 ? 38.154  10.896  -9.472   1.00 49.96  ? 214 ARG E CD  1 
ATOM   9664  N  NE  . ARG E  1 188 ? 39.401  10.466  -10.099  1.00 55.13  ? 214 ARG E NE  1 
ATOM   9665  C  CZ  . ARG E  1 188 ? 40.410  11.277  -10.401  1.00 59.65  ? 214 ARG E CZ  1 
ATOM   9666  N  NH1 . ARG E  1 188 ? 41.503  10.788  -10.966  1.00 55.86  ? 214 ARG E NH1 1 
ATOM   9667  N  NH2 . ARG E  1 188 ? 40.326  12.575  -10.139  1.00 66.28  ? 214 ARG E NH2 1 
ATOM   9668  N  N   . ASN E  1 189 ? 37.115  6.021   -9.753   1.00 44.51  ? 215 ASN E N   1 
ATOM   9669  C  CA  . ASN E  1 189 ? 37.248  4.936   -8.793   1.00 41.98  ? 215 ASN E CA  1 
ATOM   9670  C  C   . ASN E  1 189 ? 38.745  4.728   -8.547   1.00 40.90  ? 215 ASN E C   1 
ATOM   9671  O  O   . ASN E  1 189 ? 39.344  3.737   -8.957   1.00 42.21  ? 215 ASN E O   1 
ATOM   9672  C  CB  . ASN E  1 189 ? 36.578  3.656   -9.304   1.00 45.48  ? 215 ASN E CB  1 
ATOM   9673  C  CG  . ASN E  1 189 ? 36.540  2.550   -8.260   1.00 44.87  ? 215 ASN E CG  1 
ATOM   9674  O  OD1 . ASN E  1 189 ? 37.346  2.520   -7.333   1.00 42.70  ? 215 ASN E OD1 1 
ATOM   9675  N  ND2 . ASN E  1 189 ? 35.600  1.630   -8.416   1.00 50.42  ? 215 ASN E ND2 1 
ATOM   9676  N  N   . ASP E  1 190 ? 39.364  5.687   -7.868   1.00 41.84  ? 216 ASP E N   1 
ATOM   9677  C  CA  . ASP E  1 190 ? 40.795  5.638   -7.613   1.00 42.14  ? 216 ASP E CA  1 
ATOM   9678  C  C   . ASP E  1 190 ? 41.082  6.367   -6.303   1.00 44.15  ? 216 ASP E C   1 
ATOM   9679  O  O   . ASP E  1 190 ? 40.170  6.680   -5.531   1.00 36.38  ? 216 ASP E O   1 
ATOM   9680  C  CB  . ASP E  1 190 ? 41.573  6.236   -8.792   1.00 40.81  ? 216 ASP E CB  1 
ATOM   9681  C  CG  . ASP E  1 190 ? 41.167  7.662   -9.090   1.00 47.70  ? 216 ASP E CG  1 
ATOM   9682  O  OD1 . ASP E  1 190 ? 41.608  8.570   -8.355   1.00 48.24  ? 216 ASP E OD1 1 
ATOM   9683  O  OD2 . ASP E  1 190 ? 40.410  7.878   -10.061  1.00 53.39  ? 216 ASP E OD2 1 
ATOM   9684  N  N   . PHE E  1 191 ? 42.366  6.644   -6.062   1.00 49.05  ? 217 PHE E N   1 
ATOM   9685  C  CA  . PHE E  1 191 ? 42.782  7.294   -4.824   1.00 46.37  ? 217 PHE E CA  1 
ATOM   9686  C  C   . PHE E  1 191 ? 42.123  8.656   -4.644   1.00 50.01  ? 217 PHE E C   1 
ATOM   9687  O  O   . PHE E  1 191 ? 41.853  9.067   -3.510   1.00 55.96  ? 217 PHE E O   1 
ATOM   9688  C  CB  . PHE E  1 191 ? 44.308  7.418   -4.804   1.00 52.22  ? 217 PHE E CB  1 
ATOM   9689  C  CG  . PHE E  1 191 ? 44.828  8.452   -3.842   1.00 63.76  ? 217 PHE E CG  1 
ATOM   9690  C  CD1 . PHE E  1 191 ? 45.236  9.699   -4.298   1.00 65.05  ? 217 PHE E CD1 1 
ATOM   9691  C  CD2 . PHE E  1 191 ? 44.918  8.178   -2.485   1.00 66.74  ? 217 PHE E CD2 1 
ATOM   9692  C  CE1 . PHE E  1 191 ? 45.718  10.654  -3.419   1.00 67.59  ? 217 PHE E CE1 1 
ATOM   9693  C  CE2 . PHE E  1 191 ? 45.399  9.130   -1.600   1.00 66.24  ? 217 PHE E CE2 1 
ATOM   9694  C  CZ  . PHE E  1 191 ? 45.800  10.369  -2.068   1.00 69.55  ? 217 PHE E CZ  1 
ATOM   9695  N  N   . PHE E  1 192 ? 41.841  9.362   -5.737   1.00 51.86  ? 218 PHE E N   1 
ATOM   9696  C  CA  . PHE E  1 192 ? 41.273  10.701  -5.649   1.00 54.18  ? 218 PHE E CA  1 
ATOM   9697  C  C   . PHE E  1 192 ? 39.763  10.709  -5.429   1.00 56.53  ? 218 PHE E C   1 
ATOM   9698  O  O   . PHE E  1 192 ? 39.179  11.796  -5.349   1.00 60.91  ? 218 PHE E O   1 
ATOM   9699  C  CB  . PHE E  1 192 ? 41.617  11.503  -6.910   1.00 64.27  ? 218 PHE E CB  1 
ATOM   9700  C  CG  . PHE E  1 192 ? 43.040  11.996  -6.948   1.00 74.23  ? 218 PHE E CG  1 
ATOM   9701  C  CD1 . PHE E  1 192 ? 43.388  13.196  -6.340   1.00 71.38  ? 218 PHE E CD1 1 
ATOM   9702  C  CD2 . PHE E  1 192 ? 44.028  11.262  -7.588   1.00 65.28  ? 218 PHE E CD2 1 
ATOM   9703  C  CE1 . PHE E  1 192 ? 44.693  13.654  -6.367   1.00 55.31  ? 218 PHE E CE1 1 
ATOM   9704  C  CE2 . PHE E  1 192 ? 45.336  11.714  -7.618   1.00 67.12  ? 218 PHE E CE2 1 
ATOM   9705  C  CZ  . PHE E  1 192 ? 45.668  12.913  -7.006   1.00 66.13  ? 218 PHE E CZ  1 
ATOM   9706  N  N   . GLY E  1 193 ? 39.123  9.555   -5.328   1.00 49.41  ? 219 GLY E N   1 
ATOM   9707  C  CA  . GLY E  1 193 ? 37.702  9.492   -5.039   1.00 45.28  ? 219 GLY E CA  1 
ATOM   9708  C  C   . GLY E  1 193 ? 37.059  8.241   -5.605   1.00 38.56  ? 219 GLY E C   1 
ATOM   9709  O  O   . GLY E  1 193 ? 37.595  7.558   -6.475   1.00 40.26  ? 219 GLY E O   1 
ATOM   9710  N  N   . HIS E  1 194 ? 35.862  7.937   -5.091   1.00 33.26  ? 220 HIS E N   1 
ATOM   9711  C  CA  . HIS E  1 194 ? 35.069  6.777   -5.519   1.00 38.42  ? 220 HIS E CA  1 
ATOM   9712  C  C   . HIS E  1 194 ? 33.609  7.230   -5.582   1.00 36.58  ? 220 HIS E C   1 
ATOM   9713  O  O   . HIS E  1 194 ? 32.874  7.127   -4.597   1.00 34.15  ? 220 HIS E O   1 
ATOM   9714  C  CB  . HIS E  1 194 ? 35.250  5.589   -4.574   1.00 33.93  ? 220 HIS E CB  1 
ATOM   9715  C  CG  . HIS E  1 194 ? 36.681  5.251   -4.287   1.00 34.41  ? 220 HIS E CG  1 
ATOM   9716  N  ND1 . HIS E  1 194 ? 37.372  4.283   -4.984   1.00 34.66  ? 220 HIS E ND1 1 
ATOM   9717  C  CD2 . HIS E  1 194 ? 37.549  5.751   -3.376   1.00 30.79  ? 220 HIS E CD2 1 
ATOM   9718  C  CE1 . HIS E  1 194 ? 38.606  4.204   -4.517   1.00 33.34  ? 220 HIS E CE1 1 
ATOM   9719  N  NE2 . HIS E  1 194 ? 38.739  5.084   -3.541   1.00 31.02  ? 220 HIS E NE2 1 
ATOM   9720  N  N   . TYR E  1 195 ? 33.187  7.724   -6.743   1.00 39.05  ? 221 TYR E N   1 
ATOM   9721  C  CA  . TYR E  1 195 ? 31.851  8.290   -6.859   1.00 37.98  ? 221 TYR E CA  1 
ATOM   9722  C  C   . TYR E  1 195 ? 31.365  8.204   -8.297   1.00 37.56  ? 221 TYR E C   1 
ATOM   9723  O  O   . TYR E  1 195 ? 32.134  7.949   -9.228   1.00 38.11  ? 221 TYR E O   1 
ATOM   9724  C  CB  . TYR E  1 195 ? 31.816  9.746   -6.374   1.00 39.38  ? 221 TYR E CB  1 
ATOM   9725  C  CG  . TYR E  1 195 ? 32.764  10.678  -7.102   1.00 38.25  ? 221 TYR E CG  1 
ATOM   9726  C  CD1 . TYR E  1 195 ? 32.380  11.318  -8.277   1.00 42.03  ? 221 TYR E CD1 1 
ATOM   9727  C  CD2 . TYR E  1 195 ? 34.039  10.930  -6.606   1.00 39.04  ? 221 TYR E CD2 1 
ATOM   9728  C  CE1 . TYR E  1 195 ? 33.244  12.175  -8.942   1.00 45.76  ? 221 TYR E CE1 1 
ATOM   9729  C  CE2 . TYR E  1 195 ? 34.909  11.784  -7.263   1.00 44.86  ? 221 TYR E CE2 1 
ATOM   9730  C  CZ  . TYR E  1 195 ? 34.506  12.404  -8.430   1.00 47.10  ? 221 TYR E CZ  1 
ATOM   9731  O  OH  . TYR E  1 195 ? 35.368  13.254  -9.081   1.00 39.13  ? 221 TYR E OH  1 
ATOM   9732  N  N   . THR E  1 196 ? 30.064  8.422   -8.457   1.00 36.62  ? 222 THR E N   1 
ATOM   9733  C  CA  . THR E  1 196 ? 29.415  8.604   -9.746   1.00 32.91  ? 222 THR E CA  1 
ATOM   9734  C  C   . THR E  1 196 ? 28.704  9.954   -9.756   1.00 33.30  ? 222 THR E C   1 
ATOM   9735  O  O   . THR E  1 196 ? 28.599  10.634  -8.733   1.00 30.93  ? 222 THR E O   1 
ATOM   9736  C  CB  . THR E  1 196 ? 28.421  7.472   -10.033  1.00 31.61  ? 222 THR E CB  1 
ATOM   9737  O  OG1 . THR E  1 196 ? 27.393  7.470   -9.033   1.00 39.41  ? 222 THR E OG1 1 
ATOM   9738  C  CG2 . THR E  1 196 ? 29.131  6.130   -10.015  1.00 33.39  ? 222 THR E CG2 1 
ATOM   9739  N  N   . CYS E  1 197 ? 28.216  10.347  -10.929  1.00 42.30  ? 223 CYS E N   1 
ATOM   9740  C  CA  . CYS E  1 197 ? 27.517  11.616  -11.100  1.00 37.93  ? 223 CYS E CA  1 
ATOM   9741  C  C   . CYS E  1 197 ? 26.058  11.349  -11.435  1.00 31.00  ? 223 CYS E C   1 
ATOM   9742  O  O   . CYS E  1 197 ? 25.759  10.495  -12.274  1.00 34.57  ? 223 CYS E O   1 
ATOM   9743  C  CB  . CYS E  1 197 ? 28.163  12.454  -12.204  1.00 34.07  ? 223 CYS E CB  1 
ATOM   9744  S  SG  . CYS E  1 197 ? 29.918  12.790  -11.965  1.00 46.33  ? 223 CYS E SG  1 
