data_5NVL
# 
_entry.id   5NVL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NVL         
WWPDB D_1200004615 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NVL 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Peter, D.'  1 0000-0003-1156-1033 
'Valkov, E.' 2 0000-0002-3721-1739 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_id_ASTM           GEDEEP 
_citation.journal_id_CSD            2056 
_citation.journal_id_ISSN           1549-5477 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                1147 
_citation.page_last                 1161 
_citation.title                     
'GIGYF1/2 proteins use auxiliary sequences to selectively bind to 4EHP and repress target mRNA expression.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1101/gad.299420.117 
_citation.pdbx_database_id_PubMed   28698298 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Peter, D.'      1 
primary 'Weber, R.'      2 
primary 'Sandmeir, F.'   3 
primary 'Wohlbold, L.'   4 
primary 'Helms, S.'      5 
primary 'Bawankar, P.'   6 
primary 'Valkov, E.'     7 
primary 'Igreja, C.'     8 
primary 'Izaurralde, E.' 9 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NVL 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     82.550 
_cell.length_a_esd                 ? 
_cell.length_b                     82.550 
_cell.length_b_esd                 ? 
_cell.length_c                     148.490 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NVL 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Eukaryotic translation initiation factor 4E type 2' 21979.102 2  ? ? ? 
;the first 5 residues of the coordinate sequence of chain A and the first residue of the coordinate sequence of chain C belong to the expression tag
;
2 polymer man 'GRB10-interacting GYF protein 2'                    8689.040  2  ? ? ? ? 
3 water   nat water                                                18.015    70 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;eIF4E type 2,Eukaryotic translation initiation factor 4E homologous protein,Eukaryotic translation initiation factor 4E-like 3,eIF4E-like protein 4E-LP,mRNA cap-binding protein 4EHP,h4EHP,mRNA cap-binding protein type 3
;
2 'PERQ amino acid-rich with GYF domain-containing protein 2,Trinucleotide repeat-containing gene 15 protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPHMLEAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWE
DDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLN
LPPNTIMEYKTHTDSIKMPGRLGPQRLLF
;
;GPHMLEAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWE
DDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLN
LPPNTIMEYKTHTDSIKMPGRLGPQRLLF
;
A,C ? 
2 'polypeptide(L)' no no GPHMKYKLADYRYGREEMLALFLKDNKIPSDLLDKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLT 
GPHMKYKLADYRYGREEMLALFLKDNKIPSDLLDKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLT B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   LEU n 
1 6   GLU n 
1 7   ALA n 
1 8   GLU n 
1 9   HIS n 
1 10  PRO n 
1 11  LEU n 
1 12  GLN n 
1 13  TYR n 
1 14  ASN n 
1 15  TYR n 
1 16  THR n 
1 17  PHE n 
1 18  TRP n 
1 19  TYR n 
1 20  SER n 
1 21  ARG n 
1 22  ARG n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  ARG n 
1 27  PRO n 
1 28  THR n 
1 29  SER n 
1 30  SER n 
1 31  GLN n 
1 32  SER n 
1 33  TYR n 
1 34  GLU n 
1 35  GLN n 
1 36  ASN n 
1 37  ILE n 
1 38  LYS n 
1 39  GLN n 
1 40  ILE n 
1 41  GLY n 
1 42  THR n 
1 43  PHE n 
1 44  ALA n 
1 45  SER n 
1 46  VAL n 
1 47  GLU n 
1 48  GLN n 
1 49  PHE n 
1 50  TRP n 
1 51  ARG n 
1 52  PHE n 
1 53  TYR n 
1 54  SER n 
1 55  HIS n 
1 56  MET n 
1 57  VAL n 
1 58  ARG n 
1 59  PRO n 
1 60  GLY n 
1 61  ASP n 
1 62  LEU n 
1 63  THR n 
1 64  GLY n 
1 65  HIS n 
1 66  SER n 
1 67  ASP n 
1 68  PHE n 
1 69  HIS n 
1 70  LEU n 
1 71  PHE n 
1 72  LYS n 
1 73  GLU n 
1 74  GLY n 
1 75  ILE n 
1 76  LYS n 
1 77  PRO n 
1 78  MET n 
1 79  TRP n 
1 80  GLU n 
1 81  ASP n 
1 82  ASP n 
1 83  ALA n 
1 84  ASN n 
1 85  LYS n 
1 86  ASN n 
1 87  GLY n 
1 88  GLY n 
1 89  LYS n 
1 90  TRP n 
1 91  ILE n 
1 92  ILE n 
1 93  ARG n 
1 94  LEU n 
1 95  ARG n 
1 96  LYS n 
1 97  GLY n 
1 98  LEU n 
1 99  ALA n 
1 100 SER n 
1 101 ARG n 
1 102 CYS n 
1 103 TRP n 
1 104 GLU n 
1 105 ASN n 
1 106 LEU n 
1 107 ILE n 
1 108 LEU n 
1 109 ALA n 
1 110 MET n 
1 111 LEU n 
1 112 GLY n 
1 113 GLU n 
1 114 GLN n 
1 115 PHE n 
1 116 MET n 
1 117 VAL n 
1 118 GLY n 
1 119 GLU n 
1 120 GLU n 
1 121 ILE n 
1 122 CYS n 
1 123 GLY n 
1 124 ALA n 
1 125 VAL n 
1 126 VAL n 
1 127 SER n 
1 128 VAL n 
1 129 ARG n 
1 130 PHE n 
1 131 GLN n 
1 132 GLU n 
1 133 ASP n 
1 134 ILE n 
1 135 ILE n 
1 136 SER n 
1 137 ILE n 
1 138 TRP n 
1 139 ASN n 
1 140 LYS n 
1 141 THR n 
1 142 ALA n 
1 143 SER n 
1 144 ASP n 
1 145 GLN n 
1 146 ALA n 
1 147 THR n 
1 148 THR n 
1 149 ALA n 
1 150 ARG n 
1 151 ILE n 
1 152 ARG n 
1 153 ASP n 
1 154 THR n 
1 155 LEU n 
1 156 ARG n 
1 157 ARG n 
1 158 VAL n 
1 159 LEU n 
1 160 ASN n 
1 161 LEU n 
1 162 PRO n 
1 163 PRO n 
1 164 ASN n 
1 165 THR n 
1 166 ILE n 
1 167 MET n 
1 168 GLU n 
1 169 TYR n 
1 170 LYS n 
1 171 THR n 
1 172 HIS n 
1 173 THR n 
1 174 ASP n 
1 175 SER n 
1 176 ILE n 
1 177 LYS n 
1 178 MET n 
1 179 PRO n 
1 180 GLY n 
1 181 ARG n 
1 182 LEU n 
1 183 GLY n 
1 184 PRO n 
1 185 GLN n 
1 186 ARG n 
1 187 LEU n 
1 188 LEU n 
1 189 PHE n 
2 1   GLY n 
2 2   PRO n 
2 3   HIS n 
2 4   MET n 
2 5   LYS n 
2 6   TYR n 
2 7   LYS n 
2 8   LEU n 
2 9   ALA n 
2 10  ASP n 
2 11  TYR n 
2 12  ARG n 
2 13  TYR n 
2 14  GLY n 
2 15  ARG n 
2 16  GLU n 
2 17  GLU n 
2 18  MET n 
2 19  LEU n 
2 20  ALA n 
2 21  LEU n 
2 22  PHE n 
2 23  LEU n 
2 24  LYS n 
2 25  ASP n 
2 26  ASN n 
2 27  LYS n 
2 28  ILE n 
2 29  PRO n 
2 30  SER n 
2 31  ASP n 
2 32  LEU n 
2 33  LEU n 
2 34  ASP n 
2 35  LYS n 
2 36  GLU n 
2 37  PHE n 
2 38  LEU n 
2 39  PRO n 
2 40  ILE n 
2 41  LEU n 
2 42  GLN n 
2 43  GLU n 
2 44  GLU n 
2 45  PRO n 
2 46  LEU n 
2 47  PRO n 
2 48  PRO n 
2 49  LEU n 
2 50  ALA n 
2 51  LEU n 
2 52  VAL n 
2 53  PRO n 
2 54  PHE n 
2 55  THR n 
2 56  GLU n 
2 57  GLU n 
2 58  GLU n 
2 59  GLN n 
2 60  ARG n 
2 61  ASN n 
2 62  PHE n 
2 63  SER n 
2 64  MET n 
2 65  SER n 
2 66  VAL n 
2 67  ASN n 
2 68  SER n 
2 69  ALA n 
2 70  ALA n 
2 71  VAL n 
2 72  LEU n 
2 73  ARG n 
2 74  LEU n 
2 75  THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 189 Human ? 'EIF4E2, EIF4EL3'                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? STAR ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 75  Human ? 'GIGYF2, KIAA0642, PERQ2, TNRC15' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? STAR ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP IF4E2_HUMAN O60573 ?        1 
;AEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKN
GGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTI
MEYKTHTDSIKMPGRLGPQRLLF
;
52 
2 UNP GGYF2_HUMAN Q6Y7W6 Q6Y7W6-3 2 KYKLADYRYGREEMLALFLKDNKIPSDLLDKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLT 35 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5NVL A 7 ? 189 ? O60573 52 ? 234 ? 52 234 
2 2 5NVL B 5 ? 75  ? Q6Y7W6 35 ? 105 ? 35 105 
3 1 5NVL C 7 ? 189 ? O60573 52 ? 234 ? 52 234 
4 2 5NVL D 5 ? 75  ? Q6Y7W6 35 ? 105 ? 35 105 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5NVL GLY A 1 ? UNP O60573 ? ? 'expression tag' 46 1  
1 5NVL PRO A 2 ? UNP O60573 ? ? 'expression tag' 47 2  
1 5NVL HIS A 3 ? UNP O60573 ? ? 'expression tag' 48 3  
1 5NVL MET A 4 ? UNP O60573 ? ? 'expression tag' 49 4  
1 5NVL LEU A 5 ? UNP O60573 ? ? 'expression tag' 50 5  
1 5NVL GLU A 6 ? UNP O60573 ? ? 'expression tag' 51 6  
2 5NVL GLY B 1 ? UNP Q6Y7W6 ? ? 'expression tag' 31 7  
2 5NVL PRO B 2 ? UNP Q6Y7W6 ? ? 'expression tag' 32 8  
2 5NVL HIS B 3 ? UNP Q6Y7W6 ? ? 'expression tag' 33 9  
2 5NVL MET B 4 ? UNP Q6Y7W6 ? ? 'expression tag' 34 10 
3 5NVL GLY C 1 ? UNP O60573 ? ? 'expression tag' 46 11 
3 5NVL PRO C 2 ? UNP O60573 ? ? 'expression tag' 47 12 
3 5NVL HIS C 3 ? UNP O60573 ? ? 'expression tag' 48 13 
3 5NVL MET C 4 ? UNP O60573 ? ? 'expression tag' 49 14 
3 5NVL LEU C 5 ? UNP O60573 ? ? 'expression tag' 50 15 
3 5NVL GLU C 6 ? UNP O60573 ? ? 'expression tag' 51 16 
4 5NVL GLY D 1 ? UNP Q6Y7W6 ? ? 'expression tag' 31 17 
4 5NVL PRO D 2 ? UNP Q6Y7W6 ? ? 'expression tag' 32 18 
4 5NVL HIS D 3 ? UNP Q6Y7W6 ? ? 'expression tag' 33 19 
4 5NVL MET D 4 ? UNP Q6Y7W6 ? ? 'expression tag' 34 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NVL 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.06 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.35 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M sodium citrate pH 5.0
0.1 M magnesium chloride
12% PEG 4000
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00001 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00001 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5NVL 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 45.9 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       23500 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.125 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.30 
_reflns_shell.d_res_low                   2.36 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.06 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           1690 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             10.6 
_reflns_shell.pdbx_Rsym_value             0.938 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               62.0 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5NVL 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             45.888 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     23497 
_refine.ls_number_reflns_R_free                  1168 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_percent_reflns_R_free                 4.97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2072 
_refine.ls_R_factor_R_free                       0.2423 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2053 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2JGB 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.90 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.32 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3741 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             70 
_refine_hist.number_atoms_total               3811 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        45.888 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 3832 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.540  ? 5180 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.822 ? 2305 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.041  ? 554  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 665  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3000 2.4047  . . 131 2688 99.00  . . . 0.3811 . 0.2923 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4047 2.5315  . . 120 2777 100.00 . . . 0.2912 . 0.2730 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5315 2.6901  . . 155 2734 100.00 . . . 0.3245 . 0.2534 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6901 2.8977  . . 149 2737 100.00 . . . 0.3167 . 0.2443 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8977 3.1893  . . 149 2785 100.00 . . . 0.2751 . 0.2272 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1893 3.6506  . . 146 2792 100.00 . . . 0.2445 . 0.2023 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6506 4.5987  . . 155 2831 100.00 . . . 0.1725 . 0.1726 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5987 45.8969 . . 163 2985 100.00 . . . 0.2328 . 0.1846 . . . . . . . . . . 
# 
_struct.entry_id                     5NVL 
_struct.title                        'Crystal structure of the human 4EHP-GIGYF2 complex' 
_struct.pdbx_descriptor              'Eukaryotic translation initiation factor 4E type 2, GRB10-interacting GYF protein 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NVL 
_struct_keywords.text            
'translational regulation, cap-binding protein, 4EHP-binding protein, GRB10-interacting GYF protein 2, translation' 
_struct_keywords.pdbx_keywords   TRANSLATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 46  ? HIS A 55  ? VAL A 91  HIS A 100 1 ? 10 
HELX_P HELX_P2  AA2 ASP A 82  ? LYS A 85  ? ASP A 127 LYS A 130 5 ? 4  
HELX_P HELX_P3  AA3 ALA A 99  ? LEU A 111 ? ALA A 144 LEU A 156 1 ? 13 
HELX_P HELX_P4  AA4 GLN A 145 ? VAL A 158 ? GLN A 190 VAL A 203 1 ? 14 
HELX_P HELX_P5  AA5 ARG B 15  ? LEU B 21  ? ARG B 45  LEU B 51  1 ? 7  
HELX_P HELX_P6  AA6 GLU B 56  ? SER B 63  ? GLU B 86  SER B 93  1 ? 8  
HELX_P HELX_P7  AA7 ALA B 69  ? LEU B 74  ? ALA B 99  LEU B 104 1 ? 6  
HELX_P HELX_P8  AA8 VAL C 46  ? HIS C 55  ? VAL C 91  HIS C 100 1 ? 10 
HELX_P HELX_P9  AA9 ASP C 82  ? LYS C 85  ? ASP C 127 LYS C 130 5 ? 4  
HELX_P HELX_P10 AB1 ALA C 99  ? LEU C 111 ? ALA C 144 LEU C 156 1 ? 13 
HELX_P HELX_P11 AB2 GLN C 145 ? LEU C 159 ? GLN C 190 LEU C 204 1 ? 15 
HELX_P HELX_P12 AB3 ARG D 15  ? LEU D 21  ? ARG D 45  LEU D 51  1 ? 7  
HELX_P HELX_P13 AB4 GLU D 56  ? SER D 63  ? GLU D 86  SER D 93  1 ? 8  
HELX_P HELX_P14 AB5 ALA D 69  ? ARG D 73  ? ALA D 99  ARG D 103 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 38  ? SER A 45  ? LYS A 83  SER A 90  
AA1 2 LEU A 11  ? ARG A 21  ? LEU A 56  ARG A 66  
AA1 3 SER A 66  ? LYS A 72  ? SER A 111 LYS A 117 
AA1 4 ILE A 121 ? VAL A 128 ? ILE A 166 VAL A 173 
AA1 5 ASP A 133 ? ASN A 139 ? ASP A 178 ASN A 184 
AA1 6 GLY A 88  ? LEU A 94  ? GLY A 133 LEU A 139 
AA1 7 MET A 167 ? THR A 171 ? MET A 212 THR A 216 
AA2 1 ILE C 37  ? SER C 45  ? ILE C 82  SER C 90  
AA2 2 LEU C 11  ? ARG C 21  ? LEU C 56  ARG C 66  
AA2 3 SER C 66  ? LYS C 72  ? SER C 111 LYS C 117 
AA2 4 ILE C 121 ? VAL C 128 ? ILE C 166 VAL C 173 
AA2 5 ASP C 133 ? ASN C 139 ? ASP C 178 ASN C 184 
AA2 6 GLY C 88  ? LEU C 94  ? GLY C 133 LEU C 139 
AA2 7 MET C 167 ? THR C 171 ? MET C 212 THR C 216 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ILE A 40  ? O ILE A 85  N PHE A 17  ? N PHE A 62  
AA1 2 3 N THR A 16  ? N THR A 61  O PHE A 71  ? O PHE A 116 
AA1 3 4 N SER A 66  ? N SER A 111 O VAL A 128 ? O VAL A 173 
AA1 4 5 N CYS A 122 ? N CYS A 167 O TRP A 138 ? O TRP A 183 
AA1 5 6 O ASP A 133 ? O ASP A 178 N LEU A 94  ? N LEU A 139 
AA1 6 7 N ILE A 91  ? N ILE A 136 O GLU A 168 ? O GLU A 213 
AA2 1 2 O ILE C 40  ? O ILE C 85  N PHE C 17  ? N PHE C 62  
AA2 2 3 N TRP C 18  ? N TRP C 63  O HIS C 69  ? O HIS C 114 
AA2 3 4 N SER C 66  ? N SER C 111 O VAL C 128 ? O VAL C 173 
AA2 4 5 N SER C 127 ? N SER C 172 O ILE C 134 ? O ILE C 179 
AA2 5 6 O ASP C 133 ? O ASP C 178 N LEU C 94  ? N LEU C 139 
AA2 6 7 N ILE C 91  ? N ILE C 136 O GLU C 168 ? O GLU C 213 
# 
_atom_sites.entry_id                    5NVL 
_atom_sites.fract_transf_matrix[1][1]   0.012114 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012114 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006734 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . PRO A 1 2   ? 71.016 38.949  68.588 1.00 232.98 ? 47  PRO A N    1 
ATOM   2    C CA   . PRO A 1 2   ? 70.465 37.640  68.950 1.00 235.37 ? 47  PRO A CA   1 
ATOM   3    C C    . PRO A 1 2   ? 71.542 36.634  69.335 1.00 227.94 ? 47  PRO A C    1 
ATOM   4    O O    . PRO A 1 2   ? 71.954 35.824  68.505 1.00 228.54 ? 47  PRO A O    1 
ATOM   5    C CB   . PRO A 1 2   ? 69.743 37.204  67.675 1.00 232.37 ? 47  PRO A CB   1 
ATOM   6    C CG   . PRO A 1 2   ? 70.500 37.865  66.584 1.00 236.25 ? 47  PRO A CG   1 
ATOM   7    C CD   . PRO A 1 2   ? 70.946 39.190  67.137 1.00 236.17 ? 47  PRO A CD   1 
ATOM   8    H HA   . PRO A 1 2   ? 69.824 37.726  69.674 1.00 282.44 ? 47  PRO A HA   1 
ATOM   9    H HB2  . PRO A 1 2   ? 69.783 36.239  67.588 1.00 278.84 ? 47  PRO A HB2  1 
ATOM   10   H HB3  . PRO A 1 2   ? 68.824 37.513  67.695 1.00 278.84 ? 47  PRO A HB3  1 
ATOM   11   H HG2  . PRO A 1 2   ? 71.266 37.321  66.344 1.00 283.50 ? 47  PRO A HG2  1 
ATOM   12   H HG3  . PRO A 1 2   ? 69.919 37.994  65.818 1.00 283.50 ? 47  PRO A HG3  1 
ATOM   13   H HD2  . PRO A 1 2   ? 71.821 39.423  66.790 1.00 283.40 ? 47  PRO A HD2  1 
ATOM   14   H HD3  . PRO A 1 2   ? 70.290 39.876  66.939 1.00 283.40 ? 47  PRO A HD3  1 
ATOM   15   N N    . HIS A 1 3   ? 71.993 36.694  70.584 1.00 240.78 ? 48  HIS A N    1 
ATOM   16   C CA   . HIS A 1 3   ? 73.002 35.758  71.055 1.00 199.20 ? 48  HIS A CA   1 
ATOM   17   C C    . HIS A 1 3   ? 72.485 34.330  70.935 1.00 192.29 ? 48  HIS A C    1 
ATOM   18   O O    . HIS A 1 3   ? 71.291 34.063  71.090 1.00 188.89 ? 48  HIS A O    1 
ATOM   19   C CB   . HIS A 1 3   ? 73.377 36.064  72.505 1.00 158.64 ? 48  HIS A CB   1 
ATOM   20   C CG   . HIS A 1 3   ? 73.867 37.462  72.718 1.00 134.61 ? 48  HIS A CG   1 
ATOM   21   N ND1  . HIS A 1 3   ? 73.028 38.556  72.694 1.00 127.74 ? 48  HIS A ND1  1 
ATOM   22   C CD2  . HIS A 1 3   ? 75.109 37.946  72.958 1.00 132.60 ? 48  HIS A CD2  1 
ATOM   23   C CE1  . HIS A 1 3   ? 73.732 39.653  72.910 1.00 126.00 ? 48  HIS A CE1  1 
ATOM   24   N NE2  . HIS A 1 3   ? 74.998 39.311  73.074 1.00 128.74 ? 48  HIS A NE2  1 
ATOM   25   H H    . HIS A 1 3   ? 71.733 37.264  71.173 1.00 288.93 ? 48  HIS A H    1 
ATOM   26   H HA   . HIS A 1 3   ? 73.799 35.841  70.509 1.00 239.04 ? 48  HIS A HA   1 
ATOM   27   H HB2  . HIS A 1 3   ? 72.596 35.934  73.065 1.00 190.37 ? 48  HIS A HB2  1 
ATOM   28   H HB3  . HIS A 1 3   ? 74.083 35.458  72.780 1.00 190.37 ? 48  HIS A HB3  1 
ATOM   29   H HD2  . HIS A 1 3   ? 75.891 37.448  73.032 1.00 159.12 ? 48  HIS A HD2  1 
ATOM   30   H HE1  . HIS A 1 3   ? 73.394 40.519  72.942 1.00 151.20 ? 48  HIS A HE1  1 
ATOM   31   H HE2  . HIS A 1 3   ? 75.647 39.854  73.228 1.00 154.48 ? 48  HIS A HE2  1 
ATOM   32   N N    . MET A 1 4   ? 73.400 33.406  70.653 1.00 177.72 ? 49  MET A N    1 
ATOM   33   C CA   . MET A 1 4   ? 73.051 32.012  70.415 1.00 139.67 ? 49  MET A CA   1 
ATOM   34   C C    . MET A 1 4   ? 73.905 31.112  71.294 1.00 121.59 ? 49  MET A C    1 
ATOM   35   O O    . MET A 1 4   ? 75.128 31.272  71.353 1.00 122.08 ? 49  MET A O    1 
ATOM   36   C CB   . MET A 1 4   ? 73.238 31.646  68.940 1.00 122.37 ? 49  MET A CB   1 
ATOM   37   C CG   . MET A 1 4   ? 72.875 30.205  68.609 1.00 106.26 ? 49  MET A CG   1 
ATOM   38   S SD   . MET A 1 4   ? 72.348 29.993  66.894 1.00 97.66  ? 49  MET A SD   1 
ATOM   39   C CE   . MET A 1 4   ? 73.725 30.726  66.016 1.00 96.50  ? 49  MET A CE   1 
ATOM   40   H H    . MET A 1 4   ? 74.243 33.566  70.594 1.00 213.26 ? 49  MET A H    1 
ATOM   41   H HA   . MET A 1 4   ? 72.117 31.879  70.641 1.00 167.60 ? 49  MET A HA   1 
ATOM   42   H HB2  . MET A 1 4   ? 72.674 32.224  68.402 1.00 146.84 ? 49  MET A HB2  1 
ATOM   43   H HB3  . MET A 1 4   ? 74.168 31.780  68.701 1.00 146.84 ? 49  MET A HB3  1 
ATOM   44   H HG2  . MET A 1 4   ? 73.651 29.642  68.755 1.00 127.52 ? 49  MET A HG2  1 
ATOM   45   H HG3  . MET A 1 4   ? 72.147 29.922  69.183 1.00 127.52 ? 49  MET A HG3  1 
ATOM   46   H HE1  . MET A 1 4   ? 73.556 30.671  65.062 1.00 115.80 ? 49  MET A HE1  1 
ATOM   47   H HE2  . MET A 1 4   ? 73.813 31.654  66.284 1.00 115.80 ? 49  MET A HE2  1 
ATOM   48   H HE3  . MET A 1 4   ? 74.535 30.239  66.237 1.00 115.80 ? 49  MET A HE3  1 
ATOM   49   N N    . LEU A 1 5   ? 73.257 30.166  71.966 1.00 126.02 ? 50  LEU A N    1 
ATOM   50   C CA   . LEU A 1 5   ? 73.931 29.215  72.836 1.00 123.87 ? 50  LEU A CA   1 
ATOM   51   C C    . LEU A 1 5   ? 74.232 27.925  72.078 1.00 114.00 ? 50  LEU A C    1 
ATOM   52   O O    . LEU A 1 5   ? 73.615 27.614  71.056 1.00 111.26 ? 50  LEU A O    1 
ATOM   53   C CB   . LEU A 1 5   ? 73.071 28.918  74.069 1.00 117.50 ? 50  LEU A CB   1 
ATOM   54   C CG   . LEU A 1 5   ? 73.687 28.057  75.178 1.00 121.71 ? 50  LEU A CG   1 
ATOM   55   C CD1  . LEU A 1 5   ? 74.906 28.734  75.799 1.00 123.88 ? 50  LEU A CD1  1 
ATOM   56   C CD2  . LEU A 1 5   ? 72.647 27.740  76.242 1.00 119.12 ? 50  LEU A CD2  1 
ATOM   57   H H    . LEU A 1 5   ? 72.405 30.054  71.932 1.00 151.22 ? 50  LEU A H    1 
ATOM   58   H HA   . LEU A 1 5   ? 74.771 29.596  73.136 1.00 148.64 ? 50  LEU A HA   1 
ATOM   59   H HB2  . LEU A 1 5   ? 72.824 29.764  74.473 1.00 141.00 ? 50  LEU A HB2  1 
ATOM   60   H HB3  . LEU A 1 5   ? 72.269 28.462  73.771 1.00 141.00 ? 50  LEU A HB3  1 
ATOM   61   H HG   . LEU A 1 5   ? 73.981 27.217  74.793 1.00 146.05 ? 50  LEU A HG   1 
ATOM   62   H HD11 . LEU A 1 5   ? 75.266 28.161  76.494 1.00 148.65 ? 50  LEU A HD11 1 
ATOM   63   H HD12 . LEU A 1 5   ? 75.573 28.877  75.109 1.00 148.65 ? 50  LEU A HD12 1 
ATOM   64   H HD13 . LEU A 1 5   ? 74.635 29.585  76.179 1.00 148.65 ? 50  LEU A HD13 1 
ATOM   65   H HD21 . LEU A 1 5   ? 73.058 27.196  76.932 1.00 142.95 ? 50  LEU A HD21 1 
ATOM   66   H HD22 . LEU A 1 5   ? 72.323 28.571  76.624 1.00 142.95 ? 50  LEU A HD22 1 
ATOM   67   H HD23 . LEU A 1 5   ? 71.913 27.256  75.832 1.00 142.95 ? 50  LEU A HD23 1 
ATOM   68   N N    . GLU A 1 6   ? 75.205 27.171  72.598 1.00 114.16 ? 51  GLU A N    1 
ATOM   69   C CA   . GLU A 1 6   ? 75.616 25.931  71.948 1.00 110.87 ? 51  GLU A CA   1 
ATOM   70   C C    . GLU A 1 6   ? 74.564 24.837  72.093 1.00 104.42 ? 51  GLU A C    1 
ATOM   71   O O    . GLU A 1 6   ? 74.455 23.966  71.222 1.00 103.98 ? 51  GLU A O    1 
ATOM   72   C CB   . GLU A 1 6   ? 76.956 25.466  72.522 1.00 117.72 ? 51  GLU A CB   1 
ATOM   73   C CG   . GLU A 1 6   ? 77.518 24.199  71.879 1.00 120.57 ? 51  GLU A CG   1 
ATOM   74   C CD   . GLU A 1 6   ? 77.157 22.929  72.633 1.00 123.98 ? 51  GLU A CD   1 
ATOM   75   O OE1  . GLU A 1 6   ? 76.890 23.004  73.850 1.00 125.85 ? 51  GLU A OE1  1 
ATOM   76   O OE2  . GLU A 1 6   ? 77.145 21.849  72.005 1.00 125.24 ? 51  GLU A OE2  1 
ATOM   77   H H    . GLU A 1 6   ? 75.636 27.356  73.319 1.00 136.99 ? 51  GLU A H    1 
ATOM   78   H HA   . GLU A 1 6   ? 75.741 26.100  71.001 1.00 133.04 ? 51  GLU A HA   1 
ATOM   79   H HB2  . GLU A 1 6   ? 77.609 26.172  72.399 1.00 141.27 ? 51  GLU A HB2  1 
ATOM   80   H HB3  . GLU A 1 6   ? 76.843 25.288  73.469 1.00 141.27 ? 51  GLU A HB3  1 
ATOM   81   H HG2  . GLU A 1 6   ? 77.166 24.122  70.978 1.00 144.68 ? 51  GLU A HG2  1 
ATOM   82   H HG3  . GLU A 1 6   ? 78.486 24.264  71.851 1.00 144.68 ? 51  GLU A HG3  1 
ATOM   83   N N    . ALA A 1 7   ? 73.775 24.867  73.170 1.00 108.21 ? 52  ALA A N    1 
ATOM   84   C CA   . ALA A 1 7   ? 72.812 23.800  73.420 1.00 105.34 ? 52  ALA A CA   1 
ATOM   85   C C    . ALA A 1 7   ? 71.579 23.909  72.533 1.00 96.58  ? 52  ALA A C    1 
ATOM   86   O O    . ALA A 1 7   ? 70.941 22.890  72.245 1.00 96.49  ? 52  ALA A O    1 
ATOM   87   C CB   . ALA A 1 7   ? 72.391 23.808  74.890 1.00 104.73 ? 52  ALA A CB   1 
ATOM   88   H H    . ALA A 1 7   ? 73.780 25.489  73.764 1.00 129.85 ? 52  ALA A H    1 
ATOM   89   H HA   . ALA A 1 7   ? 73.235 22.947  73.237 1.00 126.41 ? 52  ALA A HA   1 
ATOM   90   H HB1  . ALA A 1 7   ? 71.751 23.094  75.039 1.00 125.68 ? 52  ALA A HB1  1 
ATOM   91   H HB2  . ALA A 1 7   ? 73.175 23.671  75.444 1.00 125.68 ? 52  ALA A HB2  1 
ATOM   92   H HB3  . ALA A 1 7   ? 71.985 24.664  75.098 1.00 125.68 ? 52  ALA A HB3  1 
ATOM   93   N N    . GLU A 1 8   ? 71.229 25.114  72.091 1.00 82.06  ? 53  GLU A N    1 
ATOM   94   C CA   . GLU A 1 8   ? 70.010 25.313  71.323 1.00 69.90  ? 53  GLU A CA   1 
ATOM   95   C C    . GLU A 1 8   ? 70.268 25.089  69.833 1.00 60.64  ? 53  GLU A C    1 
ATOM   96   O O    . GLU A 1 8   ? 71.410 24.974  69.380 1.00 59.85  ? 53  GLU A O    1 
ATOM   97   C CB   . GLU A 1 8   ? 69.431 26.705  71.587 1.00 71.11  ? 53  GLU A CB   1 
ATOM   98   C CG   . GLU A 1 8   ? 70.354 27.867  71.321 1.00 74.56  ? 53  GLU A CG   1 
ATOM   99   C CD   . GLU A 1 8   ? 69.749 29.189  71.778 1.00 78.33  ? 53  GLU A CD   1 
ATOM   100  O OE1  . GLU A 1 8   ? 68.851 29.165  72.648 1.00 78.90  ? 53  GLU A OE1  1 
ATOM   101  O OE2  . GLU A 1 8   ? 70.162 30.251  71.263 1.00 81.31  ? 53  GLU A OE2  1 
ATOM   102  H H    . GLU A 1 8   ? 71.683 25.832  72.223 1.00 98.47  ? 53  GLU A H    1 
ATOM   103  H HA   . GLU A 1 8   ? 69.352 24.661  71.610 1.00 83.88  ? 53  GLU A HA   1 
ATOM   104  H HB2  . GLU A 1 8   ? 68.650 26.821  71.025 1.00 85.33  ? 53  GLU A HB2  1 
ATOM   105  H HB3  . GLU A 1 8   ? 69.167 26.753  72.519 1.00 85.33  ? 53  GLU A HB3  1 
ATOM   106  H HG2  . GLU A 1 8   ? 71.185 27.732  71.802 1.00 89.47  ? 53  GLU A HG2  1 
ATOM   107  H HG3  . GLU A 1 8   ? 70.525 27.927  70.368 1.00 89.47  ? 53  GLU A HG3  1 
ATOM   108  N N    . HIS A 1 9   ? 69.170 25.026  69.068 1.00 53.36  ? 54  HIS A N    1 
ATOM   109  C CA   . HIS A 1 9   ? 69.189 24.546  67.692 1.00 49.05  ? 54  HIS A CA   1 
ATOM   110  C C    . HIS A 1 9   ? 69.097 25.719  66.727 1.00 46.66  ? 54  HIS A C    1 
ATOM   111  O O    . HIS A 1 9   ? 68.042 26.363  66.658 1.00 46.41  ? 54  HIS A O    1 
ATOM   112  C CB   . HIS A 1 9   ? 68.032 23.573  67.456 1.00 45.97  ? 54  HIS A CB   1 
ATOM   113  C CG   . HIS A 1 9   ? 68.173 22.286  68.207 1.00 46.84  ? 54  HIS A CG   1 
ATOM   114  N ND1  . HIS A 1 9   ? 68.150 22.221  69.584 1.00 47.28  ? 54  HIS A ND1  1 
ATOM   115  C CD2  . HIS A 1 9   ? 68.368 21.018  67.774 1.00 47.12  ? 54  HIS A CD2  1 
ATOM   116  C CE1  . HIS A 1 9   ? 68.317 20.968  69.967 1.00 48.30  ? 54  HIS A CE1  1 
ATOM   117  N NE2  . HIS A 1 9   ? 68.453 20.219  68.889 1.00 48.55  ? 54  HIS A NE2  1 
ATOM   118  H H    . HIS A 1 9   ? 68.388 25.263  69.337 1.00 64.04  ? 54  HIS A H    1 
ATOM   119  H HA   . HIS A 1 9   ? 70.022 24.078  67.525 1.00 58.86  ? 54  HIS A HA   1 
ATOM   120  H HB2  . HIS A 1 9   ? 67.206 23.994  67.739 1.00 55.16  ? 54  HIS A HB2  1 
ATOM   121  H HB3  . HIS A 1 9   ? 67.988 23.363  66.510 1.00 55.16  ? 54  HIS A HB3  1 
ATOM   122  H HD1  . HIS A 1 9   ? 68.045 22.892  70.111 1.00 56.73  ? 54  HIS A HD1  1 
ATOM   123  H HD2  . HIS A 1 9   ? 68.432 20.740  66.889 1.00 56.54  ? 54  HIS A HD2  1 
ATOM   124  H HE1  . HIS A 1 9   ? 68.333 20.665  70.846 1.00 57.96  ? 54  HIS A HE1  1 
ATOM   125  N N    . PRO A 1 10  ? 70.133 26.021  65.950 1.00 47.33  ? 55  PRO A N    1 
ATOM   126  C CA   . PRO A 1 10  ? 70.077 27.211  65.095 1.00 46.19  ? 55  PRO A CA   1 
ATOM   127  C C    . PRO A 1 10  ? 69.032 27.091  63.998 1.00 43.30  ? 55  PRO A C    1 
ATOM   128  O O    . PRO A 1 10  ? 68.734 26.004  63.503 1.00 42.13  ? 55  PRO A O    1 
ATOM   129  C CB   . PRO A 1 10  ? 71.490 27.292  64.499 1.00 47.97  ? 55  PRO A CB   1 
ATOM   130  C CG   . PRO A 1 10  ? 72.340 26.454  65.379 1.00 49.92  ? 55  PRO A CG   1 
ATOM   131  C CD   . PRO A 1 10  ? 71.450 25.367  65.885 1.00 49.23  ? 55  PRO A CD   1 
ATOM   132  H HA   . PRO A 1 10  ? 69.902 28.004  65.626 1.00 55.42  ? 55  PRO A HA   1 
ATOM   133  H HB2  . PRO A 1 10  ? 71.483 26.940  63.595 1.00 57.57  ? 55  PRO A HB2  1 
ATOM   134  H HB3  . PRO A 1 10  ? 71.795 28.213  64.505 1.00 57.57  ? 55  PRO A HB3  1 
ATOM   135  H HG2  . PRO A 1 10  ? 73.074 26.082  64.865 1.00 59.91  ? 55  PRO A HG2  1 
ATOM   136  H HG3  . PRO A 1 10  ? 72.675 26.990  66.114 1.00 59.91  ? 55  PRO A HG3  1 
ATOM   137  H HD2  . PRO A 1 10  ? 71.431 24.626  65.259 1.00 59.08  ? 55  PRO A HD2  1 
ATOM   138  H HD3  . PRO A 1 10  ? 71.732 25.082  66.768 1.00 59.08  ? 55  PRO A HD3  1 
ATOM   139  N N    . LEU A 1 11  ? 68.489 28.236  63.608 1.00 42.68  ? 56  LEU A N    1 
ATOM   140  C CA   . LEU A 1 11  ? 67.702 28.331  62.393 1.00 42.61  ? 56  LEU A CA   1 
ATOM   141  C C    . LEU A 1 11  ? 68.612 28.681  61.227 1.00 45.93  ? 56  LEU A C    1 
ATOM   142  O O    . LEU A 1 11  ? 69.693 29.250  61.404 1.00 47.84  ? 56  LEU A O    1 
ATOM   143  C CB   . LEU A 1 11  ? 66.609 29.384  62.544 1.00 40.55  ? 56  LEU A CB   1 
ATOM   144  C CG   . LEU A 1 11  ? 65.608 29.114  63.665 1.00 39.45  ? 56  LEU A CG   1 
ATOM   145  C CD1  . LEU A 1 11  ? 64.832 30.365  63.990 1.00 38.74  ? 56  LEU A CD1  1 
ATOM   146  C CD2  . LEU A 1 11  ? 64.669 27.988  63.259 1.00 37.84  ? 56  LEU A CD2  1 
ATOM   147  H H    . LEU A 1 11  ? 68.564 28.978  64.036 1.00 51.22  ? 56  LEU A H    1 
ATOM   148  H HA   . LEU A 1 11  ? 67.283 27.475  62.211 1.00 51.13  ? 56  LEU A HA   1 
ATOM   149  H HB2  . LEU A 1 11  ? 67.027 30.241  62.724 1.00 48.66  ? 56  LEU A HB2  1 
ATOM   150  H HB3  . LEU A 1 11  ? 66.111 29.434  61.712 1.00 48.66  ? 56  LEU A HB3  1 
ATOM   151  H HG   . LEU A 1 11  ? 66.087 28.837  64.462 1.00 47.34  ? 56  LEU A HG   1 
ATOM   152  H HD11 . LEU A 1 11  ? 64.204 30.170  64.704 1.00 46.48  ? 56  LEU A HD11 1 
ATOM   153  H HD12 . LEU A 1 11  ? 65.452 31.055  64.274 1.00 46.48  ? 56  LEU A HD12 1 
ATOM   154  H HD13 . LEU A 1 11  ? 64.354 30.654  63.198 1.00 46.48  ? 56  LEU A HD13 1 
ATOM   155  H HD21 . LEU A 1 11  ? 64.039 27.827  63.979 1.00 45.41  ? 56  LEU A HD21 1 
ATOM   156  H HD22 . LEU A 1 11  ? 64.193 28.249  62.455 1.00 45.41  ? 56  LEU A HD22 1 
ATOM   157  H HD23 . LEU A 1 11  ? 65.190 27.188  63.090 1.00 45.41  ? 56  LEU A HD23 1 
ATOM   158  N N    . GLN A 1 12  ? 68.169 28.333  60.017 1.00 44.43  ? 57  GLN A N    1 
ATOM   159  C CA   . GLN A 1 12  ? 68.987 28.632  58.845 1.00 47.44  ? 57  GLN A CA   1 
ATOM   160  C C    . GLN A 1 12  ? 69.208 30.126  58.700 1.00 49.94  ? 57  GLN A C    1 
ATOM   161  O O    . GLN A 1 12  ? 70.211 30.555  58.121 1.00 51.67  ? 57  GLN A O    1 
ATOM   162  C CB   . GLN A 1 12  ? 68.346 28.080  57.575 1.00 46.26  ? 57  GLN A CB   1 
ATOM   163  C CG   . GLN A 1 12  ? 69.237 28.229  56.342 1.00 48.54  ? 57  GLN A CG   1 
ATOM   164  C CD   . GLN A 1 12  ? 70.538 27.462  56.461 1.00 51.63  ? 57  GLN A CD   1 
ATOM   165  O OE1  . GLN A 1 12  ? 70.552 26.232  56.395 1.00 52.23  ? 57  GLN A OE1  1 
ATOM   166  N NE2  . GLN A 1 12  ? 71.642 28.184  56.634 1.00 54.36  ? 57  GLN A NE2  1 
ATOM   167  H H    . GLN A 1 12  ? 67.424 27.936  59.853 1.00 53.32  ? 57  GLN A H    1 
ATOM   168  H HA   . GLN A 1 12  ? 69.854 28.210  58.951 1.00 56.92  ? 57  GLN A HA   1 
ATOM   169  H HB2  . GLN A 1 12  ? 68.163 27.135  57.700 1.00 55.52  ? 57  GLN A HB2  1 
ATOM   170  H HB3  . GLN A 1 12  ? 67.519 28.557  57.406 1.00 55.52  ? 57  GLN A HB3  1 
ATOM   171  H HG2  . GLN A 1 12  ? 68.762 27.894  55.566 1.00 58.24  ? 57  GLN A HG2  1 
ATOM   172  H HG3  . GLN A 1 12  ? 69.453 29.167  56.220 1.00 58.24  ? 57  GLN A HG3  1 
ATOM   173  H HE21 . GLN A 1 12  ? 71.594 29.041  56.673 1.00 65.23  ? 57  GLN A HE21 1 
ATOM   174  H HE22 . GLN A 1 12  ? 72.404 27.792  56.707 1.00 65.23  ? 57  GLN A HE22 1 
ATOM   175  N N    . TYR A 1 13  ? 68.291 30.932  59.217 1.00 53.58  ? 58  TYR A N    1 
ATOM   176  C CA   . TYR A 1 13  ? 68.436 32.374  59.195 1.00 57.21  ? 58  TYR A CA   1 
ATOM   177  C C    . TYR A 1 13  ? 67.979 32.923  60.531 1.00 57.24  ? 58  TYR A C    1 
ATOM   178  O O    . TYR A 1 13  ? 67.171 32.304  61.230 1.00 56.65  ? 58  TYR A O    1 
ATOM   179  C CB   . TYR A 1 13  ? 67.610 33.011  58.074 1.00 57.50  ? 58  TYR A CB   1 
ATOM   180  C CG   . TYR A 1 13  ? 67.783 32.348  56.728 1.00 59.74  ? 58  TYR A CG   1 
ATOM   181  C CD1  . TYR A 1 13  ? 67.007 31.257  56.370 1.00 57.71  ? 58  TYR A CD1  1 
ATOM   182  C CD2  . TYR A 1 13  ? 68.712 32.823  55.809 1.00 62.51  ? 58  TYR A CD2  1 
ATOM   183  C CE1  . TYR A 1 13  ? 67.156 30.650  55.140 1.00 58.88  ? 58  TYR A CE1  1 
ATOM   184  C CE2  . TYR A 1 13  ? 68.869 32.222  54.579 1.00 63.65  ? 58  TYR A CE2  1 
ATOM   185  C CZ   . TYR A 1 13  ? 68.090 31.138  54.248 1.00 62.16  ? 58  TYR A CZ   1 
ATOM   186  O OH   . TYR A 1 13  ? 68.245 30.538  53.020 1.00 63.76  ? 58  TYR A OH   1 
ATOM   187  H H    . TYR A 1 13  ? 67.566 30.660  59.592 1.00 64.30  ? 58  TYR A H    1 
ATOM   188  H HA   . TYR A 1 13  ? 69.369 32.607  59.065 1.00 68.66  ? 58  TYR A HA   1 
ATOM   189  H HB2  . TYR A 1 13  ? 66.671 32.959  58.311 1.00 69.00  ? 58  TYR A HB2  1 
ATOM   190  H HB3  . TYR A 1 13  ? 67.874 33.940  57.983 1.00 69.00  ? 58  TYR A HB3  1 
ATOM   191  H HD1  . TYR A 1 13  ? 66.378 30.926  56.970 1.00 69.25  ? 58  TYR A HD1  1 
ATOM   192  H HD2  . TYR A 1 13  ? 69.241 33.555  56.031 1.00 75.01  ? 58  TYR A HD2  1 
ATOM   193  H HE1  . TYR A 1 13  ? 66.632 29.916  54.913 1.00 70.65  ? 58  TYR A HE1  1 
ATOM   194  H HE2  . TYR A 1 13  ? 69.496 32.549  53.976 1.00 76.38  ? 58  TYR A HE2  1 
ATOM   195  H HH   . TYR A 1 13  ? 67.713 29.893  52.946 1.00 76.51  ? 58  TYR A HH   1 
ATOM   196  N N    . ASN A 1 14  ? 68.510 34.086  60.888 1.00 52.39  ? 59  ASN A N    1 
ATOM   197  C CA   . ASN A 1 14  ? 67.862 34.881  61.916 1.00 49.55  ? 59  ASN A CA   1 
ATOM   198  C C    . ASN A 1 14  ? 66.562 35.433  61.358 1.00 46.47  ? 59  ASN A C    1 
ATOM   199  O O    . ASN A 1 14  ? 66.471 35.769  60.175 1.00 46.84  ? 59  ASN A O    1 
ATOM   200  C CB   . ASN A 1 14  ? 68.773 36.012  62.382 1.00 51.11  ? 59  ASN A CB   1 
ATOM   201  C CG   . ASN A 1 14  ? 70.018 35.501  63.078 1.00 52.73  ? 59  ASN A CG   1 
ATOM   202  O OD1  . ASN A 1 14  ? 70.057 34.365  63.546 1.00 52.38  ? 59  ASN A OD1  1 
ATOM   203  N ND2  . ASN A 1 14  ? 71.039 36.341  63.158 1.00 55.44  ? 59  ASN A ND2  1 
ATOM   204  H H    . ASN A 1 14  ? 69.226 34.429  60.558 1.00 62.87  ? 59  ASN A H    1 
ATOM   205  H HA   . ASN A 1 14  ? 67.656 34.318  62.679 1.00 59.46  ? 59  ASN A HA   1 
ATOM   206  H HB2  . ASN A 1 14  ? 69.051 36.533  61.613 1.00 61.33  ? 59  ASN A HB2  1 
ATOM   207  H HB3  . ASN A 1 14  ? 68.288 36.573  63.007 1.00 61.33  ? 59  ASN A HB3  1 
ATOM   208  H HD21 . ASN A 1 14  ? 71.768 36.097  63.544 1.00 66.53  ? 59  ASN A HD21 1 
ATOM   209  H HD22 . ASN A 1 14  ? 70.973 37.131  62.824 1.00 66.53  ? 59  ASN A HD22 1 
ATOM   210  N N    . TYR A 1 15  ? 65.541 35.490  62.202 1.00 47.96  ? 60  TYR A N    1 
ATOM   211  C CA   . TYR A 1 15  ? 64.261 36.056  61.814 1.00 47.49  ? 60  TYR A CA   1 
ATOM   212  C C    . TYR A 1 15  ? 63.859 37.142  62.802 1.00 47.12  ? 60  TYR A C    1 
ATOM   213  O O    . TYR A 1 15  ? 64.300 37.162  63.954 1.00 47.97  ? 60  TYR A O    1 
ATOM   214  C CB   . TYR A 1 15  ? 63.177 34.987  61.740 1.00 46.54  ? 60  TYR A CB   1 
ATOM   215  C CG   . TYR A 1 15  ? 63.312 34.037  60.568 1.00 48.73  ? 60  TYR A CG   1 
ATOM   216  C CD1  . TYR A 1 15  ? 64.151 32.932  60.638 1.00 50.06  ? 60  TYR A CD1  1 
ATOM   217  C CD2  . TYR A 1 15  ? 62.587 34.236  59.400 1.00 48.60  ? 60  TYR A CD2  1 
ATOM   218  C CE1  . TYR A 1 15  ? 64.261 32.047  59.573 1.00 50.12  ? 60  TYR A CE1  1 
ATOM   219  C CE2  . TYR A 1 15  ? 62.698 33.365  58.331 1.00 49.05  ? 60  TYR A CE2  1 
ATOM   220  C CZ   . TYR A 1 15  ? 63.531 32.271  58.424 1.00 50.20  ? 60  TYR A CZ   1 
ATOM   221  O OH   . TYR A 1 15  ? 63.640 31.397  57.365 1.00 50.63  ? 60  TYR A OH   1 
ATOM   222  H H    . TYR A 1 15  ? 65.566 35.205  63.013 1.00 57.55  ? 60  TYR A H    1 
ATOM   223  H HA   . TYR A 1 15  ? 64.345 36.462  60.937 1.00 56.98  ? 60  TYR A HA   1 
ATOM   224  H HB2  . TYR A 1 15  ? 63.207 34.458  62.552 1.00 55.84  ? 60  TYR A HB2  1 
ATOM   225  H HB3  . TYR A 1 15  ? 62.314 35.424  61.667 1.00 55.84  ? 60  TYR A HB3  1 
ATOM   226  H HD1  . TYR A 1 15  ? 64.640 32.776  61.414 1.00 60.08  ? 60  TYR A HD1  1 
ATOM   227  H HD2  . TYR A 1 15  ? 62.019 34.969  59.334 1.00 58.31  ? 60  TYR A HD2  1 
ATOM   228  H HE1  . TYR A 1 15  ? 64.827 31.311  59.632 1.00 60.14  ? 60  TYR A HE1  1 
ATOM   229  H HE2  . TYR A 1 15  ? 62.204 33.512  57.556 1.00 58.86  ? 60  TYR A HE2  1 
ATOM   230  H HH   . TYR A 1 15  ? 63.146 31.648  56.734 1.00 60.76  ? 60  TYR A HH   1 
ATOM   231  N N    . THR A 1 16  ? 63.002 38.044  62.331 1.00 42.03  ? 61  THR A N    1 
ATOM   232  C CA   . THR A 1 16  ? 62.565 39.196  63.107 1.00 42.25  ? 61  THR A CA   1 
ATOM   233  C C    . THR A 1 16  ? 61.043 39.256  63.109 1.00 40.39  ? 61  THR A C    1 
ATOM   234  O O    . THR A 1 16  ? 60.418 39.268  62.042 1.00 39.07  ? 61  THR A O    1 
ATOM   235  C CB   . THR A 1 16  ? 63.159 40.478  62.525 1.00 43.43  ? 61  THR A CB   1 
ATOM   236  O OG1  . THR A 1 16  ? 64.586 40.382  62.562 1.00 45.28  ? 61  THR A OG1  1 
ATOM   237  C CG2  . THR A 1 16  ? 62.709 41.714  63.313 1.00 44.05  ? 61  THR A CG2  1 
ATOM   238  H H    . THR A 1 16  ? 62.653 38.008  61.545 1.00 50.44  ? 61  THR A H    1 
ATOM   239  H HA   . THR A 1 16  ? 62.870 39.103  64.023 1.00 50.70  ? 61  THR A HA   1 
ATOM   240  H HB   . THR A 1 16  ? 62.868 40.579  61.606 1.00 52.11  ? 61  THR A HB   1 
ATOM   241  H HG1  . THR A 1 16  ? 64.929 41.080  62.245 1.00 54.33  ? 61  THR A HG1  1 
ATOM   242  H HG21 . THR A 1 16  ? 63.099 42.513  62.925 1.00 52.85  ? 61  THR A HG21 1 
ATOM   243  H HG22 . THR A 1 16  ? 61.742 41.789  63.286 1.00 52.85  ? 61  THR A HG22 1 
ATOM   244  H HG23 . THR A 1 16  ? 62.995 41.640  64.237 1.00 52.85  ? 61  THR A HG23 1 
ATOM   245  N N    . PHE A 1 17  ? 60.453 39.283  64.303 1.00 43.78  ? 62  PHE A N    1 
ATOM   246  C CA   . PHE A 1 17  ? 59.020 39.511  64.446 1.00 45.10  ? 62  PHE A CA   1 
ATOM   247  C C    . PHE A 1 17  ? 58.722 41.005  64.382 1.00 44.73  ? 62  PHE A C    1 
ATOM   248  O O    . PHE A 1 17  ? 59.408 41.813  65.010 1.00 46.12  ? 62  PHE A O    1 
ATOM   249  C CB   . PHE A 1 17  ? 58.506 38.960  65.781 1.00 48.50  ? 62  PHE A CB   1 
ATOM   250  C CG   . PHE A 1 17  ? 58.022 37.534  65.729 1.00 48.84  ? 62  PHE A CG   1 
ATOM   251  C CD1  . PHE A 1 17  ? 56.841 37.209  65.085 1.00 49.74  ? 62  PHE A CD1  1 
ATOM   252  C CD2  . PHE A 1 17  ? 58.723 36.523  66.372 1.00 50.81  ? 62  PHE A CD2  1 
ATOM   253  C CE1  . PHE A 1 17  ? 56.383 35.893  65.054 1.00 48.53  ? 62  PHE A CE1  1 
ATOM   254  C CE2  . PHE A 1 17  ? 58.262 35.205  66.346 1.00 50.64  ? 62  PHE A CE2  1 
ATOM   255  C CZ   . PHE A 1 17  ? 57.092 34.899  65.688 1.00 48.35  ? 62  PHE A CZ   1 
ATOM   256  H H    . PHE A 1 17  ? 60.865 39.171  65.049 1.00 52.54  ? 62  PHE A H    1 
ATOM   257  H HA   . PHE A 1 17  ? 58.546 39.068  63.724 1.00 54.12  ? 62  PHE A HA   1 
ATOM   258  H HB2  . PHE A 1 17  ? 59.225 39.002  66.430 1.00 58.20  ? 62  PHE A HB2  1 
ATOM   259  H HB3  . PHE A 1 17  ? 57.765 39.511  66.078 1.00 58.20  ? 62  PHE A HB3  1 
ATOM   260  H HD1  . PHE A 1 17  ? 56.355 37.875  64.655 1.00 59.69  ? 62  PHE A HD1  1 
ATOM   261  H HD2  . PHE A 1 17  ? 59.513 36.724  66.819 1.00 60.97  ? 62  PHE A HD2  1 
ATOM   262  H HE1  . PHE A 1 17  ? 55.592 35.687  64.610 1.00 58.23  ? 62  PHE A HE1  1 
ATOM   263  H HE2  . PHE A 1 17  ? 58.745 34.534  66.772 1.00 60.77  ? 62  PHE A HE2  1 
ATOM   264  H HZ   . PHE A 1 17  ? 56.786 34.021  65.666 1.00 58.02  ? 62  PHE A HZ   1 
ATOM   265  N N    . TRP A 1 18  ? 57.684 41.365  63.631 1.00 41.93  ? 63  TRP A N    1 
ATOM   266  C CA   . TRP A 1 18  ? 57.172 42.726  63.585 1.00 43.86  ? 63  TRP A CA   1 
ATOM   267  C C    . TRP A 1 18  ? 55.676 42.706  63.868 1.00 42.77  ? 63  TRP A C    1 
ATOM   268  O O    . TRP A 1 18  ? 55.002 41.686  63.699 1.00 39.09  ? 63  TRP A O    1 
ATOM   269  C CB   . TRP A 1 18  ? 57.412 43.391  62.226 1.00 44.89  ? 63  TRP A CB   1 
ATOM   270  C CG   . TRP A 1 18  ? 58.815 43.302  61.702 1.00 47.80  ? 63  TRP A CG   1 
ATOM   271  C CD1  . TRP A 1 18  ? 59.491 42.172  61.339 1.00 46.71  ? 63  TRP A CD1  1 
ATOM   272  C CD2  . TRP A 1 18  ? 59.704 44.396  61.457 1.00 51.20  ? 63  TRP A CD2  1 
ATOM   273  N NE1  . TRP A 1 18  ? 60.750 42.497  60.898 1.00 49.19  ? 63  TRP A NE1  1 
ATOM   274  C CE2  . TRP A 1 18  ? 60.903 43.857  60.959 1.00 51.68  ? 63  TRP A CE2  1 
ATOM   275  C CE3  . TRP A 1 18  ? 59.603 45.783  61.612 1.00 53.26  ? 63  TRP A CE3  1 
ATOM   276  C CZ2  . TRP A 1 18  ? 61.993 44.654  60.615 1.00 55.07  ? 63  TRP A CZ2  1 
ATOM   277  C CZ3  . TRP A 1 18  ? 60.691 46.571  61.271 1.00 56.73  ? 63  TRP A CZ3  1 
ATOM   278  C CH2  . TRP A 1 18  ? 61.865 46.005  60.779 1.00 57.15  ? 63  TRP A CH2  1 
ATOM   279  H H    . TRP A 1 18  ? 57.249 40.821  63.126 1.00 50.32  ? 63  TRP A H    1 
ATOM   280  H HA   . TRP A 1 18  ? 57.608 43.258  64.269 1.00 52.63  ? 63  TRP A HA   1 
ATOM   281  H HB2  . TRP A 1 18  ? 56.831 42.971  61.572 1.00 53.87  ? 63  TRP A HB2  1 
ATOM   282  H HB3  . TRP A 1 18  ? 57.188 44.332  62.301 1.00 53.87  ? 63  TRP A HB3  1 
ATOM   283  H HD1  . TRP A 1 18  ? 59.151 41.308  61.394 1.00 56.05  ? 63  TRP A HD1  1 
ATOM   284  H HE1  . TRP A 1 18  ? 61.344 41.939  60.625 1.00 59.02  ? 63  TRP A HE1  1 
ATOM   285  H HE3  . TRP A 1 18  ? 58.823 46.168  61.940 1.00 63.91  ? 63  TRP A HE3  1 
ATOM   286  H HZ2  . TRP A 1 18  ? 62.780 44.281  60.288 1.00 66.09  ? 63  TRP A HZ2  1 
ATOM   287  H HZ3  . TRP A 1 18  ? 60.637 47.494  61.372 1.00 68.08  ? 63  TRP A HZ3  1 
ATOM   288  H HH2  . TRP A 1 18  ? 62.579 46.559  60.560 1.00 68.58  ? 63  TRP A HH2  1 
ATOM   289  N N    . TYR A 1 19  ? 55.159 43.864  64.278 1.00 43.34  ? 64  TYR A N    1 
ATOM   290  C CA   . TYR A 1 19  ? 53.757 44.024  64.634 1.00 44.33  ? 64  TYR A CA   1 
ATOM   291  C C    . TYR A 1 19  ? 53.270 45.390  64.182 1.00 45.73  ? 64  TYR A C    1 
ATOM   292  O O    . TYR A 1 19  ? 53.961 46.394  64.374 1.00 45.41  ? 64  TYR A O    1 
ATOM   293  C CB   . TYR A 1 19  ? 53.557 43.883  66.140 1.00 46.78  ? 64  TYR A CB   1 
ATOM   294  C CG   . TYR A 1 19  ? 52.214 44.348  66.625 1.00 49.80  ? 64  TYR A CG   1 
ATOM   295  C CD1  . TYR A 1 19  ? 51.054 43.682  66.253 1.00 49.46  ? 64  TYR A CD1  1 
ATOM   296  C CD2  . TYR A 1 19  ? 52.104 45.431  67.475 1.00 52.80  ? 64  TYR A CD2  1 
ATOM   297  C CE1  . TYR A 1 19  ? 49.816 44.097  66.704 1.00 50.96  ? 64  TYR A CE1  1 
ATOM   298  C CE2  . TYR A 1 19  ? 50.871 45.857  67.933 1.00 55.21  ? 64  TYR A CE2  1 
ATOM   299  C CZ   . TYR A 1 19  ? 49.733 45.183  67.543 1.00 54.17  ? 64  TYR A CZ   1 
ATOM   300  O OH   . TYR A 1 19  ? 48.511 45.596  67.995 1.00 56.06  ? 64  TYR A OH   1 
ATOM   301  H H    . TYR A 1 19  ? 55.616 44.588  64.359 1.00 52.01  ? 64  TYR A H    1 
ATOM   302  H HA   . TYR A 1 19  ? 53.228 43.344  64.187 1.00 53.20  ? 64  TYR A HA   1 
ATOM   303  H HB2  . TYR A 1 19  ? 53.651 42.948  66.381 1.00 56.13  ? 64  TYR A HB2  1 
ATOM   304  H HB3  . TYR A 1 19  ? 54.234 44.408  66.595 1.00 56.13  ? 64  TYR A HB3  1 
ATOM   305  H HD1  . TYR A 1 19  ? 51.111 42.948  65.685 1.00 59.35  ? 64  TYR A HD1  1 
ATOM   306  H HD2  . TYR A 1 19  ? 52.872 45.886  67.738 1.00 63.36  ? 64  TYR A HD2  1 
ATOM   307  H HE1  . TYR A 1 19  ? 49.046 43.645  66.443 1.00 61.16  ? 64  TYR A HE1  1 
ATOM   308  H HE2  . TYR A 1 19  ? 50.810 46.590  68.502 1.00 66.25  ? 64  TYR A HE2  1 
ATOM   309  H HH   . TYR A 1 19  ? 48.600 46.264  68.496 1.00 67.27  ? 64  TYR A HH   1 
ATOM   310  N N    . SER A 1 20  ? 52.084 45.426  63.580 1.00 49.02  ? 65  SER A N    1 
ATOM   311  C CA   . SER A 1 20  ? 51.504 46.673  63.107 1.00 53.75  ? 65  SER A CA   1 
ATOM   312  C C    . SER A 1 20  ? 50.010 46.691  63.392 1.00 55.13  ? 65  SER A C    1 
ATOM   313  O O    . SER A 1 20  ? 49.337 45.658  63.296 1.00 51.40  ? 65  SER A O    1 
ATOM   314  C CB   . SER A 1 20  ? 51.745 46.865  61.609 1.00 55.67  ? 65  SER A CB   1 
ATOM   315  O OG   . SER A 1 20  ? 51.050 45.893  60.860 1.00 56.12  ? 65  SER A OG   1 
ATOM   316  H H    . SER A 1 20  ? 51.594 44.734  63.433 1.00 58.83  ? 65  SER A H    1 
ATOM   317  H HA   . SER A 1 20  ? 51.912 47.415  63.578 1.00 64.50  ? 65  SER A HA   1 
ATOM   318  H HB2  . SER A 1 20  ? 51.434 47.746  61.349 1.00 66.81  ? 65  SER A HB2  1 
ATOM   319  H HB3  . SER A 1 20  ? 52.695 46.782  61.429 1.00 66.81  ? 65  SER A HB3  1 
ATOM   320  H HG   . SER A 1 20  ? 51.189 46.008  60.039 1.00 67.35  ? 65  SER A HG   1 
ATOM   321  N N    . ARG A 1 21  ? 49.501 47.871  63.745 1.00 53.21  ? 66  ARG A N    1 
ATOM   322  C CA   . ARG A 1 21  ? 48.073 48.078  63.935 1.00 55.67  ? 66  ARG A CA   1 
ATOM   323  C C    . ARG A 1 21  ? 47.677 49.433  63.371 1.00 57.38  ? 66  ARG A C    1 
ATOM   324  O O    . ARG A 1 21  ? 48.368 50.430  63.591 1.00 57.16  ? 66  ARG A O    1 
ATOM   325  C CB   . ARG A 1 21  ? 47.677 48.005  65.414 1.00 58.61  ? 66  ARG A CB   1 
ATOM   326  C CG   . ARG A 1 21  ? 46.170 47.959  65.627 1.00 62.23  ? 66  ARG A CG   1 
ATOM   327  C CD   . ARG A 1 21  ? 45.793 48.040  67.099 1.00 68.56  ? 66  ARG A CD   1 
ATOM   328  N NE   . ARG A 1 21  ? 44.355 47.868  67.302 1.00 73.28  ? 66  ARG A NE   1 
ATOM   329  C CZ   . ARG A 1 21  ? 43.450 48.839  67.190 1.00 80.58  ? 66  ARG A CZ   1 
ATOM   330  N NH1  . ARG A 1 21  ? 43.822 50.076  66.874 1.00 83.78  ? 66  ARG A NH1  1 
ATOM   331  N NH2  . ARG A 1 21  ? 42.163 48.572  67.393 1.00 82.59  ? 66  ARG A NH2  1 
ATOM   332  H H    . ARG A 1 21  ? 49.974 48.577  63.881 1.00 63.85  ? 66  ARG A H    1 
ATOM   333  H HA   . ARG A 1 21  ? 47.583 47.393  63.455 1.00 66.81  ? 66  ARG A HA   1 
ATOM   334  H HB2  . ARG A 1 21  ? 48.058 47.203  65.803 1.00 70.34  ? 66  ARG A HB2  1 
ATOM   335  H HB3  . ARG A 1 21  ? 48.019 48.789  65.871 1.00 70.34  ? 66  ARG A HB3  1 
ATOM   336  H HG2  . ARG A 1 21  ? 45.762 48.711  65.170 1.00 74.67  ? 66  ARG A HG2  1 
ATOM   337  H HG3  . ARG A 1 21  ? 45.825 47.125  65.273 1.00 74.67  ? 66  ARG A HG3  1 
ATOM   338  H HD2  . ARG A 1 21  ? 46.254 47.338  67.585 1.00 82.27  ? 66  ARG A HD2  1 
ATOM   339  H HD3  . ARG A 1 21  ? 46.047 48.910  67.446 1.00 82.27  ? 66  ARG A HD3  1 
ATOM   340  H HE   . ARG A 1 21  ? 44.072 47.083  67.509 1.00 87.93  ? 66  ARG A HE   1 
ATOM   341  H HH11 . ARG A 1 21  ? 44.653 50.255  66.740 1.00 100.54 ? 66  ARG A HH11 1 
ATOM   342  H HH12 . ARG A 1 21  ? 43.232 50.698  66.803 1.00 100.54 ? 66  ARG A HH12 1 
ATOM   343  H HH21 . ARG A 1 21  ? 41.917 47.774  67.598 1.00 99.11  ? 66  ARG A HH21 1 
ATOM   344  H HH22 . ARG A 1 21  ? 41.578 49.198  67.322 1.00 99.11  ? 66  ARG A HH22 1 
ATOM   345  N N    . ARG A 1 22  ? 46.562 49.464  62.649 1.00 57.45  ? 67  ARG A N    1 
ATOM   346  C CA   . ARG A 1 22  ? 46.011 50.713  62.135 1.00 63.10  ? 67  ARG A CA   1 
ATOM   347  C C    . ARG A 1 22  ? 45.186 51.364  63.237 1.00 75.07  ? 67  ARG A C    1 
ATOM   348  O O    . ARG A 1 22  ? 44.152 50.828  63.646 1.00 70.60  ? 67  ARG A O    1 
ATOM   349  C CB   . ARG A 1 22  ? 45.165 50.460  60.891 1.00 66.52  ? 67  ARG A CB   1 
ATOM   350  C CG   . ARG A 1 22  ? 44.640 51.722  60.229 1.00 71.49  ? 67  ARG A CG   1 
ATOM   351  C CD   . ARG A 1 22  ? 43.727 51.402  59.052 1.00 75.32  ? 67  ARG A CD   1 
ATOM   352  N NE   . ARG A 1 22  ? 42.537 50.657  59.459 1.00 79.07  ? 67  ARG A NE   1 
ATOM   353  C CZ   . ARG A 1 22  ? 41.556 50.300  58.635 1.00 81.85  ? 67  ARG A CZ   1 
ATOM   354  N NH1  . ARG A 1 22  ? 41.612 50.618  57.349 1.00 83.65  ? 67  ARG A NH1  1 
ATOM   355  N NH2  . ARG A 1 22  ? 40.516 49.620  59.096 1.00 82.02  ? 67  ARG A NH2  1 
ATOM   356  H H    . ARG A 1 22  ? 46.101 48.768  62.442 1.00 68.94  ? 67  ARG A H    1 
ATOM   357  H HA   . ARG A 1 22  ? 46.735 51.313  61.898 1.00 75.72  ? 67  ARG A HA   1 
ATOM   358  H HB2  . ARG A 1 22  ? 45.706 49.987  60.238 1.00 79.83  ? 67  ARG A HB2  1 
ATOM   359  H HB3  . ARG A 1 22  ? 44.401 49.916  61.139 1.00 79.83  ? 67  ARG A HB3  1 
ATOM   360  H HG2  . ARG A 1 22  ? 44.132 52.234  60.877 1.00 85.79  ? 67  ARG A HG2  1 
ATOM   361  H HG3  . ARG A 1 22  ? 45.388 52.245  59.899 1.00 85.79  ? 67  ARG A HG3  1 
ATOM   362  H HD2  . ARG A 1 22  ? 43.437 52.231  58.640 1.00 90.38  ? 67  ARG A HD2  1 
ATOM   363  H HD3  . ARG A 1 22  ? 44.214 50.863  58.409 1.00 90.38  ? 67  ARG A HD3  1 
ATOM   364  H HE   . ARG A 1 22  ? 42.466 50.436  60.287 1.00 94.88  ? 67  ARG A HE   1 
ATOM   365  H HH11 . ARG A 1 22  ? 42.286 51.058  57.044 1.00 100.38 ? 67  ARG A HH11 1 
ATOM   366  H HH12 . ARG A 1 22  ? 40.976 50.385  56.820 1.00 100.38 ? 67  ARG A HH12 1 
ATOM   367  H HH21 . ARG A 1 22  ? 40.473 49.411  59.929 1.00 98.43  ? 67  ARG A HH21 1 
ATOM   368  H HH22 . ARG A 1 22  ? 39.881 49.390  58.563 1.00 98.43  ? 67  ARG A HH22 1 
ATOM   369  N N    . THR A 1 23  ? 45.641 52.518  63.720 1.00 99.02  ? 68  THR A N    1 
ATOM   370  C CA   . THR A 1 23  ? 44.988 53.216  64.817 1.00 106.57 ? 68  THR A CA   1 
ATOM   371  C C    . THR A 1 23  ? 44.409 54.528  64.313 1.00 105.62 ? 68  THR A C    1 
ATOM   372  O O    . THR A 1 23  ? 45.172 55.381  63.837 1.00 106.79 ? 68  THR A O    1 
ATOM   373  C CB   . THR A 1 23  ? 45.983 53.478  65.948 1.00 104.84 ? 68  THR A CB   1 
ATOM   374  O OG1  . THR A 1 23  ? 46.545 52.232  66.388 1.00 105.82 ? 68  THR A OG1  1 
ATOM   375  C CG2  . THR A 1 23  ? 45.296 54.179  67.126 1.00 112.55 ? 68  THR A CG2  1 
ATOM   376  H H    . THR A 1 23  ? 46.340 52.921  63.421 1.00 118.82 ? 68  THR A H    1 
ATOM   377  H HA   . THR A 1 23  ? 44.264 52.672  65.163 1.00 127.88 ? 68  THR A HA   1 
ATOM   378  H HB   . THR A 1 23  ? 46.693 54.053  65.624 1.00 125.81 ? 68  THR A HB   1 
ATOM   379  H HG1  . THR A 1 23  ? 47.093 52.368  67.010 1.00 126.99 ? 68  THR A HG1  1 
ATOM   380  H HG21 . THR A 1 23  ? 45.937 54.339  67.836 1.00 135.07 ? 68  THR A HG21 1 
ATOM   381  H HG22 . THR A 1 23  ? 44.927 55.028  66.836 1.00 135.07 ? 68  THR A HG22 1 
ATOM   382  H HG23 . THR A 1 23  ? 44.578 53.624  67.469 1.00 135.07 ? 68  THR A HG23 1 
ATOM   383  N N    . PRO A 1 24  ? 43.084 54.741  64.374 1.00 94.71  ? 69  PRO A N    1 
ATOM   384  C CA   . PRO A 1 24  ? 42.529 56.059  64.038 1.00 95.37  ? 69  PRO A CA   1 
ATOM   385  C C    . PRO A 1 24  ? 42.978 57.153  65.003 1.00 99.19  ? 69  PRO A C    1 
ATOM   386  O O    . PRO A 1 24  ? 43.891 57.913  64.677 1.00 98.90  ? 69  PRO A O    1 
ATOM   387  C CB   . PRO A 1 24  ? 41.015 55.840  64.136 1.00 95.42  ? 69  PRO A CB   1 
ATOM   388  C CG   . PRO A 1 24  ? 40.825 54.373  63.934 1.00 91.81  ? 69  PRO A CG   1 
ATOM   389  C CD   . PRO A 1 24  ? 42.029 53.730  64.556 1.00 91.09  ? 69  PRO A CD   1 
ATOM   390  H HA   . PRO A 1 24  ? 42.764 56.307  63.131 1.00 114.44 ? 69  PRO A HA   1 
ATOM   391  H HB2  . PRO A 1 24  ? 40.701 56.110  65.013 1.00 114.51 ? 69  PRO A HB2  1 
ATOM   392  H HB3  . PRO A 1 24  ? 40.566 56.344  63.439 1.00 114.51 ? 69  PRO A HB3  1 
ATOM   393  H HG2  . PRO A 1 24  ? 40.013 54.085  64.381 1.00 110.18 ? 69  PRO A HG2  1 
ATOM   394  H HG3  . PRO A 1 24  ? 40.783 54.177  62.985 1.00 110.18 ? 69  PRO A HG3  1 
ATOM   395  H HD2  . PRO A 1 24  ? 41.876 53.565  65.500 1.00 109.30 ? 69  PRO A HD2  1 
ATOM   396  H HD3  . PRO A 1 24  ? 42.258 52.913  64.084 1.00 109.30 ? 69  PRO A HD3  1 
ATOM   397  N N    . GLU A 1 34  ? 49.039 53.977  62.743 1.00 115.15 ? 79  GLU A N    1 
ATOM   398  C CA   . GLU A 1 34  ? 48.212 53.796  61.557 1.00 119.60 ? 79  GLU A CA   1 
ATOM   399  C C    . GLU A 1 34  ? 48.926 52.922  60.531 1.00 136.66 ? 79  GLU A C    1 
ATOM   400  O O    . GLU A 1 34  ? 49.403 53.411  59.508 1.00 135.49 ? 79  GLU A O    1 
ATOM   401  C CB   . GLU A 1 34  ? 47.854 55.146  60.944 1.00 117.40 ? 79  GLU A CB   1 
ATOM   402  C CG   . GLU A 1 34  ? 46.869 55.051  59.790 1.00 110.34 ? 79  GLU A CG   1 
ATOM   403  C CD   . GLU A 1 34  ? 46.457 56.411  59.275 1.00 112.10 ? 79  GLU A CD   1 
ATOM   404  O OE1  . GLU A 1 34  ? 46.719 57.409  59.976 1.00 116.27 ? 79  GLU A OE1  1 
ATOM   405  O OE2  . GLU A 1 34  ? 45.879 56.481  58.170 1.00 114.33 ? 79  GLU A OE2  1 
ATOM   406  H HA   . GLU A 1 34  ? 47.388 53.351  61.810 1.00 143.52 ? 79  GLU A HA   1 
ATOM   407  H HB2  . GLU A 1 34  ? 47.456 55.705  61.629 1.00 140.88 ? 79  GLU A HB2  1 
ATOM   408  H HB3  . GLU A 1 34  ? 48.664 55.563  60.609 1.00 140.88 ? 79  GLU A HB3  1 
ATOM   409  H HG2  . GLU A 1 34  ? 47.282 54.564  59.060 1.00 132.40 ? 79  GLU A HG2  1 
ATOM   410  H HG3  . GLU A 1 34  ? 46.071 54.588  60.091 1.00 132.40 ? 79  GLU A HG3  1 
ATOM   411  N N    . GLN A 1 35  ? 48.998 51.624  60.820 1.00 160.80 ? 80  GLN A N    1 
ATOM   412  C CA   . GLN A 1 35  ? 49.630 50.623  59.967 1.00 157.53 ? 80  GLN A CA   1 
ATOM   413  C C    . GLN A 1 35  ? 51.140 50.797  59.904 1.00 149.93 ? 80  GLN A C    1 
ATOM   414  O O    . GLN A 1 35  ? 51.791 50.214  59.027 1.00 149.36 ? 80  GLN A O    1 
ATOM   415  C CB   . GLN A 1 35  ? 49.045 50.638  58.549 1.00 157.17 ? 80  GLN A CB   1 
ATOM   416  C CG   . GLN A 1 35  ? 49.218 49.327  57.788 1.00 159.73 ? 80  GLN A CG   1 
ATOM   417  C CD   . GLN A 1 35  ? 48.526 49.336  56.437 1.00 162.67 ? 80  GLN A CD   1 
ATOM   418  O OE1  . GLN A 1 35  ? 47.960 50.347  56.023 1.00 164.68 ? 80  GLN A OE1  1 
ATOM   419  N NE2  . GLN A 1 35  ? 48.568 48.205  55.741 1.00 159.63 ? 80  GLN A NE2  1 
ATOM   420  H H    . GLN A 1 35  ? 48.671 51.287  61.540 1.00 192.96 ? 80  GLN A H    1 
ATOM   421  H HA   . GLN A 1 35  ? 49.454 49.747  60.344 1.00 189.03 ? 80  GLN A HA   1 
ATOM   422  H HB2  . GLN A 1 35  ? 48.094 50.823  58.606 1.00 188.61 ? 80  GLN A HB2  1 
ATOM   423  H HB3  . GLN A 1 35  ? 49.484 51.336  58.038 1.00 188.61 ? 80  GLN A HB3  1 
ATOM   424  H HG2  . GLN A 1 35  ? 50.163 49.170  57.639 1.00 191.68 ? 80  GLN A HG2  1 
ATOM   425  H HG3  . GLN A 1 35  ? 48.840 48.605  58.313 1.00 191.68 ? 80  GLN A HG3  1 
ATOM   426  H HE21 . GLN A 1 35  ? 48.973 47.517  56.062 1.00 191.56 ? 80  GLN A HE21 1 
ATOM   427  H HE22 . GLN A 1 35  ? 48.190 48.160  54.970 1.00 191.56 ? 80  GLN A HE22 1 
ATOM   428  N N    . ASN A 1 36  ? 51.720 51.586  60.804 1.00 131.97 ? 81  ASN A N    1 
ATOM   429  C CA   . ASN A 1 36  ? 53.168 51.705  60.889 1.00 106.68 ? 81  ASN A CA   1 
ATOM   430  C C    . ASN A 1 36  ? 53.734 50.446  61.534 1.00 87.28  ? 81  ASN A C    1 
ATOM   431  O O    . ASN A 1 36  ? 53.316 50.052  62.628 1.00 78.05  ? 81  ASN A O    1 
ATOM   432  C CB   . ASN A 1 36  ? 53.553 52.945  61.694 1.00 103.80 ? 81  ASN A CB   1 
ATOM   433  C CG   . ASN A 1 36  ? 55.024 53.310  61.553 1.00 103.67 ? 81  ASN A CG   1 
ATOM   434  O OD1  . ASN A 1 36  ? 55.641 53.076  60.513 1.00 103.32 ? 81  ASN A OD1  1 
ATOM   435  N ND2  . ASN A 1 36  ? 55.589 53.895  62.603 1.00 107.33 ? 81  ASN A ND2  1 
ATOM   436  H H    . ASN A 1 36  ? 51.294 52.064  61.378 1.00 158.37 ? 81  ASN A H    1 
ATOM   437  H HA   . ASN A 1 36  ? 53.539 51.789  59.997 1.00 128.01 ? 81  ASN A HA   1 
ATOM   438  H HB2  . ASN A 1 36  ? 53.027 53.699  61.385 1.00 124.56 ? 81  ASN A HB2  1 
ATOM   439  H HB3  . ASN A 1 36  ? 53.375 52.780  62.633 1.00 124.56 ? 81  ASN A HB3  1 
ATOM   440  H HD21 . ASN A 1 36  ? 56.418 54.121  62.574 1.00 128.80 ? 81  ASN A HD21 1 
ATOM   441  H HD22 . ASN A 1 36  ? 55.126 54.048  63.311 1.00 128.80 ? 81  ASN A HD22 1 
ATOM   442  N N    . ILE A 1 37  ? 54.676 49.810  60.853 1.00 88.26  ? 82  ILE A N    1 
ATOM   443  C CA   . ILE A 1 37  ? 55.188 48.525  61.305 1.00 80.44  ? 82  ILE A CA   1 
ATOM   444  C C    . ILE A 1 37  ? 56.248 48.759  62.370 1.00 75.43  ? 82  ILE A C    1 
ATOM   445  O O    . ILE A 1 37  ? 57.106 49.639  62.235 1.00 80.78  ? 82  ILE A O    1 
ATOM   446  C CB   . ILE A 1 37  ? 55.737 47.709  60.120 1.00 76.92  ? 82  ILE A CB   1 
ATOM   447  C CG1  . ILE A 1 37  ? 54.652 47.509  59.053 1.00 77.04  ? 82  ILE A CG1  1 
ATOM   448  C CG2  . ILE A 1 37  ? 56.236 46.348  60.591 1.00 76.51  ? 82  ILE A CG2  1 
ATOM   449  C CD1  . ILE A 1 37  ? 54.654 48.544  57.946 1.00 79.45  ? 82  ILE A CD1  1 
ATOM   450  H H    . ILE A 1 37  ? 55.036 50.100  60.128 1.00 105.91 ? 82  ILE A H    1 
ATOM   451  H HA   . ILE A 1 37  ? 54.464 48.019  61.708 1.00 96.52  ? 82  ILE A HA   1 
ATOM   452  H HB   . ILE A 1 37  ? 56.478 48.194  59.724 1.00 92.31  ? 82  ILE A HB   1 
ATOM   453  H HG12 . ILE A 1 37  ? 54.779 46.639  58.642 1.00 92.45  ? 82  ILE A HG12 1 
ATOM   454  H HG13 . ILE A 1 37  ? 53.784 47.542  59.484 1.00 92.45  ? 82  ILE A HG13 1 
ATOM   455  H HG21 . ILE A 1 37  ? 56.576 45.855  59.828 1.00 91.81  ? 82  ILE A HG21 1 
ATOM   456  H HG22 . ILE A 1 37  ? 56.943 46.480  61.242 1.00 91.81  ? 82  ILE A HG22 1 
ATOM   457  H HG23 . ILE A 1 37  ? 55.499 45.865  60.996 1.00 91.81  ? 82  ILE A HG23 1 
ATOM   458  H HD11 . ILE A 1 37  ? 53.940 48.339  57.322 1.00 95.34  ? 82  ILE A HD11 1 
ATOM   459  H HD12 . ILE A 1 37  ? 54.513 49.421  58.335 1.00 95.34  ? 82  ILE A HD12 1 
ATOM   460  H HD13 . ILE A 1 37  ? 55.510 48.516  57.491 1.00 95.34  ? 82  ILE A HD13 1 
ATOM   461  N N    . LYS A 1 38  ? 56.178 47.975  63.444 1.00 62.25  ? 83  LYS A N    1 
ATOM   462  C CA   . LYS A 1 38  ? 57.083 48.084  64.579 1.00 57.86  ? 83  LYS A CA   1 
ATOM   463  C C    . LYS A 1 38  ? 57.816 46.763  64.768 1.00 49.26  ? 83  LYS A C    1 
ATOM   464  O O    . LYS A 1 38  ? 57.187 45.700  64.818 1.00 43.91  ? 83  LYS A O    1 
ATOM   465  C CB   . LYS A 1 38  ? 56.327 48.445  65.860 1.00 60.41  ? 83  LYS A CB   1 
ATOM   466  C CG   . LYS A 1 38  ? 55.458 49.686  65.758 1.00 65.31  ? 83  LYS A CG   1 
ATOM   467  C CD   . LYS A 1 38  ? 56.276 50.928  65.410 1.00 71.88  ? 83  LYS A CD   1 
ATOM   468  C CE   . LYS A 1 38  ? 55.587 52.207  65.871 1.00 78.24  ? 83  LYS A CE   1 
ATOM   469  N NZ   . LYS A 1 38  ? 54.194 52.327  65.352 1.00 79.75  ? 83  LYS A NZ   1 
ATOM   470  H H    . LYS A 1 38  ? 55.592 47.352  63.538 1.00 74.70  ? 83  LYS A H    1 
ATOM   471  H HA   . LYS A 1 38  ? 57.739 48.777  64.403 1.00 69.43  ? 83  LYS A HA   1 
ATOM   472  H HB2  . LYS A 1 38  ? 55.750 47.702  66.099 1.00 72.49  ? 83  LYS A HB2  1 
ATOM   473  H HB3  . LYS A 1 38  ? 56.973 48.596  66.568 1.00 72.49  ? 83  LYS A HB3  1 
ATOM   474  H HG2  . LYS A 1 38  ? 54.796 49.555  65.062 1.00 78.37  ? 83  LYS A HG2  1 
ATOM   475  H HG3  . LYS A 1 38  ? 55.021 49.840  66.610 1.00 78.37  ? 83  LYS A HG3  1 
ATOM   476  H HD2  . LYS A 1 38  ? 57.139 50.874  65.848 1.00 86.25  ? 83  LYS A HD2  1 
ATOM   477  H HD3  . LYS A 1 38  ? 56.390 50.975  64.448 1.00 86.25  ? 83  LYS A HD3  1 
ATOM   478  H HE2  . LYS A 1 38  ? 55.548 52.214  66.840 1.00 93.89  ? 83  LYS A HE2  1 
ATOM   479  H HE3  . LYS A 1 38  ? 56.093 52.971  65.553 1.00 93.89  ? 83  LYS A HE3  1 
ATOM   480  H HZ1  . LYS A 1 38  ? 53.826 53.084  65.642 1.00 95.70  ? 83  LYS A HZ1  1 
ATOM   481  H HZ2  . LYS A 1 38  ? 54.200 52.331  64.462 1.00 95.70  ? 83  LYS A HZ2  1 
ATOM   482  H HZ3  . LYS A 1 38  ? 53.704 51.641  65.635 1.00 95.70  ? 83  LYS A HZ3  1 
ATOM   483  N N    . GLN A 1 39  ? 59.138 46.841  64.897 1.00 51.74  ? 84  GLN A N    1 
ATOM   484  C CA   . GLN A 1 39  ? 59.978 45.668  65.096 1.00 48.95  ? 84  GLN A CA   1 
ATOM   485  C C    . GLN A 1 39  ? 59.881 45.187  66.539 1.00 48.02  ? 84  GLN A C    1 
ATOM   486  O O    . GLN A 1 39  ? 60.053 45.972  67.476 1.00 50.67  ? 84  GLN A O    1 
ATOM   487  C CB   . GLN A 1 39  ? 61.428 46.015  64.748 1.00 52.01  ? 84  GLN A CB   1 
ATOM   488  C CG   . GLN A 1 39  ? 62.422 44.895  64.961 1.00 51.84  ? 84  GLN A CG   1 
ATOM   489  C CD   . GLN A 1 39  ? 63.822 45.274  64.511 1.00 56.62  ? 84  GLN A CD   1 
ATOM   490  O OE1  . GLN A 1 39  ? 64.046 46.363  63.980 1.00 59.16  ? 84  GLN A OE1  1 
ATOM   491  N NE2  . GLN A 1 39  ? 64.776 44.376  64.729 1.00 56.90  ? 84  GLN A NE2  1 
ATOM   492  H H    . GLN A 1 39  ? 59.578 47.580  64.873 1.00 62.09  ? 84  GLN A H    1 
ATOM   493  H HA   . GLN A 1 39  ? 59.682 44.953  64.511 1.00 58.74  ? 84  GLN A HA   1 
ATOM   494  H HB2  . GLN A 1 39  ? 61.468 46.268  63.812 1.00 62.42  ? 84  GLN A HB2  1 
ATOM   495  H HB3  . GLN A 1 39  ? 61.707 46.762  65.299 1.00 62.42  ? 84  GLN A HB3  1 
ATOM   496  H HG2  . GLN A 1 39  ? 62.457 44.678  65.905 1.00 62.21  ? 84  GLN A HG2  1 
ATOM   497  H HG3  . GLN A 1 39  ? 62.141 44.120  64.450 1.00 62.21  ? 84  GLN A HG3  1 
ATOM   498  H HE21 . GLN A 1 39  ? 64.583 43.628  65.107 1.00 68.27  ? 84  GLN A HE21 1 
ATOM   499  H HE22 . GLN A 1 39  ? 65.586 44.543  64.493 1.00 68.27  ? 84  GLN A HE22 1 
ATOM   500  N N    . ILE A 1 40  ? 59.613 43.896  66.722 1.00 50.46  ? 85  ILE A N    1 
ATOM   501  C CA   . ILE A 1 40  ? 59.538 43.337  68.068 1.00 52.86  ? 85  ILE A CA   1 
ATOM   502  C C    . ILE A 1 40  ? 60.917 42.856  68.493 1.00 54.92  ? 85  ILE A C    1 
ATOM   503  O O    . ILE A 1 40  ? 61.459 43.317  69.502 1.00 57.64  ? 85  ILE A O    1 
ATOM   504  C CB   . ILE A 1 40  ? 58.516 42.196  68.164 1.00 50.48  ? 85  ILE A CB   1 
ATOM   505  C CG1  . ILE A 1 40  ? 57.123 42.700  67.812 1.00 50.90  ? 85  ILE A CG1  1 
ATOM   506  C CG2  . ILE A 1 40  ? 58.517 41.612  69.577 1.00 52.65  ? 85  ILE A CG2  1 
ATOM   507  C CD1  . ILE A 1 40  ? 56.083 41.600  67.712 1.00 48.45  ? 85  ILE A CD1  1 
ATOM   508  H H    . ILE A 1 40  ? 59.471 43.329  66.091 1.00 60.55  ? 85  ILE A H    1 
ATOM   509  H HA   . ILE A 1 40  ? 59.263 44.035  68.683 1.00 63.44  ? 85  ILE A HA   1 
ATOM   510  H HB   . ILE A 1 40  ? 58.764 41.499  67.536 1.00 60.58  ? 85  ILE A HB   1 
ATOM   511  H HG12 . ILE A 1 40  ? 56.833 43.322  68.498 1.00 61.08  ? 85  ILE A HG12 1 
ATOM   512  H HG13 . ILE A 1 40  ? 57.161 43.151  66.954 1.00 61.08  ? 85  ILE A HG13 1 
ATOM   513  H HG21 . ILE A 1 40  ? 57.868 40.893  69.623 1.00 63.18  ? 85  ILE A HG21 1 
ATOM   514  H HG22 . ILE A 1 40  ? 59.403 41.271  69.777 1.00 63.18  ? 85  ILE A HG22 1 
ATOM   515  H HG23 . ILE A 1 40  ? 58.282 42.311  70.207 1.00 63.18  ? 85  ILE A HG23 1 
ATOM   516  H HD11 . ILE A 1 40  ? 55.226 41.996  67.486 1.00 58.15  ? 85  ILE A HD11 1 
ATOM   517  H HD12 . ILE A 1 40  ? 56.351 40.974  67.021 1.00 58.15  ? 85  ILE A HD12 1 
ATOM   518  H HD13 . ILE A 1 40  ? 56.022 41.145  68.566 1.00 58.15  ? 85  ILE A HD13 1 
ATOM   519  N N    . GLY A 1 41  ? 61.492 41.928  67.740 1.00 55.68  ? 86  GLY A N    1 
ATOM   520  C CA   . GLY A 1 41  ? 62.814 41.433  68.081 1.00 56.92  ? 86  GLY A CA   1 
ATOM   521  C C    . GLY A 1 41  ? 63.253 40.345  67.130 1.00 55.80  ? 86  GLY A C    1 
ATOM   522  O O    . GLY A 1 41  ? 62.466 39.812  66.340 1.00 52.27  ? 86  GLY A O    1 
ATOM   523  H H    . GLY A 1 41  ? 61.144 41.574  67.038 1.00 66.81  ? 86  GLY A H    1 
ATOM   524  H HA2  . GLY A 1 41  ? 63.456 42.160  68.040 1.00 68.31  ? 86  GLY A HA2  1 
ATOM   525  H HA3  . GLY A 1 41  ? 62.807 41.075  68.982 1.00 68.31  ? 86  GLY A HA3  1 
ATOM   526  N N    . THR A 1 42  ? 64.530 40.010  67.235 1.00 48.82  ? 87  THR A N    1 
ATOM   527  C CA   . THR A 1 42  ? 65.156 39.039  66.356 1.00 47.23  ? 87  THR A CA   1 
ATOM   528  C C    . THR A 1 42  ? 65.557 37.802  67.145 1.00 45.89  ? 87  THR A C    1 
ATOM   529  O O    . THR A 1 42  ? 65.921 37.884  68.321 1.00 47.19  ? 87  THR A O    1 
ATOM   530  C CB   . THR A 1 42  ? 66.382 39.637  65.672 1.00 50.69  ? 87  THR A CB   1 
ATOM   531  O OG1  . THR A 1 42  ? 65.992 40.810  64.950 1.00 49.89  ? 87  THR A OG1  1 
ATOM   532  C CG2  . THR A 1 42  ? 67.016 38.632  64.711 1.00 48.07  ? 87  THR A CG2  1 
ATOM   533  H H    . THR A 1 42  ? 65.067 40.340  67.821 1.00 58.58  ? 87  THR A H    1 
ATOM   534  H HA   . THR A 1 42  ? 64.523 38.772  65.670 1.00 56.68  ? 87  THR A HA   1 
ATOM   535  H HB   . THR A 1 42  ? 67.040 39.876  66.343 1.00 60.83  ? 87  THR A HB   1 
ATOM   536  H HG1  . THR A 1 42  ? 65.417 40.612  64.369 1.00 59.87  ? 87  THR A HG1  1 
ATOM   537  H HG21 . THR A 1 42  ? 67.793 39.027  64.285 1.00 57.68  ? 87  THR A HG21 1 
ATOM   538  H HG22 . THR A 1 42  ? 67.291 37.838  65.195 1.00 57.68  ? 87  THR A HG22 1 
ATOM   539  H HG23 . THR A 1 42  ? 66.376 38.379  64.027 1.00 57.68  ? 87  THR A HG23 1 
ATOM   540  N N    . PHE A 1 43  ? 65.476 36.651  66.487 1.00 50.03  ? 88  PHE A N    1 
ATOM   541  C CA   . PHE A 1 43  ? 65.862 35.392  67.102 1.00 50.36  ? 88  PHE A CA   1 
ATOM   542  C C    . PHE A 1 43  ? 66.634 34.559  66.088 1.00 50.38  ? 88  PHE A C    1 
ATOM   543  O O    . PHE A 1 43  ? 66.559 34.784  64.876 1.00 50.61  ? 88  PHE A O    1 
ATOM   544  C CB   . PHE A 1 43  ? 64.643 34.620  67.637 1.00 49.54  ? 88  PHE A CB   1 
ATOM   545  C CG   . PHE A 1 43  ? 63.611 34.292  66.600 1.00 50.10  ? 88  PHE A CG   1 
ATOM   546  C CD1  . PHE A 1 43  ? 63.743 33.170  65.799 1.00 49.77  ? 88  PHE A CD1  1 
ATOM   547  C CD2  . PHE A 1 43  ? 62.490 35.081  66.452 1.00 49.14  ? 88  PHE A CD2  1 
ATOM   548  C CE1  . PHE A 1 43  ? 62.785 32.856  64.852 1.00 47.44  ? 88  PHE A CE1  1 
ATOM   549  C CE2  . PHE A 1 43  ? 61.529 34.773  65.508 1.00 46.97  ? 88  PHE A CE2  1 
ATOM   550  C CZ   . PHE A 1 43  ? 61.676 33.660  64.708 1.00 46.75  ? 88  PHE A CZ   1 
ATOM   551  H H    . PHE A 1 43  ? 65.198 36.574  65.677 1.00 60.03  ? 88  PHE A H    1 
ATOM   552  H HA   . PHE A 1 43  ? 66.452 35.575  67.850 1.00 60.43  ? 88  PHE A HA   1 
ATOM   553  H HB2  . PHE A 1 43  ? 64.950 33.784  68.021 1.00 59.45  ? 88  PHE A HB2  1 
ATOM   554  H HB3  . PHE A 1 43  ? 64.212 35.156  68.321 1.00 59.45  ? 88  PHE A HB3  1 
ATOM   555  H HD1  . PHE A 1 43  ? 64.491 32.625  65.893 1.00 59.73  ? 88  PHE A HD1  1 
ATOM   556  H HD2  . PHE A 1 43  ? 62.384 35.834  66.987 1.00 58.97  ? 88  PHE A HD2  1 
ATOM   557  H HE1  . PHE A 1 43  ? 62.889 32.104  64.315 1.00 56.93  ? 88  PHE A HE1  1 
ATOM   558  H HE2  . PHE A 1 43  ? 60.781 35.317  65.412 1.00 56.36  ? 88  PHE A HE2  1 
ATOM   559  H HZ   . PHE A 1 43  ? 61.029 33.453  64.073 1.00 56.10  ? 88  PHE A HZ   1 
ATOM   560  N N    . ALA A 1 44  ? 67.375 33.576  66.609 1.00 49.11  ? 89  ALA A N    1 
ATOM   561  C CA   . ALA A 1 44  ? 68.341 32.831  65.815 1.00 49.47  ? 89  ALA A CA   1 
ATOM   562  C C    . ALA A 1 44  ? 68.257 31.319  65.966 1.00 49.03  ? 89  ALA A C    1 
ATOM   563  O O    . ALA A 1 44  ? 68.895 30.612  65.179 1.00 50.12  ? 89  ALA A O    1 
ATOM   564  C CB   . ALA A 1 44  ? 69.768 33.276  66.174 1.00 51.83  ? 89  ALA A CB   1 
ATOM   565  H H    . ALA A 1 44  ? 67.332 33.323  67.430 1.00 58.93  ? 89  ALA A H    1 
ATOM   566  H HA   . ALA A 1 44  ? 68.195 33.039  64.879 1.00 59.37  ? 89  ALA A HA   1 
ATOM   567  H HB1  . ALA A 1 44  ? 70.400 32.771  65.638 1.00 62.20  ? 89  ALA A HB1  1 
ATOM   568  H HB2  . ALA A 1 44  ? 69.859 34.224  65.988 1.00 62.20  ? 89  ALA A HB2  1 
ATOM   569  H HB3  . ALA A 1 44  ? 69.924 33.106  67.116 1.00 62.20  ? 89  ALA A HB3  1 
ATOM   570  N N    . SER A 1 45  ? 67.516 30.801  66.943 1.00 49.06  ? 90  SER A N    1 
ATOM   571  C CA   . SER A 1 45  ? 67.420 29.366  67.185 1.00 50.16  ? 90  SER A CA   1 
ATOM   572  C C    . SER A 1 45  ? 65.956 28.968  67.311 1.00 48.05  ? 90  SER A C    1 
ATOM   573  O O    . SER A 1 45  ? 65.066 29.813  67.447 1.00 47.09  ? 90  SER A O    1 
ATOM   574  C CB   . SER A 1 45  ? 68.169 28.957  68.458 1.00 53.22  ? 90  SER A CB   1 
ATOM   575  O OG   . SER A 1 45  ? 67.456 29.394  69.606 1.00 53.74  ? 90  SER A OG   1 
ATOM   576  H H    . SER A 1 45  ? 67.051 31.273  67.491 1.00 58.87  ? 90  SER A H    1 
ATOM   577  H HA   . SER A 1 45  ? 67.804 28.886  66.435 1.00 60.19  ? 90  SER A HA   1 
ATOM   578  H HB2  . SER A 1 45  ? 68.251 27.991  68.482 1.00 63.86  ? 90  SER A HB2  1 
ATOM   579  H HB3  . SER A 1 45  ? 69.049 29.366  68.454 1.00 63.86  ? 90  SER A HB3  1 
ATOM   580  H HG   . SER A 1 45  ? 67.868 29.169  70.303 1.00 64.49  ? 90  SER A HG   1 
ATOM   581  N N    . VAL A 1 46  ? 65.715 27.654  67.275 1.00 48.03  ? 91  VAL A N    1 
ATOM   582  C CA   . VAL A 1 46  ? 64.360 27.135  67.447 1.00 46.39  ? 91  VAL A CA   1 
ATOM   583  C C    . VAL A 1 46  ? 63.844 27.464  68.840 1.00 47.00  ? 91  VAL A C    1 
ATOM   584  O O    . VAL A 1 46  ? 62.685 27.869  69.011 1.00 44.30  ? 91  VAL A O    1 
ATOM   585  C CB   . VAL A 1 46  ? 64.328 25.616  67.181 1.00 46.51  ? 91  VAL A CB   1 
ATOM   586  C CG1  . VAL A 1 46  ? 62.919 25.046  67.442 1.00 45.50  ? 91  VAL A CG1  1 
ATOM   587  C CG2  . VAL A 1 46  ? 64.769 25.317  65.766 1.00 46.91  ? 91  VAL A CG2  1 
ATOM   588  H H    . VAL A 1 46  ? 66.315 27.050  67.152 1.00 57.64  ? 91  VAL A H    1 
ATOM   589  H HA   . VAL A 1 46  ? 63.775 27.563  66.803 1.00 55.67  ? 91  VAL A HA   1 
ATOM   590  H HB   . VAL A 1 46  ? 64.945 25.177  67.787 1.00 55.81  ? 91  VAL A HB   1 
ATOM   591  H HG11 . VAL A 1 46  ? 62.928 24.091  67.267 1.00 54.60  ? 91  VAL A HG11 1 
ATOM   592  H HG12 . VAL A 1 46  ? 62.678 25.211  68.367 1.00 54.60  ? 91  VAL A HG12 1 
ATOM   593  H HG13 . VAL A 1 46  ? 62.287 25.484  66.851 1.00 54.60  ? 91  VAL A HG13 1 
ATOM   594  H HG21 . VAL A 1 46  ? 64.740 24.358  65.623 1.00 56.29  ? 91  VAL A HG21 1 
ATOM   595  H HG22 . VAL A 1 46  ? 64.168 25.762  65.147 1.00 56.29  ? 91  VAL A HG22 1 
ATOM   596  H HG23 . VAL A 1 46  ? 65.674 25.643  65.642 1.00 56.29  ? 91  VAL A HG23 1 
ATOM   597  N N    . GLU A 1 47  ? 64.687 27.269  69.858 1.00 47.76  ? 92  GLU A N    1 
ATOM   598  C CA   . GLU A 1 47  ? 64.302 27.588  71.229 1.00 49.77  ? 92  GLU A CA   1 
ATOM   599  C C    . GLU A 1 47  ? 64.012 29.076  71.382 1.00 51.70  ? 92  GLU A C    1 
ATOM   600  O O    . GLU A 1 47  ? 63.072 29.469  72.083 1.00 50.41  ? 92  GLU A O    1 
ATOM   601  C CB   . GLU A 1 47  ? 65.408 27.163  72.200 1.00 51.36  ? 92  GLU A CB   1 
ATOM   602  C CG   . GLU A 1 47  ? 65.654 25.655  72.282 1.00 51.66  ? 92  GLU A CG   1 
ATOM   603  C CD   . GLU A 1 47  ? 66.497 25.112  71.138 1.00 51.00  ? 92  GLU A CD   1 
ATOM   604  O OE1  . GLU A 1 47  ? 66.762 25.849  70.166 1.00 50.22  ? 92  GLU A OE1  1 
ATOM   605  O OE2  . GLU A 1 47  ? 66.900 23.935  71.216 1.00 52.76  ? 92  GLU A OE2  1 
ATOM   606  H H    . GLU A 1 47  ? 65.483 26.955  69.778 1.00 57.31  ? 92  GLU A H    1 
ATOM   607  H HA   . GLU A 1 47  ? 63.496 27.098  71.456 1.00 59.72  ? 92  GLU A HA   1 
ATOM   608  H HB2  . GLU A 1 47  ? 66.239 27.580  71.922 1.00 61.63  ? 92  GLU A HB2  1 
ATOM   609  H HB3  . GLU A 1 47  ? 65.172 27.470  73.090 1.00 61.63  ? 92  GLU A HB3  1 
ATOM   610  H HG2  . GLU A 1 47  ? 66.116 25.458  73.112 1.00 61.99  ? 92  GLU A HG2  1 
ATOM   611  H HG3  . GLU A 1 47  ? 64.799 25.197  72.265 1.00 61.99  ? 92  GLU A HG3  1 
ATOM   612  N N    . GLN A 1 48  ? 64.819 29.918  70.737 1.00 50.39  ? 93  GLN A N    1 
ATOM   613  C CA   . GLN A 1 48  ? 64.585 31.356  70.773 1.00 51.94  ? 93  GLN A CA   1 
ATOM   614  C C    . GLN A 1 48  ? 63.251 31.709  70.124 1.00 45.38  ? 93  GLN A C    1 
