data_5NDD
# 
_entry.id   5NDD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NDD         
WWPDB D_1200003919 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NDD 
_pdbx_database_status.recvd_initial_deposition_date   2017-03-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Cheng, R.K.Y.'     1  ? 
'Fiez-Vandal, C.'   2  ? 
'Schlenker, O.'     3  ? 
'Edman, K.'         4  ? 
'Aggeler, B.'       5  ? 
'Brown, D.G.'       6  ? 
'Brown, G.'         7  ? 
'Cooke, R.M.'       8  ? 
'Dumelin, C.E.'     9  ? 
'Dore, A.S.'        10 ? 
'Geschwindner, S.'  11 ? 
'Grebner, C.'       12 ? 
'Hermansson, N.-O.' 13 ? 
'Jazayeri, A.'      14 ? 
'Johansson, P.'     15 ? 
'Leong, L.'         16 ? 
'Prihandoko, R.'    17 ? 
'Rappas, M.'        18 ? 
'Soutter, H.'       19 ? 
'Snijder, A.'       20 ? 
'Sundstrom, L.'     21 ? 
'Tehan, B.'         22 ? 
'Thornton, P.'      23 ? 
'Troast, D.'        24 ? 
'Wiggin, G.'        25 ? 
'Zhukov, A.'        26 ? 
'Marshall, F.H.'    27 ? 
'Dekker, N.'        28 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            545 
_citation.language                  ? 
_citation.page_first                112 
_citation.page_last                 115 
_citation.title                     'Structural insight into allosteric modulation of protease-activated receptor 2.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature22309 
_citation.pdbx_database_id_PubMed   28445455 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cheng, R.K.Y.'    1  
primary 'Fiez-Vandal, C.'  2  
primary 'Schlenker, O.'    3  
primary 'Edman, K.'        4  
primary 'Aggeler, B.'      5  
primary 'Brown, D.G.'      6  
primary 'Brown, G.A.'      7  
primary 'Cooke, R.M.'      8  
primary 'Dumelin, C.E.'    9  
primary 'Dore, A.S.'       10 
primary 'Geschwindner, S.' 11 
primary 'Grebner, C.'      12 
primary 'Hermansson, N.O.' 13 
primary 'Jazayeri, A.'     14 
primary 'Johansson, P.'    15 
primary 'Leong, L.'        16 
primary 'Prihandoko, R.'   17 
primary 'Rappas, M.'       18 
primary 'Soutter, H.'      19 
primary 'Snijder, A.'      20 
primary 'Sundstrom, L.'    21 
primary 'Tehan, B.'        22 
primary 'Thornton, P.'     23 
primary 'Troast, D.'       24 
primary 'Wiggin, G.'       25 
primary 'Zhukov, A.'       26 
primary 'Marshall, F.H.'   27 
primary 'Dekker, N.'       28 
# 
_cell.angle_alpha                  104.88 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.88 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  96.89 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NDD 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     37.109 
_cell.length_a_esd                 ? 
_cell.length_b                     62.264 
_cell.length_b_esd                 ? 
_cell.length_c                     87.341 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NDD 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lysozyme,Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2' 69558.898 1  
3.2.1.17 'G89A, H108A, G157A, M166L, Y174A, V176E, N222Q, M268A,I289A, L293A' ? ? 
2 non-polymer syn '(~{S})-(4-fluoranyl-2-propyl-phenyl)-(1~{H}-imidazol-2-yl)methanol'                               234.269   1  
?        ?                                                                    ? ? 
3 non-polymer syn 'SODIUM ION'                                                                                       22.990    1  
?        ?                                                                    ? ? 
4 non-polymer syn 'PHOSPHATE ION'                                                                                    94.971    1  
?        ?                                                                    ? ? 
5 water       nat water                                                                                              18.015    10 
?        ?                                                                    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;PAR-2,Coagulation factor II receptor-like 1,G-protein coupled receptor 11,Thrombin receptor-like 1,Cytochrome b-562,PAR-2,Coagulation factor II receptor-like 1,G-protein coupled receptor 11,Thrombin receptor-like 1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVSAIVLYVLLAAAAHSAFAAASNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVI
TKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRW
YNQTPNRAKRVITTFRTGTWDAYIYEFFSVDEFSASVLTGKLTTVFLPIVYTIVFVVALPSNGMALWVFLFRTKKKAPAV
IYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYANMYCSILFLTCLSVQRAWEIVNPMGHSRKKANIA
IGISLAIWLLILLVTIPLYVVKQTIFIPALQITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRALAD
LEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEG
KVKEAQAAAEQLKTTRNAYIQKYLENSEKKRKRAIKLAVTVAAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALC
LSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKAAAHHHHHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVSAIVLYVLLAAAAHSAFAAASNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVI
TKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRW
YNQTPNRAKRVITTFRTGTWDAYIYEFFSVDEFSASVLTGKLTTVFLPIVYTIVFVVALPSNGMALWVFLFRTKKKAPAV
IYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYANMYCSILFLTCLSVQRAWEIVNPMGHSRKKANIA
IGISLAIWLLILLVTIPLYVVKQTIFIPALQITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRALAD
LEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEG
KVKEAQAAAEQLKTTRNAYIQKYLENSEKKRKRAIKLAVTVAAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALC
LSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKAAAHHHHHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   SER n 
1 4   ALA n 
1 5   ILE n 
1 6   VAL n 
1 7   LEU n 
1 8   TYR n 
1 9   VAL n 
1 10  LEU n 
1 11  LEU n 
1 12  ALA n 
1 13  ALA n 
1 14  ALA n 
1 15  ALA n 
1 16  HIS n 
1 17  SER n 
1 18  ALA n 
1 19  PHE n 
1 20  ALA n 
1 21  ALA n 
1 22  ALA n 
1 23  SER n 
1 24  ASN n 
1 25  ILE n 
1 26  PHE n 
1 27  GLU n 
1 28  MET n 
1 29  LEU n 
1 30  ARG n 
1 31  ILE n 
1 32  ASP n 
1 33  GLU n 
1 34  GLY n 
1 35  LEU n 
1 36  ARG n 
1 37  LEU n 
1 38  LYS n 
1 39  ILE n 
1 40  TYR n 
1 41  LYS n 
1 42  ASP n 
1 43  THR n 
1 44  GLU n 
1 45  GLY n 
1 46  TYR n 
1 47  TYR n 
1 48  THR n 
1 49  ILE n 
1 50  GLY n 
1 51  ILE n 
1 52  GLY n 
1 53  HIS n 
1 54  LEU n 
1 55  LEU n 
1 56  THR n 
1 57  LYS n 
1 58  SER n 
1 59  PRO n 
1 60  SER n 
1 61  LEU n 
1 62  ASN n 
1 63  ALA n 
1 64  ALA n 
1 65  LYS n 
1 66  SER n 
1 67  GLU n 
1 68  LEU n 
1 69  ASP n 
1 70  LYS n 
1 71  ALA n 
1 72  ILE n 
1 73  GLY n 
1 74  ARG n 
1 75  ASN n 
1 76  THR n 
1 77  ASN n 
1 78  GLY n 
1 79  VAL n 
1 80  ILE n 
1 81  THR n 
1 82  LYS n 
1 83  ASP n 
1 84  GLU n 
1 85  ALA n 
1 86  GLU n 
1 87  LYS n 
1 88  LEU n 
1 89  PHE n 
1 90  ASN n 
1 91  GLN n 
1 92  ASP n 
1 93  VAL n 
1 94  ASP n 
1 95  ALA n 
1 96  ALA n 
1 97  VAL n 
1 98  ARG n 
1 99  GLY n 
1 100 ILE n 
1 101 LEU n 
1 102 ARG n 
1 103 ASN n 
1 104 ALA n 
1 105 LYS n 
1 106 LEU n 
1 107 LYS n 
1 108 PRO n 
1 109 VAL n 
1 110 TYR n 
1 111 ASP n 
1 112 SER n 
1 113 LEU n 
1 114 ASP n 
1 115 ALA n 
1 116 VAL n 
1 117 ARG n 
1 118 ARG n 
1 119 ALA n 
1 120 ALA n 
1 121 LEU n 
1 122 ILE n 
1 123 ASN n 
1 124 MET n 
1 125 VAL n 
1 126 PHE n 
1 127 GLN n 
1 128 MET n 
1 129 GLY n 
1 130 GLU n 
1 131 THR n 
1 132 GLY n 
1 133 VAL n 
1 134 ALA n 
1 135 GLY n 
1 136 PHE n 
1 137 THR n 
1 138 ASN n 
1 139 SER n 
1 140 LEU n 
1 141 ARG n 
1 142 MET n 
1 143 LEU n 
1 144 GLN n 
1 145 GLN n 
1 146 LYS n 
1 147 ARG n 
1 148 TRP n 
1 149 ASP n 
1 150 GLU n 
1 151 ALA n 
1 152 ALA n 
1 153 VAL n 
1 154 ASN n 
1 155 LEU n 
1 156 ALA n 
1 157 LYS n 
1 158 SER n 
1 159 ARG n 
1 160 TRP n 
1 161 TYR n 
1 162 ASN n 
1 163 GLN n 
1 164 THR n 
1 165 PRO n 
1 166 ASN n 
1 167 ARG n 
1 168 ALA n 
1 169 LYS n 
1 170 ARG n 
1 171 VAL n 
1 172 ILE n 
1 173 THR n 
1 174 THR n 
1 175 PHE n 
1 176 ARG n 
1 177 THR n 
1 178 GLY n 
1 179 THR n 
1 180 TRP n 
1 181 ASP n 
1 182 ALA n 
1 183 TYR n 
1 184 ILE n 
1 185 TYR n 
1 186 GLU n 
1 187 PHE n 
1 188 PHE n 
1 189 SER n 
1 190 VAL n 
1 191 ASP n 
1 192 GLU n 
1 193 PHE n 
1 194 SER n 
1 195 ALA n 
1 196 SER n 
1 197 VAL n 
1 198 LEU n 
1 199 THR n 
1 200 GLY n 
1 201 LYS n 
1 202 LEU n 
1 203 THR n 
1 204 THR n 
1 205 VAL n 
1 206 PHE n 
1 207 LEU n 
1 208 PRO n 
1 209 ILE n 
1 210 VAL n 
1 211 TYR n 
1 212 THR n 
1 213 ILE n 
1 214 VAL n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ALA n 
1 219 LEU n 
1 220 PRO n 
1 221 SER n 
1 222 ASN n 
1 223 GLY n 
1 224 MET n 
1 225 ALA n 
1 226 LEU n 
1 227 TRP n 
1 228 VAL n 
1 229 PHE n 
1 230 LEU n 
1 231 PHE n 
1 232 ARG n 
1 233 THR n 
1 234 LYS n 
1 235 LYS n 
1 236 LYS n 
1 237 ALA n 
1 238 PRO n 
1 239 ALA n 
1 240 VAL n 
1 241 ILE n 
1 242 TYR n 
1 243 MET n 
1 244 ALA n 
1 245 ASN n 
1 246 LEU n 
1 247 ALA n 
1 248 LEU n 
1 249 ALA n 
1 250 ASP n 
1 251 LEU n 
1 252 LEU n 
1 253 SER n 
1 254 VAL n 
1 255 ILE n 
1 256 TRP n 
1 257 PHE n 
1 258 PRO n 
1 259 LEU n 
1 260 LYS n 
1 261 ILE n 
1 262 ALA n 
1 263 TYR n 
1 264 HIS n 
1 265 ILE n 
1 266 HIS n 
1 267 GLY n 
1 268 ASN n 
1 269 ASN n 
1 270 TRP n 
1 271 ILE n 
1 272 TYR n 
1 273 GLY n 
1 274 GLU n 
1 275 ALA n 
1 276 LEU n 
1 277 CYS n 
1 278 ASN n 
1 279 VAL n 
1 280 LEU n 
1 281 ILE n 
1 282 GLY n 
1 283 PHE n 
1 284 PHE n 
1 285 TYR n 
1 286 ALA n 
1 287 ASN n 
1 288 MET n 
1 289 TYR n 
1 290 CYS n 
1 291 SER n 
1 292 ILE n 
1 293 LEU n 
1 294 PHE n 
1 295 LEU n 
1 296 THR n 
1 297 CYS n 
1 298 LEU n 
1 299 SER n 
1 300 VAL n 
1 301 GLN n 
1 302 ARG n 
1 303 ALA n 
1 304 TRP n 
1 305 GLU n 
1 306 ILE n 
1 307 VAL n 
1 308 ASN n 
1 309 PRO n 
1 310 MET n 
1 311 GLY n 
1 312 HIS n 
1 313 SER n 
1 314 ARG n 
1 315 LYS n 
1 316 LYS n 
1 317 ALA n 
1 318 ASN n 
1 319 ILE n 
1 320 ALA n 
1 321 ILE n 
1 322 GLY n 
1 323 ILE n 
1 324 SER n 
1 325 LEU n 
1 326 ALA n 
1 327 ILE n 
1 328 TRP n 
1 329 LEU n 
1 330 LEU n 
1 331 ILE n 
1 332 LEU n 
1 333 LEU n 
1 334 VAL n 
1 335 THR n 
1 336 ILE n 
1 337 PRO n 
1 338 LEU n 
1 339 TYR n 
1 340 VAL n 
1 341 VAL n 
1 342 LYS n 
1 343 GLN n 
1 344 THR n 
1 345 ILE n 
1 346 PHE n 
1 347 ILE n 
1 348 PRO n 
1 349 ALA n 
1 350 LEU n 
1 351 GLN n 
1 352 ILE n 
1 353 THR n 
1 354 THR n 
1 355 CYS n 
1 356 HIS n 
1 357 ASP n 
1 358 VAL n 
1 359 LEU n 
1 360 PRO n 
1 361 GLU n 
1 362 GLN n 
1 363 LEU n 
1 364 LEU n 
1 365 VAL n 
1 366 GLY n 
1 367 ASP n 
1 368 MET n 
1 369 PHE n 
1 370 ASN n 
1 371 TYR n 
1 372 PHE n 
1 373 LEU n 
1 374 SER n 
1 375 LEU n 
1 376 ALA n 
1 377 ILE n 
1 378 GLY n 
1 379 VAL n 
1 380 PHE n 
1 381 LEU n 
1 382 PHE n 
1 383 PRO n 
1 384 ALA n 
1 385 PHE n 
1 386 LEU n 
1 387 THR n 
1 388 ALA n 
1 389 SER n 
1 390 ALA n 
1 391 TYR n 
1 392 VAL n 
1 393 LEU n 
1 394 MET n 
1 395 ILE n 
1 396 ARG n 
1 397 ALA n 
1 398 LEU n 
1 399 ALA n 
1 400 ASP n 
1 401 LEU n 
1 402 GLU n 
1 403 ASP n 
1 404 ASN n 
1 405 TRP n 
1 406 GLU n 
1 407 THR n 
1 408 LEU n 
1 409 ASN n 
1 410 ASP n 
1 411 ASN n 
1 412 LEU n 
1 413 LYS n 
1 414 VAL n 
1 415 ILE n 
1 416 GLU n 
1 417 LYS n 
1 418 ALA n 
1 419 ASP n 
1 420 ASN n 
1 421 ALA n 
1 422 ALA n 
1 423 GLN n 
1 424 VAL n 
1 425 LYS n 
1 426 ASP n 
1 427 ALA n 
1 428 LEU n 
1 429 THR n 
1 430 LYS n 
1 431 MET n 
1 432 ARG n 
1 433 ALA n 
1 434 ALA n 
1 435 ALA n 
1 436 LEU n 
1 437 ASP n 
1 438 ALA n 
1 439 GLN n 
1 440 LYS n 
1 441 ALA n 
1 442 THR n 
1 443 PRO n 
1 444 PRO n 
1 445 LYS n 
1 446 LEU n 
1 447 GLU n 
1 448 ASP n 
1 449 LYS n 
1 450 SER n 
1 451 PRO n 
1 452 ASP n 
1 453 SER n 
1 454 PRO n 
1 455 GLU n 
1 456 MET n 
1 457 LYS n 
1 458 ASP n 
1 459 PHE n 
1 460 ARG n 
1 461 HIS n 
1 462 GLY n 
1 463 PHE n 
1 464 ASP n 
1 465 ILE n 
1 466 LEU n 
1 467 VAL n 
1 468 GLY n 
1 469 GLN n 
1 470 ILE n 
1 471 ASP n 
1 472 ASP n 
1 473 ALA n 
1 474 LEU n 
1 475 LYS n 
1 476 LEU n 
1 477 ALA n 
1 478 ASN n 
1 479 GLU n 
1 480 GLY n 
1 481 LYS n 
1 482 VAL n 
1 483 LYS n 
1 484 GLU n 
1 485 ALA n 
1 486 GLN n 
1 487 ALA n 
1 488 ALA n 
1 489 ALA n 
1 490 GLU n 
1 491 GLN n 
1 492 LEU n 
1 493 LYS n 
1 494 THR n 
1 495 THR n 
1 496 ARG n 
1 497 ASN n 
1 498 ALA n 
1 499 TYR n 
1 500 ILE n 
1 501 GLN n 
1 502 LYS n 
1 503 TYR n 
1 504 LEU n 
1 505 GLU n 
1 506 ASN n 
1 507 SER n 
1 508 GLU n 
1 509 LYS n 
1 510 LYS n 
1 511 ARG n 
1 512 LYS n 
1 513 ARG n 
1 514 ALA n 
1 515 ILE n 
1 516 LYS n 
1 517 LEU n 
1 518 ALA n 
1 519 VAL n 
1 520 THR n 
1 521 VAL n 
1 522 ALA n 
1 523 ALA n 
1 524 MET n 
1 525 TYR n 
1 526 LEU n 
1 527 ILE n 
1 528 CYS n 
1 529 PHE n 
1 530 THR n 
1 531 PRO n 
1 532 SER n 
1 533 ASN n 
1 534 LEU n 
1 535 LEU n 
1 536 LEU n 
1 537 VAL n 
1 538 VAL n 
1 539 HIS n 
1 540 TYR n 
1 541 PHE n 
1 542 LEU n 
1 543 ILE n 
1 544 LYS n 
1 545 SER n 
1 546 GLN n 
1 547 GLY n 
1 548 GLN n 
1 549 SER n 
1 550 HIS n 
1 551 VAL n 
1 552 TYR n 
1 553 ALA n 
1 554 LEU n 
1 555 TYR n 
1 556 ILE n 
1 557 VAL n 
1 558 ALA n 
1 559 LEU n 
1 560 CYS n 
1 561 LEU n 
1 562 SER n 
1 563 THR n 
1 564 LEU n 
1 565 ASN n 
1 566 SER n 
1 567 CYS n 
1 568 ILE n 
1 569 ASP n 
1 570 PRO n 
1 571 PHE n 
1 572 VAL n 
1 573 TYR n 
1 574 TYR n 
1 575 PHE n 
1 576 VAL n 
1 577 SER n 
1 578 HIS n 
1 579 ASP n 
1 580 PHE n 
1 581 ARG n 
1 582 ASP n 
1 583 HIS n 
1 584 ALA n 
1 585 LYS n 
1 586 ASN n 
1 587 ALA n 
1 588 LEU n 
1 589 LEU n 
1 590 CYS n 
1 591 ARG n 
1 592 SER n 
1 593 VAL n 
1 594 ARG n 
1 595 THR n 
1 596 VAL n 
1 597 LYS n 
1 598 GLN n 
1 599 MET n 
1 600 GLN n 
1 601 VAL n 
1 602 SER n 
1 603 LEU n 
1 604 THR n 
1 605 SER n 
1 606 LYS n 
1 607 ALA n 
1 608 ALA n 
1 609 ALA n 
1 610 HIS n 
1 611 HIS n 
1 612 HIS n 
1 613 HIS n 
1 614 HIS n 
1 615 HIS n 
1 616 HIS n 
1 617 HIS n 
1 618 HIS n 
1 619 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   187 ?     ? 'e, T4Tp126'         ? ? ? ? ? ? 'Enterobacteria phage T4' 10665 ? ? ? ? ? ? ? 
'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Plasmid ? ? ? pFASTBAC ? ? 
1 2 sample 'Biological sequence' 188 398 Human ? 'F2RL1, GPR11, PAR2' ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? 
'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Plasmid ? ? ? pFASTBAC ? ? 
1 3 sample 'Biological sequence' 399 504 ?     ? cybC                 ? ? ? ? ? ? 'Escherichia coli'        562   ? ? ? ? ? ? ? 
'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Plasmid ? ? ? pFASTBAC ? ? 
1 4 sample 'Biological sequence' 505 619 Human ? 'F2RL1, GPR11, PAR2' ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? 
'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Plasmid ? ? ? pFASTBAC ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP D9IEF7_BPT4 D9IEF7 ? 1 
;NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRN
AKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY

;
2   
2 UNP PAR2_HUMAN  P55085 ? 1 
;FSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHG
NNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFI
PALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRML
;
59  
3 UNP C562_ECOLX  P0ABE7 ? 1 
;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYHQKY
;
23  
4 UNP PAR2_HUMAN  P55085 ? 1 
;ENSEKKRKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHA
KNALLCRSVRTVKQMQVSLTSK
;
276 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5NDD A 24  ? 183 ? D9IEF7 2   ? 161 ? 1002 1161 
2 2 5NDD A 188 ? 398 ? P55085 59  ? 269 ? 59   269  
3 3 5NDD A 399 ? 503 ? P0ABE7 23  ? 127 ? 2000 2104 
4 4 5NDD A 505 ? 606 ? P55085 276 ? 377 ? 276  377  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5NDD MET A 1   ? UNP D9IEF7 ?   ?   'initiating methionine' 979  1  
1 5NDD VAL A 2   ? UNP D9IEF7 ?   ?   'expression tag'        980  2  
1 5NDD SER A 3   ? UNP D9IEF7 ?   ?   'expression tag'        981  3  
1 5NDD ALA A 4   ? UNP D9IEF7 ?   ?   'expression tag'        982  4  
1 5NDD ILE A 5   ? UNP D9IEF7 ?   ?   'expression tag'        983  5  
1 5NDD VAL A 6   ? UNP D9IEF7 ?   ?   'expression tag'        984  6  
1 5NDD LEU A 7   ? UNP D9IEF7 ?   ?   'expression tag'        985  7  
1 5NDD TYR A 8   ? UNP D9IEF7 ?   ?   'expression tag'        986  8  
1 5NDD VAL A 9   ? UNP D9IEF7 ?   ?   'expression tag'        987  9  
1 5NDD LEU A 10  ? UNP D9IEF7 ?   ?   'expression tag'        988  10 
1 5NDD LEU A 11  ? UNP D9IEF7 ?   ?   'expression tag'        989  11 
1 5NDD ALA A 12  ? UNP D9IEF7 ?   ?   'expression tag'        990  12 
1 5NDD ALA A 13  ? UNP D9IEF7 ?   ?   'expression tag'        991  13 
1 5NDD ALA A 14  ? UNP D9IEF7 ?   ?   'expression tag'        992  14 
1 5NDD ALA A 15  ? UNP D9IEF7 ?   ?   'expression tag'        993  15 
1 5NDD HIS A 16  ? UNP D9IEF7 ?   ?   'expression tag'        994  16 
1 5NDD SER A 17  ? UNP D9IEF7 ?   ?   'expression tag'        995  17 
1 5NDD ALA A 18  ? UNP D9IEF7 ?   ?   'expression tag'        996  18 
1 5NDD PHE A 19  ? UNP D9IEF7 ?   ?   'expression tag'        997  19 
1 5NDD ALA A 20  ? UNP D9IEF7 ?   ?   'expression tag'        998  20 
1 5NDD ALA A 21  ? UNP D9IEF7 ?   ?   'expression tag'        999  21 
1 5NDD ALA A 22  ? UNP D9IEF7 ?   ?   'expression tag'        1000 22 
1 5NDD SER A 23  ? UNP D9IEF7 ?   ?   'expression tag'        1001 23 
1 5NDD THR A 76  ? UNP D9IEF7 CYS 54  conflict                1054 24 
1 5NDD ALA A 119 ? UNP D9IEF7 CYS 97  conflict                1097 25 
1 5NDD ILE A 184 ? UNP D9IEF7 ?   ?   linker                  1162 26 
1 5NDD TYR A 185 ? UNP D9IEF7 ?   ?   linker                  1163 27 
1 5NDD GLU A 186 ? UNP D9IEF7 ?   ?   linker                  1164 28 
1 5NDD PHE A 187 ? UNP D9IEF7 ?   ?   linker                  1165 29 
2 5NDD ALA A 218 ? UNP P55085 GLY 89  'engineered mutation'   89   30 
2 5NDD ALA A 237 ? UNP P55085 HIS 108 'engineered mutation'   108  31 
2 5NDD ALA A 286 ? UNP P55085 GLY 157 'engineered mutation'   157  32 
2 5NDD LEU A 295 ? UNP P55085 MET 166 'engineered mutation'   166  33 
2 5NDD ALA A 303 ? UNP P55085 TYR 174 'engineered mutation'   174  34 
2 5NDD GLU A 305 ? UNP P55085 VAL 176 'engineered mutation'   176  35 
2 5NDD GLN A 351 ? UNP P55085 ASN 222 'engineered mutation'   222  36 
2 5NDD ALA A 397 ? UNP P55085 MET 268 'engineered mutation'   268  37 
3 5NDD TRP A 405 ? UNP P0ABE7 MET 29  conflict                2006 38 
3 5NDD ILE A 500 ? UNP P0ABE7 HIS 124 conflict                2101 39 
3 5NDD LEU A 504 ? UNP P0ABE7 ?   ?   linker                  2105 40 
4 5NDD ALA A 518 ? UNP P55085 ILE 289 'engineered mutation'   289  41 
4 5NDD ALA A 522 ? UNP P55085 LEU 293 'engineered mutation'   293  42 
4 5NDD ALA A 607 ? UNP P55085 ?   ?   'expression tag'        378  43 
4 5NDD ALA A 608 ? UNP P55085 ?   ?   'expression tag'        379  44 
4 5NDD ALA A 609 ? UNP P55085 ?   ?   'expression tag'        380  45 
4 5NDD HIS A 610 ? UNP P55085 ?   ?   'expression tag'        381  46 
4 5NDD HIS A 611 ? UNP P55085 ?   ?   'expression tag'        382  47 
4 5NDD HIS A 612 ? UNP P55085 ?   ?   'expression tag'        383  48 
4 5NDD HIS A 613 ? UNP P55085 ?   ?   'expression tag'        384  49 
4 5NDD HIS A 614 ? UNP P55085 ?   ?   'expression tag'        385  50 
4 5NDD HIS A 615 ? UNP P55085 ?   ?   'expression tag'        386  51 
4 5NDD HIS A 616 ? UNP P55085 ?   ?   'expression tag'        387  52 
4 5NDD HIS A 617 ? UNP P55085 ?   ?   'expression tag'        388  53 
4 5NDD HIS A 618 ? UNP P55085 ?   ?   'expression tag'        389  54 
4 5NDD HIS A 619 ? UNP P55085 ?   ?   'expression tag'        390  55 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8TZ non-polymer         . '(~{S})-(4-fluoranyl-2-propyl-phenyl)-(1~{H}-imidazol-2-yl)methanol' ? 'C13 H15 F N2 O' 234.269 
ALA 'L-peptide linking' y ALANINE                                                              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                           ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                                                         ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                                        ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                                      ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE                                                              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                               ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NDD 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.04 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.52 
_exptl_crystal.description                 'Needle-shaped crystals (on average 0.1mm long)' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    Constant 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M sodium citrate/citrate acid pH 5.5-6.2, 0.2 M ammonium phosphate dibasic, 38-43 % (w/v) PEG400 and 1 mM AZ8838' 
_exptl_crystal_grow.pdbx_pH_range   5.5-6.2 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96859 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.96859 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            24.2 
_reflns.entry_id                         5NDD 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.80 
_reflns.d_resolution_low                 34.34 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17995 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.4 
_reflns.pdbx_Rmerge_I_obs                0.134 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.110 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.989 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.80 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.7 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2671 
_reflns_shell.percent_possible_all        98.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.633 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.522 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.692 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5NDD 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.801 
_refine.ls_d_res_low                             34.336 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     17823 
_refine.ls_number_reflns_R_free                  858 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.65 
_refine.ls_percent_reflns_R_free                 4.81 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2244 
_refine.ls_R_factor_R_free                       0.2639 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2224 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.92 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3VW7 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.31 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.33 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4498 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               4531 
_refine_hist.d_res_high                       2.801 
_refine_hist.d_res_low                        34.336 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006 ? 4624 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.631 ? 6269 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 9.256 ? 1664 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.022 ? 726  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003 ? 780  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8009 2.9762  . . 139 2803 96.00 . . . 0.2961 . 0.2811 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9762 3.2059  . . 139 2842 97.00 . . . 0.3177 . 0.2814 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2059 3.5282  . . 153 2848 97.00 . . . 0.2902 . 0.2558 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5282 4.0381  . . 152 2835 97.00 . . . 0.2690 . 0.2261 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0381 5.0849  . . 142 2830 97.00 . . . 0.2577 . 0.2034 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0849 34.3390 . . 133 2807 96.00 . . . 0.2216 . 0.1867 . . . . . . . . . . 
# 
_struct.entry_id                     5NDD 
_struct.title                        
;Crystal structure of a thermostabilised human protease-activated receptor-2 (PAR2) in complex with AZ8838 at 2.8 angstrom resolution
;
_struct.pdbx_descriptor              
'Lysozyme,Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2 (E.C.3.2.1.17)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NDD 
_struct_keywords.text            'MEMBRANE PROTEIN, GPCR, 7TM' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 24  ? GLY A 34  ? ASN A 1002 GLY A 1012 1 ? 11 
HELX_P HELX_P2  AA2 SER A 60  ? GLY A 73  ? SER A 1038 GLY A 1051 1 ? 14 
HELX_P HELX_P3  AA3 THR A 81  ? ASN A 103 ? THR A 1059 ASN A 1081 1 ? 23 
HELX_P HELX_P4  AA4 LEU A 106 ? LEU A 113 ? LEU A 1084 LEU A 1091 1 ? 8  
HELX_P HELX_P5  AA5 ASP A 114 ? GLY A 135 ? ASP A 1092 GLY A 1113 1 ? 22 
HELX_P HELX_P6  AA6 PHE A 136 ? GLN A 145 ? PHE A 1114 GLN A 1123 1 ? 10 
HELX_P HELX_P7  AA7 ARG A 147 ? LYS A 157 ? ARG A 1125 LYS A 1135 1 ? 11 
HELX_P HELX_P8  AA8 SER A 158 ? THR A 164 ? SER A 1136 THR A 1142 1 ? 7  
HELX_P HELX_P9  AA9 THR A 164 ? GLY A 178 ? THR A 1142 GLY A 1156 1 ? 15 
HELX_P HELX_P10 AB1 TRP A 180 ? TYR A 185 ? TRP A 1158 TYR A 1163 1 ? 6  
HELX_P HELX_P11 AB2 ASP A 191 ? LEU A 198 ? ASP A 62   LEU A 69   1 ? 8  
HELX_P HELX_P12 AB3 GLY A 200 ? VAL A 205 ? GLY A 71   VAL A 76   1 ? 6  
HELX_P HELX_P13 AB4 VAL A 205 ? ARG A 232 ? VAL A 76   ARG A 103  1 ? 28 
HELX_P HELX_P14 AB5 ALA A 237 ? ILE A 255 ? ALA A 108  ILE A 126  1 ? 19 
HELX_P HELX_P15 AB6 TRP A 256 ? HIS A 266 ? TRP A 127  HIS A 137  1 ? 11 
HELX_P HELX_P16 AB7 GLY A 273 ? ASN A 308 ? GLY A 144  ASN A 179  1 ? 36 
HELX_P HELX_P17 AB8 ARG A 314 ? THR A 335 ? ARG A 185  THR A 206  1 ? 22 
HELX_P HELX_P18 AB9 THR A 335 ? VAL A 340 ? THR A 206  VAL A 211  1 ? 6  
HELX_P HELX_P19 AC1 GLU A 361 ? LEU A 363 ? GLU A 232  LEU A 234  5 ? 3  
HELX_P HELX_P20 AC2 LEU A 364 ? VAL A 379 ? LEU A 235  VAL A 250  1 ? 16 
HELX_P HELX_P21 AC3 PHE A 380 ? GLU A 416 ? PHE A 251  GLU A 2017 1 ? 37 
HELX_P HELX_P22 AC4 ASN A 420 ? ALA A 441 ? ASN A 2021 ALA A 2042 1 ? 22 
HELX_P HELX_P23 AC5 SER A 453 ? GLU A 479 ? SER A 2054 GLU A 2080 1 ? 27 
HELX_P HELX_P24 AC6 LYS A 481 ? ILE A 500 ? LYS A 2082 ILE A 2101 1 ? 20 
HELX_P HELX_P25 AC7 ILE A 500 ? GLU A 505 ? ILE A 2101 GLU A 276  1 ? 6  
HELX_P HELX_P26 AC8 SER A 507 ? CYS A 528 ? SER A 278  CYS A 299  1 ? 22 
HELX_P HELX_P27 AC9 PHE A 529 ? GLN A 546 ? PHE A 300  GLN A 317  1 ? 18 
HELX_P HELX_P28 AD1 VAL A 551 ? SER A 562 ? VAL A 322  SER A 333  1 ? 12 
HELX_P HELX_P29 AD2 LEU A 564 ? SER A 577 ? LEU A 335  SER A 348  1 ? 14 
HELX_P HELX_P30 AD3 SER A 577 ? LEU A 588 ? SER A 348  LEU A 359  1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 277 SG  ? ? ? 1_555 A CYS 355 SG ? ? A CYS 148  A CYS 226  1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1 metalc ? ? A ASP 250 OD1 ? ? ? 1_555 C NA  .   NA ? ? A ASP 121  A NA  2202 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc2 metalc ? ? A ASN 287 OD1 ? ? ? 1_555 C NA  .   NA ? ? A ASN 158  A NA  2202 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc3 metalc ? ? A SER 291 OG  ? ? ? 1_555 C NA  .   NA ? ? A SER 162  A NA  2202 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc4 metalc ? ? A ASN 565 OD1 ? ? ? 1_555 C NA  .   NA ? ? A ASN 336  A NA  2202 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc5 metalc ? ? A ASP 569 OD2 ? ? ? 1_555 C NA  .   NA ? ? A ASP 340  A NA  2202 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc6 metalc ? ? C NA  .   NA  ? ? ? 1_555 E HOH .   O  ? ? A NA  2202 A HOH 2307 1_555 ? ? ? ? ? ? ? 3.079 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 36  ? LYS A 41  ? ARG A 1014 LYS A 1019 
AA1 2 TYR A 47  ? GLY A 50  ? TYR A 1025 GLY A 1028 
AA1 3 HIS A 53  ? THR A 56  ? HIS A 1031 THR A 1034 
AA2 1 THR A 344 ? ILE A 347 ? THR A 215  ILE A 218  
AA2 2 ILE A 352 ? CYS A 355 ? ILE A 223  CYS A 226  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 40  ? N TYR A 1018 O THR A 48  ? O THR A 1026 
AA1 2 3 N TYR A 47  ? N TYR A 1025 O LEU A 55  ? O LEU A 1033 
AA2 1 2 N ILE A 347 ? N ILE A 218  O ILE A 352 ? O ILE A 223  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 8TZ 2201 ? 13 'binding site for residue 8TZ A 2201' 
AC2 Software A NA  2202 ? 6  'binding site for residue NA A 2202'  
AC3 Software A PO4 2203 ? 5  'binding site for residue PO4 A 2203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 TYR A 211 ? TYR A 82   . ? 1_555 ? 
2  AC1 13 LYS A 260 ? LYS A 131  . ? 1_555 ? 
3  AC1 13 TYR A 263 ? TYR A 134  . ? 1_555 ? 
4  AC1 13 HIS A 264 ? HIS A 135  . ? 1_555 ? 
5  AC1 13 TRP A 270 ? TRP A 141  . ? 1_555 ? 
6  AC1 13 ILE A 281 ? ILE A 152  . ? 1_555 ? 
7  AC1 13 PHE A 284 ? PHE A 155  . ? 1_555 ? 
8  AC1 13 TYR A 285 ? TYR A 156  . ? 1_555 ? 
9  AC1 13 CYS A 355 ? CYS A 226  . ? 1_555 ? 
10 AC1 13 HIS A 356 ? HIS A 227  . ? 1_555 ? 
11 AC1 13 ASP A 357 ? ASP A 228  . ? 1_555 ? 
12 AC1 13 ILE A 556 ? ILE A 327  . ? 1_555 ? 
13 AC1 13 LEU A 559 ? LEU A 330  . ? 1_555 ? 
14 AC2 6  ASP A 250 ? ASP A 121  . ? 1_555 ? 
15 AC2 6  ASN A 287 ? ASN A 158  . ? 1_555 ? 
16 AC2 6  SER A 291 ? SER A 162  . ? 1_555 ? 
17 AC2 6  ASN A 565 ? ASN A 336  . ? 1_555 ? 
18 AC2 6  ASP A 569 ? ASP A 340  . ? 1_555 ? 
19 AC2 6  HOH E .   ? HOH A 2307 . ? 1_555 ? 
20 AC3 5  GLN A 163 ? GLN A 1141 . ? 1_555 ? 
21 AC3 5  THR A 164 ? THR A 1142 . ? 1_555 ? 
22 AC3 5  PRO A 165 ? PRO A 1143 . ? 1_555 ? 
23 AC3 5  ASN A 166 ? ASN A 1144 . ? 1_555 ? 
24 AC3 5  ARG A 167 ? ARG A 1145 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5NDD 
_atom_sites.fract_transf_matrix[1][1]   0.026948 
_atom_sites.fract_transf_matrix[1][2]   0.003257 
_atom_sites.fract_transf_matrix[1][3]   0.001306 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016178 
_atom_sites.fract_transf_matrix[2][3]   0.004365 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011860 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 22  ? 9.677   -0.883  91.806  1.00 70.05  ? 1000 ALA A N   1 
ATOM   2    C  CA  . ALA A 1 22  ? 8.302   -1.267  92.102  1.00 69.05  ? 1000 ALA A CA  1 
ATOM   3    C  C   . ALA A 1 22  ? 8.244   -2.626  92.787  1.00 69.90  ? 1000 ALA A C   1 
ATOM   4    O  O   . ALA A 1 22  ? 9.009   -3.534  92.458  1.00 69.12  ? 1000 ALA A O   1 
ATOM   5    C  CB  . ALA A 1 22  ? 7.470   -1.279  90.836  1.00 65.77  ? 1000 ALA A CB  1 
ATOM   6    N  N   . SER A 1 23  ? 7.324   -2.760  93.735  1.00 70.13  ? 1001 SER A N   1 
ATOM   7    C  CA  . SER A 1 23  ? 7.206   -3.979  94.525  1.00 71.71  ? 1001 SER A CA  1 
ATOM   8    C  C   . SER A 1 23  ? 5.791   -4.545  94.469  1.00 71.27  ? 1001 SER A C   1 
ATOM   9    O  O   . SER A 1 23  ? 5.599   -5.761  94.452  1.00 70.63  ? 1001 SER A O   1 
ATOM   10   C  CB  . SER A 1 23  ? 7.605   -3.713  95.980  1.00 73.23  ? 1001 SER A CB  1 
ATOM   11   O  OG  . SER A 1 23  ? 8.947   -3.265  96.070  1.00 74.27  ? 1001 SER A OG  1 
ATOM   12   N  N   . ASN A 1 24  ? 4.805   -3.655  94.443  1.00 68.23  ? 1002 ASN A N   1 
ATOM   13   C  CA  . ASN A 1 24  ? 3.408   -4.063  94.463  1.00 64.66  ? 1002 ASN A CA  1 
ATOM   14   C  C   . ASN A 1 24  ? 2.506   -3.068  93.738  1.00 66.93  ? 1002 ASN A C   1 
ATOM   15   O  O   . ASN A 1 24  ? 2.987   -2.107  93.134  1.00 66.96  ? 1002 ASN A O   1 
ATOM   16   C  CB  . ASN A 1 24  ? 2.936   -4.245  95.905  1.00 67.06  ? 1002 ASN A CB  1 
ATOM   17   C  CG  . ASN A 1 24  ? 3.121   -2.993  96.737  1.00 70.12  ? 1002 ASN A CG  1 
ATOM   18   O  OD1 . ASN A 1 24  ? 2.207   -2.180  96.862  1.00 69.80  ? 1002 ASN A OD1 1 
ATOM   19   N  ND2 . ASN A 1 24  ? 4.310   -2.830  97.308  1.00 72.03  ? 1002 ASN A ND2 1 
ATOM   20   N  N   . ILE A 1 25  ? 1.200   -3.308  93.803  1.00 64.03  ? 1003 ILE A N   1 
ATOM   21   C  CA  . ILE A 1 25  ? 0.223   -2.476  93.110  1.00 60.46  ? 1003 ILE A CA  1 
ATOM   22   C  C   . ILE A 1 25  ? 0.301   -1.018  93.564  1.00 62.13  ? 1003 ILE A C   1 
ATOM   23   O  O   . ILE A 1 25  ? 0.319   -0.108  92.734  1.00 61.47  ? 1003 ILE A O   1 
ATOM   24   C  CB  . ILE A 1 25  ? -1.220  -3.016  93.311  1.00 59.98  ? 1003 ILE A CB  1 
ATOM   25   C  CG1 . ILE A 1 25  ? -2.258  -2.012  92.801  1.00 60.40  ? 1003 ILE A CG1 1 
ATOM   26   C  CG2 . ILE A 1 25  ? -1.478  -3.374  94.772  1.00 63.13  ? 1003 ILE A CG2 1 
ATOM   27   C  CD1 . ILE A 1 25  ? -2.236  -1.807  91.303  1.00 50.61  ? 1003 ILE A CD1 1 
ATOM   28   N  N   . PHE A 1 26  ? 0.373   -0.803  94.876  1.00 65.43  ? 1004 PHE A N   1 
ATOM   29   C  CA  . PHE A 1 26  ? 0.443   0.545   95.435  1.00 66.29  ? 1004 PHE A CA  1 
ATOM   30   C  C   . PHE A 1 26  ? 1.675   1.297   94.936  1.00 63.25  ? 1004 PHE A C   1 
ATOM   31   O  O   . PHE A 1 26  ? 1.614   2.493   94.662  1.00 63.06  ? 1004 PHE A O   1 
ATOM   32   C  CB  . PHE A 1 26  ? 0.458   0.502   96.967  1.00 65.25  ? 1004 PHE A CB  1 
ATOM   33   C  CG  . PHE A 1 26  ? -0.743  -0.169  97.576  1.00 66.11  ? 1004 PHE A CG  1 
ATOM   34   C  CD1 . PHE A 1 26  ? -1.939  0.513   97.717  1.00 67.12  ? 1004 PHE A CD1 1 
ATOM   35   C  CD2 . PHE A 1 26  ? -0.668  -1.477  98.025  1.00 65.82  ? 1004 PHE A CD2 1 
ATOM   36   C  CE1 . PHE A 1 26  ? -3.041  -0.102  98.281  1.00 69.31  ? 1004 PHE A CE1 1 
ATOM   37   C  CE2 . PHE A 1 26  ? -1.766  -2.096  98.591  1.00 65.28  ? 1004 PHE A CE2 1 
ATOM   38   C  CZ  . PHE A 1 26  ? -2.953  -1.408  98.720  1.00 67.17  ? 1004 PHE A CZ  1 
ATOM   39   N  N   . GLU A 1 27  ? 2.794   0.595   94.821  1.00 63.88  ? 1005 GLU A N   1 
ATOM   40   C  CA  . GLU A 1 27  ? 4.033   1.231   94.389  1.00 69.25  ? 1005 GLU A CA  1 
ATOM   41   C  C   . GLU A 1 27  ? 4.000   1.529   92.893  1.00 68.56  ? 1005 GLU A C   1 
ATOM   42   O  O   . GLU A 1 27  ? 4.516   2.552   92.441  1.00 66.91  ? 1005 GLU A O   1 
ATOM   43   C  CB  . GLU A 1 27  ? 5.238   0.351   94.734  1.00 74.01  ? 1005 GLU A CB  1 
ATOM   44   C  CG  . GLU A 1 27  ? 6.572   0.929   94.286  1.00 78.09  ? 1005 GLU A CG  1 
ATOM   45   C  CD  . GLU A 1 27  ? 6.752   2.376   94.701  1.00 91.57  ? 1005 GLU A CD  1 
ATOM   46   O  OE1 . GLU A 1 27  ? 7.172   3.190   93.851  1.00 90.80  ? 1005 GLU A OE1 1 
ATOM   47   O  OE2 . GLU A 1 27  ? 6.479   2.699   95.878  1.00 97.04  ? 1005 GLU A OE2 1 
ATOM   48   N  N   . MET A 1 28  ? 3.385   0.626   92.137  1.00 68.34  ? 1006 MET A N   1 
ATOM   49   C  CA  . MET A 1 28  ? 3.216   0.793   90.700  1.00 60.01  ? 1006 MET A CA  1 
ATOM   50   C  C   . MET A 1 28  ? 2.398   2.041   90.371  1.00 59.50  ? 1006 MET A C   1 
ATOM   51   O  O   . MET A 1 28  ? 2.803   2.859   89.542  1.00 58.34  ? 1006 MET A O   1 
ATOM   52   C  CB  . MET A 1 28  ? 2.550   -0.453  90.107  1.00 60.43  ? 1006 MET A CB  1 
ATOM   53   C  CG  . MET A 1 28  ? 2.016   -0.280  88.694  1.00 57.49  ? 1006 MET A CG  1 
ATOM   54   S  SD  . MET A 1 28  ? 0.915   -1.625  88.206  1.00 52.28  ? 1006 MET A SD  1 
ATOM   55   C  CE  . MET A 1 28  ? 2.049   -2.755  87.411  1.00 52.93  ? 1006 MET A CE  1 
ATOM   56   N  N   . LEU A 1 29  ? 1.254   2.187   91.033  1.00 57.34  ? 1007 LEU A N   1 
ATOM   57   C  CA  . LEU A 1 29  ? 0.343   3.294   90.757  1.00 57.07  ? 1007 LEU A CA  1 
ATOM   58   C  C   . LEU A 1 29  ? 0.959   4.652   91.070  1.00 57.37  ? 1007 LEU A C   1 
ATOM   59   O  O   . LEU A 1 29  ? 0.696   5.632   90.375  1.00 60.75  ? 1007 LEU A O   1 
ATOM   60   C  CB  . LEU A 1 29  ? -0.956  3.119   91.544  1.00 57.88  ? 1007 LEU A CB  1 
ATOM   61   C  CG  . LEU A 1 29  ? -1.866  2.005   91.027  1.00 56.73  ? 1007 LEU A CG  1 
ATOM   62   C  CD1 . LEU A 1 29  ? -3.071  1.825   91.933  1.00 57.45  ? 1007 LEU A CD1 1 
ATOM   63   C  CD2 . LEU A 1 29  ? -2.302  2.307   89.601  1.00 53.30  ? 1007 LEU A CD2 1 
ATOM   64   N  N   . ARG A 1 30  ? 1.780   4.705   92.114  1.00 59.99  ? 1008 ARG A N   1 
ATOM   65   C  CA  . ARG A 1 30  ? 2.435   5.948   92.508  1.00 60.50  ? 1008 ARG A CA  1 
ATOM   66   C  C   . ARG A 1 30  ? 3.316   6.486   91.387  1.00 59.25  ? 1008 ARG A C   1 
ATOM   67   O  O   . ARG A 1 30  ? 3.468   7.696   91.229  1.00 57.78  ? 1008 ARG A O   1 
ATOM   68   C  CB  . ARG A 1 30  ? 3.269   5.740   93.774  1.00 64.28  ? 1008 ARG A CB  1 
ATOM   69   C  CG  . ARG A 1 30  ? 2.451   5.536   95.036  1.00 64.66  ? 1008 ARG A CG  1 
ATOM   70   C  CD  . ARG A 1 30  ? 3.343   5.497   96.271  1.00 69.81  ? 1008 ARG A CD  1 
ATOM   71   N  NE  . ARG A 1 30  ? 2.568   5.419   97.508  1.00 73.83  ? 1008 ARG A NE  1 
ATOM   72   C  CZ  . ARG A 1 30  ? 2.255   4.284   98.125  1.00 73.93  ? 1008 ARG A CZ  1 
ATOM   73   N  NH1 . ARG A 1 30  ? 1.546   4.308   99.245  1.00 77.47  ? 1008 ARG A NH1 1 
ATOM   74   N  NH2 . ARG A 1 30  ? 2.653   3.124   97.622  1.00 74.78  ? 1008 ARG A NH2 1 
ATOM   75   N  N   . ILE A 1 31  ? 3.887   5.576   90.607  1.00 62.29  ? 1009 ILE A N   1 
ATOM   76   C  CA  . ILE A 1 31  ? 4.766   5.950   89.509  1.00 59.93  ? 1009 ILE A CA  1 
ATOM   77   C  C   . ILE A 1 31  ? 3.970   6.459   88.309  1.00 58.95  ? 1009 ILE A C   1 
ATOM   78   O  O   . ILE A 1 31  ? 4.403   7.377   87.614  1.00 61.48  ? 1009 ILE A O   1 
ATOM   79   C  CB  . ILE A 1 31  ? 5.646   4.762   89.081  1.00 61.56  ? 1009 ILE A CB  1 
ATOM   80   C  CG1 . ILE A 1 31  ? 6.293   4.121   90.311  1.00 61.66  ? 1009 ILE A CG1 1 
ATOM   81   C  CG2 . ILE A 1 31  ? 6.706   5.211   88.084  1.00 59.32  ? 1009 ILE A CG2 1 
ATOM   82   C  CD1 . ILE A 1 31  ? 7.026   2.830   90.024  1.00 63.46  ? 1009 ILE A CD1 1 
ATOM   83   N  N   . ASP A 1 32  ? 2.801   5.867   88.078  1.00 56.38  ? 1010 ASP A N   1 
ATOM   84   C  CA  . ASP A 1 32  ? 1.954   6.260   86.956  1.00 57.83  ? 1010 ASP A CA  1 
ATOM   85   C  C   . ASP A 1 32  ? 1.173   7.538   87.240  1.00 59.78  ? 1010 ASP A C   1 
ATOM   86   O  O   . ASP A 1 32  ? 1.049   8.404   86.374  1.00 60.25  ? 1010 ASP A O   1 
ATOM   87   C  CB  . ASP A 1 32  ? 0.976   5.138   86.600  1.00 56.17  ? 1010 ASP A CB  1 
ATOM   88   C  CG  . ASP A 1 32  ? 1.632   4.012   85.825  1.00 55.45  ? 1010 ASP A CG  1 
ATOM   89   O  OD1 . ASP A 1 32  ? 2.590   4.284   85.071  1.00 52.61  ? 1010 ASP A OD1 1 
ATOM   90   O  OD2 . ASP A 1 32  ? 1.175   2.857   85.958  1.00 53.74  ? 1010 ASP A OD2 1 
ATOM   91   N  N   . GLU A 1 33  ? 0.643   7.647   88.454  1.00 61.85  ? 1011 GLU A N   1 
ATOM   92   C  CA  . GLU A 1 33  ? -0.249  8.750   88.801  1.00 61.43  ? 1011 GLU A CA  1 
ATOM   93   C  C   . GLU A 1 33  ? 0.494   9.922   89.434  1.00 62.41  ? 1011 GLU A C   1 
ATOM   94   O  O   . GLU A 1 33  ? 0.016   11.056  89.409  1.00 64.29  ? 1011 GLU A O   1 
ATOM   95   C  CB  . GLU A 1 33  ? -1.349  8.265   89.749  1.00 59.03  ? 1011 GLU A CB  1 
ATOM   96   C  CG  . GLU A 1 33  ? -2.118  7.048   89.251  1.00 59.94  ? 1011 GLU A CG  1 
ATOM   97   C  CD  . GLU A 1 33  ? -2.896  7.318   87.972  1.00 61.77  ? 1011 GLU A CD  1 
ATOM   98   O  OE1 . GLU A 1 33  ? -3.138  6.358   87.209  1.00 55.79  ? 1011 GLU A OE1 1 
ATOM   99   O  OE2 . GLU A 1 33  ? -3.273  8.484   87.732  1.00 60.73  ? 1011 GLU A OE2 1 
ATOM   100  N  N   . GLY A 1 34  ? 1.662   9.647   90.002  1.00 61.12  ? 1012 GLY A N   1 
ATOM   101  C  CA  . GLY A 1 34  ? 2.425   10.678  90.678  1.00 61.78  ? 1012 GLY A CA  1 
ATOM   102  C  C   . GLY A 1 34  ? 1.776   11.076  91.989  1.00 68.46  ? 1012 GLY A C   1 
ATOM   103  O  O   . GLY A 1 34  ? 0.857   10.408  92.466  1.00 67.83  ? 1012 GLY A O   1 
ATOM   104  N  N   . LEU A 1 35  ? 2.253   12.170  92.575  1.00 73.05  ? 1013 LEU A N   1 
ATOM   105  C  CA  . LEU A 1 35  ? 1.726   12.643  93.849  1.00 74.77  ? 1013 LEU A CA  1 
ATOM   106  C  C   . LEU A 1 35  ? 1.661   14.164  93.896  1.00 77.35  ? 1013 LEU A C   1 
ATOM   107  O  O   . LEU A 1 35  ? 2.688   14.840  93.881  1.00 79.35  ? 1013 LEU A O   1 
ATOM   108  C  CB  . LEU A 1 35  ? 2.577   12.116  95.005  1.00 79.32  ? 1013 LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 35  ? 2.217   12.614  96.406  1.00 79.78  ? 1013 LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 35  ? 0.752   12.343  96.714  1.00 77.29  ? 1013 LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 35  ? 3.116   11.963  97.448  1.00 78.46  ? 1013 LEU A CD2 1 
ATOM   112  N  N   . ARG A 1 36  ? 0.445   14.697  93.953  1.00 81.47  ? 1014 ARG A N   1 
ATOM   113  C  CA  . ARG A 1 36  ? 0.243   16.138  94.037  1.00 84.80  ? 1014 ARG A CA  1 
ATOM   114  C  C   . ARG A 1 36  ? -0.854  16.461  95.045  1.00 83.23  ? 1014 ARG A C   1 
ATOM   115  O  O   . ARG A 1 36  ? -1.935  15.875  95.009  1.00 81.02  ? 1014 ARG A O   1 
ATOM   116  C  CB  . ARG A 1 36  ? -0.101  16.715  92.664  1.00 85.26  ? 1014 ARG A CB  1 
ATOM   117  C  CG  . ARG A 1 36  ? -0.181  18.230  92.633  1.00 88.26  ? 1014 ARG A CG  1 
ATOM   118  C  CD  . ARG A 1 36  ? -0.180  18.747  91.205  1.00 89.89  ? 1014 ARG A CD  1 
ATOM   119  N  NE  . ARG A 1 36  ? -0.283  20.203  91.145  1.00 94.62  ? 1014 ARG A NE  1 
ATOM   120  C  CZ  . ARG A 1 36  ? -0.201  20.911  90.023  1.00 92.27  ? 1014 ARG A CZ  1 
ATOM   121  N  NH1 . ARG A 1 36  ? -0.012  20.300  88.861  1.00 92.14  ? 1014 ARG A NH1 1 
ATOM   122  N  NH2 . ARG A 1 36  ? -0.306  22.232  90.062  1.00 88.70  ? 1014 ARG A NH2 1 
ATOM   123  N  N   . LEU A 1 37  ? -0.568  17.394  95.947  1.00 89.06  ? 1015 LEU A N   1 
ATOM   124  C  CA  . LEU A 1 37  ? -1.489  17.710  97.032  1.00 90.05  ? 1015 LEU A CA  1 
ATOM   125  C  C   . LEU A 1 37  ? -2.478  18.810  96.653  1.00 90.58  ? 1015 LEU A C   1 
ATOM   126  O  O   . LEU A 1 37  ? -3.277  19.245  97.480  1.00 93.84  ? 1015 LEU A O   1 
ATOM   127  C  CB  . LEU A 1 37  ? -0.709  18.117  98.286  1.00 90.59  ? 1015 LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 37  ? 0.322   17.116  98.815  1.00 91.67  ? 1015 LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 37  ? 0.879   17.574  100.157 1.00 97.71  ? 1015 LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 37  ? -0.272  15.718  98.924  1.00 90.53  ? 1015 LEU A CD2 1 
ATOM   131  N  N   . LYS A 1 38  ? -2.423  19.257  95.403  1.00 88.97  ? 1016 LYS A N   1 
ATOM   132  C  CA  . LYS A 1 38  ? -3.339  20.289  94.925  1.00 91.84  ? 1016 LYS A CA  1 
ATOM   133  C  C   . LYS A 1 38  ? -4.110  19.825  93.696  1.00 88.23  ? 1016 LYS A C   1 
ATOM   134  O  O   . LYS A 1 38  ? -3.626  18.994  92.928  1.00 88.69  ? 1016 LYS A O   1 
ATOM   135  C  CB  . LYS A 1 38  ? -2.578  21.577  94.611  1.00 91.77  ? 1016 LYS A CB  1 
ATOM   136  C  CG  . LYS A 1 38  ? -1.909  22.202  95.821  1.00 93.50  ? 1016 LYS A CG  1 
ATOM   137  C  CD  . LYS A 1 38  ? -1.234  23.509  95.457  1.00 94.98  ? 1016 LYS A CD  1 
ATOM   138  C  CE  . LYS A 1 38  ? -0.472  24.088  96.635  1.00 96.65  ? 1016 LYS A CE  1 
ATOM   139  N  NZ  . LYS A 1 38  ? 0.300   25.297  96.238  1.00 89.75  ? 1016 LYS A NZ  1 
ATOM   140  N  N   . ILE A 1 39  ? -5.312  20.366  93.514  1.00 87.40  ? 1017 ILE A N   1 
ATOM   141  C  CA  . ILE A 1 39  ? -6.152  19.985  92.383  1.00 89.20  ? 1017 ILE A CA  1 
ATOM   142  C  C   . ILE A 1 39  ? -5.515  20.397  91.066  1.00 86.95  ? 1017 ILE A C   1 
ATOM   143  O  O   . ILE A 1 39  ? -5.214  21.570  90.845  1.00 87.25  ? 1017 ILE A O   1 
ATOM   144  C  CB  . ILE A 1 39  ? -7.558  20.608  92.471  1.00 89.98  ? 1017 ILE A CB  1 
ATOM   145  C  CG1 . ILE A 1 39  ? -8.283  20.116  93.723  1.00 89.94  ? 1017 ILE A CG1 1 
ATOM   146  C  CG2 . ILE A 1 39  ? -8.369  20.269  91.227  1.00 89.63  ? 1017 ILE A CG2 1 
ATOM   147  C  CD1 . ILE A 1 39  ? -9.704  20.619  93.836  1.00 96.19  ? 1017 ILE A CD1 1 
ATOM   148  N  N   . TYR A 1 40  ? -5.310  19.422  90.191  1.00 85.09  ? 1018 TYR A N   1 
ATOM   149  C  CA  . TYR A 1 40  ? -4.685  19.680  88.905  1.00 88.05  ? 1018 TYR A CA  1 
ATOM   150  C  C   . TYR A 1 40  ? -5.475  19.055  87.766  1.00 87.85  ? 1018 TYR A C   1 
ATOM   151  O  O   . TYR A 1 40  ? -6.261  18.130  87.972  1.00 86.60  ? 1018 TYR A O   1 
ATOM   152  C  CB  . TYR A 1 40  ? -3.252  19.149  88.893  1.00 87.22  ? 1018 TYR A CB  1 
ATOM   153  C  CG  . TYR A 1 40  ? -3.158  17.651  89.077  1.00 86.72  ? 1018 TYR A CG  1 
ATOM   154  C  CD1 . TYR A 1 40  ? -3.180  17.085  90.346  1.00 86.12  ? 1018 TYR A CD1 1 
ATOM   155  C  CD2 . TYR A 1 40  ? -3.044  16.803  87.983  1.00 85.27  ? 1018 TYR A CD2 1 
ATOM   156  C  CE1 . TYR A 1 40  ? -3.094  15.718  90.520  1.00 85.36  ? 1018 TYR A CE1 1 
ATOM   157  C  CE2 . TYR A 1 40  ? -2.956  15.435  88.147  1.00 84.97  ? 1018 TYR A CE2 1 
ATOM   158  C  CZ  . TYR A 1 40  ? -2.981  14.898  89.417  1.00 84.94  ? 1018 TYR A CZ  1 
ATOM   159  O  OH  . TYR A 1 40  ? -2.896  13.535  89.585  1.00 85.51  ? 1018 TYR A OH  1 
ATOM   160  N  N   . LYS A 1 41  ? -5.262  19.569  86.563  1.00 90.88  ? 1019 LYS A N   1 
ATOM   161  C  CA  . LYS A 1 41  ? -5.819  18.954  85.369  1.00 96.69  ? 1019 LYS A CA  1 
ATOM   162  C  C   . LYS A 1 41  ? -4.898  17.836  84.894  1.00 95.98  ? 1019 LYS A C   1 
ATOM   163  O  O   . LYS A 1 41  ? -3.696  18.043  84.723  1.00 94.92  ? 1019 LYS A O   1 
ATOM   164  C  CB  . LYS A 1 41  ? -6.017  19.995  84.263  1.00 99.85  ? 1019 LYS A CB  1 
ATOM   165  C  CG  . LYS A 1 41  ? -7.264  20.856  84.429  1.00 101.36 ? 1019 LYS A CG  1 
ATOM   166  C  CD  . LYS A 1 41  ? -7.213  22.095  83.544  1.00 103.60 ? 1019 LYS A CD  1 
ATOM   167  C  CE  . LYS A 1 41  ? -6.176  23.094  84.043  1.00 111.17 ? 1019 LYS A CE  1 
ATOM   168  N  NZ  . LYS A 1 41  ? -5.200  23.463  82.980  1.00 106.76 ? 1019 LYS A NZ  1 
ATOM   169  N  N   . ASP A 1 42  ? -5.456  16.648  84.690  1.00 95.95  ? 1020 ASP A N   1 
ATOM   170  C  CA  . ASP A 1 42  ? -4.664  15.528  84.199  1.00 99.91  ? 1020 ASP A CA  1 
ATOM   171  C  C   . ASP A 1 42  ? -4.334  15.716  82.718  1.00 106.65 ? 1020 ASP A C   1 
ATOM   172  O  O   . ASP A 1 42  ? -4.548  16.793  82.161  1.00 105.02 ? 1020 ASP A O   1 
ATOM   173  C  CB  . ASP A 1 42  ? -5.398  14.202  84.429  1.00 99.98  ? 1020 ASP A CB  1 
ATOM   174  C  CG  . ASP A 1 42  ? -6.649  14.062  83.575  1.00 101.86 ? 1020 ASP A CG  1 
ATOM   175  O  OD1 . ASP A 1 42  ? -7.183  15.091  83.114  1.00 103.10 ? 1020 ASP A OD1 1 
ATOM   176  O  OD2 . ASP A 1 42  ? -7.104  12.917  83.372  1.00 99.89  ? 1020 ASP A OD2 1 
ATOM   177  N  N   . THR A 1 43  ? -3.819  14.666  82.085  1.00 114.07 ? 1021 THR A N   1 
ATOM   178  C  CA  . THR A 1 43  ? -3.408  14.743  80.687  1.00 110.86 ? 1021 THR A CA  1 
ATOM   179  C  C   . THR A 1 43  ? -4.575  15.086  79.761  1.00 109.15 ? 1021 THR A C   1 
ATOM   180  O  O   . THR A 1 43  ? -4.386  15.732  78.730  1.00 106.81 ? 1021 THR A O   1 
ATOM   181  C  CB  . THR A 1 43  ? -2.766  13.423  80.219  1.00 109.65 ? 1021 THR A CB  1 
ATOM   182  O  OG1 . THR A 1 43  ? -3.710  12.354  80.354  1.00 109.34 ? 1021 THR A OG1 1 
ATOM   183  C  CG2 . THR A 1 43  ? -1.524  13.109  81.047  1.00 97.73  ? 1021 THR A CG2 1 
ATOM   184  N  N   . GLU A 1 44  ? -5.779  14.657  80.134  1.00 109.30 ? 1022 GLU A N   1 
ATOM   185  C  CA  . GLU A 1 44  ? -6.969  14.922  79.327  1.00 109.51 ? 1022 GLU A CA  1 
ATOM   186  C  C   . GLU A 1 44  ? -7.665  16.219  79.729  1.00 109.67 ? 1022 GLU A C   1 
ATOM   187  O  O   . GLU A 1 44  ? -8.306  16.867  78.901  1.00 113.29 ? 1022 GLU A O   1 
ATOM   188  C  CB  . GLU A 1 44  ? -7.953  13.755  79.426  1.00 105.73 ? 1022 GLU A CB  1 
ATOM   189  C  CG  . GLU A 1 44  ? -7.413  12.450  78.865  1.00 107.51 ? 1022 GLU A CG  1 
ATOM   190  C  CD  . GLU A 1 44  ? -8.461  11.355  78.808  1.00 103.77 ? 1022 GLU A CD  1 
ATOM   191  O  OE1 . GLU A 1 44  ? -9.592  11.586  79.285  1.00 101.51 ? 1022 GLU A OE1 1 
ATOM   192  O  OE2 . GLU A 1 44  ? -8.154  10.264  78.282  1.00 96.43  ? 1022 GLU A OE2 1 
ATOM   193  N  N   . GLY A 1 45  ? -7.545  16.592  81.000  1.00 104.83 ? 1023 GLY A N   1 
ATOM   194  C  CA  . GLY A 1 45  ? -8.137  17.825  81.488  1.00 104.74 ? 1023 GLY A CA  1 
ATOM   195  C  C   . GLY A 1 45  ? -9.012  17.631  82.711  1.00 108.08 ? 1023 GLY A C   1 
ATOM   196  O  O   . GLY A 1 45  ? -9.477  18.601  83.312  1.00 107.90 ? 1023 GLY A O   1 
ATOM   197  N  N   . TYR A 1 46  ? -9.239  16.375  83.082  1.00 107.38 ? 1024 TYR A N   1 
ATOM   198  C  CA  . TYR A 1 46  ? -10.063 16.058  84.243  1.00 99.76  ? 1024 TYR A CA  1 
ATOM   199  C  C   . TYR A 1 46  ? -9.363  16.459  85.536  1.00 94.84  ? 1024 TYR A C   1 
ATOM   200  O  O   . TYR A 1 46  ? -8.208  16.100  85.766  1.00 95.84  ? 1024 TYR A O   1 
ATOM   201  C  CB  . TYR A 1 46  ? -10.404 14.565  84.273  1.00 102.63 ? 1024 TYR A CB  1 
ATOM   202  C  CG  . TYR A 1 46  ? -11.222 14.084  83.093  1.00 100.01 ? 1024 TYR A CG  1 
ATOM   203  C  CD1 . TYR A 1 46  ? -12.049 14.952  82.392  1.00 99.39  ? 1024 TYR A CD1 1 
ATOM   204  C  CD2 . TYR A 1 46  ? -11.167 12.758  82.683  1.00 100.71 ? 1024 TYR A CD2 1 
ATOM   205  C  CE1 . TYR A 1 46  ? -12.797 14.512  81.315  1.00 100.05 ? 1024 TYR A CE1 1 
ATOM   206  C  CE2 . TYR A 1 46  ? -11.911 12.309  81.608  1.00 99.89  ? 1024 TYR A CE2 1 
ATOM   207  C  CZ  . TYR A 1 46  ? -12.724 13.189  80.928  1.00 98.96  ? 1024 TYR A CZ  1 
ATOM   208  O  OH  . TYR A 1 46  ? -13.464 12.741  79.857  1.00 91.68  ? 1024 TYR A OH  1 
ATOM   209  N  N   . TYR A 1 47  ? -10.071 17.206  86.375  1.00 95.29  ? 1025 TYR A N   1 
ATOM   210  C  CA  . TYR A 1 47  ? -9.525  17.650  87.650  1.00 92.82  ? 1025 TYR A CA  1 
ATOM   211  C  C   . TYR A 1 47  ? -9.338  16.475  88.602  1.00 87.65  ? 1025 TYR A C   1 
ATOM   212  O  O   . TYR A 1 47  ? -10.289 15.765  88.927  1.00 85.36  ? 1025 TYR A O   1 
ATOM   213  C  CB  . TYR A 1 47  ? -10.433 18.708  88.282  1.00 94.88  ? 1025 TYR A CB  1 
ATOM   214  C  CG  . TYR A 1 47  ? -10.441 20.028  87.543  1.00 96.03  ? 1025 TYR A CG  1 
ATOM   215  C  CD1 . TYR A 1 47  ? -9.442  20.970  87.757  1.00 96.19  ? 1025 TYR A CD1 1 
ATOM   216  C  CD2 . TYR A 1 47  ? -11.446 20.334  86.635  1.00 92.76  ? 1025 TYR A CD2 1 
ATOM   217  C  CE1 . TYR A 1 47  ? -9.442  22.178  87.085  1.00 94.49  ? 1025 TYR A CE1 1 
ATOM   218  C  CE2 . TYR A 1 47  ? -11.454 21.541  85.958  1.00 93.00  ? 1025 TYR A CE2 1 
ATOM   219  C  CZ  . TYR A 1 47  ? -10.450 22.458  86.188  1.00 92.45  ? 1025 TYR A CZ  1 
ATOM   220  O  OH  . TYR A 1 47  ? -10.453 23.660  85.519  1.00 92.87  ? 1025 TYR A OH  1 
ATOM   221  N  N   . THR A 1 48  ? -8.099  16.266  89.032  1.00 87.66  ? 1026 THR A N   1 
ATOM   222  C  CA  . THR A 1 48  ? -7.781  15.194  89.967  1.00 87.11  ? 1026 THR A CA  1 
ATOM   223  C  C   . THR A 1 48  ? -6.923  15.720  91.115  1.00 83.24  ? 1026 THR A C   1 
ATOM   224  O  O   . THR A 1 48  ? -6.517  16.883  91.117  1.00 82.62  ? 1026 THR A O   1 
ATOM   225  C  CB  . THR A 1 48  ? -7.045  14.029  89.271  1.00 83.51  ? 1026 THR A CB  1 
ATOM   226  O  OG1 . THR A 1 48  ? -5.863  14.522  88.633  1.00 87.99  ? 1026 THR A OG1 1 
ATOM   227  C  CG2 . THR A 1 48  ? -7.934  13.374  88.224  1.00 84.72  ? 1026 THR A CG2 1 
ATOM   228  N  N   . ILE A 1 49  ? -6.652  14.860  92.090  1.00 81.08  ? 1027 ILE A N   1 
ATOM   229  C  CA  . ILE A 1 49  ? -5.810  15.232  93.220  1.00 82.45  ? 1027 ILE A CA  1 
ATOM   230  C  C   . ILE A 1 49  ? -5.255  13.979  93.889  1.00 81.60  ? 1027 ILE A C   1 
ATOM   231  O  O   . ILE A 1 49  ? -5.788  12.882  93.707  1.00 76.98  ? 1027 ILE A O   1 
ATOM   232  C  CB  . ILE A 1 49  ? -6.584  16.086  94.253  1.00 81.74  ? 1027 ILE A CB  1 
ATOM   233  C  CG1 . ILE A 1 49  ? -5.614  16.899  95.117  1.00 84.14  ? 1027 ILE A CG1 1 
ATOM   234  C  CG2 . ILE A 1 49  ? -7.499  15.212  95.098  1.00 76.88  ? 1027 ILE A CG2 1 
ATOM   235  C  CD1 . ILE A 1 49  ? -6.289  17.825  96.097  1.00 88.53  ? 1027 ILE A CD1 1 
ATOM   236  N  N   . GLY A 1 50  ? -4.178  14.146  94.654  1.00 81.18  ? 1028 GLY A N   1 
ATOM   237  C  CA  . GLY A 1 50  ? -3.536  13.035  95.332  1.00 74.93  ? 1028 GLY A CA  1 
ATOM   238  C  C   . GLY A 1 50  ? -2.849  12.117  94.344  1.00 71.28  ? 1028 GLY A C   1 
ATOM   239  O  O   . GLY A 1 50  ? -2.124  12.573  93.461  1.00 73.59  ? 1028 GLY A O   1 
ATOM   240  N  N   . ILE A 1 51  ? -3.083  10.818  94.487  1.00 68.86  ? 1029 ILE A N   1 
ATOM   241  C  CA  . ILE A 1 51  ? -2.521  9.844   93.566  1.00 66.88  ? 1029 ILE A CA  1 
ATOM   242  C  C   . ILE A 1 51  ? -3.614  9.301   92.657  1.00 66.88  ? 1029 ILE A C   1 
ATOM   243  O  O   . ILE A 1 51  ? -4.270  8.311   92.982  1.00 66.77  ? 1029 ILE A O   1 
ATOM   244  C  CB  . ILE A 1 51  ? -1.836  8.679   94.309  1.00 66.89  ? 1029 ILE A CB  1 
ATOM   245  C  CG1 . ILE A 1 51  ? -0.835  9.210   95.338  1.00 69.19  ? 1029 ILE A CG1 1 
ATOM   246  C  CG2 . ILE A 1 51  ? -1.139  7.751   93.328  1.00 62.31  ? 1029 ILE A CG2 1 
ATOM   247  C  CD1 . ILE A 1 51  ? -1.375  9.281   96.754  1.00 72.63  ? 1029 ILE A CD1 1 
ATOM   248  N  N   . GLY A 1 52  ? -3.817  9.979   91.529  1.00 68.13  ? 1030 GLY A N   1 
ATOM   249  C  CA  . GLY A 1 52  ? -4.749  9.538   90.506  1.00 66.02  ? 1030 GLY A CA  1 
ATOM   250  C  C   . GLY A 1 52  ? -6.197  9.443   90.944  1.00 65.73  ? 1030 GLY A C   1 
ATOM   251  O  O   . GLY A 1 52  ? -6.961  8.645   90.405  1.00 65.41  ? 1030 GLY A O   1 
ATOM   252  N  N   . HIS A 1 53  ? -6.581  10.251  91.925  1.00 73.96  ? 1031 HIS A N   1 
ATOM   253  C  CA  . HIS A 1 53  ? -7.964  10.259  92.387  1.00 77.62  ? 1031 HIS A CA  1 
ATOM   254  C  C   . HIS A 1 53  ? -8.816  11.211  91.555  1.00 77.99  ? 1031 HIS A C   1 
ATOM   255  O  O   . HIS A 1 53  ? -8.619  12.426  91.590  1.00 78.37  ? 1031 HIS A O   1 
ATOM   256  C  CB  . HIS A 1 53  ? -8.046  10.648  93.862  1.00 75.81  ? 1031 HIS A CB  1 
ATOM   257  C  CG  . HIS A 1 53  ? -9.446  10.875  94.341  1.00 79.25  ? 1031 HIS A CG  1 
ATOM   258  N  ND1 . HIS A 1 53  ? -10.381 9.865   94.416  1.00 80.28  ? 1031 HIS A ND1 1 
ATOM   259  C  CD2 . HIS A 1 53  ? -10.076 12.002  94.747  1.00 80.78  ? 1031 HIS A CD2 1 
ATOM   260  C  CE1 . HIS A 1 53  ? -11.524 10.359  94.858  1.00 82.32  ? 1031 HIS A CE1 1 
ATOM   261  N  NE2 . HIS A 1 53  ? -11.367 11.653  95.066  1.00 82.68  ? 1031 HIS A NE2 1 
ATOM   262  N  N   . LEU A 1 54  ? -9.768  10.652  90.812  1.00 78.55  ? 1032 LEU A N   1 
ATOM   263  C  CA  . LEU A 1 54  ? -10.635 11.451  89.949  1.00 83.53  ? 1032 LEU A CA  1 
ATOM   264  C  C   . LEU A 1 54  ? -11.737 12.147  90.744  1.00 79.93  ? 1032 LEU A C   1 
ATOM   265  O  O   . LEU A 1 54  ? -12.424 11.517  91.550  1.00 79.69  ? 1032 LEU A O   1 
ATOM   266  C  CB  . LEU A 1 54  ? -11.253 10.578  88.855  1.00 88.44  ? 1032 LEU A CB  1 
ATOM   267  C  CG  . LEU A 1 54  ? -12.144 11.296  87.837  1.00 80.67  ? 1032 LEU A CG  1 
ATOM   268  C  CD1 . LEU A 1 54  ? -11.368 12.368  87.083  1.00 80.35  ? 1032 LEU A CD1 1 
ATOM   269  C  CD2 . LEU A 1 54  ? -12.759 10.296  86.872  1.00 80.19  ? 1032 LEU A CD2 1 
ATOM   270  N  N   . LEU A 1 55  ? -11.901 13.446  90.509  1.00 80.17  ? 1033 LEU A N   1 
ATOM   271  C  CA  . LEU A 1 55  ? -12.903 14.238  91.216  1.00 82.61  ? 1033 LEU A CA  1 
ATOM   272  C  C   . LEU A 1 55  ? -14.190 14.372  90.408  1.00 83.43  ? 1033 LEU A C   1 
ATOM   273  O  O   . LEU A 1 55  ? -15.253 13.933  90.847  1.00 84.88  ? 1033 LEU A O   1 
ATOM   274  C  CB  . LEU A 1 55  ? -12.348 15.625  91.551  1.00 84.38  ? 1033 LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 55  ? -11.128 15.665  92.474  1.00 80.81  ? 1033 LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 55  ? -10.624 17.091  92.654  1.00 82.74  ? 1033 LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 55  ? -11.448 15.028  93.819  1.00 78.91  ? 1033 LEU A CD2 1 
ATOM   278  N  N   . THR A 1 56  ? -14.089 14.984  89.231  1.00 84.91  ? 1034 THR A N   1 
ATOM   279  C  CA  . THR A 1 56  ? -15.239 15.157  88.348  1.00 86.90  ? 1034 THR A CA  1 
ATOM   280  C  C   . THR A 1 56  ? -14.788 15.308  86.897  1.00 87.43  ? 1034 THR A C   1 
ATOM   281  O  O   . THR A 1 56  ? -13.616 15.571  86.632  1.00 87.87  ? 1034 THR A O   1 
ATOM   282  C  CB  . THR A 1 56  ? -16.081 16.384  88.746  1.00 86.03  ? 1034 THR A CB  1 
ATOM   283  O  OG1 . THR A 1 56  ? -17.249 16.455  87.919  1.00 87.18  ? 1034 THR A OG1 1 
ATOM   284  C  CG2 . THR A 1 56  ? -15.269 17.660  88.581  1.00 87.84  ? 1034 THR A CG2 1 
ATOM   285  N  N   . LYS A 1 57  ? -15.718 15.145  85.960  1.00 87.12  ? 1035 LYS A N   1 
ATOM   286  C  CA  . LYS A 1 57  ? -15.387 15.257  84.542  1.00 90.83  ? 1035 LYS A CA  1 
ATOM   287  C  C   . LYS A 1 57  ? -16.036 16.471  83.879  1.00 92.32  ? 1035 LYS A C   1 
ATOM   288  O  O   . LYS A 1 57  ? -16.349 16.441  82.690  1.00 95.33  ? 1035 LYS A O   1 
ATOM   289  C  CB  . LYS A 1 57  ? -15.793 13.983  83.799  1.00 91.85  ? 1035 LYS A CB  1 
ATOM   290  C  CG  . LYS A 1 57  ? -14.958 12.766  84.162  1.00 91.85  ? 1035 LYS A CG  1 
ATOM   291  C  CD  . LYS A 1 57  ? -15.341 11.559  83.326  1.00 88.48  ? 1035 LYS A CD  1 
ATOM   292  C  CE  . LYS A 1 57  ? -14.449 10.370  83.640  1.00 86.27  ? 1035 LYS A CE  1 
ATOM   293  N  NZ  . LYS A 1 57  ? -14.814 9.177   82.830  1.00 82.41  ? 1035 LYS A NZ  1 
ATOM   294  N  N   . SER A 1 58  ? -16.226 17.538  84.649  1.00 92.18  ? 1036 SER A N   1 
ATOM   295  C  CA  . SER A 1 58  ? -16.805 18.771  84.120  1.00 94.12  ? 1036 SER A CA  1 
ATOM   296  C  C   . SER A 1 58  ? -15.831 19.942  84.251  1.00 93.83  ? 1036 SER A C   1 
ATOM   297  O  O   . SER A 1 58  ? -15.162 20.087  85.275  1.00 91.75  ? 1036 SER A O   1 
ATOM   298  C  CB  . SER A 1 58  ? -18.118 19.099  84.834  1.00 92.30  ? 1036 SER A CB  1 
ATOM   299  O  OG  . SER A 1 58  ? -17.906 19.319  86.217  1.00 92.14  ? 1036 SER A OG  1 
ATOM   300  N  N   . PRO A 1 59  ? -15.752 20.785  83.209  1.00 97.33  ? 1037 PRO A N   1 
ATOM   301  C  CA  . PRO A 1 59  ? -14.848 21.942  83.204  1.00 96.17  ? 1037 PRO A CA  1 
ATOM   302  C  C   . PRO A 1 59  ? -15.266 23.021  84.201  1.00 94.63  ? 1037 PRO A C   1 
ATOM   303  O  O   . PRO A 1 59  ? -15.613 24.134  83.804  1.00 96.52  ? 1037 PRO A O   1 
ATOM   304  C  CB  . PRO A 1 59  ? -14.948 22.458  81.765  1.00 93.80  ? 1037 PRO A CB  1 
ATOM   305  C  CG  . PRO A 1 59  ? -16.286 22.006  81.299  1.00 91.93  ? 1037 PRO A CG  1 
ATOM   306  C  CD  . PRO A 1 59  ? -16.519 20.677  81.956  1.00 92.15  ? 1037 PRO A CD  1 
ATOM   307  N  N   . SER A 1 60  ? -15.227 22.683  85.485  1.00 91.90  ? 1038 SER A N   1 
ATOM   308  C  CA  . SER A 1 60  ? -15.588 23.618  86.541  1.00 91.80  ? 1038 SER A CA  1 
ATOM   309  C  C   . SER A 1 60  ? -14.710 23.403  87.767  1.00 91.81  ? 1038 SER A C   1 
ATOM   310  O  O   . SER A 1 60  ? -14.750 22.342  88.390  1.00 91.11  ? 1038 SER A O   1 
ATOM   311  C  CB  . SER A 1 60  ? -17.063 23.467  86.912  1.00 93.50  ? 1038 SER A CB  1 
ATOM   312  O  OG  . SER A 1 60  ? -17.388 24.245  88.051  1.00 91.96  ? 1038 SER A OG  1 
ATOM   313  N  N   . LEU A 1 61  ? -13.919 24.417  88.106  1.00 91.22  ? 1039 LEU A N   1 
ATOM   314  C  CA  . LEU A 1 61  ? -12.992 24.333  89.229  1.00 92.64  ? 1039 LEU A CA  1 
ATOM   315  C  C   . LEU A 1 61  ? -13.730 24.187  90.560  1.00 96.19  ? 1039 LEU A C   1 
ATOM   316  O  O   . LEU A 1 61  ? -13.222 23.567  91.494  1.00 100.61 ? 1039 LEU A O   1 
ATOM   317  C  CB  . LEU A 1 61  ? -12.082 25.565  89.258  1.00 89.65  ? 1039 LEU A CB  1 
ATOM   318  C  CG  . LEU A 1 61  ? -10.925 25.572  90.260  1.00 80.29  ? 1039 LEU A CG  1 
ATOM   319  C  CD1 . LEU A 1 61  ? -10.024 24.364  90.055  1.00 84.40  ? 1039 LEU A CD1 1 
ATOM   320  C  CD2 . LEU A 1 61  ? -10.130 26.864  90.138  1.00 74.34  ? 1039 LEU A CD2 1 
ATOM   321  N  N   . ASN A 1 62  ? -14.931 24.752  90.640  1.00 94.44  ? 1040 ASN A N   1 
ATOM   322  C  CA  . ASN A 1 62  ? -15.733 24.660  91.856  1.00 95.82  ? 1040 ASN A CA  1 