ATOM   9745  N  N   . ASP E  1 198 ? 25.154  12.069  -10.775  1.00 30.99  ? 224 ASP E N   1 
ATOM   9746  C  CA  . ASP E  1 198 ? 23.741  11.998  -11.121  1.00 40.18  ? 224 ASP E CA  1 
ATOM   9747  C  C   . ASP E  1 198 ? 23.463  12.979  -12.261  1.00 46.67  ? 224 ASP E C   1 
ATOM   9748  O  O   . ASP E  1 198 ? 24.381  13.542  -12.864  1.00 46.89  ? 224 ASP E O   1 
ATOM   9749  C  CB  . ASP E  1 198 ? 22.866  12.252  -9.895   1.00 42.92  ? 224 ASP E CB  1 
ATOM   9750  C  CG  . ASP E  1 198 ? 23.231  13.528  -9.159   1.00 49.02  ? 224 ASP E CG  1 
ATOM   9751  O  OD1 . ASP E  1 198 ? 23.923  14.392  -9.741   1.00 50.47  ? 224 ASP E OD1 1 
ATOM   9752  O  OD2 . ASP E  1 198 ? 22.807  13.668  -7.991   1.00 43.00  ? 224 ASP E OD2 1 
ATOM   9753  N  N   . GLN E  1 199 ? 22.186  13.201  -12.575  1.00 50.62  ? 225 GLN E N   1 
ATOM   9754  C  CA  . GLN E  1 199 ? 21.852  14.021  -13.734  1.00 56.36  ? 225 GLN E CA  1 
ATOM   9755  C  C   . GLN E  1 199 ? 21.902  15.515  -13.445  1.00 51.78  ? 225 GLN E C   1 
ATOM   9756  O  O   . GLN E  1 199 ? 21.750  16.314  -14.374  1.00 51.24  ? 225 GLN E O   1 
ATOM   9757  C  CB  . GLN E  1 199 ? 20.472  13.637  -14.275  1.00 58.77  ? 225 GLN E CB  1 
ATOM   9758  C  CG  . GLN E  1 199 ? 20.373  12.180  -14.713  1.00 65.38  ? 225 GLN E CG  1 
ATOM   9759  C  CD  . GLN E  1 199 ? 19.376  11.962  -15.841  1.00 74.04  ? 225 GLN E CD  1 
ATOM   9760  O  OE1 . GLN E  1 199 ? 18.987  12.902  -16.536  1.00 78.94  ? 225 GLN E OE1 1 
ATOM   9761  N  NE2 . GLN E  1 199 ? 18.966  10.714  -16.032  1.00 73.55  ? 225 GLN E NE2 1 
ATOM   9762  N  N   . TYR E  1 200 ? 22.121  15.912  -12.197  1.00 49.84  ? 226 TYR E N   1 
ATOM   9763  C  CA  . TYR E  1 200 ? 22.278  17.316  -11.849  1.00 49.94  ? 226 TYR E CA  1 
ATOM   9764  C  C   . TYR E  1 200 ? 23.737  17.748  -11.789  1.00 46.21  ? 226 TYR E C   1 
ATOM   9765  O  O   . TYR E  1 200 ? 24.009  18.935  -11.587  1.00 46.43  ? 226 TYR E O   1 
ATOM   9766  C  CB  . TYR E  1 200 ? 21.597  17.603  -10.507  1.00 56.81  ? 226 TYR E CB  1 
ATOM   9767  C  CG  . TYR E  1 200 ? 20.107  17.357  -10.512  1.00 59.13  ? 226 TYR E CG  1 
ATOM   9768  C  CD1 . TYR E  1 200 ? 19.590  16.088  -10.275  1.00 52.30  ? 226 TYR E CD1 1 
ATOM   9769  C  CD2 . TYR E  1 200 ? 19.215  18.396  -10.749  1.00 57.90  ? 226 TYR E CD2 1 
ATOM   9770  C  CE1 . TYR E  1 200 ? 18.226  15.863  -10.278  1.00 63.02  ? 226 TYR E CE1 1 
ATOM   9771  C  CE2 . TYR E  1 200 ? 17.851  18.180  -10.754  1.00 57.27  ? 226 TYR E CE2 1 
ATOM   9772  C  CZ  . TYR E  1 200 ? 17.361  16.914  -10.518  1.00 65.90  ? 226 TYR E CZ  1 
ATOM   9773  O  OH  . TYR E  1 200 ? 16.001  16.700  -10.522  1.00 72.39  ? 226 TYR E OH  1 
ATOM   9774  N  N   . GLY E  1 201 ? 24.676  16.817  -11.962  1.00 41.84  ? 227 GLY E N   1 
ATOM   9775  C  CA  . GLY E  1 201 ? 26.090  17.104  -11.865  1.00 37.79  ? 227 GLY E CA  1 
ATOM   9776  C  C   . GLY E  1 201 ? 26.689  16.930  -10.486  1.00 54.07  ? 227 GLY E C   1 
ATOM   9777  O  O   . GLY E  1 201 ? 27.873  17.243  -10.299  1.00 53.75  ? 227 GLY E O   1 
ATOM   9778  N  N   . ASN E  1 202 ? 25.915  16.447  -9.517   1.00 53.23  ? 228 ASN E N   1 
ATOM   9779  C  CA  . ASN E  1 202 ? 26.403  16.246  -8.162   1.00 44.08  ? 228 ASN E CA  1 
ATOM   9780  C  C   . ASN E  1 202 ? 27.074  14.886  -8.037   1.00 47.62  ? 228 ASN E C   1 
ATOM   9781  O  O   . ASN E  1 202 ? 26.762  13.948  -8.778   1.00 43.69  ? 228 ASN E O   1 
ATOM   9782  C  CB  . ASN E  1 202 ? 25.261  16.357  -7.153   1.00 43.38  ? 228 ASN E CB  1 
ATOM   9783  C  CG  . ASN E  1 202 ? 24.645  17.740  -7.123   1.00 44.37  ? 228 ASN E CG  1 
ATOM   9784  O  OD1 . ASN E  1 202 ? 25.301  18.730  -7.445   1.00 46.92  ? 228 ASN E OD1 1 
ATOM   9785  N  ND2 . ASN E  1 202 ? 23.379  17.817  -6.732   1.00 42.55  ? 228 ASN E ND2 1 
ATOM   9786  N  N   . LYS E  1 203 ? 28.009  14.793  -7.093   1.00 47.41  ? 229 LYS E N   1 
ATOM   9787  C  CA  . LYS E  1 203 ? 28.700  13.540  -6.822   1.00 42.03  ? 229 LYS E CA  1 
ATOM   9788  C  C   . LYS E  1 203 ? 27.862  12.642  -5.925   1.00 41.67  ? 229 LYS E C   1 
ATOM   9789  O  O   . LYS E  1 203 ? 27.260  13.099  -4.951   1.00 46.46  ? 229 LYS E O   1 
ATOM   9790  C  CB  . LYS E  1 203 ? 30.044  13.798  -6.154   1.00 37.02  ? 229 LYS E CB  1 
ATOM   9791  C  CG  . LYS E  1 203 ? 31.073  14.408  -7.048   1.00 35.78  ? 229 LYS E CG  1 
ATOM   9792  C  CD  . LYS E  1 203 ? 32.328  14.663  -6.258   1.00 49.40  ? 229 LYS E CD  1 
ATOM   9793  C  CE  . LYS E  1 203 ? 33.267  15.496  -7.068   1.00 55.11  ? 229 LYS E CE  1 
ATOM   9794  N  NZ  . LYS E  1 203 ? 34.086  16.289  -6.169   1.00 62.22  ? 229 LYS E NZ  1 
ATOM   9795  N  N   . ALA E  1 204 ? 27.837  11.355  -6.257   1.00 40.37  ? 230 ALA E N   1 
ATOM   9796  C  CA  . ALA E  1 204 ? 27.172  10.338  -5.454   1.00 36.89  ? 230 ALA E CA  1 
ATOM   9797  C  C   . ALA E  1 204 ? 28.194  9.267   -5.109   1.00 39.81  ? 230 ALA E C   1 
ATOM   9798  O  O   . ALA E  1 204 ? 28.793  8.665   -6.007   1.00 35.54  ? 230 ALA E O   1 
ATOM   9799  C  CB  . ALA E  1 204 ? 25.982  9.731   -6.199   1.00 35.74  ? 230 ALA E CB  1 
ATOM   9800  N  N   . CYS E  1 205 ? 28.390  9.038   -3.812   1.00 41.12  ? 231 CYS E N   1 
ATOM   9801  C  CA  . CYS E  1 205 ? 29.370  8.062   -3.357   1.00 33.83  ? 231 CYS E CA  1 
ATOM   9802  C  C   . CYS E  1 205 ? 29.012  6.663   -3.840   1.00 33.24  ? 231 CYS E C   1 
ATOM   9803  O  O   . CYS E  1 205 ? 27.852  6.246   -3.787   1.00 28.66  ? 231 CYS E O   1 
ATOM   9804  C  CB  . CYS E  1 205 ? 29.459  8.077   -1.828   1.00 37.37  ? 231 CYS E CB  1 
ATOM   9805  S  SG  . CYS E  1 205 ? 30.043  9.639   -1.128   1.00 54.68  ? 231 CYS E SG  1 
ATOM   9806  N  N   . MET E  1 206 ? 30.018  5.945   -4.334   1.00 31.85  ? 232 MET E N   1 
ATOM   9807  C  CA  . MET E  1 206 ? 29.858  4.514   -4.535   1.00 30.55  ? 232 MET E CA  1 
ATOM   9808  C  C   . MET E  1 206 ? 29.633  3.842   -3.187   1.00 34.69  ? 232 MET E C   1 
ATOM   9809  O  O   . MET E  1 206 ? 30.141  4.289   -2.155   1.00 34.72  ? 232 MET E O   1 
ATOM   9810  C  CB  . MET E  1 206 ? 31.085  3.923   -5.227   1.00 31.51  ? 232 MET E CB  1 
ATOM   9811  C  CG  . MET E  1 206 ? 31.474  4.635   -6.510   1.00 30.79  ? 232 MET E CG  1 
ATOM   9812  S  SD  . MET E  1 206 ? 32.960  3.949   -7.271   1.00 33.44  ? 232 MET E SD  1 
ATOM   9813  C  CE  . MET E  1 206 ? 32.363  2.356   -7.834   1.00 34.14  ? 232 MET E CE  1 
ATOM   9814  N  N   . ASP E  1 207 ? 28.847  2.768   -3.197   1.00 35.85  ? 233 ASP E N   1 
ATOM   9815  C  CA  . ASP E  1 207 ? 28.484  2.115   -1.947   1.00 43.57  ? 233 ASP E CA  1 
ATOM   9816  C  C   . ASP E  1 207 ? 29.730  1.589   -1.237   1.00 40.07  ? 233 ASP E C   1 
ATOM   9817  O  O   . ASP E  1 207 ? 30.653  1.062   -1.868   1.00 35.47  ? 233 ASP E O   1 
ATOM   9818  C  CB  . ASP E  1 207 ? 27.486  0.984   -2.212   1.00 40.85  ? 233 ASP E CB  1 
ATOM   9819  C  CG  . ASP E  1 207 ? 26.983  0.337   -0.930   1.00 61.79  ? 233 ASP E CG  1 
ATOM   9820  O  OD1 . ASP E  1 207 ? 27.003  -0.915  -0.845   1.00 70.46  ? 233 ASP E OD1 1 
ATOM   9821  O  OD2 . ASP E  1 207 ? 26.572  1.075   0.000    1.00 63.88  ? 233 ASP E OD2 1 
ATOM   9822  N  N   . GLY E  1 208 ? 29.748  1.740   0.091    1.00 32.89  ? 234 GLY E N   1 
ATOM   9823  C  CA  . GLY E  1 208 ? 30.904  1.411   0.898    1.00 30.05  ? 234 GLY E CA  1 
ATOM   9824  C  C   . GLY E  1 208 ? 31.829  2.576   1.171    1.00 35.40  ? 234 GLY E C   1 
ATOM   9825  O  O   . GLY E  1 208 ? 32.782  2.427   1.951    1.00 32.33  ? 234 GLY E O   1 