ATOM   615  O O    . GLN A 1 48  ? 62.516 32.576  70.614 1.00 43.48  ? 93  GLN A O    1 
ATOM   616  C CB   . GLN A 1 48  ? 65.744 32.060  70.073 1.00 59.14  ? 93  GLN A CB   1 
ATOM   617  C CG   . GLN A 1 48  ? 66.180 33.366  70.696 1.00 66.87  ? 93  GLN A CG   1 
ATOM   618  C CD   . GLN A 1 48  ? 67.547 33.826  70.198 1.00 74.29  ? 93  GLN A CD   1 
ATOM   619  O OE1  . GLN A 1 48  ? 67.724 34.988  69.836 1.00 77.88  ? 93  GLN A OE1  1 
ATOM   620  N NE2  . GLN A 1 48  ? 68.520 32.918  70.191 1.00 77.22  ? 93  GLN A NE2  1 
ATOM   621  H H    . GLN A 1 48  ? 65.505 29.681  70.275 1.00 60.47  ? 93  GLN A H    1 
ATOM   622  H HA   . GLN A 1 48  ? 64.561 31.653  71.696 1.00 62.33  ? 93  GLN A HA   1 
ATOM   623  H HB2  . GLN A 1 48  ? 66.511 31.466  70.077 1.00 70.97  ? 93  GLN A HB2  1 
ATOM   624  H HB3  . GLN A 1 48  ? 65.483 32.246  69.158 1.00 70.97  ? 93  GLN A HB3  1 
ATOM   625  H HG2  . GLN A 1 48  ? 65.532 34.054  70.474 1.00 80.25  ? 93  GLN A HG2  1 
ATOM   626  H HG3  . GLN A 1 48  ? 66.232 33.257  71.658 1.00 80.25  ? 93  GLN A HG3  1 
ATOM   627  H HE21 . GLN A 1 48  ? 68.362 32.116  70.459 1.00 92.67  ? 93  GLN A HE21 1 
ATOM   628  H HE22 . GLN A 1 48  ? 69.307 33.133  69.918 1.00 92.67  ? 93  GLN A HE22 1 
ATOM   629  N N    . PHE A 1 49  ? 62.919 31.040  69.021 1.00 45.75  ? 94  PHE A N    1 
ATOM   630  C CA   . PHE A 1 49  ? 61.634 31.274  68.375 1.00 43.59  ? 94  PHE A CA   1 
ATOM   631  C C    . PHE A 1 49  ? 60.484 31.019  69.339 1.00 43.14  ? 94  PHE A C    1 
ATOM   632  O O    . PHE A 1 49  ? 59.584 31.858  69.489 1.00 42.88  ? 94  PHE A O    1 
ATOM   633  C CB   . PHE A 1 49  ? 61.505 30.383  67.142 1.00 41.90  ? 94  PHE A CB   1 
ATOM   634  C CG   . PHE A 1 49  ? 60.084 30.119  66.740 1.00 40.12  ? 94  PHE A CG   1 
ATOM   635  C CD1  . PHE A 1 49  ? 59.322 31.111  66.153 1.00 39.05  ? 94  PHE A CD1  1 
ATOM   636  C CD2  . PHE A 1 49  ? 59.508 28.875  66.951 1.00 39.14  ? 94  PHE A CD2  1 
ATOM   637  C CE1  . PHE A 1 49  ? 58.014 30.868  65.776 1.00 37.87  ? 94  PHE A CE1  1 
ATOM   638  C CE2  . PHE A 1 49  ? 58.202 28.629  66.581 1.00 37.85  ? 94  PHE A CE2  1 
ATOM   639  C CZ   . PHE A 1 49  ? 57.452 29.632  65.998 1.00 36.64  ? 94  PHE A CZ   1 
ATOM   640  H H    . PHE A 1 49  ? 63.414 30.454  68.633 1.00 54.90  ? 94  PHE A H    1 
ATOM   641  H HA   . PHE A 1 49  ? 61.587 32.199  68.085 1.00 52.30  ? 94  PHE A HA   1 
ATOM   642  H HB2  . PHE A 1 49  ? 61.950 30.814  66.396 1.00 50.28  ? 94  PHE A HB2  1 
ATOM   643  H HB3  . PHE A 1 49  ? 61.925 29.529  67.328 1.00 50.28  ? 94  PHE A HB3  1 
ATOM   644  H HD1  . PHE A 1 49  ? 59.695 31.950  66.003 1.00 46.86  ? 94  PHE A HD1  1 
ATOM   645  H HD2  . PHE A 1 49  ? 60.009 28.198  67.347 1.00 46.97  ? 94  PHE A HD2  1 
ATOM   646  H HE1  . PHE A 1 49  ? 57.510 31.543  65.384 1.00 45.45  ? 94  PHE A HE1  1 
ATOM   647  H HE2  . PHE A 1 49  ? 57.826 27.792  66.729 1.00 45.43  ? 94  PHE A HE2  1 
ATOM   648  H HZ   . PHE A 1 49  ? 56.572 29.469  65.745 1.00 43.97  ? 94  PHE A HZ   1 
ATOM   649  N N    . TRP A 1 50  ? 60.499 29.866  70.014 1.00 43.25  ? 95  TRP A N    1 
ATOM   650  C CA   . TRP A 1 50  ? 59.383 29.519  70.888 1.00 44.12  ? 95  TRP A CA   1 
ATOM   651  C C    . TRP A 1 50  ? 59.242 30.509  72.031 1.00 46.49  ? 95  TRP A C    1 
ATOM   652  O O    . TRP A 1 50  ? 58.126 30.749  72.506 1.00 45.66  ? 95  TRP A O    1 
ATOM   653  C CB   . TRP A 1 50  ? 59.549 28.105  71.442 1.00 43.32  ? 95  TRP A CB   1 
ATOM   654  C CG   . TRP A 1 50  ? 59.294 27.024  70.442 1.00 41.76  ? 95  TRP A CG   1 
ATOM   655  C CD1  . TRP A 1 50  ? 60.174 26.069  70.029 1.00 42.26  ? 95  TRP A CD1  1 
ATOM   656  C CD2  . TRP A 1 50  ? 58.076 26.783  69.727 1.00 40.74  ? 95  TRP A CD2  1 
ATOM   657  N NE1  . TRP A 1 50  ? 59.581 25.246  69.101 1.00 40.83  ? 95  TRP A NE1  1 
ATOM   658  C CE2  . TRP A 1 50  ? 58.292 25.664  68.899 1.00 40.15  ? 95  TRP A CE2  1 
ATOM   659  C CE3  . TRP A 1 50  ? 56.825 27.400  69.708 1.00 39.44  ? 95  TRP A CE3  1 
ATOM   660  C CZ2  . TRP A 1 50  ? 57.304 25.156  68.063 1.00 39.10  ? 95  TRP A CZ2  1 
ATOM   661  C CZ3  . TRP A 1 50  ? 55.853 26.895  68.878 1.00 38.83  ? 95  TRP A CZ3  1 
ATOM   662  C CH2  . TRP A 1 50  ? 56.095 25.788  68.066 1.00 38.89  ? 95  TRP A CH2  1 
ATOM   663  H H    . TRP A 1 50  ? 61.129 29.281  69.982 1.00 51.90  ? 95  TRP A H    1 
ATOM   664  H HA   . TRP A 1 50  ? 58.562 29.542  70.372 1.00 52.94  ? 95  TRP A HA   1 
ATOM   665  H HB2  . TRP A 1 50  ? 60.458 28.002  71.764 1.00 51.99  ? 95  TRP A HB2  1 
ATOM   666  H HB3  . TRP A 1 50  ? 58.926 27.982  72.175 1.00 51.99  ? 95  TRP A HB3  1 
ATOM   667  H HD1  . TRP A 1 50  ? 61.049 25.985  70.332 1.00 50.71  ? 95  TRP A HD1  1 
ATOM   668  H HE1  . TRP A 1 50  ? 59.957 24.579  68.710 1.00 48.99  ? 95  TRP A HE1  1 
ATOM   669  H HE3  . TRP A 1 50  ? 56.654 28.140  70.244 1.00 47.33  ? 95  TRP A HE3  1 
ATOM   670  H HZ2  . TRP A 1 50  ? 57.462 24.418  67.520 1.00 46.92  ? 95  TRP A HZ2  1 
ATOM   671  H HZ3  . TRP A 1 50  ? 55.016 27.301  68.858 1.00 46.59  ? 95  TRP A HZ3  1 
ATOM   672  H HH2  . TRP A 1 50  ? 55.414 25.470  67.518 1.00 46.67  ? 95  TRP A HH2  1 
ATOM   673  N N    . ARG A 1 51  ? 60.354 31.087  72.493 1.00 48.36  ? 96  ARG A N    1 
ATOM   674  C CA   . ARG A 1 51  ? 60.277 32.082  73.560 1.00 51.63  ? 96  ARG A CA   1 
ATOM   675  C C    . ARG A 1 51  ? 59.483 33.302  73.116 1.00 47.33  ? 96  ARG A C    1 
ATOM   676  O O    . ARG A 1 51  ? 58.701 33.857  73.895 1.00 47.74  ? 96  ARG A O    1 
ATOM   677  C CB   . ARG A 1 51  ? 61.679 32.494  74.009 1.00 58.92  ? 96  ARG A CB   1 
ATOM   678  C CG   . ARG A 1 51  ? 62.473 31.376  74.651 1.00 64.43  ? 96  ARG A CG   1 
ATOM   679  C CD   . ARG A 1 51  ? 63.794 31.868  75.222 1.00 72.90  ? 96  ARG A CD   1 
ATOM   680  N NE   . ARG A 1 51  ? 64.859 30.893  74.997 1.00 78.05  ? 96  ARG A NE   1 
ATOM   681  C CZ   . ARG A 1 51  ? 64.918 29.696  75.578 1.00 82.56  ? 96  ARG A CZ   1 
ATOM   682  N NH1  . ARG A 1 51  ? 63.974 29.311  76.430 1.00 83.83  ? 96  ARG A NH1  1 
ATOM   683  N NH2  . ARG A 1 51  ? 65.924 28.876  75.300 1.00 85.08  ? 96  ARG A NH2  1 
ATOM   684  H H    . ARG A 1 51  ? 61.150 30.923  72.211 1.00 58.04  ? 96  ARG A H    1 
ATOM   685  H HA   . ARG A 1 51  ? 59.822 31.691  74.322 1.00 61.96  ? 96  ARG A HA   1 
ATOM   686  H HB2  . ARG A 1 51  ? 62.176 32.803  73.235 1.00 70.70  ? 96  ARG A HB2  1 
ATOM   687  H HB3  . ARG A 1 51  ? 61.601 33.211  74.657 1.00 70.70  ? 96  ARG A HB3  1 
ATOM   688  H HG2  . ARG A 1 51  ? 61.955 30.993  75.375 1.00 77.31  ? 96  ARG A HG2  1 
ATOM   689  H HG3  . ARG A 1 51  ? 62.666 30.699  73.983 1.00 77.31  ? 96  ARG A HG3  1 
ATOM   690  H HD2  . ARG A 1 51  ? 64.044 32.698  74.786 1.00 87.48  ? 96  ARG A HD2  1 
ATOM   691  H HD3  . ARG A 1 51  ? 63.701 32.004  76.178 1.00 87.48  ? 96  ARG A HD3  1 
ATOM   692  H HE   . ARG A 1 51  ? 65.490 31.106  74.453 1.00 93.66  ? 96  ARG A HE   1 
ATOM   693  H HH11 . ARG A 1 51  ? 63.319 29.837  76.612 1.00 100.60 ? 96  ARG A HH11 1 
ATOM   694  H HH12 . ARG A 1 51  ? 64.020 28.537  76.802 1.00 100.60 ? 96  ARG A HH12 1 
ATOM   695  H HH21 . ARG A 1 51  ? 66.538 29.120  74.750 1.00 102.10 ? 96  ARG A HH21 1 
ATOM   696  H HH22 . ARG A 1 51  ? 65.965 28.104  75.676 1.00 102.10 ? 96  ARG A HH22 1 
ATOM   697  N N    . PHE A 1 52  ? 59.674 33.739  71.869 1.00 45.49  ? 97  PHE A N    1 
ATOM   698  C CA   . PHE A 1 52  ? 58.881 34.841  71.330 1.00 44.10  ? 97  PHE A CA   1 
ATOM   699  C C    . PHE A 1 52  ? 57.442 34.398  71.076 1.00 42.03  ? 97  PHE A C    1 
ATOM   700  O O    . PHE A 1 52  ? 56.494 34.947  71.648 1.00 41.37  ? 97  PHE A O    1 
ATOM   701  C CB   . PHE A 1 52  ? 59.521 35.363  70.036 1.00 43.89  ? 97  PHE A CB   1 
ATOM   702  C CG   . PHE A 1 52  ? 60.584 36.404  70.253 1.00 46.91  ? 97  PHE A CG   1 
ATOM   703  C CD1  . PHE A 1 52  ? 61.885 36.038  70.570 1.00 48.71  ? 97  PHE A CD1  1 
ATOM   704  C CD2  . PHE A 1 52  ? 60.285 37.752  70.132 1.00 48.01  ? 97  PHE A CD2  1 
ATOM   705  C CE1  . PHE A 1 52  ? 62.869 37.004  70.771 1.00 51.07  ? 97  PHE A CE1  1 
ATOM   706  C CE2  . PHE A 1 52  ? 61.262 38.723  70.332 1.00 50.62  ? 97  PHE A CE2  1 
ATOM   707  C CZ   . PHE A 1 52  ? 62.552 38.349  70.652 1.00 51.64  ? 97  PHE A CZ   1 
ATOM   708  H H    . PHE A 1 52  ? 60.251 33.415  71.320 1.00 54.59  ? 97  PHE A H    1 
ATOM   709  H HA   . PHE A 1 52  ? 58.865 35.567  71.973 1.00 52.92  ? 97  PHE A HA   1 
ATOM   710  H HB2  . PHE A 1 52  ? 59.929 34.617  69.568 1.00 52.67  ? 97  PHE A HB2  1 
ATOM   711  H HB3  . PHE A 1 52  ? 58.829 35.758  69.483 1.00 52.67  ? 97  PHE A HB3  1 
ATOM   712  H HD1  . PHE A 1 52  ? 62.101 35.137  70.654 1.00 58.45  ? 97  PHE A HD1  1 
ATOM   713  H HD2  . PHE A 1 52  ? 59.418 38.011  69.920 1.00 57.61  ? 97  PHE A HD2  1 
ATOM   714  H HE1  . PHE A 1 52  ? 63.737 36.747  70.985 1.00 61.28  ? 97  PHE A HE1  1 
ATOM   715  H HE2  . PHE A 1 52  ? 61.046 39.624  70.249 1.00 60.74  ? 97  PHE A HE2  1 
ATOM   716  H HZ   . PHE A 1 52  ? 63.207 38.996  70.783 1.00 61.97  ? 97  PHE A HZ   1 
ATOM   717  N N    . TYR A 1 53  ? 57.270 33.374  70.239 1.00 40.84  ? 98  TYR A N    1 
ATOM   718  C CA   . TYR A 1 53  ? 55.946 32.998  69.762 1.00 40.49  ? 98  TYR A CA   1 
ATOM   719  C C    . TYR A 1 53  ? 55.018 32.624  70.914 1.00 41.74  ? 98  TYR A C    1 
ATOM   720  O O    . TYR A 1 53  ? 53.868 33.078  70.972 1.00 42.98  ? 98  TYR A O    1 
ATOM   721  C CB   . TYR A 1 53  ? 56.078 31.849  68.770 1.00 40.00  ? 98  TYR A CB   1 
ATOM   722  C CG   . TYR A 1 53  ? 54.767 31.300  68.282 1.00 39.23  ? 98  TYR A CG   1 
ATOM   723  C CD1  . TYR A 1 53  ? 54.007 31.989  67.344 1.00 39.55  ? 98  TYR A CD1  1 
ATOM   724  C CD2  . TYR A 1 53  ? 54.292 30.085  68.747 1.00 39.68  ? 98  TYR A CD2  1 
ATOM   725  C CE1  . TYR A 1 53  ? 52.800 31.479  66.886 1.00 39.26  ? 98  TYR A CE1  1 
ATOM   726  C CE2  . TYR A 1 53  ? 53.091 29.574  68.300 1.00 40.15  ? 98  TYR A CE2  1 
ATOM   727  C CZ   . TYR A 1 53  ? 52.350 30.272  67.371 1.00 39.61  ? 98  TYR A CZ   1 
ATOM   728  O OH   . TYR A 1 53  ? 51.150 29.759  66.930 1.00 40.49  ? 98  TYR A OH   1 
ATOM   729  H H    . TYR A 1 53  ? 57.906 32.883  69.933 1.00 49.01  ? 98  TYR A H    1 
ATOM   730  H HA   . TYR A 1 53  ? 55.553 33.752  69.296 1.00 48.59  ? 98  TYR A HA   1 
ATOM   731  H HB2  . TYR A 1 53  ? 56.573 32.162  67.997 1.00 48.00  ? 98  TYR A HB2  1 
ATOM   732  H HB3  . TYR A 1 53  ? 56.561 31.124  69.197 1.00 48.00  ? 98  TYR A HB3  1 
ATOM   733  H HD1  . TYR A 1 53  ? 54.313 32.805  67.017 1.00 47.46  ? 98  TYR A HD1  1 
ATOM   734  H HD2  . TYR A 1 53  ? 54.787 29.610  69.374 1.00 47.62  ? 98  TYR A HD2  1 
ATOM   735  H HE1  . TYR A 1 53  ? 52.297 31.951  66.261 1.00 47.11  ? 98  TYR A HE1  1 
ATOM   736  H HE2  . TYR A 1 53  ? 52.783 28.759  68.624 1.00 48.17  ? 98  TYR A HE2  1 
ATOM   737  H HH   . TYR A 1 53  ? 50.997 29.023  67.304 1.00 48.59  ? 98  TYR A HH   1 
ATOM   738  N N    . SER A 1 54  ? 55.494 31.798  71.845 1.00 46.13  ? 99  SER A N    1 
ATOM   739  C CA   . SER A 1 54  ? 54.651 31.379  72.958 1.00 48.01  ? 99  SER A CA   1 
ATOM   740  C C    . SER A 1 54  ? 54.264 32.536  73.870 1.00 49.89  ? 99  SER A C    1 
ATOM   741  O O    . SER A 1 54  ? 53.393 32.357  74.729 1.00 52.60  ? 99  SER A O    1 
ATOM   742  C CB   . SER A 1 54  ? 55.350 30.294  73.780 1.00 50.24  ? 99  SER A CB   1 
ATOM   743  O OG   . SER A 1 54  ? 56.360 30.847  74.603 1.00 52.80  ? 99  SER A OG   1 
ATOM   744  H H    . SER A 1 54  ? 56.290 31.473  71.855 1.00 55.36  ? 99  SER A H    1 
ATOM   745  H HA   . SER A 1 54  ? 53.833 30.999  72.602 1.00 57.61  ? 99  SER A HA   1 
ATOM   746  H HB2  . SER A 1 54  ? 54.694 29.851  74.341 1.00 60.29  ? 99  SER A HB2  1 
ATOM   747  H HB3  . SER A 1 54  ? 55.754 29.652  73.175 1.00 60.29  ? 99  SER A HB3  1 
ATOM   748  H HG   . SER A 1 54  ? 56.936 31.233  74.130 1.00 63.37  ? 99  SER A HG   1 
ATOM   749  N N    . HIS A 1 55  ? 54.885 33.707  73.716 1.00 49.24  ? 100 HIS A N    1 
ATOM   750  C CA   . HIS A 1 55  ? 54.526 34.889  74.490 1.00 49.92  ? 100 HIS A CA   1 
ATOM   751  C C    . HIS A 1 55  ? 53.889 35.969  73.625 1.00 47.91  ? 100 HIS A C    1 
ATOM   752  O O    . HIS A 1 55  ? 53.796 37.128  74.045 1.00 48.97  ? 100 HIS A O    1 
ATOM   753  C CB   . HIS A 1 55  ? 55.752 35.436  75.216 1.00 50.88  ? 100 HIS A CB   1 
ATOM   754  C CG   . HIS A 1 55  ? 56.156 34.623  76.402 1.00 51.90  ? 100 HIS A CG   1 
ATOM   755  N ND1  . HIS A 1 55  ? 55.414 34.580  77.561 1.00 53.08  ? 100 HIS A ND1  1 
ATOM   756  C CD2  . HIS A 1 55  ? 57.226 33.822  76.609 1.00 51.50  ? 100 HIS A CD2  1 
ATOM   757  C CE1  . HIS A 1 55  ? 56.008 33.787  78.433 1.00 54.16  ? 100 HIS A CE1  1 
ATOM   758  N NE2  . HIS A 1 55  ? 57.111 33.315  77.880 1.00 53.47  ? 100 HIS A NE2  1 
ATOM   759  H H    . HIS A 1 55  ? 55.527 33.841  73.159 1.00 59.09  ? 100 HIS A H    1 
ATOM   760  H HA   . HIS A 1 55  ? 53.877 34.632  75.163 1.00 59.90  ? 100 HIS A HA   1 
ATOM   761  H HB2  . HIS A 1 55  ? 56.500 35.454  74.599 1.00 61.06  ? 100 HIS A HB2  1 
ATOM   762  H HB3  . HIS A 1 55  ? 55.558 36.335  75.525 1.00 61.06  ? 100 HIS A HB3  1 
ATOM   763  H HD1  . HIS A 1 55  ? 54.678 35.004  77.696 1.00 63.70  ? 100 HIS A HD1  1 
ATOM   764  H HD2  . HIS A 1 55  ? 57.912 33.648  76.005 1.00 61.80  ? 100 HIS A HD2  1 
ATOM   765  H HE1  . HIS A 1 55  ? 55.703 33.595  79.290 1.00 65.00  ? 100 HIS A HE1  1 
ATOM   766  H HE2  . HIS A 1 55  ? 57.666 32.776  78.255 1.00 64.16  ? 100 HIS A HE2  1 
ATOM   767  N N    . MET A 1 56  ? 53.437 35.605  72.431 1.00 45.83  ? 101 MET A N    1 
ATOM   768  C CA   . MET A 1 56  ? 52.693 36.496  71.559 1.00 45.31  ? 101 MET A CA   1 
ATOM   769  C C    . MET A 1 56  ? 51.246 36.030  71.486 1.00 43.76  ? 101 MET A C    1 
ATOM   770  O O    . MET A 1 56  ? 50.983 34.834  71.334 1.00 41.78  ? 101 MET A O    1 
ATOM   771  C CB   . MET A 1 56  ? 53.318 36.529  70.165 1.00 43.54  ? 101 MET A CB   1 
ATOM   772  C CG   . MET A 1 56  ? 54.678 37.207  70.148 1.00 44.42  ? 101 MET A CG   1 
ATOM   773  S SD   . MET A 1 56  ? 55.471 37.185  68.542 1.00 44.87  ? 101 MET A SD   1 
ATOM   774  C CE   . MET A 1 56  ? 54.291 38.094  67.546 1.00 44.03  ? 101 MET A CE   1 
ATOM   775  H H    . MET A 1 56  ? 53.555 34.822  72.097 1.00 54.99  ? 101 MET A H    1 
ATOM   776  H HA   . MET A 1 56  ? 52.720 37.395  71.923 1.00 54.37  ? 101 MET A HA   1 
ATOM   777  H HB2  . MET A 1 56  ? 53.432 35.620  69.848 1.00 52.25  ? 101 MET A HB2  1 
ATOM   778  H HB3  . MET A 1 56  ? 52.731 37.018  69.567 1.00 52.25  ? 101 MET A HB3  1 
ATOM   779  H HG2  . MET A 1 56  ? 54.569 38.134  70.413 1.00 53.31  ? 101 MET A HG2  1 
ATOM   780  H HG3  . MET A 1 56  ? 55.262 36.753  70.775 1.00 53.31  ? 101 MET A HG3  1 
ATOM   781  H HE1  . MET A 1 56  ? 54.621 38.147  66.636 1.00 52.84  ? 101 MET A HE1  1 
ATOM   782  H HE2  . MET A 1 56  ? 53.440 37.628  67.563 1.00 52.84  ? 101 MET A HE2  1 
ATOM   783  H HE3  . MET A 1 56  ? 54.188 38.985  67.914 1.00 52.84  ? 101 MET A HE3  1 
ATOM   784  N N    . VAL A 1 57  ? 50.316 36.969  71.626 1.00 44.39  ? 102 VAL A N    1 
ATOM   785  C CA   . VAL A 1 57  ? 48.900 36.675  71.459 1.00 44.78  ? 102 VAL A CA   1 
ATOM   786  C C    . VAL A 1 57  ? 48.728 36.017  70.098 1.00 42.41  ? 102 VAL A C    1 
ATOM   787  O O    . VAL A 1 57  ? 49.477 36.316  69.161 1.00 38.73  ? 102 VAL A O    1 
ATOM   788  C CB   . VAL A 1 57  ? 48.051 37.955  71.599 1.00 48.44  ? 102 VAL A CB   1 
ATOM   789  C CG1  . VAL A 1 57  ? 46.632 37.725  71.151 1.00 49.68  ? 102 VAL A CG1  1 
ATOM   790  C CG2  . VAL A 1 57  ? 48.054 38.431  73.047 1.00 52.11  ? 102 VAL A CG2  1 
ATOM   791  H H    . VAL A 1 57  ? 50.482 37.791  71.819 1.00 53.27  ? 102 VAL A H    1 
ATOM   792  H HA   . VAL A 1 57  ? 48.619 36.045  72.141 1.00 53.73  ? 102 VAL A HA   1 
ATOM   793  H HB   . VAL A 1 57  ? 48.434 38.655  71.048 1.00 58.13  ? 102 VAL A HB   1 
ATOM   794  H HG11 . VAL A 1 57  ? 46.132 38.550  71.254 1.00 59.62  ? 102 VAL A HG11 1 
ATOM   795  H HG12 . VAL A 1 57  ? 46.636 37.454  70.220 1.00 59.62  ? 102 VAL A HG12 1 
ATOM   796  H HG13 . VAL A 1 57  ? 46.238 37.028  71.698 1.00 59.62  ? 102 VAL A HG13 1 
ATOM   797  H HG21 . VAL A 1 57  ? 47.516 39.235  73.116 1.00 62.53  ? 102 VAL A HG21 1 
ATOM   798  H HG22 . VAL A 1 57  ? 47.682 37.734  73.609 1.00 62.53  ? 102 VAL A HG22 1 
ATOM   799  H HG23 . VAL A 1 57  ? 48.968 38.619  73.314 1.00 62.53  ? 102 VAL A HG23 1 
ATOM   800  N N    . ARG A 1 58  ? 47.772 35.092  69.991 1.00 39.82  ? 103 ARG A N    1 
ATOM   801  C CA   . ARG A 1 58  ? 47.480 34.461  68.715 1.00 39.08  ? 103 ARG A CA   1 
ATOM   802  C C    . ARG A 1 58  ? 46.900 35.488  67.748 1.00 38.44  ? 103 ARG A C    1 
ATOM   803  O O    . ARG A 1 58  ? 46.216 36.426  68.167 1.00 40.05  ? 103 ARG A O    1 
ATOM   804  C CB   . ARG A 1 58  ? 46.478 33.319  68.881 1.00 43.82  ? 103 ARG A CB   1 
ATOM   805  C CG   . ARG A 1 58  ? 46.848 32.293  69.925 1.00 47.68  ? 103 ARG A CG   1 
ATOM   806  C CD   . ARG A 1 58  ? 48.226 31.731  69.685 1.00 49.81  ? 103 ARG A CD   1 
ATOM   807  N NE   . ARG A 1 58  ? 48.404 30.458  70.375 1.00 55.81  ? 103 ARG A NE   1 
ATOM   808  C CZ   . ARG A 1 58  ? 49.582 29.888  70.607 1.00 57.92  ? 103 ARG A CZ   1 
ATOM   809  N NH1  . ARG A 1 58  ? 50.701 30.481  70.217 1.00 58.53  ? 103 ARG A NH1  1 
ATOM   810  N NH2  . ARG A 1 58  ? 49.640 28.727  71.242 1.00 59.98  ? 103 ARG A NH2  1 
ATOM   811  H H    . ARG A 1 58  ? 47.282 34.817  70.643 1.00 47.79  ? 103 ARG A H    1 
ATOM   812  H HA   . ARG A 1 58  ? 48.297 34.103  68.334 1.00 46.89  ? 103 ARG A HA   1 
ATOM   813  H HB2  . ARG A 1 58  ? 45.620 33.695  69.132 1.00 52.58  ? 103 ARG A HB2  1 
ATOM   814  H HB3  . ARG A 1 58  ? 46.394 32.856  68.033 1.00 52.58  ? 103 ARG A HB3  1 
ATOM   815  H HG2  . ARG A 1 58  ? 46.839 32.710  70.801 1.00 57.21  ? 103 ARG A HG2  1 
ATOM   816  H HG3  . ARG A 1 58  ? 46.212 31.562  69.895 1.00 57.21  ? 103 ARG A HG3  1 
ATOM   817  H HD2  . ARG A 1 58  ? 48.351 31.582  68.735 1.00 59.77  ? 103 ARG A HD2  1 
ATOM   818  H HD3  . ARG A 1 58  ? 48.890 32.354  70.019 1.00 59.77  ? 103 ARG A HD3  1 
ATOM   819  H HE   . ARG A 1 58  ? 47.699 30.049  70.649 1.00 66.97  ? 103 ARG A HE   1 
ATOM   820  H HH11 . ARG A 1 58  ? 50.667 31.235  69.805 1.00 70.24  ? 103 ARG A HH11 1 
ATOM   821  H HH12 . ARG A 1 58  ? 51.461 30.110  70.371 1.00 70.24  ? 103 ARG A HH12 1 
ATOM   822  H HH21 . ARG A 1 58  ? 48.916 28.341  71.499 1.00 71.98  ? 103 ARG A HH21 1 
ATOM   823  H HH22 . ARG A 1 58  ? 50.402 28.359  71.396 1.00 71.98  ? 103 ARG A HH22 1 
ATOM   824  N N    . PRO A 1 59  ? 47.138 35.327  66.447 1.00 39.83  ? 104 PRO A N    1 
ATOM   825  C CA   . PRO A 1 59  ? 46.549 36.272  65.484 1.00 41.63  ? 104 PRO A CA   1 
ATOM   826  C C    . PRO A 1 59  ? 45.041 36.424  65.645 1.00 42.35  ? 104 PRO A C    1 
ATOM   827  O O    . PRO A 1 59  ? 44.524 37.551  65.660 1.00 41.26  ? 104 PRO A O    1 
ATOM   828  C CB   . PRO A 1 59  ? 46.929 35.660  64.128 1.00 40.37  ? 104 PRO A CB   1 
ATOM   829  C CG   . PRO A 1 59  ? 48.134 34.816  64.409 1.00 40.53  ? 104 PRO A CG   1 
ATOM   830  C CD   . PRO A 1 59  ? 47.943 34.285  65.786 1.00 40.54  ? 104 PRO A CD   1 
ATOM   831  H HA   . PRO A 1 59  ? 46.968 37.143  65.570 1.00 49.95  ? 104 PRO A HA   1 
ATOM   832  H HB2  . PRO A 1 59  ? 46.197 35.115  63.799 1.00 48.44  ? 104 PRO A HB2  1 
ATOM   833  H HB3  . PRO A 1 59  ? 47.143 36.366  63.499 1.00 48.44  ? 104 PRO A HB3  1 
ATOM   834  H HG2  . PRO A 1 59  ? 48.179 34.090  63.767 1.00 48.64  ? 104 PRO A HG2  1 
ATOM   835  H HG3  . PRO A 1 59  ? 48.933 35.364  64.362 1.00 48.64  ? 104 PRO A HG3  1 
ATOM   836  H HD2  . PRO A 1 59  ? 47.456 33.447  65.761 1.00 48.65  ? 104 PRO A HD2  1 
ATOM   837  H HD3  . PRO A 1 59  ? 48.799 34.186  66.232 1.00 48.65  ? 104 PRO A HD3  1 
ATOM   838  N N    . GLY A 1 60  ? 44.322 35.308  65.785 1.00 36.56  ? 105 GLY A N    1 
ATOM   839  C CA   . GLY A 1 60  ? 42.874 35.351  65.889 1.00 38.85  ? 105 GLY A CA   1 
ATOM   840  C C    . GLY A 1 60  ? 42.372 36.095  67.102 1.00 43.39  ? 105 GLY A C    1 
ATOM   841  O O    . GLY A 1 60  ? 41.192 36.460  67.150 1.00 42.71  ? 105 GLY A O    1 
ATOM   842  H H    . GLY A 1 60  ? 44.654 34.515  65.822 1.00 43.87  ? 105 GLY A H    1 
ATOM   843  H HA2  . GLY A 1 60  ? 42.510 35.780  65.098 1.00 46.62  ? 105 GLY A HA2  1 
ATOM   844  H HA3  . GLY A 1 60  ? 42.530 34.444  65.927 1.00 46.62  ? 105 GLY A HA3  1 
ATOM   845  N N    . ASP A 1 61  ? 43.235 36.328  68.088 1.00 51.42  ? 106 ASP A N    1 
ATOM   846  C CA   . ASP A 1 61  ? 42.866 37.073  69.283 1.00 57.97  ? 106 ASP A CA   1 
ATOM   847  C C    . ASP A 1 61  ? 43.318 38.527  69.227 1.00 58.19  ? 106 ASP A C    1 
ATOM   848  O O    . ASP A 1 61  ? 43.292 39.211  70.254 1.00 60.58  ? 106 ASP A O    1 
ATOM   849  C CB   . ASP A 1 61  ? 43.446 36.401  70.528 1.00 64.36  ? 106 ASP A CB   1 
ATOM   850  C CG   . ASP A 1 61  ? 43.094 34.938  70.616 1.00 68.67  ? 106 ASP A CG   1 
ATOM   851  O OD1  . ASP A 1 61  ? 42.097 34.527  69.991 1.00 72.14  ? 106 ASP A OD1  1 
ATOM   852  O OD2  . ASP A 1 61  ? 43.823 34.196  71.307 1.00 70.98  ? 106 ASP A OD2  1 
ATOM   853  H H    . ASP A 1 61  ? 44.052 36.060  68.087 1.00 61.70  ? 106 ASP A H    1 
ATOM   854  H HA   . ASP A 1 61  ? 41.899 37.068  69.367 1.00 69.56  ? 106 ASP A HA   1 
ATOM   855  H HB2  . ASP A 1 61  ? 44.413 36.476  70.506 1.00 77.23  ? 106 ASP A HB2  1 
ATOM   856  H HB3  . ASP A 1 61  ? 43.097 36.842  71.318 1.00 77.23  ? 106 ASP A HB3  1 
ATOM   857  N N    . LEU A 1 62  ? 43.747 39.006  68.062 1.00 53.51  ? 107 LEU A N    1 
ATOM   858  C CA   . LEU A 1 62  ? 44.100 40.409  67.900 1.00 53.21  ? 107 LEU A CA   1 
ATOM   859  C C    . LEU A 1 62  ? 42.856 41.235  67.609 1.00 59.03  ? 107 LEU A C    1 
ATOM   860  O O    . LEU A 1 62  ? 41.970 40.808  66.866 1.00 60.02  ? 107 LEU A O    1 
ATOM   861  C CB   . LEU A 1 62  ? 45.097 40.588  66.761 1.00 49.91  ? 107 LEU A CB   1 
ATOM   862  C CG   . LEU A 1 62  ? 46.496 40.009  66.947 1.00 46.27  ? 107 LEU A CG   1 
ATOM   863  C CD1  . LEU A 1 62  ? 47.324 40.250  65.692 1.00 43.87  ? 107 LEU A CD1  1 
ATOM   864  C CD2  . LEU A 1 62  ? 47.178 40.618  68.164 1.00 46.59  ? 107 LEU A CD2  1 
ATOM   865  H H    . LEU A 1 62  ? 43.843 38.535  67.349 1.00 64.21  ? 107 LEU A H    1 
ATOM   866  H HA   . LEU A 1 62  ? 44.504 40.738  68.718 1.00 63.86  ? 107 LEU A HA   1 
ATOM   867  H HB2  . LEU A 1 62  ? 44.722 40.173  65.968 1.00 59.89  ? 107 LEU A HB2  1 
ATOM   868  H HB3  . LEU A 1 62  ? 45.202 41.539  66.602 1.00 59.89  ? 107 LEU A HB3  1 
ATOM   869  H HG   . LEU A 1 62  ? 46.428 39.052  67.085 1.00 55.53  ? 107 LEU A HG   1 
ATOM   870  H HD11 . LEU A 1 62  ? 48.210 39.878  65.823 1.00 52.65  ? 107 LEU A HD11 1 
ATOM   871  H HD12 . LEU A 1 62  ? 46.890 39.816  64.940 1.00 52.65  ? 107 LEU A HD12 1 
ATOM   872  H HD13 . LEU A 1 62  ? 47.385 41.205  65.533 1.00 52.65  ? 107 LEU A HD13 1 
ATOM   873  H HD21 . LEU A 1 62  ? 48.063 40.231  68.256 1.00 55.91  ? 107 LEU A HD21 1 
ATOM   874  H HD22 . LEU A 1 62  ? 47.247 41.577  68.041 1.00 55.91  ? 107 LEU A HD22 1 
ATOM   875  H HD23 . LEU A 1 62  ? 46.648 40.423  68.953 1.00 55.91  ? 107 LEU A HD23 1 
ATOM   876  N N    . THR A 1 63  ? 42.810 42.434  68.175 1.00 71.49  ? 108 THR A N    1 
ATOM   877  C CA   . THR A 1 63  ? 41.699 43.352  67.973 1.00 74.37  ? 108 THR A CA   1 
ATOM   878  C C    . THR A 1 63  ? 42.048 44.338  66.868 1.00 76.55  ? 108 THR A C    1 
ATOM   879  O O    . THR A 1 63  ? 43.161 44.872  66.832 1.00 80.40  ? 108 THR A O    1 
ATOM   880  C CB   . THR A 1 63  ? 41.369 44.107  69.260 1.00 79.33  ? 108 THR A CB   1 
ATOM   881  O OG1  . THR A 1 63  ? 41.098 43.168  70.308 1.00 80.96  ? 108 THR A OG1  1 
ATOM   882  C CG2  . THR A 1 63  ? 40.154 44.998  69.062 1.00 83.54  ? 108 THR A CG2  1 
ATOM   883  H H    . THR A 1 63  ? 43.424 42.744  68.692 1.00 85.79  ? 108 THR A H    1 
ATOM   884  H HA   . THR A 1 63  ? 40.914 42.852  67.701 1.00 89.25  ? 108 THR A HA   1 
ATOM   885  H HB   . THR A 1 63  ? 42.123 44.664  69.511 1.00 95.19  ? 108 THR A HB   1 
ATOM   886  H HG1  . THR A 1 63  ? 40.916 43.577  71.019 1.00 97.15  ? 108 THR A HG1  1 
ATOM   887  H HG21 . THR A 1 63  ? 39.954 45.473  69.884 1.00 100.25 ? 108 THR A HG21 1 
ATOM   888  H HG22 . THR A 1 63  ? 40.329 45.645  68.360 1.00 100.25 ? 108 THR A HG22 1 
ATOM   889  H HG23 . THR A 1 63  ? 39.386 44.461  68.812 1.00 100.25 ? 108 THR A HG23 1 
ATOM   890  N N    . GLY A 1 64  ? 41.100 44.568  65.970 1.00 70.07  ? 109 GLY A N    1 
ATOM   891  C CA   . GLY A 1 64  ? 41.248 45.599  64.970 1.00 69.04  ? 109 GLY A CA   1 
ATOM   892  C C    . GLY A 1 64  ? 42.114 45.179  63.796 1.00 63.78  ? 109 GLY A C    1 
ATOM   893  O O    . GLY A 1 64  ? 42.414 44.004  63.569 1.00 60.68  ? 109 GLY A O    1 
ATOM   894  H H    . GLY A 1 64  ? 40.358 44.135  65.922 1.00 84.09  ? 109 GLY A H    1 
ATOM   895  H HA2  . GLY A 1 64  ? 40.373 45.843  64.630 1.00 82.84  ? 109 GLY A HA2  1 
ATOM   896  H HA3  . GLY A 1 64  ? 41.647 46.384  65.376 1.00 82.84  ? 109 GLY A HA3  1 
ATOM   897  N N    . HIS A 1 65  ? 42.522 46.197  63.040 1.00 75.11  ? 110 HIS A N    1 
ATOM   898  C CA   . HIS A 1 65  ? 43.302 46.050  61.812 1.00 74.86  ? 110 HIS A CA   1 
ATOM   899  C C    . HIS A 1 65  ? 44.764 45.838  62.201 1.00 69.57  ? 110 HIS A C    1 
ATOM   900  O O    . HIS A 1 65  ? 45.574 46.766  62.242 1.00 71.54  ? 110 HIS A O    1 
ATOM   901  C CB   . HIS A 1 65  ? 43.106 47.292  60.950 1.00 82.70  ? 110 HIS A CB   1 
ATOM   902  C CG   . HIS A 1 65  ? 43.619 47.172  59.550 1.00 87.16  ? 110 HIS A CG   1 
ATOM   903  N ND1  . HIS A 1 65  ? 44.950 47.327  59.227 1.00 88.30  ? 110 HIS A ND1  1 
ATOM   904  C CD2  . HIS A 1 65  ? 42.971 46.957  58.380 1.00 89.41  ? 110 HIS A CD2  1 
ATOM   905  C CE1  . HIS A 1 65  ? 45.103 47.191  57.921 1.00 88.45  ? 110 HIS A CE1  1 
ATOM   906  N NE2  . HIS A 1 65  ? 43.917 46.965  57.384 1.00 89.40  ? 110 HIS A NE2  1 
ATOM   907  H H    . HIS A 1 65  ? 42.350 47.018  63.228 1.00 90.13  ? 110 HIS A H    1 
ATOM   908  H HA   . HIS A 1 65  ? 42.994 45.275  61.318 1.00 89.83  ? 110 HIS A HA   1 
ATOM   909  H HB2  . HIS A 1 65  ? 42.157 47.487  60.899 1.00 99.24  ? 110 HIS A HB2  1 
ATOM   910  H HB3  . HIS A 1 65  ? 43.569 48.035  61.368 1.00 99.24  ? 110 HIS A HB3  1 
ATOM   911  H HD2  . HIS A 1 65  ? 42.057 46.819  58.273 1.00 107.29 ? 110 HIS A HD2  1 
ATOM   912  H HE1  . HIS A 1 65  ? 45.908 47.244  57.459 1.00 106.14 ? 110 HIS A HE1  1 
ATOM   913  H HE2  . HIS A 1 65  ? 43.763 46.843  56.547 1.00 107.28 ? 110 HIS A HE2  1 
ATOM   914  N N    . SER A 1 66  ? 45.101 44.582  62.499 1.00 58.79  ? 111 SER A N    1 
ATOM   915  C CA   . SER A 1 66  ? 46.397 44.214  63.055 1.00 52.99  ? 111 SER A CA   1 
ATOM   916  C C    . SER A 1 66  ? 47.085 43.184  62.170 1.00 49.28  ? 111 SER A C    1 
ATOM   917  O O    . SER A 1 66  ? 46.427 42.423  61.454 1.00 47.31  ? 111 SER A O    1 
ATOM   918  C CB   . SER A 1 66  ? 46.245 43.641  64.473 1.00 51.43  ? 111 SER A CB   1 
ATOM   919  O OG   . SER A 1 66  ? 45.680 44.592  65.360 1.00 52.29  ? 111 SER A OG   1 
ATOM   920  H H    . SER A 1 66  ? 44.578 43.910  62.384 1.00 70.54  ? 111 SER A H    1 
ATOM   921  H HA   . SER A 1 66  ? 46.961 45.002  63.103 1.00 63.58  ? 111 SER A HA   1 
ATOM   922  H HB2  . SER A 1 66  ? 45.667 42.863  64.437 1.00 61.72  ? 111 SER A HB2  1 
ATOM   923  H HB3  . SER A 1 66  ? 47.121 43.386  64.804 1.00 61.72  ? 111 SER A HB3  1 
ATOM   924  H HG   . SER A 1 66  ? 45.605 44.260  66.128 1.00 62.75  ? 111 SER A HG   1 
ATOM   925  N N    . ASP A 1 67  ? 48.418 43.155  62.243 1.00 52.92  ? 112 ASP A N    1 
ATOM   926  C CA   . ASP A 1 67  ? 49.236 42.241  61.454 1.00 53.37  ? 112 ASP A CA   1 
ATOM   927  C C    . ASP A 1 67  ? 50.455 41.814  62.261 1.00 50.33  ? 112 ASP A C    1 
ATOM   928  O O    . ASP A 1 67  ? 51.024 42.616  63.004 1.00 50.80  ? 112 ASP A O    1 
ATOM   929  C CB   . ASP A 1 67  ? 49.723 42.880  60.145 1.00 58.30  ? 112 ASP A CB   1 
ATOM   930  C CG   . ASP A 1 67  ? 48.615 43.546  59.362 1.00 63.48  ? 112 ASP A CG   1 
ATOM   931  O OD1  . ASP A 1 67  ? 47.523 42.962  59.255 1.00 65.80  ? 112 ASP A OD1  1 
ATOM   932  O OD2  . ASP A 1 67  ? 48.834 44.661  58.850 1.00 66.70  ? 112 ASP A OD2  1 
ATOM   933  H H    . ASP A 1 67  ? 48.879 43.669  62.756 1.00 63.51  ? 112 ASP A H    1 
ATOM   934  H HA   . ASP A 1 67  ? 48.719 41.450  61.236 1.00 64.04  ? 112 ASP A HA   1 
ATOM   935  H HB2  . ASP A 1 67  ? 50.389 43.554  60.353 1.00 69.96  ? 112 ASP A HB2  1 
ATOM   936  H HB3  . ASP A 1 67  ? 50.113 42.192  59.584 1.00 69.96  ? 112 ASP A HB3  1 
ATOM   937  N N    . PHE A 1 68  ? 50.844 40.550  62.114 1.00 45.93  ? 113 PHE A N    1 
ATOM   938  C CA   . PHE A 1 68  ? 52.153 40.064  62.520 1.00 44.41  ? 113 PHE A CA   1 
ATOM   939  C C    . PHE A 1 68  ? 52.991 39.845  61.271 1.00 43.19  ? 113 PHE A C    1 
ATOM   940  O O    . PHE A 1 68  ? 52.483 39.377  60.249 1.00 43.16  ? 113 PHE A O    1 
ATOM   941  C CB   . PHE A 1 68  ? 52.071 38.743  63.292 1.00 43.63  ? 113 PHE A CB   1 
ATOM   942  C CG   . PHE A 1 68  ? 51.570 38.867  64.700 1.00 44.35  ? 113 PHE A CG   1 
ATOM   943  C CD1  . PHE A 1 68  ? 51.823 39.994  65.457 1.00 46.38  ? 113 PHE A CD1  1 
ATOM   944  C CD2  . PHE A 1 68  ? 50.853 37.826  65.278 1.00 44.48  ? 113 PHE A CD2  1 
ATOM   945  C CE1  . PHE A 1 68  ? 51.361 40.094  66.759 1.00 48.21  ? 113 PHE A CE1  1 
ATOM   946  C CE2  . PHE A 1 68  ? 50.387 37.918  66.580 1.00 46.47  ? 113 PHE A CE2  1 
ATOM   947  C CZ   . PHE A 1 68  ? 50.644 39.055  67.323 1.00 46.94  ? 113 PHE A CZ   1 
ATOM   948  H H    . PHE A 1 68  ? 50.347 39.938  61.769 1.00 55.11  ? 113 PHE A H    1 
ATOM   949  H HA   . PHE A 1 68  ? 52.591 40.726  63.079 1.00 53.29  ? 113 PHE A HA   1 
ATOM   950  H HB2  . PHE A 1 68  ? 51.471 38.146  62.818 1.00 52.36  ? 113 PHE A HB2  1 
ATOM   951  H HB3  . PHE A 1 68  ? 52.958 38.352  63.329 1.00 52.36  ? 113 PHE A HB3  1 
ATOM   952  H HD1  . PHE A 1 68  ? 52.304 40.698  65.086 1.00 55.65  ? 113 PHE A HD1  1 
ATOM   953  H HD2  . PHE A 1 68  ? 50.678 37.060  64.781 1.00 53.38  ? 113 PHE A HD2  1 
ATOM   954  H HE1  . PHE A 1 68  ? 51.536 40.861  67.256 1.00 57.85  ? 113 PHE A HE1  1 
ATOM   955  H HE2  . PHE A 1 68  ? 49.905 37.216  66.953 1.00 55.76  ? 113 PHE A HE2  1 
ATOM   956  H HZ   . PHE A 1 68  ? 50.333 39.122  68.197 1.00 56.32  ? 113 PHE A HZ   1 
ATOM   957  N N    . HIS A 1 69  ? 54.266 40.186  61.349 1.00 43.03  ? 114 HIS A N    1 
ATOM   958  C CA   . HIS A 1 69  ? 55.206 39.915  60.275 1.00 43.52  ? 114 HIS A CA   1 
ATOM   959  C C    . HIS A 1 69  ? 56.371 39.119  60.838 1.00 43.41  ? 114 HIS A C    1 
ATOM   960  O O    . HIS A 1 69  ? 56.779 39.325  61.985 1.00 44.51  ? 114 HIS A O    1 
ATOM   961  C CB   . HIS A 1 69  ? 55.738 41.195  59.628 1.00 45.80  ? 114 HIS A CB   1 
ATOM   962  C CG   . HIS A 1 69  ? 54.719 42.285  59.480 1.00 47.08  ? 114 HIS A CG   1 
ATOM   963  N ND1  . HIS A 1 69  ? 54.246 42.692  58.251 1.00 48.02  ? 114 HIS A ND1  1 
ATOM   964  C CD2  . HIS A 1 69  ? 54.105 43.068  60.398 1.00 48.25  ? 114 HIS A CD2  1 
ATOM   965  C CE1  . HIS A 1 69  ? 53.377 43.673  58.419 1.00 49.61  ? 114 HIS A CE1  1 
ATOM   966  N NE2  . HIS A 1 69  ? 53.276 43.924  59.713 1.00 49.77  ? 114 HIS A NE2  1 
ATOM   967  H H    . HIS A 1 69  ? 54.618 40.582  62.027 1.00 51.64  ? 114 HIS A H    1 
ATOM   968  H HA   . HIS A 1 69  ? 54.772 39.383  59.591 1.00 52.23  ? 114 HIS A HA   1 
ATOM   969  H HB2  . HIS A 1 69  ? 56.461 41.541  60.174 1.00 54.97  ? 114 HIS A HB2  1 
ATOM   970  H HB3  . HIS A 1 69  ? 56.071 40.980  58.743 1.00 54.97  ? 114 HIS A HB3  1 
ATOM   971  H HD1  . HIS A 1 69  ? 54.478 42.358  57.493 1.00 57.63  ? 114 HIS A HD1  1 
ATOM   972  H HD2  . HIS A 1 69  ? 54.223 43.035  61.320 1.00 57.90  ? 114 HIS A HD2  1 
ATOM   973  H HE1  . HIS A 1 69  ? 52.916 44.113  57.742 1.00 59.53  ? 114 HIS A HE1  1 
ATOM   974  N N    . LEU A 1 70  ? 56.889 38.198  60.030 1.00 43.55  ? 115 LEU A N    1 
ATOM   975  C CA   . LEU A 1 70  ? 58.041 37.381  60.404 1.00 43.08  ? 115 LEU A CA   1 
ATOM   976  C C    . LEU A 1 70  ? 58.930 37.289  59.168 1.00 43.15  ? 115 LEU A C    1 
ATOM   977  O O    . LEU A 1 70  ? 58.671 36.486  58.265 1.00 42.59  ? 115 LEU A O    1 
ATOM   978  C CB   . LEU A 1 70  ? 57.611 36.004  60.900 1.00 42.15  ? 115 LEU A CB   1 
ATOM   979  C CG   . LEU A 1 70  ? 58.704 35.118  61.519 1.00 43.41  ? 115 LEU A CG   1 
ATOM   980  C CD1  . LEU A 1 70  ? 59.459 35.836  62.638 1.00 44.18  ? 115 LEU A CD1  1 
ATOM   981  C CD2  . LEU A 1 70  ? 58.085 33.827  62.051 1.00 41.69  ? 115 LEU A CD2  1 
ATOM   982  H H    . LEU A 1 70  ? 56.585 38.025  59.245 1.00 52.26  ? 115 LEU A H    1 
ATOM   983  H HA   . LEU A 1 70  ? 58.538 37.822  61.111 1.00 51.69  ? 115 LEU A HA   1 
ATOM   984  H HB2  . LEU A 1 70  ? 56.926 36.127  61.576 1.00 50.57  ? 115 LEU A HB2  1 
ATOM   985  H HB3  . LEU A 1 70  ? 57.237 35.516  60.150 1.00 50.57  ? 115 LEU A HB3  1 
ATOM   986  H HG   . LEU A 1 70  ? 59.345 34.881  60.830 1.00 52.10  ? 115 LEU A HG   1 
ATOM   987  H HD11 . LEU A 1 70  ? 60.135 35.239  62.996 1.00 53.02  ? 115 LEU A HD11 1 
ATOM   988  H HD12 . LEU A 1 70  ? 59.878 36.632  62.275 1.00 53.02  ? 115 LEU A HD12 1 
ATOM   989  H HD13 . LEU A 1 70  ? 58.831 36.080  63.335 1.00 53.02  ? 115 LEU A HD13 1 
ATOM   990  H HD21 . LEU A 1 70  ? 58.784 33.278  62.438 1.00 50.03  ? 115 LEU A HD21 1 
ATOM   991  H HD22 . LEU A 1 70  ? 57.426 34.049  62.727 1.00 50.03  ? 115 LEU A HD22 1 
ATOM   992  H HD23 . LEU A 1 70  ? 57.661 33.355  61.317 1.00 50.03  ? 115 LEU A HD23 1 
ATOM   993  N N    . PHE A 1 71  ? 59.962 38.126  59.125 1.00 42.17  ? 116 PHE A N    1 
ATOM   994  C CA   . PHE A 1 71  ? 60.879 38.200  58.000 1.00 43.49  ? 116 PHE A CA   1 
ATOM   995  C C    . PHE A 1 71  ? 62.298 37.891  58.458 1.00 43.16  ? 116 PHE A C    1 
ATOM   996  O O    . PHE A 1 71  ? 62.627 37.967  59.646 1.00 41.51  ? 116 PHE A O    1 
ATOM   997  C CB   . PHE A 1 71  ? 60.835 39.585  57.341 1.00 45.06  ? 116 PHE A CB   1 
ATOM   998  C CG   . PHE A 1 71  ? 59.623 39.807  56.488 1.00 45.18  ? 116 PHE A CG   1 
ATOM   999  C CD1  . PHE A 1 71  ? 58.358 39.791  57.043 1.00 44.49  ? 116 PHE A CD1  1 
ATOM   1000 C CD2  . PHE A 1 71  ? 59.750 40.026  55.132 1.00 47.41  ? 116 PHE A CD2  1 
ATOM   1001 C CE1  . PHE A 1 71  ? 57.237 39.991  56.258 1.00 44.30  ? 116 PHE A CE1  1 
ATOM   1002 C CE2  . PHE A 1 71  ? 58.640 40.229  54.341 1.00 47.26  ? 116 PHE A CE2  1 
ATOM   1003 C CZ   . PHE A 1 71  ? 57.380 40.213  54.906 1.00 45.58  ? 116 PHE A CZ   1 
ATOM   1004 H H    . PHE A 1 71  ? 60.154 38.677  59.757 1.00 50.60  ? 116 PHE A H    1 
ATOM   1005 H HA   . PHE A 1 71  ? 60.624 37.540  57.336 1.00 52.19  ? 116 PHE A HA   1 
ATOM   1006 H HB2  . PHE A 1 71  ? 60.837 40.262  58.036 1.00 54.07  ? 116 PHE A HB2  1 
ATOM   1007 H HB3  . PHE A 1 71  ? 61.617 39.688  56.777 1.00 54.07  ? 116 PHE A HB3  1 
ATOM   1008 H HD1  . PHE A 1 71  ? 58.258 39.642  57.956 1.00 53.39  ? 116 PHE A HD1  1 
ATOM   1009 H HD2  . PHE A 1 71  ? 60.597 40.039  54.747 1.00 56.89  ? 116 PHE A HD2  1 
ATOM   1010 H HE1  . PHE A 1 71  ? 56.391 39.980  56.643 1.00 53.17  ? 116 PHE A HE1  1 
ATOM   1011 H HE2  . PHE A 1 71  ? 58.739 40.377  53.429 1.00 56.71  ? 116 PHE A HE2  1 
ATOM   1012 H HZ   . PHE A 1 71  ? 56.629 40.349  54.374 1.00 54.70  ? 116 PHE A HZ   1 
ATOM   1013 N N    . LYS A 1 72  ? 63.136 37.517  57.498 1.00 44.50  ? 117 LYS A N    1 
ATOM   1014 C CA   . LYS A 1 72  ? 64.543 37.310  57.799 1.00 46.89  ? 117 LYS A CA   1 
ATOM   1015 C C    . LYS A 1 72  ? 65.139 38.598  58.340 1.00 48.84  ? 117 LYS A C    1 
ATOM   1016 O O    . LYS A 1 72  ? 64.796 39.695  57.889 1.00 51.15  ? 117 LYS A O    1 
ATOM   1017 C CB   . LYS A 1 72  ? 65.296 36.864  56.550 1.00 49.72  ? 117 LYS A CB   1 
ATOM   1018 C CG   . LYS A 1 72  ? 64.927 35.467  56.077 1.00 46.98  ? 117 LYS A CG   1 
ATOM   1019 C CD   . LYS A 1 72  ? 65.557 35.149  54.735 1.00 51.46  ? 117 LYS A CD   1 
ATOM   1020 C CE   . LYS A 1 72  ? 65.262 33.724  54.317 1.00 49.95  ? 117 LYS A CE   1 
ATOM   1021 N NZ   . LYS A 1 72  ? 65.812 33.434  52.968 1.00 53.44  ? 117 LYS A NZ   1 
ATOM   1022 H H    . LYS A 1 72  ? 62.918 37.379  56.678 1.00 53.40  ? 117 LYS A H    1 
ATOM   1023 H HA   . LYS A 1 72  ? 64.632 36.621  58.476 1.00 56.26  ? 117 LYS A HA   1 
ATOM   1024 H HB2  . LYS A 1 72  ? 65.099 37.482  55.829 1.00 59.66  ? 117 LYS A HB2  1 
ATOM   1025 H HB3  . LYS A 1 72  ? 66.247 36.871  56.739 1.00 59.66  ? 117 LYS A HB3  1 
ATOM   1026 H HG2  . LYS A 1 72  ? 65.244 34.817  56.723 1.00 56.38  ? 117 LYS A HG2  1 
ATOM   1027 H HG3  . LYS A 1 72  ? 63.964 35.405  55.984 1.00 56.38  ? 117 LYS A HG3  1 
ATOM   1028 H HD2  . LYS A 1 72  ? 65.195 35.746  54.061 1.00 61.75  ? 117 LYS A HD2  1 
ATOM   1029 H HD3  . LYS A 1 72  ? 66.519 35.256  54.798 1.00 61.75  ? 117 LYS A HD3  1 
ATOM   1030 H HE2  . LYS A 1 72  ? 65.669 33.113  54.950 1.00 59.94  ? 117 LYS A HE2  1 
ATOM   1031 H HE3  . LYS A 1 72  ? 64.301 33.590  54.290 1.00 59.94  ? 117 LYS A HE3  1 
ATOM   1032 H HZ1  . LYS A 1 72  ? 65.629 32.594  52.739 1.00 64.13  ? 117 LYS A HZ1  1 
ATOM   1033 H HZ2  . LYS A 1 72  ? 65.450 33.983  52.367 1.00 64.13  ? 117 LYS A HZ2  1 
ATOM   1034 H HZ3  . LYS A 1 72  ? 66.694 33.549  52.968 1.00 64.13  ? 117 LYS A HZ3  1 
ATOM   1035 N N    . GLU A 1 73  ? 66.012 38.467  59.333 1.00 48.86  ? 118 GLU A N    1 
ATOM   1036 C CA   . GLU A 1 73  ? 66.730 39.629  59.840 1.00 50.10  ? 118 GLU A CA   1 
ATOM   1037 C C    . GLU A 1 73  ? 67.312 40.417  58.676 1.00 53.48  ? 118 GLU A C    1 
ATOM   1038 O O    . GLU A 1 73  ? 67.820 39.844  57.711 1.00 55.69  ? 118 GLU A O    1 
ATOM   1039 C CB   . GLU A 1 73  ? 67.838 39.185  60.790 1.00 52.16  ? 118 GLU A CB   1 
ATOM   1040 C CG   . GLU A 1 73  ? 68.521 40.314  61.546 1.00 54.43  ? 118 GLU A CG   1 
ATOM   1041 C CD   . GLU A 1 73  ? 69.776 39.839  62.268 1.00 57.55  ? 118 GLU A CD   1 
ATOM   1042 O OE1  . GLU A 1 73  ? 70.274 38.742  61.935 1.00 57.66  ? 118 GLU A OE1  1 
ATOM   1043 O OE2  . GLU A 1 73  ? 70.265 40.556  63.165 1.00 59.87  ? 118 GLU A OE2  1 
ATOM   1044 H H    . GLU A 1 73  ? 66.204 37.726  59.726 1.00 58.63  ? 118 GLU A H    1 
ATOM   1045 H HA   . GLU A 1 73  ? 66.117 40.202  60.326 1.00 60.12  ? 118 GLU A HA   1 
ATOM   1046 H HB2  . GLU A 1 73  ? 67.458 38.581  61.447 1.00 62.60  ? 118 GLU A HB2  1 
ATOM   1047 H HB3  . GLU A 1 73  ? 68.518 38.722  60.277 1.00 62.60  ? 118 GLU A HB3  1 
ATOM   1048 H HG2  . GLU A 1 73  ? 68.778 41.008  60.918 1.00 65.32  ? 118 GLU A HG2  1 
ATOM   1049 H HG3  . GLU A 1 73  ? 67.909 40.671  62.207 1.00 65.32  ? 118 GLU A HG3  1 
ATOM   1050 N N    . GLY A 1 74  ? 67.206 41.742  58.758 1.00 64.99  ? 119 GLY A N    1 
ATOM   1051 C CA   . GLY A 1 74  ? 67.729 42.626  57.739 1.00 66.86  ? 119 GLY A CA   1 
ATOM   1052 C C    . GLY A 1 74  ? 66.788 42.905  56.583 1.00 68.64  ? 119 GLY A C    1 
ATOM   1053 O O    . GLY A 1 74  ? 67.034 43.847  55.823 1.00 71.42  ? 119 GLY A O    1 
ATOM   1054 H H    . GLY A 1 74  ? 66.827 42.155  59.410 1.00 77.98  ? 119 GLY A H    1 
ATOM   1055 H HA2  . GLY A 1 74  ? 67.959 43.475  58.147 1.00 80.23  ? 119 GLY A HA2  1 
ATOM   1056 H HA3  . GLY A 1 74  ? 68.541 42.239  57.375 1.00 80.23  ? 119 GLY A HA3  1 
ATOM   1057 N N    . ILE A 1 75  ? 65.732 42.111  56.415 1.00 64.24  ? 120 ILE A N    1 
ATOM   1058 C CA   . ILE A 1 75  ? 64.716 42.374  55.400 1.00 63.86  ? 120 ILE A CA   1 
ATOM   1059 C C    . ILE A 1 75  ? 63.597 43.173  56.047 1.00 61.74  ? 120 ILE A C    1 
ATOM   1060 O O    . ILE A 1 75  ? 63.004 42.739  57.040 1.00 58.75  ? 120 ILE A O    1 
ATOM   1061 C CB   . ILE A 1 75  ? 64.175 41.073  54.786 1.00 63.07  ? 120 ILE A CB   1 
ATOM   1062 C CG1  . ILE A 1 75  ? 65.262 40.379  53.966 1.00 65.52  ? 120 ILE A CG1  1 
ATOM   1063 C CG2  . ILE A 1 75  ? 62.950 41.368  53.907 1.00 62.25  ? 120 ILE A CG2  1 
ATOM   1064 C CD1  . ILE A 1 75  ? 64.822 39.079  53.321 1.00 64.25  ? 120 ILE A CD1  1 
ATOM   1065 H H    . ILE A 1 75  ? 65.579 41.406  56.883 1.00 77.09  ? 120 ILE A H    1 
ATOM   1066 H HA   . ILE A 1 75  ? 65.103 42.909  54.689 1.00 76.64  ? 120 ILE A HA   1 
ATOM   1067 H HB   . ILE A 1 75  ? 63.905 40.481  55.505 1.00 75.68  ? 120 ILE A HB   1 
ATOM   1068 H HG12 . ILE A 1 75  ? 65.547 40.978  53.258 1.00 78.63  ? 120 ILE A HG12 1 
ATOM   1069 H HG13 . ILE A 1 75  ? 66.012 40.181  54.548 1.00 78.63  ? 120 ILE A HG13 1 
ATOM   1070 H HG21 . ILE A 1 75  ? 62.625 40.536  53.530 1.00 74.70  ? 120 ILE A HG21 1 
ATOM   1071 H HG22 . ILE A 1 75  ? 62.260 41.776  54.454 1.00 74.70  ? 120 ILE A HG22 1 
ATOM   1072 H HG23 . ILE A 1 75  ? 63.211 41.974  53.196 1.00 74.70  ? 120 ILE A HG23 1 
ATOM   1073 H HD11 . ILE A 1 75  ? 65.566 38.707  52.823 1.00 77.10  ? 120 ILE A HD11 1 
ATOM   1074 H HD12 . ILE A 1 75  ? 64.545 38.461  54.015 1.00 77.10  ? 120 ILE A HD12 1 
ATOM   1075 H HD13 . ILE A 1 75  ? 64.080 39.259  52.723 1.00 77.10  ? 120 ILE A HD13 1 
ATOM   1076 N N    . LYS A 1 76  ? 63.292 44.321  55.476 1.00 62.37  ? 121 LYS A N    1 
ATOM   1077 C CA   . LYS A 1 76  ? 62.226 45.159  56.009 1.00 61.97  ? 121 LYS A CA   1 
ATOM   1078 C C    . LYS A 1 76  ? 60.884 44.679  55.463 1.00 57.71  ? 121 LYS A C    1 
ATOM   1079 O O    . LYS A 1 76  ? 60.773 44.418  54.262 1.00 56.85  ? 121 LYS A O    1 
ATOM   1080 C CB   . LYS A 1 76  ? 62.472 46.618  55.637 1.00 66.97  ? 121 LYS A CB   1 
ATOM   1081 C CG   . LYS A 1 76  ? 63.862 47.106  56.039 1.00 68.79  ? 121 LYS A CG   1 
ATOM   1082 C CD   . LYS A 1 76  ? 64.183 48.469  55.455 1.00 75.94  ? 121 LYS A CD   1 
ATOM   1083 C CE   . LYS A 1 76  ? 63.361 49.573  56.099 1.00 77.46  ? 121 LYS A CE   1 
ATOM   1084 N NZ   . LYS A 1 76  ? 63.848 50.926  55.698 1.00 87.50  ? 121 LYS A NZ   1 
ATOM   1085 H H    . LYS A 1 76  ? 63.684 44.642  54.780 1.00 74.84  ? 121 LYS A H    1 
ATOM   1086 H HA   . LYS A 1 76  ? 62.209 45.086  56.976 1.00 74.37  ? 121 LYS A HA   1 
ATOM   1087 H HB2  . LYS A 1 76  ? 62.385 46.718  54.676 1.00 80.36  ? 121 LYS A HB2  1 
ATOM   1088 H HB3  . LYS A 1 76  ? 61.817 47.173  56.088 1.00 80.36  ? 121 LYS A HB3  1 
ATOM   1089 H HG2  . LYS A 1 76  ? 63.908 47.174  57.006 1.00 82.54  ? 121 LYS A HG2  1 
ATOM   1090 H HG3  . LYS A 1 76  ? 64.526 46.476  55.718 1.00 82.54  ? 121 LYS A HG3  1 
ATOM   1091 H HD2  . LYS A 1 76  ? 65.121 48.665  55.602 1.00 91.13  ? 121 LYS A HD2  1 
ATOM   1092 H HD3  . LYS A 1 76  ? 63.987 48.461  54.505 1.00 91.13  ? 121 LYS A HD3  1 
ATOM   1093 H HE2  . LYS A 1 76  ? 62.436 49.488  55.819 1.00 92.95  ? 121 LYS A HE2  1 
ATOM   1094 H HE3  . LYS A 1 76  ? 63.428 49.499  57.064 1.00 92.95  ? 121 LYS A HE3  1 
ATOM   1095 H HZ1  . LYS A 1 76  ? 63.353 51.555  56.087 1.00 105.00 ? 121 LYS A HZ1  1 
ATOM   1096 H HZ2  . LYS A 1 76  ? 64.696 51.030  55.948 1.00 105.00 ? 121 LYS A HZ2  1 
ATOM   1097 H HZ3  . LYS A 1 76  ? 63.794 51.020  54.815 1.00 105.00 ? 121 LYS A HZ3  1 
ATOM   1098 N N    . PRO A 1 77  ? 59.841 44.540  56.307 1.00 55.12  ? 122 PRO A N    1 
ATOM   1099 C CA   . PRO A 1 77  ? 58.567 43.999  55.807 1.00 54.79  ? 122 PRO A CA   1 
ATOM   1100 C C    . PRO A 1 77  ? 57.739 44.996  55.008 1.00 60.39  ? 122 PRO A C    1 
ATOM   1101 O O    . PRO A 1 77  ? 56.515 44.862  54.935 1.00 55.36  ? 122 PRO A O    1 
ATOM   1102 C CB   . PRO A 1 77  ? 57.826 43.587  57.091 1.00 51.10  ? 122 PRO A CB   1 
ATOM   1103 C CG   . PRO A 1 77  ? 58.812 43.719  58.201 1.00 52.76  ? 122 PRO A CG   1 
ATOM   1104 C CD   . PRO A 1 77  ? 59.795 44.745  57.763 1.00 54.63  ? 122 PRO A CD   1 
ATOM   1105 H HA   . PRO A 1 77  ? 58.728 43.211  55.266 1.00 65.75  ? 122 PRO A HA   1 
ATOM   1106 H HB2  . PRO A 1 77  ? 57.072 44.180  57.234 1.00 61.33  ? 122 PRO A HB2  1 
ATOM   1107 H HB3  . PRO A 1 77  ? 57.526 42.668  57.011 1.00 61.33  ? 122 PRO A HB3  1 
ATOM   1108 H HG2  . PRO A 1 77  ? 58.355 44.008  59.007 1.00 63.31  ? 122 PRO A HG2  1 
ATOM   1109 H HG3  . PRO A 1 77  ? 59.252 42.867  58.347 1.00 63.31  ? 122 PRO A HG3  1 
ATOM   1110 H HD2  . PRO A 1 77  ? 59.474 45.637  57.971 1.00 65.55  ? 122 PRO A HD2  1 
ATOM   1111 H HD3  . PRO A 1 77  ? 60.664 44.576  58.158 1.00 65.55  ? 122 PRO A HD3  1 
ATOM   1112 N N    . MET A 1 78  ? 58.377 45.993  54.411 1.00 62.12  ? 123 MET A N    1 
ATOM   1113 C CA   . MET A 1 78  ? 57.705 46.950  53.546 1.00 72.13  ? 123 MET A CA   1 
ATOM   1114 C C    . MET A 1 78  ? 58.165 46.761  52.104 1.00 85.26  ? 123 MET A C    1 
ATOM   1115 O O    . MET A 1 78  ? 59.168 46.098  51.821 1.00 80.82  ? 123 MET A O    1 
ATOM   1116 C CB   . MET A 1 78  ? 57.980 48.380  54.023 1.00 81.68  ? 123 MET A CB   1 
ATOM   1117 C CG   . MET A 1 78  ? 57.376 48.699  55.384 1.00 82.07  ? 123 MET A CG   1 
ATOM   1118 S SD   . MET A 1 78  ? 58.309 49.954  56.282 1.00 97.31  ? 123 MET A SD   1 
ATOM   1119 C CE   . MET A 1 78  ? 59.761 49.025  56.782 1.00 98.33  ? 123 MET A CE   1 
ATOM   1120 H H    . MET A 1 78  ? 59.221 46.139  54.494 1.00 74.55  ? 123 MET A H    1 
ATOM   1121 H HA   . MET A 1 78  ? 56.748 46.798  53.594 1.00 86.56  ? 123 MET A HA   1 
ATOM   1122 H HB2  . MET A 1 78  ? 58.939 48.511  54.086 1.00 98.01  ? 123 MET A HB2  1 
ATOM   1123 H HB3  . MET A 1 78  ? 57.605 49.002  53.379 1.00 98.01  ? 123 MET A HB3  1 
ATOM   1124 H HG2  . MET A 1 78  ? 56.472 49.029  55.259 1.00 98.48  ? 123 MET A HG2  1 
ATOM   1125 H HG3  . MET A 1 78  ? 57.364 47.892  55.921 1.00 98.48  ? 123 MET A HG3  1 
ATOM   1126 H HE1  . MET A 1 78  ? 60.351 49.608  57.285 1.00 117.99 ? 123 MET A HE1  1 
ATOM   1127 H HE2  . MET A 1 78  ? 59.483 48.279  57.336 1.00 117.99 ? 123 MET A HE2  1 
ATOM   1128 H HE3  . MET A 1 78  ? 60.215 48.698  55.990 1.00 117.99 ? 123 MET A HE3  1 
ATOM   1129 N N    . TRP A 1 79  ? 57.413 47.361  51.183 1.00 114.46 ? 124 TRP A N    1 
ATOM   1130 C CA   . TRP A 1 79  ? 57.689 47.222  49.758 1.00 122.90 ? 124 TRP A CA   1 
ATOM   1131 C C    . TRP A 1 79  ? 58.765 48.180  49.254 1.00 123.67 ? 124 TRP A C    1 
ATOM   1132 O O    . TRP A 1 79  ? 59.117 48.118  48.071 1.00 125.93 ? 124 TRP A O    1 
ATOM   1133 C CB   . TRP A 1 79  ? 56.396 47.419  48.960 1.00 121.94 ? 124 TRP A CB   1 
ATOM   1134 C CG   . TRP A 1 79  ? 55.468 46.235  49.034 1.00 126.35 ? 124 TRP A CG   1 
ATOM   1135 C CD1  . TRP A 1 79  ? 55.613 45.130  49.821 1.00 124.34 ? 124 TRP A CD1  1 
ATOM   1136 C CD2  . TRP A 1 79  ? 54.261 46.035  48.285 1.00 128.25 ? 124 TRP A CD2  1 
ATOM   1137 N NE1  . TRP A 1 79  ? 54.574 44.256  49.611 1.00 122.73 ? 124 TRP A NE1  1 
ATOM   1138 C CE2  . TRP A 1 79  ? 53.731 44.788  48.673 1.00 125.54 ? 124 TRP A CE2  1 
ATOM   1139 C CE3  . TRP A 1 79  ? 53.578 46.788  47.325 1.00 131.86 ? 124 TRP A CE3  1 
ATOM   1140 C CZ2  . TRP A 1 79  ? 52.550 44.280  48.138 1.00 125.56 ? 124 TRP A CZ2  1 
ATOM   1141 C CZ3  . TRP A 1 79  ? 52.406 46.280  46.793 1.00 131.81 ? 124 TRP A CZ3  1 
ATOM   1142 C CH2  . TRP A 1 79  ? 51.903 45.039  47.202 1.00 128.91 ? 124 TRP A CH2  1 
ATOM   1143 H H    . TRP A 1 79  ? 56.733 47.857  51.360 1.00 137.36 ? 124 TRP A H    1 
ATOM   1144 H HA   . TRP A 1 79  ? 58.001 46.319  49.591 1.00 147.48 ? 124 TRP A HA   1 
ATOM   1145 H HB2  . TRP A 1 79  ? 55.924 48.191  49.310 1.00 146.33 ? 124 TRP A HB2  1 
ATOM   1146 H HB3  . TRP A 1 79  ? 56.621 47.564  48.027 1.00 146.33 ? 124 TRP A HB3  1 
ATOM   1147 H HD1  . TRP A 1 79  ? 56.316 44.988  50.413 1.00 149.21 ? 124 TRP A HD1  1 
ATOM   1148 H HE1  . TRP A 1 79  ? 54.470 43.500  50.006 1.00 147.27 ? 124 TRP A HE1  1 
ATOM   1149 H HE3  . TRP A 1 79  ? 53.906 47.614  47.049 1.00 158.23 ? 124 TRP A HE3  1 
ATOM   1150 H HZ2  . TRP A 1 79  ? 52.214 43.456  48.407 1.00 150.68 ? 124 TRP A HZ2  1 
ATOM   1151 H HZ3  . TRP A 1 79  ? 51.943 46.773  46.155 1.00 158.17 ? 124 TRP A HZ3  1 
ATOM   1152 H HH2  . TRP A 1 79  ? 51.113 44.723  46.828 1.00 154.69 ? 124 TRP A HH2  1 
ATOM   1153 N N    . GLU A 1 80  ? 59.299 49.052  50.111 1.00 123.29 ? 125 GLU A N    1 
ATOM   1154 C CA   . GLU A 1 80  ? 60.434 49.882  49.729 1.00 127.93 ? 125 GLU A CA   1 
ATOM   1155 C C    . GLU A 1 80  ? 61.751 49.122  49.800 1.00 118.98 ? 125 GLU A C    1 
ATOM   1156 O O    . GLU A 1 80  ? 62.705 49.492  49.105 1.00 121.58 ? 125 GLU A O    1 
ATOM   1157 C CB   . GLU A 1 80  ? 60.509 51.122  50.624 1.00 124.97 ? 125 GLU A CB   1 
ATOM   1158 C CG   . GLU A 1 80  ? 59.423 52.158  50.355 1.00 128.45 ? 125 GLU A CG   1 
ATOM   1159 C CD   . GLU A 1 80  ? 58.023 51.630  50.618 1.00 125.78 ? 125 GLU A CD   1 
ATOM   1160 O OE1  . GLU A 1 80  ? 57.897 50.483  51.097 1.00 122.58 ? 125 GLU A OE1  1 
ATOM   1161 O OE2  . GLU A 1 80  ? 57.048 52.358  50.340 1.00 127.23 ? 125 GLU A OE2  1 
ATOM   1162 H H    . GLU A 1 80  ? 59.021 49.180  50.915 1.00 147.95 ? 125 GLU A H    1 
ATOM   1163 H HA   . GLU A 1 80  ? 60.311 50.181  48.814 1.00 153.51 ? 125 GLU A HA   1 
ATOM   1164 H HB2  . GLU A 1 80  ? 60.427 50.843  51.549 1.00 149.96 ? 125 GLU A HB2  1 
ATOM   1165 H HB3  . GLU A 1 80  ? 61.367 51.553  50.487 1.00 149.96 ? 125 GLU A HB3  1 
ATOM   1166 H HG2  . GLU A 1 80  ? 59.567 52.924  50.934 1.00 154.14 ? 125 GLU A HG2  1 
ATOM   1167 H HG3  . GLU A 1 80  ? 59.470 52.432  49.426 1.00 154.14 ? 125 GLU A HG3  1 
ATOM   1168 N N    . ASP A 1 81  ? 61.819 48.078  50.625 1.00 103.29 ? 126 ASP A N    1 
ATOM   1169 C CA   . ASP A 1 81  ? 63.006 47.238  50.714 1.00 94.03  ? 126 ASP A CA   1 
ATOM   1170 C C    . ASP A 1 81  ? 63.411 46.749  49.329 1.00 94.51  ? 126 ASP A C    1 
ATOM   1171 O O    . ASP A 1 81  ? 62.562 46.485  48.472 1.00 88.86  ? 126 ASP A O    1 
ATOM   1172 C CB   . ASP A 1 81  ? 62.722 46.050  51.643 1.00 90.60  ? 126 ASP A CB   1 
ATOM   1173 C CG   . ASP A 1 81  ? 63.976 45.278  52.039 1.00 89.35  ? 126 ASP A CG   1 
ATOM   1174 O OD1  . ASP A 1 81  ? 64.579 45.612  53.083 1.00 90.94  ? 126 ASP A OD1  1 
ATOM   1175 O OD2  . ASP A 1 81  ? 64.339 44.319  51.324 1.00 90.15  ? 126 ASP A OD2  1 
ATOM   1176 H H    . ASP A 1 81  ? 61.181 47.835  51.148 1.00 123.95 ? 126 ASP A H    1 
ATOM   1177 H HA   . ASP A 1 81  ? 63.740 47.752  51.086 1.00 112.84 ? 126 ASP A HA   1 
ATOM   1178 H HB2  . ASP A 1 81  ? 62.306 46.379  52.456 1.00 108.72 ? 126 ASP A HB2  1 
ATOM   1179 H HB3  . ASP A 1 81  ? 62.123 45.435  51.192 1.00 108.72 ? 126 ASP A HB3  1 
ATOM   1180 N N    . ASP A 1 82  ? 64.723 46.634  49.112 1.00 108.41 ? 127 ASP A N    1 
ATOM   1181 C CA   . ASP A 1 82  ? 65.220 46.218  47.805 1.00 115.67 ? 127 ASP A CA   1 
ATOM   1182 C C    . ASP A 1 82  ? 64.881 44.758  47.526 1.00 112.04 ? 127 ASP A C    1 
ATOM   1183 O O    . ASP A 1 82  ? 64.462 44.414  46.414 1.00 116.42 ? 127 ASP A O    1 
ATOM   1184 C CB   . ASP A 1 82  ? 66.731 46.454  47.726 1.00 119.05 ? 127 ASP A CB   1 
ATOM   1185 C CG   . ASP A 1 82  ? 67.240 46.551  46.293 1.00 124.96 ? 127 ASP A CG   1 
ATOM   1186 O OD1  . ASP A 1 82  ? 66.415 46.749  45.376 1.00 125.75 ? 127 ASP A OD1  1 
ATOM   1187 O OD2  . ASP A 1 82  ? 68.470 46.444  46.086 1.00 127.80 ? 127 ASP A OD2  1 
ATOM   1188 H H    . ASP A 1 82  ? 65.334 46.788  49.697 1.00 130.10 ? 127 ASP A H    1 
ATOM   1189 H HA   . ASP A 1 82  ? 64.797 46.760  47.120 1.00 138.81 ? 127 ASP A HA   1 
ATOM   1190 H HB2  . ASP A 1 82  ? 66.945 47.285  48.177 1.00 142.86 ? 127 ASP A HB2  1 
ATOM   1191 H HB3  . ASP A 1 82  ? 67.189 45.715  48.157 1.00 142.86 ? 127 ASP A HB3  1 
ATOM   1192 N N    . ALA A 1 83  ? 65.035 43.886  48.527 1.00 109.69 ? 128 ALA A N    1 
ATOM   1193 C CA   . ALA A 1 83  ? 64.717 42.473  48.348 1.00 106.89 ? 128 ALA A CA   1 
ATOM   1194 C C    . ALA A 1 83  ? 63.265 42.251  47.944 1.00 103.40 ? 128 ALA A C    1 
ATOM   1195 O O    . ALA A 1 83  ? 62.927 41.164  47.463 1.00 102.81 ? 128 ALA A O    1 
ATOM   1196 C CB   . ALA A 1 83  ? 65.020 41.696  49.632 1.00 105.61 ? 128 ALA A CB   1 
ATOM   1197 H H    . ALA A 1 83  ? 65.320 44.089  49.312 1.00 131.63 ? 128 ALA A H    1 
ATOM   1198 H HA   . ALA A 1 83  ? 65.279 42.113  47.644 1.00 128.27 ? 128 ALA A HA   1 
ATOM   1199 H HB1  . ALA A 1 83  ? 64.802 40.761  49.494 1.00 126.73 ? 128 ALA A HB1  1 
ATOM   1200 H HB2  . ALA A 1 83  ? 65.962 41.790  49.843 1.00 126.73 ? 128 ALA A HB2  1 
ATOM   1201 H HB3  . ALA A 1 83  ? 64.481 42.058  50.354 1.00 126.73 ? 128 ALA A HB3  1 
ATOM   1202 N N    . ASN A 1 84  ? 62.402 43.255  48.120 1.00 100.50 ? 129 ASN A N    1 
ATOM   1203 C CA   . ASN A 1 84  ? 60.989 43.134  47.795 1.00 95.83  ? 129 ASN A CA   1 
ATOM   1204 C C    . ASN A 1 84  ? 60.588 43.870  46.523 1.00 91.83  ? 129 ASN A C    1 
ATOM   1205 O O    . ASN A 1 84  ? 59.478 43.646  46.029 1.00 87.56  ? 129 ASN A O    1 
ATOM   1206 C CB   . ASN A 1 84  ? 60.137 43.651  48.963 1.00 96.00  ? 129 ASN A CB   1 
ATOM   1207 C CG   . ASN A 1 84  ? 60.500 42.994  50.281 1.00 97.15  ? 129 ASN A CG   1 
ATOM   1208 O OD1  . ASN A 1 84  ? 60.683 43.670  51.292 1.00 98.15  ? 129 ASN A OD1  1 
ATOM   1209 N ND2  . ASN A 1 84  ? 60.612 41.667  50.274 1.00 95.97  ? 129 ASN A ND2  1 
ATOM   1210 H H    . ASN A 1 84  ? 62.620 44.026  48.432 1.00 120.59 ? 129 ASN A H    1 
ATOM   1211 H HA   . ASN A 1 84  ? 60.779 42.196  47.669 1.00 115.00 ? 129 ASN A HA   1 
ATOM   1212 H HB2  . ASN A 1 84  ? 60.273 44.607  49.056 1.00 115.20 ? 129 ASN A HB2  1 
ATOM   1213 H HB3  . ASN A 1 84  ? 59.203 43.464  48.781 1.00 115.20 ? 129 ASN A HB3  1 
ATOM   1214 H HD21 . ASN A 1 84  ? 60.816 41.249  50.997 1.00 115.16 ? 129 ASN A HD21 1 
ATOM   1215 H HD22 . ASN A 1 84  ? 60.480 41.228  49.546 1.00 115.16 ? 129 ASN A HD22 1 
ATOM   1216 N N    . LYS A 1 85  ? 61.449 44.733  45.979 1.00 84.17  ? 130 LYS A N    1 
ATOM   1217 C CA   . LYS A 1 85  ? 61.098 45.452  44.757 1.00 81.66  ? 130 LYS A CA   1 
ATOM   1218 C C    . LYS A 1 85  ? 60.846 44.489  43.601 1.00 79.34  ? 130 LYS A C    1 
ATOM   1219 O O    . LYS A 1 85  ? 59.969 44.729  42.763 1.00 78.52  ? 130 LYS A O    1 
ATOM   1220 C CB   . LYS A 1 85  ? 62.204 46.447  44.394 1.00 84.07  ? 130 LYS A CB   1 
ATOM   1221 C CG   . LYS A 1 85  ? 61.936 47.235  43.111 1.00 85.87  ? 130 LYS A CG   1 
ATOM   1222 C CD   . LYS A 1 85  ? 63.040 48.244  42.814 1.00 90.26  ? 130 LYS A CD   1 
ATOM   1223 C CE   . LYS A 1 85  ? 62.742 49.031  41.539 1.00 95.01  ? 130 LYS A CE   1 
ATOM   1224 N NZ   . LYS A 1 85  ? 63.801 50.032  41.210 1.00 99.72  ? 130 LYS A NZ   1 
ATOM   1225 H H    . LYS A 1 85  ? 62.229 44.916  46.292 1.00 101.01 ? 130 LYS A H    1 
ATOM   1226 H HA   . LYS A 1 85  ? 60.282 45.955  44.910 1.00 97.99  ? 130 LYS A HA   1 
ATOM   1227 H HB2  . LYS A 1 85  ? 62.299 47.085  45.118 1.00 100.88 ? 130 LYS A HB2  1 
ATOM   1228 H HB3  . LYS A 1 85  ? 63.034 45.960  44.274 1.00 100.88 ? 130 LYS A HB3  1 
ATOM   1229 H HG2  . LYS A 1 85  ? 61.882 46.618  42.364 1.00 103.04 ? 130 LYS A HG2  1 
ATOM   1230 H HG3  . LYS A 1 85  ? 61.101 47.720  43.204 1.00 103.04 ? 130 LYS A HG3  1 
ATOM   1231 H HD2  . LYS A 1 85  ? 63.108 48.872  43.550 1.00 108.31 ? 130 LYS A HD2  1 
ATOM   1232 H HD3  . LYS A 1 85  ? 63.880 47.774  42.693 1.00 108.31 ? 130 LYS A HD3  1 
ATOM   1233 H HE2  . LYS A 1 85  ? 62.675 48.412  40.795 1.00 114.02 ? 130 LYS A HE2  1 
ATOM   1234 H HE3  . LYS A 1 85  ? 61.905 49.507  41.650 1.00 114.02 ? 130 LYS A HE3  1 
ATOM   1235 H HZ1  . LYS A 1 85  ? 63.588 50.466  40.463 1.00 119.66 ? 130 LYS A HZ1  1 
ATOM   1236 H HZ2  . LYS A 1 85  ? 63.879 50.620  41.874 1.00 119.66 ? 130 LYS A HZ2  1 
ATOM   1237 H HZ3  . LYS A 1 85  ? 64.582 49.621  41.094 1.00 119.66 ? 130 LYS A HZ3  1 
ATOM   1238 N N    . ASN A 1 86  ? 61.607 43.397  43.536 1.00 81.44  ? 131 ASN A N    1 
ATOM   1239 C CA   . ASN A 1 86  ? 61.461 42.399  42.485 1.00 82.09  ? 131 ASN A CA   1 
ATOM   1240 C C    . ASN A 1 86  ? 60.813 41.119  42.987 1.00 78.29  ? 131 ASN A C    1 
ATOM   1241 O O    . ASN A 1 86  ? 60.866 40.097  42.296 1.00 81.53  ? 131 ASN A O    1 
ATOM   1242 C CB   . ASN A 1 86  ? 62.821 42.079  41.869 1.00 86.19  ? 131 ASN A CB   1 
ATOM   1243 C CG   . ASN A 1 86  ? 63.464 43.285  41.234 1.00 89.55  ? 131 ASN A CG   1 
ATOM   1244 O OD1  . ASN A 1 86  ? 62.780 44.148  40.684 1.00 92.03  ? 131 ASN A OD1  1 
ATOM   1245 N ND2  . ASN A 1 86  ? 64.786 43.357  41.307 1.00 92.63  ? 131 ASN A ND2  1 
ATOM   1246 H H    . ASN A 1 86  ? 62.227 43.211  44.103 1.00 97.73  ? 131 ASN A H    1 
ATOM   1247 H HA   . ASN A 1 86  ? 60.896 42.763  41.786 1.00 98.51  ? 131 ASN A HA   1 
ATOM   1248 H HB2  . ASN A 1 86  ? 63.415 41.753  42.564 1.00 103.42 ? 131 ASN A HB2  1 
ATOM   1249 H HB3  . ASN A 1 86  ? 62.707 41.403  41.184 1.00 103.42 ? 131 ASN A HB3  1 
ATOM   1250 H HD21 . ASN A 1 86  ? 65.200 44.026  40.960 1.00 111.15 ? 131 ASN A HD21 1 
ATOM   1251 H HD22 . ASN A 1 86  ? 65.229 42.735  41.702 1.00 111.15 ? 131 ASN A HD22 1 
ATOM   1252 N N    . GLY A 1 87  ? 60.208 41.147  44.174 1.00 72.38  ? 132 GLY A N    1 
ATOM   1253 C CA   . GLY A 1 87  ? 59.598 39.980  44.763 1.00 66.72  ? 132 GLY A CA   1 
ATOM   1254 C C    . GLY A 1 87  ? 58.079 40.033  44.708 1.00 65.09  ? 132 GLY A C    1 
ATOM   1255 O O    . GLY A 1 87  ? 57.467 41.026  44.324 1.00 66.32  ? 132 GLY A O    1 
ATOM   1256 H H    . GLY A 1 87  ? 60.141 41.853  44.661 1.00 86.86  ? 132 GLY A H    1 
ATOM   1257 H HA2  . GLY A 1 87  ? 59.895 39.186  44.291 1.00 80.06  ? 132 GLY A HA2  1 
ATOM   1258 H HA3  . GLY A 1 87  ? 59.870 39.906  45.691 1.00 80.06  ? 132 GLY A HA3  1 
ATOM   1259 N N    . GLY A 1 88  ? 57.479 38.913  45.096 1.00 65.33  ? 133 GLY A N    1 
ATOM   1260 C CA   . GLY A 1 88  ? 56.038 38.804  45.166 1.00 62.57  ? 133 GLY A CA   1 
ATOM   1261 C C    . GLY A 1 88  ? 55.610 38.077  46.420 1.00 59.32  ? 133 GLY A C    1 
ATOM   1262 O O    . GLY A 1 88  ? 56.445 37.765  47.275 1.00 56.87  ? 133 GLY A O    1 
ATOM   1263 H H    . GLY A 1 88  ? 57.895 38.196  45.326 1.00 78.40  ? 133 GLY A H    1 
ATOM   1264 H HA2  . GLY A 1 88  ? 55.642 39.689  45.168 1.00 75.08  ? 133 GLY A HA2  1 
ATOM   1265 H HA3  . GLY A 1 88  ? 55.708 38.316  44.395 1.00 75.08  ? 133 GLY A HA3  1 
ATOM   1266 N N    . LYS A 1 89  ? 54.316 37.801  46.543 1.00 54.63  ? 134 LYS A N    1 
ATOM   1267 C CA   . LYS A 1 89  ? 53.799 37.103  47.708 1.00 51.32  ? 134 LYS A CA   1 
ATOM   1268 C C    . LYS A 1 89  ? 52.563 36.311  47.317 1.00 49.83  ? 134 LYS A C    1 
ATOM   1269 O O    . LYS A 1 89  ? 51.756 36.773  46.506 1.00 50.05  ? 134 LYS A O    1 
ATOM   1270 C CB   . LYS A 1 89  ? 53.460 38.083  48.838 1.00 51.73  ? 134 LYS A CB   1 
ATOM   1271 C CG   . LYS A 1 89  ? 52.389 39.116  48.485 1.00 54.55  ? 134 LYS A CG   1 
ATOM   1272 C CD   . LYS A 1 89  ? 52.202 40.123  49.618 1.00 55.75  ? 134 LYS A CD   1 
ATOM   1273 C CE   . LYS A 1 89  ? 51.084 41.114  49.318 1.00 59.02  ? 134 LYS A CE   1 
ATOM   1274 N NZ   . LYS A 1 89  ? 50.885 42.120  50.401 1.00 59.08  ? 134 LYS A NZ   1 
ATOM   1275 H H    . LYS A 1 89  ? 53.716 38.008  45.962 1.00 65.55  ? 134 LYS A H    1 
ATOM   1276 H HA   . LYS A 1 89  ? 54.469 36.482  48.034 1.00 61.58  ? 134 LYS A HA   1 
ATOM   1277 H HB2  . LYS A 1 89  ? 53.141 37.577  49.602 1.00 62.08  ? 134 LYS A HB2  1 
ATOM   1278 H HB3  . LYS A 1 89  ? 54.266 38.566  49.081 1.00 62.08  ? 134 LYS A HB3  1 
ATOM   1279 H HG2  . LYS A 1 89  ? 52.658 39.600  47.689 1.00 65.46  ? 134 LYS A HG2  1 
ATOM   1280 H HG3  . LYS A 1 89  ? 51.543 38.665  48.336 1.00 65.46  ? 134 LYS A HG3  1 
ATOM   1281 H HD2  . LYS A 1 89  ? 51.975 39.648  50.432 1.00 66.90  ? 134 LYS A HD2  1 
ATOM   1282 H HD3  . LYS A 1 89  ? 53.024 40.622  49.739 1.00 66.90  ? 134 LYS A HD3  1 
ATOM   1283 H HE2  . LYS A 1 89  ? 51.299 41.592  48.502 1.00 70.83  ? 134 LYS A HE2  1 
ATOM   1284 H HE3  . LYS A 1 89  ? 50.253 40.626  49.207 1.00 70.83  ? 134 LYS A HE3  1 
ATOM   1285 H HZ1  . LYS A 1 89  ? 50.224 42.675  50.182 1.00 70.89  ? 134 LYS A HZ1  1 
ATOM   1286 H HZ2  . LYS A 1 89  ? 50.677 41.709  51.163 1.00 70.89  ? 134 LYS A HZ2  1 
ATOM   1287 H HZ3  . LYS A 1 89  ? 51.631 42.590  50.520 1.00 70.89  ? 134 LYS A HZ3  1 
ATOM   1288 N N    . TRP A 1 90  ? 52.429 35.116  47.891 1.00 46.61  ? 135 TRP A N    1 
ATOM   1289 C CA   . TRP A 1 90  ? 51.199 34.347  47.788 1.00 45.07  ? 135 TRP A CA   1 
ATOM   1290 C C    . TRP A 1 90  ? 50.254 34.796  48.891 1.00 45.89  ? 135 TRP A C    1 
ATOM   1291 O O    . TRP A 1 90  ? 50.671 34.989  50.034 1.00 44.89  ? 135 TRP A O    1 
ATOM   1292 C CB   . TRP A 1 90  ? 51.469 32.846  47.900 1.00 43.06  ? 135 TRP A CB   1 
ATOM   1293 C CG   . TRP A 1 90  ? 51.909 32.230  46.610 1.00 43.30  ? 135 TRP A CG   1 
ATOM   1294 C CD1  . TRP A 1 90  ? 53.169 31.809  46.281 1.00 43.92  ? 135 TRP A CD1  1 
ATOM   1295 C CD2  . TRP A 1 90  ? 51.089 31.974  45.463 1.00 44.71  ? 135 TRP A CD2  1 
ATOM   1296 N NE1  . TRP A 1 90  ? 53.181 31.307  44.999 1.00 45.95  ? 135 TRP A NE1  1 
ATOM   1297 C CE2  . TRP A 1 90  ? 51.917 31.399  44.476 1.00 46.68  ? 135 TRP A CE2  1 
ATOM   1298 C CE3  . TRP A 1 90  ? 49.734 32.177  45.173 1.00 44.69  ? 135 TRP A CE3  1 
ATOM   1299 C CZ2  . TRP A 1 90  ? 51.433 31.023  43.227 1.00 49.18  ? 135 TRP A CZ2  1 
ATOM   1300 C CZ3  . TRP A 1 90  ? 49.259 31.808  43.934 1.00 47.10  ? 135 TRP A CZ3  1 
ATOM   1301 C CH2  . TRP A 1 90  ? 50.104 31.232  42.977 1.00 49.50  ? 135 TRP A CH2  1 
ATOM   1302 H H    . TRP A 1 90  ? 53.044 34.728  48.350 1.00 55.93  ? 135 TRP A H    1 
ATOM   1303 H HA   . TRP A 1 90  ? 50.778 34.521  46.932 1.00 54.09  ? 135 TRP A HA   1 
ATOM   1304 H HB2  . TRP A 1 90  ? 52.170 32.701  48.555 1.00 51.67  ? 135 TRP A HB2  1 
ATOM   1305 H HB3  . TRP A 1 90  ? 50.656 32.400  48.182 1.00 51.67  ? 135 TRP A HB3  1 
ATOM   1306 H HD1  . TRP A 1 90  ? 53.910 31.857  46.841 1.00 52.70  ? 135 TRP A HD1  1 
ATOM   1307 H HE1  . TRP A 1 90  ? 53.868 30.987  44.593 1.00 55.14  ? 135 TRP A HE1  1 
ATOM   1308 H HE3  . TRP A 1 90  ? 49.166 32.559  45.804 1.00 53.63  ? 135 TRP A HE3  1 
ATOM   1309 H HZ2  . TRP A 1 90  ? 51.991 30.641  42.588 1.00 59.02  ? 135 TRP A HZ2  1 
ATOM   1310 H HZ3  . TRP A 1 90  ? 48.361 31.937  43.732 1.00 56.52  ? 135 TRP A HZ3  1 
ATOM   1311 H HH2  . TRP A 1 90  ? 49.754 30.992  42.149 1.00 59.40  ? 135 TRP A HH2  1 
ATOM   1312 N N    . ILE A 1 91  ? 48.984 34.973  48.536 1.00 53.23  ? 136 ILE A N    1 
ATOM   1313 C CA   . ILE A 1 91  ? 47.970 35.503  49.440 1.00 55.73  ? 136 ILE A CA   1 
ATOM   1314 C C    . ILE A 1 91  ? 46.862 34.474  49.583 1.00 54.61  ? 136 ILE A C    1 
ATOM   1315 O O    . ILE A 1 91  ? 46.335 33.978  48.581 1.00 56.28  ? 136 ILE A O    1 
ATOM   1316 C CB   . ILE A 1 91  ? 47.398 36.836  48.925 1.00 61.05  ? 136 ILE A CB   1 
ATOM   1317 C CG1  . ILE A 1 91  ? 48.501 37.885  48.835 1.00 65.02  ? 136 ILE A CG1  1 
ATOM   1318 C CG2  . ILE A 1 91  ? 46.274 37.332  49.827 1.00 63.42  ? 136 ILE A CG2  1 
ATOM   1319 C CD1  . ILE A 1 91  ? 48.116 39.069  47.989 1.00 68.27  ? 136 ILE A CD1  1 
ATOM   1320 H H    . ILE A 1 91  ? 48.678 34.786  47.754 1.00 63.88  ? 136 ILE A H    1 
ATOM   1321 H HA   . ILE A 1 91  ? 48.363 35.655  50.314 1.00 66.87  ? 136 ILE A HA   1 
ATOM   1322 H HB   . ILE A 1 91  ? 47.038 36.692  48.036 1.00 73.26  ? 136 ILE A HB   1 
ATOM   1323 H HG12 . ILE A 1 91  ? 48.703 38.207  49.728 1.00 78.02  ? 136 ILE A HG12 1 
ATOM   1324 H HG13 . ILE A 1 91  ? 49.290 37.480  48.443 1.00 78.02  ? 136 ILE A HG13 1 
ATOM   1325 H HG21 . ILE A 1 91  ? 45.935 38.171  49.477 1.00 76.10  ? 136 ILE A HG21 1 
ATOM   1326 H HG22 . ILE A 1 91  ? 45.566 36.669  49.842 1.00 76.10  ? 136 ILE A HG22 1 
ATOM   1327 H HG23 . ILE A 1 91  ? 46.623 37.464  50.722 1.00 76.10  ? 136 ILE A HG23 1 
ATOM   1328 H HD11 . ILE A 1 91  ? 48.855 39.698  47.971 1.00 81.92  ? 136 ILE A HD11 1 
ATOM   1329 H HD12 . ILE A 1 91  ? 47.919 38.764  47.090 1.00 81.92  ? 136 ILE A HD12 1 
ATOM   1330 H HD13 . ILE A 1 91  ? 47.332 39.491  48.375 1.00 81.92  ? 136 ILE A HD13 1 
ATOM   1331 N N    . ILE A 1 92  ? 46.497 34.170  50.820 1.00 48.88  ? 137 ILE A N    1 
ATOM   1332 C CA   . ILE A 1 92  ? 45.355 33.319  51.116 1.00 47.26  ? 137 ILE A CA   1 
ATOM   1333 C C    . ILE A 1 92  ? 44.422 34.138  51.989 1.00 45.28  ? 137 ILE A C    1 
ATOM   1334 O O    . ILE A 1 92  ? 44.778 34.505  53.117 1.00 42.60  ? 137 ILE A O    1 
ATOM   1335 C CB   . ILE A 1 92  ? 45.748 32.012  51.816 1.00 46.65  ? 137 ILE A CB   1 
ATOM   1336 C CG1  . ILE A 1 92  ? 46.830 31.276  51.030 1.00 46.57  ? 137 ILE A CG1  1 
ATOM   1337 C CG2  . ILE A 1 92  ? 44.522 31.122  51.968 1.00 46.87  ? 137 ILE A CG2  1 
ATOM   1338 C CD1  . ILE A 1 92  ? 47.400 30.081  51.766 1.00 46.13  ? 137 ILE A CD1  1 
ATOM   1339 H H    . ILE A 1 92  ? 46.906 34.452  51.523 1.00 58.66  ? 137 ILE A H    1 
ATOM   1340 H HA   . ILE A 1 92  ? 44.893 33.099  50.292 1.00 56.71  ? 137 ILE A HA   1 
ATOM   1341 H HB   . ILE A 1 92  ? 46.092 32.222  52.699 1.00 55.98  ? 137 ILE A HB   1 
ATOM   1342 H HG12 . ILE A 1 92  ? 46.450 30.959  50.196 1.00 55.88  ? 137 ILE A HG12 1 
ATOM   1343 H HG13 . ILE A 1 92  ? 47.558 31.890  50.849 1.00 55.88  ? 137 ILE A HG13 1 
ATOM   1344 H HG21 . ILE A 1 92  ? 44.782 30.300  52.411 1.00 56.25  ? 137 ILE A HG21 1 
ATOM   1345 H HG22 . ILE A 1 92  ? 43.857 31.589  52.498 1.00 56.25  ? 137 ILE A HG22 1 
ATOM   1346 H HG23 . ILE A 1 92  ? 44.164 30.925  51.087 1.00 56.25  ? 137 ILE A HG23 1 
ATOM   1347 H HD11 . ILE A 1 92  ? 48.077 29.664  51.211 1.00 55.36  ? 137 ILE A HD11 1 
ATOM   1348 H HD12 . ILE A 1 92  ? 47.794 30.383  52.599 1.00 55.36  ? 137 ILE A HD12 1 
ATOM   1349 H HD13 . ILE A 1 92  ? 46.685 29.451  51.946 1.00 55.36  ? 137 ILE A HD13 1 
ATOM   1350 N N    . ARG A 1 93  ? 43.235 34.430  51.468 1.00 44.46  ? 138 ARG A N    1 
ATOM   1351 C CA   . ARG A 1 93  ? 42.219 35.160  52.211 1.00 44.83  ? 138 ARG A CA   1 
ATOM   1352 C C    . ARG A 1 93  ? 41.303 34.132  52.868 1.00 44.65  ? 138 ARG A C    1 
ATOM   1353 O O    . ARG A 1 93  ? 40.537 33.441  52.188 1.00 45.61  ? 138 ARG A O    1 
ATOM   1354 C CB   . ARG A 1 93  ? 41.461 36.109  51.288 1.00 46.49  ? 138 ARG A CB   1 
ATOM   1355 C CG   . ARG A 1 93  ? 42.358 37.172  50.679 1.00 45.97  ? 138 ARG A CG   1 
ATOM   1356 C CD   . ARG A 1 93  ? 41.633 38.014  49.644 1.00 47.91  ? 138 ARG A CD   1 
ATOM   1357 N NE   . ARG A 1 93  ? 40.514 38.754  50.212 1.00 48.32  ? 138 ARG A NE   1 
ATOM   1358 C CZ   . ARG A 1 93  ? 39.783 39.635  49.534 1.00 50.59  ? 138 ARG A CZ   1 
ATOM   1359 N NH1  . ARG A 1 93  ? 40.060 39.888  48.263 1.00 51.81  ? 138 ARG A NH1  1 
ATOM   1360 N NH2  . ARG A 1 93  ? 38.775 40.265  50.123 1.00 51.55  ? 138 ARG A NH2  1 
ATOM   1361 H H    . ARG A 1 93  ? 42.992 34.213  50.672 1.00 53.36  ? 138 ARG A H    1 
ATOM   1362 H HA   . ARG A 1 93  ? 42.643 35.684  52.909 1.00 53.80  ? 138 ARG A HA   1 
ATOM   1363 H HB2  . ARG A 1 93  ? 41.066 35.598  50.564 1.00 55.79  ? 138 ARG A HB2  1 
ATOM   1364 H HB3  . ARG A 1 93  ? 40.767 36.557  51.796 1.00 55.79  ? 138 ARG A HB3  1 
ATOM   1365 H HG2  . ARG A 1 93  ? 42.672 37.762  51.381 1.00 55.17  ? 138 ARG A HG2  1 
ATOM   1366 H HG3  . ARG A 1 93  ? 43.110 36.741  50.244 1.00 55.17  ? 138 ARG A HG3  1 
ATOM   1367 H HD2  . ARG A 1 93  ? 42.255 38.654  49.265 1.00 57.50  ? 138 ARG A HD2  1 
ATOM   1368 H HD3  . ARG A 1 93  ? 41.288 37.433  48.949 1.00 57.50  ? 138 ARG A HD3  1 
ATOM   1369 H HE   . ARG A 1 93  ? 40.270 38.562  51.015 1.00 57.99  ? 138 ARG A HE   1 
ATOM   1370 H HH11 . ARG A 1 93  ? 40.711 39.482  47.876 1.00 62.17  ? 138 ARG A HH11 1 
ATOM   1371 H HH12 . ARG A 1 93  ? 39.587 40.458  47.826 1.00 62.17  ? 138 ARG A HH12 1 
ATOM   1372 H HH21 . ARG A 1 93  ? 38.591 40.106  50.948 1.00 61.86  ? 138 ARG A HH21 1 
ATOM   1373 H HH22 . ARG A 1 93  ? 38.307 40.835  49.680 1.00 61.86  ? 138 ARG A HH22 1 
ATOM   1374 N N    . LEU A 1 94  ? 41.407 34.026  54.187 1.00 45.50  ? 139 LEU A N    1 
ATOM   1375 C CA   . LEU A 1 94  ? 40.756 32.988  54.965 1.00 45.60  ? 139 LEU A CA   1 
ATOM   1376 C C    . LEU A 1 94  ? 39.503 33.515  55.646 1.00 47.21  ? 139 LEU A C    1 
ATOM   1377 O O    . LEU A 1 94  ? 39.414 34.691  56.008 1.00 47.51  ? 139 LEU A O    1 
ATOM   1378 C CB   . LEU A 1 94  ? 41.715 32.447  56.027 1.00 44.01  ? 139 LEU A CB   1 
ATOM   1379 C CG   . LEU A 1 94  ? 42.997 31.826  55.487 1.00 42.95  ? 139 LEU A CG   1 
ATOM   1380 C CD1  . LEU A 1 94  ? 44.018 31.626  56.608 1.00 41.08  ? 139 LEU A CD1  1 
ATOM   1381 C CD2  . LEU A 1 94  ? 42.673 30.507  54.802 1.00 43.31  ? 139 LEU A CD2  1 
ATOM   1382 H H    . LEU A 1 94  ? 41.868 34.568  54.670 1.00 54.61  ? 139 LEU A H    1 
ATOM   1383 H HA   . LEU A 1 94  ? 40.502 32.257  54.379 1.00 54.72  ? 139 LEU A HA   1 
ATOM   1384 H HB2  . LEU A 1 94  ? 41.968 33.177  56.614 1.00 52.81  ? 139 LEU A HB2  1 
ATOM   1385 H HB3  . LEU A 1 94  ? 41.253 31.765  56.540 1.00 52.81  ? 139 LEU A HB3  1 
ATOM   1386 H HG   . LEU A 1 94  ? 43.386 32.421  54.827 1.00 51.54  ? 139 LEU A HG   1 
ATOM   1387 H HD11 . LEU A 1 94  ? 44.822 31.231  56.236 1.00 49.30  ? 139 LEU A HD11 1 
ATOM   1388 H HD12 . LEU A 1 94  ? 44.225 32.488  57.003 1.00 49.30  ? 139 LEU A HD12 1 
ATOM   1389 H HD13 . LEU A 1 94  ? 43.639 31.037  57.278 1.00 49.30  ? 139 LEU A HD13 1 
ATOM   1390 H HD21 . LEU A 1 94  ? 43.494 30.119  54.462 1.00 51.97  ? 139 LEU A HD21 1 
ATOM   1391 H HD22 . LEU A 1 94  ? 42.267 29.908  55.448 1.00 51.97  ? 139 LEU A HD22 1 
ATOM   1392 H HD23 . LEU A 1 94  ? 42.058 30.674  54.071 1.00 51.97  ? 139 LEU A HD23 1 
ATOM   1393 N N    . ARG A 1 95  ? 38.538 32.621  55.829 1.00 47.61  ? 140 ARG A N    1 
ATOM   1394 C CA   . ARG A 1 95  ? 37.427 32.896  56.726 1.00 49.39  ? 140 ARG A CA   1 
ATOM   1395 C C    . ARG A 1 95  ? 37.934 32.962  58.161 1.00 46.22  ? 140 ARG A C    1 
ATOM   1396 O O    . ARG A 1 95  ? 38.928 32.323  58.521 1.00 42.25  ? 140 ARG A O    1 