ATOM   323  C  C   . ASN A 1 62  ? -16.463 23.322  91.965  1.00 94.78  ? 1040 ASN A C   1 
ATOM   324  O  O   . ASN A 1 62  ? -16.773 22.864  93.065  1.00 95.01  ? 1040 ASN A O   1 
ATOM   325  C  CB  . ASN A 1 62  ? -16.740 25.812  91.923  1.00 99.16  ? 1040 ASN A CB  1 
ATOM   326  C  CG  . ASN A 1 62  ? -16.069 27.170  92.022  1.00 101.78 ? 1040 ASN A CG  1 
ATOM   327  O  OD1 . ASN A 1 62  ? -16.392 28.089  91.269  1.00 105.47 ? 1040 ASN A OD1 1 
ATOM   328  N  ND2 . ASN A 1 62  ? -15.130 27.303  92.952  1.00 97.75  ? 1040 ASN A ND2 1 
ATOM   329  N  N   . ALA A 1 63  ? -16.735 22.701  90.820  1.00 94.73  ? 1041 ALA A N   1 
ATOM   330  C  CA  . ALA A 1 63  ? -17.397 21.399  90.792  1.00 93.13  ? 1041 ALA A CA  1 
ATOM   331  C  C   . ALA A 1 63  ? -16.457 20.305  91.278  1.00 92.94  ? 1041 ALA A C   1 
ATOM   332  O  O   . ALA A 1 63  ? -16.895 19.280  91.799  1.00 91.86  ? 1041 ALA A O   1 
ATOM   333  C  CB  . ALA A 1 63  ? -17.898 21.083  89.394  1.00 87.11  ? 1041 ALA A CB  1 
ATOM   334  N  N   . ALA A 1 64  ? -15.160 20.528  91.095  1.00 92.33  ? 1042 ALA A N   1 
ATOM   335  C  CA  . ALA A 1 64  ? -14.148 19.599  91.577  1.00 92.74  ? 1042 ALA A CA  1 
ATOM   336  C  C   . ALA A 1 64  ? -13.906 19.818  93.066  1.00 95.93  ? 1042 ALA A C   1 
ATOM   337  O  O   . ALA A 1 64  ? -13.498 18.903  93.782  1.00 95.07  ? 1042 ALA A O   1 
ATOM   338  C  CB  . ALA A 1 64  ? -12.857 19.764  90.793  1.00 90.94  ? 1042 ALA A CB  1 
ATOM   339  N  N   . LYS A 1 65  ? -14.165 21.039  93.523  1.00 96.34  ? 1043 LYS A N   1 
ATOM   340  C  CA  . LYS A 1 65  ? -14.013 21.383  94.931  1.00 97.53  ? 1043 LYS A CA  1 
ATOM   341  C  C   . LYS A 1 65  ? -15.053 20.675  95.792  1.00 97.69  ? 1043 LYS A C   1 
ATOM   342  O  O   . LYS A 1 65  ? -14.738 20.170  96.870  1.00 97.95  ? 1043 LYS A O   1 
ATOM   343  C  CB  . LYS A 1 65  ? -14.117 22.897  95.128  1.00 96.90  ? 1043 LYS A CB  1 
ATOM   344  C  CG  . LYS A 1 65  ? -12.862 23.667  94.757  1.00 96.76  ? 1043 LYS A CG  1 
ATOM   345  C  CD  . LYS A 1 65  ? -11.694 23.268  95.645  1.00 106.41 ? 1043 LYS A CD  1 
ATOM   346  C  CE  . LYS A 1 65  ? -12.008 23.488  97.119  1.00 108.50 ? 1043 LYS A CE  1 
ATOM   347  N  NZ  . LYS A 1 65  ? -12.280 24.918  97.432  1.00 113.76 ? 1043 LYS A NZ  1 
ATOM   348  N  N   . SER A 1 66  ? -16.290 20.641  95.307  1.00 96.78  ? 1044 SER A N   1 
ATOM   349  C  CA  . SER A 1 66  ? -17.394 20.041  96.049  1.00 97.57  ? 1044 SER A CA  1 
ATOM   350  C  C   . SER A 1 66  ? -17.224 18.531  96.199  1.00 96.96  ? 1044 SER A C   1 
ATOM   351  O  O   . SER A 1 66  ? -17.612 17.953  97.215  1.00 98.60  ? 1044 SER A O   1 
ATOM   352  C  CB  . SER A 1 66  ? -18.725 20.352  95.362  1.00 98.39  ? 1044 SER A CB  1 
ATOM   353  O  OG  . SER A 1 66  ? -19.815 19.845  96.111  1.00 104.52 ? 1044 SER A OG  1 
ATOM   354  N  N   . GLU A 1 67  ? -16.643 17.899  95.184  1.00 95.46  ? 1045 GLU A N   1 
ATOM   355  C  CA  . GLU A 1 67  ? -16.431 16.455  95.201  1.00 96.37  ? 1045 GLU A CA  1 
ATOM   356  C  C   . GLU A 1 67  ? -15.238 16.075  96.073  1.00 95.04  ? 1045 GLU A C   1 
ATOM   357  O  O   . GLU A 1 67  ? -15.110 14.930  96.505  1.00 93.59  ? 1045 GLU A O   1 
ATOM   358  C  CB  . GLU A 1 67  ? -16.228 15.926  93.778  1.00 93.68  ? 1045 GLU A CB  1 
ATOM   359  C  CG  . GLU A 1 67  ? -17.453 16.046  92.881  1.00 93.09  ? 1045 GLU A CG  1 
ATOM   360  C  CD  . GLU A 1 67  ? -18.529 15.024  93.207  1.00 91.71  ? 1045 GLU A CD  1 
ATOM   361  O  OE1 . GLU A 1 67  ? -19.611 15.084  92.585  1.00 100.39 ? 1045 GLU A OE1 1 
ATOM   362  O  OE2 . GLU A 1 67  ? -18.296 14.159  94.076  1.00 86.05  ? 1045 GLU A OE2 1 
ATOM   363  N  N   . LEU A 1 68  ? -14.368 17.046  96.325  1.00 94.60  ? 1046 LEU A N   1 
ATOM   364  C  CA  . LEU A 1 68  ? -13.186 16.826  97.147  1.00 95.74  ? 1046 LEU A CA  1 
ATOM   365  C  C   . LEU A 1 68  ? -13.500 17.008  98.628  1.00 96.94  ? 1046 LEU A C   1 
ATOM   366  O  O   . LEU A 1 68  ? -12.943 16.317  99.482  1.00 97.83  ? 1046 LEU A O   1 
ATOM   367  C  CB  . LEU A 1 68  ? -12.064 17.777  96.726  1.00 95.41  ? 1046 LEU A CB  1 
ATOM   368  C  CG  . LEU A 1 68  ? -10.745 17.685  97.493  1.00 94.67  ? 1046 LEU A CG  1 
ATOM   369  C  CD1 . LEU A 1 68  ? -10.182 16.275  97.424  1.00 91.82  ? 1046 LEU A CD1 1 
ATOM   370  C  CD2 . LEU A 1 68  ? -9.747  18.690  96.945  1.00 91.33  ? 1046 LEU A CD2 1 
ATOM   371  N  N   . ASP A 1 69  ? -14.398 17.940  98.924  1.00 96.88  ? 1047 ASP A N   1 
ATOM   372  C  CA  . ASP A 1 69  ? -14.740 18.262  100.302 1.00 96.76  ? 1047 ASP A CA  1 
ATOM   373  C  C   . ASP A 1 69  ? -15.462 17.110  100.995 1.00 97.55  ? 1047 ASP A C   1 
ATOM   374  O  O   . ASP A 1 69  ? -15.192 16.812  102.158 1.00 98.38  ? 1047 ASP A O   1 
ATOM   375  C  CB  . ASP A 1 69  ? -15.594 19.530  100.352 1.00 96.48  ? 1047 ASP A CB  1 
ATOM   376  C  CG  . ASP A 1 69  ? -14.857 20.748  99.825  1.00 98.13  ? 1047 ASP A CG  1 
ATOM   377  O  OD1 . ASP A 1 69  ? -13.609 20.711  99.766  1.00 100.56 ? 1047 ASP A OD1 1 
ATOM   378  O  OD2 . ASP A 1 69  ? -15.524 21.743  99.472  1.00 94.69  ? 1047 ASP A OD2 1 
ATOM   379  N  N   . LYS A 1 70  ? -16.373 16.461  100.278 1.00 97.95  ? 1048 LYS A N   1 
ATOM   380  C  CA  . LYS A 1 70  ? -17.125 15.344  100.840 1.00 99.93  ? 1048 LYS A CA  1 
ATOM   381  C  C   . LYS A 1 70  ? -16.354 14.030  100.743 1.00 100.35 ? 1048 LYS A C   1 
ATOM   382  O  O   . LYS A 1 70  ? -16.710 13.045  101.391 1.00 101.68 ? 1048 LYS A O   1 
ATOM   383  C  CB  . LYS A 1 70  ? -18.484 15.204  100.149 1.00 102.39 ? 1048 LYS A CB  1 
ATOM   384  C  CG  . LYS A 1 70  ? -19.512 16.233  100.593 1.00 104.74 ? 1048 LYS A CG  1 
ATOM   385  C  CD  . LYS A 1 70  ? -20.910 15.854  100.128 1.00 102.42 ? 1048 LYS A CD  1 
ATOM   386  C  CE  . LYS A 1 70  ? -21.955 16.809  100.683 1.00 98.56  ? 1048 LYS A CE  1 
ATOM   387  N  NZ  . LYS A 1 70  ? -23.332 16.437  100.256 1.00 98.07  ? 1048 LYS A NZ  1 
ATOM   388  N  N   . ALA A 1 71  ? -15.303 14.016  99.930  1.00 98.51  ? 1049 ALA A N   1 
ATOM   389  C  CA  . ALA A 1 71  ? -14.443 12.844  99.831  1.00 97.54  ? 1049 ALA A CA  1 
ATOM   390  C  C   . ALA A 1 71  ? -13.492 12.795  101.020 1.00 100.56 ? 1049 ALA A C   1 
ATOM   391  O  O   . ALA A 1 71  ? -13.204 11.725  101.557 1.00 101.62 ? 1049 ALA A O   1 
ATOM   392  C  CB  . ALA A 1 71  ? -13.666 12.858  98.527  1.00 96.29  ? 1049 ALA A CB  1 
ATOM   393  N  N   . ILE A 1 72  ? -13.011 13.964  101.427 1.00 100.11 ? 1050 ILE A N   1 
ATOM   394  C  CA  . ILE A 1 72  ? -12.108 14.070  102.564 1.00 101.36 ? 1050 ILE A CA  1 
ATOM   395  C  C   . ILE A 1 72  ? -12.889 14.139  103.869 1.00 104.13 ? 1050 ILE A C   1 
ATOM   396  O  O   . ILE A 1 72  ? -12.555 13.464  104.845 1.00 106.25 ? 1050 ILE A O   1 
ATOM   397  C  CB  . ILE A 1 72  ? -11.199 15.308  102.447 1.00 101.70 ? 1050 ILE A CB  1 
ATOM   398  C  CG1 . ILE A 1 72  ? -10.369 15.236  101.165 1.00 100.49 ? 1050 ILE A CG1 1 
ATOM   399  C  CG2 . ILE A 1 72  ? -10.287 15.420  103.657 1.00 105.48 ? 1050 ILE A CG2 1 
ATOM   400  C  CD1 . ILE A 1 72  ? -9.434  14.051  101.114 1.00 102.77 ? 1050 ILE A CD1 1 
ATOM   401  N  N   . GLY A 1 73  ? -13.938 14.954  103.876 1.00 103.31 ? 1051 GLY A N   1 
ATOM   402  C  CA  . GLY A 1 73  ? -14.753 15.139  105.062 1.00 103.55 ? 1051 GLY A CA  1 
ATOM   403  C  C   . GLY A 1 73  ? -14.702 16.569  105.563 1.00 105.03 ? 1051 GLY A C   1 
ATOM   404  O  O   . GLY A 1 73  ? -15.554 16.997  106.341 1.00 109.95 ? 1051 GLY A O   1 
ATOM   405  N  N   . ARG A 1 74  ? -13.695 17.310  105.113 1.00 105.74 ? 1052 ARG A N   1 
ATOM   406  C  CA  . ARG A 1 74  ? -13.522 18.704  105.507 1.00 105.14 ? 1052 ARG A CA  1 
ATOM   407  C  C   . ARG A 1 74  ? -13.417 19.596  104.277 1.00 106.84 ? 1052 ARG A C   1 
ATOM   408  O  O   . ARG A 1 74  ? -13.500 19.118  103.145 1.00 105.46 ? 1052 ARG A O   1 
ATOM   409  C  CB  . ARG A 1 74  ? -12.274 18.867  106.376 1.00 105.18 ? 1052 ARG A CB  1 
ATOM   410  C  CG  . ARG A 1 74  ? -10.979 18.619  105.625 1.00 106.14 ? 1052 ARG A CG  1 
ATOM   411  C  CD  . ARG A 1 74  ? -9.760  18.889  106.486 1.00 107.68 ? 1052 ARG A CD  1 
ATOM   412  N  NE  . ARG A 1 74  ? -8.530  18.750  105.713 1.00 107.89 ? 1052 ARG A NE  1 
ATOM   413  C  CZ  . ARG A 1 74  ? -7.953  19.744  105.047 1.00 107.54 ? 1052 ARG A CZ  1 
ATOM   414  N  NH1 . ARG A 1 74  ? -8.491  20.956  105.067 1.00 105.50 ? 1052 ARG A NH1 1 
ATOM   415  N  NH2 . ARG A 1 74  ? -6.837  19.528  104.364 1.00 108.66 ? 1052 ARG A NH2 1 
ATOM   416  N  N   . ASN A 1 75  ? -13.232 20.893  104.504 1.00 107.44 ? 1053 ASN A N   1 
ATOM   417  C  CA  . ASN A 1 75  ? -13.010 21.829  103.411 1.00 106.46 ? 1053 ASN A CA  1 
ATOM   418  C  C   . ASN A 1 75  ? -11.519 22.011  103.160 1.00 109.82 ? 1053 ASN A C   1 
ATOM   419  O  O   . ASN A 1 75  ? -10.862 22.833  103.802 1.00 109.34 ? 1053 ASN A O   1 
ATOM   420  C  CB  . ASN A 1 75  ? -13.667 23.177  103.707 1.00 106.11 ? 1053 ASN A CB  1 
ATOM   421  C  CG  . ASN A 1 75  ? -13.585 24.134  102.533 1.00 107.04 ? 1053 ASN A CG  1 
ATOM   422  O  OD1 . ASN A 1 75  ? -13.325 23.725  101.400 1.00 107.89 ? 1053 ASN A OD1 1 
ATOM   423  N  ND2 . ASN A 1 75  ? -13.811 25.416  102.796 1.00 106.49 ? 1053 ASN A ND2 1 
ATOM   424  N  N   . THR A 1 76  ? -10.994 21.231  102.221 1.00 111.37 ? 1054 THR A N   1 
ATOM   425  C  CA  . THR A 1 76  ? -9.568  21.234  101.922 1.00 112.05 ? 1054 THR A CA  1 
ATOM   426  C  C   . THR A 1 76  ? -9.140  22.517  101.217 1.00 112.33 ? 1054 THR A C   1 
ATOM   427  O  O   . THR A 1 76  ? -7.959  22.868  101.222 1.00 114.38 ? 1054 THR A O   1 
ATOM   428  C  CB  . THR A 1 76  ? -9.185  20.027  101.051 1.00 110.33 ? 1054 THR A CB  1 
ATOM   429  O  OG1 . THR A 1 76  ? -9.922  20.073  99.823  1.00 109.52 ? 1054 THR A OG1 1 
ATOM   430  C  CG2 . THR A 1 76  ? -9.504  18.728  101.778 1.00 108.83 ? 1054 THR A CG2 1 
ATOM   431  N  N   . ASN A 1 77  ? -10.108 23.202  100.611 1.00 111.50 ? 1055 ASN A N   1 
ATOM   432  C  CA  . ASN A 1 77  ? -9.872  24.458  99.902  1.00 113.89 ? 1055 ASN A CA  1 
ATOM   433  C  C   . ASN A 1 77  ? -8.892  24.284  98.741  1.00 114.30 ? 1055 ASN A C   1 
ATOM   434  O  O   . ASN A 1 77  ? -8.181  25.215  98.364  1.00 115.07 ? 1055 ASN A O   1 
ATOM   435  C  CB  . ASN A 1 77  ? -9.370  25.534  100.873 1.00 115.82 ? 1055 ASN A CB  1 
ATOM   436  C  CG  . ASN A 1 77  ? -9.570  26.942  100.343 1.00 118.80 ? 1055 ASN A CG  1 
ATOM   437  O  OD1 . ASN A 1 77  ? -8.633  27.572  99.852  1.00 119.54 ? 1055 ASN A OD1 1 
ATOM   438  N  ND2 . ASN A 1 77  ? -10.796 27.442  100.438 1.00 116.61 ? 1055 ASN A ND2 1 
ATOM   439  N  N   . GLY A 1 78  ? -8.862  23.081  98.176  1.00 113.23 ? 1056 GLY A N   1 
ATOM   440  C  CA  . GLY A 1 78  ? -8.015  22.795  97.032  1.00 110.09 ? 1056 GLY A CA  1 
ATOM   441  C  C   . GLY A 1 78  ? -6.705  22.118  97.388  1.00 105.14 ? 1056 GLY A C   1 
ATOM   442  O  O   . GLY A 1 78  ? -6.081  21.477  96.541  1.00 98.23  ? 1056 GLY A O   1 
ATOM   443  N  N   . VAL A 1 79  ? -6.283  22.258  98.641  1.00 104.51 ? 1057 VAL A N   1 
ATOM   444  C  CA  . VAL A 1 79  ? -5.013  21.691  99.080  1.00 101.17 ? 1057 VAL A CA  1 
ATOM   445  C  C   . VAL A 1 79  ? -5.203  20.656  100.184 1.00 102.97 ? 1057 VAL A C   1 
ATOM   446  O  O   . VAL A 1 79  ? -5.744  20.957  101.249 1.00 107.28 ? 1057 VAL A O   1 
ATOM   447  C  CB  . VAL A 1 79  ? -4.054  22.785  99.583  1.00 101.08 ? 1057 VAL A CB  1 
ATOM   448  C  CG1 . VAL A 1 79  ? -2.739  22.169  100.039 1.00 100.73 ? 1057 VAL A CG1 1 
ATOM   449  C  CG2 . VAL A 1 79  ? -3.814  23.822  98.497  1.00 100.44 ? 1057 VAL A CG2 1 
ATOM   450  N  N   . ILE A 1 80  ? -4.749  19.435  99.922  1.00 100.23 ? 1058 ILE A N   1 
ATOM   451  C  CA  . ILE A 1 80  ? -4.816  18.366  100.909 1.00 102.48 ? 1058 ILE A CA  1 
ATOM   452  C  C   . ILE A 1 80  ? -3.437  18.086  101.492 1.00 99.10  ? 1058 ILE A C   1 
ATOM   453  O  O   . ILE A 1 80  ? -2.432  18.623  101.025 1.00 97.26  ? 1058 ILE A O   1 
ATOM   454  C  CB  . ILE A 1 80  ? -5.383  17.068  100.307 1.00 102.74 ? 1058 ILE A CB  1 
ATOM   455  C  CG1 . ILE A 1 80  ? -4.469  16.553  99.192  1.00 97.48  ? 1058 ILE A CG1 1 
ATOM   456  C  CG2 . ILE A 1 80  ? -6.795  17.293  99.788  1.00 98.67  ? 1058 ILE A CG2 1 
ATOM   457  C  CD1 . ILE A 1 80  ? -4.954  15.273  98.544  1.00 88.85  ? 1058 ILE A CD1 1 
ATOM   458  N  N   . THR A 1 81  ? -3.395  17.240  102.515 1.00 101.10 ? 1059 THR A N   1 
ATOM   459  C  CA  . THR A 1 81  ? -2.140  16.899  103.170 1.00 102.05 ? 1059 THR A CA  1 
ATOM   460  C  C   . THR A 1 81  ? -1.515  15.661  102.532 1.00 100.21 ? 1059 THR A C   1 
ATOM   461  O  O   . THR A 1 81  ? -2.170  14.953  101.766 1.00 98.15  ? 1059 THR A O   1 
ATOM   462  C  CB  . THR A 1 81  ? -2.345  16.658  104.677 1.00 101.20 ? 1059 THR A CB  1 
ATOM   463  O  OG1 . THR A 1 81  ? -3.203  15.529  104.872 1.00 98.12  ? 1059 THR A OG1 1 
ATOM   464  C  CG2 . THR A 1 81  ? -2.975  17.881  105.327 1.00 102.12 ? 1059 THR A CG2 1 
ATOM   465  N  N   . LYS A 1 82  ? -0.247  15.411  102.846 1.00 98.87  ? 1060 LYS A N   1 
ATOM   466  C  CA  . LYS A 1 82  ? 0.463   14.251  102.316 1.00 98.12  ? 1060 LYS A CA  1 
ATOM   467  C  C   . LYS A 1 82  ? -0.089  12.963  102.918 1.00 98.06  ? 1060 LYS A C   1 
ATOM   468  O  O   . LYS A 1 82  ? 0.014   11.888  102.326 1.00 97.29  ? 1060 LYS A O   1 
ATOM   469  C  CB  . LYS A 1 82  ? 1.965   14.368  102.591 1.00 99.13  ? 1060 LYS A CB  1 
ATOM   470  C  CG  . LYS A 1 82  ? 2.811   13.259  101.976 1.00 95.64  ? 1060 LYS A CG  1 
ATOM   471  C  CD  . LYS A 1 82  ? 4.283   13.427  102.326 1.00 103.25 ? 1060 LYS A CD  1 
ATOM   472  C  CE  . LYS A 1 82  ? 5.134   12.339  101.686 1.00 106.77 ? 1060 LYS A CE  1 
ATOM   473  N  NZ  . LYS A 1 82  ? 6.581   12.502  102.002 1.00 111.73 ? 1060 LYS A NZ  1 
ATOM   474  N  N   . ASP A 1 83  ? -0.685  13.083  104.100 1.00 100.17 ? 1061 ASP A N   1 
ATOM   475  C  CA  . ASP A 1 83  ? -1.254  11.934  104.791 1.00 103.03 ? 1061 ASP A CA  1 
ATOM   476  C  C   . ASP A 1 83  ? -2.643  11.595  104.253 1.00 100.42 ? 1061 ASP A C   1 
ATOM   477  O  O   . ASP A 1 83  ? -3.010  10.425  104.153 1.00 98.38  ? 1061 ASP A O   1 
ATOM   478  C  CB  . ASP A 1 83  ? -1.319  12.198  106.297 1.00 107.84 ? 1061 ASP A CB  1 
ATOM   479  C  CG  . ASP A 1 83  ? -1.681  10.958  107.091 1.00 111.10 ? 1061 ASP A CG  1 
ATOM   480  O  OD1 . ASP A 1 83  ? -2.393  11.088  108.109 1.00 111.80 ? 1061 ASP A OD1 1 
ATOM   481  O  OD2 . ASP A 1 83  ? -1.249  9.853   106.698 1.00 111.03 ? 1061 ASP A OD2 1 
ATOM   482  N  N   . GLU A 1 84  ? -3.409  12.625  103.904 1.00 101.27 ? 1062 GLU A N   1 
ATOM   483  C  CA  . GLU A 1 84  ? -4.760  12.436  103.383 1.00 99.68  ? 1062 GLU A CA  1 
ATOM   484  C  C   . GLU A 1 84  ? -4.748  11.870  101.967 1.00 96.85  ? 1062 GLU A C   1 
ATOM   485  O  O   . GLU A 1 84  ? -5.732  11.285  101.514 1.00 94.95  ? 1062 GLU A O   1 
ATOM   486  C  CB  . GLU A 1 84  ? -5.539  13.753  103.410 1.00 101.40 ? 1062 GLU A CB  1 
ATOM   487  C  CG  . GLU A 1 84  ? -6.091  14.125  104.778 1.00 103.83 ? 1062 GLU A CG  1 
ATOM   488  C  CD  . GLU A 1 84  ? -6.956  15.373  104.743 1.00 104.90 ? 1062 GLU A CD  1 
ATOM   489  O  OE1 . GLU A 1 84  ? -6.853  16.145  103.766 1.00 104.26 ? 1062 GLU A OE1 1 
ATOM   490  O  OE2 . GLU A 1 84  ? -7.743  15.581  105.691 1.00 106.14 ? 1062 GLU A OE2 1 
ATOM   491  N  N   . ALA A 1 85  ? -3.634  12.055  101.267 1.00 96.83  ? 1063 ALA A N   1 
ATOM   492  C  CA  . ALA A 1 85  ? -3.478  11.491  99.933  1.00 91.49  ? 1063 ALA A CA  1 
ATOM   493  C  C   . ALA A 1 85  ? -3.410  9.969   100.008 1.00 90.05  ? 1063 ALA A C   1 
ATOM   494  O  O   . ALA A 1 85  ? -4.115  9.272   99.281  1.00 86.96  ? 1063 ALA A O   1 
ATOM   495  C  CB  . ALA A 1 85  ? -2.235  12.052  99.257  1.00 89.43  ? 1063 ALA A CB  1 
ATOM   496  N  N   . GLU A 1 86  ? -2.562  9.465   100.901 1.00 90.94  ? 1064 GLU A N   1 
ATOM   497  C  CA  . GLU A 1 86  ? -2.386  8.028   101.091 1.00 88.72  ? 1064 GLU A CA  1 
ATOM   498  C  C   . GLU A 1 86  ? -3.679  7.340   101.519 1.00 89.13  ? 1064 GLU A C   1 
ATOM   499  O  O   . GLU A 1 86  ? -4.026  6.273   101.011 1.00 85.90  ? 1064 GLU A O   1 
ATOM   500  C  CB  . GLU A 1 86  ? -1.293  7.764   102.128 1.00 89.86  ? 1064 GLU A CB  1 
ATOM   501  C  CG  . GLU A 1 86  ? 0.086   8.226   101.703 1.00 87.79  ? 1064 GLU A CG  1 
ATOM   502  C  CD  . GLU A 1 86  ? 0.657   7.375   100.593 1.00 85.55  ? 1064 GLU A CD  1 
ATOM   503  O  OE1 . GLU A 1 86  ? 0.277   6.187   100.501 1.00 81.32  ? 1064 GLU A OE1 1 
ATOM   504  O  OE2 . GLU A 1 86  ? 1.482   7.893   99.811  1.00 87.62  ? 1064 GLU A OE2 1 
ATOM   505  N  N   . LYS A 1 87  ? -4.384  7.960   102.459 1.00 93.05  ? 1065 LYS A N   1 
ATOM   506  C  CA  . LYS A 1 87  ? -5.621  7.405   102.997 1.00 93.28  ? 1065 LYS A CA  1 
ATOM   507  C  C   . LYS A 1 87  ? -6.697  7.289   101.923 1.00 88.39  ? 1065 LYS A C   1 
ATOM   508  O  O   . LYS A 1 87  ? -7.475  6.335   101.906 1.00 86.67  ? 1065 LYS A O   1 
ATOM   509  C  CB  . LYS A 1 87  ? -6.126  8.267   104.157 1.00 102.44 ? 1065 LYS A CB  1 
ATOM   510  C  CG  . LYS A 1 87  ? -5.182  8.323   105.353 1.00 102.37 ? 1065 LYS A CG  1 
ATOM   511  C  CD  . LYS A 1 87  ? -5.617  9.384   106.355 1.00 103.15 ? 1065 LYS A CD  1 
ATOM   512  C  CE  . LYS A 1 87  ? -7.043  9.154   106.826 1.00 104.95 ? 1065 LYS A CE  1 
ATOM   513  N  NZ  . LYS A 1 87  ? -7.512  10.236  107.734 1.00 108.10 ? 1065 LYS A NZ  1 
ATOM   514  N  N   . LEU A 1 88  ? -6.736  8.268   101.026 1.00 88.34  ? 1066 LEU A N   1 
ATOM   515  C  CA  . LEU A 1 88  ? -7.703  8.269   99.937  1.00 87.02  ? 1066 LEU A CA  1 
ATOM   516  C  C   . LEU A 1 88  ? -7.253  7.346   98.809  1.00 84.44  ? 1066 LEU A C   1 
ATOM   517  O  O   . LEU A 1 88  ? -8.074  6.717   98.141  1.00 81.38  ? 1066 LEU A O   1 
ATOM   518  C  CB  . LEU A 1 88  ? -7.910  9.689   99.411  1.00 85.49  ? 1066 LEU A CB  1 
ATOM   519  C  CG  . LEU A 1 88  ? -9.018  9.870   98.376  1.00 84.88  ? 1066 LEU A CG  1 
ATOM   520  C  CD1 . LEU A 1 88  ? -10.324 9.282   98.887  1.00 86.65  ? 1066 LEU A CD1 1 
ATOM   521  C  CD2 . LEU A 1 88  ? -9.187  11.341  98.042  1.00 86.42  ? 1066 LEU A CD2 1 
ATOM   522  N  N   . PHE A 1 89  ? -5.941  7.273   98.605  1.00 84.68  ? 1067 PHE A N   1 
ATOM   523  C  CA  . PHE A 1 89  ? -5.363  6.393   97.597  1.00 79.99  ? 1067 PHE A CA  1 
ATOM   524  C  C   . PHE A 1 89  ? -5.579  4.930   97.963  1.00 79.11  ? 1067 PHE A C   1 
ATOM   525  O  O   . PHE A 1 89  ? -5.883  4.107   97.101  1.00 78.46  ? 1067 PHE A O   1 
ATOM   526  C  CB  . PHE A 1 89  ? -3.869  6.686   97.428  1.00 77.49  ? 1067 PHE A CB  1 
ATOM   527  C  CG  . PHE A 1 89  ? -3.115  5.617   96.687  1.00 73.23  ? 1067 PHE A CG  1 
ATOM   528  C  CD1 . PHE A 1 89  ? -3.251  5.476   95.316  1.00 71.17  ? 1067 PHE A CD1 1 
ATOM   529  C  CD2 . PHE A 1 89  ? -2.254  4.766   97.360  1.00 72.10  ? 1067 PHE A CD2 1 
ATOM   530  C  CE1 . PHE A 1 89  ? -2.552  4.497   94.634  1.00 67.55  ? 1067 PHE A CE1 1 
ATOM   531  C  CE2 . PHE A 1 89  ? -1.552  3.787   96.683  1.00 68.64  ? 1067 PHE A CE2 1 
ATOM   532  C  CZ  . PHE A 1 89  ? -1.702  3.652   95.319  1.00 67.01  ? 1067 PHE A CZ  1 
ATOM   533  N  N   . ASN A 1 90  ? -5.429  4.612   99.246  1.00 80.87  ? 1068 ASN A N   1 
ATOM   534  C  CA  . ASN A 1 90  ? -5.582  3.240   99.712  1.00 80.27  ? 1068 ASN A CA  1 
ATOM   535  C  C   . ASN A 1 90  ? -7.026  2.752   99.592  1.00 81.12  ? 1068 ASN A C   1 
ATOM   536  O  O   . ASN A 1 90  ? -7.278  1.552   99.492  1.00 80.63  ? 1068 ASN A O   1 
ATOM   537  C  CB  . ASN A 1 90  ? -5.104  3.111   101.160 1.00 82.09  ? 1068 ASN A CB  1 
ATOM   538  C  CG  . ASN A 1 90  ? -5.011  1.669   101.615 1.00 83.59  ? 1068 ASN A CG  1 
ATOM   539  O  OD1 . ASN A 1 90  ? -4.907  0.755   100.796 1.00 78.47  ? 1068 ASN A OD1 1 
ATOM   540  N  ND2 . ASN A 1 90  ? -5.048  1.455   102.926 1.00 91.89  ? 1068 ASN A ND2 1 
ATOM   541  N  N   . GLN A 1 91  ? -7.970  3.687   99.595  1.00 81.22  ? 1069 GLN A N   1 
ATOM   542  C  CA  . GLN A 1 91  ? -9.380  3.344   99.456  1.00 82.02  ? 1069 GLN A CA  1 
ATOM   543  C  C   . GLN A 1 91  ? -9.770  3.179   97.992  1.00 78.56  ? 1069 GLN A C   1 
ATOM   544  O  O   . GLN A 1 91  ? -10.635 2.370   97.659  1.00 78.38  ? 1069 GLN A O   1 
ATOM   545  C  CB  . GLN A 1 91  ? -10.259 4.406   100.116 1.00 87.25  ? 1069 GLN A CB  1 
ATOM   546  C  CG  . GLN A 1 91  ? -10.108 4.480   101.626 1.00 93.49  ? 1069 GLN A CG  1 
ATOM   547  C  CD  . GLN A 1 91  ? -11.011 5.525   102.246 1.00 103.71 ? 1069 GLN A CD  1 
ATOM   548  O  OE1 . GLN A 1 91  ? -11.476 6.442   101.567 1.00 98.42  ? 1069 GLN A OE1 1 
ATOM   549  N  NE2 . GLN A 1 91  ? -11.272 5.389   103.542 1.00 112.25 ? 1069 GLN A NE2 1 
ATOM   550  N  N   . ASP A 1 92  ? -9.131  3.956   97.123  1.00 77.22  ? 1070 ASP A N   1 
ATOM   551  C  CA  . ASP A 1 92  ? -9.366  3.864   95.686  1.00 72.97  ? 1070 ASP A CA  1 
ATOM   552  C  C   . ASP A 1 92  ? -8.930  2.512   95.141  1.00 71.80  ? 1070 ASP A C   1 
ATOM   553  O  O   . ASP A 1 92  ? -9.528  1.983   94.204  1.00 71.63  ? 1070 ASP A O   1 
ATOM   554  C  CB  . ASP A 1 92  ? -8.624  4.978   94.948  1.00 72.62  ? 1070 ASP A CB  1 
ATOM   555  C  CG  . ASP A 1 92  ? -9.246  6.337   95.169  1.00 76.12  ? 1070 ASP A CG  1 
ATOM   556  O  OD1 . ASP A 1 92  ? -8.489  7.301   95.410  1.00 77.29  ? 1070 ASP A OD1 1 
ATOM   557  O  OD2 . ASP A 1 92  ? -10.488 6.443   95.092  1.00 75.66  ? 1070 ASP A OD2 1 
ATOM   558  N  N   . VAL A 1 93  ? -7.874  1.965   95.731  1.00 71.64  ? 1071 VAL A N   1 
ATOM   559  C  CA  . VAL A 1 93  ? -7.359  0.666   95.327  1.00 68.42  ? 1071 VAL A CA  1 
ATOM   560  C  C   . VAL A 1 93  ? -8.321  -0.440  95.747  1.00 69.80  ? 1071 VAL A C   1 
ATOM   561  O  O   . VAL A 1 93  ? -8.638  -1.328  94.957  1.00 67.24  ? 1071 VAL A O   1 
ATOM   562  C  CB  . VAL A 1 93  ? -5.965  0.404   95.927  1.00 67.94  ? 1071 VAL A CB  1 
ATOM   563  C  CG1 . VAL A 1 93  ? -5.495  -1.003  95.598  1.00 66.59  ? 1071 VAL A CG1 1 
ATOM   564  C  CG2 . VAL A 1 93  ? -4.971  1.435   95.414  1.00 65.44  ? 1071 VAL A CG2 1 
ATOM   565  N  N   . ASP A 1 94  ? -8.793  -0.367  96.989  1.00 73.50  ? 1072 ASP A N   1 
ATOM   566  C  CA  . ASP A 1 94  ? -9.729  -1.351  97.521  1.00 71.62  ? 1072 ASP A CA  1 
ATOM   567  C  C   . ASP A 1 94  ? -11.030 -1.366  96.727  1.00 70.34  ? 1072 ASP A C   1 
ATOM   568  O  O   . ASP A 1 94  ? -11.648 -2.417  96.555  1.00 71.83  ? 1072 ASP A O   1 
ATOM   569  C  CB  . ASP A 1 94  ? -10.020 -1.070  98.996  1.00 76.69  ? 1072 ASP A CB  1 
ATOM   570  C  CG  . ASP A 1 94  ? -8.769  -1.097  99.853  1.00 84.08  ? 1072 ASP A CG  1 
ATOM   571  O  OD1 . ASP A 1 94  ? -7.803  -1.795  99.478  1.00 90.36  ? 1072 ASP A OD1 1 
ATOM   572  O  OD2 . ASP A 1 94  ? -8.751  -0.420  100.902 1.00 86.29  ? 1072 ASP A OD2 1 
ATOM   573  N  N   . ALA A 1 95  ? -11.441 -0.198  96.243  1.00 70.38  ? 1073 ALA A N   1 
ATOM   574  C  CA  . ALA A 1 95  ? -12.653 -0.085  95.438  1.00 71.85  ? 1073 ALA A CA  1 
ATOM   575  C  C   . ALA A 1 95  ? -12.417 -0.607  94.024  1.00 69.50  ? 1073 ALA A C   1 
ATOM   576  O  O   . ALA A 1 95  ? -13.311 -1.192  93.412  1.00 69.98  ? 1073 ALA A O   1 
ATOM   577  C  CB  . ALA A 1 95  ? -13.136 1.358   95.397  1.00 71.76  ? 1073 ALA A CB  1 
ATOM   578  N  N   . ALA A 1 96  ? -11.208 -0.389  93.514  1.00 68.15  ? 1074 ALA A N   1 
ATOM   579  C  CA  . ALA A 1 96  ? -10.832 -0.853  92.184  1.00 64.27  ? 1074 ALA A CA  1 
ATOM   580  C  C   . ALA A 1 96  ? -10.825 -2.374  92.120  1.00 65.27  ? 1074 ALA A C   1 
ATOM   581  O  O   . ALA A 1 96  ? -11.105 -2.960  91.075  1.00 62.84  ? 1074 ALA A O   1 
ATOM   582  C  CB  . ALA A 1 96  ? -9.471  -0.300  91.794  1.00 59.16  ? 1074 ALA A CB  1 
ATOM   583  N  N   . VAL A 1 97  ? -10.504 -3.007  93.246  1.00 66.04  ? 1075 VAL A N   1 
ATOM   584  C  CA  . VAL A 1 97  ? -10.512 -4.462  93.339  1.00 63.88  ? 1075 VAL A CA  1 
ATOM   585  C  C   . VAL A 1 97  ? -11.938 -4.988  93.499  1.00 65.56  ? 1075 VAL A C   1 
ATOM   586  O  O   . VAL A 1 97  ? -12.310 -5.992  92.890  1.00 65.56  ? 1075 VAL A O   1 
ATOM   587  C  CB  . VAL A 1 97  ? -9.650  -4.960  94.518  1.00 57.98  ? 1075 VAL A CB  1 
ATOM   588  C  CG1 . VAL A 1 97  ? -9.641  -6.480  94.567  1.00 58.62  ? 1075 VAL A CG1 1 
ATOM   589  C  CG2 . VAL A 1 97  ? -8.234  -4.427  94.402  1.00 54.41  ? 1075 VAL A CG2 1 
ATOM   590  N  N   . ARG A 1 98  ? -12.732 -4.300  94.314  1.00 65.64  ? 1076 ARG A N   1 
ATOM   591  C  CA  . ARG A 1 98  ? -14.111 -4.706  94.558  1.00 70.89  ? 1076 ARG A CA  1 
ATOM   592  C  C   . ARG A 1 98  ? -14.911 -4.724  93.261  1.00 71.14  ? 1076 ARG A C   1 
ATOM   593  O  O   . ARG A 1 98  ? -15.695 -5.642  93.016  1.00 70.88  ? 1076 ARG A O   1 
ATOM   594  C  CB  . ARG A 1 98  ? -14.782 -3.777  95.571  1.00 82.01  ? 1076 ARG A CB  1 
ATOM   595  C  CG  . ARG A 1 98  ? -16.256 -4.094  95.807  1.00 104.63 ? 1076 ARG A CG  1 
ATOM   596  C  CD  . ARG A 1 98  ? -16.948 -3.014  96.625  1.00 109.48 ? 1076 ARG A CD  1 
ATOM   597  N  NE  . ARG A 1 98  ? -18.376 -3.281  96.788  1.00 115.92 ? 1076 ARG A NE  1 
ATOM   598  C  CZ  . ARG A 1 98  ? -19.311 -2.900  95.924  1.00 116.72 ? 1076 ARG A CZ  1 
ATOM   599  N  NH1 . ARG A 1 98  ? -18.972 -2.235  94.828  1.00 114.90 ? 1076 ARG A NH1 1 
ATOM   600  N  NH2 . ARG A 1 98  ? -20.586 -3.185  96.153  1.00 118.74 ? 1076 ARG A NH2 1 
ATOM   601  N  N   . GLY A 1 99  ? -14.705 -3.704  92.434  1.00 70.19  ? 1077 GLY A N   1 
ATOM   602  C  CA  . GLY A 1 99  ? -15.375 -3.620  91.151  1.00 70.70  ? 1077 GLY A CA  1 
ATOM   603  C  C   . GLY A 1 99  ? -14.993 -4.770  90.241  1.00 67.87  ? 1077 GLY A C   1 
ATOM   604  O  O   . GLY A 1 99  ? -15.819 -5.274  89.479  1.00 71.55  ? 1077 GLY A O   1 
ATOM   605  N  N   . ILE A 1 100 ? -13.735 -5.191  90.327  1.00 62.72  ? 1078 ILE A N   1 
ATOM   606  C  CA  . ILE A 1 100 ? -13.238 -6.287  89.506  1.00 63.15  ? 1078 ILE A CA  1 
ATOM   607  C  C   . ILE A 1 100 ? -13.974 -7.590  89.806  1.00 64.09  ? 1078 ILE A C   1 
ATOM   608  O  O   . ILE A 1 100 ? -14.410 -8.292  88.890  1.00 63.83  ? 1078 ILE A O   1 
ATOM   609  C  CB  . ILE A 1 100 ? -11.724 -6.490  89.709  1.00 63.41  ? 1078 ILE A CB  1 
ATOM   610  C  CG1 . ILE A 1 100 ? -10.945 -5.367  89.024  1.00 60.62  ? 1078 ILE A CG1 1 
ATOM   611  C  CG2 . ILE A 1 100 ? -11.280 -7.832  89.163  1.00 57.42  ? 1078 ILE A CG2 1 
ATOM   612  C  CD1 . ILE A 1 100 ? -9.444  -5.471  89.194  1.00 57.54  ? 1078 ILE A CD1 1 
ATOM   613  N  N   . LEU A 1 101 ? -14.123 -7.902  91.089  1.00 64.45  ? 1079 LEU A N   1 
ATOM   614  C  CA  . LEU A 1 101 ? -14.793 -9.129  91.502  1.00 66.19  ? 1079 LEU A CA  1 
ATOM   615  C  C   . LEU A 1 101 ? -16.304 -9.032  91.314  1.00 65.08  ? 1079 LEU A C   1 
ATOM   616  O  O   . LEU A 1 101 ? -16.979 -10.040 91.098  1.00 62.15  ? 1079 LEU A O   1 
ATOM   617  C  CB  . LEU A 1 101 ? -14.457 -9.452  92.958  1.00 65.08  ? 1079 LEU A CB  1 
ATOM   618  C  CG  . LEU A 1 101 ? -12.976 -9.752  93.199  1.00 68.48  ? 1079 LEU A CG  1 
ATOM   619  C  CD1 . LEU A 1 101 ? -12.706 -10.064 94.663  1.00 71.41  ? 1079 LEU A CD1 1 
ATOM   620  C  CD2 . LEU A 1 101 ? -12.516 -10.898 92.307  1.00 65.71  ? 1079 LEU A CD2 1 
ATOM   621  N  N   . ARG A 1 102 ? -16.827 -7.813  91.394  1.00 67.20  ? 1080 ARG A N   1 
ATOM   622  C  CA  . ARG A 1 102 ? -18.245 -7.565  91.164  1.00 68.65  ? 1080 ARG A CA  1 
ATOM   623  C  C   . ARG A 1 102 ? -18.603 -7.828  89.709  1.00 68.11  ? 1080 ARG A C   1 
ATOM   624  O  O   . ARG A 1 102 ? -19.685 -8.329  89.399  1.00 65.29  ? 1080 ARG A O   1 
ATOM   625  C  CB  . ARG A 1 102 ? -18.609 -6.128  91.541  1.00 71.19  ? 1080 ARG A CB  1 
ATOM   626  C  CG  . ARG A 1 102 ? -20.073 -5.794  91.340  1.00 85.43  ? 1080 ARG A CG  1 
ATOM   627  C  CD  . ARG A 1 102 ? -20.362 -4.341  91.668  1.00 97.85  ? 1080 ARG A CD  1 
ATOM   628  N  NE  . ARG A 1 102 ? -19.736 -3.424  90.721  1.00 85.91  ? 1080 ARG A NE  1 
ATOM   629  C  CZ  . ARG A 1 102 ? -19.957 -2.113  90.698  1.00 88.11  ? 1080 ARG A CZ  1 
ATOM   630  N  NH1 . ARG A 1 102 ? -20.791 -1.566  91.571  1.00 94.97  ? 1080 ARG A NH1 1 
ATOM   631  N  NH2 . ARG A 1 102 ? -19.348 -1.349  89.801  1.00 83.81  ? 1080 ARG A NH2 1 
ATOM   632  N  N   . ASN A 1 103 ? -17.670 -7.489  88.825  1.00 65.60  ? 1081 ASN A N   1 
ATOM   633  C  CA  . ASN A 1 103 ? -17.874 -7.589  87.388  1.00 63.73  ? 1081 ASN A CA  1 
ATOM   634  C  C   . ASN A 1 103 ? -17.761 -9.026  86.891  1.00 61.46  ? 1081 ASN A C   1 
ATOM   635  O  O   . ASN A 1 103 ? -16.813 -9.733  87.223  1.00 62.30  ? 1081 ASN A O   1 
ATOM   636  C  CB  . ASN A 1 103 ? -16.866 -6.695  86.665  1.00 63.47  ? 1081 ASN A CB  1 
ATOM   637  C  CG  . ASN A 1 103 ? -17.237 -6.438  85.223  1.00 62.35  ? 1081 ASN A CG  1 
ATOM   638  O  OD1 . ASN A 1 103 ? -17.517 -7.365  84.463  1.00 65.36  ? 1081 ASN A OD1 1 
ATOM   639  N  ND2 . ASN A 1 103 ? -17.243 -5.167  84.835  1.00 61.67  ? 1081 ASN A ND2 1 
ATOM   640  N  N   . ALA A 1 104 ? -18.733 -9.449  86.091  1.00 62.94  ? 1082 ALA A N   1 
ATOM   641  C  CA  . ALA A 1 104 ? -18.765 -10.813 85.579  1.00 61.93  ? 1082 ALA A CA  1 
ATOM   642  C  C   . ALA A 1 104 ? -17.731 -11.019 84.480  1.00 62.68  ? 1082 ALA A C   1 
ATOM   643  O  O   . ALA A 1 104 ? -17.350 -12.150 84.178  1.00 62.48  ? 1082 ALA A O   1 
ATOM   644  C  CB  . ALA A 1 104 ? -20.156 -11.152 85.068  1.00 58.98  ? 1082 ALA A CB  1 
ATOM   645  N  N   . LYS A 1 105 ? -17.282 -9.921  83.883  1.00 62.29  ? 1083 LYS A N   1 
ATOM   646  C  CA  . LYS A 1 105 ? -16.317 -9.983  82.794  1.00 61.63  ? 1083 LYS A CA  1 
ATOM   647  C  C   . LYS A 1 105 ? -14.892 -9.740  83.288  1.00 60.38  ? 1083 LYS A C   1 
ATOM   648  O  O   . LYS A 1 105 ? -13.925 -10.025 82.580  1.00 57.83  ? 1083 LYS A O   1 
ATOM   649  C  CB  . LYS A 1 105 ? -16.681 -8.971  81.703  1.00 62.01  ? 1083 LYS A CB  1 
ATOM   650  C  CG  . LYS A 1 105 ? -17.990 -9.279  80.989  1.00 65.31  ? 1083 LYS A CG  1 
ATOM   651  C  CD  . LYS A 1 105 ? -18.220 -8.360  79.795  1.00 69.07  ? 1083 LYS A CD  1 
ATOM   652  C  CE  . LYS A 1 105 ? -18.470 -6.924  80.232  1.00 77.59  ? 1083 LYS A CE  1 
ATOM   653  N  NZ  . LYS A 1 105 ? -18.829 -6.041  79.084  1.00 71.12  ? 1083 LYS A NZ  1 
ATOM   654  N  N   . LEU A 1 106 ? -14.767 -9.223  84.508  1.00 59.86  ? 1084 LEU A N   1 
ATOM   655  C  CA  . LEU A 1 106 ? -13.458 -8.900  85.072  1.00 60.72  ? 1084 LEU A CA  1 
ATOM   656  C  C   . LEU A 1 106 ? -12.991 -9.927  86.099  1.00 60.99  ? 1084 LEU A C   1 
ATOM   657  O  O   . LEU A 1 106 ? -11.791 -10.152 86.258  1.00 58.22  ? 1084 LEU A O   1 
ATOM   658  C  CB  . LEU A 1 106 ? -13.481 -7.513  85.716  1.00 58.56  ? 1084 LEU A CB  1 
ATOM   659  C  CG  . LEU A 1 106 ? -13.676 -6.322  84.778  1.00 55.90  ? 1084 LEU A CG  1 
ATOM   660  C  CD1 . LEU A 1 106 ? -13.597 -5.019  85.551  1.00 57.03  ? 1084 LEU A CD1 1 
ATOM   661  C  CD2 . LEU A 1 106 ? -12.649 -6.347  83.662  1.00 56.50  ? 1084 LEU A CD2 1 
ATOM   662  N  N   . LYS A 1 107 ? -13.939 -10.540 86.798  1.00 60.72  ? 1085 LYS A N   1 
ATOM   663  C  CA  . LYS A 1 107 ? -13.609 -11.511 87.837  1.00 63.62  ? 1085 LYS A CA  1 
ATOM   664  C  C   . LYS A 1 107 ? -12.868 -12.755 87.325  1.00 60.71  ? 1085 LYS A C   1 
ATOM   665  O  O   . LYS A 1 107 ? -11.824 -13.098 87.872  1.00 58.66  ? 1085 LYS A O   1 
ATOM   666  C  CB  . LYS A 1 107 ? -14.874 -11.942 88.585  1.00 67.15  ? 1085 LYS A CB  1 
ATOM   667  C  CG  . LYS A 1 107 ? -14.638 -13.019 89.631  1.00 68.21  ? 1085 LYS A CG  1 
ATOM   668  C  CD  . LYS A 1 107 ? -15.928 -13.382 90.345  1.00 81.54  ? 1085 LYS A CD  1 
ATOM   669  C  CE  . LYS A 1 107 ? -15.717 -14.532 91.314  1.00 81.80  ? 1085 LYS A CE  1 
ATOM   670  N  NZ  . LYS A 1 107 ? -15.263 -15.765 90.612  1.00 85.24  ? 1085 LYS A NZ  1 
ATOM   671  N  N   . PRO A 1 108 ? -13.393 -13.437 86.285  1.00 60.61  ? 1086 PRO A N   1 
ATOM   672  C  CA  . PRO A 1 108 ? -12.710 -14.684 85.920  1.00 60.27  ? 1086 PRO A CA  1 
ATOM   673  C  C   . PRO A 1 108 ? -11.284 -14.472 85.412  1.00 59.18  ? 1086 PRO A C   1 
ATOM   674  O  O   . PRO A 1 108 ? -10.420 -15.308 85.676  1.00 59.23  ? 1086 PRO A O   1 
ATOM   675  C  CB  . PRO A 1 108 ? -13.600 -15.259 84.814  1.00 60.80  ? 1086 PRO A CB  1 
ATOM   676  C  CG  . PRO A 1 108 ? -14.284 -14.082 84.234  1.00 61.87  ? 1086 PRO A CG  1 
ATOM   677  C  CD  . PRO A 1 108 ? -14.528 -13.159 85.385  1.00 60.02  ? 1086 PRO A CD  1 
ATOM   678  N  N   . VAL A 1 109 ? -11.046 -13.370 84.706  1.00 59.00  ? 1087 VAL A N   1 
ATOM   679  C  CA  . VAL A 1 109 ? -9.715  -13.063 84.190  1.00 59.13  ? 1087 VAL A CA  1 
ATOM   680  C  C   . VAL A 1 109 ? -8.752  -12.802 85.341  1.00 56.29  ? 1087 VAL A C   1 
ATOM   681  O  O   . VAL A 1 109 ? -7.645  -13.335 85.381  1.00 53.43  ? 1087 VAL A O   1 
ATOM   682  C  CB  . VAL A 1 109 ? -9.742  -11.839 83.259  1.00 56.16  ? 1087 VAL A CB  1 
ATOM   683  C  CG1 . VAL A 1 109 ? -8.352  -11.544 82.727  1.00 52.63  ? 1087 VAL A CG1 1 
ATOM   684  C  CG2 . VAL A 1 109 ? -10.718 -12.069 82.115  1.00 68.28  ? 1087 VAL A CG2 1 
ATOM   685  N  N   . TYR A 1 110 ? -9.208  -11.979 86.278  1.00 57.02  ? 1088 TYR A N   1 
ATOM   686  C  CA  . TYR A 1 110 ? -8.465  -11.619 87.478  1.00 55.21  ? 1088 TYR A CA  1 
ATOM   687  C  C   . TYR A 1 110 ? -8.085  -12.832 88.327  1.00 58.40  ? 1088 TYR A C   1 
ATOM   688  O  O   . TYR A 1 110 ? -7.006  -12.876 88.920  1.00 57.25  ? 1088 TYR A O   1 
ATOM   689  C  CB  . TYR A 1 110 ? -9.302  -10.644 88.302  1.00 54.36  ? 1088 TYR A CB  1 
ATOM   690  C  CG  . TYR A 1 110 ? -8.626  -10.088 89.528  1.00 53.48  ? 1088 TYR A CG  1 
ATOM   691  C  CD1 . TYR A 1 110 ? -7.813  -8.968  89.444  1.00 51.22  ? 1088 TYR A CD1 1 
ATOM   692  C  CD2 . TYR A 1 110 ? -8.827  -10.663 90.776  1.00 53.67  ? 1088 TYR A CD2 1 
ATOM   693  C  CE1 . TYR A 1 110 ? -7.201  -8.446  90.564  1.00 51.61  ? 1088 TYR A CE1 1 
ATOM   694  C  CE2 . TYR A 1 110 ? -8.222  -10.148 91.903  1.00 50.38  ? 1088 TYR A CE2 1 
ATOM   695  C  CZ  . TYR A 1 110 ? -7.410  -9.039  91.792  1.00 50.89  ? 1088 TYR A CZ  1 
ATOM   696  O  OH  . TYR A 1 110 ? -6.804  -8.519  92.910  1.00 55.09  ? 1088 TYR A OH  1 
ATOM   697  N  N   . ASP A 1 111 ? -8.981  -13.812 88.384  1.00 58.74  ? 1089 ASP A N   1 
ATOM   698  C  CA  . ASP A 1 111 ? -8.747  -15.026 89.159  1.00 60.78  ? 1089 ASP A CA  1 
ATOM   699  C  C   . ASP A 1 111 ? -7.691  -15.911 88.502  1.00 61.59  ? 1089 ASP A C   1 
ATOM   700  O  O   . ASP A 1 111 ? -7.108  -16.783 89.149  1.00 60.77  ? 1089 ASP A O   1 
ATOM   701  C  CB  . ASP A 1 111 ? -10.050 -15.814 89.334  1.00 64.48  ? 1089 ASP A CB  1 
ATOM   702  C  CG  . ASP A 1 111 ? -11.061 -15.091 90.205  1.00 68.29  ? 1089 ASP A CG  1 
ATOM   703  O  OD1 . ASP A 1 111 ? -10.642 -14.340 91.111  1.00 63.55  ? 1089 ASP A OD1 1 
ATOM   704  O  OD2 . ASP A 1 111 ? -12.277 -15.280 89.986  1.00 69.78  ? 1089 ASP A OD2 1 
ATOM   705  N  N   . SER A 1 112 ? -7.453  -15.681 87.215  1.00 57.74  ? 1090 SER A N   1 
ATOM   706  C  CA  . SER A 1 112 ? -6.496  -16.474 86.456  1.00 56.33  ? 1090 SER A CA  1 
ATOM   707  C  C   . SER A 1 112 ? -5.114  -15.825 86.432  1.00 56.42  ? 1090 SER A C   1 
ATOM   708  O  O   . SER A 1 112 ? -4.114  -16.485 86.149  1.00 55.48  ? 1090 SER A O   1 
ATOM   709  C  CB  . SER A 1 112 ? -6.996  -16.681 85.025  1.00 56.92  ? 1090 SER A CB  1 
ATOM   710  O  OG  . SER A 1 112 ? -7.065  -15.446 84.335  1.00 55.82  ? 1090 SER A OG  1 
ATOM   711  N  N   . LEU A 1 113 ? -5.066  -14.531 86.730  1.00 53.71  ? 1091 LEU A N   1 
ATOM   712  C  CA  . LEU A 1 113 ? -3.831  -13.765 86.615  1.00 53.54  ? 1091 LEU A CA  1 
ATOM   713  C  C   . LEU A 1 113 ? -2.951  -13.864 87.855  1.00 55.16  ? 1091 LEU A C   1 
ATOM   714  O  O   . LEU A 1 113 ? -3.443  -13.845 88.983  1.00 61.76  ? 1091 LEU A O   1 
ATOM   715  C  CB  . LEU A 1 113 ? -4.147  -12.296 86.328  1.00 52.63  ? 1091 LEU A CB  1 
ATOM   716  C  CG  . LEU A 1 113 ? -4.742  -12.010 84.950  1.00 53.01  ? 1091 LEU A CG  1 
ATOM   717  C  CD1 . LEU A 1 113 ? -4.936  -10.515 84.749  1.00 51.01  ? 1091 LEU A CD1 1 
ATOM   718  C  CD2 . LEU A 1 113 ? -3.859  -12.599 83.861  1.00 52.96  ? 1091 LEU A CD2 1 
ATOM   719  N  N   . ASP A 1 114 ? -1.644  -13.970 87.635  1.00 53.02  ? 1092 ASP A N   1 
ATOM   720  C  CA  . ASP A 1 114 ? -0.681  -13.944 88.728  1.00 52.38  ? 1092 ASP A CA  1 
ATOM   721  C  C   . ASP A 1 114 ? -0.649  -12.554 89.344  1.00 50.89  ? 1092 ASP A C   1 
ATOM   722  O  O   . ASP A 1 114 ? -1.071  -11.583 88.713  1.00 50.40  ? 1092 ASP A O   1 
ATOM   723  C  CB  . ASP A 1 114 ? 0.711   -14.345 88.238  1.00 54.35  ? 1092 ASP A CB  1 
ATOM   724  C  CG  . ASP A 1 114 ? 1.248   -13.405 87.180  1.00 52.89  ? 1092 ASP A CG  1 
ATOM   725  O  OD1 . ASP A 1 114 ? 0.951   -13.621 85.986  1.00 52.79  ? 1092 ASP A OD1 1 
ATOM   726  O  OD2 . ASP A 1 114 ? 1.968   -12.451 87.543  1.00 49.99  ? 1092 ASP A OD2 1 
ATOM   727  N  N   . ALA A 1 115 ? -0.139  -12.464 90.570  1.00 49.95  ? 1093 ALA A N   1 
ATOM   728  C  CA  . ALA A 1 115 ? -0.187  -11.228 91.349  1.00 50.15  ? 1093 ALA A CA  1 
ATOM   729  C  C   . ALA A 1 115 ? 0.424   -10.034 90.618  1.00 50.29  ? 1093 ALA A C   1 
ATOM   730  O  O   . ALA A 1 115 ? -0.027  -8.903  90.781  1.00 53.39  ? 1093 ALA A O   1 
ATOM   731  C  CB  . ALA A 1 115 ? 0.503   -11.427 92.684  1.00 46.76  ? 1093 ALA A CB  1 
ATOM   732  N  N   . VAL A 1 116 ? 1.447   -10.284 89.811  1.00 47.69  ? 1094 VAL A N   1 
ATOM   733  C  CA  . VAL A 1 116 ? 2.080   -9.208  89.065  1.00 48.75  ? 1094 VAL A CA  1 
ATOM   734  C  C   . VAL A 1 116 ? 1.132   -8.678  87.990  1.00 50.57  ? 1094 VAL A C   1 
ATOM   735  O  O   . VAL A 1 116 ? 0.957   -7.468  87.842  1.00 48.97  ? 1094 VAL A O   1 
ATOM   736  C  CB  . VAL A 1 116 ? 3.398   -9.664  88.411  1.00 51.86  ? 1094 VAL A CB  1 
ATOM   737  C  CG1 . VAL A 1 116 ? 4.107   -8.478  87.768  1.00 51.28  ? 1094 VAL A CG1 1 
ATOM   738  C  CG2 . VAL A 1 116 ? 4.299   -10.326 89.440  1.00 49.05  ? 1094 VAL A CG2 1 
ATOM   739  N  N   . ARG A 1 117 ? 0.511   -9.588  87.248  1.00 48.56  ? 1095 ARG A N   1 
ATOM   740  C  CA  . ARG A 1 117 ? -0.419  -9.189  86.203  1.00 45.88  ? 1095 ARG A CA  1 
ATOM   741  C  C   . ARG A 1 117 ? -1.731  -8.674  86.792  1.00 47.68  ? 1095 ARG A C   1 
ATOM   742  O  O   . ARG A 1 117 ? -2.424  -7.873  86.164  1.00 46.68  ? 1095 ARG A O   1 
ATOM   743  C  CB  . ARG A 1 117 ? -0.677  -10.353 85.247  1.00 48.61  ? 1095 ARG A CB  1 
ATOM   744  C  CG  . ARG A 1 117 ? 0.513   -10.669 84.353  1.00 49.97  ? 1095 ARG A CG  1 
ATOM   745  C  CD  . ARG A 1 117 ? 0.186   -11.747 83.338  1.00 50.30  ? 1095 ARG A CD  1 
ATOM   746  N  NE  . ARG A 1 117 ? 1.292   -11.995 82.415  1.00 49.56  ? 1095 ARG A NE  1 
ATOM   747  C  CZ  . ARG A 1 117 ? 2.223   -12.928 82.592  1.00 50.20  ? 1095 ARG A CZ  1 
ATOM   748  N  NH1 . ARG A 1 117 ? 2.189   -13.709 83.662  1.00 47.25  ? 1095 ARG A NH1 1 
ATOM   749  N  NH2 . ARG A 1 117 ? 3.189   -13.081 81.697  1.00 53.72  ? 1095 ARG A NH2 1 
ATOM   750  N  N   . ARG A 1 118 ? -2.063  -9.127  87.999  1.00 49.23  ? 1096 ARG A N   1 
ATOM   751  C  CA  . ARG A 1 118 ? -3.239  -8.628  88.711  1.00 47.71  ? 1096 ARG A CA  1 
ATOM   752  C  C   . ARG A 1 118 ? -3.130  -7.131  88.969  1.00 46.61  ? 1096 ARG A C   1 
ATOM   753  O  O   . ARG A 1 118 ? -4.115  -6.401  88.875  1.00 45.30  ? 1096 ARG A O   1 
ATOM   754  C  CB  . ARG A 1 118 ? -3.432  -9.364  90.038  1.00 48.57  ? 1096 ARG A CB  1 
ATOM   755  C  CG  . ARG A 1 118 ? -3.975  -10.774 89.907  1.00 52.42  ? 1096 ARG A CG  1 
ATOM   756  C  CD  . ARG A 1 118 ? -4.338  -11.344 91.268  1.00 54.08  ? 1096 ARG A CD  1 
ATOM   757  N  NE  . ARG A 1 118 ? -4.906  -12.685 91.165  1.00 58.85  ? 1096 ARG A NE  1 
ATOM   758  C  CZ  . ARG A 1 118 ? -5.413  -13.364 92.190  1.00 65.30  ? 1096 ARG A CZ  1 
ATOM   759  N  NH1 . ARG A 1 118 ? -5.427  -12.828 93.404  1.00 55.62  ? 1096 ARG A NH1 1 
ATOM   760  N  NH2 . ARG A 1 118 ? -5.909  -14.579 91.999  1.00 67.63  ? 1096 ARG A NH2 1 
ATOM   761  N  N   . ALA A 1 119 ? -1.923  -6.683  89.299  1.00 46.69  ? 1097 ALA A N   1 
ATOM   762  C  CA  . ALA A 1 119 ? -1.662  -5.269  89.519  1.00 44.68  ? 1097 ALA A CA  1 
ATOM   763  C  C   . ALA A 1 119 ? -1.862  -4.485  88.230  1.00 42.64  ? 1097 ALA A C   1 
ATOM   764  O  O   . ALA A 1 119 ? -2.406  -3.381  88.239  1.00 40.85  ? 1097 ALA A O   1 
ATOM   765  C  CB  . ALA A 1 119 ? -0.260  -5.068  90.046  1.00 46.04  ? 1097 ALA A CB  1 
ATOM   766  N  N   . ALA A 1 120 ? -1.418  -5.067  87.121  1.00 43.19  ? 1098 ALA A N   1 
ATOM   767  C  CA  . ALA A 1 120 ? -1.552  -4.424  85.820  1.00 45.26  ? 1098 ALA A CA  1 
ATOM   768  C  C   . ALA A 1 120 ? -3.022  -4.233  85.458  1.00 42.64  ? 1098 ALA A C   1 
ATOM   769  O  O   . ALA A 1 120 ? -3.412  -3.180  84.959  1.00 40.58  ? 1098 ALA A O   1 
ATOM   770  C  CB  . ALA A 1 120 ? -0.838  -5.235  84.747  1.00 45.61  ? 1098 ALA A CB  1 
ATOM   771  N  N   . LEU A 1 121 ? -3.834  -5.253  85.720  1.00 41.66  ? 1099 LEU A N   1 
ATOM   772  C  CA  . LEU A 1 121 ? -5.270  -5.153  85.500  1.00 39.98  ? 1099 LEU A CA  1 
ATOM   773  C  C   . LEU A 1 121 ? -5.882  -4.079  86.400  1.00 45.41  ? 1099 LEU A C   1 
ATOM   774  O  O   . LEU A 1 121 ? -6.678  -3.262  85.935  1.00 50.09  ? 1099 LEU A O   1 
ATOM   775  C  CB  . LEU A 1 121 ? -5.951  -6.504  85.739  1.00 40.94  ? 1099 LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 121 ? -7.484  -6.520  85.667  1.00 45.86  ? 1099 LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 121 ? -7.984  -6.005  84.323  1.00 41.37  ? 1099 LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 121 ? -8.046  -7.914  85.948  1.00 44.20  ? 1099 LEU A CD2 1 
ATOM   779  N  N   . ILE A 1 122 ? -5.508  -4.077  87.679  1.00 43.32  ? 1100 ILE A N   1 
ATOM   780  C  CA  . ILE A 1 122 ? -6.022  -3.084  88.628  1.00 45.50  ? 1100 ILE A CA  1 
ATOM   781  C  C   . ILE A 1 122 ? -5.584  -1.676  88.232  1.00 44.98  ? 1100 ILE A C   1 
ATOM   782  O  O   . ILE A 1 122 ? -6.299  -0.700  88.465  1.00 46.41  ? 1100 ILE A O   1 
ATOM   783  C  CB  . ILE A 1 122 ? -5.553  -3.373  90.076  1.00 48.48  ? 1100 ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 122 ? -6.118  -4.700  90.573  1.00 49.20  ? 1100 ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 122 ? -5.987  -2.268  91.028  1.00 46.53  ? 1100 ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 122 ? -5.587  -5.101  91.929  1.00 46.30  ? 1100 ILE A CD1 1 
ATOM   787  N  N   . ASN A 1 123 ? -4.403  -1.582  87.631  1.00 43.57  ? 1101 ASN A N   1 
ATOM   788  C  CA  . ASN A 1 123 ? -3.874  -0.308  87.166  1.00 43.59  ? 1101 ASN A CA  1 
ATOM   789  C  C   . ASN A 1 123 ? -4.776  0.278   86.089  1.00 44.67  ? 1101 ASN A C   1 
ATOM   790  O  O   . ASN A 1 123 ? -5.006  1.486   86.039  1.00 46.19  ? 1101 ASN A O   1 
ATOM   791  C  CB  . ASN A 1 123 ? -2.448  -0.491  86.637  1.00 43.94  ? 1101 ASN A CB  1 
ATOM   792  C  CG  . ASN A 1 123 ? -1.721  0.828   86.424  1.00 47.65  ? 1101 ASN A CG  1 
ATOM   793  O  OD1 . ASN A 1 123 ? -2.298  1.810   85.961  1.00 50.50  ? 1101 ASN A OD1 1 
ATOM   794  N  ND2 . ASN A 1 123 ? -0.438  0.850   86.761  1.00 49.53  ? 1101 ASN A ND2 1 
ATOM   795  N  N   . MET A 1 124 ? -5.295  -0.591  85.232  1.00 45.55  ? 1102 MET A N   1 
ATOM   796  C  CA  . MET A 1 124 ? -6.195  -0.165  84.172  1.00 47.53  ? 1102 MET A CA  1 
ATOM   797  C  C   . MET A 1 124 ? -7.529  0.291   84.749  1.00 46.88  ? 1102 MET A C   1 
ATOM   798  O  O   . MET A 1 124 ? -8.070  1.322   84.352  1.00 48.65  ? 1102 MET A O   1 
ATOM   799  C  CB  . MET A 1 124 ? -6.414  -1.295  83.169  1.00 44.57  ? 1102 MET A CB  1 
ATOM   800  C  CG  . MET A 1 124 ? -5.148  -1.778  82.495  1.00 40.97  ? 1102 MET A CG  1 
ATOM   801  S  SD  . MET A 1 124 ? -5.496  -3.070  81.291  1.00 48.45  ? 1102 MET A SD  1 
ATOM   802  C  CE  . MET A 1 124 ? -6.589  -2.192  80.173  1.00 46.89  ? 1102 MET A CE  1 
ATOM   803  N  N   . VAL A 1 125 ? -8.052  -0.491  85.686  1.00 45.83  ? 1103 VAL A N   1 
ATOM   804  C  CA  . VAL A 1 125 ? -9.309  -0.167  86.343  1.00 49.03  ? 1103 VAL A CA  1 
ATOM   805  C  C   . VAL A 1 125 ? -9.171  1.126   87.143  1.00 52.33  ? 1103 VAL A C   1 
ATOM   806  O  O   . VAL A 1 125 ? -10.107 1.917   87.231  1.00 58.09  ? 1103 VAL A O   1 
ATOM   807  C  CB  . VAL A 1 125 ? -9.763  -1.314  87.264  1.00 51.54  ? 1103 VAL A CB  1 
ATOM   808  C  CG1 . VAL A 1 125 ? -11.088 -0.975  87.932  1.00 54.76  ? 1103 VAL A CG1 1 
ATOM   809  C  CG2 . VAL A 1 125 ? -9.881  -2.607  86.470  1.00 47.72  ? 1103 VAL A CG2 1 
ATOM   810  N  N   . PHE A 1 126 ? -7.989  1.346   87.708  1.00 47.82  ? 1104 PHE A N   1 
ATOM   811  C  CA  . PHE A 1 126 ? -7.710  2.568   88.450  1.00 50.72  ? 1104 PHE A CA  1 
ATOM   812  C  C   . PHE A 1 126 ? -7.753  3.788   87.532  1.00 54.37  ? 1104 PHE A C   1 
ATOM   813  O  O   . PHE A 1 126 ? -8.089  4.890   87.964  1.00 59.94  ? 1104 PHE A O   1 
ATOM   814  C  CB  . PHE A 1 126 ? -6.344  2.471   89.134  1.00 57.82  ? 1104 PHE A CB  1 
ATOM   815  C  CG  . PHE A 1 126 ? -6.117  3.508   90.199  1.00 54.39  ? 1104 PHE A CG  1 
ATOM   816  C  CD1 . PHE A 1 126 ? -5.595  4.750   89.877  1.00 53.77  ? 1104 PHE A CD1 1 
ATOM   817  C  CD2 . PHE A 1 126 ? -6.409  3.231   91.524  1.00 56.86  ? 1104 PHE A CD2 1 
ATOM   818  C  CE1 . PHE A 1 126 ? -5.380  5.700   90.854  1.00 57.69  ? 1104 PHE A CE1 1 
ATOM   819  C  CE2 . PHE A 1 126 ? -6.195  4.179   92.509  1.00 62.66  ? 1104 PHE A CE2 1 
ATOM   820  C  CZ  . PHE A 1 126 ? -5.680  5.416   92.173  1.00 60.85  ? 1104 PHE A CZ  1 
ATOM   821  N  N   . GLN A 1 127 ? -7.417  3.579   86.263  1.00 56.28  ? 1105 GLN A N   1 
ATOM   822  C  CA  . GLN A 1 127 ? -7.328  4.674   85.299  1.00 53.83  ? 1105 GLN A CA  1 
ATOM   823  C  C   . GLN A 1 127 ? -8.616  4.870   84.501  1.00 56.34  ? 1105 GLN A C   1 
ATOM   824  O  O   . GLN A 1 127 ? -9.097  5.993   84.352  1.00 57.19  ? 1105 GLN A O   1 
ATOM   825  C  CB  . GLN A 1 127 ? -6.162  4.434   84.337  1.00 48.37  ? 1105 GLN A CB  1 
ATOM   826  C  CG  . GLN A 1 127 ? -5.935  5.559   83.340  1.00 49.60  ? 1105 GLN A CG  1 
ATOM   827  C  CD  . GLN A 1 127 ? -4.881  5.222   82.299  1.00 50.62  ? 1105 GLN A CD  1 
ATOM   828  O  OE1 . GLN A 1 127 ? -4.381  4.097   82.241  1.00 51.51  ? 1105 GLN A OE1 1 
ATOM   829  N  NE2 . GLN A 1 127 ? -4.538  6.200   81.470  1.00 49.77  ? 1105 GLN A NE2 1 
ATOM   830  N  N   . MET A 1 128 ? -9.169  3.775   83.989  1.00 53.21  ? 1106 MET A N   1 
ATOM   831  C  CA  . MET A 1 128 ? -10.318 3.844   83.091  1.00 52.55  ? 1106 MET A CA  1 
ATOM   832  C  C   . MET A 1 128 ? -11.617 3.391   83.755  1.00 54.92  ? 1106 MET A C   1 
ATOM   833  O  O   . MET A 1 128 ? -12.667 3.349   83.115  1.00 55.64  ? 1106 MET A O   1 
ATOM   834  C  CB  . MET A 1 128 ? -10.056 2.998   81.841  1.00 52.94  ? 1106 MET A CB  1 
ATOM   835  C  CG  . MET A 1 128 ? -8.728  3.299   81.162  1.00 56.64  ? 1106 MET A CG  1 
ATOM   836  S  SD  . MET A 1 128 ? -8.316  2.132   79.850  1.00 61.80  ? 1106 MET A SD  1 
ATOM   837  C  CE  . MET A 1 128 ? -9.716  2.357   78.752  1.00 74.14  ? 1106 MET A CE  1 
ATOM   838  N  N   . GLY A 1 129 ? -11.547 3.048   85.035  1.00 55.58  ? 1107 GLY A N   1 
ATOM   839  C  CA  . GLY A 1 129 ? -12.719 2.581   85.751  1.00 53.06  ? 1107 GLY A CA  1 
ATOM   840  C  C   . GLY A 1 129 ? -13.073 1.148   85.406  1.00 54.07  ? 1107 GLY A C   1 
ATOM   841  O  O   . GLY A 1 129 ? -12.573 0.589   84.431  1.00 54.43  ? 1107 GLY A O   1 
ATOM   842  N  N   . GLU A 1 130 ? -13.945 0.554   86.213  1.00 56.07  ? 1108 GLU A N   1 
ATOM   843  C  CA  . GLU A 1 130 ? -14.379 -0.825  86.014  1.00 58.93  ? 1108 GLU A CA  1 
ATOM   844  C  C   . GLU A 1 130 ? -15.014 -1.063  84.645  1.00 56.97  ? 1108 GLU A C   1 
ATOM   845  O  O   . GLU A 1 130 ? -14.645 -2.005  83.941  1.00 53.50  ? 1108 GLU A O   1 
ATOM   846  C  CB  . GLU A 1 130 ? -15.368 -1.225  87.109  1.00 63.11  ? 1108 GLU A CB  1 
ATOM   847  C  CG  . GLU A 1 130 ? -16.077 -2.539  86.850  1.00 63.73  ? 1108 GLU A CG  1 
ATOM   848  C  CD  . GLU A 1 130 ? -17.097 -2.859  87.920  1.00 71.29  ? 1108 GLU A CD  1 
ATOM   849  O  OE1 . GLU A 1 130 ? -17.213 -2.077  88.887  1.00 74.65  ? 1108 GLU A OE1 1 
ATOM   850  O  OE2 . GLU A 1 130 ? -17.785 -3.893  87.793  1.00 75.69  ? 1108 GLU A OE2 1 
ATOM   851  N  N   . THR A 1 131 ? -15.965 -0.210  84.275  1.00 62.16  ? 1109 THR A N   1 
ATOM   852  C  CA  . THR A 1 131 ? -16.709 -0.372  83.025  1.00 57.30  ? 1109 THR A CA  1 
ATOM   853  C  C   . THR A 1 131 ? -15.803 -0.277  81.801  1.00 55.25  ? 1109 THR A C   1 
ATOM   854  O  O   . THR A 1 131 ? -15.910 -1.085  80.877  1.00 54.57  ? 1109 THR A O   1 
ATOM   855  C  CB  . THR A 1 131 ? -17.828 0.677   82.898  1.00 59.45  ? 1109 THR A CB  1 
ATOM   856  O  OG1 . THR A 1 131 ? -18.605 0.697   84.103  1.00 66.73  ? 1109 THR A OG1 1 
ATOM   857  C  CG2 . THR A 1 131 ? -18.732 0.349   81.724  1.00 59.49  ? 1109 THR A CG2 1 
ATOM   858  N  N   . GLY A 1 132 ? -14.908 0.706   81.805  1.00 54.29  ? 1110 GLY A N   1 
ATOM   859  C  CA  . GLY A 1 132 ? -13.982 0.911   80.704  1.00 52.98  ? 1110 GLY A CA  1 
ATOM   860  C  C   . GLY A 1 132 ? -13.142 -0.306  80.360  1.00 53.26  ? 1110 GLY A C   1 
ATOM   861  O  O   . GLY A 1 132 ? -13.050 -0.695  79.196  1.00 55.36  ? 1110 GLY A O   1 
ATOM   862  N  N   . VAL A 1 133 ? -12.529 -0.908  81.373  1.00 52.61  ? 1111 VAL A N   1 
ATOM   863  C  CA  . VAL A 1 133 ? -11.680 -2.075  81.165  1.00 50.84  ? 1111 VAL A CA  1 
ATOM   864  C  C   . VAL A 1 133 ? -12.511 -3.268  80.694  1.00 49.25  ? 1111 VAL A C   1 
ATOM   865  O  O   . VAL A 1 133 ? -12.035 -4.104  79.924  1.00 46.83  ? 1111 VAL A O   1 
ATOM   866  C  CB  . VAL A 1 133 ? -10.906 -2.440  82.452  1.00 47.95  ? 1111 VAL A CB  1 
ATOM   867  C  CG1 . VAL A 1 133 ? -9.958  -3.601  82.207  1.00 43.05  ? 1111 VAL A CG1 1 
ATOM   868  C  CG2 . VAL A 1 133 ? -10.137 -1.235  82.956  1.00 47.49  ? 1111 VAL A CG2 1 
ATOM   869  N  N   . ALA A 1 134 ? -13.765 -3.326  81.137  1.00 51.06  ? 1112 ALA A N   1 
ATOM   870  C  CA  . ALA A 1 134 ? -14.671 -4.406  80.750  1.00 54.47  ? 1112 ALA A CA  1 
ATOM   871  C  C   . ALA A 1 134 ? -14.972 -4.399  79.246  1.00 52.67  ? 1112 ALA A C   1 
ATOM   872  O  O   . ALA A 1 134 ? -15.469 -5.385  78.696  1.00 48.04  ? 1112 ALA A O   1 
ATOM   873  C  CB  . ALA A 1 134 ? -15.960 -4.315  81.544  1.00 50.03  ? 1112 ALA A CB  1 
ATOM   874  N  N   . GLY A 1 135 ? -14.670 -3.284  78.589  1.00 50.57  ? 1113 GLY A N   1 
ATOM   875  C  CA  . GLY A 1 135 ? -14.881 -3.154  77.161  1.00 48.71  ? 1113 GLY A CA  1 
ATOM   876  C  C   . GLY A 1 135 ? -13.871 -3.942  76.349  1.00 51.12  ? 1113 GLY A C   1 
ATOM   877  O  O   . GLY A 1 135 ? -14.138 -4.321  75.207  1.00 52.26  ? 1113 GLY A O   1 
ATOM   878  N  N   . PHE A 1 136 ? -12.704 -4.186  76.937  1.00 51.49  ? 1114 PHE A N   1 
ATOM   879  C  CA  . PHE A 1 136 ? -11.664 -4.963  76.271  1.00 49.39  ? 1114 PHE A CA  1 
ATOM   880  C  C   . PHE A 1 136 ? -11.960 -6.452  76.370  1.00 50.64  ? 1114 PHE A C   1 
ATOM   881  O  O   . PHE A 1 136 ? -11.203 -7.201  76.979  1.00 48.44  ? 1114 PHE A O   1 
ATOM   882  C  CB  . PHE A 1 136 ? -10.292 -4.660  76.871  1.00 45.46  ? 1114 PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 136 ? -9.898  -3.218  76.773  1.00 47.12  ? 1114 PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 136 ? -9.371  -2.709  75.599  1.00 47.41  ? 1114 PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 136 ? -10.055 -2.370  77.854  1.00 50.70  ? 1114 PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 136 ? -9.009  -1.382  75.504  1.00 46.97  ? 1114 PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 136 ? -9.693  -1.041  77.766  1.00 52.47  ? 1114 PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 136 ? -9.169  -0.547  76.589  1.00 50.71  ? 1114 PHE A CZ  1 
ATOM   889  N  N   . THR A 1 137 ? -13.061 -6.871  75.758  1.00 51.41  ? 1115 THR A N   1 
ATOM   890  C  CA  . THR A 1 137 ? -13.521 -8.250  75.849  1.00 51.64  ? 1115 THR A CA  1 
ATOM   891  C  C   . THR A 1 137 ? -12.537 -9.237  75.231  1.00 51.53  ? 1115 THR A C   1 
ATOM   892  O  O   . THR A 1 137 ? -12.274 -10.297 75.797  1.00 53.31  ? 1115 THR A O   1 
ATOM   893  C  CB  . THR A 1 137 ? -14.888 -8.422  75.164  1.00 50.73  ? 1115 THR A CB  1 
ATOM   894  O  OG1 . THR A 1 137 ? -15.820 -7.483  75.715  1.00 51.43  ? 1115 THR A OG1 1 
ATOM   895  C  CG2 . THR A 1 137 ? -15.411 -9.833  75.363  1.00 48.47  ? 1115 THR A CG2 1 
ATOM   896  N  N   . ASN A 1 138 ? -11.998 -8.883  74.070  1.00 49.91  ? 1116 ASN A N   1 
ATOM   897  C  CA  . ASN A 1 138 ? -11.124 -9.786  73.328  1.00 55.12  ? 1116 ASN A CA  1 
ATOM   898  C  C   . ASN A 1 138 ? -9.765  -9.962  73.994  1.00 55.73  ? 1116 ASN A C   1 
ATOM   899  O  O   . ASN A 1 138 ? -9.234  -11.072 74.063  1.00 56.35  ? 1116 ASN A O   1 
ATOM   900  C  CB  . ASN A 1 138 ? -10.941 -9.283  71.894  1.00 56.90  ? 1116 ASN A CB  1 
ATOM   901  C  CG  . ASN A 1 138 ? -12.238 -9.284  71.107  1.00 54.75  ? 1116 ASN A CG  1 
ATOM   902  O  OD1 . ASN A 1 138 ? -12.980 -10.268 71.114  1.00 57.56  ? 1116 ASN A OD1 1 
ATOM   903  N  ND2 . ASN A 1 138 ? -12.524 -8.175  70.435  1.00 51.21  ? 1116 ASN A ND2 1 
ATOM   904  N  N   . SER A 1 139 ? -9.210  -8.859  74.483  1.00 53.44  ? 1117 SER A N   1 
ATOM   905  C  CA  . SER A 1 139 ? -7.921  -8.884  75.158  1.00 52.23  ? 1117 SER A CA  1 
ATOM   906  C  C   . SER A 1 139 ? -8.006  -9.631  76.486  1.00 54.11  ? 1117 SER A C   1 
ATOM   907  O  O   . SER A 1 139 ? -7.084  -10.360 76.854  1.00 57.39  ? 1117 SER A O   1 
ATOM   908  C  CB  . SER A 1 139 ? -7.415  -7.461  75.386  1.00 51.29  ? 1117 SER A CB  1 
ATOM   909  O  OG  . SER A 1 139 ? -7.249  -6.773  74.158  1.00 50.80  ? 1117 SER A OG  1 
ATOM   910  N  N   . LEU A 1 140 ? -9.112  -9.446  77.201  1.00 50.30  ? 1118 LEU A N   1 
ATOM   911  C  CA  . LEU A 1 140 ? -9.328  -10.133 78.471  1.00 52.06  ? 1118 LEU A CA  1 
ATOM   912  C  C   . LEU A 1 140 ? -9.393  -11.642 78.267  1.00 54.12  ? 1118 LEU A C   1 
ATOM   913  O  O   . LEU A 1 140 ? -8.953  -12.415 79.118  1.00 55.57  ? 1118 LEU A O   1 
ATOM   914  C  CB  . LEU A 1 140 ? -10.610 -9.636  79.144  1.00 53.33  ? 1118 LEU A CB  1 
ATOM   915  C  CG  . LEU A 1 140 ? -10.546 -8.252  79.795  1.00 51.15  ? 1118 LEU A CG  1 
ATOM   916  C  CD1 . LEU A 1 140 ? -11.925 -7.803  80.253  1.00 50.76  ? 1118 LEU A CD1 1 
ATOM   917  C  CD2 . LEU A 1 140 ? -9.563  -8.238  80.952  1.00 52.89  ? 1118 LEU A CD2 1 
ATOM   918  N  N   . ARG A 1 141 ? -9.943  -12.054 77.132  1.00 57.65  ? 1119 ARG A N   1 
ATOM   919  C  CA  . ARG A 1 141 ? -10.020 -13.468 76.789  1.00 60.11  ? 1119 ARG A CA  1 
ATOM   920  C  C   . ARG A 1 141 ? -8.629  -14.022 76.500  1.00 59.82  ? 1119 ARG A C   1 
ATOM   921  O  O   . ARG A 1 141 ? -8.319  -15.165 76.836  1.00 59.64  ? 1119 ARG A O   1 
ATOM   922  C  CB  . ARG A 1 141 ? -10.938 -13.674 75.585  1.00 58.55  ? 1119 ARG A CB  1 
ATOM   923  C  CG  . ARG A 1 141 ? -11.144 -15.123 75.194  1.00 62.90  ? 1119 ARG A CG  1 
ATOM   924  C  CD  . ARG A 1 141 ? -12.039 -15.236 73.970  1.00 69.70  ? 1119 ARG A CD  1 
ATOM   925  N  NE  . ARG A 1 141 ? -11.464 -14.570 72.804  1.00 82.46  ? 1119 ARG A NE  1 
ATOM   926  C  CZ  . ARG A 1 141 ? -11.860 -13.386 72.343  1.00 77.37  ? 1119 ARG A CZ  1 
ATOM   927  N  NH1 . ARG A 1 141 ? -12.843 -12.730 72.945  1.00 62.51  ? 1119 ARG A NH1 1 
ATOM   928  N  NH2 . ARG A 1 141 ? -11.273 -12.860 71.275  1.00 79.14  ? 1119 ARG A NH2 1 
ATOM   929  N  N   . MET A 1 142 ? -7.793  -13.200 75.878  1.00 59.00  ? 1120 MET A N   1 
ATOM   930  C  CA  . MET A 1 142 ? -6.424  -13.590 75.580  1.00 56.78  ? 1120 MET A CA  1 
ATOM   931  C  C   . MET A 1 142 ? -5.598  -13.696 76.859  1.00 55.99  ? 1120 MET A C   1 
ATOM   932  O  O   . MET A 1 142 ? -4.833  -14.643 77.036  1.00 56.81  ? 1120 MET A O   1 
ATOM   933  C  CB  . MET A 1 142 ? -5.790  -12.593 74.610  1.00 55.94  ? 1120 MET A CB  1 
ATOM   934  C  CG  . MET A 1 142 ? -6.410  -12.621 73.225  1.00 58.81  ? 1120 MET A CG  1 
ATOM   935  S  SD  . MET A 1 142 ? -5.807  -11.319 72.136  1.00 64.09  ? 1120 MET A SD  1 
ATOM   936  C  CE  . MET A 1 142 ? -6.391  -11.919 70.555  1.00 66.49  ? 1120 MET A CE  1 
ATOM   937  N  N   . LEU A 1 143 ? -5.767  -12.725 77.752  1.00 54.99  ? 1121 LEU A N   1 
ATOM   938  C  CA  . LEU A 1 143 ? -5.068  -12.728 79.033  1.00 55.08  ? 1121 LEU A CA  1 
ATOM   939  C  C   . LEU A 1 143 ? -5.472  -13.933 79.876  1.00 55.48  ? 1121 LEU A C   1 
ATOM   940  O  O   . LEU A 1 143 ? -4.653  -14.509 80.591  1.00 56.67  ? 1121 LEU A O   1 
ATOM   941  C  CB  . LEU A 1 143 ? -5.344  -11.429 79.794  1.00 51.44  ? 1121 LEU A CB  1 
ATOM   942  C  CG  . LEU A 1 143 ? -4.716  -10.170 79.192  1.00 47.78  ? 1121 LEU A CG  1 
ATOM   943  C  CD1 . LEU A 1 143 ? -5.183  -8.925  79.920  1.00 44.09  ? 1121 LEU A CD1 1 
ATOM   944  C  CD2 . LEU A 1 143 ? -3.199  -10.270 79.229  1.00 50.07  ? 1121 LEU A CD2 1 
ATOM   945  N  N   . GLN A 1 144 ? -6.740  -14.315 79.779  1.00 55.70  ? 1122 GLN A N   1 
ATOM   946  C  CA  . GLN A 1 144 ? -7.247  -15.479 80.490  1.00 55.23  ? 1122 GLN A CA  1 
ATOM   947  C  C   . GLN A 1 144 ? -6.683  -16.771 79.907  1.00 59.40  ? 1122 GLN A C   1 
ATOM   948  O  O   . GLN A 1 144 ? -6.485  -17.749 80.625  1.00 61.74  ? 1122 GLN A O   1 
ATOM   949  C  CB  . GLN A 1 144 ? -8.775  -15.503 80.445  1.00 59.50  ? 1122 GLN A CB  1 
ATOM   950  C  CG  . GLN A 1 144 ? -9.411  -16.557 81.333  1.00 62.92  ? 1122 GLN A CG  1 
ATOM   951  C  CD  . GLN A 1 144 ? -10.904 -16.351 81.491  1.00 67.36  ? 1122 GLN A CD  1 
ATOM   952  O  OE1 . GLN A 1 144 ? -11.476 -15.416 80.930  1.00 75.26  ? 1122 GLN A OE1 1 
ATOM   953  N  NE2 . GLN A 1 144 ? -11.543 -17.224 82.260  1.00 77.67  ? 1122 GLN A NE2 1 
ATOM   954  N  N   . GLN A 1 145 ? -6.422  -16.771 78.603  1.00 60.11  ? 1123 GLN A N   1 
ATOM   955  C  CA  . GLN A 1 145 ? -5.881  -17.953 77.936  1.00 60.54  ? 1123 GLN A CA  1 
ATOM   956  C  C   . GLN A 1 145 ? -4.354  -17.947 77.934  1.00 61.13  ? 1123 GLN A C   1 
ATOM   957  O  O   . GLN A 1 145 ? -3.721  -18.733 77.229  1.00 57.03  ? 1123 GLN A O   1 
ATOM   958  C  CB  . GLN A 1 145 ? -6.416  -18.052 76.505  1.00 63.89  ? 1123 GLN A CB  1 
ATOM   959  C  CG  . GLN A 1 145 ? -7.910  -18.337 76.435  1.00 66.51  ? 1123 GLN A CG  1 
ATOM   960  C  CD  . GLN A 1 145 ? -8.410  -18.550 75.019  1.00 67.78  ? 1123 GLN A CD  1 
ATOM   961  O  OE1 . GLN A 1 145 ? -7.787  -18.112 74.050  1.00 68.45  ? 1123 GLN A OE1 1 
ATOM   962  N  NE2 . GLN A 1 145 ? -9.544  -19.228 74.893  1.00 70.18  ? 1123 GLN A NE2 1 
ATOM   963  N  N   . LYS A 1 146 ? -3.780  -17.053 78.736  1.00 61.88  ? 1124 LYS A N   1 
ATOM   964  C  CA  . LYS A 1 146 ? -2.334  -16.944 78.917  1.00 59.44  ? 1124 LYS A CA  1 
ATOM   965  C  C   . LYS A 1 146 ? -1.602  -16.600 77.616  1.00 59.22  ? 1124 LYS A C   1 
ATOM   966  O  O   . LYS A 1 146 ? -0.429  -16.930 77.448  1.00 62.60  ? 1124 LYS A O   1 
ATOM   967  C  CB  . LYS A 1 146 ? -1.771  -18.242 79.510  1.00 60.71  ? 1124 LYS A CB  1 
ATOM   968  C  CG  . LYS A 1 146 ? -2.509  -18.747 80.747  1.00 59.16  ? 1124 LYS A CG  1 
ATOM   969  C  CD  . LYS A 1 146 ? -2.172  -17.924 81.977  1.00 63.10  ? 1124 LYS A CD  1 
ATOM   970  C  CE  . LYS A 1 146 ? -3.086  -18.259 83.147  1.00 62.02  ? 1124 LYS A CE  1 