ATOM   9826  N  N   . TRP E  1 209 ? 31.578  3.726   0.556    1.00 32.79  ? 235 TRP E N   1 
ATOM   9827  C  CA  . TRP E  1 209 ? 32.405  4.909   0.696    1.00 29.07  ? 235 TRP E CA  1 
ATOM   9828  C  C   . TRP E  1 209 ? 31.560  6.060   1.216    1.00 36.29  ? 235 TRP E C   1 
ATOM   9829  O  O   . TRP E  1 209 ? 30.354  6.135   0.963    1.00 40.42  ? 235 TRP E O   1 
ATOM   9830  C  CB  . TRP E  1 209 ? 33.045  5.308   -0.639   1.00 33.39  ? 235 TRP E CB  1 
ATOM   9831  C  CG  . TRP E  1 209 ? 33.980  4.282   -1.204   1.00 33.58  ? 235 TRP E CG  1 
ATOM   9832  C  CD1 . TRP E  1 209 ? 33.665  3.266   -2.059   1.00 31.61  ? 235 TRP E CD1 1 
ATOM   9833  C  CD2 . TRP E  1 209 ? 35.388  4.180   -0.961   1.00 30.16  ? 235 TRP E CD2 1 
ATOM   9834  N  NE1 . TRP E  1 209 ? 34.788  2.534   -2.358   1.00 26.98  ? 235 TRP E NE1 1 
ATOM   9835  C  CE2 . TRP E  1 209 ? 35.860  3.077   -1.698   1.00 28.86  ? 235 TRP E CE2 1 
ATOM   9836  C  CE3 . TRP E  1 209 ? 36.295  4.915   -0.190   1.00 30.91  ? 235 TRP E CE3 1 
ATOM   9837  C  CZ2 . TRP E  1 209 ? 37.201  2.692   -1.692   1.00 28.02  ? 235 TRP E CZ2 1 
ATOM   9838  C  CZ3 . TRP E  1 209 ? 37.626  4.528   -0.182   1.00 32.20  ? 235 TRP E CZ3 1 
ATOM   9839  C  CH2 . TRP E  1 209 ? 38.066  3.425   -0.928   1.00 25.50  ? 235 TRP E CH2 1 
ATOM   9840  N  N   . MET E  1 210 ? 32.210  6.960   1.944    1.00 37.10  ? 236 MET E N   1 
ATOM   9841  C  CA  . MET E  1 210 ? 31.543  8.139   2.468    1.00 37.18  ? 236 MET E CA  1 
ATOM   9842  C  C   . MET E  1 210 ? 32.554  9.270   2.540    1.00 39.42  ? 236 MET E C   1 
ATOM   9843  O  O   . MET E  1 210 ? 33.747  9.084   2.287    1.00 31.82  ? 236 MET E O   1 
ATOM   9844  C  CB  . MET E  1 210 ? 30.924  7.876   3.846    1.00 36.56  ? 236 MET E CB  1 
ATOM   9845  C  CG  . MET E  1 210 ? 31.930  7.801   4.985    1.00 30.42  ? 236 MET E CG  1 
ATOM   9846  S  SD  . MET E  1 210 ? 31.143  7.451   6.571    1.00 45.07  ? 236 MET E SD  1 
ATOM   9847  C  CE  . MET E  1 210 ? 32.430  7.961   7.716    1.00 41.54  ? 236 MET E CE  1 
ATOM   9848  N  N   . GLY E  1 211 ? 32.061  10.447  2.889    1.00 39.85  ? 237 GLY E N   1 
ATOM   9849  C  CA  . GLY E  1 211 ? 32.902  11.600  3.109    1.00 46.48  ? 237 GLY E CA  1 
ATOM   9850  C  C   . GLY E  1 211 ? 32.779  12.617  1.993    1.00 51.52  ? 237 GLY E C   1 
ATOM   9851  O  O   . GLY E  1 211 ? 31.856  12.591  1.171    1.00 52.42  ? 237 GLY E O   1 
ATOM   9852  N  N   . LYS E  1 212 ? 33.758  13.522  1.975    1.00 62.66  ? 238 LYS E N   1 
ATOM   9853  C  CA  . LYS E  1 212 ? 33.675  14.715  1.143    1.00 72.24  ? 238 LYS E CA  1 
ATOM   9854  C  C   . LYS E  1 212 ? 33.644  14.334  -0.326   1.00 71.88  ? 238 LYS E C   1 
ATOM   9855  O  O   . LYS E  1 212 ? 32.702  14.642  -1.045   1.00 67.17  ? 238 LYS E O   1 
ATOM   9856  C  CB  . LYS E  1 212 ? 34.825  15.668  1.534    1.00 77.76  ? 238 LYS E CB  1 
ATOM   9857  C  CG  . LYS E  1 212 ? 36.259  15.497  1.014    1.00 76.61  ? 238 LYS E CG  1 
ATOM   9858  C  CD  . LYS E  1 212 ? 36.543  16.396  -0.157   1.00 76.71  ? 238 LYS E CD  1 
ATOM   9859  C  CE  . LYS E  1 212 ? 37.971  16.262  -0.720   1.00 78.67  ? 238 LYS E CE  1 
ATOM   9860  N  NZ  . LYS E  1 212 ? 38.069  16.948  -2.062   1.00 84.94  ? 238 LYS E NZ  1 
ATOM   9861  N  N   . GLU E  1 213 ? 34.601  13.554  -0.765   1.00 66.73  ? 239 GLU E N   1 
ATOM   9862  C  CA  . GLU E  1 213 ? 34.528  12.988  -2.097   1.00 66.32  ? 239 GLU E CA  1 
ATOM   9863  C  C   . GLU E  1 213 ? 34.447  11.487  -2.071   1.00 55.10  ? 239 GLU E C   1 
ATOM   9864  O  O   . GLU E  1 213 ? 35.025  10.863  -2.960   1.00 58.35  ? 239 GLU E O   1 
ATOM   9865  C  CB  . GLU E  1 213 ? 35.749  13.374  -2.923   1.00 68.85  ? 239 GLU E CB  1 
ATOM   9866  C  CG  . GLU E  1 213 ? 36.034  14.913  -2.998   1.00 74.61  ? 239 GLU E CG  1 
ATOM   9867  C  CD  . GLU E  1 213 ? 36.332  15.382  -4.364   1.00 83.14  ? 239 GLU E CD  1 
ATOM   9868  O  OE1 . GLU E  1 213 ? 37.210  14.780  -4.892   1.00 81.24  ? 239 GLU E OE1 1 
ATOM   9869  O  OE2 . GLU E  1 213 ? 35.606  16.242  -4.937   1.00 86.33  ? 239 GLU E OE2 1 
ATOM   9870  N  N   . CYS E  1 214 ? 33.775  10.899  -1.077   1.00 43.33  ? 240 CYS E N   1 
ATOM   9871  C  CA  . CYS E  1 214 ? 33.659  9.458   -0.985   1.00 46.82  ? 240 CYS E CA  1 
ATOM   9872  C  C   . CYS E  1 214 ? 35.054  8.847   -1.003   1.00 44.56  ? 240 CYS E C   1 
ATOM   9873  O  O   . CYS E  1 214 ? 35.400  8.005   -1.838   1.00 41.48  ? 240 CYS E O   1 
ATOM   9874  C  CB  . CYS E  1 214 ? 32.779  8.936   -2.110   1.00 48.23  ? 240 CYS E CB  1 
ATOM   9875  S  SG  . CYS E  1 214 ? 31.473  10.137  -2.478   1.00 51.10  ? 240 CYS E SG  1 
ATOM   9876  N  N   . LYS E  1 215 ? 35.887  9.354   -0.095   1.00 45.60  ? 241 LYS E N   1 
ATOM   9877  C  CA  . LYS E  1 215 ? 37.256  8.897   0.039    1.00 39.98  ? 241 LYS E CA  1 
ATOM   9878  C  C   . LYS E  1 215 ? 37.482  8.031   1.266    1.00 39.87  ? 241 LYS E C   1 
ATOM   9879  O  O   . LYS E  1 215 ? 38.481  7.311   1.308    1.00 36.91  ? 241 LYS E O   1 
ATOM   9880  C  CB  . LYS E  1 215 ? 38.220  10.093  0.082    1.00 42.66  ? 241 LYS E CB  1 
ATOM   9881  C  CG  . LYS E  1 215 ? 39.241  10.098  -1.060   1.00 54.47  ? 241 LYS E CG  1 
ATOM   9882  C  CD  . LYS E  1 215 ? 40.201  11.280  -0.974   1.00 56.81  ? 241 LYS E CD  1 
ATOM   9883  C  CE  . LYS E  1 215 ? 39.561  12.556  -1.508   1.00 58.93  ? 241 LYS E CE  1 
ATOM   9884  N  NZ  . LYS E  1 215 ? 40.300  13.783  -1.085   1.00 63.46  ? 241 LYS E NZ  1 
ATOM   9885  N  N   . GLU E  1 216 ? 36.575  8.062   2.244    1.00 39.92  ? 242 GLU E N   1 
ATOM   9886  C  CA  . GLU E  1 216 ? 36.700  7.282   3.470    1.00 37.95  ? 242 GLU E CA  1 
ATOM   9887  C  C   . GLU E  1 216 ? 35.911  5.984   3.334    1.00 37.89  ? 242 GLU E C   1 
ATOM   9888  O  O   . GLU E  1 216 ? 34.693  6.009   3.120    1.00 32.56  ? 242 GLU E O   1 
ATOM   9889  C  CB  . GLU E  1 216 ? 36.201  8.075   4.677    1.00 34.13  ? 242 GLU E CB  1 
ATOM   9890  C  CG  . GLU E  1 216 ? 36.515  9.556   4.635    1.00 41.35  ? 242 GLU E CG  1 
ATOM   9891  C  CD  . GLU E  1 216 ? 35.751  10.336  5.691    1.00 58.39  ? 242 GLU E CD  1 
ATOM   9892  O  OE1 . GLU E  1 216 ? 34.731  9.817   6.199    1.00 54.27  ? 242 GLU E OE1 1 
ATOM   9893  O  OE2 . GLU E  1 216 ? 36.171  11.469  6.013    1.00 65.32  ? 242 GLU E OE2 1 
ATOM   9894  N  N   . ALA E  1 217 ? 36.601  4.858   3.482    1.00 33.93  ? 243 ALA E N   1 
ATOM   9895  C  CA  . ALA E  1 217 ? 35.966  3.557   3.364    1.00 28.34  ? 243 ALA E CA  1 
ATOM   9896  C  C   . ALA E  1 217 ? 35.256  3.181   4.659    1.00 30.12  ? 243 ALA E C   1 
ATOM   9897  O  O   . ALA E  1 217 ? 35.619  3.631   5.750    1.00 26.08  ? 243 ALA E O   1 
ATOM   9898  C  CB  . ALA E  1 217 ? 36.998  2.490   3.001    1.00 28.03  ? 243 ALA E CB  1 
ATOM   9899  N  N   . VAL E  1 218 ? 34.224  2.356   4.527    1.00 29.29  ? 244 VAL E N   1 
ATOM   9900  C  CA  . VAL E  1 218 ? 33.453  1.869   5.662    1.00 25.45  ? 244 VAL E CA  1 
ATOM   9901  C  C   . VAL E  1 218 ? 33.933  0.456   5.957    1.00 29.10  ? 244 VAL E C   1 
ATOM   9902  O  O   . VAL E  1 218 ? 33.729  -0.460  5.152    1.00 34.37  ? 244 VAL E O   1 
ATOM   9903  C  CB  . VAL E  1 218 ? 31.947  1.907   5.380    1.00 23.77  ? 244 VAL E CB  1 
ATOM   9904  C  CG1 . VAL E  1 218 ? 31.175  1.378   6.571    1.00 28.70  ? 244 VAL E CG1 1 
ATOM   9905  C  CG2 . VAL E  1 218 ? 31.512  3.322   5.051    1.00 27.51  ? 244 VAL E CG2 1 
ATOM   9906  N  N   . CYS E  1 219 ? 34.577  0.274   7.108    1.00 25.33  ? 245 CYS E N   1 
ATOM   9907  C  CA  . CYS E  1 219 ? 35.150  -1.018  7.449    1.00 28.64  ? 245 CYS E CA  1 