ATOM   1397 C CB   . ARG A 1 95  ? 36.353 31.816  56.605 1.00 52.97  ? 140 ARG A CB   1 
ATOM   1398 C CG   . ARG A 1 95  ? 36.839 30.411  56.964 1.00 55.02  ? 140 ARG A CG   1 
ATOM   1399 C CD   . ARG A 1 95  ? 35.734 29.368  56.798 1.00 60.77  ? 140 ARG A CD   1 
ATOM   1400 N NE   . ARG A 1 95  ? 34.700 29.491  57.825 1.00 65.74  ? 140 ARG A NE   1 
ATOM   1401 C CZ   . ARG A 1 95  ? 33.542 28.835  57.810 1.00 72.09  ? 140 ARG A CZ   1 
ATOM   1402 N NH1  . ARG A 1 95  ? 33.248 28.008  56.812 1.00 74.20  ? 140 ARG A NH1  1 
ATOM   1403 N NH2  . ARG A 1 95  ? 32.671 29.011  58.797 1.00 75.36  ? 140 ARG A NH2  1 
ATOM   1404 H H    . ARG A 1 95  ? 38.505 31.851  55.447 1.00 57.13  ? 140 ARG A H    1 
ATOM   1405 H HA   . ARG A 1 95  ? 37.031 33.752  56.499 1.00 59.27  ? 140 ARG A HA   1 
ATOM   1406 H HB2  . ARG A 1 95  ? 35.620 32.037  57.201 1.00 63.57  ? 140 ARG A HB2  1 
ATOM   1407 H HB3  . ARG A 1 95  ? 36.036 31.793  55.688 1.00 63.57  ? 140 ARG A HB3  1 
ATOM   1408 H HG2  . ARG A 1 95  ? 37.575 30.169  56.380 1.00 66.02  ? 140 ARG A HG2  1 
ATOM   1409 H HG3  . ARG A 1 95  ? 37.129 30.401  57.890 1.00 66.02  ? 140 ARG A HG3  1 
ATOM   1410 H HD2  . ARG A 1 95  ? 35.315 29.485  55.931 1.00 72.92  ? 140 ARG A HD2  1 
ATOM   1411 H HD3  . ARG A 1 95  ? 36.122 28.481  56.864 1.00 72.92  ? 140 ARG A HD3  1 
ATOM   1412 H HE   . ARG A 1 95  ? 34.850 30.023  58.484 1.00 78.89  ? 140 ARG A HE   1 
ATOM   1413 H HH11 . ARG A 1 95  ? 33.811 27.890  56.172 1.00 89.04  ? 140 ARG A HH11 1 
ATOM   1414 H HH12 . ARG A 1 95  ? 32.498 27.588  56.807 1.00 89.04  ? 140 ARG A HH12 1 
ATOM   1415 H HH21 . ARG A 1 95  ? 32.856 29.547  59.443 1.00 90.44  ? 140 ARG A HH21 1 
ATOM   1416 H HH22 . ARG A 1 95  ? 31.920 28.592  58.787 1.00 90.44  ? 140 ARG A HH22 1 
ATOM   1417 N N    . LYS A 1 96  ? 37.236 33.741  58.982 1.00 43.19  ? 141 LYS A N    1 
ATOM   1418 C CA   . LYS A 1 96  ? 37.632 33.907  60.372 1.00 41.27  ? 141 LYS A CA   1 
ATOM   1419 C C    . LYS A 1 96  ? 37.719 32.555  61.071 1.00 39.67  ? 141 LYS A C    1 
ATOM   1420 O O    . LYS A 1 96  ? 36.961 31.630  60.779 1.00 40.90  ? 141 LYS A O    1 
ATOM   1421 C CB   . LYS A 1 96  ? 36.637 34.811  61.101 1.00 46.08  ? 141 LYS A CB   1 
ATOM   1422 C CG   . LYS A 1 96  ? 36.831 36.306  60.845 1.00 46.89  ? 141 LYS A CG   1 
ATOM   1423 C CD   . LYS A 1 96  ? 38.206 36.772  61.329 1.00 47.64  ? 141 LYS A CD   1 
ATOM   1424 C CE   . LYS A 1 96  ? 38.266 38.281  61.477 1.00 50.01  ? 141 LYS A CE   1 
ATOM   1425 N NZ   . LYS A 1 96  ? 39.501 38.699  62.191 1.00 49.38  ? 141 LYS A NZ   1 
ATOM   1426 H H    . LYS A 1 96  ? 36.533 34.182  58.758 1.00 51.83  ? 141 LYS A H    1 
ATOM   1427 H HA   . LYS A 1 96  ? 38.507 34.325  60.408 1.00 49.53  ? 141 LYS A HA   1 
ATOM   1428 H HB2  . LYS A 1 96  ? 35.740 34.578  60.816 1.00 55.30  ? 141 LYS A HB2  1 
ATOM   1429 H HB3  . LYS A 1 96  ? 36.725 34.663  62.056 1.00 55.30  ? 141 LYS A HB3  1 
ATOM   1430 H HG2  . LYS A 1 96  ? 36.767 36.480  59.893 1.00 56.27  ? 141 LYS A HG2  1 
ATOM   1431 H HG3  . LYS A 1 96  ? 36.153 36.805  61.326 1.00 56.27  ? 141 LYS A HG3  1 
ATOM   1432 H HD2  . LYS A 1 96  ? 38.393 36.375  62.193 1.00 57.17  ? 141 LYS A HD2  1 
ATOM   1433 H HD3  . LYS A 1 96  ? 38.879 36.504  60.684 1.00 57.17  ? 141 LYS A HD3  1 
ATOM   1434 H HE2  . LYS A 1 96  ? 38.267 38.691  60.598 1.00 60.01  ? 141 LYS A HE2  1 
ATOM   1435 H HE3  . LYS A 1 96  ? 37.500 38.584  61.990 1.00 60.01  ? 141 LYS A HE3  1 
ATOM   1436 H HZ1  . LYS A 1 96  ? 39.522 39.585  62.270 1.00 59.25  ? 141 LYS A HZ1  1 
ATOM   1437 H HZ2  . LYS A 1 96  ? 39.521 38.335  63.003 1.00 59.25  ? 141 LYS A HZ2  1 
ATOM   1438 H HZ3  . LYS A 1 96  ? 40.219 38.433  61.737 1.00 59.25  ? 141 LYS A HZ3  1 
ATOM   1439 N N    . GLY A 1 97  ? 38.670 32.446  61.996 1.00 41.89  ? 142 GLY A N    1 
ATOM   1440 C CA   . GLY A 1 97  ? 38.808 31.269  62.829 1.00 41.26  ? 142 GLY A CA   1 
ATOM   1441 C C    . GLY A 1 97  ? 39.883 30.299  62.397 1.00 40.17  ? 142 GLY A C    1 
ATOM   1442 O O    . GLY A 1 97  ? 40.132 29.324  63.114 1.00 40.61  ? 142 GLY A O    1 
ATOM   1443 H H    . GLY A 1 97  ? 39.256 33.055  62.159 1.00 50.26  ? 142 GLY A H    1 
ATOM   1444 H HA2  . GLY A 1 97  ? 39.005 31.548  63.736 1.00 49.51  ? 142 GLY A HA2  1 
ATOM   1445 H HA3  . GLY A 1 97  ? 37.963 30.792  62.839 1.00 49.51  ? 142 GLY A HA3  1 
ATOM   1446 N N    . LEU A 1 98  ? 40.535 30.540  61.258 1.00 41.83  ? 143 LEU A N    1 
ATOM   1447 C CA   . LEU A 1 98  ? 41.542 29.638  60.725 1.00 41.69  ? 143 LEU A CA   1 
ATOM   1448 C C    . LEU A 1 98  ? 42.955 30.197  60.758 1.00 41.73  ? 143 LEU A C    1 
ATOM   1449 O O    . LEU A 1 98  ? 43.909 29.421  60.648 1.00 42.13  ? 143 LEU A O    1 
ATOM   1450 C CB   . LEU A 1 98  ? 41.209 29.277  59.269 1.00 41.39  ? 143 LEU A CB   1 
ATOM   1451 C CG   . LEU A 1 98  ? 39.812 28.730  59.000 1.00 42.18  ? 143 LEU A CG   1 
ATOM   1452 C CD1  . LEU A 1 98  ? 39.642 28.486  57.517 1.00 42.88  ? 143 LEU A CD1  1 
ATOM   1453 C CD2  . LEU A 1 98  ? 39.558 27.461  59.785 1.00 43.31  ? 143 LEU A CD2  1 
ATOM   1454 H H    . LEU A 1 98  ? 40.404 31.235  60.770 1.00 50.20  ? 143 LEU A H    1 
ATOM   1455 H HA   . LEU A 1 98  ? 41.535 28.818  61.244 1.00 50.03  ? 143 LEU A HA   1 
ATOM   1456 H HB2  . LEU A 1 98  ? 41.312 30.076  58.729 1.00 49.66  ? 143 LEU A HB2  1 
ATOM   1457 H HB3  . LEU A 1 98  ? 41.842 28.605  58.972 1.00 49.66  ? 143 LEU A HB3  1 
ATOM   1458 H HG   . LEU A 1 98  ? 39.155 29.390  59.274 1.00 50.61  ? 143 LEU A HG   1 
ATOM   1459 H HD11 . LEU A 1 98  ? 38.751 28.138  57.356 1.00 51.46  ? 143 LEU A HD11 1 
ATOM   1460 H HD12 . LEU A 1 98  ? 39.761 29.324  57.044 1.00 51.46  ? 143 LEU A HD12 1 
ATOM   1461 H HD13 . LEU A 1 98  ? 40.306 27.842  57.225 1.00 51.46  ? 143 LEU A HD13 1 
ATOM   1462 H HD21 . LEU A 1 98  ? 38.662 27.143  59.589 1.00 51.97  ? 143 LEU A HD21 1 
ATOM   1463 H HD22 . LEU A 1 98  ? 40.211 26.793  59.524 1.00 51.97  ? 143 LEU A HD22 1 
ATOM   1464 H HD23 . LEU A 1 98  ? 39.641 27.653  60.732 1.00 51.97  ? 143 LEU A HD23 1 
ATOM   1465 N N    . ALA A 1 99  ? 43.116 31.513  60.912 1.00 40.11  ? 144 ALA A N    1 
ATOM   1466 C CA   . ALA A 1 99  ? 44.419 32.132  60.684 1.00 37.58  ? 144 ALA A CA   1 
ATOM   1467 C C    . ALA A 1 99  ? 45.446 31.704  61.723 1.00 35.05  ? 144 ALA A C    1 
ATOM   1468 O O    . ALA A 1 99  ? 46.628 31.554  61.404 1.00 33.61  ? 144 ALA A O    1 
ATOM   1469 C CB   . ALA A 1 99  ? 44.278 33.654  60.677 1.00 38.80  ? 144 ALA A CB   1 
ATOM   1470 H H    . ALA A 1 99  ? 42.495 32.061  61.145 1.00 48.13  ? 144 ALA A H    1 
ATOM   1471 H HA   . ALA A 1 99  ? 44.746 31.859  59.813 1.00 45.09  ? 144 ALA A HA   1 
ATOM   1472 H HB1  . ALA A 1 99  ? 45.150 34.051  60.525 1.00 46.56  ? 144 ALA A HB1  1 
ATOM   1473 H HB2  . ALA A 1 99  ? 43.668 33.911  59.967 1.00 46.56  ? 144 ALA A HB2  1 
ATOM   1474 H HB3  . ALA A 1 99  ? 43.928 33.942  61.535 1.00 46.56  ? 144 ALA A HB3  1 
ATOM   1475 N N    . SER A 1 100 ? 45.038 31.540  62.978 1.00 34.46  ? 145 SER A N    1 
ATOM   1476 C CA   . SER A 1 100 ? 46.020 31.232  64.010 1.00 34.22  ? 145 SER A CA   1 
ATOM   1477 C C    . SER A 1 100 ? 46.754 29.935  63.705 1.00 32.96  ? 145 SER A C    1 
ATOM   1478 O O    . SER A 1 100 ? 47.980 29.864  63.834 1.00 32.08  ? 145 SER A O    1 
ATOM   1479 C CB   . SER A 1 100 ? 45.348 31.157  65.374 1.00 33.64  ? 145 SER A CB   1 
ATOM   1480 O OG   . SER A 1 100 ? 44.944 32.450  65.793 1.00 33.76  ? 145 SER A OG   1 
ATOM   1481 H H    . SER A 1 100 ? 44.225 31.599  63.251 1.00 41.35  ? 145 SER A H    1 
ATOM   1482 H HA   . SER A 1 100 ? 46.677 31.945  64.040 1.00 41.06  ? 145 SER A HA   1 
ATOM   1483 H HB2  . SER A 1 100 ? 44.567 30.585  65.312 1.00 40.37  ? 145 SER A HB2  1 
ATOM   1484 H HB3  . SER A 1 100 ? 45.976 30.796  66.018 1.00 40.37  ? 145 SER A HB3  1 
ATOM   1485 H HG   . SER A 1 100 ? 44.401 32.775  65.241 1.00 40.51  ? 145 SER A HG   1 
ATOM   1486 N N    . ARG A 1 101 ? 46.023 28.897  63.298 1.00 36.09  ? 146 ARG A N    1 
ATOM   1487 C CA   . ARG A 1 101 ? 46.659 27.621  62.987 1.00 37.19  ? 146 ARG A CA   1 
ATOM   1488 C C    . ARG A 1 101 ? 47.469 27.704  61.703 1.00 37.75  ? 146 ARG A C    1 
ATOM   1489 O O    . ARG A 1 101 ? 48.534 27.081  61.595 1.00 36.47  ? 146 ARG A O    1 
ATOM   1490 C CB   . ARG A 1 101 ? 45.604 26.514  62.882 1.00 38.28  ? 146 ARG A CB   1 
ATOM   1491 C CG   . ARG A 1 101 ? 45.093 26.016  64.219 1.00 39.33  ? 146 ARG A CG   1 
ATOM   1492 C CD   . ARG A 1 101 ? 44.267 24.749  64.038 1.00 41.74  ? 146 ARG A CD   1 
ATOM   1493 N NE   . ARG A 1 101 ? 43.627 24.321  65.282 1.00 43.05  ? 146 ARG A NE   1 
ATOM   1494 C CZ   . ARG A 1 101 ? 44.193 23.538  66.197 1.00 43.47  ? 146 ARG A CZ   1 
ATOM   1495 N NH1  . ARG A 1 101 ? 43.518 23.223  67.297 1.00 45.41  ? 146 ARG A NH1  1 
ATOM   1496 N NH2  . ARG A 1 101 ? 45.427 23.074  66.024 1.00 42.49  ? 146 ARG A NH2  1 
ATOM   1497 H H    . ARG A 1 101 ? 45.169 28.906  63.196 1.00 43.30  ? 146 ARG A H    1 
ATOM   1498 H HA   . ARG A 1 101 ? 47.265 27.389  63.708 1.00 44.63  ? 146 ARG A HA   1 
ATOM   1499 H HB2  . ARG A 1 101 ? 44.845 26.854  62.383 1.00 45.94  ? 146 ARG A HB2  1 
ATOM   1500 H HB3  . ARG A 1 101 ? 45.992 25.758  62.414 1.00 45.94  ? 146 ARG A HB3  1 
ATOM   1501 H HG2  . ARG A 1 101 ? 45.845 25.813  64.797 1.00 47.20  ? 146 ARG A HG2  1 
ATOM   1502 H HG3  . ARG A 1 101 ? 44.529 26.695  64.622 1.00 47.20  ? 146 ARG A HG3  1 
ATOM   1503 H HD2  . ARG A 1 101 ? 43.571 24.914  63.383 1.00 50.09  ? 146 ARG A HD2  1 
ATOM   1504 H HD3  . ARG A 1 101 ? 44.847 24.033  63.735 1.00 50.09  ? 146 ARG A HD3  1 
ATOM   1505 H HE   . ARG A 1 101 ? 42.826 24.595  65.432 1.00 51.66  ? 146 ARG A HE   1 
ATOM   1506 H HH11 . ARG A 1 101 ? 42.719 23.521  67.411 1.00 54.49  ? 146 ARG A HH11 1 
ATOM   1507 H HH12 . ARG A 1 101 ? 43.877 22.715  67.890 1.00 54.49  ? 146 ARG A HH12 1 
ATOM   1508 H HH21 . ARG A 1 101 ? 45.868 23.279  65.315 1.00 50.98  ? 146 ARG A HH21 1 
ATOM   1509 H HH22 . ARG A 1 101 ? 45.783 22.568  66.622 1.00 50.98  ? 146 ARG A HH22 1 
ATOM   1510 N N    . CYS A 1 102 ? 46.973 28.444  60.708 1.00 38.54  ? 147 CYS A N    1 
ATOM   1511 C CA   . CYS A 1 102 ? 47.711 28.572  59.457 1.00 40.95  ? 147 CYS A CA   1 
ATOM   1512 C C    . CYS A 1 102 ? 49.000 29.361  59.664 1.00 38.86  ? 147 CYS A C    1 
ATOM   1513 O O    . CYS A 1 102 ? 50.039 29.032  59.077 1.00 35.79  ? 147 CYS A O    1 
ATOM   1514 C CB   . CYS A 1 102 ? 46.839 29.240  58.398 1.00 42.30  ? 147 CYS A CB   1 
ATOM   1515 S SG   . CYS A 1 102 ? 45.392 28.271  57.899 1.00 46.90  ? 147 CYS A SG   1 
ATOM   1516 H H    . CYS A 1 102 ? 46.227 28.872  60.733 1.00 46.25  ? 147 CYS A H    1 
ATOM   1517 H HA   . CYS A 1 102 ? 47.949 27.688  59.137 1.00 49.15  ? 147 CYS A HA   1 
ATOM   1518 H HB2  . CYS A 1 102 ? 46.520 30.087  58.748 1.00 50.75  ? 147 CYS A HB2  1 
ATOM   1519 H HB3  . CYS A 1 102 ? 47.377 29.395  57.606 1.00 50.75  ? 147 CYS A HB3  1 
ATOM   1520 H HG   . CYS A 1 102 ? 44.699 28.080  58.860 1.00 56.28  ? 147 CYS A HG   1 
ATOM   1521 N N    . TRP A 1 103 ? 48.948 30.408  60.492 1.00 33.81  ? 148 TRP A N    1 
ATOM   1522 C CA   . TRP A 1 103 ? 50.154 31.157  60.834 1.00 33.76  ? 148 TRP A CA   1 
ATOM   1523 C C    . TRP A 1 103 ? 51.204 30.236  61.441 1.00 35.32  ? 148 TRP A C    1 
ATOM   1524 O O    . TRP A 1 103 ? 52.357 30.211  61.002 1.00 34.45  ? 148 TRP A O    1 
ATOM   1525 C CB   . TRP A 1 103 ? 49.796 32.279  61.801 1.00 33.21  ? 148 TRP A CB   1 
ATOM   1526 C CG   . TRP A 1 103 ? 50.931 33.178  62.231 1.00 33.08  ? 148 TRP A CG   1 
ATOM   1527 C CD1  . TRP A 1 103 ? 51.312 33.447  63.513 1.00 32.05  ? 148 TRP A CD1  1 
ATOM   1528 C CD2  . TRP A 1 103 ? 51.790 33.957  61.388 1.00 32.79  ? 148 TRP A CD2  1 
ATOM   1529 N NE1  . TRP A 1 103 ? 52.350 34.336  63.522 1.00 33.04  ? 148 TRP A NE1  1 
ATOM   1530 C CE2  . TRP A 1 103 ? 52.666 34.665  62.230 1.00 33.27  ? 148 TRP A CE2  1 
ATOM   1531 C CE3  . TRP A 1 103 ? 51.898 34.125  60.007 1.00 31.58  ? 148 TRP A CE3  1 
ATOM   1532 C CZ2  . TRP A 1 103 ? 53.650 35.523  61.740 1.00 34.37  ? 148 TRP A CZ2  1 
ATOM   1533 C CZ3  . TRP A 1 103 ? 52.873 34.972  59.516 1.00 35.00  ? 148 TRP A CZ3  1 
ATOM   1534 C CH2  . TRP A 1 103 ? 53.736 35.668  60.383 1.00 34.17  ? 148 TRP A CH2  1 
ATOM   1535 H H    . TRP A 1 103 ? 48.231 30.700  60.867 1.00 40.57  ? 148 TRP A H    1 
ATOM   1536 H HA   . TRP A 1 103 ? 50.525 31.553  60.030 1.00 40.51  ? 148 TRP A HA   1 
ATOM   1537 H HB2  . TRP A 1 103 ? 49.127 32.841  61.380 1.00 39.85  ? 148 TRP A HB2  1 
ATOM   1538 H HB3  . TRP A 1 103 ? 49.423 31.881  62.603 1.00 39.85  ? 148 TRP A HB3  1 
ATOM   1539 H HD1  . TRP A 1 103 ? 50.917 33.085  64.273 1.00 38.46  ? 148 TRP A HD1  1 
ATOM   1540 H HE1  . TRP A 1 103 ? 52.747 34.634  64.224 1.00 39.65  ? 148 TRP A HE1  1 
ATOM   1541 H HE3  . TRP A 1 103 ? 51.328 33.673  59.428 1.00 37.89  ? 148 TRP A HE3  1 
ATOM   1542 H HZ2  . TRP A 1 103 ? 54.224 35.978  62.313 1.00 41.24  ? 148 TRP A HZ2  1 
ATOM   1543 H HZ3  . TRP A 1 103 ? 52.955 35.091  58.598 1.00 42.00  ? 148 TRP A HZ3  1 
ATOM   1544 H HH2  . TRP A 1 103 ? 54.386 36.229  60.026 1.00 41.01  ? 148 TRP A HH2  1 
ATOM   1545 N N    . GLU A 1 104 ? 50.811 29.450  62.442 1.00 38.92  ? 149 GLU A N    1 
ATOM   1546 C CA   . GLU A 1 104 ? 51.764 28.578  63.113 1.00 41.00  ? 149 GLU A CA   1 
ATOM   1547 C C    . GLU A 1 104 ? 52.354 27.567  62.140 1.00 41.58  ? 149 GLU A C    1 
ATOM   1548 O O    . GLU A 1 104 ? 53.578 27.440  62.028 1.00 41.53  ? 149 GLU A O    1 
ATOM   1549 C CB   . GLU A 1 104 ? 51.087 27.868  64.282 1.00 42.30  ? 149 GLU A CB   1 
ATOM   1550 C CG   . GLU A 1 104 ? 52.064 27.115  65.177 1.00 43.52  ? 149 GLU A CG   1 
ATOM   1551 C CD   . GLU A 1 104 ? 51.384 26.431  66.347 1.00 44.65  ? 149 GLU A CD   1 
ATOM   1552 O OE1  . GLU A 1 104 ? 51.179 25.198  66.267 1.00 44.87  ? 149 GLU A OE1  1 
ATOM   1553 O OE2  . GLU A 1 104 ? 51.053 27.126  67.338 1.00 44.45  ? 149 GLU A OE2  1 
ATOM   1554 H H    . GLU A 1 104 ? 50.008 29.406  62.747 1.00 46.70  ? 149 GLU A H    1 
ATOM   1555 H HA   . GLU A 1 104 ? 52.490 29.114  63.467 1.00 49.20  ? 149 GLU A HA   1 
ATOM   1556 H HB2  . GLU A 1 104 ? 50.629 28.527  64.827 1.00 50.75  ? 149 GLU A HB2  1 
ATOM   1557 H HB3  . GLU A 1 104 ? 50.448 27.227  63.932 1.00 50.75  ? 149 GLU A HB3  1 
ATOM   1558 H HG2  . GLU A 1 104 ? 52.514 26.435  64.652 1.00 52.23  ? 149 GLU A HG2  1 
ATOM   1559 H HG3  . GLU A 1 104 ? 52.713 27.742  65.533 1.00 52.23  ? 149 GLU A HG3  1 
ATOM   1560 N N    . ASN A 1 105 ? 51.494 26.841  61.422 1.00 38.33  ? 150 ASN A N    1 
ATOM   1561 C CA   . ASN A 1 105 ? 51.979 25.859  60.460 1.00 37.81  ? 150 ASN A CA   1 
ATOM   1562 C C    . ASN A 1 105 ? 52.879 26.501  59.419 1.00 37.74  ? 150 ASN A C    1 
ATOM   1563 O O    . ASN A 1 105 ? 53.880 25.907  59.000 1.00 37.48  ? 150 ASN A O    1 
ATOM   1564 C CB   . ASN A 1 105 ? 50.802 25.169  59.781 1.00 36.65  ? 150 ASN A CB   1 
ATOM   1565 C CG   . ASN A 1 105 ? 50.102 24.209  60.697 1.00 36.41  ? 150 ASN A CG   1 
ATOM   1566 O OD1  . ASN A 1 105 ? 50.703 23.698  61.644 1.00 35.52  ? 150 ASN A OD1  1 
ATOM   1567 N ND2  . ASN A 1 105 ? 48.818 23.959  60.435 1.00 36.55  ? 150 ASN A ND2  1 
ATOM   1568 H H    . ASN A 1 105 ? 50.637 26.900  61.473 1.00 45.99  ? 150 ASN A H    1 
ATOM   1569 H HA   . ASN A 1 105 ? 52.495 25.184  60.929 1.00 45.37  ? 150 ASN A HA   1 
ATOM   1570 H HB2  . ASN A 1 105 ? 50.160 25.839  59.499 1.00 43.98  ? 150 ASN A HB2  1 
ATOM   1571 H HB3  . ASN A 1 105 ? 51.125 24.672  59.013 1.00 43.98  ? 150 ASN A HB3  1 
ATOM   1572 H HD21 . ASN A 1 105 ? 48.376 23.415  60.932 1.00 43.86  ? 150 ASN A HD21 1 
ATOM   1573 H HD22 . ASN A 1 105 ? 48.434 24.341  59.767 1.00 43.86  ? 150 ASN A HD22 1 
ATOM   1574 N N    . LEU A 1 106 ? 52.526 27.705  58.973 1.00 34.99  ? 151 LEU A N    1 
ATOM   1575 C CA   . LEU A 1 106 ? 53.327 28.385  57.968 1.00 36.52  ? 151 LEU A CA   1 
ATOM   1576 C C    . LEU A 1 106 ? 54.708 28.717  58.511 1.00 37.03  ? 151 LEU A C    1 
ATOM   1577 O O    . LEU A 1 106 ? 55.726 28.378  57.896 1.00 37.15  ? 151 LEU A O    1 
ATOM   1578 C CB   . LEU A 1 106 ? 52.623 29.655  57.501 1.00 36.73  ? 151 LEU A CB   1 
ATOM   1579 C CG   . LEU A 1 106 ? 53.457 30.563  56.587 1.00 39.38  ? 151 LEU A CG   1 
ATOM   1580 C CD1  . LEU A 1 106 ? 54.009 29.784  55.405 1.00 39.46  ? 151 LEU A CD1  1 
ATOM   1581 C CD2  . LEU A 1 106 ? 52.630 31.759  56.103 1.00 38.90  ? 151 LEU A CD2  1 
ATOM   1582 H H    . LEU A 1 106 ? 51.833 28.143  59.235 1.00 41.99  ? 151 LEU A H    1 
ATOM   1583 H HA   . LEU A 1 106 ? 53.437 27.801  57.201 1.00 43.82  ? 151 LEU A HA   1 
ATOM   1584 H HB2  . LEU A 1 106 ? 51.825 29.402  57.011 1.00 44.08  ? 151 LEU A HB2  1 
ATOM   1585 H HB3  . LEU A 1 106 ? 52.375 30.175  58.281 1.00 44.08  ? 151 LEU A HB3  1 
ATOM   1586 H HG   . LEU A 1 106 ? 54.210 30.908  57.092 1.00 47.25  ? 151 LEU A HG   1 
ATOM   1587 H HD11 . LEU A 1 106 ? 54.530 30.384  54.848 1.00 47.35  ? 151 LEU A HD11 1 
ATOM   1588 H HD12 . LEU A 1 106 ? 54.571 29.067  55.736 1.00 47.35  ? 151 LEU A HD12 1 
ATOM   1589 H HD13 . LEU A 1 106 ? 53.269 29.418  54.896 1.00 47.35  ? 151 LEU A HD13 1 
ATOM   1590 H HD21 . LEU A 1 106 ? 53.183 32.313  55.530 1.00 46.68  ? 151 LEU A HD21 1 
ATOM   1591 H HD22 . LEU A 1 106 ? 51.862 31.433  55.609 1.00 46.68  ? 151 LEU A HD22 1 
ATOM   1592 H HD23 . LEU A 1 106 ? 52.335 32.271  56.873 1.00 46.68  ? 151 LEU A HD23 1 
ATOM   1593 N N    . ILE A 1 107 ? 54.767 29.382  59.667 1.00 39.37  ? 152 ILE A N    1 
ATOM   1594 C CA   . ILE A 1 107 ? 56.068 29.822  60.161 1.00 40.50  ? 152 ILE A CA   1 
ATOM   1595 C C    . ILE A 1 107 ? 56.908 28.627  60.598 1.00 41.94  ? 152 ILE A C    1 
ATOM   1596 O O    . ILE A 1 107 ? 58.140 28.658  60.479 1.00 41.55  ? 152 ILE A O    1 
ATOM   1597 C CB   . ILE A 1 107 ? 55.914 30.858  61.293 1.00 41.43  ? 152 ILE A CB   1 
ATOM   1598 C CG1  . ILE A 1 107 ? 55.221 30.247  62.509 1.00 41.49  ? 152 ILE A CG1  1 
ATOM   1599 C CG2  . ILE A 1 107 ? 55.161 32.084  60.780 1.00 41.99  ? 152 ILE A CG2  1 
ATOM   1600 C CD1  . ILE A 1 107 ? 55.133 31.176  63.693 1.00 42.17  ? 152 ILE A CD1  1 
ATOM   1601 H H    . ILE A 1 107 ? 54.096 29.583  60.165 1.00 47.24  ? 152 ILE A H    1 
ATOM   1602 H HA   . ILE A 1 107 ? 56.540 30.257  59.434 1.00 48.60  ? 152 ILE A HA   1 
ATOM   1603 H HB   . ILE A 1 107 ? 56.801 31.141  61.564 1.00 49.72  ? 152 ILE A HB   1 
ATOM   1604 H HG12 . ILE A 1 107 ? 54.317 29.997  62.261 1.00 49.79  ? 152 ILE A HG12 1 
ATOM   1605 H HG13 . ILE A 1 107 ? 55.715 29.460  62.787 1.00 49.79  ? 152 ILE A HG13 1 
ATOM   1606 H HG21 . ILE A 1 107 ? 55.072 32.725  61.503 1.00 50.39  ? 152 ILE A HG21 1 
ATOM   1607 H HG22 . ILE A 1 107 ? 55.660 32.477  60.047 1.00 50.39  ? 152 ILE A HG22 1 
ATOM   1608 H HG23 . ILE A 1 107 ? 54.283 31.809  60.472 1.00 50.39  ? 152 ILE A HG23 1 
ATOM   1609 H HD11 . ILE A 1 107 ? 54.683 30.719  64.420 1.00 50.60  ? 152 ILE A HD11 1 
ATOM   1610 H HD12 . ILE A 1 107 ? 56.029 31.428  63.964 1.00 50.60  ? 152 ILE A HD12 1 
ATOM   1611 H HD13 . ILE A 1 107 ? 54.630 31.966  63.437 1.00 50.60  ? 152 ILE A HD13 1 
ATOM   1612 N N    . LEU A 1 108 ? 56.277 27.555  61.094 1.00 36.33  ? 153 LEU A N    1 
ATOM   1613 C CA   . LEU A 1 108 ? 57.038 26.343  61.388 1.00 37.29  ? 153 LEU A CA   1 
ATOM   1614 C C    . LEU A 1 108 ? 57.704 25.797  60.131 1.00 38.74  ? 153 LEU A C    1 
ATOM   1615 O O    . LEU A 1 108 ? 58.876 25.410  60.161 1.00 37.21  ? 153 LEU A O    1 
ATOM   1616 C CB   . LEU A 1 108 ? 56.142 25.269  62.011 1.00 34.31  ? 153 LEU A CB   1 
ATOM   1617 C CG   . LEU A 1 108 ? 55.700 25.472  63.460 1.00 33.16  ? 153 LEU A CG   1 
ATOM   1618 C CD1  . LEU A 1 108 ? 54.839 24.299  63.931 1.00 33.35  ? 153 LEU A CD1  1 
ATOM   1619 C CD2  . LEU A 1 108 ? 56.862 25.649  64.394 1.00 33.58  ? 153 LEU A CD2  1 
ATOM   1620 H H    . LEU A 1 108 ? 55.435 27.507  61.264 1.00 43.59  ? 153 LEU A H    1 
ATOM   1621 H HA   . LEU A 1 108 ? 57.736 26.557  62.027 1.00 44.75  ? 153 LEU A HA   1 
ATOM   1622 H HB2  . LEU A 1 108 ? 55.336 25.204  61.475 1.00 41.17  ? 153 LEU A HB2  1 
ATOM   1623 H HB3  . LEU A 1 108 ? 56.617 24.424  61.975 1.00 41.17  ? 153 LEU A HB3  1 
ATOM   1624 H HG   . LEU A 1 108 ? 55.157 26.275  63.510 1.00 39.79  ? 153 LEU A HG   1 
ATOM   1625 H HD11 . LEU A 1 108 ? 54.573 24.453  64.850 1.00 40.01  ? 153 LEU A HD11 1 
ATOM   1626 H HD12 . LEU A 1 108 ? 54.054 24.237  63.364 1.00 40.01  ? 153 LEU A HD12 1 
ATOM   1627 H HD13 . LEU A 1 108 ? 55.359 23.482  63.868 1.00 40.01  ? 153 LEU A HD13 1 
ATOM   1628 H HD21 . LEU A 1 108 ? 56.527 25.773  65.296 1.00 40.29  ? 153 LEU A HD21 1 
ATOM   1629 H HD22 . LEU A 1 108 ? 57.421 24.857  64.355 1.00 40.29  ? 153 LEU A HD22 1 
ATOM   1630 H HD23 . LEU A 1 108 ? 57.372 26.428  64.120 1.00 40.29  ? 153 LEU A HD23 1 
ATOM   1631 N N    . ALA A 1 109 ? 56.971 25.748  59.019 1.00 38.88  ? 154 ALA A N    1 
ATOM   1632 C CA   . ALA A 1 109 ? 57.542 25.224  57.785 1.00 39.60  ? 154 ALA A CA   1 
ATOM   1633 C C    . ALA A 1 109 ? 58.580 26.176  57.213 1.00 40.20  ? 154 ALA A C    1 
ATOM   1634 O O    . ALA A 1 109 ? 59.623 25.738  56.704 1.00 41.25  ? 154 ALA A O    1 
ATOM   1635 C CB   . ALA A 1 109 ? 56.437 24.963  56.770 1.00 41.13  ? 154 ALA A CB   1 
ATOM   1636 H H    . ALA A 1 109 ? 56.154 26.009  58.954 1.00 46.65  ? 154 ALA A H    1 
ATOM   1637 H HA   . ALA A 1 109 ? 57.981 24.380  57.974 1.00 47.52  ? 154 ALA A HA   1 
ATOM   1638 H HB1  . ALA A 1 109 ? 56.833 24.615  55.955 1.00 49.36  ? 154 ALA A HB1  1 
ATOM   1639 H HB2  . ALA A 1 109 ? 55.815 24.316  57.139 1.00 49.36  ? 154 ALA A HB2  1 
ATOM   1640 H HB3  . ALA A 1 109 ? 55.976 25.796  56.584 1.00 49.36  ? 154 ALA A HB3  1 
ATOM   1641 N N    . MET A 1 110 ? 58.318 27.485  57.293 1.00 38.73  ? 155 MET A N    1 
ATOM   1642 C CA   . MET A 1 110 ? 59.300 28.462  56.828 1.00 38.58  ? 155 MET A CA   1 
ATOM   1643 C C    . MET A 1 110 ? 60.580 28.384  57.655 1.00 40.01  ? 155 MET A C    1 
ATOM   1644 O O    . MET A 1 110 ? 61.680 28.245  57.107 1.00 41.12  ? 155 MET A O    1 
ATOM   1645 C CB   . MET A 1 110 ? 58.714 29.874  56.882 1.00 37.00  ? 155 MET A CB   1 
ATOM   1646 C CG   . MET A 1 110 ? 59.702 30.970  56.471 1.00 37.93  ? 155 MET A CG   1 
ATOM   1647 S SD   . MET A 1 110 ? 58.984 32.620  56.488 1.00 35.94  ? 155 MET A SD   1 
ATOM   1648 C CE   . MET A 1 110 ? 58.833 32.891  58.248 1.00 36.51  ? 155 MET A CE   1 
ATOM   1649 H H    . MET A 1 110 ? 57.593 27.825  57.606 1.00 46.47  ? 155 MET A H    1 
ATOM   1650 H HA   . MET A 1 110 ? 59.516 28.268  55.903 1.00 46.30  ? 155 MET A HA   1 
ATOM   1651 H HB2  . MET A 1 110 ? 57.954 29.920  56.281 1.00 44.40  ? 155 MET A HB2  1 
ATOM   1652 H HB3  . MET A 1 110 ? 58.427 30.059  57.790 1.00 44.40  ? 155 MET A HB3  1 
ATOM   1653 H HG2  . MET A 1 110 ? 60.451 30.965  57.087 1.00 45.51  ? 155 MET A HG2  1 
ATOM   1654 H HG3  . MET A 1 110 ? 60.014 30.790  55.570 1.00 45.51  ? 155 MET A HG3  1 
ATOM   1655 H HE1  . MET A 1 110 ? 58.449 33.769  58.400 1.00 43.81  ? 155 MET A HE1  1 
ATOM   1656 H HE2  . MET A 1 110 ? 58.258 32.208  58.625 1.00 43.81  ? 155 MET A HE2  1 
ATOM   1657 H HE3  . MET A 1 110 ? 59.714 32.842  58.652 1.00 43.81  ? 155 MET A HE3  1 
ATOM   1658 N N    . LEU A 1 111 ? 60.458 28.482  58.980 1.00 39.50  ? 156 LEU A N    1 
ATOM   1659 C CA   . LEU A 1 111 ? 61.640 28.401  59.831 1.00 42.76  ? 156 LEU A CA   1 
ATOM   1660 C C    . LEU A 1 111 ? 62.332 27.051  59.683 1.00 43.26  ? 156 LEU A C    1 
ATOM   1661 O O    . LEU A 1 111 ? 63.564 26.970  59.735 1.00 44.14  ? 156 LEU A O    1 
ATOM   1662 C CB   . LEU A 1 111 ? 61.259 28.647  61.291 1.00 44.05  ? 156 LEU A CB   1 
ATOM   1663 C CG   . LEU A 1 111 ? 60.681 30.021  61.645 1.00 45.95  ? 156 LEU A CG   1 
ATOM   1664 C CD1  . LEU A 1 111 ? 60.315 30.055  63.113 1.00 46.62  ? 156 LEU A CD1  1 
ATOM   1665 C CD2  . LEU A 1 111 ? 61.651 31.138  61.323 1.00 48.41  ? 156 LEU A CD2  1 
ATOM   1666 H H    . LEU A 1 111 ? 59.716 28.594  59.401 1.00 47.40  ? 156 LEU A H    1 
ATOM   1667 H HA   . LEU A 1 111 ? 62.268 29.090  59.565 1.00 51.31  ? 156 LEU A HA   1 
ATOM   1668 H HB2  . LEU A 1 111 ? 60.596 27.986  61.544 1.00 52.86  ? 156 LEU A HB2  1 
ATOM   1669 H HB3  . LEU A 1 111 ? 62.054 28.524  61.833 1.00 52.86  ? 156 LEU A HB3  1 
ATOM   1670 H HG   . LEU A 1 111 ? 59.873 30.167  61.130 1.00 55.14  ? 156 LEU A HG   1 
ATOM   1671 H HD11 . LEU A 1 111 ? 59.950 30.929  63.327 1.00 55.95  ? 156 LEU A HD11 1 
ATOM   1672 H HD12 . LEU A 1 111 ? 59.653 29.368  63.289 1.00 55.95  ? 156 LEU A HD12 1 
ATOM   1673 H HD13 . LEU A 1 111 ? 61.111 29.891  63.641 1.00 55.95  ? 156 LEU A HD13 1 
ATOM   1674 H HD21 . LEU A 1 111 ? 61.245 31.986  61.563 1.00 58.10  ? 156 LEU A HD21 1 
ATOM   1675 H HD22 . LEU A 1 111 ? 62.466 31.004  61.832 1.00 58.10  ? 156 LEU A HD22 1 
ATOM   1676 H HD23 . LEU A 1 111 ? 61.847 31.121  60.374 1.00 58.10  ? 156 LEU A HD23 1 
ATOM   1677 N N    . GLY A 1 112 ? 61.556 25.980  59.499 1.00 35.28  ? 157 GLY A N    1 
ATOM   1678 C CA   . GLY A 1 112 ? 62.115 24.650  59.332 1.00 36.89  ? 157 GLY A CA   1 
ATOM   1679 C C    . GLY A 1 112 ? 62.807 24.411  58.003 1.00 36.54  ? 157 GLY A C    1 
ATOM   1680 O O    . GLY A 1 112 ? 63.429 23.356  57.837 1.00 37.47  ? 157 GLY A O    1 
ATOM   1681 H H    . GLY A 1 112 ? 60.697 26.005  59.467 1.00 42.34  ? 157 GLY A H    1 
ATOM   1682 H HA2  . GLY A 1 112 ? 62.760 24.488  60.038 1.00 44.26  ? 157 GLY A HA2  1 
ATOM   1683 H HA3  . GLY A 1 112 ? 61.403 23.996  59.420 1.00 44.26  ? 157 GLY A HA3  1 
ATOM   1684 N N    . GLU A 1 113 ? 62.720 25.358  57.064 1.00 41.45  ? 158 GLU A N    1 
ATOM   1685 C CA   . GLU A 1 113 ? 63.303 25.206  55.726 1.00 44.75  ? 158 GLU A CA   1 
ATOM   1686 C C    . GLU A 1 113 ? 62.653 24.060  54.951 1.00 46.39  ? 158 GLU A C    1 
ATOM   1687 O O    . GLU A 1 113 ? 63.316 23.333  54.208 1.00 49.54  ? 158 GLU A O    1 
ATOM   1688 C CB   . GLU A 1 113 ? 64.821 25.010  55.801 1.00 46.60  ? 158 GLU A CB   1 
ATOM   1689 C CG   . GLU A 1 113 ? 65.578 26.257  56.251 1.00 48.28  ? 158 GLU A CG   1 
ATOM   1690 C CD   . GLU A 1 113 ? 65.342 27.440  55.330 1.00 47.69  ? 158 GLU A CD   1 
ATOM   1691 O OE1  . GLU A 1 113 ? 65.374 27.253  54.092 1.00 48.53  ? 158 GLU A OE1  1 
ATOM   1692 O OE2  . GLU A 1 113 ? 65.097 28.550  55.851 1.00 47.09  ? 158 GLU A OE2  1 
ATOM   1693 H H    . GLU A 1 113 ? 62.321 26.111  57.180 1.00 49.74  ? 158 GLU A H    1 
ATOM   1694 H HA   . GLU A 1 113 ? 63.140 26.022  55.227 1.00 53.69  ? 158 GLU A HA   1 
ATOM   1695 H HB2  . GLU A 1 113 ? 65.015 24.300  56.434 1.00 55.92  ? 158 GLU A HB2  1 
ATOM   1696 H HB3  . GLU A 1 113 ? 65.149 24.765  54.921 1.00 55.92  ? 158 GLU A HB3  1 
ATOM   1697 H HG2  . GLU A 1 113 ? 65.281 26.504  57.141 1.00 57.94  ? 158 GLU A HG2  1 
ATOM   1698 H HG3  . GLU A 1 113 ? 66.529 26.065  56.258 1.00 57.94  ? 158 GLU A HG3  1 
ATOM   1699 N N    . GLN A 1 114 ? 61.340 23.907  55.099 1.00 42.67  ? 159 GLN A N    1 
ATOM   1700 C CA   . GLN A 1 114 ? 60.623 22.852  54.395 1.00 43.15  ? 159 GLN A CA   1 
ATOM   1701 C C    . GLN A 1 114 ? 60.084 23.300  53.040 1.00 43.12  ? 159 GLN A C    1 
ATOM   1702 O O    . GLN A 1 114 ? 59.506 22.483  52.321 1.00 43.11  ? 159 GLN A O    1 
ATOM   1703 C CB   . GLN A 1 114 ? 59.477 22.325  55.265 1.00 41.32  ? 159 GLN A CB   1 
ATOM   1704 C CG   . GLN A 1 114 ? 59.928 21.710  56.594 1.00 41.13  ? 159 GLN A CG   1 
ATOM   1705 C CD   . GLN A 1 114 ? 60.854 20.518  56.421 1.00 43.19  ? 159 GLN A CD   1 
ATOM   1706 O OE1  . GLN A 1 114 ? 60.454 19.461  55.930 1.00 44.24  ? 159 GLN A OE1  1 
ATOM   1707 N NE2  . GLN A 1 114 ? 62.101 20.680  56.841 1.00 44.41  ? 159 GLN A NE2  1 
ATOM   1708 H H    . GLN A 1 114 ? 60.844 24.400  55.599 1.00 51.20  ? 159 GLN A H    1 
ATOM   1709 H HA   . GLN A 1 114 ? 61.234 22.116  54.237 1.00 51.78  ? 159 GLN A HA   1 
ATOM   1710 H HB2  . GLN A 1 114 ? 58.877 23.059  55.468 1.00 49.59  ? 159 GLN A HB2  1 
ATOM   1711 H HB3  . GLN A 1 114 ? 59.000 21.640  54.770 1.00 49.59  ? 159 GLN A HB3  1 
ATOM   1712 H HG2  . GLN A 1 114 ? 60.401 22.383  57.107 1.00 49.36  ? 159 GLN A HG2  1 
ATOM   1713 H HG3  . GLN A 1 114 ? 59.145 21.411  57.083 1.00 49.36  ? 159 GLN A HG3  1 
ATOM   1714 H HE21 . GLN A 1 114 ? 62.344 21.428  57.188 1.00 53.29  ? 159 GLN A HE21 1 
ATOM   1715 H HE22 . GLN A 1 114 ? 62.667 20.037  56.766 1.00 53.29  ? 159 GLN A HE22 1 
ATOM   1716 N N    . PHE A 1 115 ? 60.269 24.569  52.668 1.00 43.29  ? 160 PHE A N    1 
ATOM   1717 C CA   . PHE A 1 115 ? 59.837 25.038  51.355 1.00 44.49  ? 160 PHE A CA   1 
ATOM   1718 C C    . PHE A 1 115 ? 60.821 24.666  50.252 1.00 49.16  ? 160 PHE A C    1 
ATOM   1719 O O    . PHE A 1 115 ? 60.420 24.547  49.089 1.00 49.92  ? 160 PHE A O    1 
ATOM   1720 C CB   . PHE A 1 115 ? 59.617 26.553  51.392 1.00 42.48  ? 160 PHE A CB   1 
ATOM   1721 C CG   . PHE A 1 115 ? 58.326 26.947  52.048 1.00 38.26  ? 160 PHE A CG   1 
ATOM   1722 C CD1  . PHE A 1 115 ? 58.250 27.091  53.421 1.00 36.25  ? 160 PHE A CD1  1 
ATOM   1723 C CD2  . PHE A 1 115 ? 57.183 27.148  51.294 1.00 37.96  ? 160 PHE A CD2  1 
ATOM   1724 C CE1  . PHE A 1 115 ? 57.060 27.446  54.034 1.00 34.16  ? 160 PHE A CE1  1 
ATOM   1725 C CE2  . PHE A 1 115 ? 55.985 27.491  51.901 1.00 35.69  ? 160 PHE A CE2  1 
ATOM   1726 C CZ   . PHE A 1 115 ? 55.923 27.641  53.270 1.00 33.55  ? 160 PHE A CZ   1 
ATOM   1727 H H    . PHE A 1 115 ? 60.640 25.172  53.156 1.00 51.94  ? 160 PHE A H    1 
ATOM   1728 H HA   . PHE A 1 115 ? 58.987 24.623  51.142 1.00 53.39  ? 160 PHE A HA   1 
ATOM   1729 H HB2  . PHE A 1 115 ? 60.341 26.964  51.889 1.00 50.97  ? 160 PHE A HB2  1 
ATOM   1730 H HB3  . PHE A 1 115 ? 59.605 26.891  50.483 1.00 50.97  ? 160 PHE A HB3  1 
ATOM   1731 H HD1  . PHE A 1 115 ? 59.011 26.958  53.939 1.00 43.50  ? 160 PHE A HD1  1 
ATOM   1732 H HD2  . PHE A 1 115 ? 57.217 27.045  50.371 1.00 45.55  ? 160 PHE A HD2  1 
ATOM   1733 H HE1  . PHE A 1 115 ? 57.022 27.543  54.959 1.00 41.00  ? 160 PHE A HE1  1 
ATOM   1734 H HE2  . PHE A 1 115 ? 55.224 27.628  51.383 1.00 42.83  ? 160 PHE A HE2  1 
ATOM   1735 H HZ   . PHE A 1 115 ? 55.122 27.880  53.677 1.00 40.26  ? 160 PHE A HZ   1 
ATOM   1736 N N    . MET A 1 116 ? 62.098 24.480  50.585 1.00 55.51  ? 161 MET A N    1 
ATOM   1737 C CA   . MET A 1 116 ? 63.067 23.903  49.652 1.00 60.80  ? 161 MET A CA   1 
ATOM   1738 C C    . MET A 1 116 ? 63.314 24.814  48.448 1.00 63.49  ? 161 MET A C    1 
ATOM   1739 O O    . MET A 1 116 ? 63.441 24.338  47.320 1.00 66.10  ? 161 MET A O    1 
ATOM   1740 C CB   . MET A 1 116 ? 62.606 22.523  49.173 1.00 63.85  ? 161 MET A CB   1 
ATOM   1741 C CG   . MET A 1 116 ? 62.267 21.512  50.271 1.00 64.13  ? 161 MET A CG   1 
ATOM   1742 S SD   . MET A 1 116 ? 63.681 20.745  51.089 1.00 66.48  ? 161 MET A SD   1 
ATOM   1743 C CE   . MET A 1 116 ? 64.613 20.084  49.714 1.00 70.78  ? 161 MET A CE   1 
ATOM   1744 H H    . MET A 1 116 ? 62.432 24.681  51.352 1.00 66.61  ? 161 MET A H    1 
ATOM   1745 H HA   . MET A 1 116 ? 63.908 23.781  50.121 1.00 72.96  ? 161 MET A HA   1 
ATOM   1746 H HB2  . MET A 1 116 ? 61.810 22.638  48.630 1.00 76.61  ? 161 MET A HB2  1 
ATOM   1747 H HB3  . MET A 1 116 ? 63.311 22.136  48.631 1.00 76.61  ? 161 MET A HB3  1 
ATOM   1748 H HG2  . MET A 1 116 ? 61.747 21.964  50.954 1.00 76.95  ? 161 MET A HG2  1 
ATOM   1749 H HG3  . MET A 1 116 ? 61.737 20.800  49.879 1.00 76.95  ? 161 MET A HG3  1 
ATOM   1750 H HE1  . MET A 1 116 ? 65.407 19.643  50.054 1.00 84.93  ? 161 MET A HE1  1 
ATOM   1751 H HE2  . MET A 1 116 ? 64.060 19.447  49.235 1.00 84.93  ? 161 MET A HE2  1 
ATOM   1752 H HE3  . MET A 1 116 ? 64.865 20.812  49.125 1.00 84.93  ? 161 MET A HE3  1 
ATOM   1753 N N    . VAL A 1 117 ? 63.388 26.125  48.673 1.00 63.87  ? 162 VAL A N    1 
ATOM   1754 C CA   . VAL A 1 117 ? 63.568 27.060  47.565 1.00 65.97  ? 162 VAL A CA   1 
ATOM   1755 C C    . VAL A 1 117 ? 64.787 27.940  47.803 1.00 66.12  ? 162 VAL A C    1 
ATOM   1756 O O    . VAL A 1 117 ? 64.776 29.134  47.484 1.00 67.19  ? 162 VAL A O    1 
ATOM   1757 C CB   . VAL A 1 117 ? 62.311 27.919  47.351 1.00 65.81  ? 162 VAL A CB   1 
ATOM   1758 C CG1  . VAL A 1 117 ? 61.166 27.057  46.859 1.00 65.50  ? 162 VAL A CG1  1 
ATOM   1759 C CG2  . VAL A 1 117 ? 61.928 28.647  48.631 1.00 63.20  ? 162 VAL A CG2  1 
ATOM   1760 H H    . VAL A 1 117 ? 63.336 26.495  49.448 1.00 76.64  ? 162 VAL A H    1 
ATOM   1761 H HA   . VAL A 1 117 ? 63.723 26.554  46.752 1.00 79.16  ? 162 VAL A HA   1 
ATOM   1762 H HB   . VAL A 1 117 ? 62.496 28.586  46.671 1.00 78.98  ? 162 VAL A HB   1 
ATOM   1763 H HG11 . VAL A 1 117 ? 60.383 27.615  46.729 1.00 78.60  ? 162 VAL A HG11 1 
ATOM   1764 H HG12 . VAL A 1 117 ? 61.421 26.644  46.019 1.00 78.60  ? 162 VAL A HG12 1 
ATOM   1765 H HG13 . VAL A 1 117 ? 60.979 26.373  47.521 1.00 78.60  ? 162 VAL A HG13 1 
ATOM   1766 H HG21 . VAL A 1 117 ? 61.134 29.180  48.466 1.00 75.84  ? 162 VAL A HG21 1 
ATOM   1767 H HG22 . VAL A 1 117 ? 61.749 27.993  49.325 1.00 75.84  ? 162 VAL A HG22 1 
ATOM   1768 H HG23 . VAL A 1 117 ? 62.662 29.222  48.899 1.00 75.84  ? 162 VAL A HG23 1 
ATOM   1769 N N    . GLY A 1 118 ? 65.847 27.357  48.352 1.00 60.82  ? 163 GLY A N    1 
ATOM   1770 C CA   . GLY A 1 118 ? 67.078 28.105  48.549 1.00 60.70  ? 163 GLY A CA   1 
ATOM   1771 C C    . GLY A 1 118 ? 66.877 29.244  49.526 1.00 58.07  ? 163 GLY A C    1 
ATOM   1772 O O    . GLY A 1 118 ? 66.379 29.055  50.642 1.00 53.72  ? 163 GLY A O    1 
ATOM   1773 H H    . GLY A 1 118 ? 65.878 26.539  48.615 1.00 72.98  ? 163 GLY A H    1 
ATOM   1774 H HA2  . GLY A 1 118 ? 67.767 27.516  48.896 1.00 72.85  ? 163 GLY A HA2  1 
ATOM   1775 H HA3  . GLY A 1 118 ? 67.378 28.470  47.702 1.00 72.85  ? 163 GLY A HA3  1 
ATOM   1776 N N    . GLU A 1 119 ? 67.274 30.447  49.106 1.00 64.16  ? 164 GLU A N    1 
ATOM   1777 C CA   . GLU A 1 119 ? 67.114 31.651  49.910 1.00 64.96  ? 164 GLU A CA   1 
ATOM   1778 C C    . GLU A 1 119 ? 65.974 32.536  49.416 1.00 62.20  ? 164 GLU A C    1 
ATOM   1779 O O    . GLU A 1 119 ? 65.865 33.688  49.844 1.00 61.37  ? 164 GLU A O    1 
ATOM   1780 C CB   . GLU A 1 119 ? 68.422 32.446  49.932 1.00 72.83  ? 164 GLU A CB   1 
ATOM   1781 C CG   . GLU A 1 119 ? 69.621 31.629  50.391 1.00 79.15  ? 164 GLU A CG   1 
ATOM   1782 C CD   . GLU A 1 119 ? 70.810 32.480  50.783 1.00 86.00  ? 164 GLU A CD   1 
ATOM   1783 O OE1  . GLU A 1 119 ? 71.025 33.540  50.159 1.00 89.73  ? 164 GLU A OE1  1 
ATOM   1784 O OE2  . GLU A 1 119 ? 71.529 32.083  51.725 1.00 87.97  ? 164 GLU A OE2  1 
ATOM   1785 H H    . GLU A 1 119 ? 67.646 30.590  48.344 1.00 76.99  ? 164 GLU A H    1 
ATOM   1786 H HA   . GLU A 1 119 ? 66.911 31.391  50.822 1.00 77.95  ? 164 GLU A HA   1 
ATOM   1787 H HB2  . GLU A 1 119 ? 68.608 32.769  49.036 1.00 87.39  ? 164 GLU A HB2  1 
ATOM   1788 H HB3  . GLU A 1 119 ? 68.323 33.196  50.539 1.00 87.39  ? 164 GLU A HB3  1 
ATOM   1789 H HG2  . GLU A 1 119 ? 69.364 31.101  51.163 1.00 94.98  ? 164 GLU A HG2  1 
ATOM   1790 H HG3  . GLU A 1 119 ? 69.897 31.044  49.668 1.00 94.98  ? 164 GLU A HG3  1 
ATOM   1791 N N    . GLU A 1 120 ? 65.104 32.015  48.550 1.00 59.79  ? 165 GLU A N    1 
ATOM   1792 C CA   . GLU A 1 120 ? 64.078 32.837  47.923 1.00 58.17  ? 165 GLU A CA   1 
ATOM   1793 C C    . GLU A 1 120 ? 63.057 33.389  48.912 1.00 56.74  ? 165 GLU A C    1 
ATOM   1794 O O    . GLU A 1 120 ? 62.378 34.368  48.587 1.00 58.42  ? 165 GLU A O    1 
ATOM   1795 C CB   . GLU A 1 120 ? 63.359 32.026  46.847 1.00 57.51  ? 165 GLU A CB   1 
ATOM   1796 C CG   . GLU A 1 120 ? 64.058 32.030  45.508 1.00 59.50  ? 165 GLU A CG   1 
ATOM   1797 C CD   . GLU A 1 120 ? 63.932 33.360  44.799 1.00 60.52  ? 165 GLU A CD   1 
ATOM   1798 O OE1  . GLU A 1 120 ? 62.949 34.084  45.071 1.00 59.15  ? 165 GLU A OE1  1 
ATOM   1799 O OE2  . GLU A 1 120 ? 64.814 33.679  43.976 1.00 64.46  ? 165 GLU A OE2  1 
ATOM   1800 H H    . GLU A 1 120 ? 65.089 31.189  48.312 1.00 71.75  ? 165 GLU A H    1 
ATOM   1801 H HA   . GLU A 1 120 ? 64.506 33.591  47.488 1.00 69.80  ? 165 GLU A HA   1 
ATOM   1802 H HB2  . GLU A 1 120 ? 63.292 31.104  47.144 1.00 69.01  ? 165 GLU A HB2  1 
ATOM   1803 H HB3  . GLU A 1 120 ? 62.471 32.394  46.719 1.00 69.01  ? 165 GLU A HB3  1 
ATOM   1804 H HG2  . GLU A 1 120 ? 65.002 31.848  45.642 1.00 71.41  ? 165 GLU A HG2  1 
ATOM   1805 H HG3  . GLU A 1 120 ? 63.664 31.349  44.942 1.00 71.41  ? 165 GLU A HG3  1 
ATOM   1806 N N    . ILE A 1 121 ? 62.923 32.795  50.093 1.00 59.10  ? 166 ILE A N    1 
ATOM   1807 C CA   . ILE A 1 121 ? 61.890 33.208  51.039 1.00 57.42  ? 166 ILE A CA   1 
ATOM   1808 C C    . ILE A 1 121 ? 62.336 34.473  51.761 1.00 55.85  ? 166 ILE A C    1 
ATOM   1809 O O    . ILE A 1 121 ? 63.467 34.558  52.249 1.00 60.25  ? 166 ILE A O    1 
ATOM   1810 C CB   . ILE A 1 121 ? 61.587 32.080  52.037 1.00 57.61  ? 166 ILE A CB   1 
ATOM   1811 C CG1  . ILE A 1 121 ? 61.209 30.790  51.300 1.00 57.80  ? 166 ILE A CG1  1 
ATOM   1812 C CG2  . ILE A 1 121 ? 60.469 32.493  52.989 1.00 55.76  ? 166 ILE A CG2  1 
ATOM   1813 C CD1  . ILE A 1 121 ? 59.963 30.902  50.447 1.00 57.88  ? 166 ILE A CD1  1 
ATOM   1814 H H    . ILE A 1 121 ? 63.417 32.148  50.372 1.00 70.92  ? 166 ILE A H    1 
ATOM   1815 H HA   . ILE A 1 121 ? 61.075 33.408  50.552 1.00 68.90  ? 166 ILE A HA   1 
ATOM   1816 H HB   . ILE A 1 121 ? 62.387 31.910  52.560 1.00 69.13  ? 166 ILE A HB   1 
ATOM   1817 H HG12 . ILE A 1 121 ? 61.943 30.538  50.718 1.00 69.36  ? 166 ILE A HG12 1 
ATOM   1818 H HG13 . ILE A 1 121 ? 61.056 30.091  51.955 1.00 69.36  ? 166 ILE A HG13 1 
ATOM   1819 H HG21 . ILE A 1 121 ? 60.297 31.766  53.608 1.00 66.91  ? 166 ILE A HG21 1 
ATOM   1820 H HG22 . ILE A 1 121 ? 60.746 33.284  53.477 1.00 66.91  ? 166 ILE A HG22 1 
ATOM   1821 H HG23 . ILE A 1 121 ? 59.670 32.685  52.473 1.00 66.91  ? 166 ILE A HG23 1 
ATOM   1822 H HD11 . ILE A 1 121 ? 59.797 30.048  50.019 1.00 69.46  ? 166 ILE A HD11 1 
ATOM   1823 H HD12 . ILE A 1 121 ? 59.213 31.140  51.014 1.00 69.46  ? 166 ILE A HD12 1 
ATOM   1824 H HD13 . ILE A 1 121 ? 60.102 31.588  49.775 1.00 69.46  ? 166 ILE A HD13 1 
ATOM   1825 N N    . CYS A 1 122 ? 61.441 35.459  51.838 1.00 51.67  ? 167 CYS A N    1 
ATOM   1826 C CA   . CYS A 1 122 ? 61.684 36.687  52.591 1.00 48.58  ? 167 CYS A CA   1 
ATOM   1827 C C    . CYS A 1 122 ? 61.035 36.658  53.971 1.00 44.48  ? 167 CYS A C    1 
ATOM   1828 O O    . CYS A 1 122 ? 61.676 37.009  54.970 1.00 43.57  ? 167 CYS A O    1 
ATOM   1829 C CB   . CYS A 1 122 ? 61.165 37.901  51.813 1.00 47.91  ? 167 CYS A CB   1 
ATOM   1830 S SG   . CYS A 1 122 ? 61.928 38.152  50.194 1.00 51.19  ? 167 CYS A SG   1 
ATOM   1831 H H    . CYS A 1 122 ? 60.671 35.437  51.456 1.00 62.00  ? 167 CYS A H    1 
ATOM   1832 H HA   . CYS A 1 122 ? 62.640 36.797  52.713 1.00 58.30  ? 167 CYS A HA   1 
ATOM   1833 H HB2  . CYS A 1 122 ? 60.211 37.794  51.674 1.00 57.49  ? 167 CYS A HB2  1 
ATOM   1834 H HB3  . CYS A 1 122 ? 61.329 38.698  52.341 1.00 57.49  ? 167 CYS A HB3  1 
ATOM   1835 H HG   . CYS A 1 122 ? 61.447 39.124  49.682 1.00 61.43  ? 167 CYS A HG   1 
ATOM   1836 N N    . GLY A 1 123 ? 59.775 36.244  54.044 1.00 45.06  ? 168 GLY A N    1 
ATOM   1837 C CA   . GLY A 1 123 ? 59.081 36.175  55.311 1.00 43.28  ? 168 GLY A CA   1 
ATOM   1838 C C    . GLY A 1 123 ? 57.615 35.855  55.104 1.00 43.24  ? 168 GLY A C    1 
ATOM   1839 O O    . GLY A 1 123 ? 57.167 35.570  53.991 1.00 43.78  ? 168 GLY A O    1 
ATOM   1840 H H    . GLY A 1 123 ? 59.303 35.997  53.369 1.00 54.07  ? 168 GLY A H    1 
ATOM   1841 H HA2  . GLY A 1 123 ? 59.477 35.485  55.866 1.00 51.94  ? 168 GLY A HA2  1 
ATOM   1842 H HA3  . GLY A 1 123 ? 59.154 37.026  55.772 1.00 51.94  ? 168 GLY A HA3  1 
ATOM   1843 N N    . ALA A 1 124 ? 56.880 35.919  56.206 1.00 39.87  ? 169 ALA A N    1 
ATOM   1844 C CA   . ALA A 1 124 ? 55.463 35.600  56.230 1.00 38.13  ? 169 ALA A CA   1 
ATOM   1845 C C    . ALA A 1 124 ? 54.708 36.685  56.983 1.00 38.07  ? 169 ALA A C    1 
ATOM   1846 O O    . ALA A 1 124 ? 55.272 37.366  57.845 1.00 37.10  ? 169 ALA A O    1 
ATOM   1847 C CB   . ALA A 1 124 ? 55.226 34.242  56.893 1.00 37.10  ? 169 ALA A CB   1 
ATOM   1848 H H    . ALA A 1 124 ? 57.190 36.152  56.973 1.00 47.85  ? 169 ALA A H    1 
ATOM   1849 H HA   . ALA A 1 124 ? 55.124 35.562  55.322 1.00 45.76  ? 169 ALA A HA   1 
ATOM   1850 H HB1  . ALA A 1 124 ? 54.275 34.054  56.895 1.00 44.52  ? 169 ALA A HB1  1 
ATOM   1851 H HB2  . ALA A 1 124 ? 55.697 33.560  56.390 1.00 44.52  ? 169 ALA A HB2  1 
ATOM   1852 H HB3  . ALA A 1 124 ? 55.560 34.273  57.803 1.00 44.52  ? 169 ALA A HB3  1 
ATOM   1853 N N    . VAL A 1 125 ? 53.424 36.837  56.659 1.00 39.58  ? 170 VAL A N    1 
ATOM   1854 C CA   . VAL A 1 125 ? 52.570 37.843  57.287 1.00 42.25  ? 170 VAL A CA   1 
ATOM   1855 C C    . VAL A 1 125 ? 51.190 37.246  57.529 1.00 41.74  ? 170 VAL A C    1 
ATOM   1856 O O    . VAL A 1 125 ? 50.613 36.620  56.634 1.00 42.53  ? 170 VAL A O    1 
ATOM   1857 C CB   . VAL A 1 125 ? 52.451 39.114  56.419 1.00 43.51  ? 170 VAL A CB   1 
ATOM   1858 C CG1  . VAL A 1 125 ? 51.422 40.088  57.005 1.00 44.92  ? 170 VAL A CG1  1 
ATOM   1859 C CG2  . VAL A 1 125 ? 53.802 39.787  56.281 1.00 45.21  ? 170 VAL A CG2  1 
ATOM   1860 H H    . VAL A 1 125 ? 53.018 36.362  56.068 1.00 47.50  ? 170 VAL A H    1 
ATOM   1861 H HA   . VAL A 1 125 ? 52.948 38.094  58.145 1.00 50.70  ? 170 VAL A HA   1 
ATOM   1862 H HB   . VAL A 1 125 ? 52.151 38.861  55.532 1.00 52.21  ? 170 VAL A HB   1 
ATOM   1863 H HG11 . VAL A 1 125 ? 51.372 40.873  56.437 1.00 53.90  ? 170 VAL A HG11 1 
ATOM   1864 H HG12 . VAL A 1 125 ? 50.557 39.650  57.041 1.00 53.90  ? 170 VAL A HG12 1 
ATOM   1865 H HG13 . VAL A 1 125 ? 51.701 40.342  57.898 1.00 53.90  ? 170 VAL A HG13 1 
ATOM   1866 H HG21 . VAL A 1 125 ? 53.704 40.581  55.733 1.00 54.25  ? 170 VAL A HG21 1 
ATOM   1867 H HG22 . VAL A 1 125 ? 54.125 40.030  57.162 1.00 54.25  ? 170 VAL A HG22 1 
ATOM   1868 H HG23 . VAL A 1 125 ? 54.421 39.169  55.861 1.00 54.25  ? 170 VAL A HG23 1 
ATOM   1869 N N    . VAL A 1 126 ? 50.649 37.458  58.725 1.00 40.56  ? 171 VAL A N    1 
ATOM   1870 C CA   . VAL A 1 126 ? 49.246 37.174  59.003 1.00 39.51  ? 171 VAL A CA   1 
ATOM   1871 C C    . VAL A 1 126 ? 48.576 38.507  59.307 1.00 42.88  ? 171 VAL A C    1 
ATOM   1872 O O    . VAL A 1 126 ? 49.028 39.251  60.189 1.00 42.89  ? 171 VAL A O    1 
ATOM   1873 C CB   . VAL A 1 126 ? 49.057 36.166  60.153 1.00 36.91  ? 171 VAL A CB   1 
ATOM   1874 C CG1  . VAL A 1 126 ? 49.723 36.644  61.412 1.00 36.14  ? 171 VAL A CG1  1 
ATOM   1875 C CG2  . VAL A 1 126 ? 47.579 35.921  60.412 1.00 36.45  ? 171 VAL A CG2  1 
ATOM   1876 H H    . VAL A 1 126 ? 51.081 37.769  59.401 1.00 48.67  ? 171 VAL A H    1 
ATOM   1877 H HA   . VAL A 1 126 ? 48.833 36.803  58.208 1.00 47.41  ? 171 VAL A HA   1 
ATOM   1878 H HB   . VAL A 1 126 ? 49.462 35.321  59.902 1.00 44.29  ? 171 VAL A HB   1 
ATOM   1879 H HG11 . VAL A 1 126 ? 49.583 35.986  62.112 1.00 43.36  ? 171 VAL A HG11 1 
ATOM   1880 H HG12 . VAL A 1 126 ? 50.672 36.753  61.245 1.00 43.36  ? 171 VAL A HG12 1 
ATOM   1881 H HG13 . VAL A 1 126 ? 49.333 37.493  61.673 1.00 43.36  ? 171 VAL A HG13 1 
ATOM   1882 H HG21 . VAL A 1 126 ? 47.488 35.285  61.139 1.00 43.73  ? 171 VAL A HG21 1 
ATOM   1883 H HG22 . VAL A 1 126 ? 47.158 36.761  60.652 1.00 43.73  ? 171 VAL A HG22 1 
ATOM   1884 H HG23 . VAL A 1 126 ? 47.173 35.565  59.607 1.00 43.73  ? 171 VAL A HG23 1 
ATOM   1885 N N    . SER A 1 127 ? 47.516 38.816  58.563 1.00 45.60  ? 172 SER A N    1 
ATOM   1886 C CA   . SER A 1 127 ? 46.795 40.077  58.695 1.00 48.65  ? 172 SER A CA   1 
ATOM   1887 C C    . SER A 1 127 ? 45.384 39.782  59.174 1.00 49.22  ? 172 SER A C    1 
ATOM   1888 O O    . SER A 1 127 ? 44.641 39.056  58.510 1.00 49.85  ? 172 SER A O    1 
ATOM   1889 C CB   . SER A 1 127 ? 46.753 40.840  57.368 1.00 49.74  ? 172 SER A CB   1 
ATOM   1890 O OG   . SER A 1 127 ? 48.013 41.403  57.047 1.00 50.19  ? 172 SER A OG   1 
ATOM   1891 H H    . SER A 1 127 ? 47.189 38.297  57.961 1.00 54.72  ? 172 SER A H    1 
ATOM   1892 H HA   . SER A 1 127 ? 47.235 40.634  59.356 1.00 58.38  ? 172 SER A HA   1 
ATOM   1893 H HB2  . SER A 1 127 ? 46.495 40.226  56.663 1.00 59.68  ? 172 SER A HB2  1 
ATOM   1894 H HB3  . SER A 1 127 ? 46.100 41.553  57.438 1.00 59.68  ? 172 SER A HB3  1 
ATOM   1895 H HG   . SER A 1 127 ? 47.966 41.815  56.316 1.00 60.23  ? 172 SER A HG   1 
ATOM   1896 N N    . VAL A 1 128 ? 45.026 40.344  60.322 1.00 48.80  ? 173 VAL A N    1 
ATOM   1897 C CA   . VAL A 1 128 ? 43.702 40.188  60.914 1.00 50.15  ? 173 VAL A CA   1 
ATOM   1898 C C    . VAL A 1 128 ? 42.858 41.389  60.508 1.00 51.80  ? 173 VAL A C    1 
ATOM   1899 O O    . VAL A 1 128 ? 43.234 42.538  60.772 1.00 50.97  ? 173 VAL A O    1 
ATOM   1900 C CB   . VAL A 1 128 ? 43.789 40.070  62.444 1.00 50.21  ? 173 VAL A CB   1 
ATOM   1901 C CG1  . VAL A 1 128 ? 42.404 39.921  63.057 1.00 53.20  ? 173 VAL A CG1  1 
ATOM   1902 C CG2  . VAL A 1 128 ? 44.681 38.908  62.831 1.00 49.85  ? 173 VAL A CG2  1 
ATOM   1903 H H    . VAL A 1 128 ? 45.550 40.838  60.792 1.00 58.57  ? 173 VAL A H    1 
ATOM   1904 H HA   . VAL A 1 128 ? 43.283 39.385  60.566 1.00 60.18  ? 173 VAL A HA   1 
ATOM   1905 H HB   . VAL A 1 128 ? 44.186 40.881  62.798 1.00 60.25  ? 173 VAL A HB   1 
ATOM   1906 H HG11 . VAL A 1 128 ? 42.492 39.850  64.021 1.00 63.85  ? 173 VAL A HG11 1 
ATOM   1907 H HG12 . VAL A 1 128 ? 41.873 40.701  62.830 1.00 63.85  ? 173 VAL A HG12 1 
ATOM   1908 H HG13 . VAL A 1 128 ? 41.986 39.121  62.703 1.00 63.85  ? 173 VAL A HG13 1 
ATOM   1909 H HG21 . VAL A 1 128 ? 44.723 38.852  63.799 1.00 59.82  ? 173 VAL A HG21 1 
ATOM   1910 H HG22 . VAL A 1 128 ? 44.309 38.090  62.467 1.00 59.82  ? 173 VAL A HG22 1 
ATOM   1911 H HG23 . VAL A 1 128 ? 45.569 39.058  62.470 1.00 59.82  ? 173 VAL A HG23 1 
ATOM   1912 N N    . ARG A 1 129 ? 41.715 41.127  59.881 1.00 49.36  ? 174 ARG A N    1 
ATOM   1913 C CA   . ARG A 1 129 ? 40.818 42.166  59.394 1.00 51.83  ? 174 ARG A CA   1 
ATOM   1914 C C    . ARG A 1 129 ? 39.424 41.941  59.974 1.00 52.54  ? 174 ARG A C    1 
ATOM   1915 O O    . ARG A 1 129 ? 39.205 41.055  60.800 1.00 51.75  ? 174 ARG A O    1 
ATOM   1916 C CB   . ARG A 1 129 ? 40.794 42.189  57.862 1.00 55.16  ? 174 ARG A CB   1 
ATOM   1917 C CG   . ARG A 1 129 ? 42.172 42.366  57.210 1.00 55.81  ? 174 ARG A CG   1 
ATOM   1918 C CD   . ARG A 1 129 ? 42.694 43.782  57.382 1.00 61.85  ? 174 ARG A CD   1 
ATOM   1919 N NE   . ARG A 1 129 ? 43.964 43.999  56.687 1.00 65.63  ? 174 ARG A NE   1 
ATOM   1920 C CZ   . ARG A 1 129 ? 45.159 44.099  57.276 1.00 69.48  ? 174 ARG A CZ   1 
ATOM   1921 N NH1  . ARG A 1 129 ? 45.281 44.017  58.597 1.00 69.59  ? 174 ARG A NH1  1 
ATOM   1922 N NH2  . ARG A 1 129 ? 46.247 44.289  56.537 1.00 70.10  ? 174 ARG A NH2  1 
ATOM   1923 H H    . ARG A 1 129 ? 41.432 40.331  59.721 1.00 59.23  ? 174 ARG A H    1 
ATOM   1924 H HA   . ARG A 1 129 ? 41.137 43.029  59.702 1.00 62.20  ? 174 ARG A HA   1 
ATOM   1925 H HB2  . ARG A 1 129 ? 40.423 41.351  57.544 1.00 66.20  ? 174 ARG A HB2  1 
ATOM   1926 H HB3  . ARG A 1 129 ? 40.234 42.926  57.571 1.00 66.20  ? 174 ARG A HB3  1 
ATOM   1927 H HG2  . ARG A 1 129 ? 42.802 41.757  57.625 1.00 66.98  ? 174 ARG A HG2  1 
ATOM   1928 H HG3  . ARG A 1 129 ? 42.102 42.181  56.260 1.00 66.98  ? 174 ARG A HG3  1 
ATOM   1929 H HD2  . ARG A 1 129 ? 42.044 44.406  57.022 1.00 74.22  ? 174 ARG A HD2  1 
ATOM   1930 H HD3  . ARG A 1 129 ? 42.835 43.955  58.326 1.00 74.22  ? 174 ARG A HD3  1 
ATOM   1931 H HE   . ARG A 1 129 ? 43.939 44.067  55.830 1.00 78.75  ? 174 ARG A HE   1 
ATOM   1932 H HH11 . ARG A 1 129 ? 44.585 43.893  59.087 1.00 83.51  ? 174 ARG A HH11 1 
ATOM   1933 H HH12 . ARG A 1 129 ? 46.057 44.085  58.962 1.00 83.51  ? 174 ARG A HH12 1 
ATOM   1934 H HH21 . ARG A 1 129 ? 46.181 44.346  55.682 1.00 84.12  ? 174 ARG A HH21 1 
ATOM   1935 H HH22 . ARG A 1 129 ? 47.017 44.358  56.915 1.00 84.12  ? 174 ARG A HH22 1 
ATOM   1936 N N    . PHE A 1 130 ? 38.472 42.765  59.541 1.00 62.75  ? 175 PHE A N    1 
ATOM   1937 C CA   . PHE A 1 130 ? 37.160 42.775  60.181 1.00 67.29  ? 175 PHE A CA   1 
ATOM   1938 C C    . PHE A 1 130 ? 36.451 41.433  60.017 1.00 68.00  ? 175 PHE A C    1 
ATOM   1939 O O    . PHE A 1 130 ? 36.046 40.806  61.003 1.00 68.51  ? 175 PHE A O    1 
ATOM   1940 C CB   . PHE A 1 130 ? 36.313 43.919  59.616 1.00 70.67  ? 175 PHE A CB   1 
ATOM   1941 C CG   . PHE A 1 130 ? 34.930 43.982  60.188 1.00 75.88  ? 175 PHE A CG   1 
ATOM   1942 C CD1  . PHE A 1 130 ? 34.729 43.939  61.559 1.00 76.55  ? 175 PHE A CD1  1 
ATOM   1943 C CD2  . PHE A 1 130 ? 33.825 44.089  59.358 1.00 78.41  ? 175 PHE A CD2  1 
ATOM   1944 C CE1  . PHE A 1 130 ? 33.449 43.993  62.089 1.00 79.04  ? 175 PHE A CE1  1 
ATOM   1945 C CE2  . PHE A 1 130 ? 32.546 44.146  59.884 1.00 80.70  ? 175 PHE A CE2  1 
ATOM   1946 C CZ   . PHE A 1 130 ? 32.360 44.099  61.248 1.00 81.66  ? 175 PHE A CZ   1 
ATOM   1947 H H    . PHE A 1 130 ? 38.558 43.319  58.889 1.00 75.30  ? 175 PHE A H    1 
ATOM   1948 H HA   . PHE A 1 130 ? 37.277 42.934  61.131 1.00 80.75  ? 175 PHE A HA   1 
ATOM   1949 H HB2  . PHE A 1 130 ? 36.754 44.760  59.811 1.00 84.81  ? 175 PHE A HB2  1 
ATOM   1950 H HB3  . PHE A 1 130 ? 36.233 43.804  58.656 1.00 84.81  ? 175 PHE A HB3  1 
ATOM   1951 H HD1  . PHE A 1 130 ? 35.461 43.866  62.129 1.00 91.86  ? 175 PHE A HD1  1 
ATOM   1952 H HD2  . PHE A 1 130 ? 33.944 44.120  58.436 1.00 94.10  ? 175 PHE A HD2  1 
ATOM   1953 H HE1  . PHE A 1 130 ? 33.325 43.963  63.010 1.00 94.84  ? 175 PHE A HE1  1 
ATOM   1954 H HE2  . PHE A 1 130 ? 31.813 44.217  59.317 1.00 96.84  ? 175 PHE A HE2  1 
ATOM   1955 H HZ   . PHE A 1 130 ? 31.501 44.138  61.602 1.00 97.99  ? 175 PHE A HZ   1 
ATOM   1956 N N    . GLN A 1 131 ? 36.296 40.969  58.773 1.00 56.95  ? 176 GLN A N    1 
ATOM   1957 C CA   . GLN A 1 131 ? 35.519 39.764  58.500 1.00 54.25  ? 176 GLN A CA   1 
ATOM   1958 C C    . GLN A 1 131 ? 36.309 38.747  57.682 1.00 49.52  ? 176 GLN A C    1 
ATOM   1959 O O    . GLN A 1 131 ? 35.713 37.865  57.050 1.00 48.69  ? 176 GLN A O    1 
ATOM   1960 C CB   . GLN A 1 131 ? 34.204 40.128  57.799 1.00 58.66  ? 176 GLN A CB   1 
ATOM   1961 C CG   . GLN A 1 131 ? 34.363 40.988  56.553 1.00 59.63  ? 176 GLN A CG   1 
ATOM   1962 C CD   . GLN A 1 131 ? 33.162 41.884  56.298 1.00 65.88  ? 176 GLN A CD   1 
ATOM   1963 O OE1  . GLN A 1 131 ? 32.186 41.868  57.049 1.00 69.60  ? 176 GLN A OE1  1 
ATOM   1964 N NE2  . GLN A 1 131 ? 33.233 42.678  55.235 1.00 68.15  ? 176 GLN A NE2  1 
ATOM   1965 H H    . GLN A 1 131 ? 36.633 41.337  58.072 1.00 68.34  ? 176 GLN A H    1 
ATOM   1966 H HA   . GLN A 1 131 ? 35.294 39.346  59.345 1.00 65.10  ? 176 GLN A HA   1 
ATOM   1967 H HB2  . GLN A 1 131 ? 33.757 39.308  57.535 1.00 70.40  ? 176 GLN A HB2  1 
ATOM   1968 H HB3  . GLN A 1 131 ? 33.645 40.616  58.424 1.00 70.40  ? 176 GLN A HB3  1 
ATOM   1969 H HG2  . GLN A 1 131 ? 35.143 41.555  56.659 1.00 71.56  ? 176 GLN A HG2  1 
ATOM   1970 H HG3  . GLN A 1 131 ? 34.475 40.410  55.782 1.00 71.56  ? 176 GLN A HG3  1 
ATOM   1971 H HE21 . GLN A 1 131 ? 33.933 42.666  54.735 1.00 81.78  ? 176 GLN A HE21 1 
ATOM   1972 H HE22 . GLN A 1 131 ? 32.580 43.204  55.046 1.00 81.78  ? 176 GLN A HE22 1 
ATOM   1973 N N    . GLU A 1 132 ? 37.636 38.845  57.696 1.00 53.45  ? 177 GLU A N    1 
ATOM   1974 C CA   . GLU A 1 132 ? 38.496 37.876  57.039 1.00 52.58  ? 177 GLU A CA   1 
ATOM   1975 C C    . GLU A 1 132 ? 39.902 38.035  57.589 1.00 50.71  ? 177 GLU A C    1 
ATOM   1976 O O    . GLU A 1 132 ? 40.266 39.085  58.121 1.00 51.49  ? 177 GLU A O    1 
ATOM   1977 C CB   . GLU A 1 132 ? 38.503 38.053  55.520 1.00 54.36  ? 177 GLU A CB   1 
ATOM   1978 C CG   . GLU A 1 132 ? 39.097 39.366  55.048 1.00 56.88  ? 177 GLU A CG   1 
ATOM   1979 C CD   . GLU A 1 132 ? 39.232 39.434  53.542 1.00 57.94  ? 177 GLU A CD   1 
ATOM   1980 O OE1  . GLU A 1 132 ? 39.333 38.367  52.905 1.00 57.87  ? 177 GLU A OE1  1 
ATOM   1981 O OE2  . GLU A 1 132 ? 39.232 40.555  52.992 1.00 60.21  ? 177 GLU A OE2  1 
ATOM   1982 H H    . GLU A 1 132 ? 38.066 39.478  58.088 1.00 64.14  ? 177 GLU A H    1 
ATOM   1983 H HA   . GLU A 1 132 ? 38.186 36.979  57.242 1.00 63.10  ? 177 GLU A HA   1 
ATOM   1984 H HB2  . GLU A 1 132 ? 39.024 37.336  55.126 1.00 65.23  ? 177 GLU A HB2  1 
ATOM   1985 H HB3  . GLU A 1 132 ? 37.589 38.010  55.198 1.00 65.23  ? 177 GLU A HB3  1 
ATOM   1986 H HG2  . GLU A 1 132 ? 38.522 40.094  55.332 1.00 68.25  ? 177 GLU A HG2  1 
ATOM   1987 H HG3  . GLU A 1 132 ? 39.981 39.471  55.434 1.00 68.25  ? 177 GLU A HG3  1 
ATOM   1988 N N    . ASP A 1 133 ? 40.686 36.975  57.447 1.00 46.29  ? 178 ASP A N    1 
ATOM   1989 C CA   . ASP A 1 133 ? 42.102 36.993  57.769 1.00 43.67  ? 178 ASP A CA   1 
ATOM   1990 C C    . ASP A 1 133 ? 42.882 36.679  56.504 1.00 42.10  ? 178 ASP A C    1 
ATOM   1991 O O    . ASP A 1 133 ? 42.380 35.998  55.606 1.00 40.20  ? 178 ASP A O    1 
ATOM   1992 C CB   . ASP A 1 133 ? 42.441 35.988  58.868 1.00 43.54  ? 178 ASP A CB   1 
ATOM   1993 C CG   . ASP A 1 133 ? 41.698 36.270  60.152 1.00 46.12  ? 178 ASP A CG   1 
ATOM   1994 O OD1  . ASP A 1 133 ? 41.583 37.460  60.517 1.00 46.65  ? 178 ASP A OD1  1 
ATOM   1995 O OD2  . ASP A 1 133 ? 41.214 35.302  60.781 1.00 46.49  ? 178 ASP A OD2  1 
ATOM   1996 H H    . ASP A 1 133 ? 40.411 36.213  57.158 1.00 55.54  ? 178 ASP A H    1 
ATOM   1997 H HA   . ASP A 1 133 ? 42.354 37.879  58.074 1.00 52.40  ? 178 ASP A HA   1 
ATOM   1998 H HB2  . ASP A 1 133 ? 42.200 35.098  58.569 1.00 52.25  ? 178 ASP A HB2  1 
ATOM   1999 H HB3  . ASP A 1 133 ? 43.392 36.031  59.055 1.00 52.25  ? 178 ASP A HB3  1 
ATOM   2000 N N    . ILE A 1 134 ? 44.110 37.184  56.437 1.00 41.35  ? 179 ILE A N    1 
ATOM   2001 C CA   . ILE A 1 134 ? 44.925 37.091  55.231 1.00 43.27  ? 179 ILE A CA   1 
ATOM   2002 C C    . ILE A 1 134 ? 46.302 36.559  55.613 1.00 43.66  ? 179 ILE A C    1 
ATOM   2003 O O    . ILE A 1 134 ? 47.051 37.224  56.340 1.00 43.08  ? 179 ILE A O    1 
ATOM   2004 C CB   . ILE A 1 134 ? 45.033 38.441  54.512 1.00 45.20  ? 179 ILE A CB   1 
ATOM   2005 C CG1  . ILE A 1 134 ? 43.627 39.012  54.267 1.00 47.13  ? 179 ILE A CG1  1 
ATOM   2006 C CG2  . ILE A 1 134 ? 45.758 38.284  53.194 1.00 44.90  ? 179 ILE A CG2  1 
ATOM   2007 C CD1  . ILE A 1 134 ? 43.616 40.428  53.748 1.00 48.98  ? 179 ILE A CD1  1 
ATOM   2008 H H    . ILE A 1 134 ? 44.499 37.591  57.087 1.00 49.62  ? 179 ILE A H    1 
ATOM   2009 H HA   . ILE A 1 134 ? 44.517 36.457  54.621 1.00 51.93  ? 179 ILE A HA   1 
ATOM   2010 H HB   . ILE A 1 134 ? 45.530 39.058  55.073 1.00 54.24  ? 179 ILE A HB   1 
ATOM   2011 H HG12 . ILE A 1 134 ? 43.174 38.455  53.614 1.00 56.56  ? 179 ILE A HG12 1 
ATOM   2012 H HG13 . ILE A 1 134 ? 43.136 39.001  55.103 1.00 56.56  ? 179 ILE A HG13 1 
ATOM   2013 H HG21 . ILE A 1 134 ? 45.813 39.149  52.759 1.00 53.88  ? 179 ILE A HG21 1 
ATOM   2014 H HG22 . ILE A 1 134 ? 46.649 37.940  53.363 1.00 53.88  ? 179 ILE A HG22 1 
ATOM   2015 H HG23 . ILE A 1 134 ? 45.264 37.664  52.635 1.00 53.88  ? 179 ILE A HG23 1 
ATOM   2016 H HD11 . ILE A 1 134 ? 42.697 40.711  53.620 1.00 58.78  ? 179 ILE A HD11 1 
ATOM   2017 H HD12 . ILE A 1 134 ? 44.053 41.004  54.394 1.00 58.78  ? 179 ILE A HD12 1 
ATOM   2018 H HD13 . ILE A 1 134 ? 44.092 40.458  52.903 1.00 58.78  ? 179 ILE A HD13 1 
ATOM   2019 N N    . ILE A 1 135 ? 46.631 35.360  55.130 1.00 46.84  ? 180 ILE A N    1 
ATOM   2020 C CA   . ILE A 1 135 ? 47.957 34.763  55.272 1.00 48.44  ? 180 ILE A CA   1 
ATOM   2021 C C    . ILE A 1 135 ? 48.724 34.991  53.979 1.00 47.96  ? 180 ILE A C    1 
ATOM   2022 O O    . ILE A 1 135 ? 48.183 34.797  52.882 1.00 48.59  ? 180 ILE A O    1 
ATOM   2023 C CB   . ILE A 1 135 ? 47.853 33.255  55.587 1.00 51.29  ? 180 ILE A CB   1 
ATOM   2024 C CG1  . ILE A 1 135 ? 47.168 33.019  56.939 1.00 53.53  ? 180 ILE A CG1  1 
ATOM   2025 C CG2  . ILE A 1 135 ? 49.232 32.587  55.563 1.00 51.81  ? 180 ILE A CG2  1 
ATOM   2026 C CD1  . ILE A 1 135 ? 48.006 33.412  58.151 1.00 54.10  ? 180 ILE A CD1  1 
ATOM   2027 H H    . ILE A 1 135 ? 46.081 34.857  54.700 1.00 56.20  ? 180 ILE A H    1 
ATOM   2028 H HA   . ILE A 1 135 ? 48.434 35.198  55.996 1.00 58.13  ? 180 ILE A HA   1 
ATOM   2029 H HB   . ILE A 1 135 ? 47.308 32.842  54.899 1.00 61.55  ? 180 ILE A HB   1 
ATOM   2030 H HG12 . ILE A 1 135 ? 46.349 33.538  56.966 1.00 64.23  ? 180 ILE A HG12 1 
ATOM   2031 H HG13 . ILE A 1 135 ? 46.958 32.075  57.020 1.00 64.23  ? 180 ILE A HG13 1 
ATOM   2032 H HG21 . ILE A 1 135 ? 49.129 31.644  55.765 1.00 62.17  ? 180 ILE A HG21 1 
ATOM   2033 H HG22 . ILE A 1 135 ? 49.620 32.697  54.682 1.00 62.17  ? 180 ILE A HG22 1 
ATOM   2034 H HG23 . ILE A 1 135 ? 49.797 33.008  56.230 1.00 62.17  ? 180 ILE A HG23 1 
ATOM   2035 H HD11 . ILE A 1 135 ? 47.498 33.231  58.957 1.00 64.92  ? 180 ILE A HD11 1 
ATOM   2036 H HD12 . ILE A 1 135 ? 48.824 32.892  58.151 1.00 64.92  ? 180 ILE A HD12 1 
ATOM   2037 H HD13 . ILE A 1 135 ? 48.214 34.358  58.097 1.00 64.92  ? 180 ILE A HD13 1 
ATOM   2038 N N    . SER A 1 136 ? 49.986 35.392  54.093 1.00 45.15  ? 181 SER A N    1 
ATOM   2039 C CA   . SER A 1 136 ? 50.809 35.552  52.904 1.00 44.87  ? 181 SER A CA   1 
ATOM   2040 C C    . SER A 1 136 ? 52.246 35.152  53.205 1.00 41.71  ? 181 SER A C    1 
ATOM   2041 O O    . SER A 1 136 ? 52.668 35.082  54.361 1.00 39.62  ? 181 SER A O    1 
ATOM   2042 C CB   . SER A 1 136 ? 50.760 36.992  52.362 1.00 47.30  ? 181 SER A CB   1 
ATOM   2043 O OG   . SER A 1 136 ? 51.285 37.920  53.293 1.00 47.36  ? 181 SER A OG   1 
ATOM   2044 H H    . SER A 1 136 ? 50.383 35.575  54.834 1.00 54.18  ? 181 SER A H    1 
ATOM   2045 H HA   . SER A 1 136 ? 50.475 34.962  52.210 1.00 53.84  ? 181 SER A HA   1 
ATOM   2046 H HB2  . SER A 1 136 ? 51.283 37.038  51.546 1.00 56.76  ? 181 SER A HB2  1 
ATOM   2047 H HB3  . SER A 1 136 ? 49.837 37.225  52.175 1.00 56.76  ? 181 SER A HB3  1 
ATOM   2048 H HG   . SER A 1 136 ? 50.841 37.895  54.006 1.00 56.83  ? 181 SER A HG   1 
ATOM   2049 N N    . ILE A 1 137 ? 52.994 34.886  52.138 1.00 42.72  ? 182 ILE A N    1 
ATOM   2050 C CA   . ILE A 1 137 ? 54.415 34.575  52.234 1.00 42.73  ? 182 ILE A CA   1 
ATOM   2051 C C    . ILE A 1 137 ? 55.117 35.226  51.050 1.00 44.51  ? 182 ILE A C    1 
ATOM   2052 O O    . ILE A 1 137 ? 54.665 35.100  49.908 1.00 46.90  ? 182 ILE A O    1 
ATOM   2053 C CB   . ILE A 1 137 ? 54.672 33.054  52.268 1.00 42.39  ? 182 ILE A CB   1 
ATOM   2054 C CG1  . ILE A 1 137 ? 56.180 32.776  52.268 1.00 42.96  ? 182 ILE A CG1  1 
ATOM   2055 C CG2  . ILE A 1 137 ? 53.978 32.356  51.097 1.00 42.40  ? 182 ILE A CG2  1 
ATOM   2056 C CD1  . ILE A 1 137 ? 56.531 31.338  52.538 1.00 42.97  ? 182 ILE A CD1  1 
ATOM   2057 H H    . ILE A 1 137 ? 52.694 34.879  51.332 1.00 51.27  ? 182 ILE A H    1 
ATOM   2058 H HA   . ILE A 1 137 ? 54.772 34.961  53.049 1.00 51.27  ? 182 ILE A HA   1 
ATOM   2059 H HB   . ILE A 1 137 ? 54.300 32.704  53.092 1.00 50.86  ? 182 ILE A HB   1 
ATOM   2060 H HG12 . ILE A 1 137 ? 56.541 33.011  51.398 1.00 51.55  ? 182 ILE A HG12 1 
ATOM   2061 H HG13 . ILE A 1 137 ? 56.598 33.318  52.955 1.00 51.55  ? 182 ILE A HG13 1 
ATOM   2062 H HG21 . ILE A 1 137 ? 54.158 31.404  51.146 1.00 50.88  ? 182 ILE A HG21 1 
ATOM   2063 H HG22 . ILE A 1 137 ? 53.023 32.516  51.155 1.00 50.88  ? 182 ILE A HG22 1 
ATOM   2064 H HG23 . ILE A 1 137 ? 54.323 32.716  50.265 1.00 50.88  ? 182 ILE A HG23 1 
ATOM   2065 H HD11 . ILE A 1 137 ? 57.496 31.241  52.522 1.00 51.56  ? 182 ILE A HD11 1 
ATOM   2066 H HD12 . ILE A 1 137 ? 56.188 31.089  53.410 1.00 51.56  ? 182 ILE A HD12 1 
ATOM   2067 H HD13 . ILE A 1 137 ? 56.131 30.781  51.853 1.00 51.56  ? 182 ILE A HD13 1 
ATOM   2068 N N    . TRP A 1 138 ? 56.214 35.925  51.320 1.00 43.78  ? 183 TRP A N    1 
ATOM   2069 C CA   . TRP A 1 138 ? 56.913 36.707  50.308 1.00 45.34  ? 183 TRP A CA   1 
ATOM   2070 C C    . TRP A 1 138 ? 58.169 35.980  49.851 1.00 44.83  ? 183 TRP A C    1 
ATOM   2071 O O    . TRP A 1 138 ? 58.856 35.343  50.653 1.00 43.21  ? 183 TRP A O    1 
ATOM   2072 C CB   . TRP A 1 138 ? 57.308 38.087  50.845 1.00 48.10  ? 183 TRP A CB   1 
ATOM   2073 C CG   . TRP A 1 138 ? 56.203 38.919  51.418 1.00 48.48  ? 183 TRP A CG   1 
ATOM   2074 C CD1  . TRP A 1 138 ? 54.975 38.495  51.842 1.00 47.65  ? 183 TRP A CD1  1 
ATOM   2075 C CD2  . TRP A 1 138 ? 56.235 40.332  51.638 1.00 51.30  ? 183 TRP A CD2  1 
ATOM   2076 N NE1  . TRP A 1 138 ? 54.248 39.555  52.317 1.00 48.16  ? 183 TRP A NE1  1 
ATOM   2077 C CE2  . TRP A 1 138 ? 54.995 40.696  52.197 1.00 50.81  ? 183 TRP A CE2  1 
ATOM   2078 C CE3  . TRP A 1 138 ? 57.193 41.325  51.417 1.00 54.29  ? 183 TRP A CE3  1 
ATOM   2079 C CZ2  . TRP A 1 138 ? 54.685 42.007  52.535 1.00 52.37  ? 183 TRP A CZ2  1 
ATOM   2080 C CZ3  . TRP A 1 138 ? 56.884 42.629  51.757 1.00 56.33  ? 183 TRP A CZ3  1 
ATOM   2081 C CH2  . TRP A 1 138 ? 55.637 42.958  52.310 1.00 54.99  ? 183 TRP A CH2  1 
ATOM   2082 H H    . TRP A 1 138 ? 56.579 35.963  52.098 1.00 52.54  ? 183 TRP A H    1 
ATOM   2083 H HA   . TRP A 1 138 ? 56.334 36.831  49.540 1.00 54.41  ? 183 TRP A HA   1 
ATOM   2084 H HB2  . TRP A 1 138 ? 57.967 37.963  51.546 1.00 57.71  ? 183 TRP A HB2  1 
ATOM   2085 H HB3  . TRP A 1 138 ? 57.703 38.594  50.119 1.00 57.71  ? 183 TRP A HB3  1 
ATOM   2086 H HD1  . TRP A 1 138 ? 54.679 37.614  51.820 1.00 57.18  ? 183 TRP A HD1  1 
ATOM   2087 H HE1  . TRP A 1 138 ? 53.447 39.512  52.627 1.00 57.79  ? 183 TRP A HE1  1 
ATOM   2088 H HE3  . TRP A 1 138 ? 58.021 41.113  51.050 1.00 65.15  ? 183 TRP A HE3  1 
ATOM   2089 H HZ2  . TRP A 1 138 ? 53.860 42.228  52.904 1.00 62.84  ? 183 TRP A HZ2  1 
ATOM   2090 H HZ3  . TRP A 1 138 ? 57.512 43.300  51.613 1.00 67.59  ? 183 TRP A HZ3  1 
ATOM   2091 H HH2  . TRP A 1 138 ? 55.456 43.844  52.528 1.00 65.98  ? 183 TRP A HH2  1 
ATOM   2092 N N    . ASN A 1 139 ? 58.484 36.103  48.564 1.00 48.74  ? 184 ASN A N    1 
ATOM   2093 C CA   . ASN A 1 139 ? 59.693 35.510  48.013 1.00 52.75  ? 184 ASN A CA   1 
ATOM   2094 C C    . ASN A 1 139 ? 60.463 36.560  47.221 1.00 58.86  ? 184 ASN A C    1 
ATOM   2095 O O    . ASN A 1 139 ? 59.917 37.587  46.808 1.00 59.22  ? 184 ASN A O    1 
ATOM   2096 C CB   . ASN A 1 139 ? 59.381 34.277  47.143 1.00 51.10  ? 184 ASN A CB   1 
ATOM   2097 C CG   . ASN A 1 139 ? 58.738 34.629  45.829 1.00 52.44  ? 184 ASN A CG   1 
ATOM   2098 O OD1  . ASN A 1 139 ? 57.543 34.912  45.766 1.00 51.32  ? 184 ASN A OD1  1 
ATOM   2099 N ND2  . ASN A 1 139 ? 59.520 34.588  44.762 1.00 55.15  ? 184 ASN A ND2  1 
ATOM   2100 H H    . ASN A 1 139 ? 58.009 36.528  47.987 1.00 58.49  ? 184 ASN A H    1 
ATOM   2101 H HA   . ASN A 1 139 ? 60.258 35.219  48.746 1.00 63.30  ? 184 ASN A HA   1 
ATOM   2102 H HB2  . ASN A 1 139 ? 60.209 33.807  46.954 1.00 61.32  ? 184 ASN A HB2  1 
ATOM   2103 H HB3  . ASN A 1 139 ? 58.774 33.695  47.627 1.00 61.32  ? 184 ASN A HB3  1 
ATOM   2104 H HD21 . ASN A 1 139 ? 59.201 34.781  43.987 1.00 66.19  ? 184 ASN A HD21 1 
ATOM   2105 H HD22 . ASN A 1 139 ? 60.348 34.369  44.843 1.00 66.19  ? 184 ASN A HD22 1 
ATOM   2106 N N    . LYS A 1 140 ? 61.755 36.277  47.017 1.00 62.75  ? 185 LYS A N    1 
ATOM   2107 C CA   . LYS A 1 140 ? 62.693 37.291  46.540 1.00 68.17  ? 185 LYS A CA   1 
ATOM   2108 C C    . LYS A 1 140 ? 62.346 37.763  45.134 1.00 69.60  ? 185 LYS A C    1 
ATOM   2109 O O    . LYS A 1 140 ? 62.235 38.969  44.879 1.00 70.86  ? 185 LYS A O    1 
ATOM   2110 C CB   . LYS A 1 140 ? 64.119 36.732  46.561 1.00 74.85  ? 185 LYS A CB   1 
ATOM   2111 C CG   . LYS A 1 140 ? 65.138 37.576  47.313 1.00 79.51  ? 185 LYS A CG   1 
ATOM   2112 C CD   . LYS A 1 140 ? 65.261 37.123  48.761 1.00 80.78  ? 185 LYS A CD   1 
ATOM   2113 C CE   . LYS A 1 140 ? 66.475 37.734  49.439 1.00 85.56  ? 185 LYS A CE   1 
ATOM   2114 N NZ   . LYS A 1 140 ? 66.684 37.166  50.800 1.00 84.44  ? 185 LYS A NZ   1 
ATOM   2115 H H    . LYS A 1 140 ? 62.110 35.504  47.149 1.00 75.30  ? 185 LYS A H    1 
ATOM   2116 H HA   . LYS A 1 140 ? 62.661 38.058  47.133 1.00 81.80  ? 185 LYS A HA   1 
ATOM   2117 H HB2  . LYS A 1 140 ? 64.100 35.857  46.979 1.00 89.82  ? 185 LYS A HB2  1 
ATOM   2118 H HB3  . LYS A 1 140 ? 64.430 36.647  45.646 1.00 89.82  ? 185 LYS A HB3  1 
ATOM   2119 H HG2  . LYS A 1 140 ? 66.005 37.485  46.890 1.00 95.41  ? 185 LYS A HG2  1 
ATOM   2120 H HG3  . LYS A 1 140 ? 64.854 38.503  47.306 1.00 95.41  ? 185 LYS A HG3  1 
ATOM   2121 H HD2  . LYS A 1 140 ? 64.470 37.398  49.250 1.00 96.93  ? 185 LYS A HD2  1 
ATOM   2122 H HD3  . LYS A 1 140 ? 65.353 36.158  48.788 1.00 96.93  ? 185 LYS A HD3  1 
ATOM   2123 H HE2  . LYS A 1 140 ? 67.265 37.550  48.907 1.00 102.68 ? 185 LYS A HE2  1 
ATOM   2124 H HE3  . LYS A 1 140 ? 66.344 38.692  49.526 1.00 102.68 ? 185 LYS A HE3  1 
ATOM   2125 H HZ1  . LYS A 1 140 ? 67.399 37.537  51.178 1.00 101.33 ? 185 LYS A HZ1  1 
ATOM   2126 H HZ2  . LYS A 1 140 ? 65.972 37.326  51.309 1.00 101.33 ? 185 LYS A HZ2  1 
ATOM   2127 H HZ3  . LYS A 1 140 ? 66.810 36.286  50.746 1.00 101.33 ? 185 LYS A HZ3  1 
ATOM   2128 N N    . THR A 1 141 ? 62.210 36.827  44.200 1.00 72.14  ? 186 THR A N    1 
ATOM   2129 C CA   . THR A 1 141 ? 62.074 37.132  42.782 1.00 76.01  ? 186 THR A CA   1 
ATOM   2130 C C    . THR A 1 141 ? 60.683 36.719  42.323 1.00 71.92  ? 186 THR A C    1 
ATOM   2131 O O    . THR A 1 141 ? 60.349 35.530  42.337 1.00 69.87  ? 186 THR A O    1 
ATOM   2132 C CB   . THR A 1 141 ? 63.143 36.407  41.963 1.00 81.39  ? 186 THR A CB   1 
ATOM   2133 O OG1  . THR A 1 141 ? 64.422 36.564  42.590 1.00 84.52  ? 186 THR A OG1  1 
ATOM   2134 C CG2  . THR A 1 141 ? 63.209 36.969  40.549 1.00 87.26  ? 186 THR A CG2  1 
ATOM   2135 H H    . THR A 1 141 ? 62.193 35.984  44.370 1.00 86.57  ? 186 THR A H    1 
ATOM   2136 H HA   . THR A 1 141 ? 62.173 38.087  42.644 1.00 91.21  ? 186 THR A HA   1 
ATOM   2137 H HB   . THR A 1 141 ? 62.924 35.464  41.908 1.00 97.67  ? 186 THR A HB   1 
ATOM   2138 H HG1  . THR A 1 141 ? 64.403 36.240  43.365 1.00 101.43 ? 186 THR A HG1  1 
ATOM   2139 H HG21 . THR A 1 141 ? 63.890 36.503  40.039 1.00 104.71 ? 186 THR A HG21 1 
ATOM   2140 H HG22 . THR A 1 141 ? 62.353 36.857  40.108 1.00 104.71 ? 186 THR A HG22 1 
ATOM   2141 H HG23 . THR A 1 141 ? 63.428 37.914  40.578 1.00 104.71 ? 186 THR A HG23 1 
ATOM   2142 N N    . ALA A 1 142 ? 59.877 37.699  41.916 1.00 67.50  ? 187 ALA A N    1 
ATOM   2143 C CA   . ALA A 1 142 ? 58.527 37.393  41.456 1.00 64.34  ? 187 ALA A CA   1 
ATOM   2144 C C    . ALA A 1 142 ? 58.552 36.706  40.099 1.00 66.80  ? 187 ALA A C    1 
ATOM   2145 O O    . ALA A 1 142 ? 57.755 35.795  39.845 1.00 65.05  ? 187 ALA A O    1 
ATOM   2146 C CB   . ALA A 1 142 ? 57.689 38.668  41.390 1.00 63.28  ? 187 ALA A CB   1 
ATOM   2147 H H    . ALA A 1 142 ? 60.084 38.534  41.896 1.00 81.00  ? 187 ALA A H    1 
ATOM   2148 H HA   . ALA A 1 142 ? 58.107 36.791  42.089 1.00 77.21  ? 187 ALA A HA   1 
ATOM   2149 H HB1  . ALA A 1 142 ? 56.797 38.443  41.083 1.00 75.93  ? 187 ALA A HB1  1 
ATOM   2150 H HB2  . ALA A 1 142 ? 57.645 39.062  42.276 1.00 75.93  ? 187 ALA A HB2  1 
ATOM   2151 H HB3  . ALA A 1 142 ? 58.106 39.288  40.772 1.00 75.93  ? 187 ALA A HB3  1 
ATOM   2152 N N    . SER A 1 143 ? 59.457 37.129  39.214 1.00 72.12  ? 188 SER A N    1 
ATOM   2153 C CA   . SER A 1 143 ? 59.550 36.519  37.895 1.00 76.78  ? 188 SER A CA   1 
ATOM   2154 C C    . SER A 1 143 ? 59.948 35.052  37.967 1.00 78.69  ? 188 SER A C    1 
ATOM   2155 O O    . SER A 1 143 ? 59.777 34.326  36.981 1.00 82.53  ? 188 SER A O    1 
ATOM   2156 C CB   . SER A 1 143 ? 60.556 37.283  37.035 1.00 81.12  ? 188 SER A CB   1 
ATOM   2157 O OG   . SER A 1 143 ? 61.846 37.265  37.623 1.00 80.32  ? 188 SER A OG   1 
ATOM   2158 H H    . SER A 1 143 ? 60.022 37.762  39.355 1.00 86.55  ? 188 SER A H    1 
ATOM   2159 H HA   . SER A 1 143 ? 58.684 36.572  37.461 1.00 92.13  ? 188 SER A HA   1 
ATOM   2160 H HB2  . SER A 1 143 ? 60.603 36.867  36.160 1.00 97.34  ? 188 SER A HB2  1 
ATOM   2161 H HB3  . SER A 1 143 ? 60.262 38.204  36.948 1.00 97.34  ? 188 SER A HB3  1 
ATOM   2162 H HG   . SER A 1 143 ? 62.388 37.689  37.141 1.00 96.39  ? 188 SER A HG   1 
ATOM   2163 N N    . ASP A 1 144 ? 60.482 34.603  39.103 1.00 81.52  ? 189 ASP A N    1 
ATOM   2164 C CA   . ASP A 1 144 ? 60.899 33.213  39.276 1.00 84.12  ? 189 ASP A CA   1 
ATOM   2165 C C    . ASP A 1 144 ? 59.649 32.339  39.337 1.00 81.71  ? 189 ASP A C    1 
ATOM   2166 O O    . ASP A 1 144 ? 59.171 31.946  40.403 1.00 78.25  ? 189 ASP A O    1 
ATOM   2167 C CB   . ASP A 1 144 ? 61.751 33.066  40.532 1.00 86.37  ? 189 ASP A CB   1 
ATOM   2168 C CG   . ASP A 1 144 ? 62.385 31.695  40.653 1.00 90.23  ? 189 ASP A CG   1 
ATOM   2169 O OD1  . ASP A 1 144 ? 63.472 31.595  41.258 1.00 91.61  ? 189 ASP A OD1  1 
ATOM   2170 O OD2  . ASP A 1 144 ? 61.798 30.717  40.146 1.00 91.84  ? 189 ASP A OD2  1 
ATOM   2171 H H    . ASP A 1 144 ? 60.615 35.092  39.798 1.00 97.82  ? 189 ASP A H    1 
ATOM   2172 H HA   . ASP A 1 144 ? 61.429 32.937  38.512 1.00 100.94 ? 189 ASP A HA   1 
ATOM   2173 H HB2  . ASP A 1 144 ? 62.463 33.724  40.509 1.00 103.65 ? 189 ASP A HB2  1 
ATOM   2174 H HB3  . ASP A 1 144 ? 61.192 33.209  41.311 1.00 103.65 ? 189 ASP A HB3  1 
ATOM   2175 N N    . GLN A 1 145 ? 59.105 32.037  38.154 1.00 85.33  ? 190 GLN A N    1 
ATOM   2176 C CA   . GLN A 1 145 ? 57.945 31.154  38.071 1.00 85.06  ? 190 GLN A CA   1 
ATOM   2177 C C    . GLN A 1 145 ? 58.248 29.782  38.660 1.00 81.44  ? 190 GLN A C    1 
ATOM   2178 O O    . GLN A 1 145 ? 57.344 29.110  39.171 1.00 75.76  ? 190 GLN A O    1 