ATOM   971  N  NZ  . LYS A 1 146 ? -4.481  -17.790 82.919  1.00 63.13  ? 1124 LYS A NZ  1 
ATOM   972  N  N   . ARG A 1 147 ? -2.298  -15.930 76.702  1.00 58.96  ? 1125 ARG A N   1 
ATOM   973  C  CA  . ARG A 1 147 ? -1.702  -15.498 75.439  1.00 60.01  ? 1125 ARG A CA  1 
ATOM   974  C  C   . ARG A 1 147 ? -1.210  -14.058 75.542  1.00 57.15  ? 1125 ARG A C   1 
ATOM   975  O  O   . ARG A 1 147 ? -1.875  -13.133 75.076  1.00 58.15  ? 1125 ARG A O   1 
ATOM   976  C  CB  . ARG A 1 147 ? -2.711  -15.630 74.294  1.00 66.68  ? 1125 ARG A CB  1 
ATOM   977  C  CG  . ARG A 1 147 ? -3.204  -17.049 74.047  1.00 70.63  ? 1125 ARG A CG  1 
ATOM   978  C  CD  . ARG A 1 147 ? -4.205  -17.092 72.902  1.00 79.08  ? 1125 ARG A CD  1 
ATOM   979  N  NE  . ARG A 1 147 ? -4.582  -18.460 72.556  1.00 97.24  ? 1125 ARG A NE  1 
ATOM   980  C  CZ  . ARG A 1 147 ? -5.388  -18.782 71.550  1.00 90.38  ? 1125 ARG A CZ  1 
ATOM   981  N  NH1 . ARG A 1 147 ? -5.908  -17.833 70.784  1.00 85.91  ? 1125 ARG A NH1 1 
ATOM   982  N  NH2 . ARG A 1 147 ? -5.674  -20.055 71.308  1.00 91.89  ? 1125 ARG A NH2 1 
ATOM   983  N  N   . TRP A 1 148 ? -0.038  -13.875 76.142  1.00 55.58  ? 1126 TRP A N   1 
ATOM   984  C  CA  . TRP A 1 148 ? 0.438   -12.546 76.517  1.00 52.91  ? 1126 TRP A CA  1 
ATOM   985  C  C   . TRP A 1 148 ? 0.825   -11.664 75.333  1.00 54.48  ? 1126 TRP A C   1 
ATOM   986  O  O   . TRP A 1 148 ? 0.586   -10.457 75.352  1.00 51.75  ? 1126 TRP A O   1 
ATOM   987  C  CB  . TRP A 1 148 ? 1.627   -12.669 77.469  1.00 54.06  ? 1126 TRP A CB  1 
ATOM   988  C  CG  . TRP A 1 148 ? 1.419   -13.657 78.579  1.00 54.93  ? 1126 TRP A CG  1 
ATOM   989  C  CD1 . TRP A 1 148 ? 2.216   -14.720 78.885  1.00 55.42  ? 1126 TRP A CD1 1 
ATOM   990  C  CD2 . TRP A 1 148 ? 0.342   -13.678 79.524  1.00 56.36  ? 1126 TRP A CD2 1 
ATOM   991  N  NE1 . TRP A 1 148 ? 1.708   -15.399 79.964  1.00 53.91  ? 1126 TRP A NE1 1 
ATOM   992  C  CE2 . TRP A 1 148 ? 0.555   -14.781 80.376  1.00 56.94  ? 1126 TRP A CE2 1 
ATOM   993  C  CE3 . TRP A 1 148 ? -0.782  -12.872 79.737  1.00 55.30  ? 1126 TRP A CE3 1 
ATOM   994  C  CZ2 . TRP A 1 148 ? -0.308  -15.097 81.421  1.00 56.30  ? 1126 TRP A CZ2 1 
ATOM   995  C  CZ3 . TRP A 1 148 ? -1.643  -13.190 80.775  1.00 56.62  ? 1126 TRP A CZ3 1 
ATOM   996  C  CH2 . TRP A 1 148 ? -1.400  -14.293 81.604  1.00 55.68  ? 1126 TRP A CH2 1 
ATOM   997  N  N   . ASP A 1 149 ? 1.431   -12.261 74.312  1.00 58.00  ? 1127 ASP A N   1 
ATOM   998  C  CA  . ASP A 1 149 ? 1.863   -11.501 73.144  1.00 56.42  ? 1127 ASP A CA  1 
ATOM   999  C  C   . ASP A 1 149 ? 0.676   -10.975 72.337  1.00 57.41  ? 1127 ASP A C   1 
ATOM   1000 O  O   . ASP A 1 149 ? 0.640   -9.798  71.973  1.00 55.34  ? 1127 ASP A O   1 
ATOM   1001 C  CB  . ASP A 1 149 ? 2.766   -12.354 72.252  1.00 61.95  ? 1127 ASP A CB  1 
ATOM   1002 C  CG  . ASP A 1 149 ? 4.121   -12.624 72.879  1.00 67.29  ? 1127 ASP A CG  1 
ATOM   1003 O  OD1 . ASP A 1 149 ? 4.665   -13.728 72.665  1.00 71.75  ? 1127 ASP A OD1 1 
ATOM   1004 O  OD2 . ASP A 1 149 ? 4.642   -11.731 73.581  1.00 66.08  ? 1127 ASP A OD2 1 
ATOM   1005 N  N   . GLU A 1 150 ? -0.293  -11.845 72.063  1.00 57.97  ? 1128 GLU A N   1 
ATOM   1006 C  CA  . GLU A 1 150 ? -1.475  -11.457 71.294  1.00 56.26  ? 1128 GLU A CA  1 
ATOM   1007 C  C   . GLU A 1 150 ? -2.285  -10.393 72.018  1.00 55.15  ? 1128 GLU A C   1 
ATOM   1008 O  O   . GLU A 1 150 ? -2.774  -9.446  71.401  1.00 55.28  ? 1128 GLU A O   1 
ATOM   1009 C  CB  . GLU A 1 150 ? -2.363  -12.669 71.005  1.00 62.29  ? 1128 GLU A CB  1 
ATOM   1010 C  CG  . GLU A 1 150 ? -1.800  -13.617 69.961  1.00 69.96  ? 1128 GLU A CG  1 
ATOM   1011 C  CD  . GLU A 1 150 ? -2.817  -14.643 69.501  1.00 85.12  ? 1128 GLU A CD  1 
ATOM   1012 O  OE1 . GLU A 1 150 ? -3.862  -14.787 70.170  1.00 89.55  ? 1128 GLU A OE1 1 
ATOM   1013 O  OE2 . GLU A 1 150 ? -2.574  -15.302 68.468  1.00 103.25 ? 1128 GLU A OE2 1 
ATOM   1014 N  N   . ALA A 1 151 ? -2.423  -10.560 73.329  1.00 56.27  ? 1129 ALA A N   1 
ATOM   1015 C  CA  . ALA A 1 151 ? -3.138  -9.602  74.162  1.00 50.38  ? 1129 ALA A CA  1 
ATOM   1016 C  C   . ALA A 1 151 ? -2.439  -8.252  74.136  1.00 48.83  ? 1129 ALA A C   1 
ATOM   1017 O  O   . ALA A 1 151 ? -3.087  -7.207  74.068  1.00 45.94  ? 1129 ALA A O   1 
ATOM   1018 C  CB  . ALA A 1 151 ? -3.246  -10.115 75.584  1.00 51.45  ? 1129 ALA A CB  1 
ATOM   1019 N  N   . ALA A 1 152 ? -1.111  -8.288  74.183  1.00 49.08  ? 1130 ALA A N   1 
ATOM   1020 C  CA  . ALA A 1 152 ? -0.297  -7.080  74.153  1.00 48.01  ? 1130 ALA A CA  1 
ATOM   1021 C  C   . ALA A 1 152 ? -0.510  -6.292  72.863  1.00 51.97  ? 1130 ALA A C   1 
ATOM   1022 O  O   . ALA A 1 152 ? -0.611  -5.066  72.887  1.00 52.26  ? 1130 ALA A O   1 
ATOM   1023 C  CB  . ALA A 1 152 ? 1.172   -7.434  74.320  1.00 51.61  ? 1130 ALA A CB  1 
ATOM   1024 N  N   . VAL A 1 153 ? -0.578  -7.002  71.739  1.00 52.44  ? 1131 VAL A N   1 
ATOM   1025 C  CA  . VAL A 1 153 ? -0.780  -6.368  70.440  1.00 50.00  ? 1131 VAL A CA  1 
ATOM   1026 C  C   . VAL A 1 153 ? -2.167  -5.738  70.336  1.00 51.60  ? 1131 VAL A C   1 
ATOM   1027 O  O   . VAL A 1 153 ? -2.311  -4.613  69.856  1.00 51.04  ? 1131 VAL A O   1 
ATOM   1028 C  CB  . VAL A 1 153 ? -0.589  -7.373  69.286  1.00 51.02  ? 1131 VAL A CB  1 
ATOM   1029 C  CG1 . VAL A 1 153 ? -1.008  -6.754  67.964  1.00 49.98  ? 1131 VAL A CG1 1 
ATOM   1030 C  CG2 . VAL A 1 153 ? 0.856   -7.842  69.225  1.00 47.36  ? 1131 VAL A CG2 1 
ATOM   1031 N  N   . ASN A 1 154 ? -3.181  -6.469  70.793  1.00 48.80  ? 1132 ASN A N   1 
ATOM   1032 C  CA  . ASN A 1 154 ? -4.554  -5.975  70.791  1.00 52.72  ? 1132 ASN A CA  1 
ATOM   1033 C  C   . ASN A 1 154 ? -4.716  -4.686  71.588  1.00 55.07  ? 1132 ASN A C   1 
ATOM   1034 O  O   . ASN A 1 154 ? -5.423  -3.767  71.167  1.00 54.33  ? 1132 ASN A O   1 
ATOM   1035 C  CB  . ASN A 1 154 ? -5.500  -7.036  71.352  1.00 56.72  ? 1132 ASN A CB  1 
ATOM   1036 C  CG  . ASN A 1 154 ? -6.064  -7.939  70.282  1.00 62.67  ? 1132 ASN A CG  1 
ATOM   1037 O  OD1 . ASN A 1 154 ? -5.580  -7.963  69.149  1.00 75.45  ? 1132 ASN A OD1 1 
ATOM   1038 N  ND2 . ASN A 1 154 ? -7.101  -8.689  70.634  1.00 67.17  ? 1132 ASN A ND2 1 
ATOM   1039 N  N   . LEU A 1 155 ? -4.064  -4.632  72.745  1.00 48.47  ? 1133 LEU A N   1 
ATOM   1040 C  CA  . LEU A 1 155 ? -4.153  -3.474  73.624  1.00 48.91  ? 1133 LEU A CA  1 
ATOM   1041 C  C   . LEU A 1 155 ? -3.384  -2.295  73.048  1.00 48.41  ? 1133 LEU A C   1 
ATOM   1042 O  O   . LEU A 1 155 ? -3.689  -1.135  73.339  1.00 46.58  ? 1133 LEU A O   1 
ATOM   1043 C  CB  . LEU A 1 155 ? -3.625  -3.817  75.017  1.00 49.19  ? 1133 LEU A CB  1 
ATOM   1044 C  CG  . LEU A 1 155 ? -4.397  -4.869  75.813  1.00 47.35  ? 1133 LEU A CG  1 
ATOM   1045 C  CD1 . LEU A 1 155 ? -3.638  -5.244  77.076  1.00 45.54  ? 1133 LEU A CD1 1 
ATOM   1046 C  CD2 . LEU A 1 155 ? -5.784  -4.354  76.152  1.00 46.77  ? 1133 LEU A CD2 1 
ATOM   1047 N  N   . ALA A 1 156 ? -2.386  -2.601  72.227  1.00 46.34  ? 1134 ALA A N   1 
ATOM   1048 C  CA  . ALA A 1 156 ? -1.529  -1.576  71.650  1.00 49.71  ? 1134 ALA A CA  1 
ATOM   1049 C  C   . ALA A 1 156 ? -2.289  -0.733  70.633  1.00 54.01  ? 1134 ALA A C   1 
ATOM   1050 O  O   . ALA A 1 156 ? -1.906  0.400   70.346  1.00 56.16  ? 1134 ALA A O   1 
ATOM   1051 C  CB  . ALA A 1 156 ? -0.308  -2.208  71.011  1.00 49.51  ? 1134 ALA A CB  1 
ATOM   1052 N  N   . LYS A 1 157 ? -3.363  -1.292  70.086  1.00 52.43  ? 1135 LYS A N   1 
ATOM   1053 C  CA  . LYS A 1 157 ? -4.214  -0.550  69.165  1.00 51.91  ? 1135 LYS A CA  1 
ATOM   1054 C  C   . LYS A 1 157 ? -5.544  -0.202  69.820  1.00 54.92  ? 1135 LYS A C   1 
ATOM   1055 O  O   . LYS A 1 157 ? -6.533  -0.918  69.677  1.00 67.38  ? 1135 LYS A O   1 
ATOM   1056 C  CB  . LYS A 1 157 ? -4.438  -1.340  67.871  1.00 52.88  ? 1135 LYS A CB  1 
ATOM   1057 C  CG  . LYS A 1 157 ? -4.624  -2.838  68.051  1.00 51.76  ? 1135 LYS A CG  1 
ATOM   1058 C  CD  . LYS A 1 157 ? -4.476  -3.556  66.717  1.00 46.66  ? 1135 LYS A CD  1 
ATOM   1059 C  CE  . LYS A 1 157 ? -4.437  -5.066  66.885  1.00 51.05  ? 1135 LYS A CE  1 
ATOM   1060 N  NZ  . LYS A 1 157 ? -3.976  -5.747  65.641  1.00 47.00  ? 1135 LYS A NZ  1 
ATOM   1061 N  N   . SER A 1 158 ? -5.553  0.909   70.546  1.00 52.34  ? 1136 SER A N   1 
ATOM   1062 C  CA  . SER A 1 158 ? -6.752  1.387   71.217  1.00 47.73  ? 1136 SER A CA  1 
ATOM   1063 C  C   . SER A 1 158 ? -6.574  2.850   71.592  1.00 48.94  ? 1136 SER A C   1 
ATOM   1064 O  O   . SER A 1 158 ? -5.459  3.367   71.569  1.00 53.06  ? 1136 SER A O   1 
ATOM   1065 C  CB  . SER A 1 158 ? -7.050  0.549   72.462  1.00 50.72  ? 1136 SER A CB  1 
ATOM   1066 O  OG  . SER A 1 158 ? -5.990  0.628   73.400  1.00 52.69  ? 1136 SER A OG  1 
ATOM   1067 N  N   . ARG A 1 159 ? -7.670  3.517   71.934  1.00 48.36  ? 1137 ARG A N   1 
ATOM   1068 C  CA  . ARG A 1 159 ? -7.600  4.911   72.353  1.00 51.82  ? 1137 ARG A CA  1 
ATOM   1069 C  C   . ARG A 1 159 ? -6.754  5.034   73.624  1.00 55.87  ? 1137 ARG A C   1 
ATOM   1070 O  O   . ARG A 1 159 ? -6.069  6.038   73.833  1.00 55.23  ? 1137 ARG A O   1 
ATOM   1071 C  CB  . ARG A 1 159 ? -9.002  5.484   72.576  1.00 45.26  ? 1137 ARG A CB  1 
ATOM   1072 C  CG  . ARG A 1 159 ? -9.001  6.962   72.920  1.00 48.74  ? 1137 ARG A CG  1 
ATOM   1073 C  CD  . ARG A 1 159 ? -10.395 7.473   73.201  1.00 51.34  ? 1137 ARG A CD  1 
ATOM   1074 N  NE  . ARG A 1 159 ? -10.380 8.823   73.753  1.00 53.28  ? 1137 ARG A NE  1 
ATOM   1075 C  CZ  . ARG A 1 159 ? -10.350 9.930   73.018  1.00 59.67  ? 1137 ARG A CZ  1 
ATOM   1076 N  NH1 . ARG A 1 159 ? -10.329 9.849   71.693  1.00 61.17  ? 1137 ARG A NH1 1 
ATOM   1077 N  NH2 . ARG A 1 159 ? -10.341 11.118  73.609  1.00 59.13  ? 1137 ARG A NH2 1 
ATOM   1078 N  N   . TRP A 1 160 ? -6.804  3.999   74.458  1.00 49.32  ? 1138 TRP A N   1 
ATOM   1079 C  CA  . TRP A 1 160 ? -5.982  3.919   75.659  1.00 48.79  ? 1138 TRP A CA  1 
ATOM   1080 C  C   . TRP A 1 160 ? -4.513  4.143   75.313  1.00 52.98  ? 1138 TRP A C   1 
ATOM   1081 O  O   . TRP A 1 160 ? -3.837  4.968   75.926  1.00 53.49  ? 1138 TRP A O   1 
ATOM   1082 C  CB  . TRP A 1 160 ? -6.171  2.559   76.336  1.00 50.58  ? 1138 TRP A CB  1 
ATOM   1083 C  CG  . TRP A 1 160 ? -5.338  2.338   77.567  1.00 51.85  ? 1138 TRP A CG  1 
ATOM   1084 C  CD1 . TRP A 1 160 ? -5.103  3.228   78.576  1.00 50.90  ? 1138 TRP A CD1 1 
ATOM   1085 C  CD2 . TRP A 1 160 ? -4.628  1.139   77.916  1.00 48.96  ? 1138 TRP A CD2 1 
ATOM   1086 N  NE1 . TRP A 1 160 ? -4.294  2.657   79.532  1.00 46.15  ? 1138 TRP A NE1 1 
ATOM   1087 C  CE2 . TRP A 1 160 ? -3.988  1.376   79.149  1.00 46.54  ? 1138 TRP A CE2 1 
ATOM   1088 C  CE3 . TRP A 1 160 ? -4.472  -0.110  77.303  1.00 45.05  ? 1138 TRP A CE3 1 
ATOM   1089 C  CZ2 . TRP A 1 160 ? -3.205  0.409   79.783  1.00 45.20  ? 1138 TRP A CZ2 1 
ATOM   1090 C  CZ3 . TRP A 1 160 ? -3.694  -1.068  77.933  1.00 44.63  ? 1138 TRP A CZ3 1 
ATOM   1091 C  CH2 . TRP A 1 160 ? -3.071  -0.803  79.159  1.00 47.65  ? 1138 TRP A CH2 1 
ATOM   1092 N  N   . TYR A 1 161 ? -4.035  3.413   74.312  1.00 55.22  ? 1139 TYR A N   1 
ATOM   1093 C  CA  . TYR A 1 161 ? -2.662  3.548   73.848  1.00 56.01  ? 1139 TYR A CA  1 
ATOM   1094 C  C   . TYR A 1 161 ? -2.423  4.897   73.168  1.00 59.43  ? 1139 TYR A C   1 
ATOM   1095 O  O   . TYR A 1 161 ? -1.353  5.484   73.310  1.00 66.89  ? 1139 TYR A O   1 
ATOM   1096 C  CB  . TYR A 1 161 ? -2.314  2.405   72.891  1.00 54.21  ? 1139 TYR A CB  1 
ATOM   1097 C  CG  . TYR A 1 161 ? -0.880  2.415   72.412  1.00 58.00  ? 1139 TYR A CG  1 
ATOM   1098 C  CD1 . TYR A 1 161 ? 0.110   1.731   73.107  1.00 59.02  ? 1139 TYR A CD1 1 
ATOM   1099 C  CD2 . TYR A 1 161 ? -0.515  3.102   71.261  1.00 57.73  ? 1139 TYR A CD2 1 
ATOM   1100 C  CE1 . TYR A 1 161 ? 1.423   1.736   72.671  1.00 61.47  ? 1139 TYR A CE1 1 
ATOM   1101 C  CE2 . TYR A 1 161 ? 0.791   3.115   70.820  1.00 60.78  ? 1139 TYR A CE2 1 
ATOM   1102 C  CZ  . TYR A 1 161 ? 1.757   2.429   71.527  1.00 61.97  ? 1139 TYR A CZ  1 
ATOM   1103 O  OH  . TYR A 1 161 ? 3.060   2.439   71.086  1.00 62.73  ? 1139 TYR A OH  1 
ATOM   1104 N  N   . ASN A 1 162 ? -3.413  5.384   72.426  1.00 55.95  ? 1140 ASN A N   1 
ATOM   1105 C  CA  . ASN A 1 162 ? -3.266  6.648   71.708  1.00 57.15  ? 1140 ASN A CA  1 
ATOM   1106 C  C   . ASN A 1 162 ? -3.155  7.850   72.642  1.00 60.55  ? 1140 ASN A C   1 
ATOM   1107 O  O   . ASN A 1 162 ? -2.323  8.733   72.430  1.00 62.59  ? 1140 ASN A O   1 
ATOM   1108 C  CB  . ASN A 1 162 ? -4.437  6.861   70.745  1.00 56.60  ? 1140 ASN A CB  1 
ATOM   1109 C  CG  . ASN A 1 162 ? -4.517  5.792   69.676  1.00 57.12  ? 1140 ASN A CG  1 
ATOM   1110 O  OD1 . ASN A 1 162 ? -3.519  5.157   69.337  1.00 56.94  ? 1140 ASN A OD1 1 
ATOM   1111 N  ND2 . ASN A 1 162 ? -5.713  5.590   69.134  1.00 55.40  ? 1140 ASN A ND2 1 
ATOM   1112 N  N   . GLN A 1 163 ? -3.997  7.886   73.670  1.00 59.25  ? 1141 GLN A N   1 
ATOM   1113 C  CA  . GLN A 1 163 ? -4.020  9.019   74.590  1.00 62.10  ? 1141 GLN A CA  1 
ATOM   1114 C  C   . GLN A 1 163 ? -2.850  8.972   75.568  1.00 62.21  ? 1141 GLN A C   1 
ATOM   1115 O  O   . GLN A 1 163 ? -2.204  9.989   75.819  1.00 62.41  ? 1141 GLN A O   1 
ATOM   1116 C  CB  . GLN A 1 163 ? -5.346  9.067   75.356  1.00 62.37  ? 1141 GLN A CB  1 
ATOM   1117 C  CG  . GLN A 1 163 ? -6.577  9.221   74.471  1.00 61.83  ? 1141 GLN A CG  1 
ATOM   1118 C  CD  . GLN A 1 163 ? -6.532  10.465  73.600  1.00 65.57  ? 1141 GLN A CD  1 
ATOM   1119 O  OE1 . GLN A 1 163 ? -6.834  10.413  72.406  1.00 63.51  ? 1141 GLN A OE1 1 
ATOM   1120 N  NE2 . GLN A 1 163 ? -6.161  11.593  74.196  1.00 69.30  ? 1141 GLN A NE2 1 
ATOM   1121 N  N   . THR A 1 164 ? -2.583  7.791   76.118  1.00 61.74  ? 1142 THR A N   1 
ATOM   1122 C  CA  . THR A 1 164 ? -1.475  7.609   77.051  1.00 60.38  ? 1142 THR A CA  1 
ATOM   1123 C  C   . THR A 1 164 ? -0.596  6.423   76.654  1.00 59.62  ? 1142 THR A C   1 
ATOM   1124 O  O   . THR A 1 164 ? -0.740  5.330   77.202  1.00 57.44  ? 1142 THR A O   1 
ATOM   1125 C  CB  . THR A 1 164 ? -1.980  7.392   78.489  1.00 58.02  ? 1142 THR A CB  1 
ATOM   1126 O  OG1 . THR A 1 164 ? -2.894  6.289   78.512  1.00 54.77  ? 1142 THR A OG1 1 
ATOM   1127 C  CG2 . THR A 1 164 ? -2.682  8.638   79.008  1.00 59.68  ? 1142 THR A CG2 1 
ATOM   1128 N  N   . PRO A 1 165 ? 0.323   6.641   75.699  1.00 60.82  ? 1143 PRO A N   1 
ATOM   1129 C  CA  . PRO A 1 165 ? 1.189   5.576   75.179  1.00 59.15  ? 1143 PRO A CA  1 
ATOM   1130 C  C   . PRO A 1 165 ? 2.232   5.087   76.188  1.00 58.97  ? 1143 PRO A C   1 
ATOM   1131 O  O   . PRO A 1 165 ? 2.314   3.883   76.428  1.00 56.88  ? 1143 PRO A O   1 
ATOM   1132 C  CB  . PRO A 1 165 ? 1.860   6.233   73.965  1.00 59.59  ? 1143 PRO A CB  1 
ATOM   1133 C  CG  . PRO A 1 165 ? 1.803   7.687   74.233  1.00 61.67  ? 1143 PRO A CG  1 
ATOM   1134 C  CD  . PRO A 1 165 ? 0.541   7.922   75.005  1.00 65.46  ? 1143 PRO A CD  1 
ATOM   1135 N  N   . ASN A 1 166 ? 3.007   5.997   76.768  1.00 59.33  ? 1144 ASN A N   1 
ATOM   1136 C  CA  . ASN A 1 166 ? 4.009   5.621   77.761  1.00 58.81  ? 1144 ASN A CA  1 
ATOM   1137 C  C   . ASN A 1 166 ? 3.386   4.894   78.952  1.00 56.08  ? 1144 ASN A C   1 
ATOM   1138 O  O   . ASN A 1 166 ? 3.951   3.933   79.474  1.00 56.44  ? 1144 ASN A O   1 
ATOM   1139 C  CB  . ASN A 1 166 ? 4.771   6.857   78.240  1.00 58.23  ? 1144 ASN A CB  1 
ATOM   1140 C  CG  . ASN A 1 166 ? 5.425   7.612   77.102  1.00 63.89  ? 1144 ASN A CG  1 
ATOM   1141 O  OD1 . ASN A 1 166 ? 5.867   7.014   76.119  1.00 65.79  ? 1144 ASN A OD1 1 
ATOM   1142 N  ND2 . ASN A 1 166 ? 5.489   8.933   77.226  1.00 66.23  ? 1144 ASN A ND2 1 
ATOM   1143 N  N   . ARG A 1 167 ? 2.216   5.360   79.372  1.00 54.40  ? 1145 ARG A N   1 
ATOM   1144 C  CA  . ARG A 1 167 ? 1.479   4.726   80.458  1.00 53.99  ? 1145 ARG A CA  1 
ATOM   1145 C  C   . ARG A 1 167 ? 1.024   3.325   80.060  1.00 51.56  ? 1145 ARG A C   1 
ATOM   1146 O  O   . ARG A 1 167 ? 1.230   2.367   80.803  1.00 50.80  ? 1145 ARG A O   1 
ATOM   1147 C  CB  . ARG A 1 167 ? 0.276   5.590   80.859  1.00 57.43  ? 1145 ARG A CB  1 
ATOM   1148 C  CG  . ARG A 1 167 ? -0.769  4.893   81.736  1.00 51.30  ? 1145 ARG A CG  1 
ATOM   1149 C  CD  . ARG A 1 167 ? -0.239  4.587   83.119  1.00 50.29  ? 1145 ARG A CD  1 
ATOM   1150 N  NE  . ARG A 1 167 ? -1.265  4.037   84.005  1.00 53.75  ? 1145 ARG A NE  1 
ATOM   1151 C  CZ  . ARG A 1 167 ? -2.060  4.771   84.781  1.00 51.23  ? 1145 ARG A CZ  1 
ATOM   1152 N  NH1 . ARG A 1 167 ? -1.961  6.093   84.779  1.00 50.98  ? 1145 ARG A NH1 1 
ATOM   1153 N  NH2 . ARG A 1 167 ? -2.960  4.182   85.557  1.00 47.89  ? 1145 ARG A NH2 1 
ATOM   1154 N  N   . ALA A 1 168 ? 0.414   3.209   78.884  1.00 54.72  ? 1146 ALA A N   1 
ATOM   1155 C  CA  . ALA A 1 168 ? -0.112  1.931   78.415  1.00 51.24  ? 1146 ALA A CA  1 
ATOM   1156 C  C   . ALA A 1 168 ? 0.996   0.913   78.153  1.00 50.85  ? 1146 ALA A C   1 
ATOM   1157 O  O   . ALA A 1 168 ? 0.817   -0.277  78.410  1.00 48.14  ? 1146 ALA A O   1 
ATOM   1158 C  CB  . ALA A 1 168 ? -0.951  2.134   77.162  1.00 49.05  ? 1146 ALA A CB  1 
ATOM   1159 N  N   . LYS A 1 169 ? 2.135   1.380   77.645  1.00 51.98  ? 1147 LYS A N   1 
ATOM   1160 C  CA  . LYS A 1 169 ? 3.272   0.501   77.365  1.00 49.93  ? 1147 LYS A CA  1 
ATOM   1161 C  C   . LYS A 1 169 ? 3.748   -0.234  78.611  1.00 50.32  ? 1147 LYS A C   1 
ATOM   1162 O  O   . LYS A 1 169 ? 3.987   -1.440  78.572  1.00 49.10  ? 1147 LYS A O   1 
ATOM   1163 C  CB  . LYS A 1 169 ? 4.435   1.293   76.767  1.00 54.05  ? 1147 LYS A CB  1 
ATOM   1164 C  CG  . LYS A 1 169 ? 4.226   1.734   75.330  1.00 62.40  ? 1147 LYS A CG  1 
ATOM   1165 C  CD  . LYS A 1 169 ? 5.381   2.603   74.860  1.00 73.42  ? 1147 LYS A CD  1 
ATOM   1166 C  CE  . LYS A 1 169 ? 5.070   3.266   73.530  1.00 69.99  ? 1147 LYS A CE  1 
ATOM   1167 N  NZ  . LYS A 1 169 ? 6.211   4.097   73.054  1.00 94.04  ? 1147 LYS A NZ  1 
ATOM   1168 N  N   . ARG A 1 170 ? 3.882   0.502   79.712  1.00 51.08  ? 1148 ARG A N   1 
ATOM   1169 C  CA  . ARG A 1 170 ? 4.358   -0.069  80.969  1.00 50.08  ? 1148 ARG A CA  1 
ATOM   1170 C  C   . ARG A 1 170 ? 3.413   -1.143  81.489  1.00 49.58  ? 1148 ARG A C   1 
ATOM   1171 O  O   . ARG A 1 170 ? 3.846   -2.206  81.937  1.00 50.33  ? 1148 ARG A O   1 
ATOM   1172 C  CB  . ARG A 1 170 ? 4.535   1.026   82.023  1.00 54.64  ? 1148 ARG A CB  1 
ATOM   1173 C  CG  . ARG A 1 170 ? 5.674   1.989   81.730  1.00 57.87  ? 1148 ARG A CG  1 
ATOM   1174 C  CD  . ARG A 1 170 ? 6.001   2.851   82.944  1.00 54.99  ? 1148 ARG A CD  1 
ATOM   1175 N  NE  . ARG A 1 170 ? 4.916   3.766   83.284  1.00 52.67  ? 1148 ARG A NE  1 
ATOM   1176 C  CZ  . ARG A 1 170 ? 4.796   4.998   82.798  1.00 50.70  ? 1148 ARG A CZ  1 
ATOM   1177 N  NH1 . ARG A 1 170 ? 5.695   5.468   81.945  1.00 50.05  ? 1148 ARG A NH1 1 
ATOM   1178 N  NH2 . ARG A 1 170 ? 3.775   5.761   83.163  1.00 55.22  ? 1148 ARG A NH2 1 
ATOM   1179 N  N   . VAL A 1 171 ? 2.118   -0.858  81.426  1.00 49.99  ? 1149 VAL A N   1 
ATOM   1180 C  CA  . VAL A 1 171 ? 1.103   -1.815  81.844  1.00 46.63  ? 1149 VAL A CA  1 
ATOM   1181 C  C   . VAL A 1 171 ? 1.070   -3.016  80.903  1.00 45.65  ? 1149 VAL A C   1 
ATOM   1182 O  O   . VAL A 1 171 ? 0.990   -4.158  81.352  1.00 47.56  ? 1149 VAL A O   1 
ATOM   1183 C  CB  . VAL A 1 171 ? -0.297  -1.165  81.901  1.00 43.57  ? 1149 VAL A CB  1 
ATOM   1184 C  CG1 . VAL A 1 171 ? -1.354  -2.196  82.260  1.00 42.46  ? 1149 VAL A CG1 1 
ATOM   1185 C  CG2 . VAL A 1 171 ? -0.305  -0.019  82.895  1.00 43.18  ? 1149 VAL A CG2 1 
ATOM   1186 N  N   . ILE A 1 172 ? 1.138   -2.757  79.599  1.00 44.11  ? 1150 ILE A N   1 
ATOM   1187 C  CA  . ILE A 1 172 ? 1.098   -3.830  78.610  1.00 45.52  ? 1150 ILE A CA  1 
ATOM   1188 C  C   . ILE A 1 172 ? 2.303   -4.754  78.771  1.00 45.41  ? 1150 ILE A C   1 
ATOM   1189 O  O   . ILE A 1 172 ? 2.171   -5.977  78.709  1.00 44.81  ? 1150 ILE A O   1 
ATOM   1190 C  CB  . ILE A 1 172 ? 1.046   -3.274  77.168  1.00 46.26  ? 1150 ILE A CB  1 
ATOM   1191 C  CG1 . ILE A 1 172 ? -0.348  -2.722  76.861  1.00 45.57  ? 1150 ILE A CG1 1 
ATOM   1192 C  CG2 . ILE A 1 172 ? 1.380   -4.355  76.160  1.00 45.62  ? 1150 ILE A CG2 1 
ATOM   1193 C  CD1 . ILE A 1 172 ? -0.473  -2.099  75.486  1.00 42.99  ? 1150 ILE A CD1 1 
ATOM   1194 N  N   . THR A 1 173 ? 3.472   -4.162  79.001  1.00 46.69  ? 1151 THR A N   1 
ATOM   1195 C  CA  . THR A 1 173 ? 4.695   -4.927  79.228  1.00 47.80  ? 1151 THR A CA  1 
ATOM   1196 C  C   . THR A 1 173 ? 4.563   -5.828  80.456  1.00 47.93  ? 1151 THR A C   1 
ATOM   1197 O  O   . THR A 1 173 ? 5.043   -6.965  80.461  1.00 47.95  ? 1151 THR A O   1 
ATOM   1198 C  CB  . THR A 1 173 ? 5.911   -3.999  79.401  1.00 49.82  ? 1151 THR A CB  1 
ATOM   1199 O  OG1 . THR A 1 173 ? 6.051   -3.173  78.238  1.00 53.93  ? 1151 THR A OG1 1 
ATOM   1200 C  CG2 . THR A 1 173 ? 7.188   -4.809  79.592  1.00 50.63  ? 1151 THR A CG2 1 
ATOM   1201 N  N   . THR A 1 174 ? 3.900   -5.313  81.488  1.00 47.84  ? 1152 THR A N   1 
ATOM   1202 C  CA  . THR A 1 174 ? 3.635   -6.080  82.701  1.00 45.36  ? 1152 THR A CA  1 
ATOM   1203 C  C   . THR A 1 174 ? 2.808   -7.320  82.384  1.00 45.94  ? 1152 THR A C   1 
ATOM   1204 O  O   . THR A 1 174 ? 3.077   -8.401  82.897  1.00 48.13  ? 1152 THR A O   1 
ATOM   1205 C  CB  . THR A 1 174 ? 2.899   -5.235  83.751  1.00 44.29  ? 1152 THR A CB  1 
ATOM   1206 O  OG1 . THR A 1 174 ? 3.590   -3.994  83.934  1.00 47.78  ? 1152 THR A OG1 1 
ATOM   1207 C  CG2 . THR A 1 174 ? 2.821   -5.976  85.078  1.00 42.18  ? 1152 THR A CG2 1 
ATOM   1208 N  N   . PHE A 1 175 ? 1.799   -7.158  81.534  1.00 49.18  ? 1153 PHE A N   1 
ATOM   1209 C  CA  . PHE A 1 175 ? 1.008   -8.291  81.067  1.00 50.36  ? 1153 PHE A CA  1 
ATOM   1210 C  C   . PHE A 1 175 ? 1.882   -9.277  80.303  1.00 48.42  ? 1153 PHE A C   1 
ATOM   1211 O  O   . PHE A 1 175 ? 1.886   -10.475 80.586  1.00 48.41  ? 1153 PHE A O   1 
ATOM   1212 C  CB  . PHE A 1 175 ? -0.147  -7.818  80.179  1.00 43.31  ? 1153 PHE A CB  1 
ATOM   1213 C  CG  . PHE A 1 175 ? -1.284  -7.213  80.943  1.00 43.69  ? 1153 PHE A CG  1 
ATOM   1214 C  CD1 . PHE A 1 175 ? -1.824  -7.867  82.039  1.00 46.41  ? 1153 PHE A CD1 1 
ATOM   1215 C  CD2 . PHE A 1 175 ? -1.801  -5.984  80.579  1.00 41.66  ? 1153 PHE A CD2 1 
ATOM   1216 C  CE1 . PHE A 1 175 ? -2.867  -7.315  82.749  1.00 41.10  ? 1153 PHE A CE1 1 
ATOM   1217 C  CE2 . PHE A 1 175 ? -2.841  -5.423  81.287  1.00 43.18  ? 1153 PHE A CE2 1 
ATOM   1218 C  CZ  . PHE A 1 175 ? -3.377  -6.090  82.374  1.00 41.60  ? 1153 PHE A CZ  1 
ATOM   1219 N  N   . ARG A 1 176 ? 2.635   -8.753  79.344  1.00 46.11  ? 1154 ARG A N   1 
ATOM   1220 C  CA  . ARG A 1 176 ? 3.431   -9.581  78.454  1.00 52.18  ? 1154 ARG A CA  1 
ATOM   1221 C  C   . ARG A 1 176 ? 4.554   -10.312 79.197  1.00 54.65  ? 1154 ARG A C   1 
ATOM   1222 O  O   . ARG A 1 176 ? 4.773   -11.502 78.974  1.00 57.77  ? 1154 ARG A O   1 
ATOM   1223 C  CB  . ARG A 1 176 ? 4.002   -8.724  77.322  1.00 52.86  ? 1154 ARG A CB  1 
ATOM   1224 C  CG  . ARG A 1 176 ? 4.494   -9.515  76.125  1.00 60.08  ? 1154 ARG A CG  1 
ATOM   1225 C  CD  . ARG A 1 176 ? 4.877   -8.593  74.973  1.00 67.00  ? 1154 ARG A CD  1 
ATOM   1226 N  NE  . ARG A 1 176 ? 5.916   -7.639  75.356  1.00 72.50  ? 1154 ARG A NE  1 
ATOM   1227 C  CZ  . ARG A 1 176 ? 7.220   -7.891  75.292  1.00 81.49  ? 1154 ARG A CZ  1 
ATOM   1228 N  NH1 . ARG A 1 176 ? 7.648   -9.069  74.860  1.00 87.62  ? 1154 ARG A NH1 1 
ATOM   1229 N  NH2 . ARG A 1 176 ? 8.098   -6.968  75.662  1.00 79.58  ? 1154 ARG A NH2 1 
ATOM   1230 N  N   . THR A 1 177 ? 5.248   -9.611  80.091  1.00 49.49  ? 1155 THR A N   1 
ATOM   1231 C  CA  . THR A 1 177 ? 6.419   -10.181 80.757  1.00 50.37  ? 1155 THR A CA  1 
ATOM   1232 C  C   . THR A 1 177 ? 6.127   -10.775 82.141  1.00 51.51  ? 1155 THR A C   1 
ATOM   1233 O  O   . THR A 1 177 ? 6.830   -11.677 82.594  1.00 52.99  ? 1155 THR A O   1 
ATOM   1234 C  CB  . THR A 1 177 ? 7.538   -9.130  80.914  1.00 51.24  ? 1155 THR A CB  1 
ATOM   1235 O  OG1 . THR A 1 177 ? 7.112   -8.095  81.808  1.00 52.47  ? 1155 THR A OG1 1 
ATOM   1236 C  CG2 . THR A 1 177 ? 7.890   -8.519  79.570  1.00 51.95  ? 1155 THR A CG2 1 
ATOM   1237 N  N   . GLY A 1 178 ? 5.105   -10.265 82.818  1.00 49.36  ? 1156 GLY A N   1 
ATOM   1238 C  CA  . GLY A 1 178 ? 4.749   -10.761 84.135  1.00 47.81  ? 1156 GLY A CA  1 
ATOM   1239 C  C   . GLY A 1 178 ? 5.715   -10.330 85.224  1.00 52.66  ? 1156 GLY A C   1 
ATOM   1240 O  O   . GLY A 1 178 ? 5.726   -10.900 86.322  1.00 46.90  ? 1156 GLY A O   1 
ATOM   1241 N  N   . THR A 1 179 ? 6.527   -9.319  84.921  1.00 52.51  ? 1157 THR A N   1 
ATOM   1242 C  CA  . THR A 1 179 ? 7.503   -8.800  85.876  1.00 52.85  ? 1157 THR A CA  1 
ATOM   1243 C  C   . THR A 1 179 ? 7.282   -7.316  86.143  1.00 53.12  ? 1157 THR A C   1 
ATOM   1244 O  O   . THR A 1 179 ? 6.479   -6.668  85.468  1.00 51.62  ? 1157 THR A O   1 
ATOM   1245 C  CB  . THR A 1 179 ? 8.951   -9.000  85.383  1.00 53.72  ? 1157 THR A CB  1 
ATOM   1246 O  OG1 . THR A 1 179 ? 9.199   -8.151  84.256  1.00 50.15  ? 1157 THR A OG1 1 
ATOM   1247 C  CG2 . THR A 1 179 ? 9.191   -10.449 84.991  1.00 50.58  ? 1157 THR A CG2 1 
ATOM   1248 N  N   . TRP A 1 180 ? 8.009   -6.780  87.119  1.00 54.72  ? 1158 TRP A N   1 
ATOM   1249 C  CA  . TRP A 1 180 ? 7.915   -5.364  87.465  1.00 54.17  ? 1158 TRP A CA  1 
ATOM   1250 C  C   . TRP A 1 180 ? 8.947   -4.534  86.712  1.00 53.24  ? 1158 TRP A C   1 
ATOM   1251 O  O   . TRP A 1 180 ? 9.176   -3.371  87.041  1.00 55.43  ? 1158 TRP A O   1 
ATOM   1252 C  CB  . TRP A 1 180 ? 8.092   -5.162  88.971  1.00 54.89  ? 1158 TRP A CB  1 
ATOM   1253 C  CG  . TRP A 1 180 ? 7.068   -5.872  89.791  1.00 54.96  ? 1158 TRP A CG  1 
ATOM   1254 C  CD1 . TRP A 1 180 ? 7.204   -7.084  90.402  1.00 53.65  ? 1158 TRP A CD1 1 
ATOM   1255 C  CD2 . TRP A 1 180 ? 5.739   -5.422  90.085  1.00 57.27  ? 1158 TRP A CD2 1 
ATOM   1256 N  NE1 . TRP A 1 180 ? 6.045   -7.414  91.061  1.00 56.96  ? 1158 TRP A NE1 1 
ATOM   1257 C  CE2 . TRP A 1 180 ? 5.130   -6.409  90.881  1.00 54.77  ? 1158 TRP A CE2 1 
ATOM   1258 C  CE3 . TRP A 1 180 ? 5.009   -4.276  89.751  1.00 57.25  ? 1158 TRP A CE3 1 
ATOM   1259 C  CZ2 . TRP A 1 180 ? 3.823   -6.289  91.349  1.00 54.37  ? 1158 TRP A CZ2 1 
ATOM   1260 C  CZ3 . TRP A 1 180 ? 3.712   -4.157  90.219  1.00 53.06  ? 1158 TRP A CZ3 1 
ATOM   1261 C  CH2 . TRP A 1 180 ? 3.133   -5.157  91.008  1.00 53.77  ? 1158 TRP A CH2 1 
ATOM   1262 N  N   . ASP A 1 181 ? 9.558   -5.135  85.696  1.00 53.75  ? 1159 ASP A N   1 
ATOM   1263 C  CA  . ASP A 1 181 ? 10.645  -4.495  84.961  1.00 57.32  ? 1159 ASP A CA  1 
ATOM   1264 C  C   . ASP A 1 181 ? 10.239  -3.169  84.330  1.00 58.51  ? 1159 ASP A C   1 
ATOM   1265 O  O   . ASP A 1 181 ? 11.069  -2.277  84.158  1.00 59.36  ? 1159 ASP A O   1 
ATOM   1266 C  CB  . ASP A 1 181 ? 11.172  -5.433  83.876  1.00 61.08  ? 1159 ASP A CB  1 
ATOM   1267 C  CG  . ASP A 1 181 ? 11.846  -6.663  84.447  1.00 66.70  ? 1159 ASP A CG  1 
ATOM   1268 O  OD1 . ASP A 1 181 ? 12.401  -6.575  85.563  1.00 59.46  ? 1159 ASP A OD1 1 
ATOM   1269 O  OD2 . ASP A 1 181 ? 11.817  -7.717  83.778  1.00 71.02  ? 1159 ASP A OD2 1 
ATOM   1270 N  N   . ALA A 1 182 ? 8.962   -3.040  83.992  1.00 60.20  ? 1160 ALA A N   1 
ATOM   1271 C  CA  . ALA A 1 182 ? 8.475   -1.852  83.301  1.00 59.64  ? 1160 ALA A CA  1 
ATOM   1272 C  C   . ALA A 1 182 ? 8.484   -0.628  84.209  1.00 60.86  ? 1160 ALA A C   1 
ATOM   1273 O  O   . ALA A 1 182 ? 8.409   0.504   83.737  1.00 64.78  ? 1160 ALA A O   1 
ATOM   1274 C  CB  . ALA A 1 182 ? 7.078   -2.097  82.758  1.00 56.02  ? 1160 ALA A CB  1 
ATOM   1275 N  N   . TYR A 1 183 ? 8.582   -0.860  85.513  1.00 59.12  ? 1161 TYR A N   1 
ATOM   1276 C  CA  . TYR A 1 183 ? 8.562   0.229   86.483  1.00 61.19  ? 1161 TYR A CA  1 
ATOM   1277 C  C   . TYR A 1 183 ? 9.888   0.338   87.232  1.00 62.96  ? 1161 TYR A C   1 
ATOM   1278 O  O   . TYR A 1 183 ? 10.116  1.291   87.975  1.00 63.72  ? 1161 TYR A O   1 
ATOM   1279 C  CB  . TYR A 1 183 ? 7.398   0.041   87.460  1.00 61.49  ? 1161 TYR A CB  1 
ATOM   1280 C  CG  . TYR A 1 183 ? 6.048   0.209   86.797  1.00 63.28  ? 1161 TYR A CG  1 
ATOM   1281 C  CD1 . TYR A 1 183 ? 5.465   -0.834  86.090  1.00 64.16  ? 1161 TYR A CD1 1 
ATOM   1282 C  CD2 . TYR A 1 183 ? 5.367   1.418   86.860  1.00 57.35  ? 1161 TYR A CD2 1 
ATOM   1283 C  CE1 . TYR A 1 183 ? 4.240   -0.681  85.471  1.00 58.93  ? 1161 TYR A CE1 1 
ATOM   1284 C  CE2 . TYR A 1 183 ? 4.145   1.580   86.248  1.00 58.35  ? 1161 TYR A CE2 1 
ATOM   1285 C  CZ  . TYR A 1 183 ? 3.584   0.528   85.555  1.00 59.95  ? 1161 TYR A CZ  1 
ATOM   1286 O  OH  . TYR A 1 183 ? 2.363   0.686   84.942  1.00 59.55  ? 1161 TYR A OH  1 
ATOM   1287 N  N   . ILE A 1 184 ? 10.763  -0.639  87.022  1.00 59.19  ? 1162 ILE A N   1 
ATOM   1288 C  CA  . ILE A 1 184 ? 12.091  -0.616  87.618  1.00 64.06  ? 1162 ILE A CA  1 
ATOM   1289 C  C   . ILE A 1 184 ? 13.096  0.005   86.653  1.00 64.39  ? 1162 ILE A C   1 
ATOM   1290 O  O   . ILE A 1 184 ? 13.970  0.776   87.054  1.00 63.03  ? 1162 ILE A O   1 
ATOM   1291 C  CB  . ILE A 1 184 ? 12.565  -2.033  88.008  1.00 63.81  ? 1162 ILE A CB  1 
ATOM   1292 C  CG1 . ILE A 1 184 ? 11.565  -2.687  88.963  1.00 62.22  ? 1162 ILE A CG1 1 
ATOM   1293 C  CG2 . ILE A 1 184 ? 13.939  -1.976  88.652  1.00 68.59  ? 1162 ILE A CG2 1 
ATOM   1294 C  CD1 . ILE A 1 184 ? 11.883  -4.128  89.289  1.00 57.28  ? 1162 ILE A CD1 1 
ATOM   1295 N  N   . TYR A 1 185 ? 12.955  -0.329  85.376  1.00 63.17  ? 1163 TYR A N   1 
ATOM   1296 C  CA  . TYR A 1 185 ? 13.904  0.115   84.365  1.00 63.71  ? 1163 TYR A CA  1 
ATOM   1297 C  C   . TYR A 1 185 ? 13.224  0.894   83.244  1.00 61.29  ? 1163 TYR A C   1 
ATOM   1298 O  O   . TYR A 1 185 ? 12.416  0.349   82.496  1.00 63.53  ? 1163 TYR A O   1 
ATOM   1299 C  CB  . TYR A 1 185 ? 14.654  -1.086  83.786  1.00 66.16  ? 1163 TYR A CB  1 
ATOM   1300 C  CG  . TYR A 1 185 ? 15.146  -2.062  84.833  1.00 66.33  ? 1163 TYR A CG  1 
ATOM   1301 C  CD1 . TYR A 1 185 ? 16.309  -1.815  85.550  1.00 68.44  ? 1163 TYR A CD1 1 
ATOM   1302 C  CD2 . TYR A 1 185 ? 14.449  -3.233  85.101  1.00 64.78  ? 1163 TYR A CD2 1 
ATOM   1303 C  CE1 . TYR A 1 185 ? 16.762  -2.704  86.507  1.00 70.64  ? 1163 TYR A CE1 1 
ATOM   1304 C  CE2 . TYR A 1 185 ? 14.894  -4.129  86.054  1.00 67.54  ? 1163 TYR A CE2 1 
ATOM   1305 C  CZ  . TYR A 1 185 ? 16.051  -3.861  86.754  1.00 71.74  ? 1163 TYR A CZ  1 
ATOM   1306 O  OH  . TYR A 1 185 ? 16.498  -4.749  87.707  1.00 76.22  ? 1163 TYR A OH  1 
ATOM   1307 N  N   . GLU A 1 186 ? 13.559  2.175   83.137  1.00 63.02  ? 1164 GLU A N   1 
ATOM   1308 C  CA  . GLU A 1 186 ? 13.056  3.023   82.065  1.00 66.11  ? 1164 GLU A CA  1 
ATOM   1309 C  C   . GLU A 1 186 ? 13.886  2.778   80.807  1.00 67.14  ? 1164 GLU A C   1 
ATOM   1310 O  O   . GLU A 1 186 ? 15.047  2.376   80.904  1.00 74.19  ? 1164 GLU A O   1 
ATOM   1311 C  CB  . GLU A 1 186 ? 13.104  4.496   82.482  1.00 70.99  ? 1164 GLU A CB  1 
ATOM   1312 C  CG  . GLU A 1 186 ? 12.214  5.418   81.665  1.00 83.26  ? 1164 GLU A CG  1 
ATOM   1313 C  CD  . GLU A 1 186 ? 11.992  6.759   82.341  1.00 87.31  ? 1164 GLU A CD  1 
ATOM   1314 O  OE1 . GLU A 1 186 ? 12.545  6.973   83.442  1.00 84.86  ? 1164 GLU A OE1 1 
ATOM   1315 O  OE2 . GLU A 1 186 ? 11.260  7.596   81.774  1.00 82.48  ? 1164 GLU A OE2 1 
ATOM   1316 N  N   . PHE A 1 187 ? 13.299  3.004   79.633  1.00 67.32  ? 1165 PHE A N   1 
ATOM   1317 C  CA  . PHE A 1 187 ? 14.000  2.732   78.379  1.00 65.42  ? 1165 PHE A CA  1 
ATOM   1318 C  C   . PHE A 1 187 ? 15.279  3.553   78.270  1.00 66.64  ? 1165 PHE A C   1 
ATOM   1319 O  O   . PHE A 1 187 ? 15.285  4.750   78.565  1.00 68.83  ? 1165 PHE A O   1 
ATOM   1320 C  CB  . PHE A 1 187 ? 13.106  3.009   77.171  1.00 59.37  ? 1165 PHE A CB  1 
ATOM   1321 C  CG  . PHE A 1 187 ? 13.808  2.837   75.855  1.00 59.61  ? 1165 PHE A CG  1 
ATOM   1322 C  CD1 . PHE A 1 187 ? 14.235  1.585   75.443  1.00 61.10  ? 1165 PHE A CD1 1 
ATOM   1323 C  CD2 . PHE A 1 187 ? 14.048  3.925   75.032  1.00 61.58  ? 1165 PHE A CD2 1 
ATOM   1324 C  CE1 . PHE A 1 187 ? 14.888  1.422   74.233  1.00 58.58  ? 1165 PHE A CE1 1 
ATOM   1325 C  CE2 . PHE A 1 187 ? 14.700  3.767   73.821  1.00 59.12  ? 1165 PHE A CE2 1 
ATOM   1326 C  CZ  . PHE A 1 187 ? 15.119  2.514   73.423  1.00 58.13  ? 1165 PHE A CZ  1 
ATOM   1327 N  N   . PHE A 1 188 ? 16.359  2.902   77.847  1.00 67.01  ? 59   PHE A N   1 
ATOM   1328 C  CA  . PHE A 1 188 ? 17.664  3.547   77.795  1.00 63.90  ? 59   PHE A CA  1 
ATOM   1329 C  C   . PHE A 1 188 ? 18.348  3.351   76.442  1.00 58.03  ? 59   PHE A C   1 
ATOM   1330 O  O   . PHE A 1 188 ? 18.927  4.292   75.892  1.00 54.22  ? 59   PHE A O   1 
ATOM   1331 C  CB  . PHE A 1 188 ? 18.552  3.015   78.922  1.00 62.04  ? 59   PHE A CB  1 
ATOM   1332 C  CG  . PHE A 1 188 ? 19.781  3.842   79.175  1.00 57.58  ? 59   PHE A CG  1 
ATOM   1333 C  CD1 . PHE A 1 188 ? 19.675  5.174   79.544  1.00 57.81  ? 59   PHE A CD1 1 
ATOM   1334 C  CD2 . PHE A 1 188 ? 21.042  3.280   79.068  1.00 56.71  ? 59   PHE A CD2 1 
ATOM   1335 C  CE1 . PHE A 1 188 ? 20.805  5.933   79.784  1.00 57.32  ? 59   PHE A CE1 1 
ATOM   1336 C  CE2 . PHE A 1 188 ? 22.175  4.034   79.310  1.00 56.38  ? 59   PHE A CE2 1 
ATOM   1337 C  CZ  . PHE A 1 188 ? 22.056  5.361   79.667  1.00 59.66  ? 59   PHE A CZ  1 
ATOM   1338 N  N   . SER A 1 189 ? 18.285  2.136   75.904  1.00 58.57  ? 60   SER A N   1 
ATOM   1339 C  CA  . SER A 1 189 ? 18.944  1.859   74.631  1.00 60.43  ? 60   SER A CA  1 
ATOM   1340 C  C   . SER A 1 189 ? 18.358  0.678   73.871  1.00 57.78  ? 60   SER A C   1 
ATOM   1341 O  O   . SER A 1 189 ? 17.579  -0.112  74.407  1.00 60.63  ? 60   SER A O   1 
ATOM   1342 C  CB  . SER A 1 189 ? 20.441  1.619   74.850  1.00 63.34  ? 60   SER A CB  1 
ATOM   1343 O  OG  . SER A 1 189 ? 20.669  0.636   75.844  1.00 74.55  ? 60   SER A OG  1 
ATOM   1344 N  N   . VAL A 1 190 ? 18.759  0.575   72.610  1.00 56.64  ? 61   VAL A N   1 
ATOM   1345 C  CA  . VAL A 1 190 ? 18.387  -0.536  71.753  1.00 55.56  ? 61   VAL A CA  1 
ATOM   1346 C  C   . VAL A 1 190 ? 19.345  -1.694  71.988  1.00 52.13  ? 61   VAL A C   1 
ATOM   1347 O  O   . VAL A 1 190 ? 20.141  -1.660  72.926  1.00 56.21  ? 61   VAL A O   1 
ATOM   1348 C  CB  . VAL A 1 190 ? 18.411  -0.131  70.275  1.00 51.87  ? 61   VAL A CB  1 
ATOM   1349 C  CG1 . VAL A 1 190 ? 17.362  0.938   70.009  1.00 48.45  ? 61   VAL A CG1 1 
ATOM   1350 C  CG2 . VAL A 1 190 ? 19.792  0.378   69.894  1.00 46.92  ? 61   VAL A CG2 1 
ATOM   1351 N  N   . ASP A 1 191 ? 19.278  -2.717  71.142  1.00 49.23  ? 62   ASP A N   1 
ATOM   1352 C  CA  . ASP A 1 191 ? 20.181  -3.850  71.289  1.00 50.50  ? 62   ASP A CA  1 
ATOM   1353 C  C   . ASP A 1 191 ? 21.603  -3.390  70.999  1.00 52.67  ? 62   ASP A C   1 
ATOM   1354 O  O   . ASP A 1 191 ? 21.812  -2.348  70.375  1.00 52.08  ? 62   ASP A O   1 
ATOM   1355 C  CB  . ASP A 1 191 ? 19.778  -5.010  70.375  1.00 52.56  ? 62   ASP A CB  1 
ATOM   1356 C  CG  . ASP A 1 191 ? 19.921  -4.677  68.905  1.00 56.60  ? 62   ASP A CG  1 
ATOM   1357 O  OD1 . ASP A 1 191 ? 18.952  -4.154  68.313  1.00 52.89  ? 62   ASP A OD1 1 
ATOM   1358 O  OD2 . ASP A 1 191 ? 21.000  -4.951  68.337  1.00 61.16  ? 62   ASP A OD2 1 
ATOM   1359 N  N   . GLU A 1 192 ? 22.579  -4.157  71.472  1.00 53.42  ? 63   GLU A N   1 
ATOM   1360 C  CA  . GLU A 1 192 ? 23.975  -3.755  71.372  1.00 51.03  ? 63   GLU A CA  1 
ATOM   1361 C  C   . GLU A 1 192 ? 24.435  -3.669  69.925  1.00 51.14  ? 63   GLU A C   1 
ATOM   1362 O  O   . GLU A 1 192 ? 25.184  -2.765  69.553  1.00 50.10  ? 63   GLU A O   1 
ATOM   1363 C  CB  . GLU A 1 192 ? 24.866  -4.728  72.140  1.00 50.37  ? 63   GLU A CB  1 
ATOM   1364 C  CG  . GLU A 1 192 ? 26.305  -4.276  72.245  1.00 48.74  ? 63   GLU A CG  1 
ATOM   1365 C  CD  . GLU A 1 192 ? 27.128  -5.196  73.112  1.00 50.93  ? 63   GLU A CD  1 
ATOM   1366 O  OE1 . GLU A 1 192 ? 26.586  -6.236  73.545  1.00 50.60  ? 63   GLU A OE1 1 
ATOM   1367 O  OE2 . GLU A 1 192 ? 28.312  -4.878  73.359  1.00 52.39  ? 63   GLU A OE2 1 
ATOM   1368 N  N   . PHE A 1 193 ? 23.974  -4.612  69.111  1.00 51.94  ? 64   PHE A N   1 
ATOM   1369 C  CA  . PHE A 1 193 ? 24.383  -4.682  67.716  1.00 52.50  ? 64   PHE A CA  1 
ATOM   1370 C  C   . PHE A 1 193 ? 23.882  -3.469  66.938  1.00 52.62  ? 64   PHE A C   1 
ATOM   1371 O  O   . PHE A 1 193 ? 24.561  -2.976  66.041  1.00 56.69  ? 64   PHE A O   1 
ATOM   1372 C  CB  . PHE A 1 193 ? 23.877  -5.977  67.081  1.00 53.00  ? 64   PHE A CB  1 
ATOM   1373 C  CG  . PHE A 1 193 ? 24.377  -6.204  65.686  1.00 54.77  ? 64   PHE A CG  1 
ATOM   1374 C  CD1 . PHE A 1 193 ? 25.658  -6.677  65.465  1.00 62.56  ? 64   PHE A CD1 1 
ATOM   1375 C  CD2 . PHE A 1 193 ? 23.564  -5.952  64.596  1.00 57.16  ? 64   PHE A CD2 1 
ATOM   1376 C  CE1 . PHE A 1 193 ? 26.121  -6.888  64.179  1.00 62.52  ? 64   PHE A CE1 1 
ATOM   1377 C  CE2 . PHE A 1 193 ? 24.020  -6.161  63.311  1.00 56.52  ? 64   PHE A CE2 1 
ATOM   1378 C  CZ  . PHE A 1 193 ? 25.300  -6.630  63.102  1.00 56.49  ? 64   PHE A CZ  1 
ATOM   1379 N  N   . SER A 1 194 ? 22.698  -2.984  67.293  1.00 48.08  ? 65   SER A N   1 
ATOM   1380 C  CA  . SER A 1 194 ? 22.142  -1.797  66.655  1.00 47.65  ? 65   SER A CA  1 
ATOM   1381 C  C   . SER A 1 194 ? 22.858  -0.535  67.127  1.00 45.96  ? 65   SER A C   1 
ATOM   1382 O  O   . SER A 1 194 ? 23.173  0.346   66.326  1.00 45.77  ? 65   SER A O   1 
ATOM   1383 C  CB  . SER A 1 194 ? 20.641  -1.687  66.938  1.00 48.58  ? 65   SER A CB  1 
ATOM   1384 O  OG  . SER A 1 194 ? 19.955  -2.855  66.523  1.00 49.30  ? 65   SER A OG  1 
ATOM   1385 N  N   . ALA A 1 195 ? 23.113  -0.455  68.430  1.00 45.45  ? 66   ALA A N   1 
ATOM   1386 C  CA  . ALA A 1 195 ? 23.755  0.713   69.024  1.00 43.80  ? 66   ALA A CA  1 
ATOM   1387 C  C   . ALA A 1 195 ? 25.171  0.942   68.487  1.00 47.75  ? 66   ALA A C   1 
ATOM   1388 O  O   . ALA A 1 195 ? 25.641  2.079   68.421  1.00 46.67  ? 66   ALA A O   1 
ATOM   1389 C  CB  . ALA A 1 195 ? 23.784  0.574   70.537  1.00 43.14  ? 66   ALA A CB  1 
ATOM   1390 N  N   . SER A 1 196 ? 25.848  -0.137  68.108  1.00 46.14  ? 67   SER A N   1 
ATOM   1391 C  CA  . SER A 1 196 ? 27.190  -0.033  67.549  1.00 47.66  ? 67   SER A CA  1 
ATOM   1392 C  C   . SER A 1 196 ? 27.129  0.469   66.112  1.00 44.93  ? 67   SER A C   1 
ATOM   1393 O  O   . SER A 1 196 ? 27.959  1.274   65.685  1.00 43.29  ? 67   SER A O   1 
ATOM   1394 C  CB  . SER A 1 196 ? 27.908  -1.381  67.612  1.00 48.69  ? 67   SER A CB  1 
ATOM   1395 O  OG  . SER A 1 196 ? 27.159  -2.381  66.945  1.00 51.95  ? 67   SER A OG  1 
ATOM   1396 N  N   . VAL A 1 197 ? 26.137  -0.014  65.371  1.00 45.10  ? 68   VAL A N   1 
ATOM   1397 C  CA  . VAL A 1 197 ? 25.922  0.421   63.996  1.00 43.24  ? 68   VAL A CA  1 
ATOM   1398 C  C   . VAL A 1 197 ? 25.509  1.893   63.959  1.00 41.72  ? 68   VAL A C   1 
ATOM   1399 O  O   . VAL A 1 197 ? 25.978  2.658   63.116  1.00 43.68  ? 68   VAL A O   1 
ATOM   1400 C  CB  . VAL A 1 197 ? 24.853  -0.447  63.295  1.00 46.67  ? 68   VAL A CB  1 
ATOM   1401 C  CG1 . VAL A 1 197 ? 24.474  0.144   61.948  1.00 45.77  ? 68   VAL A CG1 1 
ATOM   1402 C  CG2 . VAL A 1 197 ? 25.356  -1.877  63.127  1.00 45.77  ? 68   VAL A CG2 1 
ATOM   1403 N  N   . LEU A 1 198 ? 24.653  2.291   64.896  1.00 42.44  ? 69   LEU A N   1 
ATOM   1404 C  CA  . LEU A 1 198 ? 24.154  3.662   64.948  1.00 42.76  ? 69   LEU A CA  1 
ATOM   1405 C  C   . LEU A 1 198 ? 25.196  4.653   65.463  1.00 43.36  ? 69   LEU A C   1 
ATOM   1406 O  O   . LEU A 1 198 ? 24.947  5.859   65.510  1.00 45.46  ? 69   LEU A O   1 
ATOM   1407 C  CB  . LEU A 1 198 ? 22.899  3.732   65.817  1.00 45.11  ? 69   LEU A CB  1 
ATOM   1408 C  CG  . LEU A 1 198 ? 21.650  3.122   65.182  1.00 43.30  ? 69   LEU A CG  1 
ATOM   1409 C  CD1 . LEU A 1 198 ? 20.484  3.142   66.153  1.00 38.71  ? 69   LEU A CD1 1 
ATOM   1410 C  CD2 . LEU A 1 198 ? 21.301  3.865   63.904  1.00 43.72  ? 69   LEU A CD2 1 
ATOM   1411 N  N   . THR A 1 199 ? 26.359  4.146   65.854  1.00 43.99  ? 70   THR A N   1 
ATOM   1412 C  CA  . THR A 1 199 ? 27.445  5.010   66.301  1.00 45.38  ? 70   THR A CA  1 
ATOM   1413 C  C   . THR A 1 199 ? 28.683  4.761   65.447  1.00 40.09  ? 70   THR A C   1 
ATOM   1414 O  O   . THR A 1 199 ? 29.667  5.496   65.525  1.00 41.04  ? 70   THR A O   1 
ATOM   1415 C  CB  . THR A 1 199 ? 27.768  4.794   67.799  1.00 48.09  ? 70   THR A CB  1 
ATOM   1416 O  OG1 . THR A 1 199 ? 28.044  3.409   68.044  1.00 49.00  ? 70   THR A OG1 1 
ATOM   1417 C  CG2 . THR A 1 199 ? 26.586  5.217   68.659  1.00 43.14  ? 70   THR A CG2 1 
ATOM   1418 N  N   . GLY A 1 200 ? 28.611  3.728   64.613  1.00 40.42  ? 71   GLY A N   1 
ATOM   1419 C  CA  . GLY A 1 200 ? 29.697  3.381   63.713  1.00 41.04  ? 71   GLY A CA  1 
ATOM   1420 C  C   . GLY A 1 200 ? 29.824  4.289   62.503  1.00 39.14  ? 71   GLY A C   1 
ATOM   1421 O  O   . GLY A 1 200 ? 28.948  5.106   62.215  1.00 39.62  ? 71   GLY A O   1 
ATOM   1422 N  N   . LYS A 1 201 ? 30.929  4.130   61.784  1.00 43.27  ? 72   LYS A N   1 
ATOM   1423 C  CA  . LYS A 1 201 ? 31.238  4.965   60.630  1.00 39.93  ? 72   LYS A CA  1 
ATOM   1424 C  C   . LYS A 1 201 ? 30.448  4.535   59.396  1.00 40.08  ? 72   LYS A C   1 
ATOM   1425 O  O   . LYS A 1 201 ? 30.290  5.305   58.446  1.00 39.20  ? 72   LYS A O   1 
ATOM   1426 C  CB  . LYS A 1 201 ? 32.739  4.925   60.349  1.00 39.58  ? 72   LYS A CB  1 
ATOM   1427 C  CG  . LYS A 1 201 ? 33.592  5.324   61.550  1.00 39.83  ? 72   LYS A CG  1 
ATOM   1428 C  CD  . LYS A 1 201 ? 33.378  6.785   61.906  1.00 42.55  ? 72   LYS A CD  1 
ATOM   1429 C  CE  . LYS A 1 201 ? 34.197  7.197   63.118  1.00 42.07  ? 72   LYS A CE  1 
ATOM   1430 N  NZ  . LYS A 1 201 ? 34.014  8.642   63.431  1.00 38.17  ? 72   LYS A NZ  1 
ATOM   1431 N  N   . LEU A 1 202 ? 29.947  3.305   59.424  1.00 39.05  ? 73   LEU A N   1 
ATOM   1432 C  CA  . LEU A 1 202 ? 29.097  2.801   58.351  1.00 39.28  ? 73   LEU A CA  1 
ATOM   1433 C  C   . LEU A 1 202 ? 27.908  3.717   58.101  1.00 40.45  ? 73   LEU A C   1 
ATOM   1434 O  O   . LEU A 1 202 ? 27.555  3.985   56.954  1.00 42.36  ? 73   LEU A O   1 
ATOM   1435 C  CB  . LEU A 1 202 ? 28.591  1.395   58.669  1.00 40.15  ? 73   LEU A CB  1 
ATOM   1436 C  CG  . LEU A 1 202 ? 27.584  0.864   57.646  1.00 40.15  ? 73   LEU A CG  1 
ATOM   1437 C  CD1 . LEU A 1 202 ? 28.251  0.695   56.289  1.00 46.17  ? 73   LEU A CD1 1 
ATOM   1438 C  CD2 . LEU A 1 202 ? 26.957  -0.438  58.112  1.00 43.62  ? 73   LEU A CD2 1 
ATOM   1439 N  N   . THR A 1 203 ? 27.292  4.198   59.176  1.00 39.92  ? 74   THR A N   1 
ATOM   1440 C  CA  . THR A 1 203 ? 26.122  5.061   59.045  1.00 41.93  ? 74   THR A CA  1 
ATOM   1441 C  C   . THR A 1 203 ? 26.505  6.534   59.024  1.00 41.35  ? 74   THR A C   1 
ATOM   1442 O  O   . THR A 1 203 ? 25.861  7.335   58.350  1.00 42.54  ? 74   THR A O   1 
ATOM   1443 C  CB  . THR A 1 203 ? 25.108  4.828   60.183  1.00 38.44  ? 74   THR A CB  1 
ATOM   1444 O  OG1 . THR A 1 203 ? 25.722  5.130   61.442  1.00 41.43  ? 74   THR A OG1 1 
ATOM   1445 C  CG2 . THR A 1 203 ? 24.631  3.385   60.184  1.00 36.76  ? 74   THR A CG2 1 
ATOM   1446 N  N   . THR A 1 204 ? 27.561  6.883   59.751  1.00 39.26  ? 75   THR A N   1 
ATOM   1447 C  CA  . THR A 1 204 ? 27.936  8.281   59.943  1.00 38.80  ? 75   THR A CA  1 
ATOM   1448 C  C   . THR A 1 204 ? 28.967  8.796   58.933  1.00 38.81  ? 75   THR A C   1 
ATOM   1449 O  O   . THR A 1 204 ? 29.253  9.993   58.887  1.00 39.15  ? 75   THR A O   1 
ATOM   1450 C  CB  . THR A 1 204 ? 28.485  8.496   61.365  1.00 37.37  ? 75   THR A CB  1 
ATOM   1451 O  OG1 . THR A 1 204 ? 29.592  7.613   61.583  1.00 38.39  ? 75   THR A OG1 1 
ATOM   1452 C  CG2 . THR A 1 204 ? 27.408  8.193   62.391  1.00 38.77  ? 75   THR A CG2 1 
ATOM   1453 N  N   . VAL A 1 205 ? 29.531  7.897   58.131  1.00 37.49  ? 76   VAL A N   1 
ATOM   1454 C  CA  . VAL A 1 205 ? 30.533  8.298   57.149  1.00 37.76  ? 76   VAL A CA  1 
ATOM   1455 C  C   . VAL A 1 205 ? 30.267  7.711   55.768  1.00 38.60  ? 76   VAL A C   1 
ATOM   1456 O  O   . VAL A 1 205 ? 30.274  8.431   54.774  1.00 41.97  ? 76   VAL A O   1 
ATOM   1457 C  CB  . VAL A 1 205 ? 31.954  7.891   57.590  1.00 41.64  ? 76   VAL A CB  1 
ATOM   1458 C  CG1 . VAL A 1 205 ? 32.960  8.174   56.480  1.00 35.77  ? 76   VAL A CG1 1 
ATOM   1459 C  CG2 . VAL A 1 205 ? 32.343  8.619   58.867  1.00 39.17  ? 76   VAL A CG2 1 
ATOM   1460 N  N   . PHE A 1 206 ? 30.040  6.404   55.704  1.00 37.10  ? 77   PHE A N   1 
ATOM   1461 C  CA  . PHE A 1 206 ? 29.807  5.746   54.425  1.00 38.25  ? 77   PHE A CA  1 
ATOM   1462 C  C   . PHE A 1 206 ? 28.510  6.228   53.788  1.00 42.31  ? 77   PHE A C   1 
ATOM   1463 O  O   . PHE A 1 206 ? 28.487  6.610   52.615  1.00 40.31  ? 77   PHE A O   1 
ATOM   1464 C  CB  . PHE A 1 206 ? 29.772  4.227   54.595  1.00 37.28  ? 77   PHE A CB  1 
ATOM   1465 C  CG  . PHE A 1 206 ? 29.440  3.484   53.333  1.00 39.84  ? 77   PHE A CG  1 
ATOM   1466 C  CD1 . PHE A 1 206 ? 30.406  3.282   52.360  1.00 40.05  ? 77   PHE A CD1 1 
ATOM   1467 C  CD2 . PHE A 1 206 ? 28.164  2.981   53.118  1.00 39.99  ? 77   PHE A CD2 1 
ATOM   1468 C  CE1 . PHE A 1 206 ? 30.109  2.598   51.196  1.00 38.34  ? 77   PHE A CE1 1 
ATOM   1469 C  CE2 . PHE A 1 206 ? 27.859  2.293   51.950  1.00 38.31  ? 77   PHE A CE2 1 
ATOM   1470 C  CZ  . PHE A 1 206 ? 28.832  2.103   50.990  1.00 35.19  ? 77   PHE A CZ  1 
ATOM   1471 N  N   . LEU A 1 207 ? 27.434  6.204   54.568  1.00 39.92  ? 78   LEU A N   1 
ATOM   1472 C  CA  . LEU A 1 207 ? 26.127  6.598   54.064  1.00 40.94  ? 78   LEU A CA  1 
ATOM   1473 C  C   . LEU A 1 207 ? 26.092  8.046   53.550  1.00 41.85  ? 78   LEU A C   1 
ATOM   1474 O  O   . LEU A 1 207 ? 25.699  8.266   52.403  1.00 47.76  ? 78   LEU A O   1 
ATOM   1475 C  CB  . LEU A 1 207 ? 25.046  6.391   55.134  1.00 44.19  ? 78   LEU A CB  1 
ATOM   1476 C  CG  . LEU A 1 207 ? 24.753  4.963   55.606  1.00 44.55  ? 78   LEU A CG  1 
ATOM   1477 C  CD1 . LEU A 1 207 ? 23.453  4.915   56.394  1.00 44.24  ? 78   LEU A CD1 1 
ATOM   1478 C  CD2 . LEU A 1 207 ? 24.704  3.990   54.446  1.00 39.16  ? 78   LEU A CD2 1 
ATOM   1479 N  N   . PRO A 1 208 ? 26.505  9.036   54.371  1.00 40.04  ? 79   PRO A N   1 
ATOM   1480 C  CA  . PRO A 1 208 ? 26.379  10.402  53.845  1.00 40.39  ? 79   PRO A CA  1 
ATOM   1481 C  C   . PRO A 1 208 ? 27.223  10.661  52.598  1.00 40.12  ? 79   PRO A C   1 
ATOM   1482 O  O   . PRO A 1 208 ? 26.868  11.526  51.800  1.00 40.70  ? 79   PRO A O   1 
ATOM   1483 C  CB  . PRO A 1 208 ? 26.857  11.278  55.010  1.00 37.97  ? 79   PRO A CB  1 
ATOM   1484 C  CG  . PRO A 1 208 ? 27.672  10.387  55.851  1.00 39.25  ? 79   PRO A CG  1 
ATOM   1485 C  CD  . PRO A 1 208 ? 27.044  9.036   55.743  1.00 38.80  ? 79   PRO A CD  1 
ATOM   1486 N  N   . ILE A 1 209 ? 28.312  9.918   52.428  1.00 39.30  ? 80   ILE A N   1 
ATOM   1487 C  CA  . ILE A 1 209 ? 29.124  10.061  51.229  1.00 42.00  ? 80   ILE A CA  1 
ATOM   1488 C  C   . ILE A 1 209 ? 28.372  9.548   50.006  1.00 38.17  ? 80   ILE A C   1 
ATOM   1489 O  O   . ILE A 1 209 ? 28.238  10.258  49.011  1.00 37.70  ? 80   ILE A O   1 
ATOM   1490 C  CB  . ILE A 1 209 ? 30.463  9.320   51.355  1.00 42.97  ? 80   ILE A CB  1 
ATOM   1491 C  CG1 . ILE A 1 209 ? 31.357  10.024  52.376  1.00 42.76  ? 80   ILE A CG1 1 
ATOM   1492 C  CG2 . ILE A 1 209 ? 31.167  9.267   50.009  1.00 35.49  ? 80   ILE A CG2 1 
ATOM   1493 C  CD1 . ILE A 1 209 ? 32.653  9.300   52.654  1.00 41.29  ? 80   ILE A CD1 1 
ATOM   1494 N  N   . VAL A 1 210 ? 27.877  8.319   50.089  1.00 37.59  ? 81   VAL A N   1 
ATOM   1495 C  CA  . VAL A 1 210 ? 27.135  7.724   48.989  1.00 38.55  ? 81   VAL A CA  1 
ATOM   1496 C  C   . VAL A 1 210 ? 25.898  8.555   48.659  1.00 42.47  ? 81   VAL A C   1 
ATOM   1497 O  O   . VAL A 1 210 ? 25.621  8.828   47.489  1.00 43.99  ? 81   VAL A O   1 
ATOM   1498 C  CB  . VAL A 1 210 ? 26.720  6.274   49.306  1.00 40.62  ? 81   VAL A CB  1 
ATOM   1499 C  CG1 . VAL A 1 210 ? 25.746  5.758   48.262  1.00 39.24  ? 81   VAL A CG1 1 
ATOM   1500 C  CG2 . VAL A 1 210 ? 27.949  5.375   49.387  1.00 39.49  ? 81   VAL A CG2 1 
ATOM   1501 N  N   . TYR A 1 211 ? 25.174  8.975   49.694  1.00 40.49  ? 82   TYR A N   1 
ATOM   1502 C  CA  . TYR A 1 211 ? 23.995  9.817   49.513  1.00 37.45  ? 82   TYR A CA  1 
ATOM   1503 C  C   . TYR A 1 211 ? 24.332  11.157  48.862  1.00 38.05  ? 82   TYR A C   1 
ATOM   1504 O  O   . TYR A 1 211 ? 23.575  11.654  48.026  1.00 39.69  ? 82   TYR A O   1 
ATOM   1505 C  CB  . TYR A 1 211 ? 23.299  10.054  50.853  1.00 39.56  ? 82   TYR A CB  1 
ATOM   1506 C  CG  . TYR A 1 211 ? 22.599  8.830   51.399  1.00 42.86  ? 82   TYR A CG  1 
ATOM   1507 C  CD1 . TYR A 1 211 ? 22.066  7.871   50.546  1.00 37.89  ? 82   TYR A CD1 1 
ATOM   1508 C  CD2 . TYR A 1 211 ? 22.472  8.632   52.768  1.00 41.74  ? 82   TYR A CD2 1 
ATOM   1509 C  CE1 . TYR A 1 211 ? 21.429  6.751   51.040  1.00 39.44  ? 82   TYR A CE1 1 
ATOM   1510 C  CE2 . TYR A 1 211 ? 21.836  7.514   53.273  1.00 40.64  ? 82   TYR A CE2 1 
ATOM   1511 C  CZ  . TYR A 1 211 ? 21.317  6.576   52.405  1.00 42.14  ? 82   TYR A CZ  1 
ATOM   1512 O  OH  . TYR A 1 211 ? 20.681  5.462   52.908  1.00 41.54  ? 82   TYR A OH  1 
ATOM   1513 N  N   . THR A 1 212 ? 25.465  11.738  49.250  1.00 39.25  ? 83   THR A N   1 
ATOM   1514 C  CA  . THR A 1 212 ? 25.932  12.990  48.659  1.00 38.20  ? 83   THR A CA  1 
ATOM   1515 C  C   . THR A 1 212 ? 26.201  12.820  47.174  1.00 39.96  ? 83   THR A C   1 
ATOM   1516 O  O   . THR A 1 212 ? 25.787  13.651  46.359  1.00 41.35  ? 83   THR A O   1 
ATOM   1517 C  CB  . THR A 1 212 ? 27.212  13.504  49.346  1.00 37.87  ? 83   THR A CB  1 
ATOM   1518 O  OG1 . THR A 1 212 ? 26.907  13.900  50.689  1.00 36.78  ? 83   THR A OG1 1 
ATOM   1519 C  CG2 . THR A 1 212 ? 27.783  14.696  48.593  1.00 38.66  ? 83   THR A CG2 1 
ATOM   1520 N  N   . ILE A 1 213 ? 26.892  11.735  46.833  1.00 39.37  ? 84   ILE A N   1 
ATOM   1521 C  CA  . ILE A 1 213 ? 27.161  11.398  45.444  1.00 38.44  ? 84   ILE A CA  1 
ATOM   1522 C  C   . ILE A 1 213 ? 25.862  11.322  44.653  1.00 41.41  ? 84   ILE A C   1 
ATOM   1523 O  O   . ILE A 1 213 ? 25.726  11.951  43.600  1.00 41.99  ? 84   ILE A O   1 
ATOM   1524 C  CB  . ILE A 1 213 ? 27.908  10.062  45.323  1.00 38.28  ? 84   ILE A CB  1 
ATOM   1525 C  CG1 . ILE A 1 213 ? 29.319  10.191  45.893  1.00 43.58  ? 84   ILE A CG1 1 
ATOM   1526 C  CG2 . ILE A 1 213 ? 27.955  9.601   43.871  1.00 36.53  ? 84   ILE A CG2 1 
ATOM   1527 C  CD1 . ILE A 1 213 ? 30.149  8.935   45.765  1.00 41.04  ? 84   ILE A CD1 1 
ATOM   1528 N  N   . VAL A 1 214 ? 24.908  10.556  45.175  1.00 39.15  ? 85   VAL A N   1 
ATOM   1529 C  CA  . VAL A 1 214 ? 23.611  10.402  44.531  1.00 37.59  ? 85   VAL A CA  1 
ATOM   1530 C  C   . VAL A 1 214 ? 22.954  11.761  44.333  1.00 38.39  ? 85   VAL A C   1 
ATOM   1531 O  O   . VAL A 1 214 ? 22.364  12.023  43.292  1.00 41.38  ? 85   VAL A O   1 
ATOM   1532 C  CB  . VAL A 1 214 ? 22.678  9.487   45.345  1.00 35.51  ? 85   VAL A CB  1 
ATOM   1533 C  CG1 . VAL A 1 214 ? 21.269  9.519   44.783  1.00 40.43  ? 85   VAL A CG1 1 
ATOM   1534 C  CG2 . VAL A 1 214 ? 23.212  8.066   45.359  1.00 35.25  ? 85   VAL A CG2 1 
ATOM   1535 N  N   . PHE A 1 215 ? 23.080  12.637  45.322  1.00 37.52  ? 86   PHE A N   1 
ATOM   1536 C  CA  . PHE A 1 215 ? 22.480  13.959  45.215  1.00 39.15  ? 86   PHE A CA  1 
ATOM   1537 C  C   . PHE A 1 215 ? 23.087  14.747  44.059  1.00 42.16  ? 86   PHE A C   1 
ATOM   1538 O  O   . PHE A 1 215 ? 22.361  15.312  43.235  1.00 41.26  ? 86   PHE A O   1 
ATOM   1539 C  CB  . PHE A 1 215 ? 22.636  14.738  46.521  1.00 38.22  ? 86   PHE A CB  1 
ATOM   1540 C  CG  . PHE A 1 215 ? 22.056  16.121  46.467  1.00 40.81  ? 86   PHE A CG  1 
ATOM   1541 C  CD1 . PHE A 1 215 ? 20.684  16.314  46.528  1.00 42.87  ? 86   PHE A CD1 1 
ATOM   1542 C  CD2 . PHE A 1 215 ? 22.880  17.230  46.346  1.00 39.10  ? 86   PHE A CD2 1 
ATOM   1543 C  CE1 . PHE A 1 215 ? 20.145  17.585  46.474  1.00 42.66  ? 86   PHE A CE1 1 
ATOM   1544 C  CE2 . PHE A 1 215 ? 22.346  18.506  46.292  1.00 37.00  ? 86   PHE A CE2 1 
ATOM   1545 C  CZ  . PHE A 1 215 ? 20.979  18.683  46.356  1.00 40.70  ? 86   PHE A CZ  1 
ATOM   1546 N  N   . VAL A 1 216 ? 24.417  14.771  43.993  1.00 39.79  ? 87   VAL A N   1 
ATOM   1547 C  CA  . VAL A 1 216 ? 25.111  15.502  42.937  1.00 39.10  ? 87   VAL A CA  1 
ATOM   1548 C  C   . VAL A 1 216 ? 24.842  14.902  41.556  1.00 40.49  ? 87   VAL A C   1 
ATOM   1549 O  O   . VAL A 1 216 ? 24.667  15.632  40.585  1.00 43.89  ? 87   VAL A O   1 
ATOM   1550 C  CB  . VAL A 1 216 ? 26.629  15.540  43.184  1.00 43.06  ? 87   VAL A CB  1 
ATOM   1551 C  CG1 . VAL A 1 216 ? 27.339  16.276  42.056  1.00 40.24  ? 87   VAL A CG1 1 
ATOM   1552 C  CG2 . VAL A 1 216 ? 26.925  16.206  44.521  1.00 43.35  ? 87   VAL A CG2 1 
ATOM   1553 N  N   . VAL A 1 217 ? 24.789  13.577  41.474  1.00 40.27  ? 88   VAL A N   1 
ATOM   1554 C  CA  . VAL A 1 217 ? 24.608  12.898  40.192  1.00 41.16  ? 88   VAL A CA  1 
ATOM   1555 C  C   . VAL A 1 217 ? 23.147  12.804  39.746  1.00 42.16  ? 88   VAL A C   1 
ATOM   1556 O  O   . VAL A 1 217 ? 22.826  13.138  38.608  1.00 48.71  ? 88   VAL A O   1 
ATOM   1557 C  CB  . VAL A 1 217 ? 25.197  11.473  40.226  1.00 45.50  ? 88   VAL A CB  1 
ATOM   1558 C  CG1 . VAL A 1 217 ? 24.804  10.702  38.975  1.00 40.83  ? 88   VAL A CG1 1 
ATOM   1559 C  CG2 . VAL A 1 217 ? 26.711  11.525  40.375  1.00 42.60  ? 88   VAL A CG2 1 
ATOM   1560 N  N   . ALA A 1 218 ? 22.264  12.356  40.636  1.00 42.21  ? 89   ALA A N   1 
ATOM   1561 C  CA  . ALA A 1 218 ? 20.882  12.058  40.252  1.00 44.41  ? 89   ALA A CA  1 
ATOM   1562 C  C   . ALA A 1 218 ? 19.993  13.292  40.087  1.00 45.16  ? 89   ALA A C   1 
ATOM   1563 O  O   . ALA A 1 218 ? 19.096  13.303  39.238  1.00 46.83  ? 89   ALA A O   1 
ATOM   1564 C  CB  . ALA A 1 218 ? 20.250  11.105  41.263  1.00 40.30  ? 89   ALA A CB  1 
ATOM   1565 N  N   . LEU A 1 219 ? 20.222  14.323  40.894  1.00 41.69  ? 90   LEU A N   1 
ATOM   1566 C  CA  . LEU A 1 219 ? 19.342  15.489  40.863  1.00 42.81  ? 90   LEU A CA  1 
ATOM   1567 C  C   . LEU A 1 219 ? 19.372  16.233  39.519  1.00 44.00  ? 90   LEU A C   1 
ATOM   1568 O  O   . LEU A 1 219 ? 18.320  16.441  38.915  1.00 43.68  ? 90   LEU A O   1 
ATOM   1569 C  CB  . LEU A 1 219 ? 19.675  16.455  42.006  1.00 43.31  ? 90   LEU A CB  1 
ATOM   1570 C  CG  . LEU A 1 219 ? 18.667  17.587  42.218  1.00 42.03  ? 90   LEU A CG  1 
ATOM   1571 C  CD1 . LEU A 1 219 ? 17.335  17.030  42.696  1.00 46.03  ? 90   LEU A CD1 1 
ATOM   1572 C  CD2 . LEU A 1 219 ? 19.195  18.627  43.193  1.00 40.31  ? 90   LEU A CD2 1 
ATOM   1573 N  N   . PRO A 1 220 ? 20.563  16.629  39.031  1.00 44.69  ? 91   PRO A N   1 
ATOM   1574 C  CA  . PRO A 1 220 ? 20.511  17.383  37.775  1.00 43.48  ? 91   PRO A CA  1 
ATOM   1575 C  C   . PRO A 1 220 ? 20.250  16.497  36.561  1.00 47.77  ? 91   PRO A C   1 
ATOM   1576 O  O   . PRO A 1 220 ? 19.663  16.968  35.588  1.00 48.91  ? 91   PRO A O   1 
ATOM   1577 C  CB  . PRO A 1 220 ? 21.896  18.024  37.698  1.00 41.76  ? 91   PRO A CB  1 
ATOM   1578 C  CG  . PRO A 1 220 ? 22.775  17.087  38.430  1.00 43.86  ? 91   PRO A CG  1 
ATOM   1579 C  CD  . PRO A 1 220 ? 21.946  16.482  39.523  1.00 44.33  ? 91   PRO A CD  1 
ATOM   1580 N  N   . SER A 1 221 ? 20.672  15.237  36.618  1.00 45.53  ? 92   SER A N   1 
ATOM   1581 C  CA  . SER A 1 221 ? 20.455  14.314  35.508  1.00 43.47  ? 92   SER A CA  1 
ATOM   1582 C  C   . SER A 1 221 ? 18.965  14.046  35.283  1.00 47.75  ? 92   SER A C   1 
ATOM   1583 O  O   . SER A 1 221 ? 18.473  14.159  34.164  1.00 54.90  ? 92   SER A O   1 
ATOM   1584 C  CB  . SER A 1 221 ? 21.199  13.002  35.748  1.00 43.83  ? 92   SER A CB  1 
ATOM   1585 O  OG  . SER A 1 221 ? 20.815  12.412  36.977  1.00 43.83  ? 92   SER A OG  1 
ATOM   1586 N  N   . ASN A 1 222 ? 18.248  13.695  36.347  1.00 50.29  ? 93   ASN A N   1 
ATOM   1587 C  CA  . ASN A 1 222 ? 16.798  13.529  36.264  1.00 45.74  ? 93   ASN A CA  1 
ATOM   1588 C  C   . ASN A 1 222 ? 16.092  14.864  36.099  1.00 47.36  ? 93   ASN A C   1 
ATOM   1589 O  O   . ASN A 1 222 ? 14.991  14.932  35.564  1.00 52.37  ? 93   ASN A O   1 
ATOM   1590 C  CB  . ASN A 1 222 ? 16.254  12.826  37.505  1.00 44.93  ? 93   ASN A CB  1 
ATOM   1591 C  CG  . ASN A 1 222 ? 16.585  11.355  37.532  1.00 46.34  ? 93   ASN A CG  1 
ATOM   1592 O  OD1 . ASN A 1 222 ? 15.987  10.561  36.805  1.00 48.06  ? 93   ASN A OD1 1 
ATOM   1593 N  ND2 . ASN A 1 222 ? 17.532  10.977  38.380  1.00 42.01  ? 93   ASN A ND2 1 
ATOM   1594 N  N   . GLY A 1 223 ? 16.729  15.922  36.584  1.00 48.20  ? 94   GLY A N   1 
ATOM   1595 C  CA  . GLY A 1 223 ? 16.187  17.258  36.457  1.00 47.46  ? 94   GLY A CA  1 
ATOM   1596 C  C   . GLY A 1 223 ? 16.122  17.655  35.000  1.00 51.56  ? 94   GLY A C   1 
ATOM   1597 O  O   . GLY A 1 223 ? 15.137  18.238  34.548  1.00 54.88  ? 94   GLY A O   1 
ATOM   1598 N  N   . MET A 1 224 ? 17.177  17.329  34.260  1.00 52.94  ? 95   MET A N   1 
ATOM   1599 C  CA  . MET A 1 224 ? 17.237  17.634  32.837  1.00 54.59  ? 95   MET A CA  1 
ATOM   1600 C  C   . MET A 1 224 ? 16.346  16.681  32.052  1.00 57.82  ? 95   MET A C   1 
ATOM   1601 O  O   . MET A 1 224 ? 15.699  17.079  31.084  1.00 62.50  ? 95   MET A O   1 
ATOM   1602 C  CB  . MET A 1 224 ? 18.673  17.553  32.320  1.00 56.21  ? 95   MET A CB  1 
ATOM   1603 C  CG  . MET A 1 224 ? 18.835  18.057  30.896  1.00 70.00  ? 95   MET A CG  1 
ATOM   1604 S  SD  . MET A 1 224 ? 20.456  17.711  30.185  1.00 83.27  ? 95   MET A SD  1 
ATOM   1605 C  CE  . MET A 1 224 ? 20.389  15.927  30.028  1.00 67.34  ? 95   MET A CE  1 
ATOM   1606 N  N   . ALA A 1 225 ? 16.317  15.422  32.479  1.00 54.59  ? 96   ALA A N   1 
ATOM   1607 C  CA  . ALA A 1 225 ? 15.494  14.407  31.832  1.00 56.57  ? 96   ALA A CA  1 
ATOM   1608 C  C   . ALA A 1 225 ? 14.019  14.778  31.905  1.00 57.46  ? 96   ALA A C   1 
ATOM   1609 O  O   . ALA A 1 225 ? 13.292  14.667  30.916  1.00 58.49  ? 96   ALA A O   1 
ATOM   1610 C  CB  . ALA A 1 225 ? 15.729  13.048  32.467  1.00 54.09  ? 96   ALA A CB  1 
ATOM   1611 N  N   . LEU A 1 226 ? 13.590  15.225  33.081  1.00 57.35  ? 97   LEU A N   1 
ATOM   1612 C  CA  . LEU A 1 226 ? 12.210  15.647  33.291  1.00 58.79  ? 97   LEU A CA  1 
ATOM   1613 C  C   . LEU A 1 226 ? 11.895  16.855  32.415  1.00 62.82  ? 97   LEU A C   1 
ATOM   1614 O  O   . LEU A 1 226 ? 10.780  17.002  31.916  1.00 64.62  ? 97   LEU A O   1 
ATOM   1615 C  CB  . LEU A 1 226 ? 11.970  15.970  34.768  1.00 55.78  ? 97   LEU A CB  1 
ATOM   1616 C  CG  . LEU A 1 226 ? 10.536  16.107  35.293  1.00 58.61  ? 97   LEU A CG  1 
ATOM   1617 C  CD1 . LEU A 1 226 ? 9.982   17.505  35.059  1.00 64.88  ? 97   LEU A CD1 1 
ATOM   1618 C  CD2 . LEU A 1 226 ? 9.630   15.055  34.668  1.00 56.45  ? 97   LEU A CD2 1 
ATOM   1619 N  N   . TRP A 1 227 ? 12.890  17.714  32.229  1.00 62.08  ? 98   TRP A N   1 
ATOM   1620 C  CA  . TRP A 1 227 ? 12.737  18.896  31.393  1.00 63.42  ? 98   TRP A CA  1 