ATOM   9908  C  C   . CYS E  1 219 ? 34.045  -2.010  7.802    1.00 29.69  ? 245 CYS E C   1 
ATOM   9909  O  O   . CYS E  1 219 ? 32.861  -1.668  7.884    1.00 30.65  ? 245 CYS E O   1 
ATOM   9910  C  CB  . CYS E  1 219 ? 36.147  -0.880  8.600    1.00 27.70  ? 245 CYS E CB  1 
ATOM   9911  S  SG  . CYS E  1 219 ? 37.446  0.366   8.352    1.00 33.36  ? 245 CYS E SG  1 
ATOM   9912  N  N   . LYS E  1 220 ? 34.454  -3.262  8.009    1.00 29.47  ? 246 LYS E N   1 
ATOM   9913  C  CA  . LYS E  1 220 ? 33.524  -4.328  8.355    1.00 23.52  ? 246 LYS E CA  1 
ATOM   9914  C  C   . LYS E  1 220 ? 32.762  -3.984  9.629    1.00 26.90  ? 246 LYS E C   1 
ATOM   9915  O  O   . LYS E  1 220 ? 33.330  -3.463  10.592   1.00 31.10  ? 246 LYS E O   1 
ATOM   9916  C  CB  . LYS E  1 220 ? 34.285  -5.644  8.536    1.00 25.66  ? 246 LYS E CB  1 
ATOM   9917  C  CG  . LYS E  1 220 ? 33.406  -6.841  8.868    1.00 28.09  ? 246 LYS E CG  1 
ATOM   9918  C  CD  . LYS E  1 220 ? 34.228  -8.012  9.389    1.00 25.38  ? 246 LYS E CD  1 
ATOM   9919  C  CE  . LYS E  1 220 ? 35.261  -8.472  8.375    1.00 22.34  ? 246 LYS E CE  1 
ATOM   9920  N  NZ  . LYS E  1 220 ? 36.022  -9.659  8.857    1.00 26.24  ? 246 LYS E NZ  1 
ATOM   9921  N  N   . GLN E  1 221 ? 31.464  -4.278  9.628    1.00 26.46  ? 247 GLN E N   1 
ATOM   9922  C  CA  . GLN E  1 221 ? 30.624  -4.001  10.787   1.00 32.59  ? 247 GLN E CA  1 
ATOM   9923  C  C   . GLN E  1 221 ? 31.045  -4.905  11.940   1.00 36.16  ? 247 GLN E C   1 
ATOM   9924  O  O   . GLN E  1 221 ? 30.947  -6.134  11.849   1.00 30.13  ? 247 GLN E O   1 
ATOM   9925  C  CB  . GLN E  1 221 ? 29.151  -4.193  10.434   1.00 35.89  ? 247 GLN E CB  1 
ATOM   9926  C  CG  . GLN E  1 221 ? 28.658  -3.315  9.279    1.00 47.11  ? 247 GLN E CG  1 
ATOM   9927  C  CD  . GLN E  1 221 ? 28.599  -1.822  9.623    1.00 50.26  ? 247 GLN E CD  1 
ATOM   9928  O  OE1 . GLN E  1 221 ? 28.431  -0.981  8.734    1.00 58.72  ? 247 GLN E OE1 1 
ATOM   9929  N  NE2 . GLN E  1 221 ? 28.725  -1.492  10.913   1.00 36.04  ? 247 GLN E NE2 1 
ATOM   9930  N  N   . GLY E  1 222 ? 31.522  -4.291  13.024   1.00 31.76  ? 248 GLY E N   1 
ATOM   9931  C  CA  . GLY E  1 222 ? 32.079  -4.994  14.162   1.00 27.97  ? 248 GLY E CA  1 
ATOM   9932  C  C   . GLY E  1 222 ? 33.577  -4.842  14.316   1.00 32.73  ? 248 GLY E C   1 
ATOM   9933  O  O   . GLY E  1 222 ? 34.121  -5.262  15.346   1.00 30.40  ? 248 GLY E O   1 
ATOM   9934  N  N   . CYS E  1 223 ? 34.258  -4.255  13.333   1.00 34.60  ? 249 CYS E N   1 
ATOM   9935  C  CA  . CYS E  1 223 ? 35.710  -4.134  13.370   1.00 31.61  ? 249 CYS E CA  1 
ATOM   9936  C  C   . CYS E  1 223 ? 36.143  -3.209  14.498   1.00 31.32  ? 249 CYS E C   1 
ATOM   9937  O  O   . CYS E  1 223 ? 35.643  -2.088  14.623   1.00 35.49  ? 249 CYS E O   1 
ATOM   9938  C  CB  . CYS E  1 223 ? 36.225  -3.606  12.030   1.00 28.70  ? 249 CYS E CB  1 
ATOM   9939  S  SG  . CYS E  1 223 ? 38.030  -3.565  11.832   1.00 21.96  ? 249 CYS E SG  1 
ATOM   9940  N  N   . ASN E  1 224 ? 37.076  -3.682  15.320   1.00 28.10  ? 250 ASN E N   1 
ATOM   9941  C  CA  . ASN E  1 224 ? 37.612  -2.894  16.428   1.00 23.23  ? 250 ASN E CA  1 
ATOM   9942  C  C   . ASN E  1 224 ? 38.492  -1.801  15.846   1.00 23.24  ? 250 ASN E C   1 
ATOM   9943  O  O   . ASN E  1 224 ? 39.627  -2.054  15.438   1.00 28.17  ? 250 ASN E O   1 
ATOM   9944  C  CB  . ASN E  1 224 ? 38.387  -3.794  17.386   1.00 26.03  ? 250 ASN E CB  1 
ATOM   9945  C  CG  . ASN E  1 224 ? 38.833  -3.074  18.651   1.00 27.15  ? 250 ASN E CG  1 
ATOM   9946  O  OD1 . ASN E  1 224 ? 39.431  -1.996  18.596   1.00 24.38  ? 250 ASN E OD1 1 
ATOM   9947  N  ND2 . ASN E  1 224 ? 38.541  -3.675  19.803   1.00 26.75  ? 250 ASN E ND2 1 
ATOM   9948  N  N   . LEU E  1 225 ? 37.976  -0.577  15.801   1.00 22.36  ? 251 LEU E N   1 
ATOM   9949  C  CA  . LEU E  1 225 ? 38.692  0.506   15.137   1.00 25.61  ? 251 LEU E CA  1 
ATOM   9950  C  C   . LEU E  1 225 ? 39.748  1.149   16.023   1.00 25.21  ? 251 LEU E C   1 
ATOM   9951  O  O   . LEU E  1 225 ? 40.343  2.154   15.621   1.00 26.63  ? 251 LEU E O   1 
ATOM   9952  C  CB  . LEU E  1 225 ? 37.707  1.562   14.630   1.00 26.70  ? 251 LEU E CB  1 
ATOM   9953  C  CG  . LEU E  1 225 ? 36.656  1.036   13.647   1.00 23.90  ? 251 LEU E CG  1 
ATOM   9954  C  CD1 . LEU E  1 225 ? 35.953  2.181   12.970   1.00 24.41  ? 251 LEU E CD1 1 
ATOM   9955  C  CD2 . LEU E  1 225 ? 37.277  0.106   12.613   1.00 26.89  ? 251 LEU E CD2 1 
ATOM   9956  N  N   . LEU E  1 226 ? 39.988  0.598   17.211   1.00 26.05  ? 252 LEU E N   1 
ATOM   9957  C  CA  . LEU E  1 226 ? 41.140  0.981   18.013   1.00 22.06  ? 252 LEU E CA  1 
ATOM   9958  C  C   . LEU E  1 226 ? 42.391  0.211   17.613   1.00 27.04  ? 252 LEU E C   1 
ATOM   9959  O  O   . LEU E  1 226 ? 43.494  0.770   17.652   1.00 31.88  ? 252 LEU E O   1 
ATOM   9960  C  CB  . LEU E  1 226 ? 40.847  0.762   19.500   1.00 23.33  ? 252 LEU E CB  1 
ATOM   9961  C  CG  . LEU E  1 226 ? 41.940  1.163   20.496   1.00 26.65  ? 252 LEU E CG  1 
ATOM   9962  C  CD1 . LEU E  1 226 ? 42.032  2.674   20.643   1.00 17.65  ? 252 LEU E CD1 1 
ATOM   9963  C  CD2 . LEU E  1 226 ? 41.710  0.505   21.845   1.00 27.45  ? 252 LEU E CD2 1 
ATOM   9964  N  N   . HIS E  1 227 ? 42.244  -1.055  17.216   1.00 23.15  ? 253 HIS E N   1 
ATOM   9965  C  CA  . HIS E  1 227 ? 43.363  -1.868  16.761   1.00 22.88  ? 253 HIS E CA  1 
ATOM   9966  C  C   . HIS E  1 227 ? 43.242  -2.285  15.301   1.00 25.92  ? 253 HIS E C   1 
ATOM   9967  O  O   . HIS E  1 227 ? 44.146  -2.956  14.788   1.00 25.57  ? 253 HIS E O   1 
ATOM   9968  C  CB  . HIS E  1 227 ? 43.507  -3.124  17.636   1.00 23.67  ? 253 HIS E CB  1 
ATOM   9969  C  CG  . HIS E  1 227 ? 43.503  -2.847  19.111   1.00 31.96  ? 253 HIS E CG  1 
ATOM   9970  N  ND1 . HIS E  1 227 ? 44.409  -2.000  19.715   1.00 32.08  ? 253 HIS E ND1 1 
ATOM   9971  C  CD2 . HIS E  1 227 ? 42.712  -3.320  20.104   1.00 26.36  ? 253 HIS E CD2 1 
ATOM   9972  C  CE1 . HIS E  1 227 ? 44.167  -1.953  21.013   1.00 26.69  ? 253 HIS E CE1 1 
ATOM   9973  N  NE2 . HIS E  1 227 ? 43.145  -2.748  21.276   1.00 27.16  ? 253 HIS E NE2 1 
ATOM   9974  N  N   . GLY E  1 228 ? 42.155  -1.914  14.615   1.00 24.97  ? 254 GLY E N   1 
ATOM   9975  C  CA  . GLY E  1 228 ? 41.946  -2.314  13.242   1.00 24.22  ? 254 GLY E CA  1 
ATOM   9976  C  C   . GLY E  1 228 ? 41.496  -1.150  12.374   1.00 29.19  ? 254 GLY E C   1 
ATOM   9977  O  O   . GLY E  1 228 ? 41.129  -0.076  12.862   1.00 26.39  ? 254 GLY E O   1 
ATOM   9978  N  N   . GLY E  1 229 ? 41.530  -1.389  11.070   1.00 27.92  ? 255 GLY E N   1 
ATOM   9979  C  CA  . GLY E  1 229 ? 41.132  -0.380  10.111   1.00 22.23  ? 255 GLY E CA  1 
ATOM   9980  C  C   . GLY E  1 229 ? 40.938  -0.993  8.743    1.00 25.98  ? 255 GLY E C   1 
ATOM   9981  O  O   . GLY E  1 229 ? 40.971  -2.215  8.579    1.00 27.50  ? 255 GLY E O   1 
ATOM   9982  N  N   . CYS E  1 230 ? 40.739  -0.122  7.755    1.00 18.88  ? 256 CYS E N   1 
ATOM   9983  C  CA  . CYS E  1 230 ? 40.518  -0.569  6.387    1.00 23.33  ? 256 CYS E CA  1 
ATOM   9984  C  C   . CYS E  1 230 ? 40.850  0.558   5.420    1.00 27.37  ? 256 CYS E C   1 
ATOM   9985  O  O   . CYS E  1 230 ? 40.695  1.739   5.740    1.00 24.24  ? 256 CYS E O   1 
ATOM   9986  C  CB  . CYS E  1 230 ? 39.072  -1.026  6.175    1.00 26.44  ? 256 CYS E CB  1 
ATOM   9987  S  SG  . CYS E  1 230 ? 37.851  0.300   6.350    1.00 32.83  ? 256 CYS E SG  1 
ATOM   9988  N  N   . THR E  1 231 ? 41.301  0.175   4.227    1.00 28.24  ? 257 THR E N   1 
ATOM   9989  C  CA  . THR E  1 231 ? 41.502  1.130   3.149    1.00 27.48  ? 257 THR E CA  1 