ATOM   2179 C CB   . GLN A 1 145 ? 57.495 31.018  36.615 1.00 90.74  ? 190 GLN A CB   1 
ATOM   2180 C CG   . GLN A 1 145 ? 57.092 32.333  35.958 1.00 96.46  ? 190 GLN A CG   1 
ATOM   2181 C CD   . GLN A 1 145 ? 56.986 32.233  34.439 1.00 104.22 ? 190 GLN A CD   1 
ATOM   2182 O OE1  . GLN A 1 145 ? 56.860 31.141  33.877 1.00 105.75 ? 190 GLN A OE1  1 
ATOM   2183 N NE2  . GLN A 1 145 ? 57.044 33.381  33.768 1.00 106.98 ? 190 GLN A NE2  1 
ATOM   2184 H H    . GLN A 1 145 ? 59.386 32.327  37.395 1.00 102.40 ? 190 GLN A H    1 
ATOM   2185 H HA   . GLN A 1 145 ? 57.215 31.543  38.577 1.00 102.08 ? 190 GLN A HA   1 
ATOM   2186 H HB2  . GLN A 1 145 ? 58.223 30.641  36.098 1.00 108.89 ? 190 GLN A HB2  1 
ATOM   2187 H HB3  . GLN A 1 145 ? 56.728 30.425  36.581 1.00 108.89 ? 190 GLN A HB3  1 
ATOM   2188 H HG2  . GLN A 1 145 ? 56.227 32.606  36.301 1.00 115.75 ? 190 GLN A HG2  1 
ATOM   2189 H HG3  . GLN A 1 145 ? 57.759 33.007  36.167 1.00 115.75 ? 190 GLN A HG3  1 
ATOM   2190 H HE21 . GLN A 1 145 ? 57.137 34.123  34.193 1.00 128.38 ? 190 GLN A HE21 1 
ATOM   2191 H HE22 . GLN A 1 145 ? 56.989 33.380  32.910 1.00 128.38 ? 190 GLN A HE22 1 
ATOM   2192 N N    . ALA A 1 146 ? 59.510 29.351  38.602 1.00 72.87  ? 191 ALA A N    1 
ATOM   2193 C CA   . ALA A 1 146 ? 59.881 28.064  39.178 1.00 68.09  ? 191 ALA A CA   1 
ATOM   2194 C C    . ALA A 1 146 ? 59.704 28.066  40.690 1.00 71.19  ? 191 ALA A C    1 
ATOM   2195 O O    . ALA A 1 146 ? 59.182 27.102  41.262 1.00 64.58  ? 191 ALA A O    1 
ATOM   2196 C CB   . ALA A 1 146 ? 61.325 27.721  38.807 1.00 69.71  ? 191 ALA A CB   1 
ATOM   2197 H H    . ALA A 1 146 ? 60.161 29.782  38.239 1.00 87.45  ? 191 ALA A H    1 
ATOM   2198 H HA   . ALA A 1 146 ? 59.305 27.375  38.810 1.00 81.71  ? 191 ALA A HA   1 
ATOM   2199 H HB1  . ALA A 1 146 ? 61.555 26.863  39.197 1.00 83.65  ? 191 ALA A HB1  1 
ATOM   2200 H HB2  . ALA A 1 146 ? 61.400 27.676  37.841 1.00 83.65  ? 191 ALA A HB2  1 
ATOM   2201 H HB3  . ALA A 1 146 ? 61.912 28.411  39.154 1.00 83.65  ? 191 ALA A HB3  1 
ATOM   2202 N N    . THR A 1 147 ? 60.139 29.139  41.356 1.00 80.29  ? 192 THR A N    1 
ATOM   2203 C CA   . THR A 1 147 ? 59.991 29.223  42.805 1.00 76.55  ? 192 THR A CA   1 
ATOM   2204 C C    . THR A 1 147 ? 58.547 29.504  43.192 1.00 69.46  ? 192 THR A C    1 
ATOM   2205 O O    . THR A 1 147 ? 58.042 28.949  44.174 1.00 69.42  ? 192 THR A O    1 
ATOM   2206 C CB   . THR A 1 147 ? 60.909 30.310  43.362 1.00 70.21  ? 192 THR A CB   1 
ATOM   2207 O OG1  . THR A 1 147 ? 62.270 29.991  43.051 1.00 75.12  ? 192 THR A OG1  1 
ATOM   2208 C CG2  . THR A 1 147 ? 60.759 30.431  44.869 1.00 69.26  ? 192 THR A CG2  1 
ATOM   2209 H H    . THR A 1 147 ? 60.519 29.821  40.995 1.00 96.34  ? 192 THR A H    1 
ATOM   2210 H HA   . THR A 1 147 ? 60.250 28.376  43.201 1.00 91.86  ? 192 THR A HA   1 
ATOM   2211 H HB   . THR A 1 147 ? 60.678 31.163  42.962 1.00 84.26  ? 192 THR A HB   1 
ATOM   2212 H HG1  . THR A 1 147 ? 62.477 29.252  43.393 1.00 90.14  ? 192 THR A HG1  1 
ATOM   2213 H HG21 . THR A 1 147 ? 61.348 31.124  45.206 1.00 83.12  ? 192 THR A HG21 1 
ATOM   2214 H HG22 . THR A 1 147 ? 59.843 30.659  45.093 1.00 83.12  ? 192 THR A HG22 1 
ATOM   2215 H HG23 . THR A 1 147 ? 60.987 29.589  45.293 1.00 83.12  ? 192 THR A HG23 1 
ATOM   2216 N N    . THR A 1 148 ? 57.870 30.370  42.437 1.00 70.21  ? 193 THR A N    1 
ATOM   2217 C CA   . THR A 1 148 ? 56.488 30.707  42.755 1.00 65.23  ? 193 THR A CA   1 
ATOM   2218 C C    . THR A 1 148 ? 55.601 29.471  42.737 1.00 62.70  ? 193 THR A C    1 
ATOM   2219 O O    . THR A 1 148 ? 54.666 29.358  43.538 1.00 60.11  ? 193 THR A O    1 
ATOM   2220 C CB   . THR A 1 148 ? 55.971 31.750  41.769 1.00 67.92  ? 193 THR A CB   1 
ATOM   2221 O OG1  . THR A 1 148 ? 56.777 32.928  41.869 1.00 67.36  ? 193 THR A OG1  1 
ATOM   2222 C CG2  . THR A 1 148 ? 54.526 32.113  42.073 1.00 65.40  ? 193 THR A CG2  1 
ATOM   2223 H H    . THR A 1 148 ? 58.186 30.770  41.745 1.00 84.25  ? 193 THR A H    1 
ATOM   2224 H HA   . THR A 1 148 ? 56.452 31.090  43.645 1.00 78.28  ? 193 THR A HA   1 
ATOM   2225 H HB   . THR A 1 148 ? 56.019 31.398  40.867 1.00 81.50  ? 193 THR A HB   1 
ATOM   2226 H HG1  . THR A 1 148 ? 57.577 32.745  41.687 1.00 80.83  ? 193 THR A HG1  1 
ATOM   2227 H HG21 . THR A 1 148 ? 54.211 32.776  41.439 1.00 78.48  ? 193 THR A HG21 1 
ATOM   2228 H HG22 . THR A 1 148 ? 53.966 31.324  42.008 1.00 78.48  ? 193 THR A HG22 1 
ATOM   2229 H HG23 . THR A 1 148 ? 54.457 32.475  42.970 1.00 78.48  ? 193 THR A HG23 1 
ATOM   2230 N N    . ALA A 1 149 ? 55.875 28.532  41.829 1.00 70.94  ? 194 ALA A N    1 
ATOM   2231 C CA   . ALA A 1 149 ? 55.058 27.327  41.748 1.00 70.41  ? 194 ALA A CA   1 
ATOM   2232 C C    . ALA A 1 149 ? 55.352 26.380  42.905 1.00 67.08  ? 194 ALA A C    1 
ATOM   2233 O O    . ALA A 1 149 ? 54.426 25.821  43.505 1.00 65.24  ? 194 ALA A O    1 
ATOM   2234 C CB   . ALA A 1 149 ? 55.291 26.627  40.413 1.00 75.33  ? 194 ALA A CB   1 
ATOM   2235 H H    . ALA A 1 149 ? 56.518 28.570  41.259 1.00 85.13  ? 194 ALA A H    1 
ATOM   2236 H HA   . ALA A 1 149 ? 54.122 27.576  41.796 1.00 84.49  ? 194 ALA A HA   1 
ATOM   2237 H HB1  . ALA A 1 149 ? 54.742 25.828  40.375 1.00 90.40  ? 194 ALA A HB1  1 
ATOM   2238 H HB2  . ALA A 1 149 ? 55.049 27.230  39.694 1.00 90.40  ? 194 ALA A HB2  1 
ATOM   2239 H HB3  . ALA A 1 149 ? 56.229 26.387  40.342 1.00 90.40  ? 194 ALA A HB3  1 
ATOM   2240 N N    . ARG A 1 150 ? 56.632 26.185  43.233 1.00 60.89  ? 195 ARG A N    1 
ATOM   2241 C CA   . ARG A 1 150 ? 56.981 25.322  44.357 1.00 57.16  ? 195 ARG A CA   1 
ATOM   2242 C C    . ARG A 1 150 ? 56.351 25.832  45.644 1.00 50.27  ? 195 ARG A C    1 
ATOM   2243 O O    . ARG A 1 150 ? 55.747 25.065  46.403 1.00 47.62  ? 195 ARG A O    1 
ATOM   2244 C CB   . ARG A 1 150 ? 58.500 25.230  44.506 1.00 59.90  ? 195 ARG A CB   1 
ATOM   2245 C CG   . ARG A 1 150 ? 59.177 24.350  43.473 1.00 66.27  ? 195 ARG A CG   1 
ATOM   2246 C CD   . ARG A 1 150 ? 60.679 24.261  43.721 1.00 71.49  ? 195 ARG A CD   1 
ATOM   2247 N NE   . ARG A 1 150 ? 61.343 23.351  42.792 1.00 79.50  ? 195 ARG A NE   1 
ATOM   2248 C CZ   . ARG A 1 150 ? 61.622 23.643  41.524 1.00 86.97  ? 195 ARG A CZ   1 
ATOM   2249 N NH1  . ARG A 1 150 ? 61.285 24.824  41.018 1.00 88.10  ? 195 ARG A NH1  1 
ATOM   2250 N NH2  . ARG A 1 150 ? 62.234 22.751  40.753 1.00 90.96  ? 195 ARG A NH2  1 
ATOM   2251 H H    . ARG A 1 150 ? 57.304 26.535  42.826 1.00 73.07  ? 195 ARG A H    1 
ATOM   2252 H HA   . ARG A 1 150 ? 56.641 24.430  44.189 1.00 68.59  ? 195 ARG A HA   1 
ATOM   2253 H HB2  . ARG A 1 150 ? 58.875 26.121  44.425 1.00 71.88  ? 195 ARG A HB2  1 
ATOM   2254 H HB3  . ARG A 1 150 ? 58.706 24.868  45.382 1.00 71.88  ? 195 ARG A HB3  1 
ATOM   2255 H HG2  . ARG A 1 150 ? 58.806 23.455  43.522 1.00 79.52  ? 195 ARG A HG2  1 
ATOM   2256 H HG3  . ARG A 1 150 ? 59.035 24.725  42.590 1.00 79.52  ? 195 ARG A HG3  1 
ATOM   2257 H HD2  . ARG A 1 150 ? 61.071 25.142  43.612 1.00 85.79  ? 195 ARG A HD2  1 
ATOM   2258 H HD3  . ARG A 1 150 ? 60.833 23.937  44.622 1.00 85.79  ? 195 ARG A HD3  1 
ATOM   2259 H HE   . ARG A 1 150 ? 61.569 22.574  43.084 1.00 95.40  ? 195 ARG A HE   1 
ATOM   2260 H HH11 . ARG A 1 150 ? 60.889 25.406  41.513 1.00 105.72 ? 195 ARG A HH11 1 
ATOM   2261 H HH12 . ARG A 1 150 ? 61.466 25.008  40.198 1.00 105.72 ? 195 ARG A HH12 1 
ATOM   2262 H HH21 . ARG A 1 150 ? 62.453 21.984  41.074 1.00 109.15 ? 195 ARG A HH21 1 
ATOM   2263 H HH22 . ARG A 1 150 ? 62.410 22.941  39.933 1.00 109.15 ? 195 ARG A HH22 1 
ATOM   2264 N N    . ILE A 1 151 ? 56.479 27.133  45.909 1.00 49.77  ? 196 ILE A N    1 
ATOM   2265 C CA   . ILE A 1 151 ? 55.902 27.702  47.123 1.00 46.94  ? 196 ILE A CA   1 
ATOM   2266 C C    . ILE A 1 151 ? 54.404 27.430  47.178 1.00 48.03  ? 196 ILE A C    1 
ATOM   2267 O O    . ILE A 1 151 ? 53.864 27.053  48.226 1.00 45.63  ? 196 ILE A O    1 
ATOM   2268 C CB   . ILE A 1 151 ? 56.212 29.207  47.201 1.00 47.18  ? 196 ILE A CB   1 
ATOM   2269 C CG1  . ILE A 1 151 ? 57.718 29.413  47.380 1.00 48.12  ? 196 ILE A CG1  1 
ATOM   2270 C CG2  . ILE A 1 151 ? 55.443 29.856  48.341 1.00 44.66  ? 196 ILE A CG2  1 
ATOM   2271 C CD1  . ILE A 1 151 ? 58.161 30.872  47.335 1.00 48.51  ? 196 ILE A CD1  1 
ATOM   2272 H H    . ILE A 1 151 ? 56.891 27.699  45.408 1.00 59.72  ? 196 ILE A H    1 
ATOM   2273 H HA   . ILE A 1 151 ? 56.309 27.275  47.893 1.00 56.33  ? 196 ILE A HA   1 
ATOM   2274 H HB   . ILE A 1 151 ? 55.939 29.623  46.368 1.00 56.61  ? 196 ILE A HB   1 
ATOM   2275 H HG12 . ILE A 1 151 ? 57.981 29.051  48.240 1.00 57.74  ? 196 ILE A HG12 1 
ATOM   2276 H HG13 . ILE A 1 151 ? 58.182 28.942  46.671 1.00 57.74  ? 196 ILE A HG13 1 
ATOM   2277 H HG21 . ILE A 1 151 ? 55.657 30.802  48.367 1.00 53.60  ? 196 ILE A HG21 1 
ATOM   2278 H HG22 . ILE A 1 151 ? 54.493 29.736  48.189 1.00 53.60  ? 196 ILE A HG22 1 
ATOM   2279 H HG23 . ILE A 1 151 ? 55.702 29.435  49.176 1.00 53.60  ? 196 ILE A HG23 1 
ATOM   2280 H HD11 . ILE A 1 151 ? 59.123 30.913  47.456 1.00 58.21  ? 196 ILE A HD11 1 
ATOM   2281 H HD12 . ILE A 1 151 ? 57.919 31.249  46.475 1.00 58.21  ? 196 ILE A HD12 1 
ATOM   2282 H HD13 . ILE A 1 151 ? 57.717 31.358  48.047 1.00 58.21  ? 196 ILE A HD13 1 
ATOM   2283 N N    . ARG A 1 152 ? 53.707 27.614  46.054 1.00 57.30  ? 197 ARG A N    1 
ATOM   2284 C CA   . ARG A 1 152 ? 52.269 27.377  46.039 1.00 63.37  ? 197 ARG A CA   1 
ATOM   2285 C C    . ARG A 1 152 ? 51.950 25.943  46.439 1.00 62.04  ? 197 ARG A C    1 
ATOM   2286 O O    . ARG A 1 152 ? 51.162 25.700  47.359 1.00 59.42  ? 197 ARG A O    1 
ATOM   2287 C CB   . ARG A 1 152 ? 51.695 27.683  44.658 1.00 72.46  ? 197 ARG A CB   1 
ATOM   2288 C CG   . ARG A 1 152 ? 50.173 27.631  44.627 1.00 80.23  ? 197 ARG A CG   1 
ATOM   2289 C CD   . ARG A 1 152 ? 49.625 27.730  43.220 1.00 89.59  ? 197 ARG A CD   1 
ATOM   2290 N NE   . ARG A 1 152 ? 48.167 27.835  43.218 1.00 94.48  ? 197 ARG A NE   1 
ATOM   2291 C CZ   . ARG A 1 152 ? 47.428 28.063  42.136 1.00 102.10 ? 197 ARG A CZ   1 
ATOM   2292 N NH1  . ARG A 1 152 ? 48.004 28.215  40.948 1.00 106.24 ? 197 ARG A NH1  1 
ATOM   2293 N NH2  . ARG A 1 152 ? 46.108 28.144  42.241 1.00 104.20 ? 197 ARG A NH2  1 
ATOM   2294 H H    . ARG A 1 152 ? 54.039 27.870  45.303 1.00 68.75  ? 197 ARG A H    1 
ATOM   2295 H HA   . ARG A 1 152 ? 51.844 27.969  46.679 1.00 76.05  ? 197 ARG A HA   1 
ATOM   2296 H HB2  . ARG A 1 152 ? 51.970 28.575  44.392 1.00 86.95  ? 197 ARG A HB2  1 
ATOM   2297 H HB3  . ARG A 1 152 ? 52.031 27.029  44.025 1.00 86.95  ? 197 ARG A HB3  1 
ATOM   2298 H HG2  . ARG A 1 152 ? 49.877 26.790  45.008 1.00 96.28  ? 197 ARG A HG2  1 
ATOM   2299 H HG3  . ARG A 1 152 ? 49.820 28.374  45.142 1.00 96.28  ? 197 ARG A HG3  1 
ATOM   2300 H HD2  . ARG A 1 152 ? 49.986 28.521  42.790 1.00 107.50 ? 197 ARG A HD2  1 
ATOM   2301 H HD3  . ARG A 1 152 ? 49.872 26.935  42.723 1.00 107.50 ? 197 ARG A HD3  1 
ATOM   2302 H HE   . ARG A 1 152 ? 47.758 27.742  43.970 1.00 113.38 ? 197 ARG A HE   1 
ATOM   2303 H HH11 . ARG A 1 152 ? 48.860 28.164  40.875 1.00 127.49 ? 197 ARG A HH11 1 
ATOM   2304 H HH12 . ARG A 1 152 ? 47.522 28.362  40.252 1.00 127.49 ? 197 ARG A HH12 1 
ATOM   2305 H HH21 . ARG A 1 152 ? 45.731 28.047  43.008 1.00 125.05 ? 197 ARG A HH21 1 
ATOM   2306 H HH22 . ARG A 1 152 ? 45.629 28.291  41.542 1.00 125.05 ? 197 ARG A HH22 1 
ATOM   2307 N N    . ASP A 1 153 ? 52.558 24.976  45.754 1.00 59.41  ? 198 ASP A N    1 
ATOM   2308 C CA   . ASP A 1 153 ? 52.302 23.584  46.082 1.00 57.08  ? 198 ASP A CA   1 
ATOM   2309 C C    . ASP A 1 153 ? 52.681 23.278  47.524 1.00 53.78  ? 198 ASP A C    1 
ATOM   2310 O O    . ASP A 1 153 ? 52.029 22.453  48.174 1.00 52.37  ? 198 ASP A O    1 
ATOM   2311 C CB   . ASP A 1 153 ? 53.064 22.678  45.119 1.00 59.48  ? 198 ASP A CB   1 
ATOM   2312 C CG   . ASP A 1 153 ? 52.698 22.937  43.673 1.00 61.51  ? 198 ASP A CG   1 
ATOM   2313 O OD1  . ASP A 1 153 ? 51.662 23.599  43.433 1.00 61.57  ? 198 ASP A OD1  1 
ATOM   2314 O OD2  . ASP A 1 153 ? 53.438 22.476  42.780 1.00 63.68  ? 198 ASP A OD2  1 
ATOM   2315 H H    . ASP A 1 153 ? 53.112 25.099  45.108 1.00 71.29  ? 198 ASP A H    1 
ATOM   2316 H HA   . ASP A 1 153 ? 51.355 23.404  45.977 1.00 68.50  ? 198 ASP A HA   1 
ATOM   2317 H HB2  . ASP A 1 153 ? 54.016 22.835  45.222 1.00 71.37  ? 198 ASP A HB2  1 
ATOM   2318 H HB3  . ASP A 1 153 ? 52.856 21.753  45.322 1.00 71.37  ? 198 ASP A HB3  1 
ATOM   2319 N N    . THR A 1 154 ? 53.716 23.939  48.049 1.00 49.98  ? 199 THR A N    1 
ATOM   2320 C CA   . THR A 1 154 ? 54.113 23.687  49.430 1.00 46.56  ? 199 THR A CA   1 
ATOM   2321 C C    . THR A 1 154 ? 53.072 24.230  50.401 1.00 43.01  ? 199 THR A C    1 
ATOM   2322 O O    . THR A 1 154 ? 52.681 23.544  51.351 1.00 42.34  ? 199 THR A O    1 
ATOM   2323 C CB   . THR A 1 154 ? 55.489 24.294  49.709 1.00 46.93  ? 199 THR A CB   1 
ATOM   2324 O OG1  . THR A 1 154 ? 56.461 23.686  48.848 1.00 49.39  ? 199 THR A OG1  1 
ATOM   2325 C CG2  . THR A 1 154 ? 55.905 24.052  51.154 1.00 45.08  ? 199 THR A CG2  1 
ATOM   2326 H H    . THR A 1 154 ? 54.193 24.523  47.636 1.00 59.97  ? 199 THR A H    1 
ATOM   2327 H HA   . THR A 1 154 ? 54.177 22.729  49.568 1.00 55.87  ? 199 THR A HA   1 
ATOM   2328 H HB   . THR A 1 154 ? 55.464 25.251  49.549 1.00 56.32  ? 199 THR A HB   1 
ATOM   2329 H HG1  . THR A 1 154 ? 56.257 23.820  48.045 1.00 59.27  ? 199 THR A HG1  1 
ATOM   2330 H HG21 . THR A 1 154 ? 56.779 24.441  51.318 1.00 54.10  ? 199 THR A HG21 1 
ATOM   2331 H HG22 . THR A 1 154 ? 55.262 24.456  51.757 1.00 54.10  ? 199 THR A HG22 1 
ATOM   2332 H HG23 . THR A 1 154 ? 55.947 23.099  51.331 1.00 54.10  ? 199 THR A HG23 1 
ATOM   2333 N N    . LEU A 1 155 ? 52.619 25.467  50.188 1.00 44.28  ? 200 LEU A N    1 
ATOM   2334 C CA   . LEU A 1 155 ? 51.551 26.011  51.019 1.00 43.79  ? 200 LEU A CA   1 
ATOM   2335 C C    . LEU A 1 155 ? 50.371 25.051  51.068 1.00 44.97  ? 200 LEU A C    1 
ATOM   2336 O O    . LEU A 1 155 ? 49.850 24.741  52.145 1.00 43.39  ? 200 LEU A O    1 
ATOM   2337 C CB   . LEU A 1 155 ? 51.108 27.377  50.484 1.00 44.29  ? 200 LEU A CB   1 
ATOM   2338 C CG   . LEU A 1 155 ? 51.985 28.594  50.790 1.00 44.23  ? 200 LEU A CG   1 
ATOM   2339 C CD1  . LEU A 1 155 ? 51.536 29.769  49.941 1.00 45.28  ? 200 LEU A CD1  1 
ATOM   2340 C CD2  . LEU A 1 155 ? 51.937 28.967  52.270 1.00 42.51  ? 200 LEU A CD2  1 
ATOM   2341 H H    . LEU A 1 155 ? 52.909 26.001  49.579 1.00 53.13  ? 200 LEU A H    1 
ATOM   2342 H HA   . LEU A 1 155 ? 51.881 26.132  51.923 1.00 52.55  ? 200 LEU A HA   1 
ATOM   2343 H HB2  . LEU A 1 155 ? 51.046 27.311  49.518 1.00 53.15  ? 200 LEU A HB2  1 
ATOM   2344 H HB3  . LEU A 1 155 ? 50.228 27.566  50.845 1.00 53.15  ? 200 LEU A HB3  1 
ATOM   2345 H HG   . LEU A 1 155 ? 52.905 28.389  50.560 1.00 53.07  ? 200 LEU A HG   1 
ATOM   2346 H HD11 . LEU A 1 155 ? 52.097 30.535  50.141 1.00 54.34  ? 200 LEU A HD11 1 
ATOM   2347 H HD12 . LEU A 1 155 ? 51.622 29.532  49.004 1.00 54.34  ? 200 LEU A HD12 1 
ATOM   2348 H HD13 . LEU A 1 155 ? 50.611 29.973  50.148 1.00 54.34  ? 200 LEU A HD13 1 
ATOM   2349 H HD21 . LEU A 1 155 ? 52.504 29.740  52.419 1.00 51.01  ? 200 LEU A HD21 1 
ATOM   2350 H HD22 . LEU A 1 155 ? 51.021 29.176  52.513 1.00 51.01  ? 200 LEU A HD22 1 
ATOM   2351 H HD23 . LEU A 1 155 ? 52.256 28.216  52.795 1.00 51.01  ? 200 LEU A HD23 1 
ATOM   2352 N N    . ARG A 1 156 ? 49.951 24.556  49.902 1.00 50.10  ? 201 ARG A N    1 
ATOM   2353 C CA   . ARG A 1 156 ? 48.828 23.627  49.839 1.00 53.83  ? 201 ARG A CA   1 
ATOM   2354 C C    . ARG A 1 156 ? 49.011 22.483  50.828 1.00 50.09  ? 201 ARG A C    1 
ATOM   2355 O O    . ARG A 1 156 ? 48.132 22.210  51.653 1.00 49.40  ? 201 ARG A O    1 
ATOM   2356 C CB   . ARG A 1 156 ? 48.681 23.098  48.409 1.00 61.49  ? 201 ARG A CB   1 
ATOM   2357 C CG   . ARG A 1 156 ? 47.371 22.359  48.126 1.00 68.45  ? 201 ARG A CG   1 
ATOM   2358 C CD   . ARG A 1 156 ? 47.508 20.836  48.263 1.00 74.35  ? 201 ARG A CD   1 
ATOM   2359 N NE   . ARG A 1 156 ? 48.490 20.271  47.336 1.00 78.92  ? 201 ARG A NE   1 
ATOM   2360 C CZ   . ARG A 1 156 ? 48.772 18.974  47.235 1.00 83.48  ? 201 ARG A CZ   1 
ATOM   2361 N NH1  . ARG A 1 156 ? 48.143 18.090  48.000 1.00 84.35  ? 201 ARG A NH1  1 
ATOM   2362 N NH2  . ARG A 1 156 ? 49.688 18.556  46.368 1.00 85.45  ? 201 ARG A NH2  1 
ATOM   2363 H H    . ARG A 1 156 ? 50.299 24.743  49.139 1.00 60.12  ? 201 ARG A H    1 
ATOM   2364 H HA   . ARG A 1 156 ? 48.013 24.098  50.071 1.00 64.59  ? 201 ARG A HA   1 
ATOM   2365 H HB2  . ARG A 1 156 ? 48.733 23.847  47.796 1.00 73.79  ? 201 ARG A HB2  1 
ATOM   2366 H HB3  . ARG A 1 156 ? 49.408 22.481  48.232 1.00 73.79  ? 201 ARG A HB3  1 
ATOM   2367 H HG2  . ARG A 1 156 ? 46.697 22.658  48.757 1.00 82.15  ? 201 ARG A HG2  1 
ATOM   2368 H HG3  . ARG A 1 156 ? 47.087 22.555  47.219 1.00 82.15  ? 201 ARG A HG3  1 
ATOM   2369 H HD2  . ARG A 1 156 ? 47.791 20.624  49.166 1.00 89.22  ? 201 ARG A HD2  1 
ATOM   2370 H HD3  . ARG A 1 156 ? 46.649 20.424  48.079 1.00 89.22  ? 201 ARG A HD3  1 
ATOM   2371 H HE   . ARG A 1 156 ? 48.913 20.815  46.821 1.00 94.70  ? 201 ARG A HE   1 
ATOM   2372 H HH11 . ARG A 1 156 ? 47.551 18.355  48.565 1.00 101.22 ? 201 ARG A HH11 1 
ATOM   2373 H HH12 . ARG A 1 156 ? 48.327 17.253  47.931 1.00 101.22 ? 201 ARG A HH12 1 
ATOM   2374 H HH21 . ARG A 1 156 ? 50.098 19.124  45.869 1.00 102.53 ? 201 ARG A HH21 1 
ATOM   2375 H HH22 . ARG A 1 156 ? 49.867 17.717  46.302 1.00 102.53 ? 201 ARG A HH22 1 
ATOM   2376 N N    . ARG A 1 157 ? 50.169 21.821  50.783 1.00 45.57  ? 202 ARG A N    1 
ATOM   2377 C CA   . ARG A 1 157 ? 50.390 20.665  51.645 1.00 42.81  ? 202 ARG A CA   1 
ATOM   2378 C C    . ARG A 1 157 ? 50.634 21.086  53.088 1.00 41.71  ? 202 ARG A C    1 
ATOM   2379 O O    . ARG A 1 157 ? 50.150 20.437  54.021 1.00 41.26  ? 202 ARG A O    1 
ATOM   2380 C CB   . ARG A 1 157 ? 51.568 19.843  51.121 1.00 40.69  ? 202 ARG A CB   1 
ATOM   2381 C CG   . ARG A 1 157 ? 51.410 19.367  49.692 1.00 41.13  ? 202 ARG A CG   1 
ATOM   2382 C CD   . ARG A 1 157 ? 52.500 18.359  49.315 1.00 42.38  ? 202 ARG A CD   1 
ATOM   2383 N NE   . ARG A 1 157 ? 53.825 18.974  49.275 1.00 41.41  ? 202 ARG A NE   1 
ATOM   2384 C CZ   . ARG A 1 157 ? 54.404 19.469  48.185 1.00 43.05  ? 202 ARG A CZ   1 
ATOM   2385 N NH1  . ARG A 1 157 ? 53.793 19.429  47.009 1.00 44.43  ? 202 ARG A NH1  1 
ATOM   2386 N NH2  . ARG A 1 157 ? 55.612 20.009  48.275 1.00 42.71  ? 202 ARG A NH2  1 
ATOM   2387 H H    . ARG A 1 157 ? 50.831 22.019  50.270 1.00 54.68  ? 202 ARG A H    1 
ATOM   2388 H HA   . ARG A 1 157 ? 49.600 20.102  51.626 1.00 51.37  ? 202 ARG A HA   1 
ATOM   2389 H HB2  . ARG A 1 157 ? 52.370 20.387  51.163 1.00 48.83  ? 202 ARG A HB2  1 
ATOM   2390 H HB3  . ARG A 1 157 ? 51.674 19.059  51.683 1.00 48.83  ? 202 ARG A HB3  1 
ATOM   2391 H HG2  . ARG A 1 157 ? 50.547 18.934  49.593 1.00 49.35  ? 202 ARG A HG2  1 
ATOM   2392 H HG3  . ARG A 1 157 ? 51.476 20.126  49.092 1.00 49.35  ? 202 ARG A HG3  1 
ATOM   2393 H HD2  . ARG A 1 157 ? 52.517 17.647  49.973 1.00 50.85  ? 202 ARG A HD2  1 
ATOM   2394 H HD3  . ARG A 1 157 ? 52.308 17.996  48.436 1.00 50.85  ? 202 ARG A HD3  1 
ATOM   2395 H HE   . ARG A 1 157 ? 54.265 19.018  50.013 1.00 49.69  ? 202 ARG A HE   1 
ATOM   2396 H HH11 . ARG A 1 157 ? 53.009 19.082  46.943 1.00 53.31  ? 202 ARG A HH11 1 
ATOM   2397 H HH12 . ARG A 1 157 ? 54.180 19.753  46.312 1.00 53.31  ? 202 ARG A HH12 1 
ATOM   2398 H HH21 . ARG A 1 157 ? 56.016 20.037  49.034 1.00 51.26  ? 202 ARG A HH21 1 
ATOM   2399 H HH22 . ARG A 1 157 ? 55.993 20.328  47.573 1.00 51.26  ? 202 ARG A HH22 1 
ATOM   2400 N N    . VAL A 1 158 ? 51.362 22.184  53.293 1.00 41.23  ? 203 VAL A N    1 
ATOM   2401 C CA   . VAL A 1 158 ? 51.800 22.551  54.636 1.00 40.72  ? 203 VAL A CA   1 
ATOM   2402 C C    . VAL A 1 158 ? 50.652 23.136  55.452 1.00 39.04  ? 203 VAL A C    1 
ATOM   2403 O O    . VAL A 1 158 ? 50.575 22.930  56.671 1.00 37.80  ? 203 VAL A O    1 
ATOM   2404 C CB   . VAL A 1 158 ? 52.986 23.525  54.533 1.00 42.10  ? 203 VAL A CB   1 
ATOM   2405 C CG1  . VAL A 1 158 ? 53.106 24.368  55.781 1.00 40.99  ? 203 VAL A CG1  1 
ATOM   2406 C CG2  . VAL A 1 158 ? 54.281 22.736  54.276 1.00 43.61  ? 203 VAL A CG2  1 
ATOM   2407 H H    . VAL A 1 158 ? 51.612 22.727  52.676 1.00 49.48  ? 203 VAL A H    1 
ATOM   2408 H HA   . VAL A 1 158 ? 52.111 21.753  55.092 1.00 48.87  ? 203 VAL A HA   1 
ATOM   2409 H HB   . VAL A 1 158 ? 52.842 24.120  53.781 1.00 50.53  ? 203 VAL A HB   1 
ATOM   2410 H HG11 . VAL A 1 158 ? 53.861 24.970  55.683 1.00 49.19  ? 203 VAL A HG11 1 
ATOM   2411 H HG12 . VAL A 1 158 ? 52.289 24.878  55.897 1.00 49.19  ? 203 VAL A HG12 1 
ATOM   2412 H HG13 . VAL A 1 158 ? 53.243 23.785  56.543 1.00 49.19  ? 203 VAL A HG13 1 
ATOM   2413 H HG21 . VAL A 1 158 ? 55.022 23.358  54.213 1.00 52.33  ? 203 VAL A HG21 1 
ATOM   2414 H HG22 . VAL A 1 158 ? 54.427 22.121  55.012 1.00 52.33  ? 203 VAL A HG22 1 
ATOM   2415 H HG23 . VAL A 1 158 ? 54.191 22.243  53.446 1.00 52.33  ? 203 VAL A HG23 1 
ATOM   2416 N N    . LEU A 1 159 ? 49.767 23.902  54.811 1.00 38.97  ? 204 LEU A N    1 
ATOM   2417 C CA   . LEU A 1 159 ? 48.585 24.431  55.484 1.00 39.71  ? 204 LEU A CA   1 
ATOM   2418 C C    . LEU A 1 159 ? 47.373 23.507  55.369 1.00 45.24  ? 204 LEU A C    1 
ATOM   2419 O O    . LEU A 1 159 ? 46.318 23.816  55.934 1.00 45.10  ? 204 LEU A O    1 
ATOM   2420 C CB   . LEU A 1 159 ? 48.240 25.817  54.926 1.00 37.93  ? 204 LEU A CB   1 
ATOM   2421 C CG   . LEU A 1 159 ? 49.399 26.831  54.875 1.00 36.54  ? 204 LEU A CG   1 
ATOM   2422 C CD1  . LEU A 1 159 ? 48.895 28.187  54.429 1.00 35.46  ? 204 LEU A CD1  1 
ATOM   2423 C CD2  . LEU A 1 159 ? 50.106 26.946  56.219 1.00 33.81  ? 204 LEU A CD2  1 
ATOM   2424 H H    . LEU A 1 159 ? 49.830 24.129  53.984 1.00 46.76  ? 204 LEU A H    1 
ATOM   2425 H HA   . LEU A 1 159 ? 48.786 24.536  56.427 1.00 47.65  ? 204 LEU A HA   1 
ATOM   2426 H HB2  . LEU A 1 159 ? 47.911 25.708  54.020 1.00 45.51  ? 204 LEU A HB2  1 
ATOM   2427 H HB3  . LEU A 1 159 ? 47.542 26.204  55.478 1.00 45.51  ? 204 LEU A HB3  1 
ATOM   2428 H HG   . LEU A 1 159 ? 50.051 26.527  54.223 1.00 43.85  ? 204 LEU A HG   1 
ATOM   2429 H HD11 . LEU A 1 159 ? 49.640 28.808  54.404 1.00 42.55  ? 204 LEU A HD11 1 
ATOM   2430 H HD12 . LEU A 1 159 ? 48.504 28.103  53.545 1.00 42.55  ? 204 LEU A HD12 1 
ATOM   2431 H HD13 . LEU A 1 159 ? 48.226 28.497  55.059 1.00 42.55  ? 204 LEU A HD13 1 
ATOM   2432 H HD21 . LEU A 1 159 ? 50.826 27.592  56.142 1.00 40.58  ? 204 LEU A HD21 1 
ATOM   2433 H HD22 . LEU A 1 159 ? 49.468 27.241  56.887 1.00 40.58  ? 204 LEU A HD22 1 
ATOM   2434 H HD23 . LEU A 1 159 ? 50.465 26.079  56.462 1.00 40.58  ? 204 LEU A HD23 1 
ATOM   2435 N N    . ASN A 1 160 ? 47.496 22.383  54.671 1.00 53.60  ? 205 ASN A N    1 
ATOM   2436 C CA   . ASN A 1 160 ? 46.393 21.442  54.501 1.00 59.93  ? 205 ASN A CA   1 
ATOM   2437 C C    . ASN A 1 160 ? 45.172 22.146  53.912 1.00 60.15  ? 205 ASN A C    1 
ATOM   2438 O O    . ASN A 1 160 ? 44.066 22.112  54.457 1.00 61.73  ? 205 ASN A O    1 
ATOM   2439 C CB   . ASN A 1 160 ? 46.052 20.758  55.829 1.00 64.94  ? 205 ASN A CB   1 
ATOM   2440 C CG   . ASN A 1 160 ? 46.881 19.507  56.071 1.00 70.29  ? 205 ASN A CG   1 
ATOM   2441 O OD1  . ASN A 1 160 ? 47.924 19.552  56.726 1.00 70.32  ? 205 ASN A OD1  1 
ATOM   2442 N ND2  . ASN A 1 160 ? 46.417 18.379  55.536 1.00 73.59  ? 205 ASN A ND2  1 
ATOM   2443 H H    . ASN A 1 160 ? 48.221 22.138  54.279 1.00 64.32  ? 205 ASN A H    1 
ATOM   2444 H HA   . ASN A 1 160 ? 46.665 20.753  53.876 1.00 71.92  ? 205 ASN A HA   1 
ATOM   2445 H HB2  . ASN A 1 160 ? 46.222 21.377  56.556 1.00 77.93  ? 205 ASN A HB2  1 
ATOM   2446 H HB3  . ASN A 1 160 ? 45.116 20.502  55.822 1.00 77.93  ? 205 ASN A HB3  1 
ATOM   2447 H HD21 . ASN A 1 160 ? 46.848 17.643  55.643 1.00 88.31  ? 205 ASN A HD21 1 
ATOM   2448 H HD22 . ASN A 1 160 ? 45.686 18.387  55.083 1.00 88.31  ? 205 ASN A HD22 1 
ATOM   2449 N N    . LEU A 1 161 ? 45.394 22.784  52.770 1.00 54.77  ? 206 LEU A N    1 
ATOM   2450 C CA   . LEU A 1 161 ? 44.326 23.521  52.111 1.00 52.48  ? 206 LEU A CA   1 
ATOM   2451 C C    . LEU A 1 161 ? 43.469 22.570  51.285 1.00 51.97  ? 206 LEU A C    1 
ATOM   2452 O O    . LEU A 1 161 ? 44.014 21.737  50.550 1.00 53.05  ? 206 LEU A O    1 
ATOM   2453 C CB   . LEU A 1 161 ? 44.896 24.610  51.208 1.00 51.17  ? 206 LEU A CB   1 
ATOM   2454 C CG   . LEU A 1 161 ? 45.807 25.649  51.856 1.00 48.49  ? 206 LEU A CG   1 
ATOM   2455 C CD1  . LEU A 1 161 ? 46.184 26.711  50.831 1.00 48.82  ? 206 LEU A CD1  1 
ATOM   2456 C CD2  . LEU A 1 161 ? 45.148 26.278  53.073 1.00 47.12  ? 206 LEU A CD2  1 
ATOM   2457 H H    . LEU A 1 161 ? 46.149 22.805  52.359 1.00 65.72  ? 206 LEU A H    1 
ATOM   2458 H HA   . LEU A 1 161 ? 43.763 23.941  52.780 1.00 62.97  ? 206 LEU A HA   1 
ATOM   2459 H HB2  . LEU A 1 161 ? 45.409 24.180  50.506 1.00 61.40  ? 206 LEU A HB2  1 
ATOM   2460 H HB3  . LEU A 1 161 ? 44.154 25.091  50.810 1.00 61.40  ? 206 LEU A HB3  1 
ATOM   2461 H HG   . LEU A 1 161 ? 46.623 25.213  52.149 1.00 58.18  ? 206 LEU A HG   1 
ATOM   2462 H HD11 . LEU A 1 161 ? 46.762 27.365  51.254 1.00 58.58  ? 206 LEU A HD11 1 
ATOM   2463 H HD12 . LEU A 1 161 ? 46.649 26.286  50.093 1.00 58.58  ? 206 LEU A HD12 1 
ATOM   2464 H HD13 . LEU A 1 161 ? 45.376 27.141  50.511 1.00 58.58  ? 206 LEU A HD13 1 
ATOM   2465 H HD21 . LEU A 1 161 ? 45.754 26.930  53.458 1.00 56.54  ? 206 LEU A HD21 1 
ATOM   2466 H HD22 . LEU A 1 161 ? 44.326 26.711  52.797 1.00 56.54  ? 206 LEU A HD22 1 
ATOM   2467 H HD23 . LEU A 1 161 ? 44.955 25.583  53.722 1.00 56.54  ? 206 LEU A HD23 1 
ATOM   2468 N N    . PRO A 1 162 ? 42.142 22.658  51.375 1.00 48.65  ? 207 PRO A N    1 
ATOM   2469 C CA   . PRO A 1 162 ? 41.283 21.881  50.482 1.00 49.44  ? 207 PRO A CA   1 
ATOM   2470 C C    . PRO A 1 162 ? 41.645 22.138  49.032 1.00 51.11  ? 207 PRO A C    1 
ATOM   2471 O O    . PRO A 1 162 ? 42.141 23.224  48.695 1.00 48.52  ? 207 PRO A O    1 
ATOM   2472 C CB   . PRO A 1 162 ? 39.877 22.400  50.807 1.00 50.03  ? 207 PRO A CB   1 
ATOM   2473 C CG   . PRO A 1 162 ? 39.973 22.865  52.205 1.00 48.32  ? 207 PRO A CG   1 
ATOM   2474 C CD   . PRO A 1 162 ? 41.359 23.398  52.380 1.00 45.89  ? 207 PRO A CD   1 
ATOM   2475 H HA   . PRO A 1 162 ? 41.342 20.933  50.679 1.00 59.33  ? 207 PRO A HA   1 
ATOM   2476 H HB2  . PRO A 1 162 ? 39.651 23.134  50.214 1.00 60.04  ? 207 PRO A HB2  1 
ATOM   2477 H HB3  . PRO A 1 162 ? 39.232 21.680  50.727 1.00 60.04  ? 207 PRO A HB3  1 
ATOM   2478 H HG2  . PRO A 1 162 ? 39.319 23.565  52.358 1.00 57.98  ? 207 PRO A HG2  1 
ATOM   2479 H HG3  . PRO A 1 162 ? 39.819 22.119  52.805 1.00 57.98  ? 207 PRO A HG3  1 
ATOM   2480 H HD2  . PRO A 1 162 ? 41.381 24.349  52.192 1.00 55.07  ? 207 PRO A HD2  1 
ATOM   2481 H HD3  . PRO A 1 162 ? 41.685 23.204  53.272 1.00 55.07  ? 207 PRO A HD3  1 
ATOM   2482 N N    . PRO A 1 163 ? 41.390 21.176  48.140 1.00 59.74  ? 208 PRO A N    1 
ATOM   2483 C CA   . PRO A 1 163 ? 41.925 21.294  46.772 1.00 64.34  ? 208 PRO A CA   1 
ATOM   2484 C C    . PRO A 1 163 ? 41.547 22.582  46.061 1.00 67.28  ? 208 PRO A C    1 
ATOM   2485 O O    . PRO A 1 163 ? 42.381 23.147  45.340 1.00 68.80  ? 208 PRO A O    1 
ATOM   2486 C CB   . PRO A 1 163 ? 41.345 20.059  46.062 1.00 66.72  ? 208 PRO A CB   1 
ATOM   2487 C CG   . PRO A 1 163 ? 40.215 19.586  46.926 1.00 66.47  ? 208 PRO A CG   1 
ATOM   2488 C CD   . PRO A 1 163 ? 40.596 19.951  48.323 1.00 63.33  ? 208 PRO A CD   1 
ATOM   2489 H HA   . PRO A 1 163 ? 42.892 21.219  46.789 1.00 77.21  ? 208 PRO A HA   1 
ATOM   2490 H HB2  . PRO A 1 163 ? 41.020 20.311  45.184 1.00 80.06  ? 208 PRO A HB2  1 
ATOM   2491 H HB3  . PRO A 1 163 ? 42.028 19.374  45.989 1.00 80.06  ? 208 PRO A HB3  1 
ATOM   2492 H HG2  . PRO A 1 163 ? 39.397 20.037  46.666 1.00 79.76  ? 208 PRO A HG2  1 
ATOM   2493 H HG3  . PRO A 1 163 ? 40.119 18.625  46.839 1.00 79.76  ? 208 PRO A HG3  1 
ATOM   2494 H HD2  . PRO A 1 163 ? 39.804 20.136  48.853 1.00 76.00  ? 208 PRO A HD2  1 
ATOM   2495 H HD3  . PRO A 1 163 ? 41.137 19.251  48.721 1.00 76.00  ? 208 PRO A HD3  1 
ATOM   2496 N N    . ASN A 1 164 ? 40.320 23.071  46.241 1.00 66.81  ? 209 ASN A N    1 
ATOM   2497 C CA   . ASN A 1 164 ? 39.838 24.227  45.497 1.00 68.13  ? 209 ASN A CA   1 
ATOM   2498 C C    . ASN A 1 164 ? 40.108 25.560  46.205 1.00 62.52  ? 209 ASN A C    1 
ATOM   2499 O O    . ASN A 1 164 ? 39.518 26.579  45.830 1.00 62.32  ? 209 ASN A O    1 
ATOM   2500 C CB   . ASN A 1 164 ? 38.343 24.072  45.215 1.00 74.48  ? 209 ASN A CB   1 
ATOM   2501 C CG   . ASN A 1 164 ? 38.067 23.164  44.031 1.00 80.21  ? 209 ASN A CG   1 
ATOM   2502 O OD1  . ASN A 1 164 ? 38.931 22.396  43.606 1.00 82.10  ? 209 ASN A OD1  1 
ATOM   2503 N ND2  . ASN A 1 164 ? 36.861 23.254  43.485 1.00 84.94  ? 209 ASN A ND2  1 
ATOM   2504 H H    . ASN A 1 164 ? 39.745 22.746  46.792 1.00 80.17  ? 209 ASN A H    1 
ATOM   2505 H HA   . ASN A 1 164 ? 40.295 24.255  44.642 1.00 81.75  ? 209 ASN A HA   1 
ATOM   2506 H HB2  . ASN A 1 164 ? 37.911 23.690  45.994 1.00 89.38  ? 209 ASN A HB2  1 
ATOM   2507 H HB3  . ASN A 1 164 ? 37.965 24.944  45.019 1.00 89.38  ? 209 ASN A HB3  1 
ATOM   2508 H HD21 . ASN A 1 164 ? 36.655 22.760  42.811 1.00 101.93 ? 209 ASN A HD21 1 
ATOM   2509 H HD22 . ASN A 1 164 ? 36.284 23.806  43.805 1.00 101.93 ? 209 ASN A HD22 1 
ATOM   2510 N N    . THR A 1 165 ? 40.993 25.583  47.197 1.00 56.34  ? 210 THR A N    1 
ATOM   2511 C CA   . THR A 1 165 ? 41.268 26.823  47.909 1.00 53.33  ? 210 THR A CA   1 
ATOM   2512 C C    . THR A 1 165 ? 41.828 27.873  46.956 1.00 54.88  ? 210 THR A C    1 
ATOM   2513 O O    . THR A 1 165 ? 42.710 27.587  46.140 1.00 54.84  ? 210 THR A O    1 
ATOM   2514 C CB   . THR A 1 165 ? 42.253 26.568  49.050 1.00 47.99  ? 210 THR A CB   1 
ATOM   2515 O OG1  . THR A 1 165 ? 41.675 25.643  49.980 1.00 47.95  ? 210 THR A OG1  1 
ATOM   2516 C CG2  . THR A 1 165 ? 42.597 27.864  49.772 1.00 45.63  ? 210 THR A CG2  1 
ATOM   2517 H H    . THR A 1 165 ? 41.441 24.903  47.473 1.00 67.61  ? 210 THR A H    1 
ATOM   2518 H HA   . THR A 1 165 ? 40.444 27.165  48.289 1.00 63.99  ? 210 THR A HA   1 
ATOM   2519 H HB   . THR A 1 165 ? 43.072 26.193  48.689 1.00 57.58  ? 210 THR A HB   1 
ATOM   2520 H HG1  . THR A 1 165 ? 41.504 24.917  49.594 1.00 57.54  ? 210 THR A HG1  1 
ATOM   2521 H HG21 . THR A 1 165 ? 43.222 27.686  50.492 1.00 54.76  ? 210 THR A HG21 1 
ATOM   2522 H HG22 . THR A 1 165 ? 43.001 28.492  49.153 1.00 54.76  ? 210 THR A HG22 1 
ATOM   2523 H HG23 . THR A 1 165 ? 41.793 28.260  50.144 1.00 54.76  ? 210 THR A HG23 1 
ATOM   2524 N N    . ILE A 1 166 ? 41.314 29.101  47.075 1.00 53.41  ? 211 ILE A N    1 
ATOM   2525 C CA   . ILE A 1 166 ? 41.721 30.215  46.223 1.00 54.86  ? 211 ILE A CA   1 
ATOM   2526 C C    . ILE A 1 166 ? 42.963 30.869  46.812 1.00 51.49  ? 211 ILE A C    1 
ATOM   2527 O O    . ILE A 1 166 ? 42.982 31.246  47.990 1.00 48.15  ? 211 ILE A O    1 
ATOM   2528 C CB   . ILE A 1 166 ? 40.586 31.242  46.077 1.00 59.66  ? 211 ILE A CB   1 
ATOM   2529 C CG1  . ILE A 1 166 ? 39.410 30.649  45.293 1.00 64.30  ? 211 ILE A CG1  1 
ATOM   2530 C CG2  . ILE A 1 166 ? 41.081 32.501  45.375 1.00 59.63  ? 211 ILE A CG2  1 
ATOM   2531 C CD1  . ILE A 1 166 ? 38.418 29.873  46.147 1.00 67.58  ? 211 ILE A CD1  1 
ATOM   2532 H H    . ILE A 1 166 ? 40.717 29.314  47.656 1.00 64.09  ? 211 ILE A H    1 
ATOM   2533 H HA   . ILE A 1 166 ? 41.943 29.879  45.341 1.00 65.83  ? 211 ILE A HA   1 
ATOM   2534 H HB   . ILE A 1 166 ? 40.274 31.486  46.962 1.00 71.59  ? 211 ILE A HB   1 
ATOM   2535 H HG12 . ILE A 1 166 ? 38.927 31.372  44.863 1.00 77.16  ? 211 ILE A HG12 1 
ATOM   2536 H HG13 . ILE A 1 166 ? 39.759 30.043  44.621 1.00 77.16  ? 211 ILE A HG13 1 
ATOM   2537 H HG21 . ILE A 1 166 ? 40.346 33.129  45.297 1.00 71.56  ? 211 ILE A HG21 1 
ATOM   2538 H HG22 . ILE A 1 166 ? 41.797 32.893  45.898 1.00 71.56  ? 211 ILE A HG22 1 
ATOM   2539 H HG23 . ILE A 1 166 ? 41.408 32.263  44.493 1.00 71.56  ? 211 ILE A HG23 1 
ATOM   2540 H HD11 . ILE A 1 166 ? 37.710 29.534  45.578 1.00 81.10  ? 211 ILE A HD11 1 
ATOM   2541 H HD12 . ILE A 1 166 ? 38.881 29.136  46.576 1.00 81.10  ? 211 ILE A HD12 1 
ATOM   2542 H HD13 . ILE A 1 166 ? 38.048 30.467  46.818 1.00 81.10  ? 211 ILE A HD13 1 
ATOM   2543 N N    . MET A 1 167 ? 43.991 31.024  45.982 1.00 57.28  ? 212 MET A N    1 
ATOM   2544 C CA   . MET A 1 167 ? 45.230 31.690  46.354 1.00 58.56  ? 212 MET A CA   1 
ATOM   2545 C C    . MET A 1 167 ? 45.609 32.652  45.240 1.00 58.66  ? 212 MET A C    1 
ATOM   2546 O O    . MET A 1 167 ? 45.381 32.365  44.061 1.00 60.67  ? 212 MET A O    1 
ATOM   2547 C CB   . MET A 1 167 ? 46.369 30.690  46.575 1.00 61.72  ? 212 MET A CB   1 
ATOM   2548 C CG   . MET A 1 167 ? 46.032 29.541  47.515 1.00 63.74  ? 212 MET A CG   1 
ATOM   2549 S SD   . MET A 1 167 ? 47.332 28.285  47.607 1.00 68.33  ? 212 MET A SD   1 
ATOM   2550 C CE   . MET A 1 167 ? 48.718 29.244  48.188 1.00 66.04  ? 212 MET A CE   1 
ATOM   2551 H H    . MET A 1 167 ? 43.990 30.741  45.170 1.00 68.73  ? 212 MET A H    1 
ATOM   2552 H HA   . MET A 1 167 ? 45.095 32.187  47.176 1.00 70.27  ? 212 MET A HA   1 
ATOM   2553 H HB2  . MET A 1 167 ? 46.615 30.306  45.719 1.00 74.07  ? 212 MET A HB2  1 
ATOM   2554 H HB3  . MET A 1 167 ? 47.129 31.163  46.950 1.00 74.07  ? 212 MET A HB3  1 
ATOM   2555 H HG2  . MET A 1 167 ? 45.896 29.896  48.408 1.00 76.48  ? 212 MET A HG2  1 
ATOM   2556 H HG3  . MET A 1 167 ? 45.221 29.109  47.205 1.00 76.48  ? 212 MET A HG3  1 
ATOM   2557 H HE1  . MET A 1 167 ? 49.489 28.662  48.276 1.00 79.25  ? 212 MET A HE1  1 
ATOM   2558 H HE2  . MET A 1 167 ? 48.905 29.947  47.547 1.00 79.25  ? 212 MET A HE2  1 
ATOM   2559 H HE3  . MET A 1 167 ? 48.494 29.631  49.049 1.00 79.25  ? 212 MET A HE3  1 
ATOM   2560 N N    . GLU A 1 168 ? 46.185 33.790  45.613 1.00 57.37  ? 213 GLU A N    1 
ATOM   2561 C CA   . GLU A 1 168 ? 46.602 34.805  44.655 1.00 61.40  ? 213 GLU A CA   1 
ATOM   2562 C C    . GLU A 1 168 ? 48.068 35.147  44.870 1.00 57.72  ? 213 GLU A C    1 
ATOM   2563 O O    . GLU A 1 168 ? 48.523 35.288  46.009 1.00 53.70  ? 213 GLU A O    1 
ATOM   2564 C CB   . GLU A 1 168 ? 45.761 36.077  44.783 1.00 67.65  ? 213 GLU A CB   1 
ATOM   2565 C CG   . GLU A 1 168 ? 44.281 35.871  44.520 1.00 74.83  ? 213 GLU A CG   1 
ATOM   2566 C CD   . GLU A 1 168 ? 43.499 37.175  44.529 1.00 80.67  ? 213 GLU A CD   1 
ATOM   2567 O OE1  . GLU A 1 168 ? 44.131 38.252  44.610 1.00 83.18  ? 213 GLU A OE1  1 
ATOM   2568 O OE2  . GLU A 1 168 ? 42.253 37.120  44.455 1.00 84.19  ? 213 GLU A OE2  1 
ATOM   2569 H H    . GLU A 1 168 ? 46.348 34.000  46.431 1.00 68.85  ? 213 GLU A H    1 
ATOM   2570 H HA   . GLU A 1 168 ? 46.498 34.459  43.755 1.00 73.68  ? 213 GLU A HA   1 
ATOM   2571 H HB2  . GLU A 1 168 ? 45.855 36.423  45.684 1.00 81.17  ? 213 GLU A HB2  1 
ATOM   2572 H HB3  . GLU A 1 168 ? 46.086 36.731  44.145 1.00 81.17  ? 213 GLU A HB3  1 
ATOM   2573 H HG2  . GLU A 1 168 ? 44.169 35.460  43.649 1.00 89.79  ? 213 GLU A HG2  1 
ATOM   2574 H HG3  . GLU A 1 168 ? 43.914 35.296  45.209 1.00 89.79  ? 213 GLU A HG3  1 
ATOM   2575 N N    . TYR A 1 169 ? 48.802 35.290  43.768 1.00 61.92  ? 214 TYR A N    1 
ATOM   2576 C CA   . TYR A 1 169 ? 50.188 35.743  43.796 1.00 61.82  ? 214 TYR A CA   1 
ATOM   2577 C C    . TYR A 1 169 ? 50.226 37.173  43.276 1.00 66.21  ? 214 TYR A C    1 
ATOM   2578 O O    . TYR A 1 169 ? 49.973 37.414  42.092 1.00 69.00  ? 214 TYR A O    1 
ATOM   2579 C CB   . TYR A 1 169 ? 51.092 34.839  42.963 1.00 61.53  ? 214 TYR A CB   1 
ATOM   2580 C CG   . TYR A 1 169 ? 52.557 35.151  43.160 1.00 60.12  ? 214 TYR A CG   1 
ATOM   2581 C CD1  . TYR A 1 169 ? 53.256 34.627  44.240 1.00 56.87  ? 214 TYR A CD1  1 
ATOM   2582 C CD2  . TYR A 1 169 ? 53.234 35.986  42.283 1.00 62.11  ? 214 TYR A CD2  1 
ATOM   2583 C CE1  . TYR A 1 169 ? 54.588 34.917  44.436 1.00 57.03  ? 214 TYR A CE1  1 
ATOM   2584 C CE2  . TYR A 1 169 ? 54.569 36.281  42.470 1.00 62.18  ? 214 TYR A CE2  1 
ATOM   2585 C CZ   . TYR A 1 169 ? 55.239 35.744  43.548 1.00 59.49  ? 214 TYR A CZ   1 
ATOM   2586 O OH   . TYR A 1 169 ? 56.566 36.030  43.744 1.00 59.96  ? 214 TYR A OH   1 
ATOM   2587 H H    . TYR A 1 169 ? 48.511 35.128  42.975 1.00 74.31  ? 214 TYR A H    1 
ATOM   2588 H HA   . TYR A 1 169 ? 50.511 35.740  44.711 1.00 74.18  ? 214 TYR A HA   1 
ATOM   2589 H HB2  . TYR A 1 169 ? 50.944 33.916  43.222 1.00 73.83  ? 214 TYR A HB2  1 
ATOM   2590 H HB3  . TYR A 1 169 ? 50.883 34.959  42.023 1.00 73.83  ? 214 TYR A HB3  1 
ATOM   2591 H HD1  . TYR A 1 169 ? 52.818 34.069  44.841 1.00 68.24  ? 214 TYR A HD1  1 
ATOM   2592 H HD2  . TYR A 1 169 ? 52.783 36.350  41.556 1.00 74.53  ? 214 TYR A HD2  1 
ATOM   2593 H HE1  . TYR A 1 169 ? 55.045 34.556  45.161 1.00 68.43  ? 214 TYR A HE1  1 
ATOM   2594 H HE2  . TYR A 1 169 ? 55.013 36.839  41.873 1.00 74.61  ? 214 TYR A HE2  1 
ATOM   2595 H HH   . TYR A 1 169 ? 56.845 35.639  44.433 1.00 71.96  ? 214 TYR A HH   1 
ATOM   2596 N N    . LYS A 1 170 ? 50.537 38.115  44.160 1.00 67.31  ? 215 LYS A N    1 
ATOM   2597 C CA   . LYS A 1 170 ? 50.616 39.523  43.804 1.00 72.07  ? 215 LYS A CA   1 
ATOM   2598 C C    . LYS A 1 170 ? 52.069 39.955  43.665 1.00 71.56  ? 215 LYS A C    1 
ATOM   2599 O O    . LYS A 1 170 ? 52.940 39.512  44.419 1.00 67.79  ? 215 LYS A O    1 
ATOM   2600 C CB   . LYS A 1 170 ? 49.915 40.394  44.848 1.00 75.86  ? 215 LYS A CB   1 
ATOM   2601 C CG   . LYS A 1 170 ? 48.393 40.334  44.787 1.00 80.89  ? 215 LYS A CG   1 
ATOM   2602 C CD   . LYS A 1 170 ? 47.755 41.346  45.734 1.00 84.71  ? 215 LYS A CD   1 
ATOM   2603 C CE   . LYS A 1 170 ? 46.269 41.062  45.941 1.00 87.60  ? 215 LYS A CE   1 
ATOM   2604 N NZ   . LYS A 1 170 ? 45.658 41.931  46.997 1.00 88.81  ? 215 LYS A NZ   1 
ATOM   2605 H H    . LYS A 1 170 ? 50.709 37.958  44.988 1.00 80.77  ? 215 LYS A H    1 
ATOM   2606 H HA   . LYS A 1 170 ? 50.177 39.660  42.950 1.00 86.48  ? 215 LYS A HA   1 
ATOM   2607 H HB2  . LYS A 1 170 ? 50.188 40.102  45.732 1.00 91.03  ? 215 LYS A HB2  1 
ATOM   2608 H HB3  . LYS A 1 170 ? 50.180 41.317  44.712 1.00 91.03  ? 215 LYS A HB3  1 
ATOM   2609 H HG2  . LYS A 1 170 ? 48.100 40.536  43.885 1.00 97.07  ? 215 LYS A HG2  1 
ATOM   2610 H HG3  . LYS A 1 170 ? 48.097 39.447  45.046 1.00 97.07  ? 215 LYS A HG3  1 
ATOM   2611 H HD2  . LYS A 1 170 ? 48.196 41.300  46.596 1.00 101.65 ? 215 LYS A HD2  1 
ATOM   2612 H HD3  . LYS A 1 170 ? 47.845 42.236  45.358 1.00 101.65 ? 215 LYS A HD3  1 
ATOM   2613 H HE2  . LYS A 1 170 ? 45.797 41.223  45.109 1.00 105.12 ? 215 LYS A HE2  1 
ATOM   2614 H HE3  . LYS A 1 170 ? 46.158 40.137  46.212 1.00 105.12 ? 215 LYS A HE3  1 
ATOM   2615 H HZ1  . LYS A 1 170 ? 44.794 41.737  47.089 1.00 106.58 ? 215 LYS A HZ1  1 
ATOM   2616 H HZ2  . LYS A 1 170 ? 46.068 41.798  47.775 1.00 106.58 ? 215 LYS A HZ2  1 
ATOM   2617 H HZ3  . LYS A 1 170 ? 45.739 42.788  46.770 1.00 106.58 ? 215 LYS A HZ3  1 
ATOM   2618 N N    . THR A 1 171 ? 52.318 40.816  42.687 1.00 74.70  ? 216 THR A N    1 
ATOM   2619 C CA   . THR A 1 171 ? 53.601 41.468  42.488 1.00 77.67  ? 216 THR A CA   1 
ATOM   2620 C C    . THR A 1 171 ? 53.399 42.978  42.572 1.00 89.74  ? 216 THR A C    1 
ATOM   2621 O O    . THR A 1 171 ? 52.292 43.470  42.803 1.00 84.79  ? 216 THR A O    1 
ATOM   2622 C CB   . THR A 1 171 ? 54.216 41.068  41.144 1.00 82.04  ? 216 THR A CB   1 
ATOM   2623 O OG1  . THR A 1 171 ? 53.440 41.615  40.073 1.00 83.33  ? 216 THR A OG1  1 
ATOM   2624 C CG2  . THR A 1 171 ? 54.248 39.557  41.005 1.00 79.84  ? 216 THR A CG2  1 
ATOM   2625 H H    . THR A 1 171 ? 51.731 41.046  42.102 1.00 89.64  ? 216 THR A H    1 
ATOM   2626 H HA   . THR A 1 171 ? 54.211 41.201  43.194 1.00 93.20  ? 216 THR A HA   1 
ATOM   2627 H HB   . THR A 1 171 ? 55.125 41.402  41.090 1.00 98.44  ? 216 THR A HB   1 
ATOM   2628 H HG1  . THR A 1 171 ? 53.775 41.397  39.335 1.00 100.00 ? 216 THR A HG1  1 
ATOM   2629 H HG21 . THR A 1 171 ? 54.639 39.311  40.152 1.00 95.81  ? 216 THR A HG21 1 
ATOM   2630 H HG22 . THR A 1 171 ? 54.780 39.170  41.718 1.00 95.81  ? 216 THR A HG22 1 
ATOM   2631 H HG23 . THR A 1 171 ? 53.348 39.201  41.054 1.00 95.81  ? 216 THR A HG23 1 
ATOM   2632 N N    . HIS A 1 172 ? 54.487 43.718  42.379 1.00 104.82 ? 217 HIS A N    1 
ATOM   2633 C CA   . HIS A 1 172 ? 54.443 45.171  42.425 1.00 114.17 ? 217 HIS A CA   1 
ATOM   2634 C C    . HIS A 1 172 ? 54.284 45.803  41.050 1.00 115.67 ? 217 HIS A C    1 
ATOM   2635 O O    . HIS A 1 172 ? 54.033 47.010  40.966 1.00 120.68 ? 217 HIS A O    1 
ATOM   2636 C CB   . HIS A 1 172 ? 55.711 45.707  43.096 1.00 112.31 ? 217 HIS A CB   1 
ATOM   2637 C CG   . HIS A 1 172 ? 56.006 45.065  44.415 1.00 112.52 ? 217 HIS A CG   1 
ATOM   2638 N ND1  . HIS A 1 172 ? 56.221 43.711  44.552 1.00 110.51 ? 217 HIS A ND1  1 
ATOM   2639 C CD2  . HIS A 1 172 ? 56.117 45.590  45.658 1.00 111.76 ? 217 HIS A CD2  1 
ATOM   2640 C CE1  . HIS A 1 172 ? 56.452 43.428  45.821 1.00 107.99 ? 217 HIS A CE1  1 
ATOM   2641 N NE2  . HIS A 1 172 ? 56.395 44.551  46.513 1.00 108.38 ? 217 HIS A NE2  1 
ATOM   2642 H H    . HIS A 1 172 ? 55.268 43.397  42.218 1.00 125.79 ? 217 HIS A H    1 
ATOM   2643 H HA   . HIS A 1 172 ? 53.684 45.443  42.965 1.00 137.00 ? 217 HIS A HA   1 
ATOM   2644 H HB2  . HIS A 1 172 ? 56.467 45.546  42.511 1.00 134.77 ? 217 HIS A HB2  1 
ATOM   2645 H HB3  . HIS A 1 172 ? 55.607 46.660  43.246 1.00 134.77 ? 217 HIS A HB3  1 
ATOM   2646 H HD2  . HIS A 1 172 ? 56.023 46.486  45.889 1.00 134.12 ? 217 HIS A HD2  1 
ATOM   2647 H HE1  . HIS A 1 172 ? 56.627 42.583  46.168 1.00 129.59 ? 217 HIS A HE1  1 
ATOM   2648 H HE2  . HIS A 1 172 ? 56.514 44.621  47.362 1.00 130.05 ? 217 HIS A HE2  1 
ATOM   2649 N N    . THR A 1 173 ? 54.418 45.023  39.981 1.00 117.83 ? 218 THR A N    1 
ATOM   2650 C CA   . THR A 1 173 ? 54.256 45.533  38.625 1.00 123.17 ? 218 THR A CA   1 
ATOM   2651 C C    . THR A 1 173 ? 52.912 45.097  38.048 1.00 123.35 ? 218 THR A C    1 
ATOM   2652 O O    . THR A 1 173 ? 52.084 44.517  38.751 1.00 120.04 ? 218 THR A O    1 
ATOM   2653 C CB   . THR A 1 173 ? 55.395 45.051  37.696 1.00 126.68 ? 218 THR A CB   1 
ATOM   2654 O OG1  . THR A 1 173 ? 55.191 45.567  36.374 1.00 131.37 ? 218 THR A OG1  1 
ATOM   2655 C CG2  . THR A 1 173 ? 55.455 43.525  37.645 1.00 124.61 ? 218 THR A CG2  1 
ATOM   2656 H H    . THR A 1 173 ? 54.605 44.185  40.017 1.00 141.39 ? 218 THR A H    1 
ATOM   2657 H HA   . THR A 1 173 ? 54.275 46.502  38.646 1.00 147.80 ? 218 THR A HA   1 
ATOM   2658 H HB   . THR A 1 173 ? 56.243 45.376  38.037 1.00 152.02 ? 218 THR A HB   1 
ATOM   2659 H HG1  . THR A 1 173 ? 55.807 45.308  35.866 1.00 157.64 ? 218 THR A HG1  1 
ATOM   2660 H HG21 . THR A 1 173 ? 56.174 43.241  37.059 1.00 149.54 ? 218 THR A HG21 1 
ATOM   2661 H HG22 . THR A 1 173 ? 55.614 43.171  38.534 1.00 149.54 ? 218 THR A HG22 1 
ATOM   2662 H HG23 . THR A 1 173 ? 54.616 43.172  37.310 1.00 149.54 ? 218 THR A HG23 1 
ATOM   2663 N N    . LYS B 2 7   ? 70.011 25.827  45.899 1.00 107.55 ? 37  LYS B N    1 
ATOM   2664 C CA   . LYS B 2 7   ? 70.671 25.909  47.196 1.00 106.09 ? 37  LYS B CA   1 
ATOM   2665 C C    . LYS B 2 7   ? 70.002 24.982  48.209 1.00 101.22 ? 37  LYS B C    1 
ATOM   2666 O O    . LYS B 2 7   ? 68.776 24.855  48.229 1.00 99.08  ? 37  LYS B O    1 
ATOM   2667 C CB   . LYS B 2 7   ? 70.648 27.344  47.718 1.00 105.41 ? 37  LYS B CB   1 
ATOM   2668 C CG   . LYS B 2 7   ? 70.812 28.402  46.645 1.00 108.42 ? 37  LYS B CG   1 
ATOM   2669 C CD   . LYS B 2 7   ? 70.855 29.791  47.256 1.00 107.91 ? 37  LYS B CD   1 
ATOM   2670 C CE   . LYS B 2 7   ? 70.810 30.878  46.195 1.00 109.67 ? 37  LYS B CE   1 
ATOM   2671 N NZ   . LYS B 2 7   ? 71.892 30.732  45.185 1.00 113.96 ? 37  LYS B NZ   1 
ATOM   2672 H H    . LYS B 2 7   ? 69.262 26.249  45.860 1.00 129.07 ? 37  LYS B H    1 
ATOM   2673 H HA   . LYS B 2 7   ? 71.597 25.637  47.101 1.00 127.31 ? 37  LYS B HA   1 
ATOM   2674 H HB2  . LYS B 2 7   ? 69.798 27.501  48.158 1.00 126.50 ? 37  LYS B HB2  1 
ATOM   2675 H HB3  . LYS B 2 7   ? 71.371 27.455  48.354 1.00 126.50 ? 37  LYS B HB3  1 
ATOM   2676 H HG2  . LYS B 2 7   ? 71.644 28.251  46.169 1.00 130.10 ? 37  LYS B HG2  1 
ATOM   2677 H HG3  . LYS B 2 7   ? 70.061 28.359  46.033 1.00 130.10 ? 37  LYS B HG3  1 
ATOM   2678 H HD2  . LYS B 2 7   ? 70.088 29.906  47.840 1.00 129.49 ? 37  LYS B HD2  1 
ATOM   2679 H HD3  . LYS B 2 7   ? 71.677 29.893  47.759 1.00 129.49 ? 37  LYS B HD3  1 
ATOM   2680 H HE2  . LYS B 2 7   ? 69.959 30.833  45.732 1.00 131.60 ? 37  LYS B HE2  1 
ATOM   2681 H HE3  . LYS B 2 7   ? 70.912 31.742  46.622 1.00 131.60 ? 37  LYS B HE3  1 
ATOM   2682 H HZ1  . LYS B 2 7   ? 71.834 31.384  44.581 1.00 136.75 ? 37  LYS B HZ1  1 
ATOM   2683 H HZ2  . LYS B 2 7   ? 72.687 30.776  45.583 1.00 136.75 ? 37  LYS B HZ2  1 
ATOM   2684 H HZ3  . LYS B 2 7   ? 71.818 29.947  44.771 1.00 136.75 ? 37  LYS B HZ3  1 
ATOM   2685 N N    . LEU B 2 8   ? 70.813 24.349  49.055 1.00 94.07  ? 38  LEU B N    1 
ATOM   2686 C CA   . LEU B 2 8   ? 70.335 23.395  50.047 1.00 86.82  ? 38  LEU B CA   1 
ATOM   2687 C C    . LEU B 2 8   ? 70.508 23.959  51.450 1.00 82.17  ? 38  LEU B C    1 
ATOM   2688 O O    . LEU B 2 8   ? 71.492 24.647  51.736 1.00 83.67  ? 38  LEU B O    1 
ATOM   2689 C CB   . LEU B 2 8   ? 71.085 22.065  49.934 1.00 87.01  ? 38  LEU B CB   1 
ATOM   2690 C CG   . LEU B 2 8   ? 71.066 21.400  48.559 1.00 87.01  ? 38  LEU B CG   1 
ATOM   2691 C CD1  . LEU B 2 8   ? 71.795 20.070  48.620 1.00 88.72  ? 38  LEU B CD1  1 
ATOM   2692 C CD2  . LEU B 2 8   ? 69.642 21.211  48.056 1.00 85.17  ? 38  LEU B CD2  1 
ATOM   2693 H H    . LEU B 2 8   ? 71.665 24.461  49.073 1.00 112.88 ? 38  LEU B H    1 
ATOM   2694 H HA   . LEU B 2 8   ? 69.391 23.226  49.901 1.00 104.19 ? 38  LEU B HA   1 
ATOM   2695 H HB2  . LEU B 2 8   ? 72.013 22.218  50.169 1.00 104.41 ? 38  LEU B HB2  1 
ATOM   2696 H HB3  . LEU B 2 8   ? 70.692 21.440  50.563 1.00 104.41 ? 38  LEU B HB3  1 
ATOM   2697 H HG   . LEU B 2 8   ? 71.534 21.968  47.927 1.00 104.41 ? 38  LEU B HG   1 
ATOM   2698 H HD11 . LEU B 2 8   ? 71.776 19.659  47.742 1.00 106.46 ? 38  LEU B HD11 1 
ATOM   2699 H HD12 . LEU B 2 8   ? 72.713 20.226  48.893 1.00 106.46 ? 38  LEU B HD12 1 
ATOM   2700 H HD13 . LEU B 2 8   ? 71.351 19.497  49.264 1.00 106.46 ? 38  LEU B HD13 1 
ATOM   2701 H HD21 . LEU B 2 8   ? 69.669 20.787  47.184 1.00 102.20 ? 38  LEU B HD21 1 
ATOM   2702 H HD22 . LEU B 2 8   ? 69.159 20.649  48.682 1.00 102.20 ? 38  LEU B HD22 1 
ATOM   2703 H HD23 . LEU B 2 8   ? 69.213 22.078  47.990 1.00 102.20 ? 38  LEU B HD23 1 
ATOM   2704 N N    . ALA B 2 9   ? 69.557 23.649  52.326 1.00 75.02  ? 39  ALA B N    1 
ATOM   2705 C CA   . ALA B 2 9   ? 69.566 24.152  53.692 1.00 70.89  ? 39  ALA B CA   1 
ATOM   2706 C C    . ALA B 2 9   ? 70.379 23.232  54.595 1.00 68.51  ? 39  ALA B C    1 
ATOM   2707 O O    . ALA B 2 9   ? 70.283 22.005  54.504 1.00 68.41  ? 39  ALA B O    1 
ATOM   2708 C CB   . ALA B 2 9   ? 68.139 24.279  54.227 1.00 67.70  ? 39  ALA B CB   1 
ATOM   2709 H H    . ALA B 2 9   ? 68.885 23.142  52.149 1.00 90.02  ? 39  ALA B H    1 
ATOM   2710 H HA   . ALA B 2 9   ? 69.976 25.031  53.707 1.00 85.07  ? 39  ALA B HA   1 
ATOM   2711 H HB1  . ALA B 2 9   ? 68.172 24.615  55.137 1.00 81.23  ? 39  ALA B HB1  1 
ATOM   2712 H HB2  . ALA B 2 9   ? 67.645 24.896  53.664 1.00 81.23  ? 39  ALA B HB2  1 
ATOM   2713 H HB3  . ALA B 2 9   ? 67.718 23.406  54.212 1.00 81.23  ? 39  ALA B HB3  1 
ATOM   2714 N N    . ASP B 2 10  ? 71.188 23.840  55.465 1.00 62.64  ? 40  ASP B N    1 
ATOM   2715 C CA   . ASP B 2 10  ? 71.992 23.102  56.428 1.00 59.43  ? 40  ASP B CA   1 
ATOM   2716 C C    . ASP B 2 10  ? 71.285 22.890  57.759 1.00 55.55  ? 40  ASP B C    1 
ATOM   2717 O O    . ASP B 2 10  ? 71.687 22.007  58.524 1.00 53.86  ? 40  ASP B O    1 
ATOM   2718 C CB   . ASP B 2 10  ? 73.311 23.833  56.693 1.00 61.81  ? 40  ASP B CB   1 
ATOM   2719 C CG   . ASP B 2 10  ? 74.192 23.911  55.470 1.00 65.64  ? 40  ASP B CG   1 
ATOM   2720 O OD1  . ASP B 2 10  ? 74.680 22.859  55.009 1.00 66.11  ? 40  ASP B OD1  1 
ATOM   2721 O OD2  . ASP B 2 10  ? 74.412 25.035  54.976 1.00 67.38  ? 40  ASP B OD2  1 
ATOM   2722 H H    . ASP B 2 10  ? 71.287 24.693  55.514 1.00 75.17  ? 40  ASP B H    1 
ATOM   2723 H HA   . ASP B 2 10  ? 72.203 22.229  56.059 1.00 71.32  ? 40  ASP B HA   1 
ATOM   2724 H HB2  . ASP B 2 10  ? 73.118 24.739  56.981 1.00 74.17  ? 40  ASP B HB2  1 
ATOM   2725 H HB3  . ASP B 2 10  ? 73.801 23.362  57.385 1.00 74.17  ? 40  ASP B HB3  1 
ATOM   2726 N N    . TYR B 2 11  ? 70.271 23.691  58.062 1.00 54.38  ? 41  TYR B N    1 
ATOM   2727 C CA   . TYR B 2 11  ? 69.528 23.603  59.315 1.00 53.79  ? 41  TYR B CA   1 
ATOM   2728 C C    . TYR B 2 11  ? 68.068 23.367  58.949 1.00 54.52  ? 41  TYR B C    1 
ATOM   2729 O O    . TYR B 2 11  ? 67.368 24.288  58.521 1.00 54.95  ? 41  TYR B O    1 
ATOM   2730 C CB   . TYR B 2 11  ? 69.723 24.864  60.156 1.00 54.02  ? 41  TYR B CB   1 
ATOM   2731 C CG   . TYR B 2 11  ? 71.148 25.005  60.640 1.00 56.37  ? 41  TYR B CG   1 
ATOM   2732 C CD1  . TYR B 2 11  ? 71.542 24.480  61.865 1.00 55.86  ? 41  TYR B CD1  1 
ATOM   2733 C CD2  . TYR B 2 11  ? 72.111 25.629  59.856 1.00 58.26  ? 41  TYR B CD2  1 
ATOM   2734 C CE1  . TYR B 2 11  ? 72.856 24.587  62.305 1.00 58.92  ? 41  TYR B CE1  1 
ATOM   2735 C CE2  . TYR B 2 11  ? 73.432 25.738  60.285 1.00 60.67  ? 41  TYR B CE2  1 
ATOM   2736 C CZ   . TYR B 2 11  ? 73.796 25.218  61.513 1.00 61.93  ? 41  TYR B CZ   1 
ATOM   2737 O OH   . TYR B 2 11  ? 75.101 25.323  61.955 1.00 64.61  ? 41  TYR B OH   1 
ATOM   2738 H H    . TYR B 2 11  ? 69.985 24.313  57.542 1.00 65.25  ? 41  TYR B H    1 
ATOM   2739 H HA   . TYR B 2 11  ? 69.843 22.841  59.826 1.00 64.55  ? 41  TYR B HA   1 
ATOM   2740 H HB2  . TYR B 2 11  ? 69.507 25.643  59.619 1.00 64.83  ? 41  TYR B HB2  1 
ATOM   2741 H HB3  . TYR B 2 11  ? 69.143 24.823  60.933 1.00 64.83  ? 41  TYR B HB3  1 
ATOM   2742 H HD1  . TYR B 2 11  ? 70.914 24.053  62.402 1.00 67.04  ? 41  TYR B HD1  1 
ATOM   2743 H HD2  . TYR B 2 11  ? 71.869 25.979  59.029 1.00 69.91  ? 41  TYR B HD2  1 
ATOM   2744 H HE1  . TYR B 2 11  ? 73.102 24.236  63.130 1.00 70.70  ? 41  TYR B HE1  1 
ATOM   2745 H HE2  . TYR B 2 11  ? 74.063 26.165  59.752 1.00 72.81  ? 41  TYR B HE2  1 
ATOM   2746 H HH   . TYR B 2 11  ? 75.567 25.725  61.383 1.00 77.53  ? 41  TYR B HH   1 
ATOM   2747 N N    . ARG B 2 12  ? 67.620 22.125  59.103 1.00 61.43  ? 42  ARG B N    1 
ATOM   2748 C CA   . ARG B 2 12  ? 66.292 21.706  58.683 1.00 61.34  ? 42  ARG B CA   1 
ATOM   2749 C C    . ARG B 2 12  ? 65.590 21.046  59.859 1.00 57.52  ? 42  ARG B C    1 
ATOM   2750 O O    . ARG B 2 12  ? 66.184 20.220  60.556 1.00 57.75  ? 42  ARG B O    1 
ATOM   2751 C CB   . ARG B 2 12  ? 66.375 20.745  57.489 1.00 69.00  ? 42  ARG B CB   1 
ATOM   2752 C CG   . ARG B 2 12  ? 66.936 21.389  56.226 1.00 76.37  ? 42  ARG B CG   1 
ATOM   2753 C CD   . ARG B 2 12  ? 67.122 20.387  55.103 1.00 82.07  ? 42  ARG B CD   1 
ATOM   2754 N NE   . ARG B 2 12  ? 68.452 19.782  55.128 1.00 87.62  ? 42  ARG B NE   1 
ATOM   2755 C CZ   . ARG B 2 12  ? 68.759 18.629  55.716 1.00 90.00  ? 42  ARG B CZ   1 
ATOM   2756 N NH1  . ARG B 2 12  ? 67.830 17.917  56.344 1.00 89.39  ? 42  ARG B NH1  1 
ATOM   2757 N NH2  . ARG B 2 12  ? 70.007 18.181  55.672 1.00 93.21  ? 42  ARG B NH2  1 
ATOM   2758 H H    . ARG B 2 12  ? 68.082 21.492  59.458 1.00 73.71  ? 42  ARG B H    1 
ATOM   2759 H HA   . ARG B 2 12  ? 65.778 22.484  58.416 1.00 73.61  ? 42  ARG B HA   1 
ATOM   2760 H HB2  . ARG B 2 12  ? 66.952 20.002  57.725 1.00 82.80  ? 42  ARG B HB2  1 
ATOM   2761 H HB3  . ARG B 2 12  ? 65.484 20.419  57.286 1.00 82.80  ? 42  ARG B HB3  1 
ATOM   2762 H HG2  . ARG B 2 12  ? 66.321 22.074  55.919 1.00 91.65  ? 42  ARG B HG2  1 
ATOM   2763 H HG3  . ARG B 2 12  ? 67.800 21.782  56.426 1.00 91.65  ? 42  ARG B HG3  1 
ATOM   2764 H HD2  . ARG B 2 12  ? 66.466 19.679  55.196 1.00 98.48  ? 42  ARG B HD2  1 
ATOM   2765 H HD3  . ARG B 2 12  ? 67.010 20.838  54.252 1.00 98.48  ? 42  ARG B HD3  1 
ATOM   2766 H HE   . ARG B 2 12  ? 69.087 20.205  54.730 1.00 105.14 ? 42  ARG B HE   1 
ATOM   2767 H HH11 . ARG B 2 12  ? 67.019 18.202  56.377 1.00 107.27 ? 42  ARG B HH11 1 
ATOM   2768 H HH12 . ARG B 2 12  ? 68.040 17.173  56.720 1.00 107.27 ? 42  ARG B HH12 1 
ATOM   2769 H HH21 . ARG B 2 12  ? 70.613 18.636  55.266 1.00 111.85 ? 42  ARG B HH21 1 
ATOM   2770 H HH22 . ARG B 2 12  ? 70.210 17.435  56.049 1.00 111.85 ? 42  ARG B HH22 1 
ATOM   2771 N N    . TYR B 2 13  ? 64.336 21.425  60.082 1.00 46.67  ? 43  TYR B N    1 
ATOM   2772 C CA   . TYR B 2 13  ? 63.535 20.865  61.164 1.00 42.03  ? 43  TYR B CA   1 
ATOM   2773 C C    . TYR B 2 13  ? 62.141 20.581  60.632 1.00 39.14  ? 43  TYR B C    1 
ATOM   2774 O O    . TYR B 2 13  ? 61.437 21.504  60.208 1.00 38.21  ? 43  TYR B O    1 
ATOM   2775 C CB   . TYR B 2 13  ? 63.454 21.814  62.361 1.00 41.67  ? 43  TYR B CB   1 
ATOM   2776 C CG   . TYR B 2 13  ? 64.797 22.290  62.843 1.00 42.29  ? 43  TYR B CG   1 
ATOM   2777 C CD1  . TYR B 2 13  ? 65.584 21.490  63.663 1.00 44.84  ? 43  TYR B CD1  1 
ATOM   2778 C CD2  . TYR B 2 13  ? 65.282 23.535  62.475 1.00 43.54  ? 43  TYR B CD2  1 
ATOM   2779 C CE1  . TYR B 2 13  ? 66.820 21.917  64.104 1.00 46.62  ? 43  TYR B CE1  1 
ATOM   2780 C CE2  . TYR B 2 13  ? 66.519 23.975  62.909 1.00 46.06  ? 43  TYR B CE2  1 
ATOM   2781 C CZ   . TYR B 2 13  ? 67.282 23.163  63.721 1.00 45.84  ? 43  TYR B CZ   1 
ATOM   2782 O OH   . TYR B 2 13  ? 68.509 23.594  64.152 1.00 50.02  ? 43  TYR B OH   1 
ATOM   2783 H H    . TYR B 2 13  ? 63.920 22.015  59.614 1.00 56.01  ? 43  TYR B H    1 
ATOM   2784 H HA   . TYR B 2 13  ? 63.928 20.030  61.459 1.00 50.44  ? 43  TYR B HA   1 
ATOM   2785 H HB2  . TYR B 2 13  ? 62.935 22.594  62.109 1.00 50.01  ? 43  TYR B HB2  1 
ATOM   2786 H HB3  . TYR B 2 13  ? 63.020 21.354  63.097 1.00 50.01  ? 43  TYR B HB3  1 
ATOM   2787 H HD1  . TYR B 2 13  ? 65.273 20.651  63.918 1.00 53.81  ? 43  TYR B HD1  1 
ATOM   2788 H HD2  . TYR B 2 13  ? 64.769 24.082  61.925 1.00 52.25  ? 43  TYR B HD2  1 
ATOM   2789 H HE1  . TYR B 2 13  ? 67.337 21.372  64.651 1.00 55.94  ? 43  TYR B HE1  1 
ATOM   2790 H HE2  . TYR B 2 13  ? 66.834 24.812  62.654 1.00 55.27  ? 43  TYR B HE2  1 
ATOM   2791 H HH   . TYR B 2 13  ? 68.666 24.362  63.850 1.00 60.02  ? 43  TYR B HH   1 
ATOM   2792 N N    . GLY B 2 14  ? 61.756 19.307  60.648 1.00 40.52  ? 44  GLY B N    1 
ATOM   2793 C CA   . GLY B 2 14  ? 60.384 18.942  60.382 1.00 38.54  ? 44  GLY B CA   1 
ATOM   2794 C C    . GLY B 2 14  ? 59.458 19.467  61.461 1.00 39.13  ? 44  GLY B C    1 
ATOM   2795 O O    . GLY B 2 14  ? 59.882 19.944  62.519 1.00 38.11  ? 44  GLY B O    1 
ATOM   2796 H H    . GLY B 2 14  ? 62.275 18.641  60.812 1.00 48.63  ? 44  GLY B H    1 
ATOM   2797 H HA2  . GLY B 2 14  ? 60.107 19.309  59.528 1.00 46.25  ? 44  GLY B HA2  1 
ATOM   2798 H HA3  . GLY B 2 14  ? 60.304 17.976  60.346 1.00 46.25  ? 44  GLY B HA3  1 
ATOM   2799 N N    . ARG B 2 15  ? 58.154 19.365  61.177 1.00 40.57  ? 45  ARG B N    1 
ATOM   2800 C CA   . ARG B 2 15  ? 57.144 19.875  62.098 1.00 39.02  ? 45  ARG B CA   1 
ATOM   2801 C C    . ARG B 2 15  ? 57.315 19.274  63.489 1.00 39.42  ? 45  ARG B C    1 
ATOM   2802 O O    . ARG B 2 15  ? 57.396 20.001  64.485 1.00 38.29  ? 45  ARG B O    1 
ATOM   2803 C CB   . ARG B 2 15  ? 55.749 19.583  61.542 1.00 40.20  ? 45  ARG B CB   1 
ATOM   2804 C CG   . ARG B 2 15  ? 54.611 20.399  62.157 1.00 40.08  ? 45  ARG B CG   1 
ATOM   2805 C CD   . ARG B 2 15  ? 53.337 20.174  61.365 1.00 40.22  ? 45  ARG B CD   1 
ATOM   2806 N NE   . ARG B 2 15  ? 52.204 20.955  61.868 1.00 41.16  ? 45  ARG B NE   1 
ATOM   2807 C CZ   . ARG B 2 15  ? 51.253 20.491  62.683 1.00 41.67  ? 45  ARG B CZ   1 
ATOM   2808 N NH1  . ARG B 2 15  ? 51.283 19.236  63.125 1.00 42.05  ? 45  ARG B NH1  1 
ATOM   2809 N NH2  . ARG B 2 15  ? 50.264 21.291  63.068 1.00 40.95  ? 45  ARG B NH2  1 
ATOM   2810 H H    . ARG B 2 15  ? 57.836 19.006  60.463 1.00 48.68  ? 45  ARG B H    1 
ATOM   2811 H HA   . ARG B 2 15  ? 57.241 20.837  62.173 1.00 46.83  ? 45  ARG B HA   1 
ATOM   2812 H HB2  . ARG B 2 15  ? 55.755 19.763  60.589 1.00 48.23  ? 45  ARG B HB2  1 
ATOM   2813 H HB3  . ARG B 2 15  ? 55.549 18.646  61.693 1.00 48.23  ? 45  ARG B HB3  1 
ATOM   2814 H HG2  . ARG B 2 15  ? 54.461 20.113  63.072 1.00 48.10  ? 45  ARG B HG2  1 
ATOM   2815 H HG3  . ARG B 2 15  ? 54.832 21.343  62.125 1.00 48.10  ? 45  ARG B HG3  1 
ATOM   2816 H HD2  . ARG B 2 15  ? 53.491 20.429  60.442 1.00 48.26  ? 45  ARG B HD2  1 
ATOM   2817 H HD3  . ARG B 2 15  ? 53.098 19.235  61.413 1.00 48.26  ? 45  ARG B HD3  1 
ATOM   2818 H HE   . ARG B 2 15  ? 52.147 21.777  61.619 1.00 49.40  ? 45  ARG B HE   1 
ATOM   2819 H HH11 . ARG B 2 15  ? 51.918 18.709  62.880 1.00 50.46  ? 45  ARG B HH11 1 
ATOM   2820 H HH12 . ARG B 2 15  ? 50.666 18.950  63.651 1.00 50.46  ? 45  ARG B HH12 1 
ATOM   2821 H HH21 . ARG B 2 15  ? 50.236 22.105  62.792 1.00 49.14  ? 45  ARG B HH21 1 
ATOM   2822 H HH22 . ARG B 2 15  ? 49.653 20.996  63.597 1.00 49.14  ? 45  ARG B HH22 1 
ATOM   2823 N N    . GLU B 2 16  ? 57.396 17.945  63.578 1.00 38.87  ? 46  GLU B N    1 
ATOM   2824 C CA   . GLU B 2 16  ? 57.524 17.308  64.887 1.00 39.33  ? 46  GLU B CA   1 
ATOM   2825 C C    . GLU B 2 16  ? 58.801 17.739  65.603 1.00 40.67  ? 46  GLU B C    1 
ATOM   2826 O O    . GLU B 2 16  ? 58.814 17.872  66.833 1.00 39.92  ? 46  GLU B O    1 
ATOM   2827 C CB   . GLU B 2 16  ? 57.483 15.790  64.735 1.00 40.52  ? 46  GLU B CB   1 
ATOM   2828 C CG   . GLU B 2 16  ? 56.136 15.285  64.256 1.00 40.63  ? 46  GLU B CG   1 
ATOM   2829 C CD   . GLU B 2 16  ? 55.020 15.588  65.248 1.00 39.84  ? 46  GLU B CD   1 
ATOM   2830 O OE1  . GLU B 2 16  ? 55.198 15.284  66.449 1.00 40.72  ? 46  GLU B OE1  1 
ATOM   2831 O OE2  . GLU B 2 16  ? 53.977 16.138  64.835 1.00 38.21  ? 46  GLU B OE2  1 
ATOM   2832 H H    . GLU B 2 16  ? 57.380 17.402  62.912 1.00 46.64  ? 46  GLU B H    1 
ATOM   2833 H HA   . GLU B 2 16  ? 56.771 17.571  65.439 1.00 47.20  ? 46  GLU B HA   1 
ATOM   2834 H HB2  . GLU B 2 16  ? 58.152 15.519  64.087 1.00 48.63  ? 46  GLU B HB2  1 
ATOM   2835 H HB3  . GLU B 2 16  ? 57.669 15.381  65.594 1.00 48.63  ? 46  GLU B HB3  1 
ATOM   2836 H HG2  . GLU B 2 16  ? 55.917 15.714  63.414 1.00 48.76  ? 46  GLU B HG2  1 
ATOM   2837 H HG3  . GLU B 2 16  ? 56.182 14.323  64.138 1.00 48.76  ? 46  GLU B HG3  1 
ATOM   2838 N N    . GLU B 2 17  ? 59.888 17.950  64.855 1.00 43.37  ? 47  GLU B N    1 
ATOM   2839 C CA   . GLU B 2 17  ? 61.133 18.404  65.467 1.00 44.99  ? 47  GLU B CA   1 
ATOM   2840 C C    . GLU B 2 17  ? 60.963 19.786  66.078 1.00 43.09  ? 47  GLU B C    1 
ATOM   2841 O O    . GLU B 2 17  ? 61.377 20.029  67.216 1.00 42.66  ? 47  GLU B O    1 
ATOM   2842 C CB   . GLU B 2 17  ? 62.255 18.427  64.434 1.00 47.95  ? 47  GLU B CB   1 
ATOM   2843 C CG   . GLU B 2 17  ? 62.492 17.118  63.726 1.00 50.47  ? 47  GLU B CG   1 
ATOM   2844 C CD   . GLU B 2 17  ? 63.613 17.214  62.706 1.00 53.42  ? 47  GLU B CD   1 
ATOM   2845 O OE1  . GLU B 2 17  ? 64.692 17.739  63.071 1.00 53.23  ? 47  GLU B OE1  1 
ATOM   2846 O OE2  . GLU B 2 17  ? 63.409 16.785  61.546 1.00 52.86  ? 47  GLU B OE2  1 
ATOM   2847 H H    . GLU B 2 17  ? 59.928 17.839  64.003 1.00 52.04  ? 47  GLU B H    1 
ATOM   2848 H HA   . GLU B 2 17  ? 61.383 17.789  66.174 1.00 53.99  ? 47  GLU B HA   1 
ATOM   2849 H HB2  . GLU B 2 17  ? 62.041 19.091  63.760 1.00 57.54  ? 47  GLU B HB2  1 
ATOM   2850 H HB3  . GLU B 2 17  ? 63.081 18.672  64.881 1.00 57.54  ? 47  GLU B HB3  1 
ATOM   2851 H HG2  . GLU B 2 17  ? 62.735 16.443  64.379 1.00 60.57  ? 47  GLU B HG2  1 
ATOM   2852 H HG3  . GLU B 2 17  ? 61.682 16.857  63.261 1.00 60.57  ? 47  GLU B HG3  1 
ATOM   2853 N N    . MET B 2 18  ? 60.377 20.717  65.321 1.00 37.50  ? 48  MET B N    1 
ATOM   2854 C CA   . MET B 2 18  ? 60.081 22.036  65.871 1.00 37.86  ? 48  MET B CA   1 
ATOM   2855 C C    . MET B 2 18  ? 59.289 21.911  67.164 1.00 35.40  ? 48  MET B C    1 
ATOM   2856 O O    . MET B 2 18  ? 59.592 22.574  68.165 1.00 36.53  ? 48  MET B O    1 
ATOM   2857 C CB   . MET B 2 18  ? 59.293 22.869  64.858 1.00 41.30  ? 48  MET B CB   1 
ATOM   2858 C CG   . MET B 2 18  ? 60.031 23.171  63.569 1.00 45.48  ? 48  MET B CG   1 
ATOM   2859 S SD   . MET B 2 18  ? 61.469 24.227  63.826 1.00 48.84  ? 48  MET B SD   1 
ATOM   2860 C CE   . MET B 2 18  ? 60.709 25.819  64.124 1.00 53.39  ? 48  MET B CE   1 
ATOM   2861 H H    . MET B 2 18  ? 60.146 20.610  64.500 1.00 45.00  ? 48  MET B H    1 
ATOM   2862 H HA   . MET B 2 18  ? 60.915 22.496  66.054 1.00 45.43  ? 48  MET B HA   1 
ATOM   2863 H HB2  . MET B 2 18  ? 58.483 22.389  64.627 1.00 49.57  ? 48  MET B HB2  1 
ATOM   2864 H HB3  . MET B 2 18  ? 59.063 23.717  65.269 1.00 49.57  ? 48  MET B HB3  1 
ATOM   2865 H HG2  . MET B 2 18  ? 60.335 22.339  63.176 1.00 54.58  ? 48  MET B HG2  1 
ATOM   2866 H HG3  . MET B 2 18  ? 59.429 23.627  62.960 1.00 54.58  ? 48  MET B HG3  1 
ATOM   2867 H HE1  . MET B 2 18  ? 61.405 26.477  64.278 1.00 64.06  ? 48  MET B HE1  1 
ATOM   2868 H HE2  . MET B 2 18  ? 60.184 26.068  63.347 1.00 64.06  ? 48  MET B HE2  1 
ATOM   2869 H HE3  . MET B 2 18  ? 60.136 25.754  64.904 1.00 64.06  ? 48  MET B HE3  1 
ATOM   2870 N N    . LEU B 2 19  ? 58.262 21.056  67.154 1.00 38.89  ? 49  LEU B N    1 
ATOM   2871 C CA   . LEU B 2 19  ? 57.398 20.904  68.320 1.00 38.32  ? 49  LEU B CA   1 
ATOM   2872 C C    . LEU B 2 19  ? 58.121 20.201  69.453 1.00 39.93  ? 49  LEU B C    1 
ATOM   2873 O O    . LEU B 2 19  ? 57.934 20.547  70.625 1.00 41.71  ? 49  LEU B O    1 
ATOM   2874 C CB   . LEU B 2 19  ? 56.140 20.124  67.940 1.00 37.47  ? 49  LEU B CB   1 
ATOM   2875 C CG   . LEU B 2 19  ? 55.242 20.769  66.893 1.00 35.83  ? 49  LEU B CG   1 
ATOM   2876 C CD1  . LEU B 2 19  ? 54.131 19.808  66.474 1.00 36.45  ? 49  LEU B CD1  1 
ATOM   2877 C CD2  . LEU B 2 19  ? 54.667 22.037  67.453 1.00 35.39  ? 49  LEU B CD2  1 
ATOM   2878 H H    . LEU B 2 19  ? 58.048 20.557  66.488 1.00 46.67  ? 49  LEU B H    1 
ATOM   2879 H HA   . LEU B 2 19  ? 57.127 21.782  68.633 1.00 45.99  ? 49  LEU B HA   1 
ATOM   2880 H HB2  . LEU B 2 19  ? 56.411 19.259  67.595 1.00 44.96  ? 49  LEU B HB2  1 
ATOM   2881 H HB3  . LEU B 2 19  ? 55.606 19.999  68.740 1.00 44.96  ? 49  LEU B HB3  1 
ATOM   2882 H HG   . LEU B 2 19  ? 55.768 20.991  66.109 1.00 43.00  ? 49  LEU B HG   1 
ATOM   2883 H HD11 . LEU B 2 19  ? 53.574 20.241  65.808 1.00 43.74  ? 49  LEU B HD11 1 
ATOM   2884 H HD12 . LEU B 2 19  ? 54.531 19.007  66.101 1.00 43.74  ? 49  LEU B HD12 1 
ATOM   2885 H HD13 . LEU B 2 19  ? 53.600 19.581  67.254 1.00 43.74  ? 49  LEU B HD13 1 
ATOM   2886 H HD21 . LEU B 2 19  ? 54.096 22.446  66.784 1.00 42.47  ? 49  LEU B HD21 1 
ATOM   2887 H HD22 . LEU B 2 19  ? 54.151 21.825  68.246 1.00 42.47  ? 49  LEU B HD22 1 
ATOM   2888 H HD23 . LEU B 2 19  ? 55.393 22.638  67.681 1.00 42.47  ? 49  LEU B HD23 1 
ATOM   2889 N N    . ALA B 2 20  ? 58.933 19.196  69.126 1.00 41.05  ? 50  ALA B N    1 
ATOM   2890 C CA   . ALA B 2 20  ? 59.716 18.514  70.149 1.00 43.34  ? 50  ALA B CA   1 
ATOM   2891 C C    . ALA B 2 20  ? 60.551 19.495  70.955 1.00 45.08  ? 50  ALA B C    1 
ATOM   2892 O O    . ALA B 2 20  ? 60.777 19.279  72.149 1.00 46.46  ? 50  ALA B O    1 
ATOM   2893 C CB   . ALA B 2 20  ? 60.625 17.465  69.510 1.00 43.24  ? 50  ALA B CB   1 
ATOM   2894 H H    . ALA B 2 20  ? 59.046 18.894  68.328 1.00 49.26  ? 50  ALA B H    1 
ATOM   2895 H HA   . ALA B 2 20  ? 59.114 18.060  70.758 1.00 52.00  ? 50  ALA B HA   1 
ATOM   2896 H HB1  . ALA B 2 20  ? 61.136 17.024  70.207 1.00 51.89  ? 50  ALA B HB1  1 
ATOM   2897 H HB2  . ALA B 2 20  ? 60.077 16.816  69.041 1.00 51.89  ? 50  ALA B HB2  1 
ATOM   2898 H HB3  . ALA B 2 20  ? 61.225 17.904  68.887 1.00 51.89  ? 50  ALA B HB3  1 
ATOM   2899 N N    . LEU B 2 21  ? 60.995 20.582  70.331 1.00 46.14  ? 51  LEU B N    1 
ATOM   2900 C CA   . LEU B 2 21  ? 61.900 21.537  70.954 1.00 48.85  ? 51  LEU B CA   1 
ATOM   2901 C C    . LEU B 2 21  ? 61.183 22.671  71.675 1.00 49.57  ? 51  LEU B C    1 
ATOM   2902 O O    . LEU B 2 21  ? 61.851 23.593  72.160 1.00 50.05  ? 51  LEU B O    1 
ATOM   2903 C CB   . LEU B 2 21  ? 62.841 22.122  69.896 1.00 48.97  ? 51  LEU B CB   1 
ATOM   2904 C CG   . LEU B 2 21  ? 63.765 21.107  69.223 1.00 49.97  ? 51  LEU B CG   1 
ATOM   2905 C CD1  . LEU B 2 21  ? 64.358 21.692  67.963 1.00 50.56  ? 51  LEU B CD1  1 
ATOM   2906 C CD2  . LEU B 2 21  ? 64.871 20.669  70.178 1.00 51.36  ? 51  LEU B CD2  1 
ATOM   2907 H H    . LEU B 2 21  ? 60.779 20.792  69.525 1.00 55.37  ? 51  LEU B H    1 
ATOM   2908 H HA   . LEU B 2 21  ? 62.444 21.069  71.607 1.00 58.62  ? 51  LEU B HA   1 
ATOM   2909 H HB2  . LEU B 2 21  ? 62.305 22.536  69.201 1.00 58.77  ? 51  LEU B HB2  1 
ATOM   2910 H HB3  . LEU B 2 21  ? 63.400 22.793  70.318 1.00 58.77  ? 51  LEU B HB3  1 
ATOM   2911 H HG   . LEU B 2 21  ? 63.250 20.322  68.978 1.00 59.97  ? 51  LEU B HG   1 
ATOM   2912 H HD11 . LEU B 2 21  ? 64.940 21.034  67.552 1.00 60.67  ? 51  LEU B HD11 1 
ATOM   2913 H HD12 . LEU B 2 21  ? 63.639 21.924  67.354 1.00 60.67  ? 51  LEU B HD12 1 
ATOM   2914 H HD13 . LEU B 2 21  ? 64.867 22.486  68.192 1.00 60.67  ? 51  LEU B HD13 1 
ATOM   2915 H HD21 . LEU B 2 21  ? 65.441 20.027  69.727 1.00 61.64  ? 51  LEU B HD21 1 
ATOM   2916 H HD22 . LEU B 2 21  ? 65.389 21.446  70.438 1.00 61.64  ? 51  LEU B HD22 1 
ATOM   2917 H HD23 . LEU B 2 21  ? 64.468 20.262  70.961 1.00 61.64  ? 51  LEU B HD23 1 
ATOM   2918 N N    . PHE B 2 22  ? 59.854 22.636  71.751 1.00 51.13  ? 52  PHE B N    1 
ATOM   2919 C CA   . PHE B 2 22  ? 59.118 23.611  72.543 1.00 52.44  ? 52  PHE B CA   1 
ATOM   2920 C C    . PHE B 2 22  ? 59.247 23.289  74.021 1.00 56.19  ? 52  PHE B C    1 
ATOM   2921 O O    . PHE B 2 22  ? 59.155 22.130  74.428 1.00 57.75  ? 52  PHE B O    1 
ATOM   2922 C CB   . PHE B 2 22  ? 57.637 23.621  72.162 1.00 51.81  ? 52  PHE B CB   1 
ATOM   2923 C CG   . PHE B 2 22  ? 56.777 24.419  73.111 1.00 51.37  ? 52  PHE B CG   1 
ATOM   2924 C CD1  . PHE B 2 22  ? 56.673 25.794  72.981 1.00 50.87  ? 52  PHE B CD1  1 
ATOM   2925 C CD2  . PHE B 2 22  ? 56.086 23.794  74.139 1.00 51.66  ? 52  PHE B CD2  1 
ATOM   2926 C CE1  . PHE B 2 22  ? 55.889 26.537  73.857 1.00 50.78  ? 52  PHE B CE1  1 
ATOM   2927 C CE2  . PHE B 2 22  ? 55.299 24.526  75.016 1.00 52.01  ? 52  PHE B CE2  1 
ATOM   2928 C CZ   . PHE B 2 22  ? 55.203 25.901  74.875 1.00 51.84  ? 52  PHE B CZ   1 
ATOM   2929 H H    . PHE B 2 22  ? 59.358 22.057  71.353 1.00 61.36  ? 52  PHE B H    1 
ATOM   2930 H HA   . PHE B 2 22  ? 59.482 24.496  72.387 1.00 62.93  ? 52  PHE B HA   1 
ATOM   2931 H HB2  . PHE B 2 22  ? 57.543 24.010  71.278 1.00 62.17  ? 52  PHE B HB2  1 
ATOM   2932 H HB3  . PHE B 2 22  ? 57.307 22.709  72.157 1.00 62.17  ? 52  PHE B HB3  1 
ATOM   2933 H HD1  . PHE B 2 22  ? 57.134 26.226  72.298 1.00 61.04  ? 52  PHE B HD1  1 
ATOM   2934 H HD2  . PHE B 2 22  ? 56.148 22.871  74.239 1.00 62.00  ? 52  PHE B HD2  1 
ATOM   2935 H HE1  . PHE B 2 22  ? 55.825 27.460  73.757 1.00 60.94  ? 52  PHE B HE1  1 
ATOM   2936 H HE2  . PHE B 2 22  ? 54.839 24.095  75.700 1.00 62.41  ? 52  PHE B HE2  1 
ATOM   2937 H HZ   . PHE B 2 22  ? 54.675 26.394  75.461 1.00 62.21  ? 52  PHE B HZ   1 
ATOM   2938 N N    . LEU B 2 23  ? 59.441 24.326  74.829 1.00 61.78  ? 53  LEU B N    1 
ATOM   2939 C CA   . LEU B 2 23  ? 59.491 24.174  76.276 1.00 65.81  ? 53  LEU B CA   1 
ATOM   2940 C C    . LEU B 2 23  ? 58.826 25.385  76.908 1.00 66.25  ? 53  LEU B C    1 
ATOM   2941 O O    . LEU B 2 23  ? 59.114 26.524  76.523 1.00 65.59  ? 53  LEU B O    1 
ATOM   2942 C CB   . LEU B 2 23  ? 60.935 24.025  76.776 1.00 69.12  ? 53  LEU B CB   1 
ATOM   2943 C CG   . LEU B 2 23  ? 61.844 25.252  76.651 1.00 71.87  ? 53  LEU B CG   1 
ATOM   2944 C CD1  . LEU B 2 23  ? 61.889 26.032  77.962 1.00 73.51  ? 53  LEU B CD1  1 
ATOM   2945 C CD2  . LEU B 2 23  ? 63.249 24.848  76.212 1.00 73.24  ? 53  LEU B CD2  1 
ATOM   2946 H H    . LEU B 2 23  ? 59.547 25.136  74.560 1.00 74.14  ? 53  LEU B H    1 
ATOM   2947 H HA   . LEU B 2 23  ? 58.993 23.382  76.535 1.00 78.98  ? 53  LEU B HA   1 
ATOM   2948 H HB2  . LEU B 2 23  ? 60.906 23.786  77.716 1.00 82.94  ? 53  LEU B HB2  1 
ATOM   2949 H HB3  . LEU B 2 23  ? 61.355 23.307  76.277 1.00 82.94  ? 53  LEU B HB3  1 
ATOM   2950 H HG   . LEU B 2 23  ? 61.480 25.840  75.971 1.00 86.24  ? 53  LEU B HG   1 
ATOM   2951 H HD11 . LEU B 2 23  ? 62.470 26.800  77.851 1.00 88.21  ? 53  LEU B HD11 1 
ATOM   2952 H HD12 . LEU B 2 23  ? 60.992 26.324  78.186 1.00 88.21  ? 53  LEU B HD12 1 
ATOM   2953 H HD13 . LEU B 2 23  ? 62.233 25.454  78.661 1.00 88.21  ? 53  LEU B HD13 1 
ATOM   2954 H HD21 . LEU B 2 23  ? 63.798 25.644  76.142 1.00 87.88  ? 53  LEU B HD21 1 
ATOM   2955 H HD22 . LEU B 2 23  ? 63.624 24.244  76.872 1.00 87.88  ? 53  LEU B HD22 1 
ATOM   2956 H HD23 . LEU B 2 23  ? 63.195 24.406  75.351 1.00 87.88  ? 53  LEU B HD23 1 
ATOM   2957 N N    . LYS B 2 24  ? 57.923 25.137  77.855 1.00 63.63  ? 54  LYS B N    1 
ATOM   2958 C CA   . LYS B 2 24  ? 57.300 26.220  78.600 1.00 64.69  ? 54  LYS B CA   1 
ATOM   2959 C C    . LYS B 2 24  ? 58.360 26.999  79.367 1.00 64.19  ? 54  LYS B C    1 