ATOM   1621 C  C   . TRP A 1 227 ? 12.573  18.513  29.929  1.00 65.02  ? 98   TRP A C   1 
ATOM   1622 O  O   . TRP A 1 227 ? 11.740  19.074  29.221  1.00 67.68  ? 98   TRP A O   1 
ATOM   1623 C  CB  . TRP A 1 227 ? 13.936  19.826  31.561  1.00 61.94  ? 98   TRP A CB  1 
ATOM   1624 C  CG  . TRP A 1 227 ? 13.914  20.998  30.644  1.00 66.15  ? 98   TRP A CG  1 
ATOM   1625 C  CD1 . TRP A 1 227 ? 13.106  22.091  30.734  1.00 68.41  ? 98   TRP A CD1 1 
ATOM   1626 C  CD2 . TRP A 1 227 ? 14.743  21.204  29.497  1.00 68.07  ? 98   TRP A CD2 1 
ATOM   1627 N  NE1 . TRP A 1 227 ? 13.377  22.965  29.711  1.00 72.68  ? 98   TRP A NE1 1 
ATOM   1628 C  CE2 . TRP A 1 227 ? 14.382  22.443  28.937  1.00 71.09  ? 98   TRP A CE2 1 
ATOM   1629 C  CE3 . TRP A 1 227 ? 15.760  20.460  28.889  1.00 70.74  ? 98   TRP A CE3 1 
ATOM   1630 C  CZ2 . TRP A 1 227 ? 14.995  22.957  27.799  1.00 74.49  ? 98   TRP A CZ2 1 
ATOM   1631 C  CZ3 . TRP A 1 227 ? 16.369  20.972  27.758  1.00 73.86  ? 98   TRP A CZ3 1 
ATOM   1632 C  CH2 . TRP A 1 227 ? 15.985  22.208  27.225  1.00 77.00  ? 98   TRP A CH2 1 
ATOM   1633 N  N   . VAL A 1 228 ? 13.373  17.548  29.487  1.00 63.47  ? 99   VAL A N   1 
ATOM   1634 C  CA  . VAL A 1 228 ? 13.333  17.079  28.107  1.00 65.66  ? 99   VAL A CA  1 
ATOM   1635 C  C   . VAL A 1 228 ? 11.997  16.414  27.789  1.00 66.47  ? 99   VAL A C   1 
ATOM   1636 O  O   . VAL A 1 228 ? 11.403  16.663  26.742  1.00 67.90  ? 99   VAL A O   1 
ATOM   1637 C  CB  . VAL A 1 228 ? 14.483  16.088  27.818  1.00 65.05  ? 99   VAL A CB  1 
ATOM   1638 C  CG1 . VAL A 1 228 ? 14.294  15.418  26.465  1.00 64.21  ? 99   VAL A CG1 1 
ATOM   1639 C  CG2 . VAL A 1 228 ? 15.824  16.801  27.881  1.00 66.74  ? 99   VAL A CG2 1 
ATOM   1640 N  N   . PHE A 1 229 ? 11.521  15.581  28.707  1.00 65.35  ? 100  PHE A N   1 
ATOM   1641 C  CA  . PHE A 1 229 ? 10.280  14.844  28.494  1.00 66.07  ? 100  PHE A CA  1 
ATOM   1642 C  C   . PHE A 1 229 ? 9.064   15.768  28.453  1.00 67.48  ? 100  PHE A C   1 
ATOM   1643 O  O   . PHE A 1 229 ? 8.057   15.452  27.818  1.00 71.99  ? 100  PHE A O   1 
ATOM   1644 C  CB  . PHE A 1 229 ? 10.104  13.784  29.582  1.00 59.96  ? 100  PHE A CB  1 
ATOM   1645 C  CG  . PHE A 1 229 ? 11.202  12.759  29.608  1.00 57.76  ? 100  PHE A CG  1 
ATOM   1646 C  CD1 . PHE A 1 229 ? 11.860  12.401  28.443  1.00 61.39  ? 100  PHE A CD1 1 
ATOM   1647 C  CD2 . PHE A 1 229 ? 11.583  12.159  30.797  1.00 58.09  ? 100  PHE A CD2 1 
ATOM   1648 C  CE1 . PHE A 1 229 ? 12.876  11.461  28.462  1.00 61.25  ? 100  PHE A CE1 1 
ATOM   1649 C  CE2 . PHE A 1 229 ? 12.599  11.221  30.823  1.00 56.28  ? 100  PHE A CE2 1 
ATOM   1650 C  CZ  . PHE A 1 229 ? 13.245  10.870  29.655  1.00 57.12  ? 100  PHE A CZ  1 
ATOM   1651 N  N   . LEU A 1 230 ? 9.168   16.914  29.116  1.00 62.63  ? 101  LEU A N   1 
ATOM   1652 C  CA  . LEU A 1 230 ? 8.058   17.858  29.190  1.00 64.59  ? 101  LEU A CA  1 
ATOM   1653 C  C   . LEU A 1 230 ? 8.133   18.954  28.132  1.00 68.09  ? 101  LEU A C   1 
ATOM   1654 O  O   . LEU A 1 230 ? 7.127   19.293  27.511  1.00 71.71  ? 101  LEU A O   1 
ATOM   1655 C  CB  . LEU A 1 230 ? 8.001   18.503  30.578  1.00 66.87  ? 101  LEU A CB  1 
ATOM   1656 C  CG  . LEU A 1 230 ? 7.142   17.855  31.667  1.00 62.82  ? 101  LEU A CG  1 
ATOM   1657 C  CD1 . LEU A 1 230 ? 7.513   16.397  31.903  1.00 63.28  ? 101  LEU A CD1 1 
ATOM   1658 C  CD2 . LEU A 1 230 ? 7.262   18.649  32.957  1.00 61.35  ? 101  LEU A CD2 1 
ATOM   1659 N  N   . PHE A 1 231 ? 9.324   19.510  27.931  1.00 69.68  ? 102  PHE A N   1 
ATOM   1660 C  CA  . PHE A 1 231 ? 9.467   20.715  27.117  1.00 70.61  ? 102  PHE A CA  1 
ATOM   1661 C  C   . PHE A 1 231 ? 10.374  20.546  25.893  1.00 71.92  ? 102  PHE A C   1 
ATOM   1662 O  O   . PHE A 1 231 ? 10.638  21.513  25.179  1.00 74.08  ? 102  PHE A O   1 
ATOM   1663 C  CB  . PHE A 1 231 ? 9.991   21.866  27.983  1.00 70.18  ? 102  PHE A CB  1 
ATOM   1664 C  CG  . PHE A 1 231 ? 9.127   22.174  29.180  1.00 70.76  ? 102  PHE A CG  1 
ATOM   1665 C  CD1 . PHE A 1 231 ? 7.743   22.108  29.099  1.00 73.86  ? 102  PHE A CD1 1 
ATOM   1666 C  CD2 . PHE A 1 231 ? 9.704   22.525  30.389  1.00 69.45  ? 102  PHE A CD2 1 
ATOM   1667 C  CE1 . PHE A 1 231 ? 6.953   22.390  30.203  1.00 71.88  ? 102  PHE A CE1 1 
ATOM   1668 C  CE2 . PHE A 1 231 ? 8.922   22.805  31.492  1.00 70.17  ? 102  PHE A CE2 1 
ATOM   1669 C  CZ  . PHE A 1 231 ? 7.545   22.738  31.400  1.00 74.04  ? 102  PHE A CZ  1 
ATOM   1670 N  N   . ARG A 1 232 ? 10.840  19.326  25.640  1.00 70.50  ? 103  ARG A N   1 
ATOM   1671 C  CA  . ARG A 1 232 ? 11.706  19.080  24.486  1.00 72.44  ? 103  ARG A CA  1 
ATOM   1672 C  C   . ARG A 1 232 ? 11.291  17.855  23.683  1.00 75.80  ? 103  ARG A C   1 
ATOM   1673 O  O   . ARG A 1 232 ? 11.686  17.702  22.529  1.00 82.91  ? 103  ARG A O   1 
ATOM   1674 C  CB  . ARG A 1 232 ? 13.162  18.932  24.929  1.00 71.39  ? 103  ARG A CB  1 
ATOM   1675 C  CG  . ARG A 1 232 ? 13.854  20.253  25.219  1.00 74.44  ? 103  ARG A CG  1 
ATOM   1676 C  CD  . ARG A 1 232 ? 13.973  21.096  23.959  1.00 77.10  ? 103  ARG A CD  1 
ATOM   1677 N  NE  . ARG A 1 232 ? 14.566  22.405  24.217  1.00 80.79  ? 103  ARG A NE  1 
ATOM   1678 C  CZ  . ARG A 1 232 ? 13.865  23.501  24.492  1.00 79.37  ? 103  ARG A CZ  1 
ATOM   1679 N  NH1 . ARG A 1 232 ? 14.486  24.652  24.711  1.00 80.89  ? 103  ARG A NH1 1 
ATOM   1680 N  NH2 . ARG A 1 232 ? 12.541  23.447  24.548  1.00 75.74  ? 103  ARG A NH2 1 
ATOM   1681 N  N   . THR A 1 233 ? 10.504  16.978  24.292  1.00 75.08  ? 104  THR A N   1 
ATOM   1682 C  CA  . THR A 1 233 ? 9.975   15.832  23.568  1.00 79.19  ? 104  THR A CA  1 
ATOM   1683 C  C   . THR A 1 233 ? 8.618   16.190  22.980  1.00 88.38  ? 104  THR A C   1 
ATOM   1684 O  O   . THR A 1 233 ? 7.648   16.410  23.707  1.00 93.01  ? 104  THR A O   1 
ATOM   1685 C  CB  . THR A 1 233 ? 9.840   14.591  24.464  1.00 79.85  ? 104  THR A CB  1 
ATOM   1686 O  OG1 . THR A 1 233 ? 11.126  14.228  24.981  1.00 85.06  ? 104  THR A OG1 1 
ATOM   1687 C  CG2 . THR A 1 233 ? 9.273   13.425  23.666  1.00 81.71  ? 104  THR A CG2 1 
ATOM   1688 N  N   . LYS A 1 234 ? 8.564   16.258  21.655  1.00 93.66  ? 105  LYS A N   1 
ATOM   1689 C  CA  . LYS A 1 234 ? 7.334   16.594  20.951  1.00 98.03  ? 105  LYS A CA  1 
ATOM   1690 C  C   . LYS A 1 234 ? 6.711   15.355  20.319  1.00 98.11  ? 105  LYS A C   1 
ATOM   1691 O  O   . LYS A 1 234 ? 5.901   15.450  19.403  1.00 100.60 ? 105  LYS A O   1 
ATOM   1692 C  CB  . LYS A 1 234 ? 7.606   17.668  19.892  1.00 105.85 ? 105  LYS A CB  1 
ATOM   1693 C  CG  . LYS A 1 234 ? 8.145   18.967  20.472  1.00 104.55 ? 105  LYS A CG  1 
ATOM   1694 C  CD  . LYS A 1 234 ? 8.241   20.074  19.433  1.00 111.55 ? 105  LYS A CD  1 
ATOM   1695 C  CE  . LYS A 1 234 ? 8.677   21.384  20.077  1.00 113.40 ? 105  LYS A CE  1 
ATOM   1696 N  NZ  . LYS A 1 234 ? 8.713   22.522  19.115  1.00 119.23 ? 105  LYS A NZ  1 
ATOM   1697 N  N   . LYS A 1 235 ? 7.105   14.191  20.822  1.00 97.87  ? 106  LYS A N   1 
ATOM   1698 C  CA  . LYS A 1 235 ? 6.512   12.931  20.396  1.00 98.81  ? 106  LYS A CA  1 
ATOM   1699 C  C   . LYS A 1 235 ? 5.371   12.551  21.332  1.00 98.60  ? 106  LYS A C   1 
ATOM   1700 O  O   . LYS A 1 235 ? 4.290   12.157  20.888  1.00 102.73 ? 106  LYS A O   1 
ATOM   1701 C  CB  . LYS A 1 235 ? 7.560   11.816  20.364  1.00 101.70 ? 106  LYS A CB  1 
ATOM   1702 C  CG  . LYS A 1 235 ? 8.762   12.103  19.480  1.00 104.02 ? 106  LYS A CG  1 
ATOM   1703 C  CD  . LYS A 1 235 ? 9.766   10.962  19.552  1.00 99.44  ? 106  LYS A CD  1 
ATOM   1704 C  CE  . LYS A 1 235 ? 10.985  11.233  18.687  1.00 97.89  ? 106  LYS A CE  1 
ATOM   1705 N  NZ  . LYS A 1 235 ? 11.971  10.117  18.754  1.00 90.84  ? 106  LYS A NZ  1 
ATOM   1706 N  N   . LYS A 1 236 ? 5.628   12.681  22.631  1.00 100.81 ? 107  LYS A N   1 
ATOM   1707 C  CA  . LYS A 1 236 ? 4.658   12.354  23.674  1.00 97.75  ? 107  LYS A CA  1 
ATOM   1708 C  C   . LYS A 1 236 ? 4.124   10.931  23.535  1.00 88.90  ? 107  LYS A C   1 
ATOM   1709 O  O   . LYS A 1 236 ? 2.914   10.707  23.545  1.00 93.61  ? 107  LYS A O   1 
ATOM   1710 C  CB  . LYS A 1 236 ? 3.500   13.357  23.663  1.00 100.15 ? 107  LYS A CB  1 
ATOM   1711 C  CG  . LYS A 1 236 ? 3.910   14.778  24.014  1.00 99.87  ? 107  LYS A CG  1 
ATOM   1712 C  CD  . LYS A 1 236 ? 4.551   14.838  25.393  1.00 95.28  ? 107  LYS A CD  1 
ATOM   1713 C  CE  . LYS A 1 236 ? 5.085   16.229  25.699  1.00 92.15  ? 107  LYS A CE  1 
ATOM   1714 N  NZ  . LYS A 1 236 ? 4.022   17.269  25.625  1.00 101.10 ? 107  LYS A NZ  1 
ATOM   1715 N  N   . ALA A 1 237 ? 5.037   9.978   23.396  1.00 81.45  ? 108  ALA A N   1 
ATOM   1716 C  CA  . ALA A 1 237 ? 4.680   8.567   23.365  1.00 73.16  ? 108  ALA A CA  1 
ATOM   1717 C  C   . ALA A 1 237 ? 4.551   8.050   24.797  1.00 67.19  ? 108  ALA A C   1 
ATOM   1718 O  O   . ALA A 1 237 ? 5.092   8.658   25.720  1.00 65.67  ? 108  ALA A O   1 
ATOM   1719 C  CB  . ALA A 1 237 ? 5.722   7.771   22.588  1.00 73.05  ? 108  ALA A CB  1 
ATOM   1720 N  N   . PRO A 1 238 ? 3.823   6.935   24.990  1.00 63.47  ? 109  PRO A N   1 
ATOM   1721 C  CA  . PRO A 1 238 ? 3.671   6.317   26.314  1.00 62.07  ? 109  PRO A CA  1 
ATOM   1722 C  C   . PRO A 1 238 ? 4.992   6.031   27.035  1.00 56.28  ? 109  PRO A C   1 
ATOM   1723 O  O   . PRO A 1 238 ? 5.003   5.965   28.262  1.00 54.09  ? 109  PRO A O   1 
ATOM   1724 C  CB  . PRO A 1 238 ? 2.945   5.010   26.000  1.00 59.64  ? 109  PRO A CB  1 
ATOM   1725 C  CG  . PRO A 1 238 ? 2.149   5.319   24.802  1.00 62.61  ? 109  PRO A CG  1 
ATOM   1726 C  CD  . PRO A 1 238 ? 2.958   6.288   23.988  1.00 63.98  ? 109  PRO A CD  1 
ATOM   1727 N  N   . ALA A 1 239 ? 6.081   5.863   26.291  1.00 56.97  ? 110  ALA A N   1 
ATOM   1728 C  CA  . ALA A 1 239 ? 7.379   5.590   26.902  1.00 57.53  ? 110  ALA A CA  1 
ATOM   1729 C  C   . ALA A 1 239 ? 7.917   6.832   27.600  1.00 57.02  ? 110  ALA A C   1 
ATOM   1730 O  O   . ALA A 1 239 ? 8.487   6.750   28.688  1.00 52.69  ? 110  ALA A O   1 
ATOM   1731 C  CB  . ALA A 1 239 ? 8.368   5.098   25.860  1.00 50.55  ? 110  ALA A CB  1 
ATOM   1732 N  N   . VAL A 1 240 ? 7.725   7.982   26.963  1.00 58.50  ? 111  VAL A N   1 
ATOM   1733 C  CA  . VAL A 1 240 ? 8.163   9.259   27.515  1.00 56.71  ? 111  VAL A CA  1 
ATOM   1734 C  C   . VAL A 1 240 ? 7.456   9.563   28.833  1.00 55.48  ? 111  VAL A C   1 
ATOM   1735 O  O   . VAL A 1 240 ? 8.063   10.067  29.779  1.00 55.25  ? 111  VAL A O   1 
ATOM   1736 C  CB  . VAL A 1 240 ? 7.905   10.409  26.523  1.00 59.71  ? 111  VAL A CB  1 
ATOM   1737 C  CG1 . VAL A 1 240 ? 8.392   11.732  27.090  1.00 59.05  ? 111  VAL A CG1 1 
ATOM   1738 C  CG2 . VAL A 1 240 ? 8.574   10.114  25.191  1.00 69.94  ? 111  VAL A CG2 1 
ATOM   1739 N  N   . ILE A 1 241 ? 6.169   9.243   28.886  1.00 55.37  ? 112  ILE A N   1 
ATOM   1740 C  CA  . ILE A 1 241 ? 5.348   9.527   30.053  1.00 51.04  ? 112  ILE A CA  1 
ATOM   1741 C  C   . ILE A 1 241 ? 5.791   8.709   31.257  1.00 50.58  ? 112  ILE A C   1 
ATOM   1742 O  O   . ILE A 1 241 ? 5.917   9.236   32.364  1.00 53.35  ? 112  ILE A O   1 
ATOM   1743 C  CB  . ILE A 1 241 ? 3.863   9.254   29.761  1.00 53.36  ? 112  ILE A CB  1 
ATOM   1744 C  CG1 . ILE A 1 241 ? 3.414   10.079  28.552  1.00 55.13  ? 112  ILE A CG1 1 
ATOM   1745 C  CG2 . ILE A 1 241 ? 3.010   9.570   30.979  1.00 49.15  ? 112  ILE A CG2 1 
ATOM   1746 C  CD1 . ILE A 1 241 ? 2.035   9.738   28.057  1.00 55.86  ? 112  ILE A CD1 1 
ATOM   1747 N  N   . TYR A 1 242 ? 6.033   7.421   31.036  1.00 47.25  ? 113  TYR A N   1 
ATOM   1748 C  CA  . TYR A 1 242 ? 6.519   6.550   32.097  1.00 47.86  ? 113  TYR A CA  1 
ATOM   1749 C  C   . TYR A 1 242 ? 7.878   7.025   32.611  1.00 49.30  ? 113  TYR A C   1 
ATOM   1750 O  O   . TYR A 1 242 ? 8.119   7.056   33.817  1.00 46.65  ? 113  TYR A O   1 
ATOM   1751 C  CB  . TYR A 1 242 ? 6.606   5.105   31.607  1.00 46.79  ? 113  TYR A CB  1 
ATOM   1752 C  CG  . TYR A 1 242 ? 5.261   4.487   31.304  1.00 49.47  ? 113  TYR A CG  1 
ATOM   1753 C  CD1 . TYR A 1 242 ? 4.132   4.852   32.025  1.00 51.64  ? 113  TYR A CD1 1 
ATOM   1754 C  CD2 . TYR A 1 242 ? 5.115   3.545   30.292  1.00 52.97  ? 113  TYR A CD2 1 
ATOM   1755 C  CE1 . TYR A 1 242 ? 2.894   4.294   31.751  1.00 53.32  ? 113  TYR A CE1 1 
ATOM   1756 C  CE2 . TYR A 1 242 ? 3.881   2.982   30.011  1.00 53.27  ? 113  TYR A CE2 1 
ATOM   1757 C  CZ  . TYR A 1 242 ? 2.776   3.361   30.744  1.00 54.00  ? 113  TYR A CZ  1 
ATOM   1758 O  OH  . TYR A 1 242 ? 1.548   2.804   30.472  1.00 55.04  ? 113  TYR A OH  1 
ATOM   1759 N  N   . MET A 1 243 ? 8.754   7.413   31.691  1.00 50.43  ? 114  MET A N   1 
ATOM   1760 C  CA  . MET A 1 243 ? 10.080  7.893   32.059  1.00 51.08  ? 114  MET A CA  1 
ATOM   1761 C  C   . MET A 1 243 ? 10.013  9.238   32.780  1.00 49.08  ? 114  MET A C   1 
ATOM   1762 O  O   . MET A 1 243 ? 10.885  9.559   33.589  1.00 51.62  ? 114  MET A O   1 
ATOM   1763 C  CB  . MET A 1 243 ? 10.976  8.003   30.821  1.00 51.06  ? 114  MET A CB  1 
ATOM   1764 C  CG  . MET A 1 243 ? 11.339  6.663   30.202  1.00 50.73  ? 114  MET A CG  1 
ATOM   1765 S  SD  . MET A 1 243 ? 12.505  6.806   28.833  1.00 56.99  ? 114  MET A SD  1 
ATOM   1766 C  CE  . MET A 1 243 ? 11.596  7.857   27.706  1.00 56.27  ? 114  MET A CE  1 
ATOM   1767 N  N   . ALA A 1 244 ? 8.979   10.021  32.488  1.00 45.39  ? 115  ALA A N   1 
ATOM   1768 C  CA  . ALA A 1 244 ? 8.802   11.315  33.140  1.00 50.37  ? 115  ALA A CA  1 
ATOM   1769 C  C   . ALA A 1 244 ? 8.448   11.141  34.616  1.00 49.14  ? 115  ALA A C   1 
ATOM   1770 O  O   . ALA A 1 244 ? 8.917   11.892  35.471  1.00 46.53  ? 115  ALA A O   1 
ATOM   1771 C  CB  . ALA A 1 244 ? 7.731   12.129  32.430  1.00 52.68  ? 115  ALA A CB  1 
ATOM   1772 N  N   . ASN A 1 245 ? 7.613   10.150  34.909  1.00 48.78  ? 116  ASN A N   1 
ATOM   1773 C  CA  . ASN A 1 245 ? 7.241   9.849   36.286  1.00 49.83  ? 116  ASN A CA  1 
ATOM   1774 C  C   . ASN A 1 245 ? 8.389   9.184   37.019  1.00 47.86  ? 116  ASN A C   1 
ATOM   1775 O  O   . ASN A 1 245 ? 8.579   9.384   38.220  1.00 48.90  ? 116  ASN A O   1 
ATOM   1776 C  CB  . ASN A 1 245 ? 6.007   8.952   36.327  1.00 51.75  ? 116  ASN A CB  1 
ATOM   1777 C  CG  . ASN A 1 245 ? 4.780   9.636   35.779  1.00 49.75  ? 116  ASN A CG  1 
ATOM   1778 O  OD1 . ASN A 1 245 ? 4.259   9.254   34.733  1.00 49.37  ? 116  ASN A OD1 1 
ATOM   1779 N  ND2 . ASN A 1 245 ? 4.314   10.661  36.480  1.00 45.24  ? 116  ASN A ND2 1 
ATOM   1780 N  N   . LEU A 1 246 ? 9.143   8.381   36.277  1.00 49.28  ? 117  LEU A N   1 
ATOM   1781 C  CA  . LEU A 1 246 ? 10.345  7.750   36.790  1.00 46.56  ? 117  LEU A CA  1 
ATOM   1782 C  C   . LEU A 1 246 ? 11.314  8.822   37.267  1.00 47.78  ? 117  LEU A C   1 
ATOM   1783 O  O   . LEU A 1 246 ? 11.834  8.760   38.381  1.00 47.07  ? 117  LEU A O   1 
ATOM   1784 C  CB  . LEU A 1 246 ? 10.989  6.887   35.711  1.00 46.69  ? 117  LEU A CB  1 
ATOM   1785 C  CG  . LEU A 1 246 ? 11.871  5.741   36.195  1.00 51.86  ? 117  LEU A CG  1 
ATOM   1786 C  CD1 . LEU A 1 246 ? 11.027  4.715   36.926  1.00 49.54  ? 117  LEU A CD1 1 
ATOM   1787 C  CD2 . LEU A 1 246 ? 12.598  5.107   35.024  1.00 54.60  ? 117  LEU A CD2 1 
ATOM   1788 N  N   . ALA A 1 247 ? 11.542  9.812   36.411  1.00 47.67  ? 118  ALA A N   1 
ATOM   1789 C  CA  . ALA A 1 247 ? 12.379  10.952  36.757  1.00 46.93  ? 118  ALA A CA  1 
ATOM   1790 C  C   . ALA A 1 247 ? 11.761  11.739  37.906  1.00 45.02  ? 118  ALA A C   1 
ATOM   1791 O  O   . ALA A 1 247 ? 12.473  12.275  38.752  1.00 43.87  ? 118  ALA A O   1 
ATOM   1792 C  CB  . ALA A 1 247 ? 12.584  11.852  35.548  1.00 46.52  ? 118  ALA A CB  1 
ATOM   1793 N  N   . LEU A 1 248 ? 10.434  11.799  37.933  1.00 47.53  ? 119  LEU A N   1 
ATOM   1794 C  CA  . LEU A 1 248 ? 9.717   12.532  38.972  1.00 47.40  ? 119  LEU A CA  1 
ATOM   1795 C  C   . LEU A 1 248 ? 9.845   11.825  40.319  1.00 44.80  ? 119  LEU A C   1 
ATOM   1796 O  O   . LEU A 1 248 ? 10.089  12.462  41.345  1.00 42.07  ? 119  LEU A O   1 
ATOM   1797 C  CB  . LEU A 1 248 ? 8.244   12.700  38.594  1.00 44.61  ? 119  LEU A CB  1 
ATOM   1798 C  CG  . LEU A 1 248 ? 7.369   13.469  39.586  1.00 47.02  ? 119  LEU A CG  1 
ATOM   1799 C  CD1 . LEU A 1 248 ? 7.941   14.853  39.852  1.00 43.66  ? 119  LEU A CD1 1 
ATOM   1800 C  CD2 . LEU A 1 248 ? 5.940   13.565  39.073  1.00 47.19  ? 119  LEU A CD2 1 
ATOM   1801 N  N   . ALA A 1 249 ? 9.680   10.506  40.302  1.00 44.54  ? 120  ALA A N   1 
ATOM   1802 C  CA  . ALA A 1 249 ? 9.888   9.683   41.488  1.00 42.72  ? 120  ALA A CA  1 
ATOM   1803 C  C   . ALA A 1 249 ? 11.304  9.857   42.028  1.00 45.10  ? 120  ALA A C   1 
ATOM   1804 O  O   . ALA A 1 249 ? 11.511  9.917   43.237  1.00 50.36  ? 120  ALA A O   1 
ATOM   1805 C  CB  . ALA A 1 249 ? 9.618   8.223   41.174  1.00 44.43  ? 120  ALA A CB  1 
ATOM   1806 N  N   . ASP A 1 250 ? 12.274  9.935   41.122  1.00 44.80  ? 121  ASP A N   1 
ATOM   1807 C  CA  . ASP A 1 250 ? 13.667  10.172  41.489  1.00 44.75  ? 121  ASP A CA  1 
ATOM   1808 C  C   . ASP A 1 250 ? 13.844  11.509  42.190  1.00 44.22  ? 121  ASP A C   1 
ATOM   1809 O  O   . ASP A 1 250 ? 14.452  11.591  43.260  1.00 40.86  ? 121  ASP A O   1 
ATOM   1810 C  CB  . ASP A 1 250 ? 14.569  10.136  40.251  1.00 45.94  ? 121  ASP A CB  1 
ATOM   1811 C  CG  . ASP A 1 250 ? 14.740  8.746   39.694  1.00 45.16  ? 121  ASP A CG  1 
ATOM   1812 O  OD1 . ASP A 1 250 ? 14.618  7.784   40.470  1.00 44.01  ? 121  ASP A OD1 1 
ATOM   1813 O  OD2 . ASP A 1 250 ? 15.008  8.616   38.483  1.00 49.54  ? 121  ASP A OD2 1 
ATOM   1814 N  N   . LEU A 1 251 ? 13.325  12.555  41.556  1.00 43.32  ? 122  LEU A N   1 
ATOM   1815 C  CA  . LEU A 1 251 ? 13.500  13.917  42.031  1.00 43.58  ? 122  LEU A CA  1 
ATOM   1816 C  C   . LEU A 1 251 ? 12.854  14.112  43.388  1.00 47.10  ? 122  LEU A C   1 
ATOM   1817 O  O   . LEU A 1 251 ? 13.455  14.683  44.297  1.00 45.38  ? 122  LEU A O   1 
ATOM   1818 C  CB  . LEU A 1 251 ? 12.915  14.908  41.028  1.00 43.69  ? 122  LEU A CB  1 
ATOM   1819 C  CG  . LEU A 1 251 ? 13.699  15.109  39.735  1.00 43.69  ? 122  LEU A CG  1 
ATOM   1820 C  CD1 . LEU A 1 251 ? 12.928  16.012  38.783  1.00 44.73  ? 122  LEU A CD1 1 
ATOM   1821 C  CD2 . LEU A 1 251 ? 15.069  15.688  40.046  1.00 42.78  ? 122  LEU A CD2 1 
ATOM   1822 N  N   . LEU A 1 252 ? 11.629  13.616  43.522  1.00 46.46  ? 123  LEU A N   1 
ATOM   1823 C  CA  . LEU A 1 252 ? 10.858  13.790  44.744  1.00 45.29  ? 123  LEU A CA  1 
ATOM   1824 C  C   . LEU A 1 252 ? 11.485  13.098  45.952  1.00 44.92  ? 123  LEU A C   1 
ATOM   1825 O  O   . LEU A 1 252 ? 11.015  13.269  47.078  1.00 47.49  ? 123  LEU A O   1 
ATOM   1826 C  CB  . LEU A 1 252 ? 9.431   13.281  44.542  1.00 44.30  ? 123  LEU A CB  1 
ATOM   1827 C  CG  . LEU A 1 252 ? 8.528   14.172  43.692  1.00 42.92  ? 123  LEU A CG  1 
ATOM   1828 C  CD1 . LEU A 1 252 ? 7.077   13.768  43.871  1.00 44.14  ? 123  LEU A CD1 1 
ATOM   1829 C  CD2 . LEU A 1 252 ? 8.730   15.638  44.044  1.00 43.61  ? 123  LEU A CD2 1 
ATOM   1830 N  N   . SER A 1 253 ? 12.540  12.321  45.730  1.00 41.69  ? 124  SER A N   1 
ATOM   1831 C  CA  . SER A 1 253 ? 13.252  11.705  46.845  1.00 47.01  ? 124  SER A CA  1 
ATOM   1832 C  C   . SER A 1 253 ? 14.628  12.334  47.068  1.00 43.41  ? 124  SER A C   1 
ATOM   1833 O  O   . SER A 1 253 ? 15.050  12.528  48.202  1.00 45.82  ? 124  SER A O   1 
ATOM   1834 C  CB  . SER A 1 253 ? 13.405  10.200  46.628  1.00 46.12  ? 124  SER A CB  1 
ATOM   1835 O  OG  . SER A 1 253 ? 14.025  9.600   47.751  1.00 48.71  ? 124  SER A OG  1 
ATOM   1836 N  N   . VAL A 1 254 ? 15.319  12.658  45.983  1.00 43.49  ? 125  VAL A N   1 
ATOM   1837 C  CA  . VAL A 1 254 ? 16.685  13.164  46.070  1.00 45.65  ? 125  VAL A CA  1 
ATOM   1838 C  C   . VAL A 1 254 ? 16.723  14.585  46.642  1.00 44.91  ? 125  VAL A C   1 
ATOM   1839 O  O   . VAL A 1 254 ? 17.712  14.991  47.257  1.00 47.89  ? 125  VAL A O   1 
ATOM   1840 C  CB  . VAL A 1 254 ? 17.383  13.117  44.680  1.00 43.14  ? 125  VAL A CB  1 
ATOM   1841 C  CG1 . VAL A 1 254 ? 18.748  13.786  44.715  1.00 40.97  ? 125  VAL A CG1 1 
ATOM   1842 C  CG2 . VAL A 1 254 ? 17.527  11.678  44.217  1.00 42.67  ? 125  VAL A CG2 1 
ATOM   1843 N  N   . ILE A 1 255 ? 15.637  15.332  46.465  1.00 43.00  ? 126  ILE A N   1 
ATOM   1844 C  CA  . ILE A 1 255 ? 15.581  16.710  46.947  1.00 44.58  ? 126  ILE A CA  1 
ATOM   1845 C  C   . ILE A 1 255 ? 15.643  16.755  48.477  1.00 44.36  ? 126  ILE A C   1 
ATOM   1846 O  O   . ILE A 1 255 ? 16.127  17.724  49.063  1.00 48.23  ? 126  ILE A O   1 
ATOM   1847 C  CB  . ILE A 1 255 ? 14.314  17.429  46.427  1.00 46.27  ? 126  ILE A CB  1 
ATOM   1848 C  CG1 . ILE A 1 255 ? 14.420  17.629  44.915  1.00 50.24  ? 126  ILE A CG1 1 
ATOM   1849 C  CG2 . ILE A 1 255 ? 14.131  18.782  47.088  1.00 44.34  ? 126  ILE A CG2 1 
ATOM   1850 C  CD1 . ILE A 1 255 ? 13.225  18.321  44.298  1.00 68.44  ? 126  ILE A CD1 1 
ATOM   1851 N  N   . TRP A 1 256 ? 15.195  15.685  49.124  1.00 43.94  ? 127  TRP A N   1 
ATOM   1852 C  CA  . TRP A 1 256 ? 15.214  15.632  50.582  1.00 44.45  ? 127  TRP A CA  1 
ATOM   1853 C  C   . TRP A 1 256 ? 16.547  15.136  51.140  1.00 46.57  ? 127  TRP A C   1 
ATOM   1854 O  O   . TRP A 1 256 ? 16.747  15.115  52.356  1.00 47.13  ? 127  TRP A O   1 
ATOM   1855 C  CB  . TRP A 1 256 ? 14.073  14.747  51.090  1.00 45.40  ? 127  TRP A CB  1 
ATOM   1856 C  CG  . TRP A 1 256 ? 12.714  15.263  50.716  1.00 50.77  ? 127  TRP A CG  1 
ATOM   1857 C  CD1 . TRP A 1 256 ? 11.865  14.743  49.781  1.00 47.32  ? 127  TRP A CD1 1 
ATOM   1858 C  CD2 . TRP A 1 256 ? 12.057  16.416  51.256  1.00 48.59  ? 127  TRP A CD2 1 
ATOM   1859 N  NE1 . TRP A 1 256 ? 10.717  15.495  49.713  1.00 47.82  ? 127  TRP A NE1 1 
ATOM   1860 C  CE2 . TRP A 1 256 ? 10.810  16.529  50.608  1.00 49.05  ? 127  TRP A CE2 1 
ATOM   1861 C  CE3 . TRP A 1 256 ? 12.400  17.361  52.227  1.00 49.25  ? 127  TRP A CE3 1 
ATOM   1862 C  CZ2 . TRP A 1 256 ? 9.908   17.547  50.900  1.00 53.10  ? 127  TRP A CZ2 1 
ATOM   1863 C  CZ3 . TRP A 1 256 ? 11.504  18.371  52.515  1.00 50.85  ? 127  TRP A CZ3 1 
ATOM   1864 C  CH2 . TRP A 1 256 ? 10.272  18.456  51.854  1.00 55.72  ? 127  TRP A CH2 1 
ATOM   1865 N  N   . PHE A 1 257 ? 17.458  14.746  50.251  1.00 44.17  ? 128  PHE A N   1 
ATOM   1866 C  CA  . PHE A 1 257 ? 18.748  14.193  50.667  1.00 43.59  ? 128  PHE A CA  1 
ATOM   1867 C  C   . PHE A 1 257 ? 19.658  15.120  51.494  1.00 45.03  ? 128  PHE A C   1 
ATOM   1868 O  O   . PHE A 1 257 ? 20.378  14.629  52.357  1.00 43.71  ? 128  PHE A O   1 
ATOM   1869 C  CB  . PHE A 1 257 ? 19.524  13.696  49.446  1.00 42.87  ? 128  PHE A CB  1 
ATOM   1870 C  CG  . PHE A 1 257 ? 19.207  12.279  49.069  1.00 43.06  ? 128  PHE A CG  1 
ATOM   1871 C  CD1 . PHE A 1 257 ? 17.945  11.759  49.295  1.00 43.82  ? 128  PHE A CD1 1 
ATOM   1872 C  CD2 . PHE A 1 257 ? 20.175  11.461  48.510  1.00 36.88  ? 128  PHE A CD2 1 
ATOM   1873 C  CE1 . PHE A 1 257 ? 17.646  10.453  48.954  1.00 41.05  ? 128  PHE A CE1 1 
ATOM   1874 C  CE2 . PHE A 1 257 ? 19.883  10.155  48.170  1.00 36.41  ? 128  PHE A CE2 1 
ATOM   1875 C  CZ  . PHE A 1 257 ? 18.617  9.651   48.393  1.00 39.92  ? 128  PHE A CZ  1 
ATOM   1876 N  N   . PRO A 1 258 ? 19.657  16.444  51.228  1.00 45.88  ? 129  PRO A N   1 
ATOM   1877 C  CA  . PRO A 1 258 ? 20.437  17.324  52.110  1.00 44.94  ? 129  PRO A CA  1 
ATOM   1878 C  C   . PRO A 1 258 ? 20.084  17.191  53.596  1.00 47.14  ? 129  PRO A C   1 
ATOM   1879 O  O   . PRO A 1 258 ? 20.962  17.311  54.452  1.00 46.89  ? 129  PRO A O   1 
ATOM   1880 C  CB  . PRO A 1 258 ? 20.083  18.721  51.601  1.00 44.94  ? 129  PRO A CB  1 
ATOM   1881 C  CG  . PRO A 1 258 ? 19.818  18.521  50.163  1.00 45.60  ? 129  PRO A CG  1 
ATOM   1882 C  CD  . PRO A 1 258 ? 19.170  17.172  50.040  1.00 46.47  ? 129  PRO A CD  1 
ATOM   1883 N  N   . LEU A 1 259 ? 18.813  16.950  53.895  1.00 44.14  ? 130  LEU A N   1 
ATOM   1884 C  CA  . LEU A 1 259 ? 18.402  16.689  55.266  1.00 43.99  ? 130  LEU A CA  1 
ATOM   1885 C  C   . LEU A 1 259 ? 18.759  15.257  55.625  1.00 43.91  ? 130  LEU A C   1 
ATOM   1886 O  O   . LEU A 1 259 ? 18.999  14.933  56.784  1.00 45.17  ? 130  LEU A O   1 
ATOM   1887 C  CB  . LEU A 1 259 ? 16.901  16.924  55.458  1.00 44.79  ? 130  LEU A CB  1 
ATOM   1888 C  CG  . LEU A 1 259 ? 16.385  18.364  55.435  1.00 46.83  ? 130  LEU A CG  1 
ATOM   1889 C  CD1 . LEU A 1 259 ? 17.216  19.252  56.349  1.00 49.97  ? 130  LEU A CD1 1 
ATOM   1890 C  CD2 . LEU A 1 259 ? 16.336  18.930  54.018  1.00 48.14  ? 130  LEU A CD2 1 
ATOM   1891 N  N   . LYS A 1 260 ? 18.796  14.399  54.615  1.00 48.93  ? 131  LYS A N   1 
ATOM   1892 C  CA  . LYS A 1 260 ? 19.120  12.997  54.828  1.00 46.86  ? 131  LYS A CA  1 
ATOM   1893 C  C   . LYS A 1 260 ? 20.606  12.832  55.123  1.00 46.38  ? 131  LYS A C   1 
ATOM   1894 O  O   . LYS A 1 260 ? 20.991  12.056  55.994  1.00 45.11  ? 131  LYS A O   1 
ATOM   1895 C  CB  . LYS A 1 260 ? 18.718  12.169  53.610  1.00 42.70  ? 131  LYS A CB  1 
ATOM   1896 C  CG  . LYS A 1 260 ? 18.809  10.675  53.813  1.00 42.51  ? 131  LYS A CG  1 
ATOM   1897 C  CD  . LYS A 1 260 ? 18.302  9.947   52.583  1.00 40.55  ? 131  LYS A CD  1 
ATOM   1898 C  CE  . LYS A 1 260 ? 18.331  8.453   52.788  1.00 42.56  ? 131  LYS A CE  1 
ATOM   1899 N  NZ  . LYS A 1 260 ? 17.720  7.733   51.644  1.00 54.82  ? 131  LYS A NZ  1 
ATOM   1900 N  N   . ILE A 1 261 ? 21.435  13.569  54.390  1.00 46.25  ? 132  ILE A N   1 
ATOM   1901 C  CA  . ILE A 1 261 ? 22.876  13.542  54.599  1.00 43.19  ? 132  ILE A CA  1 
ATOM   1902 C  C   . ILE A 1 261 ? 23.234  14.124  55.969  1.00 43.75  ? 132  ILE A C   1 
ATOM   1903 O  O   . ILE A 1 261 ? 23.981  13.510  56.731  1.00 42.54  ? 132  ILE A O   1 
ATOM   1904 C  CB  . ILE A 1 261 ? 23.620  14.316  53.489  1.00 46.85  ? 132  ILE A CB  1 
ATOM   1905 C  CG1 . ILE A 1 261 ? 23.317  13.705  52.118  1.00 46.56  ? 132  ILE A CG1 1 
ATOM   1906 C  CG2 . ILE A 1 261 ? 25.122  14.301  53.737  1.00 43.68  ? 132  ILE A CG2 1 
ATOM   1907 C  CD1 . ILE A 1 261 ? 23.713  14.583  50.954  1.00 41.08  ? 132  ILE A CD1 1 
ATOM   1908 N  N   . ALA A 1 262 ? 22.685  15.297  56.279  1.00 44.84  ? 133  ALA A N   1 
ATOM   1909 C  CA  . ALA A 1 262 ? 22.923  15.965  57.562  1.00 46.32  ? 133  ALA A CA  1 
ATOM   1910 C  C   . ALA A 1 262 ? 22.559  15.072  58.745  1.00 44.56  ? 133  ALA A C   1 
ATOM   1911 O  O   . ALA A 1 262 ? 23.222  15.089  59.782  1.00 45.84  ? 133  ALA A O   1 
ATOM   1912 C  CB  . ALA A 1 262 ? 22.138  17.267  57.631  1.00 40.53  ? 133  ALA A CB  1 
ATOM   1913 N  N   . TYR A 1 263 ? 21.494  14.297  58.570  1.00 43.45  ? 134  TYR A N   1 
ATOM   1914 C  CA  . TYR A 1 263 ? 21.005  13.369  59.585  1.00 41.59  ? 134  TYR A CA  1 
ATOM   1915 C  C   . TYR A 1 263 ? 22.073  12.369  60.031  1.00 42.81  ? 134  TYR A C   1 
ATOM   1916 O  O   . TYR A 1 263 ? 22.303  12.181  61.227  1.00 42.48  ? 134  TYR A O   1 
ATOM   1917 C  CB  . TYR A 1 263 ? 19.776  12.629  59.045  1.00 39.13  ? 134  TYR A CB  1 
ATOM   1918 C  CG  . TYR A 1 263 ? 19.347  11.431  59.857  1.00 38.97  ? 134  TYR A CG  1 
ATOM   1919 C  CD1 . TYR A 1 263 ? 18.774  11.585  61.115  1.00 39.99  ? 134  TYR A CD1 1 
ATOM   1920 C  CD2 . TYR A 1 263 ? 19.493  10.146  59.355  1.00 37.36  ? 134  TYR A CD2 1 
ATOM   1921 C  CE1 . TYR A 1 263 ? 18.372  10.492  61.852  1.00 38.98  ? 134  TYR A CE1 1 
ATOM   1922 C  CE2 . TYR A 1 263 ? 19.094  9.044   60.087  1.00 39.19  ? 134  TYR A CE2 1 
ATOM   1923 C  CZ  . TYR A 1 263 ? 18.535  9.224   61.336  1.00 40.87  ? 134  TYR A CZ  1 
ATOM   1924 O  OH  . TYR A 1 263 ? 18.138  8.135   62.074  1.00 43.03  ? 134  TYR A OH  1 
ATOM   1925 N  N   . HIS A 1 264 ? 22.726  11.743  59.057  1.00 45.00  ? 135  HIS A N   1 
ATOM   1926 C  CA  . HIS A 1 264 ? 23.713  10.702  59.321  1.00 42.99  ? 135  HIS A CA  1 
ATOM   1927 C  C   . HIS A 1 264 ? 25.044  11.274  59.807  1.00 43.98  ? 135  HIS A C   1 
ATOM   1928 O  O   . HIS A 1 264 ? 25.688  10.702  60.688  1.00 41.91  ? 135  HIS A O   1 
ATOM   1929 C  CB  . HIS A 1 264 ? 23.936  9.860   58.063  1.00 41.17  ? 135  HIS A CB  1 
ATOM   1930 C  CG  . HIS A 1 264 ? 22.759  9.018   57.681  1.00 41.52  ? 135  HIS A CG  1 
ATOM   1931 N  ND1 . HIS A 1 264 ? 22.407  7.875   58.366  1.00 41.68  ? 135  HIS A ND1 1 
ATOM   1932 C  CD2 . HIS A 1 264 ? 21.858  9.146   56.677  1.00 41.18  ? 135  HIS A CD2 1 
ATOM   1933 C  CE1 . HIS A 1 264 ? 21.339  7.338   57.804  1.00 41.63  ? 135  HIS A CE1 1 
ATOM   1934 N  NE2 . HIS A 1 264 ? 20.986  8.089   56.778  1.00 39.63  ? 135  HIS A NE2 1 
ATOM   1935 N  N   . ILE A 1 265 ? 25.452  12.399  59.226  1.00 45.65  ? 136  ILE A N   1 
ATOM   1936 C  CA  . ILE A 1 265 ? 26.702  13.055  59.602  1.00 45.55  ? 136  ILE A CA  1 
ATOM   1937 C  C   . ILE A 1 265 ? 26.726  13.374  61.091  1.00 45.22  ? 136  ILE A C   1 
ATOM   1938 O  O   . ILE A 1 265 ? 27.763  13.274  61.743  1.00 45.65  ? 136  ILE A O   1 
ATOM   1939 C  CB  . ILE A 1 265 ? 26.922  14.355  58.797  1.00 47.33  ? 136  ILE A CB  1 
ATOM   1940 C  CG1 . ILE A 1 265 ? 27.098  14.036  57.311  1.00 43.35  ? 136  ILE A CG1 1 
ATOM   1941 C  CG2 . ILE A 1 265 ? 28.132  15.120  59.319  1.00 43.45  ? 136  ILE A CG2 1 
ATOM   1942 C  CD1 . ILE A 1 265 ? 27.380  15.253  56.455  1.00 43.11  ? 136  ILE A CD1 1 
ATOM   1943 N  N   . HIS A 1 266 ? 25.568  13.735  61.629  1.00 46.49  ? 137  HIS A N   1 
ATOM   1944 C  CA  . HIS A 1 266 ? 25.458  14.081  63.039  1.00 43.78  ? 137  HIS A CA  1 
ATOM   1945 C  C   . HIS A 1 266 ? 25.025  12.883  63.883  1.00 42.12  ? 137  HIS A C   1 
ATOM   1946 O  O   . HIS A 1 266 ? 24.308  13.030  64.871  1.00 43.89  ? 137  HIS A O   1 
ATOM   1947 C  CB  . HIS A 1 266 ? 24.491  15.248  63.215  1.00 43.77  ? 137  HIS A CB  1 
ATOM   1948 C  CG  . HIS A 1 266 ? 24.924  16.492  62.502  1.00 49.49  ? 137  HIS A CG  1 
ATOM   1949 N  ND1 . HIS A 1 266 ? 26.168  17.053  62.685  1.00 52.41  ? 137  HIS A ND1 1 
ATOM   1950 C  CD2 . HIS A 1 266 ? 24.284  17.274  61.605  1.00 57.26  ? 137  HIS A CD2 1 
ATOM   1951 C  CE1 . HIS A 1 266 ? 26.277  18.133  61.932  1.00 54.07  ? 137  HIS A CE1 1 
ATOM   1952 N  NE2 . HIS A 1 266 ? 25.145  18.290  61.264  1.00 66.39  ? 137  HIS A NE2 1 
ATOM   1953 N  N   . GLY A 1 267 ? 25.475  11.698  63.485  1.00 42.09  ? 138  GLY A N   1 
ATOM   1954 C  CA  . GLY A 1 267 ? 25.290  10.499  64.281  1.00 42.73  ? 138  GLY A CA  1 
ATOM   1955 C  C   . GLY A 1 267 ? 23.868  9.982   64.337  1.00 46.10  ? 138  GLY A C   1 
ATOM   1956 O  O   . GLY A 1 267 ? 23.414  9.551   65.396  1.00 55.73  ? 138  GLY A O   1 
ATOM   1957 N  N   . ASN A 1 268 ? 23.172  10.025  63.202  1.00 43.38  ? 139  ASN A N   1 
ATOM   1958 C  CA  . ASN A 1 268 ? 21.802  9.523   63.098  1.00 41.94  ? 139  ASN A CA  1 
ATOM   1959 C  C   . ASN A 1 268 ? 20.860  10.193  64.087  1.00 43.72  ? 139  ASN A C   1 
ATOM   1960 O  O   . ASN A 1 268 ? 20.229  9.526   64.906  1.00 42.62  ? 139  ASN A O   1 
ATOM   1961 C  CB  . ASN A 1 268 ? 21.776  8.010   63.307  1.00 43.04  ? 139  ASN A CB  1 
ATOM   1962 C  CG  . ASN A 1 268 ? 22.743  7.286   62.401  1.00 47.04  ? 139  ASN A CG  1 
ATOM   1963 O  OD1 . ASN A 1 268 ? 22.830  7.579   61.208  1.00 48.64  ? 139  ASN A OD1 1 
ATOM   1964 N  ND2 . ASN A 1 268 ? 23.490  6.343   62.964  1.00 49.48  ? 139  ASN A ND2 1 
ATOM   1965 N  N   . ASN A 1 269 ? 20.767  11.515  64.001  1.00 43.23  ? 140  ASN A N   1 
ATOM   1966 C  CA  . ASN A 1 269 ? 19.988  12.293  64.951  1.00 43.38  ? 140  ASN A CA  1 
ATOM   1967 C  C   . ASN A 1 269 ? 19.070  13.276  64.233  1.00 46.88  ? 140  ASN A C   1 
ATOM   1968 O  O   . ASN A 1 269 ? 19.532  14.208  63.573  1.00 44.78  ? 140  ASN A O   1 
ATOM   1969 C  CB  . ASN A 1 269 ? 20.929  13.022  65.913  1.00 49.17  ? 140  ASN A CB  1 
ATOM   1970 C  CG  . ASN A 1 269 ? 20.194  13.892  66.904  1.00 48.35  ? 140  ASN A CG  1 
ATOM   1971 O  OD1 . ASN A 1 269 ? 19.510  13.396  67.797  1.00 47.29  ? 140  ASN A OD1 1 
ATOM   1972 N  ND2 . ASN A 1 269 ? 20.342  15.201  66.760  1.00 54.39  ? 140  ASN A ND2 1 
ATOM   1973 N  N   . TRP A 1 270 ? 17.764  13.054  64.354  1.00 48.55  ? 141  TRP A N   1 
ATOM   1974 C  CA  . TRP A 1 270 ? 16.789  13.849  63.619  1.00 47.45  ? 141  TRP A CA  1 
ATOM   1975 C  C   . TRP A 1 270 ? 16.178  14.930  64.503  1.00 49.08  ? 141  TRP A C   1 
ATOM   1976 O  O   . TRP A 1 270 ? 15.641  14.648  65.573  1.00 47.65  ? 141  TRP A O   1 
ATOM   1977 C  CB  . TRP A 1 270 ? 15.695  12.949  63.042  1.00 45.50  ? 141  TRP A CB  1 
ATOM   1978 C  CG  . TRP A 1 270 ? 14.774  13.661  62.104  1.00 46.98  ? 141  TRP A CG  1 
ATOM   1979 C  CD1 . TRP A 1 270 ? 13.589  14.256  62.415  1.00 47.96  ? 141  TRP A CD1 1 
ATOM   1980 C  CD2 . TRP A 1 270 ? 14.966  13.856  60.698  1.00 51.16  ? 141  TRP A CD2 1 
ATOM   1981 N  NE1 . TRP A 1 270 ? 13.027  14.809  61.290  1.00 48.62  ? 141  TRP A NE1 1 
ATOM   1982 C  CE2 . TRP A 1 270 ? 13.853  14.578  60.222  1.00 51.22  ? 141  TRP A CE2 1 
ATOM   1983 C  CE3 . TRP A 1 270 ? 15.969  13.489  59.794  1.00 44.46  ? 141  TRP A CE3 1 
ATOM   1984 C  CZ2 . TRP A 1 270 ? 13.715  14.940  58.883  1.00 49.02  ? 141  TRP A CZ2 1 
ATOM   1985 C  CZ3 . TRP A 1 270 ? 15.831  13.851  58.466  1.00 44.94  ? 141  TRP A CZ3 1 
ATOM   1986 C  CH2 . TRP A 1 270 ? 14.712  14.569  58.023  1.00 46.23  ? 141  TRP A CH2 1 
ATOM   1987 N  N   . ILE A 1 271 ? 16.264  16.172  64.040  1.00 51.51  ? 142  ILE A N   1 
ATOM   1988 C  CA  . ILE A 1 271 ? 15.818  17.319  64.817  1.00 55.46  ? 142  ILE A CA  1 
ATOM   1989 C  C   . ILE A 1 271 ? 14.896  18.222  64.006  1.00 57.32  ? 142  ILE A C   1 
ATOM   1990 O  O   . ILE A 1 271 ? 14.760  19.408  64.301  1.00 62.77  ? 142  ILE A O   1 
ATOM   1991 C  CB  . ILE A 1 271 ? 17.017  18.146  65.316  1.00 57.28  ? 142  ILE A CB  1 
ATOM   1992 C  CG1 . ILE A 1 271 ? 17.892  18.574  64.134  1.00 53.72  ? 142  ILE A CG1 1 
ATOM   1993 C  CG2 . ILE A 1 271 ? 17.837  17.348  66.315  1.00 58.31  ? 142  ILE A CG2 1 
ATOM   1994 C  CD1 . ILE A 1 271 ? 19.090  19.408  64.523  1.00 50.19  ? 142  ILE A CD1 1 
ATOM   1995 N  N   . TYR A 1 272 ? 14.255  17.653  62.990  1.00 52.27  ? 143  TYR A N   1 
ATOM   1996 C  CA  . TYR A 1 272 ? 13.433  18.438  62.078  1.00 54.88  ? 143  TYR A CA  1 
ATOM   1997 C  C   . TYR A 1 272 ? 11.943  18.136  62.238  1.00 57.10  ? 143  TYR A C   1 
ATOM   1998 O  O   . TYR A 1 272 ? 11.104  18.754  61.582  1.00 53.96  ? 143  TYR A O   1 
ATOM   1999 C  CB  . TYR A 1 272 ? 13.875  18.193  60.633  1.00 54.74  ? 143  TYR A CB  1 
ATOM   2000 C  CG  . TYR A 1 272 ? 15.344  18.471  60.398  1.00 56.65  ? 143  TYR A CG  1 
ATOM   2001 C  CD1 . TYR A 1 272 ? 15.789  19.749  60.088  1.00 57.77  ? 143  TYR A CD1 1 
ATOM   2002 C  CD2 . TYR A 1 272 ? 16.288  17.456  60.497  1.00 57.12  ? 143  TYR A CD2 1 
ATOM   2003 C  CE1 . TYR A 1 272 ? 17.132  20.010  59.879  1.00 57.45  ? 143  TYR A CE1 1 
ATOM   2004 C  CE2 . TYR A 1 272 ? 17.635  17.706  60.290  1.00 64.51  ? 143  TYR A CE2 1 
ATOM   2005 C  CZ  . TYR A 1 272 ? 18.050  18.984  59.980  1.00 63.64  ? 143  TYR A CZ  1 
ATOM   2006 O  OH  . TYR A 1 272 ? 19.387  19.237  59.772  1.00 67.64  ? 143  TYR A OH  1 
ATOM   2007 N  N   . GLY A 1 273 ? 11.618  17.189  63.112  1.00 56.56  ? 144  GLY A N   1 
ATOM   2008 C  CA  . GLY A 1 273 ? 10.229  16.882  63.405  1.00 58.67  ? 144  GLY A CA  1 
ATOM   2009 C  C   . GLY A 1 273 ? 9.761   15.530  62.902  1.00 55.70  ? 144  GLY A C   1 
ATOM   2010 O  O   . GLY A 1 273 ? 10.324  14.979  61.957  1.00 53.17  ? 144  GLY A O   1 
ATOM   2011 N  N   . GLU A 1 274 ? 8.716   15.003  63.536  1.00 56.95  ? 145  GLU A N   1 
ATOM   2012 C  CA  . GLU A 1 274 ? 8.168   13.694  63.192  1.00 57.87  ? 145  GLU A CA  1 
ATOM   2013 C  C   . GLU A 1 274 ? 7.507   13.685  61.819  1.00 54.58  ? 145  GLU A C   1 
ATOM   2014 O  O   . GLU A 1 274 ? 7.644   12.727  61.056  1.00 49.46  ? 145  GLU A O   1 
ATOM   2015 C  CB  . GLU A 1 274 ? 7.155   13.251  64.245  1.00 58.94  ? 145  GLU A CB  1 
ATOM   2016 C  CG  . GLU A 1 274 ? 7.717   13.187  65.644  1.00 64.72  ? 145  GLU A CG  1 
ATOM   2017 C  CD  . GLU A 1 274 ? 6.656   12.881  66.675  1.00 76.89  ? 145  GLU A CD  1 
ATOM   2018 O  OE1 . GLU A 1 274 ? 5.531   12.510  66.276  1.00 73.34  ? 145  GLU A OE1 1 
ATOM   2019 O  OE2 . GLU A 1 274 ? 6.947   13.016  67.882  1.00 74.44  ? 145  GLU A OE2 1 
ATOM   2020 N  N   . ALA A 1 275 ? 6.776   14.752  61.520  1.00 52.90  ? 146  ALA A N   1 
ATOM   2021 C  CA  . ALA A 1 275 ? 6.070   14.863  60.254  1.00 52.79  ? 146  ALA A CA  1 
ATOM   2022 C  C   . ALA A 1 275 ? 7.047   14.887  59.081  1.00 52.21  ? 146  ALA A C   1 
ATOM   2023 O  O   . ALA A 1 275 ? 6.811   14.255  58.047  1.00 46.33  ? 146  ALA A O   1 
ATOM   2024 C  CB  . ALA A 1 275 ? 5.196   16.107  60.246  1.00 49.56  ? 146  ALA A CB  1 
ATOM   2025 N  N   . LEU A 1 276 ? 8.147   15.613  59.251  1.00 50.36  ? 147  LEU A N   1 
ATOM   2026 C  CA  . LEU A 1 276 ? 9.121   15.788  58.180  1.00 47.29  ? 147  LEU A CA  1 
ATOM   2027 C  C   . LEU A 1 276 ? 9.940   14.518  57.985  1.00 46.68  ? 147  LEU A C   1 
ATOM   2028 O  O   . LEU A 1 276 ? 10.448  14.253  56.897  1.00 45.09  ? 147  LEU A O   1 
ATOM   2029 C  CB  . LEU A 1 276 ? 10.029  16.978  58.480  1.00 47.54  ? 147  LEU A CB  1 
ATOM   2030 C  CG  . LEU A 1 276 ? 10.945  17.467  57.359  1.00 47.81  ? 147  LEU A CG  1 
ATOM   2031 C  CD1 . LEU A 1 276 ? 10.176  17.624  56.058  1.00 48.12  ? 147  LEU A CD1 1 
ATOM   2032 C  CD2 . LEU A 1 276 ? 11.591  18.783  57.754  1.00 48.27  ? 147  LEU A CD2 1 
ATOM   2033 N  N   . CYS A 1 277 ? 10.061  13.737  59.053  1.00 48.18  ? 148  CYS A N   1 
ATOM   2034 C  CA  . CYS A 1 277 ? 10.674  12.418  58.987  1.00 42.70  ? 148  CYS A CA  1 
ATOM   2035 C  C   . CYS A 1 277 ? 9.834   11.486  58.123  1.00 43.67  ? 148  CYS A C   1 
ATOM   2036 O  O   . CYS A 1 277 ? 10.348  10.800  57.240  1.00 43.51  ? 148  CYS A O   1 
ATOM   2037 C  CB  . CYS A 1 277 ? 10.835  11.838  60.395  1.00 46.05  ? 148  CYS A CB  1 
ATOM   2038 S  SG  . CYS A 1 277 ? 11.239  10.076  60.478  1.00 47.05  ? 148  CYS A SG  1 
ATOM   2039 N  N   . ASN A 1 278 ? 8.530   11.478  58.380  1.00 48.75  ? 149  ASN A N   1 
ATOM   2040 C  CA  . ASN A 1 278 ? 7.606   10.611  57.660  1.00 44.98  ? 149  ASN A CA  1 
ATOM   2041 C  C   . ASN A 1 278 ? 7.461   11.008  56.197  1.00 41.98  ? 149  ASN A C   1 
ATOM   2042 O  O   . ASN A 1 278 ? 7.074   10.193  55.362  1.00 42.45  ? 149  ASN A O   1 
ATOM   2043 C  CB  . ASN A 1 278 ? 6.242   10.610  58.350  1.00 45.06  ? 149  ASN A CB  1 
ATOM   2044 C  CG  . ASN A 1 278 ? 6.277   9.909   59.691  1.00 45.18  ? 149  ASN A CG  1 
ATOM   2045 O  OD1 . ASN A 1 278 ? 7.338   9.769   60.299  1.00 51.95  ? 149  ASN A OD1 1 
ATOM   2046 N  ND2 . ASN A 1 278 ? 5.120   9.456   60.158  1.00 42.44  ? 149  ASN A ND2 1 
ATOM   2047 N  N   . VAL A 1 279 ? 7.778   12.263  55.893  1.00 41.41  ? 150  VAL A N   1 
ATOM   2048 C  CA  . VAL A 1 279 ? 7.834   12.730  54.514  1.00 43.35  ? 150  VAL A CA  1 
ATOM   2049 C  C   . VAL A 1 279 ? 8.945   12.010  53.764  1.00 43.48  ? 150  VAL A C   1 
ATOM   2050 O  O   . VAL A 1 279 ? 8.711   11.387  52.727  1.00 41.98  ? 150  VAL A O   1 
ATOM   2051 C  CB  . VAL A 1 279 ? 8.073   14.249  54.436  1.00 44.55  ? 150  VAL A CB  1 
ATOM   2052 C  CG1 . VAL A 1 279 ? 8.500   14.652  53.029  1.00 47.08  ? 150  VAL A CG1 1 
ATOM   2053 C  CG2 . VAL A 1 279 ? 6.827   15.004  54.862  1.00 48.19  ? 150  VAL A CG2 1 
ATOM   2054 N  N   . LEU A 1 280 ? 10.156  12.102  54.308  1.00 46.34  ? 151  LEU A N   1 
ATOM   2055 C  CA  . LEU A 1 280 ? 11.322  11.445  53.734  1.00 42.27  ? 151  LEU A CA  1 
ATOM   2056 C  C   . LEU A 1 280 ? 11.101  9.948   53.602  1.00 41.88  ? 151  LEU A C   1 
ATOM   2057 O  O   . LEU A 1 280 ? 11.408  9.354   52.566  1.00 39.96  ? 151  LEU A O   1 
ATOM   2058 C  CB  . LEU A 1 280 ? 12.562  11.712  54.586  1.00 42.61  ? 151  LEU A CB  1 
ATOM   2059 C  CG  . LEU A 1 280 ? 13.395  12.940  54.214  1.00 45.80  ? 151  LEU A CG  1 
ATOM   2060 C  CD1 . LEU A 1 280 ? 12.653  14.236  54.532  1.00 40.50  ? 151  LEU A CD1 1 
ATOM   2061 C  CD2 . LEU A 1 280 ? 14.754  12.891  54.906  1.00 43.49  ? 151  LEU A CD2 1 
ATOM   2062 N  N   . ILE A 1 281 ? 10.568  9.346   54.659  1.00 41.48  ? 152  ILE A N   1 
ATOM   2063 C  CA  . ILE A 1 281 ? 10.258  7.924   54.654  1.00 42.44  ? 152  ILE A CA  1 
ATOM   2064 C  C   . ILE A 1 281 ? 9.264   7.579   53.552  1.00 42.38  ? 152  ILE A C   1 
ATOM   2065 O  O   . ILE A 1 281 ? 9.441   6.593   52.833  1.00 41.64  ? 152  ILE A O   1 
ATOM   2066 C  CB  . ILE A 1 281 ? 9.697   7.477   56.008  1.00 40.37  ? 152  ILE A CB  1 
ATOM   2067 C  CG1 . ILE A 1 281 ? 10.788  7.577   57.072  1.00 39.76  ? 152  ILE A CG1 1 
ATOM   2068 C  CG2 . ILE A 1 281 ? 9.145   6.061   55.926  1.00 39.30  ? 152  ILE A CG2 1 
ATOM   2069 C  CD1 . ILE A 1 281 ? 10.343  7.146   58.434  1.00 39.76  ? 152  ILE A CD1 1 
ATOM   2070 N  N   . GLY A 1 282 ? 8.232   8.407   53.416  1.00 43.23  ? 153  GLY A N   1 
ATOM   2071 C  CA  . GLY A 1 282 ? 7.209   8.204   52.409  1.00 41.57  ? 153  GLY A CA  1 
ATOM   2072 C  C   . GLY A 1 282 ? 7.781   8.236   51.007  1.00 44.95  ? 153  GLY A C   1 
ATOM   2073 O  O   . GLY A 1 282 ? 7.599   7.294   50.237  1.00 44.03  ? 153  GLY A O   1 
ATOM   2074 N  N   . PHE A 1 283 ? 8.491   9.313   50.682  1.00 43.67  ? 154  PHE A N   1 
ATOM   2075 C  CA  . PHE A 1 283 ? 9.037   9.490   49.342  1.00 42.82  ? 154  PHE A CA  1 
ATOM   2076 C  C   . PHE A 1 283 ? 10.172  8.523   49.053  1.00 43.85  ? 154  PHE A C   1 
ATOM   2077 O  O   . PHE A 1 283 ? 10.509  8.279   47.896  1.00 46.44  ? 154  PHE A O   1 
ATOM   2078 C  CB  . PHE A 1 283 ? 9.516   10.926  49.142  1.00 44.30  ? 154  PHE A CB  1 
ATOM   2079 C  CG  . PHE A 1 283 ? 8.406   11.899  48.881  1.00 48.93  ? 154  PHE A CG  1 
ATOM   2080 C  CD1 . PHE A 1 283 ? 7.720   11.876  47.677  1.00 47.36  ? 154  PHE A CD1 1 
ATOM   2081 C  CD2 . PHE A 1 283 ? 8.046   12.837  49.835  1.00 47.77  ? 154  PHE A CD2 1 
ATOM   2082 C  CE1 . PHE A 1 283 ? 6.693   12.769  47.431  1.00 48.76  ? 154  PHE A CE1 1 
ATOM   2083 C  CE2 . PHE A 1 283 ? 7.022   13.733  49.594  1.00 45.02  ? 154  PHE A CE2 1 
ATOM   2084 C  CZ  . PHE A 1 283 ? 6.344   13.700  48.393  1.00 48.00  ? 154  PHE A CZ  1 
ATOM   2085 N  N   . PHE A 1 284 ? 10.767  7.975   50.104  1.00 44.99  ? 155  PHE A N   1 
ATOM   2086 C  CA  . PHE A 1 284 ? 11.796  6.966   49.921  1.00 42.84  ? 155  PHE A CA  1 
ATOM   2087 C  C   . PHE A 1 284 ? 11.185  5.694   49.359  1.00 42.75  ? 155  PHE A C   1 
ATOM   2088 O  O   . PHE A 1 284 ? 11.587  5.213   48.301  1.00 42.21  ? 155  PHE A O   1 
ATOM   2089 C  CB  . PHE A 1 284 ? 12.512  6.659   51.233  1.00 41.24  ? 155  PHE A CB  1 
ATOM   2090 C  CG  . PHE A 1 284 ? 13.431  5.480   51.143  1.00 39.68  ? 155  PHE A CG  1 
ATOM   2091 C  CD1 . PHE A 1 284 ? 13.028  4.234   51.593  1.00 38.07  ? 155  PHE A CD1 1 
ATOM   2092 C  CD2 . PHE A 1 284 ? 14.685  5.610   50.577  1.00 38.82  ? 155  PHE A CD2 1 
ATOM   2093 C  CE1 . PHE A 1 284 ? 13.867  3.145   51.498  1.00 40.10  ? 155  PHE A CE1 1 
ATOM   2094 C  CE2 . PHE A 1 284 ? 15.529  4.528   50.480  1.00 39.73  ? 155  PHE A CE2 1 
ATOM   2095 C  CZ  . PHE A 1 284 ? 15.121  3.291   50.942  1.00 40.83  ? 155  PHE A CZ  1 
ATOM   2096 N  N   . TYR A 1 285 ? 10.210  5.152   50.080  1.00 45.02  ? 156  TYR A N   1 
ATOM   2097 C  CA  . TYR A 1 285 ? 9.538   3.928   49.665  1.00 44.94  ? 156  TYR A CA  1 
ATOM   2098 C  C   . TYR A 1 285 ? 8.692   4.155   48.415  1.00 48.28  ? 156  TYR A C   1 
ATOM   2099 O  O   . TYR A 1 285 ? 8.462   3.228   47.636  1.00 48.10  ? 156  TYR A O   1 
ATOM   2100 C  CB  . TYR A 1 285 ? 8.679   3.381   50.805  1.00 42.77  ? 156  TYR A CB  1 
ATOM   2101 C  CG  . TYR A 1 285 ? 9.490   2.749   51.907  1.00 41.28  ? 156  TYR A CG  1 
ATOM   2102 C  CD1 . TYR A 1 285 ? 9.868   3.480   53.024  1.00 42.08  ? 156  TYR A CD1 1 
ATOM   2103 C  CD2 . TYR A 1 285 ? 9.894   1.424   51.823  1.00 43.34  ? 156  TYR A CD2 1 
ATOM   2104 C  CE1 . TYR A 1 285 ? 10.621  2.903   54.036  1.00 42.41  ? 156  TYR A CE1 1 
ATOM   2105 C  CE2 . TYR A 1 285 ? 10.645  0.839   52.826  1.00 45.04  ? 156  TYR A CE2 1 
ATOM   2106 C  CZ  . TYR A 1 285 ? 11.005  1.582   53.929  1.00 45.73  ? 156  TYR A CZ  1 
ATOM   2107 O  OH  . TYR A 1 285 ? 11.753  0.999   54.926  1.00 46.22  ? 156  TYR A OH  1 
ATOM   2108 N  N   . ALA A 1 286 ? 8.239   5.391   48.225  1.00 46.59  ? 157  ALA A N   1 
ATOM   2109 C  CA  . ALA A 1 286 ? 7.516   5.752   47.014  1.00 42.26  ? 157  ALA A CA  1 
ATOM   2110 C  C   . ALA A 1 286 ? 8.400   5.543   45.788  1.00 47.87  ? 157  ALA A C   1 
ATOM   2111 O  O   . ALA A 1 286 ? 8.024   4.813   44.872  1.00 49.13  ? 157  ALA A O   1 
ATOM   2112 C  CB  . ALA A 1 286 ? 7.033   7.188   47.084  1.00 41.98  ? 157  ALA A CB  1 
ATOM   2113 N  N   . ASN A 1 287 ? 9.573   6.176   45.775  1.00 47.30  ? 158  ASN A N   1 
ATOM   2114 C  CA  . ASN A 1 287 ? 10.510  6.009   44.666  1.00 48.77  ? 158  ASN A CA  1 
ATOM   2115 C  C   . ASN A 1 287 ? 10.963  4.564   44.535  1.00 47.00  ? 158  ASN A C   1 
ATOM   2116 O  O   . ASN A 1 287 ? 11.223  4.082   43.437  1.00 46.37  ? 158  ASN A O   1 
ATOM   2117 C  CB  . ASN A 1 287 ? 11.731  6.912   44.828  1.00 46.30  ? 158  ASN A CB  1 
ATOM   2118 C  CG  . ASN A 1 287 ? 12.889  6.477   43.945  1.00 46.98  ? 158  ASN A CG  1 
ATOM   2119 O  OD1 . ASN A 1 287 ? 12.846  6.623   42.720  1.00 55.70  ? 158  ASN A OD1 1 
ATOM   2120 N  ND2 . ASN A 1 287 ? 13.922  5.920   44.562  1.00 44.73  ? 158  ASN A ND2 1 
ATOM   2121 N  N   . MET A 1 288 ? 11.054  3.878   45.667  1.00 46.48  ? 159  MET A N   1 
ATOM   2122 C  CA  . MET A 1 288 ? 11.405  2.469   45.673  1.00 45.51  ? 159  MET A CA  1 
ATOM   2123 C  C   . MET A 1 288 ? 10.420  1.671   44.825  1.00 48.83  ? 159  MET A C   1 
ATOM   2124 O  O   . MET A 1 288 ? 10.821  0.869   43.984  1.00 48.08  ? 159  MET A O   1 
ATOM   2125 C  CB  . MET A 1 288 ? 11.436  1.931   47.103  1.00 46.55  ? 159  MET A CB  1 
ATOM   2126 C  CG  . MET A 1 288 ? 11.383  0.416   47.206  1.00 49.32  ? 159  MET A CG  1 
ATOM   2127 S  SD  . MET A 1 288 ? 12.928  -0.405  46.781  1.00 62.96  ? 159  MET A SD  1 
ATOM   2128 C  CE  . MET A 1 288 ? 13.990  0.200   48.092  1.00 62.35  ? 159  MET A CE  1 
ATOM   2129 N  N   . TYR A 1 289 ? 9.130   1.915   45.027  1.00 51.63  ? 160  TYR A N   1 
ATOM   2130 C  CA  . TYR A 1 289 ? 8.107   1.116   44.362  1.00 47.11  ? 160  TYR A CA  1 
ATOM   2131 C  C   . TYR A 1 289 ? 7.578   1.734   43.074  1.00 49.27  ? 160  TYR A C   1 
ATOM   2132 O  O   . TYR A 1 289 ? 7.149   1.013   42.176  1.00 49.37  ? 160  TYR A O   1 
ATOM   2133 C  CB  . TYR A 1 289 ? 6.960   0.841   45.327  1.00 43.68  ? 160  TYR A CB  1 
ATOM   2134 C  CG  . TYR A 1 289 ? 7.379   -0.096  46.429  1.00 50.02  ? 160  TYR A CG  1 
ATOM   2135 C  CD1 . TYR A 1 289 ? 7.816   -1.382  46.136  1.00 50.76  ? 160  TYR A CD1 1 
ATOM   2136 C  CD2 . TYR A 1 289 ? 7.360   0.304   47.757  1.00 47.75  ? 160  TYR A CD2 1 
ATOM   2137 C  CE1 . TYR A 1 289 ? 8.212   -2.247  47.135  1.00 49.50  ? 160  TYR A CE1 1 
ATOM   2138 C  CE2 . TYR A 1 289 ? 7.755   -0.555  48.765  1.00 45.83  ? 160  TYR A CE2 1 
ATOM   2139 C  CZ  . TYR A 1 289 ? 8.179   -1.830  48.447  1.00 47.56  ? 160  TYR A CZ  1 
ATOM   2140 O  OH  . TYR A 1 289 ? 8.576   -2.695  49.440  1.00 50.13  ? 160  TYR A OH  1 
ATOM   2141 N  N   . CYS A 1 290 ? 7.611   3.057   42.971  1.00 49.92  ? 161  CYS A N   1 
ATOM   2142 C  CA  . CYS A 1 290 ? 7.245   3.698   41.714  1.00 46.53  ? 161  CYS A CA  1 
ATOM   2143 C  C   . CYS A 1 290 ? 8.223   3.279   40.629  1.00 46.01  ? 161  CYS A C   1 
ATOM   2144 O  O   . CYS A 1 290 ? 7.818   2.972   39.512  1.00 52.39  ? 161  CYS A O   1 
ATOM   2145 C  CB  . CYS A 1 290 ? 7.214   5.221   41.847  1.00 48.58  ? 161  CYS A CB  1 
ATOM   2146 S  SG  . CYS A 1 290 ? 5.609   5.887   42.353  1.00 50.22  ? 161  CYS A SG  1 
ATOM   2147 N  N   . SER A 1 291 ? 9.508   3.245   40.974  1.00 47.59  ? 162  SER A N   1 
ATOM   2148 C  CA  . SER A 1 291 ? 10.561  2.869   40.031  1.00 46.58  ? 162  SER A CA  1 
ATOM   2149 C  C   . SER A 1 291 ? 10.336  1.485   39.439  1.00 48.23  ? 162  SER A C   1 
ATOM   2150 O  O   . SER A 1 291 ? 10.432  1.305   38.228  1.00 51.19  ? 162  SER A O   1 
ATOM   2151 C  CB  . SER A 1 291 ? 11.931  2.920   40.706  1.00 46.14  ? 162  SER A CB  1 
ATOM   2152 O  OG  . SER A 1 291 ? 12.207  4.226   41.175  1.00 43.60  ? 162  SER A OG  1 
ATOM   2153 N  N   . ILE A 1 292 ? 10.033  0.512   40.292  1.00 46.67  ? 163  ILE A N   1 
ATOM   2154 C  CA  . ILE A 1 292 ? 9.765   -0.845  39.833  1.00 46.20  ? 163  ILE A CA  1 
ATOM   2155 C  C   . ILE A 1 292 ? 8.546   -0.882  38.912  1.00 50.87  ? 163  ILE A C   1 
ATOM   2156 O  O   . ILE A 1 292 ? 8.603   -1.439  37.814  1.00 51.52  ? 163  ILE A O   1 
ATOM   2157 C  CB  . ILE A 1 292 ? 9.540   -1.805  41.016  1.00 47.19  ? 163  ILE A CB  1 
ATOM   2158 C  CG1 . ILE A 1 292 ? 10.733  -1.753  41.973  1.00 50.22  ? 163  ILE A CG1 1 
ATOM   2159 C  CG2 . ILE A 1 292 ? 9.310   -3.223  40.517  1.00 46.69  ? 163  ILE A CG2 1 
ATOM   2160 C  CD1 . ILE A 1 292 ? 10.582  -2.632  43.194  1.00 47.41  ? 163  ILE A CD1 1 
ATOM   2161 N  N   . LEU A 1 293 ? 7.452   -0.271  39.353  1.00 47.86  ? 164  LEU A N   1 
ATOM   2162 C  CA  . LEU A 1 293 ? 6.214   -0.293  38.585  1.00 47.11  ? 164  LEU A CA  1 
ATOM   2163 C  C   . LEU A 1 293 ? 6.342   0.469   37.268  1.00 48.22  ? 164  LEU A C   1 
ATOM   2164 O  O   . LEU A 1 293 ? 5.835   0.029   36.238  1.00 48.88  ? 164  LEU A O   1 
ATOM   2165 C  CB  . LEU A 1 293 ? 5.063   0.276   39.415  1.00 47.30  ? 164  LEU A CB  1 
ATOM   2166 C  CG  . LEU A 1 293 ? 4.771   -0.490  40.706  1.00 48.87  ? 164  LEU A CG  1 
ATOM   2167 C  CD1 . LEU A 1 293 ? 3.580   0.107   41.434  1.00 45.54  ? 164  LEU A CD1 1 
ATOM   2168 C  CD2 . LEU A 1 293 ? 4.557   -1.969  40.421  1.00 49.04  ? 164  LEU A CD2 1 
ATOM   2169 N  N   . PHE A 1 294 ? 7.024   1.608   37.295  1.00 45.82  ? 165  PHE A N   1 
ATOM   2170 C  CA  . PHE A 1 294 ? 7.210   2.389   36.079  1.00 46.12  ? 165  PHE A CA  1 
ATOM   2171 C  C   . PHE A 1 294 ? 8.269   1.764   35.171  1.00 51.13  ? 165  PHE A C   1 
ATOM   2172 O  O   . PHE A 1 294 ? 8.300   2.037   33.972  1.00 49.46  ? 165  PHE A O   1 
ATOM   2173 C  CB  . PHE A 1 294 ? 7.580   3.833   36.417  1.00 47.10  ? 165  PHE A CB  1 
ATOM   2174 C  CG  . PHE A 1 294 ? 6.419   4.657   36.897  1.00 49.23  ? 165  PHE A CG  1 
ATOM   2175 C  CD1 . PHE A 1 294 ? 5.206   4.614   36.234  1.00 48.69  ? 165  PHE A CD1 1 
ATOM   2176 C  CD2 . PHE A 1 294 ? 6.539   5.469   38.014  1.00 47.64  ? 165  PHE A CD2 1 
ATOM   2177 C  CE1 . PHE A 1 294 ? 4.136   5.370   36.671  1.00 51.65  ? 165  PHE A CE1 1 
ATOM   2178 C  CE2 . PHE A 1 294 ? 5.472   6.225   38.458  1.00 47.68  ? 165  PHE A CE2 1 
ATOM   2179 C  CZ  . PHE A 1 294 ? 4.269   6.176   37.786  1.00 49.67  ? 165  PHE A CZ  1 
ATOM   2180 N  N   . LEU A 1 295 ? 9.137   0.929   35.735  1.00 48.79  ? 166  LEU A N   1 
ATOM   2181 C  CA  . LEU A 1 295 ? 10.049  0.149   34.909  1.00 46.70  ? 166  LEU A CA  1 
ATOM   2182 C  C   . LEU A 1 295 ? 9.286   -0.963  34.208  1.00 50.89  ? 166  LEU A C   1 
ATOM   2183 O  O   . LEU A 1 295 ? 9.551   -1.280  33.050  1.00 51.88  ? 166  LEU A O   1 
ATOM   2184 C  CB  . LEU A 1 295 ? 11.189  -0.448  35.734  1.00 47.37  ? 166  LEU A CB  1 
ATOM   2185 C  CG  . LEU A 1 295 ? 12.465  0.384   35.867  1.00 49.31  ? 166  LEU A CG  1 
ATOM   2186 C  CD1 . LEU A 1 295 ? 13.592  -0.485  36.394  1.00 48.29  ? 166  LEU A CD1 1 
ATOM   2187 C  CD2 . LEU A 1 295 ? 12.848  1.024   34.541  1.00 48.33  ? 166  LEU A CD2 1 
ATOM   2188 N  N   . THR A 1 296 ? 8.337   -1.556  34.922  1.00 50.32  ? 167  THR A N   1 
ATOM   2189 C  CA  . THR A 1 296 ? 7.542   -2.636  34.364  1.00 49.67  ? 167  THR A CA  1 
ATOM   2190 C  C   . THR A 1 296 ? 6.666   -2.109  33.240  1.00 49.96  ? 167  THR A C   1 
ATOM   2191 O  O   . THR A 1 296 ? 6.520   -2.759  32.208  1.00 56.15  ? 167  THR A O   1 
ATOM   2192 C  CB  . THR A 1 296 ? 6.663   -3.305  35.427  1.00 52.16  ? 167  THR A CB  1 
ATOM   2193 O  OG1 . THR A 1 296 ? 7.468   -3.649  36.561  1.00 49.85  ? 167  THR A OG1 1 
ATOM   2194 C  CG2 . THR A 1 296 ? 6.019   -4.563  34.864  1.00 53.81  ? 167  THR A CG2 1 
ATOM   2195 N  N   . CYS A 1 297 ? 6.092   -0.927  33.440  1.00 47.88  ? 168  CYS A N   1 
ATOM   2196 C  CA  . CYS A 1 297 ? 5.276   -0.289  32.411  1.00 49.70  ? 168  CYS A CA  1 
ATOM   2197 C  C   . CYS A 1 297 ? 6.097   -0.013  31.155  1.00 50.90  ? 168  CYS A C   1 
ATOM   2198 O  O   . CYS A 1 297 ? 5.733   -0.439  30.060  1.00 50.25  ? 168  CYS A O   1 
ATOM   2199 C  CB  . CYS A 1 297 ? 4.665   1.014   32.935  1.00 50.57  ? 168  CYS A CB  1 
ATOM   2200 S  SG  . CYS A 1 297 ? 3.397   0.790   34.201  1.00 47.78  ? 168  CYS A SG  1 
ATOM   2201 N  N   . LEU A 1 298 ? 7.212   0.691   31.334  1.00 50.33  ? 169  LEU A N   1 
ATOM   2202 C  CA  . LEU A 1 298 ? 8.104   1.061   30.239  1.00 48.65  ? 169  LEU A CA  1 
ATOM   2203 C  C   . LEU A 1 298 ? 8.587   -0.153  29.441  1.00 48.93  ? 169  LEU A C   1 
ATOM   2204 O  O   . LEU A 1 298 ? 8.497   -0.173  28.214  1.00 47.87  ? 169  LEU A O   1 
ATOM   2205 C  CB  . LEU A 1 298 ? 9.304   1.839   30.789  1.00 45.35  ? 169  LEU A CB  1 
ATOM   2206 C  CG  . LEU A 1 298 ? 10.381  2.333   29.819  1.00 48.75  ? 169  LEU A CG  1 
ATOM   2207 C  CD1 . LEU A 1 298 ? 9.800   3.319   28.818  1.00 52.10  ? 169  LEU A CD1 1 
ATOM   2208 C  CD2 . LEU A 1 298 ? 11.544  2.961   30.582  1.00 41.18  ? 169  LEU A CD2 1 
ATOM   2209 N  N   . SER A 1 299 ? 9.091   -1.161  30.148  1.00 48.06  ? 170  SER A N   1 
ATOM   2210 C  CA  . SER A 1 299 ? 9.630   -2.360  29.513  1.00 46.72  ? 170  SER A CA  1 
ATOM   2211 C  C   . SER A 1 299 ? 8.565   -3.120  28.737  1.00 49.95  ? 170  SER A C   1 
ATOM   2212 O  O   . SER A 1 299 ? 8.810   -3.578  27.622  1.00 52.15  ? 170  SER A O   1 
ATOM   2213 C  CB  . SER A 1 299 ? 10.259  -3.285  30.557  1.00 43.66  ? 170  SER A CB  1 
ATOM   2214 O  OG  . SER A 1 299 ? 11.234  -2.599  31.320  1.00 45.73  ? 170  SER A OG  1 
ATOM   2215 N  N   . VAL A 1 300 ? 7.386   -3.258  29.335  1.00 51.25  ? 171  VAL A N   1 
ATOM   2216 C  CA  . VAL A 1 300 ? 6.287   -3.979  28.702  1.00 52.62  ? 171  VAL A CA  1 
ATOM   2217 C  C   . VAL A 1 300 ? 5.771   -3.207  27.494  1.00 52.23  ? 171  VAL A C   1 
ATOM   2218 O  O   . VAL A 1 300 ? 5.592   -3.772  26.415  1.00 54.26  ? 171  VAL A O   1 
ATOM   2219 C  CB  . VAL A 1 300 ? 5.136   -4.235  29.695  1.00 49.92  ? 171  VAL A CB  1 
ATOM   2220 C  CG1 . VAL A 1 300 ? 3.857   -4.597  28.959  1.00 53.25  ? 171  VAL A CG1 1 
ATOM   2221 C  CG2 . VAL A 1 300 ? 5.526   -5.333  30.674  1.00 47.59  ? 171  VAL A CG2 1 
ATOM   2222 N  N   . GLN A 1 301 ? 5.553   -1.910  27.686  1.00 51.67  ? 172  GLN A N   1 
ATOM   2223 C  CA  . GLN A 1 301 ? 5.118   -1.020  26.616  1.00 53.46  ? 172  GLN A CA  1 
ATOM   2224 C  C   . GLN A 1 301 ? 6.035   -1.080  25.396  1.00 58.36  ? 172  GLN A C   1 
ATOM   2225 O  O   . GLN A 1 301 ? 5.565   -1.241  24.271  1.00 62.03  ? 172  GLN A O   1 
ATOM   2226 C  CB  . GLN A 1 301 ? 5.036   0.419   27.131  1.00 53.40  ? 172  GLN A CB  1 
ATOM   2227 C  CG  . GLN A 1 301 ? 4.740   1.453   26.058  1.00 60.03  ? 172  GLN A CG  1 
ATOM   2228 C  CD  . GLN A 1 301 ? 3.310   1.390   25.564  1.00 62.80  ? 172  GLN A CD  1 
ATOM   2229 O  OE1 . GLN A 1 301 ? 2.464   0.716   26.153  1.00 65.18  ? 172  GLN A OE1 1 
ATOM   2230 N  NE2 . GLN A 1 301 ? 3.031   2.098   24.477  1.00 63.86  ? 172  GLN A NE2 1 
ATOM   2231 N  N   . ARG A 1 302 ? 7.339   -0.951  25.618  1.00 56.41  ? 173  ARG A N   1 
ATOM   2232 C  CA  . ARG A 1 302 ? 8.294   -0.967  24.515  1.00 57.13  ? 173  ARG A CA  1 
ATOM   2233 C  C   . ARG A 1 302 ? 8.377   -2.342  23.861  1.00 57.52  ? 173  ARG A C   1 
ATOM   2234 O  O   . ARG A 1 302 ? 8.601   -2.447  22.655  1.00 61.68  ? 173  ARG A O   1 
ATOM   2235 C  CB  . ARG A 1 302 ? 9.679   -0.524  24.989  1.00 52.74  ? 173  ARG A CB  1 
ATOM   2236 C  CG  . ARG A 1 302 ? 9.880   0.979   24.942  1.00 49.91  ? 173  ARG A CG  1 
ATOM   2237 C  CD  . ARG A 1 302 ? 11.340  1.347   25.122  1.00 61.85  ? 173  ARG A CD  1 
ATOM   2238 N  NE  . ARG A 1 302 ? 12.187  0.829   24.049  1.00 60.73  ? 173  ARG A NE  1 
ATOM   2239 C  CZ  . ARG A 1 302 ? 12.491  1.503   22.943  1.00 60.80  ? 173  ARG A CZ  1 
ATOM   2240 N  NH1 . ARG A 1 302 ? 12.019  2.727   22.754  1.00 60.50  ? 173  ARG A NH1 1 
ATOM   2241 N  NH2 . ARG A 1 302 ? 13.269  0.950   22.023  1.00 67.69  ? 173  ARG A NH2 1 
ATOM   2242 N  N   . ALA A 1 303 ? 8.196   -3.391  24.653  1.00 51.94  ? 174  ALA A N   1 
ATOM   2243 C  CA  . ALA A 1 303 ? 8.159   -4.740  24.108  1.00 57.15  ? 174  ALA A CA  1 
ATOM   2244 C  C   . ALA A 1 303 ? 6.860   -4.959  23.334  1.00 63.07  ? 174  ALA A C   1 
ATOM   2245 O  O   . ALA A 1 303 ? 6.835   -5.663  22.321  1.00 61.70  ? 174  ALA A O   1 
ATOM   2246 C  CB  . ALA A 1 303 ? 8.303   -5.770  25.218  1.00 50.53  ? 174  ALA A CB  1 
ATOM   2247 N  N   . TRP A 1 304 ? 5.785   -4.339  23.812  1.00 63.85  ? 175  TRP A N   1 
ATOM   2248 C  CA  . TRP A 1 304 ? 4.469   -4.503  23.206  1.00 68.13  ? 175  TRP A CA  1 
ATOM   2249 C  C   . TRP A 1 304 ? 4.359   -3.765  21.872  1.00 68.20  ? 175  TRP A C   1 
ATOM   2250 O  O   . TRP A 1 304 ? 3.566   -4.145  21.013  1.00 70.95  ? 175  TRP A O   1 
ATOM   2251 C  CB  . TRP A 1 304 ? 3.378   -4.019  24.168  1.00 70.32  ? 175  TRP A CB  1 
ATOM   2252 C  CG  . TRP A 1 304 ? 1.990   -4.461  23.796  1.00 82.05  ? 175  TRP A CG  1 
ATOM   2253 C  CD1 . TRP A 1 304 ? 1.020   -3.707  23.197  1.00 83.04  ? 175  TRP A CD1 1 
ATOM   2254 C  CD2 . TRP A 1 304 ? 1.417   -5.759  24.003  1.00 92.04  ? 175  TRP A CD2 1 
ATOM   2255 N  NE1 . TRP A 1 304 ? -0.120  -4.457  23.019  1.00 86.89  ? 175  TRP A NE1 1 
ATOM   2256 C  CE2 . TRP A 1 304 ? 0.099   -5.719  23.505  1.00 91.32  ? 175  TRP A CE2 1 
ATOM   2257 C  CE3 . TRP A 1 304 ? 1.893   -6.950  24.560  1.00 98.86  ? 175  TRP A CE3 1 
ATOM   2258 C  CZ2 . TRP A 1 304 ? -0.749  -6.826  23.548  1.00 97.73  ? 175  TRP A CZ2 1 
ATOM   2259 C  CZ3 . TRP A 1 304 ? 1.049   -8.047  24.601  1.00 110.98 ? 175  TRP A CZ3 1 
ATOM   2260 C  CH2 . TRP A 1 304 ? -0.257  -7.977  24.098  1.00 102.67 ? 175  TRP A CH2 1 
ATOM   2261 N  N   . GLU A 1 305 ? 5.153   -2.713  21.698  1.00 64.05  ? 176  GLU A N   1 
ATOM   2262 C  CA  . GLU A 1 305 ? 5.151   -1.961  20.445  1.00 66.13  ? 176  GLU A CA  1 
ATOM   2263 C  C   . GLU A 1 305 ? 5.911   -2.704  19.350  1.00 69.76  ? 176  GLU A C   1 
ATOM   2264 O  O   . GLU A 1 305 ? 5.905   -2.294  18.189  1.00 70.88  ? 176  GLU A O   1 
ATOM   2265 C  CB  . GLU A 1 305 ? 5.762   -0.574  20.645  1.00 64.43  ? 176  GLU A CB  1 
ATOM   2266 C  CG  . GLU A 1 305 ? 4.993   0.321   21.589  1.00 66.68  ? 176  GLU A CG  1 
ATOM   2267 C  CD  . GLU A 1 305 ? 5.724   1.617   21.869  1.00 71.41  ? 176  GLU A CD  1 
ATOM   2268 O  OE1 . GLU A 1 305 ? 5.503   2.206   22.949  1.00 66.75  ? 176  GLU A OE1 1 
ATOM   2269 O  OE2 . GLU A 1 305 ? 6.522   2.043   21.007  1.00 77.04  ? 176  GLU A OE2 1 