ATOM   9990  C  C   . THR E  1 231 ? 40.548  0.934   1.982    1.00 33.71  ? 257 THR E C   1 
ATOM   9991  O  O   . THR E  1 231 ? 40.396  1.855   1.172    1.00 38.07  ? 257 THR E O   1 
ATOM   9992  C  CB  . THR E  1 231 ? 42.948  1.069   2.635    1.00 26.58  ? 257 THR E CB  1 
ATOM   9993  O  OG1 . THR E  1 231 ? 43.325  -0.294  2.411    1.00 32.62  ? 257 THR E OG1 1 
ATOM   9994  C  CG2 . THR E  1 231 ? 43.890  1.694   3.645    1.00 24.11  ? 257 THR E CG2 1 
ATOM   9995  N  N   . VAL E  1 232 ? 39.917  -0.234  1.872    1.00 32.26  ? 258 VAL E N   1 
ATOM   9996  C  CA  . VAL E  1 232 ? 38.823  -0.471  0.930    1.00 34.34  ? 258 VAL E CA  1 
ATOM   9997  C  C   . VAL E  1 232 ? 37.635  -1.003  1.727    1.00 39.10  ? 258 VAL E C   1 
ATOM   9998  O  O   . VAL E  1 232 ? 37.831  -1.635  2.777    1.00 33.91  ? 258 VAL E O   1 
ATOM   9999  C  CB  . VAL E  1 232 ? 39.238  -1.435  -0.196   1.00 35.14  ? 258 VAL E CB  1 
ATOM   10000 C  CG1 . VAL E  1 232 ? 40.575  -1.021  -0.790   1.00 39.92  ? 258 VAL E CG1 1 
ATOM   10001 C  CG2 . VAL E  1 232 ? 39.279  -2.874  0.301    1.00 37.45  ? 258 VAL E CG2 1 
ATOM   10002 N  N   . PRO E  1 233 ? 36.397  -0.781  1.275    1.00 40.66  ? 259 PRO E N   1 
ATOM   10003 C  CA  . PRO E  1 233 ? 35.237  -1.051  2.137    1.00 36.93  ? 259 PRO E CA  1 
ATOM   10004 C  C   . PRO E  1 233 ? 35.109  -2.519  2.516    1.00 39.30  ? 259 PRO E C   1 
ATOM   10005 O  O   . PRO E  1 233 ? 35.548  -3.416  1.791    1.00 38.38  ? 259 PRO E O   1 
ATOM   10006 C  CB  . PRO E  1 233 ? 34.048  -0.594  1.282    1.00 33.54  ? 259 PRO E CB  1 
ATOM   10007 C  CG  . PRO E  1 233 ? 34.629  0.350   0.291    1.00 32.05  ? 259 PRO E CG  1 
ATOM   10008 C  CD  . PRO E  1 233 ? 35.995  -0.180  -0.007   1.00 30.22  ? 259 PRO E CD  1 
ATOM   10009 N  N   . GLY E  1 234 ? 34.494  -2.751  3.679    1.00 33.22  ? 260 GLY E N   1 
ATOM   10010 C  CA  . GLY E  1 234 ? 34.204  -4.084  4.167    1.00 26.07  ? 260 GLY E CA  1 
ATOM   10011 C  C   . GLY E  1 234 ? 35.379  -4.840  4.743    1.00 30.79  ? 260 GLY E C   1 
ATOM   10012 O  O   . GLY E  1 234 ? 35.192  -5.965  5.222    1.00 33.46  ? 260 GLY E O   1 
ATOM   10013 N  N   . GLU E  1 235 ? 36.575  -4.265  4.718    1.00 34.25  ? 261 GLU E N   1 
ATOM   10014 C  CA  . GLU E  1 235 ? 37.784  -4.909  5.203    1.00 29.92  ? 261 GLU E CA  1 
ATOM   10015 C  C   . GLU E  1 235 ? 37.989  -4.618  6.691    1.00 28.11  ? 261 GLU E C   1 
ATOM   10016 O  O   . GLU E  1 235 ? 37.386  -3.706  7.262    1.00 25.90  ? 261 GLU E O   1 
ATOM   10017 C  CB  . GLU E  1 235 ? 38.988  -4.422  4.393    1.00 36.32  ? 261 GLU E CB  1 
ATOM   10018 C  CG  . GLU E  1 235 ? 40.136  -5.410  4.272    1.00 43.02  ? 261 GLU E CG  1 
ATOM   10019 C  CD  . GLU E  1 235 ? 41.362  -4.806  3.593    1.00 60.23  ? 261 GLU E CD  1 
ATOM   10020 O  OE1 . GLU E  1 235 ? 41.503  -3.560  3.594    1.00 48.36  ? 261 GLU E OE1 1 
ATOM   10021 O  OE2 . GLU E  1 235 ? 42.186  -5.581  3.056    1.00 70.94  ? 261 GLU E OE2 1 
ATOM   10022 N  N   . CYS E  1 236 ? 38.859  -5.418  7.322    1.00 28.91  ? 262 CYS E N   1 
ATOM   10023 C  CA  . CYS E  1 236 ? 39.237  -5.188  8.720    1.00 26.59  ? 262 CYS E CA  1 
ATOM   10024 C  C   . CYS E  1 236 ? 40.632  -5.792  8.929    1.00 29.31  ? 262 CYS E C   1 
ATOM   10025 O  O   . CYS E  1 236 ? 40.798  -6.911  9.419    1.00 34.12  ? 262 CYS E O   1 
ATOM   10026 C  CB  . CYS E  1 236 ? 38.212  -5.777  9.690    1.00 22.14  ? 262 CYS E CB  1 
ATOM   10027 S  SG  . CYS E  1 236 ? 38.538  -5.507  11.470   1.00 23.96  ? 262 CYS E SG  1 
ATOM   10028 N  N   . ARG E  1 237 ? 41.659  -5.031  8.551    1.00 28.73  ? 263 ARG E N   1 
ATOM   10029 C  CA  . ARG E  1 237 ? 43.040  -5.476  8.704    1.00 35.32  ? 263 ARG E CA  1 
ATOM   10030 C  C   . ARG E  1 237 ? 43.634  -4.913  9.991    1.00 30.55  ? 263 ARG E C   1 
ATOM   10031 O  O   . ARG E  1 237 ? 43.400  -3.754  10.346   1.00 30.08  ? 263 ARG E O   1 
ATOM   10032 C  CB  . ARG E  1 237 ? 43.883  -5.061  7.496    1.00 35.23  ? 263 ARG E CB  1 
ATOM   10033 C  CG  . ARG E  1 237 ? 44.013  -3.570  7.304    1.00 34.30  ? 263 ARG E CG  1 
ATOM   10034 C  CD  . ARG E  1 237 ? 44.763  -3.231  6.023    1.00 52.89  ? 263 ARG E CD  1 
ATOM   10035 N  NE  . ARG E  1 237 ? 45.930  -4.084  5.803    1.00 53.66  ? 263 ARG E NE  1 
ATOM   10036 C  CZ  . ARG E  1 237 ? 46.020  -4.988  4.831    1.00 56.09  ? 263 ARG E CZ  1 
ATOM   10037 N  NH1 . ARG E  1 237 ? 45.008  -5.155  3.988    1.00 64.46  ? 263 ARG E NH1 1 
ATOM   10038 N  NH2 . ARG E  1 237 ? 47.119  -5.721  4.699    1.00 39.33  ? 263 ARG E NH2 1 
ATOM   10039 N  N   . CYS E  1 238 ? 44.415  -5.737  10.683   1.00 25.61  ? 264 CYS E N   1 
ATOM   10040 C  CA  . CYS E  1 238 ? 44.750  -5.495  12.080   1.00 29.72  ? 264 CYS E CA  1 
ATOM   10041 C  C   . CYS E  1 238 ? 46.114  -4.831  12.246   1.00 28.93  ? 264 CYS E C   1 
ATOM   10042 O  O   . CYS E  1 238 ? 47.010  -4.972  11.408   1.00 24.63  ? 264 CYS E O   1 
ATOM   10043 C  CB  . CYS E  1 238 ? 44.714  -6.807  12.864   1.00 22.06  ? 264 CYS E CB  1 
ATOM   10044 S  SG  . CYS E  1 238 ? 43.252  -7.814  12.521   1.00 29.63  ? 264 CYS E SG  1 
ATOM   10045 N  N   . SER E  1 239 ? 46.261  -4.103  13.352   1.00 26.96  ? 265 SER E N   1 
ATOM   10046 C  CA  . SER E  1 239 ? 47.544  -3.521  13.713   1.00 25.78  ? 265 SER E CA  1 
ATOM   10047 C  C   . SER E  1 239 ? 48.521  -4.614  14.136   1.00 25.01  ? 265 SER E C   1 
ATOM   10048 O  O   . SER E  1 239 ? 48.142  -5.756  14.411   1.00 25.88  ? 265 SER E O   1 
ATOM   10049 C  CB  . SER E  1 239 ? 47.382  -2.509  14.845   1.00 23.19  ? 265 SER E CB  1 
ATOM   10050 O  OG  . SER E  1 239 ? 46.385  -1.555  14.545   1.00 26.35  ? 265 SER E OG  1 
ATOM   10051 N  N   . TYR E  1 240 ? 49.797  -4.245  14.198   1.00 21.01  ? 266 TYR E N   1 
ATOM   10052 C  CA  . TYR E  1 240 ? 50.847  -5.200  14.537   1.00 23.53  ? 266 TYR E CA  1 
ATOM   10053 C  C   . TYR E  1 240 ? 50.692  -5.613  15.996   1.00 28.30  ? 266 TYR E C   1 
ATOM   10054 O  O   . TYR E  1 240 ? 50.816  -4.783  16.903   1.00 28.88  ? 266 TYR E O   1 
ATOM   10055 C  CB  . TYR E  1 240 ? 52.221  -4.591  14.267   1.00 25.68  ? 266 TYR E CB  1 
ATOM   10056 C  CG  . TYR E  1 240 ? 53.353  -5.579  14.388   1.00 26.98  ? 266 TYR E CG  1 
ATOM   10057 C  CD1 . TYR E  1 240 ? 53.436  -6.679  13.540   1.00 27.39  ? 266 TYR E CD1 1 
ATOM   10058 C  CD2 . TYR E  1 240 ? 54.338  -5.418  15.352   1.00 29.42  ? 266 TYR E CD2 1 
ATOM   10059 C  CE1 . TYR E  1 240 ? 54.472  -7.592  13.654   1.00 32.00  ? 266 TYR E CE1 1 
ATOM   10060 C  CE2 . TYR E  1 240 ? 55.380  -6.321  15.472   1.00 31.07  ? 266 TYR E CE2 1 
ATOM   10061 C  CZ  . TYR E  1 240 ? 55.442  -7.407  14.623   1.00 31.39  ? 266 TYR E CZ  1 
ATOM   10062 O  OH  . TYR E  1 240 ? 56.478  -8.304  14.749   1.00 24.93  ? 266 TYR E OH  1 
ATOM   10063 N  N   . GLY E  1 241 ? 50.405  -6.895  16.224   1.00 22.55  ? 267 GLY E N   1 
ATOM   10064 C  CA  . GLY E  1 241 ? 50.105  -7.400  17.549   1.00 22.98  ? 267 GLY E CA  1 
ATOM   10065 C  C   . GLY E  1 241 ? 48.680  -7.876  17.734   1.00 27.80  ? 267 GLY E C   1 
ATOM   10066 O  O   . GLY E  1 241 ? 48.346  -8.380  18.815   1.00 23.74  ? 267 GLY E O   1 
ATOM   10067 N  N   . TRP E  1 242 ? 47.834  -7.747  16.716   1.00 27.55  ? 268 TRP E N   1 
ATOM   10068 C  CA  . TRP E  1 242 ? 46.426  -8.087  16.826   1.00 26.52  ? 268 TRP E CA  1 
ATOM   10069 C  C   . TRP E  1 242 ? 46.028  -8.985  15.668   1.00 25.14  ? 268 TRP E C   1 
ATOM   10070 O  O   . TRP E  1 242 ? 46.686  -9.016  14.625   1.00 30.44  ? 268 TRP E O   1 