ATOM   2960 O O    . LYS B 2 24  ? 58.959 26.487  80.318 1.00 63.10  ? 54  LYS B O    1 
ATOM   2961 C CB   . LYS B 2 24  ? 56.236 25.684  79.558 1.00 67.73  ? 54  LYS B CB   1 
ATOM   2962 C CG   . LYS B 2 24  ? 54.856 25.570  78.951 1.00 69.92  ? 54  LYS B CG   1 
ATOM   2963 C CD   . LYS B 2 24  ? 53.845 25.135  79.997 1.00 74.01  ? 54  LYS B CD   1 
ATOM   2964 C CE   . LYS B 2 24  ? 52.461 24.955  79.398 1.00 75.26  ? 54  LYS B CE   1 
ATOM   2965 N NZ   . LYS B 2 24  ? 51.525 24.334  80.377 1.00 78.29  ? 54  LYS B NZ   1 
ATOM   2966 H H    . LYS B 2 24  ? 57.657 24.351  78.083 1.00 76.35  ? 54  LYS B H    1 
ATOM   2967 H HA   . LYS B 2 24  ? 56.869 26.827  77.979 1.00 77.63  ? 54  LYS B HA   1 
ATOM   2968 H HB2  . LYS B 2 24  ? 56.502 24.800  79.855 1.00 81.28  ? 54  LYS B HB2  1 
ATOM   2969 H HB3  . LYS B 2 24  ? 56.175 26.281  80.320 1.00 81.28  ? 54  LYS B HB3  1 
ATOM   2970 H HG2  . LYS B 2 24  ? 54.584 26.434  78.603 1.00 83.90  ? 54  LYS B HG2  1 
ATOM   2971 H HG3  . LYS B 2 24  ? 54.868 24.908  78.242 1.00 83.90  ? 54  LYS B HG3  1 
ATOM   2972 H HD2  . LYS B 2 24  ? 54.123 24.287  80.377 1.00 88.82  ? 54  LYS B HD2  1 
ATOM   2973 H HD3  . LYS B 2 24  ? 53.790 25.811  80.690 1.00 88.82  ? 54  LYS B HD3  1 
ATOM   2974 H HE2  . LYS B 2 24  ? 52.107 25.822  79.145 1.00 90.31  ? 54  LYS B HE2  1 
ATOM   2975 H HE3  . LYS B 2 24  ? 52.520 24.376  78.622 1.00 90.31  ? 54  LYS B HE3  1 
ATOM   2976 H HZ1  . LYS B 2 24  ? 50.721 24.237  80.008 1.00 93.95  ? 54  LYS B HZ1  1 
ATOM   2977 H HZ2  . LYS B 2 24  ? 51.829 23.535  80.623 1.00 93.95  ? 54  LYS B HZ2  1 
ATOM   2978 H HZ3  . LYS B 2 24  ? 51.453 24.851  81.098 1.00 93.95  ? 54  LYS B HZ3  1 
ATOM   2979 N N    . ASP B 2 25  ? 58.603 28.233  78.947 1.00 62.24  ? 55  ASP B N    1 
ATOM   2980 C CA   . ASP B 2 25  ? 59.553 29.124  79.601 1.00 63.35  ? 55  ASP B CA   1 
ATOM   2981 C C    . ASP B 2 25  ? 58.790 30.384  79.989 1.00 62.78  ? 55  ASP B C    1 
ATOM   2982 O O    . ASP B 2 25  ? 58.478 31.215  79.129 1.00 61.50  ? 55  ASP B O    1 
ATOM   2983 C CB   . ASP B 2 25  ? 60.728 29.438  78.682 1.00 64.68  ? 55  ASP B CB   1 
ATOM   2984 C CG   . ASP B 2 25  ? 61.666 30.465  79.271 1.00 66.96  ? 55  ASP B CG   1 
ATOM   2985 O OD1  . ASP B 2 25  ? 61.760 30.529  80.514 1.00 69.34  ? 55  ASP B OD1  1 
ATOM   2986 O OD2  . ASP B 2 25  ? 62.304 31.209  78.492 1.00 68.11  ? 55  ASP B OD2  1 
ATOM   2987 H H    . ASP B 2 25  ? 58.219 28.588  78.264 1.00 74.68  ? 55  ASP B H    1 
ATOM   2988 H HA   . ASP B 2 25  ? 59.893 28.705  80.408 1.00 76.02  ? 55  ASP B HA   1 
ATOM   2989 H HB2  . ASP B 2 25  ? 61.233 28.625  78.524 1.00 77.62  ? 55  ASP B HB2  1 
ATOM   2990 H HB3  . ASP B 2 25  ? 60.389 29.787  77.843 1.00 77.62  ? 55  ASP B HB3  1 
ATOM   2991 N N    . ASN B 2 26  ? 58.476 30.522  81.281 1.00 68.66  ? 56  ASN B N    1 
ATOM   2992 C CA   . ASN B 2 26  ? 57.752 31.698  81.752 1.00 70.98  ? 56  ASN B CA   1 
ATOM   2993 C C    . ASN B 2 26  ? 58.557 32.980  81.590 1.00 75.13  ? 56  ASN B C    1 
ATOM   2994 O O    . ASN B 2 26  ? 57.984 34.069  81.711 1.00 77.16  ? 56  ASN B O    1 
ATOM   2995 C CB   . ASN B 2 26  ? 57.352 31.525  83.222 1.00 72.42  ? 56  ASN B CB   1 
ATOM   2996 C CG   . ASN B 2 26  ? 56.306 30.435  83.426 1.00 71.47  ? 56  ASN B CG   1 
ATOM   2997 O OD1  . ASN B 2 26  ? 55.583 30.065  82.499 1.00 69.06  ? 56  ASN B OD1  1 
ATOM   2998 N ND2  . ASN B 2 26  ? 56.217 29.925  84.650 1.00 72.77  ? 56  ASN B ND2  1 
ATOM   2999 H H    . ASN B 2 26  ? 58.671 29.953  81.896 1.00 82.39  ? 56  ASN B H    1 
ATOM   3000 H HA   . ASN B 2 26  ? 56.938 31.792  81.233 1.00 85.18  ? 56  ASN B HA   1 
ATOM   3001 H HB2  . ASN B 2 26  ? 58.138 31.286  83.738 1.00 86.91  ? 56  ASN B HB2  1 
ATOM   3002 H HB3  . ASN B 2 26  ? 56.983 32.360  83.550 1.00 86.91  ? 56  ASN B HB3  1 
ATOM   3003 H HD21 . ASN B 2 26  ? 55.642 29.308  84.818 1.00 87.32  ? 56  ASN B HD21 1 
ATOM   3004 H HD22 . ASN B 2 26  ? 56.733 30.213  85.275 1.00 87.32  ? 56  ASN B HD22 1 
ATOM   3005 N N    . LYS B 2 27  ? 59.858 32.882  81.318 1.00 80.96  ? 57  LYS B N    1 
ATOM   3006 C CA   . LYS B 2 27  ? 60.679 34.068  81.113 1.00 83.61  ? 57  LYS B CA   1 
ATOM   3007 C C    . LYS B 2 27  ? 60.313 34.720  79.785 1.00 80.69  ? 57  LYS B C    1 
ATOM   3008 O O    . LYS B 2 27  ? 60.490 34.120  78.718 1.00 80.10  ? 57  LYS B O    1 
ATOM   3009 C CB   . LYS B 2 27  ? 62.161 33.701  81.148 1.00 87.29  ? 57  LYS B CB   1 
ATOM   3010 C CG   . LYS B 2 27  ? 63.080 34.910  81.221 1.00 91.03  ? 57  LYS B CG   1 
ATOM   3011 C CD   . LYS B 2 27  ? 64.423 34.572  81.851 1.00 93.92  ? 57  LYS B CD   1 
ATOM   3012 C CE   . LYS B 2 27  ? 65.219 35.835  82.153 1.00 96.04  ? 57  LYS B CE   1 
ATOM   3013 N NZ   . LYS B 2 27  ? 66.488 35.545  82.869 1.00 98.83  ? 57  LYS B NZ   1 
ATOM   3014 H H    . LYS B 2 27  ? 60.287 32.139  81.249 1.00 97.15  ? 57  LYS B H    1 
ATOM   3015 H HA   . LYS B 2 27  ? 60.506 34.705  81.823 1.00 100.34 ? 57  LYS B HA   1 
ATOM   3016 H HB2  . LYS B 2 27  ? 62.330 33.151  81.929 1.00 104.75 ? 57  LYS B HB2  1 
ATOM   3017 H HB3  . LYS B 2 27  ? 62.382 33.207  80.343 1.00 104.75 ? 57  LYS B HB3  1 
ATOM   3018 H HG2  . LYS B 2 27  ? 63.242 35.241  80.324 1.00 109.24 ? 57  LYS B HG2  1 
ATOM   3019 H HG3  . LYS B 2 27  ? 62.658 35.597  81.760 1.00 109.24 ? 57  LYS B HG3  1 
ATOM   3020 H HD2  . LYS B 2 27  ? 64.277 34.097  82.684 1.00 112.71 ? 57  LYS B HD2  1 
ATOM   3021 H HD3  . LYS B 2 27  ? 64.938 34.026  81.237 1.00 112.71 ? 57  LYS B HD3  1 
ATOM   3022 H HE2  . LYS B 2 27  ? 65.439 36.279  81.319 1.00 115.25 ? 57  LYS B HE2  1 
ATOM   3023 H HE3  . LYS B 2 27  ? 64.685 36.421  82.712 1.00 115.25 ? 57  LYS B HE3  1 
ATOM   3024 H HZ1  . LYS B 2 27  ? 66.927 36.302  83.029 1.00 118.60 ? 57  LYS B HZ1  1 
ATOM   3025 H HZ2  . LYS B 2 27  ? 66.314 35.142  83.643 1.00 118.60 ? 57  LYS B HZ2  1 
ATOM   3026 H HZ3  . LYS B 2 27  ? 67.001 35.012  82.374 1.00 118.60 ? 57  LYS B HZ3  1 
ATOM   3027 N N    . ILE B 2 28  ? 59.800 35.946  79.856 1.00 75.39  ? 58  ILE B N    1 
ATOM   3028 C CA   . ILE B 2 28  ? 59.332 36.680  78.683 1.00 70.16  ? 58  ILE B CA   1 
ATOM   3029 C C    . ILE B 2 28  ? 60.520 37.391  78.046 1.00 66.19  ? 58  ILE B C    1 
ATOM   3030 O O    . ILE B 2 28  ? 61.260 38.089  78.752 1.00 67.46  ? 58  ILE B O    1 
ATOM   3031 C CB   . ILE B 2 28  ? 58.236 37.691  79.059 1.00 70.68  ? 58  ILE B CB   1 
ATOM   3032 C CG1  . ILE B 2 28  ? 57.068 36.978  79.740 1.00 70.68  ? 58  ILE B CG1  1 
ATOM   3033 C CG2  . ILE B 2 28  ? 57.750 38.438  77.823 1.00 69.56  ? 58  ILE B CG2  1 
ATOM   3034 C CD1  . ILE B 2 28  ? 56.079 37.913  80.390 1.00 71.78  ? 58  ILE B CD1  1 
ATOM   3035 H H    . ILE B 2 28  ? 59.711 36.383  80.591 1.00 90.47  ? 58  ILE B H    1 
ATOM   3036 H HA   . ILE B 2 28  ? 58.965 36.056  78.037 1.00 84.20  ? 58  ILE B HA   1 
ATOM   3037 H HB   . ILE B 2 28  ? 58.610 38.334  79.682 1.00 84.82  ? 58  ILE B HB   1 
ATOM   3038 H HG12 . ILE B 2 28  ? 56.590 36.457  79.076 1.00 84.82  ? 58  ILE B HG12 1 
ATOM   3039 H HG13 . ILE B 2 28  ? 57.418 36.391  80.428 1.00 84.82  ? 58  ILE B HG13 1 
ATOM   3040 H HG21 . ILE B 2 28  ? 57.060 39.068  78.087 1.00 83.48  ? 58  ILE B HG21 1 
ATOM   3041 H HG22 . ILE B 2 28  ? 58.497 38.913  77.427 1.00 83.48  ? 58  ILE B HG22 1 
ATOM   3042 H HG23 . ILE B 2 28  ? 57.389 37.799  77.189 1.00 83.48  ? 58  ILE B HG23 1 
ATOM   3043 H HD11 . ILE B 2 28  ? 55.372 37.389  80.798 1.00 86.13  ? 58  ILE B HD11 1 
ATOM   3044 H HD12 . ILE B 2 28  ? 56.537 38.435  81.067 1.00 86.13  ? 58  ILE B HD12 1 
ATOM   3045 H HD13 . ILE B 2 28  ? 55.709 38.500  79.713 1.00 86.13  ? 58  ILE B HD13 1 
ATOM   3046 N N    . PRO B 2 29  ? 60.741 37.263  76.736 1.00 54.89  ? 59  PRO B N    1 
ATOM   3047 C CA   . PRO B 2 29  ? 61.842 38.006  76.103 1.00 52.80  ? 59  PRO B CA   1 
ATOM   3048 C C    . PRO B 2 29  ? 61.694 39.503  76.332 1.00 53.31  ? 59  PRO B C    1 
ATOM   3049 O O    . PRO B 2 29  ? 60.635 40.084  76.088 1.00 51.18  ? 59  PRO B O    1 
ATOM   3050 C CB   . PRO B 2 29  ? 61.708 37.643  74.618 1.00 50.01  ? 59  PRO B CB   1 
ATOM   3051 C CG   . PRO B 2 29  ? 60.944 36.363  74.600 1.00 48.69  ? 59  PRO B CG   1 
ATOM   3052 C CD   . PRO B 2 29  ? 60.020 36.416  75.770 1.00 50.52  ? 59  PRO B CD   1 
ATOM   3053 H HA   . PRO B 2 29  ? 62.700 37.704  76.440 1.00 63.36  ? 59  PRO B HA   1 
ATOM   3054 H HB2  . PRO B 2 29  ? 61.221 38.341  74.153 1.00 60.01  ? 59  PRO B HB2  1 
ATOM   3055 H HB3  . PRO B 2 29  ? 62.589 37.522  74.231 1.00 60.01  ? 59  PRO B HB3  1 
ATOM   3056 H HG2  . PRO B 2 29  ? 60.442 36.297  73.773 1.00 58.43  ? 59  PRO B HG2  1 
ATOM   3057 H HG3  . PRO B 2 29  ? 61.559 35.617  74.686 1.00 58.43  ? 59  PRO B HG3  1 
ATOM   3058 H HD2  . PRO B 2 29  ? 59.180 36.831  75.519 1.00 60.62  ? 59  PRO B HD2  1 
ATOM   3059 H HD3  . PRO B 2 29  ? 59.884 35.528  76.135 1.00 60.62  ? 59  PRO B HD3  1 
ATOM   3060 N N    . SER B 2 30  ? 62.774 40.128  76.801 1.00 62.07  ? 60  SER B N    1 
ATOM   3061 C CA   . SER B 2 30  ? 62.737 41.554  77.119 1.00 64.85  ? 60  SER B CA   1 
ATOM   3062 C C    . SER B 2 30  ? 62.124 42.366  75.985 1.00 64.98  ? 60  SER B C    1 
ATOM   3063 O O    . SER B 2 30  ? 61.385 43.328  76.226 1.00 67.01  ? 60  SER B O    1 
ATOM   3064 C CB   . SER B 2 30  ? 64.149 42.051  77.426 1.00 69.49  ? 60  SER B CB   1 
ATOM   3065 O OG   . SER B 2 30  ? 64.995 41.871  76.305 1.00 69.44  ? 60  SER B OG   1 
ATOM   3066 H H    . SER B 2 30  ? 63.535 39.753  76.942 1.00 74.49  ? 60  SER B H    1 
ATOM   3067 H HA   . SER B 2 30  ? 62.193 41.686  77.911 1.00 77.82  ? 60  SER B HA   1 
ATOM   3068 H HB2  . SER B 2 30  ? 64.111 42.995  77.645 1.00 83.39  ? 60  SER B HB2  1 
ATOM   3069 H HB3  . SER B 2 30  ? 64.505 41.549  78.175 1.00 83.39  ? 60  SER B HB3  1 
ATOM   3070 H HG   . SER B 2 30  ? 65.768 42.147  76.482 1.00 83.33  ? 60  SER B HG   1 
ATOM   3071 N N    . ASP B 2 31  ? 62.417 41.989  74.738 1.00 66.41  ? 61  ASP B N    1 
ATOM   3072 C CA   . ASP B 2 31  ? 61.859 42.698  73.591 1.00 65.65  ? 61  ASP B CA   1 
ATOM   3073 C C    . ASP B 2 31  ? 60.346 42.823  73.691 1.00 64.26  ? 61  ASP B C    1 
ATOM   3074 O O    . ASP B 2 31  ? 59.772 43.837  73.280 1.00 65.55  ? 61  ASP B O    1 
ATOM   3075 C CB   . ASP B 2 31  ? 62.238 41.978  72.297 1.00 65.07  ? 61  ASP B CB   1 
ATOM   3076 C CG   . ASP B 2 31  ? 63.714 42.077  71.982 1.00 67.86  ? 61  ASP B CG   1 
ATOM   3077 O OD1  . ASP B 2 31  ? 64.320 43.134  72.267 1.00 69.14  ? 61  ASP B OD1  1 
ATOM   3078 O OD2  . ASP B 2 31  ? 64.267 41.094  71.450 1.00 67.08  ? 61  ASP B OD2  1 
ATOM   3079 H H    . ASP B 2 31  ? 62.932 41.331  74.533 1.00 79.70  ? 61  ASP B H    1 
ATOM   3080 H HA   . ASP B 2 31  ? 62.233 43.592  73.559 1.00 78.78  ? 61  ASP B HA   1 
ATOM   3081 H HB2  . ASP B 2 31  ? 62.012 41.038  72.381 1.00 78.08  ? 61  ASP B HB2  1 
ATOM   3082 H HB3  . ASP B 2 31  ? 61.747 42.373  71.560 1.00 78.08  ? 61  ASP B HB3  1 
ATOM   3083 N N    . LEU B 2 32  ? 59.678 41.795  74.221 1.00 62.59  ? 62  LEU B N    1 
ATOM   3084 C CA   . LEU B 2 32  ? 58.220 41.790  74.303 1.00 61.04  ? 62  LEU B CA   1 
ATOM   3085 C C    . LEU B 2 32  ? 57.689 42.529  75.520 1.00 63.52  ? 62  LEU B C    1 
ATOM   3086 O O    . LEU B 2 32  ? 56.475 42.737  75.612 1.00 63.16  ? 62  LEU B O    1 
ATOM   3087 C CB   . LEU B 2 32  ? 57.683 40.354  74.331 1.00 58.35  ? 62  LEU B CB   1 
ATOM   3088 C CG   . LEU B 2 32  ? 57.535 39.646  72.988 1.00 55.99  ? 62  LEU B CG   1 
ATOM   3089 C CD1  . LEU B 2 32  ? 57.151 38.192  73.214 1.00 54.53  ? 62  LEU B CD1  1 
ATOM   3090 C CD2  . LEU B 2 32  ? 56.495 40.339  72.114 1.00 55.14  ? 62  LEU B CD2  1 
ATOM   3091 H H    . LEU B 2 32  ? 60.050 41.089  74.541 1.00 75.11  ? 62  LEU B H    1 
ATOM   3092 H HA   . LEU B 2 32  ? 57.863 42.226  73.513 1.00 73.25  ? 62  LEU B HA   1 
ATOM   3093 H HB2  . LEU B 2 32  ? 58.283 39.817  74.872 1.00 70.02  ? 62  LEU B HB2  1 
ATOM   3094 H HB3  . LEU B 2 32  ? 56.805 40.368  74.745 1.00 70.02  ? 62  LEU B HB3  1 
ATOM   3095 H HG   . LEU B 2 32  ? 58.385 39.666  72.522 1.00 67.19  ? 62  LEU B HG   1 
ATOM   3096 H HD11 . LEU B 2 32  ? 57.060 37.753  72.354 1.00 65.44  ? 62  LEU B HD11 1 
ATOM   3097 H HD12 . LEU B 2 32  ? 57.845 37.760  73.735 1.00 65.44  ? 62  LEU B HD12 1 
ATOM   3098 H HD13 . LEU B 2 32  ? 56.308 38.159  73.693 1.00 65.44  ? 62  LEU B HD13 1 
ATOM   3099 H HD21 . LEU B 2 32  ? 56.426 39.865  71.271 1.00 66.17  ? 62  LEU B HD21 1 
ATOM   3100 H HD22 . LEU B 2 32  ? 55.639 40.326  72.572 1.00 66.17  ? 62  LEU B HD22 1 
ATOM   3101 H HD23 . LEU B 2 32  ? 56.774 41.254  71.958 1.00 66.17  ? 62  LEU B HD23 1 
ATOM   3102 N N    . LEU B 2 33  ? 58.551 42.908  76.459 1.00 71.74  ? 63  LEU B N    1 
ATOM   3103 C CA   . LEU B 2 33  ? 58.117 43.694  77.605 1.00 75.76  ? 63  LEU B CA   1 
ATOM   3104 C C    . LEU B 2 33  ? 58.066 45.185  77.305 1.00 78.93  ? 63  LEU B C    1 
ATOM   3105 O O    . LEU B 2 33  ? 57.770 45.974  78.208 1.00 81.26  ? 63  LEU B O    1 
ATOM   3106 C CB   . LEU B 2 33  ? 59.036 43.431  78.799 1.00 78.25  ? 63  LEU B CB   1 
ATOM   3107 C CG   . LEU B 2 33  ? 59.024 41.993  79.326 1.00 77.03  ? 63  LEU B CG   1 
ATOM   3108 C CD1  . LEU B 2 33  ? 60.051 41.819  80.432 1.00 80.23  ? 63  LEU B CD1  1 
ATOM   3109 C CD2  . LEU B 2 33  ? 57.637 41.600  79.821 1.00 76.85  ? 63  LEU B CD2  1 
ATOM   3110 H H    . LEU B 2 33  ? 59.391 42.722  76.455 1.00 86.09  ? 63  LEU B H    1 
ATOM   3111 H HA   . LEU B 2 33  ? 57.222 43.413  77.853 1.00 90.91  ? 63  LEU B HA   1 
ATOM   3112 H HB2  . LEU B 2 33  ? 59.947 43.639  78.538 1.00 93.90  ? 63  LEU B HB2  1 
ATOM   3113 H HB3  . LEU B 2 33  ? 58.767 44.011  79.528 1.00 93.90  ? 63  LEU B HB3  1 
ATOM   3114 H HG   . LEU B 2 33  ? 59.262 41.392  78.602 1.00 92.44  ? 63  LEU B HG   1 
ATOM   3115 H HD11 . LEU B 2 33  ? 60.023 40.902  80.747 1.00 96.27  ? 63  LEU B HD11 1 
ATOM   3116 H HD12 . LEU B 2 33  ? 60.931 42.022  80.079 1.00 96.27  ? 63  LEU B HD12 1 
ATOM   3117 H HD13 . LEU B 2 33  ? 59.837 42.425  81.158 1.00 96.27  ? 63  LEU B HD13 1 
ATOM   3118 H HD21 . LEU B 2 33  ? 57.665 40.687  80.146 1.00 92.22  ? 63  LEU B HD21 1 
ATOM   3119 H HD22 . LEU B 2 33  ? 57.377 42.199  80.538 1.00 92.22  ? 63  LEU B HD22 1 
ATOM   3120 H HD23 . LEU B 2 33  ? 57.008 41.670  79.086 1.00 92.22  ? 63  LEU B HD23 1 
ATOM   3121 N N    . ASP B 2 34  ? 58.351 45.588  76.072 1.00 77.01  ? 64  ASP B N    1 
ATOM   3122 C CA   . ASP B 2 34  ? 58.148 46.971  75.676 1.00 79.15  ? 64  ASP B CA   1 
ATOM   3123 C C    . ASP B 2 34  ? 56.673 47.330  75.811 1.00 74.94  ? 64  ASP B C    1 
ATOM   3124 O O    . ASP B 2 34  ? 55.789 46.501  75.580 1.00 71.56  ? 64  ASP B O    1 
ATOM   3125 C CB   . ASP B 2 34  ? 58.624 47.173  74.238 1.00 81.46  ? 64  ASP B CB   1 
ATOM   3126 C CG   . ASP B 2 34  ? 58.701 48.632  73.844 1.00 85.73  ? 64  ASP B CG   1 
ATOM   3127 O OD1  . ASP B 2 34  ? 59.701 49.013  73.202 1.00 88.89  ? 64  ASP B OD1  1 
ATOM   3128 O OD2  . ASP B 2 34  ? 57.765 49.394  74.167 1.00 87.73  ? 64  ASP B OD2  1 
ATOM   3129 H H    . ASP B 2 34  ? 58.661 45.081  75.450 1.00 92.41  ? 64  ASP B H    1 
ATOM   3130 H HA   . ASP B 2 34  ? 58.662 47.553  76.257 1.00 94.98  ? 64  ASP B HA   1 
ATOM   3131 H HB2  . ASP B 2 34  ? 59.510 46.790  74.143 1.00 97.75  ? 64  ASP B HB2  1 
ATOM   3132 H HB3  . ASP B 2 34  ? 58.005 46.732  73.636 1.00 97.75  ? 64  ASP B HB3  1 
ATOM   3133 N N    . LYS B 2 35  ? 56.410 48.580  76.195 1.00 67.85  ? 65  LYS B N    1 
ATOM   3134 C CA   . LYS B 2 35  ? 55.033 49.002  76.437 1.00 64.83  ? 65  LYS B CA   1 
ATOM   3135 C C    . LYS B 2 35  ? 54.201 48.991  75.162 1.00 66.79  ? 65  LYS B C    1 
ATOM   3136 O O    . LYS B 2 35  ? 52.995 48.723  75.216 1.00 61.39  ? 65  LYS B O    1 
ATOM   3137 C CB   . LYS B 2 35  ? 55.012 50.396  77.067 1.00 69.15  ? 65  LYS B CB   1 
ATOM   3138 C CG   . LYS B 2 35  ? 55.516 50.438  78.506 1.00 71.05  ? 65  LYS B CG   1 
ATOM   3139 C CD   . LYS B 2 35  ? 54.854 51.557  79.303 1.00 75.50  ? 65  LYS B CD   1 
ATOM   3140 C CE   . LYS B 2 35  ? 55.316 52.933  78.848 1.00 80.98  ? 65  LYS B CE   1 
ATOM   3141 N NZ   . LYS B 2 35  ? 56.736 53.196  79.220 1.00 84.20  ? 65  LYS B NZ   1 
ATOM   3142 H H    . LYS B 2 35  ? 57.000 49.192  76.320 1.00 81.42  ? 65  LYS B H    1 
ATOM   3143 H HA   . LYS B 2 35  ? 54.623 48.386  77.064 1.00 77.80  ? 65  LYS B HA   1 
ATOM   3144 H HB2  . LYS B 2 35  ? 55.574 50.985  76.540 1.00 82.98  ? 65  LYS B HB2  1 
ATOM   3145 H HB3  . LYS B 2 35  ? 54.099 50.725  77.064 1.00 82.98  ? 65  LYS B HB3  1 
ATOM   3146 H HG2  . LYS B 2 35  ? 55.313 49.595  78.940 1.00 85.26  ? 65  LYS B HG2  1 
ATOM   3147 H HG3  . LYS B 2 35  ? 56.474 50.593  78.504 1.00 85.26  ? 65  LYS B HG3  1 
ATOM   3148 H HD2  . LYS B 2 35  ? 53.893 51.506  79.184 1.00 90.60  ? 65  LYS B HD2  1 
ATOM   3149 H HD3  . LYS B 2 35  ? 55.080 51.456  80.241 1.00 90.60  ? 65  LYS B HD3  1 
ATOM   3150 H HE2  . LYS B 2 35  ? 55.240 52.992  77.883 1.00 97.18  ? 65  LYS B HE2  1 
ATOM   3151 H HE3  . LYS B 2 35  ? 54.763 53.610  79.269 1.00 97.18  ? 65  LYS B HE3  1 
ATOM   3152 H HZ1  . LYS B 2 35  ? 56.978 54.006  78.942 1.00 101.04 ? 65  LYS B HZ1  1 
ATOM   3153 H HZ2  . LYS B 2 35  ? 56.832 53.153  80.104 1.00 101.04 ? 65  LYS B HZ2  1 
ATOM   3154 H HZ3  . LYS B 2 35  ? 57.267 52.590  78.841 1.00 101.04 ? 65  LYS B HZ3  1 
ATOM   3155 N N    . GLU B 2 36  ? 54.812 49.270  74.013 1.00 81.06  ? 66  GLU B N    1 
ATOM   3156 C CA   . GLU B 2 36  ? 54.052 49.312  72.771 1.00 85.73  ? 66  GLU B CA   1 
ATOM   3157 C C    . GLU B 2 36  ? 53.597 47.934  72.305 1.00 78.23  ? 66  GLU B C    1 
ATOM   3158 O O    . GLU B 2 36  ? 52.861 47.855  71.314 1.00 77.84  ? 66  GLU B O    1 
ATOM   3159 C CB   . GLU B 2 36  ? 54.880 49.984  71.672 1.00 88.98  ? 66  GLU B CB   1 
ATOM   3160 C CG   . GLU B 2 36  ? 56.112 49.205  71.243 1.00 97.56  ? 66  GLU B CG   1 
ATOM   3161 C CD   . GLU B 2 36  ? 56.944 49.950  70.214 1.00 102.93 ? 66  GLU B CD   1 
ATOM   3162 O OE1  . GLU B 2 36  ? 58.157 49.668  70.111 1.00 104.50 ? 66  GLU B OE1  1 
ATOM   3163 O OE2  . GLU B 2 36  ? 56.384 50.820  69.510 1.00 103.97 ? 66  GLU B OE2  1 
ATOM   3164 H H    . GLU B 2 36  ? 55.652 49.435  73.928 1.00 97.28  ? 66  GLU B H    1 
ATOM   3165 H HA   . GLU B 2 36  ? 53.258 49.851  72.912 1.00 102.88 ? 66  GLU B HA   1 
ATOM   3166 H HB2  . GLU B 2 36  ? 54.319 50.102  70.890 1.00 106.77 ? 66  GLU B HB2  1 
ATOM   3167 H HB3  . GLU B 2 36  ? 55.177 50.850  71.994 1.00 106.77 ? 66  GLU B HB3  1 
ATOM   3168 H HG2  . GLU B 2 36  ? 56.670 49.042  72.020 1.00 117.07 ? 66  GLU B HG2  1 
ATOM   3169 H HG3  . GLU B 2 36  ? 55.833 48.362  70.852 1.00 117.07 ? 66  GLU B HG3  1 
ATOM   3170 N N    . PHE B 2 37  ? 53.999 46.857  72.980 1.00 68.50  ? 67  PHE B N    1 
ATOM   3171 C CA   . PHE B 2 37  ? 53.559 45.512  72.633 1.00 59.54  ? 67  PHE B CA   1 
ATOM   3172 C C    . PHE B 2 37  ? 52.649 44.906  73.694 1.00 61.78  ? 67  PHE B C    1 
ATOM   3173 O O    . PHE B 2 37  ? 52.361 43.706  73.639 1.00 57.78  ? 67  PHE B O    1 
ATOM   3174 C CB   . PHE B 2 37  ? 54.771 44.613  72.384 1.00 53.81  ? 67  PHE B CB   1 
ATOM   3175 C CG   . PHE B 2 37  ? 55.637 45.083  71.252 1.00 47.77  ? 67  PHE B CG   1 
ATOM   3176 C CD1  . PHE B 2 37  ? 55.083 45.383  70.017 1.00 45.90  ? 67  PHE B CD1  1 
ATOM   3177 C CD2  . PHE B 2 37  ? 57.000 45.263  71.430 1.00 48.61  ? 67  PHE B CD2  1 
ATOM   3178 C CE1  . PHE B 2 37  ? 55.873 45.830  68.976 1.00 46.22  ? 67  PHE B CE1  1 
ATOM   3179 C CE2  . PHE B 2 37  ? 57.794 45.712  70.392 1.00 48.58  ? 67  PHE B CE2  1 
ATOM   3180 C CZ   . PHE B 2 37  ? 57.229 45.999  69.165 1.00 47.61  ? 67  PHE B CZ   1 
ATOM   3181 H H    . PHE B 2 37  ? 54.535 46.883  73.653 1.00 82.20  ? 67  PHE B H    1 
ATOM   3182 H HA   . PHE B 2 37  ? 53.053 45.558  71.807 1.00 71.44  ? 67  PHE B HA   1 
ATOM   3183 H HB2  . PHE B 2 37  ? 55.316 44.591  73.187 1.00 64.57  ? 67  PHE B HB2  1 
ATOM   3184 H HB3  . PHE B 2 37  ? 54.461 43.719  72.171 1.00 64.57  ? 67  PHE B HB3  1 
ATOM   3185 H HD1  . PHE B 2 37  ? 54.169 45.272  69.885 1.00 55.07  ? 67  PHE B HD1  1 
ATOM   3186 H HD2  . PHE B 2 37  ? 57.385 45.073  72.254 1.00 58.33  ? 67  PHE B HD2  1 
ATOM   3187 H HE1  . PHE B 2 37  ? 55.490 46.022  68.150 1.00 55.47  ? 67  PHE B HE1  1 
ATOM   3188 H HE2  . PHE B 2 37  ? 58.708 45.823  70.520 1.00 58.29  ? 67  PHE B HE2  1 
ATOM   3189 H HZ   . PHE B 2 37  ? 57.763 46.298  68.465 1.00 57.13  ? 67  PHE B HZ   1 
ATOM   3190 N N    . LEU B 2 38  ? 52.181 45.706  74.649 1.00 73.23  ? 68  LEU B N    1 
ATOM   3191 C CA   . LEU B 2 38  ? 51.197 45.219  75.610 1.00 74.57  ? 68  LEU B CA   1 
ATOM   3192 C C    . LEU B 2 38  ? 49.962 44.628  74.947 1.00 71.61  ? 68  LEU B C    1 
ATOM   3193 O O    . LEU B 2 38  ? 49.472 43.596  75.433 1.00 73.24  ? 68  LEU B O    1 
ATOM   3194 C CB   . LEU B 2 38  ? 50.793 46.358  76.558 1.00 78.66  ? 68  LEU B CB   1 
ATOM   3195 C CG   . LEU B 2 38  ? 51.691 46.566  77.779 1.00 84.36  ? 68  LEU B CG   1 
ATOM   3196 C CD1  . LEU B 2 38  ? 51.353 47.874  78.470 1.00 87.32  ? 68  LEU B CD1  1 
ATOM   3197 C CD2  . LEU B 2 38  ? 51.559 45.395  78.752 1.00 84.86  ? 68  LEU B CD2  1 
ATOM   3198 H H    . LEU B 2 38  ? 52.415 46.526  74.761 1.00 87.88  ? 68  LEU B H    1 
ATOM   3199 H HA   . LEU B 2 38  ? 51.605 44.521  76.145 1.00 89.49  ? 68  LEU B HA   1 
ATOM   3200 H HB2  . LEU B 2 38  ? 50.793 47.188  76.055 1.00 94.40  ? 68  LEU B HB2  1 
ATOM   3201 H HB3  . LEU B 2 38  ? 49.897 46.180  76.885 1.00 94.40  ? 68  LEU B HB3  1 
ATOM   3202 H HG   . LEU B 2 38  ? 52.615 46.610  77.488 1.00 101.23 ? 68  LEU B HG   1 
ATOM   3203 H HD11 . LEU B 2 38  ? 51.934 47.984  79.239 1.00 104.79 ? 68  LEU B HD11 1 
ATOM   3204 H HD12 . LEU B 2 38  ? 51.489 48.604  77.846 1.00 104.79 ? 68  LEU B HD12 1 
ATOM   3205 H HD13 . LEU B 2 38  ? 50.426 47.850  78.755 1.00 104.79 ? 68  LEU B HD13 1 
ATOM   3206 H HD21 . LEU B 2 38  ? 52.138 45.552  79.515 1.00 101.84 ? 68  LEU B HD21 1 
ATOM   3207 H HD22 . LEU B 2 38  ? 50.636 45.330  79.044 1.00 101.84 ? 68  LEU B HD22 1 
ATOM   3208 H HD23 . LEU B 2 38  ? 51.822 44.578  78.300 1.00 101.84 ? 68  LEU B HD23 1 
ATOM   3209 N N    . PRO B 2 39  ? 49.416 45.202  73.872 1.00 60.05  ? 69  PRO B N    1 
ATOM   3210 C CA   . PRO B 2 39  ? 48.235 44.593  73.239 1.00 54.69  ? 69  PRO B CA   1 
ATOM   3211 C C    . PRO B 2 39  ? 48.455 43.170  72.755 1.00 52.38  ? 69  PRO B C    1 
ATOM   3212 O O    . PRO B 2 39  ? 47.473 42.428  72.616 1.00 50.33  ? 69  PRO B O    1 
ATOM   3213 C CB   . PRO B 2 39  ? 47.939 45.537  72.066 1.00 54.34  ? 69  PRO B CB   1 
ATOM   3214 C CG   . PRO B 2 39  ? 48.550 46.827  72.448 1.00 56.15  ? 69  PRO B CG   1 
ATOM   3215 C CD   . PRO B 2 39  ? 49.771 46.485  73.243 1.00 58.65  ? 69  PRO B CD   1 
ATOM   3216 H HA   . PRO B 2 39  ? 47.484 44.606  73.853 1.00 65.63  ? 69  PRO B HA   1 
ATOM   3217 H HB2  . PRO B 2 39  ? 48.346 45.190  71.256 1.00 65.20  ? 69  PRO B HB2  1 
ATOM   3218 H HB3  . PRO B 2 39  ? 46.980 45.630  71.955 1.00 65.20  ? 69  PRO B HB3  1 
ATOM   3219 H HG2  . PRO B 2 39  ? 48.791 47.321  71.648 1.00 67.37  ? 69  PRO B HG2  1 
ATOM   3220 H HG3  . PRO B 2 39  ? 47.924 47.335  72.986 1.00 67.37  ? 69  PRO B HG3  1 
ATOM   3221 H HD2  . PRO B 2 39  ? 50.537 46.375  72.658 1.00 70.38  ? 69  PRO B HD2  1 
ATOM   3222 H HD3  . PRO B 2 39  ? 49.934 47.160  73.920 1.00 70.38  ? 69  PRO B HD3  1 
ATOM   3223 N N    . ILE B 2 40  ? 49.698 42.758  72.498 1.00 54.55  ? 70  ILE B N    1 
ATOM   3224 C CA   . ILE B 2 40  ? 49.975 41.437  71.943 1.00 53.39  ? 70  ILE B CA   1 
ATOM   3225 C C    . ILE B 2 40  ? 50.747 40.550  72.899 1.00 54.78  ? 70  ILE B C    1 
ATOM   3226 O O    . ILE B 2 40  ? 51.037 39.393  72.552 1.00 54.63  ? 70  ILE B O    1 
ATOM   3227 C CB   . ILE B 2 40  ? 50.719 41.536  70.598 1.00 52.07  ? 70  ILE B CB   1 
ATOM   3228 C CG1  . ILE B 2 40  ? 52.136 42.085  70.791 1.00 52.93  ? 70  ILE B CG1  1 
ATOM   3229 C CG2  . ILE B 2 40  ? 49.937 42.406  69.632 1.00 52.22  ? 70  ILE B CG2  1 
ATOM   3230 C CD1  . ILE B 2 40  ? 53.004 41.984  69.551 1.00 52.59  ? 70  ILE B CD1  1 
ATOM   3231 H H    . ILE B 2 40  ? 50.402 43.232  72.637 1.00 65.45  ? 70  ILE B H    1 
ATOM   3232 H HA   . ILE B 2 40  ? 49.127 40.999  71.769 1.00 64.06  ? 70  ILE B HA   1 
ATOM   3233 H HB   . ILE B 2 40  ? 50.786 40.645  70.220 1.00 62.48  ? 70  ILE B HB   1 
ATOM   3234 H HG12 . ILE B 2 40  ? 52.077 43.022  71.036 1.00 63.51  ? 70  ILE B HG12 1 
ATOM   3235 H HG13 . ILE B 2 40  ? 52.571 41.586  71.499 1.00 63.51  ? 70  ILE B HG13 1 
ATOM   3236 H HG21 . ILE B 2 40  ? 50.420 42.457  68.792 1.00 62.66  ? 70  ILE B HG21 1 
ATOM   3237 H HG22 . ILE B 2 40  ? 49.063 42.011  69.488 1.00 62.66  ? 70  ILE B HG22 1 
ATOM   3238 H HG23 . ILE B 2 40  ? 49.841 43.293  70.013 1.00 62.66  ? 70  ILE B HG23 1 
ATOM   3239 H HD11 . ILE B 2 40  ? 53.880 42.349  69.749 1.00 63.10  ? 70  ILE B HD11 1 
ATOM   3240 H HD12 . ILE B 2 40  ? 53.083 41.051  69.297 1.00 63.10  ? 70  ILE B HD12 1 
ATOM   3241 H HD13 . ILE B 2 40  ? 52.589 42.488  68.833 1.00 63.10  ? 70  ILE B HD13 1 
ATOM   3242 N N    . LEU B 2 41  ? 51.091 41.037  74.087 1.00 55.06  ? 71  LEU B N    1 
ATOM   3243 C CA   . LEU B 2 41  ? 51.882 40.236  75.010 1.00 54.68  ? 71  LEU B CA   1 
ATOM   3244 C C    . LEU B 2 41  ? 51.032 39.133  75.621 1.00 54.45  ? 71  LEU B C    1 
ATOM   3245 O O    . LEU B 2 41  ? 49.939 39.386  76.137 1.00 55.35  ? 71  LEU B O    1 
ATOM   3246 C CB   . LEU B 2 41  ? 52.465 41.104  76.118 1.00 55.13  ? 71  LEU B CB   1 
ATOM   3247 C CG   . LEU B 2 41  ? 53.193 40.329  77.221 1.00 54.67  ? 71  LEU B CG   1 
ATOM   3248 C CD1  . LEU B 2 41  ? 54.368 39.547  76.642 1.00 54.09  ? 71  LEU B CD1  1 
ATOM   3249 C CD2  . LEU B 2 41  ? 53.659 41.266  78.322 1.00 56.70  ? 71  LEU B CD2  1 
ATOM   3250 H H    . LEU B 2 41  ? 50.882 41.819  74.378 1.00 66.07  ? 71  LEU B H    1 
ATOM   3251 H HA   . LEU B 2 41  ? 52.615 39.823  74.529 1.00 65.61  ? 71  LEU B HA   1 
ATOM   3252 H HB2  . LEU B 2 41  ? 53.102 41.721  75.725 1.00 66.15  ? 71  LEU B HB2  1 
ATOM   3253 H HB3  . LEU B 2 41  ? 51.744 41.601  76.535 1.00 66.15  ? 71  LEU B HB3  1 
ATOM   3254 H HG   . LEU B 2 41  ? 52.576 39.691  77.615 1.00 65.60  ? 71  LEU B HG   1 
ATOM   3255 H HD11 . LEU B 2 41  ? 54.811 39.066  77.359 1.00 64.91  ? 71  LEU B HD11 1 
ATOM   3256 H HD12 . LEU B 2 41  ? 54.035 38.922  75.980 1.00 64.91  ? 71  LEU B HD12 1 
ATOM   3257 H HD13 . LEU B 2 41  ? 54.987 40.169  76.229 1.00 64.91  ? 71  LEU B HD13 1 
ATOM   3258 H HD21 . LEU B 2 41  ? 54.115 40.749  79.005 1.00 68.04  ? 71  LEU B HD21 1 
ATOM   3259 H HD22 . LEU B 2 41  ? 54.266 41.921  77.943 1.00 68.04  ? 71  LEU B HD22 1 
ATOM   3260 H HD23 . LEU B 2 41  ? 52.888 41.713  78.705 1.00 68.04  ? 71  LEU B HD23 1 
ATOM   3261 N N    . GLN B 2 42  ? 51.541 37.909  75.561 1.00 51.86  ? 72  GLN B N    1 
ATOM   3262 C CA   . GLN B 2 42  ? 50.955 36.763  76.245 1.00 51.87  ? 72  GLN B CA   1 
ATOM   3263 C C    . GLN B 2 42  ? 51.872 36.436  77.416 1.00 55.21  ? 72  GLN B C    1 
ATOM   3264 O O    . GLN B 2 42  ? 52.979 35.925  77.216 1.00 55.35  ? 72  GLN B O    1 
ATOM   3265 C CB   . GLN B 2 42  ? 50.809 35.576  75.297 1.00 49.64  ? 72  GLN B CB   1 
ATOM   3266 C CG   . GLN B 2 42  ? 50.305 34.309  75.955 1.00 48.93  ? 72  GLN B CG   1 
ATOM   3267 C CD   . GLN B 2 42  ? 48.911 34.462  76.508 1.00 48.99  ? 72  GLN B CD   1 
ATOM   3268 O OE1  . GLN B 2 42  ? 48.127 35.276  76.022 1.00 49.34  ? 72  GLN B OE1  1 
ATOM   3269 N NE2  . GLN B 2 42  ? 48.593 33.685  77.537 1.00 50.13  ? 72  GLN B NE2  1 
ATOM   3270 H H    . GLN B 2 42  ? 52.249 37.711  75.114 1.00 62.23  ? 72  GLN B H    1 
ATOM   3271 H HA   . GLN B 2 42  ? 50.080 36.999  76.590 1.00 62.24  ? 72  GLN B HA   1 
ATOM   3272 H HB2  . GLN B 2 42  ? 50.181 35.814  74.597 1.00 59.57  ? 72  GLN B HB2  1 
ATOM   3273 H HB3  . GLN B 2 42  ? 51.675 35.381  74.907 1.00 59.57  ? 72  GLN B HB3  1 
ATOM   3274 H HG2  . GLN B 2 42  ? 50.291 33.595  75.299 1.00 58.72  ? 72  GLN B HG2  1 
ATOM   3275 H HG3  . GLN B 2 42  ? 50.896 34.076  76.688 1.00 58.72  ? 72  GLN B HG3  1 
ATOM   3276 H HE21 . GLN B 2 42  ? 49.170 33.131  77.852 1.00 60.15  ? 72  GLN B HE21 1 
ATOM   3277 H HE22 . GLN B 2 42  ? 47.809 33.735  77.887 1.00 60.15  ? 72  GLN B HE22 1 
ATOM   3278 N N    . GLU B 2 43  ? 51.422 36.749  78.632 1.00 63.02  ? 73  GLU B N    1 
ATOM   3279 C CA   . GLU B 2 43  ? 52.276 36.573  79.804 1.00 68.78  ? 73  GLU B CA   1 
ATOM   3280 C C    . GLU B 2 43  ? 52.530 35.096  80.075 1.00 70.56  ? 73  GLU B C    1 
ATOM   3281 O O    . GLU B 2 43  ? 53.678 34.636  80.056 1.00 71.17  ? 73  GLU B O    1 
ATOM   3282 C CB   . GLU B 2 43  ? 51.644 37.251  81.023 1.00 73.09  ? 73  GLU B CB   1 
ATOM   3283 C CG   . GLU B 2 43  ? 51.428 38.752  80.843 1.00 76.02  ? 73  GLU B CG   1 
ATOM   3284 C CD   . GLU B 2 43  ? 51.155 39.479  82.150 1.00 79.64  ? 73  GLU B CD   1 
ATOM   3285 O OE1  . GLU B 2 43  ? 51.990 39.383  83.075 1.00 81.61  ? 73  GLU B OE1  1 
ATOM   3286 O OE2  . GLU B 2 43  ? 50.105 40.146  82.252 1.00 80.53  ? 73  GLU B OE2  1 
ATOM   3287 H H    . GLU B 2 43  ? 50.639 37.061  78.803 1.00 75.63  ? 73  GLU B H    1 
ATOM   3288 H HA   . GLU B 2 43  ? 53.132 36.998  79.637 1.00 82.54  ? 73  GLU B HA   1 
ATOM   3289 H HB2  . GLU B 2 43  ? 50.780 36.845  81.194 1.00 87.71  ? 73  GLU B HB2  1 
ATOM   3290 H HB3  . GLU B 2 43  ? 52.225 37.124  81.789 1.00 87.71  ? 73  GLU B HB3  1 
ATOM   3291 H HG2  . GLU B 2 43  ? 52.224 39.139  80.447 1.00 91.22  ? 73  GLU B HG2  1 
ATOM   3292 H HG3  . GLU B 2 43  ? 50.666 38.892  80.259 1.00 91.22  ? 73  GLU B HG3  1 
ATOM   3293 N N    . GLU B 2 44  ? 51.473 34.339  80.327 1.00 72.88  ? 74  GLU B N    1 
ATOM   3294 C CA   . GLU B 2 44  ? 51.615 32.905  80.533 1.00 75.51  ? 74  GLU B CA   1 
ATOM   3295 C C    . GLU B 2 44  ? 51.953 32.245  79.202 1.00 66.91  ? 74  GLU B C    1 
ATOM   3296 O O    . GLU B 2 44  ? 51.197 32.410  78.237 1.00 65.22  ? 74  GLU B O    1 
ATOM   3297 C CB   . GLU B 2 44  ? 50.329 32.322  81.112 1.00 82.98  ? 74  GLU B CB   1 
ATOM   3298 C CG   . GLU B 2 44  ? 50.414 30.839  81.460 1.00 90.46  ? 74  GLU B CG   1 
ATOM   3299 C CD   . GLU B 2 44  ? 51.379 30.554  82.602 1.00 97.94  ? 74  GLU B CD   1 
ATOM   3300 O OE1  . GLU B 2 44  ? 51.724 31.497  83.349 1.00 100.56 ? 74  GLU B OE1  1 
ATOM   3301 O OE2  . GLU B 2 44  ? 51.793 29.384  82.750 1.00 99.66  ? 74  GLU B OE2  1 
ATOM   3302 H H    . GLU B 2 44  ? 50.665 34.628  80.384 1.00 87.46  ? 74  GLU B H    1 
ATOM   3303 H HA   . GLU B 2 44  ? 52.339 32.735  81.156 1.00 90.61  ? 74  GLU B HA   1 
ATOM   3304 H HB2  . GLU B 2 44  ? 50.107 32.804  81.924 1.00 99.57  ? 74  GLU B HB2  1 
ATOM   3305 H HB3  . GLU B 2 44  ? 49.617 32.433  80.462 1.00 99.57  ? 74  GLU B HB3  1 
ATOM   3306 H HG2  . GLU B 2 44  ? 49.535 30.526  81.726 1.00 108.55 ? 74  GLU B HG2  1 
ATOM   3307 H HG3  . GLU B 2 44  ? 50.719 30.348  80.681 1.00 108.55 ? 74  GLU B HG3  1 
ATOM   3308 N N    . PRO B 2 45  ? 53.060 31.511  79.089 1.00 60.19  ? 75  PRO B N    1 
ATOM   3309 C CA   . PRO B 2 45  ? 53.416 30.931  77.789 1.00 54.78  ? 75  PRO B CA   1 
ATOM   3310 C C    . PRO B 2 45  ? 52.386 29.908  77.336 1.00 52.18  ? 75  PRO B C    1 
ATOM   3311 O O    . PRO B 2 45  ? 51.867 29.124  78.132 1.00 51.74  ? 75  PRO B O    1 
ATOM   3312 C CB   . PRO B 2 45  ? 54.785 30.288  78.046 1.00 55.41  ? 75  PRO B CB   1 
ATOM   3313 C CG   . PRO B 2 45  ? 54.834 30.052  79.513 1.00 57.63  ? 75  PRO B CG   1 
ATOM   3314 C CD   . PRO B 2 45  ? 54.042 31.165  80.132 1.00 59.98  ? 75  PRO B CD   1 
ATOM   3315 H HA   . PRO B 2 45  ? 53.503 31.626  77.118 1.00 65.74  ? 75  PRO B HA   1 
ATOM   3316 H HB2  . PRO B 2 45  ? 54.849 29.451  77.561 1.00 66.49  ? 75  PRO B HB2  1 
ATOM   3317 H HB3  . PRO B 2 45  ? 55.488 30.898  77.773 1.00 66.49  ? 75  PRO B HB3  1 
ATOM   3318 H HG2  . PRO B 2 45  ? 54.433 29.193  79.717 1.00 69.15  ? 75  PRO B HG2  1 
ATOM   3319 H HG3  . PRO B 2 45  ? 55.755 30.080  79.816 1.00 69.15  ? 75  PRO B HG3  1 
ATOM   3320 H HD2  . PRO B 2 45  ? 53.589 30.854  80.931 1.00 71.97  ? 75  PRO B HD2  1 
ATOM   3321 H HD3  . PRO B 2 45  ? 54.615 31.924  80.320 1.00 71.97  ? 75  PRO B HD3  1 
ATOM   3322 N N    . LEU B 2 46  ? 52.093 29.925  76.043 1.00 46.91  ? 76  LEU B N    1 
ATOM   3323 C CA   . LEU B 2 46  ? 51.092 29.036  75.472 1.00 46.49  ? 76  LEU B CA   1 
ATOM   3324 C C    . LEU B 2 46  ? 51.752 27.889  74.719 1.00 46.00  ? 76  LEU B C    1 
ATOM   3325 O O    . LEU B 2 46  ? 52.710 28.109  73.973 1.00 43.95  ? 76  LEU B O    1 
ATOM   3326 C CB   . LEU B 2 46  ? 50.182 29.790  74.505 1.00 46.06  ? 76  LEU B CB   1 
ATOM   3327 C CG   . LEU B 2 46  ? 49.311 30.884  75.109 1.00 46.44  ? 76  LEU B CG   1 
ATOM   3328 C CD1  . LEU B 2 46  ? 48.747 31.752  73.996 1.00 46.05  ? 76  LEU B CD1  1 
ATOM   3329 C CD2  . LEU B 2 46  ? 48.197 30.279  75.952 1.00 48.19  ? 76  LEU B CD2  1 
ATOM   3330 H H    . LEU B 2 46  ? 52.464 30.447  75.469 1.00 56.30  ? 76  LEU B H    1 
ATOM   3331 H HA   . LEU B 2 46  ? 50.546 28.664  76.182 1.00 55.78  ? 76  LEU B HA   1 
ATOM   3332 H HB2  . LEU B 2 46  ? 50.738 30.206  73.828 1.00 55.27  ? 76  LEU B HB2  1 
ATOM   3333 H HB3  . LEU B 2 46  ? 49.588 29.149  74.085 1.00 55.27  ? 76  LEU B HB3  1 
ATOM   3334 H HG   . LEU B 2 46  ? 49.856 31.444  75.684 1.00 55.73  ? 76  LEU B HG   1 
ATOM   3335 H HD11 . LEU B 2 46  ? 48.193 32.446  74.387 1.00 55.26  ? 76  LEU B HD11 1 
ATOM   3336 H HD12 . LEU B 2 46  ? 49.481 32.151  73.505 1.00 55.26  ? 76  LEU B HD12 1 
ATOM   3337 H HD13 . LEU B 2 46  ? 48.214 31.198  73.404 1.00 55.26  ? 76  LEU B HD13 1 
ATOM   3338 H HD21 . LEU B 2 46  ? 47.659 30.995  76.324 1.00 57.83  ? 76  LEU B HD21 1 
ATOM   3339 H HD22 . LEU B 2 46  ? 47.649 29.711  75.389 1.00 57.83  ? 76  LEU B HD22 1 
ATOM   3340 H HD23 . LEU B 2 46  ? 48.592 29.756  76.667 1.00 57.83  ? 76  LEU B HD23 1 
ATOM   3341 N N    . PRO B 2 47  ? 51.267 26.660  74.858 1.00 53.17  ? 77  PRO B N    1 
ATOM   3342 C CA   . PRO B 2 47  ? 51.785 25.570  74.032 1.00 54.12  ? 77  PRO B CA   1 
ATOM   3343 C C    . PRO B 2 47  ? 51.404 25.773  72.577 1.00 48.57  ? 77  PRO B C    1 
ATOM   3344 O O    . PRO B 2 47  ? 50.474 26.533  72.266 1.00 48.15  ? 77  PRO B O    1 
ATOM   3345 C CB   . PRO B 2 47  ? 51.114 24.319  74.625 1.00 55.32  ? 77  PRO B CB   1 
ATOM   3346 C CG   . PRO B 2 47  ? 49.906 24.815  75.286 1.00 57.87  ? 77  PRO B CG   1 
ATOM   3347 C CD   . PRO B 2 47  ? 50.224 26.195  75.787 1.00 57.15  ? 77  PRO B CD   1 
ATOM   3348 H HA   . PRO B 2 47  ? 52.748 25.499  74.115 1.00 64.95  ? 77  PRO B HA   1 
ATOM   3349 H HB2  . PRO B 2 47  ? 50.886 23.701  73.913 1.00 66.39  ? 77  PRO B HB2  1 
ATOM   3350 H HB3  . PRO B 2 47  ? 51.709 23.901  75.266 1.00 66.39  ? 77  PRO B HB3  1 
ATOM   3351 H HG2  . PRO B 2 47  ? 49.178 24.847  74.645 1.00 69.45  ? 77  PRO B HG2  1 
ATOM   3352 H HG3  . PRO B 2 47  ? 49.681 24.229  76.026 1.00 69.45  ? 77  PRO B HG3  1 
ATOM   3353 H HD2  . PRO B 2 47  ? 49.441 26.764  75.730 1.00 68.58  ? 77  PRO B HD2  1 
ATOM   3354 H HD3  . PRO B 2 47  ? 50.570 26.154  76.693 1.00 68.58  ? 77  PRO B HD3  1 
ATOM   3355 N N    . PRO B 2 48  ? 52.104 25.124  71.654 1.00 39.10  ? 78  PRO B N    1 
ATOM   3356 C CA   . PRO B 2 48  ? 51.741 25.259  70.241 1.00 37.19  ? 78  PRO B CA   1 
ATOM   3357 C C    . PRO B 2 48  ? 50.302 24.833  69.993 1.00 37.93  ? 78  PRO B C    1 
ATOM   3358 O O    . PRO B 2 48  ? 49.812 23.860  70.571 1.00 35.28  ? 78  PRO B O    1 
ATOM   3359 C CB   . PRO B 2 48  ? 52.725 24.331  69.533 1.00 35.98  ? 78  PRO B CB   1 
ATOM   3360 C CG   . PRO B 2 48  ? 53.881 24.227  70.466 1.00 37.89  ? 78  PRO B CG   1 
ATOM   3361 C CD   . PRO B 2 48  ? 53.306 24.296  71.840 1.00 39.43  ? 78  PRO B CD   1 
ATOM   3362 H HA   . PRO B 2 48  ? 51.872 26.171  69.938 1.00 44.63  ? 78  PRO B HA   1 
ATOM   3363 H HB2  . PRO B 2 48  ? 52.315 23.462  69.393 1.00 43.18  ? 78  PRO B HB2  1 
ATOM   3364 H HB3  . PRO B 2 48  ? 52.998 24.724  68.689 1.00 43.18  ? 78  PRO B HB3  1 
ATOM   3365 H HG2  . PRO B 2 48  ? 54.334 23.380  70.329 1.00 45.46  ? 78  PRO B HG2  1 
ATOM   3366 H HG3  . PRO B 2 48  ? 54.489 24.967  70.314 1.00 45.46  ? 78  PRO B HG3  1 
ATOM   3367 H HD2  . PRO B 2 48  ? 53.064 23.410  72.152 1.00 47.32  ? 78  PRO B HD2  1 
ATOM   3368 H HD3  . PRO B 2 48  ? 53.927 24.731  72.446 1.00 47.32  ? 78  PRO B HD3  1 
ATOM   3369 N N    . LEU B 2 49  ? 49.630 25.564  69.103 1.00 35.28  ? 79  LEU B N    1 
ATOM   3370 C CA   . LEU B 2 49  ? 48.314 25.138  68.654 1.00 37.90  ? 79  LEU B CA   1 
ATOM   3371 C C    . LEU B 2 49  ? 48.348 23.742  68.056 1.00 36.94  ? 79  LEU B C    1 
ATOM   3372 O O    . LEU B 2 49  ? 47.320 23.051  68.055 1.00 35.27  ? 79  LEU B O    1 
ATOM   3373 C CB   . LEU B 2 49  ? 47.765 26.126  67.628 1.00 41.10  ? 79  LEU B CB   1 
ATOM   3374 C CG   . LEU B 2 49  ? 47.308 27.471  68.184 1.00 43.36  ? 79  LEU B CG   1 
ATOM   3375 C CD1  . LEU B 2 49  ? 46.877 28.399  67.061 1.00 44.68  ? 79  LEU B CD1  1 
ATOM   3376 C CD2  . LEU B 2 49  ? 46.173 27.281  69.174 1.00 47.13  ? 79  LEU B CD2  1 
ATOM   3377 H H    . LEU B 2 49  ? 49.912 26.297  68.753 1.00 42.34  ? 79  LEU B H    1 
ATOM   3378 H HA   . LEU B 2 49  ? 47.710 25.125  69.412 1.00 45.48  ? 79  LEU B HA   1 
ATOM   3379 H HB2  . LEU B 2 49  ? 48.458 26.303  66.973 1.00 49.31  ? 79  LEU B HB2  1 
ATOM   3380 H HB3  . LEU B 2 49  ? 47.002 25.719  67.190 1.00 49.31  ? 79  LEU B HB3  1 
ATOM   3381 H HG   . LEU B 2 49  ? 48.049 27.888  68.652 1.00 52.04  ? 79  LEU B HG   1 
ATOM   3382 H HD11 . LEU B 2 49  ? 46.592 29.244  67.443 1.00 53.61  ? 79  LEU B HD11 1 
ATOM   3383 H HD12 . LEU B 2 49  ? 47.627 28.541  66.464 1.00 53.61  ? 79  LEU B HD12 1 
ATOM   3384 H HD13 . LEU B 2 49  ? 46.142 27.990  66.578 1.00 53.61  ? 79  LEU B HD13 1 
ATOM   3385 H HD21 . LEU B 2 49  ? 45.901 28.148  69.512 1.00 56.55  ? 79  LEU B HD21 1 
ATOM   3386 H HD22 . LEU B 2 49  ? 45.428 26.853  68.722 1.00 56.55  ? 79  LEU B HD22 1 
ATOM   3387 H HD23 . LEU B 2 49  ? 46.482 26.722  69.905 1.00 56.55  ? 79  LEU B HD23 1 
ATOM   3388 N N    . ALA B 2 50  ? 49.507 23.311  67.553 1.00 36.17  ? 80  ALA B N    1 
ATOM   3389 C CA   . ALA B 2 50  ? 49.624 21.974  66.988 1.00 36.61  ? 80  ALA B CA   1 
ATOM   3390 C C    . ALA B 2 50  ? 49.197 20.904  67.984 1.00 39.11  ? 80  ALA B C    1 
ATOM   3391 O O    . ALA B 2 50  ? 48.695 19.849  67.578 1.00 40.10  ? 80  ALA B O    1 
ATOM   3392 C CB   . ALA B 2 50  ? 51.061 21.729  66.527 1.00 36.89  ? 80  ALA B CB   1 
ATOM   3393 H H    . ALA B 2 50  ? 50.233 23.772  67.530 1.00 43.40  ? 80  ALA B H    1 
ATOM   3394 H HA   . ALA B 2 50  ? 49.046 21.909  66.212 1.00 43.94  ? 80  ALA B HA   1 
ATOM   3395 H HB1  . ALA B 2 50  ? 51.125 20.837  66.153 1.00 44.27  ? 80  ALA B HB1  1 
ATOM   3396 H HB2  . ALA B 2 50  ? 51.293 22.388  65.853 1.00 44.27  ? 80  ALA B HB2  1 
ATOM   3397 H HB3  . ALA B 2 50  ? 51.656 21.812  67.289 1.00 44.27  ? 80  ALA B HB3  1 
ATOM   3398 N N    . LEU B 2 51  ? 49.390 21.148  69.283 1.00 40.25  ? 81  LEU B N    1 
ATOM   3399 C CA   . LEU B 2 51  ? 49.014 20.178  70.305 1.00 41.66  ? 81  LEU B CA   1 
ATOM   3400 C C    . LEU B 2 51  ? 47.534 20.228  70.645 1.00 44.21  ? 81  LEU B C    1 
ATOM   3401 O O    . LEU B 2 51  ? 47.042 19.323  71.326 1.00 46.93  ? 81  LEU B O    1 
ATOM   3402 C CB   . LEU B 2 51  ? 49.829 20.403  71.581 1.00 41.74  ? 81  LEU B CB   1 
ATOM   3403 C CG   . LEU B 2 51  ? 51.356 20.471  71.409 1.00 41.07  ? 81  LEU B CG   1 
ATOM   3404 C CD1  . LEU B 2 51  ? 52.044 20.564  72.763 1.00 40.89  ? 81  LEU B CD1  1 
ATOM   3405 C CD2  . LEU B 2 51  ? 51.871 19.281  70.626 1.00 40.82  ? 81  LEU B CD2  1 
ATOM   3406 H H    . LEU B 2 51  ? 49.737 21.870  69.595 1.00 48.30  ? 81  LEU B H    1 
ATOM   3407 H HA   . LEU B 2 51  ? 49.213 19.286  69.978 1.00 49.99  ? 81  LEU B HA   1 
ATOM   3408 H HB2  . LEU B 2 51  ? 49.547 21.242  71.979 1.00 50.09  ? 81  LEU B HB2  1 
ATOM   3409 H HB3  . LEU B 2 51  ? 49.640 19.676  72.196 1.00 50.09  ? 81  LEU B HB3  1 
ATOM   3410 H HG   . LEU B 2 51  ? 51.578 21.272  70.909 1.00 49.29  ? 81  LEU B HG   1 
ATOM   3411 H HD11 . LEU B 2 51  ? 53.004 20.605  72.626 1.00 49.07  ? 81  LEU B HD11 1 
ATOM   3412 H HD12 . LEU B 2 51  ? 51.739 21.365  73.217 1.00 49.07  ? 81  LEU B HD12 1 
ATOM   3413 H HD13 . LEU B 2 51  ? 51.817 19.779  73.286 1.00 49.07  ? 81  LEU B HD13 1 
ATOM   3414 H HD21 . LEU B 2 51  ? 52.834 19.356  70.536 1.00 48.99  ? 81  LEU B HD21 1 
ATOM   3415 H HD22 . LEU B 2 51  ? 51.645 18.468  71.104 1.00 48.99  ? 81  LEU B HD22 1 
ATOM   3416 H HD23 . LEU B 2 51  ? 51.456 19.276  69.750 1.00 48.99  ? 81  LEU B HD23 1 
ATOM   3417 N N    . VAL B 2 52  ? 46.822 21.259  70.204 1.00 46.31  ? 82  VAL B N    1 
ATOM   3418 C CA   . VAL B 2 52  ? 45.391 21.389  70.445 1.00 47.60  ? 82  VAL B CA   1 
ATOM   3419 C C    . VAL B 2 52  ? 44.660 20.628  69.339 1.00 48.31  ? 82  VAL B C    1 
ATOM   3420 O O    . VAL B 2 52  ? 44.860 20.947  68.157 1.00 47.02  ? 82  VAL B O    1 
ATOM   3421 C CB   . VAL B 2 52  ? 44.958 22.858  70.472 1.00 46.66  ? 82  VAL B CB   1 
ATOM   3422 C CG1  . VAL B 2 52  ? 43.478 22.973  70.806 1.00 49.37  ? 82  VAL B CG1  1 
ATOM   3423 C CG2  . VAL B 2 52  ? 45.802 23.642  71.477 1.00 47.51  ? 82  VAL B CG2  1 
ATOM   3424 H H    . VAL B 2 52  ? 47.154 21.910  69.752 1.00 55.58  ? 82  VAL B H    1 
ATOM   3425 H HA   . VAL B 2 52  ? 45.166 20.985  71.299 1.00 57.12  ? 82  VAL B HA   1 
ATOM   3426 H HB   . VAL B 2 52  ? 45.099 23.246  69.594 1.00 56.00  ? 82  VAL B HB   1 
ATOM   3427 H HG11 . VAL B 2 52  ? 43.229 23.910  70.816 1.00 59.24  ? 82  VAL B HG11 1 
ATOM   3428 H HG12 . VAL B 2 52  ? 42.965 22.502  70.130 1.00 59.24  ? 82  VAL B HG12 1 
ATOM   3429 H HG13 . VAL B 2 52  ? 43.319 22.578  71.677 1.00 59.24  ? 82  VAL B HG13 1 
ATOM   3430 H HG21 . VAL B 2 52  ? 45.513 24.568  71.478 1.00 57.01  ? 82  VAL B HG21 1 
ATOM   3431 H HG22 . VAL B 2 52  ? 45.682 23.257  72.359 1.00 57.01  ? 82  VAL B HG22 1 
ATOM   3432 H HG23 . VAL B 2 52  ? 46.735 23.587  71.216 1.00 57.01  ? 82  VAL B HG23 1 
ATOM   3433 N N    . PRO B 2 53  ? 43.843 19.628  69.663 1.00 48.59  ? 83  PRO B N    1 
ATOM   3434 C CA   . PRO B 2 53  ? 43.045 18.964  68.622 1.00 49.16  ? 83  PRO B CA   1 
ATOM   3435 C C    . PRO B 2 53  ? 42.045 19.913  67.972 1.00 49.07  ? 83  PRO B C    1 
ATOM   3436 O O    . PRO B 2 53  ? 41.620 20.912  68.556 1.00 46.75  ? 83  PRO B O    1 
ATOM   3437 C CB   . PRO B 2 53  ? 42.329 17.843  69.384 1.00 50.74  ? 83  PRO B CB   1 
ATOM   3438 C CG   . PRO B 2 53  ? 43.183 17.590  70.580 1.00 52.00  ? 83  PRO B CG   1 
ATOM   3439 C CD   . PRO B 2 53  ? 43.746 18.930  70.956 1.00 50.81  ? 83  PRO B CD   1 
ATOM   3440 H HA   . PRO B 2 53  ? 43.621 18.580  67.942 1.00 59.00  ? 83  PRO B HA   1 
ATOM   3441 H HB2  . PRO B 2 53  ? 41.444 18.140  69.649 1.00 60.89  ? 83  PRO B HB2  1 
ATOM   3442 H HB3  . PRO B 2 53  ? 42.274 17.051  68.827 1.00 60.89  ? 83  PRO B HB3  1 
ATOM   3443 H HG2  . PRO B 2 53  ? 42.639 17.232  71.300 1.00 62.40  ? 83  PRO B HG2  1 
ATOM   3444 H HG3  . PRO B 2 53  ? 43.894 16.972  70.349 1.00 62.40  ? 83  PRO B HG3  1 
ATOM   3445 H HD2  . PRO B 2 53  ? 43.138 19.399  71.549 1.00 60.97  ? 83  PRO B HD2  1 
ATOM   3446 H HD3  . PRO B 2 53  ? 44.625 18.829  71.354 1.00 60.97  ? 83  PRO B HD3  1 
ATOM   3447 N N    . PHE B 2 54  ? 41.676 19.585  66.734 1.00 48.47  ? 84  PHE B N    1 
ATOM   3448 C CA   . PHE B 2 54  ? 40.630 20.317  66.031 1.00 49.93  ? 84  PHE B CA   1 
ATOM   3449 C C    . PHE B 2 54  ? 39.287 20.138  66.726 1.00 52.23  ? 84  PHE B C    1 
ATOM   3450 O O    . PHE B 2 54  ? 38.983 19.081  67.285 1.00 53.21  ? 84  PHE B O    1 
ATOM   3451 C CB   . PHE B 2 54  ? 40.481 19.830  64.584 1.00 51.55  ? 84  PHE B CB   1 
ATOM   3452 C CG   . PHE B 2 54  ? 41.579 20.269  63.647 1.00 50.95  ? 84  PHE B CG   1 
ATOM   3453 C CD1  . PHE B 2 54  ? 42.544 21.184  64.036 1.00 50.35  ? 84  PHE B CD1  1 
ATOM   3454 C CD2  . PHE B 2 54  ? 41.632 19.761  62.356 1.00 51.84  ? 84  PHE B CD2  1 
ATOM   3455 C CE1  . PHE B 2 54  ? 43.537 21.576  63.161 1.00 49.91  ? 84  PHE B CE1  1 
ATOM   3456 C CE2  . PHE B 2 54  ? 42.622 20.152  61.481 1.00 51.60  ? 84  PHE B CE2  1 
ATOM   3457 C CZ   . PHE B 2 54  ? 43.574 21.066  61.885 1.00 50.41  ? 84  PHE B CZ   1 
ATOM   3458 H H    . PHE B 2 54  ? 42.018 18.940  66.280 1.00 58.16  ? 84  PHE B H    1 
ATOM   3459 H HA   . PHE B 2 54  ? 40.847 21.263  66.019 1.00 59.92  ? 84  PHE B HA   1 
ATOM   3460 H HB2  . PHE B 2 54  ? 40.468 18.860  64.584 1.00 61.86  ? 84  PHE B HB2  1 
ATOM   3461 H HB3  . PHE B 2 54  ? 39.643 20.167  64.230 1.00 61.86  ? 84  PHE B HB3  1 
ATOM   3462 H HD1  . PHE B 2 54  ? 42.523 21.537  64.896 1.00 60.42  ? 84  PHE B HD1  1 
ATOM   3463 H HD2  . PHE B 2 54  ? 40.990 19.148  62.078 1.00 62.21  ? 84  PHE B HD2  1 
ATOM   3464 H HE1  . PHE B 2 54  ? 44.179 22.191  63.434 1.00 59.90  ? 84  PHE B HE1  1 
ATOM   3465 H HE2  . PHE B 2 54  ? 42.646 19.804  60.619 1.00 61.92  ? 84  PHE B HE2  1 
ATOM   3466 H HZ   . PHE B 2 54  ? 44.246 21.330  61.297 1.00 60.49  ? 84  PHE B HZ   1 
ATOM   3467 N N    . THR B 2 55  ? 38.469 21.180  66.663 1.00 56.01  ? 85  THR B N    1 
ATOM   3468 C CA   . THR B 2 55  ? 37.056 21.037  66.974 1.00 60.30  ? 85  THR B CA   1 
ATOM   3469 C C    . THR B 2 55  ? 36.335 20.434  65.770 1.00 63.86  ? 85  THR B C    1 
ATOM   3470 O O    . THR B 2 55  ? 36.928 20.175  64.719 1.00 61.47  ? 85  THR B O    1 
ATOM   3471 C CB   . THR B 2 55  ? 36.449 22.386  67.345 1.00 60.47  ? 85  THR B CB   1 
ATOM   3472 O OG1  . THR B 2 55  ? 36.439 23.232  66.190 1.00 61.67  ? 85  THR B OG1  1 
ATOM   3473 C CG2  . THR B 2 55  ? 37.253 23.052  68.452 1.00 60.50  ? 85  THR B CG2  1 
ATOM   3474 H H    . THR B 2 55  ? 38.706 21.978  66.445 1.00 67.22  ? 85  THR B H    1 
ATOM   3475 H HA   . THR B 2 55  ? 36.951 20.436  67.728 1.00 72.36  ? 85  THR B HA   1 
ATOM   3476 H HB   . THR B 2 55  ? 35.541 22.257  67.660 1.00 72.56  ? 85  THR B HB   1 
ATOM   3477 H HG1  . THR B 2 55  ? 36.106 23.979  66.384 1.00 74.00  ? 85  THR B HG1  1 
ATOM   3478 H HG21 . THR B 2 55  ? 36.857 23.908  68.679 1.00 72.59  ? 85  THR B HG21 1 
ATOM   3479 H HG22 . THR B 2 55  ? 37.260 22.488  69.241 1.00 72.59  ? 85  THR B HG22 1 
ATOM   3480 H HG23 . THR B 2 55  ? 38.166 23.194  68.158 1.00 72.59  ? 85  THR B HG23 1 
ATOM   3481 N N    . GLU B 2 56  ? 35.030 20.209  65.916 1.00 69.90  ? 86  GLU B N    1 
ATOM   3482 C CA   . GLU B 2 56  ? 34.249 19.739  64.778 1.00 75.00  ? 86  GLU B CA   1 
ATOM   3483 C C    . GLU B 2 56  ? 34.193 20.796  63.683 1.00 70.25  ? 86  GLU B C    1 
ATOM   3484 O O    . GLU B 2 56  ? 34.252 20.467  62.493 1.00 69.73  ? 86  GLU B O    1 
ATOM   3485 C CB   . GLU B 2 56  ? 32.842 19.349  65.230 1.00 84.81  ? 86  GLU B CB   1 
ATOM   3486 C CG   . GLU B 2 56  ? 32.796 18.089  66.081 1.00 93.22  ? 86  GLU B CG   1 
ATOM   3487 C CD   . GLU B 2 56  ? 33.274 16.866  65.326 1.00 99.89  ? 86  GLU B CD   1 
ATOM   3488 O OE1  . GLU B 2 56  ? 33.314 16.923  64.080 1.00 101.11 ? 86  GLU B OE1  1 
ATOM   3489 O OE2  . GLU B 2 56  ? 33.613 15.854  65.977 1.00 102.86 ? 86  GLU B OE2  1 
ATOM   3490 H H    . GLU B 2 56  ? 34.584 20.318  66.643 1.00 83.87  ? 86  GLU B H    1 
ATOM   3491 H HA   . GLU B 2 56  ? 34.674 18.949  64.409 1.00 90.00  ? 86  GLU B HA   1 
ATOM   3492 H HB2  . GLU B 2 56  ? 32.471 20.075  65.755 1.00 101.77 ? 86  GLU B HB2  1 
ATOM   3493 H HB3  . GLU B 2 56  ? 32.293 19.197  64.445 1.00 101.77 ? 86  GLU B HB3  1 
ATOM   3494 H HG2  . GLU B 2 56  ? 33.368 18.208  66.855 1.00 111.86 ? 86  GLU B HG2  1 
ATOM   3495 H HG3  . GLU B 2 56  ? 31.882 17.931  66.363 1.00 111.86 ? 86  GLU B HG3  1 
ATOM   3496 N N    . GLU B 2 57  ? 34.095 22.072  64.065 1.00 61.96  ? 87  GLU B N    1 
ATOM   3497 C CA   . GLU B 2 57  ? 34.059 23.145  63.075 1.00 57.88  ? 87  GLU B CA   1 
ATOM   3498 C C    . GLU B 2 57  ? 35.395 23.272  62.358 1.00 55.58  ? 87  GLU B C    1 
ATOM   3499 O O    . GLU B 2 57  ? 35.450 23.296  61.123 1.00 56.55  ? 87  GLU B O    1 
ATOM   3500 C CB   . GLU B 2 57  ? 33.684 24.470  63.746 1.00 55.33  ? 87  GLU B CB   1 
ATOM   3501 C CG   . GLU B 2 57  ? 32.251 24.529  64.236 1.00 54.90  ? 87  GLU B CG   1 
ATOM   3502 C CD   . GLU B 2 57  ? 31.246 24.433  63.100 1.00 55.59  ? 87  GLU B CD   1 
ATOM   3503 O OE1  . GLU B 2 57  ? 31.659 24.588  61.931 1.00 53.98  ? 87  GLU B OE1  1 
ATOM   3504 O OE2  . GLU B 2 57  ? 30.045 24.194  63.375 1.00 58.04  ? 87  GLU B OE2  1 
ATOM   3505 H H    . GLU B 2 57  ? 34.049 22.338  64.881 1.00 74.35  ? 87  GLU B H    1 
ATOM   3506 H HA   . GLU B 2 57  ? 33.380 22.941  62.412 1.00 69.45  ? 87  GLU B HA   1 
ATOM   3507 H HB2  . GLU B 2 57  ? 34.264 24.607  64.512 1.00 66.39  ? 87  GLU B HB2  1 
ATOM   3508 H HB3  . GLU B 2 57  ? 33.808 25.190  63.108 1.00 66.39  ? 87  GLU B HB3  1 
ATOM   3509 H HG2  . GLU B 2 57  ? 32.093 23.788  64.842 1.00 65.88  ? 87  GLU B HG2  1 
ATOM   3510 H HG3  . GLU B 2 57  ? 32.107 25.371  64.695 1.00 65.88  ? 87  GLU B HG3  1 
ATOM   3511 N N    . GLU B 2 58  ? 36.485 23.366  63.118 1.00 55.51  ? 88  GLU B N    1 
ATOM   3512 C CA   . GLU B 2 58  ? 37.806 23.450  62.507 1.00 54.38  ? 88  GLU B CA   1 
ATOM   3513 C C    . GLU B 2 58  ? 38.021 22.316  61.517 1.00 52.46  ? 88  GLU B C    1 
ATOM   3514 O O    . GLU B 2 58  ? 38.524 22.532  60.408 1.00 52.51  ? 88  GLU B O    1 
ATOM   3515 C CB   . GLU B 2 58  ? 38.885 23.426  63.590 1.00 55.83  ? 88  GLU B CB   1 
ATOM   3516 C CG   . GLU B 2 58  ? 38.894 24.649  64.484 1.00 57.69  ? 88  GLU B CG   1 
ATOM   3517 C CD   . GLU B 2 58  ? 39.912 24.523  65.596 1.00 59.34  ? 88  GLU B CD   1 
ATOM   3518 O OE1  . GLU B 2 58  ? 39.921 23.456  66.249 1.00 60.47  ? 88  GLU B OE1  1 
ATOM   3519 O OE2  . GLU B 2 58  ? 40.703 25.471  65.800 1.00 57.21  ? 88  GLU B OE2  1 
ATOM   3520 H H    . GLU B 2 58  ? 36.486 23.382  63.978 1.00 66.61  ? 88  GLU B H    1 
ATOM   3521 H HA   . GLU B 2 58  ? 37.881 24.289  62.025 1.00 65.25  ? 88  GLU B HA   1 
ATOM   3522 H HB2  . GLU B 2 58  ? 38.742 22.649  64.153 1.00 67.00  ? 88  GLU B HB2  1 
ATOM   3523 H HB3  . GLU B 2 58  ? 39.753 23.365  63.162 1.00 67.00  ? 88  GLU B HB3  1 
ATOM   3524 H HG2  . GLU B 2 58  ? 39.119 25.430  63.955 1.00 69.23  ? 88  GLU B HG2  1 
ATOM   3525 H HG3  . GLU B 2 58  ? 38.018 24.757  64.886 1.00 69.23  ? 88  GLU B HG3  1 
ATOM   3526 N N    . GLN B 2 59  ? 37.627 21.098  61.897 1.00 50.75  ? 89  GLN B N    1 
ATOM   3527 C CA   . GLN B 2 59  ? 37.781 19.953  61.008 1.00 49.71  ? 89  GLN B CA   1 
ATOM   3528 C C    . GLN B 2 59  ? 37.002 20.160  59.716 1.00 49.92  ? 89  GLN B C    1 
ATOM   3529 O O    . GLN B 2 59  ? 37.526 19.938  58.620 1.00 49.02  ? 89  GLN B O    1 
ATOM   3530 C CB   . GLN B 2 59  ? 37.325 18.680  61.721 1.00 51.50  ? 89  GLN B CB   1 
ATOM   3531 C CG   . GLN B 2 59  ? 37.317 17.426  60.844 1.00 53.53  ? 89  GLN B CG   1 
ATOM   3532 C CD   . GLN B 2 59  ? 38.708 17.038  60.355 1.00 52.78  ? 89  GLN B CD   1 
ATOM   3533 O OE1  . GLN B 2 59  ? 39.720 17.531  60.861 1.00 51.24  ? 89  GLN B OE1  1 
ATOM   3534 N NE2  . GLN B 2 59  ? 38.759 16.155  59.364 1.00 54.10  ? 89  GLN B NE2  1 
ATOM   3535 H H    . GLN B 2 59  ? 37.272 20.913  62.659 1.00 60.89  ? 89  GLN B H    1 
ATOM   3536 H HA   . GLN B 2 59  ? 38.718 19.851  60.781 1.00 59.65  ? 89  GLN B HA   1 
ATOM   3537 H HB2  . GLN B 2 59  ? 37.922 18.513  62.467 1.00 61.81  ? 89  GLN B HB2  1 
ATOM   3538 H HB3  . GLN B 2 59  ? 36.423 18.816  62.049 1.00 61.81  ? 89  GLN B HB3  1 
ATOM   3539 H HG2  . GLN B 2 59  ? 36.962 16.684  61.358 1.00 64.23  ? 89  GLN B HG2  1 
ATOM   3540 H HG3  . GLN B 2 59  ? 36.760 17.588  60.067 1.00 64.23  ? 89  GLN B HG3  1 
ATOM   3541 H HE21 . GLN B 2 59  ? 38.032 15.835  59.034 1.00 64.92  ? 89  GLN B HE21 1 
ATOM   3542 H HE22 . GLN B 2 59  ? 39.520 15.903  59.051 1.00 64.92  ? 89  GLN B HE22 1 
ATOM   3543 N N    . ARG B 2 60  ? 35.743 20.588  59.822 1.00 56.10  ? 90  ARG B N    1 
ATOM   3544 C CA   . ARG B 2 60  ? 34.940 20.807  58.623 1.00 60.16  ? 90  ARG B CA   1 
ATOM   3545 C C    . ARG B 2 60  ? 35.567 21.878  57.737 1.00 56.66  ? 90  ARG B C    1 
ATOM   3546 O O    . ARG B 2 60  ? 35.737 21.678  56.529 1.00 55.80  ? 90  ARG B O    1 
ATOM   3547 C CB   . ARG B 2 60  ? 33.513 21.190  59.008 1.00 67.01  ? 90  ARG B CB   1 
ATOM   3548 C CG   . ARG B 2 60  ? 32.558 21.258  57.824 1.00 75.96  ? 90  ARG B CG   1 
ATOM   3549 C CD   . ARG B 2 60  ? 31.139 21.591  58.250 1.00 84.19  ? 90  ARG B CD   1 
ATOM   3550 N NE   . ARG B 2 60  ? 31.079 22.857  58.975 1.00 89.34  ? 90  ARG B NE   1 
ATOM   3551 C CZ   . ARG B 2 60  ? 31.128 24.059  58.403 1.00 93.64  ? 90  ARG B CZ   1 
ATOM   3552 N NH1  . ARG B 2 60  ? 31.241 24.177  57.086 1.00 95.77  ? 90  ARG B NH1  1 
ATOM   3553 N NH2  . ARG B 2 60  ? 31.071 25.150  59.153 1.00 94.36  ? 90  ARG B NH2  1 
ATOM   3554 H H    . ARG B 2 60  ? 35.338 20.754  60.562 1.00 67.32  ? 90  ARG B H    1 
ATOM   3555 H HA   . ARG B 2 60  ? 34.902 19.982  58.114 1.00 72.20  ? 90  ARG B HA   1 
ATOM   3556 H HB2  . ARG B 2 60  ? 33.168 20.530  59.630 1.00 80.42  ? 90  ARG B HB2  1 
ATOM   3557 H HB3  . ARG B 2 60  ? 33.526 22.064  59.429 1.00 80.42  ? 90  ARG B HB3  1 
ATOM   3558 H HG2  . ARG B 2 60  ? 32.860 21.947  57.212 1.00 91.15  ? 90  ARG B HG2  1 
ATOM   3559 H HG3  . ARG B 2 60  ? 32.545 20.397  57.377 1.00 91.15  ? 90  ARG B HG3  1 
ATOM   3560 H HD2  . ARG B 2 60  ? 30.578 21.666  57.462 1.00 101.03 ? 90  ARG B HD2  1 
ATOM   3561 H HD3  . ARG B 2 60  ? 30.807 20.891  58.833 1.00 101.03 ? 90  ARG B HD3  1 
ATOM   3562 H HE   . ARG B 2 60  ? 31.006 22.824  59.831 1.00 107.21 ? 90  ARG B HE   1 
ATOM   3563 H HH11 . ARG B 2 60  ? 31.280 23.473  56.593 1.00 114.92 ? 90  ARG B HH11 1 
ATOM   3564 H HH12 . ARG B 2 60  ? 31.272 24.957  56.725 1.00 114.92 ? 90  ARG B HH12 1 
ATOM   3565 H HH21 . ARG B 2 60  ? 30.998 25.082  60.007 1.00 113.23 ? 90  ARG B HH21 1 
ATOM   3566 H HH22 . ARG B 2 60  ? 31.102 25.927  58.785 1.00 113.23 ? 90  ARG B HH22 1 
ATOM   3567 N N    . ASN B 2 61  ? 35.940 23.016  58.328 1.00 53.42  ? 91  ASN B N    1 
ATOM   3568 C CA   . ASN B 2 61  ? 36.460 24.137  57.548 1.00 53.15  ? 91  ASN B CA   1 
ATOM   3569 C C    . ASN B 2 61  ? 37.758 23.760  56.841 1.00 51.90  ? 91  ASN B C    1 
ATOM   3570 O O    . ASN B 2 61  ? 37.879 23.895  55.618 1.00 51.22  ? 91  ASN B O    1 
ATOM   3571 C CB   . ASN B 2 61  ? 36.676 25.353  58.455 1.00 53.65  ? 91  ASN B CB   1 
ATOM   3572 C CG   . ASN B 2 61  ? 35.373 25.991  58.909 1.00 57.00  ? 91  ASN B CG   1 
ATOM   3573 O OD1  . ASN B 2 61  ? 34.284 25.497  58.614 1.00 59.73  ? 91  ASN B OD1  1 
ATOM   3574 N ND2  . ASN B 2 61  ? 35.485 27.094  59.640 1.00 57.03  ? 91  ASN B ND2  1 
ATOM   3575 H H    . ASN B 2 61  ? 35.901 23.162  59.175 1.00 64.10  ? 91  ASN B H    1 
ATOM   3576 H HA   . ASN B 2 61  ? 35.810 24.380  56.871 1.00 63.78  ? 91  ASN B HA   1 
ATOM   3577 H HB2  . ASN B 2 61  ? 37.164 25.074  59.246 1.00 64.37  ? 91  ASN B HB2  1 
ATOM   3578 H HB3  . ASN B 2 61  ? 37.185 26.022  57.971 1.00 64.37  ? 91  ASN B HB3  1 
ATOM   3579 H HD21 . ASN B 2 61  ? 34.779 27.496  59.923 1.00 68.43  ? 91  ASN B HD21 1 
ATOM   3580 H HD22 . ASN B 2 61  ? 36.263 27.407  59.831 1.00 68.43  ? 91  ASN B HD22 1 
ATOM   3581 N N    . PHE B 2 62  ? 38.749 23.287  57.599 1.00 50.98  ? 92  PHE B N    1 
ATOM   3582 C CA   . PHE B 2 62  ? 40.012 22.894  56.982 1.00 51.34  ? 92  PHE B CA   1 
ATOM   3583 C C    . PHE B 2 62  ? 39.838 21.776  55.966 1.00 53.86  ? 92  PHE B C    1 
ATOM   3584 O O    . PHE B 2 62  ? 40.690 21.619  55.087 1.00 55.86  ? 92  PHE B O    1 
ATOM   3585 C CB   . PHE B 2 62  ? 41.021 22.470  58.051 1.00 52.42  ? 92  PHE B CB   1 
ATOM   3586 C CG   . PHE B 2 62  ? 41.599 23.625  58.828 1.00 51.28  ? 92  PHE B CG   1 
ATOM   3587 C CD1  . PHE B 2 62  ? 42.489 24.509  58.228 1.00 51.25  ? 92  PHE B CD1  1 
ATOM   3588 C CD2  . PHE B 2 62  ? 41.256 23.829  60.156 1.00 51.59  ? 92  PHE B CD2  1 
ATOM   3589 C CE1  . PHE B 2 62  ? 43.025 25.579  58.945 1.00 51.34  ? 92  PHE B CE1  1 
ATOM   3590 C CE2  . PHE B 2 62  ? 41.791 24.891  60.876 1.00 51.93  ? 92  PHE B CE2  1 
ATOM   3591 C CZ   . PHE B 2 62  ? 42.675 25.769  60.268 1.00 50.41  ? 92  PHE B CZ   1 
ATOM   3592 H H    . PHE B 2 62  ? 38.715 23.186  58.452 1.00 61.18  ? 92  PHE B H    1 
ATOM   3593 H HA   . PHE B 2 62  ? 40.381 23.660  56.516 1.00 61.61  ? 92  PHE B HA   1 
ATOM   3594 H HB2  . PHE B 2 62  ? 40.580 21.879  58.681 1.00 62.91  ? 92  PHE B HB2  1 
ATOM   3595 H HB3  . PHE B 2 62  ? 41.755 22.004  57.621 1.00 62.91  ? 92  PHE B HB3  1 
ATOM   3596 H HD1  . PHE B 2 62  ? 42.728 24.387  57.338 1.00 61.50  ? 92  PHE B HD1  1 
ATOM   3597 H HD2  . PHE B 2 62  ? 40.663 23.245  60.571 1.00 61.91  ? 92  PHE B HD2  1 
ATOM   3598 H HE1  . PHE B 2 62  ? 43.620 26.164  58.533 1.00 61.61  ? 92  PHE B HE1  1 
ATOM   3599 H HE2  . PHE B 2 62  ? 41.552 25.016  61.766 1.00 62.31  ? 92  PHE B HE2  1 
ATOM   3600 H HZ   . PHE B 2 62  ? 43.032 26.480  60.749 1.00 60.50  ? 92  PHE B HZ   1 
ATOM   3601 N N    . SER B 2 63  ? 38.750 21.009  56.051 1.00 65.27  ? 93  SER B N    1 
ATOM   3602 C CA   . SER B 2 63  ? 38.529 19.893  55.140 1.00 66.14  ? 93  SER B CA   1 
ATOM   3603 C C    . SER B 2 63  ? 37.803 20.294  53.864 1.00 65.01  ? 93  SER B C    1 
ATOM   3604 O O    . SER B 2 63  ? 37.998 19.648  52.829 1.00 64.74  ? 93  SER B O    1 
ATOM   3605 C CB   . SER B 2 63  ? 37.725 18.794  55.840 1.00 70.50  ? 93  SER B CB   1 
ATOM   3606 O OG   . SER B 2 63  ? 38.440 18.267  56.943 1.00 73.32  ? 93  SER B OG   1 
ATOM   3607 H H    . SER B 2 63  ? 38.123 21.118  56.630 1.00 78.32  ? 93  SER B H    1 
ATOM   3608 H HA   . SER B 2 63  ? 39.388 19.520  54.888 1.00 79.36  ? 93  SER B HA   1 
ATOM   3609 H HB2  . SER B 2 63  ? 36.888 19.169  56.157 1.00 84.60  ? 93  SER B HB2  1 
ATOM   3610 H HB3  . SER B 2 63  ? 37.550 18.080  55.208 1.00 84.60  ? 93  SER B HB3  1 
ATOM   3611 H HG   . SER B 2 63  ? 38.598 18.876  57.500 1.00 87.98  ? 93  SER B HG   1 
ATOM   3612 N N    . MET B 2 64  ? 36.974 21.338  53.909 1.00 57.53  ? 94  MET B N    1 
ATOM   3613 C CA   . MET B 2 64  ? 36.099 21.678  52.790 1.00 57.54  ? 94  MET B CA   1 
ATOM   3614 C C    . MET B 2 64  ? 36.288 23.100  52.283 1.00 55.74  ? 94  MET B C    1 
ATOM   3615 O O    . MET B 2 64  ? 36.442 23.299  51.072 1.00 55.44  ? 94  MET B O    1 
ATOM   3616 C CB   . MET B 2 64  ? 34.628 21.468  53.193 1.00 59.25  ? 94  MET B CB   1 
ATOM   3617 C CG   . MET B 2 64  ? 34.332 20.094  53.792 1.00 59.78  ? 94  MET B CG   1 
ATOM   3618 S SD   . MET B 2 64  ? 34.749 18.697  52.710 1.00 63.69  ? 94  MET B SD   1 
ATOM   3619 C CE   . MET B 2 64  ? 33.678 18.995  51.306 1.00 66.31  ? 94  MET B CE   1 
ATOM   3620 H H    . MET B 2 64  ? 36.900 21.868  54.582 1.00 69.03  ? 94  MET B H    1 
ATOM   3621 H HA   . MET B 2 64  ? 36.289 21.068  52.060 1.00 69.05  ? 94  MET B HA   1 
ATOM   3622 H HB2  . MET B 2 64  ? 34.388 22.136  53.855 1.00 71.10  ? 94  MET B HB2  1 
ATOM   3623 H HB3  . MET B 2 64  ? 34.071 21.573  52.406 1.00 71.10  ? 94  MET B HB3  1 
ATOM   3624 H HG2  . MET B 2 64  ? 34.844 19.995  54.610 1.00 71.73  ? 94  MET B HG2  1 
ATOM   3625 H HG3  . MET B 2 64  ? 33.384 20.039  53.990 1.00 71.73  ? 94  MET B HG3  1 
ATOM   3626 H HE1  . MET B 2 64  ? 33.817 18.295  50.649 1.00 79.57  ? 94  MET B HE1  1 
ATOM   3627 H HE2  . MET B 2 64  ? 32.755 18.988  51.607 1.00 79.57  ? 94  MET B HE2  1 
ATOM   3628 H HE3  . MET B 2 64  ? 33.894 19.859  50.922 1.00 79.57  ? 94  MET B HE3  1 
ATOM   3629 N N    . SER B 2 65  ? 36.259 24.103  53.160 1.00 62.33  ? 95  SER B N    1 
ATOM   3630 C CA   . SER B 2 65  ? 36.248 25.494  52.714 1.00 64.73  ? 95  SER B CA   1 
ATOM   3631 C C    . SER B 2 65  ? 36.949 26.363  53.743 1.00 61.21  ? 95  SER B C    1 
ATOM   3632 O O    . SER B 2 65  ? 36.528 26.418  54.901 1.00 61.90  ? 95  SER B O    1 
ATOM   3633 C CB   . SER B 2 65  ? 34.818 25.990  52.495 1.00 70.21  ? 95  SER B CB   1 
ATOM   3634 O OG   . SER B 2 65  ? 34.074 25.944  53.701 1.00 73.42  ? 95  SER B OG   1 
ATOM   3635 H H    . SER B 2 65  ? 36.246 24.004  54.015 1.00 74.79  ? 95  SER B H    1 
ATOM   3636 H HA   . SER B 2 65  ? 36.728 25.566  51.875 1.00 77.68  ? 95  SER B HA   1 
ATOM   3637 H HB2  . SER B 2 65  ? 34.848 26.906  52.177 1.00 84.25  ? 95  SER B HB2  1 
ATOM   3638 H HB3  . SER B 2 65  ? 34.386 25.424  51.836 1.00 84.25  ? 95  SER B HB3  1 
ATOM   3639 H HG   . SER B 2 65  ? 34.437 26.430  54.282 1.00 88.11  ? 95  SER B HG   1 
ATOM   3640 N N    . VAL B 2 66  ? 38.003 27.047  53.311 1.00 53.12  ? 96  VAL B N    1 
ATOM   3641 C CA   . VAL B 2 66  ? 38.748 27.939  54.187 1.00 46.99  ? 96  VAL B CA   1 
ATOM   3642 C C    . VAL B 2 66  ? 38.702 29.388  53.732 1.00 44.27  ? 96  VAL B C    1 
ATOM   3643 O O    . VAL B 2 66  ? 39.037 30.280  54.530 1.00 41.16  ? 96  VAL B O    1 
ATOM   3644 C CB   . VAL B 2 66  ? 40.213 27.479  54.322 1.00 43.81  ? 96  VAL B CB   1 
ATOM   3645 C CG1  . VAL B 2 66  ? 40.275 26.061  54.870 1.00 42.91  ? 96  VAL B CG1  1 
ATOM   3646 C CG2  . VAL B 2 66  ? 40.921 27.569  52.978 1.00 43.27  ? 96  VAL B CG2  1 
ATOM   3647 H H    . VAL B 2 66  ? 38.309 27.011  52.508 1.00 63.74  ? 96  VAL B H    1 
ATOM   3648 H HA   . VAL B 2 66  ? 38.349 27.901  55.071 1.00 56.39  ? 96  VAL B HA   1 
ATOM   3649 H HB   . VAL B 2 66  ? 40.673 28.063  54.945 1.00 52.58  ? 96  VAL B HB   1 
ATOM   3650 H HG11 . VAL B 2 66  ? 41.204 25.794  54.946 1.00 51.49  ? 96  VAL B HG11 1 
ATOM   3651 H HG12 . VAL B 2 66  ? 39.852 26.042  55.742 1.00 51.49  ? 96  VAL B HG12 1 
ATOM   3652 H HG13 . VAL B 2 66  ? 39.808 25.468  54.262 1.00 51.49  ? 96  VAL B HG13 1 
ATOM   3653 H HG21 . VAL B 2 66  ? 41.839 27.275  53.085 1.00 51.93  ? 96  VAL B HG21 1 
ATOM   3654 H HG22 . VAL B 2 66  ? 40.462 26.999  52.341 1.00 51.93  ? 96  VAL B HG22 1 
ATOM   3655 H HG23 . VAL B 2 66  ? 40.901 28.489  52.672 1.00 51.93  ? 96  VAL B HG23 1 
ATOM   3656 N N    . ASN B 2 67  ? 38.319 29.666  52.490 1.00 45.57  ? 97  ASN B N    1 
ATOM   3657 C CA   . ASN B 2 67  ? 38.374 31.026  51.981 1.00 47.53  ? 97  ASN B CA   1 
ATOM   3658 C C    . ASN B 2 67  ? 37.281 31.882  52.602 1.00 44.90  ? 97  ASN B C    1 
ATOM   3659 O O    . ASN B 2 67  ? 36.197 31.399  52.938 1.00 45.01  ? 97  ASN B O    1 
ATOM   3660 C CB   . ASN B 2 67  ? 38.231 31.037  50.463 1.00 52.83  ? 97  ASN B CB   1 
ATOM   3661 C CG   . ASN B 2 67  ? 39.448 30.482  49.763 1.00 55.74  ? 97  ASN B CG   1 
ATOM   3662 O OD1  . ASN B 2 67  ? 39.342 29.555  48.964 1.00 59.07  ? 97  ASN B OD1  1 
ATOM   3663 N ND2  . ASN B 2 67  ? 40.618 31.041  50.065 1.00 56.83  ? 97  ASN B ND2  1 
ATOM   3664 H H    . ASN B 2 67  ? 38.025 29.086  51.927 1.00 54.68  ? 97  ASN B H    1 
ATOM   3665 H HA   . ASN B 2 67  ? 39.232 31.418  52.208 1.00 57.03  ? 97  ASN B HA   1 
ATOM   3666 H HB2  . ASN B 2 67  ? 37.467 30.495  50.212 1.00 63.39  ? 97  ASN B HB2  1 
ATOM   3667 H HB3  . ASN B 2 67  ? 38.103 31.951  50.163 1.00 63.39  ? 97  ASN B HB3  1 
ATOM   3668 H HD21 . ASN B 2 67  ? 41.339 30.758  49.691 1.00 68.19  ? 97  ASN B HD21 1 
ATOM   3669 H HD22 . ASN B 2 67  ? 40.652 31.685  50.634 1.00 68.19  ? 97  ASN B HD22 1 
ATOM   3670 N N    . SER B 2 68  ? 37.577 33.167  52.755 1.00 42.21  ? 98  SER B N    1 
ATOM   3671 C CA   . SER B 2 68  ? 36.583 34.105  53.246 1.00 41.01  ? 98  SER B CA   1 
ATOM   3672 C C    . SER B 2 68  ? 35.474 34.274  52.221 1.00 41.50  ? 98  SER B C    1 
ATOM   3673 O O    . SER B 2 68  ? 35.658 34.042  51.025 1.00 42.16  ? 98  SER B O    1 
ATOM   3674 C CB   . SER B 2 68  ? 37.217 35.464  53.534 1.00 41.31  ? 98  SER B CB   1 
ATOM   3675 O OG   . SER B 2 68  ? 37.585 36.096  52.317 1.00 41.51  ? 98  SER B OG   1 
ATOM   3676 H H    . SER B 2 68  ? 38.344 33.518  52.583 1.00 50.65  ? 98  SER B H    1 
ATOM   3677 H HA   . SER B 2 68  ? 36.195 33.766  54.068 1.00 49.21  ? 98  SER B HA   1 
ATOM   3678 H HB2  . SER B 2 68  ? 36.576 36.022  54.001 1.00 49.57  ? 98  SER B HB2  1 
ATOM   3679 H HB3  . SER B 2 68  ? 38.009 35.337  54.079 1.00 49.57  ? 98  SER B HB3  1 
ATOM   3680 H HG   . SER B 2 68  ? 37.933 36.843  52.476 1.00 49.81  ? 98  SER B HG   1 
ATOM   3681 N N    . ALA B 2 69  ? 34.306 34.700  52.702 1.00 50.25  ? 99  ALA B N    1 
ATOM   3682 C CA   . ALA B 2 69  ? 33.217 35.015  51.782 1.00 52.76  ? 99  ALA B CA   1 
ATOM   3683 C C    . ALA B 2 69  ? 33.597 36.168  50.869 1.00 52.90  ? 99  ALA B C    1 
ATOM   3684 O O    . ALA B 2 69  ? 33.191 36.199  49.704 1.00 54.90  ? 99  ALA B O    1 
ATOM   3685 C CB   . ALA B 2 69  ? 31.940 35.348  52.557 1.00 54.74  ? 99  ALA B CB   1 
ATOM   3686 H H    . ALA B 2 69  ? 34.122 34.813  53.535 1.00 60.31  ? 99  ALA B H    1 
ATOM   3687 H HA   . ALA B 2 69  ? 33.039 34.239  51.228 1.00 63.31  ? 99  ALA B HA   1 
ATOM   3688 H HB1  . ALA B 2 69  ? 31.232 35.552  51.925 1.00 65.69  ? 99  ALA B HB1  1 
ATOM   3689 H HB2  . ALA B 2 69  ? 31.690 34.582  53.097 1.00 65.69  ? 99  ALA B HB2  1 
ATOM   3690 H HB3  . ALA B 2 69  ? 32.107 36.115  53.126 1.00 65.69  ? 99  ALA B HB3  1 
ATOM   3691 N N    . ALA B 2 70  ? 34.395 37.110  51.374 1.00 42.92  ? 100 ALA B N    1 
ATOM   3692 C CA   . ALA B 2 70  ? 34.763 38.277  50.582 1.00 43.62  ? 100 ALA B CA   1 
ATOM   3693 C C    . ALA B 2 70  ? 35.527 37.877  49.325 1.00 44.22  ? 100 ALA B C    1 
ATOM   3694 O O    . ALA B 2 70  ? 35.238 38.375  48.232 1.00 45.93  ? 100 ALA B O    1 
ATOM   3695 C CB   . ALA B 2 70  ? 35.590 39.241  51.433 1.00 42.31  ? 100 ALA B CB   1 
ATOM   3696 H H    . ALA B 2 70  ? 34.732 37.095  52.165 1.00 51.51  ? 100 ALA B H    1 
ATOM   3697 H HA   . ALA B 2 70  ? 33.956 38.738  50.306 1.00 52.35  ? 100 ALA B HA   1 
ATOM   3698 H HB1  . ALA B 2 70  ? 35.828 40.012  50.894 1.00 50.77  ? 100 ALA B HB1  1 
ATOM   3699 H HB2  . ALA B 2 70  ? 35.061 39.522  52.196 1.00 50.77  ? 100 ALA B HB2  1 
ATOM   3700 H HB3  . ALA B 2 70  ? 36.393 38.787  51.734 1.00 50.77  ? 100 ALA B HB3  1 
ATOM   3701 N N    . VAL B 2 71  ? 36.510 36.977  49.456 1.00 45.59  ? 101 VAL B N    1 
ATOM   3702 C CA   . VAL B 2 71  ? 37.287 36.577  48.281 1.00 47.19  ? 101 VAL B CA   1 
ATOM   3703 C C    . VAL B 2 71  ? 36.453 35.698  47.368 1.00 49.32  ? 101 VAL B C    1 
ATOM   3704 O O    . VAL B 2 71  ? 36.624 35.723  46.143 1.00 51.34  ? 101 VAL B O    1 
ATOM   3705 C CB   . VAL B 2 71  ? 38.599 35.874  48.687 1.00 46.88  ? 101 VAL B CB   1 
ATOM   3706 C CG1  . VAL B 2 71  ? 38.325 34.570  49.398 1.00 46.78  ? 101 VAL B CG1  1 
ATOM   3707 C CG2  . VAL B 2 71  ? 39.478 35.637  47.465 1.00 48.19  ? 101 VAL B CG2  1 
ATOM   3708 H H    . VAL B 2 71  ? 36.739 36.594  50.191 1.00 54.71  ? 101 VAL B H    1 
ATOM   3709 H HA   . VAL B 2 71  ? 37.524 37.375  47.783 1.00 56.63  ? 101 VAL B HA   1 
ATOM   3710 H HB   . VAL B 2 71  ? 39.086 36.449  49.297 1.00 56.26  ? 101 VAL B HB   1 
ATOM   3711 H HG11 . VAL B 2 71  ? 39.170 34.158  49.637 1.00 56.14  ? 101 VAL B HG11 1 
ATOM   3712 H HG12 . VAL B 2 71  ? 37.806 34.750  50.198 1.00 56.14  ? 101 VAL B HG12 1 
ATOM   3713 H HG13 . VAL B 2 71  ? 37.827 33.986  48.805 1.00 56.14  ? 101 VAL B HG13 1 
ATOM   3714 H HG21 . VAL B 2 71  ? 40.294 35.195  47.746 1.00 57.83  ? 101 VAL B HG21 1 
ATOM   3715 H HG22 . VAL B 2 71  ? 38.998 35.077  46.835 1.00 57.83  ? 101 VAL B HG22 1 
ATOM   3716 H HG23 . VAL B 2 71  ? 39.687 36.491  47.056 1.00 57.83  ? 101 VAL B HG23 1 
ATOM   3717 N N    . LEU B 2 72  ? 35.544 34.905  47.935 1.00 52.46  ? 102 LEU B N    1 
ATOM   3718 C CA   . LEU B 2 72  ? 34.650 34.107  47.111 1.00 56.74  ? 102 LEU B CA   1 
ATOM   3719 C C    . LEU B 2 72  ? 33.636 34.973  46.391 1.00 60.74  ? 102 LEU B C    1 
ATOM   3720 O O    . LEU B 2 72  ? 33.091 34.552  45.367 1.00 62.81  ? 102 LEU B O    1 
ATOM   3721 C CB   . LEU B 2 72  ? 33.931 33.068  47.969 1.00 57.25  ? 102 LEU B CB   1 
ATOM   3722 C CG   . LEU B 2 72  ? 34.842 32.038  48.639 1.00 57.33  ? 102 LEU B CG   1 
ATOM   3723 C CD1  . LEU B 2 72  ? 34.134 31.384  49.804 1.00 56.80  ? 102 LEU B CD1  1 
ATOM   3724 C CD2  . LEU B 2 72  ? 35.310 30.987  47.646 1.00 57.96  ? 102 LEU B CD2  1 
ATOM   3725 H H    . LEU B 2 72  ? 35.428 34.814  48.782 1.00 62.95  ? 102 LEU B H    1 
ATOM   3726 H HA   . LEU B 2 72  ? 35.172 33.636  46.442 1.00 68.09  ? 102 LEU B HA   1 
ATOM   3727 H HB2  . LEU B 2 72  ? 33.446 33.530  48.671 1.00 68.70  ? 102 LEU B HB2  1 
ATOM   3728 H HB3  . LEU B 2 72  ? 33.305 32.584  47.407 1.00 68.70  ? 102 LEU B HB3  1 
ATOM   3729 H HG   . LEU B 2 72  ? 35.627 32.491  48.984 1.00 68.80  ? 102 LEU B HG   1 
ATOM   3730 H HD11 . LEU B 2 72  ? 34.730 30.737  50.212 1.00 68.16  ? 102 LEU B HD11 1 
ATOM   3731 H HD12 . LEU B 2 72  ? 33.894 32.067  50.450 1.00 68.16  ? 102 LEU B HD12 1 
ATOM   3732 H HD13 . LEU B 2 72  ? 33.335 30.941  49.479 1.00 68.16  ? 102 LEU B HD13 1 
ATOM   3733 H HD21 . LEU B 2 72  ? 35.884 30.353  48.105 1.00 69.56  ? 102 LEU B HD21 1 
ATOM   3734 H HD22 . LEU B 2 72  ? 34.536 30.529  47.282 1.00 69.56  ? 102 LEU B HD22 1 
ATOM   3735 H HD23 . LEU B 2 72  ? 35.802 31.423  46.933 1.00 69.56  ? 102 LEU B HD23 1 
ATOM   3736 N N    . ARG B 2 73  ? 33.384 36.177  46.897 1.00 62.62  ? 103 ARG B N    1 
ATOM   3737 C CA   . ARG B 2 73  ? 32.409 37.065  46.283 1.00 66.80  ? 103 ARG B CA   1 
ATOM   3738 C C    . ARG B 2 73  ? 32.897 37.612  44.948 1.00 69.79  ? 103 ARG B C    1 
ATOM   3739 O O    . ARG B 2 73  ? 32.081 38.086  44.151 1.00 71.28  ? 103 ARG B O    1 
ATOM   3740 C CB   . ARG B 2 73  ? 32.094 38.209  47.249 1.00 65.77  ? 103 ARG B CB   1 
ATOM   3741 C CG   . ARG B 2 73  ? 30.791 38.928  46.983 1.00 68.40  ? 103 ARG B CG   1 