ATOM   2270 N  N   . ILE A 1 306 ? 6.568   -3.795  19.729  1.00 67.56  ? 177  ILE A N   1 
ATOM   2271 C  CA  . ILE A 1 306 ? 7.356   -4.581  18.790  1.00 67.28  ? 177  ILE A CA  1 
ATOM   2272 C  C   . ILE A 1 306 ? 6.629   -5.862  18.393  1.00 69.81  ? 177  ILE A C   1 
ATOM   2273 O  O   . ILE A 1 306 ? 6.559   -6.209  17.214  1.00 74.51  ? 177  ILE A O   1 
ATOM   2274 C  CB  . ILE A 1 306 ? 8.732   -4.928  19.380  1.00 64.44  ? 177  ILE A CB  1 
ATOM   2275 C  CG1 . ILE A 1 306 ? 9.505   -3.643  19.688  1.00 63.38  ? 177  ILE A CG1 1 
ATOM   2276 C  CG2 . ILE A 1 306 ? 9.519   -5.809  18.424  1.00 60.54  ? 177  ILE A CG2 1 
ATOM   2277 C  CD1 . ILE A 1 306 ? 10.913  -3.879  20.165  1.00 63.15  ? 177  ILE A CD1 1 
ATOM   2278 N  N   . VAL A 1 307 ? 6.087   -6.561  19.384  1.00 69.06  ? 178  VAL A N   1 
ATOM   2279 C  CA  . VAL A 1 307 ? 5.325   -7.778  19.132  1.00 72.16  ? 178  VAL A CA  1 
ATOM   2280 C  C   . VAL A 1 307 ? 3.987   -7.457  18.464  1.00 75.60  ? 178  VAL A C   1 
ATOM   2281 O  O   . VAL A 1 307 ? 3.690   -7.971  17.387  1.00 86.52  ? 178  VAL A O   1 
ATOM   2282 C  CB  . VAL A 1 307 ? 5.075   -8.565  20.432  1.00 75.00  ? 178  VAL A CB  1 
ATOM   2283 C  CG1 . VAL A 1 307 ? 4.253   -9.814  20.149  1.00 79.26  ? 178  VAL A CG1 1 
ATOM   2284 C  CG2 . VAL A 1 307 ? 6.396   -8.929  21.092  1.00 71.75  ? 178  VAL A CG2 1 
ATOM   2285 N  N   . ASN A 1 308 ? 3.186   -6.609  19.108  1.00 75.10  ? 179  ASN A N   1 
ATOM   2286 C  CA  . ASN A 1 308 ? 1.890   -6.195  18.566  1.00 74.46  ? 179  ASN A CA  1 
ATOM   2287 C  C   . ASN A 1 308 ? 1.681   -4.685  18.616  1.00 72.17  ? 179  ASN A C   1 
ATOM   2288 O  O   . ASN A 1 308 ? 0.964   -4.186  19.483  1.00 73.42  ? 179  ASN A O   1 
ATOM   2289 C  CB  . ASN A 1 308 ? 0.745   -6.882  19.317  1.00 79.22  ? 179  ASN A CB  1 
ATOM   2290 C  CG  . ASN A 1 308 ? 0.631   -8.356  18.990  1.00 87.19  ? 179  ASN A CG  1 
ATOM   2291 O  OD1 . ASN A 1 308 ? 0.802   -9.212  19.859  1.00 93.30  ? 179  ASN A OD1 1 
ATOM   2292 N  ND2 . ASN A 1 308 ? 0.333   -8.661  17.731  1.00 86.40  ? 179  ASN A ND2 1 
ATOM   2293 N  N   . PRO A 1 309 ? 2.296   -3.952  17.675  1.00 71.08  ? 180  PRO A N   1 
ATOM   2294 C  CA  . PRO A 1 309 ? 2.177   -2.490  17.603  1.00 73.09  ? 180  PRO A CA  1 
ATOM   2295 C  C   . PRO A 1 309 ? 0.777   -2.002  17.224  1.00 74.42  ? 180  PRO A C   1 
ATOM   2296 O  O   . PRO A 1 309 ? 0.070   -2.660  16.460  1.00 72.52  ? 180  PRO A O   1 
ATOM   2297 C  CB  . PRO A 1 309 ? 3.184   -2.114  16.512  1.00 73.64  ? 180  PRO A CB  1 
ATOM   2298 C  CG  . PRO A 1 309 ? 3.276   -3.330  15.661  1.00 72.56  ? 180  PRO A CG  1 
ATOM   2299 C  CD  . PRO A 1 309 ? 3.158   -4.486  16.607  1.00 71.53  ? 180  PRO A CD  1 
ATOM   2300 N  N   . MET A 1 310 ? 0.393   -0.850  17.765  1.00 77.64  ? 181  MET A N   1 
ATOM   2301 C  CA  . MET A 1 310 ? -0.873  -0.211  17.423  1.00 79.30  ? 181  MET A CA  1 
ATOM   2302 C  C   . MET A 1 310 ? -0.614  1.201   16.906  1.00 80.97  ? 181  MET A C   1 
ATOM   2303 O  O   . MET A 1 310 ? 0.539   1.618   16.778  1.00 80.78  ? 181  MET A O   1 
ATOM   2304 C  CB  . MET A 1 310 ? -1.813  -0.178  18.630  1.00 85.38  ? 181  MET A CB  1 
ATOM   2305 C  CG  . MET A 1 310 ? -2.364  -1.540  19.028  1.00 86.90  ? 181  MET A CG  1 
ATOM   2306 S  SD  . MET A 1 310 ? -3.484  -1.461  20.443  1.00 113.53 ? 181  MET A SD  1 
ATOM   2307 C  CE  . MET A 1 310 ? -2.355  -0.963  21.742  1.00 91.58  ? 181  MET A CE  1 
ATOM   2308 N  N   . GLY A 1 311 ? -1.683  1.936   16.616  1.00 81.10  ? 182  GLY A N   1 
ATOM   2309 C  CA  . GLY A 1 311 ? -1.550  3.247   16.005  1.00 84.52  ? 182  GLY A CA  1 
ATOM   2310 C  C   . GLY A 1 311 ? -2.479  4.312   16.552  1.00 91.62  ? 182  GLY A C   1 
ATOM   2311 O  O   . GLY A 1 311 ? -3.248  4.924   15.808  1.00 96.34  ? 182  GLY A O   1 
ATOM   2312 N  N   . HIS A 1 312 ? -2.408  4.535   17.859  1.00 90.08  ? 183  HIS A N   1 
ATOM   2313 C  CA  . HIS A 1 312 ? -3.146  5.618   18.495  1.00 91.53  ? 183  HIS A CA  1 
ATOM   2314 C  C   . HIS A 1 312 ? -2.224  6.361   19.451  1.00 88.59  ? 183  HIS A C   1 
ATOM   2315 O  O   . HIS A 1 312 ? -2.462  6.388   20.656  1.00 89.51  ? 183  HIS A O   1 
ATOM   2316 C  CB  . HIS A 1 312 ? -4.375  5.087   19.239  1.00 92.46  ? 183  HIS A CB  1 
ATOM   2317 C  CG  . HIS A 1 312 ? -5.501  4.682   18.338  1.00 98.55  ? 183  HIS A CG  1 
ATOM   2318 N  ND1 . HIS A 1 312 ? -5.454  3.564   17.537  1.00 102.86 ? 183  HIS A ND1 1 
ATOM   2319 C  CD2 . HIS A 1 312 ? -6.713  5.251   18.117  1.00 97.41  ? 183  HIS A CD2 1 
ATOM   2320 C  CE1 . HIS A 1 312 ? -6.583  3.458   16.858  1.00 98.73  ? 183  HIS A CE1 1 
ATOM   2321 N  NE2 . HIS A 1 312 ? -7.364  4.471   17.194  1.00 99.32  ? 183  HIS A NE2 1 
ATOM   2322 N  N   . SER A 1 313 ? -1.174  6.966   18.901  1.00 87.64  ? 184  SER A N   1 
ATOM   2323 C  CA  . SER A 1 313 ? -0.124  7.586   19.704  1.00 89.41  ? 184  SER A CA  1 
ATOM   2324 C  C   . SER A 1 313 ? -0.641  8.683   20.631  1.00 88.65  ? 184  SER A C   1 
ATOM   2325 O  O   . SER A 1 313 ? 0.001   9.011   21.629  1.00 91.26  ? 184  SER A O   1 
ATOM   2326 C  CB  . SER A 1 313 ? 0.967   8.157   18.797  1.00 93.75  ? 184  SER A CB  1 
ATOM   2327 O  OG  . SER A 1 313 ? 2.015   8.724   19.565  1.00 101.96 ? 184  SER A OG  1 
ATOM   2328 N  N   . ARG A 1 314 ? -1.798  9.249   20.299  1.00 87.53  ? 185  ARG A N   1 
ATOM   2329 C  CA  . ARG A 1 314 ? -2.403  10.284  21.130  1.00 87.47  ? 185  ARG A CA  1 
ATOM   2330 C  C   . ARG A 1 314 ? -3.280  9.673   22.219  1.00 80.29  ? 185  ARG A C   1 
ATOM   2331 O  O   . ARG A 1 314 ? -3.317  10.160  23.349  1.00 74.39  ? 185  ARG A O   1 
ATOM   2332 C  CB  . ARG A 1 314 ? -3.222  11.253  20.272  1.00 99.33  ? 185  ARG A CB  1 
ATOM   2333 C  CG  . ARG A 1 314 ? -2.390  12.046  19.272  1.00 113.72 ? 185  ARG A CG  1 
ATOM   2334 C  CD  . ARG A 1 314 ? -3.227  13.079  18.526  1.00 122.58 ? 185  ARG A CD  1 
ATOM   2335 N  NE  . ARG A 1 314 ? -2.408  13.882  17.620  1.00 132.64 ? 185  ARG A NE  1 
ATOM   2336 C  CZ  . ARG A 1 314 ? -2.878  14.857  16.848  1.00 138.14 ? 185  ARG A CZ  1 
ATOM   2337 N  NH1 . ARG A 1 314 ? -4.169  15.157  16.864  1.00 145.03 ? 185  ARG A NH1 1 
ATOM   2338 N  NH2 . ARG A 1 314 ? -2.055  15.532  16.056  1.00 136.11 ? 185  ARG A NH2 1 
ATOM   2339 N  N   . LYS A 1 315 ? -3.986  8.602   21.872  1.00 84.17  ? 186  LYS A N   1 
ATOM   2340 C  CA  . LYS A 1 315 ? -4.857  7.919   22.823  1.00 80.18  ? 186  LYS A CA  1 
ATOM   2341 C  C   . LYS A 1 315 ? -4.030  7.065   23.782  1.00 71.28  ? 186  LYS A C   1 
ATOM   2342 O  O   . LYS A 1 315 ? -4.262  7.068   24.990  1.00 66.56  ? 186  LYS A O   1 
ATOM   2343 C  CB  . LYS A 1 315 ? -5.884  7.051   22.088  1.00 84.04  ? 186  LYS A CB  1 
ATOM   2344 C  CG  . LYS A 1 315 ? -6.598  7.755   20.939  1.00 90.91  ? 186  LYS A CG  1 
ATOM   2345 C  CD  . LYS A 1 315 ? -7.343  8.994   21.414  1.00 97.45  ? 186  LYS A CD  1 
ATOM   2346 C  CE  . LYS A 1 315 ? -8.020  9.716   20.257  1.00 87.85  ? 186  LYS A CE  1 
ATOM   2347 N  NZ  . LYS A 1 315 ? -8.674  10.980  20.700  1.00 81.08  ? 186  LYS A NZ  1 
ATOM   2348 N  N   . LYS A 1 316 ? -3.062  6.338   23.231  1.00 72.42  ? 187  LYS A N   1 
ATOM   2349 C  CA  . LYS A 1 316 ? -2.159  5.512   24.026  1.00 71.72  ? 187  LYS A CA  1 
ATOM   2350 C  C   . LYS A 1 316 ? -1.389  6.358   25.036  1.00 65.76  ? 187  LYS A C   1 
ATOM   2351 O  O   . LYS A 1 316 ? -0.973  5.866   26.085  1.00 60.26  ? 187  LYS A O   1 
ATOM   2352 C  CB  . LYS A 1 316 ? -1.181  4.759   23.118  1.00 74.29  ? 187  LYS A CB  1 
ATOM   2353 C  CG  . LYS A 1 316 ? -1.815  3.649   22.293  1.00 74.68  ? 187  LYS A CG  1 
ATOM   2354 C  CD  . LYS A 1 316 ? -2.045  2.396   23.125  1.00 78.11  ? 187  LYS A CD  1 
ATOM   2355 C  CE  . LYS A 1 316 ? -0.725  1.797   23.597  1.00 80.53  ? 187  LYS A CE  1 
ATOM   2356 N  NZ  . LYS A 1 316 ? -0.913  0.531   24.362  1.00 82.37  ? 187  LYS A NZ  1 
ATOM   2357 N  N   . ALA A 1 317 ? -1.201  7.632   24.708  1.00 65.41  ? 188  ALA A N   1 
ATOM   2358 C  CA  . ALA A 1 317 ? -0.541  8.564   25.609  1.00 61.35  ? 188  ALA A CA  1 
ATOM   2359 C  C   . ALA A 1 317 ? -1.455  8.904   26.776  1.00 60.71  ? 188  ALA A C   1 
ATOM   2360 O  O   . ALA A 1 317 ? -1.049  8.822   27.937  1.00 58.80  ? 188  ALA A O   1 
ATOM   2361 C  CB  . ALA A 1 317 ? -0.131  9.824   24.867  1.00 64.35  ? 188  ALA A CB  1 
ATOM   2362 N  N   . ASN A 1 318 ? -2.689  9.287   26.462  1.00 61.12  ? 189  ASN A N   1 
ATOM   2363 C  CA  . ASN A 1 318 ? -3.672  9.612   27.487  1.00 57.06  ? 189  ASN A CA  1 
ATOM   2364 C  C   . ASN A 1 318 ? -3.871  8.438   28.440  1.00 55.02  ? 189  ASN A C   1 
ATOM   2365 O  O   . ASN A 1 318 ? -3.959  8.622   29.653  1.00 51.96  ? 189  ASN A O   1 
ATOM   2366 C  CB  . ASN A 1 318 ? -5.003  10.017  26.850  1.00 61.92  ? 189  ASN A CB  1 
ATOM   2367 C  CG  . ASN A 1 318 ? -4.914  11.335  26.098  1.00 65.79  ? 189  ASN A CG  1 
ATOM   2368 O  OD1 . ASN A 1 318 ? -3.946  12.082  26.244  1.00 65.69  ? 189  ASN A OD1 1 
ATOM   2369 N  ND2 . ASN A 1 318 ? -5.932  11.631  25.296  1.00 67.19  ? 189  ASN A ND2 1 
ATOM   2370 N  N   . ILE A 1 319 ? -3.916  7.232   27.884  1.00 55.65  ? 190  ILE A N   1 
ATOM   2371 C  CA  . ILE A 1 319 ? -4.011  6.019   28.690  1.00 54.99  ? 190  ILE A CA  1 
ATOM   2372 C  C   . ILE A 1 319 ? -2.827  5.885   29.645  1.00 55.65  ? 190  ILE A C   1 
ATOM   2373 O  O   . ILE A 1 319 ? -3.004  5.605   30.829  1.00 56.60  ? 190  ILE A O   1 
ATOM   2374 C  CB  . ILE A 1 319 ? -4.079  4.758   27.810  1.00 58.16  ? 190  ILE A CB  1 
ATOM   2375 C  CG1 . ILE A 1 319 ? -5.340  4.772   26.948  1.00 54.37  ? 190  ILE A CG1 1 
ATOM   2376 C  CG2 . ILE A 1 319 ? -4.048  3.502   28.669  1.00 57.26  ? 190  ILE A CG2 1 
ATOM   2377 C  CD1 . ILE A 1 319 ? -5.469  3.560   26.045  1.00 53.41  ? 190  ILE A CD1 1 
ATOM   2378 N  N   . ALA A 1 320 ? -1.621  6.095   29.124  1.00 56.10  ? 191  ALA A N   1 
ATOM   2379 C  CA  . ALA A 1 320 ? -0.406  5.959   29.922  1.00 52.61  ? 191  ALA A CA  1 
ATOM   2380 C  C   . ALA A 1 320 ? -0.357  6.979   31.061  1.00 53.47  ? 191  ALA A C   1 
ATOM   2381 O  O   . ALA A 1 320 ? 0.207   6.707   32.120  1.00 55.12  ? 191  ALA A O   1 
ATOM   2382 C  CB  . ALA A 1 320 ? 0.824   6.094   29.039  1.00 58.94  ? 191  ALA A CB  1 
ATOM   2383 N  N   . ILE A 1 321 ? -0.948  8.150   30.840  1.00 53.93  ? 192  ILE A N   1 
ATOM   2384 C  CA  . ILE A 1 321 ? -1.028  9.167   31.884  1.00 51.92  ? 192  ILE A CA  1 
ATOM   2385 C  C   . ILE A 1 321 ? -1.945  8.701   33.004  1.00 53.92  ? 192  ILE A C   1 
ATOM   2386 O  O   . ILE A 1 321 ? -1.588  8.773   34.179  1.00 57.94  ? 192  ILE A O   1 
ATOM   2387 C  CB  . ILE A 1 321 ? -1.537  10.513  31.341  1.00 50.60  ? 192  ILE A CB  1 
ATOM   2388 C  CG1 . ILE A 1 321 ? -0.499  11.140  30.408  1.00 50.34  ? 192  ILE A CG1 1 
ATOM   2389 C  CG2 . ILE A 1 321 ? -1.852  11.460  32.485  1.00 48.91  ? 192  ILE A CG2 1 
ATOM   2390 C  CD1 . ILE A 1 321 ? -0.806  12.577  30.033  1.00 46.79  ? 192  ILE A CD1 1 
ATOM   2391 N  N   . GLY A 1 322 ? -3.126  8.218   32.631  1.00 51.41  ? 193  GLY A N   1 
ATOM   2392 C  CA  . GLY A 1 322 ? -4.078  7.702   33.596  1.00 51.27  ? 193  GLY A CA  1 
ATOM   2393 C  C   . GLY A 1 322 ? -3.512  6.562   34.421  1.00 51.91  ? 193  GLY A C   1 
ATOM   2394 O  O   . GLY A 1 322 ? -3.765  6.470   35.622  1.00 50.95  ? 193  GLY A O   1 
ATOM   2395 N  N   . ILE A 1 323 ? -2.740  5.695   33.772  1.00 49.65  ? 194  ILE A N   1 
ATOM   2396 C  CA  . ILE A 1 323 ? -2.083  4.586   34.455  1.00 49.82  ? 194  ILE A CA  1 
ATOM   2397 C  C   . ILE A 1 323 ? -1.097  5.110   35.493  1.00 50.10  ? 194  ILE A C   1 
ATOM   2398 O  O   . ILE A 1 323 ? -0.979  4.560   36.589  1.00 49.13  ? 194  ILE A O   1 
ATOM   2399 C  CB  . ILE A 1 323 ? -1.347  3.665   33.461  1.00 51.05  ? 194  ILE A CB  1 
ATOM   2400 C  CG1 . ILE A 1 323 ? -2.352  2.936   32.568  1.00 46.38  ? 194  ILE A CG1 1 
ATOM   2401 C  CG2 . ILE A 1 323 ? -0.476  2.657   34.196  1.00 47.58  ? 194  ILE A CG2 1 
ATOM   2402 C  CD1 . ILE A 1 323 ? -1.714  2.012   31.558  1.00 41.51  ? 194  ILE A CD1 1 
ATOM   2403 N  N   . SER A 1 324 ? -0.403  6.187   35.143  1.00 50.37  ? 195  SER A N   1 
ATOM   2404 C  CA  . SER A 1 324 ? 0.570   6.800   36.037  1.00 50.48  ? 195  SER A CA  1 
ATOM   2405 C  C   . SER A 1 324 ? -0.109  7.389   37.271  1.00 51.80  ? 195  SER A C   1 
ATOM   2406 O  O   . SER A 1 324 ? 0.374   7.229   38.393  1.00 50.54  ? 195  SER A O   1 
ATOM   2407 C  CB  . SER A 1 324 ? 1.360   7.879   35.301  1.00 49.69  ? 195  SER A CB  1 
ATOM   2408 O  OG  . SER A 1 324 ? 2.011   7.336   34.167  1.00 53.19  ? 195  SER A OG  1 
ATOM   2409 N  N   . LEU A 1 325 ? -1.228  8.073   37.056  1.00 51.90  ? 196  LEU A N   1 
ATOM   2410 C  CA  . LEU A 1 325 ? -2.027  8.591   38.159  1.00 48.65  ? 196  LEU A CA  1 
ATOM   2411 C  C   . LEU A 1 325 ? -2.494  7.443   39.043  1.00 49.06  ? 196  LEU A C   1 
ATOM   2412 O  O   . LEU A 1 325 ? -2.448  7.537   40.269  1.00 49.29  ? 196  LEU A O   1 
ATOM   2413 C  CB  . LEU A 1 325 ? -3.230  9.385   37.643  1.00 53.16  ? 196  LEU A CB  1 
ATOM   2414 C  CG  . LEU A 1 325 ? -3.050  10.878  37.346  1.00 61.53  ? 196  LEU A CG  1 
ATOM   2415 C  CD1 . LEU A 1 325 ? -2.018  11.121  36.256  1.00 62.76  ? 196  LEU A CD1 1 
ATOM   2416 C  CD2 . LEU A 1 325 ? -4.381  11.509  36.965  1.00 67.89  ? 196  LEU A CD2 1 
ATOM   2417 N  N   . ALA A 1 326 ? -2.934  6.359   38.410  1.00 45.38  ? 197  ALA A N   1 
ATOM   2418 C  CA  . ALA A 1 326 ? -3.395  5.183   39.138  1.00 45.65  ? 197  ALA A CA  1 
ATOM   2419 C  C   . ALA A 1 326 ? -2.280  4.621   40.006  1.00 48.94  ? 197  ALA A C   1 
ATOM   2420 O  O   . ALA A 1 326 ? -2.494  4.290   41.173  1.00 49.36  ? 197  ALA A O   1 
ATOM   2421 C  CB  . ALA A 1 326 ? -3.903  4.125   38.176  1.00 42.55  ? 197  ALA A CB  1 
ATOM   2422 N  N   . ILE A 1 327 ? -1.087  4.524   39.430  1.00 49.24  ? 198  ILE A N   1 
ATOM   2423 C  CA  . ILE A 1 327 ? 0.075   4.025   40.153  1.00 46.91  ? 198  ILE A CA  1 
ATOM   2424 C  C   . ILE A 1 327 ? 0.454   4.962   41.304  1.00 46.65  ? 198  ILE A C   1 
ATOM   2425 O  O   . ILE A 1 327 ? 0.721   4.507   42.414  1.00 46.84  ? 198  ILE A O   1 
ATOM   2426 C  CB  . ILE A 1 327 ? 1.279   3.831   39.207  1.00 45.58  ? 198  ILE A CB  1 
ATOM   2427 C  CG1 . ILE A 1 327 ? 1.010   2.662   38.258  1.00 46.05  ? 198  ILE A CG1 1 
ATOM   2428 C  CG2 . ILE A 1 327 ? 2.553   3.571   39.993  1.00 46.74  ? 198  ILE A CG2 1 
ATOM   2429 C  CD1 . ILE A 1 327 ? 2.157   2.338   37.335  1.00 44.64  ? 198  ILE A CD1 1 
ATOM   2430 N  N   . TRP A 1 328 ? 0.455   6.266   41.048  1.00 45.08  ? 199  TRP A N   1 
ATOM   2431 C  CA  . TRP A 1 328 ? 0.806   7.236   42.083  1.00 46.69  ? 199  TRP A CA  1 
ATOM   2432 C  C   . TRP A 1 328 ? -0.143  7.185   43.279  1.00 49.09  ? 199  TRP A C   1 
ATOM   2433 O  O   . TRP A 1 328 ? 0.291   7.269   44.427  1.00 53.59  ? 199  TRP A O   1 
ATOM   2434 C  CB  . TRP A 1 328 ? 0.837   8.653   41.507  1.00 47.23  ? 199  TRP A CB  1 
ATOM   2435 C  CG  . TRP A 1 328 ? 2.173   9.026   40.941  1.00 49.21  ? 199  TRP A CG  1 
ATOM   2436 C  CD1 . TRP A 1 328 ? 2.512   9.099   39.623  1.00 50.08  ? 199  TRP A CD1 1 
ATOM   2437 C  CD2 . TRP A 1 328 ? 3.359   9.363   41.679  1.00 50.26  ? 199  TRP A CD2 1 
ATOM   2438 N  NE1 . TRP A 1 328 ? 3.829   9.467   39.491  1.00 51.12  ? 199  TRP A NE1 1 
ATOM   2439 C  CE2 . TRP A 1 328 ? 4.372   9.634   40.738  1.00 48.39  ? 199  TRP A CE2 1 
ATOM   2440 C  CE3 . TRP A 1 328 ? 3.659   9.465   43.044  1.00 48.82  ? 199  TRP A CE3 1 
ATOM   2441 C  CZ2 . TRP A 1 328 ? 5.667   10.001  41.116  1.00 47.03  ? 199  TRP A CZ2 1 
ATOM   2442 C  CZ3 . TRP A 1 328 ? 4.945   9.829   43.418  1.00 45.46  ? 199  TRP A CZ3 1 
ATOM   2443 C  CH2 . TRP A 1 328 ? 5.931   10.093  42.457  1.00 48.94  ? 199  TRP A CH2 1 
ATOM   2444 N  N   . LEU A 1 329 ? -1.436  7.039   43.014  1.00 50.60  ? 200  LEU A N   1 
ATOM   2445 C  CA  . LEU A 1 329 ? -2.423  7.010   44.087  1.00 49.08  ? 200  LEU A CA  1 
ATOM   2446 C  C   . LEU A 1 329 ? -2.414  5.673   44.823  1.00 49.48  ? 200  LEU A C   1 
ATOM   2447 O  O   . LEU A 1 329 ? -2.661  5.621   46.027  1.00 53.23  ? 200  LEU A O   1 
ATOM   2448 C  CB  . LEU A 1 329 ? -3.820  7.300   43.537  1.00 47.58  ? 200  LEU A CB  1 
ATOM   2449 C  CG  . LEU A 1 329 ? -3.969  8.657   42.849  1.00 47.56  ? 200  LEU A CG  1 
ATOM   2450 C  CD1 . LEU A 1 329 ? -5.368  8.822   42.272  1.00 44.79  ? 200  LEU A CD1 1 
ATOM   2451 C  CD2 . LEU A 1 329 ? -3.631  9.790   43.812  1.00 42.85  ? 200  LEU A CD2 1 
ATOM   2452 N  N   . LEU A 1 330 ? -2.132  4.595   44.100  1.00 47.29  ? 201  LEU A N   1 
ATOM   2453 C  CA  . LEU A 1 330 ? -2.092  3.271   44.709  1.00 48.69  ? 201  LEU A CA  1 
ATOM   2454 C  C   . LEU A 1 330 ? -0.921  3.156   45.675  1.00 53.03  ? 201  LEU A C   1 
ATOM   2455 O  O   . LEU A 1 330 ? -1.001  2.464   46.687  1.00 57.20  ? 201  LEU A O   1 
ATOM   2456 C  CB  . LEU A 1 330 ? -1.998  2.184   43.637  1.00 52.31  ? 201  LEU A CB  1 
ATOM   2457 C  CG  . LEU A 1 330 ? -3.285  1.420   43.317  1.00 60.03  ? 201  LEU A CG  1 
ATOM   2458 C  CD1 . LEU A 1 330 ? -4.411  2.370   42.931  1.00 60.92  ? 201  LEU A CD1 1 
ATOM   2459 C  CD2 . LEU A 1 330 ? -3.033  0.405   42.214  1.00 58.15  ? 201  LEU A CD2 1 
ATOM   2460 N  N   . ILE A 1 331 ? 0.168   3.846   45.360  1.00 49.39  ? 202  ILE A N   1 
ATOM   2461 C  CA  . ILE A 1 331 ? 1.342   3.827   46.216  1.00 47.84  ? 202  ILE A CA  1 
ATOM   2462 C  C   . ILE A 1 331 ? 1.169   4.802   47.380  1.00 49.43  ? 202  ILE A C   1 
ATOM   2463 O  O   . ILE A 1 331 ? 1.619   4.533   48.496  1.00 52.20  ? 202  ILE A O   1 
ATOM   2464 C  CB  . ILE A 1 331 ? 2.618   4.145   45.413  1.00 47.07  ? 202  ILE A CB  1 
ATOM   2465 C  CG1 . ILE A 1 331 ? 2.881   3.011   44.421  1.00 47.81  ? 202  ILE A CG1 1 
ATOM   2466 C  CG2 . ILE A 1 331 ? 3.816   4.319   46.333  1.00 48.31  ? 202  ILE A CG2 1 
ATOM   2467 C  CD1 . ILE A 1 331 ? 4.235   3.055   43.772  1.00 48.58  ? 202  ILE A CD1 1 
ATOM   2468 N  N   . LEU A 1 332 ? 0.495   5.920   47.129  1.00 47.23  ? 203  LEU A N   1 
ATOM   2469 C  CA  . LEU A 1 332 ? 0.147   6.846   48.203  1.00 49.10  ? 203  LEU A CA  1 
ATOM   2470 C  C   . LEU A 1 332 ? -0.727  6.150   49.244  1.00 49.51  ? 203  LEU A C   1 
ATOM   2471 O  O   . LEU A 1 332 ? -0.637  6.431   50.437  1.00 50.07  ? 203  LEU A O   1 
ATOM   2472 C  CB  . LEU A 1 332 ? -0.578  8.074   47.652  1.00 50.53  ? 203  LEU A CB  1 
ATOM   2473 C  CG  . LEU A 1 332 ? -1.104  9.064   48.698  1.00 50.06  ? 203  LEU A CG  1 
ATOM   2474 C  CD1 . LEU A 1 332 ? 0.043   9.740   49.437  1.00 46.44  ? 203  LEU A CD1 1 
ATOM   2475 C  CD2 . LEU A 1 332 ? -2.030  10.098  48.067  1.00 51.62  ? 203  LEU A CD2 1 
ATOM   2476 N  N   . LEU A 1 333 ? -1.568  5.234   48.780  1.00 47.64  ? 204  LEU A N   1 
ATOM   2477 C  CA  . LEU A 1 333 ? -2.456  4.491   49.663  1.00 48.09  ? 204  LEU A CA  1 
ATOM   2478 C  C   . LEU A 1 333 ? -1.736  3.330   50.347  1.00 47.14  ? 204  LEU A C   1 
ATOM   2479 O  O   . LEU A 1 333 ? -2.043  2.991   51.489  1.00 46.84  ? 204  LEU A O   1 
ATOM   2480 C  CB  . LEU A 1 333 ? -3.664  3.966   48.882  1.00 49.42  ? 204  LEU A CB  1 
ATOM   2481 C  CG  . LEU A 1 333 ? -4.926  4.829   48.779  1.00 47.49  ? 204  LEU A CG  1 
ATOM   2482 C  CD1 . LEU A 1 333 ? -4.601  6.280   48.469  1.00 47.44  ? 204  LEU A CD1 1 
ATOM   2483 C  CD2 . LEU A 1 333 ? -5.857  4.257   47.716  1.00 38.06  ? 204  LEU A CD2 1 
ATOM   2484 N  N   . VAL A 1 334 ? -0.783  2.719   49.650  1.00 48.19  ? 205  VAL A N   1 
ATOM   2485 C  CA  . VAL A 1 334 ? -0.097  1.543   50.184  1.00 49.33  ? 205  VAL A CA  1 
ATOM   2486 C  C   . VAL A 1 334 ? 1.022   1.930   51.156  1.00 48.29  ? 205  VAL A C   1 
ATOM   2487 O  O   . VAL A 1 334 ? 1.462   1.110   51.965  1.00 44.50  ? 205  VAL A O   1 
ATOM   2488 C  CB  . VAL A 1 334 ? 0.485   0.663   49.053  1.00 47.09  ? 205  VAL A CB  1 
ATOM   2489 C  CG1 . VAL A 1 334 ? 1.861   1.158   48.640  1.00 46.21  ? 205  VAL A CG1 1 
ATOM   2490 C  CG2 . VAL A 1 334 ? 0.554   -0.787  49.497  1.00 45.82  ? 205  VAL A CG2 1 
ATOM   2491 N  N   . THR A 1 335 ? 1.471   3.180   51.082  1.00 47.17  ? 206  THR A N   1 
ATOM   2492 C  CA  . THR A 1 335 ? 2.495   3.672   51.995  1.00 49.25  ? 206  THR A CA  1 
ATOM   2493 C  C   . THR A 1 335 ? 1.877   4.367   53.202  1.00 50.88  ? 206  THR A C   1 
ATOM   2494 O  O   . THR A 1 335 ? 2.575   5.032   53.970  1.00 51.82  ? 206  THR A O   1 
ATOM   2495 C  CB  . THR A 1 335 ? 3.455   4.653   51.302  1.00 46.18  ? 206  THR A CB  1 
ATOM   2496 O  OG1 . THR A 1 335 ? 2.700   5.682   50.650  1.00 50.24  ? 206  THR A OG1 1 
ATOM   2497 C  CG2 . THR A 1 335 ? 4.307   3.930   50.280  1.00 48.40  ? 206  THR A CG2 1 
ATOM   2498 N  N   . ILE A 1 336 ? 0.567   4.216   53.363  1.00 49.05  ? 207  ILE A N   1 
ATOM   2499 C  CA  . ILE A 1 336 ? -0.125  4.809   54.500  1.00 49.49  ? 207  ILE A CA  1 
ATOM   2500 C  C   . ILE A 1 336 ? 0.412   4.285   55.843  1.00 51.01  ? 207  ILE A C   1 
ATOM   2501 O  O   . ILE A 1 336 ? 0.690   5.087   56.735  1.00 51.89  ? 207  ILE A O   1 
ATOM   2502 C  CB  . ILE A 1 336 ? -1.650  4.584   54.411  1.00 46.16  ? 207  ILE A CB  1 
ATOM   2503 C  CG1 . ILE A 1 336 ? -2.257  5.523   53.369  1.00 46.83  ? 207  ILE A CG1 1 
ATOM   2504 C  CG2 . ILE A 1 336 ? -2.311  4.818   55.755  1.00 47.52  ? 207  ILE A CG2 1 
ATOM   2505 C  CD1 . ILE A 1 336 ? -3.763  5.409   53.249  1.00 45.33  ? 207  ILE A CD1 1 
ATOM   2506 N  N   . PRO A 1 337 ? 0.598   2.955   55.995  1.00 48.95  ? 208  PRO A N   1 
ATOM   2507 C  CA  . PRO A 1 337 ? 1.155   2.519   57.286  1.00 45.30  ? 208  PRO A CA  1 
ATOM   2508 C  C   . PRO A 1 337 ? 2.628   2.879   57.509  1.00 51.13  ? 208  PRO A C   1 
ATOM   2509 O  O   . PRO A 1 337 ? 3.256   2.337   58.419  1.00 52.11  ? 208  PRO A O   1 
ATOM   2510 C  CB  . PRO A 1 337 ? 0.983   0.996   57.247  1.00 43.73  ? 208  PRO A CB  1 
ATOM   2511 C  CG  . PRO A 1 337 ? 0.879   0.657   55.825  1.00 42.42  ? 208  PRO A CG  1 
ATOM   2512 C  CD  . PRO A 1 337 ? 0.185   1.803   55.172  1.00 46.14  ? 208  PRO A CD  1 
ATOM   2513 N  N   . LEU A 1 338 ? 3.165   3.778   56.692  1.00 53.79  ? 209  LEU A N   1 
ATOM   2514 C  CA  . LEU A 1 338 ? 4.510   4.301   56.894  1.00 48.96  ? 209  LEU A CA  1 
ATOM   2515 C  C   . LEU A 1 338 ? 4.430   5.789   57.218  1.00 50.21  ? 209  LEU A C   1 
ATOM   2516 O  O   . LEU A 1 338 ? 5.229   6.312   57.992  1.00 52.81  ? 209  LEU A O   1 
ATOM   2517 C  CB  . LEU A 1 338 ? 5.377   4.064   55.656  1.00 56.69  ? 209  LEU A CB  1 
ATOM   2518 C  CG  . LEU A 1 338 ? 5.590   2.612   55.218  1.00 53.28  ? 209  LEU A CG  1 
ATOM   2519 C  CD1 . LEU A 1 338 ? 6.420   2.555   53.946  1.00 48.33  ? 209  LEU A CD1 1 
ATOM   2520 C  CD2 . LEU A 1 338 ? 6.250   1.796   56.319  1.00 55.44  ? 209  LEU A CD2 1 
ATOM   2521 N  N   . TYR A 1 339 ? 3.453   6.460   56.614  1.00 52.85  ? 210  TYR A N   1 
ATOM   2522 C  CA  . TYR A 1 339 ? 3.173   7.865   56.893  1.00 54.54  ? 210  TYR A CA  1 
ATOM   2523 C  C   . TYR A 1 339 ? 2.630   8.081   58.297  1.00 50.73  ? 210  TYR A C   1 
ATOM   2524 O  O   . TYR A 1 339 ? 3.015   9.026   58.982  1.00 62.35  ? 210  TYR A O   1 
ATOM   2525 C  CB  . TYR A 1 339 ? 2.151   8.426   55.897  1.00 56.89  ? 210  TYR A CB  1 
ATOM   2526 C  CG  . TYR A 1 339 ? 2.715   8.899   54.580  1.00 55.86  ? 210  TYR A CG  1 
ATOM   2527 C  CD1 . TYR A 1 339 ? 3.334   10.137  54.472  1.00 57.22  ? 210  TYR A CD1 1 
ATOM   2528 C  CD2 . TYR A 1 339 ? 2.602   8.120   53.436  1.00 56.23  ? 210  TYR A CD2 1 
ATOM   2529 C  CE1 . TYR A 1 339 ? 3.844   10.580  53.263  1.00 56.89  ? 210  TYR A CE1 1 
ATOM   2530 C  CE2 . TYR A 1 339 ? 3.108   8.552   52.222  1.00 59.91  ? 210  TYR A CE2 1 
ATOM   2531 C  CZ  . TYR A 1 339 ? 3.728   9.782   52.139  1.00 62.00  ? 210  TYR A CZ  1 
ATOM   2532 O  OH  . TYR A 1 339 ? 4.232   10.212  50.931  1.00 54.39  ? 210  TYR A OH  1 
ATOM   2533 N  N   . VAL A 1 340 ? 1.721   7.204   58.712  1.00 49.79  ? 211  VAL A N   1 
ATOM   2534 C  CA  . VAL A 1 340 ? 0.852   7.483   59.851  1.00 52.71  ? 211  VAL A CA  1 
ATOM   2535 C  C   . VAL A 1 340 ? 1.366   6.944   61.180  1.00 47.60  ? 211  VAL A C   1 
ATOM   2536 O  O   . VAL A 1 340 ? 0.835   7.277   62.235  1.00 48.60  ? 211  VAL A O   1 
ATOM   2537 C  CB  . VAL A 1 340 ? -0.557  6.912   59.608  1.00 47.60  ? 211  VAL A CB  1 
ATOM   2538 C  CG1 . VAL A 1 340 ? -1.098  7.415   58.285  1.00 44.18  ? 211  VAL A CG1 1 
ATOM   2539 C  CG2 . VAL A 1 340 ? -0.531  5.391   59.631  1.00 43.36  ? 211  VAL A CG2 1 
ATOM   2540 N  N   . VAL A 1 341 ? 2.391   6.106   61.130  1.00 49.22  ? 212  VAL A N   1 
ATOM   2541 C  CA  . VAL A 1 341 ? 2.929   5.516   62.345  1.00 47.17  ? 212  VAL A CA  1 
ATOM   2542 C  C   . VAL A 1 341 ? 4.121   6.328   62.845  1.00 45.94  ? 212  VAL A C   1 
ATOM   2543 O  O   . VAL A 1 341 ? 4.867   6.903   62.053  1.00 44.92  ? 212  VAL A O   1 
ATOM   2544 C  CB  . VAL A 1 341 ? 3.338   4.050   62.113  1.00 46.98  ? 212  VAL A CB  1 
ATOM   2545 C  CG1 . VAL A 1 341 ? 3.622   3.356   63.435  1.00 46.98  ? 212  VAL A CG1 1 
ATOM   2546 C  CG2 . VAL A 1 341 ? 2.232   3.318   61.374  1.00 47.82  ? 212  VAL A CG2 1 
ATOM   2547 N  N   . LYS A 1 342 ? 4.265   6.395   64.167  1.00 48.96  ? 213  LYS A N   1 
ATOM   2548 C  CA  . LYS A 1 342 ? 5.392   7.064   64.810  1.00 49.36  ? 213  LYS A CA  1 
ATOM   2549 C  C   . LYS A 1 342 ? 6.709   6.442   64.348  1.00 45.62  ? 213  LYS A C   1 
ATOM   2550 O  O   . LYS A 1 342 ? 6.955   5.257   64.575  1.00 45.83  ? 213  LYS A O   1 
ATOM   2551 C  CB  . LYS A 1 342 ? 5.258   6.975   66.334  1.00 47.95  ? 213  LYS A CB  1 
ATOM   2552 C  CG  . LYS A 1 342 ? 6.384   7.630   67.115  1.00 50.33  ? 213  LYS A CG  1 
ATOM   2553 C  CD  . LYS A 1 342 ? 6.198   9.134   67.217  1.00 56.58  ? 213  LYS A CD  1 
ATOM   2554 C  CE  . LYS A 1 342 ? 7.327   9.772   68.020  1.00 65.02  ? 213  LYS A CE  1 
ATOM   2555 N  NZ  . LYS A 1 342 ? 7.468   9.200   69.390  1.00 54.24  ? 213  LYS A NZ  1 
ATOM   2556 N  N   . GLN A 1 343 ? 7.546   7.237   63.687  1.00 42.86  ? 214  GLN A N   1 
ATOM   2557 C  CA  . GLN A 1 343 ? 8.781   6.714   63.113  1.00 43.63  ? 214  GLN A CA  1 
ATOM   2558 C  C   . GLN A 1 343 ? 10.038  7.335   63.724  1.00 45.34  ? 214  GLN A C   1 
ATOM   2559 O  O   . GLN A 1 343 ? 11.152  7.100   63.250  1.00 44.40  ? 214  GLN A O   1 
ATOM   2560 C  CB  . GLN A 1 343 ? 8.790   6.922   61.598  1.00 42.07  ? 214  GLN A CB  1 
ATOM   2561 C  CG  . GLN A 1 343 ? 7.760   6.106   60.833  1.00 44.42  ? 214  GLN A CG  1 
ATOM   2562 C  CD  . GLN A 1 343 ? 8.125   4.637   60.714  1.00 43.20  ? 214  GLN A CD  1 
ATOM   2563 O  OE1 . GLN A 1 343 ? 8.992   4.140   61.426  1.00 43.52  ? 214  GLN A OE1 1 
ATOM   2564 N  NE2 . GLN A 1 343 ? 7.462   3.937   59.802  1.00 45.26  ? 214  GLN A NE2 1 
ATOM   2565 N  N   . THR A 1 344 ? 9.856   8.129   64.773  1.00 43.61  ? 215  THR A N   1 
ATOM   2566 C  CA  . THR A 1 344 ? 10.984  8.697   65.498  1.00 44.83  ? 215  THR A CA  1 
ATOM   2567 C  C   . THR A 1 344 ? 10.997  8.196   66.940  1.00 47.52  ? 215  THR A C   1 
ATOM   2568 O  O   . THR A 1 344 ? 9.944   7.979   67.541  1.00 46.51  ? 215  THR A O   1 
ATOM   2569 C  CB  . THR A 1 344 ? 10.950  10.239  65.489  1.00 45.18  ? 215  THR A CB  1 
ATOM   2570 O  OG1 . THR A 1 344 ? 9.725   10.695  66.072  1.00 53.47  ? 215  THR A OG1 1 
ATOM   2571 C  CG2 . THR A 1 344 ? 11.049  10.770  64.068  1.00 45.21  ? 215  THR A CG2 1 
ATOM   2572 N  N   . ILE A 1 345 ? 12.193  7.995   67.484  1.00 45.78  ? 216  ILE A N   1 
ATOM   2573 C  CA  . ILE A 1 345 ? 12.344  7.622   68.888  1.00 47.76  ? 216  ILE A CA  1 
ATOM   2574 C  C   . ILE A 1 345 ? 13.651  8.170   69.457  1.00 47.77  ? 216  ILE A C   1 
ATOM   2575 O  O   . ILE A 1 345 ? 14.697  8.115   68.805  1.00 48.78  ? 216  ILE A O   1 
ATOM   2576 C  CB  . ILE A 1 345 ? 12.292  6.083   69.087  1.00 48.21  ? 216  ILE A CB  1 
ATOM   2577 C  CG1 . ILE A 1 345 ? 12.507  5.722   70.563  1.00 46.84  ? 216  ILE A CG1 1 
ATOM   2578 C  CG2 . ILE A 1 345 ? 13.306  5.377   68.191  1.00 43.92  ? 216  ILE A CG2 1 
ATOM   2579 C  CD1 . ILE A 1 345 ? 12.389  4.241   70.870  1.00 48.89  ? 216  ILE A CD1 1 
ATOM   2580 N  N   . PHE A 1 346 ? 13.580  8.717   70.667  1.00 48.45  ? 217  PHE A N   1 
ATOM   2581 C  CA  . PHE A 1 346 ? 14.765  9.207   71.358  1.00 48.85  ? 217  PHE A CA  1 
ATOM   2582 C  C   . PHE A 1 346 ? 15.419  8.077   72.145  1.00 53.44  ? 217  PHE A C   1 
ATOM   2583 O  O   . PHE A 1 346 ? 14.778  7.446   72.986  1.00 53.83  ? 217  PHE A O   1 
ATOM   2584 C  CB  . PHE A 1 346 ? 14.407  10.368  72.287  1.00 48.51  ? 217  PHE A CB  1 
ATOM   2585 C  CG  . PHE A 1 346 ? 15.592  10.980  72.981  1.00 57.29  ? 217  PHE A CG  1 
ATOM   2586 C  CD1 . PHE A 1 346 ? 16.361  11.944  72.346  1.00 58.37  ? 217  PHE A CD1 1 
ATOM   2587 C  CD2 . PHE A 1 346 ? 15.935  10.596  74.271  1.00 57.99  ? 217  PHE A CD2 1 
ATOM   2588 C  CE1 . PHE A 1 346 ? 17.453  12.509  72.984  1.00 62.00  ? 217  PHE A CE1 1 
ATOM   2589 C  CE2 . PHE A 1 346 ? 17.024  11.157  74.912  1.00 55.07  ? 217  PHE A CE2 1 
ATOM   2590 C  CZ  . PHE A 1 346 ? 17.783  12.114  74.269  1.00 59.34  ? 217  PHE A CZ  1 
ATOM   2591 N  N   . ILE A 1 347 ? 16.693  7.819   71.861  1.00 53.56  ? 218  ILE A N   1 
ATOM   2592 C  CA  . ILE A 1 347 ? 17.441  6.790   72.574  1.00 54.12  ? 218  ILE A CA  1 
ATOM   2593 C  C   . ILE A 1 347 ? 18.402  7.436   73.568  1.00 53.48  ? 218  ILE A C   1 
ATOM   2594 O  O   . ILE A 1 347 ? 19.433  7.986   73.174  1.00 53.43  ? 218  ILE A O   1 
ATOM   2595 C  CB  . ILE A 1 347 ? 18.230  5.881   71.610  1.00 51.16  ? 218  ILE A CB  1 
ATOM   2596 C  CG1 . ILE A 1 347 ? 17.304  5.272   70.557  1.00 50.56  ? 218  ILE A CG1 1 
ATOM   2597 C  CG2 . ILE A 1 347 ? 18.943  4.783   72.377  1.00 52.27  ? 218  ILE A CG2 1 
ATOM   2598 C  CD1 . ILE A 1 347 ? 17.341  5.986   69.231  1.00 48.21  ? 218  ILE A CD1 1 
ATOM   2599 N  N   . PRO A 1 348 ? 18.060  7.374   74.865  1.00 57.21  ? 219  PRO A N   1 
ATOM   2600 C  CA  . PRO A 1 348 ? 18.808  8.024   75.951  1.00 57.61  ? 219  PRO A CA  1 
ATOM   2601 C  C   . PRO A 1 348 ? 20.301  7.698   75.959  1.00 55.75  ? 219  PRO A C   1 
ATOM   2602 O  O   . PRO A 1 348 ? 21.116  8.606   76.110  1.00 56.64  ? 219  PRO A O   1 
ATOM   2603 C  CB  . PRO A 1 348 ? 18.133  7.476   77.211  1.00 54.34  ? 219  PRO A CB  1 
ATOM   2604 C  CG  . PRO A 1 348 ? 16.738  7.171   76.776  1.00 56.64  ? 219  PRO A CG  1 
ATOM   2605 C  CD  . PRO A 1 348 ? 16.864  6.671   75.365  1.00 56.40  ? 219  PRO A CD  1 
ATOM   2606 N  N   . ALA A 1 349 ? 20.649  6.425   75.799  1.00 54.44  ? 220  ALA A N   1 
ATOM   2607 C  CA  . ALA A 1 349 ? 22.044  6.003   75.851  1.00 53.99  ? 220  ALA A CA  1 
ATOM   2608 C  C   . ALA A 1 349 ? 22.858  6.561   74.688  1.00 54.60  ? 220  ALA A C   1 
ATOM   2609 O  O   . ALA A 1 349 ? 24.068  6.756   74.806  1.00 54.70  ? 220  ALA A O   1 
ATOM   2610 C  CB  . ALA A 1 349 ? 22.135  4.492   75.867  1.00 53.52  ? 220  ALA A CB  1 
ATOM   2611 N  N   . LEU A 1 350 ? 22.193  6.814   73.567  1.00 50.98  ? 221  LEU A N   1 
ATOM   2612 C  CA  . LEU A 1 350 ? 22.881  7.300   72.381  1.00 51.79  ? 221  LEU A CA  1 
ATOM   2613 C  C   . LEU A 1 350 ? 22.722  8.807   72.220  1.00 53.37  ? 221  LEU A C   1 
ATOM   2614 O  O   . LEU A 1 350 ? 23.447  9.430   71.440  1.00 55.18  ? 221  LEU A O   1 
ATOM   2615 C  CB  . LEU A 1 350 ? 22.366  6.580   71.137  1.00 48.60  ? 221  LEU A CB  1 
ATOM   2616 C  CG  . LEU A 1 350 ? 22.442  5.055   71.207  1.00 49.35  ? 221  LEU A CG  1 
ATOM   2617 C  CD1 . LEU A 1 350 ? 21.919  4.437   69.920  1.00 50.09  ? 221  LEU A CD1 1 
ATOM   2618 C  CD2 . LEU A 1 350 ? 23.867  4.600   71.489  1.00 45.58  ? 221  LEU A CD2 1 
ATOM   2619 N  N   . GLN A 1 351 ? 21.772  9.378   72.960  1.00 49.12  ? 222  GLN A N   1 
ATOM   2620 C  CA  . GLN A 1 351 ? 21.511  10.817  72.932  1.00 51.32  ? 222  GLN A CA  1 
ATOM   2621 C  C   . GLN A 1 351 ? 21.160  11.296  71.530  1.00 49.96  ? 222  GLN A C   1 
ATOM   2622 O  O   . GLN A 1 351 ? 21.478  12.420  71.146  1.00 47.09  ? 222  GLN A O   1 
ATOM   2623 C  CB  . GLN A 1 351 ? 22.716  11.594  73.468  1.00 54.78  ? 222  GLN A CB  1 
ATOM   2624 C  CG  . GLN A 1 351 ? 22.854  11.543  74.975  1.00 56.75  ? 222  GLN A CG  1 
ATOM   2625 C  CD  . GLN A 1 351 ? 21.722  12.265  75.673  1.00 62.85  ? 222  GLN A CD  1 
ATOM   2626 O  OE1 . GLN A 1 351 ? 21.326  13.358  75.269  1.00 65.98  ? 222  GLN A OE1 1 
ATOM   2627 N  NE2 . GLN A 1 351 ? 21.186  11.653  76.722  1.00 65.11  ? 222  GLN A NE2 1 
ATOM   2628 N  N   . ILE A 1 352 ? 20.507  10.428  70.766  1.00 53.41  ? 223  ILE A N   1 
ATOM   2629 C  CA  . ILE A 1 352 ? 20.097  10.760  69.409  1.00 51.76  ? 223  ILE A CA  1 
ATOM   2630 C  C   . ILE A 1 352 ? 18.633  10.421  69.181  1.00 47.90  ? 223  ILE A C   1 
ATOM   2631 O  O   . ILE A 1 352 ? 18.057  9.589   69.885  1.00 49.10  ? 223  ILE A O   1 
ATOM   2632 C  CB  . ILE A 1 352 ? 20.943  10.022  68.348  1.00 47.94  ? 223  ILE A CB  1 
ATOM   2633 C  CG1 . ILE A 1 352 ? 20.743  8.510   68.463  1.00 46.55  ? 223  ILE A CG1 1 
ATOM   2634 C  CG2 . ILE A 1 352 ? 22.412  10.394  68.475  1.00 46.76  ? 223  ILE A CG2 1 
ATOM   2635 C  CD1 . ILE A 1 352 ? 21.471  7.717   67.410  1.00 46.45  ? 223  ILE A CD1 1 
ATOM   2636 N  N   . THR A 1 353 ? 18.042  11.080  68.192  1.00 48.10  ? 224  THR A N   1 
ATOM   2637 C  CA  . THR A 1 353 ? 16.679  10.796  67.768  1.00 49.24  ? 224  THR A CA  1 
ATOM   2638 C  C   . THR A 1 353 ? 16.703  10.162  66.380  1.00 45.06  ? 224  THR A C   1 
ATOM   2639 O  O   . THR A 1 353 ? 16.946  10.849  65.387  1.00 43.50  ? 224  THR A O   1 
ATOM   2640 C  CB  . THR A 1 353 ? 15.817  12.074  67.743  1.00 48.45  ? 224  THR A CB  1 
ATOM   2641 O  OG1 . THR A 1 353 ? 15.877  12.722  69.021  1.00 52.51  ? 224  THR A OG1 1 
ATOM   2642 C  CG2 . THR A 1 353 ? 14.376  11.743  67.402  1.00 44.05  ? 224  THR A CG2 1 
ATOM   2643 N  N   . THR A 1 354 ? 16.464  8.855   66.312  1.00 43.53  ? 225  THR A N   1 
ATOM   2644 C  CA  . THR A 1 354 ? 16.549  8.138   65.041  1.00 42.40  ? 225  THR A CA  1 
ATOM   2645 C  C   . THR A 1 354 ? 15.274  8.247   64.212  1.00 44.59  ? 225  THR A C   1 
ATOM   2646 O  O   . THR A 1 354 ? 14.164  8.207   64.742  1.00 45.52  ? 225  THR A O   1 
ATOM   2647 C  CB  . THR A 1 354 ? 16.867  6.641   65.244  1.00 44.36  ? 225  THR A CB  1 
ATOM   2648 O  OG1 . THR A 1 354 ? 15.923  6.062   66.156  1.00 43.75  ? 225  THR A OG1 1 
ATOM   2649 C  CG2 . THR A 1 354 ? 18.283  6.458   65.778  1.00 44.35  ? 225  THR A CG2 1 
ATOM   2650 N  N   . CYS A 1 355 ? 15.455  8.384   62.904  1.00 43.72  ? 226  CYS A N   1 
ATOM   2651 C  CA  . CYS A 1 355 ? 14.353  8.409   61.957  1.00 42.20  ? 226  CYS A CA  1 
ATOM   2652 C  C   . CYS A 1 355 ? 14.396  7.138   61.119  1.00 42.71  ? 226  CYS A C   1 
ATOM   2653 O  O   . CYS A 1 355 ? 15.422  6.831   60.517  1.00 43.47  ? 226  CYS A O   1 
ATOM   2654 C  CB  . CYS A 1 355 ? 14.437  9.653   61.068  1.00 45.25  ? 226  CYS A CB  1 
ATOM   2655 S  SG  . CYS A 1 355 ? 13.139  9.802   59.815  1.00 44.94  ? 226  CYS A SG  1 
ATOM   2656 N  N   . HIS A 1 356 ? 13.294  6.391   61.117  1.00 41.66  ? 227  HIS A N   1 
ATOM   2657 C  CA  . HIS A 1 356 ? 13.160  5.153   60.345  1.00 38.30  ? 227  HIS A CA  1 
ATOM   2658 C  C   . HIS A 1 356 ? 14.036  3.998   60.834  1.00 38.72  ? 227  HIS A C   1 
ATOM   2659 O  O   . HIS A 1 356 ? 13.565  2.863   60.926  1.00 38.19  ? 227  HIS A O   1 
ATOM   2660 C  CB  . HIS A 1 356 ? 13.459  5.414   58.865  1.00 39.71  ? 227  HIS A CB  1 
ATOM   2661 C  CG  . HIS A 1 356 ? 13.363  4.195   58.006  1.00 39.08  ? 227  HIS A CG  1 
ATOM   2662 N  ND1 . HIS A 1 356 ? 14.444  3.379   57.742  1.00 40.61  ? 227  HIS A ND1 1 
ATOM   2663 C  CD2 . HIS A 1 356 ? 12.312  3.645   57.354  1.00 39.82  ? 227  HIS A CD2 1 
ATOM   2664 C  CE1 . HIS A 1 356 ? 14.063  2.387   56.965  1.00 43.72  ? 227  HIS A CE1 1 
ATOM   2665 N  NE2 . HIS A 1 356 ? 12.773  2.521   56.712  1.00 43.16  ? 227  HIS A NE2 1 
ATOM   2666 N  N   . ASP A 1 357 ? 15.300  4.287   61.141  1.00 41.25  ? 228  ASP A N   1 
ATOM   2667 C  CA  . ASP A 1 357 ? 16.303  3.253   61.425  1.00 42.39  ? 228  ASP A CA  1 
ATOM   2668 C  C   . ASP A 1 357 ? 15.967  2.389   62.639  1.00 43.20  ? 228  ASP A C   1 
ATOM   2669 O  O   . ASP A 1 357 ? 16.378  1.230   62.720  1.00 43.58  ? 228  ASP A O   1 
ATOM   2670 C  CB  . ASP A 1 357 ? 17.679  3.893   61.631  1.00 41.53  ? 228  ASP A CB  1 
ATOM   2671 C  CG  . ASP A 1 357 ? 18.052  4.853   60.517  1.00 44.75  ? 228  ASP A CG  1 
ATOM   2672 O  OD1 . ASP A 1 357 ? 17.717  4.576   59.345  1.00 40.66  ? 228  ASP A OD1 1 
ATOM   2673 O  OD2 . ASP A 1 357 ? 18.678  5.891   60.820  1.00 45.02  ? 228  ASP A OD2 1 
ATOM   2674 N  N   . VAL A 1 358 ? 15.231  2.961   63.585  1.00 43.25  ? 229  VAL A N   1 
ATOM   2675 C  CA  . VAL A 1 358 ? 14.800  2.231   64.774  1.00 44.01  ? 229  VAL A CA  1 
ATOM   2676 C  C   . VAL A 1 358 ? 13.285  2.274   64.874  1.00 41.38  ? 229  VAL A C   1 
ATOM   2677 O  O   . VAL A 1 358 ? 12.683  3.338   64.740  1.00 42.40  ? 229  VAL A O   1 
ATOM   2678 C  CB  . VAL A 1 358 ? 15.415  2.816   66.067  1.00 42.78  ? 229  VAL A CB  1 
ATOM   2679 C  CG1 . VAL A 1 358 ? 14.972  2.016   67.280  1.00 40.33  ? 229  VAL A CG1 1 
ATOM   2680 C  CG2 . VAL A 1 358 ? 16.923  2.837   65.969  1.00 41.47  ? 229  VAL A CG2 1 
ATOM   2681 N  N   . LEU A 1 359 ? 12.668  1.118   65.098  1.00 41.08  ? 230  LEU A N   1 
ATOM   2682 C  CA  . LEU A 1 359 ? 11.217  1.052   65.234  1.00 42.65  ? 230  LEU A CA  1 
ATOM   2683 C  C   . LEU A 1 359 ? 10.806  1.411   66.661  1.00 46.27  ? 230  LEU A C   1 
ATOM   2684 O  O   . LEU A 1 359 ? 11.138  0.691   67.603  1.00 45.59  ? 230  LEU A O   1 
ATOM   2685 C  CB  . LEU A 1 359 ? 10.704  -0.339  64.859  1.00 42.13  ? 230  LEU A CB  1 
ATOM   2686 C  CG  . LEU A 1 359 ? 9.185   -0.515  64.797  1.00 51.33  ? 230  LEU A CG  1 
ATOM   2687 C  CD1 . LEU A 1 359 ? 8.571   0.378   63.726  1.00 49.64  ? 230  LEU A CD1 1 
ATOM   2688 C  CD2 . LEU A 1 359 ? 8.835   -1.970  64.547  1.00 54.27  ? 230  LEU A CD2 1 
ATOM   2689 N  N   . PRO A 1 360 ? 10.084  2.534   66.823  1.00 45.63  ? 231  PRO A N   1 
ATOM   2690 C  CA  . PRO A 1 360 ? 9.712   3.054   68.145  1.00 47.14  ? 231  PRO A CA  1 
ATOM   2691 C  C   . PRO A 1 360 ? 8.804   2.111   68.926  1.00 48.72  ? 231  PRO A C   1 
ATOM   2692 O  O   . PRO A 1 360 ? 8.852   2.083   70.157  1.00 51.97  ? 231  PRO A O   1 
ATOM   2693 C  CB  . PRO A 1 360 ? 8.978   4.360   67.813  1.00 43.59  ? 231  PRO A CB  1 
ATOM   2694 C  CG  . PRO A 1 360 ? 9.461   4.738   66.462  1.00 40.65  ? 231  PRO A CG  1 
ATOM   2695 C  CD  . PRO A 1 360 ? 9.648   3.437   65.745  1.00 41.27  ? 231  PRO A CD  1 
ATOM   2696 N  N   . GLU A 1 361 ? 7.988   1.346   68.210  1.00 49.65  ? 232  GLU A N   1 
ATOM   2697 C  CA  . GLU A 1 361 ? 7.050   0.425   68.836  1.00 50.05  ? 232  GLU A CA  1 
ATOM   2698 C  C   . GLU A 1 361 ? 7.308   -1.006  68.380  1.00 52.72  ? 232  GLU A C   1 
ATOM   2699 O  O   . GLU A 1 361 ? 6.861   -1.412  67.310  1.00 53.89  ? 232  GLU A O   1 
ATOM   2700 C  CB  . GLU A 1 361 ? 5.610   0.831   68.517  1.00 52.10  ? 232  GLU A CB  1 
ATOM   2701 C  CG  . GLU A 1 361 ? 4.572   -0.040  69.188  1.00 54.90  ? 232  GLU A CG  1 
ATOM   2702 C  CD  . GLU A 1 361 ? 4.811   -0.154  70.679  1.00 56.78  ? 232  GLU A CD  1 
ATOM   2703 O  OE1 . GLU A 1 361 ? 4.680   0.872   71.377  1.00 63.50  ? 232  GLU A OE1 1 
ATOM   2704 O  OE2 . GLU A 1 361 ? 5.145   -1.261  71.152  1.00 52.03  ? 232  GLU A OE2 1 
ATOM   2705 N  N   . GLN A 1 362 ? 8.016   -1.770  69.205  1.00 56.68  ? 233  GLN A N   1 
ATOM   2706 C  CA  . GLN A 1 362 ? 8.409   -3.134  68.853  1.00 58.21  ? 233  GLN A CA  1 
ATOM   2707 C  C   . GLN A 1 362 ? 7.225   -4.101  68.797  1.00 60.39  ? 233  GLN A C   1 
ATOM   2708 O  O   . GLN A 1 362 ? 7.392   -5.273  68.468  1.00 67.80  ? 233  GLN A O   1 
ATOM   2709 C  CB  . GLN A 1 362 ? 9.448   -3.658  69.849  1.00 60.90  ? 233  GLN A CB  1 
ATOM   2710 C  CG  . GLN A 1 362 ? 10.702  -2.795  69.975  1.00 67.88  ? 233  GLN A CG  1 
ATOM   2711 C  CD  . GLN A 1 362 ? 11.736  -3.086  68.898  1.00 63.58  ? 233  GLN A CD  1 
ATOM   2712 O  OE1 . GLN A 1 362 ? 11.944  -4.237  68.514  1.00 63.01  ? 233  GLN A OE1 1 
ATOM   2713 N  NE2 . GLN A 1 362 ? 12.394  -2.038  68.410  1.00 56.17  ? 233  GLN A NE2 1 
ATOM   2714 N  N   . LEU A 1 363 ? 6.034   -3.613  69.125  1.00 56.13  ? 234  LEU A N   1 
ATOM   2715 C  CA  . LEU A 1 363 ? 4.837   -4.447  69.106  1.00 56.34  ? 234  LEU A CA  1 
ATOM   2716 C  C   . LEU A 1 363 ? 4.198   -4.487  67.721  1.00 59.13  ? 234  LEU A C   1 
ATOM   2717 O  O   . LEU A 1 363 ? 3.319   -5.309  67.460  1.00 63.15  ? 234  LEU A O   1 
ATOM   2718 C  CB  . LEU A 1 363 ? 3.813   -3.948  70.132  1.00 54.10  ? 234  LEU A CB  1 
ATOM   2719 C  CG  . LEU A 1 363 ? 3.846   -4.525  71.551  1.00 53.79  ? 234  LEU A CG  1 
ATOM   2720 C  CD1 . LEU A 1 363 ? 5.182   -4.285  72.239  1.00 65.54  ? 234  LEU A CD1 1 
ATOM   2721 C  CD2 . LEU A 1 363 ? 2.711   -3.947  72.381  1.00 53.83  ? 234  LEU A CD2 1 
ATOM   2722 N  N   . LEU A 1 364 ? 4.639   -3.598  66.837  1.00 58.33  ? 235  LEU A N   1 
ATOM   2723 C  CA  . LEU A 1 364 ? 4.081   -3.524  65.490  1.00 56.12  ? 235  LEU A CA  1 
ATOM   2724 C  C   . LEU A 1 364 ? 4.911   -4.301  64.472  1.00 56.38  ? 235  LEU A C   1 
ATOM   2725 O  O   . LEU A 1 364 ? 4.668   -4.210  63.269  1.00 60.10  ? 235  LEU A O   1 
ATOM   2726 C  CB  . LEU A 1 364 ? 3.960   -2.067  65.041  1.00 53.52  ? 235  LEU A CB  1 
ATOM   2727 C  CG  . LEU A 1 364 ? 3.020   -1.152  65.824  1.00 50.28  ? 235  LEU A CG  1 
ATOM   2728 C  CD1 . LEU A 1 364 ? 3.013   0.236   65.204  1.00 42.27  ? 235  LEU A CD1 1 
ATOM   2729 C  CD2 . LEU A 1 364 ? 1.614   -1.734  65.873  1.00 52.35  ? 235  LEU A CD2 1 
ATOM   2730 N  N   . VAL A 1 365 ? 5.889   -5.062  64.952  1.00 59.33  ? 236  VAL A N   1 
ATOM   2731 C  CA  . VAL A 1 365 ? 6.766   -5.824  64.065  1.00 62.04  ? 236  VAL A CA  1 
ATOM   2732 C  C   . VAL A 1 365 ? 5.977   -6.885  63.303  1.00 58.94  ? 236  VAL A C   1 
ATOM   2733 O  O   . VAL A 1 365 ? 6.280   -7.192  62.150  1.00 59.87  ? 236  VAL A O   1 
ATOM   2734 C  CB  . VAL A 1 365 ? 7.917   -6.493  64.844  1.00 61.10  ? 236  VAL A CB  1 
ATOM   2735 C  CG1 . VAL A 1 365 ? 8.818   -7.272  63.906  1.00 60.06  ? 236  VAL A CG1 1 
ATOM   2736 C  CG2 . VAL A 1 365 ? 8.719   -5.445  65.588  1.00 68.46  ? 236  VAL A CG2 1 
ATOM   2737 N  N   . GLY A 1 366 ? 4.955   -7.433  63.952  1.00 58.26  ? 237  GLY A N   1 
ATOM   2738 C  CA  . GLY A 1 366 ? 4.093   -8.411  63.317  1.00 60.44  ? 237  GLY A CA  1 
ATOM   2739 C  C   . GLY A 1 366 ? 3.391   -7.824  62.107  1.00 59.42  ? 237  GLY A C   1 
ATOM   2740 O  O   . GLY A 1 366 ? 3.292   -8.468  61.062  1.00 57.71  ? 237  GLY A O   1 
ATOM   2741 N  N   . ASP A 1 367 ? 2.910   -6.593  62.250  1.00 59.13  ? 238  ASP A N   1 
ATOM   2742 C  CA  . ASP A 1 367 ? 2.264   -5.890  61.148  1.00 60.83  ? 238  ASP A CA  1 
ATOM   2743 C  C   . ASP A 1 367 ? 3.278   -5.497  60.080  1.00 57.87  ? 238  ASP A C   1 
ATOM   2744 O  O   . ASP A 1 367 ? 3.003   -5.599  58.884  1.00 55.71  ? 238  ASP A O   1 
ATOM   2745 C  CB  . ASP A 1 367 ? 1.526   -4.647  61.654  1.00 64.83  ? 238  ASP A CB  1 
ATOM   2746 C  CG  . ASP A 1 367 ? 0.220   -4.986  62.347  1.00 62.97  ? 238  ASP A CG  1 
ATOM   2747 O  OD1 . ASP A 1 367 ? -0.253  -4.169  63.166  1.00 64.10  ? 238  ASP A OD1 1 
ATOM   2748 O  OD2 . ASP A 1 367 ? -0.334  -6.072  62.072  1.00 59.69  ? 238  ASP A OD2 1 
ATOM   2749 N  N   . MET A 1 368 ? 4.452   -5.055  60.522  1.00 59.51  ? 239  MET A N   1 
ATOM   2750 C  CA  . MET A 1 368 ? 5.511   -4.639  59.610  1.00 55.82  ? 239  MET A CA  1 
ATOM   2751 C  C   . MET A 1 368 ? 6.007   -5.794  58.749  1.00 54.23  ? 239  MET A C   1 
ATOM   2752 O  O   . MET A 1 368 ? 6.263   -5.615  57.560  1.00 55.48  ? 239  MET A O   1 
ATOM   2753 C  CB  . MET A 1 368 ? 6.679   -4.028  60.385  1.00 56.22  ? 239  MET A CB  1 
ATOM   2754 C  CG  . MET A 1 368 ? 6.434   -2.603  60.862  1.00 60.19  ? 239  MET A CG  1 
ATOM   2755 S  SD  . MET A 1 368 ? 6.211   -1.439  59.497  1.00 81.91  ? 239  MET A SD  1 
ATOM   2756 C  CE  . MET A 1 368 ? 6.124   0.118   60.379  1.00 64.43  ? 239  MET A CE  1 
ATOM   2757 N  N   . PHE A 1 369 ? 6.136   -6.977  59.345  1.00 53.94  ? 240  PHE A N   1 
ATOM   2758 C  CA  . PHE A 1 369 ? 6.623   -8.142  58.610  1.00 53.62  ? 240  PHE A CA  1 
ATOM   2759 C  C   . PHE A 1 369 ? 5.715   -8.496  57.436  1.00 56.08  ? 240  PHE A C   1 
ATOM   2760 O  O   . PHE A 1 369 ? 6.170   -8.565  56.291  1.00 52.26  ? 240  PHE A O   1 
ATOM   2761 C  CB  . PHE A 1 369 ? 6.759   -9.357  59.530  1.00 53.96  ? 240  PHE A CB  1 
ATOM   2762 C  CG  . PHE A 1 369 ? 7.023   -10.640 58.791  1.00 54.57  ? 240  PHE A CG  1 
ATOM   2763 C  CD1 . PHE A 1 369 ? 8.289   -10.922 58.296  1.00 58.09  ? 240  PHE A CD1 1 
ATOM   2764 C  CD2 . PHE A 1 369 ? 6.006   -11.558 58.576  1.00 55.39  ? 240  PHE A CD2 1 
ATOM   2765 C  CE1 . PHE A 1 369 ? 8.537   -12.098 57.606  1.00 55.56  ? 240  PHE A CE1 1 
ATOM   2766 C  CE2 . PHE A 1 369 ? 6.247   -12.735 57.888  1.00 55.46  ? 240  PHE A CE2 1 
ATOM   2767 C  CZ  . PHE A 1 369 ? 7.515   -13.005 57.402  1.00 56.36  ? 240  PHE A CZ  1 
ATOM   2768 N  N   . ASN A 1 370 ? 4.439   -8.732  57.730  1.00 56.50  ? 241  ASN A N   1 
ATOM   2769 C  CA  . ASN A 1 370 ? 3.460   -9.069  56.702  1.00 53.34  ? 241  ASN A CA  1 
ATOM   2770 C  C   . ASN A 1 370 ? 3.419   -8.011  55.610  1.00 52.85  ? 241  ASN A C   1 
ATOM   2771 O  O   . ASN A 1 370 ? 3.359   -8.331  54.423  1.00 53.54  ? 241  ASN A O   1 
ATOM   2772 C  CB  . ASN A 1 370 ? 2.066   -9.236  57.311  1.00 56.65  ? 241  ASN A CB  1 
ATOM   2773 C  CG  . ASN A 1 370 ? 2.015   -10.323 58.364  1.00 59.73  ? 241  ASN A CG  1 
ATOM   2774 O  OD1 . ASN A 1 370 ? 2.001   -11.513 58.046  1.00 62.41  ? 241  ASN A OD1 1 
ATOM   2775 N  ND2 . ASN A 1 370 ? 1.975   -9.919  59.627  1.00 67.08  ? 241  ASN A ND2 1 
ATOM   2776 N  N   . TYR A 1 371 ? 3.462   -6.751  56.030  1.00 49.77  ? 242  TYR A N   1 
ATOM   2777 C  CA  . TYR A 1 371 ? 3.413   -5.620  55.113  1.00 48.35  ? 242  TYR A CA  1 
ATOM   2778 C  C   . TYR A 1 371 ? 4.530   -5.673  54.070  1.00 51.73  ? 242  TYR A C   1 
ATOM   2779 O  O   . TYR A 1 371 ? 4.263   -5.595  52.870  1.00 51.33  ? 242  TYR A O   1 
ATOM   2780 C  CB  . TYR A 1 371 ? 3.475   -4.311  55.903  1.00 47.00  ? 242  TYR A CB  1 
ATOM   2781 C  CG  . TYR A 1 371 ? 3.637   -3.068  55.060  1.00 46.92  ? 242  TYR A CG  1 
ATOM   2782 C  CD1 . TYR A 1 371 ? 2.551   -2.494  54.410  1.00 44.85  ? 242  TYR A CD1 1 
ATOM   2783 C  CD2 . TYR A 1 371 ? 4.875   -2.455  54.933  1.00 49.43  ? 242  TYR A CD2 1 
ATOM   2784 C  CE1 . TYR A 1 371 ? 2.702   -1.352  53.646  1.00 42.69  ? 242  TYR A CE1 1 
ATOM   2785 C  CE2 . TYR A 1 371 ? 5.034   -1.316  54.173  1.00 45.79  ? 242  TYR A CE2 1 
ATOM   2786 C  CZ  . TYR A 1 371 ? 3.946   -0.768  53.535  1.00 42.26  ? 242  TYR A CZ  1 
ATOM   2787 O  OH  . TYR A 1 371 ? 4.112   0.367   52.779  1.00 45.27  ? 242  TYR A OH  1 
ATOM   2788 N  N   . PHE A 1 372 ? 5.775   -5.821  54.515  1.00 50.22  ? 243  PHE A N   1 
ATOM   2789 C  CA  . PHE A 1 372 ? 6.897   -5.824  53.581  1.00 48.88  ? 243  PHE A CA  1 
ATOM   2790 C  C   . PHE A 1 372 ? 7.046   -7.156  52.851  1.00 51.26  ? 243  PHE A C   1 
ATOM   2791 O  O   . PHE A 1 372 ? 7.759   -7.244  51.853  1.00 50.36  ? 243  PHE A O   1 
ATOM   2792 C  CB  . PHE A 1 372 ? 8.196   -5.459  54.300  1.00 46.17  ? 243  PHE A CB  1 
ATOM   2793 C  CG  . PHE A 1 372 ? 8.328   -3.991  54.578  1.00 48.51  ? 243  PHE A CG  1 
ATOM   2794 C  CD1 . PHE A 1 372 ? 8.508   -3.093  53.539  1.00 45.91  ? 243  PHE A CD1 1 
ATOM   2795 C  CD2 . PHE A 1 372 ? 8.257   -3.504  55.872  1.00 51.29  ? 243  PHE A CD2 1 
ATOM   2796 C  CE1 . PHE A 1 372 ? 8.621   -1.738  53.785  1.00 46.56  ? 243  PHE A CE1 1 
ATOM   2797 C  CE2 . PHE A 1 372 ? 8.371   -2.150  56.126  1.00 50.23  ? 243  PHE A CE2 1 
ATOM   2798 C  CZ  . PHE A 1 372 ? 8.553   -1.266  55.081  1.00 47.24  ? 243  PHE A CZ  1 
ATOM   2799 N  N   . LEU A 1 373 ? 6.363   -8.186  53.339  1.00 53.48  ? 244  LEU A N   1 
ATOM   2800 C  CA  . LEU A 1 373 ? 6.316   -9.462  52.631  1.00 53.30  ? 244  LEU A CA  1 
ATOM   2801 C  C   . LEU A 1 373 ? 5.281   -9.400  51.508  1.00 52.10  ? 244  LEU A C   1 
ATOM   2802 O  O   . LEU A 1 373 ? 5.443   -10.028 50.462  1.00 54.48  ? 244  LEU A O   1 
ATOM   2803 C  CB  . LEU A 1 373 ? 5.994   -10.611 53.588  1.00 53.14  ? 244  LEU A CB  1 
ATOM   2804 C  CG  . LEU A 1 373 ? 5.961   -12.002 52.948  1.00 49.78  ? 244  LEU A CG  1 
ATOM   2805 C  CD1 . LEU A 1 373 ? 7.308   -12.341 52.329  1.00 52.51  ? 244  LEU A CD1 1 
ATOM   2806 C  CD2 . LEU A 1 373 ? 5.549   -13.061 53.956  1.00 52.01  ? 244  LEU A CD2 1 
ATOM   2807 N  N   . SER A 1 374 ? 4.216   -8.638  51.734  1.00 51.69  ? 245  SER A N   1 
ATOM   2808 C  CA  . SER A 1 374 ? 3.199   -8.423  50.711  1.00 53.08  ? 245  SER A CA  1 
ATOM   2809 C  C   . SER A 1 374 ? 3.799   -7.672  49.534  1.00 51.50  ? 245  SER A C   1 
ATOM   2810 O  O   . SER A 1 374 ? 3.635   -8.064  48.380  1.00 52.34  ? 245  SER A O   1 
ATOM   2811 C  CB  . SER A 1 374 ? 2.009   -7.643  51.278  1.00 52.80  ? 245  SER A CB  1 
ATOM   2812 O  OG  . SER A 1 374 ? 1.416   -8.323  52.372  1.00 49.47  ? 245  SER A OG  1 
ATOM   2813 N  N   . LEU A 1 375 ? 4.501   -6.588  49.846  1.00 52.70  ? 246  LEU A N   1 
ATOM   2814 C  CA  . LEU A 1 375 ? 5.114   -5.742  48.832  1.00 54.49  ? 246  LEU A CA  1 
ATOM   2815 C  C   . LEU A 1 375 ? 6.218   -6.467  48.067  1.00 53.88  ? 246  LEU A C   1 
ATOM   2816 O  O   . LEU A 1 375 ? 6.369   -6.280  46.859  1.00 53.48  ? 246  LEU A O   1 
ATOM   2817 C  CB  . LEU A 1 375 ? 5.675   -4.472  49.473  1.00 52.70  ? 246  LEU A CB  1 
ATOM   2818 C  CG  . LEU A 1 375 ? 4.659   -3.605  50.220  1.00 52.75  ? 246  LEU A CG  1 
ATOM   2819 C  CD1 . LEU A 1 375 ? 5.290   -2.298  50.665  1.00 52.01  ? 246  LEU A CD1 1 
ATOM   2820 C  CD2 . LEU A 1 375 ? 3.436   -3.345  49.356  1.00 53.72  ? 246  LEU A CD2 1 
ATOM   2821 N  N   . ALA A 1 376 ? 6.983   -7.293  48.776  1.00 52.07  ? 247  ALA A N   1 
ATOM   2822 C  CA  . ALA A 1 376 ? 8.106   -8.009  48.178  1.00 49.50  ? 247  ALA A CA  1 
ATOM   2823 C  C   . ALA A 1 376 ? 7.634   -9.033  47.155  1.00 52.38  ? 247  ALA A C   1 
ATOM   2824 O  O   . ALA A 1 376 ? 8.385   -9.433  46.266  1.00 54.32  ? 247  ALA A O   1 
ATOM   2825 C  CB  . ALA A 1 376 ? 8.937   -8.689  49.254  1.00 48.93  ? 247  ALA A CB  1 
ATOM   2826 N  N   . ILE A 1 377 ? 6.386   -9.460  47.291  1.00 53.27  ? 248  ILE A N   1 
ATOM   2827 C  CA  . ILE A 1 377 ? 5.813   -10.417 46.360  1.00 53.93  ? 248  ILE A CA  1 
ATOM   2828 C  C   . ILE A 1 377 ? 5.062   -9.700  45.243  1.00 52.02  ? 248  ILE A C   1 
ATOM   2829 O  O   . ILE A 1 377 ? 5.395   -9.842  44.070  1.00 54.86  ? 248  ILE A O   1 
ATOM   2830 C  CB  . ILE A 1 377 ? 4.871   -11.397 47.081  1.00 53.94  ? 248  ILE A CB  1 
ATOM   2831 C  CG1 . ILE A 1 377 ? 5.672   -12.274 48.047  1.00 53.42  ? 248  ILE A CG1 1 
ATOM   2832 C  CG2 . ILE A 1 377 ? 4.119   -12.257 46.079  1.00 53.00  ? 248  ILE A CG2 1 
ATOM   2833 C  CD1 . ILE A 1 377 ? 4.818   -13.182 48.908  1.00 54.48  ? 248  ILE A CD1 1 
ATOM   2834 N  N   . GLY A 1 378 ? 4.064   -8.908  45.618  1.00 51.32  ? 249  GLY A N   1 
ATOM   2835 C  CA  . GLY A 1 378 ? 3.176   -8.287  44.653  1.00 54.05  ? 249  GLY A CA  1 
ATOM   2836 C  C   . GLY A 1 378 ? 3.703   -7.046  43.959  1.00 53.26  ? 249  GLY A C   1 
ATOM   2837 O  O   . GLY A 1 378 ? 3.248   -6.703  42.873  1.00 50.56  ? 249  GLY A O   1 
ATOM   2838 N  N   . VAL A 1 379 ? 4.654   -6.359  44.581  1.00 55.92  ? 250  VAL A N   1 
ATOM   2839 C  CA  . VAL A 1 379 ? 5.191   -5.135  43.995  1.00 54.88  ? 250  VAL A CA  1 
ATOM   2840 C  C   . VAL A 1 379 ? 6.681   -5.276  43.693  1.00 54.29  ? 250  VAL A C   1 
ATOM   2841 O  O   . VAL A 1 379 ? 7.338   -4.318  43.286  1.00 58.18  ? 250  VAL A O   1 
ATOM   2842 C  CB  . VAL A 1 379 ? 4.967   -3.919  44.917  1.00 54.60  ? 250  VAL A CB  1 
ATOM   2843 C  CG1 . VAL A 1 379 ? 4.882   -2.638  44.097  1.00 50.87  ? 250  VAL A CG1 1 
ATOM   2844 C  CG2 . VAL A 1 379 ? 3.698   -4.098  45.731  1.00 55.38  ? 250  VAL A CG2 1 
ATOM   2845 N  N   . PHE A 1 380 ? 7.217   -6.475  43.885  1.00 51.28  ? 251  PHE A N   1 
ATOM   2846 C  CA  . PHE A 1 380 ? 8.613   -6.709  43.550  1.00 51.79  ? 251  PHE A CA  1 
ATOM   2847 C  C   . PHE A 1 380 ? 8.787   -7.899  42.609  1.00 52.93  ? 251  PHE A C   1 
ATOM   2848 O  O   . PHE A 1 380 ? 9.195   -7.729  41.465  1.00 50.96  ? 251  PHE A O   1 
ATOM   2849 C  CB  . PHE A 1 380 ? 9.446   -6.917  44.812  1.00 46.82  ? 251  PHE A CB  1 
ATOM   2850 C  CG  . PHE A 1 380 ? 10.838  -7.396  44.535  1.00 48.37  ? 251  PHE A CG  1 
ATOM   2851 C  CD1 . PHE A 1 380 ? 11.719  -6.615  43.805  1.00 48.12  ? 251  PHE A CD1 1 
ATOM   2852 C  CD2 . PHE A 1 380 ? 11.264  -8.632  44.994  1.00 49.30  ? 251  PHE A CD2 1 
ATOM   2853 C  CE1 . PHE A 1 380 ? 13.002  -7.055  43.537  1.00 49.46  ? 251  PHE A CE1 1 
ATOM   2854 C  CE2 . PHE A 1 380 ? 12.549  -9.080  44.734  1.00 49.27  ? 251  PHE A CE2 1 
ATOM   2855 C  CZ  . PHE A 1 380 ? 13.419  -8.290  44.004  1.00 50.19  ? 251  PHE A CZ  1 
ATOM   2856 N  N   . LEU A 1 381 ? 8.480   -9.098  43.093  1.00 52.25  ? 252  LEU A N   1 
ATOM   2857 C  CA  . LEU A 1 381 ? 8.621   -10.305 42.286  1.00 52.81  ? 252  LEU A CA  1 
ATOM   2858 C  C   . LEU A 1 381 ? 7.724   -10.284 41.055  1.00 53.66  ? 252  LEU A C   1 
ATOM   2859 O  O   . LEU A 1 381 ? 8.181   -10.515 39.934  1.00 54.69  ? 252  LEU A O   1 
ATOM   2860 C  CB  . LEU A 1 381 ? 8.309   -11.543 43.123  1.00 52.81  ? 252  LEU A CB  1 
ATOM   2861 C  CG  . LEU A 1 381 ? 9.325   -11.883 44.208  1.00 51.64  ? 252  LEU A CG  1 
ATOM   2862 C  CD1 . LEU A 1 381 ? 8.904   -13.151 44.923  1.00 55.58  ? 252  LEU A CD1 1 
ATOM   2863 C  CD2 . LEU A 1 381 ? 10.712  -12.029 43.604  1.00 47.39  ? 252  LEU A CD2 1 
ATOM   2864 N  N   . PHE A 1 382 ? 6.444   -10.013 41.273  1.00 51.84  ? 253  PHE A N   1 
ATOM   2865 C  CA  . PHE A 1 382 ? 5.476   -9.990  40.188  1.00 54.34  ? 253  PHE A CA  1 
ATOM   2866 C  C   . PHE A 1 382 ? 5.843   -8.956  39.108  1.00 56.07  ? 253  PHE A C   1 
ATOM   2867 O  O   . PHE A 1 382 ? 5.810   -9.278  37.921  1.00 58.08  ? 253  PHE A O   1 
ATOM   2868 C  CB  . PHE A 1 382 ? 4.071   -9.738  40.747  1.00 53.98  ? 253  PHE A CB  1 
ATOM   2869 C  CG  . PHE A 1 382 ? 3.009   -9.613  39.695  1.00 55.99  ? 253  PHE A CG  1 
ATOM   2870 C  CD1 . PHE A 1 382 ? 2.764   -10.651 38.811  1.00 58.89  ? 253  PHE A CD1 1 
ATOM   2871 C  CD2 . PHE A 1 382 ? 2.240   -8.462  39.601  1.00 55.79  ? 253  PHE A CD2 1 
ATOM   2872 C  CE1 . PHE A 1 382 ? 1.781   -10.540 37.842  1.00 60.98  ? 253  PHE A CE1 1 
ATOM   2873 C  CE2 . PHE A 1 382 ? 1.254   -8.346  38.637  1.00 59.21  ? 253  PHE A CE2 1 
ATOM   2874 C  CZ  . PHE A 1 382 ? 1.024   -9.386  37.757  1.00 63.37  ? 253  PHE A CZ  1 
ATOM   2875 N  N   . PRO A 1 383 ? 6.207   -7.719  39.503  1.00 53.50  ? 254  PRO A N   1 
ATOM   2876 C  CA  . PRO A 1 383 ? 6.678   -6.825  38.438  1.00 52.24  ? 254  PRO A CA  1 
ATOM   2877 C  C   . PRO A 1 383 ? 8.038   -7.227  37.863  1.00 52.38  ? 254  PRO A C   1 
ATOM   2878 O  O   . PRO A 1 383 ? 8.345   -6.858  36.734  1.00 53.71  ? 254  PRO A O   1 
ATOM   2879 C  CB  . PRO A 1 383 ? 6.779   -5.465  39.137  1.00 52.71  ? 254  PRO A CB  1 
ATOM   2880 C  CG  . PRO A 1 383 ? 5.883   -5.568  40.309  1.00 53.71  ? 254  PRO A CG  1 
ATOM   2881 C  CD  . PRO A 1 383 ? 6.012   -6.986  40.767  1.00 55.71  ? 254  PRO A CD  1 
ATOM   2882 N  N   . ALA A 1 384 ? 8.842   -7.960  38.626  1.00 50.25  ? 255  ALA A N   1 
ATOM   2883 C  CA  . ALA A 1 384 ? 10.137  -8.410  38.128  1.00 53.92  ? 255  ALA A CA  1 
ATOM   2884 C  C   . ALA A 1 384 ? 9.937   -9.487  37.077  1.00 55.76  ? 255  ALA A C   1 
ATOM   2885 O  O   . ALA A 1 384 ? 10.668  -9.555  36.089  1.00 55.08  ? 255  ALA A O   1 
ATOM   2886 C  CB  . ALA A 1 384 ? 11.005  -8.930  39.261  1.00 50.61  ? 255  ALA A CB  1 
ATOM   2887 N  N   . PHE A 1 385 ? 8.935   -10.327 37.302  1.00 56.96  ? 256  PHE A N   1 
ATOM   2888 C  CA  . PHE A 1 385 ? 8.599   -11.391 36.371  1.00 57.44  ? 256  PHE A CA  1 
ATOM   2889 C  C   . PHE A 1 385 ? 8.098   -10.819 35.047  1.00 58.75  ? 256  PHE A C   1 
ATOM   2890 O  O   . PHE A 1 385 ? 8.459   -11.302 33.974  1.00 59.98  ? 256  PHE A O   1 
ATOM   2891 C  CB  . PHE A 1 385 ? 7.549   -12.316 36.986  1.00 60.89  ? 256  PHE A CB  1 
ATOM   2892 C  CG  . PHE A 1 385 ? 7.070   -13.388 36.056  1.00 64.72  ? 256  PHE A CG  1 
ATOM   2893 C  CD1 . PHE A 1 385 ? 7.852   -14.503 35.803  1.00 66.50  ? 256  PHE A CD1 1 
ATOM   2894 C  CD2 . PHE A 1 385 ? 5.836   -13.285 35.438  1.00 67.65  ? 256  PHE A CD2 1 
ATOM   2895 C  CE1 . PHE A 1 385 ? 7.415   -15.493 34.948  1.00 69.57  ? 256  PHE A CE1 1 
ATOM   2896 C  CE2 . PHE A 1 385 ? 5.391   -14.273 34.580  1.00 70.54  ? 256  PHE A CE2 1 
ATOM   2897 C  CZ  . PHE A 1 385 ? 6.183   -15.379 34.335  1.00 72.64  ? 256  PHE A CZ  1 
ATOM   2898 N  N   . LEU A 1 386 ? 7.270   -9.783  35.131  1.00 57.80  ? 257  LEU A N   1 
ATOM   2899 C  CA  . LEU A 1 386 ? 6.737   -9.131  33.941  1.00 56.51  ? 257  LEU A CA  1 
ATOM   2900 C  C   . LEU A 1 386 ? 7.804   -8.296  33.240  1.00 56.45  ? 257  LEU A C   1 
ATOM   2901 O  O   . LEU A 1 386 ? 7.738   -8.072  32.034  1.00 57.10  ? 257  LEU A O   1 
ATOM   2902 C  CB  . LEU A 1 386 ? 5.542   -8.251  34.306  1.00 54.01  ? 257  LEU A CB  1 
ATOM   2903 C  CG  . LEU A 1 386 ? 4.383   -8.991  34.974  1.00 60.35  ? 257  LEU A CG  1 
ATOM   2904 C  CD1 . LEU A 1 386 ? 3.261   -8.031  35.342  1.00 58.63  ? 257  LEU A CD1 1 
ATOM   2905 C  CD2 . LEU A 1 386 ? 3.875   -10.100 34.068  1.00 61.75  ? 257  LEU A CD2 1 
ATOM   2906 N  N   . THR A 1 387 ? 8.786   -7.837  34.007  1.00 56.21  ? 258  THR A N   1 
ATOM   2907 C  CA  . THR A 1 387 ? 9.841   -6.988  33.473  1.00 52.86  ? 258  THR A CA  1 
ATOM   2908 C  C   . THR A 1 387 ? 10.868  -7.811  32.709  1.00 54.84  ? 258  THR A C   1 
ATOM   2909 O  O   . THR A 1 387 ? 11.278  -7.436  31.612  1.00 55.86  ? 258  THR A O   1 
ATOM   2910 C  CB  . THR A 1 387 ? 10.545  -6.199  34.595  1.00 51.00  ? 258  THR A CB  1 
ATOM   2911 O  OG1 . THR A 1 387 ? 9.568   -5.456  35.335  1.00 56.56  ? 258  THR A OG1 1 
ATOM   2912 C  CG2 . THR A 1 387 ? 11.570  -5.238  34.023  1.00 47.85  ? 258  THR A CG2 1 
ATOM   2913 N  N   . ALA A 1 388 ? 11.276  -8.933  33.293  1.00 53.80  ? 259  ALA A N   1 
ATOM   2914 C  CA  . ALA A 1 388 ? 12.276  -9.799  32.679  1.00 54.85  ? 259  ALA A CA  1 
ATOM   2915 C  C   . ALA A 1 388 ? 11.765  -10.410 31.376  1.00 64.10  ? 259  ALA A C   1 
ATOM   2916 O  O   . ALA A 1 388 ? 12.442  -10.362 30.345  1.00 59.78  ? 259  ALA A O   1 
ATOM   2917 C  CB  . ALA A 1 388 ? 12.691  -10.894 33.649  1.00 53.75  ? 259  ALA A CB  1 
ATOM   2918 N  N   . SER A 1 389 ? 10.566  -10.981 31.425  1.00 60.46  ? 260  SER A N   1 
ATOM   2919 C  CA  . SER A 1 389 ? 9.995   -11.644 30.261  1.00 55.53  ? 260  SER A CA  1 