ATOM   10071 C  CB  . TRP E  1 242 ? 45.558  -6.827  16.853   1.00 28.47  ? 268 TRP E CB  1 
ATOM   10072 C  CG  . TRP E  1 242 ? 45.825  -5.967  18.042   1.00 26.47  ? 268 TRP E CG  1 
ATOM   10073 C  CD1 . TRP E  1 242 ? 46.652  -4.884  18.106   1.00 25.64  ? 268 TRP E CD1 1 
ATOM   10074 C  CD2 . TRP E  1 242 ? 45.273  -6.130  19.351   1.00 26.15  ? 268 TRP E CD2 1 
ATOM   10075 N  NE1 . TRP E  1 242 ? 46.642  -4.355  19.376   1.00 24.74  ? 268 TRP E NE1 1 
ATOM   10076 C  CE2 . TRP E  1 242 ? 45.801  -5.105  20.158   1.00 25.62  ? 268 TRP E CE2 1 
ATOM   10077 C  CE3 . TRP E  1 242 ? 44.375  -7.040  19.917   1.00 26.58  ? 268 TRP E CE3 1 
ATOM   10078 C  CZ2 . TRP E  1 242 ? 45.463  -4.966  21.500   1.00 25.82  ? 268 TRP E CZ2 1 
ATOM   10079 C  CZ3 . TRP E  1 242 ? 44.042  -6.899  21.249   1.00 27.75  ? 268 TRP E CZ3 1 
ATOM   10080 C  CH2 . TRP E  1 242 ? 44.585  -5.872  22.026   1.00 24.92  ? 268 TRP E CH2 1 
ATOM   10081 N  N   . GLN E  1 243 ? 44.939  -9.721  15.867   1.00 26.08  ? 269 GLN E N   1 
ATOM   10082 C  CA  . GLN E  1 243 ? 44.465  -10.679 14.877   1.00 29.80  ? 269 GLN E CA  1 
ATOM   10083 C  C   . GLN E  1 243 ? 42.979  -10.911 15.102   1.00 28.17  ? 269 GLN E C   1 
ATOM   10084 O  O   . GLN E  1 243 ? 42.388  -10.402 16.057   1.00 31.84  ? 269 GLN E O   1 
ATOM   10085 C  CB  . GLN E  1 243 ? 45.244  -11.995 14.962   1.00 26.54  ? 269 GLN E CB  1 
ATOM   10086 C  CG  . GLN E  1 243 ? 45.173  -12.643 16.336   1.00 32.78  ? 269 GLN E CG  1 
ATOM   10087 C  CD  . GLN E  1 243 ? 45.949  -13.939 16.417   1.00 32.24  ? 269 GLN E CD  1 
ATOM   10088 O  OE1 . GLN E  1 243 ? 46.300  -14.533 15.398   1.00 41.99  ? 269 GLN E OE1 1 
ATOM   10089 N  NE2 . GLN E  1 243 ? 46.225  -14.384 17.635   1.00 26.92  ? 269 GLN E NE2 1 
ATOM   10090 N  N   . GLY E  1 244 ? 42.382  -11.683 14.208   1.00 26.84  ? 270 GLY E N   1 
ATOM   10091 C  CA  . GLY E  1 244 ? 40.997  -12.085 14.333   1.00 31.73  ? 270 GLY E CA  1 
ATOM   10092 C  C   . GLY E  1 244 ? 40.110  -11.437 13.282   1.00 31.17  ? 270 GLY E C   1 
ATOM   10093 O  O   . GLY E  1 244 ? 40.504  -10.524 12.556   1.00 33.95  ? 270 GLY E O   1 
ATOM   10094 N  N   . ARG E  1 245 ? 38.874  -11.941 13.227   1.00 32.67  ? 271 ARG E N   1 
ATOM   10095 C  CA  . ARG E  1 245 ? 37.889  -11.419 12.287   1.00 28.66  ? 271 ARG E CA  1 
ATOM   10096 C  C   . ARG E  1 245 ? 37.657  -9.927  12.496   1.00 31.60  ? 271 ARG E C   1 
ATOM   10097 O  O   . ARG E  1 245 ? 37.485  -9.174  11.529   1.00 28.22  ? 271 ARG E O   1 
ATOM   10098 C  CB  . ARG E  1 245 ? 36.576  -12.195 12.425   1.00 31.49  ? 271 ARG E CB  1 
ATOM   10099 C  CG  . ARG E  1 245 ? 35.420  -11.621 11.613   1.00 39.26  ? 271 ARG E CG  1 
ATOM   10100 C  CD  . ARG E  1 245 ? 34.446  -12.704 11.182   1.00 35.91  ? 271 ARG E CD  1 
ATOM   10101 N  NE  . ARG E  1 245 ? 33.320  -12.874 12.097   1.00 44.02  ? 271 ARG E NE  1 
ATOM   10102 C  CZ  . ARG E  1 245 ? 32.054  -12.597 11.792   1.00 41.30  ? 271 ARG E CZ  1 
ATOM   10103 N  NH1 . ARG E  1 245 ? 31.096  -12.789 12.690   1.00 38.95  ? 271 ARG E NH1 1 
ATOM   10104 N  NH2 . ARG E  1 245 ? 31.739  -12.137 10.588   1.00 36.25  ? 271 ARG E NH2 1 
ATOM   10105 N  N   . PHE E  1 246 ? 37.658  -9.479  13.749   1.00 31.95  ? 272 PHE E N   1 
ATOM   10106 C  CA  . PHE E  1 246 ? 37.387  -8.085  14.067   1.00 32.13  ? 272 PHE E CA  1 
ATOM   10107 C  C   . PHE E  1 246 ? 38.596  -7.371  14.645   1.00 29.50  ? 272 PHE E C   1 
ATOM   10108 O  O   . PHE E  1 246 ? 38.457  -6.241  15.125   1.00 32.03  ? 272 PHE E O   1 
ATOM   10109 C  CB  . PHE E  1 246 ? 36.206  -7.980  15.034   1.00 29.58  ? 272 PHE E CB  1 
ATOM   10110 C  CG  . PHE E  1 246 ? 34.951  -8.609  14.518   1.00 29.58  ? 272 PHE E CG  1 
ATOM   10111 C  CD1 . PHE E  1 246 ? 34.181  -7.968  13.563   1.00 34.15  ? 272 PHE E CD1 1 
ATOM   10112 C  CD2 . PHE E  1 246 ? 34.543  -9.845  14.980   1.00 29.62  ? 272 PHE E CD2 1 
ATOM   10113 C  CE1 . PHE E  1 246 ? 33.024  -8.549  13.085   1.00 38.97  ? 272 PHE E CE1 1 
ATOM   10114 C  CE2 . PHE E  1 246 ? 33.385  -10.431 14.504   1.00 30.31  ? 272 PHE E CE2 1 
ATOM   10115 C  CZ  . PHE E  1 246 ? 32.625  -9.783  13.559   1.00 31.45  ? 272 PHE E CZ  1 
ATOM   10116 N  N   . CYS E  1 247 ? 39.775  -7.996  14.604   1.00 25.21  ? 273 CYS E N   1 
ATOM   10117 C  CA  . CYS E  1 247 ? 41.010  -7.402  15.123   1.00 23.61  ? 273 CYS E CA  1 
ATOM   10118 C  C   . CYS E  1 247 ? 40.874  -7.039  16.602   1.00 24.54  ? 273 CYS E C   1 
ATOM   10119 O  O   . CYS E  1 247 ? 41.209  -5.931  17.024   1.00 25.43  ? 273 CYS E O   1 
ATOM   10120 C  CB  . CYS E  1 247 ? 41.422  -6.174  14.307   1.00 23.78  ? 273 CYS E CB  1 
ATOM   10121 S  SG  . CYS E  1 247 ? 41.715  -6.475  12.558   1.00 24.67  ? 273 CYS E SG  1 
ATOM   10122 N  N   . ASP E  1 248 ? 40.368  -7.988  17.398   1.00 24.56  ? 274 ASP E N   1 
ATOM   10123 C  CA  . ASP E  1 248 ? 40.194  -7.776  18.831   1.00 25.24  ? 274 ASP E CA  1 
ATOM   10124 C  C   . ASP E  1 248 ? 40.790  -8.915  19.650   1.00 30.56  ? 274 ASP E C   1 
ATOM   10125 O  O   . ASP E  1 248 ? 40.458  -9.064  20.832   1.00 27.73  ? 274 ASP E O   1 
ATOM   10126 C  CB  . ASP E  1 248 ? 38.716  -7.587  19.185   1.00 25.96  ? 274 ASP E CB  1 
ATOM   10127 C  CG  . ASP E  1 248 ? 37.842  -8.701  18.648   1.00 31.78  ? 274 ASP E CG  1 
ATOM   10128 O  OD1 . ASP E  1 248 ? 38.390  -9.704  18.141   1.00 34.23  ? 274 ASP E OD1 1 
ATOM   10129 O  OD2 . ASP E  1 248 ? 36.603  -8.578  18.743   1.00 41.44  ? 274 ASP E OD2 1 
ATOM   10130 N  N   . GLU E  1 249 ? 41.655  -9.724  19.046   1.00 28.62  ? 275 GLU E N   1 
ATOM   10131 C  CA  . GLU E  1 249 ? 42.381  -10.775 19.741   1.00 26.55  ? 275 GLU E CA  1 
ATOM   10132 C  C   . GLU E  1 249 ? 43.873  -10.494 19.633   1.00 30.26  ? 275 GLU E C   1 
ATOM   10133 O  O   . GLU E  1 249 ? 44.374  -10.208 18.540   1.00 27.50  ? 275 GLU E O   1 
ATOM   10134 C  CB  . GLU E  1 249 ? 42.041  -12.143 19.155   1.00 24.92  ? 275 GLU E CB  1 
ATOM   10135 C  CG  . GLU E  1 249 ? 40.553  -12.436 19.165   1.00 33.91  ? 275 GLU E CG  1 
ATOM   10136 C  CD  . GLU E  1 249 ? 40.185  -13.680 18.376   1.00 36.77  ? 275 GLU E CD  1 
ATOM   10137 O  OE1 . GLU E  1 249 ? 41.037  -14.185 17.613   1.00 30.62  ? 275 GLU E OE1 1 
ATOM   10138 O  OE2 . GLU E  1 249 ? 39.036  -14.148 18.520   1.00 40.41  ? 275 GLU E OE2 1 
ATOM   10139 N  N   . CYS E  1 250 ? 44.575  -10.564 20.763   1.00 29.09  ? 276 CYS E N   1 
ATOM   10140 C  CA  . CYS E  1 250 ? 46.003  -10.288 20.767   1.00 27.35  ? 276 CYS E CA  1 
ATOM   10141 C  C   . CYS E  1 250 ? 46.782  -11.461 20.180   1.00 26.94  ? 276 CYS E C   1 
ATOM   10142 O  O   . CYS E  1 250 ? 46.315  -12.608 20.149   1.00 23.09  ? 276 CYS E O   1 
ATOM   10143 C  CB  . CYS E  1 250 ? 46.499  -9.986  22.185   1.00 27.67  ? 276 CYS E CB  1 
ATOM   10144 S  SG  . CYS E  1 250 ? 46.055  -11.221 23.422   1.00 39.61  ? 276 CYS E SG  1 
ATOM   10145 N  N   . VAL E  1 251 ? 47.982  -11.163 19.700   1.00 25.27  ? 277 VAL E N   1 
ATOM   10146 C  CA  . VAL E  1 251 ? 48.901  -12.164 19.184   1.00 25.15  ? 277 VAL E CA  1 
ATOM   10147 C  C   . VAL E  1 251 ? 49.830  -12.582 20.335   1.00 27.56  ? 277 VAL E C   1 
ATOM   10148 O  O   . VAL E  1 251 ? 50.538  -11.706 20.861   1.00 27.14  ? 277 VAL E O   1 
ATOM   10149 C  CB  . VAL E  1 251 ? 49.705  -11.650 17.989   1.00 24.65  ? 277 VAL E CB  1 
ATOM   10150 C  CG1 . VAL E  1 251 ? 50.712  -12.695 17.535   1.00 23.29  ? 277 VAL E CG1 1 
ATOM   10151 C  CG2 . VAL E  1 251 ? 48.777  -11.275 16.839   1.00 22.36  ? 277 VAL E CG2 1 
ATOM   10152 N  N   . PRO E  1 252 ? 49.840  -13.838 20.744   1.00 29.00  ? 278 PRO E N   1 