ATOM   3742 C CD   . ARG B 2 73  ? 30.453 39.871  48.123 1.00 67.86  ? 103 ARG B CD   1 
ATOM   3743 N NE   . ARG B 2 73  ? 30.286 39.156  49.388 1.00 67.14  ? 103 ARG B NE   1 
ATOM   3744 C CZ   . ARG B 2 73  ? 30.991 39.368  50.497 1.00 66.44  ? 103 ARG B CZ   1 
ATOM   3745 N NH1  . ARG B 2 73  ? 31.937 40.300  50.543 1.00 65.73  ? 103 ARG B NH1  1 
ATOM   3746 N NH2  . ARG B 2 73  ? 30.737 38.644  51.581 1.00 65.62  ? 103 ARG B NH2  1 
ATOM   3747 H H    . ARG B 2 73  ? 33.765 36.501  47.596 1.00 75.14  ? 103 ARG B H    1 
ATOM   3748 H HA   . ARG B 2 73  ? 31.589 36.573  46.123 1.00 80.16  ? 103 ARG B HA   1 
ATOM   3749 H HB2  . ARG B 2 73  ? 32.052 37.849  48.149 1.00 78.92  ? 103 ARG B HB2  1 
ATOM   3750 H HB3  . ARG B 2 73  ? 32.807 38.864  47.193 1.00 78.92  ? 103 ARG B HB3  1 
ATOM   3751 H HG2  . ARG B 2 73  ? 30.870 39.449  46.168 1.00 82.08  ? 103 ARG B HG2  1 
ATOM   3752 H HG3  . ARG B 2 73  ? 30.075 38.279  46.901 1.00 82.08  ? 103 ARG B HG3  1 
ATOM   3753 H HD2  . ARG B 2 73  ? 31.172 40.513  48.230 1.00 81.43  ? 103 ARG B HD2  1 
ATOM   3754 H HD3  . ARG B 2 73  ? 29.622 40.329  47.922 1.00 81.43  ? 103 ARG B HD3  1 
ATOM   3755 H HE   . ARG B 2 73  ? 29.681 38.546  49.418 1.00 80.57  ? 103 ARG B HE   1 
ATOM   3756 H HH11 . ARG B 2 73  ? 32.108 40.774  49.846 1.00 78.87  ? 103 ARG B HH11 1 
ATOM   3757 H HH12 . ARG B 2 73  ? 32.382 40.426  51.268 1.00 78.87  ? 103 ARG B HH12 1 
ATOM   3758 H HH21 . ARG B 2 73  ? 30.125 38.040  51.560 1.00 78.74  ? 103 ARG B HH21 1 
ATOM   3759 H HH22 . ARG B 2 73  ? 31.186 38.777  52.302 1.00 78.74  ? 103 ARG B HH22 1 
ATOM   3760 N N    . LEU B 2 74  ? 34.202 37.548  44.686 1.00 67.10  ? 104 LEU B N    1 
ATOM   3761 C CA   . LEU B 2 74  ? 34.776 38.044  43.441 1.00 70.09  ? 104 LEU B CA   1 
ATOM   3762 C C    . LEU B 2 74  ? 34.757 36.987  42.345 1.00 75.16  ? 104 LEU B C    1 
ATOM   3763 O O    . LEU B 2 74  ? 34.366 37.270  41.209 1.00 78.34  ? 104 LEU B O    1 
ATOM   3764 C CB   . LEU B 2 74  ? 36.215 38.509  43.680 1.00 67.35  ? 104 LEU B CB   1 
ATOM   3765 C CG   . LEU B 2 74  ? 36.419 39.429  44.881 1.00 64.63  ? 104 LEU B CG   1 
ATOM   3766 C CD1  . LEU B 2 74  ? 37.901 39.761  45.044 1.00 62.33  ? 104 LEU B CD1  1 
ATOM   3767 C CD2  . LEU B 2 74  ? 35.568 40.702  44.735 1.00 65.53  ? 104 LEU B CD2  1 
ATOM   3768 H H    . LEU B 2 74  ? 34.784 37.215  45.225 1.00 80.53  ? 104 LEU B H    1 
ATOM   3769 H HA   . LEU B 2 74  ? 34.260 38.806  43.134 1.00 84.11  ? 104 LEU B HA   1 
ATOM   3770 H HB2  . LEU B 2 74  ? 36.771 37.726  43.816 1.00 80.81  ? 104 LEU B HB2  1 
ATOM   3771 H HB3  . LEU B 2 74  ? 36.517 38.988  42.892 1.00 80.81  ? 104 LEU B HB3  1 
ATOM   3772 H HG   . LEU B 2 74  ? 36.129 38.967  45.682 1.00 77.56  ? 104 LEU B HG   1 
ATOM   3773 H HD11 . LEU B 2 74  ? 38.011 40.346  45.810 1.00 74.79  ? 104 LEU B HD11 1 
ATOM   3774 H HD12 . LEU B 2 74  ? 38.396 38.938  45.182 1.00 74.79  ? 104 LEU B HD12 1 
ATOM   3775 H HD13 . LEU B 2 74  ? 38.215 40.206  44.241 1.00 74.79  ? 104 LEU B HD13 1 
ATOM   3776 H HD21 . LEU B 2 74  ? 35.715 41.270  45.508 1.00 78.63  ? 104 LEU B HD21 1 
ATOM   3777 H HD22 . LEU B 2 74  ? 35.833 41.168  43.927 1.00 78.63  ? 104 LEU B HD22 1 
ATOM   3778 H HD23 . LEU B 2 74  ? 34.632 40.451  44.681 1.00 78.63  ? 104 LEU B HD23 1 
ATOM   3779 N N    . THR B 2 75  ? 35.185 35.775  42.675 1.00 81.16  ? 105 THR B N    1 
ATOM   3780 C CA   . THR B 2 75  ? 35.252 34.672  41.725 1.00 85.60  ? 105 THR B CA   1 
ATOM   3781 C C    . THR B 2 75  ? 33.953 34.507  40.944 1.00 90.59  ? 105 THR B C    1 
ATOM   3782 O O    . THR B 2 75  ? 33.764 33.511  40.245 1.00 94.00  ? 105 THR B O    1 
ATOM   3783 C CB   . THR B 2 75  ? 35.564 33.348  42.444 1.00 84.23  ? 105 THR B CB   1 
ATOM   3784 O OG1  . THR B 2 75  ? 34.497 33.029  43.347 1.00 83.53  ? 105 THR B OG1  1 
ATOM   3785 C CG2  . THR B 2 75  ? 36.875 33.451  43.223 1.00 81.81  ? 105 THR B CG2  1 
ATOM   3786 H H    . THR B 2 75  ? 35.449 35.562  43.466 1.00 97.39  ? 105 THR B H    1 
ATOM   3787 H HA   . THR B 2 75  ? 35.965 34.844  41.090 1.00 102.72 ? 105 THR B HA   1 
ATOM   3788 H HB   . THR B 2 75  ? 35.653 32.639  41.788 1.00 101.08 ? 105 THR B HB   1 
ATOM   3789 H HG1  . THR B 2 75  ? 34.411 33.639  43.918 1.00 100.24 ? 105 THR B HG1  1 
ATOM   3790 H HG21 . THR B 2 75  ? 37.061 32.611  43.671 1.00 98.18  ? 105 THR B HG21 1 
ATOM   3791 H HG22 . THR B 2 75  ? 37.606 33.652  42.617 1.00 98.18  ? 105 THR B HG22 1 
ATOM   3792 H HG23 . THR B 2 75  ? 36.813 34.155  43.886 1.00 98.18  ? 105 THR B HG23 1 
ATOM   3793 N N    . GLU C 1 6   ? 74.468 6.350   44.627 1.00 115.90 ? 51  GLU C N    1 
ATOM   3794 C CA   . GLU C 1 6   ? 75.453 7.413   44.453 1.00 120.12 ? 51  GLU C CA   1 
ATOM   3795 C C    . GLU C 1 6   ? 74.914 8.767   44.914 1.00 114.17 ? 51  GLU C C    1 
ATOM   3796 O O    . GLU C 1 6   ? 73.964 9.295   44.338 1.00 113.46 ? 51  GLU C O    1 
ATOM   3797 C CB   . GLU C 1 6   ? 75.890 7.502   42.988 1.00 117.05 ? 51  GLU C CB   1 
ATOM   3798 C CG   . GLU C 1 6   ? 76.835 6.393   42.552 1.00 121.18 ? 51  GLU C CG   1 
ATOM   3799 C CD   . GLU C 1 6   ? 77.299 6.554   41.117 1.00 121.76 ? 51  GLU C CD   1 
ATOM   3800 O OE1  . GLU C 1 6   ? 76.606 7.242   40.341 1.00 121.62 ? 51  GLU C OE1  1 
ATOM   3801 O OE2  . GLU C 1 6   ? 78.361 5.997   40.767 1.00 121.70 ? 51  GLU C OE2  1 
ATOM   3802 H HA   . GLU C 1 6   ? 76.237 7.206   44.986 1.00 144.15 ? 51  GLU C HA   1 
ATOM   3803 H HB2  . GLU C 1 6   ? 75.101 7.457   42.425 1.00 140.45 ? 51  GLU C HB2  1 
ATOM   3804 H HB3  . GLU C 1 6   ? 76.343 8.348   42.849 1.00 140.45 ? 51  GLU C HB3  1 
ATOM   3805 H HG2  . GLU C 1 6   ? 77.618 6.402   43.124 1.00 145.41 ? 51  GLU C HG2  1 
ATOM   3806 H HG3  . GLU C 1 6   ? 76.378 5.541   42.626 1.00 145.41 ? 51  GLU C HG3  1 
ATOM   3807 N N    . ALA C 1 7   ? 75.535 9.326   45.955 1.00 126.14 ? 52  ALA C N    1 
ATOM   3808 C CA   . ALA C 1 7   ? 75.149 10.631  46.491 1.00 115.75 ? 52  ALA C CA   1 
ATOM   3809 C C    . ALA C 1 7   ? 73.713 10.613  47.008 1.00 81.86  ? 52  ALA C C    1 
ATOM   3810 O O    . ALA C 1 7   ? 72.958 11.572  46.836 1.00 67.13  ? 52  ALA C O    1 
ATOM   3811 C CB   . ALA C 1 7   ? 75.332 11.731  45.445 1.00 102.62 ? 52  ALA C CB   1 
ATOM   3812 H H    . ALA C 1 7   ? 76.193 8.962   46.372 1.00 151.36 ? 52  ALA C H    1 
ATOM   3813 H HA   . ALA C 1 7   ? 75.728 10.840  47.241 1.00 138.90 ? 52  ALA C HA   1 
ATOM   3814 H HB1  . ALA C 1 7   ? 75.068 12.581  45.832 1.00 123.15 ? 52  ALA C HB1  1 
ATOM   3815 H HB2  . ALA C 1 7   ? 76.265 11.763  45.181 1.00 123.15 ? 52  ALA C HB2  1 
ATOM   3816 H HB3  . ALA C 1 7   ? 74.777 11.531  44.676 1.00 123.15 ? 52  ALA C HB3  1 
ATOM   3817 N N    . GLU C 1 8   ? 73.334 9.515   47.655 1.00 115.46 ? 53  GLU C N    1 
ATOM   3818 C CA   . GLU C 1 8   ? 71.987 9.366   48.177 1.00 88.75  ? 53  GLU C CA   1 
ATOM   3819 C C    . GLU C 1 8   ? 71.904 9.952   49.585 1.00 66.03  ? 53  GLU C C    1 
ATOM   3820 O O    . GLU C 1 8   ? 72.866 10.515  50.109 1.00 66.00  ? 53  GLU C O    1 
ATOM   3821 C CB   . GLU C 1 8   ? 71.577 7.897   48.147 1.00 77.45  ? 53  GLU C CB   1 
ATOM   3822 C CG   . GLU C 1 8   ? 71.477 7.337   46.743 1.00 73.55  ? 53  GLU C CG   1 
ATOM   3823 C CD   . GLU C 1 8   ? 70.995 5.904   46.722 1.00 67.80  ? 53  GLU C CD   1 
ATOM   3824 O OE1  . GLU C 1 8   ? 71.197 5.201   47.737 1.00 64.76  ? 53  GLU C OE1  1 
ATOM   3825 O OE2  . GLU C 1 8   ? 70.412 5.485   45.695 1.00 65.78  ? 53  GLU C OE2  1 
ATOM   3826 H H    . GLU C 1 8   ? 73.844 8.839   47.803 1.00 138.56 ? 53  GLU C H    1 
ATOM   3827 H HA   . GLU C 1 8   ? 71.373 9.859   47.611 1.00 106.50 ? 53  GLU C HA   1 
ATOM   3828 H HB2  . GLU C 1 8   ? 72.236 7.375   48.631 1.00 92.94  ? 53  GLU C HB2  1 
ATOM   3829 H HB3  . GLU C 1 8   ? 70.708 7.804   48.568 1.00 92.94  ? 53  GLU C HB3  1 
ATOM   3830 H HG2  . GLU C 1 8   ? 70.850 7.872   46.232 1.00 88.26  ? 53  GLU C HG2  1 
ATOM   3831 H HG3  . GLU C 1 8   ? 72.353 7.365   46.328 1.00 88.26  ? 53  GLU C HG3  1 
ATOM   3832 N N    . HIS C 1 9   ? 70.736 9.822   50.206 1.00 59.68  ? 54  HIS C N    1 
ATOM   3833 C CA   . HIS C 1 9   ? 70.475 10.417  51.518 1.00 49.86  ? 54  HIS C CA   1 
ATOM   3834 C C    . HIS C 1 9   ? 70.195 9.335   52.554 1.00 44.66  ? 54  HIS C C    1 
ATOM   3835 O O    . HIS C 1 9   ? 69.091 8.758   52.556 1.00 40.46  ? 54  HIS C O    1 
ATOM   3836 C CB   . HIS C 1 9   ? 69.303 11.395  51.427 1.00 48.17  ? 54  HIS C CB   1 
ATOM   3837 C CG   . HIS C 1 9   ? 69.617 12.616  50.620 1.00 49.23  ? 54  HIS C CG   1 
ATOM   3838 N ND1  . HIS C 1 9   ? 69.549 12.632  49.243 1.00 49.91  ? 54  HIS C ND1  1 
ATOM   3839 C CD2  . HIS C 1 9   ? 70.034 13.850  50.991 1.00 50.09  ? 54  HIS C CD2  1 
ATOM   3840 C CE1  . HIS C 1 9   ? 69.900 13.828  48.802 1.00 50.86  ? 54  HIS C CE1  1 
ATOM   3841 N NE2  . HIS C 1 9   ? 70.196 14.585  49.843 1.00 51.58  ? 54  HIS C NE2  1 
ATOM   3842 H H    . HIS C 1 9   ? 70.067 9.388   49.885 1.00 71.62  ? 54  HIS C H    1 
ATOM   3843 H HA   . HIS C 1 9   ? 71.259 10.912  51.804 1.00 59.83  ? 54  HIS C HA   1 
ATOM   3844 H HB2  . HIS C 1 9   ? 68.551 10.946  51.010 1.00 57.81  ? 54  HIS C HB2  1 
ATOM   3845 H HB3  . HIS C 1 9   ? 69.062 11.682  52.322 1.00 57.81  ? 54  HIS C HB3  1 
ATOM   3846 H HD1  . HIS C 1 9   ? 69.314 11.969  48.748 1.00 59.89  ? 54  HIS C HD1  1 
ATOM   3847 H HD2  . HIS C 1 9   ? 70.178 14.146  51.861 1.00 60.11  ? 54  HIS C HD2  1 
ATOM   3848 H HE1  . HIS C 1 9   ? 69.927 14.093  47.911 1.00 61.04  ? 54  HIS C HE1  1 
ATOM   3849 N N    . PRO C 1 10  ? 71.126 9.039   53.463 1.00 43.78  ? 55  PRO C N    1 
ATOM   3850 C CA   . PRO C 1 10  ? 70.933 7.895   54.360 1.00 43.18  ? 55  PRO C CA   1 
ATOM   3851 C C    . PRO C 1 10  ? 69.726 8.071   55.267 1.00 43.72  ? 55  PRO C C    1 
ATOM   3852 O O    . PRO C 1 10  ? 69.351 9.186   55.635 1.00 41.62  ? 55  PRO C O    1 
ATOM   3853 C CB   . PRO C 1 10  ? 72.232 7.852   55.176 1.00 44.05  ? 55  PRO C CB   1 
ATOM   3854 C CG   . PRO C 1 10  ? 73.214 8.649   54.398 1.00 46.41  ? 55  PRO C CG   1 
ATOM   3855 C CD   . PRO C 1 10  ? 72.423 9.699   53.692 1.00 45.31  ? 55  PRO C CD   1 
ATOM   3856 H HA   . PRO C 1 10  ? 70.841 7.074   53.851 1.00 51.81  ? 55  PRO C HA   1 
ATOM   3857 H HB2  . PRO C 1 10  ? 72.082 8.249   56.048 1.00 52.86  ? 55  PRO C HB2  1 
ATOM   3858 H HB3  . PRO C 1 10  ? 72.531 6.933   55.264 1.00 52.86  ? 55  PRO C HB3  1 
ATOM   3859 H HG2  . PRO C 1 10  ? 73.854 9.056   55.004 1.00 55.69  ? 55  PRO C HG2  1 
ATOM   3860 H HG3  . PRO C 1 10  ? 73.666 8.076   53.760 1.00 55.69  ? 55  PRO C HG3  1 
ATOM   3861 H HD2  . PRO C 1 10  ? 72.311 10.479  54.258 1.00 54.37  ? 55  PRO C HD2  1 
ATOM   3862 H HD3  . PRO C 1 10  ? 72.840 9.928   52.847 1.00 54.37  ? 55  PRO C HD3  1 
ATOM   3863 N N    . LEU C 1 11  ? 69.122 6.941   55.625 1.00 43.85  ? 56  LEU C N    1 
ATOM   3864 C CA   . LEU C 1 11  ? 68.183 6.880   56.729 1.00 44.40  ? 56  LEU C CA   1 
ATOM   3865 C C    . LEU C 1 11  ? 68.944 6.556   58.006 1.00 44.45  ? 56  LEU C C    1 
ATOM   3866 O O    . LEU C 1 11  ? 69.999 5.919   57.974 1.00 45.89  ? 56  LEU C O    1 
ATOM   3867 C CB   . LEU C 1 11  ? 67.112 5.824   56.464 1.00 46.47  ? 56  LEU C CB   1 
ATOM   3868 C CG   . LEU C 1 11  ? 66.288 6.043   55.195 1.00 46.72  ? 56  LEU C CG   1 
ATOM   3869 C CD1  . LEU C 1 11  ? 65.469 4.820   54.873 1.00 47.66  ? 56  LEU C CD1  1 
ATOM   3870 C CD2  . LEU C 1 11  ? 65.381 7.250   55.360 1.00 47.66  ? 56  LEU C CD2  1 
ATOM   3871 H H    . LEU C 1 11  ? 69.245 6.185   55.234 1.00 52.62  ? 56  LEU C H    1 
ATOM   3872 H HA   . LEU C 1 11  ? 67.749 7.741   56.836 1.00 53.29  ? 56  LEU C HA   1 
ATOM   3873 H HB2  . LEU C 1 11  ? 67.545 4.959   56.386 1.00 55.76  ? 56  LEU C HB2  1 
ATOM   3874 H HB3  . LEU C 1 11  ? 66.497 5.813   57.214 1.00 55.76  ? 56  LEU C HB3  1 
ATOM   3875 H HG   . LEU C 1 11  ? 66.886 6.213   54.450 1.00 56.06  ? 56  LEU C HG   1 
ATOM   3876 H HD11 . LEU C 1 11  ? 64.957 4.987   54.066 1.00 57.19  ? 56  LEU C HD11 1 
ATOM   3877 H HD12 . LEU C 1 11  ? 66.066 4.068   54.737 1.00 57.19  ? 56  LEU C HD12 1 
ATOM   3878 H HD13 . LEU C 1 11  ? 64.869 4.638   55.614 1.00 57.19  ? 56  LEU C HD13 1 
ATOM   3879 H HD21 . LEU C 1 11  ? 64.867 7.372   54.547 1.00 57.19  ? 56  LEU C HD21 1 
ATOM   3880 H HD22 . LEU C 1 11  ? 64.784 7.095   56.109 1.00 57.19  ? 56  LEU C HD22 1 
ATOM   3881 H HD23 . LEU C 1 11  ? 65.926 8.034   55.529 1.00 57.19  ? 56  LEU C HD23 1 
ATOM   3882 N N    . GLN C 1 12  ? 68.417 7.019   59.138 1.00 42.01  ? 57  GLN C N    1 
ATOM   3883 C CA   . GLN C 1 12  ? 69.065 6.709   60.407 1.00 42.33  ? 57  GLN C CA   1 
ATOM   3884 C C    . GLN C 1 12  ? 69.192 5.204   60.606 1.00 42.21  ? 57  GLN C C    1 
ATOM   3885 O O    . GLN C 1 12  ? 70.121 4.741   61.275 1.00 43.24  ? 57  GLN C O    1 
ATOM   3886 C CB   . GLN C 1 12  ? 68.290 7.341   61.563 1.00 40.88  ? 57  GLN C CB   1 
ATOM   3887 C CG   . GLN C 1 12  ? 68.924 7.128   62.926 1.00 42.22  ? 57  GLN C CG   1 
ATOM   3888 C CD   . GLN C 1 12  ? 70.316 7.718   63.014 1.00 46.22  ? 57  GLN C CD   1 
ATOM   3889 O OE1  . GLN C 1 12  ? 70.553 8.846   62.578 1.00 45.46  ? 57  GLN C OE1  1 
ATOM   3890 N NE2  . GLN C 1 12  ? 71.254 6.949   63.565 1.00 47.48  ? 57  GLN C NE2  1 
ATOM   3891 H H    . GLN C 1 12  ? 67.707 7.501   59.198 1.00 50.42  ? 57  GLN C H    1 
ATOM   3892 H HA   . GLN C 1 12  ? 69.959 7.086   60.405 1.00 50.80  ? 57  GLN C HA   1 
ATOM   3893 H HB2  . GLN C 1 12  ? 68.230 8.297   61.412 1.00 49.05  ? 57  GLN C HB2  1 
ATOM   3894 H HB3  . GLN C 1 12  ? 67.400 6.957   61.588 1.00 49.05  ? 57  GLN C HB3  1 
ATOM   3895 H HG2  . GLN C 1 12  ? 68.373 7.553   63.602 1.00 50.66  ? 57  GLN C HG2  1 
ATOM   3896 H HG3  . GLN C 1 12  ? 68.989 6.176   63.100 1.00 50.66  ? 57  GLN C HG3  1 
ATOM   3897 H HE21 . GLN C 1 12  ? 71.053 6.162   63.848 1.00 56.98  ? 57  GLN C HE21 1 
ATOM   3898 H HE22 . GLN C 1 12  ? 72.060 7.239   63.637 1.00 56.98  ? 57  GLN C HE22 1 
ATOM   3899 N N    . TYR C 1 13  ? 68.272 4.430   60.037 1.00 43.01  ? 58  TYR C N    1 
ATOM   3900 C CA   . TYR C 1 13  ? 68.306 2.978   60.113 1.00 44.93  ? 58  TYR C CA   1 
ATOM   3901 C C    . TYR C 1 13  ? 68.036 2.402   58.734 1.00 43.20  ? 58  TYR C C    1 
ATOM   3902 O O    . TYR C 1 13  ? 67.364 3.022   57.906 1.00 42.70  ? 58  TYR C O    1 
ATOM   3903 C CB   . TYR C 1 13  ? 67.254 2.417   61.100 1.00 46.06  ? 58  TYR C CB   1 
ATOM   3904 C CG   . TYR C 1 13  ? 67.346 2.977   62.501 1.00 48.51  ? 58  TYR C CG   1 
ATOM   3905 C CD1  . TYR C 1 13  ? 68.068 2.319   63.489 1.00 51.02  ? 58  TYR C CD1  1 
ATOM   3906 C CD2  . TYR C 1 13  ? 66.712 4.166   62.835 1.00 48.71  ? 58  TYR C CD2  1 
ATOM   3907 C CE1  . TYR C 1 13  ? 68.157 2.835   64.768 1.00 52.50  ? 58  TYR C CE1  1 
ATOM   3908 C CE2  . TYR C 1 13  ? 66.793 4.686   64.110 1.00 49.87  ? 58  TYR C CE2  1 
ATOM   3909 C CZ   . TYR C 1 13  ? 67.512 4.018   65.070 1.00 51.86  ? 58  TYR C CZ   1 
ATOM   3910 O OH   . TYR C 1 13  ? 67.587 4.539   66.338 1.00 53.57  ? 58  TYR C OH   1 
ATOM   3911 H H    . TYR C 1 13  ? 67.603 4.734   59.590 1.00 51.61  ? 58  TYR C H    1 
ATOM   3912 H HA   . TYR C 1 13  ? 69.185 2.688   60.402 1.00 53.92  ? 58  TYR C HA   1 
ATOM   3913 H HB2  . TYR C 1 13  ? 66.369 2.621   60.760 1.00 55.27  ? 58  TYR C HB2  1 
ATOM   3914 H HB3  . TYR C 1 13  ? 67.367 1.455   61.160 1.00 55.27  ? 58  TYR C HB3  1 
ATOM   3915 H HD1  . TYR C 1 13  ? 68.502 1.522   63.285 1.00 61.23  ? 58  TYR C HD1  1 
ATOM   3916 H HD2  . TYR C 1 13  ? 66.224 4.620   62.187 1.00 58.46  ? 58  TYR C HD2  1 
ATOM   3917 H HE1  . TYR C 1 13  ? 68.641 2.385   65.422 1.00 63.00  ? 58  TYR C HE1  1 
ATOM   3918 H HE2  . TYR C 1 13  ? 66.361 5.483   64.319 1.00 59.84  ? 58  TYR C HE2  1 
ATOM   3919 H HH   . TYR C 1 13  ? 67.152 5.256   66.380 1.00 64.28  ? 58  TYR C HH   1 
ATOM   3920 N N    . ASN C 1 14  ? 68.565 1.213   58.491 1.00 43.89  ? 59  ASN C N    1 
ATOM   3921 C CA   . ASN C 1 14  ? 68.091 0.425   57.366 1.00 43.55  ? 59  ASN C CA   1 
ATOM   3922 C C    . ASN C 1 14  ? 66.696 -0.091  57.678 1.00 42.05  ? 59  ASN C C    1 
ATOM   3923 O O    . ASN C 1 14  ? 66.347 -0.317  58.836 1.00 40.33  ? 59  ASN C O    1 
ATOM   3924 C CB   . ASN C 1 14  ? 69.033 -0.747  57.085 1.00 44.53  ? 59  ASN C CB   1 
ATOM   3925 C CG   . ASN C 1 14  ? 70.436 -0.297  56.729 1.00 46.04  ? 59  ASN C CG   1 
ATOM   3926 O OD1  . ASN C 1 14  ? 70.637 0.798   56.209 1.00 45.52  ? 59  ASN C OD1  1 
ATOM   3927 N ND2  . ASN C 1 14  ? 71.416 -1.148  57.003 1.00 48.71  ? 59  ASN C ND2  1 
ATOM   3928 H H    . ASN C 1 14  ? 69.190 0.844   58.954 1.00 52.66  ? 59  ASN C H    1 
ATOM   3929 H HA   . ASN C 1 14  ? 68.046 0.983   56.574 1.00 52.26  ? 59  ASN C HA   1 
ATOM   3930 H HB2  . ASN C 1 14  ? 69.088 -1.305  57.876 1.00 53.43  ? 59  ASN C HB2  1 
ATOM   3931 H HB3  . ASN C 1 14  ? 68.684 -1.261  56.340 1.00 53.43  ? 59  ASN C HB3  1 
ATOM   3932 H HD21 . ASN C 1 14  ? 72.230 -0.940  56.820 1.00 58.46  ? 59  ASN C HD21 1 
ATOM   3933 H HD22 . ASN C 1 14  ? 71.237 -1.908  57.363 1.00 58.46  ? 59  ASN C HD22 1 
ATOM   3934 N N    . TYR C 1 15  ? 65.892 -0.270  56.637 1.00 41.94  ? 60  TYR C N    1 
ATOM   3935 C CA   . TYR C 1 15  ? 64.559 -0.835  56.793 1.00 45.04  ? 60  TYR C CA   1 
ATOM   3936 C C    . TYR C 1 15  ? 64.350 -1.957  55.786 1.00 43.61  ? 60  TYR C C    1 
ATOM   3937 O O    . TYR C 1 15  ? 65.005 -2.014  54.743 1.00 43.75  ? 60  TYR C O    1 
ATOM   3938 C CB   . TYR C 1 15  ? 63.466 0.232   56.627 1.00 47.51  ? 60  TYR C CB   1 
ATOM   3939 C CG   . TYR C 1 15  ? 63.340 1.174   57.802 1.00 50.80  ? 60  TYR C CG   1 
ATOM   3940 C CD1  . TYR C 1 15  ? 64.205 2.249   57.950 1.00 53.88  ? 60  TYR C CD1  1 
ATOM   3941 C CD2  . TYR C 1 15  ? 62.350 0.994   58.759 1.00 53.55  ? 60  TYR C CD2  1 
ATOM   3942 C CE1  . TYR C 1 15  ? 64.092 3.115   59.018 1.00 55.26  ? 60  TYR C CE1  1 
ATOM   3943 C CE2  . TYR C 1 15  ? 62.233 1.857   59.832 1.00 55.38  ? 60  TYR C CE2  1 
ATOM   3944 C CZ   . TYR C 1 15  ? 63.107 2.913   59.954 1.00 55.08  ? 60  TYR C CZ   1 
ATOM   3945 O OH   . TYR C 1 15  ? 62.991 3.772   61.019 1.00 57.65  ? 60  TYR C OH   1 
ATOM   3946 H H    . TYR C 1 15  ? 66.095 -0.071  55.825 1.00 50.32  ? 60  TYR C H    1 
ATOM   3947 H HA   . TYR C 1 15  ? 64.478 -1.211  57.684 1.00 54.05  ? 60  TYR C HA   1 
ATOM   3948 H HB2  . TYR C 1 15  ? 63.668 0.765   55.842 1.00 57.02  ? 60  TYR C HB2  1 
ATOM   3949 H HB3  . TYR C 1 15  ? 62.612 -0.212  56.511 1.00 57.02  ? 60  TYR C HB3  1 
ATOM   3950 H HD1  . TYR C 1 15  ? 64.873 2.388   57.318 1.00 64.66  ? 60  TYR C HD1  1 
ATOM   3951 H HD2  . TYR C 1 15  ? 61.759 0.281   58.678 1.00 64.26  ? 60  TYR C HD2  1 
ATOM   3952 H HE1  . TYR C 1 15  ? 64.681 3.830   59.105 1.00 66.32  ? 60  TYR C HE1  1 
ATOM   3953 H HE2  . TYR C 1 15  ? 61.567 1.725   60.467 1.00 66.46  ? 60  TYR C HE2  1 
ATOM   3954 H HH   . TYR C 1 15  ? 62.352 3.535   61.511 1.00 69.18  ? 60  TYR C HH   1 
ATOM   3955 N N    . THR C 1 16  ? 63.410 -2.844  56.114 1.00 43.34  ? 61  THR C N    1 
ATOM   3956 C CA   . THR C 1 16  ? 63.098 -4.015  55.307 1.00 44.39  ? 61  THR C CA   1 
ATOM   3957 C C    . THR C 1 16  ? 61.592 -4.088  55.087 1.00 43.22  ? 61  THR C C    1 
ATOM   3958 O O    . THR C 1 16  ? 60.820 -4.047  56.050 1.00 42.47  ? 61  THR C O    1 
ATOM   3959 C CB   . THR C 1 16  ? 63.602 -5.295  55.992 1.00 47.88  ? 61  THR C CB   1 
ATOM   3960 O OG1  . THR C 1 16  ? 65.028 -5.214  56.166 1.00 49.04  ? 61  THR C OG1  1 
ATOM   3961 C CG2  . THR C 1 16  ? 63.255 -6.551  55.164 1.00 49.38  ? 61  THR C CG2  1 
ATOM   3962 H H    . THR C 1 16  ? 62.927 -2.783  56.823 1.00 52.01  ? 61  THR C H    1 
ATOM   3963 H HA   . THR C 1 16  ? 63.531 -3.938  54.442 1.00 53.27  ? 61  THR C HA   1 
ATOM   3964 H HB   . THR C 1 16  ? 63.180 -5.379  56.861 1.00 57.46  ? 61  THR C HB   1 
ATOM   3965 H HG1  . THR C 1 16  ? 65.311 -5.911  56.541 1.00 58.85  ? 61  THR C HG1  1 
ATOM   3966 H HG21 . THR C 1 16  ? 63.582 -7.345  55.615 1.00 59.26  ? 61  THR C HG21 1 
ATOM   3967 H HG22 . THR C 1 16  ? 62.294 -6.622  55.058 1.00 59.26  ? 61  THR C HG22 1 
ATOM   3968 H HG23 . THR C 1 16  ? 63.666 -6.493  54.288 1.00 59.26  ? 61  THR C HG23 1 
ATOM   3969 N N    . PHE C 1 17  ? 61.179 -4.179  53.822 1.00 43.25  ? 62  PHE C N    1 
ATOM   3970 C CA   . PHE C 1 17  ? 59.781 -4.427  53.490 1.00 43.21  ? 62  PHE C CA   1 
ATOM   3971 C C    . PHE C 1 17  ? 59.489 -5.919  53.537 1.00 44.93  ? 62  PHE C C    1 
ATOM   3972 O O    . PHE C 1 17  ? 60.287 -6.735  53.066 1.00 46.19  ? 62  PHE C O    1 
ATOM   3973 C CB   . PHE C 1 17  ? 59.444 -3.902  52.092 1.00 43.67  ? 62  PHE C CB   1 
ATOM   3974 C CG   . PHE C 1 17  ? 58.902 -2.498  52.070 1.00 42.43  ? 62  PHE C CG   1 
ATOM   3975 C CD1  . PHE C 1 17  ? 57.660 -2.212  52.607 1.00 41.85  ? 62  PHE C CD1  1 
ATOM   3976 C CD2  . PHE C 1 17  ? 59.631 -1.468  51.489 1.00 41.63  ? 62  PHE C CD2  1 
ATOM   3977 C CE1  . PHE C 1 17  ? 57.158 -0.922  52.582 1.00 40.81  ? 62  PHE C CE1  1 
ATOM   3978 C CE2  . PHE C 1 17  ? 59.134 -0.177  51.458 1.00 40.90  ? 62  PHE C CE2  1 
ATOM   3979 C CZ   . PHE C 1 17  ? 57.902 0.098   52.004 1.00 40.36  ? 62  PHE C CZ   1 
ATOM   3980 H H    . PHE C 1 17  ? 61.693 -4.100  53.137 1.00 51.90  ? 62  PHE C H    1 
ATOM   3981 H HA   . PHE C 1 17  ? 59.210 -3.979  54.134 1.00 51.86  ? 62  PHE C HA   1 
ATOM   3982 H HB2  . PHE C 1 17  ? 60.250 -3.915  51.553 1.00 52.40  ? 62  PHE C HB2  1 
ATOM   3983 H HB3  . PHE C 1 17  ? 58.776 -4.482  51.695 1.00 52.40  ? 62  PHE C HB3  1 
ATOM   3984 H HD1  . PHE C 1 17  ? 57.160 -2.893  52.997 1.00 50.22  ? 62  PHE C HD1  1 
ATOM   3985 H HD2  . PHE C 1 17  ? 60.466 -1.647  51.120 1.00 49.95  ? 62  PHE C HD2  1 
ATOM   3986 H HE1  . PHE C 1 17  ? 56.324 -0.739  52.950 1.00 48.97  ? 62  PHE C HE1  1 
ATOM   3987 H HE2  . PHE C 1 17  ? 59.634 0.506   51.071 1.00 49.08  ? 62  PHE C HE2  1 
ATOM   3988 H HZ   . PHE C 1 17  ? 57.566 0.965   51.984 1.00 48.43  ? 62  PHE C HZ   1 
ATOM   3989 N N    . TRP C 1 18  ? 58.331 -6.269  54.095 1.00 46.32  ? 63  TRP C N    1 
ATOM   3990 C CA   . TRP C 1 18  ? 57.838 -7.638  54.106 1.00 48.74  ? 63  TRP C CA   1 
ATOM   3991 C C    . TRP C 1 18  ? 56.408 -7.663  53.588 1.00 50.96  ? 63  TRP C C    1 
ATOM   3992 O O    . TRP C 1 18  ? 55.630 -6.735  53.822 1.00 48.36  ? 63  TRP C O    1 
ATOM   3993 C CB   . TRP C 1 18  ? 57.853 -8.254  55.511 1.00 49.01  ? 63  TRP C CB   1 
ATOM   3994 C CG   . TRP C 1 18  ? 59.159 -8.174  56.254 1.00 49.60  ? 63  TRP C CG   1 
ATOM   3995 C CD1  . TRP C 1 18  ? 59.771 -7.047  56.733 1.00 46.79  ? 63  TRP C CD1  1 
ATOM   3996 C CD2  . TRP C 1 18  ? 59.996 -9.277  56.634 1.00 50.91  ? 63  TRP C CD2  1 
ATOM   3997 N NE1  . TRP C 1 18  ? 60.938 -7.382  57.376 1.00 48.06  ? 63  TRP C NE1  1 
ATOM   3998 C CE2  . TRP C 1 18  ? 61.101 -8.742  57.327 1.00 49.15  ? 63  TRP C CE2  1 
ATOM   3999 C CE3  . TRP C 1 18  ? 59.919 -10.662 56.450 1.00 52.93  ? 63  TRP C CE3  1 
ATOM   4000 C CZ2  . TRP C 1 18  ? 62.118 -9.540  57.836 1.00 50.95  ? 63  TRP C CZ2  1 
ATOM   4001 C CZ3  . TRP C 1 18  ? 60.934 -11.458 56.952 1.00 53.97  ? 63  TRP C CZ3  1 
ATOM   4002 C CH2  . TRP C 1 18  ? 62.018 -10.896 57.639 1.00 53.86  ? 63  TRP C CH2  1 
ATOM   4003 H H    . TRP C 1 18  ? 57.801 -5.713  54.483 1.00 55.58  ? 63  TRP C H    1 
ATOM   4004 H HA   . TRP C 1 18  ? 58.387 -8.185  53.523 1.00 58.49  ? 63  TRP C HA   1 
ATOM   4005 H HB2  . TRP C 1 18  ? 57.187 -7.800  56.050 1.00 58.81  ? 63  TRP C HB2  1 
ATOM   4006 H HB3  . TRP C 1 18  ? 57.621 -9.193  55.435 1.00 58.81  ? 63  TRP C HB3  1 
ATOM   4007 H HD1  . TRP C 1 18  ? 59.445 -6.181  56.637 1.00 56.15  ? 63  TRP C HD1  1 
ATOM   4008 H HE1  . TRP C 1 18  ? 61.481 -6.827  57.745 1.00 57.68  ? 63  TRP C HE1  1 
ATOM   4009 H HE3  . TRP C 1 18  ? 59.201 -11.040 55.995 1.00 63.51  ? 63  TRP C HE3  1 
ATOM   4010 H HZ2  . TRP C 1 18  ? 62.840 -9.170  58.290 1.00 61.14  ? 63  TRP C HZ2  1 
ATOM   4011 H HZ3  . TRP C 1 18  ? 60.894 -12.380 56.836 1.00 64.77  ? 63  TRP C HZ3  1 
ATOM   4012 H HH2  . TRP C 1 18  ? 62.687 -11.453 57.966 1.00 64.63  ? 63  TRP C HH2  1 
ATOM   4013 N N    . TYR C 1 19  ? 56.054 -8.756  52.916 1.00 52.22  ? 64  TYR C N    1 
ATOM   4014 C CA   . TYR C 1 19  ? 54.719 -8.927  52.359 1.00 52.97  ? 64  TYR C CA   1 
ATOM   4015 C C    . TYR C 1 19  ? 54.184 -10.293 52.756 1.00 54.95  ? 64  TYR C C    1 
ATOM   4016 O O    . TYR C 1 19  ? 54.900 -11.294 52.672 1.00 54.94  ? 64  TYR C O    1 
ATOM   4017 C CB   . TYR C 1 19  ? 54.739 -8.773  50.836 1.00 53.98  ? 64  TYR C CB   1 
ATOM   4018 C CG   . TYR C 1 19  ? 53.472 -9.206  50.144 1.00 56.54  ? 64  TYR C CG   1 
ATOM   4019 C CD1  . TYR C 1 19  ? 52.285 -8.514  50.330 1.00 55.89  ? 64  TYR C CD1  1 
ATOM   4020 C CD2  . TYR C 1 19  ? 53.467 -10.299 49.286 1.00 59.13  ? 64  TYR C CD2  1 
ATOM   4021 C CE1  . TYR C 1 19  ? 51.125 -8.906  49.690 1.00 58.59  ? 64  TYR C CE1  1 
ATOM   4022 C CE2  . TYR C 1 19  ? 52.317 -10.696 48.642 1.00 61.65  ? 64  TYR C CE2  1 
ATOM   4023 C CZ   . TYR C 1 19  ? 51.147 -9.997  48.845 1.00 61.89  ? 64  TYR C CZ   1 
ATOM   4024 O OH   . TYR C 1 19  ? 49.995 -10.392 48.206 1.00 64.39  ? 64  TYR C OH   1 
ATOM   4025 H H    . TYR C 1 19  ? 56.579 -9.421  52.767 1.00 62.66  ? 64  TYR C H    1 
ATOM   4026 H HA   . TYR C 1 19  ? 54.129 -8.250  52.726 1.00 63.56  ? 64  TYR C HA   1 
ATOM   4027 H HB2  . TYR C 1 19  ? 54.887 -7.839  50.621 1.00 64.77  ? 64  TYR C HB2  1 
ATOM   4028 H HB3  . TYR C 1 19  ? 55.465 -9.309  50.481 1.00 64.77  ? 64  TYR C HB3  1 
ATOM   4029 H HD1  . TYR C 1 19  ? 52.268 -7.778  50.899 1.00 67.07  ? 64  TYR C HD1  1 
ATOM   4030 H HD2  . TYR C 1 19  ? 54.255 -10.773 49.146 1.00 70.96  ? 64  TYR C HD2  1 
ATOM   4031 H HE1  . TYR C 1 19  ? 50.334 -8.435  49.825 1.00 70.30  ? 64  TYR C HE1  1 
ATOM   4032 H HE2  . TYR C 1 19  ? 52.329 -11.432 48.074 1.00 73.98  ? 64  TYR C HE2  1 
ATOM   4033 H HH   . TYR C 1 19  ? 50.149 -11.064 47.726 1.00 77.27  ? 64  TYR C HH   1 
ATOM   4034 N N    . SER C 1 20  ? 52.932 -10.329 53.201 1.00 55.12  ? 65  SER C N    1 
ATOM   4035 C CA   . SER C 1 20  ? 52.279 -11.578 53.553 1.00 58.47  ? 65  SER C CA   1 
ATOM   4036 C C    . SER C 1 20  ? 50.863 -11.563 53.002 1.00 62.02  ? 65  SER C C    1 
ATOM   4037 O O    . SER C 1 20  ? 50.228 -10.509 52.915 1.00 61.44  ? 65  SER C O    1 
ATOM   4038 C CB   . SER C 1 20  ? 52.247 -11.793 55.070 1.00 58.45  ? 65  SER C CB   1 
ATOM   4039 O OG   . SER C 1 20  ? 51.292 -10.946 55.667 1.00 57.03  ? 65  SER C OG   1 
ATOM   4040 H H    . SER C 1 20  ? 52.437 -9.634  53.307 1.00 66.14  ? 65  SER C H    1 
ATOM   4041 H HA   . SER C 1 20  ? 52.758 -12.318 53.148 1.00 70.16  ? 65  SER C HA   1 
ATOM   4042 H HB2  . SER C 1 20  ? 52.012 -12.716 55.254 1.00 70.13  ? 65  SER C HB2  1 
ATOM   4043 H HB3  . SER C 1 20  ? 53.122 -11.593 55.437 1.00 70.13  ? 65  SER C HB3  1 
ATOM   4044 H HG   . SER C 1 20  ? 51.279 -11.069 56.498 1.00 68.44  ? 65  SER C HG   1 
ATOM   4045 N N    . ARG C 1 21  ? 50.378 -12.748 52.627 1.00 72.69  ? 66  ARG C N    1 
ATOM   4046 C CA   . ARG C 1 21  ? 49.030 -12.914 52.102 1.00 77.76  ? 66  ARG C CA   1 
ATOM   4047 C C    . ARG C 1 21  ? 48.518 -14.287 52.512 1.00 83.45  ? 66  ARG C C    1 
ATOM   4048 O O    . ARG C 1 21  ? 49.238 -15.280 52.384 1.00 85.75  ? 66  ARG C O    1 
ATOM   4049 C CB   . ARG C 1 21  ? 49.009 -12.760 50.577 1.00 79.93  ? 66  ARG C CB   1 
ATOM   4050 C CG   . ARG C 1 21  ? 47.643 -12.971 49.951 1.00 84.10  ? 66  ARG C CG   1 
ATOM   4051 C CD   . ARG C 1 21  ? 47.583 -12.422 48.530 1.00 85.38  ? 66  ARG C CD   1 
ATOM   4052 N NE   . ARG C 1 21  ? 48.555 -13.051 47.635 1.00 87.89  ? 66  ARG C NE   1 
ATOM   4053 C CZ   . ARG C 1 21  ? 48.328 -14.148 46.915 1.00 92.09  ? 66  ARG C CZ   1 
ATOM   4054 N NH1  . ARG C 1 21  ? 49.284 -14.630 46.131 1.00 93.23  ? 66  ARG C NH1  1 
ATOM   4055 N NH2  . ARG C 1 21  ? 47.154 -14.771 46.978 1.00 95.20  ? 66  ARG C NH2  1 
ATOM   4056 H H    . ARG C 1 21  ? 50.823 -13.483 52.670 1.00 87.22  ? 66  ARG C H    1 
ATOM   4057 H HA   . ARG C 1 21  ? 48.447 -12.241 52.487 1.00 93.31  ? 66  ARG C HA   1 
ATOM   4058 H HB2  . ARG C 1 21  ? 49.303 -11.864 50.351 1.00 95.92  ? 66  ARG C HB2  1 
ATOM   4059 H HB3  . ARG C 1 21  ? 49.615 -13.411 50.190 1.00 95.92  ? 66  ARG C HB3  1 
ATOM   4060 H HG2  . ARG C 1 21  ? 47.450 -13.921 49.918 1.00 100.92 ? 66  ARG C HG2  1 
ATOM   4061 H HG3  . ARG C 1 21  ? 46.974 -12.512 50.483 1.00 100.92 ? 66  ARG C HG3  1 
ATOM   4062 H HD2  . ARG C 1 21  ? 46.697 -12.580 48.168 1.00 102.46 ? 66  ARG C HD2  1 
ATOM   4063 H HD3  . ARG C 1 21  ? 47.767 -11.470 48.551 1.00 102.46 ? 66  ARG C HD3  1 
ATOM   4064 H HE   . ARG C 1 21  ? 49.331 -12.685 47.569 1.00 105.46 ? 66  ARG C HE   1 
ATOM   4065 H HH11 . ARG C 1 21  ? 50.046 -14.232 46.088 1.00 111.88 ? 66  ARG C HH11 1 
ATOM   4066 H HH12 . ARG C 1 21  ? 49.143 -15.340 45.667 1.00 111.88 ? 66  ARG C HH12 1 
ATOM   4067 H HH21 . ARG C 1 21  ? 46.531 -14.463 47.484 1.00 114.24 ? 66  ARG C HH21 1 
ATOM   4068 H HH22 . ARG C 1 21  ? 47.018 -15.480 46.511 1.00 114.24 ? 66  ARG C HH22 1 
ATOM   4069 N N    . ARG C 1 22  ? 47.278 -14.336 53.005 1.00 90.00  ? 67  ARG C N    1 
ATOM   4070 C CA   . ARG C 1 22  ? 46.739 -15.581 53.547 1.00 97.28  ? 67  ARG C CA   1 
ATOM   4071 C C    . ARG C 1 22  ? 46.624 -16.662 52.477 1.00 111.30 ? 67  ARG C C    1 
ATOM   4072 O O    . ARG C 1 22  ? 46.940 -17.830 52.732 1.00 110.37 ? 67  ARG C O    1 
ATOM   4073 C CB   . ARG C 1 22  ? 45.377 -15.315 54.183 1.00 101.34 ? 67  ARG C CB   1 
ATOM   4074 C CG   . ARG C 1 22  ? 44.676 -16.546 54.736 1.00 105.21 ? 67  ARG C CG   1 
ATOM   4075 C CD   . ARG C 1 22  ? 43.275 -16.195 55.212 1.00 109.79 ? 67  ARG C CD   1 
ATOM   4076 N NE   . ARG C 1 22  ? 42.452 -15.665 54.126 1.00 113.41 ? 67  ARG C NE   1 
ATOM   4077 C CZ   . ARG C 1 22  ? 41.278 -15.062 54.292 1.00 116.40 ? 67  ARG C CZ   1 
ATOM   4078 N NH1  . ARG C 1 22  ? 40.771 -14.900 55.507 1.00 117.40 ? 67  ARG C NH1  1 
ATOM   4079 N NH2  . ARG C 1 22  ? 40.610 -14.615 53.238 1.00 117.88 ? 67  ARG C NH2  1 
ATOM   4080 H H    . ARG C 1 22  ? 46.736 -13.670 53.035 1.00 108.00 ? 67  ARG C H    1 
ATOM   4081 H HA   . ARG C 1 22  ? 47.335 -15.907 54.240 1.00 116.73 ? 67  ARG C HA   1 
ATOM   4082 H HB2  . ARG C 1 22  ? 45.496 -14.691 54.917 1.00 121.61 ? 67  ARG C HB2  1 
ATOM   4083 H HB3  . ARG C 1 22  ? 44.796 -14.922 53.513 1.00 121.61 ? 67  ARG C HB3  1 
ATOM   4084 H HG2  . ARG C 1 22  ? 44.603 -17.217 54.039 1.00 126.25 ? 67  ARG C HG2  1 
ATOM   4085 H HG3  . ARG C 1 22  ? 45.178 -16.894 55.489 1.00 126.25 ? 67  ARG C HG3  1 
ATOM   4086 H HD2  . ARG C 1 22  ? 42.845 -16.993 55.558 1.00 131.75 ? 67  ARG C HD2  1 
ATOM   4087 H HD3  . ARG C 1 22  ? 43.334 -15.519 55.906 1.00 131.75 ? 67  ARG C HD3  1 
ATOM   4088 H HE   . ARG C 1 22  ? 42.748 -15.750 53.323 1.00 136.09 ? 67  ARG C HE   1 
ATOM   4089 H HH11 . ARG C 1 22  ? 41.201 -15.188 56.195 1.00 140.88 ? 67  ARG C HH11 1 
ATOM   4090 H HH12 . ARG C 1 22  ? 40.012 -14.509 55.608 1.00 140.88 ? 67  ARG C HH12 1 
ATOM   4091 H HH21 . ARG C 1 22  ? 40.934 -14.717 52.448 1.00 141.46 ? 67  ARG C HH21 1 
ATOM   4092 H HH22 . ARG C 1 22  ? 39.851 -14.224 53.344 1.00 141.46 ? 67  ARG C HH22 1 
ATOM   4093 N N    . THR C 1 23  ? 46.171 -16.292 51.281 1.00 121.23 ? 68  THR C N    1 
ATOM   4094 C CA   . THR C 1 23  ? 45.955 -17.235 50.178 1.00 131.39 ? 68  THR C CA   1 
ATOM   4095 C C    . THR C 1 23  ? 45.427 -18.588 50.650 1.00 131.29 ? 68  THR C C    1 
ATOM   4096 O O    . THR C 1 23  ? 44.451 -18.658 51.393 1.00 135.50 ? 68  THR C O    1 
ATOM   4097 C CB   . THR C 1 23  ? 47.249 -17.473 49.365 1.00 129.83 ? 68  THR C CB   1 
ATOM   4098 O OG1  . THR C 1 23  ? 46.954 -18.298 48.231 1.00 136.53 ? 68  THR C OG1  1 
ATOM   4099 C CG2  . THR C 1 23  ? 48.328 -18.149 50.211 1.00 132.71 ? 68  THR C CG2  1 
ATOM   4100 H H    . THR C 1 23  ? 45.976 -15.480 51.076 1.00 145.47 ? 68  THR C H    1 
ATOM   4101 H HA   . THR C 1 23  ? 45.295 -16.858 49.575 1.00 157.67 ? 68  THR C HA   1 
ATOM   4102 H HB   . THR C 1 23  ? 47.594 -16.620 49.057 1.00 155.79 ? 68  THR C HB   1 
ATOM   4103 H HG1  . THR C 1 23  ? 47.652 -18.432 47.784 1.00 163.83 ? 68  THR C HG1  1 
ATOM   4104 H HG21 . THR C 1 23  ? 49.128 -18.286 49.679 1.00 159.26 ? 68  THR C HG21 1 
ATOM   4105 H HG22 . THR C 1 23  ? 48.549 -17.592 50.973 1.00 159.26 ? 68  THR C HG22 1 
ATOM   4106 H HG23 . THR C 1 23  ? 48.010 -19.008 50.529 1.00 159.26 ? 68  THR C HG23 1 
ATOM   4107 N N    . ASN C 1 36  ? 51.920 -16.780 55.238 1.00 87.16  ? 81  ASN C N    1 
ATOM   4108 C CA   . ASN C 1 36  ? 53.378 -16.820 55.248 1.00 86.62  ? 81  ASN C CA   1 
ATOM   4109 C C    . ASN C 1 36  ? 53.952 -15.463 54.836 1.00 82.83  ? 81  ASN C C    1 
ATOM   4110 O O    . ASN C 1 36  ? 53.660 -14.952 53.753 1.00 82.24  ? 81  ASN C O    1 
ATOM   4111 C CB   . ASN C 1 36  ? 53.885 -17.929 54.320 1.00 91.93  ? 81  ASN C CB   1 
ATOM   4112 C CG   . ASN C 1 36  ? 55.409 -18.028 54.285 1.00 93.82  ? 81  ASN C CG   1 
ATOM   4113 O OD1  . ASN C 1 36  ? 56.111 -17.399 55.081 1.00 92.04  ? 81  ASN C OD1  1 
ATOM   4114 N ND2  . ASN C 1 36  ? 55.923 -18.833 53.360 1.00 96.32  ? 81  ASN C ND2  1 
ATOM   4115 H H    . ASN C 1 36  ? 51.585 -16.423 54.532 1.00 104.59 ? 81  ASN C H    1 
ATOM   4116 H HA   . ASN C 1 36  ? 53.684 -17.016 56.148 1.00 103.94 ? 81  ASN C HA   1 
ATOM   4117 H HB2  . ASN C 1 36  ? 53.537 -18.780 54.626 1.00 110.32 ? 81  ASN C HB2  1 
ATOM   4118 H HB3  . ASN C 1 36  ? 53.577 -17.750 53.418 1.00 110.32 ? 81  ASN C HB3  1 
ATOM   4119 H HD21 . ASN C 1 36  ? 56.775 -18.925 53.296 1.00 115.59 ? 81  ASN C HD21 1 
ATOM   4120 H HD22 . ASN C 1 36  ? 55.403 -19.260 52.825 1.00 115.59 ? 81  ASN C HD22 1 
ATOM   4121 N N    . ILE C 1 37  ? 54.762 -14.884 55.700 1.00 83.61  ? 82  ILE C N    1 
ATOM   4122 C CA   . ILE C 1 37  ? 55.349 -13.580 55.428 1.00 82.34  ? 82  ILE C CA   1 
ATOM   4123 C C    . ILE C 1 37  ? 56.626 -13.762 54.620 1.00 80.87  ? 82  ILE C C    1 
ATOM   4124 O O    . ILE C 1 37  ? 57.366 -14.736 54.786 1.00 84.28  ? 82  ILE C O    1 
ATOM   4125 C CB   . ILE C 1 37  ? 55.612 -12.805 56.733 1.00 82.78  ? 82  ILE C CB   1 
ATOM   4126 C CG1  . ILE C 1 37  ? 55.993 -11.366 56.404 1.00 83.02  ? 82  ILE C CG1  1 
ATOM   4127 C CG2  . ILE C 1 37  ? 56.702 -13.485 57.556 1.00 86.82  ? 82  ILE C CG2  1 
ATOM   4128 C CD1  . ILE C 1 37  ? 55.936 -10.464 57.584 1.00 82.06  ? 82  ILE C CD1  1 
ATOM   4129 H H    . ILE C 1 37  ? 54.991 -15.223 56.456 1.00 100.34 ? 82  ILE C H    1 
ATOM   4130 H HA   . ILE C 1 37  ? 54.728 -13.061 54.893 1.00 98.81  ? 82  ILE C HA   1 
ATOM   4131 H HB   . ILE C 1 37  ? 54.794 -12.794 57.255 1.00 99.33  ? 82  ILE C HB   1 
ATOM   4132 H HG12 . ILE C 1 37  ? 56.900 -11.351 56.059 1.00 99.62  ? 82  ILE C HG12 1 
ATOM   4133 H HG13 . ILE C 1 37  ? 55.379 -11.023 55.735 1.00 99.62  ? 82  ILE C HG13 1 
ATOM   4134 H HG21 . ILE C 1 37  ? 56.846 -12.976 58.370 1.00 104.18 ? 82  ILE C HG21 1 
ATOM   4135 H HG22 . ILE C 1 37  ? 56.416 -14.385 57.774 1.00 104.18 ? 82  ILE C HG22 1 
ATOM   4136 H HG23 . ILE C 1 37  ? 57.519 -13.513 57.034 1.00 104.18 ? 82  ILE C HG23 1 
ATOM   4137 H HD11 . ILE C 1 37  ? 56.188 -9.568  57.309 1.00 98.47  ? 82  ILE C HD11 1 
ATOM   4138 H HD12 . ILE C 1 37  ? 55.032 -10.460 57.935 1.00 98.47  ? 82  ILE C HD12 1 
ATOM   4139 H HD13 . ILE C 1 37  ? 56.553 -10.788 58.259 1.00 98.47  ? 82  ILE C HD13 1 
ATOM   4140 N N    . LYS C 1 38  ? 56.886 -12.802 53.735 1.00 69.63  ? 83  LYS C N    1 
ATOM   4141 C CA   . LYS C 1 38  ? 57.991 -12.866 52.790 1.00 65.49  ? 83  LYS C CA   1 
ATOM   4142 C C    . LYS C 1 38  ? 58.770 -11.565 52.860 1.00 57.89  ? 83  LYS C C    1 
ATOM   4143 O O    . LYS C 1 38  ? 58.182 -10.484 52.765 1.00 53.29  ? 83  LYS C O    1 
ATOM   4144 C CB   . LYS C 1 38  ? 57.488 -13.079 51.358 1.00 68.54  ? 83  LYS C CB   1 
ATOM   4145 C CG   . LYS C 1 38  ? 56.516 -14.235 51.177 1.00 74.34  ? 83  LYS C CG   1 
ATOM   4146 C CD   . LYS C 1 38  ? 57.242 -15.566 51.125 1.00 79.18  ? 83  LYS C CD   1 
ATOM   4147 C CE   . LYS C 1 38  ? 56.299 -16.682 50.733 1.00 86.92  ? 83  LYS C CE   1 
ATOM   4148 N NZ   . LYS C 1 38  ? 55.706 -16.462 49.379 1.00 88.68  ? 83  LYS C NZ   1 
ATOM   4149 H H    . LYS C 1 38  ? 56.420 -12.083 53.664 1.00 83.55  ? 83  LYS C H    1 
ATOM   4150 H HA   . LYS C 1 38  ? 58.582 -13.598 53.025 1.00 78.59  ? 83  LYS C HA   1 
ATOM   4151 H HB2  . LYS C 1 38  ? 57.037 -12.271 51.067 1.00 82.25  ? 83  LYS C HB2  1 
ATOM   4152 H HB3  . LYS C 1 38  ? 58.252 -13.248 50.785 1.00 82.25  ? 83  LYS C HB3  1 
ATOM   4153 H HG2  . LYS C 1 38  ? 55.898 -14.255 51.925 1.00 89.21  ? 83  LYS C HG2  1 
ATOM   4154 H HG3  . LYS C 1 38  ? 56.032 -14.120 50.344 1.00 89.21  ? 83  LYS C HG3  1 
ATOM   4155 H HD2  . LYS C 1 38  ? 57.952 -15.519 50.465 1.00 95.02  ? 83  LYS C HD2  1 
ATOM   4156 H HD3  . LYS C 1 38  ? 57.608 -15.767 52.000 1.00 95.02  ? 83  LYS C HD3  1 
ATOM   4157 H HE2  . LYS C 1 38  ? 56.787 -17.520 50.716 1.00 104.31 ? 83  LYS C HE2  1 
ATOM   4158 H HE3  . LYS C 1 38  ? 55.575 -16.729 51.376 1.00 104.31 ? 83  LYS C HE3  1 
ATOM   4159 H HZ1  . LYS C 1 38  ? 55.157 -17.132 49.175 1.00 106.41 ? 83  LYS C HZ1  1 
ATOM   4160 H HZ2  . LYS C 1 38  ? 55.248 -15.699 49.369 1.00 106.41 ? 83  LYS C HZ2  1 
ATOM   4161 H HZ3  . LYS C 1 38  ? 56.351 -16.420 48.767 1.00 106.41 ? 83  LYS C HZ3  1 
ATOM   4162 N N    . GLN C 1 39  ? 60.085 -11.669 53.018 1.00 58.76  ? 84  GLN C N    1 
ATOM   4163 C CA   . GLN C 1 39  ? 60.939 -10.495 52.930 1.00 56.93  ? 84  GLN C CA   1 
ATOM   4164 C C    . GLN C 1 39  ? 61.025 -10.029 51.484 1.00 55.31  ? 84  GLN C C    1 
ATOM   4165 O O    . GLN C 1 39  ? 61.333 -10.816 50.584 1.00 56.71  ? 84  GLN C O    1 
ATOM   4166 C CB   . GLN C 1 39  ? 62.336 -10.804 53.469 1.00 59.01  ? 84  GLN C CB   1 
ATOM   4167 C CG   . GLN C 1 39  ? 63.307 -9.642  53.300 1.00 60.25  ? 84  GLN C CG   1 
ATOM   4168 C CD   . GLN C 1 39  ? 64.605 -9.827  54.054 1.00 61.73  ? 84  GLN C CD   1 
ATOM   4169 O OE1  . GLN C 1 39  ? 64.797 -10.819 54.755 1.00 64.77  ? 84  GLN C OE1  1 
ATOM   4170 N NE2  . GLN C 1 39  ? 65.508 -8.864  53.914 1.00 61.71  ? 84  GLN C NE2  1 
ATOM   4171 H H    . GLN C 1 39  ? 60.504 -12.404 53.175 1.00 70.51  ? 84  GLN C H    1 
ATOM   4172 H HA   . GLN C 1 39  ? 60.557 -9.779  53.461 1.00 68.32  ? 84  GLN C HA   1 
ATOM   4173 H HB2  . GLN C 1 39  ? 62.272 -11.005 54.416 1.00 70.81  ? 84  GLN C HB2  1 
ATOM   4174 H HB3  . GLN C 1 39  ? 62.697 -11.567 52.991 1.00 70.81  ? 84  GLN C HB3  1 
ATOM   4175 H HG2  . GLN C 1 39  ? 63.521 -9.546  52.359 1.00 72.30  ? 84  GLN C HG2  1 
ATOM   4176 H HG3  . GLN C 1 39  ? 62.886 -8.832  53.627 1.00 72.30  ? 84  GLN C HG3  1 
ATOM   4177 H HE21 . GLN C 1 39  ? 65.338 -8.184  53.416 1.00 74.05  ? 84  GLN C HE21 1 
ATOM   4178 H HE22 . GLN C 1 39  ? 66.263 -8.921  54.322 1.00 74.05  ? 84  GLN C HE22 1 
ATOM   4179 N N    . ILE C 1 40  ? 60.744 -8.747  51.261 1.00 48.26  ? 85  ILE C N    1 
ATOM   4180 C CA   . ILE C 1 40  ? 60.868 -8.148  49.936 1.00 47.82  ? 85  ILE C CA   1 
ATOM   4181 C C    . ILE C 1 40  ? 62.307 -7.692  49.737 1.00 46.95  ? 85  ILE C C    1 
ATOM   4182 O O    . ILE C 1 40  ? 63.011 -8.192  48.857 1.00 47.44  ? 85  ILE C O    1 
ATOM   4183 C CB   . ILE C 1 40  ? 59.889 -6.972  49.745 1.00 46.48  ? 85  ILE C CB   1 
ATOM   4184 C CG1  . ILE C 1 40  ? 58.443 -7.448  49.891 1.00 47.56  ? 85  ILE C CG1  1 
ATOM   4185 C CG2  . ILE C 1 40  ? 60.098 -6.338  48.372 1.00 46.65  ? 85  ILE C CG2  1 
ATOM   4186 C CD1  . ILE C 1 40  ? 57.406 -6.367  49.684 1.00 46.78  ? 85  ILE C CD1  1 
ATOM   4187 H H    . ILE C 1 40  ? 60.478 -8.198  51.867 1.00 57.92  ? 85  ILE C H    1 
ATOM   4188 H HA   . ILE C 1 40  ? 60.668 -8.819  49.265 1.00 57.39  ? 85  ILE C HA   1 
ATOM   4189 H HB   . ILE C 1 40  ? 60.067 -6.305  50.426 1.00 55.77  ? 85  ILE C HB   1 
ATOM   4190 H HG12 . ILE C 1 40  ? 58.277 -8.144  49.236 1.00 57.07  ? 85  ILE C HG12 1 
ATOM   4191 H HG13 . ILE C 1 40  ? 58.322 -7.805  50.785 1.00 57.07  ? 85  ILE C HG13 1 
ATOM   4192 H HG21 . ILE C 1 40  ? 59.476 -5.601  48.267 1.00 55.98  ? 85  ILE C HG21 1 
ATOM   4193 H HG22 . ILE C 1 40  ? 61.010 -6.013  48.310 1.00 55.98  ? 85  ILE C HG22 1 
ATOM   4194 H HG23 . ILE C 1 40  ? 59.937 -7.007  47.688 1.00 55.98  ? 85  ILE C HG23 1 
ATOM   4195 H HD11 . ILE C 1 40  ? 56.523 -6.752  49.794 1.00 56.13  ? 85  ILE C HD11 1 
ATOM   4196 H HD12 . ILE C 1 40  ? 57.546 -5.666  50.340 1.00 56.13  ? 85  ILE C HD12 1 
ATOM   4197 H HD13 . ILE C 1 40  ? 57.501 -6.006  48.789 1.00 56.13  ? 85  ILE C HD13 1 
ATOM   4198 N N    . GLY C 1 41  ? 62.758 -6.741  50.541 1.00 43.30  ? 86  GLY C N    1 
ATOM   4199 C CA   . GLY C 1 41  ? 64.119 -6.255  50.400 1.00 43.43  ? 86  GLY C CA   1 
ATOM   4200 C C    . GLY C 1 41  ? 64.401 -5.156  51.400 1.00 41.62  ? 86  GLY C C    1 
ATOM   4201 O O    . GLY C 1 41  ? 63.494 -4.604  52.035 1.00 40.13  ? 86  GLY C O    1 
ATOM   4202 H H    . GLY C 1 41  ? 62.304 -6.366  51.168 1.00 51.96  ? 86  GLY C H    1 
ATOM   4203 H HA2  . GLY C 1 41  ? 64.745 -6.981  50.548 1.00 52.11  ? 86  GLY C HA2  1 
ATOM   4204 H HA3  . GLY C 1 41  ? 64.252 -5.905  49.505 1.00 52.11  ? 86  GLY C HA3  1 
ATOM   4205 N N    . THR C 1 42  ? 65.686 -4.844  51.528 1.00 45.22  ? 87  THR C N    1 
ATOM   4206 C CA   . THR C 1 42  ? 66.161 -3.881  52.505 1.00 46.01  ? 87  THR C CA   1 
ATOM   4207 C C    . THR C 1 42  ? 66.724 -2.666  51.787 1.00 46.79  ? 87  THR C C    1 
ATOM   4208 O O    . THR C 1 42  ? 67.296 -2.774  50.701 1.00 48.81  ? 87  THR C O    1 
ATOM   4209 C CB   . THR C 1 42  ? 67.215 -4.509  53.420 1.00 47.37  ? 87  THR C CB   1 
ATOM   4210 O OG1  . THR C 1 42  ? 66.582 -5.496  54.242 1.00 48.43  ? 87  THR C OG1  1 
ATOM   4211 C CG2  . THR C 1 42  ? 67.873 -3.471  54.319 1.00 47.56  ? 87  THR C CG2  1 
ATOM   4212 H H    . THR C 1 42  ? 66.313 -5.187  51.049 1.00 54.26  ? 87  THR C H    1 
ATOM   4213 H HA   . THR C 1 42  ? 65.416 -3.591  53.055 1.00 55.21  ? 87  THR C HA   1 
ATOM   4214 H HB   . THR C 1 42  ? 67.903 -4.930  52.881 1.00 56.85  ? 87  THR C HB   1 
ATOM   4215 H HG1  . THR C 1 42  ? 65.982 -5.139  54.709 1.00 58.11  ? 87  THR C HG1  1 
ATOM   4216 H HG21 . THR C 1 42  ? 68.535 -3.896  54.886 1.00 57.07  ? 87  THR C HG21 1 
ATOM   4217 H HG22 . THR C 1 42  ? 68.309 -2.794  53.779 1.00 57.07  ? 87  THR C HG22 1 
ATOM   4218 H HG23 . THR C 1 42  ? 67.204 -3.046  54.878 1.00 57.07  ? 87  THR C HG23 1 
ATOM   4219 N N    . PHE C 1 43  ? 66.532 -1.501  52.395 1.00 46.84  ? 88  PHE C N    1 
ATOM   4220 C CA   . PHE C 1 43  ? 67.035 -0.260  51.836 1.00 48.23  ? 88  PHE C CA   1 
ATOM   4221 C C    . PHE C 1 43  ? 67.616 0.584   52.960 1.00 45.92  ? 88  PHE C C    1 
ATOM   4222 O O    . PHE C 1 43  ? 67.324 0.374   54.141 1.00 45.24  ? 88  PHE C O    1 
ATOM   4223 C CB   . PHE C 1 43  ? 65.933 0.504   51.083 1.00 48.83  ? 88  PHE C CB   1 
ATOM   4224 C CG   . PHE C 1 43  ? 64.719 0.784   51.907 1.00 49.29  ? 88  PHE C CG   1 
ATOM   4225 C CD1  . PHE C 1 43  ? 64.669 1.884   52.743 1.00 49.02  ? 88  PHE C CD1  1 
ATOM   4226 C CD2  . PHE C 1 43  ? 63.621 -0.052  51.841 1.00 50.72  ? 88  PHE C CD2  1 
ATOM   4227 C CE1  . PHE C 1 43  ? 63.546 2.140   53.504 1.00 48.28  ? 88  PHE C CE1  1 
ATOM   4228 C CE2  . PHE C 1 43  ? 62.496 0.202   52.595 1.00 49.41  ? 88  PHE C CE2  1 
ATOM   4229 C CZ   . PHE C 1 43  ? 62.458 1.295   53.427 1.00 48.74  ? 88  PHE C CZ   1 
ATOM   4230 H H    . PHE C 1 43  ? 66.111 -1.405  53.138 1.00 56.21  ? 88  PHE C H    1 
ATOM   4231 H HA   . PHE C 1 43  ? 67.747 -0.459  51.208 1.00 57.88  ? 88  PHE C HA   1 
ATOM   4232 H HB2  . PHE C 1 43  ? 66.291 1.355   50.786 1.00 58.60  ? 88  PHE C HB2  1 
ATOM   4233 H HB3  . PHE C 1 43  ? 65.657 -0.022  50.317 1.00 58.60  ? 88  PHE C HB3  1 
ATOM   4234 H HD1  . PHE C 1 43  ? 65.401 2.455   52.798 1.00 58.83  ? 88  PHE C HD1  1 
ATOM   4235 H HD2  . PHE C 1 43  ? 63.640 -0.794  51.281 1.00 60.86  ? 88  PHE C HD2  1 
ATOM   4236 H HE1  . PHE C 1 43  ? 63.521 2.882   54.065 1.00 57.94  ? 88  PHE C HE1  1 
ATOM   4237 H HE2  . PHE C 1 43  ? 61.764 -0.369  52.544 1.00 59.29  ? 88  PHE C HE2  1 
ATOM   4238 H HZ   . PHE C 1 43  ? 61.699 1.465   53.936 1.00 58.49  ? 88  PHE C HZ   1 
ATOM   4239 N N    . ALA C 1 44  ? 68.436 1.557   52.572 1.00 41.77  ? 89  ALA C N    1 
ATOM   4240 C CA   . ALA C 1 44  ? 69.205 2.336   53.528 1.00 41.26  ? 89  ALA C CA   1 
ATOM   4241 C C    . ALA C 1 44  ? 69.131 3.839   53.309 1.00 40.69  ? 89  ALA C C    1 
ATOM   4242 O O    . ALA C 1 44  ? 69.631 4.584   54.158 1.00 40.72  ? 89  ALA C O    1 
ATOM   4243 C CB   . ALA C 1 44  ? 70.686 1.916   53.491 1.00 42.04  ? 89  ALA C CB   1 
ATOM   4244 H H    . ALA C 1 44  ? 68.564 1.785   51.753 1.00 50.13  ? 89  ALA C H    1 
ATOM   4245 H HA   . ALA C 1 44  ? 68.869 2.152   54.419 1.00 49.51  ? 89  ALA C HA   1 
ATOM   4246 H HB1  . ALA C 1 44  ? 71.180 2.447   54.135 1.00 50.45  ? 89  ALA C HB1  1 
ATOM   4247 H HB2  . ALA C 1 44  ? 70.752 0.975   53.716 1.00 50.45  ? 89  ALA C HB2  1 
ATOM   4248 H HB3  . ALA C 1 44  ? 71.034 2.069   52.599 1.00 50.45  ? 89  ALA C HB3  1 
ATOM   4249 N N    . SER C 1 45  ? 68.552 4.306   52.206 1.00 42.53  ? 90  SER C N    1 
ATOM   4250 C CA   . SER C 1 45  ? 68.457 5.729   51.915 1.00 43.06  ? 90  SER C CA   1 
ATOM   4251 C C    . SER C 1 45  ? 67.017 6.097   51.567 1.00 41.09  ? 90  SER C C    1 
ATOM   4252 O O    . SER C 1 45  ? 66.164 5.239   51.341 1.00 40.13  ? 90  SER C O    1 
ATOM   4253 C CB   . SER C 1 45  ? 69.382 6.121   50.762 1.00 45.27  ? 90  SER C CB   1 
ATOM   4254 O OG   . SER C 1 45  ? 68.926 5.538   49.554 1.00 46.88  ? 90  SER C OG   1 
ATOM   4255 H H    . SER C 1 45  ? 68.201 3.807   51.600 1.00 51.04  ? 90  SER C H    1 
ATOM   4256 H HA   . SER C 1 45  ? 68.719 6.234   52.701 1.00 51.68  ? 90  SER C HA   1 
ATOM   4257 H HB2  . SER C 1 45  ? 69.383 7.087   50.669 1.00 54.33  ? 90  SER C HB2  1 
ATOM   4258 H HB3  . SER C 1 45  ? 70.279 5.803   50.951 1.00 54.33  ? 90  SER C HB3  1 
ATOM   4259 H HG   . SER C 1 45  ? 69.434 5.754   48.921 1.00 56.26  ? 90  SER C HG   1 
ATOM   4260 N N    . VAL C 1 46  ? 66.767 7.405   51.503 1.00 42.22  ? 91  VAL C N    1 
ATOM   4261 C CA   . VAL C 1 46  ? 65.459 7.913   51.109 1.00 41.98  ? 91  VAL C CA   1 
ATOM   4262 C C    . VAL C 1 46  ? 65.155 7.545   49.663 1.00 42.56  ? 91  VAL C C    1 
ATOM   4263 O O    . VAL C 1 46  ? 64.021 7.178   49.329 1.00 41.22  ? 91  VAL C O    1 
ATOM   4264 C CB   . VAL C 1 46  ? 65.409 9.436   51.325 1.00 43.60  ? 91  VAL C CB   1 
ATOM   4265 C CG1  . VAL C 1 46  ? 64.073 10.015  50.834 1.00 44.14  ? 91  VAL C CG1  1 
ATOM   4266 C CG2  . VAL C 1 46  ? 65.650 9.770   52.795 1.00 43.33  ? 91  VAL C CG2  1 
ATOM   4267 H H    . VAL C 1 46  ? 67.342 8.018   51.684 1.00 50.66  ? 91  VAL C H    1 
ATOM   4268 H HA   . VAL C 1 46  ? 64.779 7.508   51.671 1.00 50.37  ? 91  VAL C HA   1 
ATOM   4269 H HB   . VAL C 1 46  ? 66.118 9.848   50.807 1.00 52.32  ? 91  VAL C HB   1 
ATOM   4270 H HG11 . VAL C 1 46  ? 64.071 10.974  50.983 1.00 52.96  ? 91  VAL C HG11 1 
ATOM   4271 H HG12 . VAL C 1 46  ? 63.977 9.827   49.888 1.00 52.96  ? 91  VAL C HG12 1 
ATOM   4272 H HG13 . VAL C 1 46  ? 63.349 9.602   51.330 1.00 52.96  ? 91  VAL C HG13 1 
ATOM   4273 H HG21 . VAL C 1 46  ? 65.615 10.733  52.909 1.00 51.99  ? 91  VAL C HG21 1 
ATOM   4274 H HG22 . VAL C 1 46  ? 64.962 9.347   53.332 1.00 51.99  ? 91  VAL C HG22 1 
ATOM   4275 H HG23 . VAL C 1 46  ? 66.524 9.438   53.054 1.00 51.99  ? 91  VAL C HG23 1 
ATOM   4276 N N    . GLU C 1 47  ? 66.160 7.641   48.781 1.00 42.36  ? 92  GLU C N    1 
ATOM   4277 C CA   . GLU C 1 47  ? 65.958 7.324   47.368 1.00 44.26  ? 92  GLU C CA   1 
ATOM   4278 C C    . GLU C 1 47  ? 65.690 5.837   47.161 1.00 47.17  ? 92  GLU C C    1 
ATOM   4279 O O    . GLU C 1 47  ? 64.893 5.457   46.294 1.00 45.69  ? 92  GLU C O    1 
ATOM   4280 C CB   . GLU C 1 47  ? 67.173 7.750   46.548 1.00 45.61  ? 92  GLU C CB   1 
ATOM   4281 C CG   . GLU C 1 47  ? 67.425 9.254   46.490 1.00 46.34  ? 92  GLU C CG   1 
ATOM   4282 C CD   . GLU C 1 47  ? 68.191 9.776   47.688 1.00 45.26  ? 92  GLU C CD   1 
ATOM   4283 O OE1  . GLU C 1 47  ? 68.259 9.069   48.720 1.00 44.90  ? 92  GLU C OE1  1 
ATOM   4284 O OE2  . GLU C 1 47  ? 68.732 10.900  47.595 1.00 46.76  ? 92  GLU C OE2  1 
ATOM   4285 H H    . GLU C 1 47  ? 66.960 7.887   48.978 1.00 50.84  ? 92  GLU C H    1 
ATOM   4286 H HA   . GLU C 1 47  ? 65.188 7.815   47.041 1.00 53.11  ? 92  GLU C HA   1 
ATOM   4287 H HB2  . GLU C 1 47  ? 67.963 7.337   46.931 1.00 54.73  ? 92  GLU C HB2  1 
ATOM   4288 H HB3  . GLU C 1 47  ? 67.054 7.439   45.637 1.00 54.73  ? 92  GLU C HB3  1 
ATOM   4289 H HG2  . GLU C 1 47  ? 67.942 9.456   45.694 1.00 55.60  ? 92  GLU C HG2  1 
ATOM   4290 H HG3  . GLU C 1 47  ? 66.572 9.715   46.457 1.00 55.60  ? 92  GLU C HG3  1 
ATOM   4291 N N    . GLN C 1 48  ? 66.356 4.975   47.932 1.00 50.89  ? 93  GLN C N    1 
ATOM   4292 C CA   . GLN C 1 48  ? 66.103 3.547   47.797 1.00 55.48  ? 93  GLN C CA   1 
ATOM   4293 C C    . GLN C 1 48  ? 64.733 3.191   48.352 1.00 52.22  ? 93  GLN C C    1 
ATOM   4294 O O    . GLN C 1 48  ? 64.039 2.325   47.806 1.00 52.84  ? 93  GLN C O    1 
ATOM   4295 C CB   . GLN C 1 48  ? 67.200 2.746   48.494 1.00 62.60  ? 93  GLN C CB   1 
ATOM   4296 C CG   . GLN C 1 48  ? 67.212 1.279   48.093 1.00 69.40  ? 93  GLN C CG   1 
ATOM   4297 C CD   . GLN C 1 48  ? 68.412 0.518   48.639 1.00 75.24  ? 93  GLN C CD   1 
ATOM   4298 O OE1  . GLN C 1 48  ? 69.128 1.003   49.518 1.00 76.64  ? 93  GLN C OE1  1 
ATOM   4299 N NE2  . GLN C 1 48  ? 68.637 -0.683  48.111 1.00 77.91  ? 93  GLN C NE2  1 
ATOM   4300 H H    . GLN C 1 48  ? 66.943 5.187   48.524 1.00 61.07  ? 93  GLN C H    1 
ATOM   4301 H HA   . GLN C 1 48  ? 66.114 3.313   46.856 1.00 66.58  ? 93  GLN C HA   1 
ATOM   4302 H HB2  . GLN C 1 48  ? 68.062 3.126   48.263 1.00 75.12  ? 93  GLN C HB2  1 
ATOM   4303 H HB3  . GLN C 1 48  ? 67.063 2.793   49.453 1.00 75.12  ? 93  GLN C HB3  1 
ATOM   4304 H HG2  . GLN C 1 48  ? 66.409 0.853   48.433 1.00 83.28  ? 93  GLN C HG2  1 
ATOM   4305 H HG3  . GLN C 1 48  ? 67.234 1.217   47.126 1.00 83.28  ? 93  GLN C HG3  1 
ATOM   4306 H HE21 . GLN C 1 48  ? 68.118 -0.987  47.497 1.00 93.49  ? 93  GLN C HE21 1 
ATOM   4307 H HE22 . GLN C 1 48  ? 69.303 -1.154  48.384 1.00 93.49  ? 93  GLN C HE22 1 
ATOM   4308 N N    . PHE C 1 49  ? 64.316 3.860   49.427 1.00 48.61  ? 94  PHE C N    1 
ATOM   4309 C CA   . PHE C 1 49  ? 62.953 3.688   49.909 1.00 44.81  ? 94  PHE C CA   1 
ATOM   4310 C C    . PHE C 1 49  ? 61.953 3.994   48.805 1.00 44.81  ? 94  PHE C C    1 
ATOM   4311 O O    . PHE C 1 49  ? 60.998 3.241   48.588 1.00 45.58  ? 94  PHE C O    1 
ATOM   4312 C CB   . PHE C 1 49  ? 62.689 4.586   51.115 1.00 41.26  ? 94  PHE C CB   1 
ATOM   4313 C CG   . PHE C 1 49  ? 61.223 4.849   51.352 1.00 38.91  ? 94  PHE C CG   1 
ATOM   4314 C CD1  . PHE C 1 49  ? 60.372 3.824   51.748 1.00 38.02  ? 94  PHE C CD1  1 
ATOM   4315 C CD2  . PHE C 1 49  ? 60.692 6.113   51.157 1.00 37.99  ? 94  PHE C CD2  1 
ATOM   4316 C CE1  . PHE C 1 49  ? 59.023 4.060   51.952 1.00 36.17  ? 94  PHE C CE1  1 
ATOM   4317 C CE2  . PHE C 1 49  ? 59.347 6.355   51.360 1.00 36.74  ? 94  PHE C CE2  1 
ATOM   4318 C CZ   . PHE C 1 49  ? 58.513 5.327   51.759 1.00 36.87  ? 94  PHE C CZ   1 
ATOM   4319 H H    . PHE C 1 49  ? 64.795 4.408   49.885 1.00 58.33  ? 94  PHE C H    1 
ATOM   4320 H HA   . PHE C 1 49  ? 62.826 2.766   50.184 1.00 53.78  ? 94  PHE C HA   1 
ATOM   4321 H HB2  . PHE C 1 49  ? 63.048 4.159   51.909 1.00 49.52  ? 94  PHE C HB2  1 
ATOM   4322 H HB3  . PHE C 1 49  ? 63.126 5.440   50.972 1.00 49.52  ? 94  PHE C HB3  1 
ATOM   4323 H HD1  . PHE C 1 49  ? 60.713 2.969   51.879 1.00 45.62  ? 94  PHE C HD1  1 
ATOM   4324 H HD2  . PHE C 1 49  ? 61.248 6.808   50.887 1.00 45.59  ? 94  PHE C HD2  1 
ATOM   4325 H HE1  . PHE C 1 49  ? 58.463 3.367   52.222 1.00 43.41  ? 94  PHE C HE1  1 
ATOM   4326 H HE2  . PHE C 1 49  ? 59.003 7.209   51.230 1.00 44.09  ? 94  PHE C HE2  1 
ATOM   4327 H HZ   . PHE C 1 49  ? 57.608 5.491   51.898 1.00 44.24  ? 94  PHE C HZ   1 
ATOM   4328 N N    . TRP C 1 50  ? 62.161 5.097   48.088 1.00 45.21  ? 95  TRP C N    1 
ATOM   4329 C CA   . TRP C 1 50  ? 61.203 5.495   47.065 1.00 46.06  ? 95  TRP C CA   1 
ATOM   4330 C C    . TRP C 1 50  ? 61.150 4.475   45.938 1.00 46.42  ? 95  TRP C C    1 
ATOM   4331 O O    . TRP C 1 50  ? 60.082 4.223   45.371 1.00 46.37  ? 95  TRP C O    1 
ATOM   4332 C CB   . TRP C 1 50  ? 61.551 6.883   46.523 1.00 46.98  ? 95  TRP C CB   1 
ATOM   4333 C CG   . TRP C 1 50  ? 61.139 8.015   47.429 1.00 47.79  ? 95  TRP C CG   1 
ATOM   4334 C CD1  . TRP C 1 50  ? 61.946 8.980   47.952 1.00 48.25  ? 95  TRP C CD1  1 
ATOM   4335 C CD2  . TRP C 1 50  ? 59.819 8.290   47.919 1.00 47.85  ? 95  TRP C CD2  1 
ATOM   4336 N NE1  . TRP C 1 50  ? 61.213 9.839   48.736 1.00 47.46  ? 95  TRP C NE1  1 
ATOM   4337 C CE2  . TRP C 1 50  ? 59.904 9.437   48.729 1.00 47.17  ? 95  TRP C CE2  1 
ATOM   4338 C CE3  . TRP C 1 50  ? 58.573 7.679   47.747 1.00 48.58  ? 95  TRP C CE3  1 
ATOM   4339 C CZ2  . TRP C 1 50  ? 58.796 9.983   49.365 1.00 47.26  ? 95  TRP C CZ2  1 
ATOM   4340 C CZ3  . TRP C 1 50  ? 57.475 8.225   48.380 1.00 48.20  ? 95  TRP C CZ3  1 
ATOM   4341 C CH2  . TRP C 1 50  ? 57.592 9.366   49.175 1.00 47.28  ? 95  TRP C CH2  1 
ATOM   4342 H H    . TRP C 1 50  ? 62.836 5.623   48.174 1.00 54.25  ? 95  TRP C H    1 
ATOM   4343 H HA   . TRP C 1 50  ? 60.321 5.544   47.463 1.00 55.27  ? 95  TRP C HA   1 
ATOM   4344 H HB2  . TRP C 1 50  ? 62.512 6.938   46.399 1.00 56.37  ? 95  TRP C HB2  1 
ATOM   4345 H HB3  . TRP C 1 50  ? 61.103 7.007   45.672 1.00 56.37  ? 95  TRP C HB3  1 
ATOM   4346 H HD1  . TRP C 1 50  ? 62.861 9.046   47.803 1.00 57.89  ? 95  TRP C HD1  1 
ATOM   4347 H HE1  . TRP C 1 50  ? 61.525 10.520  49.159 1.00 56.96  ? 95  TRP C HE1  1 
ATOM   4348 H HE3  . TRP C 1 50  ? 58.486 6.920   47.216 1.00 58.30  ? 95  TRP C HE3  1 
ATOM   4349 H HZ2  . TRP C 1 50  ? 58.870 10.742  49.897 1.00 56.71  ? 95  TRP C HZ2  1 
ATOM   4350 H HZ3  . TRP C 1 50  ? 56.641 7.828   48.273 1.00 57.84  ? 95  TRP C HZ3  1 
ATOM   4351 H HH2  . TRP C 1 50  ? 56.834 9.709   49.591 1.00 56.73  ? 95  TRP C HH2  1 
ATOM   4352 N N    . ARG C 1 51  ? 62.286 3.872   45.597 1.00 45.09  ? 96  ARG C N    1 
ATOM   4353 C CA   . ARG C 1 51  ? 62.274 2.861   44.546 1.00 47.34  ? 96  ARG C CA   1 
ATOM   4354 C C    . ARG C 1 51  ? 61.443 1.651   44.959 1.00 44.95  ? 96  ARG C C    1 
ATOM   4355 O O    . ARG C 1 51  ? 60.742 1.059   44.130 1.00 45.68  ? 96  ARG C O    1 
ATOM   4356 C CB   . ARG C 1 51  ? 63.702 2.447   44.195 1.00 50.81  ? 96  ARG C CB   1 
ATOM   4357 C CG   . ARG C 1 51  ? 64.515 3.548   43.530 1.00 54.78  ? 96  ARG C CG   1 
ATOM   4358 C CD   . ARG C 1 51  ? 65.756 2.991   42.823 1.00 62.79  ? 96  ARG C CD   1 
ATOM   4359 N NE   . ARG C 1 51  ? 66.726 2.404   43.748 1.00 66.64  ? 96  ARG C NE   1 
ATOM   4360 C CZ   . ARG C 1 51  ? 67.709 3.081   44.341 1.00 70.98  ? 96  ARG C CZ   1 
ATOM   4361 N NH1  . ARG C 1 51  ? 67.864 4.382   44.119 1.00 71.64  ? 96  ARG C NH1  1 
ATOM   4362 N NH2  . ARG C 1 51  ? 68.542 2.455   45.165 1.00 72.01  ? 96  ARG C NH2  1 
ATOM   4363 H H    . ARG C 1 51  ? 63.056 4.024   45.948 1.00 54.11  ? 96  ARG C H    1 
ATOM   4364 H HA   . ARG C 1 51  ? 61.871 3.241   43.750 1.00 56.80  ? 96  ARG C HA   1 
ATOM   4365 H HB2  . ARG C 1 51  ? 64.162 2.190   45.010 1.00 60.97  ? 96  ARG C HB2  1 
ATOM   4366 H HB3  . ARG C 1 51  ? 63.668 1.693   43.586 1.00 60.97  ? 96  ARG C HB3  1 
ATOM   4367 H HG2  . ARG C 1 51  ? 63.964 3.995   42.868 1.00 65.74  ? 96  ARG C HG2  1 
ATOM   4368 H HG3  . ARG C 1 51  ? 64.808 4.181   44.204 1.00 65.74  ? 96  ARG C HG3  1 
ATOM   4369 H HD2  . ARG C 1 51  ? 65.481 2.300   42.200 1.00 75.35  ? 96  ARG C HD2  1 
ATOM   4370 H HD3  . ARG C 1 51  ? 66.197 3.711   42.345 1.00 75.35  ? 96  ARG C HD3  1 
ATOM   4371 H HE   . ARG C 1 51  ? 66.657 1.565   43.920 1.00 79.97  ? 96  ARG C HE   1 
ATOM   4372 H HH11 . ARG C 1 51  ? 67.330 4.794   43.587 1.00 85.97  ? 96  ARG C HH11 1 
ATOM   4373 H HH12 . ARG C 1 51  ? 68.501 4.811   44.507 1.00 85.97  ? 96  ARG C HH12 1 
ATOM   4374 H HH21 . ARG C 1 51  ? 68.448 1.614   45.314 1.00 86.42  ? 96  ARG C HH21 1 
ATOM   4375 H HH22 . ARG C 1 51  ? 69.176 2.892   45.549 1.00 86.42  ? 96  ARG C HH22 1 
ATOM   4376 N N    . PHE C 1 52  ? 61.504 1.266   46.235 1.00 46.32  ? 97  PHE C N    1 
ATOM   4377 C CA   . PHE C 1 52  ? 60.664 0.178   46.721 1.00 47.46  ? 97  PHE C CA   1 
ATOM   4378 C C    . PHE C 1 52  ? 59.201 0.607   46.782 1.00 48.63  ? 97  PHE C C    1 
ATOM   4379 O O    . PHE C 1 52  ? 58.333 -0.015  46.160 1.00 50.81  ? 97  PHE C O    1 
ATOM   4380 C CB   . PHE C 1 52  ? 61.152 -0.290  48.095 1.00 45.59  ? 97  PHE C CB   1 
ATOM   4381 C CG   . PHE C 1 52  ? 62.219 -1.353  48.032 1.00 45.21  ? 97  PHE C CG   1 
ATOM   4382 C CD1  . PHE C 1 52  ? 63.558 -1.010  47.914 1.00 45.77  ? 97  PHE C CD1  1 
ATOM   4383 C CD2  . PHE C 1 52  ? 61.884 -2.694  48.096 1.00 45.79  ? 97  PHE C CD2  1 
ATOM   4384 C CE1  . PHE C 1 52  ? 64.546 -1.995  47.853 1.00 47.13  ? 97  PHE C CE1  1 
ATOM   4385 C CE2  . PHE C 1 52  ? 62.864 -3.681  48.033 1.00 47.07  ? 97  PHE C CE2  1 
ATOM   4386 C CZ   . PHE C 1 52  ? 64.195 -3.331  47.912 1.00 46.61  ? 97  PHE C CZ   1 
ATOM   4387 H H    . PHE C 1 52  ? 62.018 1.615   46.830 1.00 55.58  ? 97  PHE C H    1 
ATOM   4388 H HA   . PHE C 1 52  ? 60.731 -0.571  46.108 1.00 56.95  ? 97  PHE C HA   1 
ATOM   4389 H HB2  . PHE C 1 52  ? 61.518 0.471   48.572 1.00 54.71  ? 97  PHE C HB2  1 
ATOM   4390 H HB3  . PHE C 1 52  ? 60.399 -0.655  48.586 1.00 54.71  ? 97  PHE C HB3  1 
ATOM   4391 H HD1  . PHE C 1 52  ? 63.800 -0.113  47.871 1.00 54.93  ? 97  PHE C HD1  1 
ATOM   4392 H HD2  . PHE C 1 52  ? 60.991 -2.939  48.174 1.00 54.94  ? 97  PHE C HD2  1 
ATOM   4393 H HE1  . PHE C 1 52  ? 65.440 -1.752  47.772 1.00 56.56  ? 97  PHE C HE1  1 
ATOM   4394 H HE2  . PHE C 1 52  ? 62.622 -4.578  48.076 1.00 56.48  ? 97  PHE C HE2  1 
ATOM   4395 H HZ   . PHE C 1 52  ? 64.850 -3.990  47.875 1.00 55.94  ? 97  PHE C HZ   1 
ATOM   4396 N N    . TYR C 1 53  ? 58.912 1.690   47.510 1.00 48.49  ? 98  TYR C N    1 
ATOM   4397 C CA   . TYR C 1 53  ? 57.522 2.075   47.746 1.00 49.31  ? 98  TYR C CA   1 
ATOM   4398 C C    . TYR C 1 53  ? 56.812 2.432   46.444 1.00 50.66  ? 98  TYR C C    1 
ATOM   4399 O O    . TYR C 1 53  ? 55.689 1.980   46.195 1.00 51.77  ? 98  TYR C O    1 
ATOM   4400 C CB   . TYR C 1 53  ? 57.460 3.243   48.732 1.00 48.23  ? 98  TYR C CB   1 
ATOM   4401 C CG   . TYR C 1 53  ? 56.066 3.810   48.930 1.00 49.08  ? 98  TYR C CG   1 
ATOM   4402 C CD1  . TYR C 1 53  ? 55.155 3.200   49.792 1.00 49.20  ? 98  TYR C CD1  1 
ATOM   4403 C CD2  . TYR C 1 53  ? 55.665 4.965   48.266 1.00 49.27  ? 98  TYR C CD2  1 
ATOM   4404 C CE1  . TYR C 1 53  ? 53.876 3.721   49.971 1.00 49.21  ? 98  TYR C CE1  1 
ATOM   4405 C CE2  . TYR C 1 53  ? 54.398 5.494   48.445 1.00 49.56  ? 98  TYR C CE2  1 
ATOM   4406 C CZ   . TYR C 1 53  ? 53.508 4.872   49.296 1.00 50.33  ? 98  TYR C CZ   1 
ATOM   4407 O OH   . TYR C 1 53  ? 52.252 5.410   49.467 1.00 50.31  ? 98  TYR C OH   1 
ATOM   4408 H H    . TYR C 1 53  ? 59.494 2.209   47.872 1.00 58.19  ? 98  TYR C H    1 
ATOM   4409 H HA   . TYR C 1 53  ? 57.053 1.325   48.144 1.00 59.17  ? 98  TYR C HA   1 
ATOM   4410 H HB2  . TYR C 1 53  ? 57.782 2.940   49.595 1.00 57.87  ? 98  TYR C HB2  1 
ATOM   4411 H HB3  . TYR C 1 53  ? 58.026 3.959   48.403 1.00 57.87  ? 98  TYR C HB3  1 
ATOM   4412 H HD1  . TYR C 1 53  ? 55.402 2.427   50.245 1.00 59.04  ? 98  TYR C HD1  1 
ATOM   4413 H HD2  . TYR C 1 53  ? 56.259 5.389   47.691 1.00 59.12  ? 98  TYR C HD2  1 
ATOM   4414 H HE1  . TYR C 1 53  ? 53.277 3.305   50.549 1.00 59.06  ? 98  TYR C HE1  1 
ATOM   4415 H HE2  . TYR C 1 53  ? 54.147 6.266   47.991 1.00 59.48  ? 98  TYR C HE2  1 
ATOM   4416 H HH   . TYR C 1 53  ? 52.169 6.103   48.999 1.00 60.37  ? 98  TYR C HH   1 
ATOM   4417 N N    . SER C 1 54  ? 57.448 3.243   45.598 1.00 53.72  ? 99  SER C N    1 
ATOM   4418 C CA   . SER C 1 54  ? 56.784 3.696   44.381 1.00 56.74  ? 99  SER C CA   1 
ATOM   4419 C C    . SER C 1 54  ? 56.570 2.562   43.386 1.00 58.02  ? 99  SER C C    1 
ATOM   4420 O O    . SER C 1 54  ? 55.784 2.718   42.444 1.00 59.48  ? 99  SER C O    1 
ATOM   4421 C CB   . SER C 1 54  ? 57.587 4.824   43.729 1.00 58.49  ? 99  SER C CB   1 
ATOM   4422 O OG   . SER C 1 54  ? 58.815 4.338   43.216 1.00 61.16  ? 99  SER C OG   1 
ATOM   4423 H H    . SER C 1 54  ? 58.249 3.539   45.703 1.00 64.47  ? 99  SER C H    1 
ATOM   4424 H HA   . SER C 1 54  ? 55.913 4.051   44.616 1.00 68.09  ? 99  SER C HA   1 
ATOM   4425 H HB2  . SER C 1 54  ? 57.068 5.201   43.001 1.00 70.19  ? 99  SER C HB2  1 
ATOM   4426 H HB3  . SER C 1 54  ? 57.770 5.507   44.393 1.00 70.19  ? 99  SER C HB3  1 
ATOM   4427 H HG   . SER C 1 54  ? 59.275 4.008   43.837 1.00 73.39  ? 99  SER C HG   1 
ATOM   4428 N N    . HIS C 1 55  ? 57.245 1.428   43.570 1.00 54.74  ? 100 HIS C N    1 
ATOM   4429 C CA   . HIS C 1 55  ? 57.008 0.248   42.751 1.00 55.23  ? 100 HIS C CA   1 
ATOM   4430 C C    . HIS C 1 55  ? 56.271 -0.837  43.525 1.00 54.07  ? 100 HIS C C    1 
ATOM   4431 O O    . HIS C 1 55  ? 56.317 -2.012  43.145 1.00 55.68  ? 100 HIS C O    1 
ATOM   4432 C CB   . HIS C 1 55  ? 58.329 -0.276  42.193 1.00 56.96  ? 100 HIS C CB   1 
ATOM   4433 C CG   . HIS C 1 55  ? 58.971 0.652   41.209 1.00 57.52  ? 100 HIS C CG   1 
ATOM   4434 N ND1  . HIS C 1 55  ? 58.482 0.836   39.934 1.00 60.51  ? 100 HIS C ND1  1 
ATOM   4435 C CD2  . HIS C 1 55  ? 60.058 1.453   41.314 1.00 56.75  ? 100 HIS C CD2  1 
ATOM   4436 C CE1  . HIS C 1 55  ? 59.242 1.707   39.294 1.00 60.74  ? 100 HIS C CE1  1 
ATOM   4437 N NE2  . HIS C 1 55  ? 60.207 2.094   40.109 1.00 59.40  ? 100 HIS C NE2  1 
ATOM   4438 H H    . HIS C 1 55  ? 57.851 1.318   44.170 1.00 65.69  ? 100 HIS C H    1 
ATOM   4439 H HA   . HIS C 1 55  ? 56.451 0.501   41.998 1.00 66.27  ? 100 HIS C HA   1 
ATOM   4440 H HB2  . HIS C 1 55  ? 58.950 -0.408  42.927 1.00 68.35  ? 100 HIS C HB2  1 
ATOM   4441 H HB3  . HIS C 1 55  ? 58.166 -1.120  41.743 1.00 68.35  ? 100 HIS C HB3  1 
ATOM   4442 H HD1  . HIS C 1 55  ? 57.791 0.444   39.605 1.00 72.61  ? 100 HIS C HD1  1 
ATOM   4443 H HD2  . HIS C 1 55  ? 60.605 1.546   42.060 1.00 68.10  ? 100 HIS C HD2  1 
ATOM   4444 H HE1  . HIS C 1 55  ? 59.119 1.996   38.418 1.00 72.89  ? 100 HIS C HE1  1 
ATOM   4445 H HE2  . HIS C 1 55  ? 60.825 2.660   39.917 1.00 71.28  ? 100 HIS C HE2  1 
ATOM   4446 N N    . MET C 1 56  ? 55.594 -0.461  44.605 1.00 52.47  ? 101 MET C N    1 
ATOM   4447 C CA   . MET C 1 56  ? 54.682 -1.339  45.319 1.00 52.56  ? 101 MET C CA   1 
ATOM   4448 C C    . MET C 1 56  ? 53.259 -0.829  45.148 1.00 53.05  ? 101 MET C C    1 
ATOM   4449 O O    . MET C 1 56  ? 53.007 0.372   45.276 1.00 52.12  ? 101 MET C O    1 
ATOM   4450 C CB   . MET C 1 56  ? 55.029 -1.406  46.803 1.00 50.21  ? 101 MET C CB   1 
ATOM   4451 C CG   . MET C 1 56  ? 56.270 -2.207  47.112 1.00 52.35  ? 101 MET C CG   1 
ATOM   4452 S SD   . MET C 1 56  ? 56.697 -2.101  48.852 1.00 49.09  ? 101 MET C SD   1 
ATOM   4453 C CE   . MET C 1 56  ? 55.355 -3.051  49.565 1.00 50.87  ? 101 MET C CE   1 
ATOM   4454 H H    . MET C 1 56  ? 55.650 0.324   44.951 1.00 62.96  ? 101 MET C H    1 
ATOM   4455 H HA   . MET C 1 56  ? 54.747 -2.234  44.951 1.00 63.07  ? 101 MET C HA   1 
ATOM   4456 H HB2  . MET C 1 56  ? 55.170 -0.504  47.130 1.00 60.26  ? 101 MET C HB2  1 
ATOM   4457 H HB3  . MET C 1 56  ? 54.288 -1.815  47.278 1.00 60.26  ? 101 MET C HB3  1 
ATOM   4458 H HG2  . MET C 1 56  ? 56.113 -3.139  46.893 1.00 62.82  ? 101 MET C HG2  1 
ATOM   4459 H HG3  . MET C 1 56  ? 57.013 -1.861  46.594 1.00 62.82  ? 101 MET C HG3  1 
ATOM   4460 H HE1  . MET C 1 56  ? 55.464 -3.075  50.528 1.00 61.04  ? 101 MET C HE1  1 
ATOM   4461 H HE2  . MET C 1 56  ? 54.513 -2.627  49.337 1.00 61.04  ? 101 MET C HE2  1 
ATOM   4462 H HE3  . MET C 1 56  ? 55.381 -3.951  49.205 1.00 61.04  ? 101 MET C HE3  1 
ATOM   4463 N N    . VAL C 1 57  ? 52.338 -1.746  44.853 1.00 54.00  ? 102 VAL C N    1 
ATOM   4464 C CA   . VAL C 1 57  ? 50.925 -1.408  44.826 1.00 53.55  ? 102 VAL C CA   1 
ATOM   4465 C C    . VAL C 1 57  ? 50.537 -0.791  46.168 1.00 51.66  ? 102 VAL C C    1 
ATOM   4466 O O    . VAL C 1 57  ? 51.132 -1.094  47.211 1.00 50.07  ? 102 VAL C O    1 
ATOM   4467 C CB   . VAL C 1 57  ? 50.093 -2.665  44.514 1.00 55.72  ? 102 VAL C CB   1 
ATOM   4468 C CG1  . VAL C 1 57  ? 48.605 -2.402  44.661 1.00 56.36  ? 102 VAL C CG1  1 
ATOM   4469 C CG2  . VAL C 1 57  ? 50.387 -3.144  43.109 1.00 56.81  ? 102 VAL C CG2  1 
ATOM   4470 H H    . VAL C 1 57  ? 52.509 -2.568  44.665 1.00 64.79  ? 102 VAL C H    1 
ATOM   4471 H HA   . VAL C 1 57  ? 50.763 -0.752  44.129 1.00 64.26  ? 102 VAL C HA   1 
ATOM   4472 H HB   . VAL C 1 57  ? 50.338 -3.371  45.133 1.00 66.87  ? 102 VAL C HB   1 
ATOM   4473 H HG11 . VAL C 1 57  ? 48.119 -3.216  44.456 1.00 67.63  ? 102 VAL C HG11 1 
ATOM   4474 H HG12 . VAL C 1 57  ? 48.422 -2.127  45.573 1.00 67.63  ? 102 VAL C HG12 1 
ATOM   4475 H HG13 . VAL C 1 57  ? 48.347 -1.699  44.044 1.00 67.63  ? 102 VAL C HG13 1 
ATOM   4476 H HG21 . VAL C 1 57  ? 49.856 -3.936  42.928 1.00 68.17  ? 102 VAL C HG21 1 
ATOM   4477 H HG22 . VAL C 1 57  ? 50.158 -2.441  42.481 1.00 68.17  ? 102 VAL C HG22 1 
ATOM   4478 H HG23 . VAL C 1 57  ? 51.331 -3.356  43.039 1.00 68.17  ? 102 VAL C HG23 1 
ATOM   4479 N N    . ARG C 1 58  ? 49.539 0.092   46.146 1.00 54.37  ? 103 ARG C N    1 
ATOM   4480 C CA   . ARG C 1 58  ? 49.081 0.698   47.387 1.00 52.96  ? 103 ARG C CA   1 
ATOM   4481 C C    . ARG C 1 58  ? 48.362 -0.349  48.237 1.00 53.64  ? 103 ARG C C    1 
ATOM   4482 O O    . ARG C 1 58  ? 47.759 -1.279  47.701 1.00 56.36  ? 103 ARG C O    1 
ATOM   4483 C CB   . ARG C 1 58  ? 48.131 1.862   47.119 1.00 56.71  ? 103 ARG C CB   1 
ATOM   4484 C CG   . ARG C 1 58  ? 48.583 2.857   46.064 1.00 58.90  ? 103 ARG C CG   1 
ATOM   4485 C CD   . ARG C 1 58  ? 49.817 3.629   46.466 1.00 58.71  ? 103 ARG C CD   1 
ATOM   4486 N NE   . ARG C 1 58  ? 49.977 4.804   45.615 1.00 61.47  ? 103 ARG C NE   1 
ATOM   4487 C CZ   . ARG C 1 58  ? 51.091 5.519   45.519 1.00 62.19  ? 103 ARG C CZ   1 
ATOM   4488 N NH1  . ARG C 1 58  ? 52.169 5.182   46.219 1.00 60.99  ? 103 ARG C NH1  1 
ATOM   4489 N NH2  . ARG C 1 58  ? 51.126 6.571   44.714 1.00 63.51  ? 103 ARG C NH2  1 
ATOM   4490 H H    . ARG C 1 58  ? 49.121 0.350   45.440 1.00 65.24  ? 103 ARG C H    1 
ATOM   4491 H HA   . ARG C 1 58  ? 49.843 1.030   47.887 1.00 63.55  ? 103 ARG C HA   1 
ATOM   4492 H HB2  . ARG C 1 58  ? 47.279 1.500   46.830 1.00 68.05  ? 103 ARG C HB2  1 
ATOM   4493 H HB3  . ARG C 1 58  ? 48.009 2.353   47.947 1.00 68.05  ? 103 ARG C HB3  1 
ATOM   4494 H HG2  . ARG C 1 58  ? 48.784 2.378   45.245 1.00 70.69  ? 103 ARG C HG2  1 
ATOM   4495 H HG3  . ARG C 1 58  ? 47.869 3.495   45.907 1.00 70.69  ? 103 ARG C HG3  1 
ATOM   4496 H HD2  . ARG C 1 58  ? 49.729 3.925   47.385 1.00 70.46  ? 103 ARG C HD2  1 
ATOM   4497 H HD3  . ARG C 1 58  ? 50.600 3.066   46.363 1.00 70.46  ? 103 ARG C HD3  1 
ATOM   4498 H HE   . ARG C 1 58  ? 49.302 5.050   45.143 1.00 73.76  ? 103 ARG C HE   1 
ATOM   4499 H HH11 . ARG C 1 58  ? 52.147 4.500   46.741 1.00 73.19  ? 103 ARG C HH11 1 
ATOM   4500 H HH12 . ARG C 1 58  ? 52.888 5.649   46.151 1.00 73.19  ? 103 ARG C HH12 1 
ATOM   4501 H HH21 . ARG C 1 58  ? 50.428 6.788   44.260 1.00 76.21  ? 103 ARG C HH21 1 
ATOM   4502 H HH22 . ARG C 1 58  ? 51.845 7.036   44.646 1.00 76.21  ? 103 ARG C HH22 1 
ATOM   4503 N N    . PRO C 1 59  ? 48.407 -0.224  49.566 1.00 51.67  ? 104 PRO C N    1 
ATOM   4504 C CA   . PRO C 1 59  ? 47.637 -1.165  50.398 1.00 53.23  ? 104 PRO C CA   1 
ATOM   4505 C C    . PRO C 1 59  ? 46.156 -1.188  50.055 1.00 54.25  ? 104 PRO C C    1 
ATOM   4506 O O    . PRO C 1 59  ? 45.529 -2.256  50.083 1.00 57.80  ? 104 PRO C O    1 
ATOM   4507 C CB   . PRO C 1 59  ? 47.880 -0.655  51.827 1.00 51.16  ? 104 PRO C CB   1 
ATOM   4508 C CG   . PRO C 1 59  ? 49.097 0.191   51.746 1.00 49.41  ? 104 PRO C CG   1 
ATOM   4509 C CD   . PRO C 1 59  ? 49.095 0.794   50.378 1.00 50.81  ? 104 PRO C CD   1 
ATOM   4510 H HA   . PRO C 1 59  ? 47.998 -2.061  50.314 1.00 63.88  ? 104 PRO C HA   1 
ATOM   4511 H HB2  . PRO C 1 59  ? 47.118 -0.131  52.120 1.00 61.39  ? 104 PRO C HB2  1 
ATOM   4512 H HB3  . PRO C 1 59  ? 48.026 -1.408  52.421 1.00 61.39  ? 104 PRO C HB3  1 
ATOM   4513 H HG2  . PRO C 1 59  ? 49.055 0.884   52.423 1.00 59.29  ? 104 PRO C HG2  1 
ATOM   4514 H HG3  . PRO C 1 59  ? 49.884 -0.362  51.872 1.00 59.29  ? 104 PRO C HG3  1 
ATOM   4515 H HD2  . PRO C 1 59  ? 48.594 1.625   50.375 1.00 60.97  ? 104 PRO C HD2  1 
ATOM   4516 H HD3  . PRO C 1 59  ? 50.003 0.923   50.063 1.00 60.97  ? 104 PRO C HD3  1 
ATOM   4517 N N    . GLY C 1 60  ? 45.573 -0.035  49.725 1.00 50.49  ? 105 GLY C N    1 
ATOM   4518 C CA   . GLY C 1 60  ? 44.158 0.007   49.391 1.00 52.72  ? 105 GLY C CA   1 
ATOM   4519 C C    . GLY C 1 60  ? 43.802 -0.790  48.156 1.00 54.14  ? 105 GLY C C    1 
ATOM   4520 O O    . GLY C 1 60  ? 42.643 -1.177  47.991 1.00 55.46  ? 105 GLY C O    1 
ATOM   4521 H H    . GLY C 1 60  ? 45.972 0.726   49.688 1.00 60.59  ? 105 GLY C H    1 
ATOM   4522 H HA2  . GLY C 1 60  ? 43.645 -0.343  50.136 1.00 63.26  ? 105 GLY C HA2  1 
ATOM   4523 H HA3  . GLY C 1 60  ? 43.892 0.928   49.245 1.00 63.26  ? 105 GLY C HA3  1 