ATOM   2920 C  C   . SER A 1 389 ? 9.674   -10.649 29.148  1.00 57.72  ? 260  SER A C   1 
ATOM   2921 O  O   . SER A 1 389 ? 9.586   -11.027 27.980  1.00 61.14  ? 260  SER A O   1 
ATOM   2922 C  CB  . SER A 1 389 ? 8.738   -12.422 30.653  1.00 55.65  ? 260  SER A CB  1 
ATOM   2923 O  OG  . SER A 1 389 ? 7.734   -11.557 31.151  1.00 57.43  ? 260  SER A OG  1 
ATOM   2924 N  N   . ALA A 1 390 ? 9.502   -9.380  29.506  1.00 55.13  ? 261  ALA A N   1 
ATOM   2925 C  CA  . ALA A 1 390 ? 9.257   -8.351  28.504  1.00 55.21  ? 261  ALA A CA  1 
ATOM   2926 C  C   . ALA A 1 390 ? 10.480  -8.204  27.609  1.00 56.46  ? 261  ALA A C   1 
ATOM   2927 O  O   . ALA A 1 390 ? 10.358  -8.126  26.388  1.00 59.30  ? 261  ALA A O   1 
ATOM   2928 C  CB  . ALA A 1 390 ? 8.907   -7.025  29.156  1.00 50.01  ? 261  ALA A CB  1 
ATOM   2929 N  N   . TYR A 1 391 ? 11.659  -8.182  28.222  1.00 54.10  ? 262  TYR A N   1 
ATOM   2930 C  CA  . TYR A 1 391 ? 12.904  -8.103  27.465  1.00 56.03  ? 262  TYR A CA  1 
ATOM   2931 C  C   . TYR A 1 391 ? 13.183  -9.402  26.717  1.00 58.20  ? 262  TYR A C   1 
ATOM   2932 O  O   . TYR A 1 391 ? 13.858  -9.399  25.690  1.00 60.20  ? 262  TYR A O   1 
ATOM   2933 C  CB  . TYR A 1 391 ? 14.075  -7.756  28.388  1.00 53.20  ? 262  TYR A CB  1 
ATOM   2934 C  CG  . TYR A 1 391 ? 14.042  -6.320  28.849  1.00 51.79  ? 262  TYR A CG  1 
ATOM   2935 C  CD1 . TYR A 1 391 ? 14.462  -5.295  28.011  1.00 52.12  ? 262  TYR A CD1 1 
ATOM   2936 C  CD2 . TYR A 1 391 ? 13.570  -5.984  30.108  1.00 48.05  ? 262  TYR A CD2 1 
ATOM   2937 C  CE1 . TYR A 1 391 ? 14.422  -3.979  28.419  1.00 48.58  ? 262  TYR A CE1 1 
ATOM   2938 C  CE2 . TYR A 1 391 ? 13.527  -4.672  30.526  1.00 44.05  ? 262  TYR A CE2 1 
ATOM   2939 C  CZ  . TYR A 1 391 ? 13.954  -3.673  29.677  1.00 45.51  ? 262  TYR A CZ  1 
ATOM   2940 O  OH  . TYR A 1 391 ? 13.914  -2.362  30.089  1.00 44.15  ? 262  TYR A OH  1 
ATOM   2941 N  N   . VAL A 1 392 ? 12.655  -10.509 27.229  1.00 57.26  ? 263  VAL A N   1 
ATOM   2942 C  CA  . VAL A 1 392 ? 12.783  -11.793 26.553  1.00 59.12  ? 263  VAL A CA  1 
ATOM   2943 C  C   . VAL A 1 392 ? 12.112  -11.741 25.185  1.00 61.71  ? 263  VAL A C   1 
ATOM   2944 O  O   . VAL A 1 392 ? 12.689  -12.156 24.184  1.00 65.07  ? 263  VAL A O   1 
ATOM   2945 C  CB  . VAL A 1 392 ? 12.170  -12.936 27.380  1.00 60.95  ? 263  VAL A CB  1 
ATOM   2946 C  CG1 . VAL A 1 392 ? 12.048  -14.199 26.539  1.00 65.86  ? 263  VAL A CG1 1 
ATOM   2947 C  CG2 . VAL A 1 392 ? 13.004  -13.192 28.627  1.00 61.81  ? 263  VAL A CG2 1 
ATOM   2948 N  N   . LEU A 1 393 ? 10.893  -11.215 25.149  1.00 60.87  ? 264  LEU A N   1 
ATOM   2949 C  CA  . LEU A 1 393 ? 10.157  -11.089 23.897  1.00 61.10  ? 264  LEU A CA  1 
ATOM   2950 C  C   . LEU A 1 393 ? 10.709  -9.952  23.043  1.00 62.88  ? 264  LEU A C   1 
ATOM   2951 O  O   . LEU A 1 393 ? 10.724  -10.038 21.813  1.00 65.16  ? 264  LEU A O   1 
ATOM   2952 C  CB  . LEU A 1 393 ? 8.666   -10.865 24.168  1.00 59.15  ? 264  LEU A CB  1 
ATOM   2953 C  CG  . LEU A 1 393 ? 7.949   -11.946 24.979  1.00 59.79  ? 264  LEU A CG  1 
ATOM   2954 C  CD1 . LEU A 1 393 ? 6.471   -11.624 25.113  1.00 60.93  ? 264  LEU A CD1 1 
ATOM   2955 C  CD2 . LEU A 1 393 ? 8.145   -13.315 24.349  1.00 63.15  ? 264  LEU A CD2 1 
ATOM   2956 N  N   . MET A 1 394 ? 11.163  -8.890  23.700  1.00 58.27  ? 265  MET A N   1 
ATOM   2957 C  CA  . MET A 1 394 ? 11.645  -7.711  22.990  1.00 60.36  ? 265  MET A CA  1 
ATOM   2958 C  C   . MET A 1 394 ? 12.936  -7.998  22.234  1.00 62.61  ? 265  MET A C   1 
ATOM   2959 O  O   . MET A 1 394 ? 13.046  -7.701  21.045  1.00 62.36  ? 265  MET A O   1 
ATOM   2960 C  CB  . MET A 1 394 ? 11.863  -6.551  23.960  1.00 61.14  ? 265  MET A CB  1 
ATOM   2961 C  CG  . MET A 1 394 ? 12.360  -5.279  23.296  1.00 61.45  ? 265  MET A CG  1 
ATOM   2962 S  SD  . MET A 1 394 ? 13.002  -4.079  24.483  1.00 63.77  ? 265  MET A SD  1 
ATOM   2963 C  CE  . MET A 1 394 ? 11.528  -3.740  25.448  1.00 65.84  ? 265  MET A CE  1 
ATOM   2964 N  N   . ILE A 1 395 ? 13.909  -8.575  22.933  1.00 62.95  ? 266  ILE A N   1 
ATOM   2965 C  CA  . ILE A 1 395 ? 15.215  -8.861  22.350  1.00 62.99  ? 266  ILE A CA  1 
ATOM   2966 C  C   . ILE A 1 395 ? 15.122  -9.863  21.200  1.00 63.46  ? 266  ILE A C   1 
ATOM   2967 O  O   . ILE A 1 395 ? 15.691  -9.641  20.131  1.00 63.05  ? 266  ILE A O   1 
ATOM   2968 C  CB  . ILE A 1 395 ? 16.192  -9.390  23.417  1.00 61.41  ? 266  ILE A CB  1 
ATOM   2969 C  CG1 . ILE A 1 395 ? 16.523  -8.282  24.418  1.00 60.40  ? 266  ILE A CG1 1 
ATOM   2970 C  CG2 . ILE A 1 395 ? 17.466  -9.912  22.776  1.00 65.03  ? 266  ILE A CG2 1 
ATOM   2971 C  CD1 . ILE A 1 395 ? 17.382  -8.738  25.580  1.00 62.91  ? 266  ILE A CD1 1 
ATOM   2972 N  N   . ARG A 1 396 ? 14.395  -10.956 21.417  1.00 64.40  ? 267  ARG A N   1 
ATOM   2973 C  CA  . ARG A 1 396 ? 14.229  -11.984 20.392  1.00 65.75  ? 267  ARG A CA  1 
ATOM   2974 C  C   . ARG A 1 396 ? 13.606  -11.427 19.112  1.00 62.34  ? 267  ARG A C   1 
ATOM   2975 O  O   . ARG A 1 396 ? 14.061  -11.733 18.011  1.00 61.64  ? 267  ARG A O   1 
ATOM   2976 C  CB  . ARG A 1 396 ? 13.379  -13.138 20.927  1.00 68.82  ? 267  ARG A CB  1 
ATOM   2977 C  CG  . ARG A 1 396 ? 14.094  -14.018 21.942  1.00 74.07  ? 267  ARG A CG  1 
ATOM   2978 C  CD  . ARG A 1 396 ? 13.163  -15.084 22.497  1.00 81.77  ? 267  ARG A CD  1 
ATOM   2979 N  NE  . ARG A 1 396 ? 13.837  -15.972 23.441  1.00 87.44  ? 267  ARG A NE  1 
ATOM   2980 C  CZ  . ARG A 1 396 ? 13.227  -16.933 24.128  1.00 93.94  ? 267  ARG A CZ  1 
ATOM   2981 N  NH1 . ARG A 1 396 ? 11.924  -17.130 23.979  1.00 92.15  ? 267  ARG A NH1 1 
ATOM   2982 N  NH2 . ARG A 1 396 ? 13.918  -17.694 24.966  1.00 94.65  ? 267  ARG A NH2 1 
ATOM   2983 N  N   . ALA A 1 397 ? 12.573  -10.605 19.258  1.00 63.50  ? 268  ALA A N   1 
ATOM   2984 C  CA  . ALA A 1 397 ? 11.909  -10.005 18.103  1.00 61.02  ? 268  ALA A CA  1 
ATOM   2985 C  C   . ALA A 1 397 ? 12.844  -9.057  17.356  1.00 58.59  ? 268  ALA A C   1 
ATOM   2986 O  O   . ALA A 1 397 ? 12.800  -8.963  16.131  1.00 60.14  ? 268  ALA A O   1 
ATOM   2987 C  CB  . ALA A 1 397 ? 10.652  -9.273  18.537  1.00 57.75  ? 268  ALA A CB  1 
ATOM   2988 N  N   . LEU A 1 398 ? 13.690  -8.355  18.100  1.00 59.97  ? 269  LEU A N   1 
ATOM   2989 C  CA  . LEU A 1 398 ? 14.652  -7.439  17.501  1.00 59.61  ? 269  LEU A CA  1 
ATOM   2990 C  C   . LEU A 1 398 ? 15.827  -8.213  16.920  1.00 60.25  ? 269  LEU A C   1 
ATOM   2991 O  O   . LEU A 1 398 ? 16.541  -7.717  16.048  1.00 59.27  ? 269  LEU A O   1 
ATOM   2992 C  CB  . LEU A 1 398 ? 15.141  -6.417  18.532  1.00 58.70  ? 269  LEU A CB  1 
ATOM   2993 C  CG  . LEU A 1 398 ? 14.114  -5.378  18.992  1.00 62.17  ? 269  LEU A CG  1 
ATOM   2994 C  CD1 . LEU A 1 398 ? 14.657  -4.543  20.142  1.00 60.76  ? 269  LEU A CD1 1 
ATOM   2995 C  CD2 . LEU A 1 398 ? 13.694  -4.484  17.834  1.00 60.38  ? 269  LEU A CD2 1 
ATOM   2996 N  N   . ALA A 1 399 ? 16.017  -9.433  17.411  1.00 60.96  ? 2000 ALA A N   1 
ATOM   2997 C  CA  . ALA A 1 399 ? 17.073  -10.309 16.921  1.00 59.41  ? 2000 ALA A CA  1 
ATOM   2998 C  C   . ALA A 1 399 ? 16.651  -11.004 15.627  1.00 62.27  ? 2000 ALA A C   1 
ATOM   2999 O  O   . ALA A 1 399 ? 17.477  -11.260 14.750  1.00 58.87  ? 2000 ALA A O   1 
ATOM   3000 C  CB  . ALA A 1 399 ? 17.438  -11.336 17.980  1.00 53.47  ? 2000 ALA A CB  1 
ATOM   3001 N  N   . ASP A 1 400 ? 15.361  -11.308 15.517  1.00 60.51  ? 2001 ASP A N   1 
ATOM   3002 C  CA  . ASP A 1 400 ? 14.826  -11.940 14.319  1.00 58.39  ? 2001 ASP A CA  1 
ATOM   3003 C  C   . ASP A 1 400 ? 14.833  -10.967 13.150  1.00 59.73  ? 2001 ASP A C   1 
ATOM   3004 O  O   . ASP A 1 400 ? 15.222  -11.322 12.039  1.00 62.69  ? 2001 ASP A O   1 
ATOM   3005 C  CB  . ASP A 1 400 ? 13.409  -12.458 14.563  1.00 58.39  ? 2001 ASP A CB  1 
ATOM   3006 C  CG  . ASP A 1 400 ? 13.367  -13.580 15.578  1.00 61.19  ? 2001 ASP A CG  1 
ATOM   3007 O  OD1 . ASP A 1 400 ? 14.425  -14.196 15.833  1.00 61.60  ? 2001 ASP A OD1 1 
ATOM   3008 O  OD2 . ASP A 1 400 ? 12.274  -13.850 16.119  1.00 69.83  ? 2001 ASP A OD2 1 
ATOM   3009 N  N   . LEU A 1 401 ? 14.405  -9.736  13.406  1.00 58.24  ? 2002 LEU A N   1 
ATOM   3010 C  CA  . LEU A 1 401 ? 14.414  -8.706  12.377  1.00 60.99  ? 2002 LEU A CA  1 
ATOM   3011 C  C   . LEU A 1 401 ? 15.845  -8.433  11.919  1.00 60.94  ? 2002 LEU A C   1 
ATOM   3012 O  O   . LEU A 1 401 ? 16.087  -8.150  10.745  1.00 69.79  ? 2002 LEU A O   1 
ATOM   3013 C  CB  . LEU A 1 401 ? 13.755  -7.422  12.887  1.00 59.58  ? 2002 LEU A CB  1 
ATOM   3014 C  CG  . LEU A 1 401 ? 13.751  -6.240  11.914  1.00 62.51  ? 2002 LEU A CG  1 
ATOM   3015 C  CD1 . LEU A 1 401 ? 13.132  -6.635  10.580  1.00 59.95  ? 2002 LEU A CD1 1 
ATOM   3016 C  CD2 . LEU A 1 401 ? 13.028  -5.045  12.513  1.00 65.45  ? 2002 LEU A CD2 1 
ATOM   3017 N  N   . GLU A 1 402 ? 16.789  -8.533  12.849  1.00 60.57  ? 2003 GLU A N   1 
ATOM   3018 C  CA  . GLU A 1 402 ? 18.206  -8.385  12.534  1.00 64.27  ? 2003 GLU A CA  1 
ATOM   3019 C  C   . GLU A 1 402 ? 18.682  -9.493  11.596  1.00 65.98  ? 2003 GLU A C   1 
ATOM   3020 O  O   . GLU A 1 402 ? 19.408  -9.236  10.636  1.00 66.61  ? 2003 GLU A O   1 
ATOM   3021 C  CB  . GLU A 1 402 ? 19.044  -8.394  13.815  1.00 66.18  ? 2003 GLU A CB  1 
ATOM   3022 C  CG  . GLU A 1 402 ? 20.545  -8.237  13.587  1.00 71.25  ? 2003 GLU A CG  1 
ATOM   3023 C  CD  . GLU A 1 402 ? 21.368  -8.722  14.770  1.00 73.70  ? 2003 GLU A CD  1 
ATOM   3024 O  OE1 . GLU A 1 402 ? 20.918  -9.657  15.469  1.00 66.57  ? 2003 GLU A OE1 1 
ATOM   3025 O  OE2 . GLU A 1 402 ? 22.462  -8.169  15.004  1.00 72.65  ? 2003 GLU A OE2 1 
ATOM   3026 N  N   . ASP A 1 403 ? 18.270  -10.724 11.887  1.00 64.78  ? 2004 ASP A N   1 
ATOM   3027 C  CA  . ASP A 1 403 ? 18.666  -11.883 11.091  1.00 66.76  ? 2004 ASP A CA  1 
ATOM   3028 C  C   . ASP A 1 403 ? 18.100  -11.821 9.679   1.00 65.29  ? 2004 ASP A C   1 
ATOM   3029 O  O   . ASP A 1 403 ? 18.743  -12.257 8.727   1.00 64.54  ? 2004 ASP A O   1 
ATOM   3030 C  CB  . ASP A 1 403 ? 18.219  -13.177 11.773  1.00 66.26  ? 2004 ASP A CB  1 
ATOM   3031 C  CG  . ASP A 1 403 ? 18.984  -13.453 13.049  1.00 73.36  ? 2004 ASP A CG  1 
ATOM   3032 O  OD1 . ASP A 1 403 ? 20.200  -13.169 13.084  1.00 76.33  ? 2004 ASP A OD1 1 
ATOM   3033 O  OD2 . ASP A 1 403 ? 18.370  -13.951 14.016  1.00 81.79  ? 2004 ASP A OD2 1 
ATOM   3034 N  N   . ASN A 1 404 ? 16.892  -11.281 9.552   1.00 63.15  ? 2005 ASN A N   1 
ATOM   3035 C  CA  . ASN A 1 404 ? 16.268  -11.110 8.247   1.00 64.59  ? 2005 ASN A CA  1 
ATOM   3036 C  C   . ASN A 1 404 ? 17.047  -10.136 7.370   1.00 64.64  ? 2005 ASN A C   1 
ATOM   3037 O  O   . ASN A 1 404 ? 17.352  -10.435 6.216   1.00 63.90  ? 2005 ASN A O   1 
ATOM   3038 C  CB  . ASN A 1 404 ? 14.826  -10.627 8.403   1.00 62.02  ? 2005 ASN A CB  1 
ATOM   3039 C  CG  . ASN A 1 404 ? 13.951  -11.630 9.121   1.00 61.51  ? 2005 ASN A CG  1 
ATOM   3040 O  OD1 . ASN A 1 404 ? 14.199  -12.834 9.074   1.00 61.34  ? 2005 ASN A OD1 1 
ATOM   3041 N  ND2 . ASN A 1 404 ? 12.916  -11.139 9.792   1.00 63.63  ? 2005 ASN A ND2 1 
ATOM   3042 N  N   . TRP A 1 405 ? 17.368  -8.972  7.926   1.00 65.00  ? 2006 TRP A N   1 
ATOM   3043 C  CA  . TRP A 1 405 ? 18.100  -7.945  7.192   1.00 65.27  ? 2006 TRP A CA  1 
ATOM   3044 C  C   . TRP A 1 405 ? 19.496  -8.439  6.838   1.00 65.73  ? 2006 TRP A C   1 
ATOM   3045 O  O   . TRP A 1 405 ? 20.070  -8.031  5.831   1.00 65.86  ? 2006 TRP A O   1 
ATOM   3046 C  CB  . TRP A 1 405 ? 18.169  -6.651  8.012   1.00 64.66  ? 2006 TRP A CB  1 
ATOM   3047 C  CG  . TRP A 1 405 ? 18.997  -5.549  7.398   1.00 67.06  ? 2006 TRP A CG  1 
ATOM   3048 C  CD1 . TRP A 1 405 ? 20.112  -4.970  7.935   1.00 67.13  ? 2006 TRP A CD1 1 
ATOM   3049 C  CD2 . TRP A 1 405 ? 18.771  -4.893  6.142   1.00 68.33  ? 2006 TRP A CD2 1 
ATOM   3050 N  NE1 . TRP A 1 405 ? 20.594  -3.997  7.092   1.00 69.78  ? 2006 TRP A NE1 1 
ATOM   3051 C  CE2 . TRP A 1 405 ? 19.789  -3.929  5.981   1.00 70.17  ? 2006 TRP A CE2 1 
ATOM   3052 C  CE3 . TRP A 1 405 ? 17.810  -5.024  5.133   1.00 66.81  ? 2006 TRP A CE3 1 
ATOM   3053 C  CZ2 . TRP A 1 405 ? 19.876  -3.106  4.859   1.00 69.92  ? 2006 TRP A CZ2 1 
ATOM   3054 C  CZ3 . TRP A 1 405 ? 17.897  -4.206  4.018   1.00 70.92  ? 2006 TRP A CZ3 1 
ATOM   3055 C  CH2 . TRP A 1 405 ? 18.923  -3.260  3.891   1.00 70.67  ? 2006 TRP A CH2 1 
ATOM   3056 N  N   . GLU A 1 406 ? 20.027  -9.337  7.664   1.00 69.69  ? 2007 GLU A N   1 
ATOM   3057 C  CA  . GLU A 1 406 ? 21.357  -9.896  7.448   1.00 70.78  ? 2007 GLU A CA  1 
ATOM   3058 C  C   . GLU A 1 406 ? 21.324  -11.008 6.406   1.00 69.10  ? 2007 GLU A C   1 
ATOM   3059 O  O   . GLU A 1 406 ? 22.206  -11.097 5.553   1.00 71.08  ? 2007 GLU A O   1 
ATOM   3060 C  CB  . GLU A 1 406 ? 21.936  -10.424 8.761   1.00 75.74  ? 2007 GLU A CB  1 
ATOM   3061 C  CG  . GLU A 1 406 ? 23.353  -10.959 8.644   1.00 84.38  ? 2007 GLU A CG  1 
ATOM   3062 C  CD  . GLU A 1 406 ? 23.931  -11.377 9.983   1.00 104.29 ? 2007 GLU A CD  1 
ATOM   3063 O  OE1 . GLU A 1 406 ? 25.135  -11.706 10.030  1.00 103.73 ? 2007 GLU A OE1 1 
ATOM   3064 O  OE2 . GLU A 1 406 ? 23.184  -11.376 10.987  1.00 97.82  ? 2007 GLU A OE2 1 
ATOM   3065 N  N   . THR A 1 407 ? 20.304  -11.856 6.484   1.00 67.11  ? 2008 THR A N   1 
ATOM   3066 C  CA  . THR A 1 407 ? 20.126  -12.933 5.517   1.00 66.64  ? 2008 THR A CA  1 
ATOM   3067 C  C   . THR A 1 407 ? 19.871  -12.356 4.126   1.00 66.35  ? 2008 THR A C   1 
ATOM   3068 O  O   . THR A 1 407 ? 20.301  -12.918 3.119   1.00 65.13  ? 2008 THR A O   1 
ATOM   3069 C  CB  . THR A 1 407 ? 18.965  -13.866 5.919   1.00 64.72  ? 2008 THR A CB  1 
ATOM   3070 O  OG1 . THR A 1 407 ? 19.177  -14.348 7.251   1.00 65.68  ? 2008 THR A OG1 1 
ATOM   3071 C  CG2 . THR A 1 407 ? 18.873  -15.055 4.975   1.00 73.43  ? 2008 THR A CG2 1 
ATOM   3072 N  N   . LEU A 1 408 ? 19.176  -11.223 4.081   1.00 63.41  ? 2009 LEU A N   1 
ATOM   3073 C  CA  . LEU A 1 408 ? 18.922  -10.526 2.828   1.00 63.91  ? 2009 LEU A CA  1 
ATOM   3074 C  C   . LEU A 1 408 ? 20.226  -10.095 2.161   1.00 67.23  ? 2009 LEU A C   1 
ATOM   3075 O  O   . LEU A 1 408 ? 20.517  -10.491 1.033   1.00 66.56  ? 2009 LEU A O   1 
ATOM   3076 C  CB  . LEU A 1 408 ? 18.030  -9.303  3.063   1.00 63.40  ? 2009 LEU A CB  1 
ATOM   3077 C  CG  . LEU A 1 408 ? 17.437  -8.654  1.809   1.00 63.31  ? 2009 LEU A CG  1 
ATOM   3078 C  CD1 . LEU A 1 408 ? 16.388  -9.564  1.195   1.00 64.12  ? 2009 LEU A CD1 1 
ATOM   3079 C  CD2 . LEU A 1 408 ? 16.847  -7.283  2.105   1.00 58.74  ? 2009 LEU A CD2 1 
ATOM   3080 N  N   . ASN A 1 409 ? 21.008  -9.288  2.871   1.00 66.17  ? 2010 ASN A N   1 
ATOM   3081 C  CA  . ASN A 1 409 ? 22.235  -8.715  2.325   1.00 67.83  ? 2010 ASN A CA  1 
ATOM   3082 C  C   . ASN A 1 409 ? 23.304  -9.753  2.004   1.00 71.01  ? 2010 ASN A C   1 
ATOM   3083 O  O   . ASN A 1 409 ? 24.015  -9.634  1.006   1.00 69.27  ? 2010 ASN A O   1 
ATOM   3084 C  CB  . ASN A 1 409 ? 22.808  -7.682  3.295   1.00 67.55  ? 2010 ASN A CB  1 
ATOM   3085 C  CG  . ASN A 1 409 ? 21.908  -6.476  3.459   1.00 71.44  ? 2010 ASN A CG  1 
ATOM   3086 O  OD1 . ASN A 1 409 ? 20.749  -6.492  3.045   1.00 76.19  ? 2010 ASN A OD1 1 
ATOM   3087 N  ND2 . ASN A 1 409 ? 22.437  -5.420  4.066   1.00 72.86  ? 2010 ASN A ND2 1 
ATOM   3088 N  N   . ASP A 1 410 ? 23.417  -10.766 2.855   1.00 72.59  ? 2011 ASP A N   1 
ATOM   3089 C  CA  . ASP A 1 410 ? 24.436  -11.794 2.683   1.00 74.21  ? 2011 ASP A CA  1 
ATOM   3090 C  C   . ASP A 1 410 ? 24.180  -12.634 1.431   1.00 74.03  ? 2011 ASP A C   1 
ATOM   3091 O  O   . ASP A 1 410 ? 25.084  -12.840 0.622   1.00 77.06  ? 2011 ASP A O   1 
ATOM   3092 C  CB  . ASP A 1 410 ? 24.503  -12.690 3.923   1.00 78.16  ? 2011 ASP A CB  1 
ATOM   3093 C  CG  . ASP A 1 410 ? 25.761  -13.537 3.964   1.00 92.57  ? 2011 ASP A CG  1 
ATOM   3094 O  OD1 . ASP A 1 410 ? 26.793  -13.104 3.409   1.00 92.86  ? 2011 ASP A OD1 1 
ATOM   3095 O  OD2 . ASP A 1 410 ? 25.719  -14.635 4.557   1.00 96.86  ? 2011 ASP A OD2 1 
ATOM   3096 N  N   . ASN A 1 411 ? 22.947  -13.111 1.273   1.00 71.42  ? 2012 ASN A N   1 
ATOM   3097 C  CA  . ASN A 1 411 ? 22.582  -13.924 0.116   1.00 68.06  ? 2012 ASN A CA  1 
ATOM   3098 C  C   . ASN A 1 411 ? 22.599  -13.133 -1.185  1.00 70.66  ? 2012 ASN A C   1 
ATOM   3099 O  O   . ASN A 1 411 ? 22.799  -13.693 -2.261  1.00 72.27  ? 2012 ASN A O   1 
ATOM   3100 C  CB  . ASN A 1 411 ? 21.202  -14.546 0.315   1.00 65.26  ? 2012 ASN A CB  1 
ATOM   3101 C  CG  . ASN A 1 411 ? 21.220  -15.695 1.297   1.00 67.12  ? 2012 ASN A CG  1 
ATOM   3102 O  OD1 . ASN A 1 411 ? 21.256  -16.861 0.905   1.00 65.57  ? 2012 ASN A OD1 1 
ATOM   3103 N  ND2 . ASN A 1 411 ? 21.198  -15.372 2.585   1.00 73.57  ? 2012 ASN A ND2 1 
ATOM   3104 N  N   . LEU A 1 412 ? 22.380  -11.828 -1.078  1.00 70.31  ? 2013 LEU A N   1 
ATOM   3105 C  CA  . LEU A 1 412 ? 22.402  -10.950 -2.239  1.00 68.61  ? 2013 LEU A CA  1 
ATOM   3106 C  C   . LEU A 1 412 ? 23.839  -10.692 -2.682  1.00 70.87  ? 2013 LEU A C   1 
ATOM   3107 O  O   . LEU A 1 412 ? 24.101  -10.413 -3.851  1.00 74.87  ? 2013 LEU A O   1 
ATOM   3108 C  CB  . LEU A 1 412 ? 21.692  -9.632  -1.923  1.00 68.94  ? 2013 LEU A CB  1 
ATOM   3109 C  CG  . LEU A 1 412 ? 21.486  -8.640  -3.067  1.00 68.94  ? 2013 LEU A CG  1 
ATOM   3110 C  CD1 . LEU A 1 412 ? 20.687  -9.279  -4.191  1.00 71.70  ? 2013 LEU A CD1 1 
ATOM   3111 C  CD2 . LEU A 1 412 ? 20.793  -7.388  -2.557  1.00 68.86  ? 2013 LEU A CD2 1 
ATOM   3112 N  N   . LYS A 1 413 ? 24.766  -10.797 -1.735  1.00 72.97  ? 2014 LYS A N   1 
ATOM   3113 C  CA  . LYS A 1 413 ? 26.185  -10.599 -2.010  1.00 75.42  ? 2014 LYS A CA  1 
ATOM   3114 C  C   . LYS A 1 413 ? 26.800  -11.887 -2.551  1.00 79.91  ? 2014 LYS A C   1 
ATOM   3115 O  O   . LYS A 1 413 ? 27.852  -11.870 -3.191  1.00 82.50  ? 2014 LYS A O   1 
ATOM   3116 C  CB  . LYS A 1 413 ? 26.914  -10.147 -0.742  1.00 78.18  ? 2014 LYS A CB  1 
ATOM   3117 C  CG  . LYS A 1 413 ? 28.287  -9.538  -0.977  1.00 85.79  ? 2014 LYS A CG  1 
ATOM   3118 C  CD  . LYS A 1 413 ? 28.928  -9.121  0.340   1.00 92.91  ? 2014 LYS A CD  1 
ATOM   3119 C  CE  . LYS A 1 413 ? 30.253  -8.406  0.120   1.00 105.07 ? 2014 LYS A CE  1 
ATOM   3120 N  NZ  . LYS A 1 413 ? 30.084  -7.152  -0.665  1.00 110.52 ? 2014 LYS A NZ  1 
ATOM   3121 N  N   . VAL A 1 414 ? 26.126  -13.002 -2.289  1.00 79.50  ? 2015 VAL A N   1 
ATOM   3122 C  CA  . VAL A 1 414 ? 26.572  -14.310 -2.749  1.00 80.76  ? 2015 VAL A CA  1 
ATOM   3123 C  C   . VAL A 1 414 ? 26.314  -14.483 -4.242  1.00 81.67  ? 2015 VAL A C   1 
ATOM   3124 O  O   . VAL A 1 414 ? 27.162  -15.000 -4.971  1.00 88.77  ? 2015 VAL A O   1 
ATOM   3125 C  CB  . VAL A 1 414 ? 25.872  -15.445 -1.967  1.00 80.92  ? 2015 VAL A CB  1 
ATOM   3126 C  CG1 . VAL A 1 414 ? 26.012  -16.777 -2.689  1.00 84.60  ? 2015 VAL A CG1 1 
ATOM   3127 C  CG2 . VAL A 1 414 ? 26.431  -15.535 -0.557  1.00 83.25  ? 2015 VAL A CG2 1 
ATOM   3128 N  N   . ILE A 1 415 ? 25.143  -14.038 -4.690  1.00 80.22  ? 2016 ILE A N   1 
ATOM   3129 C  CA  . ILE A 1 415 ? 24.744  -14.173 -6.090  1.00 80.78  ? 2016 ILE A CA  1 
ATOM   3130 C  C   . ILE A 1 415 ? 25.750  -13.514 -7.030  1.00 82.64  ? 2016 ILE A C   1 
ATOM   3131 O  O   . ILE A 1 415 ? 26.095  -14.067 -8.076  1.00 85.88  ? 2016 ILE A O   1 
ATOM   3132 C  CB  . ILE A 1 415 ? 23.349  -13.563 -6.336  1.00 77.27  ? 2016 ILE A CB  1 
ATOM   3133 C  CG1 . ILE A 1 415 ? 22.314  -14.219 -5.423  1.00 73.24  ? 2016 ILE A CG1 1 
ATOM   3134 C  CG2 . ILE A 1 415 ? 22.941  -13.726 -7.791  1.00 79.76  ? 2016 ILE A CG2 1 
ATOM   3135 C  CD1 . ILE A 1 415 ? 20.905  -13.734 -5.653  1.00 70.75  ? 2016 ILE A CD1 1 
ATOM   3136 N  N   . GLU A 1 416 ? 26.235  -12.341 -6.638  1.00 83.98  ? 2017 GLU A N   1 
ATOM   3137 C  CA  . GLU A 1 416 ? 27.200  -11.597 -7.442  1.00 87.14  ? 2017 GLU A CA  1 
ATOM   3138 C  C   . GLU A 1 416 ? 28.582  -12.248 -7.442  1.00 86.11  ? 2017 GLU A C   1 
ATOM   3139 O  O   . GLU A 1 416 ? 29.466  -11.834 -8.188  1.00 87.36  ? 2017 GLU A O   1 
ATOM   3140 C  CB  . GLU A 1 416 ? 27.307  -10.155 -6.939  1.00 88.87  ? 2017 GLU A CB  1 
ATOM   3141 C  CG  . GLU A 1 416 ? 26.021  -9.354  -7.072  1.00 95.53  ? 2017 GLU A CG  1 
ATOM   3142 C  CD  . GLU A 1 416 ? 26.156  -7.941  -6.538  1.00 100.06 ? 2017 GLU A CD  1 
ATOM   3143 O  OE1 . GLU A 1 416 ? 27.099  -7.688  -5.757  1.00 96.50  ? 2017 GLU A OE1 1 
ATOM   3144 O  OE2 . GLU A 1 416 ? 25.321  -7.085  -6.901  1.00 95.75  ? 2017 GLU A OE2 1 
ATOM   3145 N  N   . LYS A 1 417 ? 28.765  -13.264 -6.603  1.00 87.43  ? 2018 LYS A N   1 
ATOM   3146 C  CA  . LYS A 1 417 ? 30.054  -13.940 -6.487  1.00 89.87  ? 2018 LYS A CA  1 
ATOM   3147 C  C   . LYS A 1 417 ? 29.926  -15.451 -6.685  1.00 91.18  ? 2018 LYS A C   1 
ATOM   3148 O  O   . LYS A 1 417 ? 30.842  -16.208 -6.363  1.00 91.85  ? 2018 LYS A O   1 
ATOM   3149 C  CB  . LYS A 1 417 ? 30.693  -13.636 -5.127  1.00 88.75  ? 2018 LYS A CB  1 
ATOM   3150 C  CG  . LYS A 1 417 ? 31.018  -12.162 -4.911  1.00 90.28  ? 2018 LYS A CG  1 
ATOM   3151 C  CD  . LYS A 1 417 ? 31.634  -11.910 -3.542  1.00 93.48  ? 2018 LYS A CD  1 
ATOM   3152 C  CE  . LYS A 1 417 ? 31.994  -10.440 -3.363  1.00 96.02  ? 2018 LYS A CE  1 
ATOM   3153 N  NZ  . LYS A 1 417 ? 32.552  -10.146 -2.012  1.00 99.08  ? 2018 LYS A NZ  1 
ATOM   3154 N  N   . ALA A 1 418 ? 28.787  -15.881 -7.220  1.00 90.78  ? 2019 ALA A N   1 
ATOM   3155 C  CA  . ALA A 1 418 ? 28.553  -17.295 -7.494  1.00 94.44  ? 2019 ALA A CA  1 
ATOM   3156 C  C   . ALA A 1 418 ? 28.582  -17.564 -8.995  1.00 99.81  ? 2019 ALA A C   1 
ATOM   3157 O  O   . ALA A 1 418 ? 28.043  -16.785 -9.781  1.00 106.68 ? 2019 ALA A O   1 
ATOM   3158 C  CB  . ALA A 1 418 ? 27.227  -17.741 -6.899  1.00 89.93  ? 2019 ALA A CB  1 
ATOM   3159 N  N   . ASP A 1 419 ? 29.209  -18.669 -9.387  1.00 101.34 ? 2020 ASP A N   1 
ATOM   3160 C  CA  . ASP A 1 419 ? 29.356  -19.002 -10.802 1.00 106.76 ? 2020 ASP A CA  1 
ATOM   3161 C  C   . ASP A 1 419 ? 28.388  -20.098 -11.242 1.00 105.76 ? 2020 ASP A C   1 
ATOM   3162 O  O   . ASP A 1 419 ? 27.797  -20.020 -12.323 1.00 101.98 ? 2020 ASP A O   1 
ATOM   3163 C  CB  . ASP A 1 419 ? 30.796  -19.428 -11.096 1.00 109.50 ? 2020 ASP A CB  1 
ATOM   3164 C  CG  . ASP A 1 419 ? 31.268  -20.545 -10.187 1.00 111.07 ? 2020 ASP A CG  1 
ATOM   3165 O  OD1 . ASP A 1 419 ? 30.718  -20.675 -9.073  1.00 106.74 ? 2020 ASP A OD1 1 
ATOM   3166 O  OD2 . ASP A 1 419 ? 32.187  -21.291 -10.585 1.00 123.20 ? 2020 ASP A OD2 1 
ATOM   3167 N  N   . ASN A 1 420 ? 28.231  -21.118 -10.404 1.00 99.17  ? 2021 ASN A N   1 
ATOM   3168 C  CA  . ASN A 1 420 ? 27.342  -22.234 -10.710 1.00 92.87  ? 2021 ASN A CA  1 
ATOM   3169 C  C   . ASN A 1 420 ? 25.871  -21.857 -10.553 1.00 90.40  ? 2021 ASN A C   1 
ATOM   3170 O  O   . ASN A 1 420 ? 25.534  -20.930 -9.817  1.00 90.21  ? 2021 ASN A O   1 
ATOM   3171 C  CB  . ASN A 1 420 ? 27.672  -23.432 -9.819  1.00 85.39  ? 2021 ASN A CB  1 
ATOM   3172 C  CG  . ASN A 1 420 ? 27.769  -23.057 -8.355  1.00 89.58  ? 2021 ASN A CG  1 
ATOM   3173 O  OD1 . ASN A 1 420 ? 27.583  -21.899 -7.988  1.00 93.64  ? 2021 ASN A OD1 1 
ATOM   3174 N  ND2 . ASN A 1 420 ? 28.055  -24.039 -7.510  1.00 85.34  ? 2021 ASN A ND2 1 
ATOM   3175 N  N   . ALA A 1 421 ? 25.001  -22.584 -11.247 1.00 87.53  ? 2022 ALA A N   1 
ATOM   3176 C  CA  . ALA A 1 421 ? 23.567  -22.319 -11.198 1.00 86.70  ? 2022 ALA A CA  1 
ATOM   3177 C  C   . ALA A 1 421 ? 22.964  -22.749 -9.863  1.00 84.75  ? 2022 ALA A C   1 
ATOM   3178 O  O   . ALA A 1 421 ? 21.868  -22.320 -9.497  1.00 82.32  ? 2022 ALA A O   1 
ATOM   3179 C  CB  . ALA A 1 421 ? 22.864  -23.022 -12.344 1.00 90.92  ? 2022 ALA A CB  1 
ATOM   3180 N  N   . ALA A 1 422 ? 23.687  -23.599 -9.142  1.00 83.24  ? 2023 ALA A N   1 
ATOM   3181 C  CA  . ALA A 1 422 ? 23.217  -24.118 -7.864  1.00 82.59  ? 2023 ALA A CA  1 
ATOM   3182 C  C   . ALA A 1 422 ? 23.187  -23.033 -6.791  1.00 82.68  ? 2023 ALA A C   1 
ATOM   3183 O  O   . ALA A 1 422 ? 22.170  -22.833 -6.130  1.00 82.28  ? 2023 ALA A O   1 
ATOM   3184 C  CB  . ALA A 1 422 ? 24.091  -25.282 -7.414  1.00 81.09  ? 2023 ALA A CB  1 
ATOM   3185 N  N   . GLN A 1 423 ? 24.307  -22.336 -6.625  1.00 83.94  ? 2024 GLN A N   1 
ATOM   3186 C  CA  . GLN A 1 423 ? 24.427  -21.312 -5.594  1.00 84.80  ? 2024 GLN A CA  1 
ATOM   3187 C  C   . GLN A 1 423 ? 23.523  -20.118 -5.871  1.00 81.56  ? 2024 GLN A C   1 
ATOM   3188 O  O   . GLN A 1 423 ? 23.088  -19.432 -4.946  1.00 81.18  ? 2024 GLN A O   1 
ATOM   3189 C  CB  . GLN A 1 423 ? 25.879  -20.849 -5.468  1.00 89.31  ? 2024 GLN A CB  1 
ATOM   3190 C  CG  . GLN A 1 423 ? 26.814  -21.893 -4.876  1.00 98.81  ? 2024 GLN A CG  1 
ATOM   3191 C  CD  . GLN A 1 423 ? 28.244  -21.396 -4.754  1.00 103.33 ? 2024 GLN A CD  1 
ATOM   3192 O  OE1 . GLN A 1 423 ? 28.615  -20.385 -5.350  1.00 103.14 ? 2024 GLN A OE1 1 
ATOM   3193 N  NE2 . GLN A 1 423 ? 29.053  -22.107 -3.976  1.00 97.36  ? 2024 GLN A NE2 1 
ATOM   3194 N  N   . VAL A 1 424 ? 23.244  -19.874 -7.147  1.00 81.46  ? 2025 VAL A N   1 
ATOM   3195 C  CA  . VAL A 1 424 ? 22.383  -18.766 -7.546  1.00 80.71  ? 2025 VAL A CA  1 
ATOM   3196 C  C   . VAL A 1 424 ? 20.927  -19.016 -7.155  1.00 78.37  ? 2025 VAL A C   1 
ATOM   3197 O  O   . VAL A 1 424 ? 20.309  -18.193 -6.479  1.00 75.99  ? 2025 VAL A O   1 
ATOM   3198 C  CB  . VAL A 1 424 ? 22.465  -18.511 -9.064  1.00 81.17  ? 2025 VAL A CB  1 
ATOM   3199 C  CG1 . VAL A 1 424 ? 21.431  -17.482 -9.489  1.00 76.65  ? 2025 VAL A CG1 1 
ATOM   3200 C  CG2 . VAL A 1 424 ? 23.865  -18.060 -9.450  1.00 84.12  ? 2025 VAL A CG2 1 
ATOM   3201 N  N   . LYS A 1 425 ? 20.387  -20.153 -7.585  1.00 78.81  ? 2026 LYS A N   1 
ATOM   3202 C  CA  . LYS A 1 425 ? 19.018  -20.530 -7.252  1.00 77.91  ? 2026 LYS A CA  1 
ATOM   3203 C  C   . LYS A 1 425 ? 18.841  -20.659 -5.742  1.00 80.13  ? 2026 LYS A C   1 
ATOM   3204 O  O   . LYS A 1 425 ? 17.793  -20.313 -5.194  1.00 85.84  ? 2026 LYS A O   1 
ATOM   3205 C  CB  . LYS A 1 425 ? 18.641  -21.845 -7.941  1.00 79.28  ? 2026 LYS A CB  1 
ATOM   3206 C  CG  . LYS A 1 425 ? 17.256  -22.371 -7.582  1.00 79.73  ? 2026 LYS A CG  1 
ATOM   3207 C  CD  . LYS A 1 425 ? 17.023  -23.757 -8.172  1.00 85.85  ? 2026 LYS A CD  1 
ATOM   3208 C  CE  . LYS A 1 425 ? 15.708  -24.358 -7.691  1.00 87.98  ? 2026 LYS A CE  1 
ATOM   3209 N  NZ  . LYS A 1 425 ? 15.491  -25.727 -8.242  1.00 92.52  ? 2026 LYS A NZ  1 
ATOM   3210 N  N   . ASP A 1 426 ? 19.881  -21.145 -5.073  1.00 78.40  ? 2027 ASP A N   1 
ATOM   3211 C  CA  . ASP A 1 426 ? 19.838  -21.356 -3.631  1.00 77.94  ? 2027 ASP A CA  1 
ATOM   3212 C  C   . ASP A 1 426 ? 19.772  -20.043 -2.860  1.00 74.75  ? 2027 ASP A C   1 
ATOM   3213 O  O   . ASP A 1 426 ? 19.003  -19.915 -1.909  1.00 73.84  ? 2027 ASP A O   1 
ATOM   3214 C  CB  . ASP A 1 426 ? 21.056  -22.159 -3.170  1.00 77.75  ? 2027 ASP A CB  1 
ATOM   3215 C  CG  . ASP A 1 426 ? 21.048  -22.417 -1.682  1.00 76.25  ? 2027 ASP A CG  1 
ATOM   3216 O  OD1 . ASP A 1 426 ? 20.420  -23.409 -1.256  1.00 77.55  ? 2027 ASP A OD1 1 
ATOM   3217 O  OD2 . ASP A 1 426 ? 21.662  -21.625 -0.937  1.00 77.48  ? 2027 ASP A OD2 1 
ATOM   3218 N  N   . ALA A 1 427 ? 20.584  -19.074 -3.268  1.00 75.14  ? 2028 ALA A N   1 
ATOM   3219 C  CA  . ALA A 1 427 ? 20.633  -17.790 -2.579  1.00 72.37  ? 2028 ALA A CA  1 
ATOM   3220 C  C   . ALA A 1 427 ? 19.343  -17.007 -2.790  1.00 72.39  ? 2028 ALA A C   1 
ATOM   3221 O  O   . ALA A 1 427 ? 18.878  -16.314 -1.888  1.00 72.10  ? 2028 ALA A O   1 
ATOM   3222 C  CB  . ALA A 1 427 ? 21.830  -16.979 -3.047  1.00 69.52  ? 2028 ALA A CB  1 
ATOM   3223 N  N   . LEU A 1 428 ? 18.768  -17.123 -3.983  1.00 73.74  ? 2029 LEU A N   1 
ATOM   3224 C  CA  . LEU A 1 428 ? 17.506  -16.461 -4.291  1.00 71.76  ? 2029 LEU A CA  1 
ATOM   3225 C  C   . LEU A 1 428 ? 16.382  -16.978 -3.404  1.00 69.81  ? 2029 LEU A C   1 
ATOM   3226 O  O   . LEU A 1 428 ? 15.546  -16.208 -2.934  1.00 70.53  ? 2029 LEU A O   1 
ATOM   3227 C  CB  . LEU A 1 428 ? 17.134  -16.657 -5.764  1.00 73.41  ? 2029 LEU A CB  1 
ATOM   3228 C  CG  . LEU A 1 428 ? 17.834  -15.793 -6.815  1.00 72.90  ? 2029 LEU A CG  1 
ATOM   3229 C  CD1 . LEU A 1 428 ? 17.559  -16.330 -8.209  1.00 69.90  ? 2029 LEU A CD1 1 
ATOM   3230 C  CD2 . LEU A 1 428 ? 17.383  -14.348 -6.709  1.00 70.81  ? 2029 LEU A CD2 1 
ATOM   3231 N  N   . THR A 1 429 ? 16.368  -18.287 -3.178  1.00 70.28  ? 2030 THR A N   1 
ATOM   3232 C  CA  . THR A 1 429 ? 15.310  -18.911 -2.395  1.00 70.06  ? 2030 THR A CA  1 
ATOM   3233 C  C   . THR A 1 429 ? 15.403  -18.501 -0.929  1.00 70.51  ? 2030 THR A C   1 
ATOM   3234 O  O   . THR A 1 429 ? 14.386  -18.235 -0.282  1.00 68.68  ? 2030 THR A O   1 
ATOM   3235 C  CB  . THR A 1 429 ? 15.363  -20.444 -2.501  1.00 70.98  ? 2030 THR A CB  1 
ATOM   3236 O  OG1 . THR A 1 429 ? 15.530  -20.829 -3.872  1.00 72.93  ? 2030 THR A OG1 1 
ATOM   3237 C  CG2 . THR A 1 429 ? 14.086  -21.062 -1.949  1.00 66.90  ? 2030 THR A CG2 1 
ATOM   3238 N  N   . LYS A 1 430 ? 16.629  -18.450 -0.415  1.00 69.66  ? 2031 LYS A N   1 
ATOM   3239 C  CA  . LYS A 1 430 ? 16.871  -18.048 0.966   1.00 69.40  ? 2031 LYS A CA  1 
ATOM   3240 C  C   . LYS A 1 430 ? 16.627  -16.554 1.152   1.00 69.91  ? 2031 LYS A C   1 
ATOM   3241 O  O   . LYS A 1 430 ? 16.138  -16.121 2.196   1.00 70.24  ? 2031 LYS A O   1 
ATOM   3242 C  CB  . LYS A 1 430 ? 18.295  -18.413 1.391   1.00 66.06  ? 2031 LYS A CB  1 
ATOM   3243 C  CG  . LYS A 1 430 ? 18.512  -19.910 1.564   1.00 68.91  ? 2031 LYS A CG  1 
ATOM   3244 C  CD  . LYS A 1 430 ? 19.943  -20.237 1.960   1.00 70.78  ? 2031 LYS A CD  1 
ATOM   3245 C  CE  . LYS A 1 430 ? 20.160  -21.743 2.006   1.00 71.92  ? 2031 LYS A CE  1 
ATOM   3246 N  NZ  . LYS A 1 430 ? 21.590  -22.106 2.210   1.00 71.94  ? 2031 LYS A NZ  1 
ATOM   3247 N  N   . MET A 1 431 ? 16.967  -15.773 0.132   1.00 69.24  ? 2032 MET A N   1 
ATOM   3248 C  CA  . MET A 1 431 ? 16.727  -14.334 0.153   1.00 67.95  ? 2032 MET A CA  1 
ATOM   3249 C  C   . MET A 1 431 ? 15.232  -14.033 0.087   1.00 67.49  ? 2032 MET A C   1 
ATOM   3250 O  O   . MET A 1 431 ? 14.754  -13.063 0.677   1.00 65.87  ? 2032 MET A O   1 
ATOM   3251 C  CB  . MET A 1 431 ? 17.459  -13.654 -1.006  1.00 65.64  ? 2032 MET A CB  1 
ATOM   3252 C  CG  . MET A 1 431 ? 17.183  -12.170 -1.137  1.00 66.06  ? 2032 MET A CG  1 
ATOM   3253 S  SD  . MET A 1 431 ? 18.275  -11.370 -2.320  1.00 60.22  ? 2032 MET A SD  1 
ATOM   3254 C  CE  . MET A 1 431 ? 18.109  -12.483 -3.706  1.00 78.25  ? 2032 MET A CE  1 
ATOM   3255 N  N   . ARG A 1 432 ? 14.498  -14.878 -0.628  1.00 68.48  ? 2033 ARG A N   1 
ATOM   3256 C  CA  . ARG A 1 432 ? 13.056  -14.717 -0.756  1.00 67.78  ? 2033 ARG A CA  1 
ATOM   3257 C  C   . ARG A 1 432 ? 12.349  -14.868 0.586   1.00 67.56  ? 2033 ARG A C   1 
ATOM   3258 O  O   . ARG A 1 432 ? 11.532  -14.030 0.961   1.00 68.23  ? 2033 ARG A O   1 
ATOM   3259 C  CB  . ARG A 1 432 ? 12.488  -15.727 -1.751  1.00 69.83  ? 2033 ARG A CB  1 
ATOM   3260 C  CG  . ARG A 1 432 ? 10.972  -15.726 -1.807  1.00 71.19  ? 2033 ARG A CG  1 
ATOM   3261 C  CD  . ARG A 1 432 ? 10.437  -16.798 -2.737  1.00 72.16  ? 2033 ARG A CD  1 
ATOM   3262 N  NE  . ARG A 1 432 ? 8.985   -16.901 -2.634  1.00 78.30  ? 2033 ARG A NE  1 
ATOM   3263 C  CZ  . ARG A 1 432 ? 8.136   -16.153 -3.331  1.00 82.32  ? 2033 ARG A CZ  1 
ATOM   3264 N  NH1 . ARG A 1 432 ? 8.597   -15.253 -4.186  1.00 81.58  ? 2033 ARG A NH1 1 
ATOM   3265 N  NH2 . ARG A 1 432 ? 6.828   -16.306 -3.175  1.00 81.14  ? 2033 ARG A NH2 1 
ATOM   3266 N  N   . ALA A 1 433 ? 12.666  -15.940 1.305   1.00 70.01  ? 2034 ALA A N   1 
ATOM   3267 C  CA  . ALA A 1 433 ? 12.048  -16.202 2.600   1.00 70.83  ? 2034 ALA A CA  1 
ATOM   3268 C  C   . ALA A 1 433 ? 12.467  -15.159 3.630   1.00 69.73  ? 2034 ALA A C   1 
ATOM   3269 O  O   . ALA A 1 433 ? 11.690  -14.801 4.514   1.00 69.69  ? 2034 ALA A O   1 
ATOM   3270 C  CB  . ALA A 1 433 ? 12.404  -17.600 3.086   1.00 71.35  ? 2034 ALA A CB  1 
ATOM   3271 N  N   . ALA A 1 434 ? 13.698  -14.673 3.505   1.00 66.26  ? 2035 ALA A N   1 
ATOM   3272 C  CA  . ALA A 1 434 ? 14.221  -13.656 4.410   1.00 64.84  ? 2035 ALA A CA  1 
ATOM   3273 C  C   . ALA A 1 434 ? 13.449  -12.350 4.278   1.00 64.44  ? 2035 ALA A C   1 
ATOM   3274 O  O   . ALA A 1 434 ? 13.249  -11.636 5.258   1.00 67.36  ? 2035 ALA A O   1 
ATOM   3275 C  CB  . ALA A 1 434 ? 15.698  -13.421 4.146   1.00 66.76  ? 2035 ALA A CB  1 
ATOM   3276 N  N   . ALA A 1 435 ? 13.017  -12.043 3.061   1.00 66.01  ? 2036 ALA A N   1 
ATOM   3277 C  CA  . ALA A 1 435 ? 12.266  -10.821 2.802   1.00 65.40  ? 2036 ALA A CA  1 
ATOM   3278 C  C   . ALA A 1 435 ? 10.796  -10.986 3.181   1.00 66.21  ? 2036 ALA A C   1 
ATOM   3279 O  O   . ALA A 1 435 ? 10.112  -10.011 3.496   1.00 65.78  ? 2036 ALA A O   1 
ATOM   3280 C  CB  . ALA A 1 435 ? 12.400  -10.420 1.341   1.00 64.30  ? 2036 ALA A CB  1 
ATOM   3281 N  N   . LEU A 1 436 ? 10.316  -12.224 3.151   1.00 65.80  ? 2037 LEU A N   1 
ATOM   3282 C  CA  . LEU A 1 436 ? 8.933   -12.512 3.510   1.00 67.60  ? 2037 LEU A CA  1 
ATOM   3283 C  C   . LEU A 1 436 ? 8.718   -12.432 5.017   1.00 68.94  ? 2037 LEU A C   1 
ATOM   3284 O  O   . LEU A 1 436 ? 7.609   -12.163 5.478   1.00 69.50  ? 2037 LEU A O   1 
ATOM   3285 C  CB  . LEU A 1 436 ? 8.520   -13.890 2.991   1.00 68.04  ? 2037 LEU A CB  1 
ATOM   3286 C  CG  . LEU A 1 436 ? 8.346   -13.967 1.473   1.00 68.75  ? 2037 LEU A CG  1 
ATOM   3287 C  CD1 . LEU A 1 436 ? 7.953   -15.370 1.036   1.00 72.39  ? 2037 LEU A CD1 1 
ATOM   3288 C  CD2 . LEU A 1 436 ? 7.319   -12.946 1.012   1.00 63.38  ? 2037 LEU A CD2 1 
ATOM   3289 N  N   . ASP A 1 437 ? 9.781   -12.666 5.780   1.00 67.49  ? 2038 ASP A N   1 
ATOM   3290 C  CA  . ASP A 1 437 ? 9.706   -12.567 7.232   1.00 69.13  ? 2038 ASP A CA  1 
ATOM   3291 C  C   . ASP A 1 437 ? 9.861   -11.120 7.689   1.00 66.50  ? 2038 ASP A C   1 
ATOM   3292 O  O   . ASP A 1 437 ? 9.176   -10.677 8.609   1.00 66.72  ? 2038 ASP A O   1 
ATOM   3293 C  CB  . ASP A 1 437 ? 10.768  -13.448 7.895   1.00 72.26  ? 2038 ASP A CB  1 
ATOM   3294 C  CG  . ASP A 1 437 ? 10.401  -14.921 7.873   1.00 78.10  ? 2038 ASP A CG  1 
ATOM   3295 O  OD1 . ASP A 1 437 ? 10.955  -15.665 7.039   1.00 76.51  ? 2038 ASP A OD1 1 
ATOM   3296 O  OD2 . ASP A 1 437 ? 9.553   -15.335 8.689   1.00 87.72  ? 2038 ASP A OD2 1 
ATOM   3297 N  N   . ALA A 1 438 ? 10.759  -10.386 7.040   1.00 64.04  ? 2039 ALA A N   1 
ATOM   3298 C  CA  . ALA A 1 438 ? 10.978  -8.984  7.376   1.00 64.86  ? 2039 ALA A CA  1 
ATOM   3299 C  C   . ALA A 1 438 ? 9.768   -8.144  6.985   1.00 66.11  ? 2039 ALA A C   1 
ATOM   3300 O  O   . ALA A 1 438 ? 9.548   -7.059  7.524   1.00 66.15  ? 2039 ALA A O   1 
ATOM   3301 C  CB  . ALA A 1 438 ? 12.231  -8.462  6.696   1.00 64.92  ? 2039 ALA A CB  1 
ATOM   3302 N  N   . GLN A 1 439 ? 8.986   -8.658  6.044   1.00 68.06  ? 2040 GLN A N   1 
ATOM   3303 C  CA  . GLN A 1 439 ? 7.772   -7.988  5.601   1.00 67.24  ? 2040 GLN A CA  1 
ATOM   3304 C  C   . GLN A 1 439 ? 6.717   -7.975  6.703   1.00 65.97  ? 2040 GLN A C   1 
ATOM   3305 O  O   . GLN A 1 439 ? 5.984   -6.998  6.867   1.00 64.80  ? 2040 GLN A O   1 
ATOM   3306 C  CB  . GLN A 1 439 ? 7.215   -8.668  4.353   1.00 64.00  ? 2040 GLN A CB  1 
ATOM   3307 C  CG  . GLN A 1 439 ? 6.042   -7.942  3.734   1.00 64.20  ? 2040 GLN A CG  1 
ATOM   3308 C  CD  . GLN A 1 439 ? 5.329   -8.783  2.704   1.00 61.84  ? 2040 GLN A CD  1 
ATOM   3309 O  OE1 . GLN A 1 439 ? 5.341   -10.011 2.777   1.00 64.25  ? 2040 GLN A OE1 1 
ATOM   3310 N  NE2 . GLN A 1 439 ? 4.707   -8.128  1.733   1.00 62.20  ? 2040 GLN A NE2 1 
ATOM   3311 N  N   . LYS A 1 440 ? 6.649   -9.069  7.455   1.00 67.52  ? 2041 LYS A N   1 
ATOM   3312 C  CA  . LYS A 1 440 ? 5.671   -9.210  8.526   1.00 67.16  ? 2041 LYS A CA  1 
ATOM   3313 C  C   . LYS A 1 440 ? 6.126   -8.466  9.775   1.00 66.92  ? 2041 LYS A C   1 
ATOM   3314 O  O   . LYS A 1 440 ? 5.326   -8.171  10.660  1.00 65.03  ? 2041 LYS A O   1 
ATOM   3315 C  CB  . LYS A 1 440 ? 5.442   -10.688 8.844   1.00 66.88  ? 2041 LYS A CB  1 
ATOM   3316 C  CG  . LYS A 1 440 ? 5.098   -11.528 7.626   1.00 71.26  ? 2041 LYS A CG  1 
ATOM   3317 C  CD  . LYS A 1 440 ? 5.104   -13.012 7.948   1.00 75.64  ? 2041 LYS A CD  1 
ATOM   3318 C  CE  . LYS A 1 440 ? 4.872   -13.846 6.697   1.00 79.62  ? 2041 LYS A CE  1 
ATOM   3319 N  NZ  . LYS A 1 440 ? 4.976   -15.306 6.973   1.00 88.32  ? 2041 LYS A NZ  1 
ATOM   3320 N  N   . ALA A 1 441 ? 7.419   -8.160  9.829   1.00 73.94  ? 2042 ALA A N   1 
ATOM   3321 C  CA  . ALA A 1 441 ? 8.024   -7.538  11.004  1.00 69.86  ? 2042 ALA A CA  1 
ATOM   3322 C  C   . ALA A 1 441 ? 7.851   -6.023  11.010  1.00 70.45  ? 2042 ALA A C   1 
ATOM   3323 O  O   . ALA A 1 441 ? 7.672   -5.403  9.963   1.00 70.80  ? 2042 ALA A O   1 
ATOM   3324 C  CB  . ALA A 1 441 ? 9.501   -7.896  11.082  1.00 66.42  ? 2042 ALA A CB  1 
ATOM   3325 N  N   . THR A 1 442 ? 7.914   -5.434  12.200  1.00 71.78  ? 2043 THR A N   1 
ATOM   3326 C  CA  . THR A 1 442 ? 7.740   -3.995  12.354  1.00 73.67  ? 2043 THR A CA  1 
ATOM   3327 C  C   . THR A 1 442 ? 9.065   -3.255  12.219  1.00 71.73  ? 2043 THR A C   1 
ATOM   3328 O  O   . THR A 1 442 ? 10.002  -3.511  12.973  1.00 72.17  ? 2043 THR A O   1 
ATOM   3329 C  CB  . THR A 1 442 ? 7.105   -3.648  13.716  1.00 77.98  ? 2043 THR A CB  1 
ATOM   3330 O  OG1 . THR A 1 442 ? 5.804   -4.243  13.806  1.00 79.93  ? 2043 THR A OG1 1 
ATOM   3331 C  CG2 . THR A 1 442 ? 6.981   -2.141  13.878  1.00 78.55  ? 2043 THR A CG2 1 
ATOM   3332 N  N   . PRO A 1 443 ? 9.147   -2.334  11.248  1.00 71.50  ? 2044 PRO A N   1 
ATOM   3333 C  CA  . PRO A 1 443 ? 10.359  -1.540  11.026  1.00 72.80  ? 2044 PRO A CA  1 
ATOM   3334 C  C   . PRO A 1 443 ? 10.661  -0.620  12.205  1.00 77.03  ? 2044 PRO A C   1 
ATOM   3335 O  O   . PRO A 1 443 ? 9.736   -0.203  12.901  1.00 81.18  ? 2044 PRO A O   1 
ATOM   3336 C  CB  . PRO A 1 443 ? 10.027  -0.736  9.763   1.00 73.38  ? 2044 PRO A CB  1 
ATOM   3337 C  CG  . PRO A 1 443 ? 8.544   -0.705  9.708   1.00 73.63  ? 2044 PRO A CG  1 
ATOM   3338 C  CD  . PRO A 1 443 ? 8.087   -2.009  10.279  1.00 73.21  ? 2044 PRO A CD  1 
ATOM   3339 N  N   . PRO A 1 444 ? 11.949  -0.319  12.433  1.00 79.45  ? 2045 PRO A N   1 
ATOM   3340 C  CA  . PRO A 1 444 ? 12.418  0.517   13.544  1.00 83.02  ? 2045 PRO A CA  1 
ATOM   3341 C  C   . PRO A 1 444 ? 11.787  1.910   13.580  1.00 89.67  ? 2045 PRO A C   1 
ATOM   3342 O  O   . PRO A 1 444 ? 11.612  2.478   14.660  1.00 99.18  ? 2045 PRO A O   1 
ATOM   3343 C  CB  . PRO A 1 444 ? 13.924  0.617   13.288  1.00 78.21  ? 2045 PRO A CB  1 
ATOM   3344 C  CG  . PRO A 1 444 ? 14.254  -0.622  12.542  1.00 77.56  ? 2045 PRO A CG  1 
ATOM   3345 C  CD  . PRO A 1 444 ? 13.071  -0.879  11.659  1.00 76.81  ? 2045 PRO A CD  1 
ATOM   3346 N  N   . LYS A 1 445 ? 11.453  2.449   12.412  1.00 86.80  ? 2046 LYS A N   1 
ATOM   3347 C  CA  . LYS A 1 445 ? 10.913  3.801   12.312  1.00 90.73  ? 2046 LYS A CA  1 
ATOM   3348 C  C   . LYS A 1 445 ? 9.428   3.861   12.674  1.00 92.68  ? 2046 LYS A C   1 
ATOM   3349 O  O   . LYS A 1 445 ? 9.000   4.712   13.455  1.00 91.42  ? 2046 LYS A O   1 
ATOM   3350 C  CB  . LYS A 1 445 ? 11.127  4.344   10.896  1.00 98.80  ? 2046 LYS A CB  1 
ATOM   3351 C  CG  . LYS A 1 445 ? 10.665  5.778   10.682  1.00 97.40  ? 2046 LYS A CG  1 
ATOM   3352 C  CD  . LYS A 1 445 ? 10.692  6.140   9.202   1.00 100.10 ? 2046 LYS A CD  1 
ATOM   3353 C  CE  . LYS A 1 445 ? 12.055  5.854   8.587   1.00 97.58  ? 2046 LYS A CE  1 
ATOM   3354 N  NZ  . LYS A 1 445 ? 12.055  6.045   7.111   1.00 92.39  ? 2046 LYS A NZ  1 
ATOM   3355 N  N   . LEU A 1 446 ? 8.652   2.948   12.103  1.00 88.87  ? 2047 LEU A N   1 
ATOM   3356 C  CA  . LEU A 1 446 ? 7.202   2.961   12.255  1.00 85.44  ? 2047 LEU A CA  1 
ATOM   3357 C  C   . LEU A 1 446 ? 6.750   2.236   13.519  1.00 89.64  ? 2047 LEU A C   1 
ATOM   3358 O  O   . LEU A 1 446 ? 6.038   1.235   13.449  1.00 92.81  ? 2047 LEU A O   1 
ATOM   3359 C  CB  . LEU A 1 446 ? 6.546   2.329   11.027  1.00 85.29  ? 2047 LEU A CB  1 
ATOM   3360 C  CG  . LEU A 1 446 ? 7.088   2.781   9.667   1.00 83.67  ? 2047 LEU A CG  1 
ATOM   3361 C  CD1 . LEU A 1 446 ? 6.370   2.064   8.532   1.00 69.60  ? 2047 LEU A CD1 1 
ATOM   3362 C  CD2 . LEU A 1 446 ? 6.976   4.291   9.508   1.00 85.47  ? 2047 LEU A CD2 1 
ATOM   3363 N  N   . GLU A 1 447 ? 7.160   2.751   14.674  1.00 91.74  ? 2048 GLU A N   1 
ATOM   3364 C  CA  . GLU A 1 447 ? 6.850   2.115   15.951  1.00 92.99  ? 2048 GLU A CA  1 
ATOM   3365 C  C   . GLU A 1 447 ? 5.404   2.341   16.375  1.00 89.12  ? 2048 GLU A C   1 
ATOM   3366 O  O   . GLU A 1 447 ? 4.677   1.390   16.664  1.00 85.48  ? 2048 GLU A O   1 
ATOM   3367 C  CB  . GLU A 1 447 ? 7.795   2.624   17.041  1.00 96.48  ? 2048 GLU A CB  1 
ATOM   3368 C  CG  . GLU A 1 447 ? 9.245   2.204   16.855  1.00 96.95  ? 2048 GLU A CG  1 
ATOM   3369 C  CD  . GLU A 1 447 ? 9.457   0.717   17.074  1.00 101.38 ? 2048 GLU A CD  1 
ATOM   3370 O  OE1 . GLU A 1 447 ? 8.581   0.070   17.687  1.00 104.47 ? 2048 GLU A OE1 1 
ATOM   3371 O  OE2 . GLU A 1 447 ? 10.503  0.194   16.633  1.00 95.65  ? 2048 GLU A OE2 1 
ATOM   3372 N  N   . ASP A 1 448 ? 4.992   3.604   16.416  1.00 88.54  ? 2049 ASP A N   1 
ATOM   3373 C  CA  . ASP A 1 448 ? 3.634   3.949   16.818  1.00 90.92  ? 2049 ASP A CA  1 
ATOM   3374 C  C   . ASP A 1 448 ? 2.667   3.884   15.636  1.00 89.97  ? 2049 ASP A C   1 
ATOM   3375 O  O   . ASP A 1 448 ? 1.506   4.274   15.756  1.00 85.47  ? 2049 ASP A O   1 
ATOM   3376 C  CB  . ASP A 1 448 ? 3.597   5.343   17.454  1.00 96.28  ? 2049 ASP A CB  1 
ATOM   3377 C  CG  . ASP A 1 448 ? 4.243   5.379   18.830  1.00 97.97  ? 2049 ASP A CG  1 
ATOM   3378 O  OD1 . ASP A 1 448 ? 4.292   4.322   19.494  1.00 99.44  ? 2049 ASP A OD1 1 
ATOM   3379 O  OD2 . ASP A 1 448 ? 4.695   6.465   19.253  1.00 91.76  ? 2049 ASP A OD2 1 
ATOM   3380 N  N   . LYS A 1 449 ? 3.151   3.393   14.498  1.00 86.81  ? 2050 LYS A N   1 
ATOM   3381 C  CA  . LYS A 1 449 ? 2.313   3.228   13.312  1.00 77.77  ? 2050 LYS A CA  1 
ATOM   3382 C  C   . LYS A 1 449 ? 1.597   1.882   13.319  1.00 74.75  ? 2050 LYS A C   1 
ATOM   3383 O  O   . LYS A 1 449 ? 2.228   0.838   13.487  1.00 77.77  ? 2050 LYS A O   1 
ATOM   3384 C  CB  . LYS A 1 449 ? 3.149   3.362   12.038  1.00 76.56  ? 2050 LYS A CB  1 
ATOM   3385 C  CG  . LYS A 1 449 ? 3.668   4.764   11.772  1.00 75.16  ? 2050 LYS A CG  1 
ATOM   3386 C  CD  . LYS A 1 449 ? 2.531   5.733   11.494  1.00 67.53  ? 2050 LYS A CD  1 
ATOM   3387 C  CE  . LYS A 1 449 ? 3.060   7.131   11.214  1.00 64.16  ? 2050 LYS A CE  1 
ATOM   3388 N  NZ  . LYS A 1 449 ? 1.952   8.105   11.015  1.00 63.05  ? 2050 LYS A NZ  1 
ATOM   3389 N  N   . SER A 1 450 ? 0.280   1.914   13.133  1.00 71.07  ? 2051 SER A N   1 
ATOM   3390 C  CA  . SER A 1 450 ? -0.525  0.698   13.093  1.00 67.54  ? 2051 SER A CA  1 
ATOM   3391 C  C   . SER A 1 450 ? -0.192  -0.139  11.860  1.00 65.36  ? 2051 SER A C   1 
ATOM   3392 O  O   . SER A 1 450 ? 0.194   0.402   10.825  1.00 63.35  ? 2051 SER A O   1 
ATOM   3393 C  CB  . SER A 1 450 ? -2.015  1.049   13.113  1.00 65.14  ? 2051 SER A CB  1 
ATOM   3394 O  OG  . SER A 1 450 ? -2.319  2.019   12.126  1.00 65.45  ? 2051 SER A OG  1 
ATOM   3395 N  N   . PRO A 1 451 ? -0.336  -1.468  11.967  1.00 64.51  ? 2052 PRO A N   1 
ATOM   3396 C  CA  . PRO A 1 451 ? -0.021  -2.340  10.829  1.00 62.06  ? 2052 PRO A CA  1 
ATOM   3397 C  C   . PRO A 1 451 ? -0.945  -2.126  9.627   1.00 62.32  ? 2052 PRO A C   1 
ATOM   3398 O  O   . PRO A 1 451 ? -0.646  -2.625  8.544   1.00 63.45  ? 2052 PRO A O   1 
ATOM   3399 C  CB  . PRO A 1 451 ? -0.191  -3.750  11.407  1.00 60.47  ? 2052 PRO A CB  1 
ATOM   3400 C  CG  . PRO A 1 451 ? -1.066  -3.580  12.594  1.00 64.55  ? 2052 PRO A CG  1 
ATOM   3401 C  CD  . PRO A 1 451 ? -0.727  -2.238  13.160  1.00 66.06  ? 2052 PRO A CD  1 
ATOM   3402 N  N   . ASP A 1 452 ? -2.040  -1.391  9.810   1.00 65.78  ? 2053 ASP A N   1 
ATOM   3403 C  CA  . ASP A 1 452 ? -2.958  -1.094  8.709   1.00 63.76  ? 2053 ASP A CA  1 
ATOM   3404 C  C   . ASP A 1 452 ? -2.762  0.319   8.163   1.00 58.58  ? 2053 ASP A C   1 
ATOM   3405 O  O   . ASP A 1 452 ? -3.488  0.751   7.273   1.00 59.87  ? 2053 ASP A O   1 
ATOM   3406 C  CB  . ASP A 1 452 ? -4.411  -1.273  9.155   1.00 67.01  ? 2053 ASP A CB  1 
ATOM   3407 C  CG  . ASP A 1 452 ? -4.755  -2.716  9.465   1.00 74.59  ? 2053 ASP A CG  1 
ATOM   3408 O  OD1 . ASP A 1 452 ? -4.219  -3.619  8.787   1.00 71.34  ? 2053 ASP A OD1 1 
ATOM   3409 O  OD2 . ASP A 1 452 ? -5.564  -2.946  10.388  1.00 91.57  ? 2053 ASP A OD2 1 
ATOM   3410 N  N   . SER A 1 453 ? -1.781  1.035   8.701   1.00 58.26  ? 2054 SER A N   1 
ATOM   3411 C  CA  . SER A 1 453 ? -1.507  2.403   8.272   1.00 55.57  ? 2054 SER A CA  1 
ATOM   3412 C  C   . SER A 1 453 ? -0.933  2.431   6.857   1.00 54.81  ? 2054 SER A C   1 
ATOM   3413 O  O   . SER A 1 453 ? -0.419  1.420   6.378   1.00 53.55  ? 2054 SER A O   1 
ATOM   3414 C  CB  . SER A 1 453 ? -0.541  3.085   9.248   1.00 58.78  ? 2054 SER A CB  1 
ATOM   3415 O  OG  . SER A 1 453 ? 0.739   2.476   9.215   1.00 59.85  ? 2054 SER A OG  1 
ATOM   3416 N  N   . PRO A 1 454 ? -1.038  3.584   6.174   1.00 55.56  ? 2055 PRO A N   1 
ATOM   3417 C  CA  . PRO A 1 454 ? -0.410  3.750   4.857   1.00 54.52  ? 2055 PRO A CA  1 
ATOM   3418 C  C   . PRO A 1 454 ? 1.101   3.522   4.898   1.00 53.63  ? 2055 PRO A C   1 
ATOM   3419 O  O   . PRO A 1 454 ? 1.643   2.853   4.020   1.00 55.69  ? 2055 PRO A O   1 
ATOM   3420 C  CB  . PRO A 1 454 ? -0.734  5.202   4.499   1.00 53.98  ? 2055 PRO A CB  1 
ATOM   3421 C  CG  . PRO A 1 454 ? -2.007  5.482   5.225   1.00 55.87  ? 2055 PRO A CG  1 
ATOM   3422 C  CD  . PRO A 1 454 ? -1.904  4.727   6.520   1.00 55.04  ? 2055 PRO A CD  1 
ATOM   3423 N  N   . GLU A 1 455 ? 1.759   4.071   5.916   1.00 56.34  ? 2056 GLU A N   1 
ATOM   3424 C  CA  . GLU A 1 455 ? 3.196   3.890   6.120   1.00 55.98  ? 2056 GLU A CA  1 
ATOM   3425 C  C   . GLU A 1 455 ? 3.620   2.420   6.105   1.00 53.48  ? 2056 GLU A C   1 
ATOM   3426 O  O   . GLU A 1 455 ? 4.618   2.062   5.481   1.00 53.57  ? 2056 GLU A O   1 
ATOM   3427 C  CB  . GLU A 1 455 ? 3.627   4.529   7.446   1.00 56.23  ? 2056 GLU A CB  1 
ATOM   3428 C  CG  . GLU A 1 455 ? 3.802   6.042   7.407   1.00 49.76  ? 2056 GLU A CG  1 
ATOM   3429 C  CD  . GLU A 1 455 ? 2.498   6.798   7.548   1.00 53.51  ? 2056 GLU A CD  1 
ATOM   3430 O  OE1 . GLU A 1 455 ? 1.428   6.153   7.618   1.00 54.98  ? 2056 GLU A OE1 1 
ATOM   3431 O  OE2 . GLU A 1 455 ? 2.550   8.045   7.591   1.00 52.79  ? 2056 GLU A OE2 1 
ATOM   3432 N  N   . MET A 1 456 ? 2.862   1.578   6.804   1.00 51.91  ? 2057 MET A N   1 
ATOM   3433 C  CA  . MET A 1 456 ? 3.145   0.147   6.859   1.00 53.35  ? 2057 MET A CA  1 
ATOM   3434 C  C   . MET A 1 456 ? 2.836   -0.548  5.541   1.00 56.18  ? 2057 MET A C   1 
ATOM   3435 O  O   . MET A 1 456 ? 3.501   -1.517  5.169   1.00 55.13  ? 2057 MET A O   1 
ATOM   3436 C  CB  . MET A 1 456 ? 2.350   -0.517  7.985   1.00 53.89  ? 2057 MET A CB  1 
ATOM   3437 C  CG  . MET A 1 456 ? 3.012   -0.417  9.341   1.00 62.08  ? 2057 MET A CG  1 
ATOM   3438 S  SD  . MET A 1 456 ? 4.707   -1.034  9.308   1.00 65.06  ? 2057 MET A SD  1 
ATOM   3439 C  CE  . MET A 1 456 ? 4.444   -2.730  8.788   1.00 63.88  ? 2057 MET A CE  1 
ATOM   3440 N  N   . LYS A 1 457 ? 1.816   -0.056  4.846   1.00 56.44  ? 2058 LYS A N   1 
ATOM   3441 C  CA  . LYS A 1 457 ? 1.396   -0.650  3.585   1.00 54.13  ? 2058 LYS A CA  1 
ATOM   3442 C  C   . LYS A 1 457 ? 2.424   -0.365  2.501   1.00 51.48  ? 2058 LYS A C   1 
ATOM   3443 O  O   . LYS A 1 457 ? 2.664   -1.200  1.633   1.00 52.94  ? 2058 LYS A O   1 
ATOM   3444 C  CB  . LYS A 1 457 ? 0.015   -0.132  3.175   1.00 54.89  ? 2058 LYS A CB  1 
ATOM   3445 C  CG  . LYS A 1 457 ? -1.115  -0.676  4.040   1.00 54.45  ? 2058 LYS A CG  1 
ATOM   3446 C  CD  . LYS A 1 457 ? -2.468  -0.113  3.633   1.00 49.53  ? 2058 LYS A CD  1 
ATOM   3447 C  CE  . LYS A 1 457 ? -3.588  -0.732  4.463   1.00 50.81  ? 2058 LYS A CE  1 
ATOM   3448 N  NZ  . LYS A 1 457 ? -4.948  -0.328  3.999   1.00 56.13  ? 2058 LYS A NZ  1 
ATOM   3449 N  N   . ASP A 1 458 ? 3.035   0.814   2.566   1.00 50.71  ? 2059 ASP A N   1 
ATOM   3450 C  CA  . ASP A 1 458 ? 4.117   1.168   1.655   1.00 54.04  ? 2059 ASP A CA  1 
ATOM   3451 C  C   . ASP A 1 458 ? 5.373   0.365   1.974   1.00 56.83  ? 2059 ASP A C   1 
ATOM   3452 O  O   . ASP A 1 458 ? 6.127   -0.016  1.077   1.00 61.66  ? 2059 ASP A O   1 
ATOM   3453 C  CB  . ASP A 1 458 ? 4.417   2.667   1.725   1.00 55.14  ? 2059 ASP A CB  1 
ATOM   3454 C  CG  . ASP A 1 458 ? 3.372   3.504   1.016   1.00 62.65  ? 2059 ASP A CG  1 
ATOM   3455 O  OD1 . ASP A 1 458 ? 3.378   3.526   -0.234  1.00 75.54  ? 2059 ASP A OD1 1 
ATOM   3456 O  OD2 . ASP A 1 458 ? 2.551   4.146   1.703   1.00 59.23  ? 2059 ASP A OD2 1 
ATOM   3457 N  N   . PHE A 1 459 ? 5.594   0.118   3.260   1.00 57.30  ? 2060 PHE A N   1 
ATOM   3458 C  CA  . PHE A 1 459 ? 6.709   -0.706  3.707   1.00 59.01  ? 2060 PHE A CA  1 
ATOM   3459 C  C   . PHE A 1 459 ? 6.593   -2.119  3.148   1.00 57.64  ? 2060 PHE A C   1 
ATOM   3460 O  O   . PHE A 1 459 ? 7.531   -2.631  2.540   1.00 59.57  ? 2060 PHE A O   1 
ATOM   3461 C  CB  . PHE A 1 459 ? 6.768   -0.739  5.235   1.00 60.37  ? 2060 PHE A CB  1 
ATOM   3462 C  CG  . PHE A 1 459 ? 7.727   -1.756  5.787   1.00 63.18  ? 2060 PHE A CG  1 
ATOM   3463 C  CD1 . PHE A 1 459 ? 9.091   -1.546  5.727   1.00 62.53  ? 2060 PHE A CD1 1 
ATOM   3464 C  CD2 . PHE A 1 459 ? 7.260   -2.918  6.383   1.00 65.58  ? 2060 PHE A CD2 1 
ATOM   3465 C  CE1 . PHE A 1 459 ? 9.970   -2.477  6.240   1.00 65.20  ? 2060 PHE A CE1 1 
ATOM   3466 C  CE2 . PHE A 1 459 ? 8.138   -3.855  6.899   1.00 63.84  ? 2060 PHE A CE2 1 
ATOM   3467 C  CZ  . PHE A 1 459 ? 9.492   -3.632  6.828   1.00 64.68  ? 2060 PHE A CZ  1 
ATOM   3468 N  N   . ARG A 1 460 ? 5.432   -2.738  3.349   1.00 58.68  ? 2061 ARG A N   1 
ATOM   3469 C  CA  . ARG A 1 460 ? 5.188   -4.095  2.870   1.00 57.64  ? 2061 ARG A CA  1 
ATOM   3470 C  C   . ARG A 1 460 ? 5.215   -4.167  1.347   1.00 61.45  ? 2061 ARG A C   1 
ATOM   3471 O  O   . ARG A 1 460 ? 5.682   -5.151  0.772   1.00 62.47  ? 2061 ARG A O   1 
ATOM   3472 C  CB  . ARG A 1 460 ? 3.846   -4.618  3.382   1.00 56.83  ? 2061 ARG A CB  1 
ATOM   3473 C  CG  . ARG A 1 460 ? 3.726   -4.690  4.888   1.00 56.85  ? 2061 ARG A CG  1 
ATOM   3474 C  CD  . ARG A 1 460 ? 2.677   -5.715  5.280   1.00 58.51  ? 2061 ARG A CD  1 
ATOM   3475 N  NE  . ARG A 1 460 ? 1.760   -5.219  6.301   1.00 58.66  ? 2061 ARG A NE  1 
ATOM   3476 C  CZ  . ARG A 1 460 ? 0.576   -4.678  6.040   1.00 60.89  ? 2061 ARG A CZ  1 
ATOM   3477 N  NH1 . ARG A 1 460 ? 0.159   -4.558  4.787   1.00 71.65  ? 2061 ARG A NH1 1 
ATOM   3478 N  NH2 . ARG A 1 460 ? -0.195  -4.257  7.031   1.00 62.44  ? 2061 ARG A NH2 1 
ATOM   3479 N  N   . HIS A 1 461 ? 4.704   -3.122  0.702   1.00 61.61  ? 2062 HIS A N   1 
ATOM   3480 C  CA  . HIS A 1 461 ? 4.679   -3.060  -0.753  1.00 59.65  ? 2062 HIS A CA  1 
ATOM   3481 C  C   . HIS A 1 461 ? 6.096   -3.019  -1.312  1.00 62.80  ? 2062 HIS A C   1 
ATOM   3482 O  O   . HIS A 1 461 ? 6.366   -3.557  -2.386  1.00 64.51  ? 2062 HIS A O   1 
ATOM   3483 C  CB  . HIS A 1 461 ? 3.888   -1.842  -1.230  1.00 59.07  ? 2062 HIS A CB  1 
ATOM   3484 C  CG  . HIS A 1 461 ? 3.791   -1.733  -2.720  1.00 64.67  ? 2062 HIS A CG  1 
ATOM   3485 N  ND1 . HIS A 1 461 ? 3.136   -2.669  -3.492  1.00 61.87  ? 2062 HIS A ND1 1 
ATOM   3486 C  CD2 . HIS A 1 461 ? 4.271   -0.805  -3.579  1.00 64.26  ? 2062 HIS A CD2 1 
ATOM   3487 C  CE1 . HIS A 1 461 ? 3.215   -2.318  -4.764  1.00 63.13  ? 2062 HIS A CE1 1 
ATOM   3488 N  NE2 . HIS A 1 461 ? 3.899   -1.190  -4.843  1.00 62.26  ? 2062 HIS A NE2 1 
ATOM   3489 N  N   . GLY A 1 462 ? 6.996   -2.379  -0.572  1.00 61.92  ? 2063 GLY A N   1 
ATOM   3490 C  CA  . GLY A 1 462 ? 8.395   -2.323  -0.949  1.00 63.40  ? 2063 GLY A CA  1 
ATOM   3491 C  C   . GLY A 1 462 ? 8.997   -3.710  -1.059  1.00 64.87  ? 2063 GLY A C   1 
ATOM   3492 O  O   . GLY A 1 462 ? 9.912   -3.938  -1.849  1.00 65.32  ? 2063 GLY A O   1 
ATOM   3493 N  N   . PHE A 1 463 ? 8.478   -4.640  -0.264  1.00 64.08  ? 2064 PHE A N   1 
ATOM   3494 C  CA  . PHE A 1 463 ? 8.924   -6.027  -0.322  1.00 64.73  ? 2064 PHE A CA  1 
ATOM   3495 C  C   . PHE A 1 463 ? 8.232   -6.783  -1.448  1.00 63.78  ? 2064 PHE A C   1 
ATOM   3496 O  O   . PHE A 1 463 ? 8.830   -7.660  -2.070  1.00 64.69  ? 2064 PHE A O   1 
ATOM   3497 C  CB  . PHE A 1 463 ? 8.675   -6.731  1.011   1.00 66.55  ? 2064 PHE A CB  1 
ATOM   3498 C  CG  . PHE A 1 463 ? 9.723   -6.452  2.047   1.00 65.68  ? 2064 PHE A CG  1 
ATOM   3499 C  CD1 . PHE A 1 463 ? 10.914  -7.163  2.054   1.00 66.31  ? 2064 PHE A CD1 1 
ATOM   3500 C  CD2 . PHE A 1 463 ? 9.521   -5.482  3.014   1.00 64.87  ? 2064 PHE A CD2 1 
ATOM   3501 C  CE1 . PHE A 1 463 ? 11.885  -6.910  3.005   1.00 68.03  ? 2064 PHE A CE1 1 
ATOM   3502 C  CE2 . PHE A 1 463 ? 10.487  -5.225  3.968   1.00 66.58  ? 2064 PHE A CE2 1 
ATOM   3503 C  CZ  . PHE A 1 463 ? 11.671  -5.940  3.964   1.00 68.63  ? 2064 PHE A CZ  1 
ATOM   3504 N  N   . ASP A 1 464 ? 6.972   -6.441  -1.703  1.00 64.34  ? 2065 ASP A N   1 
ATOM   3505 C  CA  . ASP A 1 464 ? 6.212   -7.059  -2.786  1.00 63.61  ? 2065 ASP A CA  1 
ATOM   3506 C  C   . ASP A 1 464 ? 6.883   -6.806  -4.130  1.00 63.19  ? 2065 ASP A C   1 
ATOM   3507 O  O   . ASP A 1 464 ? 6.932   -7.686  -4.988  1.00 64.22  ? 2065 ASP A O   1 
ATOM   3508 C  CB  . ASP A 1 464 ? 4.775   -6.534  -2.809  1.00 65.44  ? 2065 ASP A CB  1 
ATOM   3509 C  CG  . ASP A 1 464 ? 3.943   -7.060  -1.657  1.00 64.40  ? 2065 ASP A CG  1 
ATOM   3510 O  OD1 . ASP A 1 464 ? 4.264   -8.151  -1.140  1.00 64.28  ? 2065 ASP A OD1 1 
ATOM   3511 O  OD2 . ASP A 1 464 ? 2.965   -6.384  -1.275  1.00 63.41  ? 2065 ASP A OD2 1 
ATOM   3512 N  N   . ILE A 1 465 ? 7.398   -5.594  -4.303  1.00 62.48  ? 2066 ILE A N   1 
ATOM   3513 C  CA  . ILE A 1 465 ? 8.138   -5.242  -5.506  1.00 62.24  ? 2066 ILE A CA  1 
ATOM   3514 C  C   . ILE A 1 465 ? 9.436   -6.039  -5.563  1.00 65.35  ? 2066 ILE A C   1 
ATOM   3515 O  O   . ILE A 1 465 ? 9.819   -6.553  -6.616  1.00 66.65  ? 2066 ILE A O   1 
ATOM   3516 C  CB  . ILE A 1 465 ? 8.444   -3.732  -5.558  1.00 62.60  ? 2066 ILE A CB  1 
ATOM   3517 C  CG1 . ILE A 1 465 ? 7.141   -2.930  -5.580  1.00 65.22  ? 2066 ILE A CG1 1 
ATOM   3518 C  CG2 . ILE A 1 465 ? 9.300   -3.398  -6.769  1.00 62.68  ? 2066 ILE A CG2 1 
ATOM   3519 C  CD1 . ILE A 1 465 ? 7.340   -1.431  -5.585  1.00 67.42  ? 2066 ILE A CD1 1 
ATOM   3520 N  N   . LEU A 1 466 ? 10.097  -6.152  -4.416  1.00 63.97  ? 2067 LEU A N   1 
ATOM   3521 C  CA  . LEU A 1 466 ? 11.346  -6.894  -4.317  1.00 62.34  ? 2067 LEU A CA  1 
ATOM   3522 C  C   . LEU A 1 466 ? 11.133  -8.385  -4.550  1.00 61.38  ? 2067 LEU A C   1 
ATOM   3523 O  O   . LEU A 1 466 ? 11.843  -8.999  -5.345  1.00 62.79  ? 2067 LEU A O   1 
ATOM   3524 C  CB  . LEU A 1 466 ? 11.993  -6.667  -2.951  1.00 61.44  ? 2067 LEU A CB  1 
ATOM   3525 C  CG  . LEU A 1 466 ? 13.331  -7.367  -2.716  1.00 59.06  ? 2067 LEU A CG  1 
ATOM   3526 C  CD1 . LEU A 1 466 ? 14.392  -6.834  -3.667  1.00 65.67  ? 2067 LEU A CD1 1 
ATOM   3527 C  CD2 . LEU A 1 466 ? 13.767  -7.203  -1.275  1.00 58.72  ? 2067 LEU A CD2 1 
ATOM   3528 N  N   . VAL A 1 467 ? 10.151  -8.957  -3.858  1.00 60.17  ? 2068 VAL A N   1 
ATOM   3529 C  CA  . VAL A 1 467 ? 9.865   -10.387 -3.946  1.00 60.88  ? 2068 VAL A CA  1 
ATOM   3530 C  C   . VAL A 1 467 ? 9.522   -10.803 -5.374  1.00 66.51  ? 2068 VAL A C   1 
ATOM   3531 O  O   . VAL A 1 467 ? 9.975   -11.845 -5.855  1.00 68.42  ? 2068 VAL A O   1 
ATOM   3532 C  CB  . VAL A 1 467 ? 8.711   -10.786 -2.999  1.00 58.86  ? 2068 VAL A CB  1 
ATOM   3533 C  CG1 . VAL A 1 467 ? 8.144   -12.144 -3.369  1.00 58.08  ? 2068 VAL A CG1 1 
ATOM   3534 C  CG2 . VAL A 1 467 ? 9.189   -10.785 -1.553  1.00 63.89  ? 2068 VAL A CG2 1 
ATOM   3535 N  N   . GLY A 1 468 ? 8.736   -9.976  -6.054  1.00 65.92  ? 2069 GLY A N   1 
ATOM   3536 C  CA  . GLY A 1 468 ? 8.370   -10.235 -7.434  1.00 63.45  ? 2069 GLY A CA  1 
ATOM   3537 C  C   . GLY A 1 468 ? 9.588   -10.300 -8.333  1.00 66.24  ? 2069 GLY A C   1 
ATOM   3538 O  O   . GLY A 1 468 ? 9.665   -11.131 -9.237  1.00 68.90  ? 2069 GLY A O   1 
ATOM   3539 N  N   . GLN A 1 469 ? 10.548  -9.419  -8.079  1.00 64.51  ? 2070 GLN A N   1 
ATOM   3540 C  CA  . GLN A 1 469 ? 11.785  -9.404  -8.844  1.00 65.23  ? 2070 GLN A CA  1 
ATOM   3541 C  C   . GLN A 1 469 ? 12.637  -10.632 -8.540  1.00 67.31  ? 2070 GLN A C   1 
ATOM   3542 O  O   . GLN A 1 469 ? 13.372  -11.114 -9.402  1.00 68.35  ? 2070 GLN A O   1 
ATOM   3543 C  CB  . GLN A 1 469 ? 12.572  -8.126  -8.559  1.00 65.68  ? 2070 GLN A CB  1 
ATOM   3544 C  CG  . GLN A 1 469 ? 11.907  -6.871  -9.094  1.00 64.95  ? 2070 GLN A CG  1 
ATOM   3545 C  CD  . GLN A 1 469 ? 12.706  -5.619  -8.803  1.00 68.87  ? 2070 GLN A CD  1 
ATOM   3546 O  OE1 . GLN A 1 469 ? 13.718  -5.660  -8.101  1.00 69.62  ? 2070 GLN A OE1 1 
ATOM   3547 N  NE2 . GLN A 1 469 ? 12.255  -4.493  -9.345  1.00 70.23  ? 2070 GLN A NE2 1 
ATOM   3548 N  N   . ILE A 1 470 ? 12.535  -11.137 -7.314  1.00 67.16  ? 2071 ILE A N   1 
ATOM   3549 C  CA  . ILE A 1 470 ? 13.241  -12.358 -6.942  1.00 68.21  ? 2071 ILE A CA  1 
ATOM   3550 C  C   . ILE A 1 470 ? 12.667  -13.541 -7.717  1.00 68.65  ? 2071 ILE A C   1 
ATOM   3551 O  O   . ILE A 1 470 ? 13.393  -14.463 -8.092  1.00 68.34  ? 2071 ILE A O   1 
ATOM   3552 C  CB  . ILE A 1 470 ? 13.155  -12.632 -5.425  1.00 66.55  ? 2071 ILE A CB  1 
ATOM   3553 C  CG1 . ILE A 1 470 ? 13.648  -11.419 -4.634  1.00 66.95  ? 2071 ILE A CG1 1 
ATOM   3554 C  CG2 . ILE A 1 470 ? 13.975  -13.857 -5.053  1.00 66.62  ? 2071 ILE A CG2 1 
ATOM   3555 C  CD1 . ILE A 1 470 ? 13.450  -11.540 -3.132  1.00 61.37  ? 2071 ILE A CD1 1 
ATOM   3556 N  N   . ASP A 1 471 ? 11.361  -13.503 -7.967  1.00 67.13  ? 2072 ASP A N   1 
ATOM   3557 C  CA  . ASP A 1 471 ? 10.704  -14.542 -8.753  1.00 68.77  ? 2072 ASP A CA  1 
ATOM   3558 C  C   . ASP A 1 471 ? 11.092  -14.449 -10.225 1.00 70.30  ? 2072 ASP A C   1 
ATOM   3559 O  O   . ASP A 1 471 ? 11.086  -15.450 -10.941 1.00 70.60  ? 2072 ASP A O   1 
ATOM   3560 C  CB  . ASP A 1 471 ? 9.184   -14.451 -8.607  1.00 70.85  ? 2072 ASP A CB  1 
ATOM   3561 C  CG  . ASP A 1 471 ? 8.711   -14.804 -7.211  1.00 71.38  ? 2072 ASP A CG  1 
ATOM   3562 O  OD1 . ASP A 1 471 ? 9.387   -15.613 -6.540  1.00 72.54  ? 2072 ASP A OD1 1 
ATOM   3563 O  OD2 . ASP A 1 471 ? 7.663   -14.274 -6.784  1.00 71.31  ? 2072 ASP A OD2 1 
ATOM   3564 N  N   . ASP A 1 472 ? 11.427  -13.242 -10.671 1.00 69.48  ? 2073 ASP A N   1 
ATOM   3565 C  CA  . ASP A 1 472 ? 11.858  -13.025 -12.048 1.00 67.19  ? 2073 ASP A CA  1 
ATOM   3566 C  C   . ASP A 1 472 ? 13.286  -13.517 -12.262 1.00 69.46  ? 2073 ASP A C   1 
ATOM   3567 O  O   . ASP A 1 472 ? 13.675  -13.853 -13.381 1.00 71.57  ? 2073 ASP A O   1 
ATOM   3568 C  CB  . ASP A 1 472 ? 11.749  -11.544 -12.418 1.00 67.04  ? 2073 ASP A CB  1 
ATOM   3569 C  CG  . ASP A 1 472 ? 10.312  -11.070 -12.507 1.00 71.49  ? 2073 ASP A CG  1 