ATOM   10153 C  CA  . PRO E  1 252 ? 50.804  -14.275 21.760   1.00 25.53  ? 278 PRO E CA  1 
ATOM   10154 C  C   . PRO E  1 252 ? 52.212  -14.307 21.186   1.00 23.18  ? 278 PRO E C   1 
ATOM   10155 O  O   . PRO E  1 252 ? 52.425  -14.238 19.974   1.00 33.06  ? 278 PRO E O   1 
ATOM   10156 C  CB  . PRO E  1 252 ? 50.315  -15.676 22.135   1.00 24.58  ? 278 PRO E CB  1 
ATOM   10157 C  CG  . PRO E  1 252 ? 49.620  -16.156 20.919   1.00 17.77  ? 278 PRO E CG  1 
ATOM   10158 C  CD  . PRO E  1 252 ? 48.968  -14.943 20.311   1.00 23.89  ? 278 PRO E CD  1 
ATOM   10159 N  N   . TYR E  1 253 ? 53.185  -14.410 22.082   1.00 24.09  ? 279 TYR E N   1 
ATOM   10160 C  CA  . TYR E  1 253 ? 54.576  -14.401 21.658   1.00 22.99  ? 279 TYR E CA  1 
ATOM   10161 C  C   . TYR E  1 253 ? 54.854  -15.607 20.759   1.00 21.55  ? 279 TYR E C   1 
ATOM   10162 O  O   . TYR E  1 253 ? 54.365  -16.709 21.031   1.00 21.52  ? 279 TYR E O   1 
ATOM   10163 C  CB  . TYR E  1 253 ? 55.510  -14.412 22.871   1.00 21.36  ? 279 TYR E CB  1 
ATOM   10164 C  CG  . TYR E  1 253 ? 56.950  -14.181 22.499   1.00 24.40  ? 279 TYR E CG  1 
ATOM   10165 C  CD1 . TYR E  1 253 ? 57.422  -12.903 22.244   1.00 23.39  ? 279 TYR E CD1 1 
ATOM   10166 C  CD2 . TYR E  1 253 ? 57.834  -15.243 22.374   1.00 26.33  ? 279 TYR E CD2 1 
ATOM   10167 C  CE1 . TYR E  1 253 ? 58.736  -12.689 21.886   1.00 25.34  ? 279 TYR E CE1 1 
ATOM   10168 C  CE2 . TYR E  1 253 ? 59.151  -15.036 22.019   1.00 25.18  ? 279 TYR E CE2 1 
ATOM   10169 C  CZ  . TYR E  1 253 ? 59.595  -13.758 21.777   1.00 24.13  ? 279 TYR E CZ  1 
ATOM   10170 O  OH  . TYR E  1 253 ? 60.905  -13.549 21.417   1.00 30.95  ? 279 TYR E OH  1 
ATOM   10171 N  N   . PRO E  1 254 ? 55.613  -15.433 19.677   1.00 25.63  ? 280 PRO E N   1 
ATOM   10172 C  CA  . PRO E  1 254 ? 55.854  -16.554 18.751   1.00 24.94  ? 280 PRO E CA  1 
ATOM   10173 C  C   . PRO E  1 254 ? 56.501  -17.734 19.459   1.00 23.76  ? 280 PRO E C   1 
ATOM   10174 O  O   . PRO E  1 254 ? 57.581  -17.618 20.046   1.00 24.98  ? 280 PRO E O   1 
ATOM   10175 C  CB  . PRO E  1 254 ? 56.784  -15.946 17.695   1.00 20.42  ? 280 PRO E CB  1 
ATOM   10176 C  CG  . PRO E  1 254 ? 56.504  -14.479 17.743   1.00 24.36  ? 280 PRO E CG  1 
ATOM   10177 C  CD  . PRO E  1 254 ? 56.185  -14.169 19.179   1.00 26.96  ? 280 PRO E CD  1 
ATOM   10178 N  N   . GLY E  1 255 ? 55.828  -18.880 19.397   1.00 20.10  ? 281 GLY E N   1 
ATOM   10179 C  CA  . GLY E  1 255 ? 56.294  -20.086 20.041   1.00 24.44  ? 281 GLY E CA  1 
ATOM   10180 C  C   . GLY E  1 255 ? 55.617  -20.419 21.351   1.00 26.60  ? 281 GLY E C   1 
ATOM   10181 O  O   . GLY E  1 255 ? 55.924  -21.466 21.933   1.00 28.75  ? 281 GLY E O   1 
ATOM   10182 N  N   . CYS E  1 256 ? 54.712  -19.569 21.833   1.00 22.16  ? 282 CYS E N   1 
ATOM   10183 C  CA  . CYS E  1 256 ? 54.003  -19.847 23.073   1.00 24.14  ? 282 CYS E CA  1 
ATOM   10184 C  C   . CYS E  1 256 ? 53.186  -21.126 22.930   1.00 26.99  ? 282 CYS E C   1 
ATOM   10185 O  O   . CYS E  1 256 ? 52.463  -21.309 21.949   1.00 32.28  ? 282 CYS E O   1 
ATOM   10186 C  CB  . CYS E  1 256 ? 53.101  -18.665 23.437   1.00 22.08  ? 282 CYS E CB  1 
ATOM   10187 S  SG  . CYS E  1 256 ? 52.446  -18.657 25.137   1.00 35.18  ? 282 CYS E SG  1 
ATOM   10188 N  N   . VAL E  1 257 ? 53.318  -22.021 23.908   1.00 34.50  ? 283 VAL E N   1 
ATOM   10189 C  CA  . VAL E  1 257 ? 52.668  -23.328 23.863   1.00 33.56  ? 283 VAL E CA  1 
ATOM   10190 C  C   . VAL E  1 257 ? 51.476  -23.343 24.813   1.00 32.95  ? 283 VAL E C   1 
ATOM   10191 O  O   . VAL E  1 257 ? 50.339  -23.094 24.399   1.00 42.42  ? 283 VAL E O   1 
ATOM   10192 C  CB  . VAL E  1 257 ? 53.664  -24.455 24.198   1.00 32.01  ? 283 VAL E CB  1 
ATOM   10193 C  CG1 . VAL E  1 257 ? 53.018  -25.810 23.988   1.00 29.99  ? 283 VAL E CG1 1 
ATOM   10194 C  CG2 . VAL E  1 257 ? 54.930  -24.321 23.355   1.00 21.11  ? 283 VAL E CG2 1 
ATOM   10195 N  N   . HIS E  1 258 ? 51.719  -23.628 26.091   1.00 33.08  ? 284 HIS E N   1 
ATOM   10196 C  CA  . HIS E  1 258 ? 50.645  -23.675 27.087   1.00 37.95  ? 284 HIS E CA  1 
ATOM   10197 C  C   . HIS E  1 258 ? 50.487  -22.317 27.776   1.00 37.85  ? 284 HIS E C   1 
ATOM   10198 O  O   . HIS E  1 258 ? 50.659  -22.168 28.987   1.00 36.52  ? 284 HIS E O   1 
ATOM   10199 C  CB  . HIS E  1 258 ? 50.909  -24.782 28.102   1.00 35.68  ? 284 HIS E CB  1 
ATOM   10200 C  CG  . HIS E  1 258 ? 51.094  -26.131 27.485   1.00 34.17  ? 284 HIS E CG  1 
ATOM   10201 N  ND1 . HIS E  1 258 ? 52.337  -26.688 27.270   1.00 36.07  ? 284 HIS E ND1 1 
ATOM   10202 C  CD2 . HIS E  1 258 ? 50.194  -27.031 27.022   1.00 29.92  ? 284 HIS E CD2 1 
ATOM   10203 C  CE1 . HIS E  1 258 ? 52.194  -27.875 26.709   1.00 39.81  ? 284 HIS E CE1 1 
ATOM   10204 N  NE2 . HIS E  1 258 ? 50.904  -28.107 26.548   1.00 35.96  ? 284 HIS E NE2 1 
ATOM   10205 N  N   . GLY E  1 259 ? 50.142  -21.315 26.968   1.00 30.51  ? 285 GLY E N   1 
ATOM   10206 C  CA  . GLY E  1 259 ? 49.955  -19.968 27.461   1.00 30.84  ? 285 GLY E CA  1 
ATOM   10207 C  C   . GLY E  1 259 ? 48.962  -19.209 26.605   1.00 36.07  ? 285 GLY E C   1 
ATOM   10208 O  O   . GLY E  1 259 ? 48.395  -19.741 25.648   1.00 35.15  ? 285 GLY E O   1 
ATOM   10209 N  N   . SER E  1 260 ? 48.756  -17.945 26.964   1.00 30.96  ? 286 SER E N   1 
ATOM   10210 C  CA  . SER E  1 260 ? 47.843  -17.072 26.241   1.00 26.05  ? 286 SER E CA  1 
ATOM   10211 C  C   . SER E  1 260 ? 48.229  -15.629 26.538   1.00 28.42  ? 286 SER E C   1 
ATOM   10212 O  O   . SER E  1 260 ? 49.039  -15.354 27.426   1.00 30.13  ? 286 SER E O   1 
ATOM   10213 C  CB  . SER E  1 260 ? 46.388  -17.348 26.626   1.00 26.18  ? 286 SER E CB  1 
ATOM   10214 O  OG  . SER E  1 260 ? 46.158  -17.015 27.983   1.00 26.13  ? 286 SER E OG  1 
ATOM   10215 N  N   . CYS E  1 261 ? 47.635  -14.707 25.784   1.00 24.67  ? 287 CYS E N   1 
ATOM   10216 C  CA  . CYS E  1 261 ? 47.919  -13.288 25.927   1.00 25.45  ? 287 CYS E CA  1 
ATOM   10217 C  C   . CYS E  1 261 ? 46.659  -12.531 26.324   1.00 30.05  ? 287 CYS E C   1 
ATOM   10218 O  O   . CYS E  1 261 ? 45.534  -12.999 26.128   1.00 31.94  ? 287 CYS E O   1 
ATOM   10219 C  CB  . CYS E  1 261 ? 48.489  -12.686 24.628   1.00 26.31  ? 287 CYS E CB  1 
ATOM   10220 S  SG  . CYS E  1 261 ? 47.385  -12.759 23.185   1.00 36.63  ? 287 CYS E SG  1 
ATOM   10221 N  N   . VAL E  1 262 ? 46.871  -11.342 26.889   1.00 34.58  ? 288 VAL E N   1 
ATOM   10222 C  CA  . VAL E  1 262 ? 45.825  -10.348 27.091   1.00 30.48  ? 288 VAL E CA  1 
ATOM   10223 C  C   . VAL E  1 262 ? 46.098  -9.091  26.272   1.00 33.58  ? 288 VAL E C   1 
ATOM   10224 O  O   . VAL E  1 262 ? 45.236  -8.624  25.523   1.00 38.13  ? 288 VAL E O   1 
ATOM   10225 C  CB  . VAL E  1 262 ? 45.656  -10.002 28.587   1.00 36.10  ? 288 VAL E CB  1 
ATOM   10226 C  CG1 . VAL E  1 262 ? 44.821  -8.739  28.757   1.00 28.65  ? 288 VAL E CG1 1 
ATOM   10227 C  CG2 . VAL E  1 262 ? 45.020  -11.172 29.328   1.00 26.15  ? 288 VAL E CG2 1 
ATOM   10228 N  N   . GLU E  1 263 ? 47.299  -8.537  26.397   1.00 34.77  ? 289 GLU E N   1 
ATOM   10229 C  CA  . GLU E  1 263 ? 47.821  -7.544  25.471   1.00 37.93  ? 289 GLU E CA  1 
ATOM   10230 C  C   . GLU E  1 263 ? 48.918  -8.175  24.610   1.00 33.26  ? 289 GLU E C   1 
ATOM   10231 O  O   . GLU E  1 263 ? 49.449  -9.236  24.958   1.00 32.09  ? 289 GLU E O   1 
ATOM   10232 C  CB  . GLU E  1 263 ? 48.345  -6.312  26.228   1.00 35.90  ? 289 GLU E CB  1 
ATOM   10233 C  CG  . GLU E  1 263 ? 49.173  -6.594  27.457   1.00 45.28  ? 289 GLU E CG  1 