ATOM   4524 N N    . ASP C 1 61  ? 44.772 -1.048  47.284 1.00 59.39  ? 106 ASP C N    1 
ATOM   4525 C CA   . ASP C 1 61  ? 44.543 -1.794  46.056 1.00 64.93  ? 106 ASP C CA   1 
ATOM   4526 C C    . ASP C 1 61  ? 44.879 -3.272  46.199 1.00 65.70  ? 106 ASP C C    1 
ATOM   4527 O O    . ASP C 1 61  ? 44.878 -3.998  45.201 1.00 67.26  ? 106 ASP C O    1 
ATOM   4528 C CB   . ASP C 1 61  ? 45.351 -1.170  44.917 1.00 67.60  ? 106 ASP C CB   1 
ATOM   4529 C CG   . ASP C 1 61  ? 44.918 0.257   44.619 1.00 71.76  ? 106 ASP C CG   1 
ATOM   4530 O OD1  . ASP C 1 61  ? 43.694 0.517   44.639 1.00 74.20  ? 106 ASP C OD1  1 
ATOM   4531 O OD2  . ASP C 1 61  ? 45.792 1.117   44.382 1.00 70.30  ? 106 ASP C OD2  1 
ATOM   4532 H H    . ASP C 1 61  ? 45.587 -0.795  47.385 1.00 71.27  ? 106 ASP C H    1 
ATOM   4533 H HA   . ASP C 1 61  ? 43.604 -1.727  45.822 1.00 77.92  ? 106 ASP C HA   1 
ATOM   4534 H HB2  . ASP C 1 61  ? 46.289 -1.155  45.164 1.00 81.12  ? 106 ASP C HB2  1 
ATOM   4535 H HB3  . ASP C 1 61  ? 45.226 -1.697  44.112 1.00 81.12  ? 106 ASP C HB3  1 
ATOM   4536 N N    . LEU C 1 62  ? 45.158 -3.734  47.414 1.00 60.51  ? 107 LEU C N    1 
ATOM   4537 C CA   . LEU C 1 62  ? 45.365 -5.150  47.661 1.00 58.94  ? 107 LEU C CA   1 
ATOM   4538 C C    . LEU C 1 62  ? 44.030 -5.856  47.847 1.00 67.12  ? 107 LEU C C    1 
ATOM   4539 O O    . LEU C 1 62  ? 42.992 -5.233  48.084 1.00 66.71  ? 107 LEU C O    1 
ATOM   4540 C CB   . LEU C 1 62  ? 46.216 -5.370  48.906 1.00 54.25  ? 107 LEU C CB   1 
ATOM   4541 C CG   . LEU C 1 62  ? 47.611 -4.777  48.912 1.00 48.58  ? 107 LEU C CG   1 
ATOM   4542 C CD1  . LEU C 1 62  ? 48.224 -4.952  50.288 1.00 46.23  ? 107 LEU C CD1  1 
ATOM   4543 C CD2  . LEU C 1 62  ? 48.463 -5.446  47.838 1.00 48.81  ? 107 LEU C CD2  1 
ATOM   4544 H H    . LEU C 1 62  ? 45.233 -3.241  48.115 1.00 72.61  ? 107 LEU C H    1 
ATOM   4545 H HA   . LEU C 1 62  ? 45.820 -5.548  46.902 1.00 70.73  ? 107 LEU C HA   1 
ATOM   4546 H HB2  . LEU C 1 62  ? 45.742 -4.992  49.663 1.00 65.10  ? 107 LEU C HB2  1 
ATOM   4547 H HB3  . LEU C 1 62  ? 46.313 -6.326  49.038 1.00 65.10  ? 107 LEU C HB3  1 
ATOM   4548 H HG   . LEU C 1 62  ? 47.560 -3.828  48.717 1.00 58.29  ? 107 LEU C HG   1 
ATOM   4549 H HD11 . LEU C 1 62  ? 49.116 -4.571  50.287 1.00 55.47  ? 107 LEU C HD11 1 
ATOM   4550 H HD12 . LEU C 1 62  ? 47.670 -4.496  50.941 1.00 55.47  ? 107 LEU C HD12 1 
ATOM   4551 H HD13 . LEU C 1 62  ? 48.268 -5.899  50.495 1.00 55.47  ? 107 LEU C HD13 1 
ATOM   4552 H HD21 . LEU C 1 62  ? 49.351 -5.057  47.853 1.00 58.58  ? 107 LEU C HD21 1 
ATOM   4553 H HD22 . LEU C 1 62  ? 48.514 -6.397  48.023 1.00 58.58  ? 107 LEU C HD22 1 
ATOM   4554 H HD23 . LEU C 1 62  ? 48.051 -5.299  46.972 1.00 58.58  ? 107 LEU C HD23 1 
ATOM   4555 N N    . THR C 1 63  ? 44.074 -7.185  47.766 1.00 80.28  ? 108 THR C N    1 
ATOM   4556 C CA   . THR C 1 63  ? 42.898 -8.017  47.954 1.00 85.73  ? 108 THR C CA   1 
ATOM   4557 C C    . THR C 1 63  ? 43.214 -9.116  48.956 1.00 87.54  ? 108 THR C C    1 
ATOM   4558 O O    . THR C 1 63  ? 44.372 -9.506  49.133 1.00 88.08  ? 108 THR C O    1 
ATOM   4559 C CB   . THR C 1 63  ? 42.429 -8.638  46.633 1.00 87.94  ? 108 THR C CB   1 
ATOM   4560 O OG1  . THR C 1 63  ? 42.474 -7.650  45.598 1.00 89.62  ? 108 THR C OG1  1 
ATOM   4561 C CG2  . THR C 1 63  ? 41.008 -9.156  46.759 1.00 92.94  ? 108 THR C CG2  1 
ATOM   4562 H H    . THR C 1 63  ? 44.790 -7.632  47.600 1.00 96.33  ? 108 THR C H    1 
ATOM   4563 H HA   . THR C 1 63  ? 42.176 -7.477  48.311 1.00 102.88 ? 108 THR C HA   1 
ATOM   4564 H HB   . THR C 1 63  ? 43.009 -9.380  46.399 1.00 105.52 ? 108 THR C HB   1 
ATOM   4565 H HG1  . THR C 1 63  ? 42.218 -7.983  44.871 1.00 107.54 ? 108 THR C HG1  1 
ATOM   4566 H HG21 . THR C 1 63  ? 40.722 -9.547  45.919 1.00 111.52 ? 108 THR C HG21 1 
ATOM   4567 H HG22 . THR C 1 63  ? 40.963 -9.833  47.453 1.00 111.52 ? 108 THR C HG22 1 
ATOM   4568 H HG23 . THR C 1 63  ? 40.409 -8.429  46.989 1.00 111.52 ? 108 THR C HG23 1 
ATOM   4569 N N    . GLY C 1 64  ? 42.171 -9.599  49.619 1.00 92.62  ? 109 GLY C N    1 
ATOM   4570 C CA   . GLY C 1 64  ? 42.318 -10.683 50.563 1.00 93.73  ? 109 GLY C CA   1 
ATOM   4571 C C    . GLY C 1 64  ? 42.887 -10.221 51.892 1.00 91.63  ? 109 GLY C C    1 
ATOM   4572 O O    . GLY C 1 64  ? 42.815 -9.050  52.277 1.00 88.84  ? 109 GLY C O    1 
ATOM   4573 H H    . GLY C 1 64  ? 41.365 -9.312  49.536 1.00 111.14 ? 109 GLY C H    1 
ATOM   4574 H HA2  . GLY C 1 64  ? 41.453 -11.090 50.724 1.00 112.47 ? 109 GLY C HA2  1 
ATOM   4575 H HA3  . GLY C 1 64  ? 42.911 -11.355 50.192 1.00 112.47 ? 109 GLY C HA3  1 
ATOM   4576 N N    . HIS C 1 65  ? 43.467 -11.186 52.604 1.00 88.46  ? 110 HIS C N    1 
ATOM   4577 C CA   . HIS C 1 65  ? 44.055 -10.959 53.923 1.00 85.57  ? 110 HIS C CA   1 
ATOM   4578 C C    . HIS C 1 65  ? 45.549 -10.707 53.724 1.00 79.46  ? 110 HIS C C    1 
ATOM   4579 O O    . HIS C 1 65  ? 46.393 -11.590 53.886 1.00 78.67  ? 110 HIS C O    1 
ATOM   4580 C CB   . HIS C 1 65  ? 43.773 -12.157 54.822 1.00 89.72  ? 110 HIS C CB   1 
ATOM   4581 C CG   . HIS C 1 65  ? 44.151 -11.960 56.256 1.00 90.36  ? 110 HIS C CG   1 
ATOM   4582 N ND1  . HIS C 1 65  ? 45.405 -12.261 56.743 1.00 90.42  ? 110 HIS C ND1  1 
ATOM   4583 C CD2  . HIS C 1 65  ? 43.428 -11.531 57.318 1.00 91.70  ? 110 HIS C CD2  1 
ATOM   4584 C CE1  . HIS C 1 65  ? 45.444 -12.008 58.039 1.00 89.96  ? 110 HIS C CE1  1 
ATOM   4585 N NE2  . HIS C 1 65  ? 44.258 -11.564 58.412 1.00 91.41  ? 110 HIS C NE2  1 
ATOM   4586 H H    . HIS C 1 65  ? 43.533 -12.001 52.337 1.00 106.15 ? 110 HIS C H    1 
ATOM   4587 H HA   . HIS C 1 65  ? 43.659 -10.170 54.325 1.00 102.69 ? 110 HIS C HA   1 
ATOM   4588 H HB2  . HIS C 1 65  ? 42.822 -12.349 54.792 1.00 107.67 ? 110 HIS C HB2  1 
ATOM   4589 H HB3  . HIS C 1 65  ? 44.271 -12.919 54.488 1.00 107.67 ? 110 HIS C HB3  1 
ATOM   4590 H HD2  . HIS C 1 65  ? 42.540 -11.257 57.306 1.00 110.04 ? 110 HIS C HD2  1 
ATOM   4591 H HE1  . HIS C 1 65  ? 46.182 -12.122 58.594 1.00 107.95 ? 110 HIS C HE1  1 
ATOM   4592 H HE2  . HIS C 1 65  ? 44.040 -11.332 59.211 1.00 109.69 ? 110 HIS C HE2  1 
ATOM   4593 N N    . SER C 1 66  ? 45.870 -9.467  53.356 1.00 70.54  ? 111 SER C N    1 
ATOM   4594 C CA   . SER C 1 66  ? 47.211 -9.085  52.930 1.00 66.28  ? 111 SER C CA   1 
ATOM   4595 C C    . SER C 1 66  ? 47.777 -7.983  53.821 1.00 64.29  ? 111 SER C C    1 
ATOM   4596 O O    . SER C 1 66  ? 47.053 -7.088  54.272 1.00 63.69  ? 111 SER C O    1 
ATOM   4597 C CB   . SER C 1 66  ? 47.209 -8.602  51.471 1.00 64.63  ? 111 SER C CB   1 
ATOM   4598 O OG   . SER C 1 66  ? 46.673 -9.588  50.606 1.00 66.47  ? 111 SER C OG   1 
ATOM   4599 H H    . SER C 1 66  ? 45.311 -8.814  53.344 1.00 84.64  ? 111 SER C H    1 
ATOM   4600 H HA   . SER C 1 66  ? 47.797 -9.856  52.993 1.00 79.53  ? 111 SER C HA   1 
ATOM   4601 H HB2  . SER C 1 66  ? 46.668 -7.799  51.407 1.00 77.55  ? 111 SER C HB2  1 
ATOM   4602 H HB3  . SER C 1 66  ? 48.120 -8.409  51.202 1.00 77.55  ? 111 SER C HB3  1 
ATOM   4603 H HG   . SER C 1 66  ? 45.882 -9.765  50.827 1.00 79.76  ? 111 SER C HG   1 
ATOM   4604 N N    . ASP C 1 67  ? 49.091 -8.039  54.045 1.00 67.18  ? 112 ASP C N    1 
ATOM   4605 C CA   . ASP C 1 67  ? 49.771 -7.114  54.939 1.00 66.79  ? 112 ASP C CA   1 
ATOM   4606 C C    . ASP C 1 67  ? 51.100 -6.681  54.333 1.00 62.77  ? 112 ASP C C    1 
ATOM   4607 O O    . ASP C 1 67  ? 51.848 -7.505  53.802 1.00 64.11  ? 112 ASP C O    1 
ATOM   4608 C CB   . ASP C 1 67  ? 50.036 -7.747  56.319 1.00 71.81  ? 112 ASP C CB   1 
ATOM   4609 C CG   . ASP C 1 67  ? 48.781 -8.304  56.966 1.00 78.57  ? 112 ASP C CG   1 
ATOM   4610 O OD1  . ASP C 1 67  ? 47.678 -7.809  56.673 1.00 80.65  ? 112 ASP C OD1  1 
ATOM   4611 O OD2  . ASP C 1 67  ? 48.899 -9.242  57.781 1.00 81.69  ? 112 ASP C OD2  1 
ATOM   4612 H H    . ASP C 1 67  ? 49.616 -8.616  53.682 1.00 80.61  ? 112 ASP C H    1 
ATOM   4613 H HA   . ASP C 1 67  ? 49.221 -6.325  55.065 1.00 80.14  ? 112 ASP C HA   1 
ATOM   4614 H HB2  . ASP C 1 67  ? 50.668 -8.475  56.215 1.00 86.17  ? 112 ASP C HB2  1 
ATOM   4615 H HB3  . ASP C 1 67  ? 50.403 -7.071  56.910 1.00 86.17  ? 112 ASP C HB3  1 
ATOM   4616 N N    . PHE C 1 68  ? 51.386 -5.387  54.410 1.00 56.52  ? 113 PHE C N    1 
ATOM   4617 C CA   . PHE C 1 68  ? 52.732 -4.873  54.213 1.00 51.58  ? 113 PHE C CA   1 
ATOM   4618 C C    . PHE C 1 68  ? 53.340 -4.596  55.579 1.00 48.19  ? 113 PHE C C    1 
ATOM   4619 O O    . PHE C 1 68  ? 52.690 -3.996  56.440 1.00 48.83  ? 113 PHE C O    1 
ATOM   4620 C CB   . PHE C 1 68  ? 52.739 -3.581  53.390 1.00 52.38  ? 113 PHE C CB   1 
ATOM   4621 C CG   . PHE C 1 68  ? 52.417 -3.761  51.931 1.00 52.74  ? 113 PHE C CG   1 
ATOM   4622 C CD1  . PHE C 1 68  ? 52.634 -4.962  51.289 1.00 54.82  ? 113 PHE C CD1  1 
ATOM   4623 C CD2  . PHE C 1 68  ? 51.906 -2.699  51.197 1.00 53.36  ? 113 PHE C CD2  1 
ATOM   4624 C CE1  . PHE C 1 68  ? 52.338 -5.107  49.948 1.00 56.81  ? 113 PHE C CE1  1 
ATOM   4625 C CE2  . PHE C 1 68  ? 51.609 -2.840  49.857 1.00 55.46  ? 113 PHE C CE2  1 
ATOM   4626 C CZ   . PHE C 1 68  ? 51.827 -4.045  49.232 1.00 56.04  ? 113 PHE C CZ   1 
ATOM   4627 H H    . PHE C 1 68  ? 50.804 -4.776  54.578 1.00 67.82  ? 113 PHE C H    1 
ATOM   4628 H HA   . PHE C 1 68  ? 53.274 -5.536  53.758 1.00 61.89  ? 113 PHE C HA   1 
ATOM   4629 H HB2  . PHE C 1 68  ? 52.081 -2.974  53.762 1.00 62.85  ? 113 PHE C HB2  1 
ATOM   4630 H HB3  . PHE C 1 68  ? 53.621 -3.182  53.448 1.00 62.85  ? 113 PHE C HB3  1 
ATOM   4631 H HD1  . PHE C 1 68  ? 52.978 -5.682  51.765 1.00 65.78  ? 113 PHE C HD1  1 
ATOM   4632 H HD2  . PHE C 1 68  ? 51.757 -1.882  51.616 1.00 64.03  ? 113 PHE C HD2  1 
ATOM   4633 H HE1  . PHE C 1 68  ? 52.485 -5.923  49.527 1.00 68.17  ? 113 PHE C HE1  1 
ATOM   4634 H HE2  . PHE C 1 68  ? 51.264 -2.121  49.378 1.00 66.56  ? 113 PHE C HE2  1 
ATOM   4635 H HZ   . PHE C 1 68  ? 51.628 -4.144  48.329 1.00 67.25  ? 113 PHE C HZ   1 
ATOM   4636 N N    . HIS C 1 69  ? 54.577 -5.028  55.776 1.00 47.33  ? 114 HIS C N    1 
ATOM   4637 C CA   . HIS C 1 69  ? 55.320 -4.739  56.991 1.00 45.52  ? 114 HIS C CA   1 
ATOM   4638 C C    . HIS C 1 69  ? 56.595 -4.008  56.612 1.00 43.25  ? 114 HIS C C    1 
ATOM   4639 O O    . HIS C 1 69  ? 57.240 -4.343  55.617 1.00 45.13  ? 114 HIS C O    1 
ATOM   4640 C CB   . HIS C 1 69  ? 55.682 -6.007  57.770 1.00 48.40  ? 114 HIS C CB   1 
ATOM   4641 C CG   . HIS C 1 69  ? 54.612 -7.053  57.782 1.00 51.37  ? 114 HIS C CG   1 
ATOM   4642 N ND1  . HIS C 1 69  ? 53.948 -7.422  58.933 1.00 52.26  ? 114 HIS C ND1  1 
ATOM   4643 C CD2  . HIS C 1 69  ? 54.108 -7.828  56.792 1.00 53.12  ? 114 HIS C CD2  1 
ATOM   4644 C CE1  . HIS C 1 69  ? 53.077 -8.374  58.649 1.00 55.11  ? 114 HIS C CE1  1 
ATOM   4645 N NE2  . HIS C 1 69  ? 53.157 -8.642  57.358 1.00 54.70  ? 114 HIS C NE2  1 
ATOM   4646 H H    . HIS C 1 69  ? 55.016 -5.500  55.207 1.00 56.79  ? 114 HIS C H    1 
ATOM   4647 H HA   . HIS C 1 69  ? 54.793 -4.163  57.565 1.00 54.63  ? 114 HIS C HA   1 
ATOM   4648 H HB2  . HIS C 1 69  ? 56.474 -6.401  57.372 1.00 58.08  ? 114 HIS C HB2  1 
ATOM   4649 H HB3  . HIS C 1 69  ? 55.866 -5.764  58.691 1.00 58.08  ? 114 HIS C HB3  1 
ATOM   4650 H HD1  . HIS C 1 69  ? 54.080 -7.085  59.713 1.00 62.71  ? 114 HIS C HD1  1 
ATOM   4651 H HD2  . HIS C 1 69  ? 54.362 -7.815  55.898 1.00 63.74  ? 114 HIS C HD2  1 
ATOM   4652 H HE1  . HIS C 1 69  ? 52.504 -8.785  59.255 1.00 66.13  ? 114 HIS C HE1  1 
ATOM   4653 N N    . LEU C 1 70  ? 56.948 -3.006  57.408 1.00 44.64  ? 115 LEU C N    1 
ATOM   4654 C CA   . LEU C 1 70  ? 58.157 -2.212  57.191 1.00 43.27  ? 115 LEU C CA   1 
ATOM   4655 C C    . LEU C 1 70  ? 58.811 -2.031  58.557 1.00 43.38  ? 115 LEU C C    1 
ATOM   4656 O O    . LEU C 1 70  ? 58.333 -1.245  59.381 1.00 43.84  ? 115 LEU C O    1 
ATOM   4657 C CB   . LEU C 1 70  ? 57.834 -0.872  56.544 1.00 41.65  ? 115 LEU C CB   1 
ATOM   4658 C CG   . LEU C 1 70  ? 59.016 0.071   56.289 1.00 40.49  ? 115 LEU C CG   1 
ATOM   4659 C CD1  . LEU C 1 70  ? 60.019 -0.559  55.330 1.00 41.55  ? 115 LEU C CD1  1 
ATOM   4660 C CD2  . LEU C 1 70  ? 58.518 1.412   55.759 1.00 40.28  ? 115 LEU C CD2  1 
ATOM   4661 H H    . LEU C 1 70  ? 56.494 -2.759  58.096 1.00 53.56  ? 115 LEU C H    1 
ATOM   4662 H HA   . LEU C 1 70  ? 58.768 -2.697  56.614 1.00 51.92  ? 115 LEU C HA   1 
ATOM   4663 H HB2  . LEU C 1 70  ? 57.414 -1.043  55.686 1.00 49.97  ? 115 LEU C HB2  1 
ATOM   4664 H HB3  . LEU C 1 70  ? 57.209 -0.401  57.118 1.00 49.97  ? 115 LEU C HB3  1 
ATOM   4665 H HG   . LEU C 1 70  ? 59.471 0.235   57.130 1.00 48.59  ? 115 LEU C HG   1 
ATOM   4666 H HD11 . LEU C 1 70  ? 60.753 0.060   55.191 1.00 49.86  ? 115 LEU C HD11 1 
ATOM   4667 H HD12 . LEU C 1 70  ? 60.351 -1.384  55.718 1.00 49.86  ? 115 LEU C HD12 1 
ATOM   4668 H HD13 . LEU C 1 70  ? 59.577 -0.744  54.487 1.00 49.86  ? 115 LEU C HD13 1 
ATOM   4669 H HD21 . LEU C 1 70  ? 59.280 1.992   55.605 1.00 48.34  ? 115 LEU C HD21 1 
ATOM   4670 H HD22 . LEU C 1 70  ? 58.041 1.265   54.927 1.00 48.34  ? 115 LEU C HD22 1 
ATOM   4671 H HD23 . LEU C 1 70  ? 57.926 1.810   56.415 1.00 48.34  ? 115 LEU C HD23 1 
ATOM   4672 N N    . PHE C 1 71  ? 59.897 -2.764  58.788 1.00 43.54  ? 116 PHE C N    1 
ATOM   4673 C CA   . PHE C 1 71  ? 60.567 -2.809  60.079 1.00 44.32  ? 116 PHE C CA   1 
ATOM   4674 C C    . PHE C 1 71  ? 62.049 -2.515  59.904 1.00 43.31  ? 116 PHE C C    1 
ATOM   4675 O O    . PHE C 1 71  ? 62.614 -2.654  58.817 1.00 42.22  ? 116 PHE C O    1 
ATOM   4676 C CB   . PHE C 1 71  ? 60.398 -4.183  60.755 1.00 45.63  ? 116 PHE C CB   1 
ATOM   4677 C CG   . PHE C 1 71  ? 59.058 -4.378  61.394 1.00 46.55  ? 116 PHE C CG   1 
ATOM   4678 C CD1  . PHE C 1 71  ? 57.917 -4.442  60.622 1.00 46.45  ? 116 PHE C CD1  1 
ATOM   4679 C CD2  . PHE C 1 71  ? 58.939 -4.487  62.769 1.00 47.50  ? 116 PHE C CD2  1 
ATOM   4680 C CE1  . PHE C 1 71  ? 56.676 -4.607  61.210 1.00 47.30  ? 116 PHE C CE1  1 
ATOM   4681 C CE2  . PHE C 1 71  ? 57.701 -4.657  63.363 1.00 47.45  ? 116 PHE C CE2  1 
ATOM   4682 C CZ   . PHE C 1 71  ? 56.572 -4.719  62.583 1.00 47.47  ? 116 PHE C CZ   1 
ATOM   4683 H H    . PHE C 1 71  ? 60.272 -3.258  58.193 1.00 52.25  ? 116 PHE C H    1 
ATOM   4684 H HA   . PHE C 1 71  ? 60.188 -2.133  60.662 1.00 53.18  ? 116 PHE C HA   1 
ATOM   4685 H HB2  . PHE C 1 71  ? 60.512 -4.877  60.086 1.00 54.76  ? 116 PHE C HB2  1 
ATOM   4686 H HB3  . PHE C 1 71  ? 61.073 -4.278  61.445 1.00 54.76  ? 116 PHE C HB3  1 
ATOM   4687 H HD1  . PHE C 1 71  ? 57.981 -4.365  59.697 1.00 55.74  ? 116 PHE C HD1  1 
ATOM   4688 H HD2  . PHE C 1 71  ? 59.701 -4.444  63.300 1.00 57.00  ? 116 PHE C HD2  1 
ATOM   4689 H HE1  . PHE C 1 71  ? 55.913 -4.652  60.681 1.00 56.76  ? 116 PHE C HE1  1 
ATOM   4690 H HE2  . PHE C 1 71  ? 57.633 -4.731  64.288 1.00 56.95  ? 116 PHE C HE2  1 
ATOM   4691 H HZ   . PHE C 1 71  ? 55.738 -4.835  62.979 1.00 56.96  ? 116 PHE C HZ   1 
ATOM   4692 N N    . LYS C 1 72  ? 62.678 -2.110  60.999 1.00 43.47  ? 117 LYS C N    1 
ATOM   4693 C CA   . LYS C 1 72  ? 64.115 -1.910  60.972 1.00 44.25  ? 117 LYS C CA   1 
ATOM   4694 C C    . LYS C 1 72  ? 64.813 -3.215  60.609 1.00 44.59  ? 117 LYS C C    1 
ATOM   4695 O O    . LYS C 1 72  ? 64.356 -4.305  60.966 1.00 44.10  ? 117 LYS C O    1 
ATOM   4696 C CB   . LYS C 1 72  ? 64.602 -1.398  62.327 1.00 45.89  ? 117 LYS C CB   1 
ATOM   4697 C CG   . LYS C 1 72  ? 64.148 0.019   62.645 1.00 44.42  ? 117 LYS C CG   1 
ATOM   4698 C CD   . LYS C 1 72  ? 64.636 0.435   64.010 1.00 47.13  ? 117 LYS C CD   1 
ATOM   4699 C CE   . LYS C 1 72  ? 64.248 1.859   64.324 1.00 46.39  ? 117 LYS C CE   1 
ATOM   4700 N NZ   . LYS C 1 72  ? 64.505 2.170   65.756 1.00 48.58  ? 117 LYS C NZ   1 
ATOM   4701 H H    . LYS C 1 72  ? 62.303 -1.947  61.756 1.00 52.17  ? 117 LYS C H    1 
ATOM   4702 H HA   . LYS C 1 72  ? 64.335 -1.248  60.298 1.00 53.10  ? 117 LYS C HA   1 
ATOM   4703 H HB2  . LYS C 1 72  ? 64.262 -1.981  63.023 1.00 55.07  ? 117 LYS C HB2  1 
ATOM   4704 H HB3  . LYS C 1 72  ? 65.572 -1.407  62.334 1.00 55.07  ? 117 LYS C HB3  1 
ATOM   4705 H HG2  . LYS C 1 72  ? 64.514 0.632   61.987 1.00 53.30  ? 117 LYS C HG2  1 
ATOM   4706 H HG3  . LYS C 1 72  ? 63.179 0.057   62.640 1.00 53.30  ? 117 LYS C HG3  1 
ATOM   4707 H HD2  . LYS C 1 72  ? 64.242 -0.143  64.681 1.00 56.55  ? 117 LYS C HD2  1 
ATOM   4708 H HD3  . LYS C 1 72  ? 65.604 0.371   64.037 1.00 56.55  ? 117 LYS C HD3  1 
ATOM   4709 H HE2  . LYS C 1 72  ? 64.776 2.465   63.780 1.00 55.67  ? 117 LYS C HE2  1 
ATOM   4710 H HE3  . LYS C 1 72  ? 63.302 1.982   64.148 1.00 55.67  ? 117 LYS C HE3  1 
ATOM   4711 H HZ1  . LYS C 1 72  ? 64.273 3.011   65.931 1.00 58.30  ? 117 LYS C HZ1  1 
ATOM   4712 H HZ2  . LYS C 1 72  ? 64.030 1.625   66.275 1.00 58.30  ? 117 LYS C HZ2  1 
ATOM   4713 H HZ3  . LYS C 1 72  ? 65.369 2.064   65.940 1.00 58.30  ? 117 LYS C HZ3  1 
ATOM   4714 N N    . GLU C 1 73  ? 65.914 -3.098  59.870 1.00 46.62  ? 118 GLU C N    1 
ATOM   4715 C CA   . GLU C 1 73  ? 66.710 -4.266  59.531 1.00 50.19  ? 118 GLU C CA   1 
ATOM   4716 C C    . GLU C 1 73  ? 67.027 -5.049  60.796 1.00 52.24  ? 118 GLU C C    1 
ATOM   4717 O O    . GLU C 1 73  ? 67.326 -4.470  61.843 1.00 51.84  ? 118 GLU C O    1 
ATOM   4718 C CB   . GLU C 1 73  ? 68.001 -3.843  58.829 1.00 51.18  ? 118 GLU C CB   1 
ATOM   4719 C CG   . GLU C 1 73  ? 68.803 -5.007  58.275 1.00 54.65  ? 118 GLU C CG   1 
ATOM   4720 C CD   . GLU C 1 73  ? 70.092 -4.574  57.600 1.00 55.17  ? 118 GLU C CD   1 
ATOM   4721 O OE1  . GLU C 1 73  ? 70.509 -3.409  57.785 1.00 54.26  ? 118 GLU C OE1  1 
ATOM   4722 O OE2  . GLU C 1 73  ? 70.688 -5.403  56.882 1.00 57.27  ? 118 GLU C OE2  1 
ATOM   4723 H H    . GLU C 1 73  ? 66.217 -2.357  59.555 1.00 55.94  ? 118 GLU C H    1 
ATOM   4724 H HA   . GLU C 1 73  ? 66.207 -4.839  58.932 1.00 60.23  ? 118 GLU C HA   1 
ATOM   4725 H HB2  . GLU C 1 73  ? 67.778 -3.257  58.089 1.00 61.41  ? 118 GLU C HB2  1 
ATOM   4726 H HB3  . GLU C 1 73  ? 68.563 -3.371  59.464 1.00 61.41  ? 118 GLU C HB3  1 
ATOM   4727 H HG2  . GLU C 1 73  ? 69.034 -5.606  59.002 1.00 65.58  ? 118 GLU C HG2  1 
ATOM   4728 H HG3  . GLU C 1 73  ? 68.265 -5.476  57.618 1.00 65.58  ? 118 GLU C HG3  1 
ATOM   4729 N N    . GLY C 1 74  ? 66.924 -6.375  60.702 1.00 50.56  ? 119 GLY C N    1 
ATOM   4730 C CA   . GLY C 1 74  ? 67.227 -7.246  61.815 1.00 52.82  ? 119 GLY C CA   1 
ATOM   4731 C C    . GLY C 1 74  ? 66.068 -7.526  62.745 1.00 51.92  ? 119 GLY C C    1 
ATOM   4732 O O    . GLY C 1 74  ? 66.161 -8.455  63.557 1.00 53.80  ? 119 GLY C O    1 
ATOM   4733 H H    . GLY C 1 74  ? 66.677 -6.791  59.991 1.00 60.68  ? 119 GLY C H    1 
ATOM   4734 H HA2  . GLY C 1 74  ? 67.544 -8.095  61.471 1.00 63.38  ? 119 GLY C HA2  1 
ATOM   4735 H HA3  . GLY C 1 74  ? 67.940 -6.849  62.339 1.00 63.38  ? 119 GLY C HA3  1 
ATOM   4736 N N    . ILE C 1 75  ? 64.983 -6.765  62.657 1.00 51.52  ? 120 ILE C N    1 
ATOM   4737 C CA   . ILE C 1 75  ? 63.815 -6.967  63.501 1.00 52.63  ? 120 ILE C CA   1 
ATOM   4738 C C    . ILE C 1 75  ? 62.821 -7.822  62.731 1.00 54.57  ? 120 ILE C C    1 
ATOM   4739 O O    . ILE C 1 75  ? 62.425 -7.475  61.610 1.00 54.37  ? 120 ILE C O    1 
ATOM   4740 C CB   . ILE C 1 75  ? 63.189 -5.632  63.934 1.00 51.36  ? 120 ILE C CB   1 
ATOM   4741 C CG1  . ILE C 1 75  ? 64.156 -4.887  64.860 1.00 50.81  ? 120 ILE C CG1  1 
ATOM   4742 C CG2  . ILE C 1 75  ? 61.848 -5.877  64.626 1.00 51.04  ? 120 ILE C CG2  1 
ATOM   4743 C CD1  . ILE C 1 75  ? 63.603 -3.627  65.472 1.00 49.48  ? 120 ILE C CD1  1 
ATOM   4744 H H    . ILE C 1 75  ? 64.900 -6.111  62.104 1.00 61.83  ? 120 ILE C H    1 
ATOM   4745 H HA   . ILE C 1 75  ? 64.077 -7.452  64.299 1.00 63.15  ? 120 ILE C HA   1 
ATOM   4746 H HB   . ILE C 1 75  ? 63.036 -5.090  63.145 1.00 61.63  ? 120 ILE C HB   1 
ATOM   4747 H HG12 . ILE C 1 75  ? 64.408 -5.479  65.586 1.00 60.97  ? 120 ILE C HG12 1 
ATOM   4748 H HG13 . ILE C 1 75  ? 64.945 -4.643  64.351 1.00 60.97  ? 120 ILE C HG13 1 
ATOM   4749 H HG21 . ILE C 1 75  ? 61.470 -5.024  64.891 1.00 61.25  ? 120 ILE C HG21 1 
ATOM   4750 H HG22 . ILE C 1 75  ? 61.251 -6.326  64.007 1.00 61.25  ? 120 ILE C HG22 1 
ATOM   4751 H HG23 . ILE C 1 75  ? 61.993 -6.433  65.408 1.00 61.25  ? 120 ILE C HG23 1 
ATOM   4752 H HD11 . ILE C 1 75  ? 64.282 -3.227  66.038 1.00 59.37  ? 120 ILE C HD11 1 
ATOM   4753 H HD12 . ILE C 1 75  ? 63.359 -3.013  64.762 1.00 59.37  ? 120 ILE C HD12 1 
ATOM   4754 H HD13 . ILE C 1 75  ? 62.821 -3.851  66.000 1.00 59.37  ? 120 ILE C HD13 1 
ATOM   4755 N N    . LYS C 1 76  ? 62.424 -8.938  63.335 1.00 62.03  ? 121 LYS C N    1 
ATOM   4756 C CA   . LYS C 1 76  ? 61.483 -9.857  62.714 1.00 64.63  ? 121 LYS C CA   1 
ATOM   4757 C C    . LYS C 1 76  ? 60.059 -9.357  62.928 1.00 62.82  ? 121 LYS C C    1 
ATOM   4758 O O    . LYS C 1 76  ? 59.675 -9.067  64.065 1.00 63.11  ? 121 LYS C O    1 
ATOM   4759 C CB   . LYS C 1 76  ? 61.639 -11.254 63.300 1.00 67.71  ? 121 LYS C CB   1 
ATOM   4760 C CG   . LYS C 1 76  ? 63.040 -11.818 63.148 1.00 72.23  ? 121 LYS C CG   1 
ATOM   4761 C CD   . LYS C 1 76  ? 63.129 -13.242 63.668 1.00 76.02  ? 121 LYS C CD   1 
ATOM   4762 C CE   . LYS C 1 76  ? 64.501 -13.846 63.419 1.00 77.60  ? 121 LYS C CE   1 
ATOM   4763 N NZ   . LYS C 1 76  ? 64.572 -15.264 63.892 1.00 81.69  ? 121 LYS C NZ   1 
ATOM   4764 H H    . LYS C 1 76  ? 62.690 -9.186  64.115 1.00 74.44  ? 121 LYS C H    1 
ATOM   4765 H HA   . LYS C 1 76  ? 61.655 -9.901  61.761 1.00 77.56  ? 121 LYS C HA   1 
ATOM   4766 H HB2  . LYS C 1 76  ? 61.432 -11.222 64.247 1.00 81.25  ? 121 LYS C HB2  1 
ATOM   4767 H HB3  . LYS C 1 76  ? 61.026 -11.854 62.847 1.00 81.25  ? 121 LYS C HB3  1 
ATOM   4768 H HG2  . LYS C 1 76  ? 63.284 -11.822 62.210 1.00 86.67  ? 121 LYS C HG2  1 
ATOM   4769 H HG3  . LYS C 1 76  ? 63.662 -11.271 63.654 1.00 86.67  ? 121 LYS C HG3  1 
ATOM   4770 H HD2  . LYS C 1 76  ? 62.966 -13.244 64.624 1.00 91.22  ? 121 LYS C HD2  1 
ATOM   4771 H HD3  . LYS C 1 76  ? 62.470 -13.790 63.214 1.00 91.22  ? 121 LYS C HD3  1 
ATOM   4772 H HE2  . LYS C 1 76  ? 64.688 -13.834 62.467 1.00 93.12  ? 121 LYS C HE2  1 
ATOM   4773 H HE3  . LYS C 1 76  ? 65.169 -13.332 63.899 1.00 93.12  ? 121 LYS C HE3  1 
ATOM   4774 H HZ1  . LYS C 1 76  ? 65.383 -15.596 63.736 1.00 98.03  ? 121 LYS C HZ1  1 
ATOM   4775 H HZ2  . LYS C 1 76  ? 64.407 -15.301 64.766 1.00 98.03  ? 121 LYS C HZ2  1 
ATOM   4776 H HZ3  . LYS C 1 76  ? 63.969 -15.758 63.462 1.00 98.03  ? 121 LYS C HZ3  1 
ATOM   4777 N N    . PRO C 1 77  ? 59.249 -9.268  61.886 1.00 53.21  ? 122 PRO C N    1 
ATOM   4778 C CA   . PRO C 1 77  ? 57.951 -8.599  62.030 1.00 48.81  ? 122 PRO C CA   1 
ATOM   4779 C C    . PRO C 1 77  ? 56.853 -9.530  62.514 1.00 61.01  ? 122 PRO C C    1 
ATOM   4780 O O    . PRO C 1 77  ? 55.669 -9.263  62.294 1.00 55.13  ? 122 PRO C O    1 
ATOM   4781 C CB   . PRO C 1 77  ? 57.679 -8.094  60.611 1.00 46.98  ? 122 PRO C CB   1 
ATOM   4782 C CG   . PRO C 1 77  ? 58.278 -9.168  59.763 1.00 46.22  ? 122 PRO C CG   1 
ATOM   4783 C CD   . PRO C 1 77  ? 59.472 -9.722  60.503 1.00 48.26  ? 122 PRO C CD   1 
ATOM   4784 H HA   . PRO C 1 77  ? 58.024 -7.843  62.633 1.00 58.58  ? 122 PRO C HA   1 
ATOM   4785 H HB2  . PRO C 1 77  ? 56.723 -8.021  60.459 1.00 56.38  ? 122 PRO C HB2  1 
ATOM   4786 H HB3  . PRO C 1 77  ? 58.124 -7.245  60.467 1.00 56.38  ? 122 PRO C HB3  1 
ATOM   4787 H HG2  . PRO C 1 77  ? 57.620 -9.866  59.619 1.00 55.46  ? 122 PRO C HG2  1 
ATOM   4788 H HG3  . PRO C 1 77  ? 58.556 -8.788  58.915 1.00 55.46  ? 122 PRO C HG3  1 
ATOM   4789 H HD2  . PRO C 1 77  ? 59.478 -10.691 60.461 1.00 57.91  ? 122 PRO C HD2  1 
ATOM   4790 H HD3  . PRO C 1 77  ? 60.294 -9.344  60.151 1.00 57.91  ? 122 PRO C HD3  1 
ATOM   4791 N N    . MET C 1 78  ? 57.228 -10.625 63.167 1.00 82.52  ? 123 MET C N    1 
ATOM   4792 C CA   . MET C 1 78  ? 56.259 -11.571 63.696 1.00 91.80  ? 123 MET C CA   1 
ATOM   4793 C C    . MET C 1 78  ? 55.867 -11.163 65.109 1.00 88.48  ? 123 MET C C    1 
ATOM   4794 O O    . MET C 1 78  ? 56.734 -10.932 65.961 1.00 88.82  ? 123 MET C O    1 
ATOM   4795 C CB   . MET C 1 78  ? 56.823 -12.992 63.687 1.00 94.91  ? 123 MET C CB   1 
ATOM   4796 C CG   . MET C 1 78  ? 56.892 -13.617 62.308 1.00 102.78 ? 123 MET C CG   1 
ATOM   4797 S SD   . MET C 1 78  ? 58.489 -13.383 61.515 1.00 104.73 ? 123 MET C SD   1 
ATOM   4798 C CE   . MET C 1 78  ? 59.506 -14.525 62.448 1.00 108.20 ? 123 MET C CE   1 
ATOM   4799 H H    . MET C 1 78  ? 58.047 -10.842 63.318 1.00 99.02  ? 123 MET C H    1 
ATOM   4800 H HA   . MET C 1 78  ? 55.468 -11.560 63.134 1.00 110.16 ? 123 MET C HA   1 
ATOM   4801 H HB2  . MET C 1 78  ? 57.723 -12.972 64.049 1.00 113.90 ? 123 MET C HB2  1 
ATOM   4802 H HB3  . MET C 1 78  ? 56.259 -13.555 64.240 1.00 113.90 ? 123 MET C HB3  1 
ATOM   4803 H HG2  . MET C 1 78  ? 56.732 -14.571 62.385 1.00 123.33 ? 123 MET C HG2  1 
ATOM   4804 H HG3  . MET C 1 78  ? 56.215 -13.212 61.744 1.00 123.33 ? 123 MET C HG3  1 
ATOM   4805 H HE1  . MET C 1 78  ? 60.413 -14.491 62.107 1.00 129.84 ? 123 MET C HE1  1 
ATOM   4806 H HE2  . MET C 1 78  ? 59.493 -14.267 63.383 1.00 129.84 ? 123 MET C HE2  1 
ATOM   4807 H HE3  . MET C 1 78  ? 59.148 -15.421 62.347 1.00 129.84 ? 123 MET C HE3  1 
ATOM   4808 N N    . TRP C 1 79  ? 54.557 -11.070 65.349 1.00 82.49  ? 124 TRP C N    1 
ATOM   4809 C CA   . TRP C 1 79  ? 54.060 -10.648 66.651 1.00 79.30  ? 124 TRP C CA   1 
ATOM   4810 C C    . TRP C 1 79  ? 54.320 -11.686 67.733 1.00 80.08  ? 124 TRP C C    1 
ATOM   4811 O O    . TRP C 1 79  ? 54.399 -11.327 68.912 1.00 78.67  ? 124 TRP C O    1 
ATOM   4812 C CB   . TRP C 1 79  ? 52.564 -10.346 66.557 1.00 79.87  ? 124 TRP C CB   1 
ATOM   4813 C CG   . TRP C 1 79  ? 51.974 -9.798  67.823 1.00 80.06  ? 124 TRP C CG   1 
ATOM   4814 C CD1  . TRP C 1 79  ? 51.082 -10.420 68.650 1.00 83.84  ? 124 TRP C CD1  1 
ATOM   4815 C CD2  . TRP C 1 79  ? 52.238 -8.516  68.410 1.00 79.85  ? 124 TRP C CD2  1 
ATOM   4816 N NE1  . TRP C 1 79  ? 50.772 -9.604  69.713 1.00 85.20  ? 124 TRP C NE1  1 
ATOM   4817 C CE2  . TRP C 1 79  ? 51.470 -8.431  69.589 1.00 82.26  ? 124 TRP C CE2  1 
ATOM   4818 C CE3  . TRP C 1 79  ? 53.050 -7.434  68.053 1.00 77.81  ? 124 TRP C CE3  1 
ATOM   4819 C CZ2  . TRP C 1 79  ? 51.488 -7.305  70.412 1.00 82.46  ? 124 TRP C CZ2  1 
ATOM   4820 C CZ3  . TRP C 1 79  ? 53.068 -6.319  68.872 1.00 77.70  ? 124 TRP C CZ3  1 
ATOM   4821 C CH2  . TRP C 1 79  ? 52.290 -6.262  70.036 1.00 80.06  ? 124 TRP C CH2  1 
ATOM   4822 H H    . TRP C 1 79  ? 53.941 -11.246 64.775 1.00 98.99  ? 124 TRP C H    1 
ATOM   4823 H HA   . TRP C 1 79  ? 54.514 -9.830  66.909 1.00 95.17  ? 124 TRP C HA   1 
ATOM   4824 H HB2  . TRP C 1 79  ? 52.421 -9.691  65.856 1.00 95.84  ? 124 TRP C HB2  1 
ATOM   4825 H HB3  . TRP C 1 79  ? 52.093 -11.166 66.342 1.00 95.84  ? 124 TRP C HB3  1 
ATOM   4826 H HD1  . TRP C 1 79  ? 50.732 -11.271 68.512 1.00 100.61 ? 124 TRP C HD1  1 
ATOM   4827 H HE1  . TRP C 1 79  ? 50.230 -9.799  70.351 1.00 102.24 ? 124 TRP C HE1  1 
ATOM   4828 H HE3  . TRP C 1 79  ? 53.567 -7.463  67.281 1.00 93.37  ? 124 TRP C HE3  1 
ATOM   4829 H HZ2  . TRP C 1 79  ? 50.974 -7.265  71.187 1.00 98.96  ? 124 TRP C HZ2  1 
ATOM   4830 H HZ3  . TRP C 1 79  ? 53.602 -5.593  68.644 1.00 93.24  ? 124 TRP C HZ3  1 
ATOM   4831 H HH2  . TRP C 1 79  ? 52.323 -5.499  70.567 1.00 96.07  ? 124 TRP C HH2  1 
ATOM   4832 N N    . GLU C 1 80  ? 54.467 -12.956 67.361 1.00 88.50  ? 125 GLU C N    1 
ATOM   4833 C CA   . GLU C 1 80  ? 54.688 -14.033 68.316 1.00 95.18  ? 125 GLU C CA   1 
ATOM   4834 C C    . GLU C 1 80  ? 56.156 -14.433 68.428 1.00 96.17  ? 125 GLU C C    1 
ATOM   4835 O O    . GLU C 1 80  ? 56.462 -15.441 69.071 1.00 99.46  ? 125 GLU C O    1 
ATOM   4836 C CB   . GLU C 1 80  ? 53.844 -15.253 67.935 1.00 100.87 ? 125 GLU C CB   1 
ATOM   4837 C CG   . GLU C 1 80  ? 52.359 -15.132 68.279 1.00 105.28 ? 125 GLU C CG   1 
ATOM   4838 C CD   . GLU C 1 80  ? 51.608 -14.158 67.384 1.00 104.31 ? 125 GLU C CD   1 
ATOM   4839 O OE1  . GLU C 1 80  ? 52.140 -13.788 66.315 1.00 102.13 ? 125 GLU C OE1  1 
ATOM   4840 O OE2  . GLU C 1 80  ? 50.480 -13.766 67.755 1.00 105.10 ? 125 GLU C OE2  1 
ATOM   4841 H H    . GLU C 1 80  ? 54.442 -13.222 66.543 1.00 106.20 ? 125 GLU C H    1 
ATOM   4842 H HA   . GLU C 1 80  ? 54.397 -13.735 69.192 1.00 114.22 ? 125 GLU C HA   1 
ATOM   4843 H HB2  . GLU C 1 80  ? 53.914 -15.391 66.978 1.00 121.05 ? 125 GLU C HB2  1 
ATOM   4844 H HB3  . GLU C 1 80  ? 54.192 -16.028 68.403 1.00 121.05 ? 125 GLU C HB3  1 
ATOM   4845 H HG2  . GLU C 1 80  ? 51.944 -16.003 68.186 1.00 126.33 ? 125 GLU C HG2  1 
ATOM   4846 H HG3  . GLU C 1 80  ? 52.274 -14.822 69.195 1.00 126.33 ? 125 GLU C HG3  1 
ATOM   4847 N N    . ASP C 1 81  ? 57.068 -13.671 67.831 1.00 89.11  ? 126 ASP C N    1 
ATOM   4848 C CA   . ASP C 1 81  ? 58.483 -14.008 67.890 1.00 89.50  ? 126 ASP C CA   1 
ATOM   4849 C C    . ASP C 1 81  ? 59.076 -13.568 69.224 1.00 90.63  ? 126 ASP C C    1 
ATOM   4850 O O    . ASP C 1 81  ? 58.684 -12.549 69.799 1.00 89.02  ? 126 ASP C O    1 
ATOM   4851 C CB   . ASP C 1 81  ? 59.243 -13.352 66.735 1.00 87.16  ? 126 ASP C CB   1 
ATOM   4852 C CG   . ASP C 1 81  ? 60.555 -14.057 66.418 1.00 89.07  ? 126 ASP C CG   1 
ATOM   4853 O OD1  . ASP C 1 81  ? 61.599 -13.666 66.983 1.00 89.12  ? 126 ASP C OD1  1 
ATOM   4854 O OD2  . ASP C 1 81  ? 60.542 -15.000 65.598 1.00 90.31  ? 126 ASP C OD2  1 
ATOM   4855 H H    . ASP C 1 81  ? 56.892 -12.956 67.386 1.00 106.93 ? 126 ASP C H    1 
ATOM   4856 H HA   . ASP C 1 81  ? 58.586 -14.969 67.814 1.00 107.39 ? 126 ASP C HA   1 
ATOM   4857 H HB2  . ASP C 1 81  ? 58.690 -13.376 65.938 1.00 104.59 ? 126 ASP C HB2  1 
ATOM   4858 H HB3  . ASP C 1 81  ? 59.445 -12.433 66.971 1.00 104.59 ? 126 ASP C HB3  1 
ATOM   4859 N N    . ASP C 1 82  ? 60.040 -14.355 69.710 1.00 93.98  ? 127 ASP C N    1 
ATOM   4860 C CA   . ASP C 1 82  ? 60.634 -14.096 71.019 1.00 96.60  ? 127 ASP C CA   1 
ATOM   4861 C C    . ASP C 1 82  ? 61.289 -12.720 71.085 1.00 93.55  ? 127 ASP C C    1 
ATOM   4862 O O    . ASP C 1 82  ? 61.370 -12.124 72.166 1.00 94.51  ? 127 ASP C O    1 
ATOM   4863 C CB   . ASP C 1 82  ? 61.657 -15.188 71.345 1.00 100.71 ? 127 ASP C CB   1 
ATOM   4864 C CG   . ASP C 1 82  ? 62.079 -15.182 72.802 1.00 104.01 ? 127 ASP C CG   1 
ATOM   4865 O OD1  . ASP C 1 82  ? 61.201 -15.033 73.676 1.00 105.47 ? 127 ASP C OD1  1 
ATOM   4866 O OD2  . ASP C 1 82  ? 63.290 -15.330 73.073 1.00 106.12 ? 127 ASP C OD2  1 
ATOM   4867 H H    . ASP C 1 82  ? 60.364 -15.040 69.303 1.00 112.78 ? 127 ASP C H    1 
ATOM   4868 H HA   . ASP C 1 82  ? 59.937 -14.128 71.693 1.00 115.92 ? 127 ASP C HA   1 
ATOM   4869 H HB2  . ASP C 1 82  ? 61.268 -16.054 71.149 1.00 120.85 ? 127 ASP C HB2  1 
ATOM   4870 H HB3  . ASP C 1 82  ? 62.450 -15.050 70.803 1.00 120.85 ? 127 ASP C HB3  1 
ATOM   4871 N N    . ALA C 1 83  ? 61.761 -12.198 69.948 1.00 92.22  ? 128 ALA C N    1 
ATOM   4872 C CA   . ALA C 1 83  ? 62.466 -10.920 69.954 1.00 88.75  ? 128 ALA C CA   1 
ATOM   4873 C C    . ALA C 1 83  ? 61.567 -9.787  70.440 1.00 86.74  ? 128 ALA C C    1 
ATOM   4874 O O    . ALA C 1 83  ? 61.994 -8.945  71.240 1.00 88.18  ? 128 ALA C O    1 
ATOM   4875 C CB   . ALA C 1 83  ? 63.003 -10.615 68.556 1.00 86.35  ? 128 ALA C CB   1 
ATOM   4876 H H    . ALA C 1 83  ? 61.685 -12.561 69.172 1.00 110.66 ? 128 ALA C H    1 
ATOM   4877 H HA   . ALA C 1 83  ? 63.222 -10.980 70.559 1.00 106.50 ? 128 ALA C HA   1 
ATOM   4878 H HB1  . ALA C 1 83  ? 63.469 -9.764  68.576 1.00 103.62 ? 128 ALA C HB1  1 
ATOM   4879 H HB2  . ALA C 1 83  ? 63.614 -11.321 68.293 1.00 103.62 ? 128 ALA C HB2  1 
ATOM   4880 H HB3  . ALA C 1 83  ? 62.260 -10.572 67.935 1.00 103.62 ? 128 ALA C HB3  1 
ATOM   4881 N N    . ASN C 1 84  ? 60.317 -9.747  69.965 1.00 89.92  ? 129 ASN C N    1 
ATOM   4882 C CA   . ASN C 1 84  ? 59.369 -8.699  70.330 1.00 87.77  ? 129 ASN C CA   1 
ATOM   4883 C C    . ASN C 1 84  ? 58.618 -9.012  71.618 1.00 88.48  ? 129 ASN C C    1 
ATOM   4884 O O    . ASN C 1 84  ? 57.500 -8.519  71.812 1.00 87.65  ? 129 ASN C O    1 
ATOM   4885 C CB   . ASN C 1 84  ? 58.373 -8.471  69.190 1.00 86.76  ? 129 ASN C CB   1 
ATOM   4886 C CG   . ASN C 1 84  ? 59.051 -8.156  67.869 1.00 86.37  ? 129 ASN C CG   1 
ATOM   4887 O OD1  . ASN C 1 84  ? 59.487 -7.026  67.635 1.00 84.21  ? 129 ASN C OD1  1 
ATOM   4888 N ND2  . ASN C 1 84  ? 59.128 -9.152  66.991 1.00 86.76  ? 129 ASN C ND2  1 
ATOM   4889 H H    . ASN C 1 84  ? 59.993 -10.328 69.420 1.00 107.90 ? 129 ASN C H    1 
ATOM   4890 H HA   . ASN C 1 84  ? 59.857 -7.872  70.466 1.00 105.33 ? 129 ASN C HA   1 
ATOM   4891 H HB2  . ASN C 1 84  ? 57.842 -9.273  69.070 1.00 104.11 ? 129 ASN C HB2  1 
ATOM   4892 H HB3  . ASN C 1 84  ? 57.798 -7.724  69.417 1.00 104.11 ? 129 ASN C HB3  1 
ATOM   4893 H HD21 . ASN C 1 84  ? 59.503 -9.025  66.228 1.00 104.11 ? 129 ASN C HD21 1 
ATOM   4894 H HD22 . ASN C 1 84  ? 58.803 -9.924  67.187 1.00 104.11 ? 129 ASN C HD22 1 
ATOM   4895 N N    . LYS C 1 85  ? 59.210 -9.807  72.512 1.00 85.15  ? 130 LYS C N    1 
ATOM   4896 C CA   . LYS C 1 85  ? 58.471 -10.319 73.663 1.00 85.10  ? 130 LYS C CA   1 
ATOM   4897 C C    . LYS C 1 85  ? 57.984 -9.192  74.566 1.00 81.90  ? 130 LYS C C    1 
ATOM   4898 O O    . LYS C 1 85  ? 56.899 -9.280  75.151 1.00 82.13  ? 130 LYS C O    1 
ATOM   4899 C CB   . LYS C 1 85  ? 59.349 -11.297 74.445 1.00 88.54  ? 130 LYS C CB   1 
ATOM   4900 C CG   . LYS C 1 85  ? 58.616 -12.057 75.535 1.00 92.39  ? 130 LYS C CG   1 
ATOM   4901 C CD   . LYS C 1 85  ? 59.437 -13.240 76.039 1.00 96.49  ? 130 LYS C CD   1 
ATOM   4902 C CE   . LYS C 1 85  ? 58.677 -14.036 77.090 1.00 101.55 ? 130 LYS C CE   1 
ATOM   4903 N NZ   . LYS C 1 85  ? 59.450 -15.217 77.559 1.00 105.72 ? 130 LYS C NZ   1 
ATOM   4904 H H    . LYS C 1 85  ? 60.031 -10.062 72.474 1.00 102.18 ? 130 LYS C H    1 
ATOM   4905 H HA   . LYS C 1 85  ? 57.693 -10.805 73.346 1.00 102.12 ? 130 LYS C HA   1 
ATOM   4906 H HB2  . LYS C 1 85  ? 59.716 -11.948 73.827 1.00 106.24 ? 130 LYS C HB2  1 
ATOM   4907 H HB3  . LYS C 1 85  ? 60.069 -10.801 74.864 1.00 106.24 ? 130 LYS C HB3  1 
ATOM   4908 H HG2  . LYS C 1 85  ? 58.449 -11.462 76.282 1.00 110.87 ? 130 LYS C HG2  1 
ATOM   4909 H HG3  . LYS C 1 85  ? 57.779 -12.396 75.181 1.00 110.87 ? 130 LYS C HG3  1 
ATOM   4910 H HD2  . LYS C 1 85  ? 59.638 -13.830 75.297 1.00 115.79 ? 130 LYS C HD2  1 
ATOM   4911 H HD3  . LYS C 1 85  ? 60.257 -12.913 76.440 1.00 115.79 ? 130 LYS C HD3  1 
ATOM   4912 H HE2  . LYS C 1 85  ? 58.500 -13.467 77.855 1.00 121.86 ? 130 LYS C HE2  1 
ATOM   4913 H HE3  . LYS C 1 85  ? 57.843 -14.353 76.708 1.00 121.86 ? 130 LYS C HE3  1 
ATOM   4914 H HZ1  . LYS C 1 85  ? 58.982 -15.663 78.171 1.00 126.87 ? 130 LYS C HZ1  1 
ATOM   4915 H HZ2  . LYS C 1 85  ? 59.621 -15.760 76.875 1.00 126.87 ? 130 LYS C HZ2  1 
ATOM   4916 H HZ3  . LYS C 1 85  ? 60.219 -14.953 77.919 1.00 126.87 ? 130 LYS C HZ3  1 
ATOM   4917 N N    . ASN C 1 86  ? 58.771 -8.125  74.693 1.00 79.07  ? 131 ASN C N    1 
ATOM   4918 C CA   . ASN C 1 86  ? 58.432 -6.998  75.551 1.00 77.66  ? 131 ASN C CA   1 
ATOM   4919 C C    . ASN C 1 86  ? 57.869 -5.817  74.770 1.00 71.75  ? 131 ASN C C    1 
ATOM   4920 O O    . ASN C 1 86  ? 57.791 -4.711  75.311 1.00 71.32  ? 131 ASN C O    1 
ATOM   4921 C CB   . ASN C 1 86  ? 59.667 -6.558  76.344 1.00 79.82  ? 131 ASN C CB   1 
ATOM   4922 C CG   . ASN C 1 86  ? 60.180 -7.640  77.271 1.00 84.60  ? 131 ASN C CG   1 
ATOM   4923 O OD1  . ASN C 1 86  ? 59.831 -7.680  78.451 1.00 87.82  ? 131 ASN C OD1  1 
ATOM   4924 N ND2  . ASN C 1 86  ? 61.014 -8.527  76.741 1.00 85.29  ? 131 ASN C ND2  1 
ATOM   4925 H H    . ASN C 1 86  ? 59.521 -8.032  74.283 1.00 94.88  ? 131 ASN C H    1 
ATOM   4926 H HA   . ASN C 1 86  ? 57.757 -7.282  76.187 1.00 93.20  ? 131 ASN C HA   1 
ATOM   4927 H HB2  . ASN C 1 86  ? 60.378 -6.332  75.723 1.00 95.78  ? 131 ASN C HB2  1 
ATOM   4928 H HB3  . ASN C 1 86  ? 59.438 -5.784  76.883 1.00 95.78  ? 131 ASN C HB3  1 
ATOM   4929 H HD21 . ASN C 1 86  ? 61.333 -9.161  77.227 1.00 102.35 ? 131 ASN C HD21 1 
ATOM   4930 H HD22 . ASN C 1 86  ? 61.236 -8.467  75.912 1.00 102.35 ? 131 ASN C HD22 1 
ATOM   4931 N N    . GLY C 1 87  ? 57.467 -6.027  73.516 1.00 64.40  ? 132 GLY C N    1 
ATOM   4932 C CA   . GLY C 1 87  ? 57.036 -4.943  72.662 1.00 58.34  ? 132 GLY C CA   1 
ATOM   4933 C C    . GLY C 1 87  ? 55.549 -4.661  72.751 1.00 55.88  ? 132 GLY C C    1 
ATOM   4934 O O    . GLY C 1 87  ? 54.794 -5.303  73.483 1.00 57.65  ? 132 GLY C O    1 
ATOM   4935 H H    . GLY C 1 87  ? 57.437 -6.800  73.140 1.00 77.29  ? 132 GLY C H    1 
ATOM   4936 H HA2  . GLY C 1 87  ? 57.514 -4.135  72.905 1.00 70.01  ? 132 GLY C HA2  1 
ATOM   4937 H HA3  . GLY C 1 87  ? 57.250 -5.158  71.740 1.00 70.01  ? 132 GLY C HA3  1 
ATOM   4938 N N    . GLY C 1 88  ? 55.135 -3.661  71.979 1.00 53.87  ? 133 GLY C N    1 
ATOM   4939 C CA   . GLY C 1 88  ? 53.743 -3.259  71.898 1.00 53.28  ? 133 GLY C CA   1 
ATOM   4940 C C    . GLY C 1 88  ? 53.537 -2.474  70.625 1.00 50.77  ? 133 GLY C C    1 
ATOM   4941 O O    . GLY C 1 88  ? 54.491 -2.126  69.927 1.00 49.10  ? 133 GLY C O    1 
ATOM   4942 H H    . GLY C 1 88  ? 55.657 -3.192  71.483 1.00 64.64  ? 133 GLY C H    1 
ATOM   4943 H HA2  . GLY C 1 88  ? 53.169 -4.041  71.886 1.00 63.93  ? 133 GLY C HA2  1 
ATOM   4944 H HA3  . GLY C 1 88  ? 53.510 -2.703  72.657 1.00 63.93  ? 133 GLY C HA3  1 
ATOM   4945 N N    . LYS C 1 89  ? 52.273 -2.190  70.326 1.00 48.99  ? 134 LYS C N    1 
ATOM   4946 C CA   . LYS C 1 89  ? 51.939 -1.479  69.101 1.00 47.01  ? 134 LYS C CA   1 
ATOM   4947 C C    . LYS C 1 89  ? 50.653 -0.687  69.287 1.00 47.05  ? 134 LYS C C    1 
ATOM   4948 O O    . LYS C 1 89  ? 49.706 -1.164  69.921 1.00 47.57  ? 134 LYS C O    1 
ATOM   4949 C CB   . LYS C 1 89  ? 51.781 -2.449  67.921 1.00 46.73  ? 134 LYS C CB   1 
ATOM   4950 C CG   . LYS C 1 89  ? 50.587 -3.404  68.061 1.00 51.80  ? 134 LYS C CG   1 
ATOM   4951 C CD   . LYS C 1 89  ? 50.544 -4.430  66.937 1.00 51.96  ? 134 LYS C CD   1 
ATOM   4952 C CE   . LYS C 1 89  ? 49.413 -5.425  67.139 1.00 56.34  ? 134 LYS C CE   1 
ATOM   4953 N NZ   . LYS C 1 89  ? 49.462 -6.547  66.152 1.00 56.49  ? 134 LYS C NZ   1 
ATOM   4954 H H    . LYS C 1 89  ? 51.595 -2.397  70.814 1.00 58.79  ? 134 LYS C H    1 
ATOM   4955 H HA   . LYS C 1 89  ? 52.651 -0.856  68.888 1.00 56.42  ? 134 LYS C HA   1 
ATOM   4956 H HB2  . LYS C 1 89  ? 51.656 -1.935  67.108 1.00 56.08  ? 134 LYS C HB2  1 
ATOM   4957 H HB3  . LYS C 1 89  ? 52.585 -2.987  67.850 1.00 56.08  ? 134 LYS C HB3  1 
ATOM   4958 H HG2  . LYS C 1 89  ? 50.658 -3.881  68.903 1.00 62.16  ? 134 LYS C HG2  1 
ATOM   4959 H HG3  . LYS C 1 89  ? 49.764 -2.892  68.035 1.00 62.16  ? 134 LYS C HG3  1 
ATOM   4960 H HD2  . LYS C 1 89  ? 50.402 -3.975  66.093 1.00 62.35  ? 134 LYS C HD2  1 
ATOM   4961 H HD3  . LYS C 1 89  ? 51.381 -4.920  66.918 1.00 62.35  ? 134 LYS C HD3  1 
ATOM   4962 H HE2  . LYS C 1 89  ? 49.478 -5.804  68.029 1.00 67.60  ? 134 LYS C HE2  1 
ATOM   4963 H HE3  . LYS C 1 89  ? 48.564 -4.967  67.032 1.00 67.60  ? 134 LYS C HE3  1 
ATOM   4964 H HZ1  . LYS C 1 89  ? 48.788 -7.110  66.297 1.00 67.79  ? 134 LYS C HZ1  1 
ATOM   4965 H HZ2  . LYS C 1 89  ? 49.398 -6.227  65.324 1.00 67.79  ? 134 LYS C HZ2  1 
ATOM   4966 H HZ3  . LYS C 1 89  ? 50.230 -6.989  66.232 1.00 67.79  ? 134 LYS C HZ3  1 
ATOM   4967 N N    . TRP C 1 90  ? 50.629 0.521   68.724 1.00 43.85  ? 135 TRP C N    1 
ATOM   4968 C CA   . TRP C 1 90  ? 49.386 1.266   68.575 1.00 44.14  ? 135 TRP C CA   1 
ATOM   4969 C C    . TRP C 1 90  ? 48.660 0.795   67.320 1.00 44.37  ? 135 TRP C C    1 
ATOM   4970 O O    . TRP C 1 90  ? 49.283 0.529   66.286 1.00 42.04  ? 135 TRP C O    1 
ATOM   4971 C CB   . TRP C 1 90  ? 49.655 2.774   68.497 1.00 42.99  ? 135 TRP C CB   1 
ATOM   4972 C CG   . TRP C 1 90  ? 49.868 3.426   69.834 1.00 44.35  ? 135 TRP C CG   1 
ATOM   4973 C CD1  . TRP C 1 90  ? 51.056 3.844   70.371 1.00 44.10  ? 135 TRP C CD1  1 
ATOM   4974 C CD2  . TRP C 1 90  ? 48.861 3.733   70.805 1.00 46.53  ? 135 TRP C CD2  1 
ATOM   4975 N NE1  . TRP C 1 90  ? 50.847 4.391   71.619 1.00 46.03  ? 135 TRP C NE1  1 
ATOM   4976 C CE2  . TRP C 1 90  ? 49.507 4.331   71.907 1.00 47.53  ? 135 TRP C CE2  1 
ATOM   4977 C CE3  . TRP C 1 90  ? 47.475 3.558   70.852 1.00 48.02  ? 135 TRP C CE3  1 
ATOM   4978 C CZ2  . TRP C 1 90  ? 48.813 4.757   73.037 1.00 49.96  ? 135 TRP C CZ2  1 
ATOM   4979 C CZ3  . TRP C 1 90  ? 46.789 3.974   71.977 1.00 50.41  ? 135 TRP C CZ3  1 
ATOM   4980 C CH2  . TRP C 1 90  ? 47.457 4.568   73.054 1.00 51.34  ? 135 TRP C CH2  1 
ATOM   4981 H H    . TRP C 1 90  ? 51.323 0.929   68.421 1.00 52.62  ? 135 TRP C H    1 
ATOM   4982 H HA   . TRP C 1 90  ? 48.816 1.096   69.340 1.00 52.97  ? 135 TRP C HA   1 
ATOM   4983 H HB2  . TRP C 1 90  ? 50.453 2.921   67.966 1.00 51.58  ? 135 TRP C HB2  1 
ATOM   4984 H HB3  . TRP C 1 90  ? 48.896 3.205   68.076 1.00 51.58  ? 135 TRP C HB3  1 
ATOM   4985 H HD1  . TRP C 1 90  ? 51.884 3.769   69.955 1.00 52.93  ? 135 TRP C HD1  1 
ATOM   4986 H HE1  . TRP C 1 90  ? 51.456 4.715   72.132 1.00 55.23  ? 135 TRP C HE1  1 
ATOM   4987 H HE3  . TRP C 1 90  ? 47.024 3.161   70.141 1.00 57.63  ? 135 TRP C HE3  1 
ATOM   4988 H HZ2  . TRP C 1 90  ? 49.254 5.151   73.754 1.00 59.95  ? 135 TRP C HZ2  1 
ATOM   4989 H HZ3  . TRP C 1 90  ? 45.866 3.863   72.017 1.00 60.49  ? 135 TRP C HZ3  1 
ATOM   4990 H HH2  . TRP C 1 90  ? 46.969 4.843   73.796 1.00 61.61  ? 135 TRP C HH2  1 
ATOM   4991 N N    . ILE C 1 91  ? 47.336 0.685   67.420 1.00 51.59  ? 136 ILE C N    1 
ATOM   4992 C CA   . ILE C 1 91  ? 46.506 0.115   66.366 1.00 55.81  ? 136 ILE C CA   1 
ATOM   4993 C C    . ILE C 1 91  ? 45.428 1.118   65.993 1.00 53.03  ? 136 ILE C C    1 
ATOM   4994 O O    . ILE C 1 91  ? 44.820 1.743   66.867 1.00 54.25  ? 136 ILE C O    1 
ATOM   4995 C CB   . ILE C 1 91  ? 45.865 -1.218  66.808 1.00 64.56  ? 136 ILE C CB   1 
ATOM   4996 C CG1  . ILE C 1 91  ? 46.942 -2.218  67.226 1.00 66.20  ? 136 ILE C CG1  1 
ATOM   4997 C CG2  . ILE C 1 91  ? 45.013 -1.811  65.685 1.00 65.28  ? 136 ILE C CG2  1 
ATOM   4998 C CD1  . ILE C 1 91  ? 46.388 -3.361  68.038 1.00 72.24  ? 136 ILE C CD1  1 
ATOM   4999 H H    . ILE C 1 91  ? 46.887 0.941   68.107 1.00 61.91  ? 136 ILE C H    1 
ATOM   5000 H HA   . ILE C 1 91  ? 47.052 -0.054  65.582 1.00 66.98  ? 136 ILE C HA   1 
ATOM   5001 H HB   . ILE C 1 91  ? 45.291 -1.046  67.571 1.00 77.47  ? 136 ILE C HB   1 
ATOM   5002 H HG12 . ILE C 1 91  ? 47.357 -2.588  66.431 1.00 79.44  ? 136 ILE C HG12 1 
ATOM   5003 H HG13 . ILE C 1 91  ? 47.606 -1.761  67.765 1.00 79.44  ? 136 ILE C HG13 1 
ATOM   5004 H HG21 . ILE C 1 91  ? 44.624 -2.646  65.991 1.00 78.34  ? 136 ILE C HG21 1 
ATOM   5005 H HG22 . ILE C 1 91  ? 44.310 -1.183  65.456 1.00 78.34  ? 136 ILE C HG22 1 
ATOM   5006 H HG23 . ILE C 1 91  ? 45.577 -1.972  64.912 1.00 78.34  ? 136 ILE C HG23 1 
ATOM   5007 H HD11 . ILE C 1 91  ? 47.112 -3.960  68.274 1.00 86.69  ? 136 ILE C HD11 1 
ATOM   5008 H HD12 . ILE C 1 91  ? 45.976 -3.006  68.842 1.00 86.69  ? 136 ILE C HD12 1 
ATOM   5009 H HD13 . ILE C 1 91  ? 45.727 -3.832  67.508 1.00 86.69  ? 136 ILE C HD13 1 
ATOM   5010 N N    . ILE C 1 92  ? 45.183 1.256   64.694 1.00 50.72  ? 137 ILE C N    1 
ATOM   5011 C CA   . ILE C 1 92  ? 44.109 2.092   64.177 1.00 51.57  ? 137 ILE C CA   1 
ATOM   5012 C C    . ILE C 1 92  ? 43.338 1.241   63.183 1.00 51.80  ? 137 ILE C C    1 
ATOM   5013 O O    . ILE C 1 92  ? 43.878 0.863   62.134 1.00 48.99  ? 137 ILE C O    1 
ATOM   5014 C CB   . ILE C 1 92  ? 44.617 3.376   63.509 1.00 50.29  ? 137 ILE C CB   1 
ATOM   5015 C CG1  . ILE C 1 92  ? 45.634 4.084   64.403 1.00 50.98  ? 137 ILE C CG1  1 
ATOM   5016 C CG2  . ILE C 1 92  ? 43.437 4.301   63.209 1.00 52.26  ? 137 ILE C CG2  1 
ATOM   5017 C CD1  . ILE C 1 92  ? 46.309 5.277   63.734 1.00 49.95  ? 137 ILE C CD1  1 
ATOM   5018 H H    . ILE C 1 92  ? 45.639 0.865   64.078 1.00 60.86  ? 137 ILE C H    1 
ATOM   5019 H HA   . ILE C 1 92  ? 43.513 2.338   64.901 1.00 61.89  ? 137 ILE C HA   1 
ATOM   5020 H HB   . ILE C 1 92  ? 45.049 3.141   62.672 1.00 60.35  ? 137 ILE C HB   1 
ATOM   5021 H HG12 . ILE C 1 92  ? 45.182 4.405   65.198 1.00 61.18  ? 137 ILE C HG12 1 
ATOM   5022 H HG13 . ILE C 1 92  ? 46.327 3.451   64.651 1.00 61.18  ? 137 ILE C HG13 1 
ATOM   5023 H HG21 . ILE C 1 92  ? 43.768 5.109   62.787 1.00 62.72  ? 137 ILE C HG21 1 
ATOM   5024 H HG22 . ILE C 1 92  ? 42.822 3.845   62.613 1.00 62.72  ? 137 ILE C HG22 1 
ATOM   5025 H HG23 . ILE C 1 92  ? 42.989 4.521   64.041 1.00 62.72  ? 137 ILE C HG23 1 
ATOM   5026 H HD11 . ILE C 1 92  ? 46.938 5.674   64.357 1.00 59.94  ? 137 ILE C HD11 1 
ATOM   5027 H HD12 . ILE C 1 92  ? 46.777 4.971   62.941 1.00 59.94  ? 137 ILE C HD12 1 
ATOM   5028 H HD13 . ILE C 1 92  ? 45.631 5.926   63.489 1.00 59.94  ? 137 ILE C HD13 1 
ATOM   5029 N N    . ARG C 1 93  ? 42.089 0.928   63.520 1.00 53.84  ? 138 ARG C N    1 
ATOM   5030 C CA   . ARG C 1 93  ? 41.206 0.160   62.654 1.00 56.20  ? 138 ARG C CA   1 
ATOM   5031 C C    . ARG C 1 93  ? 40.379 1.131   61.817 1.00 56.44  ? 138 ARG C C    1 
ATOM   5032 O O    . ARG C 1 93  ? 39.575 1.902   62.356 1.00 57.34  ? 138 ARG C O    1 
ATOM   5033 C CB   . ARG C 1 93  ? 40.310 -0.757  63.486 1.00 61.28  ? 138 ARG C CB   1 
ATOM   5034 C CG   . ARG C 1 93  ? 41.096 -1.700  64.401 1.00 63.31  ? 138 ARG C CG   1 
ATOM   5035 C CD   . ARG C 1 93  ? 40.196 -2.555  65.282 1.00 70.47  ? 138 ARG C CD   1 
ATOM   5036 N NE   . ARG C 1 93  ? 39.385 -3.489  64.506 1.00 75.68  ? 138 ARG C NE   1 
ATOM   5037 C CZ   . ARG C 1 93  ? 38.446 -4.280  65.021 1.00 82.72  ? 138 ARG C CZ   1 
ATOM   5038 N NH1  . ARG C 1 93  ? 38.187 -4.261  66.321 1.00 85.40  ? 138 ARG C NH1  1 
ATOM   5039 N NH2  . ARG C 1 93  ? 37.759 -5.094  64.233 1.00 85.16  ? 138 ARG C NH2  1 
ATOM   5040 H H    . ARG C 1 93  ? 41.724 1.155   64.264 1.00 64.61  ? 138 ARG C H    1 
ATOM   5041 H HA   . ARG C 1 93  ? 41.736 -0.388  62.055 1.00 67.44  ? 138 ARG C HA   1 
ATOM   5042 H HB2  . ARG C 1 93  ? 39.734 -0.211  64.044 1.00 73.54  ? 138 ARG C HB2  1 
ATOM   5043 H HB3  . ARG C 1 93  ? 39.773 -1.299  62.888 1.00 73.54  ? 138 ARG C HB3  1 
ATOM   5044 H HG2  . ARG C 1 93  ? 41.633 -2.295  63.854 1.00 75.97  ? 138 ARG C HG2  1 
ATOM   5045 H HG3  . ARG C 1 93  ? 41.669 -1.174  64.980 1.00 75.97  ? 138 ARG C HG3  1 
ATOM   5046 H HD2  . ARG C 1 93  ? 40.746 -3.070  65.893 1.00 84.57  ? 138 ARG C HD2  1 
ATOM   5047 H HD3  . ARG C 1 93  ? 39.596 -1.977  65.779 1.00 84.57  ? 138 ARG C HD3  1 
ATOM   5048 H HE   . ARG C 1 93  ? 39.523 -3.531  63.658 1.00 90.82  ? 138 ARG C HE   1 
ATOM   5049 H HH11 . ARG C 1 93  ? 38.628 -3.735  66.839 1.00 102.49 ? 138 ARG C HH11 1 
ATOM   5050 H HH12 . ARG C 1 93  ? 37.579 -4.775  66.646 1.00 102.49 ? 138 ARG C HH12 1 
ATOM   5051 H HH21 . ARG C 1 93  ? 37.921 -5.113  63.388 1.00 102.19 ? 138 ARG C HH21 1 
ATOM   5052 H HH22 . ARG C 1 93  ? 37.154 -5.606  64.566 1.00 102.19 ? 138 ARG C HH22 1 
ATOM   5053 N N    . LEU C 1 94  ? 40.576 1.085   60.503 1.00 59.36  ? 139 LEU C N    1 
ATOM   5054 C CA   . LEU C 1 94  ? 40.066 2.095   59.592 1.00 60.36  ? 139 LEU C CA   1 
ATOM   5055 C C    . LEU C 1 94  ? 39.033 1.511   58.640 1.00 65.13  ? 139 LEU C C    1 
ATOM   5056 O O    . LEU C 1 94  ? 39.073 0.325   58.296 1.00 67.95  ? 139 LEU C O    1 
ATOM   5057 C CB   . LEU C 1 94  ? 41.214 2.704   58.782 1.00 57.57  ? 139 LEU C CB   1 
ATOM   5058 C CG   . LEU C 1 94  ? 42.292 3.366   59.631 1.00 53.20  ? 139 LEU C CG   1 
ATOM   5059 C CD1  . LEU C 1 94  ? 43.529 3.562   58.799 1.00 51.22  ? 139 LEU C CD1  1 
ATOM   5060 C CD2  . LEU C 1 94  ? 41.785 4.689   60.170 1.00 54.23  ? 139 LEU C CD2  1 
ATOM   5061 H H    . LEU C 1 94  ? 41.015 0.459   60.108 1.00 71.24  ? 139 LEU C H    1 
ATOM   5062 H HA   . LEU C 1 94  ? 39.644 2.804   60.103 1.00 72.44  ? 139 LEU C HA   1 
ATOM   5063 H HB2  . LEU C 1 94  ? 41.636 2.002   58.263 1.00 69.08  ? 139 LEU C HB2  1 
ATOM   5064 H HB3  . LEU C 1 94  ? 40.851 3.378   58.186 1.00 69.08  ? 139 LEU C HB3  1 
ATOM   5065 H HG   . LEU C 1 94  ? 42.512 2.792   60.381 1.00 63.83  ? 139 LEU C HG   1 
ATOM   5066 H HD11 . LEU C 1 94  ? 44.212 3.984   59.344 1.00 61.46  ? 139 LEU C HD11 1 
ATOM   5067 H HD12 . LEU C 1 94  ? 43.841 2.697   58.489 1.00 61.46  ? 139 LEU C HD12 1 
ATOM   5068 H HD13 . LEU C 1 94  ? 43.314 4.128   58.042 1.00 61.46  ? 139 LEU C HD13 1 
ATOM   5069 H HD21 . LEU C 1 94  ? 42.481 5.098   60.707 1.00 65.07  ? 139 LEU C HD21 1 
ATOM   5070 H HD22 . LEU C 1 94  ? 41.559 5.267   59.424 1.00 65.07  ? 139 LEU C HD22 1 
ATOM   5071 H HD23 . LEU C 1 94  ? 40.998 4.527   60.714 1.00 65.07  ? 139 LEU C HD23 1 
ATOM   5072 N N    . ARG C 1 95  ? 38.097 2.359   58.227 1.00 69.46  ? 140 ARG C N    1 
ATOM   5073 C CA   . ARG C 1 95  ? 37.220 2.011   57.125 1.00 72.40  ? 140 ARG C CA   1 
ATOM   5074 C C    . ARG C 1 95  ? 38.029 1.964   55.834 1.00 66.07  ? 140 ARG C C    1 
ATOM   5075 O O    . ARG C 1 95  ? 39.110 2.543   55.732 1.00 62.49  ? 140 ARG C O    1 
ATOM   5076 C CB   . ARG C 1 95  ? 36.083 3.026   57.001 1.00 79.90  ? 140 ARG C CB   1 
ATOM   5077 C CG   . ARG C 1 95  ? 36.573 4.441   56.748 1.00 84.03  ? 140 ARG C CG   1 
ATOM   5078 C CD   . ARG C 1 95  ? 35.442 5.454   56.690 1.00 91.91  ? 140 ARG C CD   1 
ATOM   5079 N NE   . ARG C 1 95  ? 34.721 5.381   55.425 1.00 98.21  ? 140 ARG C NE   1 
ATOM   5080 C CZ   . ARG C 1 95  ? 34.012 6.378   54.909 1.00 103.87 ? 140 ARG C CZ   1 
ATOM   5081 N NH1  . ARG C 1 95  ? 33.387 6.214   53.749 1.00 107.18 ? 140 ARG C NH1  1 
ATOM   5082 N NH2  . ARG C 1 95  ? 33.931 7.539   55.545 1.00 104.97 ? 140 ARG C NH2  1 
ATOM   5083 H H    . ARG C 1 95  ? 37.953 3.135   58.567 1.00 83.36  ? 140 ARG C H    1 
ATOM   5084 H HA   . ARG C 1 95  ? 36.835 1.135   57.280 1.00 86.88  ? 140 ARG C HA   1 
ATOM   5085 H HB2  . ARG C 1 95  ? 35.512 2.770   56.260 1.00 95.88  ? 140 ARG C HB2  1 
ATOM   5086 H HB3  . ARG C 1 95  ? 35.573 3.029   57.826 1.00 95.88  ? 140 ARG C HB3  1 
ATOM   5087 H HG2  . ARG C 1 95  ? 37.172 4.701   57.465 1.00 100.84 ? 140 ARG C HG2  1 
ATOM   5088 H HG3  . ARG C 1 95  ? 37.041 4.467   55.899 1.00 100.84 ? 140 ARG C HG3  1 
ATOM   5089 H HD2  . ARG C 1 95  ? 34.815 5.274   57.408 1.00 110.29 ? 140 ARG C HD2  1 
ATOM   5090 H HD3  . ARG C 1 95  ? 35.808 6.347   56.780 1.00 110.29 ? 140 ARG C HD3  1 
ATOM   5091 H HE   . ARG C 1 95  ? 34.757 4.643   54.985 1.00 117.85 ? 140 ARG C HE   1 
ATOM   5092 H HH11 . ARG C 1 95  ? 33.440 5.463   53.334 1.00 128.61 ? 140 ARG C HH11 1 
ATOM   5093 H HH12 . ARG C 1 95  ? 32.930 6.860   53.412 1.00 128.61 ? 140 ARG C HH12 1 
ATOM   5094 H HH21 . ARG C 1 95  ? 34.335 7.647   56.297 1.00 125.97 ? 140 ARG C HH21 1 
ATOM   5095 H HH22 . ARG C 1 95  ? 33.473 8.184   55.208 1.00 125.97 ? 140 ARG C HH22 1 
ATOM   5096 N N    . LYS C 1 96  ? 37.497 1.258   54.843 1.00 57.54  ? 141 LYS C N    1 
ATOM   5097 C CA   . LYS C 1 96  ? 38.201 1.126   53.576 1.00 55.24  ? 141 LYS C CA   1 
ATOM   5098 C C    . LYS C 1 96  ? 38.402 2.494   52.936 1.00 54.44  ? 141 LYS C C    1 
ATOM   5099 O O    . LYS C 1 96  ? 37.581 3.404   53.087 1.00 55.80  ? 141 LYS C O    1 
ATOM   5100 C CB   . LYS C 1 96  ? 37.428 0.211   52.626 1.00 58.08  ? 141 LYS C CB   1 
ATOM   5101 C CG   . LYS C 1 96  ? 37.432 -1.256  53.022 1.00 61.38  ? 141 LYS C CG   1 
ATOM   5102 C CD   . LYS C 1 96  ? 38.838 -1.834  52.952 1.00 60.85  ? 141 LYS C CD   1 
ATOM   5103 C CE   . LYS C 1 96  ? 38.833 -3.344  53.142 1.00 66.52  ? 141 LYS C CE   1 
ATOM   5104 N NZ   . LYS C 1 96  ? 40.212 -3.910  53.054 1.00 64.84  ? 141 LYS C NZ   1 
ATOM   5105 H H    . LYS C 1 96  ? 36.741 0.850   54.878 1.00 69.05  ? 141 LYS C H    1 
ATOM   5106 H HA   . LYS C 1 96  ? 39.074 0.734   53.734 1.00 66.29  ? 141 LYS C HA   1 
ATOM   5107 H HB2  . LYS C 1 96  ? 36.504 0.505   52.596 1.00 69.69  ? 141 LYS C HB2  1 
ATOM   5108 H HB3  . LYS C 1 96  ? 37.821 0.278   51.742 1.00 69.69  ? 141 LYS C HB3  1 
ATOM   5109 H HG2  . LYS C 1 96  ? 37.109 -1.345  53.932 1.00 73.65  ? 141 LYS C HG2  1 
ATOM   5110 H HG3  . LYS C 1 96  ? 36.865 -1.755  52.412 1.00 73.65  ? 141 LYS C HG3  1 
ATOM   5111 H HD2  . LYS C 1 96  ? 39.221 -1.638  52.082 1.00 73.02  ? 141 LYS C HD2  1 
ATOM   5112 H HD3  . LYS C 1 96  ? 39.381 -1.441  53.653 1.00 73.02  ? 141 LYS C HD3  1 
ATOM   5113 H HE2  . LYS C 1 96  ? 38.473 -3.555  54.018 1.00 79.82  ? 141 LYS C HE2  1 
ATOM   5114 H HE3  . LYS C 1 96  ? 38.291 -3.752  52.449 1.00 79.82  ? 141 LYS C HE3  1 
ATOM   5115 H HZ1  . LYS C 1 96  ? 40.186 -4.792  53.168 1.00 77.81  ? 141 LYS C HZ1  1 
ATOM   5116 H HZ2  . LYS C 1 96  ? 40.564 -3.731  52.256 1.00 77.81  ? 141 LYS C HZ2  1 
ATOM   5117 H HZ3  . LYS C 1 96  ? 40.729 -3.552  53.684 1.00 77.81  ? 141 LYS C HZ3  1 
ATOM   5118 N N    . GLY C 1 97  ? 39.524 2.640   52.230 1.00 52.46  ? 142 GLY C N    1 
ATOM   5119 C CA   . GLY C 1 97  ? 39.795 3.828   51.450 1.00 52.01  ? 142 GLY C CA   1 
ATOM   5120 C C    . GLY C 1 97  ? 40.697 4.843   52.109 1.00 49.51  ? 142 GLY C C    1 
ATOM   5121 O O    . GLY C 1 97  ? 41.025 5.853   51.477 1.00 49.18  ? 142 GLY C O    1 
ATOM   5122 H H    . GLY C 1 97  ? 40.149 2.050   52.192 1.00 62.95  ? 142 GLY C H    1 
ATOM   5123 H HA2  . GLY C 1 97  ? 40.207 3.565   50.612 1.00 62.42  ? 142 GLY C HA2  1 
ATOM   5124 H HA3  . GLY C 1 97  ? 38.955 4.266   51.244 1.00 62.42  ? 142 GLY C HA3  1 
ATOM   5125 N N    . LEU C 1 98  ? 41.107 4.611   53.356 1.00 48.54  ? 143 LEU C N    1 
ATOM   5126 C CA   . LEU C 1 98  ? 42.002 5.512   54.064 1.00 46.92  ? 143 LEU C CA   1 
ATOM   5127 C C    . LEU C 1 98  ? 43.405 4.956   54.282 1.00 45.22  ? 143 LEU C C    1 
ATOM   5128 O O    . LEU C 1 98  ? 44.316 5.734   54.594 1.00 43.26  ? 143 LEU C O    1 
ATOM   5129 C CB   . LEU C 1 98  ? 41.405 5.869   55.430 1.00 48.33  ? 143 LEU C CB   1 
ATOM   5130 C CG   . LEU C 1 98  ? 39.956 6.355   55.402 1.00 52.16  ? 143 LEU C CG   1 
ATOM   5131 C CD1  . LEU C 1 98  ? 39.482 6.597   56.804 1.00 53.14  ? 143 LEU C CD1  1 
ATOM   5132 C CD2  . LEU C 1 98  ? 39.813 7.624   54.586 1.00 52.79  ? 143 LEU C CD2  1 
ATOM   5133 H H    . LEU C 1 98  ? 40.873 3.924   53.818 1.00 58.25  ? 143 LEU C H    1 
ATOM   5134 H HA   . LEU C 1 98  ? 42.085 6.333   53.553 1.00 56.30  ? 143 LEU C HA   1 
ATOM   5135 H HB2  . LEU C 1 98  ? 41.437 5.081   55.995 1.00 57.99  ? 143 LEU C HB2  1 
ATOM   5136 H HB3  . LEU C 1 98  ? 41.941 6.574   55.825 1.00 57.99  ? 143 LEU C HB3  1 
ATOM   5137 H HG   . LEU C 1 98  ? 39.395 5.671   55.004 1.00 62.59  ? 143 LEU C HG   1 
ATOM   5138 H HD11 . LEU C 1 98  ? 38.562 6.905   56.777 1.00 63.77  ? 143 LEU C HD11 1 
ATOM   5139 H HD12 . LEU C 1 98  ? 39.539 5.768   57.303 1.00 63.77  ? 143 LEU C HD12 1 
ATOM   5140 H HD13 . LEU C 1 98  ? 40.045 7.271   57.215 1.00 63.77  ? 143 LEU C HD13 1 
ATOM   5141 H HD21 . LEU C 1 98  ? 38.883 7.900   54.592 1.00 63.34  ? 143 LEU C HD21 1 
ATOM   5142 H HD22 . LEU C 1 98  ? 40.366 8.316   54.980 1.00 63.34  ? 143 LEU C HD22 1 
ATOM   5143 H HD23 . LEU C 1 98  ? 40.100 7.448   53.676 1.00 63.34  ? 143 LEU C HD23 1 
ATOM   5144 N N    . ALA C 1 99  ? 43.608 3.644   54.116 1.00 47.58  ? 144 ALA C N    1 
ATOM   5145 C CA   . ALA C 1 99  ? 44.868 3.028   54.528 1.00 46.57  ? 144 ALA C CA   1 
ATOM   5146 C C    . ALA C 1 99  ? 46.035 3.506   53.674 1.00 45.58  ? 144 ALA C C    1 
ATOM   5147 O O    . ALA C 1 99  ? 47.144 3.700   54.185 1.00 44.77  ? 144 ALA C O    1 
ATOM   5148 C CB   . ALA C 1 99  ? 44.754 1.506   54.463 1.00 48.21  ? 144 ALA C CB   1 
ATOM   5149 H H    . ALA C 1 99  ? 43.039 3.098   53.773 1.00 57.10  ? 144 ALA C H    1 
ATOM   5150 H HA   . ALA C 1 99  ? 45.052 3.275   55.448 1.00 55.89  ? 144 ALA C HA   1 
ATOM   5151 H HB1  . ALA C 1 99  ? 45.598 1.115   54.739 1.00 57.85  ? 144 ALA C HB1  1 
ATOM   5152 H HB2  . ALA C 1 99  ? 44.045 1.217   55.058 1.00 57.85  ? 144 ALA C HB2  1 
ATOM   5153 H HB3  . ALA C 1 99  ? 44.550 1.244   53.552 1.00 57.85  ? 144 ALA C HB3  1 
ATOM   5154 N N    . SER C 1 100 ? 45.811 3.687   52.371 1.00 47.93  ? 145 SER C N    1 
ATOM   5155 C CA   . SER C 1 100 ? 46.884 4.083   51.467 1.00 47.98  ? 145 SER C CA   1 
ATOM   5156 C C    . SER C 1 100 ? 47.572 5.358   51.948 1.00 45.65  ? 145 SER C C    1 
ATOM   5157 O O    . SER C 1 100 ? 48.791 5.386   52.144 1.00 43.17  ? 145 SER C O    1 
ATOM   5158 C CB   . SER C 1 100 ? 46.329 4.267   50.052 1.00 49.95  ? 145 SER C CB   1 
ATOM   5159 O OG   . SER C 1 100 ? 45.948 3.023   49.487 1.00 53.23  ? 145 SER C OG   1 
ATOM   5160 H H    . SER C 1 100 ? 45.047 3.587   51.990 1.00 57.52  ? 145 SER C H    1 
ATOM   5161 H HA   . SER C 1 100 ? 47.549 3.377   51.438 1.00 57.57  ? 145 SER C HA   1 
ATOM   5162 H HB2  . SER C 1 100 ? 45.551 4.846   50.092 1.00 59.95  ? 145 SER C HB2  1 
ATOM   5163 H HB3  . SER C 1 100 ? 47.013 4.669   49.495 1.00 59.95  ? 145 SER C HB3  1 
ATOM   5164 H HG   . SER C 1 100 ? 45.354 2.662   49.959 1.00 63.87  ? 145 SER C HG   1 
ATOM   5165 N N    . ARG C 1 101 ? 46.801 6.430   52.146 1.00 42.25  ? 146 ARG C N    1 
ATOM   5166 C CA   . ARG C 1 101 ? 47.409 7.688   52.565 1.00 41.19  ? 146 ARG C CA   1 
ATOM   5167 C C    . ARG C 1 101 ? 47.942 7.594   53.989 1.00 42.18  ? 146 ARG C C    1 
ATOM   5168 O O    . ARG C 1 101 ? 49.031 8.102   54.281 1.00 40.62  ? 146 ARG C O    1 
ATOM   5169 C CB   . ARG C 1 101 ? 46.406 8.836   52.428 1.00 41.14  ? 146 ARG C CB   1 
ATOM   5170 C CG   . ARG C 1 101 ? 46.098 9.175   50.974 1.00 41.97  ? 146 ARG C CG   1 
ATOM   5171 C CD   . ARG C 1 101 ? 45.259 10.421  50.831 1.00 44.68  ? 146 ARG C CD   1 
ATOM   5172 N NE   . ARG C 1 101 ? 45.008 10.754  49.428 1.00 47.59  ? 146 ARG C NE   1 
ATOM   5173 C CZ   . ARG C 1 101 ? 45.726 11.611  48.704 1.00 48.69  ? 146 ARG C CZ   1 
ATOM   5174 N NH1  . ARG C 1 101 ? 45.400 11.837  47.436 1.00 50.99  ? 146 ARG C NH1  1 
ATOM   5175 N NH2  . ARG C 1 101 ? 46.769 12.244  49.231 1.00 47.15  ? 146 ARG C NH2  1 
ATOM   5176 H H    . ARG C 1 101 ? 45.947 6.453   52.047 1.00 50.69  ? 146 ARG C H    1 
ATOM   5177 H HA   . ARG C 1 101 ? 48.160 7.880   51.981 1.00 49.43  ? 146 ARG C HA   1 
ATOM   5178 H HB2  . ARG C 1 101 ? 45.575 8.584   52.860 1.00 49.37  ? 146 ARG C HB2  1 
ATOM   5179 H HB3  . ARG C 1 101 ? 46.772 9.629   52.850 1.00 49.37  ? 146 ARG C HB3  1 
ATOM   5180 H HG2  . ARG C 1 101 ? 46.931 9.319   50.499 1.00 50.36  ? 146 ARG C HG2  1 
ATOM   5181 H HG3  . ARG C 1 101 ? 45.611 8.438   50.573 1.00 50.36  ? 146 ARG C HG3  1 
ATOM   5182 H HD2  . ARG C 1 101 ? 44.403 10.280  51.267 1.00 53.61  ? 146 ARG C HD2  1 
ATOM   5183 H HD3  . ARG C 1 101 ? 45.724 11.167  51.241 1.00 53.61  ? 146 ARG C HD3  1 
ATOM   5184 H HE   . ARG C 1 101 ? 44.345 10.366  49.041 1.00 57.10  ? 146 ARG C HE   1 
ATOM   5185 H HH11 . ARG C 1 101 ? 44.728 11.431  47.086 1.00 61.19  ? 146 ARG C HH11 1 
ATOM   5186 H HH12 . ARG C 1 101 ? 45.863 12.388  46.965 1.00 61.19  ? 146 ARG C HH12 1 
ATOM   5187 H HH21 . ARG C 1 101 ? 46.987 12.105  50.051 1.00 56.57  ? 146 ARG C HH21 1 
ATOM   5188 H HH22 . ARG C 1 101 ? 47.225 12.794  48.753 1.00 56.57  ? 146 ARG C HH22 1 
ATOM   5189 N N    . CYS C 1 102 ? 47.195 6.949   54.890 1.00 45.05  ? 147 CYS C N    1 
ATOM   5190 C CA   . CYS C 1 102 ? 47.671 6.781   56.260 1.00 45.69  ? 147 CYS C CA   1 
ATOM   5191 C C    . CYS C 1 102 ? 48.974 6.002   56.291 1.00 44.32  ? 147 CYS C C    1 
ATOM   5192 O O    . CYS C 1 102 ? 49.848 6.269   57.122 1.00 43.89  ? 147 CYS C O    1 
ATOM   5193 C CB   . CYS C 1 102 ? 46.621 6.066   57.108 1.00 47.99  ? 147 CYS C CB   1 
ATOM   5194 S SG   . CYS C 1 102 ? 45.112 7.003   57.337 1.00 51.22  ? 147 CYS C SG   1 
ATOM   5195 H H    . CYS C 1 102 ? 46.422 6.605   54.734 1.00 54.06  ? 147 CYS C H    1 
ATOM   5196 H HA   . CYS C 1 102 ? 47.832 7.654   56.651 1.00 54.83  ? 147 CYS C HA   1 
ATOM   5197 H HB2  . CYS C 1 102 ? 46.387 5.230   56.676 1.00 57.59  ? 147 CYS C HB2  1 
ATOM   5198 H HB3  . CYS C 1 102 ? 46.995 5.889   57.985 1.00 57.59  ? 147 CYS C HB3  1 
ATOM   5199 H HG   . CYS C 1 102 ? 44.621 7.221   56.264 1.00 61.47  ? 147 CYS C HG   1 
ATOM   5200 N N    . TRP C 1 103 ? 49.116 5.024   55.397 1.00 44.13  ? 148 TRP C N    1 
ATOM   5201 C CA   . TRP C 1 103 ? 50.328 4.212   55.354 1.00 41.66  ? 148 TRP C CA   1 
ATOM   5202 C C    . TRP C 1 103 ? 51.513 5.038   54.876 1.00 42.26  ? 148 TRP C C    1 
ATOM   5203 O O    . TRP C 1 103 ? 52.597 4.988   55.467 1.00 41.10  ? 148 TRP C O    1 
ATOM   5204 C CB   . TRP C 1 103 ? 50.089 3.003   54.449 1.00 41.15  ? 148 TRP C CB   1 
ATOM   5205 C CG   . TRP C 1 103 ? 51.284 2.123   54.203 1.00 39.27  ? 148 TRP C CG   1 
ATOM   5206 C CD1  . TRP C 1 103 ? 51.855 1.846   52.998 1.00 38.28  ? 148 TRP C CD1  1 
ATOM   5207 C CD2  . TRP C 1 103 ? 52.038 1.393   55.180 1.00 37.31  ? 148 TRP C CD2  1 
ATOM   5208 N NE1  . TRP C 1 103 ? 52.913 1.000   53.161 1.00 37.99  ? 148 TRP C NE1  1 
ATOM   5209 C CE2  . TRP C 1 103 ? 53.049 0.704   54.492 1.00 37.11  ? 148 TRP C CE2  1 
ATOM   5210 C CE3  . TRP C 1 103 ? 51.955 1.257   56.568 1.00 36.89  ? 148 TRP C CE3  1 
ATOM   5211 C CZ2  . TRP C 1 103 ? 53.975 -0.111  55.143 1.00 37.51  ? 148 TRP C CZ2  1 
ATOM   5212 C CZ3  . TRP C 1 103 ? 52.873 0.448   57.211 1.00 37.04  ? 148 TRP C CZ3  1 
ATOM   5213 C CH2  . TRP C 1 103 ? 53.868 -0.226  56.499 1.00 36.29  ? 148 TRP C CH2  1 
ATOM   5214 H H    . TRP C 1 103 ? 48.526 4.812   54.808 1.00 52.96  ? 148 TRP C H    1 
ATOM   5215 H HA   . TRP C 1 103 ? 50.526 3.887   56.246 1.00 49.99  ? 148 TRP C HA   1 
ATOM   5216 H HB2  . TRP C 1 103 ? 49.401 2.451   54.853 1.00 49.38  ? 148 TRP C HB2  1 
ATOM   5217 H HB3  . TRP C 1 103 ? 49.782 3.323   53.587 1.00 49.38  ? 148 TRP C HB3  1 
ATOM   5218 H HD1  . TRP C 1 103 ? 51.567 2.187   52.182 1.00 45.94  ? 148 TRP C HD1  1 
ATOM   5219 H HE1  . TRP C 1 103 ? 53.414 0.701   52.530 1.00 45.58  ? 148 TRP C HE1  1 
ATOM   5220 H HE3  . TRP C 1 103 ? 51.294 1.700   57.049 1.00 44.27  ? 148 TRP C HE3  1 
ATOM   5221 H HZ2  . TRP C 1 103 ? 54.639 -0.559  54.671 1.00 45.02  ? 148 TRP C HZ2  1 
ATOM   5222 H HZ3  . TRP C 1 103 ? 52.828 0.351   58.135 1.00 44.44  ? 148 TRP C HZ3  1 
ATOM   5223 H HH2  . TRP C 1 103 ? 54.474 -0.760  56.960 1.00 43.55  ? 148 TRP C HH2  1 
ATOM   5224 N N    . GLU C 1 104 ? 51.320 5.820   53.812 1.00 45.07  ? 149 GLU C N    1 
ATOM   5225 C CA   . GLU C 1 104 ? 52.382 6.693   53.324 1.00 44.84  ? 149 GLU C CA   1 
ATOM   5226 C C    . GLU C 1 104 ? 52.770 7.723   54.376 1.00 44.61  ? 149 GLU C C    1 
ATOM   5227 O O    . GLU C 1 104 ? 53.957 7.907   54.675 1.00 44.94  ? 149 GLU C O    1 
ATOM   5228 C CB   . GLU C 1 104 ? 51.937 7.387   52.037 1.00 46.94  ? 149 GLU C CB   1 
ATOM   5229 C CG   . GLU C 1 104 ? 53.007 8.261   51.401 1.00 46.32  ? 149 GLU C CG   1 
ATOM   5230 C CD   . GLU C 1 104 ? 52.548 8.885   50.108 1.00 47.81  ? 149 GLU C CD   1 
ATOM   5231 O OE1  . GLU C 1 104 ? 52.437 10.129  50.060 1.00 48.86  ? 149 GLU C OE1  1 
ATOM   5232 O OE2  . GLU C 1 104 ? 52.286 8.135   49.143 1.00 49.31  ? 149 GLU C OE2  1 
ATOM   5233 H H    . GLU C 1 104 ? 50.589 5.861   53.360 1.00 54.08  ? 149 GLU C H    1 
ATOM   5234 H HA   . GLU C 1 104 ? 53.166 6.158   53.123 1.00 53.81  ? 149 GLU C HA   1 
ATOM   5235 H HB2  . GLU C 1 104 ? 51.684 6.711   51.390 1.00 56.33  ? 149 GLU C HB2  1 
ATOM   5236 H HB3  . GLU C 1 104 ? 51.174 7.952   52.236 1.00 56.33  ? 149 GLU C HB3  1 
ATOM   5237 H HG2  . GLU C 1 104 ? 53.239 8.975   52.014 1.00 55.59  ? 149 GLU C HG2  1 
ATOM   5238 H HG3  . GLU C 1 104 ? 53.788 7.717   51.212 1.00 55.59  ? 149 GLU C HG3  1 
ATOM   5239 N N    . ASN C 1 105 ? 51.778 8.418   54.940 1.00 42.29  ? 150 ASN C N    1 
ATOM   5240 C CA   . ASN C 1 105 ? 52.066 9.414   55.966 1.00 41.30  ? 150 ASN C CA   1 
ATOM   5241 C C    . ASN C 1 105 ? 52.838 8.798   57.127 1.00 39.86  ? 150 ASN C C    1 
ATOM   5242 O O    . ASN C 1 105 ? 53.798 9.393   57.631 1.00 39.17  ? 150 ASN C O    1 
ATOM   5243 C CB   . ASN C 1 105 ? 50.766 10.041  56.472 1.00 41.96  ? 150 ASN C CB   1 
ATOM   5244 C CG   . ASN C 1 105 ? 50.193 11.087  55.515 1.00 43.93  ? 150 ASN C CG   1 
ATOM   5245 O OD1  . ASN C 1 105 ? 50.890 11.602  54.640 1.00 42.63  ? 150 ASN C OD1  1 
ATOM   5246 N ND2  . ASN C 1 105 ? 48.914 11.413  55.694 1.00 44.43  ? 150 ASN C ND2  1 
ATOM   5247 H H    . ASN C 1 105 ? 50.944 8.332   54.748 1.00 50.75  ? 150 ASN C H    1 
ATOM   5248 H HA   . ASN C 1 105 ? 52.611 10.118  55.582 1.00 49.56  ? 150 ASN C HA   1 
ATOM   5249 H HB2  . ASN C 1 105 ? 50.102 9.342   56.584 1.00 50.35  ? 150 ASN C HB2  1 
ATOM   5250 H HB3  . ASN C 1 105 ? 50.936 10.475  57.323 1.00 50.35  ? 150 ASN C HB3  1 
ATOM   5251 H HD21 . ASN C 1 105 ? 48.543 11.996  55.183 1.00 53.31  ? 150 ASN C HD21 1 
ATOM   5252 H HD22 . ASN C 1 105 ? 48.459 11.040  56.321 1.00 53.31  ? 150 ASN C HD22 1 
ATOM   5253 N N    . LEU C 1 106 ? 52.434 7.602   57.565 1.00 36.07  ? 151 LEU C N    1 
ATOM   5254 C CA   . LEU C 1 106 ? 53.082 6.990   58.720 1.00 36.17  ? 151 LEU C CA   1 
ATOM   5255 C C    . LEU C 1 106 ? 54.539 6.657   58.422 1.00 34.70  ? 151 LEU C C    1 
ATOM   5256 O O    . LEU C 1 106 ? 55.422 6.913   59.245 1.00 33.61  ? 151 LEU C O    1 
ATOM   5257 C CB   . LEU C 1 106 ? 52.337 5.727   59.141 1.00 34.45  ? 151 LEU C CB   1 
ATOM   5258 C CG   . LEU C 1 106 ? 52.993 4.913   60.264 1.00 33.72  ? 151 LEU C CG   1 
ATOM   5259 C CD1  . LEU C 1 106 ? 53.217 5.773   61.499 1.00 34.24  ? 151 LEU C CD1  1 
ATOM   5260 C CD2  . LEU C 1 106 ? 52.157 3.679   60.629 1.00 34.81  ? 151 LEU C CD2  1 
ATOM   5261 H H    . LEU C 1 106 ? 51.800 7.136   57.218 1.00 43.28  ? 151 LEU C H    1 
ATOM   5262 H HA   . LEU C 1 106 ? 53.062 7.614   59.462 1.00 43.40  ? 151 LEU C HA   1 
ATOM   5263 H HB2  . LEU C 1 106 ? 51.452 5.981   59.446 1.00 41.34  ? 151 LEU C HB2  1 
ATOM   5264 H HB3  . LEU C 1 106 ? 52.259 5.146   58.369 1.00 41.34  ? 151 LEU C HB3  1 
ATOM   5265 H HG   . LEU C 1 106 ? 53.860 4.603   59.958 1.00 40.46  ? 151 LEU C HG   1 
ATOM   5266 H HD11 . LEU C 1 106 ? 53.631 5.233   62.189 1.00 41.09  ? 151 LEU C HD11 1 
ATOM   5267 H HD12 . LEU C 1 106 ? 53.797 6.515   61.265 1.00 41.09  ? 151 LEU C HD12 1 
ATOM   5268 H HD13 . LEU C 1 106 ? 52.361 6.108   61.809 1.00 41.09  ? 151 LEU C HD13 1 
ATOM   5269 H HD21 . LEU C 1 106 ? 52.606 3.194   61.340 1.00 41.77  ? 151 LEU C HD21 1 
ATOM   5270 H HD22 . LEU C 1 106 ? 51.281 3.968   60.927 1.00 41.77  ? 151 LEU C HD22 1 
ATOM   5271 H HD23 . LEU C 1 106 ? 52.071 3.113   59.846 1.00 41.77  ? 151 LEU C HD23 1 
ATOM   5272 N N    . ILE C 1 107 ? 54.806 6.066   57.258 1.00 40.24  ? 152 ILE C N    1 
ATOM   5273 C CA   . ILE C 1 107 ? 56.147 5.558   56.989 1.00 43.92  ? 152 ILE C CA   1 
ATOM   5274 C C    . ILE C 1 107 ? 57.091 6.690   56.632 1.00 44.94  ? 152 ILE C C    1 
ATOM   5275 O O    . ILE C 1 107 ? 58.294 6.587   56.876 1.00 41.37  ? 152 ILE C O    1 
ATOM   5276 C CB   . ILE C 1 107 ? 56.126 4.484   55.886 1.00 45.42  ? 152 ILE C CB   1 
ATOM   5277 C CG1  . ILE C 1 107 ? 55.650 5.076   54.554 1.00 41.49  ? 152 ILE C CG1  1 
ATOM   5278 C CG2  . ILE C 1 107 ? 55.255 3.315   56.316 1.00 42.39  ? 152 ILE C CG2  1 
ATOM   5279 C CD1  . ILE C 1 107 ? 55.687 4.105   53.394 1.00 43.28  ? 152 ILE C CD1  1 
ATOM   5280 H H    . ILE C 1 107 ? 54.240 5.950   56.621 1.00 48.29  ? 152 ILE C H    1 
ATOM   5281 H HA   . ILE C 1 107 ? 56.485 5.140   57.796 1.00 52.70  ? 152 ILE C HA   1 
ATOM   5282 H HB   . ILE C 1 107 ? 57.032 4.158   55.765 1.00 54.50  ? 152 ILE C HB   1 
ATOM   5283 H HG12 . ILE C 1 107 ? 54.734 5.377   54.658 1.00 49.78  ? 152 ILE C HG12 1 
ATOM   5284 H HG13 . ILE C 1 107 ? 56.219 5.828   54.328 1.00 49.78  ? 152 ILE C HG13 1 
ATOM   5285 H HG21 . ILE C 1 107 ? 55.252 2.648   55.612 1.00 50.87  ? 152 ILE C HG21 1 
ATOM   5286 H HG22 . ILE C 1 107 ? 55.618 2.934   57.131 1.00 50.87  ? 152 ILE C HG22 1 
ATOM   5287 H HG23 . ILE C 1 107 ? 54.353 3.635   56.473 1.00 50.87  ? 152 ILE C HG23 1 
ATOM   5288 H HD11 . ILE C 1 107 ? 55.372 4.557   52.595 1.00 51.94  ? 152 ILE C HD11 1 
ATOM   5289 H HD12 . ILE C 1 107 ? 56.599 3.802   53.265 1.00 51.94  ? 152 ILE C HD12 1 
ATOM   5290 H HD13 . ILE C 1 107 ? 55.112 3.350   53.596 1.00 51.94  ? 152 ILE C HD13 1 
ATOM   5291 N N    . LEU C 1 108 ? 56.577 7.782   56.056 1.00 38.58  ? 153 LEU C N    1 
ATOM   5292 C CA   . LEU C 1 108 ? 57.404 8.973   55.881 1.00 39.23  ? 153 LEU C CA   1 
ATOM   5293 C C    . LEU C 1 108 ? 57.829 9.537   57.226 1.00 36.02  ? 153 LEU C C    1 
ATOM   5294 O O    . LEU C 1 108 ? 58.977 9.963   57.401 1.00 34.14  ? 153 LEU C O    1 
ATOM   5295 C CB   . LEU C 1 108 ? 56.647 10.027  55.075 1.00 38.07  ? 153 LEU C CB   1 
ATOM   5296 C CG   . LEU C 1 108 ? 56.380 9.687   53.611 1.00 38.93  ? 153 LEU C CG   1 
ATOM   5297 C CD1  . LEU C 1 108 ? 55.683 10.845  52.939 1.00 40.02  ? 153 LEU C CD1  1 
ATOM   5298 C CD2  . LEU C 1 108 ? 57.687 9.328   52.861 1.00 39.60  ? 153 LEU C CD2  1 
ATOM   5299 H H    . LEU C 1 108 ? 55.771 7.856   55.766 1.00 46.29  ? 153 LEU C H    1 
ATOM   5300 H HA   . LEU C 1 108 ? 58.204 8.734   55.388 1.00 47.07  ? 153 LEU C HA   1 
ATOM   5301 H HB2  . LEU C 1 108 ? 55.788 10.176  55.499 1.00 45.69  ? 153 LEU C HB2  1 
ATOM   5302 H HB3  . LEU C 1 108 ? 57.161 10.850  55.091 1.00 45.69  ? 153 LEU C HB3  1 
ATOM   5303 H HG   . LEU C 1 108 ? 55.791 8.917   53.568 1.00 46.71  ? 153 LEU C HG   1 
ATOM   5304 H HD11 . LEU C 1 108 ? 55.518 10.619  52.010 1.00 48.03  ? 153 LEU C HD11 1 
ATOM   5305 H HD12 . LEU C 1 108 ? 54.842 11.013  53.393 1.00 48.03  ? 153 LEU C HD12 1 