ATOM   3570 O  OD1 . ASP A 1 472 ? 9.427   -11.895 -12.822 1.00 73.94  ? 2073 ASP A OD1 1 
ATOM   3571 O  OD2 . ASP A 1 472 ? 10.069  -9.869  -12.266 1.00 75.15  ? 2073 ASP A OD2 1 
ATOM   3572 N  N   . ALA A 1 473 ? 14.062  -13.551 -11.184 1.00 67.56  ? 2074 ALA A N   1 
ATOM   3573 C  CA  . ALA A 1 473 ? 15.415  -14.088 -11.234 1.00 64.68  ? 2074 ALA A CA  1 
ATOM   3574 C  C   . ALA A 1 473 ? 15.378  -15.597 -11.021 1.00 67.30  ? 2074 ALA A C   1 
ATOM   3575 O  O   . ALA A 1 473 ? 16.210  -16.332 -11.556 1.00 68.46  ? 2074 ALA A O   1 
ATOM   3576 C  CB  . ALA A 1 473 ? 16.294  -13.421 -10.198 1.00 67.29  ? 2074 ALA A CB  1 
ATOM   3577 N  N   . LEU A 1 474 ? 14.408  -16.050 -10.232 1.00 67.29  ? 2075 LEU A N   1 
ATOM   3578 C  CA  . LEU A 1 474 ? 14.171  -17.477 -10.047 1.00 69.96  ? 2075 LEU A CA  1 
ATOM   3579 C  C   . LEU A 1 474 ? 13.617  -18.091 -11.327 1.00 71.16  ? 2075 LEU A C   1 
ATOM   3580 O  O   . LEU A 1 474 ? 13.879  -19.252 -11.638 1.00 70.92  ? 2075 LEU A O   1 
ATOM   3581 C  CB  . LEU A 1 474 ? 13.205  -17.722 -8.887  1.00 70.51  ? 2075 LEU A CB  1 
ATOM   3582 C  CG  . LEU A 1 474 ? 13.776  -17.713 -7.470  1.00 70.04  ? 2075 LEU A CG  1 
ATOM   3583 C  CD1 . LEU A 1 474 ? 12.647  -17.778 -6.460  1.00 72.64  ? 2075 LEU A CD1 1 
ATOM   3584 C  CD2 . LEU A 1 474 ? 14.733  -18.876 -7.274  1.00 70.75  ? 2075 LEU A CD2 1 
ATOM   3585 N  N   . LYS A 1 475 ? 12.842  -17.299 -12.061 1.00 70.09  ? 2076 LYS A N   1 
ATOM   3586 C  CA  . LYS A 1 475 ? 12.294  -17.728 -13.341 1.00 73.74  ? 2076 LYS A CA  1 
ATOM   3587 C  C   . LYS A 1 475 ? 13.428  -18.043 -14.305 1.00 73.08  ? 2076 LYS A C   1 
ATOM   3588 O  O   . LYS A 1 475 ? 13.343  -18.979 -15.098 1.00 73.91  ? 2076 LYS A O   1 
ATOM   3589 C  CB  . LYS A 1 475 ? 11.377  -16.650 -13.926 1.00 73.41  ? 2076 LYS A CB  1 
ATOM   3590 C  CG  . LYS A 1 475 ? 10.743  -17.018 -15.258 1.00 75.24  ? 2076 LYS A CG  1 
ATOM   3591 C  CD  . LYS A 1 475 ? 9.736   -18.147 -15.104 1.00 80.14  ? 2076 LYS A CD  1 
ATOM   3592 C  CE  . LYS A 1 475 ? 9.087   -18.488 -16.435 1.00 79.84  ? 2076 LYS A CE  1 
ATOM   3593 N  NZ  . LYS A 1 475 ? 10.095  -18.902 -17.450 1.00 81.83  ? 2076 LYS A NZ  1 
ATOM   3594 N  N   . LEU A 1 476 ? 14.493  -17.253 -14.221 1.00 68.18  ? 2077 LEU A N   1 
ATOM   3595 C  CA  . LEU A 1 476 ? 15.662  -17.458 -15.059 1.00 70.39  ? 2077 LEU A CA  1 
ATOM   3596 C  C   . LEU A 1 476 ? 16.542  -18.567 -14.494 1.00 71.66  ? 2077 LEU A C   1 
ATOM   3597 O  O   . LEU A 1 476 ? 17.124  -19.351 -15.241 1.00 72.68  ? 2077 LEU A O   1 
ATOM   3598 C  CB  . LEU A 1 476 ? 16.457  -16.159 -15.188 1.00 70.79  ? 2077 LEU A CB  1 
ATOM   3599 C  CG  . LEU A 1 476 ? 15.690  -14.966 -15.763 1.00 68.83  ? 2077 LEU A CG  1 
ATOM   3600 C  CD1 . LEU A 1 476 ? 16.517  -13.694 -15.661 1.00 66.43  ? 2077 LEU A CD1 1 
ATOM   3601 C  CD2 . LEU A 1 476 ? 15.283  -15.231 -17.206 1.00 69.12  ? 2077 LEU A CD2 1 
ATOM   3602 N  N   . ALA A 1 477 ? 16.632  -18.632 -13.170 1.00 72.78  ? 2078 ALA A N   1 
ATOM   3603 C  CA  . ALA A 1 477 ? 17.453  -19.644 -12.513 1.00 71.67  ? 2078 ALA A CA  1 
ATOM   3604 C  C   . ALA A 1 477 ? 16.869  -21.041 -12.702 1.00 71.28  ? 2078 ALA A C   1 
ATOM   3605 O  O   . ALA A 1 477 ? 17.601  -22.026 -12.746 1.00 73.85  ? 2078 ALA A O   1 
ATOM   3606 C  CB  . ALA A 1 477 ? 17.603  -19.327 -11.032 1.00 69.22  ? 2078 ALA A CB  1 
ATOM   3607 N  N   . ASN A 1 478 ? 15.549  -21.123 -12.818 1.00 73.07  ? 2079 ASN A N   1 
ATOM   3608 C  CA  . ASN A 1 478 ? 14.893  -22.406 -13.021 1.00 73.26  ? 2079 ASN A CA  1 
ATOM   3609 C  C   . ASN A 1 478 ? 14.836  -22.781 -14.501 1.00 75.46  ? 2079 ASN A C   1 
ATOM   3610 O  O   . ASN A 1 478 ? 14.655  -23.949 -14.847 1.00 74.41  ? 2079 ASN A O   1 
ATOM   3611 C  CB  . ASN A 1 478 ? 13.486  -22.387 -12.419 1.00 73.03  ? 2079 ASN A CB  1 
ATOM   3612 C  CG  . ASN A 1 478 ? 13.501  -22.271 -10.904 1.00 76.04  ? 2079 ASN A CG  1 
ATOM   3613 O  OD1 . ASN A 1 478 ? 14.424  -22.749 -10.244 1.00 76.82  ? 2079 ASN A OD1 1 
ATOM   3614 N  ND2 . ASN A 1 478 ? 12.479  -21.631 -10.347 1.00 75.08  ? 2079 ASN A ND2 1 
ATOM   3615 N  N   . GLU A 1 479 ? 15.001  -21.788 -15.371 1.00 74.55  ? 2080 GLU A N   1 
ATOM   3616 C  CA  . GLU A 1 479 ? 15.038  -22.032 -16.810 1.00 73.15  ? 2080 GLU A CA  1 
ATOM   3617 C  C   . GLU A 1 479 ? 16.468  -22.167 -17.321 1.00 72.34  ? 2080 GLU A C   1 
ATOM   3618 O  O   . GLU A 1 479 ? 16.725  -21.992 -18.512 1.00 72.58  ? 2080 GLU A O   1 
ATOM   3619 C  CB  . GLU A 1 479 ? 14.316  -20.916 -17.572 1.00 74.32  ? 2080 GLU A CB  1 
ATOM   3620 C  CG  . GLU A 1 479 ? 12.819  -21.142 -17.738 1.00 76.97  ? 2080 GLU A CG  1 
ATOM   3621 C  CD  . GLU A 1 479 ? 12.499  -22.332 -18.631 1.00 86.72  ? 2080 GLU A CD  1 
ATOM   3622 O  OE1 . GLU A 1 479 ? 13.105  -22.447 -19.720 1.00 83.77  ? 2080 GLU A OE1 1 
ATOM   3623 O  OE2 . GLU A 1 479 ? 11.639  -23.152 -18.246 1.00 86.78  ? 2080 GLU A OE2 1 
ATOM   3624 N  N   . GLY A 1 480 ? 17.394  -22.467 -16.414 1.00 72.86  ? 2081 GLY A N   1 
ATOM   3625 C  CA  . GLY A 1 480 ? 18.771  -22.742 -16.787 1.00 71.96  ? 2081 GLY A CA  1 
ATOM   3626 C  C   . GLY A 1 480 ? 19.600  -21.537 -17.190 1.00 71.21  ? 2081 GLY A C   1 
ATOM   3627 O  O   . GLY A 1 480 ? 20.799  -21.661 -17.440 1.00 73.03  ? 2081 GLY A O   1 
ATOM   3628 N  N   . LYS A 1 481 ? 18.969  -20.370 -17.257 1.00 71.84  ? 2082 LYS A N   1 
ATOM   3629 C  CA  . LYS A 1 481 ? 19.667  -19.149 -17.642 1.00 74.31  ? 2082 LYS A CA  1 
ATOM   3630 C  C   . LYS A 1 481 ? 20.488  -18.605 -16.474 1.00 77.12  ? 2082 LYS A C   1 
ATOM   3631 O  O   . LYS A 1 481 ? 20.060  -17.691 -15.765 1.00 77.67  ? 2082 LYS A O   1 
ATOM   3632 C  CB  . LYS A 1 481 ? 18.670  -18.101 -18.138 1.00 78.48  ? 2082 LYS A CB  1 
ATOM   3633 C  CG  . LYS A 1 481 ? 17.767  -18.608 -19.255 1.00 76.66  ? 2082 LYS A CG  1 
ATOM   3634 C  CD  . LYS A 1 481 ? 16.891  -17.504 -19.825 1.00 78.77  ? 2082 LYS A CD  1 
ATOM   3635 C  CE  . LYS A 1 481 ? 16.032  -18.026 -20.967 1.00 75.79  ? 2082 LYS A CE  1 
ATOM   3636 N  NZ  . LYS A 1 481 ? 15.226  -16.940 -21.590 1.00 77.11  ? 2082 LYS A NZ  1 
ATOM   3637 N  N   . VAL A 1 482 ? 21.675  -19.177 -16.295 1.00 77.49  ? 2083 VAL A N   1 
ATOM   3638 C  CA  . VAL A 1 482 ? 22.542  -18.880 -15.159 1.00 75.52  ? 2083 VAL A CA  1 
ATOM   3639 C  C   . VAL A 1 482 ? 22.950  -17.410 -15.075 1.00 75.96  ? 2083 VAL A C   1 
ATOM   3640 O  O   . VAL A 1 482 ? 22.531  -16.693 -14.166 1.00 78.10  ? 2083 VAL A O   1 
ATOM   3641 C  CB  . VAL A 1 482 ? 23.822  -19.735 -15.213 1.00 86.74  ? 2083 VAL A CB  1 
ATOM   3642 C  CG1 . VAL A 1 482 ? 24.609  -19.603 -13.916 1.00 88.50  ? 2083 VAL A CG1 1 
ATOM   3643 C  CG2 . VAL A 1 482 ? 23.475  -21.194 -15.489 1.00 80.75  ? 2083 VAL A CG2 1 
ATOM   3644 N  N   . LYS A 1 483 ? 23.769  -16.972 -16.027 1.00 78.15  ? 2084 LYS A N   1 
ATOM   3645 C  CA  . LYS A 1 483 ? 24.350  -15.630 -16.006 1.00 78.37  ? 2084 LYS A CA  1 
ATOM   3646 C  C   . LYS A 1 483 ? 23.295  -14.527 -16.042 1.00 75.24  ? 2084 LYS A C   1 
ATOM   3647 O  O   . LYS A 1 483 ? 23.514  -13.430 -15.525 1.00 73.76  ? 2084 LYS A O   1 
ATOM   3648 C  CB  . LYS A 1 483 ? 25.320  -15.456 -17.180 1.00 75.65  ? 2084 LYS A CB  1 
ATOM   3649 C  CG  . LYS A 1 483 ? 26.492  -16.427 -17.169 1.00 76.15  ? 2084 LYS A CG  1 
ATOM   3650 C  CD  . LYS A 1 483 ? 27.305  -16.301 -15.887 1.00 81.36  ? 2084 LYS A CD  1 
ATOM   3651 C  CE  . LYS A 1 483 ? 28.471  -17.280 -15.861 1.00 81.71  ? 2084 LYS A CE  1 
ATOM   3652 N  NZ  . LYS A 1 483 ? 29.448  -17.027 -16.959 1.00 77.65  ? 2084 LYS A NZ  1 
ATOM   3653 N  N   . GLU A 1 484 ? 22.150  -14.823 -16.648 1.00 76.78  ? 2085 GLU A N   1 
ATOM   3654 C  CA  . GLU A 1 484 ? 21.080  -13.841 -16.790 1.00 76.32  ? 2085 GLU A CA  1 
ATOM   3655 C  C   . GLU A 1 484 ? 20.377  -13.581 -15.462 1.00 74.22  ? 2085 GLU A C   1 
ATOM   3656 O  O   . GLU A 1 484 ? 19.820  -12.504 -15.246 1.00 72.25  ? 2085 GLU A O   1 
ATOM   3657 C  CB  . GLU A 1 484 ? 20.069  -14.305 -17.841 1.00 78.47  ? 2085 GLU A CB  1 
ATOM   3658 C  CG  . GLU A 1 484 ? 20.690  -14.609 -19.197 1.00 83.68  ? 2085 GLU A CG  1 
ATOM   3659 C  CD  . GLU A 1 484 ? 19.656  -14.929 -20.259 1.00 92.54  ? 2085 GLU A CD  1 
ATOM   3660 O  OE1 . GLU A 1 484 ? 20.027  -15.524 -21.294 1.00 105.11 ? 2085 GLU A OE1 1 
ATOM   3661 O  OE2 . GLU A 1 484 ? 18.472  -14.581 -20.064 1.00 93.90  ? 2085 GLU A OE2 1 
ATOM   3662 N  N   . ALA A 1 485 ? 20.407  -14.571 -14.576 1.00 73.96  ? 2086 ALA A N   1 
ATOM   3663 C  CA  . ALA A 1 485 ? 19.818  -14.424 -13.250 1.00 70.01  ? 2086 ALA A CA  1 
ATOM   3664 C  C   . ALA A 1 485 ? 20.749  -13.637 -12.332 1.00 72.90  ? 2086 ALA A C   1 
ATOM   3665 O  O   . ALA A 1 485 ? 20.296  -12.973 -11.400 1.00 70.71  ? 2086 ALA A O   1 
ATOM   3666 C  CB  . ALA A 1 485 ? 19.503  -15.785 -12.652 1.00 68.44  ? 2086 ALA A CB  1 
ATOM   3667 N  N   . GLN A 1 486 ? 22.051  -13.717 -12.597 1.00 75.20  ? 2087 GLN A N   1 
ATOM   3668 C  CA  . GLN A 1 486 ? 23.035  -12.949 -11.839 1.00 74.53  ? 2087 GLN A CA  1 
ATOM   3669 C  C   . GLN A 1 486 ? 22.877  -11.458 -12.107 1.00 72.62  ? 2087 GLN A C   1 
ATOM   3670 O  O   . GLN A 1 486 ? 23.018  -10.640 -11.201 1.00 72.98  ? 2087 GLN A O   1 
ATOM   3671 C  CB  . GLN A 1 486 ? 24.460  -13.387 -12.184 1.00 79.45  ? 2087 GLN A CB  1 
ATOM   3672 C  CG  . GLN A 1 486 ? 24.814  -14.798 -11.751 1.00 84.03  ? 2087 GLN A CG  1 
ATOM   3673 C  CD  . GLN A 1 486 ? 26.229  -15.181 -12.144 1.00 94.11  ? 2087 GLN A CD  1 
ATOM   3674 O  OE1 . GLN A 1 486 ? 26.946  -14.396 -12.765 1.00 99.80  ? 2087 GLN A OE1 1 
ATOM   3675 N  NE2 . GLN A 1 486 ? 26.638  -16.392 -11.785 1.00 101.88 ? 2087 GLN A NE2 1 
ATOM   3676 N  N   . ALA A 1 487 ? 22.587  -11.111 -13.357 1.00 72.25  ? 2088 ALA A N   1 
ATOM   3677 C  CA  . ALA A 1 487 ? 22.382  -9.717  -13.736 1.00 71.51  ? 2088 ALA A CA  1 
ATOM   3678 C  C   . ALA A 1 487 ? 21.179  -9.125  -13.006 1.00 71.67  ? 2088 ALA A C   1 
ATOM   3679 O  O   . ALA A 1 487 ? 21.115  -7.919  -12.769 1.00 74.29  ? 2088 ALA A O   1 
ATOM   3680 C  CB  . ALA A 1 487 ? 22.203  -9.595  -15.241 1.00 68.06  ? 2088 ALA A CB  1 
ATOM   3681 N  N   . ALA A 1 488 ? 20.230  -9.983  -12.646 1.00 70.03  ? 2089 ALA A N   1 
ATOM   3682 C  CA  . ALA A 1 488 ? 19.037  -9.548  -11.932 1.00 71.99  ? 2089 ALA A CA  1 
ATOM   3683 C  C   . ALA A 1 488 ? 19.366  -9.123  -10.503 1.00 72.16  ? 2089 ALA A C   1 
ATOM   3684 O  O   . ALA A 1 488 ? 18.618  -8.366  -9.892  1.00 70.33  ? 2089 ALA A O   1 
ATOM   3685 C  CB  . ALA A 1 488 ? 17.990  -10.651 -11.928 1.00 69.41  ? 2089 ALA A CB  1 
ATOM   3686 N  N   . ALA A 1 489 ? 20.488  -9.611  -9.980  1.00 74.57  ? 2090 ALA A N   1 
ATOM   3687 C  CA  . ALA A 1 489 ? 20.909  -9.289  -8.618  1.00 75.67  ? 2090 ALA A CA  1 
ATOM   3688 C  C   . ALA A 1 489 ? 21.218  -7.802  -8.451  1.00 78.87  ? 2090 ALA A C   1 
ATOM   3689 O  O   . ALA A 1 489 ? 20.942  -7.217  -7.402  1.00 80.79  ? 2090 ALA A O   1 
ATOM   3690 C  CB  . ALA A 1 489 ? 22.120  -10.123 -8.229  1.00 78.11  ? 2090 ALA A CB  1 
ATOM   3691 N  N   . GLU A 1 490 ? 21.795  -7.195  -9.483  1.00 80.34  ? 2091 GLU A N   1 
ATOM   3692 C  CA  . GLU A 1 490 ? 22.084  -5.766  -9.456  1.00 83.32  ? 2091 GLU A CA  1 
ATOM   3693 C  C   . GLU A 1 490 ? 20.787  -4.964  -9.452  1.00 76.58  ? 2091 GLU A C   1 
ATOM   3694 O  O   . GLU A 1 490 ? 20.722  -3.862  -8.906  1.00 73.66  ? 2091 GLU A O   1 
ATOM   3695 C  CB  . GLU A 1 490 ? 22.954  -5.367  -10.649 1.00 92.17  ? 2091 GLU A CB  1 
ATOM   3696 C  CG  . GLU A 1 490 ? 24.336  -6.005  -10.653 1.00 101.36 ? 2091 GLU A CG  1 
ATOM   3697 C  CD  . GLU A 1 490 ? 25.186  -5.551  -11.826 1.00 116.77 ? 2091 GLU A CD  1 
ATOM   3698 O  OE1 . GLU A 1 490 ? 24.656  -4.847  -12.714 1.00 113.06 ? 2091 GLU A OE1 1 
ATOM   3699 O  OE2 . GLU A 1 490 ? 26.385  -5.897  -11.861 1.00 129.27 ? 2091 GLU A OE2 1 
ATOM   3700 N  N   . GLN A 1 491 ? 19.755  -5.527  -10.069 1.00 77.34  ? 2092 GLN A N   1 
ATOM   3701 C  CA  . GLN A 1 491 ? 18.429  -4.926  -10.051 1.00 81.49  ? 2092 GLN A CA  1 
ATOM   3702 C  C   . GLN A 1 491 ? 17.833  -5.014  -8.649  1.00 76.38  ? 2092 GLN A C   1 
ATOM   3703 O  O   . GLN A 1 491 ? 17.095  -4.128  -8.211  1.00 73.16  ? 2092 GLN A O   1 
ATOM   3704 C  CB  . GLN A 1 491 ? 17.512  -5.611  -11.071 1.00 77.06  ? 2092 GLN A CB  1 
ATOM   3705 C  CG  . GLN A 1 491 ? 16.059  -5.165  -10.998 1.00 76.98  ? 2092 GLN A CG  1 
ATOM   3706 C  CD  . GLN A 1 491 ? 15.908  -3.661  -11.129 1.00 80.13  ? 2092 GLN A CD  1 
ATOM   3707 O  OE1 . GLN A 1 491 ? 16.643  -3.014  -11.875 1.00 89.25  ? 2092 GLN A OE1 1 
ATOM   3708 N  NE2 . GLN A 1 491 ? 14.955  -3.095  -10.397 1.00 78.80  ? 2092 GLN A NE2 1 
ATOM   3709 N  N   . LEU A 1 492 ? 18.169  -6.093  -7.950  1.00 75.59  ? 2093 LEU A N   1 
ATOM   3710 C  CA  . LEU A 1 492 ? 17.716  -6.303  -6.584  1.00 72.81  ? 2093 LEU A CA  1 
ATOM   3711 C  C   . LEU A 1 492 ? 18.424  -5.353  -5.627  1.00 73.31  ? 2093 LEU A C   1 
ATOM   3712 O  O   . LEU A 1 492 ? 17.874  -4.976  -4.592  1.00 74.89  ? 2093 LEU A O   1 
ATOM   3713 C  CB  . LEU A 1 492 ? 17.954  -7.752  -6.163  1.00 70.32  ? 2093 LEU A CB  1 
ATOM   3714 C  CG  . LEU A 1 492 ? 17.152  -8.800  -6.934  1.00 68.88  ? 2093 LEU A CG  1 
ATOM   3715 C  CD1 . LEU A 1 492 ? 17.581  -10.204 -6.547  1.00 67.45  ? 2093 LEU A CD1 1 
ATOM   3716 C  CD2 . LEU A 1 492 ? 15.666  -8.604  -6.690  1.00 70.72  ? 2093 LEU A CD2 1 
ATOM   3717 N  N   . LYS A 1 493 ? 19.648  -4.973  -5.979  1.00 71.89  ? 2094 LYS A N   1 
ATOM   3718 C  CA  . LYS A 1 493 ? 20.410  -4.022  -5.182  1.00 74.43  ? 2094 LYS A CA  1 
ATOM   3719 C  C   . LYS A 1 493 ? 19.713  -2.666  -5.175  1.00 76.85  ? 2094 LYS A C   1 
ATOM   3720 O  O   . LYS A 1 493 ? 19.581  -2.024  -4.130  1.00 77.12  ? 2094 LYS A O   1 
ATOM   3721 C  CB  . LYS A 1 493 ? 21.835  -3.889  -5.723  1.00 76.26  ? 2094 LYS A CB  1 
ATOM   3722 C  CG  . LYS A 1 493 ? 22.734  -2.989  -4.893  1.00 82.90  ? 2094 LYS A CG  1 
ATOM   3723 C  CD  . LYS A 1 493 ? 24.136  -2.924  -5.477  1.00 93.15  ? 2094 LYS A CD  1 
ATOM   3724 C  CE  . LYS A 1 493 ? 25.032  -1.999  -4.667  1.00 107.62 ? 2094 LYS A CE  1 
ATOM   3725 N  NZ  . LYS A 1 493 ? 26.415  -1.934  -5.219  1.00 104.31 ? 2094 LYS A NZ  1 
ATOM   3726 N  N   . THR A 1 494 ? 19.261  -2.246  -6.352  1.00 76.62  ? 2095 THR A N   1 
ATOM   3727 C  CA  . THR A 1 494 ? 18.558  -0.979  -6.516  1.00 74.57  ? 2095 THR A CA  1 
ATOM   3728 C  C   . THR A 1 494 ? 17.285  -0.942  -5.679  1.00 76.16  ? 2095 THR A C   1 
ATOM   3729 O  O   . THR A 1 494 ? 17.003  0.047   -5.002  1.00 76.68  ? 2095 THR A O   1 
ATOM   3730 C  CB  . THR A 1 494 ? 18.206  -0.727  -7.994  1.00 73.47  ? 2095 THR A CB  1 
ATOM   3731 O  OG1 . THR A 1 494 ? 19.410  -0.661  -8.769  1.00 71.87  ? 2095 THR A OG1 1 
ATOM   3732 C  CG2 . THR A 1 494 ? 17.434  0.573   -8.151  1.00 74.07  ? 2095 THR A CG2 1 
ATOM   3733 N  N   . THR A 1 495 ? 16.527  -2.034  -5.727  1.00 75.80  ? 2096 THR A N   1 
ATOM   3734 C  CA  . THR A 1 495 ? 15.290  -2.155  -4.963  1.00 74.61  ? 2096 THR A CA  1 
ATOM   3735 C  C   . THR A 1 495 ? 15.559  -2.140  -3.457  1.00 75.38  ? 2096 THR A C   1 
ATOM   3736 O  O   . THR A 1 495 ? 14.737  -1.650  -2.680  1.00 77.42  ? 2096 THR A O   1 
ATOM   3737 C  CB  . THR A 1 495 ? 14.528  -3.446  -5.338  1.00 71.69  ? 2096 THR A CB  1 
ATOM   3738 O  OG1 . THR A 1 495 ? 14.405  -3.532  -6.764  1.00 69.03  ? 2096 THR A OG1 1 
ATOM   3739 C  CG2 . THR A 1 495 ? 13.139  -3.458  -4.713  1.00 69.54  ? 2096 THR A CG2 1 
ATOM   3740 N  N   . ARG A 1 496 ? 16.713  -2.664  -3.051  1.00 76.39  ? 2097 ARG A N   1 
ATOM   3741 C  CA  . ARG A 1 496 ? 17.086  -2.687  -1.637  1.00 78.79  ? 2097 ARG A CA  1 
ATOM   3742 C  C   . ARG A 1 496 ? 17.287  -1.280  -1.087  1.00 79.45  ? 2097 ARG A C   1 
ATOM   3743 O  O   . ARG A 1 496 ? 16.704  -0.913  -0.069  1.00 78.41  ? 2097 ARG A O   1 
ATOM   3744 C  CB  . ARG A 1 496 ? 18.361  -3.510  -1.422  1.00 79.93  ? 2097 ARG A CB  1 
ATOM   3745 C  CG  . ARG A 1 496 ? 18.794  -3.609  0.042   1.00 78.91  ? 2097 ARG A CG  1 
ATOM   3746 C  CD  . ARG A 1 496 ? 20.204  -4.170  0.183   1.00 79.67  ? 2097 ARG A CD  1 
ATOM   3747 N  NE  . ARG A 1 496 ? 21.199  -3.305  -0.446  1.00 85.82  ? 2097 ARG A NE  1 
ATOM   3748 C  CZ  . ARG A 1 496 ? 22.509  -3.537  -0.443  1.00 83.06  ? 2097 ARG A CZ  1 
ATOM   3749 N  NH1 . ARG A 1 496 ? 22.996  -4.614  0.161   1.00 79.87  ? 2097 ARG A NH1 1 
ATOM   3750 N  NH2 . ARG A 1 496 ? 23.334  -2.691  -1.046  1.00 83.76  ? 2097 ARG A NH2 1 
ATOM   3751 N  N   . ASN A 1 497 ? 18.116  -0.497  -1.767  1.00 80.06  ? 2098 ASN A N   1 
ATOM   3752 C  CA  . ASN A 1 497 ? 18.455  0.843   -1.302  1.00 81.34  ? 2098 ASN A CA  1 
ATOM   3753 C  C   . ASN A 1 497 ? 17.294  1.825   -1.411  1.00 81.31  ? 2098 ASN A C   1 
ATOM   3754 O  O   . ASN A 1 497 ? 17.216  2.790   -0.651  1.00 83.96  ? 2098 ASN A O   1 
ATOM   3755 C  CB  . ASN A 1 497 ? 19.656  1.384   -2.079  1.00 82.88  ? 2098 ASN A CB  1 
ATOM   3756 C  CG  . ASN A 1 497 ? 20.909  0.556   -1.870  1.00 85.61  ? 2098 ASN A CG  1 
ATOM   3757 O  OD1 . ASN A 1 497 ? 20.838  -0.626  -1.534  1.00 85.60  ? 2098 ASN A OD1 1 
ATOM   3758 N  ND2 . ASN A 1 497 ? 22.066  1.175   -2.068  1.00 88.43  ? 2098 ASN A ND2 1 
ATOM   3759 N  N   . ALA A 1 498 ? 16.389  1.571   -2.351  1.00 81.14  ? 2099 ALA A N   1 
ATOM   3760 C  CA  . ALA A 1 498 ? 15.282  2.484   -2.621  1.00 81.70  ? 2099 ALA A CA  1 
ATOM   3761 C  C   . ALA A 1 498 ? 14.117  2.309   -1.649  1.00 84.43  ? 2099 ALA A C   1 
ATOM   3762 O  O   . ALA A 1 498 ? 13.602  3.288   -1.106  1.00 86.03  ? 2099 ALA A O   1 
ATOM   3763 C  CB  . ALA A 1 498 ? 14.793  2.303   -4.054  1.00 78.82  ? 2099 ALA A CB  1 
ATOM   3764 N  N   . TYR A 1 499 ? 13.703  1.064   -1.433  1.00 80.54  ? 2100 TYR A N   1 
ATOM   3765 C  CA  . TYR A 1 499 ? 12.470  0.791   -0.699  1.00 79.02  ? 2100 TYR A CA  1 
ATOM   3766 C  C   . TYR A 1 499 ? 12.676  0.101   0.647   1.00 75.81  ? 2100 TYR A C   1 
ATOM   3767 O  O   . TYR A 1 499 ? 11.822  0.193   1.526   1.00 71.75  ? 2100 TYR A O   1 
ATOM   3768 C  CB  . TYR A 1 499 ? 11.535  -0.068  -1.554  1.00 78.03  ? 2100 TYR A CB  1 
ATOM   3769 C  CG  . TYR A 1 499 ? 11.114  0.569   -2.859  1.00 78.65  ? 2100 TYR A CG  1 
ATOM   3770 C  CD1 . TYR A 1 499 ? 11.007  1.948   -2.982  1.00 82.12  ? 2100 TYR A CD1 1 
ATOM   3771 C  CD2 . TYR A 1 499 ? 10.821  -0.212  -3.968  1.00 75.79  ? 2100 TYR A CD2 1 
ATOM   3772 C  CE1 . TYR A 1 499 ? 10.620  2.531   -4.175  1.00 81.95  ? 2100 TYR A CE1 1 
ATOM   3773 C  CE2 . TYR A 1 499 ? 10.434  0.359   -5.164  1.00 78.83  ? 2100 TYR A CE2 1 
ATOM   3774 C  CZ  . TYR A 1 499 ? 10.335  1.732   -5.262  1.00 80.47  ? 2100 TYR A CZ  1 
ATOM   3775 O  OH  . TYR A 1 499 ? 9.950   2.310   -6.449  1.00 78.63  ? 2100 TYR A OH  1 
ATOM   3776 N  N   . ILE A 1 500 ? 13.794  -0.599  0.803   1.00 78.11  ? 2101 ILE A N   1 
ATOM   3777 C  CA  . ILE A 1 500 ? 14.000  -1.441  1.979   1.00 76.36  ? 2101 ILE A CA  1 
ATOM   3778 C  C   . ILE A 1 500 ? 15.028  -0.877  2.959   1.00 75.60  ? 2101 ILE A C   1 
ATOM   3779 O  O   . ILE A 1 500 ? 14.749  -0.750  4.151   1.00 74.95  ? 2101 ILE A O   1 
ATOM   3780 C  CB  . ILE A 1 500 ? 14.447  -2.863  1.576   1.00 79.04  ? 2101 ILE A CB  1 
ATOM   3781 C  CG1 . ILE A 1 500 ? 13.484  -3.462  0.549   1.00 71.19  ? 2101 ILE A CG1 1 
ATOM   3782 C  CG2 . ILE A 1 500 ? 14.551  -3.756  2.807   1.00 79.64  ? 2101 ILE A CG2 1 
ATOM   3783 C  CD1 . ILE A 1 500 ? 12.095  -3.700  1.090   1.00 70.66  ? 2101 ILE A CD1 1 
ATOM   3784 N  N   . GLN A 1 501 ? 16.212  -0.544  2.449   1.00 76.37  ? 2102 GLN A N   1 
ATOM   3785 C  CA  . GLN A 1 501 ? 17.333  -0.123  3.288   1.00 74.98  ? 2102 GLN A CA  1 
ATOM   3786 C  C   . GLN A 1 501 ? 17.010  1.117   4.117   1.00 74.62  ? 2102 GLN A C   1 
ATOM   3787 O  O   . GLN A 1 501 ? 17.551  1.299   5.203   1.00 74.74  ? 2102 GLN A O   1 
ATOM   3788 C  CB  . GLN A 1 501 ? 18.572  0.134   2.427   1.00 75.19  ? 2102 GLN A CB  1 
ATOM   3789 C  CG  . GLN A 1 501 ? 19.821  0.449   3.230   1.00 76.32  ? 2102 GLN A CG  1 
ATOM   3790 C  CD  . GLN A 1 501 ? 21.038  0.674   2.359   1.00 85.45  ? 2102 GLN A CD  1 
ATOM   3791 O  OE1 . GLN A 1 501 ? 21.077  0.250   1.203   1.00 85.75  ? 2102 GLN A OE1 1 
ATOM   3792 N  NE2 . GLN A 1 501 ? 22.042  1.345   2.910   1.00 87.96  ? 2102 GLN A NE2 1 
ATOM   3793 N  N   . LYS A 1 502 ? 16.126  1.962   3.600   1.00 76.88  ? 2103 LYS A N   1 
ATOM   3794 C  CA  . LYS A 1 502 ? 15.673  3.148   4.321   1.00 78.35  ? 2103 LYS A CA  1 
ATOM   3795 C  C   . LYS A 1 502 ? 15.067  2.773   5.678   1.00 78.45  ? 2103 LYS A C   1 
ATOM   3796 O  O   . LYS A 1 502 ? 15.245  3.483   6.669   1.00 75.77  ? 2103 LYS A O   1 
ATOM   3797 C  CB  . LYS A 1 502 ? 14.657  3.922   3.469   1.00 81.22  ? 2103 LYS A CB  1 
ATOM   3798 C  CG  . LYS A 1 502 ? 13.966  5.088   4.169   1.00 87.43  ? 2103 LYS A CG  1 
ATOM   3799 C  CD  . LYS A 1 502 ? 12.976  5.773   3.228   1.00 96.05  ? 2103 LYS A CD  1 
ATOM   3800 C  CE  . LYS A 1 502 ? 12.066  6.747   3.965   1.00 92.96  ? 2103 LYS A CE  1 
ATOM   3801 N  NZ  . LYS A 1 502 ? 12.825  7.791   4.709   1.00 88.39  ? 2103 LYS A NZ  1 
ATOM   3802 N  N   . TYR A 1 503 ? 14.375  1.638   5.720   1.00 77.04  ? 2104 TYR A N   1 
ATOM   3803 C  CA  . TYR A 1 503 ? 13.676  1.209   6.926   1.00 75.40  ? 2104 TYR A CA  1 
ATOM   3804 C  C   . TYR A 1 503 ? 14.538  0.360   7.862   1.00 74.00  ? 2104 TYR A C   1 
ATOM   3805 O  O   . TYR A 1 503 ? 14.458  0.505   9.079   1.00 77.06  ? 2104 TYR A O   1 
ATOM   3806 C  CB  . TYR A 1 503 ? 12.413  0.431   6.553   1.00 75.31  ? 2104 TYR A CB  1 
ATOM   3807 C  CG  . TYR A 1 503 ? 11.375  1.251   5.817   1.00 76.44  ? 2104 TYR A CG  1 
ATOM   3808 C  CD1 . TYR A 1 503 ? 10.400  1.960   6.509   1.00 76.28  ? 2104 TYR A CD1 1 
ATOM   3809 C  CD2 . TYR A 1 503 ? 11.365  1.310   4.430   1.00 74.64  ? 2104 TYR A CD2 1 
ATOM   3810 C  CE1 . TYR A 1 503 ? 9.448   2.708   5.839   1.00 75.01  ? 2104 TYR A CE1 1 
ATOM   3811 C  CE2 . TYR A 1 503 ? 10.416  2.055   3.750   1.00 71.62  ? 2104 TYR A CE2 1 
ATOM   3812 C  CZ  . TYR A 1 503 ? 9.460   2.751   4.459   1.00 71.03  ? 2104 TYR A CZ  1 
ATOM   3813 O  OH  . TYR A 1 503 ? 8.516   3.493   3.785   1.00 66.40  ? 2104 TYR A OH  1 
ATOM   3814 N  N   . LEU A 1 504 ? 15.357  -0.525  7.300   1.00 74.67  ? 2105 LEU A N   1 
ATOM   3815 C  CA  . LEU A 1 504 ? 16.138  -1.458  8.115   1.00 74.20  ? 2105 LEU A CA  1 
ATOM   3816 C  C   . LEU A 1 504 ? 17.616  -1.078  8.230   1.00 73.41  ? 2105 LEU A C   1 
ATOM   3817 O  O   . LEU A 1 504 ? 18.447  -1.912  8.596   1.00 67.98  ? 2105 LEU A O   1 
ATOM   3818 C  CB  . LEU A 1 504 ? 16.019  -2.876  7.550   1.00 70.90  ? 2105 LEU A CB  1 
ATOM   3819 C  CG  . LEU A 1 504 ? 14.612  -3.476  7.518   1.00 68.60  ? 2105 LEU A CG  1 
ATOM   3820 C  CD1 . LEU A 1 504 ? 14.644  -4.923  7.047   1.00 65.42  ? 2105 LEU A CD1 1 
ATOM   3821 C  CD2 . LEU A 1 504 ? 13.958  -3.367  8.885   1.00 73.18  ? 2105 LEU A CD2 1 
ATOM   3822 N  N   . GLU A 1 505 ? 17.933  0.180   7.930   1.00 76.26  ? 276  GLU A N   1 
ATOM   3823 C  CA  . GLU A 1 505 ? 19.312  0.671   7.953   1.00 76.05  ? 276  GLU A CA  1 
ATOM   3824 C  C   . GLU A 1 505 ? 19.964  0.481   9.322   1.00 77.62  ? 276  GLU A C   1 
ATOM   3825 O  O   . GLU A 1 505 ? 21.059  -0.074  9.426   1.00 78.21  ? 276  GLU A O   1 
ATOM   3826 C  CB  . GLU A 1 505 ? 19.355  2.150   7.549   1.00 77.97  ? 276  GLU A CB  1 
ATOM   3827 C  CG  . GLU A 1 505 ? 20.711  2.827   7.697   1.00 82.36  ? 276  GLU A CG  1 
ATOM   3828 C  CD  . GLU A 1 505 ? 21.756  2.304   6.728   1.00 88.43  ? 276  GLU A CD  1 
ATOM   3829 O  OE1 . GLU A 1 505 ? 22.961  2.498   6.999   1.00 101.21 ? 276  GLU A OE1 1 
ATOM   3830 O  OE2 . GLU A 1 505 ? 21.380  1.707   5.698   1.00 85.53  ? 276  GLU A OE2 1 
ATOM   3831 N  N   . ASN A 1 506 ? 19.282  0.930   10.370  1.00 78.50  ? 277  ASN A N   1 
ATOM   3832 C  CA  . ASN A 1 506 ? 19.809  0.841   11.726  1.00 75.56  ? 277  ASN A CA  1 
ATOM   3833 C  C   . ASN A 1 506 ? 18.922  0.011   12.646  1.00 73.46  ? 277  ASN A C   1 
ATOM   3834 O  O   . ASN A 1 506 ? 18.419  0.505   13.656  1.00 72.41  ? 277  ASN A O   1 
ATOM   3835 C  CB  . ASN A 1 506 ? 19.991  2.239   12.300  1.00 75.70  ? 277  ASN A CB  1 
ATOM   3836 C  CG  . ASN A 1 506 ? 18.863  3.169   11.915  1.00 78.90  ? 277  ASN A CG  1 
ATOM   3837 O  OD1 . ASN A 1 506 ? 17.746  2.728   11.637  1.00 80.72  ? 277  ASN A OD1 1 
ATOM   3838 N  ND2 . ASN A 1 506 ? 19.149  4.464   11.885  1.00 84.80  ? 277  ASN A ND2 1 
ATOM   3839 N  N   . SER A 1 507 ? 18.732  -1.253  12.286  1.00 74.81  ? 278  SER A N   1 
ATOM   3840 C  CA  . SER A 1 507 ? 17.965  -2.177  13.112  1.00 73.85  ? 278  SER A CA  1 
ATOM   3841 C  C   . SER A 1 507 ? 18.903  -2.977  14.004  1.00 68.46  ? 278  SER A C   1 
ATOM   3842 O  O   . SER A 1 507 ? 18.504  -3.480  15.052  1.00 65.78  ? 278  SER A O   1 
ATOM   3843 C  CB  . SER A 1 507 ? 17.124  -3.117  12.241  1.00 74.84  ? 278  SER A CB  1 
ATOM   3844 O  OG  . SER A 1 507 ? 17.951  -3.952  11.446  1.00 78.22  ? 278  SER A OG  1 
ATOM   3845 N  N   . GLU A 1 508 ? 20.158  -3.081  13.583  1.00 71.51  ? 279  GLU A N   1 
ATOM   3846 C  CA  . GLU A 1 508 ? 21.161  -3.792  14.363  1.00 70.46  ? 279  GLU A CA  1 
ATOM   3847 C  C   . GLU A 1 508 ? 21.665  -2.895  15.490  1.00 68.57  ? 279  GLU A C   1 
ATOM   3848 O  O   . GLU A 1 508 ? 22.080  -3.373  16.546  1.00 65.25  ? 279  GLU A O   1 
ATOM   3849 C  CB  . GLU A 1 508 ? 22.314  -4.250  13.468  1.00 72.84  ? 279  GLU A CB  1 
ATOM   3850 C  CG  . GLU A 1 508 ? 23.272  -5.223  14.125  1.00 73.56  ? 279  GLU A CG  1 
ATOM   3851 C  CD  . GLU A 1 508 ? 24.439  -4.529  14.789  1.00 81.22  ? 279  GLU A CD  1 
ATOM   3852 O  OE1 . GLU A 1 508 ? 24.661  -3.335  14.501  1.00 89.81  ? 279  GLU A OE1 1 
ATOM   3853 O  OE2 . GLU A 1 508 ? 25.132  -5.179  15.599  1.00 88.84  ? 279  GLU A OE2 1 
ATOM   3854 N  N   . LYS A 1 509 ? 21.612  -1.588  15.258  1.00 68.52  ? 280  LYS A N   1 
ATOM   3855 C  CA  . LYS A 1 509 ? 21.957  -0.610  16.282  1.00 66.55  ? 280  LYS A CA  1 
ATOM   3856 C  C   . LYS A 1 509 ? 20.860  -0.555  17.344  1.00 64.69  ? 280  LYS A C   1 
ATOM   3857 O  O   . LYS A 1 509 ? 21.130  -0.291  18.516  1.00 60.76  ? 280  LYS A O   1 
ATOM   3858 C  CB  . LYS A 1 509 ? 22.174  0.771   15.652  1.00 67.57  ? 280  LYS A CB  1 
ATOM   3859 C  CG  . LYS A 1 509 ? 22.634  1.851   16.619  1.00 71.09  ? 280  LYS A CG  1 
ATOM   3860 C  CD  . LYS A 1 509 ? 23.127  3.087   15.873  1.00 76.06  ? 280  LYS A CD  1 
ATOM   3861 C  CE  . LYS A 1 509 ? 22.046  3.671   14.976  1.00 77.76  ? 280  LYS A CE  1 
ATOM   3862 N  NZ  . LYS A 1 509 ? 20.871  4.161   15.752  1.00 74.06  ? 280  LYS A NZ  1 
ATOM   3863 N  N   . LYS A 1 510 ? 19.625  -0.821  16.927  1.00 64.73  ? 281  LYS A N   1 
ATOM   3864 C  CA  . LYS A 1 510 ? 18.480  -0.817  17.835  1.00 62.80  ? 281  LYS A CA  1 
ATOM   3865 C  C   . LYS A 1 510 ? 18.484  -2.046  18.738  1.00 61.27  ? 281  LYS A C   1 
ATOM   3866 O  O   . LYS A 1 510 ? 18.065  -1.983  19.897  1.00 59.29  ? 281  LYS A O   1 
ATOM   3867 C  CB  . LYS A 1 510 ? 17.167  -0.750  17.048  1.00 67.02  ? 281  LYS A CB  1 
ATOM   3868 C  CG  . LYS A 1 510 ? 15.924  -0.744  17.925  1.00 63.98  ? 281  LYS A CG  1 
ATOM   3869 C  CD  . LYS A 1 510 ? 14.643  -0.693  17.111  1.00 71.59  ? 281  LYS A CD  1 
ATOM   3870 C  CE  . LYS A 1 510 ? 13.420  -0.698  18.019  1.00 80.84  ? 281  LYS A CE  1 
ATOM   3871 N  NZ  . LYS A 1 510 ? 13.452  0.419   19.008  1.00 76.55  ? 281  LYS A NZ  1 
ATOM   3872 N  N   . ARG A 1 511 ? 18.953  -3.165  18.198  1.00 61.74  ? 282  ARG A N   1 
ATOM   3873 C  CA  . ARG A 1 511 ? 19.110  -4.384  18.979  1.00 60.36  ? 282  ARG A CA  1 
ATOM   3874 C  C   . ARG A 1 511 ? 20.136  -4.198  20.099  1.00 59.28  ? 282  ARG A C   1 
ATOM   3875 O  O   . ARG A 1 511 ? 19.938  -4.675  21.217  1.00 57.58  ? 282  ARG A O   1 
ATOM   3876 C  CB  . ARG A 1 511 ? 19.523  -5.548  18.077  1.00 56.74  ? 282  ARG A CB  1 
ATOM   3877 C  CG  . ARG A 1 511 ? 20.116  -6.721  18.834  1.00 58.37  ? 282  ARG A CG  1 
ATOM   3878 C  CD  . ARG A 1 511 ? 20.775  -7.697  17.889  1.00 62.96  ? 282  ARG A CD  1 
ATOM   3879 N  NE  . ARG A 1 511 ? 21.883  -8.415  18.515  1.00 62.73  ? 282  ARG A NE  1 
ATOM   3880 C  CZ  . ARG A 1 511 ? 23.161  -8.071  18.392  1.00 61.32  ? 282  ARG A CZ  1 
ATOM   3881 N  NH1 . ARG A 1 511 ? 23.502  -7.016  17.663  1.00 59.83  ? 282  ARG A NH1 1 
ATOM   3882 N  NH2 . ARG A 1 511 ? 24.101  -8.783  18.997  1.00 63.85  ? 282  ARG A NH2 1 
ATOM   3883 N  N   . LYS A 1 512 ? 21.229  -3.503  19.794  1.00 58.97  ? 283  LYS A N   1 
ATOM   3884 C  CA  . LYS A 1 512 ? 22.291  -3.283  20.772  1.00 58.01  ? 283  LYS A CA  1 
ATOM   3885 C  C   . LYS A 1 512 ? 21.818  -2.406  21.932  1.00 56.78  ? 283  LYS A C   1 
ATOM   3886 O  O   . LYS A 1 512 ? 22.230  -2.607  23.074  1.00 50.87  ? 283  LYS A O   1 
ATOM   3887 C  CB  . LYS A 1 512 ? 23.521  -2.657  20.106  1.00 59.39  ? 283  LYS A CB  1 
ATOM   3888 C  CG  . LYS A 1 512 ? 24.283  -3.598  19.185  1.00 65.51  ? 283  LYS A CG  1 
ATOM   3889 C  CD  . LYS A 1 512 ? 25.615  -2.999  18.742  1.00 75.24  ? 283  LYS A CD  1 
ATOM   3890 C  CE  . LYS A 1 512 ? 26.576  -2.837  19.915  1.00 84.93  ? 283  LYS A CE  1 
ATOM   3891 N  NZ  . LYS A 1 512 ? 27.905  -2.307  19.490  1.00 85.31  ? 283  LYS A NZ  1 
ATOM   3892 N  N   . ARG A 1 513 ? 20.952  -1.440  21.632  1.00 56.72  ? 284  ARG A N   1 
ATOM   3893 C  CA  . ARG A 1 513 ? 20.404  -0.550  22.654  1.00 51.01  ? 284  ARG A CA  1 
ATOM   3894 C  C   . ARG A 1 513 ? 19.470  -1.296  23.606  1.00 49.68  ? 284  ARG A C   1 
ATOM   3895 O  O   . ARG A 1 513 ? 19.412  -0.992  24.795  1.00 52.03  ? 284  ARG A O   1 
ATOM   3896 C  CB  . ARG A 1 513 ? 19.657  0.620   22.008  1.00 51.07  ? 284  ARG A CB  1 
ATOM   3897 C  CG  . ARG A 1 513 ? 20.551  1.676   21.380  1.00 52.58  ? 284  ARG A CG  1 
ATOM   3898 C  CD  . ARG A 1 513 ? 19.737  2.659   20.547  1.00 63.53  ? 284  ARG A CD  1 
ATOM   3899 N  NE  . ARG A 1 513 ? 20.581  3.643   19.873  1.00 71.82  ? 284  ARG A NE  1 
ATOM   3900 C  CZ  . ARG A 1 513 ? 20.123  4.604   19.075  1.00 74.80  ? 284  ARG A CZ  1 
ATOM   3901 N  NH1 . ARG A 1 513 ? 18.822  4.717   18.844  1.00 72.01  ? 284  ARG A NH1 1 
ATOM   3902 N  NH2 . ARG A 1 513 ? 20.968  5.454   18.506  1.00 79.88  ? 284  ARG A NH2 1 
ATOM   3903 N  N   . ALA A 1 514 ? 18.736  -2.269  23.077  1.00 50.77  ? 285  ALA A N   1 
ATOM   3904 C  CA  . ALA A 1 514 ? 17.806  -3.044  23.887  1.00 48.86  ? 285  ALA A CA  1 
ATOM   3905 C  C   . ALA A 1 514 ? 18.561  -3.929  24.865  1.00 48.88  ? 285  ALA A C   1 
ATOM   3906 O  O   . ALA A 1 514 ? 18.163  -4.077  26.019  1.00 48.51  ? 285  ALA A O   1 
ATOM   3907 C  CB  . ALA A 1 514 ? 16.898  -3.883  23.003  1.00 52.43  ? 285  ALA A CB  1 
ATOM   3908 N  N   . ILE A 1 515 ? 19.656  -4.513  24.393  1.00 50.36  ? 286  ILE A N   1 
ATOM   3909 C  CA  . ILE A 1 515 ? 20.481  -5.375  25.226  1.00 49.71  ? 286  ILE A CA  1 
ATOM   3910 C  C   . ILE A 1 515 ? 21.106  -4.586  26.376  1.00 48.44  ? 286  ILE A C   1 
ATOM   3911 O  O   . ILE A 1 515 ? 21.018  -4.996  27.533  1.00 48.74  ? 286  ILE A O   1 
ATOM   3912 C  CB  . ILE A 1 515 ? 21.583  -6.063  24.397  1.00 49.77  ? 286  ILE A CB  1 
ATOM   3913 C  CG1 . ILE A 1 515 ? 20.950  -7.037  23.400  1.00 48.47  ? 286  ILE A CG1 1 
ATOM   3914 C  CG2 . ILE A 1 515 ? 22.574  -6.787  25.305  1.00 41.51  ? 286  ILE A CG2 1 
ATOM   3915 C  CD1 . ILE A 1 515 ? 21.948  -7.877  22.636  1.00 48.46  ? 286  ILE A CD1 1 
ATOM   3916 N  N   . LYS A 1 516 ? 21.721  -3.450  26.056  1.00 46.96  ? 287  LYS A N   1 
ATOM   3917 C  CA  . LYS A 1 516 ? 22.300  -2.577  27.071  1.00 48.80  ? 287  LYS A CA  1 
ATOM   3918 C  C   . LYS A 1 516 ? 21.233  -2.125  28.068  1.00 50.02  ? 287  LYS A C   1 
ATOM   3919 O  O   . LYS A 1 516 ? 21.511  -1.959  29.255  1.00 45.80  ? 287  LYS A O   1 
ATOM   3920 C  CB  . LYS A 1 516 ? 22.968  -1.361  26.423  1.00 49.24  ? 287  LYS A CB  1 
ATOM   3921 C  CG  . LYS A 1 516 ? 24.200  -1.687  25.589  1.00 46.25  ? 287  LYS A CG  1 
ATOM   3922 C  CD  . LYS A 1 516 ? 24.691  -0.456  24.842  1.00 53.87  ? 287  LYS A CD  1 
ATOM   3923 C  CE  . LYS A 1 516 ? 25.761  -0.808  23.820  1.00 74.77  ? 287  LYS A CE  1 
ATOM   3924 N  NZ  . LYS A 1 516 ? 26.196  0.385   23.040  1.00 80.35  ? 287  LYS A NZ  1 
ATOM   3925 N  N   . LEU A 1 517 ? 20.013  -1.935  27.576  1.00 48.81  ? 288  LEU A N   1 
ATOM   3926 C  CA  . LEU A 1 517 ? 18.885  -1.580  28.428  1.00 49.17  ? 288  LEU A CA  1 
ATOM   3927 C  C   . LEU A 1 517 ? 18.556  -2.728  29.380  1.00 46.68  ? 288  LEU A C   1 
ATOM   3928 O  O   . LEU A 1 517 ? 18.322  -2.510  30.566  1.00 49.27  ? 288  LEU A O   1 
ATOM   3929 C  CB  . LEU A 1 517 ? 17.663  -1.220  27.581  1.00 47.28  ? 288  LEU A CB  1 
ATOM   3930 C  CG  . LEU A 1 517 ? 16.382  -0.821  28.313  1.00 48.50  ? 288  LEU A CG  1 
ATOM   3931 C  CD1 . LEU A 1 517 ? 16.602  0.420   29.168  1.00 49.55  ? 288  LEU A CD1 1 
ATOM   3932 C  CD2 . LEU A 1 517 ? 15.257  -0.594  27.315  1.00 50.88  ? 288  LEU A CD2 1 
ATOM   3933 N  N   . ALA A 1 518 ? 18.552  -3.949  28.854  1.00 46.76  ? 289  ALA A N   1 
ATOM   3934 C  CA  . ALA A 1 518 ? 18.334  -5.142  29.667  1.00 44.73  ? 289  ALA A CA  1 
ATOM   3935 C  C   . ALA A 1 518 ? 19.433  -5.312  30.707  1.00 46.26  ? 289  ALA A C   1 
ATOM   3936 O  O   . ALA A 1 518 ? 19.179  -5.774  31.818  1.00 46.33  ? 289  ALA A O   1 
ATOM   3937 C  CB  . ALA A 1 518 ? 18.253  -6.376  28.787  1.00 44.59  ? 289  ALA A CB  1 
ATOM   3938 N  N   . VAL A 1 519 ? 20.658  -4.948  30.347  1.00 47.33  ? 290  VAL A N   1 
ATOM   3939 C  CA  . VAL A 1 519 ? 21.758  -5.031  31.297  1.00 46.28  ? 290  VAL A CA  1 
ATOM   3940 C  C   . VAL A 1 519 ? 21.576  -3.969  32.376  1.00 46.65  ? 290  VAL A C   1 
ATOM   3941 O  O   . VAL A 1 519 ? 21.706  -4.252  33.567  1.00 46.30  ? 290  VAL A O   1 
ATOM   3942 C  CB  . VAL A 1 519 ? 23.127  -4.856  30.616  1.00 45.96  ? 290  VAL A CB  1 
ATOM   3943 C  CG1 . VAL A 1 519 ? 24.246  -4.950  31.648  1.00 40.52  ? 290  VAL A CG1 1 
ATOM   3944 C  CG2 . VAL A 1 519 ? 23.318  -5.909  29.538  1.00 46.66  ? 290  VAL A CG2 1 
ATOM   3945 N  N   . THR A 1 520 ? 21.258  -2.753  31.944  1.00 48.50  ? 291  THR A N   1 
ATOM   3946 C  CA  . THR A 1 520 ? 21.026  -1.631  32.845  1.00 45.03  ? 291  THR A CA  1 
ATOM   3947 C  C   . THR A 1 520 ? 19.974  -1.958  33.893  1.00 48.46  ? 291  THR A C   1 
ATOM   3948 O  O   . THR A 1 520 ? 20.174  -1.717  35.085  1.00 52.86  ? 291  THR A O   1 
ATOM   3949 C  CB  . THR A 1 520 ? 20.574  -0.380  32.072  1.00 45.25  ? 291  THR A CB  1 
ATOM   3950 O  OG1 . THR A 1 520 ? 21.532  -0.072  31.052  1.00 48.79  ? 291  THR A OG1 1 
ATOM   3951 C  CG2 . THR A 1 520 ? 20.441  0.805   33.007  1.00 46.94  ? 291  THR A CG2 1 
ATOM   3952 N  N   . VAL A 1 521 ? 18.856  -2.515  33.439  1.00 46.86  ? 292  VAL A N   1 
ATOM   3953 C  CA  . VAL A 1 521 ? 17.737  -2.832  34.320  1.00 48.00  ? 292  VAL A CA  1 
ATOM   3954 C  C   . VAL A 1 521 ? 18.092  -3.958  35.289  1.00 46.80  ? 292  VAL A C   1 
ATOM   3955 O  O   . VAL A 1 521 ? 17.779  -3.886  36.479  1.00 49.94  ? 292  VAL A O   1 
ATOM   3956 C  CB  . VAL A 1 521 ? 16.485  -3.216  33.506  1.00 44.30  ? 292  VAL A CB  1 
ATOM   3957 C  CG1 . VAL A 1 521 ? 15.385  -3.742  34.421  1.00 47.23  ? 292  VAL A CG1 1 
ATOM   3958 C  CG2 . VAL A 1 521 ? 15.995  -2.018  32.708  1.00 39.69  ? 292  VAL A CG2 1 
ATOM   3959 N  N   . ALA A 1 522 ? 18.756  -4.987  34.773  1.00 42.50  ? 293  ALA A N   1 
ATOM   3960 C  CA  . ALA A 1 522 ? 19.189  -6.118  35.582  1.00 42.98  ? 293  ALA A CA  1 
ATOM   3961 C  C   . ALA A 1 522 ? 20.103  -5.676  36.726  1.00 50.71  ? 293  ALA A C   1 
ATOM   3962 O  O   . ALA A 1 522 ? 19.998  -6.175  37.848  1.00 48.97  ? 293  ALA A O   1 
ATOM   3963 C  CB  . ALA A 1 522 ? 19.892  -7.141  34.712  1.00 42.81  ? 293  ALA A CB  1 
ATOM   3964 N  N   . ALA A 1 523 ? 21.000  -4.739  36.436  1.00 48.42  ? 294  ALA A N   1 
ATOM   3965 C  CA  . ALA A 1 523 ? 21.911  -4.229  37.451  1.00 46.81  ? 294  ALA A CA  1 
ATOM   3966 C  C   . ALA A 1 523 ? 21.128  -3.475  38.515  1.00 51.58  ? 294  ALA A C   1 
ATOM   3967 O  O   . ALA A 1 523 ? 21.433  -3.556  39.707  1.00 50.83  ? 294  ALA A O   1 
ATOM   3968 C  CB  . ALA A 1 523 ? 22.966  -3.330  36.824  1.00 46.10  ? 294  ALA A CB  1 
ATOM   3969 N  N   . MET A 1 524 ? 20.109  -2.749  38.074  1.00 50.10  ? 295  MET A N   1 
ATOM   3970 C  CA  . MET A 1 524 ? 19.273  -1.982  38.981  1.00 50.05  ? 295  MET A CA  1 
ATOM   3971 C  C   . MET A 1 524 ? 18.510  -2.915  39.911  1.00 49.63  ? 295  MET A C   1 
ATOM   3972 O  O   . MET A 1 524 ? 18.311  -2.610  41.084  1.00 49.74  ? 295  MET A O   1 
ATOM   3973 C  CB  . MET A 1 524 ? 18.308  -1.097  38.197  1.00 50.62  ? 295  MET A CB  1 
ATOM   3974 C  CG  . MET A 1 524 ? 17.595  -0.072  39.044  1.00 51.27  ? 295  MET A CG  1 
ATOM   3975 S  SD  . MET A 1 524 ? 16.442  0.906   38.070  1.00 67.84  ? 295  MET A SD  1 
ATOM   3976 C  CE  . MET A 1 524 ? 17.549  1.650   36.883  1.00 52.35  ? 295  MET A CE  1 
ATOM   3977 N  N   . TYR A 1 525 ? 18.090  -4.061  39.386  1.00 47.60  ? 296  TYR A N   1 
ATOM   3978 C  CA  . TYR A 1 525 ? 17.414  -5.055  40.209  1.00 49.90  ? 296  TYR A CA  1 
ATOM   3979 C  C   . TYR A 1 525 ? 18.398  -5.740  41.146  1.00 51.59  ? 296  TYR A C   1 
ATOM   3980 O  O   . TYR A 1 525 ? 18.091  -5.990  42.309  1.00 50.99  ? 296  TYR A O   1 
ATOM   3981 C  CB  . TYR A 1 525 ? 16.704  -6.091  39.333  1.00 49.59  ? 296  TYR A CB  1 
ATOM   3982 C  CG  . TYR A 1 525 ? 15.294  -5.688  38.959  1.00 52.38  ? 296  TYR A CG  1 
ATOM   3983 C  CD1 . TYR A 1 525 ? 15.063  -4.703  38.008  1.00 50.60  ? 296  TYR A CD1 1 
ATOM   3984 C  CD2 . TYR A 1 525 ? 14.196  -6.286  39.565  1.00 49.71  ? 296  TYR A CD2 1 
ATOM   3985 C  CE1 . TYR A 1 525 ? 13.781  -4.325  37.669  1.00 50.60  ? 296  TYR A CE1 1 
ATOM   3986 C  CE2 . TYR A 1 525 ? 12.907  -5.915  39.230  1.00 47.60  ? 296  TYR A CE2 1 
ATOM   3987 C  CZ  . TYR A 1 525 ? 12.705  -4.934  38.281  1.00 51.55  ? 296  TYR A CZ  1 
ATOM   3988 O  OH  . TYR A 1 525 ? 11.422  -4.559  37.941  1.00 53.65  ? 296  TYR A OH  1 
ATOM   3989 N  N   . LEU A 1 526 ? 19.589  -6.024  40.630  1.00 55.76  ? 297  LEU A N   1 
ATOM   3990 C  CA  . LEU A 1 526 ? 20.607  -6.760  41.372  1.00 50.68  ? 297  LEU A CA  1 
ATOM   3991 C  C   . LEU A 1 526 ? 21.191  -5.937  42.517  1.00 51.64  ? 297  LEU A C   1 
ATOM   3992 O  O   . LEU A 1 526 ? 21.610  -6.483  43.539  1.00 56.21  ? 297  LEU A O   1 
ATOM   3993 C  CB  . LEU A 1 526 ? 21.722  -7.211  40.419  1.00 49.02  ? 297  LEU A CB  1 
ATOM   3994 C  CG  . LEU A 1 526 ? 22.878  -8.046  40.973  1.00 53.21  ? 297  LEU A CG  1 
ATOM   3995 C  CD1 . LEU A 1 526 ? 23.134  -9.245  40.080  1.00 65.21  ? 297  LEU A CD1 1 
ATOM   3996 C  CD2 . LEU A 1 526 ? 24.139  -7.205  41.104  1.00 53.06  ? 297  LEU A CD2 1 
ATOM   3997 N  N   . ILE A 1 527 ? 21.205  -4.622  42.350  1.00 50.06  ? 298  ILE A N   1 
ATOM   3998 C  CA  . ILE A 1 527 ? 21.827  -3.744  43.332  1.00 48.45  ? 298  ILE A CA  1 
ATOM   3999 C  C   . ILE A 1 527 ? 20.801  -3.021  44.201  1.00 51.44  ? 298  ILE A C   1 
ATOM   4000 O  O   . ILE A 1 527 ? 20.957  -2.951  45.421  1.00 52.07  ? 298  ILE A O   1 
ATOM   4001 C  CB  . ILE A 1 527 ? 22.727  -2.700  42.642  1.00 48.04  ? 298  ILE A CB  1 
ATOM   4002 C  CG1 . ILE A 1 527 ? 23.807  -3.399  41.812  1.00 47.19  ? 298  ILE A CG1 1 
ATOM   4003 C  CG2 . ILE A 1 527 ? 23.352  -1.766  43.667  1.00 44.80  ? 298  ILE A CG2 1 
ATOM   4004 C  CD1 . ILE A 1 527 ? 24.696  -2.451  41.030  1.00 39.28  ? 298  ILE A CD1 1 
ATOM   4005 N  N   . CYS A 1 528 ? 19.745  -2.503  43.578  1.00 46.65  ? 299  CYS A N   1 
ATOM   4006 C  CA  . CYS A 1 528 ? 18.835  -1.590  44.266  1.00 45.10  ? 299  CYS A CA  1 
ATOM   4007 C  C   . CYS A 1 528 ? 17.544  -2.227  44.774  1.00 46.10  ? 299  CYS A C   1 
ATOM   4008 O  O   . CYS A 1 528 ? 17.015  -1.816  45.804  1.00 52.07  ? 299  CYS A O   1 
ATOM   4009 C  CB  . CYS A 1 528 ? 18.479  -0.422  43.346  1.00 46.72  ? 299  CYS A CB  1 
ATOM   4010 S  SG  . CYS A 1 528 ? 19.902  0.390   42.598  1.00 47.69  ? 299  CYS A SG  1 
ATOM   4011 N  N   . PHE A 1 529 ? 17.029  -3.219  44.057  1.00 49.44  ? 300  PHE A N   1 
ATOM   4012 C  CA  . PHE A 1 529 ? 15.708  -3.759  44.368  1.00 47.15  ? 300  PHE A CA  1 
ATOM   4013 C  C   . PHE A 1 529 ? 15.774  -5.066  45.156  1.00 48.76  ? 300  PHE A C   1 
ATOM   4014 O  O   . PHE A 1 529 ? 15.118  -5.205  46.191  1.00 49.09  ? 300  PHE A O   1 
ATOM   4015 C  CB  . PHE A 1 529 ? 14.907  -3.983  43.083  1.00 46.71  ? 300  PHE A CB  1 
ATOM   4016 C  CG  . PHE A 1 529 ? 14.690  -2.738  42.265  1.00 45.75  ? 300  PHE A CG  1 
ATOM   4017 C  CD1 . PHE A 1 529 ? 14.586  -1.497  42.869  1.00 45.44  ? 300  PHE A CD1 1 
ATOM   4018 C  CD2 . PHE A 1 529 ? 14.579  -2.816  40.884  1.00 48.91  ? 300  PHE A CD2 1 
ATOM   4019 C  CE1 . PHE A 1 529 ? 14.377  -0.356  42.110  1.00 45.41  ? 300  PHE A CE1 1 
ATOM   4020 C  CE2 . PHE A 1 529 ? 14.373  -1.682  40.122  1.00 48.10  ? 300  PHE A CE2 1 
ATOM   4021 C  CZ  . PHE A 1 529 ? 14.272  -0.451  40.735  1.00 48.31  ? 300  PHE A CZ  1 
ATOM   4022 N  N   . THR A 1 530 ? 16.557  -6.022  44.663  1.00 45.27  ? 301  THR A N   1 
ATOM   4023 C  CA  . THR A 1 530 ? 16.643  -7.340  45.295  1.00 49.09  ? 301  THR A CA  1 
ATOM   4024 C  C   . THR A 1 530 ? 17.283  -7.333  46.692  1.00 49.82  ? 301  THR A C   1 
ATOM   4025 O  O   . THR A 1 530 ? 16.764  -7.982  47.599  1.00 50.43  ? 301  THR A O   1 
ATOM   4026 C  CB  . THR A 1 530 ? 17.416  -8.342  44.412  1.00 46.57  ? 301  THR A CB  1 
ATOM   4027 O  OG1 . THR A 1 530 ? 16.869  -8.329  43.092  1.00 49.93  ? 301  THR A OG1 1 
ATOM   4028 C  CG2 . THR A 1 530 ? 17.307  -9.748  44.977  1.00 43.35  ? 301  THR A CG2 1 
ATOM   4029 N  N   . PRO A 1 531 ? 18.411  -6.618  46.878  1.00 47.27  ? 302  PRO A N   1 
ATOM   4030 C  CA  . PRO A 1 531 ? 18.953  -6.644  48.241  1.00 48.18  ? 302  PRO A CA  1 
ATOM   4031 C  C   . PRO A 1 531 ? 18.023  -5.982  49.252  1.00 50.82  ? 302  PRO A C   1 
ATOM   4032 O  O   . PRO A 1 531 ? 17.987  -6.387  50.411  1.00 51.78  ? 302  PRO A O   1 
ATOM   4033 C  CB  . PRO A 1 531 ? 20.260  -5.854  48.117  1.00 50.50  ? 302  PRO A CB  1 
ATOM   4034 C  CG  . PRO A 1 531 ? 20.600  -5.895  46.663  1.00 51.05  ? 302  PRO A CG  1 
ATOM   4035 C  CD  . PRO A 1 531 ? 19.286  -5.863  45.963  1.00 48.44  ? 302  PRO A CD  1 
ATOM   4036 N  N   . SER A 1 532 ? 17.271  -4.983  48.805  1.00 49.95  ? 303  SER A N   1 
ATOM   4037 C  CA  . SER A 1 532 ? 16.400  -4.228  49.696  1.00 49.48  ? 303  SER A CA  1 
ATOM   4038 C  C   . SER A 1 532 ? 15.163  -5.017  50.110  1.00 52.61  ? 303  SER A C   1 
ATOM   4039 O  O   . SER A 1 532 ? 14.904  -5.194  51.298  1.00 53.09  ? 303  SER A O   1 
ATOM   4040 C  CB  . SER A 1 532 ? 15.979  -2.917  49.035  1.00 52.34  ? 303  SER A CB  1 
ATOM   4041 O  OG  . SER A 1 532 ? 17.115  -2.161  48.662  1.00 57.56  ? 303  SER A OG  1 
ATOM   4042 N  N   . ASN A 1 533 ? 14.397  -5.484  49.129  1.00 52.92  ? 304  ASN A N   1 
ATOM   4043 C  CA  . ASN A 1 533 ? 13.143  -6.175  49.407  1.00 49.58  ? 304  ASN A CA  1 
ATOM   4044 C  C   . ASN A 1 533 ? 13.352  -7.502  50.123  1.00 52.57  ? 304  ASN A C   1 
ATOM   4045 O  O   . ASN A 1 533 ? 12.567  -7.877  50.993  1.00 54.70  ? 304  ASN A O   1 
ATOM   4046 C  CB  . ASN A 1 533 ? 12.362  -6.397  48.112  1.00 47.16  ? 304  ASN A CB  1 
ATOM   4047 C  CG  . ASN A 1 533 ? 11.718  -5.124  47.599  1.00 50.17  ? 304  ASN A CG  1 
ATOM   4048 O  OD1 . ASN A 1 533 ? 10.525  -4.897  47.798  1.00 53.82  ? 304  ASN A OD1 1 
ATOM   4049 N  ND2 . ASN A 1 533 ? 12.508  -4.280  46.945  1.00 49.05  ? 304  ASN A ND2 1 
ATOM   4050 N  N   . LEU A 1 534 ? 14.416  -8.206  49.755  1.00 52.67  ? 305  LEU A N   1 
ATOM   4051 C  CA  . LEU A 1 534 ? 14.752  -9.468  50.400  1.00 54.25  ? 305  LEU A CA  1 
ATOM   4052 C  C   . LEU A 1 534 ? 15.069  -9.259  51.876  1.00 55.31  ? 305  LEU A C   1 
ATOM   4053 O  O   . LEU A 1 534 ? 14.525  -9.945  52.739  1.00 56.40  ? 305  LEU A O   1 
ATOM   4054 C  CB  . LEU A 1 534 ? 15.935  -10.131 49.696  1.00 59.87  ? 305  LEU A CB  1 
ATOM   4055 C  CG  . LEU A 1 534 ? 16.526  -11.376 50.357  1.00 73.43  ? 305  LEU A CG  1 
ATOM   4056 C  CD1 . LEU A 1 534 ? 15.505  -12.504 50.398  1.00 74.24  ? 305  LEU A CD1 1 
ATOM   4057 C  CD2 . LEU A 1 534 ? 17.793  -11.813 49.635  1.00 67.09  ? 305  LEU A CD2 1 
ATOM   4058 N  N   . LEU A 1 535 ? 15.946  -8.301  52.161  1.00 54.59  ? 306  LEU A N   1 
ATOM   4059 C  CA  . LEU A 1 535 ? 16.369  -8.035  53.531  1.00 54.14  ? 306  LEU A CA  1 
ATOM   4060 C  C   . LEU A 1 535 ? 15.276  -7.371  54.368  1.00 53.62  ? 306  LEU A C   1 
ATOM   4061 O  O   . LEU A 1 535 ? 15.214  -7.575  55.580  1.00 52.09  ? 306  LEU A O   1 
ATOM   4062 C  CB  . LEU A 1 535 ? 17.630  -7.170  53.538  1.00 51.29  ? 306  LEU A CB  1 
ATOM   4063 C  CG  . LEU A 1 535 ? 18.930  -7.932  53.279  1.00 49.50  ? 306  LEU A CG  1 
ATOM   4064 C  CD1 . LEU A 1 535 ? 20.112  -6.982  53.158  1.00 45.92  ? 306  LEU A CD1 1 
ATOM   4065 C  CD2 . LEU A 1 535 ? 19.167  -8.950  54.386  1.00 50.67  ? 306  LEU A CD2 1 
ATOM   4066 N  N   . LEU A 1 536 ? 14.422  -6.579  53.724  1.00 53.19  ? 307  LEU A N   1 
ATOM   4067 C  CA  . LEU A 1 536 ? 13.299  -5.953  54.416  1.00 51.02  ? 307  LEU A CA  1 
ATOM   4068 C  C   . LEU A 1 536 ? 12.430  -7.018  55.068  1.00 51.78  ? 307  LEU A C   1 
ATOM   4069 O  O   . LEU A 1 536 ? 11.951  -6.845  56.186  1.00 54.56  ? 307  LEU A O   1 
ATOM   4070 C  CB  . LEU A 1 536 ? 12.464  -5.101  53.458  1.00 47.00  ? 307  LEU A CB  1 
ATOM   4071 C  CG  . LEU A 1 536 ? 12.778  -3.604  53.427  1.00 46.73  ? 307  LEU A CG  1 
ATOM   4072 C  CD1 . LEU A 1 536 ? 11.939  -2.888  52.384  1.00 46.65  ? 307  LEU A CD1 1 
ATOM   4073 C  CD2 . LEU A 1 536 ? 12.554  -2.984  54.793  1.00 49.89  ? 307  LEU A CD2 1 
ATOM   4074 N  N   . VAL A 1 537 ? 12.245  -8.129  54.364  1.00 54.18  ? 308  VAL A N   1 
ATOM   4075 C  CA  . VAL A 1 537 ? 11.521  -9.268  54.911  1.00 58.22  ? 308  VAL A CA  1 
ATOM   4076 C  C   . VAL A 1 537 ? 12.346  -9.940  56.003  1.00 55.25  ? 308  VAL A C   1 
ATOM   4077 O  O   . VAL A 1 537 ? 11.833  -10.258 57.074  1.00 57.08  ? 308  VAL A O   1 
ATOM   4078 C  CB  . VAL A 1 537 ? 11.180  -10.302 53.818  1.00 55.20  ? 308  VAL A CB  1 
ATOM   4079 C  CG1 . VAL A 1 537 ? 10.411  -11.472 54.413  1.00 54.56  ? 308  VAL A CG1 1 
ATOM   4080 C  CG2 . VAL A 1 537 ? 10.386  -9.649  52.700  1.00 51.89  ? 308  VAL A CG2 1 
ATOM   4081 N  N   . VAL A 1 538 ? 13.628  -10.146 55.722  1.00 53.74  ? 309  VAL A N   1 
ATOM   4082 C  CA  . VAL A 1 538 ? 14.528  -10.826 56.649  1.00 56.06  ? 309  VAL A CA  1 
ATOM   4083 C  C   . VAL A 1 538 ? 14.690  -10.045 57.950  1.00 54.65  ? 309  VAL A C   1 
ATOM   4084 O  O   . VAL A 1 538 ? 14.641  -10.620 59.039  1.00 56.00  ? 309  VAL A O   1 
ATOM   4085 C  CB  . VAL A 1 538 ? 15.918  -11.057 56.009  1.00 56.76  ? 309  VAL A CB  1 
ATOM   4086 C  CG1 . VAL A 1 538 ? 16.907  -11.582 57.036  1.00 56.63  ? 309  VAL A CG1 1 
ATOM   4087 C  CG2 . VAL A 1 538 ? 15.807  -12.015 54.837  1.00 52.72  ? 309  VAL A CG2 1 
ATOM   4088 N  N   . HIS A 1 539 ? 14.878  -8.733  57.824  1.00 53.61  ? 310  HIS A N   1 
ATOM   4089 C  CA  . HIS A 1 539 ? 15.048  -7.850  58.975  1.00 53.17  ? 310  HIS A CA  1 
ATOM   4090 C  C   . HIS A 1 539 ? 13.888  -7.953  59.961  1.00 56.51  ? 310  HIS A C   1 
ATOM   4091 O  O   . HIS A 1 539 ? 14.090  -8.275  61.131  1.00 59.77  ? 310  HIS A O   1 
ATOM   4092 C  CB  . HIS A 1 539 ? 15.203  -6.400  58.511  1.00 49.92  ? 310  HIS A CB  1 
ATOM   4093 C  CG  . HIS A 1 539 ? 15.389  -5.421  59.625  1.00 51.25  ? 310  HIS A CG  1 
ATOM   4094 N  ND1 . HIS A 1 539 ? 16.434  -5.503  60.526  1.00 54.77  ? 310  HIS A ND1 1 
ATOM   4095 C  CD2 . HIS A 1 539 ? 14.676  -4.327  59.985  1.00 52.75  ? 310  HIS A CD2 1 
ATOM   4096 C  CE1 . HIS A 1 539 ? 16.349  -4.508  61.388  1.00 51.77  ? 310  HIS A CE1 1 
ATOM   4097 N  NE2 . HIS A 1 539 ? 15.290  -3.779  61.082  1.00 52.59  ? 310  HIS A NE2 1 
ATOM   4098 N  N   . TYR A 1 540 ? 12.674  -7.687  59.489  1.00 54.95  ? 311  TYR A N   1 
ATOM   4099 C  CA  . TYR A 1 540 ? 11.512  -7.696  60.369  1.00 54.13  ? 311  TYR A CA  1 
ATOM   4100 C  C   . TYR A 1 540 ? 11.126  -9.113  60.782  1.00 54.57  ? 311  TYR A C   1 
ATOM   4101 O  O   . TYR A 1 540 ? 10.401  -9.299  61.757  1.00 56.56  ? 311  TYR A O   1 
ATOM   4102 C  CB  . TYR A 1 540 ? 10.319  -7.002  59.704  1.00 58.29  ? 311  TYR A CB  1 
ATOM   4103 C  CG  . TYR A 1 540 ? 10.486  -5.504  59.545  1.00 57.09  ? 311  TYR A CG  1 
ATOM   4104 C  CD1 . TYR A 1 540 ? 10.712  -4.940  58.297  1.00 54.55  ? 311  TYR A CD1 1 
ATOM   4105 C  CD2 . TYR A 1 540 ? 10.422  -4.657  60.645  1.00 55.49  ? 311  TYR A CD2 1 
ATOM   4106 C  CE1 . TYR A 1 540 ? 10.867  -3.574  58.147  1.00 55.89  ? 311  TYR A CE1 1 
ATOM   4107 C  CE2 . TYR A 1 540 ? 10.577  -3.289  60.503  1.00 56.04  ? 311  TYR A CE2 1 
ATOM   4108 C  CZ  . TYR A 1 540 ? 10.799  -2.753  59.251  1.00 57.21  ? 311  TYR A CZ  1 
ATOM   4109 O  OH  . TYR A 1 540 ? 10.953  -1.393  59.095  1.00 57.07  ? 311  TYR A OH  1 
ATOM   4110 N  N   . PHE A 1 541 ? 11.606  -10.110 60.046  1.00 53.13  ? 312  PHE A N   1 
ATOM   4111 C  CA  . PHE A 1 541 ? 11.345  -11.496 60.419  1.00 55.72  ? 312  PHE A CA  1 
ATOM   4112 C  C   . PHE A 1 541 ? 12.117  -11.882 61.675  1.00 58.70  ? 312  PHE A C   1 
ATOM   4113 O  O   . PHE A 1 541 ? 11.627  -12.646 62.504  1.00 59.17  ? 312  PHE A O   1 
ATOM   4114 C  CB  . PHE A 1 541 ? 11.707  -12.459 59.287  1.00 53.65  ? 312  PHE A CB  1 
ATOM   4115 C  CG  . PHE A 1 541 ? 11.575  -13.907 59.668  1.00 53.72  ? 312  PHE A CG  1 
ATOM   4116 C  CD1 . PHE A 1 541 ? 10.343  -14.539 59.616  1.00 52.95  ? 312  PHE A CD1 1 
ATOM   4117 C  CD2 . PHE A 1 541 ? 12.676  -14.633 60.097  1.00 54.23  ? 312  PHE A CD2 1 
ATOM   4118 C  CE1 . PHE A 1 541 ? 10.213  -15.869 59.975  1.00 49.19  ? 312  PHE A CE1 1 
ATOM   4119 C  CE2 . PHE A 1 541 ? 12.551  -15.962 60.458  1.00 53.16  ? 312  PHE A CE2 1 
ATOM   4120 C  CZ  . PHE A 1 541 ? 11.317  -16.580 60.396  1.00 49.50  ? 312  PHE A CZ  1 
ATOM   4121 N  N   . LEU A 1 542 ? 13.334  -11.366 61.804  1.00 56.85  ? 313  LEU A N   1 
ATOM   4122 C  CA  . LEU A 1 542 ? 14.167  -11.696 62.951  1.00 62.16  ? 313  LEU A CA  1 
ATOM   4123 C  C   . LEU A 1 542 ? 13.719  -10.933 64.193  1.00 66.25  ? 313  LEU A C   1 
ATOM   4124 O  O   . LEU A 1 542 ? 13.729  -11.471 65.302  1.00 67.83  ? 313  LEU A O   1 
ATOM   4125 C  CB  . LEU A 1 542 ? 15.635  -11.406 62.644  1.00 61.61  ? 313  LEU A CB  1 
ATOM   4126 C  CG  . LEU A 1 542 ? 16.221  -12.204 61.478  1.00 57.89  ? 313  LEU A CG  1 
ATOM   4127 C  CD1 . LEU A 1 542 ? 17.692  -11.872 61.267  1.00 55.13  ? 313  LEU A CD1 1 
ATOM   4128 C  CD2 . LEU A 1 542 ? 16.028  -13.691 61.713  1.00 57.19  ? 313  LEU A CD2 1 
ATOM   4129 N  N   . ILE A 1 543 ? 13.321  -9.679  63.999  1.00 63.78  ? 314  ILE A N   1 
ATOM   4130 C  CA  . ILE A 1 543 ? 12.807  -8.857  65.089  1.00 63.24  ? 314  ILE A CA  1 
ATOM   4131 C  C   . ILE A 1 543 ? 11.505  -9.450  65.616  1.00 65.21  ? 314  ILE A C   1 
ATOM   4132 O  O   . ILE A 1 543 ? 11.190  -9.344  66.801  1.00 69.20  ? 314  ILE A O   1 
ATOM   4133 C  CB  . ILE A 1 543 ? 12.573  -7.402  64.642  1.00 60.39  ? 314  ILE A CB  1 
ATOM   4134 C  CG1 . ILE A 1 543 ? 13.838  -6.831  64.003  1.00 57.21  ? 314  ILE A CG1 1 
ATOM   4135 C  CG2 . ILE A 1 543 ? 12.147  -6.540  65.817  1.00 64.26  ? 314  ILE A CG2 1 
ATOM   4136 C  CD1 . ILE A 1 543 ? 13.747  -5.356  63.694  1.00 53.73  ? 314  ILE A CD1 1 
ATOM   4137 N  N   . LYS A 1 544 ? 10.755  -10.083 64.721  1.00 63.80  ? 315  LYS A N   1 
ATOM   4138 C  CA  . LYS A 1 544 ? 9.517   -10.756 65.086  1.00 64.54  ? 315  LYS A CA  1 
ATOM   4139 C  C   . LYS A 1 544 ? 9.801   -12.062 65.824  1.00 65.53  ? 315  LYS A C   1 
ATOM   4140 O  O   . LYS A 1 544 ? 9.018   -12.495 66.668  1.00 68.90  ? 315  LYS A O   1 
ATOM   4141 C  CB  . LYS A 1 544 ? 8.674   -11.025 63.836  1.00 62.19  ? 315  LYS A CB  1 
ATOM   4142 C  CG  . LYS A 1 544 ? 7.338   -11.691 64.102  1.00 63.65  ? 315  LYS A CG  1 
ATOM   4143 C  CD  . LYS A 1 544 ? 6.609   -11.969 62.798  1.00 62.07  ? 315  LYS A CD  1 
ATOM   4144 C  CE  . LYS A 1 544 ? 5.244   -12.597 63.039  1.00 66.61  ? 315  LYS A CE  1 
ATOM   4145 N  NZ  . LYS A 1 544 ? 4.483   -12.807 61.769  1.00 66.57  ? 315  LYS A NZ  1 
ATOM   4146 N  N   . SER A 1 545 ? 10.933  -12.682 65.509  1.00 66.97  ? 316  SER A N   1 
ATOM   4147 C  CA  . SER A 1 545 ? 11.240  -14.012 66.021  1.00 68.41  ? 316  SER A CA  1 
ATOM   4148 C  C   . SER A 1 545 ? 12.145  -13.978 67.243  1.00 73.45  ? 316  SER A C   1 
ATOM   4149 O  O   . SER A 1 545 ? 12.028  -14.827 68.124  1.00 78.78  ? 316  SER A O   1 
ATOM   4150 C  CB  . SER A 1 545 ? 11.891  -14.866 64.931  1.00 67.98  ? 316  SER A CB  1 
ATOM   4151 O  OG  . SER A 1 545 ? 13.181  -14.375 64.610  1.00 75.28  ? 316  SER A OG  1 
ATOM   4152 N  N   . GLN A 1 546 ? 13.049  -13.003 67.299  1.00 73.39  ? 317  GLN A N   1 
ATOM   4153 C  CA  . GLN A 1 546 ? 14.009  -12.937 68.398  1.00 77.64  ? 317  GLN A CA  1 
ATOM   4154 C  C   . GLN A 1 546 ? 14.118  -11.551 69.038  1.00 73.87  ? 317  GLN A C   1 
ATOM   4155 O  O   . GLN A 1 546 ? 14.680  -11.405 70.122  1.00 76.50  ? 317  GLN A O   1 
ATOM   4156 C  CB  . GLN A 1 546 ? 15.386  -13.393 67.914  1.00 78.40  ? 317  GLN A CB  1 
ATOM   4157 C  CG  . GLN A 1 546 ? 15.416  -14.836 67.439  1.00 85.24  ? 317  GLN A CG  1 
ATOM   4158 C  CD  . GLN A 1 546 ? 16.817  -15.318 67.132  1.00 100.50 ? 317  GLN A CD  1 
ATOM   4159 O  OE1 . GLN A 1 546 ? 17.780  -14.557 67.221  1.00 105.47 ? 317  GLN A OE1 1 
ATOM   4160 N  NE2 . GLN A 1 546 ? 16.939  -16.590 66.773  1.00 103.63 ? 317  GLN A NE2 1 
ATOM   4161 N  N   . GLY A 1 547 ? 13.583  -10.538 68.367  1.00 70.96  ? 318  GLY A N   1 
ATOM   4162 C  CA  . GLY A 1 547 ? 13.614  -9.186  68.894  1.00 70.31  ? 318  GLY A CA  1 
ATOM   4163 C  C   . GLY A 1 547 ? 14.814  -8.388  68.422  1.00 72.21  ? 318  GLY A C   1 
ATOM   4164 O  O   . GLY A 1 547 ? 14.936  -7.197  68.711  1.00 73.16  ? 318  GLY A O   1 
ATOM   4165 N  N   . GLN A 1 548 ? 15.706  -9.051  67.695  1.00 75.16  ? 319  GLN A N   1 
ATOM   4166 C  CA  . GLN A 1 548 ? 16.872  -8.396  67.117  1.00 71.46  ? 319  GLN A CA  1 
ATOM   4167 C  C   . GLN A 1 548 ? 17.264  -9.087  65.813  1.00 67.81  ? 319  GLN A C   1 
ATOM   4168 O  O   . GLN A 1 548 ? 16.976  -10.269 65.621  1.00 68.85  ? 319  GLN A O   1 
ATOM   4169 C  CB  . GLN A 1 548 ? 18.045  -8.400  68.103  1.00 70.38  ? 319  GLN A CB  1 
ATOM   4170 C  CG  . GLN A 1 548 ? 18.477  -9.785  68.572  1.00 74.42  ? 319  GLN A CG  1 
ATOM   4171 C  CD  . GLN A 1 548 ? 19.787  -9.759  69.340  1.00 80.12  ? 319  GLN A CD  1 
ATOM   4172 O  OE1 . GLN A 1 548 ? 20.375  -8.697  69.551  1.00 74.32  ? 319  GLN A OE1 1 
ATOM   4173 N  NE2 . GLN A 1 548 ? 20.253  -10.931 69.757  1.00 93.82  ? 319  GLN A NE2 1 
ATOM   4174 N  N   . SER A 1 549 ? 17.908  -8.350  64.914  1.00 64.04  ? 320  SER A N   1 
ATOM   4175 C  CA  . SER A 1 549 ? 18.367  -8.933  63.658  1.00 65.32  ? 320  SER A CA  1 
ATOM   4176 C  C   . SER A 1 549 ? 19.840  -8.625  63.407  1.00 60.30  ? 320  SER A C   1 
ATOM   4177 O  O   . SER A 1 549 ? 20.266  -7.472  63.480  1.00 59.91  ? 320  SER A O   1 
ATOM   4178 C  CB  . SER A 1 549 ? 17.514  -8.437  62.484  1.00 61.33  ? 320  SER A CB  1 
ATOM   4179 O  OG  . SER A 1 549 ? 17.650  -7.043  62.286  1.00 58.44  ? 320  SER A OG  1 
ATOM   4180 N  N   . HIS A 1 550 ? 20.612  -9.666  63.114  1.00 60.65  ? 321  HIS A N   1 
ATOM   4181 C  CA  . HIS A 1 550 ? 22.033  -9.514  62.827  1.00 60.61  ? 321  HIS A CA  1 
ATOM   4182 C  C   . HIS A 1 550 ? 22.261  -8.990  61.412  1.00 58.73  ? 321  HIS A C   1 
ATOM   4183 O  O   . HIS A 1 550 ? 23.374  -8.602  61.052  1.00 56.00  ? 321  HIS A O   1 
ATOM   4184 C  CB  . HIS A 1 550 ? 22.763  -10.845 63.019  1.00 61.81  ? 321  HIS A CB  1 
ATOM   4185 C  CG  . HIS A 1 550 ? 22.230  -11.957 62.169  1.00 63.57  ? 321  HIS A CG  1 
ATOM   4186 N  ND1 . HIS A 1 550 ? 21.076  -12.645 62.481  1.00 63.30  ? 321  HIS A ND1 1 
ATOM   4187 C  CD2 . HIS A 1 550 ? 22.695  -12.505 61.023  1.00 63.95  ? 321  HIS A CD2 1 
ATOM   4188 C  CE1 . HIS A 1 550 ? 20.853  -13.566 61.563  1.00 62.10  ? 321  HIS A CE1 1 
ATOM   4189 N  NE2 . HIS A 1 550 ? 21.821  -13.503 60.665  1.00 68.40  ? 321  HIS A NE2 1 
ATOM   4190 N  N   . VAL A 1 551 ? 21.200  -8.980  60.610  1.00 54.87  ? 322  VAL A N   1 
ATOM   4191 C  CA  . VAL A 1 551 ? 21.289  -8.467  59.250  1.00 53.72  ? 322  VAL A CA  1 
ATOM   4192 C  C   . VAL A 1 551 ? 21.020  -6.969  59.231  1.00 51.76  ? 322  VAL A C   1 
ATOM   4193 O  O   . VAL A 1 551 ? 20.804  -6.385  58.171  1.00 53.78  ? 322  VAL A O   1 
ATOM   4194 C  CB  . VAL A 1 551 ? 20.301  -9.175  58.302  1.00 53.44  ? 322  VAL A CB  1 
ATOM   4195 C  CG1 . VAL A 1 551 ? 20.604  -10.663 58.238  1.00 52.81  ? 322  VAL A CG1 1 
ATOM   4196 C  CG2 . VAL A 1 551 ? 18.862  -8.930  58.744  1.00 53.93  ? 322  VAL A CG2 1 
ATOM   4197 N  N   . TYR A 1 552 ? 21.039  -6.354  60.409  1.00 51.08  ? 323  TYR A N   1 
ATOM   4198 C  CA  . TYR A 1 552 ? 20.763  -4.928  60.537  1.00 51.24  ? 323  TYR A CA  1 
ATOM   4199 C  C   . TYR A 1 552 ? 21.755  -4.087  59.733  1.00 49.27  ? 323  TYR A C   1 
ATOM   4200 O  O   . TYR A 1 552 ? 21.380  -3.080  59.133  1.00 49.67  ? 323  TYR A O   1 
ATOM   4201 C  CB  . TYR A 1 552 ? 20.785  -4.511  62.011  1.00 48.80  ? 323  TYR A CB  1 
ATOM   4202 C  CG  . TYR A 1 552 ? 20.420  -3.060  62.245  1.00 48.63  ? 323  TYR A CG  1 
ATOM   4203 C  CD1 . TYR A 1 552 ? 19.122  -2.608  62.041  1.00 51.23  ? 323  TYR A CD1 1 
ATOM   4204 C  CD2 . TYR A 1 552 ? 21.371  -2.144  62.673  1.00 47.15  ? 323  TYR A CD2 1 
ATOM   4205 C  CE1 . TYR A 1 552 ? 18.783  -1.285  62.254  1.00 47.91  ? 323  TYR A CE1 1 
ATOM   4206 C  CE2 . TYR A 1 552 ? 21.042  -0.819  62.888  1.00 46.99  ? 323  TYR A CE2 1 
ATOM   4207 C  CZ  . TYR A 1 552 ? 19.747  -0.395  62.676  1.00 46.20  ? 323  TYR A CZ  1 
ATOM   4208 O  OH  . TYR A 1 552 ? 19.415  0.923   62.889  1.00 45.38  ? 323  TYR A OH  1 
ATOM   4209 N  N   . ALA A 1 553 ? 23.017  -4.505  59.712  1.00 48.59  ? 324  ALA A N   1 
ATOM   4210 C  CA  . ALA A 1 553 ? 24.036  -3.787  58.954  1.00 48.57  ? 324  ALA A CA  1 
ATOM   4211 C  C   . ALA A 1 553 ? 23.818  -3.957  57.454  1.00 48.20  ? 324  ALA A C   1 
ATOM   4212 O  O   . ALA A 1 553 ? 23.971  -3.011  56.684  1.00 47.32  ? 324  ALA A O   1 
ATOM   4213 C  CB  . ALA A 1 553 ? 25.423  -4.262  59.345  1.00 48.99  ? 324  ALA A CB  1 
ATOM   4214 N  N   . LEU A 1 554 ? 23.460  -5.170  57.047  1.00 48.58  ? 325  LEU A N   1 
ATOM   4215 C  CA  . LEU A 1 554 ? 23.188  -5.457  55.644  1.00 47.50  ? 325  LEU A CA  1 
ATOM   4216 C  C   . LEU A 1 554 ? 21.917  -4.739  55.203  1.00 49.59  ? 325  LEU A C   1 
ATOM   4217 O  O   . LEU A 1 554 ? 21.816  -4.272  54.071  1.00 50.00  ? 325  LEU A O   1 
ATOM   4218 C  CB  . LEU A 1 554 ? 23.059  -6.964  55.416  1.00 45.11  ? 325  LEU A CB  1 