ATOM   10234 C  CD  . GLU E  1 263 ? 49.576  -5.318  28.181   1.00 57.25  ? 289 GLU E CD  1 
ATOM   10235 O  OE1 . GLU E  1 263 ? 48.803  -4.337  28.126   1.00 54.42  ? 289 GLU E OE1 1 
ATOM   10236 O  OE2 . GLU E  1 263 ? 50.667  -5.291  28.793   1.00 61.84  ? 289 GLU E OE2 1 
ATOM   10237 N  N   . PRO E  1 264 ? 49.260  -7.573  23.462   1.00 29.86  ? 290 PRO E N   1 
ATOM   10238 C  CA  . PRO E  1 264 ? 50.032  -8.308  22.445   1.00 29.36  ? 290 PRO E CA  1 
ATOM   10239 C  C   . PRO E  1 264 ? 51.368  -8.842  22.948   1.00 30.72  ? 290 PRO E C   1 
ATOM   10240 O  O   . PRO E  1 264 ? 52.020  -8.247  23.808   1.00 33.93  ? 290 PRO E O   1 
ATOM   10241 C  CB  . PRO E  1 264 ? 50.246  -7.265  21.341   1.00 24.27  ? 290 PRO E CB  1 
ATOM   10242 C  CG  . PRO E  1 264 ? 49.141  -6.309  21.506   1.00 27.83  ? 290 PRO E CG  1 
ATOM   10243 C  CD  . PRO E  1 264 ? 48.870  -6.235  22.978   1.00 24.49  ? 290 PRO E CD  1 
ATOM   10244 N  N   . TRP E  1 265 ? 51.760  -9.990  22.387   1.00 28.23  ? 291 TRP E N   1 
ATOM   10245 C  CA  . TRP E  1 265 ? 53.075  -10.616 22.510   1.00 24.50  ? 291 TRP E CA  1 
ATOM   10246 C  C   . TRP E  1 265 ? 53.314  -11.275 23.863   1.00 24.92  ? 291 TRP E C   1 
ATOM   10247 O  O   . TRP E  1 265 ? 54.430  -11.730 24.132   1.00 24.75  ? 291 TRP E O   1 
ATOM   10248 C  CB  . TRP E  1 265 ? 54.203  -9.620  22.211   1.00 22.38  ? 291 TRP E CB  1 
ATOM   10249 C  CG  . TRP E  1 265 ? 53.981  -8.864  20.931   1.00 25.32  ? 291 TRP E CG  1 
ATOM   10250 C  CD1 . TRP E  1 265 ? 53.828  -7.514  20.791   1.00 23.11  ? 291 TRP E CD1 1 
ATOM   10251 C  CD2 . TRP E  1 265 ? 53.858  -9.420  19.617   1.00 20.84  ? 291 TRP E CD2 1 
ATOM   10252 N  NE1 . TRP E  1 265 ? 53.631  -7.196  19.472   1.00 20.14  ? 291 TRP E NE1 1 
ATOM   10253 C  CE2 . TRP E  1 265 ? 53.644  -8.347  18.729   1.00 20.69  ? 291 TRP E CE2 1 
ATOM   10254 C  CE3 . TRP E  1 265 ? 53.913  -10.720 19.104   1.00 24.13  ? 291 TRP E CE3 1 
ATOM   10255 C  CZ2 . TRP E  1 265 ? 53.485  -8.534  17.355   1.00 22.50  ? 291 TRP E CZ2 1 
ATOM   10256 C  CZ3 . TRP E  1 265 ? 53.755  -10.904 17.739   1.00 24.17  ? 291 TRP E CZ3 1 
ATOM   10257 C  CH2 . TRP E  1 265 ? 53.543  -9.817  16.882   1.00 23.58  ? 291 TRP E CH2 1 
ATOM   10258 N  N   . GLN E  1 266 ? 52.300  -11.367 24.713   1.00 25.03  ? 292 GLN E N   1 
ATOM   10259 C  CA  . GLN E  1 266 ? 52.475  -12.024 25.997   1.00 28.12  ? 292 GLN E CA  1 
ATOM   10260 C  C   . GLN E  1 266 ? 52.442  -13.545 25.843   1.00 28.90  ? 292 GLN E C   1 
ATOM   10261 O  O   . GLN E  1 266 ? 52.120  -14.090 24.783   1.00 28.42  ? 292 GLN E O   1 
ATOM   10262 C  CB  . GLN E  1 266 ? 51.397  -11.574 26.973   1.00 29.12  ? 292 GLN E CB  1 
ATOM   10263 C  CG  . GLN E  1 266 ? 51.494  -10.118 27.344   1.00 30.57  ? 292 GLN E CG  1 
ATOM   10264 C  CD  . GLN E  1 266 ? 50.438  -9.727  28.343   1.00 33.53  ? 292 GLN E CD  1 
ATOM   10265 O  OE1 . GLN E  1 266 ? 49.357  -10.316 28.380   1.00 33.86  ? 292 GLN E OE1 1 
ATOM   10266 N  NE2 . GLN E  1 266 ? 50.743  -8.735  29.170   1.00 32.24  ? 292 GLN E NE2 1 
ATOM   10267 N  N   . CYS E  1 267 ? 52.784  -14.237 26.935   1.00 30.46  ? 293 CYS E N   1 
ATOM   10268 C  CA  . CYS E  1 267 ? 52.746  -15.697 27.009   1.00 33.01  ? 293 CYS E CA  1 
ATOM   10269 C  C   . CYS E  1 267 ? 52.524  -16.059 28.481   1.00 29.35  ? 293 CYS E C   1 
ATOM   10270 O  O   . CYS E  1 267 ? 53.389  -16.599 29.166   1.00 28.07  ? 293 CYS E O   1 
ATOM   10271 C  CB  . CYS E  1 267 ? 54.019  -16.328 26.437   1.00 27.60  ? 293 CYS E CB  1 
ATOM   10272 S  SG  . CYS E  1 267 ? 54.038  -18.150 26.309   1.00 31.54  ? 293 CYS E SG  1 
ATOM   10273 N  N   . ASN E  1 268 ? 51.328  -15.735 28.977   1.00 30.54  ? 294 ASN E N   1 
ATOM   10274 C  CA  . ASN E  1 268 ? 50.956  -15.978 30.369   1.00 27.83  ? 294 ASN E CA  1 
ATOM   10275 C  C   . ASN E  1 268 ? 50.639  -17.457 30.549   1.00 31.08  ? 294 ASN E C   1 
ATOM   10276 O  O   . ASN E  1 268 ? 49.647  -17.956 30.006   1.00 30.46  ? 294 ASN E O   1 
ATOM   10277 C  CB  . ASN E  1 268 ? 49.760  -15.114 30.756   1.00 21.78  ? 294 ASN E CB  1 
ATOM   10278 C  CG  . ASN E  1 268 ? 49.868  -13.695 30.232   1.00 27.36  ? 294 ASN E CG  1 
ATOM   10279 O  OD1 . ASN E  1 268 ? 50.927  -13.072 30.297   1.00 28.70  ? 294 ASN E OD1 1 
ATOM   10280 N  ND2 . ASN E  1 268 ? 48.765  -13.176 29.708   1.00 31.87  ? 294 ASN E ND2 1 
ATOM   10281 N  N   . CYS E  1 269 ? 51.464  -18.156 31.327   1.00 34.84  ? 295 CYS E N   1 
ATOM   10282 C  CA  . CYS E  1 269 ? 51.377  -19.610 31.386   1.00 40.90  ? 295 CYS E CA  1 
ATOM   10283 C  C   . CYS E  1 269 ? 50.105  -20.078 32.087   1.00 37.65  ? 295 CYS E C   1 
ATOM   10284 O  O   . CYS E  1 269 ? 49.516  -19.369 32.909   1.00 29.57  ? 295 CYS E O   1 
ATOM   10285 C  CB  . CYS E  1 269 ? 52.593  -20.199 32.101   1.00 30.94  ? 295 CYS E CB  1 
ATOM   10286 S  SG  . CYS E  1 269 ? 54.174  -19.853 31.321   1.00 39.85  ? 295 CYS E SG  1 
ATOM   10287 N  N   . GLU E  1 270 ? 49.676  -21.287 31.734   1.00 33.53  ? 296 GLU E N   1 
ATOM   10288 C  CA  . GLU E  1 270 ? 48.668  -21.983 32.510   1.00 43.01  ? 296 GLU E CA  1 
ATOM   10289 C  C   . GLU E  1 270 ? 49.291  -22.516 33.801   1.00 54.44  ? 296 GLU E C   1 
ATOM   10290 O  O   . GLU E  1 270 ? 50.510  -22.479 33.999   1.00 56.57  ? 296 GLU E O   1 
ATOM   10291 C  CB  . GLU E  1 270 ? 48.056  -23.117 31.690   1.00 43.52  ? 296 GLU E CB  1 
ATOM   10292 C  CG  . GLU E  1 270 ? 47.441  -22.656 30.383   1.00 42.72  ? 296 GLU E CG  1 
ATOM   10293 C  CD  . GLU E  1 270 ? 47.175  -23.796 29.415   1.00 50.36  ? 296 GLU E CD  1 
ATOM   10294 O  OE1 . GLU E  1 270 ? 47.346  -24.973 29.801   1.00 46.77  ? 296 GLU E OE1 1 
ATOM   10295 O  OE2 . GLU E  1 270 ? 46.802  -23.507 28.257   1.00 57.20  ? 296 GLU E OE2 1 
ATOM   10296 N  N   . THR E  1 271 ? 48.440  -23.019 34.690   1.00 54.49  ? 297 THR E N   1 
ATOM   10297 C  CA  . THR E  1 271 ? 48.908  -23.416 36.011   1.00 61.33  ? 297 THR E CA  1 
ATOM   10298 C  C   . THR E  1 271 ? 49.896  -24.574 35.916   1.00 56.19  ? 297 THR E C   1 
ATOM   10299 O  O   . THR E  1 271 ? 49.678  -25.542 35.180   1.00 51.70  ? 297 THR E O   1 
ATOM   10300 C  CB  . THR E  1 271 ? 47.723  -23.786 36.901   1.00 64.38  ? 297 THR E CB  1 
ATOM   10301 O  OG1 . THR E  1 271 ? 46.731  -24.462 36.119   1.00 68.28  ? 297 THR E OG1 1 
ATOM   10302 C  CG2 . THR E  1 271 ? 47.117  -22.530 37.519   1.00 59.54  ? 297 THR E CG2 1 
ATOM   10303 N  N   . ASN E  1 272 ? 50.994  -24.450 36.663   1.00 55.54  ? 298 ASN E N   1 
ATOM   10304 C  CA  . ASN E  1 272 ? 52.088  -25.425 36.674   1.00 65.56  ? 298 ASN E CA  1 
ATOM   10305 C  C   . ASN E  1 272 ? 52.635  -25.678 35.272   1.00 62.91  ? 298 ASN E C   1 
ATOM   10306 O  O   . ASN E  1 272 ? 52.920  -26.813 34.879   1.00 57.79  ? 298 ASN E O   1 
ATOM   10307 C  CB  . ASN E  1 272 ? 51.670  -26.727 37.357   1.00 75.79  ? 298 ASN E CB  1 
ATOM   10308 C  CG  . ASN E  1 272 ? 51.934  -26.696 38.853   1.00 77.42  ? 298 ASN E CG  1 
ATOM   10309 O  OD1 . ASN E  1 272 ? 53.085  -26.742 39.291   1.00 70.78  ? 298 ASN E OD1 1 
ATOM   10310 N  ND2 . ASN E  1 272 ? 50.870  -26.602 39.642   1.00 74.37  ? 298 ASN E ND2 1 
ATOM   10311 N  N   . TRP E  1 273 ? 52.771  -24.597 34.512   1.00 55.82  ? 299 TRP E N   1 
ATOM   10312 C  CA  . TRP E  1 273 ? 53.623  -24.539 33.339   1.00 41.68  ? 299 TRP E CA  1 
ATOM   10313 C  C   . TRP E  1 273 ? 54.491  -23.303 33.486   1.00 42.74  ? 299 TRP E C   1 
ATOM   10314 O  O   . TRP E  1 273 ? 54.035  -22.279 34.005   1.00 39.05  ? 299 TRP E O   1 
ATOM   10315 C  CB  . TRP E  1 273 ? 52.819  -24.480 32.039   1.00 4