ATOM   4219 C  CG  . LEU A 1 554 ? 24.181  -7.830  55.995  1.00 49.54  ? 325  LEU A CG  1 
ATOM   4220 C  CD1 . LEU A 1 554 ? 23.980  -9.295  55.633  1.00 48.36  ? 325  LEU A CD1 1 
ATOM   4221 C  CD2 . LEU A 1 554 ? 25.546  -7.340  55.535  1.00 44.96  ? 325  LEU A CD2 1 
ATOM   4222 N  N   . TYR A 1 555 ? 20.956  -4.659  56.117  1.00 48.91  ? 326  TYR A N   1 
ATOM   4223 C  CA  . TYR A 1 555 ? 19.703  -3.942  55.904  1.00 47.05  ? 326  TYR A CA  1 
ATOM   4224 C  C   . TYR A 1 555 ? 19.954  -2.467  55.610  1.00 47.11  ? 326  TYR A C   1 
ATOM   4225 O  O   . TYR A 1 555 ? 19.268  -1.860  54.791  1.00 49.27  ? 326  TYR A O   1 
ATOM   4226 C  CB  . TYR A 1 555 ? 18.806  -4.109  57.135  1.00 47.44  ? 326  TYR A CB  1 
ATOM   4227 C  CG  . TYR A 1 555 ? 17.660  -3.128  57.267  1.00 48.80  ? 326  TYR A CG  1 
ATOM   4228 C  CD1 . TYR A 1 555 ? 16.427  -3.389  56.687  1.00 49.71  ? 326  TYR A CD1 1 
ATOM   4229 C  CD2 . TYR A 1 555 ? 17.800  -1.961  58.010  1.00 51.71  ? 326  TYR A CD2 1 
ATOM   4230 C  CE1 . TYR A 1 555 ? 15.374  -2.506  56.821  1.00 47.51  ? 326  TYR A CE1 1 
ATOM   4231 C  CE2 . TYR A 1 555 ? 16.753  -1.072  58.149  1.00 48.62  ? 326  TYR A CE2 1 
ATOM   4232 C  CZ  . TYR A 1 555 ? 15.542  -1.350  57.553  1.00 46.92  ? 326  TYR A CZ  1 
ATOM   4233 O  OH  . TYR A 1 555 ? 14.494  -0.468  57.692  1.00 50.80  ? 326  TYR A OH  1 
ATOM   4234 N  N   . ILE A 1 556 ? 20.953  -1.902  56.279  1.00 47.09  ? 327  ILE A N   1 
ATOM   4235 C  CA  . ILE A 1 556 ? 21.296  -0.494  56.123  1.00 46.59  ? 327  ILE A CA  1 
ATOM   4236 C  C   . ILE A 1 556 ? 22.031  -0.244  54.812  1.00 46.20  ? 327  ILE A C   1 
ATOM   4237 O  O   . ILE A 1 556 ? 21.718  0.694   54.077  1.00 46.27  ? 327  ILE A O   1 
ATOM   4238 C  CB  . ILE A 1 556 ? 22.154  -0.002  57.303  1.00 46.19  ? 327  ILE A CB  1 
ATOM   4239 C  CG1 . ILE A 1 556 ? 21.276  0.149   58.547  1.00 46.42  ? 327  ILE A CG1 1 
ATOM   4240 C  CG2 . ILE A 1 556 ? 22.843  1.309   56.958  1.00 44.69  ? 327  ILE A CG2 1 
ATOM   4241 C  CD1 . ILE A 1 556 ? 21.866  1.028   59.611  1.00 49.70  ? 327  ILE A CD1 1 
ATOM   4242 N  N   . VAL A 1 557 ? 23.009  -1.095  54.525  1.00 49.32  ? 328  VAL A N   1 
ATOM   4243 C  CA  . VAL A 1 557 ? 23.740  -1.026  53.270  1.00 46.73  ? 328  VAL A CA  1 
ATOM   4244 C  C   . VAL A 1 557 ? 22.792  -1.248  52.093  1.00 45.48  ? 328  VAL A C   1 
ATOM   4245 O  O   . VAL A 1 557 ? 22.907  -0.589  51.057  1.00 46.67  ? 328  VAL A O   1 
ATOM   4246 C  CB  . VAL A 1 557 ? 24.881  -2.063  53.229  1.00 46.84  ? 328  VAL A CB  1 
ATOM   4247 C  CG1 . VAL A 1 557 ? 25.604  -2.012  51.891  1.00 48.23  ? 328  VAL A CG1 1 
ATOM   4248 C  CG2 . VAL A 1 557 ? 25.853  -1.819  54.365  1.00 48.07  ? 328  VAL A CG2 1 
ATOM   4249 N  N   . ALA A 1 558 ? 21.850  -2.170  52.268  1.00 43.05  ? 329  ALA A N   1 
ATOM   4250 C  CA  . ALA A 1 558 ? 20.859  -2.462  51.242  1.00 42.64  ? 329  ALA A CA  1 
ATOM   4251 C  C   . ALA A 1 558 ? 20.030  -1.227  50.919  1.00 46.53  ? 329  ALA A C   1 
ATOM   4252 O  O   . ALA A 1 558 ? 19.861  -0.873  49.750  1.00 47.35  ? 329  ALA A O   1 
ATOM   4253 C  CB  . ALA A 1 558 ? 19.959  -3.599  51.680  1.00 44.52  ? 329  ALA A CB  1 
ATOM   4254 N  N   . LEU A 1 559 ? 19.518  -0.578  51.963  1.00 45.21  ? 330  LEU A N   1 
ATOM   4255 C  CA  . LEU A 1 559 ? 18.686  0.610   51.802  1.00 44.00  ? 330  LEU A CA  1 
ATOM   4256 C  C   . LEU A 1 559 ? 19.466  1.753   51.167  1.00 42.94  ? 330  LEU A C   1 
ATOM   4257 O  O   . LEU A 1 559 ? 18.901  2.580   50.450  1.00 42.60  ? 330  LEU A O   1 
ATOM   4258 C  CB  . LEU A 1 559 ? 18.119  1.059   53.151  1.00 47.73  ? 330  LEU A CB  1 
ATOM   4259 C  CG  . LEU A 1 559 ? 16.996  0.230   53.776  1.00 49.32  ? 330  LEU A CG  1 
ATOM   4260 C  CD1 . LEU A 1 559 ? 16.599  0.829   55.115  1.00 47.27  ? 330  LEU A CD1 1 
ATOM   4261 C  CD2 . LEU A 1 559 ? 15.795  0.151   52.847  1.00 43.89  ? 330  LEU A CD2 1 
ATOM   4262 N  N   . CYS A 1 560 ? 20.764  1.794   51.441  1.00 43.23  ? 331  CYS A N   1 
ATOM   4263 C  CA  . CYS A 1 560 ? 21.629  2.827   50.891  1.00 44.01  ? 331  CYS A CA  1 
ATOM   4264 C  C   . CYS A 1 560 ? 21.867  2.617   49.401  1.00 45.57  ? 331  CYS A C   1 
ATOM   4265 O  O   . CYS A 1 560 ? 21.719  3.543   48.603  1.00 43.87  ? 331  CYS A O   1 
ATOM   4266 C  CB  . CYS A 1 560 ? 22.964  2.852   51.630  1.00 44.24  ? 331  CYS A CB  1 
ATOM   4267 S  SG  . CYS A 1 560 ? 24.147  4.038   50.963  1.00 45.78  ? 331  CYS A SG  1 
ATOM   4268 N  N   . LEU A 1 561 ? 22.237  1.396   49.033  1.00 44.96  ? 332  LEU A N   1 
ATOM   4269 C  CA  . LEU A 1 561 ? 22.497  1.070   47.635  1.00 47.81  ? 332  LEU A CA  1 
ATOM   4270 C  C   . LEU A 1 561 ? 21.226  1.124   46.796  1.00 44.26  ? 332  LEU A C   1 
ATOM   4271 O  O   . LEU A 1 561 ? 21.295  1.197   45.573  1.00 47.40  ? 332  LEU A O   1 
ATOM   4272 C  CB  . LEU A 1 561 ? 23.135  -0.315  47.512  1.00 46.29  ? 332  LEU A CB  1 
ATOM   4273 C  CG  . LEU A 1 561 ? 24.524  -0.474  48.128  1.00 46.08  ? 332  LEU A CG  1 
ATOM   4274 C  CD1 . LEU A 1 561 ? 24.980  -1.917  48.024  1.00 49.96  ? 332  LEU A CD1 1 
ATOM   4275 C  CD2 . LEU A 1 561 ? 25.516  0.457   47.452  1.00 42.47  ? 332  LEU A CD2 1 
ATOM   4276 N  N   . SER A 1 562 ? 20.069  1.083   47.450  1.00 43.23  ? 333  SER A N   1 
ATOM   4277 C  CA  . SER A 1 562 ? 18.807  1.119   46.727  1.00 42.53  ? 333  SER A CA  1 
ATOM   4278 C  C   . SER A 1 562 ? 18.594  2.493   46.106  1.00 46.35  ? 333  SER A C   1 
ATOM   4279 O  O   . SER A 1 562 ? 17.909  2.623   45.093  1.00 49.30  ? 333  SER A O   1 
ATOM   4280 C  CB  . SER A 1 562 ? 17.635  0.763   47.645  1.00 42.01  ? 333  SER A CB  1 
ATOM   4281 O  OG  . SER A 1 562 ? 17.317  1.836   48.514  1.00 43.57  ? 333  SER A OG  1 
ATOM   4282 N  N   . THR A 1 563 ? 19.196  3.515   46.706  1.00 43.26  ? 334  THR A N   1 
ATOM   4283 C  CA  . THR A 1 563 ? 19.021  4.880   46.222  1.00 42.71  ? 334  THR A CA  1 
ATOM   4284 C  C   . THR A 1 563 ? 19.826  5.129   44.947  1.00 44.16  ? 334  THR A C   1 
ATOM   4285 O  O   . THR A 1 563 ? 19.699  6.179   44.316  1.00 42.87  ? 334  THR A O   1 
ATOM   4286 C  CB  . THR A 1 563 ? 19.431  5.920   47.287  1.00 41.78  ? 334  THR A CB  1 
ATOM   4287 O  OG1 . THR A 1 563 ? 20.856  5.927   47.433  1.00 41.75  ? 334  THR A OG1 1 
ATOM   4288 C  CG2 . THR A 1 563 ? 18.780  5.605   48.631  1.00 40.28  ? 334  THR A CG2 1 
ATOM   4289 N  N   . LEU A 1 564 ? 20.651  4.159   44.569  1.00 43.27  ? 335  LEU A N   1 
ATOM   4290 C  CA  . LEU A 1 564 ? 21.468  4.283   43.369  1.00 43.29  ? 335  LEU A CA  1 
ATOM   4291 C  C   . LEU A 1 564 ? 20.624  4.178   42.102  1.00 45.20  ? 335  LEU A C   1 
ATOM   4292 O  O   . LEU A 1 564 ? 21.071  4.567   41.022  1.00 44.77  ? 335  LEU A O   1 
ATOM   4293 C  CB  . LEU A 1 564 ? 22.569  3.218   43.353  1.00 43.67  ? 335  LEU A CB  1 
ATOM   4294 C  CG  . LEU A 1 564 ? 23.733  3.370   44.338  1.00 43.46  ? 335  LEU A CG  1 
ATOM   4295 C  CD1 . LEU A 1 564 ? 24.745  2.246   44.154  1.00 40.32  ? 335  LEU A CD1 1 
ATOM   4296 C  CD2 . LEU A 1 564 ? 24.406  4.724   44.183  1.00 41.56  ? 335  LEU A CD2 1 
ATOM   4297 N  N   . ASN A 1 565 ? 19.410  3.650   42.237  1.00 43.55  ? 336  ASN A N   1 
ATOM   4298 C  CA  . ASN A 1 565 ? 18.521  3.486   41.094  1.00 44.79  ? 336  ASN A CA  1 
ATOM   4299 C  C   . ASN A 1 565 ? 18.308  4.802   40.340  1.00 47.81  ? 336  ASN A C   1 
ATOM   4300 O  O   . ASN A 1 565 ? 18.196  4.808   39.115  1.00 48.45  ? 336  ASN A O   1 
ATOM   4301 C  CB  . ASN A 1 565 ? 17.171  2.904   41.538  1.00 45.99  ? 336  ASN A CB  1 
ATOM   4302 C  CG  . ASN A 1 565 ? 16.292  3.922   42.255  1.00 47.14  ? 336  ASN A CG  1 
ATOM   4303 O  OD1 . ASN A 1 565 ? 15.610  4.724   41.620  1.00 45.75  ? 336  ASN A OD1 1 
ATOM   4304 N  ND2 . ASN A 1 565 ? 16.294  3.880   43.583  1.00 47.76  ? 336  ASN A ND2 1 
ATOM   4305 N  N   . SER A 1 566 ? 18.278  5.913   41.072  1.00 44.29  ? 337  SER A N   1 
ATOM   4306 C  CA  . SER A 1 566 ? 18.103  7.224   40.456  1.00 44.75  ? 337  SER A CA  1 
ATOM   4307 C  C   . SER A 1 566 ? 19.392  7.702   39.774  1.00 43.96  ? 337  SER A C   1 
ATOM   4308 O  O   . SER A 1 566 ? 19.383  8.692   39.037  1.00 42.82  ? 337  SER A O   1 
ATOM   4309 C  CB  . SER A 1 566 ? 17.632  8.248   41.496  1.00 42.75  ? 337  SER A CB  1 
ATOM   4310 O  OG  . SER A 1 566 ? 18.595  8.441   42.516  1.00 47.19  ? 337  SER A OG  1 
ATOM   4311 N  N   . CYS A 1 567 ? 20.492  6.995   40.025  1.00 43.12  ? 338  CYS A N   1 
ATOM   4312 C  CA  . CYS A 1 567 ? 21.749  7.235   39.320  1.00 44.27  ? 338  CYS A CA  1 
ATOM   4313 C  C   . CYS A 1 567 ? 21.855  6.332   38.098  1.00 45.75  ? 338  CYS A C   1 
ATOM   4314 O  O   . CYS A 1 567 ? 22.601  6.619   37.164  1.00 47.37  ? 338  CYS A O   1 
ATOM   4315 C  CB  . CYS A 1 567 ? 22.951  6.995   40.236  1.00 48.28  ? 338  CYS A CB  1 
ATOM   4316 S  SG  . CYS A 1 567 ? 23.255  8.271   41.469  1.00 47.07  ? 338  CYS A SG  1 
ATOM   4317 N  N   . ILE A 1 568 ? 21.120  5.227   38.121  1.00 45.44  ? 339  ILE A N   1 
ATOM   4318 C  CA  . ILE A 1 568 ? 21.113  4.291   37.007  1.00 46.38  ? 339  ILE A CA  1 
ATOM   4319 C  C   . ILE A 1 568 ? 19.989  4.656   36.036  1.00 48.32  ? 339  ILE A C   1 
ATOM   4320 O  O   . ILE A 1 568 ? 20.055  4.360   34.841  1.00 47.22  ? 339  ILE A O   1 
ATOM   4321 C  CB  . ILE A 1 568 ? 20.947  2.839   37.499  1.00 47.93  ? 339  ILE A CB  1 
ATOM   4322 C  CG1 . ILE A 1 568 ? 21.984  2.519   38.575  1.00 45.92  ? 339  ILE A CG1 1 
ATOM   4323 C  CG2 . ILE A 1 568 ? 21.093  1.857   36.356  1.00 48.86  ? 339  ILE A CG2 1 
ATOM   4324 C  CD1 . ILE A 1 568 ? 23.406  2.638   38.088  1.00 53.59  ? 339  ILE A CD1 1 
ATOM   4325 N  N   . ASP A 1 569 ? 18.965  5.322   36.562  1.00 49.17  ? 340  ASP A N   1 
ATOM   4326 C  CA  . ASP A 1 569 ? 17.830  5.767   35.754  1.00 47.28  ? 340  ASP A CA  1 
ATOM   4327 C  C   . ASP A 1 569 ? 18.201  6.642   34.537  1.00 50.69  ? 340  ASP A C   1 
ATOM   4328 O  O   . ASP A 1 569 ? 17.559  6.521   33.494  1.00 49.32  ? 340  ASP A O   1 
ATOM   4329 C  CB  . ASP A 1 569 ? 16.814  6.508   36.637  1.00 47.45  ? 340  ASP A CB  1 
ATOM   4330 C  CG  . ASP A 1 569 ? 15.794  5.567   37.274  1.00 51.58  ? 340  ASP A CG  1 
ATOM   4331 O  OD1 . ASP A 1 569 ? 15.534  4.498   36.682  1.00 52.36  ? 340  ASP A OD1 1 
ATOM   4332 O  OD2 . ASP A 1 569 ? 15.252  5.889   38.361  1.00 48.34  ? 340  ASP A OD2 1 
ATOM   4333 N  N   . PRO A 1 570 ? 19.221  7.522   34.651  1.00 49.12  ? 341  PRO A N   1 
ATOM   4334 C  CA  . PRO A 1 570 ? 19.568  8.266   33.431  1.00 48.52  ? 341  PRO A CA  1 
ATOM   4335 C  C   . PRO A 1 570 ? 20.055  7.386   32.281  1.00 47.34  ? 341  PRO A C   1 
ATOM   4336 O  O   . PRO A 1 570 ? 19.876  7.752   31.120  1.00 47.55  ? 341  PRO A O   1 
ATOM   4337 C  CB  . PRO A 1 570 ? 20.688  9.198   33.896  1.00 45.86  ? 341  PRO A CB  1 
ATOM   4338 C  CG  . PRO A 1 570 ? 20.425  9.399   35.333  1.00 47.73  ? 341  PRO A CG  1 
ATOM   4339 C  CD  . PRO A 1 570 ? 19.905  8.082   35.831  1.00 46.53  ? 341  PRO A CD  1 
ATOM   4340 N  N   . PHE A 1 571 ? 20.663  6.247   32.597  1.00 46.25  ? 342  PHE A N   1 
ATOM   4341 C  CA  . PHE A 1 571 ? 21.119  5.323   31.563  1.00 47.16  ? 342  PHE A CA  1 
ATOM   4342 C  C   . PHE A 1 571 ? 19.934  4.694   30.851  1.00 49.52  ? 342  PHE A C   1 
ATOM   4343 O  O   . PHE A 1 571 ? 20.018  4.326   29.677  1.00 48.60  ? 342  PHE A O   1 
ATOM   4344 C  CB  . PHE A 1 571 ? 22.012  4.235   32.158  1.00 46.84  ? 342  PHE A CB  1 
ATOM   4345 C  CG  . PHE A 1 571 ? 23.338  4.739   32.639  1.00 48.58  ? 342  PHE A CG  1 
ATOM   4346 C  CD1 . PHE A 1 571 ? 24.398  4.872   31.762  1.00 47.82  ? 342  PHE A CD1 1 
ATOM   4347 C  CD2 . PHE A 1 571 ? 23.523  5.083   33.969  1.00 47.78  ? 342  PHE A CD2 1 
ATOM   4348 C  CE1 . PHE A 1 571 ? 25.619  5.337   32.201  1.00 49.70  ? 342  PHE A CE1 1 
ATOM   4349 C  CE2 . PHE A 1 571 ? 24.741  5.549   34.414  1.00 47.25  ? 342  PHE A CE2 1 
ATOM   4350 C  CZ  . PHE A 1 571 ? 25.792  5.676   33.530  1.00 49.24  ? 342  PHE A CZ  1 
ATOM   4351 N  N   . VAL A 1 572 ? 18.827  4.575   31.575  1.00 49.50  ? 343  VAL A N   1 
ATOM   4352 C  CA  . VAL A 1 572 ? 17.601  4.025   31.017  1.00 49.55  ? 343  VAL A CA  1 
ATOM   4353 C  C   . VAL A 1 572 ? 17.001  4.983   29.996  1.00 46.87  ? 343  VAL A C   1 
ATOM   4354 O  O   . VAL A 1 572 ? 16.574  4.570   28.921  1.00 50.39  ? 343  VAL A O   1 
ATOM   4355 C  CB  . VAL A 1 572 ? 16.571  3.730   32.120  1.00 48.36  ? 343  VAL A CB  1 
ATOM   4356 C  CG1 . VAL A 1 572 ? 15.245  3.310   31.515  1.00 50.30  ? 343  VAL A CG1 1 
ATOM   4357 C  CG2 . VAL A 1 572 ? 17.104  2.659   33.065  1.00 47.96  ? 343  VAL A CG2 1 
ATOM   4358 N  N   . TYR A 1 573 ? 16.984  6.267   30.333  1.00 46.04  ? 344  TYR A N   1 
ATOM   4359 C  CA  . TYR A 1 573 ? 16.436  7.278   29.440  1.00 49.87  ? 344  TYR A CA  1 
ATOM   4360 C  C   . TYR A 1 573 ? 17.280  7.381   28.176  1.00 52.55  ? 344  TYR A C   1 
ATOM   4361 O  O   . TYR A 1 573 ? 16.769  7.685   27.099  1.00 52.01  ? 344  TYR A O   1 
ATOM   4362 C  CB  . TYR A 1 573 ? 16.369  8.647   30.123  1.00 50.93  ? 344  TYR A CB  1 
ATOM   4363 C  CG  . TYR A 1 573 ? 15.792  8.645   31.518  1.00 50.37  ? 344  TYR A CG  1 
ATOM   4364 C  CD1 . TYR A 1 573 ? 14.786  7.760   31.880  1.00 51.25  ? 344  TYR A CD1 1 
ATOM   4365 C  CD2 . TYR A 1 573 ? 16.260  9.533   32.476  1.00 51.69  ? 344  TYR A CD2 1 
ATOM   4366 C  CE1 . TYR A 1 573 ? 14.263  7.760   33.161  1.00 50.20  ? 344  TYR A CE1 1 
ATOM   4367 C  CE2 . TYR A 1 573 ? 15.745  9.542   33.757  1.00 50.51  ? 344  TYR A CE2 1 
ATOM   4368 C  CZ  . TYR A 1 573 ? 14.748  8.654   34.094  1.00 50.42  ? 344  TYR A CZ  1 
ATOM   4369 O  OH  . TYR A 1 573 ? 14.238  8.664   35.370  1.00 54.42  ? 344  TYR A OH  1 
ATOM   4370 N  N   . TYR A 1 574 ? 18.577  7.127   28.319  1.00 51.53  ? 345  TYR A N   1 
ATOM   4371 C  CA  . TYR A 1 574 ? 19.521  7.249   27.213  1.00 50.98  ? 345  TYR A CA  1 
ATOM   4372 C  C   . TYR A 1 574 ? 19.296  6.167   26.156  1.00 49.82  ? 345  TYR A C   1 
ATOM   4373 O  O   . TYR A 1 574 ? 19.481  6.407   24.966  1.00 50.95  ? 345  TYR A O   1 
ATOM   4374 C  CB  . TYR A 1 574 ? 20.957  7.188   27.745  1.00 51.89  ? 345  TYR A CB  1 
ATOM   4375 C  CG  . TYR A 1 574 ? 22.037  7.439   26.712  1.00 52.17  ? 345  TYR A CG  1 
ATOM   4376 C  CD1 . TYR A 1 574 ? 22.479  8.729   26.438  1.00 52.88  ? 345  TYR A CD1 1 
ATOM   4377 C  CD2 . TYR A 1 574 ? 22.629  6.385   26.026  1.00 49.85  ? 345  TYR A CD2 1 
ATOM   4378 C  CE1 . TYR A 1 574 ? 23.470  8.961   25.502  1.00 53.94  ? 345  TYR A CE1 1 
ATOM   4379 C  CE2 . TYR A 1 574 ? 23.618  6.608   25.089  1.00 51.04  ? 345  TYR A CE2 1 
ATOM   4380 C  CZ  . TYR A 1 574 ? 24.035  7.896   24.831  1.00 54.45  ? 345  TYR A CZ  1 
ATOM   4381 O  OH  . TYR A 1 574 ? 25.021  8.117   23.896  1.00 62.83  ? 345  TYR A OH  1 
ATOM   4382 N  N   . PHE A 1 575 ? 18.889  4.981   26.596  1.00 49.29  ? 346  PHE A N   1 
ATOM   4383 C  CA  . PHE A 1 575 ? 18.704  3.850   25.691  1.00 51.50  ? 346  PHE A CA  1 
ATOM   4384 C  C   . PHE A 1 575 ? 17.275  3.769   25.141  1.00 54.78  ? 346  PHE A C   1 
ATOM   4385 O  O   . PHE A 1 575 ? 16.999  2.999   24.218  1.00 53.78  ? 346  PHE A O   1 
ATOM   4386 C  CB  . PHE A 1 575 ? 19.064  2.539   26.400  1.00 49.61  ? 346  PHE A CB  1 
ATOM   4387 C  CG  . PHE A 1 575 ? 20.506  2.451   26.830  1.00 51.24  ? 346  PHE A CG  1 
ATOM   4388 C  CD1 . PHE A 1 575 ? 21.514  3.068   26.095  1.00 49.46  ? 346  PHE A CD1 1 
ATOM   4389 C  CD2 . PHE A 1 575 ? 20.855  1.747   27.976  1.00 50.39  ? 346  PHE A CD2 1 
ATOM   4390 C  CE1 . PHE A 1 575 ? 22.842  2.983   26.498  1.00 46.86  ? 346  PHE A CE1 1 
ATOM   4391 C  CE2 . PHE A 1 575 ? 22.180  1.658   28.385  1.00 45.65  ? 346  PHE A CE2 1 
ATOM   4392 C  CZ  . PHE A 1 575 ? 23.174  2.276   27.645  1.00 46.42  ? 346  PHE A CZ  1 
ATOM   4393 N  N   . VAL A 1 576 ? 16.373  4.568   25.706  1.00 53.48  ? 347  VAL A N   1 
ATOM   4394 C  CA  . VAL A 1 576 ? 14.979  4.582   25.268  1.00 56.55  ? 347  VAL A CA  1 
ATOM   4395 C  C   . VAL A 1 576 ? 14.627  5.876   24.530  1.00 57.86  ? 347  VAL A C   1 
ATOM   4396 O  O   . VAL A 1 576 ? 14.191  5.849   23.380  1.00 64.38  ? 347  VAL A O   1 
ATOM   4397 C  CB  . VAL A 1 576 ? 14.017  4.399   26.462  1.00 56.93  ? 347  VAL A CB  1 
ATOM   4398 C  CG1 . VAL A 1 576 ? 12.568  4.570   26.023  1.00 53.92  ? 347  VAL A CG1 1 
ATOM   4399 C  CG2 . VAL A 1 576 ? 14.227  3.037   27.104  1.00 54.62  ? 347  VAL A CG2 1 
ATOM   4400 N  N   . SER A 1 577 ? 14.814  7.008   25.199  1.00 59.94  ? 348  SER A N   1 
ATOM   4401 C  CA  . SER A 1 577 ? 14.502  8.303   24.608  1.00 60.23  ? 348  SER A CA  1 
ATOM   4402 C  C   . SER A 1 577 ? 15.581  8.723   23.620  1.00 63.27  ? 348  SER A C   1 
ATOM   4403 O  O   . SER A 1 577 ? 16.774  8.675   23.920  1.00 60.09  ? 348  SER A O   1 
ATOM   4404 C  CB  . SER A 1 577 ? 14.337  9.371   25.694  1.00 59.18  ? 348  SER A CB  1 
ATOM   4405 O  OG  . SER A 1 577 ? 14.027  10.636  25.132  1.00 58.43  ? 348  SER A OG  1 
ATOM   4406 N  N   . HIS A 1 578 ? 15.146  9.134   22.436  1.00 69.09  ? 349  HIS A N   1 
ATOM   4407 C  CA  . HIS A 1 578 ? 16.058  9.586   21.400  1.00 68.50  ? 349  HIS A CA  1 
ATOM   4408 C  C   . HIS A 1 578 ? 16.370  11.060  21.610  1.00 66.47  ? 349  HIS A C   1 
ATOM   4409 O  O   . HIS A 1 578 ? 17.470  11.527  21.312  1.00 70.27  ? 349  HIS A O   1 
ATOM   4410 C  CB  . HIS A 1 578 ? 15.450  9.337   20.019  1.00 76.25  ? 349  HIS A CB  1 
ATOM   4411 C  CG  . HIS A 1 578 ? 14.748  8.020   19.903  1.00 86.87  ? 349  HIS A CG  1 
ATOM   4412 N  ND1 . HIS A 1 578 ? 13.479  7.805   20.406  1.00 81.93  ? 349  HIS A ND1 1 
ATOM   4413 C  CD2 . HIS A 1 578 ? 15.137  6.844   19.358  1.00 85.94  ? 349  HIS A CD2 1 
ATOM   4414 C  CE1 . HIS A 1 578 ? 13.119  6.557   20.168  1.00 84.05  ? 349  HIS A CE1 1 
ATOM   4415 N  NE2 . HIS A 1 578 ? 14.108  5.952   19.532  1.00 90.92  ? 349  HIS A NE2 1 
ATOM   4416 N  N   . ASP A 1 579 ? 15.391  11.784  22.143  1.00 68.17  ? 350  ASP A N   1 
ATOM   4417 C  CA  . ASP A 1 579 ? 15.544  13.203  22.432  1.00 69.75  ? 350  ASP A CA  1 
ATOM   4418 C  C   . ASP A 1 579 ? 16.448  13.439  23.640  1.00 65.77  ? 350  ASP A C   1 
ATOM   4419 O  O   . ASP A 1 579 ? 17.123  14.464  23.727  1.00 66.08  ? 350  ASP A O   1 
ATOM   4420 C  CB  . ASP A 1 579 ? 14.174  13.843  22.664  1.00 71.87  ? 350  ASP A CB  1 
ATOM   4421 C  CG  . ASP A 1 579 ? 13.251  13.683  21.473  1.00 78.54  ? 350  ASP A CG  1 
ATOM   4422 O  OD1 . ASP A 1 579 ? 13.751  13.708  20.329  1.00 79.70  ? 350  ASP A OD1 1 
ATOM   4423 O  OD2 . ASP A 1 579 ? 12.029  13.530  21.679  1.00 90.56  ? 350  ASP A OD2 1 
ATOM   4424 N  N   . PHE A 1 580 ? 16.457  12.490  24.572  1.00 62.75  ? 351  PHE A N   1 
ATOM   4425 C  CA  . PHE A 1 580 ? 17.302  12.614  25.755  1.00 61.58  ? 351  PHE A CA  1 
ATOM   4426 C  C   . PHE A 1 580 ? 18.774  12.479  25.389  1.00 63.50  ? 351  PHE A C   1 
ATOM   4427 O  O   . PHE A 1 580 ? 19.629  13.126  25.991  1.00 65.09  ? 351  PHE A O   1 
ATOM   4428 C  CB  . PHE A 1 580 ? 16.925  11.573  26.812  1.00 60.27  ? 351  PHE A CB  1 
ATOM   4429 C  CG  . PHE A 1 580 ? 17.750  11.663  28.068  1.00 56.58  ? 351  PHE A CG  1 
ATOM   4430 C  CD1 . PHE A 1 580 ? 17.613  12.739  28.928  1.00 55.25  ? 351  PHE A CD1 1 
ATOM   4431 C  CD2 . PHE A 1 580 ? 18.662  10.671  28.387  1.00 56.37  ? 351  PHE A CD2 1 
ATOM   4432 C  CE1 . PHE A 1 580 ? 18.372  12.825  30.079  1.00 57.04  ? 351  PHE A CE1 1 
ATOM   4433 C  CE2 . PHE A 1 580 ? 19.422  10.749  29.537  1.00 54.02  ? 351  PHE A CE2 1 
ATOM   4434 C  CZ  . PHE A 1 580 ? 19.277  11.828  30.385  1.00 54.24  ? 351  PHE A CZ  1 
ATOM   4435 N  N   . ARG A 1 581 ? 19.061  11.639  24.399  1.00 63.98  ? 352  ARG A N   1 
ATOM   4436 C  CA  . ARG A 1 581 ? 20.426  11.454  23.922  1.00 63.17  ? 352  ARG A CA  1 
ATOM   4437 C  C   . ARG A 1 581 ? 21.024  12.755  23.397  1.00 67.02  ? 352  ARG A C   1 
ATOM   4438 O  O   . ARG A 1 581 ? 22.172  13.081  23.693  1.00 69.57  ? 352  ARG A O   1 
ATOM   4439 C  CB  . ARG A 1 581 ? 20.474  10.396  22.826  1.00 60.40  ? 352  ARG A CB  1 
ATOM   4440 C  CG  . ARG A 1 581 ? 20.000  9.026   23.248  1.00 58.36  ? 352  ARG A CG  1 
ATOM   4441 C  CD  . ARG A 1 581 ? 20.415  7.985   22.220  1.00 62.41  ? 352  ARG A CD  1 
ATOM   4442 N  NE  . ARG A 1 581 ? 19.632  6.760   22.331  1.00 66.34  ? 352  ARG A NE  1 
ATOM   4443 C  CZ  . ARG A 1 581 ? 18.630  6.440   21.519  1.00 64.66  ? 352  ARG A CZ  1 
ATOM   4444 N  NH1 . ARG A 1 581 ? 18.296  7.251   20.525  1.00 65.30  ? 352  ARG A NH1 1 
ATOM   4445 N  NH2 . ARG A 1 581 ? 17.967  5.305   21.694  1.00 64.37  ? 352  ARG A NH2 1 
ATOM   4446 N  N   . ASP A 1 582 ? 20.240  13.488  22.613  1.00 66.29  ? 353  ASP A N   1 
ATOM   4447 C  CA  . ASP A 1 582 ? 20.683  14.764  22.058  1.00 69.69  ? 353  ASP A CA  1 
ATOM   4448 C  C   . ASP A 1 582 ? 21.097  15.739  23.158  1.00 72.53  ? 353  ASP A C   1 
ATOM   4449 O  O   . ASP A 1 582 ? 22.163  16.348  23.089  1.00 76.88  ? 353  ASP A O   1 
ATOM   4450 C  CB  . ASP A 1 582 ? 19.583  15.390  21.193  1.00 72.12  ? 353  ASP A CB  1 
ATOM   4451 C  CG  . ASP A 1 582 ? 19.359  14.638  19.891  1.00 69.92  ? 353  ASP A CG  1 
ATOM   4452 O  OD1 . ASP A 1 582 ? 19.563  13.405  19.866  1.00 66.88  ? 353  ASP A OD1 1 
ATOM   4453 O  OD2 . ASP A 1 582 ? 18.977  15.281  18.891  1.00 72.32  ? 353  ASP A OD2 1 
ATOM   4454 N  N   . HIS A 1 583 ? 20.255  15.880  24.175  1.00 71.85  ? 354  HIS A N   1 
ATOM   4455 C  CA  . HIS A 1 583 ? 20.543  16.795  25.271  1.00 73.78  ? 354  HIS A CA  1 
ATOM   4456 C  C   . HIS A 1 583 ? 21.631  16.240  26.180  1.00 74.70  ? 354  HIS A C   1 
ATOM   4457 O  O   . HIS A 1 583 ? 22.307  16.992  26.883  1.00 77.23  ? 354  HIS A O   1 
ATOM   4458 C  CB  . HIS A 1 583 ? 19.275  17.085  26.074  1.00 72.32  ? 354  HIS A CB  1 
ATOM   4459 C  CG  . HIS A 1 583 ? 18.224  17.806  25.292  1.00 72.19  ? 354  HIS A CG  1 
ATOM   4460 N  ND1 . HIS A 1 583 ? 17.446  17.184  24.340  1.00 70.96  ? 354  HIS A ND1 1 
ATOM   4461 C  CD2 . HIS A 1 583 ? 17.836  19.104  25.307  1.00 72.97  ? 354  HIS A CD2 1 
ATOM   4462 C  CE1 . HIS A 1 583 ? 16.617  18.062  23.809  1.00 71.47  ? 354  HIS A CE1 1 
ATOM   4463 N  NE2 . HIS A 1 583 ? 16.833  19.237  24.376  1.00 73.57  ? 354  HIS A NE2 1 
ATOM   4464 N  N   . ALA A 1 584 ? 21.798  14.922  26.158  1.00 71.63  ? 355  ALA A N   1 
ATOM   4465 C  CA  . ALA A 1 584 ? 22.854  14.279  26.930  1.00 74.04  ? 355  ALA A CA  1 
ATOM   4466 C  C   . ALA A 1 584 ? 24.203  14.496  26.259  1.00 78.53  ? 355  ALA A C   1 
ATOM   4467 O  O   . ALA A 1 584 ? 25.190  14.815  26.920  1.00 83.36  ? 355  ALA A O   1 
ATOM   4468 C  CB  . ALA A 1 584 ? 22.574  12.793  27.092  1.00 68.36  ? 355  ALA A CB  1 
ATOM   4469 N  N   . LYS A 1 585 ? 24.235  14.325  24.941  1.00 77.20  ? 356  LYS A N   1 
ATOM   4470 C  CA  . LYS A 1 585 ? 25.471  14.457  24.182  1.00 78.50  ? 356  LYS A CA  1 
ATOM   4471 C  C   . LYS A 1 585 ? 25.921  15.914  24.065  1.00 85.07  ? 356  LYS A C   1 
ATOM   4472 O  O   . LYS A 1 585 ? 27.105  16.213  24.226  1.00 93.19  ? 356  LYS A O   1 
ATOM   4473 C  CB  . LYS A 1 585 ? 25.306  13.839  22.791  1.00 74.83  ? 356  LYS A CB  1 
ATOM   4474 C  CG  . LYS A 1 585 ? 25.115  12.328  22.803  1.00 70.36  ? 356  LYS A CG  1 
ATOM   4475 C  CD  . LYS A 1 585 ? 24.827  11.796  21.407  1.00 66.26  ? 356  LYS A CD  1 
ATOM   4476 C  CE  . LYS A 1 585 ? 24.549  10.302  21.424  1.00 64.01  ? 356  LYS A CE  1 
ATOM   4477 N  NZ  . LYS A 1 585 ? 24.256  9.782   20.058  1.00 64.05  ? 356  LYS A NZ  1 
ATOM   4478 N  N   . ASN A 1 586 ? 24.981  16.814  23.789  1.00 83.32  ? 357  ASN A N   1 
ATOM   4479 C  CA  . ASN A 1 586 ? 25.304  18.234  23.651  1.00 87.51  ? 357  ASN A CA  1 
ATOM   4480 C  C   . ASN A 1 586 ? 25.865  18.837  24.936  1.00 93.23  ? 357  ASN A C   1 
ATOM   4481 O  O   . ASN A 1 586 ? 26.748  19.695  24.893  1.00 98.96  ? 357  ASN A O   1 
ATOM   4482 C  CB  . ASN A 1 586 ? 24.072  19.028  23.209  1.00 83.76  ? 357  ASN A CB  1 
ATOM   4483 C  CG  . ASN A 1 586 ? 23.729  18.811  21.749  1.00 91.72  ? 357  ASN A CG  1 
ATOM   4484 O  OD1 . ASN A 1 586 ? 24.599  18.506  20.932  1.00 93.15  ? 357  ASN A OD1 1 
ATOM   4485 N  ND2 . ASN A 1 586 ? 22.455  18.972  21.411  1.00 95.97  ? 357  ASN A ND2 1 
ATOM   4486 N  N   . ALA A 1 587 ? 25.346  18.387  26.074  1.00 91.21  ? 358  ALA A N   1 
ATOM   4487 C  CA  . ALA A 1 587 ? 25.803  18.876  27.369  1.00 95.02  ? 358  ALA A CA  1 
ATOM   4488 C  C   . ALA A 1 587 ? 27.252  18.474  27.622  1.00 100.29 ? 358  ALA A C   1 
ATOM   4489 O  O   . ALA A 1 587 ? 28.033  19.248  28.175  1.00 104.93 ? 358  ALA A O   1 
ATOM   4490 C  CB  . ALA A 1 587 ? 24.904  18.357  28.479  1.00 92.88  ? 358  ALA A CB  1 
ATOM   4491 N  N   . LEU A 1 588 ? 27.605  17.259  27.214  1.00 98.11  ? 359  LEU A N   1 
ATOM   4492 C  CA  . LEU A 1 588 ? 28.967  16.764  27.374  1.00 100.13 ? 359  LEU A CA  1 
ATOM   4493 C  C   . LEU A 1 588 ? 29.446  16.061  26.108  1.00 97.38  ? 359  LEU A C   1 
ATOM   4494 O  O   . LEU A 1 588 ? 29.812  16.709  25.127  1.00 94.53  ? 359  LEU A O   1 
ATOM   4495 C  CB  . LEU A 1 588 ? 29.064  15.815  28.574  1.00 106.10 ? 359  LEU A CB  1 
ATOM   4496 C  CG  . LEU A 1 588 ? 28.847  16.406  29.971  1.00 114.15 ? 359  LEU A CG  1 
ATOM   4497 C  CD1 . LEU A 1 588 ? 27.377  16.359  30.364  1.00 112.59 ? 359  LEU A CD1 1 
ATOM   4498 C  CD2 . LEU A 1 588 ? 29.689  15.669  31.002  1.00 118.50 ? 359  LEU A CD2 1 
HETATM 4499 C  C1  . 8TZ B 2 .   ? 14.509  6.753   55.807  1.00 42.72  ? 2201 8TZ A C1  1 
HETATM 4500 C  C2  . 8TZ B 2 .   ? 14.174  5.788   54.814  1.00 43.46  ? 2201 8TZ A C2  1 
HETATM 4501 C  C3  . 8TZ B 2 .   ? 15.168  4.943   54.287  1.00 38.89  ? 2201 8TZ A C3  1 
HETATM 4502 C  C4  . 8TZ B 2 .   ? 16.485  5.052   54.742  1.00 39.87  ? 2201 8TZ A C4  1 
HETATM 4503 C  C5  . 8TZ B 2 .   ? 16.819  6.007   55.725  1.00 42.20  ? 2201 8TZ A C5  1 
HETATM 4504 C  C6  . 8TZ B 2 .   ? 15.822  6.854   56.257  1.00 41.51  ? 2201 8TZ A C6  1 
HETATM 4505 C  C7  . 8TZ B 2 .   ? 16.189  7.893   57.329  1.00 40.13  ? 2201 8TZ A C7  1 
HETATM 4506 C  C8  . 8TZ B 2 .   ? 15.767  9.296   56.853  1.00 41.71  ? 2201 8TZ A C8  1 
HETATM 4507 C  C9  . 8TZ B 2 .   ? 18.236  6.113   56.207  1.00 40.30  ? 2201 8TZ A C9  1 
HETATM 4508 C  C10 . 8TZ B 2 .   ? 18.940  4.779   56.002  1.00 41.25  ? 2201 8TZ A C10 1 
HETATM 4509 O  O1  . 8TZ B 2 .   ? 18.917  7.111   55.481  1.00 39.34  ? 2201 8TZ A O1  1 
HETATM 4510 N  N1  . 8TZ B 2 .   ? 19.823  4.492   55.017  1.00 44.91  ? 2201 8TZ A N1  1 
HETATM 4511 C  C11 . 8TZ B 2 .   ? 20.221  3.210   55.182  1.00 45.85  ? 2201 8TZ A C11 1 
HETATM 4512 C  C12 . 8TZ B 2 .   ? 19.581  2.707   56.268  1.00 48.81  ? 2201 8TZ A C12 1 
HETATM 4513 N  N2  . 8TZ B 2 .   ? 18.791  3.674   56.774  1.00 43.37  ? 2201 8TZ A N2  1 
HETATM 4514 F  F1  . 8TZ B 2 .   ? 12.889  5.683   54.373  1.00 43.11  ? 2201 8TZ A F1  1 
HETATM 4515 C  C13 . 8TZ B 2 .   ? 16.232  10.379  57.931  1.00 41.81  ? 2201 8TZ A C13 1 
HETATM 4516 NA NA  . NA  C 3 .   ? 13.874  5.728   40.463  1.00 49.57  ? 2202 NA  A NA  1 
HETATM 4517 P  P   . PO4 D 4 .   ? 1.627   9.395   78.733  1.00 90.60  ? 2203 PO4 A P   1 
HETATM 4518 O  O1  . PO4 D 4 .   ? 0.466   10.131  78.108  1.00 88.88  ? 2203 PO4 A O1  1 
HETATM 4519 O  O2  . PO4 D 4 .   ? 2.924   9.965   78.208  1.00 91.15  ? 2203 PO4 A O2  1 
HETATM 4520 O  O3  . PO4 D 4 .   ? 1.543   7.931   78.371  1.00 68.84  ? 2203 PO4 A O3  1 
HETATM 4521 O  O4  . PO4 D 4 .   ? 1.573   9.551   80.235  1.00 75.42  ? 2203 PO4 A O4  1 
HETATM 4522 O  O   . HOH E 5 .   ? 13.642  5.432   64.449  1.00 43.32  ? 2301 HOH A O   1 
HETATM 4523 O  O   . HOH E 5 .   ? -9.692  24.478  105.022 1.00 94.92  ? 2302 HOH A O   1 
HETATM 4524 O  O   . HOH E 5 .   ? 4.067   8.742   49.071  1.00 47.70  ? 2303 HOH A O   1 
HETATM 4525 O  O   . HOH E 5 .   ? -6.286  8.089   94.857  1.00 72.15  ? 2304 HOH A O   1 
HETATM 4526 O  O   . HOH E 5 .   ? 18.394  4.959   52.280  1.00 42.09  ? 2305 HOH A O   1 
HETATM 4527 O  O   . HOH E 5 .   ? 21.767  -2.183  10.478  1.00 62.72  ? 2306 HOH A O   1 
HETATM 4528 O  O   . HOH E 5 .   ? 14.584  3.212   38.836  1.00 46.37  ? 2307 HOH A O   1 
HETATM 4529 O  O   . HOH E 5 .   ? 14.724  4.525   47.290  1.00 41.52  ? 2308 HOH A O   1 
HETATM 4530 O  O   . HOH E 5 .   ? -13.268 2.570   88.927  1.00 65.09  ? 2309 HOH A O   1 
HETATM 4531 O  O   . HOH E 5 .   ? -10.299 3.420   91.107  1.00 58.54  ? 2310 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   979  ?    ?   ?   A . n 
A 1 2   VAL 2   980  ?    ?   ?   A . n 
A 1 3   SER 3   981  ?    ?   ?   A . n 
A 1 4   ALA 4   982  ?    ?   ?   A . n 
A 1 5   ILE 5   983  ?    ?   ?   A . n 
A 1 6   VAL 6   984  ?    ?   ?   A . n 
A 1 7   LEU 7   985  ?    ?   ?   A . n 
A 1 8   TYR 8   986  ?    ?   ?   A . n 
A 1 9   VAL 9   987  ?    ?   ?   A . n 
A 1 10  LEU 10  988  ?    ?   ?   A . n 
A 1 11  LEU 11  989  ?    ?   ?   A . n 
A 1 12  ALA 12  990  ?    ?   ?   A . n 
A 1 13  ALA 13  991  ?    ?   ?   A . n 
A 1 14  ALA 14  992  ?    ?   ?   A . n 
A 1 15  ALA 15  993  ?    ?   ?   A . n 
A 1 16  HIS 16  994  ?    ?   ?   A . n 
A 1 17  SER 17  995  ?    ?   ?   A . n 
A 1 18  ALA 18  996  ?    ?   ?   A . n 
A 1 19  PHE 19  997  ?    ?   ?   A . n 
A 1 20  ALA 20  998  ?    ?   ?   A . n 
A 1 21  ALA 21  999  ?    ?   ?   A . n 
A 1 22  ALA 22  1000 1000 ALA ALA A . n 
A 1 23  SER 23  1001 1001 SER SER A . n 
A 1 24  ASN 24  1002 1002 ASN ASN A . n 
A 1 25  ILE 25  1003 1003 ILE ILE A . n 
A 1 26  PHE 26  1004 1004 PHE PHE A . n 
A 1 27  GLU 27  1005 1005 GLU GLU A . n 
A 1 28  MET 28  1006 1006 MET MET A . n 
A 1 29  LEU 29  1007 1007 LEU LEU A . n 
A 1 30  ARG 30  1008 1008 ARG ARG A . n 
A 1 31  ILE 31  1009 1009 ILE ILE A . n 
A 1 32  ASP 32  1010 1010 ASP ASP A . n 
A 1 33  GLU 33  1011 1011 GLU GLU A . n 
A 1 34  GLY 34  1012 1012 GLY GLY A . n 
A 1 35  LEU 35  1013 1013 LEU LEU A . n 
A 1 36  ARG 36  1014 1014 ARG ARG A . n 
A 1 37  LEU 37  1015 1015 LEU LEU A . n 
A 1 38  LYS 38  1016 1016 LYS LYS A . n 
A 1 39  ILE 39  1017 1017 ILE ILE A . n 
A 1 40  TYR 40  1018 1018 TYR TYR A . n 
A 1 41  LYS 41  1019 1019 LYS LYS A . n 
A 1 42  ASP 42  1020 1020 ASP ASP A . n 
A 1 43  THR 43  1021 1021 THR THR A . n 
A 1 44  GLU 44  1022 1022 GLU GLU A . n 
A 1 45  GLY 45  1023 1023 GLY GLY A . n 
A 1 46  TYR 46  1024 1024 TYR TYR A . n 
A 1 47  TYR 47  1025 1025 TYR TYR A . n 
A 1 48  THR 48  1026 1026 THR THR A . n 
A 1 49  ILE 49  1027 1027 ILE ILE A . n 
A 1 50  GLY 50  1028 1028 GLY GLY A . n 
A 1 51  ILE 51  1029 1029 ILE ILE A . n 
A 1 52  GLY 52  1030 1030 GLY GLY A . n 
A 1 53  HIS 53  1031 1031 HIS HIS A . n 
A 1 54  LEU 54  1032 1032 LEU LEU A . n 
A 1 55  LEU 55  1033 1033 LEU LEU A . n 
A 1 56  THR 56  1034 1034 THR THR A . n 
A 1 57  LYS 57  1035 1035 LYS LYS A . n 
A 1 58  SER 58  1036 1036 SER SER A . n 
A 1 59  PRO 59  1037 1037 PRO PRO A . n 
A 1 60  SER 60  1038 1038 SER SER A . n 
A 1 61  LEU 61  1039 1039 LEU LEU A . n 
A 1 62  ASN 62  1040 1040 ASN ASN A . n 
A 1 63  ALA 63  1041 1041 ALA ALA A . n 
A 1 64  ALA 64  1042 1042 ALA ALA A . n 
A 1 65  LYS 65  1043 1043 LYS LYS A . n 
A 1 66  SER 66  1044 1044 SER SER A . n 
A 1 67  GLU 67  1045 1045 GLU GLU A . n 
A 1 68  LEU 68  1046 1046 LEU LEU A . n 
A 1 69  ASP 69  1047 1047 ASP ASP A . n 
A 1 70  LYS 70  1048 1048 LYS LYS A . n 
A 1 71  ALA 71  1049 1049 ALA ALA A . n 
A 1 72  ILE 72  1050 1050 ILE ILE A . n 
A 1 73  GLY 73  1051 1051 GLY GLY A . n 
A 1 74  ARG 74  1052 1052 ARG ARG A . n 
A 1 75  ASN 75  1053 1053 ASN ASN A . n 
A 1 76  THR 76  1054 1054 THR THR A . n 
A 1 77  ASN 77  1055 1055 ASN ASN A . n 
A 1 78  GLY 78  1056 1056 GLY GLY A . n 
A 1 79  VAL 79  1057 1057 VAL VAL A . n 
A 1 80  ILE 80  1058 1058 ILE ILE A . n 
A 1 81  THR 81  1059 1059 THR THR A . n 
A 1 82  LYS 82  1060 1060 LYS LYS A . n 
A 1 83  ASP 83  1061 1061 ASP ASP A . n 
A 1 84  GLU 84  1062 1062 GLU GLU A . n 
A 1 85  ALA 85  1063 1063 ALA ALA A . n 
A 1 86  GLU 86  1064 1064 GLU GLU A . n 
A 1 87  LYS 87  1065 1065 LYS LYS A . n 
A 1 88  LEU 88  1066 1066 LEU LEU A . n 
A 1 89  PHE 89  1067 1067 PHE PHE A . n 
A 1 90  ASN 90  1068 1068 ASN ASN A . n 
A 1 91  GLN 91  1069 1069 GLN GLN A . n 
A 1 92  ASP 92  1070 1070 ASP ASP A . n 
A 1 93  VAL 93  1071 1071 VAL VAL A . n 
A 1 94  ASP 94  1072 1072 ASP ASP A . n 
A 1 95  ALA 95  1073 1073 ALA ALA A . n 
A 1 96  ALA 96  1074 1074 ALA ALA A . n 
A 1 97  VAL 97  1075 1075 VAL VAL A . n 
A 1 98  ARG 98  1076 1076 ARG ARG A . n 
A 1 99  GLY 99  1077 1077 GLY GLY A . n 
A 1 100 ILE 100 1078 1078 ILE ILE A . n 
A 1 101 LEU 101 1079 1079 LEU LEU A . n 
A 1 102 ARG 102 1080 1080 ARG ARG A . n 
A 1 103 ASN 103 1081 1081 ASN ASN A . n 
A 1 104 ALA 104 1082 1082 ALA ALA A . n 
A 1 105 LYS 105 1083 1083 LYS LYS A . n 
A 1 106 LEU 106 1084 1084 LEU LEU A . n 
A 1 107 LYS 107 1085 1085 LYS LYS A . n 
A 1 108 PRO 108 1086 1086 PRO PRO A . n 
A 1 109 VAL 109 1087 1087 VAL VAL A . n 
A 1 110 TYR 110 1088 1088 TYR TYR A . n 
A 1 111 ASP 111 1089 1089 ASP ASP A . n 
A 1 112 SER 112 1090 1090 SER SER A . n 
A 1 113 LEU 113 1091 1091 LEU LEU A . n 
A 1 114 ASP 114 1092 1092 ASP ASP A . n 
A 1 115 ALA 115 1093 1093 ALA ALA A . n 
A 1 116 VAL 116 1094 1094 VAL VAL A . n 
A 1 117 ARG 117 1095 1095 ARG ARG A . n 
A 1 118 ARG 118 1096 1096 ARG ARG A . n 
A 1 119 ALA 119 1097 1097 ALA ALA A . n 
A 1 120 ALA 120 1098 1098 ALA ALA A . n 
A 1 121 LEU 121 1099 1099 LEU LEU A . n 
A 1 122 ILE 122 1100 1100 ILE ILE A . n 
A 1 123 ASN 123 1101 1101 ASN ASN A . n 
A 1 124 MET 124 1102 1102 MET MET A . n 
A 1 125 VAL 125 1103 1103 VAL VAL A . n 
A 1 126 PHE 126 1104 1104 PHE PHE A . n 
A 1 127 GLN 127 1105 1105 GLN GLN A . n 
A 1 128 MET 128 1106 1106 MET MET A . n 
A 1 129 GLY 129 1107 1107 GLY GLY A . n 
A 1 130 GLU 130 1108 1108 GLU GLU A . n 
A 1 131 THR 131 1109 1109 THR THR A . n 
A 1 132 GLY 132 1110 1110 GLY GLY A . n 
A 1 133 VAL 133 1111 1111 VAL VAL A . n 
A 1 134 ALA 134 1112 1112 ALA ALA A . n 
A 1 135 GLY 135 1113 1113 GLY GLY A . n 
A 1 136 PHE 136 1114 1114 PHE PHE A . n 
A 1 137 THR 137 1115 1115 THR THR A . n 
A 1 138 ASN 138 1116 1116 ASN ASN A . n 
A 1 139 SER 139 1117 1117 SER SER A . n 
A 1 140 LEU 140 1118 1118 LEU LEU A . n 
A 1 141 ARG 141 1119 1119 ARG ARG A . n 
A 1 142 MET 142 1120 1120 MET MET A . n 
A 1 143 LEU 143 1121 1121 LEU LEU A . n 
A 1 144 GLN 144 1122 1122 GLN GLN A . n 
A 1 145 GLN 145 1123 1123 GLN GLN A . n 
A 1 146 LYS 146 1124 1124 LYS LYS A . n 
A 1 147 ARG 147 1125 1125 ARG ARG A . n 
A 1 148 TRP 148 1126 1126 TRP TRP A . n 
A 1 149 ASP 149 1127 1127 ASP ASP A . n 
A 1 150 GLU 150 1128 1128 GLU GLU A . n 
A 1 151 ALA 151 1129 1129 ALA ALA A . n 
A 1 152 ALA 152 1130 1130 ALA ALA A . n 
A 1 153 VAL 153 1131 1131 VAL VAL A . n 
A 1 154 ASN 154 1132 1132 ASN ASN A . n 
A 1 155 LEU 155 1133 1133 LEU LEU A . n 
A 1 156 ALA 156 1134 1134 ALA ALA A . n 
A 1 157 LYS 157 1135 1135 LYS LYS A . n 
A 1 158 SER 158 1136 1136 SER SER A . n 
A 1 159 ARG 159 1137 1137 ARG ARG A . n 
A 1 160 TRP 160 1138 1138 TRP TRP A . n 
A 1 161 TYR 161 1139 1139 TYR TYR A . n 
A 1 162 ASN 162 1140 1140 ASN ASN A . n 
A 1 163 GLN 163 1141 1141 GLN GLN A . n 
A 1 164 THR 164 1142 1142 THR THR A . n 
A 1 165 PRO 165 1143 1143 PRO PRO A . n 
A 1 166 ASN 166 1144 1144 ASN ASN A . n 
A 1 167 ARG 167 1145 1145 ARG ARG A . n 
A 1 168 ALA 168 1146 1146 ALA ALA A . n 
A 1 169 LYS 169 1147 1147 LYS LYS A . n 
A 1 170 ARG 170 1148 1148 ARG ARG A . n 
A 1 171 VAL 171 1149 1149 VAL VAL A . n 
A 1 172 ILE 172 1150 1150 ILE ILE A . n 
A 1 173 THR 173 1151 1151 THR THR A . n 
A 1 174 THR 174 1152 1152 THR THR A . n 
A 1 175 PHE 175 1153 1153 PHE PHE A . n 
A 1 176 ARG 176 1154 1154 ARG ARG A . n 
A 1 177 THR 177 1155 1155 THR THR A . n 
A 1 178 GLY 178 1156 1156 GLY GLY A . n 
A 1 179 THR 179 1157 1157 THR THR A . n 
A 1 180 TRP 180 1158 1158 TRP TRP A . n 
A 1 181 ASP 181 1159 1159 ASP ASP A . n 
A 1 182 ALA 182 1160 1160 ALA ALA A . n 
A 1 183 TYR 183 1161 1161 TYR TYR A . n 
A 1 184 ILE 184 1162 1162 ILE ILE A . n 
A 1 185 TYR 185 1163 1163 TYR TYR A . n 
A 1 186 GLU 186 1164 1164 GLU GLU A . n 
A 1 187 PHE 187 1165 1165 PHE PHE A . n 
A 1 188 PHE 188 59   59   PHE PHE A . n 
A 1 189 SER 189 60   60   SER SER A . n 
A 1 190 VAL 190 61   61   VAL VAL A . n 
A 1 191 ASP 191 62   62   ASP ASP A . n 
A 1 192 GLU 192 63   63   GLU GLU A . n 
A 1 193 PHE 193 64   64   PHE PHE A . n 
A 1 194 SER 194 65   65   SER SER A . n 
A 1 195 ALA 195 66   66   ALA ALA A . n 
A 1 196 SER 196 67   67   SER SER A . n 
A 1 197 VAL 197 68   68   VAL VAL A . n 
A 1 198 LEU 198 69   69   LEU LEU A . n 
A 1 199 THR 199 70   70   THR THR A . n 
A 1 200 GLY 200 71   71   GLY GLY A . n 
A 1 201 LYS 201 72   72   LYS LYS A . n 
A 1 202 LEU 202 73   73   LEU LEU A . n 
A 1 203 THR 203 74   74   THR THR A . n 
A 1 204 THR 204 75   75   THR THR A . n 
A 1 205 VAL 205 76   76   VAL VAL A . n 
A 1 206 PHE 206 77   77   PHE PHE A . n 
A 1 207 LEU 207 78   78   LEU LEU A . n 
A 1 208 PRO 208 79   79   PRO PRO A . n 
A 1 209 ILE 209 80   80   ILE ILE A . n 
A 1 210 VAL 210 81   81   VAL VAL A . n 
A 1 211 TYR 211 82   82   TYR TYR A . n 
A 1 212 THR 212 83   83   THR THR A . n 
A 1 213 ILE 213 84   84   ILE ILE A . n 
A 1 214 VAL 214 85   85   VAL VAL A . n 
A 1 215 PHE 215 86   86   PHE PHE A . n 
A 1 216 VAL 216 87   87   VAL VAL A . n 
A 1 217 VAL 217 88   88   VAL VAL A . n 
A 1 218 ALA 218 89   89   ALA ALA A . n 
A 1 219 LEU 219 90   90   LEU LEU A . n 
A 1 220 PRO 220 91   91   PRO PRO A . n 
A 1 221 SER 221 92   92   SER SER A . n 
A 1 222 ASN 222 93   93   ASN ASN A . n 
A 1 223 GLY 223 94   94   GLY GLY A . n 
A 1 224 MET 224 95   95   MET MET A . n 
A 1 225 ALA 225 96   96   ALA ALA A . n 
A 1 226 LEU 226 97   97   LEU LEU A . n 
A 1 227 TRP 227 98   98   TRP TRP A . n 
A 1 228 VAL 228 99   99   VAL VAL A . n 
A 1 229 PHE 229 100  100  PHE PHE A . n 
A 1 230 LEU 230 101  101  LEU LEU A . n 
A 1 231 PHE 231 102  102  PHE PHE A . n 
A 1 232 ARG 232 103  103  ARG ARG A . n 
A 1 233 THR 233 104  104  THR THR A . n 
A 1 234 LYS 234 105  105  LYS LYS A . n 
A 1 235 LYS 235 106  106  LYS LYS A . n 
A 1 236 LYS 236 107  107  LYS LYS A . n 
A 1 237 ALA 237 108  108  ALA ALA A . n 
A 1 238 PRO 238 109  109  PRO PRO A . n 
A 1 239 ALA 239 110  110  ALA ALA A . n 
A 1 240 VAL 240 111  111  VAL VAL A . n 
A 1 241 ILE 241 112  112  ILE ILE A . n 
A 1 242 TYR 242 113  113  TYR TYR A . n 
A 1 243 MET 243 114  114  MET MET A . n 
A 1 244 ALA 244 115  115  ALA ALA A . n 
A 1 245 ASN 245 116  116  ASN ASN A . n 
A 1 246 LEU 246 117  117  LEU LEU A . n 
A 1 247 ALA 247 118  118  ALA ALA A . n 
A 1 248 LEU 248 119  119  LEU LEU A . n 
A 1 249 ALA 249 120  120  ALA ALA A . n 
A 1 250 ASP 250 121  121  ASP ASP A . n 
A 1 251 LEU 251 122  122  LEU LEU A . n 
A 1 252 LEU 252 123  123  LEU LEU A . n 
A 1 253 SER 253 124  124  SER SER A . n 
A 1 254 VAL 254 125  125  VAL VAL A . n 
A 1 255 ILE 255 126  126  ILE ILE A . n 
A 1 256 TRP 256 127  127  TRP TRP A . n 
A 1 257 PHE 257 128  128  PHE PHE A . n 
A 1 258 PRO 258 129  129  PRO PRO A . n 
A 1 259 LEU 259 130  130  LEU LEU A . n 
A 1 260 LYS 260 131  131  LYS LYS A . n 
A 1 261 ILE 261 132  132  ILE ILE A . n 
A 1 262 ALA 262 133  133  ALA ALA A . n 
A 1 263 TYR 263 134  134  TYR TYR A . n 
A 1 264 HIS 264 135  135  HIS HIS A . n 
A 1 265 ILE 265 136  136  ILE ILE A . n 
A 1 266 HIS 266 137  137  HIS HIS A . n 
A 1 267 GLY 267 138  138  GLY GLY A . n 
A 1 268 ASN 268 139  139  ASN ASN A . n 
A 1 269 ASN 269 140  140  ASN ASN A . n 
A 1 270 TRP 270 141  141  TRP TRP A . n 
A 1 271 ILE 271 142  142  ILE ILE A . n 
A 1 272 TYR 272 143  143  TYR TYR A . n 
A 1 273 GLY 273 144  144  GLY GLY A . n 
A 1 274 GLU 274 145  145  GLU GLU A . n 
A 1 275 ALA 275 146  146  ALA ALA A . n 
A 1 276 LEU 276 147  147  LEU LEU A . n 
A 1 277 CYS 277 148  148  CYS CYS A . n 
A 1 278 ASN 278 149  149  ASN ASN A . n 
A 1 279 VAL 279 150  150  VAL VAL A . n 
A 1 280 LEU 280 151  151  LEU LEU A . n 
A 1 281 ILE 281 152  152  ILE ILE A . n 
A 1 282 GLY 282 153  153  GLY GLY A . n 
A 1 283 PHE 283 154  154  PHE PHE A . n 
A 1 284 PHE 284 155  155  PHE PHE A . n 
A 1 285 TYR 285 156  156  TYR TYR A . n 
A 1 286 ALA 286 157  157  ALA ALA A . n 
A 1 287 ASN 287 158  158  ASN ASN A . n 
A 1 288 MET 288 159  159  MET MET A . n 
A 1 289 TYR 289 160  160  TYR TYR A . n 
A 1 290 CYS 290 161  161  CYS CYS A . n 
A 1 291 SER 291 162  162  SER SER A . n 
A 1 292 ILE 292 163  163  ILE ILE A . n 
A 1 293 LEU 293 164  164  LEU LEU A . n 
A 1 294 PHE 294 165  165  PHE PHE A . n 
A 1 295 LEU 295 166  166  LEU LEU A . n 
A 1 296 THR 296 167  167  THR THR A . n 
A 1 297 CYS 297 168  168  CYS CYS A . n 
A 1 298 LEU 298 169  169  LEU LEU A . n 
A 1 299 SER 299 170  170  SER SER A . n 
A 1 300 VAL 300 171  171  VAL VAL A . n 
A 1 301 GLN 301 172  172  GLN GLN A . n 
A 1 302 ARG 302 173  173  ARG ARG A . n 
A 1 303 ALA 303 174  174  ALA ALA A . n 
A 1 304 TRP 304 175  175  TRP TRP A . n 
A 1 305 GLU 305 176  176  GLU GLU A . n 
A 1 306 ILE 306 177  177  ILE ILE A . n 
A 1 307 VAL 307 178  178  VAL VAL A . n 
A 1 308 ASN 308 179  179  ASN ASN A . n 
A 1 309 PRO 309 180  180  PRO PRO A . n 
A 1 310 MET 310 181  181  MET MET A . n 
A 1 311 GLY 311 182  182  GLY GLY A . n 
A 1 312 HIS 312 183  183  HIS HIS A . n 
A 1 313 SER 313 184  184  SER SER A . n 
A 1 314 ARG 314 185  185  ARG ARG A . n 
A 1 315 LYS 315 186  186  LYS LYS A . n 
A 1 316 LYS 316 187  187  LYS LYS A . n 
A 1 317 ALA 317 188  188  ALA ALA A . n 
A 1 318 ASN 318 189  189  ASN ASN A . n 
A 1 319 ILE 319 190  190  ILE ILE A . n 
A 1 320 ALA 320 191  191  ALA ALA A . n 
A 1 321 ILE 321 192  192  ILE ILE A . n 
A 1 322 GLY 322 193  193  GLY GLY A . n 
A 1 323 ILE 323 194  194  ILE ILE A . n 
A 1 324 SER 324 195  195  SER SER A . n 
A 1 325 LEU 325 196  196  LEU LEU A . n 
A 1 326 ALA 326 197  197  ALA ALA A . n 
A 1 327 ILE 327 198  198  ILE ILE A . n 
A 1 328 TRP 328 199  199  TRP TRP A . n 
A 1 329 LEU 329 200  200  LEU LEU A . n 
A 1 330 LEU 330 201  201  LEU LEU A . n 
A 1 331 ILE 331 202  202  ILE ILE A . n 
A 1 332 LEU 332 203  203  LEU LEU A . n 
A 1 333 LEU 333 204  204  LEU LEU A . n 
A 1 334 VAL 334 205  205  VAL VAL A . n 
A 1 335 THR 335 206  206  THR THR A . n 
A 1 336 ILE 336 207  207  ILE ILE A . n 
A 1 337 PRO 337 208  208  PRO PRO A . n 
A 1 338 LEU 338 209  209  LEU LEU A . n 
A 1 339 TYR 339 210  210  TYR TYR A . n 
A 1 340 VAL 340 211  211  VAL VAL A . n 
A 1 341 VAL 341 212  212  VAL VAL A . n 
A 1 342 LYS 342 213  213  LYS LYS A . n 
A 1 343 GLN 343 214  214  GLN GLN A . n 
A 1 344 THR 344 215  215  THR THR A . n 
A 1 345 ILE 345 216  216  ILE ILE A . n 
A 1 346 PHE 346 217  217  PHE PHE A . n 
A 1 347 ILE 347 218  218  ILE ILE A . n 
A 1 348 PRO 348 219  219  PRO PRO A . n 
A 1 349 ALA 349 220  220  ALA ALA A . n 
A 1 350 LEU 350 221  221  LEU LEU A . n 
A 1 351 GLN 351 222  222  GLN GLN A . n 
A 1 352 ILE 352 223  223  ILE ILE A . n 
A 1 353 THR 353 224  224  THR THR A . n 
A 1 354 THR 354 225  225  THR THR A . n 
A 1 355 CYS 355 226  226  CYS CYS A . n 
A 1 356 HIS 356 227  227  HIS HIS A . n 
A 1 357 ASP 357 228  228  ASP ASP A . n 
A 1 358 VAL 358 229  229  VAL VAL A . n 
A 1 359 LEU 359 230  230  LEU LEU A . n 
A 1 360 PRO 360 231  231  PRO PRO A . n 
A 1 361 GLU 361 232  232  GLU GLU A . n 
A 1 362 GLN 362 233  233  GLN GLN A . n 
A 1 363 LEU 363 234  234  LEU LEU A . n 
A 1 364 LEU 364 235  235  LEU LEU A . n 
A 1 365 VAL 365 236  236  VAL VAL A . n 
A 1 366 GLY 366 237  237  GLY GLY A . n 
A 1 367 ASP 367 238  238  ASP ASP A . n 
A 1 368 MET 368 239  239  MET MET A . n 
A 1 369 PHE 369 240  240  PHE PHE A . n 
A 1 370 ASN 370 241  241  ASN ASN A . n 
A 1 371 TYR 371 242  242  TYR TYR A . n 
A 1 372 PHE 372 243  243  PHE PHE A . n 
A 1 373 LEU 373 244  244  LEU LEU A . n 
A 1 374 SER 374 245  245  SER SER A . n 
A 1 375 LEU 375 246  246  LEU LEU A . n 
A 1 376 ALA 376 247  247  ALA ALA A . n 
A 1 377 ILE 377 248  248  ILE ILE A . n 
A 1 378 GLY 378 249  249  GLY GLY A . n 
A 1 379 VAL 379 250  250  VAL VAL A . n 
A 1 380 PHE 380 251  251  PHE PHE A . n 
A 1 381 LEU 381 252  252  LEU LEU A . n 
A 1 382 PHE 382 253  253  PHE PHE A . n 
A 1 383 PRO 383 254  254  PRO PRO A . n 
A 1 384 ALA 384 255  255  ALA ALA A . n 
A 1 385 PHE 385 256  256  PHE PHE A . n 
A 1 386 LEU 386 257  257  LEU LEU A . n 
A 1 387 THR 387 258  258  THR THR A . n 
A 1 388 ALA 388 259  259  ALA ALA A . n 
A 1 389 SER 389 260  260  SER SER A . n 
A 1 390 ALA 390 261  261  ALA ALA A . n 
A 1 391 TYR 391 262  262  TYR TYR A . n 
A 1 392 VAL 392 263  263  VAL VAL A . n 
A 1 393 LEU 393 264  264  LEU LEU A . n 
A 1 394 MET 394 265  265  MET MET A . n 
A 1 395 ILE 395 266  266  ILE ILE A . n 
A 1 396 ARG 396 267  267  ARG ARG A . n 
A 1 397 ALA 397 268  268  ALA ALA A . n 
A 1 398 LEU 398 269  269  LEU LEU A . n 
A 1 399 ALA 399 2000 2000 ALA ALA A . n 
A 1 400 ASP 400 2001 2001 ASP ASP A . n 
A 1 401 LEU 401 2002 2002 LEU LEU A . n 
A 1 402 GLU 402 2003 2003 GLU GLU A . n 
A 1 403 ASP 403 2004 2004 ASP ASP A . n 
A 1 404 ASN 404 2005 2005 ASN ASN A . n 
A 1 405 TRP 405 2006 2006 TRP TRP A . n 
A 1 406 GLU 406 2007 2007 GLU GLU A . n 
A 1 407 THR 407 2008 2008 THR THR A . n 
A 1 408 LEU 408 2009 2009 LEU LEU A . n 
A 1 409 ASN 409 2010 2010 ASN ASN A . n 
A 1 410 ASP 410 2011 2011 ASP ASP A . n 
A 1 411 ASN 411 2012 2012 ASN ASN A . n 
A 1 412 LEU 412 2013 2013 LEU LEU A . n 
A 1 413 LYS 413 2014 2014 LYS LYS A . n 
A 1 414 VAL 414 2015 2015 VAL VAL A . n 
A 1 415 ILE 415 2016 2016 ILE ILE A . n 
A 1 416 GLU 416 2017 2017 GLU GLU A . n 
A 1 417 LYS 417 2018 2018 LYS LYS A . n 
A 1 418 ALA 418 2019 2019 ALA ALA A . n 
A 1 419 ASP 419 2020 2020 ASP ASP A . n 
A 1 420 ASN 420 2021 2021 ASN ASN A . n 
A 1 421 ALA 421 2022 2022 ALA ALA A . n 
A 1 422 ALA 422 2023 2023 ALA ALA A . n 
A 1 423 GLN 423 2024 2024 GLN GLN A . n 
A 1 424 VAL 424 2025 2025 VAL VAL A . n 
A 1 425 LYS 425 2026 2026 LYS LYS A . n 
A 1 426 ASP 426 2027 2027 ASP ASP A . n 
A 1 427 ALA 427 2028 2028 ALA ALA A . n 
A 1 428 LEU 428 2029 2029 LEU LEU A . n 
A 1 429 THR 429 2030 2030 THR THR A . n 
A 1 430 LYS 430 2031 2031 LYS LYS A . n 
A 1 431 MET 431 2032 2032 MET MET A . n 
A 1 432 ARG 432 2033 2033 ARG ARG A . n 
A 1 433 ALA 433 2034 2034 ALA ALA A . n 
A 1 434 ALA 434 2035 2035 ALA ALA A . n 
A 1 435 ALA 435 2036 2036 ALA ALA A . n 
A 1 436 LEU 436 2037 2037 LEU LEU A . n 
A 1 437 ASP 437 2038 2038 ASP ASP A . n 
A 1 438 ALA 438 2039 2039 ALA ALA A . n 
A 1 439 GLN 439 2040 2040 GLN GLN A . n 
A 1 440 LYS 440 2041 2041 LYS LYS A . n 
A 1 441 ALA 441 2042 2042 ALA ALA A . n 
A 1 442 THR 442 2043 2043 THR THR A . n 
A 1 443 PRO 443 2044 2044 PRO PRO A . n 
A 1 444 PRO 444 2045 2045 PRO PRO A . n 
A 1 445 LYS 445 2046 2046 LYS LYS A . n 
A 1 446 LEU 446 2047 2047 LEU LEU A . n 
A 1 447 GLU 447 2048 2048 GLU GLU A . n 
A 1 448 ASP 448 2049 2049 ASP ASP A . n 
A 1 449 LYS 449 2050 2050 LYS LYS A . n 
A 1 450 SER 450 2051 2051 SER SER A . n 
A 1 451 PRO 451 2052 2052 PRO PRO A . n 
A 1 452 ASP 452 2053 2053 ASP ASP A . n 
A 1 453 SER 453 2054 2054 SER SER A . n 
A 1 454 PRO 454 2055 2055 PRO PRO A . n 
A 1 455 GLU 455 2056 2056 GLU GLU A . n 
A 1 456 MET 456 2057 2057 MET MET A . n 
A 1 457 LYS 457 2058 2058 LYS LYS A . n 
A 1 458 ASP 458 2059 2059 ASP ASP A . n 
A 1 459 PHE 459 2060 2060 PHE PHE A . n 
A 1 460 ARG 460 2061 2061 ARG ARG A . n 
A 1 461 HIS 461 2062 2062 HIS HIS A . n 
A 1 462 GLY 462 2063 2063 GLY GLY A . n 
A 1 463 PHE 463 2064 2064 PHE PHE A . n 
A 1 464 ASP 464 2065 2065 ASP ASP A . n 
A 1 465 ILE 465 2066 2066 ILE ILE A . n 
A 1 466 LEU 466 2067 2067 LEU LEU A . n 
A 1 467 VAL 467 2068 2068 VAL VAL A . n 
A 1 468 GLY 468 2069 2069 GLY GLY A . n 
A 1 469 GLN 469 2070 2070 GLN GLN A . n 
A 1 470 ILE 470 2071 2071 ILE ILE A . n 
A 1 471 ASP 471 2072 2072 ASP ASP A . n 
A 1 472 ASP 472 2073 2073 ASP ASP A . n 
A 1 473 ALA 473 2074 2074 ALA ALA A . n 
A 1 474 LEU 474 2075 2075 LEU LEU A . n 
A 1 475 LYS 475 2076 2076 LYS LYS A . n 
A 1 476 LEU 476 2077 2077 LEU LEU A . n 
A 1 477 ALA 477 2078 2078 ALA ALA A . n 
A 1 478 ASN 478 2079 2079 ASN ASN A . n 
A 1 479 GLU 479 2080 2080 GLU GLU A . n 
A 1 480 GLY 480 2081 2081 GLY GLY A . n 
A 1 481 LYS 481 2082 2082 LYS LYS A . n 
A 1 482 VAL 482 2083 2083 VAL VAL A . n 
A 1 483 LYS 483 2084 2084 LYS LYS A . n 
A 1 484 GLU 484 2085 2085 GLU GLU A . n 
A 1 485 ALA 485 2086 2086 ALA ALA A . n 
A 1 486 GLN 486 2087 2087 GLN GLN A . n 
A 1 487 ALA 487 2088 2088 ALA ALA A . n 
A 1 488 ALA 488 2089 2089 ALA ALA A . n 
A 1 489 ALA 489 2090 2090 ALA ALA A . n 
A 1 490 GLU 490 2091 2091 GLU GLU A . n 
A 1 491 GLN 491 2092 2092 GLN GLN A . n 
A 1 492 LEU 492 2093 2093 LEU LEU A . n 
A 1 493 LYS 493 2094 2094 LYS LYS A . n 
A 1 494 THR 494 2095 2095 THR THR A . n 
A 1 495 THR 495 2096 2096 THR THR A . n 
A 1 496 ARG 496 2097 2097 ARG ARG A . n 
A 1 497 ASN 497 2098 2098 ASN ASN A . n 
A 1 498 ALA 498 2099 2099 ALA ALA A . n 
A 1 499 TYR 499 2100 2100 TYR TYR A . n 
A 1 500 ILE 500 2101 2101 ILE ILE A . n 
A 1 501 GLN 501 2102 2102 GLN GLN A . n 
A 1 502 LYS 502 2103 2103 LYS LYS A . n 
A 1 503 TYR 503 2104 2104 TYR TYR A . n 
A 1 504 LEU 504 2105 2105 LEU LEU A . n 
A 1 505 GLU 505 276  276  GLU GLU A . n 
A 1 506 ASN 506 277  277  ASN ASN A . n 
A 1 507 SER 507 278  278  SER SER A . n 
A 1 508 GLU 508 279  279  GLU GLU A . n 
A 1 509 LYS 509 280  280  LYS LYS A . n 
A 1 510 LYS 510 281  281  LYS LYS A . n 
A 1 511 ARG 511 282  282  ARG ARG A . n 
A 1 512 LYS 512 283  283  LYS LYS A . n 
A 1 513 ARG 513 284  284  ARG ARG A . n 
A 1 514 ALA 514 285  285  ALA ALA A . n 
A 1 515 ILE 515 286  286  ILE ILE A . n 
A 1 516 LYS 516 287  287  LYS LYS A . n 
A 1 517 LEU 517 288  288  LEU LEU A . n 
A 1 518 ALA 518 289  289  ALA ALA A . n 
A 1 519 VAL 519 290  290  VAL VAL A . n 
A 1 520 THR 520 291  291  THR THR A . n 
A 1 521 VAL 521 292  292  VAL VAL A . n 
A 1 522 ALA 522 293  293  ALA ALA A . n 
A 1 523 ALA 523 294  294  ALA ALA A . n 
A 1 524 MET 524 295  295  MET MET A . n 
A 1 525 TYR 525 296  296  TYR TYR A . n 
A 1 526 LEU 526 297  297  LEU LEU A . n 
A 1 527 ILE 527 298  298  ILE ILE A . n 
A 1 528 CYS 528 299  299  CYS CYS A . n 
A 1 529 PHE 529 300  300  PHE PHE A . n 
A 1 530 THR 530 301  301  THR THR A . n 
A 1 531 PRO 531 302  302  PRO PRO A . n 
A 1 532 SER 532 303  303  SER SER A . n 
A 1 533 ASN 533 304  304  ASN ASN A . n 
A 1 534 LEU 534 305  305  LEU LEU A . n 
A 1 535 LEU 535 306  306  LEU LEU A . n 
A 1 536 LEU 536 307  307  LEU LEU A . n 
A 1 537 VAL 537 308  308  VAL VAL A . n 
A 1 538 VAL 538 309  309  VAL VAL A . n 
A 1 539 HIS 539 310  310  HIS HIS A . n 
A 1 540 TYR 540 311  311  TYR TYR A . n 
A 1 541 PHE 541 312  312  PHE PHE A . n 
A 1 542 LEU 542 313  313  LEU LEU A . n 
A 1 543 ILE 543 314  314  ILE ILE A . n 
A 1 544 LYS 544 315  315  LYS LYS A . n 
A 1 545 SER 545 316  316  SER SER A . n 
A 1 546 GLN 546 317  317  GLN GLN A . n 
A 1 547 GLY 547 318  318  GLY GLY A . n 
A 1 548 GLN 548 319  319  GLN GLN A . n 
A 1 549 SER 549 320  320  SER SER A . n 
A 1 550 HIS 550 321  321  HIS HIS A . n 
A 1 551 VAL 551 322  322  VAL VAL A . n 
A 1 552 TYR 552 323  323  TYR TYR A . n 
A 1 553 ALA 553 324  324  ALA ALA A . n 
A 1 554 LEU 554 325  325  LEU LEU A . n 
A 1 555 TYR 555 326  326  TYR TYR A . n 
A 1 556 ILE 556 327  327  ILE ILE A . n 
A 1 557 VAL 557 328  328  VAL VAL A . n 
A 1 558 ALA 558 329  329  ALA ALA A . n 
A 1 559 LEU 559 330  330  LEU LEU A . n 
A 1 560 CYS 560 331  331  CYS CYS A . n 
A 1 561 LEU 561 332  332  LEU LEU A . n 
A 1 562 SER 562 333  333  SER SER A . n 
A 1 563 THR 563 334  334  THR THR A . n 
A 1 564 LEU 564 335  335  LEU LEU A . n 
A 1 565 ASN 565 336  336  ASN ASN A . n 
A 1 566 SER 566 337  337  SER SER A . n 
A 1 567 CYS 567 338  338  CYS CYS A . n 
A 1 568 ILE 568 339  339  ILE ILE A . n 
A 1 569 ASP 569 340  340  ASP ASP A . n 
A 1 570 PRO 570 341  341  PRO PRO A . n 
A 1 571 PHE 571 342  342  PHE PHE A . n 
A 1 572 VAL 572 343  343  VAL VAL A . n 
A 1 573 TYR 573 344  344  TYR TYR A . n 
A 1 574 TYR 574 345  345  TYR TYR A . n 
A 1 575 PHE 575 346  346  PHE PHE A . n 
A 1 576 VAL 576 347  347  VAL VAL A . n 
A 1 577 SER 577 348  348  SER SER A . n 
A 1 578 HIS 578 349  349  HIS HIS A . n 
A 1 579 ASP 579 350  350  ASP ASP A . n 
A 1 580 PHE 580 351  351  PHE PHE A . n 
A 1 581 ARG 581 352  352  ARG ARG A . n 
A 1 582 ASP 582 353  353  ASP ASP A . n 
A 1 583 HIS 583 354  354  HIS HIS A . n 
A 1 584 ALA 584 355  355  ALA ALA A . n 
A 1 585 LYS 585 356  356  LYS LYS A . n 
A 1 586 ASN 586 357  357  ASN ASN A . n 
A 1 587 ALA 587 358  358  ALA ALA A . n 
A 1 588 LEU 588 359  359  LEU LEU A . n 
A 1 589 LEU 589 360  ?    ?   ?   A . n 
A 1 590 CYS 590 361  ?    ?   ?   A . n 
A 1 591 ARG 591 362  ?    ?   ?   A . n 
A 1 592 SER 592 363  ?    ?   ?   A . n 
A 1 593 VAL 593 364  ?    ?   ?   A . n 
A 1 594 ARG 594 365  ?    ?   ?   A . n 
A 1 595 THR 595 366  ?    ?   ?   A . n 
A 1 596 VAL 596 367  ?    ?   ?   A . n 
A 1 597 LYS 597 368  ?    ?   ?   A . n 
A 1 598 GLN 598 369  ?    ?   ?   A . n 
A 1 599 MET 599 370  ?    ?   ?   A . n 
A 1 600 GLN 600 371  ?    ?   ?   A . n 
A 1 601 VAL 601 372  ?    ?   ?   A . n 
A 1 602 SER 602 373  ?    ?   ?   A . n 
A 1 603 LEU 603 374  ?    ?   ?   A . n 
A 1 604 THR 604 375  ?    ?   ?   A . n 
A 1 605 SER 605 376  ?    ?   ?   A . n 
A 1 606 LYS 606 377  ?    ?   ?   A . n 
A 1 607 ALA 607 378  ?    ?   ?   A . n 
A 1 608 ALA 608 379  ?    ?   ?   A . n 
A 1 609 ALA 609 380  ?    ?   ?   A . n 
A 1 610 HIS 610 381  ?    ?   ?   A . n 
A 1 611 HIS 611 382  ?    ?   ?   A . n 
A 1 612 HIS 612 383  ?    ?   ?   A . n 
A 1 613 HIS 613 384  ?    ?   ?   A . n 
A 1 614 HIS 614 385  ?    ?   ?   A . n 
A 1 615 HIS 615 386  ?    ?   ?   A . n 
A 1 616 HIS 616 387  ?    ?   ?   A . n 
A 1 617 HIS 617 388  ?    ?   ?   A . n 
A 1 618 HIS 618 389  ?    ?   ?   A . n 
A 1 619 HIS 619 390  ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 8TZ 1  2201 1  8TZ UNK A . 
C 3 NA  1  2202 1  NA  NA  A . 
D 4 PO4 1  2203 1  PO4 PO4 A . 
E 5 HOH 1  2301 6  HOH HOH A . 
E 5 HOH 2  2302 7  HOH HOH A . 
E 5 HOH 3  2303 2  HOH HOH A . 
E 5 HOH 4  2304 1  HOH HOH A . 
E 5 HOH 5  2305 10 HOH HOH A . 
E 5 HOH 6  2306 8  HOH HOH A . 
E 5 HOH 7  2307 5  HOH HOH A . 
E 5 HOH 8  2308 9  HOH HOH A . 
E 5 HOH 9  2309 3  HOH HOH A . 
E 5 HOH 10 2310 4  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 200   ? 
1 MORE         -7    ? 
1 'SSA (A^2)'  27160 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 250 ? A ASP 121 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD1 ? A ASN 287 ? A ASN 158  ? 1_555 79.1  ? 
2  OD1 ? A ASP 250 ? A ASP 121 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OG  ? A SER 291 ? A SER 162  ? 1_555 147.1 ? 
3  OD1 ? A ASN 287 ? A ASN 158 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OG  ? A SER 291 ? A SER 162  ? 1_555 71.4  ? 
4  OD1 ? A ASP 250 ? A ASP 121 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD1 ? A ASN 565 ? A ASN 336  ? 1_555 98.7  ? 
5  OD1 ? A ASN 287 ? A ASN 158 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD1 ? A ASN 565 ? A ASN 336  ? 1_555 90.7  ? 
6  OG  ? A SER 291 ? A SER 162 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD1 ? A ASN 565 ? A ASN 336  ? 1_555 95.9  ? 
7  OD1 ? A ASP 250 ? A ASP 121 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD2 ? A ASP 569 ? A ASP 340  ? 1_555 75.9  ? 
8  OD1 ? A ASN 287 ? A ASN 158 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD2 ? A ASP 569 ? A ASP 340  ? 1_555 155.0 ? 
9  OG  ? A SER 291 ? A SER 162 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD2 ? A ASP 569 ? A ASP 340  ? 1_555 132.9 ? 
10 OD1 ? A ASN 565 ? A ASN 336 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 OD2 ? A ASP 569 ? A ASP 340  ? 1_555 92.0  ? 
11 OD1 ? A ASP 250 ? A ASP 121 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 O   ? E HOH .   ? A HOH 2307 ? 1_555 133.8 ? 
12 OD1 ? A ASN 287 ? A ASN 158 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 O   ? E HOH .   ? A HOH 2307 ? 1_555 145.0 ? 
13 OG  ? A SER 291 ? A SER 162 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 O   ? E HOH .   ? A HOH 2307 ? 1_555 78.6  ? 
14 OD1 ? A ASN 565 ? A ASN 336 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 O   ? E HOH .   ? A HOH 2307 ? 1_555 74.7  ? 
15 OD2 ? A ASP 569 ? A ASP 340 ? 1_555 NA ? C NA . ? A NA 2202 ? 1_555 O   ? E HOH .   ? A HOH 2307 ? 1_555 59.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-05-03 
2 'Structure model' 1 1 2017-05-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? 2014     2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.17   3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? 2014     4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 1020 ? ? -73.39  -168.66 
2 1 LEU A 1033 ? ? -96.38  -61.60  
3 1 PRO A 1037 ? ? -68.57  64.44   
4 1 PHE A 59   ? ? -130.32 -43.10  
5 1 VAL A 76   ? ? -132.52 -50.00  
6 1 HIS A 137  ? ? -94.66  34.34   
7 1 HIS A 227  ? ? 68.30   -44.24  
8 1 PHE A 251  ? ? -126.09 -66.40  
9 1 ASN A 277  ? ? -119.67 60.05   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 979 ? A MET 1   
2  1 Y 1 A VAL 980 ? A VAL 2   
3  1 Y 1 A SER 981 ? A SER 3   
4  1 Y 1 A ALA 982 ? A ALA 4   
5  1 Y 1 A ILE 983 ? A ILE 5   
6  1 Y 1 A VAL 984 ? A VAL 6   
7  1 Y 1 A LEU 985 ? A LEU 7   
8  1 Y 1 A TYR 986 ? A TYR 8   
9  1 Y 1 A VAL 987 ? A VAL 9   
10 1 Y 1 A LEU 988 ? A LEU 10  
11 1 Y 1 A LEU 989 ? A LEU 11  
12 1 Y 1 A ALA 990 ? A ALA 12  
13 1 Y 1 A ALA 991 ? A ALA 13  
14 1 Y 1 A ALA 992 ? A ALA 14  
15 1 Y 1 A ALA 993 ? A ALA 15  
16 1 Y 1 A HIS 994 ? A HIS 16  
17 1 Y 1 A SER 995 ? A SER 17  
18 1 Y 1 A ALA 996 ? A ALA 18  
19 1 Y 1 A PHE 997 ? A PHE 19  
20 1 Y 1 A ALA 998 ? A ALA 20  
21 1 Y 1 A ALA 999 ? A ALA 21  
22 1 Y 1 A LEU 360 ? A LEU 589 
23 1 Y 1 A CYS 361 ? A CYS 590 
24 1 Y 1 A ARG 362 ? A ARG 591 
25 1 Y 1 A SER 363 ? A SER 592 
26 1 Y 1 A VAL 364 ? A VAL 593 
27 1 Y 1 A ARG 365 ? A ARG 594 
28 1 Y 1 A THR 366 ? A THR 595 
29 1 Y 1 A VAL 367 ? A VAL 596 
30 1 Y 1 A LYS 368 ? A LYS 597 
31 1 Y 1 A GLN 369 ? A GLN 598 
32 1 Y 1 A MET 370 ? A MET 599 
33 1 Y 1 A GLN 371 ? A GLN 600 
34 1 Y 1 A VAL 372 ? A VAL 601 
35 1 Y 1 A SER 373 ? A SER 602 
36 1 Y 1 A LEU 374 ? A LEU 603 
37 1 Y 1 A THR 375 ? A THR 604 
38 1 Y 1 A SER 376 ? A SER 605 
39 1 Y 1 A LYS 377 ? A LYS 606 
40 1 Y 1 A ALA 378 ? A ALA 607 
41 1 Y 1 A ALA 379 ? A ALA 608 
42 1 Y 1 A ALA 380 ? A ALA 609 
43 1 Y 1 A HIS 381 ? A HIS 610 
44 1 Y 1 A HIS 382 ? A HIS 611 
45 1 Y 1 A HIS 383 ? A HIS 612 
46 1 Y 1 A HIS 384 ? A HIS 613 
47 1 Y 1 A HIS 385 ? A HIS 614 
48 1 Y 1 A HIS 386 ? A HIS 615 
49 1 Y 1 A HIS 387 ? A HIS 616 
50 1 Y 1 A HIS 388 ? A HIS 617 
51 1 Y 1 A HIS 389 ? A HIS 618 
52 1 Y 1 A HIS 390 ? A HIS 619 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(~{S})-(4-fluoranyl-2-propyl-phenyl)-(1~{H}-imidazol-2-yl)methanol' 8TZ 
3 'SODIUM ION'                                                         NA  
4 'PHOSPHATE ION'                                                      PO4 
5 water                                                                HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#