ATOM   5306 H HD13 . LEU C 1 108 ? 56.251 11.629  52.993 1.00 48.03  ? 153 LEU C HD13 1 
ATOM   5307 H HD21 . LEU C 1 108 ? 57.474 9.119   51.938 1.00 47.53  ? 153 LEU C HD21 1 
ATOM   5308 H HD22 . LEU C 1 108 ? 58.290 10.087  52.898 1.00 47.53  ? 153 LEU C HD22 1 
ATOM   5309 H HD23 . LEU C 1 108 ? 58.096 8.559   53.289 1.00 47.53  ? 153 LEU C HD23 1 
ATOM   5310 N N    . ALA C 1 109 ? 56.917 9.534   58.195 1.00 33.83  ? 154 ALA C N    1 
ATOM   5311 C CA   . ALA C 1 109 ? 57.246 10.020  59.529 1.00 35.15  ? 154 ALA C CA   1 
ATOM   5312 C C    . ALA C 1 109 ? 58.244 9.095   60.218 1.00 36.22  ? 154 ALA C C    1 
ATOM   5313 O O    . ALA C 1 109 ? 59.223 9.554   60.821 1.00 36.17  ? 154 ALA C O    1 
ATOM   5314 C CB   . ALA C 1 109 ? 55.964 10.153  60.350 1.00 34.61  ? 154 ALA C CB   1 
ATOM   5315 H H    . ALA C 1 109 ? 56.107 9.257   58.106 1.00 40.60  ? 154 ALA C H    1 
ATOM   5316 H HA   . ALA C 1 109 ? 57.650 10.899  59.456 1.00 42.18  ? 154 ALA C HA   1 
ATOM   5317 H HB1  . ALA C 1 109 ? 56.190 10.477  61.236 1.00 41.54  ? 154 ALA C HB1  1 
ATOM   5318 H HB2  . ALA C 1 109 ? 55.371 10.781  59.908 1.00 41.54  ? 154 ALA C HB2  1 
ATOM   5319 H HB3  . ALA C 1 109 ? 55.538 9.284   60.413 1.00 41.54  ? 154 ALA C HB3  1 
ATOM   5320 N N    . MET C 1 110 ? 58.007 7.784   60.141 1.00 41.73  ? 155 MET C N    1 
ATOM   5321 C CA   . MET C 1 110 ? 58.905 6.825   60.775 1.00 44.91  ? 155 MET C CA   1 
ATOM   5322 C C    . MET C 1 110 ? 60.300 6.897   60.161 1.00 44.80  ? 155 MET C C    1 
ATOM   5323 O O    . MET C 1 110 ? 61.298 7.055   60.874 1.00 46.15  ? 155 MET C O    1 
ATOM   5324 C CB   . MET C 1 110 ? 58.321 5.413   60.648 1.00 42.76  ? 155 MET C CB   1 
ATOM   5325 C CG   . MET C 1 110 ? 59.192 4.302   61.243 1.00 44.67  ? 155 MET C CG   1 
ATOM   5326 S SD   . MET C 1 110 ? 58.392 2.677   61.180 1.00 43.10  ? 155 MET C SD   1 
ATOM   5327 C CE   . MET C 1 110 ? 58.451 2.344   59.422 1.00 42.59  ? 155 MET C CE   1 
ATOM   5328 H H    . MET C 1 110 ? 57.340 7.429   59.730 1.00 50.08  ? 155 MET C H    1 
ATOM   5329 H HA   . MET C 1 110 ? 58.969 7.035   61.719 1.00 53.89  ? 155 MET C HA   1 
ATOM   5330 H HB2  . MET C 1 110 ? 57.465 5.390   61.104 1.00 51.31  ? 155 MET C HB2  1 
ATOM   5331 H HB3  . MET C 1 110 ? 58.194 5.214   59.707 1.00 51.31  ? 155 MET C HB3  1 
ATOM   5332 H HG2  . MET C 1 110 ? 60.021 4.248   60.742 1.00 53.61  ? 155 MET C HG2  1 
ATOM   5333 H HG3  . MET C 1 110 ? 59.379 4.509   62.172 1.00 53.61  ? 155 MET C HG3  1 
ATOM   5334 H HE1  . MET C 1 110 ? 58.044 1.481   59.250 1.00 51.11  ? 155 MET C HE1  1 
ATOM   5335 H HE2  . MET C 1 110 ? 57.964 3.040   58.952 1.00 51.11  ? 155 MET C HE2  1 
ATOM   5336 H HE3  . MET C 1 110 ? 59.378 2.336   59.133 1.00 51.11  ? 155 MET C HE3  1 
ATOM   5337 N N    . LEU C 1 111 ? 60.388 6.798   58.833 1.00 41.19  ? 156 LEU C N    1 
ATOM   5338 C CA   . LEU C 1 111 ? 61.694 6.804   58.182 1.00 40.80  ? 156 LEU C CA   1 
ATOM   5339 C C    . LEU C 1 111 ? 62.410 8.130   58.397 1.00 37.87  ? 156 LEU C C    1 
ATOM   5340 O O    . LEU C 1 111 ? 63.635 8.158   58.546 1.00 37.42  ? 156 LEU C O    1 
ATOM   5341 C CB   . LEU C 1 111 ? 61.545 6.516   56.687 1.00 41.95  ? 156 LEU C CB   1 
ATOM   5342 C CG   . LEU C 1 111 ? 60.931 5.178   56.273 1.00 41.44  ? 156 LEU C CG   1 
ATOM   5343 C CD1  . LEU C 1 111 ? 61.122 4.971   54.778 1.00 43.33  ? 156 LEU C CD1  1 
ATOM   5344 C CD2  . LEU C 1 111 ? 61.532 4.029   57.051 1.00 44.10  ? 156 LEU C CD2  1 
ATOM   5345 H H    . LEU C 1 111 ? 59.719 6.726   58.297 1.00 49.43  ? 156 LEU C H    1 
ATOM   5346 H HA   . LEU C 1 111 ? 62.242 6.103   58.568 1.00 48.96  ? 156 LEU C HA   1 
ATOM   5347 H HB2  . LEU C 1 111 ? 60.989 7.212   56.304 1.00 50.34  ? 156 LEU C HB2  1 
ATOM   5348 H HB3  . LEU C 1 111 ? 62.427 6.558   56.286 1.00 50.34  ? 156 LEU C HB3  1 
ATOM   5349 H HG   . LEU C 1 111 ? 59.979 5.197   56.454 1.00 49.72  ? 156 LEU C HG   1 
ATOM   5350 H HD11 . LEU C 1 111 ? 60.730 4.121   54.525 1.00 52.00  ? 156 LEU C HD11 1 
ATOM   5351 H HD12 . LEU C 1 111 ? 60.684 5.693   54.302 1.00 52.00  ? 156 LEU C HD12 1 
ATOM   5352 H HD13 . LEU C 1 111 ? 62.071 4.971   54.579 1.00 52.00  ? 156 LEU C HD13 1 
ATOM   5353 H HD21 . LEU C 1 111 ? 61.119 3.201   56.760 1.00 52.92  ? 156 LEU C HD21 1 
ATOM   5354 H HD22 . LEU C 1 111 ? 62.487 4.000   56.883 1.00 52.92  ? 156 LEU C HD22 1 
ATOM   5355 H HD23 . LEU C 1 111 ? 61.366 4.168   57.996 1.00 52.92  ? 156 LEU C HD23 1 
ATOM   5356 N N    . GLY C 1 112 ? 61.661 9.237   58.422 1.00 35.08  ? 157 GLY C N    1 
ATOM   5357 C CA   . GLY C 1 112 ? 62.181 10.578  58.632 1.00 33.58  ? 157 GLY C CA   1 
ATOM   5358 C C    . GLY C 1 112 ? 62.590 10.898  60.051 1.00 34.26  ? 157 GLY C C    1 
ATOM   5359 O O    . GLY C 1 112 ? 63.070 12.007  60.312 1.00 34.23  ? 157 GLY C O    1 
ATOM   5360 H H    . GLY C 1 112 ? 60.808 9.227   58.314 1.00 42.10  ? 157 GLY C H    1 
ATOM   5361 H HA2  . GLY C 1 112 ? 62.955 10.706  58.063 1.00 40.30  ? 157 GLY C HA2  1 
ATOM   5362 H HA3  . GLY C 1 112 ? 61.505 11.220  58.365 1.00 40.30  ? 157 GLY C HA3  1 
ATOM   5363 N N    . GLU C 1 113 ? 62.426 9.949   60.975 1.00 36.57  ? 158 GLU C N    1 
ATOM   5364 C CA   . GLU C 1 113 ? 62.799 10.127  62.381 1.00 38.98  ? 158 GLU C CA   1 
ATOM   5365 C C    . GLU C 1 113 ? 62.002 11.240  63.054 1.00 40.25  ? 158 GLU C C    1 
ATOM   5366 O O    . GLU C 1 113 ? 62.504 11.925  63.950 1.00 40.33  ? 158 GLU C O    1 
ATOM   5367 C CB   . GLU C 1 113 ? 64.302 10.385  62.522 1.00 41.36  ? 158 GLU C CB   1 
ATOM   5368 C CG   . GLU C 1 113 ? 65.146 9.149   62.253 1.00 43.73  ? 158 GLU C CG   1 
ATOM   5369 C CD   . GLU C 1 113 ? 64.861 8.029   63.234 1.00 43.67  ? 158 GLU C CD   1 
ATOM   5370 O OE1  . GLU C 1 113 ? 64.713 8.306   64.445 1.00 44.95  ? 158 GLU C OE1  1 
ATOM   5371 O OE2  . GLU C 1 113 ? 64.770 6.873   62.786 1.00 43.58  ? 158 GLU C OE2  1 
ATOM   5372 H H    . GLU C 1 113 ? 62.091 9.175   60.808 1.00 43.89  ? 158 GLU C H    1 
ATOM   5373 H HA   . GLU C 1 113 ? 62.602 9.303   62.855 1.00 46.77  ? 158 GLU C HA   1 
ATOM   5374 H HB2  . GLU C 1 113 ? 64.565 11.071  61.888 1.00 49.63  ? 158 GLU C HB2  1 
ATOM   5375 H HB3  . GLU C 1 113 ? 64.487 10.683  63.427 1.00 49.63  ? 158 GLU C HB3  1 
ATOM   5376 H HG2  . GLU C 1 113 ? 64.955 8.823   61.360 1.00 52.48  ? 158 GLU C HG2  1 
ATOM   5377 H HG3  . GLU C 1 113 ? 66.085 9.383   62.329 1.00 52.48  ? 158 GLU C HG3  1 
ATOM   5378 N N    . GLN C 1 114 ? 60.743 11.413  62.651 1.00 40.73  ? 159 GLN C N    1 
ATOM   5379 C CA   . GLN C 1 114 ? 59.883 12.444  63.215 1.00 42.51  ? 159 GLN C CA   1 
ATOM   5380 C C    . GLN C 1 114 ? 59.164 11.998  64.482 1.00 45.18  ? 159 GLN C C    1 
ATOM   5381 O O    . GLN C 1 114 ? 58.317 12.737  64.987 1.00 46.65  ? 159 GLN C O    1 
ATOM   5382 C CB   . GLN C 1 114 ? 58.858 12.901  62.172 1.00 42.93  ? 159 GLN C CB   1 
ATOM   5383 C CG   . GLN C 1 114 ? 59.470 13.527  60.941 1.00 42.61  ? 159 GLN C CG   1 
ATOM   5384 C CD   . GLN C 1 114 ? 60.420 14.666  61.273 1.00 45.06  ? 159 GLN C CD   1 
ATOM   5385 O OE1  . GLN C 1 114 ? 60.015 15.709  61.791 1.00 45.19  ? 159 GLN C OE1  1 
ATOM   5386 N NE2  . GLN C 1 114 ? 61.696 14.462  60.984 1.00 44.02  ? 159 GLN C NE2  1 
ATOM   5387 H H    . GLN C 1 114 ? 60.362 10.937  62.044 1.00 48.88  ? 159 GLN C H    1 
ATOM   5388 H HA   . GLN C 1 114 ? 60.430 13.211  63.444 1.00 51.02  ? 159 GLN C HA   1 
ATOM   5389 H HB2  . GLN C 1 114 ? 58.340 12.133  61.887 1.00 51.52  ? 159 GLN C HB2  1 
ATOM   5390 H HB3  . GLN C 1 114 ? 58.273 13.559  62.578 1.00 51.52  ? 159 GLN C HB3  1 
ATOM   5391 H HG2  . GLN C 1 114 ? 59.970 12.850  60.458 1.00 51.14  ? 159 GLN C HG2  1 
ATOM   5392 H HG3  . GLN C 1 114 ? 58.762 13.880  60.380 1.00 51.14  ? 159 GLN C HG3  1 
ATOM   5393 H HE21 . GLN C 1 114 ? 61.943 13.719  60.630 1.00 52.83  ? 159 GLN C HE21 1 
ATOM   5394 H HE22 . GLN C 1 114 ? 62.278 15.073  61.151 1.00 52.83  ? 159 GLN C HE22 1 
ATOM   5395 N N    . PHE C 1 115 ? 59.479 10.820  65.014 1.00 45.67  ? 160 PHE C N    1 
ATOM   5396 C CA   . PHE C 1 115 ? 58.809 10.337  66.213 1.00 48.47  ? 160 PHE C CA   1 
ATOM   5397 C C    . PHE C 1 115 ? 59.545 10.690  67.501 1.00 53.67  ? 160 PHE C C    1 
ATOM   5398 O O    . PHE C 1 115 ? 58.908 10.754  68.560 1.00 59.03  ? 160 PHE C O    1 
ATOM   5399 C CB   . PHE C 1 115 ? 58.594 8.826   66.108 1.00 45.24  ? 160 PHE C CB   1 
ATOM   5400 C CG   . PHE C 1 115 ? 57.311 8.461   65.415 1.00 43.64  ? 160 PHE C CG   1 
ATOM   5401 C CD1  . PHE C 1 115 ? 57.269 8.322   64.040 1.00 40.99  ? 160 PHE C CD1  1 
ATOM   5402 C CD2  . PHE C 1 115 ? 56.140 8.291   66.136 1.00 42.81  ? 160 PHE C CD2  1 
ATOM   5403 C CE1  . PHE C 1 115 ? 56.094 7.996   63.398 1.00 39.51  ? 160 PHE C CE1  1 
ATOM   5404 C CE2  . PHE C 1 115 ? 54.959 7.975   65.497 1.00 42.36  ? 160 PHE C CE2  1 
ATOM   5405 C CZ   . PHE C 1 115 ? 54.936 7.826   64.126 1.00 40.16  ? 160 PHE C CZ   1 
ATOM   5406 H H    . PHE C 1 115 ? 60.075 10.284  64.700 1.00 54.81  ? 160 PHE C H    1 
ATOM   5407 H HA   . PHE C 1 115 ? 57.933 10.751  66.259 1.00 58.16  ? 160 PHE C HA   1 
ATOM   5408 H HB2  . PHE C 1 115 ? 59.326 8.437   65.605 1.00 54.29  ? 160 PHE C HB2  1 
ATOM   5409 H HB3  . PHE C 1 115 ? 58.569 8.449   67.001 1.00 54.29  ? 160 PHE C HB3  1 
ATOM   5410 H HD1  . PHE C 1 115 ? 58.048 8.435   63.544 1.00 49.19  ? 160 PHE C HD1  1 
ATOM   5411 H HD2  . PHE C 1 115 ? 56.151 8.391   67.061 1.00 51.38  ? 160 PHE C HD2  1 
ATOM   5412 H HE1  . PHE C 1 115 ? 56.081 7.900   62.473 1.00 47.41  ? 160 PHE C HE1  1 
ATOM   5413 H HE2  . PHE C 1 115 ? 54.180 7.856   65.991 1.00 50.83  ? 160 PHE C HE2  1 
ATOM   5414 H HZ   . PHE C 1 115 ? 54.142 7.608   63.694 1.00 48.19  ? 160 PHE C HZ   1 
ATOM   5415 N N    . MET C 1 116 ? 60.849 10.946  67.443 1.00 55.74  ? 161 MET C N    1 
ATOM   5416 C CA   . MET C 1 116 ? 61.579 11.545  68.564 1.00 57.52  ? 161 MET C CA   1 
ATOM   5417 C C    . MET C 1 116 ? 61.540 10.646  69.802 1.00 60.80  ? 161 MET C C    1 
ATOM   5418 O O    . MET C 1 116 ? 61.272 11.100  70.917 1.00 60.32  ? 161 MET C O    1 
ATOM   5419 C CB   . MET C 1 116 ? 61.021 12.937  68.897 1.00 62.82  ? 161 MET C CB   1 
ATOM   5420 C CG   . MET C 1 116 ? 60.600 13.813  67.699 1.00 60.93  ? 161 MET C CG   1 
ATOM   5421 S SD   . MET C 1 116 ? 61.942 14.378  66.628 1.00 65.49  ? 161 MET C SD   1 
ATOM   5422 C CE   . MET C 1 116 ? 62.948 15.313  67.776 1.00 69.43  ? 161 MET C CE   1 
ATOM   5423 H H    . MET C 1 116 ? 61.341 10.782  66.757 1.00 66.88  ? 161 MET C H    1 
ATOM   5424 H HA   . MET C 1 116 ? 62.504 11.660  68.298 1.00 69.03  ? 161 MET C HA   1 
ATOM   5425 H HB2  . MET C 1 116 ? 60.238 12.824  69.459 1.00 75.38  ? 161 MET C HB2  1 
ATOM   5426 H HB3  . MET C 1 116 ? 61.700 13.427  69.387 1.00 75.38  ? 161 MET C HB3  1 
ATOM   5427 H HG2  . MET C 1 116 ? 59.985 13.303  67.148 1.00 73.11  ? 161 MET C HG2  1 
ATOM   5428 H HG3  . MET C 1 116 ? 60.150 14.601  68.040 1.00 73.11  ? 161 MET C HG3  1 
ATOM   5429 H HE1  . MET C 1 116 ? 63.714 15.673  67.303 1.00 83.31  ? 161 MET C HE1  1 
ATOM   5430 H HE2  . MET C 1 116 ? 62.416 16.036  68.144 1.00 83.31  ? 161 MET C HE2  1 
ATOM   5431 H HE3  . MET C 1 116 ? 63.244 14.724  68.488 1.00 83.31  ? 161 MET C HE3  1 
ATOM   5432 N N    . VAL C 1 117 ? 61.817 9.357   69.605 1.00 64.05  ? 162 VAL C N    1 
ATOM   5433 C CA   . VAL C 1 117 ? 61.795 8.403   70.711 1.00 65.83  ? 162 VAL C CA   1 
ATOM   5434 C C    . VAL C 1 117 ? 63.028 7.512   70.657 1.00 63.55  ? 162 VAL C C    1 
ATOM   5435 O O    . VAL C 1 117 ? 62.964 6.328   71.007 1.00 65.68  ? 162 VAL C O    1 
ATOM   5436 C CB   . VAL C 1 117 ? 60.516 7.549   70.693 1.00 61.91  ? 162 VAL C CB   1 
ATOM   5437 C CG1  . VAL C 1 117 ? 59.309 8.403   70.992 1.00 64.91  ? 162 VAL C CG1  1 
ATOM   5438 C CG2  . VAL C 1 117 ? 60.366 6.847   69.357 1.00 62.47  ? 162 VAL C CG2  1 
ATOM   5439 H H    . VAL C 1 117 ? 62.019 9.012   68.844 1.00 76.86  ? 162 VAL C H    1 
ATOM   5440 H HA   . VAL C 1 117 ? 61.817 8.891   71.549 1.00 79.00  ? 162 VAL C HA   1 
ATOM   5441 H HB   . VAL C 1 117 ? 60.580 6.870   71.383 1.00 74.29  ? 162 VAL C HB   1 
ATOM   5442 H HG11 . VAL C 1 117 ? 58.516 7.845   70.975 1.00 77.89  ? 162 VAL C HG11 1 
ATOM   5443 H HG12 . VAL C 1 117 ? 59.415 8.803   71.870 1.00 77.89  ? 162 VAL C HG12 1 
ATOM   5444 H HG13 . VAL C 1 117 ? 59.239 9.097   70.318 1.00 77.89  ? 162 VAL C HG13 1 
ATOM   5445 H HG21 . VAL C 1 117 ? 59.554 6.316   69.370 1.00 74.96  ? 162 VAL C HG21 1 
ATOM   5446 H HG22 . VAL C 1 117 ? 60.315 7.514   68.655 1.00 74.96  ? 162 VAL C HG22 1 
ATOM   5447 H HG23 . VAL C 1 117 ? 61.135 6.273   69.215 1.00 74.96  ? 162 VAL C HG23 1 
ATOM   5448 N N    . GLY C 1 118 ? 64.151 8.073   70.225 1.00 59.08  ? 163 GLY C N    1 
ATOM   5449 C CA   . GLY C 1 118 ? 65.388 7.310   70.189 1.00 58.26  ? 163 GLY C CA   1 
ATOM   5450 C C    . GLY C 1 118 ? 65.250 6.100   69.287 1.00 55.31  ? 163 GLY C C    1 
ATOM   5451 O O    . GLY C 1 118 ? 64.914 6.217   68.105 1.00 52.17  ? 163 GLY C O    1 
ATOM   5452 H H    . GLY C 1 118 ? 64.223 8.884   69.950 1.00 70.89  ? 163 GLY C H    1 
ATOM   5453 H HA2  . GLY C 1 118 ? 66.108 7.868   69.855 1.00 69.91  ? 163 GLY C HA2  1 
ATOM   5454 H HA3  . GLY C 1 118 ? 65.615 7.009   71.083 1.00 69.91  ? 163 GLY C HA3  1 
ATOM   5455 N N    . GLU C 1 119 ? 65.510 4.919   69.848 1.00 64.50  ? 164 GLU C N    1 
ATOM   5456 C CA   . GLU C 1 119 ? 65.512 3.666   69.106 1.00 66.36  ? 164 GLU C CA   1 
ATOM   5457 C C    . GLU C 1 119 ? 64.255 2.842   69.346 1.00 63.96  ? 164 GLU C C    1 
ATOM   5458 O O    . GLU C 1 119 ? 64.197 1.684   68.923 1.00 63.40  ? 164 GLU C O    1 
ATOM   5459 C CB   . GLU C 1 119 ? 66.740 2.836   69.487 1.00 73.54  ? 164 GLU C CB   1 
ATOM   5460 C CG   . GLU C 1 119 ? 68.073 3.561   69.340 1.00 79.56  ? 164 GLU C CG   1 
ATOM   5461 C CD   . GLU C 1 119 ? 69.229 2.791   69.954 1.00 84.60  ? 164 GLU C CD   1 
ATOM   5462 O OE1  . GLU C 1 119 ? 68.976 1.774   70.634 1.00 87.09  ? 164 GLU C OE1  1 
ATOM   5463 O OE2  . GLU C 1 119 ? 70.390 3.206   69.758 1.00 86.99  ? 164 GLU C OE2  1 
ATOM   5464 H H    . GLU C 1 119 ? 65.692 4.820   70.683 1.00 77.40  ? 164 GLU C H    1 
ATOM   5465 H HA   . GLU C 1 119 ? 65.565 3.862   68.158 1.00 79.63  ? 164 GLU C HA   1 
ATOM   5466 H HB2  . GLU C 1 119 ? 66.655 2.564   70.415 1.00 88.25  ? 164 GLU C HB2  1 
ATOM   5467 H HB3  . GLU C 1 119 ? 66.770 2.050   68.919 1.00 88.25  ? 164 GLU C HB3  1 
ATOM   5468 H HG2  . GLU C 1 119 ? 68.262 3.687   68.397 1.00 95.47  ? 164 GLU C HG2  1 
ATOM   5469 H HG3  . GLU C 1 119 ? 68.015 4.421   69.785 1.00 95.47  ? 164 GLU C HG3  1 
ATOM   5470 N N    . GLU C 1 120 ? 63.248 3.412   70.010 1.00 56.42  ? 165 GLU C N    1 
ATOM   5471 C CA   . GLU C 1 120 ? 62.104 2.630   70.465 1.00 53.17  ? 165 GLU C CA   1 
ATOM   5472 C C    . GLU C 1 120 ? 61.240 2.104   69.325 1.00 48.89  ? 165 GLU C C    1 
ATOM   5473 O O    . GLU C 1 120 ? 60.521 1.122   69.521 1.00 48.74  ? 165 GLU C O    1 
ATOM   5474 C CB   . GLU C 1 120 ? 61.252 3.470   71.417 1.00 52.98  ? 165 GLU C CB   1 
ATOM   5475 C CG   . GLU C 1 120 ? 61.731 3.404   72.853 1.00 54.86  ? 165 GLU C CG   1 
ATOM   5476 C CD   . GLU C 1 120 ? 61.449 2.055   73.480 1.00 56.22  ? 165 GLU C CD   1 
ATOM   5477 O OE1  . GLU C 1 120 ? 60.418 1.446   73.119 1.00 55.40  ? 165 GLU C OE1  1 
ATOM   5478 O OE2  . GLU C 1 120 ? 62.255 1.601   74.323 1.00 58.71  ? 165 GLU C OE2  1 
ATOM   5479 H H    . GLU C 1 120 ? 63.206 4.248   70.208 1.00 67.70  ? 165 GLU C H    1 
ATOM   5480 H HA   . GLU C 1 120 ? 62.431 1.864   70.962 1.00 63.81  ? 165 GLU C HA   1 
ATOM   5481 H HB2  . GLU C 1 120 ? 61.283 4.397   71.134 1.00 63.57  ? 165 GLU C HB2  1 
ATOM   5482 H HB3  . GLU C 1 120 ? 60.338 3.146   71.392 1.00 63.57  ? 165 GLU C HB3  1 
ATOM   5483 H HG2  . GLU C 1 120 ? 62.689 3.554   72.876 1.00 65.83  ? 165 GLU C HG2  1 
ATOM   5484 H HG3  . GLU C 1 120 ? 61.273 4.082   73.374 1.00 65.83  ? 165 GLU C HG3  1 
ATOM   5485 N N    . ILE C 1 121 ? 61.293 2.713   68.150 1.00 45.59  ? 166 ILE C N    1 
ATOM   5486 C CA   . ILE C 1 121 ? 60.451 2.289   67.038 1.00 43.34  ? 166 ILE C CA   1 
ATOM   5487 C C    . ILE C 1 121 ? 61.017 1.017   66.426 1.00 42.97  ? 166 ILE C C    1 
ATOM   5488 O O    . ILE C 1 121 ? 62.214 0.939   66.116 1.00 42.28  ? 166 ILE C O    1 
ATOM   5489 C CB   . ILE C 1 121 ? 60.345 3.403   65.987 1.00 41.18  ? 166 ILE C CB   1 
ATOM   5490 C CG1  . ILE C 1 121 ? 59.748 4.663   66.611 1.00 41.90  ? 166 ILE C CG1  1 
ATOM   5491 C CG2  . ILE C 1 121 ? 59.523 2.940   64.794 1.00 40.73  ? 166 ILE C CG2  1 
ATOM   5492 C CD1  . ILE C 1 121 ? 58.335 4.474   67.166 1.00 42.45  ? 166 ILE C CD1  1 
ATOM   5493 H H    . ILE C 1 121 ? 61.809 3.376   67.968 1.00 54.71  ? 166 ILE C H    1 
ATOM   5494 H HA   . ILE C 1 121 ? 59.559 2.097   67.367 1.00 52.01  ? 166 ILE C HA   1 
ATOM   5495 H HB   . ILE C 1 121 ? 61.240 3.613   65.676 1.00 49.42  ? 166 ILE C HB   1 
ATOM   5496 H HG12 . ILE C 1 121 ? 60.317 4.948   67.343 1.00 50.28  ? 166 ILE C HG12 1 
ATOM   5497 H HG13 . ILE C 1 121 ? 59.709 5.357   65.935 1.00 50.28  ? 166 ILE C HG13 1 
ATOM   5498 H HG21 . ILE C 1 121 ? 59.473 3.661   64.147 1.00 48.88  ? 166 ILE C HG21 1 
ATOM   5499 H HG22 . ILE C 1 121 ? 59.953 2.168   64.395 1.00 48.88  ? 166 ILE C HG22 1 
ATOM   5500 H HG23 . ILE C 1 121 ? 58.633 2.704   65.097 1.00 48.88  ? 166 ILE C HG23 1 
ATOM   5501 H HD11 . ILE C 1 121 ? 58.029 5.314   67.542 1.00 50.94  ? 166 ILE C HD11 1 
ATOM   5502 H HD12 . ILE C 1 121 ? 57.747 4.200   66.445 1.00 50.94  ? 166 ILE C HD12 1 
ATOM   5503 H HD13 . ILE C 1 121 ? 58.355 3.791   67.854 1.00 50.94  ? 166 ILE C HD13 1 
ATOM   5504 N N    . CYS C 1 122 ? 60.150 0.023   66.227 1.00 43.15  ? 167 CYS C N    1 
ATOM   5505 C CA   . CYS C 1 122 ? 60.526 -1.228  65.578 1.00 42.38  ? 167 CYS C CA   1 
ATOM   5506 C C    . CYS C 1 122 ? 60.084 -1.288  64.122 1.00 39.83  ? 167 CYS C C    1 
ATOM   5507 O O    . CYS C 1 122 ? 60.853 -1.733  63.264 1.00 38.83  ? 167 CYS C O    1 
ATOM   5508 C CB   . CYS C 1 122 ? 59.935 -2.413  66.346 1.00 44.57  ? 167 CYS C CB   1 
ATOM   5509 S SG   . CYS C 1 122 ? 60.420 -2.458  68.086 1.00 46.82  ? 167 CYS C SG   1 
ATOM   5510 H H    . CYS C 1 122 ? 59.324 0.052   66.465 1.00 51.78  ? 167 CYS C H    1 
ATOM   5511 H HA   . CYS C 1 122 ? 61.492 -1.313  65.599 1.00 50.86  ? 167 CYS C HA   1 
ATOM   5512 H HB2  . CYS C 1 122 ? 58.967 -2.360  66.308 1.00 53.49  ? 167 CYS C HB2  1 
ATOM   5513 H HB3  . CYS C 1 122 ? 60.237 -3.237  65.931 1.00 53.49  ? 167 CYS C HB3  1 
ATOM   5514 H HG   . CYS C 1 122 ? 59.915 -3.413  68.608 1.00 56.18  ? 167 CYS C HG   1 
ATOM   5515 N N    . GLY C 1 123 ? 58.878 -0.825  63.822 1.00 41.10  ? 168 GLY C N    1 
ATOM   5516 C CA   . GLY C 1 123 ? 58.379 -0.846  62.463 1.00 40.45  ? 168 GLY C CA   1 
ATOM   5517 C C    . GLY C 1 123 ? 56.901 -0.530  62.440 1.00 41.60  ? 168 GLY C C    1 
ATOM   5518 O O    . GLY C 1 123 ? 56.281 -0.267  63.473 1.00 43.13  ? 168 GLY C O    1 
ATOM   5519 H H    . GLY C 1 123 ? 58.328 -0.493  64.394 1.00 49.32  ? 168 GLY C H    1 
ATOM   5520 H HA2  . GLY C 1 123 ? 58.849 -0.187  61.929 1.00 48.53  ? 168 GLY C HA2  1 
ATOM   5521 H HA3  . GLY C 1 123 ? 58.518 -1.723  62.073 1.00 48.53  ? 168 GLY C HA3  1 
ATOM   5522 N N    . ALA C 1 124 ? 56.347 -0.555  61.228 1.00 39.40  ? 169 ALA C N    1 
ATOM   5523 C CA   . ALA C 1 124 ? 54.932 -0.306  61.003 1.00 38.77  ? 169 ALA C CA   1 
ATOM   5524 C C    . ALA C 1 124 ? 54.339 -1.389  60.110 1.00 39.12  ? 169 ALA C C    1 
ATOM   5525 O O    . ALA C 1 124 ? 55.040 -2.039  59.330 1.00 38.47  ? 169 ALA C O    1 
ATOM   5526 C CB   . ALA C 1 124 ? 54.705 1.065   60.367 1.00 38.33  ? 169 ALA C CB   1 
ATOM   5527 H H    . ALA C 1 124 ? 56.785 -0.719  60.506 1.00 47.28  ? 169 ALA C H    1 
ATOM   5528 H HA   . ALA C 1 124 ? 54.466 -0.326  61.854 1.00 46.52  ? 169 ALA C HA   1 
ATOM   5529 H HB1  . ALA C 1 124 ? 53.753 1.197   60.232 1.00 46.00  ? 169 ALA C HB1  1 
ATOM   5530 H HB2  . ALA C 1 124 ? 55.053 1.750   60.959 1.00 46.00  ? 169 ALA C HB2  1 
ATOM   5531 H HB3  . ALA C 1 124 ? 55.168 1.098   59.515 1.00 46.00  ? 169 ALA C HB3  1 
ATOM   5532 N N    . VAL C 1 125 ? 53.023 -1.568  60.231 1.00 43.48  ? 170 VAL C N    1 
ATOM   5533 C CA   . VAL C 1 125 ? 52.284 -2.550  59.447 1.00 45.96  ? 170 VAL C CA   1 
ATOM   5534 C C    . VAL C 1 125 ? 50.993 -1.912  58.950 1.00 48.10  ? 170 VAL C C    1 
ATOM   5535 O O    . VAL C 1 125 ? 50.399 -1.061  59.620 1.00 48.95  ? 170 VAL C O    1 
ATOM   5536 C CB   . VAL C 1 125 ? 51.972 -3.822  60.269 1.00 46.46  ? 170 VAL C CB   1 
ATOM   5537 C CG1  . VAL C 1 125 ? 51.168 -4.819  59.441 1.00 49.09  ? 170 VAL C CG1  1 
ATOM   5538 C CG2  . VAL C 1 125 ? 53.246 -4.465  60.760 1.00 47.12  ? 170 VAL C CG2  1 
ATOM   5539 H H    . VAL C 1 125 ? 52.528 -1.121  60.774 1.00 52.18  ? 170 VAL C H    1 
ATOM   5540 H HA   . VAL C 1 125 ? 52.813 -2.807  58.676 1.00 55.15  ? 170 VAL C HA   1 
ATOM   5541 H HB   . VAL C 1 125 ? 51.441 -3.577  61.043 1.00 55.75  ? 170 VAL C HB   1 
ATOM   5542 H HG11 . VAL C 1 125 ? 50.988 -5.605  59.980 1.00 58.91  ? 170 VAL C HG11 1 
ATOM   5543 H HG12 . VAL C 1 125 ? 50.334 -4.404  59.171 1.00 58.91  ? 170 VAL C HG12 1 
ATOM   5544 H HG13 . VAL C 1 125 ? 51.683 -5.067  58.657 1.00 58.91  ? 170 VAL C HG13 1 
ATOM   5545 H HG21 . VAL C 1 125 ? 53.022 -5.258  61.271 1.00 56.54  ? 170 VAL C HG21 1 
ATOM   5546 H HG22 . VAL C 1 125 ? 53.793 -4.706  59.996 1.00 56.54  ? 170 VAL C HG22 1 
ATOM   5547 H HG23 . VAL C 1 125 ? 53.722 -3.833  61.322 1.00 56.54  ? 170 VAL C HG23 1 
ATOM   5548 N N    . VAL C 1 126 ? 50.556 -2.331  57.764 1.00 46.27  ? 171 VAL C N    1 
ATOM   5549 C CA   . VAL C 1 126 ? 49.218 -2.023  57.267 1.00 45.98  ? 171 VAL C CA   1 
ATOM   5550 C C    . VAL C 1 126 ? 48.568 -3.344  56.867 1.00 47.87  ? 171 VAL C C    1 
ATOM   5551 O O    . VAL C 1 126 ? 49.114 -4.081  56.038 1.00 46.79  ? 171 VAL C O    1 
ATOM   5552 C CB   . VAL C 1 126 ? 49.243 -1.021  56.093 1.00 44.49  ? 171 VAL C CB   1 
ATOM   5553 C CG1  . VAL C 1 126 ? 50.212 -1.457  55.014 1.00 43.49  ? 171 VAL C CG1  1 
ATOM   5554 C CG2  . VAL C 1 126 ? 47.840 -0.816  55.506 1.00 45.57  ? 171 VAL C CG2  1 
ATOM   5555 H H    . VAL C 1 126 ? 51.025 -2.803  57.220 1.00 55.53  ? 171 VAL C H    1 
ATOM   5556 H HA   . VAL C 1 126 ? 48.695 -1.633  57.985 1.00 55.18  ? 171 VAL C HA   1 
ATOM   5557 H HB   . VAL C 1 126 ? 49.547 -0.163  56.428 1.00 53.39  ? 171 VAL C HB   1 
ATOM   5558 H HG11 . VAL C 1 126 ? 50.199 -0.805  54.297 1.00 52.18  ? 171 VAL C HG11 1 
ATOM   5559 H HG12 . VAL C 1 126 ? 51.103 -1.514  55.395 1.00 52.18  ? 171 VAL C HG12 1 
ATOM   5560 H HG13 . VAL C 1 126 ? 49.940 -2.325  54.678 1.00 52.18  ? 171 VAL C HG13 1 
ATOM   5561 H HG21 . VAL C 1 126 ? 47.894 -0.183  54.774 1.00 54.68  ? 171 VAL C HG21 1 
ATOM   5562 H HG22 . VAL C 1 126 ? 47.505 -1.668  55.185 1.00 54.68  ? 171 VAL C HG22 1 
ATOM   5563 H HG23 . VAL C 1 126 ? 47.256 -0.471  56.200 1.00 54.68  ? 171 VAL C HG23 1 
ATOM   5564 N N    . SER C 1 127 ? 47.421 -3.654  57.478 1.00 51.01  ? 172 SER C N    1 
ATOM   5565 C CA   . SER C 1 127 ? 46.707 -4.911  57.264 1.00 54.77  ? 172 SER C CA   1 
ATOM   5566 C C    . SER C 1 127 ? 45.382 -4.627  56.572 1.00 56.44  ? 172 SER C C    1 
ATOM   5567 O O    . SER C 1 127 ? 44.527 -3.921  57.122 1.00 56.39  ? 172 SER C O    1 
ATOM   5568 C CB   . SER C 1 127 ? 46.452 -5.645  58.584 1.00 56.57  ? 172 SER C CB   1 
ATOM   5569 O OG   . SER C 1 127 ? 47.662 -6.035  59.209 1.00 56.59  ? 172 SER C OG   1 
ATOM   5570 H H    . SER C 1 127 ? 47.028 -3.133  58.038 1.00 61.21  ? 172 SER C H    1 
ATOM   5571 H HA   . SER C 1 127 ? 47.236 -5.488  56.691 1.00 65.72  ? 172 SER C HA   1 
ATOM   5572 H HB2  . SER C 1 127 ? 45.967 -5.054  59.182 1.00 67.88  ? 172 SER C HB2  1 
ATOM   5573 H HB3  . SER C 1 127 ? 45.923 -6.437  58.404 1.00 67.88  ? 172 SER C HB3  1 
ATOM   5574 H HG   . SER C 1 127 ? 47.498 -6.434  59.929 1.00 67.91  ? 172 SER C HG   1 
ATOM   5575 N N    . VAL C 1 128 ? 45.207 -5.200  55.385 1.00 58.27  ? 173 VAL C N    1 
ATOM   5576 C CA   . VAL C 1 128 ? 43.999 -5.029  54.588 1.00 61.40  ? 173 VAL C CA   1 
ATOM   5577 C C    . VAL C 1 128 ? 43.114 -6.249  54.830 1.00 64.96  ? 173 VAL C C    1 
ATOM   5578 O O    . VAL C 1 128 ? 43.479 -7.375  54.475 1.00 64.30  ? 173 VAL C O    1 
ATOM   5579 C CB   . VAL C 1 128 ? 44.339 -4.854  53.101 1.00 61.49  ? 173 VAL C CB   1 
ATOM   5580 C CG1  . VAL C 1 128 ? 43.090 -4.599  52.283 1.00 65.57  ? 173 VAL C CG1  1 
ATOM   5581 C CG2  . VAL C 1 128 ? 45.327 -3.717  52.918 1.00 60.64  ? 173 VAL C CG2  1 
ATOM   5582 H H    . VAL C 1 128 ? 45.792 -5.707  55.011 1.00 69.92  ? 173 VAL C H    1 
ATOM   5583 H HA   . VAL C 1 128 ? 43.523 -4.239  54.889 1.00 73.68  ? 173 VAL C HA   1 
ATOM   5584 H HB   . VAL C 1 128 ? 44.752 -5.668  52.773 1.00 73.79  ? 173 VAL C HB   1 
ATOM   5585 H HG11 . VAL C 1 128 ? 43.340 -4.493  51.352 1.00 78.69  ? 173 VAL C HG11 1 
ATOM   5586 H HG12 . VAL C 1 128 ? 42.489 -5.353  52.382 1.00 78.69  ? 173 VAL C HG12 1 
ATOM   5587 H HG13 . VAL C 1 128 ? 42.662 -3.790  52.605 1.00 78.69  ? 173 VAL C HG13 1 
ATOM   5588 H HG21 . VAL C 1 128 ? 45.528 -3.623  51.974 1.00 72.77  ? 173 VAL C HG21 1 
ATOM   5589 H HG22 . VAL C 1 128 ? 44.932 -2.898  53.256 1.00 72.77  ? 173 VAL C HG22 1 
ATOM   5590 H HG23 . VAL C 1 128 ? 46.137 -3.922  53.411 1.00 72.77  ? 173 VAL C HG23 1 
ATOM   5591 N N    . ARG C 1 129 ? 41.951 -6.031  55.442 1.00 62.46  ? 174 ARG C N    1 
ATOM   5592 C CA   . ARG C 1 129 ? 41.029 -7.095  55.815 1.00 66.16  ? 174 ARG C CA   1 
ATOM   5593 C C    . ARG C 1 129 ? 39.737 -6.980  55.007 1.00 66.64  ? 174 ARG C C    1 
ATOM   5594 O O    . ARG C 1 129 ? 39.569 -6.093  54.166 1.00 65.75  ? 174 ARG C O    1 
ATOM   5595 C CB   . ARG C 1 129 ? 40.730 -7.048  57.316 1.00 70.84  ? 174 ARG C CB   1 
ATOM   5596 C CG   . ARG C 1 129 ? 41.959 -7.038  58.218 1.00 72.17  ? 174 ARG C CG   1 
ATOM   5597 C CD   . ARG C 1 129 ? 42.640 -8.401  58.274 1.00 79.04  ? 174 ARG C CD   1 
ATOM   5598 N NE   . ARG C 1 129 ? 43.741 -8.410  59.238 1.00 82.38  ? 174 ARG C NE   1 
ATOM   5599 C CZ   . ARG C 1 129 ? 43.614 -8.689  60.534 1.00 87.32  ? 174 ARG C CZ   1 
ATOM   5600 N NH1  . ARG C 1 129 ? 42.431 -8.997  61.047 1.00 91.18  ? 174 ARG C NH1  1 
ATOM   5601 N NH2  . ARG C 1 129 ? 44.677 -8.662  61.326 1.00 87.45  ? 174 ARG C NH2  1 
ATOM   5602 H H    . ARG C 1 129 ? 41.668 -5.248  55.657 1.00 74.96  ? 174 ARG C H    1 
ATOM   5603 H HA   . ARG C 1 129 ? 41.435 -7.953  55.615 1.00 79.39  ? 174 ARG C HA   1 
ATOM   5604 H HB2  . ARG C 1 129 ? 40.223 -6.244  57.504 1.00 85.01  ? 174 ARG C HB2  1 
ATOM   5605 H HB3  . ARG C 1 129 ? 40.203 -7.828  57.549 1.00 85.01  ? 174 ARG C HB3  1 
ATOM   5606 H HG2  . ARG C 1 129 ? 42.599 -6.395  57.876 1.00 86.60  ? 174 ARG C HG2  1 
ATOM   5607 H HG3  . ARG C 1 129 ? 41.691 -6.798  59.118 1.00 86.60  ? 174 ARG C HG3  1 
ATOM   5608 H HD2  . ARG C 1 129 ? 41.994 -9.071  58.545 1.00 94.85  ? 174 ARG C HD2  1 
ATOM   5609 H HD3  . ARG C 1 129 ? 43.000 -8.615  57.399 1.00 94.85  ? 174 ARG C HD3  1 
ATOM   5610 H HE   . ARG C 1 129 ? 44.528 -8.222  58.946 1.00 98.86  ? 174 ARG C HE   1 
ATOM   5611 H HH11 . ARG C 1 129 ? 41.735 -9.015  60.542 1.00 109.41 ? 174 ARG C HH11 1 
ATOM   5612 H HH12 . ARG C 1 129 ? 42.359 -9.177  61.884 1.00 109.41 ? 174 ARG C HH12 1 
ATOM   5613 H HH21 . ARG C 1 129 ? 45.449 -8.466  61.003 1.00 104.94 ? 174 ARG C HH21 1 
ATOM   5614 H HH22 . ARG C 1 129 ? 44.595 -8.846  62.162 1.00 104.94 ? 174 ARG C HH22 1 
ATOM   5615 N N    . PHE C 1 130 ? 38.803 -7.892  55.286 1.00 73.92  ? 175 PHE C N    1 
ATOM   5616 C CA   . PHE C 1 130 ? 37.573 -7.968  54.503 1.00 77.78  ? 175 PHE C CA   1 
ATOM   5617 C C    . PHE C 1 130 ? 36.808 -6.650  54.529 1.00 76.47  ? 175 PHE C C    1 
ATOM   5618 O O    . PHE C 1 130 ? 36.462 -6.100  53.477 1.00 76.62  ? 175 PHE C O    1 
ATOM   5619 C CB   . PHE C 1 130 ? 36.701 -9.108  55.029 1.00 83.07  ? 175 PHE C CB   1 
ATOM   5620 C CG   . PHE C 1 130 ? 35.334 -9.163  54.411 1.00 89.05  ? 175 PHE C CG   1 
ATOM   5621 C CD1  . PHE C 1 130 ? 35.178 -9.456  53.067 1.00 91.29  ? 175 PHE C CD1  1 
ATOM   5622 C CD2  . PHE C 1 130 ? 34.205 -8.936  55.181 1.00 91.99  ? 175 PHE C CD2  1 
ATOM   5623 C CE1  . PHE C 1 130 ? 33.923 -9.511  52.498 1.00 95.17  ? 175 PHE C CE1  1 
ATOM   5624 C CE2  . PHE C 1 130 ? 32.943 -8.995  54.620 1.00 95.86  ? 175 PHE C CE2  1 
ATOM   5625 C CZ   . PHE C 1 130 ? 32.801 -9.282  53.277 1.00 97.28  ? 175 PHE C CZ   1 
ATOM   5626 H H    . PHE C 1 130 ? 38.859 -8.472  55.918 1.00 88.70  ? 175 PHE C H    1 
ATOM   5627 H HA   . PHE C 1 130 ? 37.799 -8.165  53.581 1.00 93.33  ? 175 PHE C HA   1 
ATOM   5628 H HB2  . PHE C 1 130 ? 37.144 -9.951  54.844 1.00 99.68  ? 175 PHE C HB2  1 
ATOM   5629 H HB3  . PHE C 1 130 ? 36.589 -8.999  55.986 1.00 99.68  ? 175 PHE C HB3  1 
ATOM   5630 H HD1  . PHE C 1 130 ? 35.929 -9.611  52.540 1.00 109.54 ? 175 PHE C HD1  1 
ATOM   5631 H HD2  . PHE C 1 130 ? 34.297 -8.743  56.086 1.00 110.39 ? 175 PHE C HD2  1 
ATOM   5632 H HE1  . PHE C 1 130 ? 33.829 -9.707  51.594 1.00 114.21 ? 175 PHE C HE1  1 
ATOM   5633 H HE2  . PHE C 1 130 ? 32.192 -8.838  55.145 1.00 115.03 ? 175 PHE C HE2  1 
ATOM   5634 H HZ   . PHE C 1 130 ? 31.954 -9.319  52.896 1.00 116.74 ? 175 PHE C HZ   1 
ATOM   5635 N N    . GLN C 1 131 ? 36.531 -6.126  55.724 1.00 74.73  ? 176 GLN C N    1 
ATOM   5636 C CA   . GLN C 1 131 ? 35.685 -4.947  55.872 1.00 75.68  ? 176 GLN C CA   1 
ATOM   5637 C C    . GLN C 1 131 ? 36.388 -3.817  56.619 1.00 71.88  ? 176 GLN C C    1 
ATOM   5638 O O    . GLN C 1 131 ? 35.727 -2.886  57.095 1.00 70.47  ? 176 GLN C O    1 
ATOM   5639 C CB   . GLN C 1 131 ? 34.378 -5.327  56.573 1.00 80.28  ? 176 GLN C CB   1 
ATOM   5640 C CG   . GLN C 1 131 ? 34.567 -6.049  57.901 1.00 82.65  ? 176 GLN C CG   1 
ATOM   5641 C CD   . GLN C 1 131 ? 33.266 -6.606  58.455 1.00 88.69  ? 176 GLN C CD   1 
ATOM   5642 O OE1  . GLN C 1 131 ? 32.245 -6.641  57.765 1.00 91.79  ? 176 GLN C OE1  1 
ATOM   5643 N NE2  . GLN C 1 131 ? 33.297 -7.043  59.709 1.00 89.84  ? 176 GLN C NE2  1 
ATOM   5644 H H    . GLN C 1 131 ? 36.824 -6.440  56.469 1.00 89.68  ? 176 GLN C H    1 
ATOM   5645 H HA   . GLN C 1 131 ? 35.458 -4.617  54.988 1.00 90.82  ? 176 GLN C HA   1 
ATOM   5646 H HB2  . GLN C 1 131 ? 33.872 -4.518  56.747 1.00 96.34  ? 176 GLN C HB2  1 
ATOM   5647 H HB3  . GLN C 1 131 ? 33.871 -5.912  55.989 1.00 96.34  ? 176 GLN C HB3  1 
ATOM   5648 H HG2  . GLN C 1 131 ? 35.181 -6.789  57.774 1.00 99.18  ? 176 GLN C HG2  1 
ATOM   5649 H HG3  . GLN C 1 131 ? 34.928 -5.426  58.551 1.00 99.18  ? 176 GLN C HG3  1 
ATOM   5650 H HE21 . GLN C 1 131 ? 34.028 -7.002  60.161 1.00 107.81 ? 176 GLN C HE21 1 
ATOM   5651 H HE22 . GLN C 1 131 ? 32.587 -7.368  60.069 1.00 107.81 ? 176 GLN C HE22 1 
ATOM   5652 N N    . GLU C 1 132 ? 37.713 -3.867  56.720 1.00 64.10  ? 177 GLU C N    1 
ATOM   5653 C CA   . GLU C 1 132 ? 38.451 -2.827  57.422 1.00 61.25  ? 177 GLU C CA   1 
ATOM   5654 C C    . GLU C 1 132 ? 39.928 -2.957  57.083 1.00 56.39  ? 177 GLU C C    1 
ATOM   5655 O O    . GLU C 1 132 ? 40.402 -4.023  56.686 1.00 56.49  ? 177 GLU C O    1 
ATOM   5656 C CB   . GLU C 1 132 ? 38.242 -2.911  58.938 1.00 65.50  ? 177 GLU C CB   1 
ATOM   5657 C CG   . GLU C 1 132 ? 38.841 -4.154  59.587 1.00 68.06  ? 177 GLU C CG   1 
ATOM   5658 C CD   . GLU C 1 132 ? 38.693 -4.159  61.098 1.00 72.35  ? 177 GLU C CD   1 
ATOM   5659 O OE1  . GLU C 1 132 ? 38.173 -3.166  61.646 1.00 73.78  ? 177 GLU C OE1  1 
ATOM   5660 O OE2  . GLU C 1 132 ? 39.093 -5.156  61.741 1.00 74.50  ? 177 GLU C OE2  1 
ATOM   5661 H H    . GLU C 1 132 ? 38.205 -4.491  56.392 1.00 76.92  ? 177 GLU C H    1 
ATOM   5662 H HA   . GLU C 1 132 ? 38.144 -1.957  57.120 1.00 73.50  ? 177 GLU C HA   1 
ATOM   5663 H HB2  . GLU C 1 132 ? 38.653 -2.136  59.351 1.00 78.60  ? 177 GLU C HB2  1 
ATOM   5664 H HB3  . GLU C 1 132 ? 37.289 -2.913  59.120 1.00 78.60  ? 177 GLU C HB3  1 
ATOM   5665 H HG2  . GLU C 1 132 ? 38.391 -4.940  59.239 1.00 81.67  ? 177 GLU C HG2  1 
ATOM   5666 H HG3  . GLU C 1 132 ? 39.787 -4.195  59.378 1.00 81.67  ? 177 GLU C HG3  1 
ATOM   5667 N N    . ASP C 1 133 ? 40.645 -1.853  57.239 1.00 56.65  ? 178 ASP C N    1 
ATOM   5668 C CA   . ASP C 1 133 ? 42.095 -1.828  57.132 1.00 54.14  ? 178 ASP C CA   1 
ATOM   5669 C C    . ASP C 1 133 ? 42.661 -1.383  58.473 1.00 52.47  ? 178 ASP C C    1 
ATOM   5670 O O    . ASP C 1 133 ? 42.069 -0.537  59.155 1.00 52.54  ? 178 ASP C O    1 
ATOM   5671 C CB   . ASP C 1 133 ? 42.550 -0.893  56.008 1.00 53.20  ? 178 ASP C CB   1 
ATOM   5672 C CG   . ASP C 1 133 ? 42.020 -1.318  54.648 1.00 56.60  ? 178 ASP C CG   1 
ATOM   5673 O OD1  . ASP C 1 133 ? 41.829 -2.536  54.443 1.00 57.87  ? 178 ASP C OD1  1 
ATOM   5674 O OD2  . ASP C 1 133 ? 41.792 -0.440  53.786 1.00 56.33  ? 178 ASP C OD2  1 
ATOM   5675 H H    . ASP C 1 133 ? 40.303 -1.083  57.413 1.00 67.98  ? 178 ASP C H    1 
ATOM   5676 H HA   . ASP C 1 133 ? 42.421 -2.722  56.941 1.00 64.97  ? 178 ASP C HA   1 
ATOM   5677 H HB2  . ASP C 1 133 ? 42.225 0.003   56.191 1.00 63.84  ? 178 ASP C HB2  1 
ATOM   5678 H HB3  . ASP C 1 133 ? 43.519 -0.894  55.968 1.00 63.84  ? 178 ASP C HB3  1 
ATOM   5679 N N    . ILE C 1 134 ? 43.791 -1.970  58.861 1.00 46.29  ? 179 ILE C N    1 
ATOM   5680 C CA   . ILE C 1 134 ? 44.400 -1.717  60.161 1.00 45.45  ? 179 ILE C CA   1 
ATOM   5681 C C    . ILE C 1 134 ? 45.810 -1.190  59.950 1.00 43.09  ? 179 ILE C C    1 
ATOM   5682 O O    . ILE C 1 134 ? 46.610 -1.813  59.243 1.00 42.31  ? 179 ILE C O    1 
ATOM   5683 C CB   . ILE C 1 134 ? 44.414 -2.982  61.035 1.00 46.97  ? 179 ILE C CB   1 
ATOM   5684 C CG1  . ILE C 1 134 ? 42.996 -3.538  61.162 1.00 49.78  ? 179 ILE C CG1  1 
ATOM   5685 C CG2  . ILE C 1 134 ? 44.984 -2.673  62.411 1.00 46.52  ? 179 ILE C CG2  1 
ATOM   5686 C CD1  . ILE C 1 134 ? 42.917 -4.914  61.812 1.00 51.80  ? 179 ILE C CD1  1 
ATOM   5687 H H    . ILE C 1 134 ? 44.231 -2.529  58.377 1.00 55.55  ? 179 ILE C H    1 
ATOM   5688 H HA   . ILE C 1 134 ? 43.889 -1.035  60.625 1.00 54.54  ? 179 ILE C HA   1 
ATOM   5689 H HB   . ILE C 1 134 ? 44.974 -3.650  60.609 1.00 56.36  ? 179 ILE C HB   1 
ATOM   5690 H HG12 . ILE C 1 134 ? 42.469 -2.927  61.701 1.00 59.74  ? 179 ILE C HG12 1 
ATOM   5691 H HG13 . ILE C 1 134 ? 42.609 -3.609  60.275 1.00 59.74  ? 179 ILE C HG13 1 
ATOM   5692 H HG21 . ILE C 1 134 ? 44.982 -3.484  62.943 1.00 55.83  ? 179 ILE C HG21 1 
ATOM   5693 H HG22 . ILE C 1 134 ? 45.891 -2.344  62.310 1.00 55.83  ? 179 ILE C HG22 1 
ATOM   5694 H HG23 . ILE C 1 134 ? 44.432 -1.997  62.836 1.00 55.83  ? 179 ILE C HG23 1 
ATOM   5695 H HD11 . ILE C 1 134 ? 41.989 -5.190  61.853 1.00 62.16  ? 179 ILE C HD11 1 
ATOM   5696 H HD12 . ILE C 1 134 ? 43.428 -5.544  61.280 1.00 62.16  ? 179 ILE C HD12 1 
ATOM   5697 H HD13 . ILE C 1 134 ? 43.287 -4.861  62.707 1.00 62.16  ? 179 ILE C HD13 1 
ATOM   5698 N N    . ILE C 1 135 ? 46.101 -0.039  60.558 1.00 50.32  ? 180 ILE C N    1 
ATOM   5699 C CA   . ILE C 1 135 ? 47.434 0.558   60.593 1.00 50.80  ? 180 ILE C CA   1 
ATOM   5700 C C    . ILE C 1 135 ? 47.986 0.398   62.003 1.00 49.61  ? 180 ILE C C    1 
ATOM   5701 O O    . ILE C 1 135 ? 47.270 0.616   62.986 1.00 51.57  ? 180 ILE C O    1 
ATOM   5702 C CB   . ILE C 1 135 ? 47.396 2.053   60.205 1.00 53.07  ? 180 ILE C CB   1 
ATOM   5703 C CG1  . ILE C 1 135 ? 46.828 2.248   58.796 1.00 55.40  ? 180 ILE C CG1  1 
ATOM   5704 C CG2  . ILE C 1 135 ? 48.792 2.686   60.318 1.00 52.15  ? 180 ILE C CG2  1 
ATOM   5705 C CD1  . ILE C 1 135 ? 47.785 1.889   57.685 1.00 55.90  ? 180 ILE C CD1  1 
ATOM   5706 H H    . ILE C 1 135 ? 45.514 0.432   60.975 1.00 60.39  ? 180 ILE C H    1 
ATOM   5707 H HA   . ILE C 1 135 ? 48.018 0.091   59.975 1.00 60.96  ? 180 ILE C HA   1 
ATOM   5708 H HB   . ILE C 1 135 ? 46.810 2.509   60.829 1.00 63.68  ? 180 ILE C HB   1 
ATOM   5709 H HG12 . ILE C 1 135 ? 46.041 1.691   58.699 1.00 66.49  ? 180 ILE C HG12 1 
ATOM   5710 H HG13 . ILE C 1 135 ? 46.585 3.180   58.686 1.00 66.49  ? 180 ILE C HG13 1 
ATOM   5711 H HG21 . ILE C 1 135 ? 48.736 3.622   60.069 1.00 62.58  ? 180 ILE C HG21 1 
ATOM   5712 H HG22 . ILE C 1 135 ? 49.101 2.605   61.234 1.00 62.58  ? 180 ILE C HG22 1 
ATOM   5713 H HG23 . ILE C 1 135 ? 49.399 2.220   59.722 1.00 62.58  ? 180 ILE C HG23 1 
ATOM   5714 H HD11 . ILE C 1 135 ? 47.349 2.040   56.832 1.00 67.07  ? 180 ILE C HD11 1 
ATOM   5715 H HD12 . ILE C 1 135 ? 48.575 2.446   57.756 1.00 67.07  ? 180 ILE C HD12 1 
ATOM   5716 H HD13 . ILE C 1 135 ? 48.030 0.954   57.770 1.00 67.07  ? 180 ILE C HD13 1 
ATOM   5717 N N    . SER C 1 136 ? 49.263 0.044   62.106 1.00 46.61  ? 181 SER C N    1 
ATOM   5718 C CA   . SER C 1 136 ? 49.882 -0.097  63.417 1.00 46.70  ? 181 SER C CA   1 
ATOM   5719 C C    . SER C 1 136 ? 51.358 0.279   63.342 1.00 42.99  ? 181 SER C C    1 
ATOM   5720 O O    . SER C 1 136 ? 51.986 0.217   62.282 1.00 38.40  ? 181 SER C O    1 
ATOM   5721 C CB   . SER C 1 136 ? 49.728 -1.523  63.955 1.00 48.09  ? 181 SER C CB   1 
ATOM   5722 O OG   . SER C 1 136 ? 50.343 -2.448  63.085 1.00 48.98  ? 181 SER C OG   1 
ATOM   5723 H H    . SER C 1 136 ? 49.786 -0.118  61.443 1.00 55.93  ? 181 SER C H    1 
ATOM   5724 H HA   . SER C 1 136 ? 49.448 0.508   64.039 1.00 56.04  ? 181 SER C HA   1 
ATOM   5725 H HB2  . SER C 1 136 ? 50.149 -1.580  64.827 1.00 57.70  ? 181 SER C HB2  1 
ATOM   5726 H HB3  . SER C 1 136 ? 48.784 -1.734  64.026 1.00 57.70  ? 181 SER C HB3  1 
ATOM   5727 H HG   . SER C 1 136 ? 50.255 -3.228  63.385 1.00 58.77  ? 181 SER C HG   1 
ATOM   5728 N N    . ILE C 1 137 ? 51.898 0.674   64.497 1.00 39.08  ? 182 ILE C N    1 
ATOM   5729 C CA   . ILE C 1 137 ? 53.313 0.990   64.654 1.00 39.39  ? 182 ILE C CA   1 
ATOM   5730 C C    . ILE C 1 137 ? 53.783 0.372   65.964 1.00 40.41  ? 182 ILE C C    1 
ATOM   5731 O O    . ILE C 1 137 ? 53.192 0.622   67.020 1.00 40.66  ? 182 ILE C O    1 
ATOM   5732 C CB   . ILE C 1 137 ? 53.577 2.512   64.629 1.00 39.63  ? 182 ILE C CB   1 
ATOM   5733 C CG1  . ILE C 1 137 ? 55.070 2.795   64.803 1.00 38.29  ? 182 ILE C CG1  1 
ATOM   5734 C CG2  . ILE C 1 137 ? 52.758 3.237   65.708 1.00 39.57  ? 182 ILE C CG2  1 
ATOM   5735 C CD1  . ILE C 1 137 ? 55.451 4.237   64.551 1.00 38.62  ? 182 ILE C CD1  1 
ATOM   5736 H H    . ILE C 1 137 ? 51.448 0.768   65.223 1.00 46.90  ? 182 ILE C H    1 
ATOM   5737 H HA   . ILE C 1 137 ? 53.814 0.583   63.930 1.00 47.27  ? 182 ILE C HA   1 
ATOM   5738 H HB   . ILE C 1 137 ? 53.303 2.852   63.762 1.00 47.56  ? 182 ILE C HB   1 
ATOM   5739 H HG12 . ILE C 1 137 ? 55.326 2.575   65.712 1.00 45.95  ? 182 ILE C HG12 1 
ATOM   5740 H HG13 . ILE C 1 137 ? 55.567 2.243   64.179 1.00 45.95  ? 182 ILE C HG13 1 
ATOM   5741 H HG21 . ILE C 1 137 ? 52.948 4.188   65.662 1.00 47.48  ? 182 ILE C HG21 1 
ATOM   5742 H HG22 . ILE C 1 137 ? 51.815 3.080   65.547 1.00 47.48  ? 182 ILE C HG22 1 
ATOM   5743 H HG23 . ILE C 1 137 ? 53.008 2.891   66.579 1.00 47.48  ? 182 ILE C HG23 1 
ATOM   5744 H HD11 . ILE C 1 137 ? 56.407 4.337   64.680 1.00 46.35  ? 182 ILE C HD11 1 
ATOM   5745 H HD12 . ILE C 1 137 ? 55.213 4.471   63.641 1.00 46.35  ? 182 ILE C HD12 1 
ATOM   5746 H HD13 . ILE C 1 137 ? 54.971 4.803   65.176 1.00 46.35  ? 182 ILE C HD13 1 
ATOM   5747 N N    . TRP C 1 138 ? 54.835 -0.444  65.891 1.00 46.48  ? 183 TRP C N    1 
ATOM   5748 C CA   . TRP C 1 138 ? 55.345 -1.193  67.033 1.00 50.81  ? 183 TRP C CA   1 
ATOM   5749 C C    . TRP C 1 138 ? 56.551 -0.487  67.641 1.00 50.21  ? 183 TRP C C    1 
ATOM   5750 O O    . TRP C 1 138 ? 57.364 0.108   66.930 1.00 48.68  ? 183 TRP C O    1 
ATOM   5751 C CB   . TRP C 1 138 ? 55.774 -2.614  66.641 1.00 54.64  ? 183 TRP C CB   1 
ATOM   5752 C CG   . TRP C 1 138 ? 54.788 -3.433  65.851 1.00 57.23  ? 183 TRP C CG   1 
ATOM   5753 C CD1  . TRP C 1 138 ? 53.655 -2.999  65.225 1.00 57.43  ? 183 TRP C CD1  1 
ATOM   5754 C CD2  . TRP C 1 138 ? 54.865 -4.843  65.604 1.00 59.75  ? 183 TRP C CD2  1 
ATOM   5755 N NE1  . TRP C 1 138 ? 53.025 -4.050  64.606 1.00 58.97  ? 183 TRP C NE1  1 
ATOM   5756 C CE2  . TRP C 1 138 ? 53.747 -5.193  64.824 1.00 60.44  ? 183 TRP C CE2  1 
ATOM   5757 C CE3  . TRP C 1 138 ? 55.775 -5.842  65.964 1.00 62.14  ? 183 TRP C CE3  1 
ATOM   5758 C CZ2  . TRP C 1 138 ? 53.514 -6.495  64.400 1.00 62.14  ? 183 TRP C CZ2  1 
ATOM   5759 C CZ3  . TRP C 1 138 ? 55.543 -7.133  65.542 1.00 63.39  ? 183 TRP C CZ3  1 
ATOM   5760 C CH2  . TRP C 1 138 ? 54.421 -7.449  64.768 1.00 64.05  ? 183 TRP C CH2  1 
ATOM   5761 H H    . TRP C 1 138 ? 55.280 -0.583  65.168 1.00 55.78  ? 183 TRP C H    1 
ATOM   5762 H HA   . TRP C 1 138 ? 54.654 -1.258  67.711 1.00 60.97  ? 183 TRP C HA   1 
ATOM   5763 H HB2  . TRP C 1 138 ? 56.582 -2.548  66.108 1.00 65.57  ? 183 TRP C HB2  1 
ATOM   5764 H HB3  . TRP C 1 138 ? 55.967 -3.106  67.454 1.00 65.57  ? 183 TRP C HB3  1 
ATOM   5765 H HD1  . TRP C 1 138 ? 53.353 -2.119  65.221 1.00 68.91  ? 183 TRP C HD1  1 
ATOM   5766 H HE1  . TRP C 1 138 ? 52.294 -3.999  64.156 1.00 70.76  ? 183 TRP C HE1  1 
ATOM   5767 H HE3  . TRP C 1 138 ? 56.523 -5.639  66.477 1.00 74.57  ? 183 TRP C HE3  1 
ATOM   5768 H HZ2  . TRP C 1 138 ? 52.770 -6.709  63.885 1.00 74.57  ? 183 TRP C HZ2  1 
ATOM   5769 H HZ3  . TRP C 1 138 ? 56.140 -7.806  65.778 1.00 76.07  ? 183 TRP C HZ3  1 
ATOM   5770 H HH2  . TRP C 1 138 ? 54.288 -8.330  64.500 1.00 76.86  ? 183 TRP C HH2  1 
ATOM   5771 N N    . ASN C 1 139 ? 56.680 -0.592  68.964 1.00 51.70  ? 184 ASN C N    1 
ATOM   5772 C CA   . ASN C 1 139 ? 57.827 -0.047  69.679 1.00 52.99  ? 184 ASN C CA   1 
ATOM   5773 C C    . ASN C 1 139 ? 58.426 -1.114  70.591 1.00 57.19  ? 184 ASN C C    1 
ATOM   5774 O O    . ASN C 1 139 ? 57.780 -2.109  70.934 1.00 58.82  ? 184 ASN C O    1 
ATOM   5775 C CB   . ASN C 1 139 ? 57.450 1.216   70.490 1.00 52.33  ? 184 ASN C CB   1 
ATOM   5776 C CG   . ASN C 1 139 ? 56.527 0.918   71.654 1.00 53.66  ? 184 ASN C CG   1 
ATOM   5777 O OD1  . ASN C 1 139 ? 55.362 0.572   71.464 1.00 53.49  ? 184 ASN C OD1  1 
ATOM   5778 N ND2  . ASN C 1 139 ? 57.042 1.065   72.870 1.00 55.50  ? 184 ASN C ND2  1 
ATOM   5779 H H    . ASN C 1 139 ? 56.107 -0.981  69.474 1.00 62.04  ? 184 ASN C H    1 
ATOM   5780 H HA   . ASN C 1 139 ? 58.505 0.206   69.034 1.00 63.59  ? 184 ASN C HA   1 
ATOM   5781 H HB2  . ASN C 1 139 ? 58.259 1.616   70.845 1.00 62.80  ? 184 ASN C HB2  1 
ATOM   5782 H HB3  . ASN C 1 139 ? 56.999 1.844   69.904 1.00 62.80  ? 184 ASN C HB3  1 
ATOM   5783 H HD21 . ASN C 1 139 ? 56.558 0.908   73.564 1.00 66.60  ? 184 ASN C HD21 1 
ATOM   5784 H HD22 . ASN C 1 139 ? 57.859 1.317   72.964 1.00 66.60  ? 184 ASN C HD22 1 
ATOM   5785 N N    . LYS C 1 140 ? 59.684 -0.889  70.981 1.00 61.66  ? 185 LYS C N    1 
ATOM   5786 C CA   . LYS C 1 140 ? 60.450 -1.910  71.693 1.00 67.29  ? 185 LYS C CA   1 
ATOM   5787 C C    . LYS C 1 140 ? 59.850 -2.219  73.060 1.00 67.90  ? 185 LYS C C    1 
ATOM   5788 O O    . LYS C 1 140 ? 59.642 -3.387  73.407 1.00 69.60  ? 185 LYS C O    1 
ATOM   5789 C CB   . LYS C 1 140 ? 61.904 -1.462  71.851 1.00 73.11  ? 185 LYS C CB   1 
ATOM   5790 C CG   . LYS C 1 140 ? 62.780 -1.720  70.638 1.00 77.42  ? 185 LYS C CG   1 
ATOM   5791 C CD   . LYS C 1 140 ? 64.144 -1.052  70.771 1.00 81.77  ? 185 LYS C CD   1 
ATOM   5792 C CE   . LYS C 1 140 ? 64.936 -1.585  71.962 1.00 88.25  ? 185 LYS C CE   1 
ATOM   5793 N NZ   . LYS C 1 140 ? 66.303 -0.975  72.042 1.00 91.14  ? 185 LYS C NZ   1 
ATOM   5794 H H    . LYS C 1 140 ? 60.113 -0.156  70.846 1.00 73.99  ? 185 LYS C H    1 
ATOM   5795 H HA   . LYS C 1 140 ? 60.444 -2.728  71.173 1.00 80.75  ? 185 LYS C HA   1 
ATOM   5796 H HB2  . LYS C 1 140 ? 61.917 -0.508  72.026 1.00 87.74  ? 185 LYS C HB2  1 
ATOM   5797 H HB3  . LYS C 1 140 ? 62.295 -1.936  72.602 1.00 87.74  ? 185 LYS C HB3  1 
ATOM   5798 H HG2  . LYS C 1 140 ? 62.918 -2.675  70.542 1.00 92.91  ? 185 LYS C HG2  1 
ATOM   5799 H HG3  . LYS C 1 140 ? 62.344 -1.363  69.848 1.00 92.91  ? 185 LYS C HG3  1 
ATOM   5800 H HD2  . LYS C 1 140 ? 64.659 -1.220  69.967 1.00 98.13  ? 185 LYS C HD2  1 
ATOM   5801 H HD3  . LYS C 1 140 ? 64.020 -0.098  70.894 1.00 98.13  ? 185 LYS C HD3  1 
ATOM   5802 H HE2  . LYS C 1 140 ? 64.462 -1.374  72.781 1.00 105.90 ? 185 LYS C HE2  1 
ATOM   5803 H HE3  . LYS C 1 140 ? 65.039 -2.546  71.873 1.00 105.90 ? 185 LYS C HE3  1 
ATOM   5804 H HZ1  . LYS C 1 140 ? 66.741 -1.303  72.744 1.00 109.37 ? 185 LYS C HZ1  1 
ATOM   5805 H HZ2  . LYS C 1 140 ? 66.762 -1.159  71.302 1.00 109.37 ? 185 LYS C HZ2  1 
ATOM   5806 H HZ3  . LYS C 1 140 ? 66.236 -0.092  72.129 1.00 109.37 ? 185 LYS C HZ3  1 
ATOM   5807 N N    . THR C 1 141 ? 59.588 -1.189  73.860 1.00 69.17  ? 186 THR C N    1 
ATOM   5808 C CA   . THR C 1 141 ? 59.249 -1.358  75.269 1.00 71.53  ? 186 THR C CA   1 
ATOM   5809 C C    . THR C 1 141 ? 57.807 -0.927  75.500 1.00 69.75  ? 186 THR C C    1 
ATOM   5810 O O    . THR C 1 141 ? 57.499 0.268   75.459 1.00 67.80  ? 186 THR C O    1 
ATOM   5811 C CB   . THR C 1 141 ? 60.197 -0.550  76.148 1.00 72.85  ? 186 THR C CB   1 
ATOM   5812 O OG1  . THR C 1 141 ? 61.550 -0.812  75.754 1.00 73.41  ? 186 THR C OG1  1 
ATOM   5813 C CG2  . THR C 1 141 ? 60.005 -0.922  77.605 1.00 77.65  ? 186 THR C CG2  1 
ATOM   5814 H H    . THR C 1 141 ? 59.601 -0.368  73.604 1.00 83.00  ? 186 THR C H    1 
ATOM   5815 H HA   . THR C 1 141 ? 59.331 -2.294  75.511 1.00 85.83  ? 186 THR C HA   1 
ATOM   5816 H HB   . THR C 1 141 ? 60.007 0.395   76.044 1.00 87.42  ? 186 THR C HB   1 
ATOM   5817 H HG1  . THR C 1 141 ? 62.079 -0.370  76.234 1.00 88.09  ? 186 THR C HG1  1 
ATOM   5818 H HG21 . THR C 1 141 ? 60.610 -0.406  78.161 1.00 93.18  ? 186 THR C HG21 1 
ATOM   5819 H HG22 . THR C 1 141 ? 59.093 -0.738  77.877 1.00 93.18  ? 186 THR C HG22 1 
ATOM   5820 H HG23 . THR C 1 141 ? 60.188 -1.866  77.732 1.00 93.18  ? 186 THR C HG23 1 
ATOM   5821 N N    . ALA C 1 142 ? 56.933 -1.898  75.768 1.00 67.35  ? 187 ALA C N    1 
ATOM   5822 C CA   . ALA C 1 142 ? 55.530 -1.586  76.007 1.00 65.53  ? 187 ALA C CA   1 
ATOM   5823 C C    . ALA C 1 142 ? 55.325 -0.886  77.345 1.00 66.67  ? 187 ALA C C    1 
ATOM   5824 O O    . ALA C 1 142 ? 54.368 -0.117  77.498 1.00 65.87  ? 187 ALA C O    1 
ATOM   5825 C CB   . ALA C 1 142 ? 54.694 -2.863  75.944 1.00 64.89  ? 187 ALA C CB   1 
ATOM   5826 H H    . ALA C 1 142 ? 57.127 -2.735  75.816 1.00 80.82  ? 187 ALA C H    1 
ATOM   5827 H HA   . ALA C 1 142 ? 55.217 -0.991  75.308 1.00 78.64  ? 187 ALA C HA   1 
ATOM   5828 H HB1  . ALA C 1 142 ? 53.764 -2.639  76.105 1.00 77.87  ? 187 ALA C HB1  1 
ATOM   5829 H HB2  . ALA C 1 142 ? 54.792 -3.261  75.065 1.00 77.87  ? 187 ALA C HB2  1 
ATOM   5830 H HB3  . ALA C 1 142 ? 55.009 -3.479  76.624 1.00 77.87  ? 187 ALA C HB3  1 
ATOM   5831 N N    . SER C 1 143 ? 56.204 -1.129  78.315 1.00 65.32  ? 188 SER C N    1 
ATOM   5832 C CA   . SER C 1 143 ? 56.074 -0.551  79.648 1.00 67.15  ? 188 SER C CA   1 
ATOM   5833 C C    . SER C 1 143 ? 56.593 0.879   79.737 1.00 65.44  ? 188 SER C C    1 
ATOM   5834 O O    . SER C 1 143 ? 56.475 1.497   80.801 1.00 69.28  ? 188 SER C O    1 
ATOM   5835 C CB   . SER C 1 143 ? 56.812 -1.426  80.665 1.00 71.45  ? 188 SER C CB   1 
ATOM   5836 O OG   . SER C 1 143 ? 58.172 -1.599  80.297 1.00 69.59  ? 188 SER C OG   1 
ATOM   5837 H H    . SER C 1 143 ? 56.894 -1.634  78.224 1.00 78.39  ? 188 SER C H    1 
ATOM   5838 H HA   . SER C 1 143 ? 55.135 -0.540  79.892 1.00 80.58  ? 188 SER C HA   1 
ATOM   5839 H HB2  . SER C 1 143 ? 56.773 -1.000  81.535 1.00 85.74  ? 188 SER C HB2  1 
ATOM   5840 H HB3  . SER C 1 143 ? 56.383 -2.296  80.702 1.00 85.74  ? 188 SER C HB3  1 
ATOM   5841 H HG   . SER C 1 143 ? 58.564 -2.081  80.863 1.00 83.51  ? 188 SER C HG   1 
ATOM   5842 N N    . ASP C 1 144 ? 57.164 1.421   78.664 1.00 66.23  ? 189 ASP C N    1 
ATOM   5843 C CA   . ASP C 1 144 ? 57.688 2.786   78.667 1.00 66.43  ? 189 ASP C CA   1 
ATOM   5844 C C    . ASP C 1 144 ? 56.539 3.733   78.334 1.00 64.62  ? 189 ASP C C    1 
ATOM   5845 O O    . ASP C 1 144 ? 56.296 4.071   77.172 1.00 60.76  ? 189 ASP C O    1 
ATOM   5846 C CB   . ASP C 1 144 ? 58.840 2.914   77.676 1.00 65.77  ? 189 ASP C CB   1 
ATOM   5847 C CG   . ASP C 1 144 ? 59.511 4.272   77.729 1.00 68.42  ? 189 ASP C CG   1 
ATOM   5848 O OD1  . ASP C 1 144 ? 58.970 5.189   78.385 1.00 70.24  ? 189 ASP C OD1  1 
ATOM   5849 O OD2  . ASP C 1 144 ? 60.579 4.425   77.100 1.00 67.18  ? 189 ASP C OD2  1 
ATOM   5850 H H    . ASP C 1 144 ? 57.260 1.014   77.912 1.00 79.48  ? 189 ASP C H    1 
ATOM   5851 H HA   . ASP C 1 144 ? 58.019 3.004   79.552 1.00 79.72  ? 189 ASP C HA   1 
ATOM   5852 H HB2  . ASP C 1 144 ? 59.508 2.241   77.880 1.00 78.92  ? 189 ASP C HB2  1 
ATOM   5853 H HB3  . ASP C 1 144 ? 58.499 2.782   76.777 1.00 78.92  ? 189 ASP C HB3  1 
ATOM   5854 N N    . GLN C 1 145 ? 55.823 4.174   79.373 1.00 61.01  ? 190 GLN C N    1 
ATOM   5855 C CA   . GLN C 1 145 ? 54.671 5.046   79.160 1.00 61.04  ? 190 GLN C CA   1 
ATOM   5856 C C    . GLN C 1 145 ? 55.082 6.344   78.481 1.00 57.87  ? 190 GLN C C    1 
ATOM   5857 O O    . GLN C 1 145 ? 54.373 6.844   77.601 1.00 55.84  ? 190 GLN C O    1 
ATOM   5858 C CB   . GLN C 1 145 ? 53.980 5.345   80.487 1.00 66.82  ? 190 GLN C CB   1 
ATOM   5859 C CG   . GLN C 1 145 ? 53.187 4.190   81.048 1.00 70.69  ? 190 GLN C CG   1 
ATOM   5860 C CD   . GLN C 1 145 ? 52.485 4.559   82.334 1.00 77.66  ? 190 GLN C CD   1 
ATOM   5861 O OE1  . GLN C 1 145 ? 52.134 5.718   82.550 1.00 79.97  ? 190 GLN C OE1  1 
ATOM   5862 N NE2  . GLN C 1 145 ? 52.291 3.577   83.206 1.00 82.73  ? 190 GLN C NE2  1 
ATOM   5863 H H    . GLN C 1 145 ? 55.982 3.984   80.197 1.00 73.21  ? 190 GLN C H    1 
ATOM   5864 H HA   . GLN C 1 145 ? 54.035 4.594   78.585 1.00 73.24  ? 190 GLN C HA   1 
ATOM   5865 H HB2  . GLN C 1 145 ? 54.654 5.586   81.142 1.00 80.19  ? 190 GLN C HB2  1 
ATOM   5866 H HB3  . GLN C 1 145 ? 53.369 6.088   80.358 1.00 80.19  ? 190 GLN C HB3  1 
ATOM   5867 H HG2  . GLN C 1 145 ? 52.514 3.922   80.403 1.00 84.83  ? 190 GLN C HG2  1 
ATOM   5868 H HG3  . GLN C 1 145 ? 53.787 3.451   81.232 1.00 84.83  ? 190 GLN C HG3  1 
ATOM   5869 H HE21 . GLN C 1 145 ? 52.560 2.781   83.024 1.00 99.27  ? 190 GLN C HE21 1 
ATOM   5870 H HE22 . GLN C 1 145 ? 51.896 3.737   83.953 1.00 99.27  ? 190 GLN C HE22 1 
ATOM   5871 N N    . ALA C 1 146 ? 56.219 6.911   78.885 1.00 63.66  ? 191 ALA C N    1 
ATOM   5872 C CA   . ALA C 1 146 ? 56.704 8.126   78.241 1.00 62.40  ? 191 ALA C CA   1 
ATOM   5873 C C    . ALA C 1 146 ? 56.819 7.936   76.736 1.00 60.19  ? 191 ALA C C    1 
ATOM   5874 O O    . ALA C 1 146 ? 56.441 8.820   75.960 1.00 59.24  ? 191 ALA C O    1 
ATOM   5875 C CB   . ALA C 1 146 ? 58.052 8.531   78.837 1.00 65.04  ? 191 ALA C CB   1 
ATOM   5876 H H    . ALA C 1 146 ? 56.720 6.617   79.519 1.00 76.40  ? 191 ALA C H    1 
ATOM   5877 H HA   . ALA C 1 146 ? 56.074 8.845   78.406 1.00 74.89  ? 191 ALA C HA   1 
ATOM   5878 H HB1  . ALA C 1 146 ? 58.360 9.340   78.398 1.00 78.05  ? 191 ALA C HB1  1 
ATOM   5879 H HB2  . ALA C 1 146 ? 57.942 8.691   79.787 1.00 78.05  ? 191 ALA C HB2  1 
ATOM   5880 H HB3  . ALA C 1 146 ? 58.689 7.814   78.693 1.00 78.05  ? 191 ALA C HB3  1 
ATOM   5881 N N    . THR C 1 147 ? 57.318 6.775   76.305 1.00 60.41  ? 192 THR C N    1 
ATOM   5882 C CA   . THR C 1 147 ? 57.497 6.528   74.877 1.00 57.24  ? 192 THR C CA   1 
ATOM   5883 C C    . THR C 1 147 ? 56.163 6.262   74.186 1.00 53.65  ? 192 THR C C    1 
ATOM   5884 O O    . THR C 1 147 ? 55.878 6.833   73.128 1.00 50.06  ? 192 THR C O    1 
ATOM   5885 C CB   . THR C 1 147 ? 58.450 5.350   74.660 1.00 57.69  ? 192 THR C CB   1 
ATOM   5886 O OG1  . THR C 1 147 ? 59.737 5.666   75.210 1.00 59.60  ? 192 THR C OG1  1 
ATOM   5887 C CG2  . THR C 1 147 ? 58.590 5.032   73.164 1.00 55.52  ? 192 THR C CG2  1 
ATOM   5888 H H    . THR C 1 147 ? 57.557 6.124   76.813 1.00 72.49  ? 192 THR C H    1 
ATOM   5889 H HA   . THR C 1 147 ? 57.894 7.313   74.468 1.00 68.69  ? 192 THR C HA   1 
ATOM   5890 H HB   . THR C 1 147 ? 58.096 4.565   75.106 1.00 69.23  ? 192 THR C HB   1 
ATOM   5891 H HG1  . THR C 1 147 ? 60.264 5.022   75.094 1.00 71.52  ? 192 THR C HG1  1 
ATOM   5892 H HG21 . THR C 1 147 ? 59.196 4.285   73.040 1.00 66.63  ? 192 THR C HG21 1 
ATOM   5893 H HG22 . THR C 1 147 ? 57.724 4.802   72.792 1.00 66.63  ? 192 THR C HG22 1 
ATOM   5894 H HG23 . THR C 1 147 ? 58.940 5.804   72.693 1.00 66.63  ? 192 THR C HG23 1 
ATOM   5895 N N    . THR C 1 148 ? 55.338 5.383   74.756 1.00 49.62  ? 193 THR C N    1 
ATOM   5896 C CA   . THR C 1 148 ? 54.085 5.026   74.095 1.00 48.70  ? 193 THR C CA   1 
ATOM   5897 C C    . THR C 1 148 ? 53.118 6.205   74.032 1.00 48.69  ? 193 THR C C    1 
ATOM   5898 O O    . THR C 1 148 ? 52.326 6.303   73.088 1.00 47.27  ? 193 THR C O    1 
ATOM   5899 C CB   . THR C 1 148 ? 53.430 3.841   74.806 1.00 50.73  ? 193 THR C CB   1 
ATOM   5900 O OG1  . THR C 1 148 ? 53.129 4.195   76.161 1.00 53.58  ? 193 THR C OG1  1 
ATOM   5901 C CG2  . THR C 1 148 ? 54.364 2.633   74.784 1.00 50.92  ? 193 THR C CG2  1 
ATOM   5902 H H    . THR C 1 148 ? 55.477 4.988   75.508 1.00 59.55  ? 193 THR C H    1 
ATOM   5903 H HA   . THR C 1 148 ? 54.280 4.755   73.185 1.00 58.44  ? 193 THR C HA   1 
ATOM   5904 H HB   . THR C 1 148 ? 52.610 3.603   74.346 1.00 60.87  ? 193 THR C HB   1 
ATOM   5905 H HG1  . THR C 1 148 ? 52.770 3.546   76.555 1.00 64.29  ? 193 THR C HG1  1 
ATOM   5906 H HG21 . THR C 1 148 ? 53.946 1.883   75.235 1.00 61.10  ? 193 THR C HG21 1 
ATOM   5907 H HG22 . THR C 1 148 ? 54.557 2.381   73.867 1.00 61.10  ? 193 THR C HG22 1 
ATOM   5908 H HG23 . THR C 1 148 ? 55.196 2.848   75.234 1.00 61.10  ? 193 THR C HG23 1 
ATOM   5909 N N    . ALA C 1 149 ? 53.163 7.106   75.014 1.00 50.54  ? 194 ALA C N    1 
ATOM   5910 C CA   . ALA C 1 149 ? 52.326 8.299   74.954 1.00 51.13  ? 194 ALA C CA   1 
ATOM   5911 C C    . ALA C 1 149 ? 52.817 9.259   73.878 1.00 49.99  ? 194 ALA C C    1 
ATOM   5912 O O    . ALA C 1 149 ? 52.011 9.914   73.208 1.00 49.97  ? 194 ALA C O    1 
ATOM   5913 C CB   . ALA C 1 149 ? 52.295 8.989   76.314 1.00 53.74  ? 194 ALA C CB   1 
ATOM   5914 H H    . ALA C 1 149 ? 53.661 7.050   75.713 1.00 60.64  ? 194 ALA C H    1 
ATOM   5915 H HA   . ALA C 1 149 ? 51.419 8.037   74.730 1.00 61.36  ? 194 ALA C HA   1 
ATOM   5916 H HB1  . ALA C 1 149 ? 51.735 9.779   76.255 1.00 64.49  ? 194 ALA C HB1  1 
ATOM   5917 H HB2  . ALA C 1 149 ? 51.933 8.375   76.971 1.00 64.49  ? 194 ALA C HB2  1 
ATOM   5918 H HB3  . ALA C 1 149 ? 53.199 9.242   76.560 1.00 64.49  ? 194 ALA C HB3  1 
ATOM   5919 N N    . ARG C 1 150 ? 54.137 9.353   73.695 1.00 48.46  ? 195 ARG C N    1 
ATOM   5920 C CA   . ARG C 1 150 ? 54.677 10.204  72.640 1.00 49.00  ? 195 ARG C CA   1 
ATOM   5921 C C    . ARG C 1 150 ? 54.325 9.665   71.261 1.00 44.34  ? 195 ARG C C    1 
ATOM   5922 O O    . ARG C 1 150 ? 53.939 10.432  70.372 1.00 42.39  ? 195 ARG C O    1 
ATOM   5923 C CB   . ARG C 1 150 ? 56.192 10.335  72.794 1.00 54.71  ? 195 ARG C CB   1 
ATOM   5924 C CG   . ARG C 1 150 ? 56.619 11.206  73.948 1.00 64.59  ? 195 ARG C CG   1 
ATOM   5925 C CD   . ARG C 1 150 ? 58.124 11.196  74.136 1.00 71.40  ? 195 ARG C CD   1 
ATOM   5926 N NE   . ARG C 1 150 ? 58.541 12.141  75.170 1.00 81.31  ? 195 ARG C NE   1 
ATOM   5927 C CZ   . ARG C 1 150 ? 58.801 13.427  74.950 1.00 89.25  ? 195 ARG C CZ   1 
ATOM   5928 N NH1  . ARG C 1 150 ? 58.693 13.932  73.725 1.00 89.87  ? 195 ARG C NH1  1 
ATOM   5929 N NH2  . ARG C 1 150 ? 59.172 14.210  75.956 1.00 94.83  ? 195 ARG C NH2  1 
ATOM   5930 H H    . ARG C 1 150 ? 54.730 8.941   74.162 1.00 58.16  ? 195 ARG C H    1 
ATOM   5931 H HA   . ARG C 1 150 ? 54.291 11.090  72.722 1.00 58.81  ? 195 ARG C HA   1 
ATOM   5932 H HB2  . ARG C 1 150 ? 56.568 9.452   72.934 1.00 65.65  ? 195 ARG C HB2  1 
ATOM   5933 H HB3  . ARG C 1 150 ? 56.555 10.721  71.981 1.00 65.65  ? 195 ARG C HB3  1 
ATOM   5934 H HG2  . ARG C 1 150 ? 56.342 12.120  73.778 1.00 77.50  ? 195 ARG C HG2  1 
ATOM   5935 H HG3  . ARG C 1 150 ? 56.210 10.878  74.764 1.00 77.50  ? 195 ARG C HG3  1 
ATOM   5936 H HD2  . ARG C 1 150 ? 58.407 10.308  74.405 1.00 85.68  ? 195 ARG C HD2  1 
ATOM   5937 H HD3  . ARG C 1 150 ? 58.553 11.448  73.303 1.00 85.68  ? 195 ARG C HD3  1 
ATOM   5938 H HE   . ARG C 1 150 ? 58.623 11.847  75.973 1.00 97.57  ? 195 ARG C HE   1 
ATOM   5939 H HH11 . ARG C 1 150 ? 58.452 13.427  73.071 1.00 107.84 ? 195 ARG C HH11 1 
ATOM   5940 H HH12 . ARG C 1 150 ? 58.862 14.763  73.586 1.00 107.84 ? 195 ARG C HH12 1 
ATOM   5941 H HH21 . ARG C 1 150 ? 59.243 13.886  76.749 1.00 113.79 ? 195 ARG C HH21 1 
ATOM   5942 H HH22 . ARG C 1 150 ? 59.341 15.041  75.813 1.00 113.79 ? 195 ARG C HH22 1 
ATOM   5943 N N    . ILE C 1 151 ? 54.463 8.353   71.056 1.00 43.15  ? 196 ILE C N    1 
ATOM   5944 C CA   . ILE C 1 151 ? 54.090 7.769   69.772 1.00 43.34  ? 196 ILE C CA   1 
ATOM   5945 C C    . ILE C 1 151 ? 52.623 8.041   69.474 1.00 43.96  ? 196 ILE C C    1 
ATOM   5946 O O    . ILE C 1 151 ? 52.255 8.366   68.339 1.00 41.32  ? 196 ILE C O    1 
ATOM   5947 C CB   . ILE C 1 151 ? 54.390 6.259   69.754 1.00 42.24  ? 196 ILE C CB   1 
ATOM   5948 C CG1  . ILE C 1 151 ? 55.898 6.007   69.786 1.00 43.17  ? 196 ILE C CG1  1 
ATOM   5949 C CG2  . ILE C 1 151 ? 53.769 5.599   68.517 1.00 41.83  ? 196 ILE C CG2  1 
ATOM   5950 C CD1  . ILE C 1 151 ? 56.270 4.515   69.940 1.00 43.90  ? 196 ILE C CD1  1 
ATOM   5951 H H    . ILE C 1 151 ? 54.764 7.791   71.633 1.00 51.78  ? 196 ILE C H    1 
ATOM   5952 H HA   . ILE C 1 151 ? 54.618 8.185   69.073 1.00 52.01  ? 196 ILE C HA   1 
ATOM   5953 H HB   . ILE C 1 151 ? 53.996 5.859   70.545 1.00 50.69  ? 196 ILE C HB   1 
ATOM   5954 H HG12 . ILE C 1 151 ? 56.288 6.327   68.957 1.00 51.80  ? 196 ILE C HG12 1 
ATOM   5955 H HG13 . ILE C 1 151 ? 56.281 6.487   70.537 1.00 51.80  ? 196 ILE C HG13 1 
ATOM   5956 H HG21 . ILE C 1 151 ? 53.972 4.651   68.529 1.00 50.20  ? 196 ILE C HG21 1 
ATOM   5957 H HG22 . ILE C 1 151 ? 52.808 5.732   68.537 1.00 50.20  ? 196 ILE C HG22 1 
ATOM   5958 H HG23 . ILE C 1 151 ? 54.143 6.008   67.720 1.00 50.20  ? 196 ILE C HG23 1 
ATOM   5959 H HD11 . ILE C 1 151 ? 57.236 4.430   69.952 1.00 52.68  ? 196 ILE C HD11 1 
ATOM   5960 H HD12 . ILE C 1 151 ? 55.897 4.181   70.771 1.00 52.68  ? 196 ILE C HD12 1 
ATOM   5961 H HD13 . ILE C 1 151 ? 55.904 4.020   69.190 1.00 52.68  ? 196 ILE C HD13 1 
ATOM   5962 N N    . ARG C 1 152 ? 51.757 7.894   70.477 1.00 45.28  ? 197 ARG C N    1 
ATOM   5963 C CA   . ARG C 1 152 ? 50.338 8.164   70.272 1.00 49.00  ? 197 ARG C CA   1 
ATOM   5964 C C    . ARG C 1 152 ? 50.121 9.616   69.874 1.00 48.69  ? 197 ARG C C    1 
ATOM   5965 O O    . ARG C 1 152 ? 49.438 9.911   68.886 1.00 45.30  ? 197 ARG C O    1 
ATOM   5966 C CB   . ARG C 1 152 ? 49.561 7.823   71.543 1.00 55.90  ? 197 ARG C CB   1 
ATOM   5967 C CG   . ARG C 1 152 ? 48.035 7.873   71.412 1.00 61.46  ? 197 ARG C CG   1 
ATOM   5968 C CD   . ARG C 1 152 ? 47.470 9.085   72.127 1.00 68.90  ? 197 ARG C CD   1 
ATOM   5969 N NE   . ARG C 1 152 ? 47.864 9.121   73.536 1.00 75.67  ? 197 ARG C NE   1 
ATOM   5970 C CZ   . ARG C 1 152 ? 47.972 10.231  74.264 1.00 81.14  ? 197 ARG C CZ   1 
ATOM   5971 N NH1  . ARG C 1 152 ? 47.719 11.418  73.726 1.00 82.53  ? 197 ARG C NH1  1 
ATOM   5972 N NH2  . ARG C 1 152 ? 48.340 10.154  75.535 1.00 84.66  ? 197 ARG C NH2  1 
ATOM   5973 H H    . ARG C 1 152 ? 51.963 7.642   71.274 1.00 54.34  ? 197 ARG C H    1 
ATOM   5974 H HA   . ARG C 1 152 ? 50.006 7.601   69.555 1.00 58.80  ? 197 ARG C HA   1 
ATOM   5975 H HB2  . ARG C 1 152 ? 49.800 6.924   71.818 1.00 67.08  ? 197 ARG C HB2  1 
ATOM   5976 H HB3  . ARG C 1 152 ? 49.815 8.452   72.237 1.00 67.08  ? 197 ARG C HB3  1 
ATOM   5977 H HG2  . ARG C 1 152 ? 47.794 7.932   70.475 1.00 73.75  ? 197 ARG C HG2  1 
ATOM   5978 H HG3  . ARG C 1 152 ? 47.651 7.077   71.810 1.00 73.75  ? 197 ARG C HG3  1 
ATOM   5979 H HD2  . ARG C 1 152 ? 47.800 9.890   71.700 1.00 82.68  ? 197 ARG C HD2  1 
ATOM   5980 H HD3  . ARG C 1 152 ? 46.501 9.057   72.085 1.00 82.68  ? 197 ARG C HD3  1 
ATOM   5981 H HE   . ARG C 1 152 ? 48.039 8.373   73.922 1.00 90.80  ? 197 ARG C HE   1 
ATOM   5982 H HH11 . ARG C 1 152 ? 47.480 11.474  72.901 1.00 99.04  ? 197 ARG C HH11 1 
ATOM   5983 H HH12 . ARG C 1 152 ? 47.791 12.130  74.202 1.00 99.04  ? 197 ARG C HH12 1 
ATOM   5984 H HH21 . ARG C 1 152 ? 48.506 9.389   75.889 1.00 101.59 ? 197 ARG C HH21 1 
ATOM   5985 H HH22 . ARG C 1 152 ? 48.410 10.870  76.006 1.00 101.59 ? 197 ARG C HH22 1 
ATOM   5986 N N    . ASP C 1 153 ? 50.719 10.540  70.627 1.00 51.23  ? 198 ASP C N    1 
ATOM   5987 C CA   . ASP C 1 153 ? 50.594 11.957  70.313 1.00 55.06  ? 198 ASP C CA   1 
ATOM   5988 C C    . ASP C 1 153 ? 51.099 12.251  68.905 1.00 50.39  ? 198 ASP C C    1 
ATOM   5989 O O    . ASP C 1 153 ? 50.447 12.966  68.136 1.00 48.93  ? 198 ASP C O    1 
ATOM   5990 C CB   . ASP C 1 153 ? 51.362 12.773  71.350 1.00 64.02  ? 198 ASP C CB   1 
ATOM   5991 C CG   . ASP C 1 153 ? 50.924 14.213  71.392 1.00 73.31  ? 198 ASP C CG   1 
ATOM   5992 O OD1  . ASP C 1 153 ? 49.700 14.465  71.351 1.00 77.00  ? 198 ASP C OD1  1 
ATOM   5993 O OD2  . ASP C 1 153 ? 51.808 15.092  71.461 1.00 76.41  ? 198 ASP C OD2  1 
ATOM   5994 H H    . ASP C 1 153 ? 51.198 10.370  71.320 1.00 61.48  ? 198 ASP C H    1 
ATOM   5995 H HA   . ASP C 1 153 ? 49.660 12.212  70.358 1.00 66.07  ? 198 ASP C HA   1 
ATOM   5996 H HB2  . ASP C 1 153 ? 51.214 12.389  72.228 1.00 76.82  ? 198 ASP C HB2  1 
ATOM   5997 H HB3  . ASP C 1 153 ? 52.307 12.753  71.133 1.00 76.82  ? 198 ASP C HB3  1 
ATOM   5998 N N    . THR C 1 154 ? 52.265 11.700  68.548 1.00 47.95  ? 199 THR C N    1 
ATOM   5999 C CA   . THR C 1 154 ? 52.828 11.943  67.224 1.00 45.99  ? 199 THR C CA   1 
ATOM   6000 C C    . THR C 1 154 ? 51.940 11.341  66.149 1.00 45.49  ? 199 THR C C    1 
ATOM   6001 O O    . THR C 1 154 ? 51.637 11.983  65.137 1.00 44.99  ? 199 THR C O    1 
ATOM   6002 C CB   . THR C 1 154 ? 54.247 11.361  67.130 1.00 44.59  ? 199 THR C CB   1 
ATOM   6003 O OG1  . THR C 1 154 ? 55.133 12.107  67.977 1.00 46.31  ? 199 THR C OG1  1 
ATOM   6004 C CG2  . THR C 1 154 ? 54.776 11.425  65.704 1.00 42.55  ? 199 THR C CG2  1 
ATOM   6005 H H    . THR C 1 154 ? 52.741 11.189  69.051 1.00 57.54  ? 199 THR C H    1 
ATOM   6006 H HA   . THR C 1 154 ? 52.882 12.899  67.071 1.00 55.19  ? 199 THR C HA   1 
ATOM   6007 H HB   . THR C 1 154 ? 54.235 10.433  67.412 1.00 53.50  ? 199 THR C HB   1 
ATOM   6008 H HG1  . THR C 1 154 ? 54.872 12.065  68.774 1.00 55.57  ? 199 THR C HG1  1 
ATOM   6009 H HG21 . THR C 1 154 ? 55.671 11.054  65.666 1.00 51.06  ? 199 THR C HG21 1 
ATOM   6010 H HG22 . THR C 1 154 ? 54.198 10.917  65.113 1.00 51.06  ? 199 THR C HG22 1 
ATOM   6011 H HG23 . THR C 1 154 ? 54.803 12.347  65.402 1.00 51.06  ? 199 THR C HG23 1 
ATOM   6012 N N    . LEU C 1 155 ? 51.528 10.093  66.349 1.00 45.18  ? 200 LEU C N    1 
ATOM   6013 C CA   . LEU C 1 155 ? 50.678 9.424   65.375 1.00 46.71  ? 200 LEU C CA   1 
ATOM   6014 C C    . LEU C 1 155 ? 49.421 10.247  65.110 1.00 46.46  ? 200 LEU C C    1 
ATOM   6015 O O    . LEU C 1 155 ? 49.005 10.409  63.957 1.00 43.61  ? 200 LEU C O    1 
ATOM   6016 C CB   . LEU C 1 155 ? 50.348 8.025   65.894 1.00 49.17  ? 200 LEU C CB   1 
ATOM   6017 C CG   . LEU C 1 155 ? 49.623 7.024   65.004 1.00 51.94  ? 200 LEU C CG   1 
ATOM   6018 C CD1  . LEU C 1 155 ? 50.374 6.784   63.706 1.00 51.47  ? 200 LEU C CD1  1 
ATOM   6019 C CD2  . LEU C 1 155 ? 49.449 5.720   65.775 1.00 53.22  ? 200 LEU C CD2  1 
ATOM   6020 H H    . LEU C 1 155 ? 51.725 9.616   67.037 1.00 54.21  ? 200 LEU C H    1 
ATOM   6021 H HA   . LEU C 1 155 ? 51.162 9.332   64.539 1.00 56.06  ? 200 LEU C HA   1 
ATOM   6022 H HB2  . LEU C 1 155 ? 51.185 7.606   66.149 1.00 59.01  ? 200 LEU C HB2  1 
ATOM   6023 H HB3  . LEU C 1 155 ? 49.801 8.132   66.687 1.00 59.01  ? 200 LEU C HB3  1 
ATOM   6024 H HG   . LEU C 1 155 ? 48.743 7.368   64.786 1.00 62.33  ? 200 LEU C HG   1 
ATOM   6025 H HD11 . LEU C 1 155 ? 49.880 6.143   63.171 1.00 61.77  ? 200 LEU C HD11 1 
ATOM   6026 H HD12 . LEU C 1 155 ? 50.454 7.624   63.228 1.00 61.77  ? 200 LEU C HD12 1 
ATOM   6027 H HD13 . LEU C 1 155 ? 51.255 6.435   63.912 1.00 61.77  ? 200 LEU C HD13 1 
ATOM   6028 H HD21 . LEU C 1 155 ? 48.988 5.079   65.211 1.00 63.86  ? 200 LEU C HD21 1 
ATOM   6029 H HD22 . LEU C 1 155 ? 50.324 5.378   66.017 1.00 63.86  ? 200 LEU C HD22 1 
ATOM   6030 H HD23 . LEU C 1 155 ? 48.929 5.893   66.574 1.00 63.86  ? 200 LEU C HD23 1 
ATOM   6031 N N    . ARG C 1 156 ? 48.838 10.818  66.163 1.00 49.42  ? 201 ARG C N    1 
ATOM   6032 C CA   . ARG C 1 156 ? 47.639 11.637  66.004 1.00 54.99  ? 201 ARG C CA   1 
ATOM   6033 C C    . ARG C 1 156 ? 47.863 12.753  64.989 1.00 51.45  ? 201 ARG C C    1 
ATOM   6034 O O    . ARG C 1 156 ? 47.082 12.911  64.043 1.00 50.04  ? 201 ARG C O    1 
ATOM   6035 C CB   . ARG C 1 156 ? 47.221 12.213  67.360 1.00 62.61  ? 201 ARG C CB   1 
ATOM   6036 C CG   . ARG C 1 156 ? 45.807 12.804  67.406 1.00 72.04  ? 201 ARG C CG   1 
ATOM   6037 C CD   . ARG C 1 156 ? 45.806 14.306  67.185 1.00 78.72  ? 201 ARG C CD   1 
ATOM   6038 N NE   . ARG C 1 156 ? 46.628 15.014  68.166 1.00 84.28  ? 201 ARG C NE   1 
ATOM   6039 C CZ   . ARG C 1 156 ? 46.861 16.323  68.144 1.00 88.72  ? 201 ARG C CZ   1 
ATOM   6040 N NH1  . ARG C 1 156 ? 46.331 17.082  67.192 1.00 90.26  ? 201 ARG C NH1  1 
ATOM   6041 N NH2  . ARG C 1 156 ? 47.629 16.876  69.073 1.00 90.80  ? 201 ARG C NH2  1 
ATOM   6042 H H    . ARG C 1 156 ? 49.115 10.748  66.974 1.00 59.31  ? 201 ARG C H    1 
ATOM   6043 H HA   . ARG C 1 156 ? 46.915 11.078  65.680 1.00 65.99  ? 201 ARG C HA   1 
ATOM   6044 H HB2  . ARG C 1 156 ? 47.264 11.505  68.022 1.00 75.13  ? 201 ARG C HB2  1 
ATOM   6045 H HB3  . ARG C 1 156 ? 47.842 12.919  67.599 1.00 75.13  ? 201 ARG C HB3  1 
ATOM   6046 H HG2  . ARG C 1 156 ? 45.269 12.396  66.710 1.00 86.45  ? 201 ARG C HG2  1 
ATOM   6047 H HG3  . ARG C 1 156 ? 45.417 12.627  68.276 1.00 86.45  ? 201 ARG C HG3  1 
ATOM   6048 H HD2  . ARG C 1 156 ? 46.159 14.497  66.302 1.00 94.46  ? 201 ARG C HD2  1 
ATOM   6049 H HD3  . ARG C 1 156 ? 44.897 14.637  67.259 1.00 94.46  ? 201 ARG C HD3  1 
ATOM   6050 H HE   . ARG C 1 156 ? 46.984 14.554  68.799 1.00 101.14 ? 201 ARG C HE   1 
ATOM   6051 H HH11 . ARG C 1 156 ? 45.835 16.727  66.586 1.00 108.31 ? 201 ARG C HH11 1 
ATOM   6052 H HH12 . ARG C 1 156 ? 46.483 17.928  67.181 1.00 108.31 ? 201 ARG C HH12 1 
ATOM   6053 H HH21 . ARG C 1 156 ? 47.973 16.388  69.692 1.00 108.96 ? 201 ARG C HH21 1 
ATOM   6054 H HH22 . ARG C 1 156 ? 47.777 17.723  69.061 1.00 108.96 ? 201 ARG C HH22 1 
ATOM   6055 N N    . ARG C 1 157 ? 48.939 13.532  65.162 1.00 47.20  ? 202 ARG C N    1 
ATOM   6056 C CA   . ARG C 1 157 ? 49.187 14.660  64.267 1.00 45.84  ? 202 ARG C CA   1 
ATOM   6057 C C    . ARG C 1 157 ? 49.638 14.197  62.891 1.00 44.00  ? 202 ARG C C    1 
ATOM   6058 O O    . ARG C 1 157 ? 49.295 14.823  61.880 1.00 43.74  ? 202 ARG C O    1 
ATOM   6059 C CB   . ARG C 1 157 ? 50.242 15.591  64.866 1.00 45.11  ? 202 ARG C CB   1 
ATOM   6060 C CG   . ARG C 1 157 ? 49.837 16.228  66.170 1.00 46.80  ? 202 ARG C CG   1 
ATOM   6061 C CD   . ARG C 1 157 ? 50.909 17.181  66.657 1.00 49.45  ? 202 ARG C CD   1 
ATOM   6062 N NE   . ARG C 1 157 ? 52.135 16.468  66.997 1.00 49.25  ? 202 ARG C NE   1 
ATOM   6063 C CZ   . ARG C 1 157 ? 52.450 16.050  68.218 1.00 51.76  ? 202 ARG C CZ   1 
ATOM   6064 N NH1  . ARG C 1 157 ? 51.633 16.277  69.237 1.00 53.70  ? 202 ARG C NH1  1 
ATOM   6065 N NH2  . ARG C 1 157 ? 53.591 15.403  68.420 1.00 51.58  ? 202 ARG C NH2  1 
ATOM   6066 H H    . ARG C 1 157 ? 49.528 13.428  65.779 1.00 56.63  ? 202 ARG C H    1 
ATOM   6067 H HA   . ARG C 1 157 ? 48.366 15.166  64.160 1.00 55.01  ? 202 ARG C HA   1 
ATOM   6068 H HB2  . ARG C 1 157 ? 51.052 15.081  65.026 1.00 54.13  ? 202 ARG C HB2  1 
ATOM   6069 H HB3  . ARG C 1 157 ? 50.424 16.303  64.233 1.00 54.13  ? 202 ARG C HB3  1 
ATOM   6070 H HG2  . ARG C 1 157 ? 49.016 16.729  66.042 1.00 56.16  ? 202 ARG C HG2  1 
ATOM   6071 H HG3  . ARG C 1 157 ? 49.711 15.539  66.840 1.00 56.16  ? 202 ARG C HG3  1 
ATOM   6072 H HD2  . ARG C 1 157 ? 51.113 17.821  65.957 1.00 59.34  ? 202 ARG C HD2  1 
ATOM   6073 H HD3  . ARG C 1 157 ? 50.593 17.641  67.451 1.00 59.34  ? 202 ARG C HD3  1 
ATOM   6074 H HE   . ARG C 1 157 ? 52.693 16.308  66.363 1.00 59.10  ? 202 ARG C HE   1 
ATOM   6075 H HH11 . ARG C 1 157 ? 50.893 16.695  69.109 1.00 64.45  ? 202 ARG C HH11 1 
ATOM   6076 H HH12 . ARG C 1 157 ? 51.844 16.005  70.025 1.00 64.45  ? 202 ARG C HH12 1 
ATOM   6077 H HH21 . ARG C 1 157 ? 54.124 15.255  67.762 1.00 61.90  ? 202 ARG C HH21 1 
ATOM   6078 H HH22 . ARG C 1 157 ? 53.798 15.134  69.211 1.00 61.90  ? 202 ARG C HH22 1 
ATOM   6079 N N    . VAL C 1 158 ? 50.401 13.107  62.835 1.00 42.00  ? 203 VAL C N    1 
ATOM   6080 C CA   . VAL C 1 158 ? 51.012 12.668  61.586 1.00 42.27  ? 203 VAL C CA   1 
ATOM   6081 C C    . VAL C 1 158 ? 49.963 12.163  60.599 1.00 42.56  ? 203 VAL C C    1 
ATOM   6082 O O    . VAL C 1 158 ? 50.111 12.335  59.383 1.00 42.09  ? 203 VAL C O    1 
ATOM   6083 C CB   . VAL C 1 158 ? 52.072 11.590  61.883 1.00 42.31  ? 203 VAL C CB   1 
ATOM   6084 C CG1  . VAL C 1 158 ? 52.399 10.788  60.635 1.00 41.51  ? 203 VAL C CG1  1 
ATOM   6085 C CG2  . VAL C 1 158 ? 53.316 12.235  62.447 1.00 42.33  ? 203 VAL C CG2  1 
ATOM   6086 H H    . VAL C 1 158 ? 50.579 12.604  63.509 1.00 50.40  ? 203 VAL C H    1 
ATOM   6087 H HA   . VAL C 1 158 ? 51.464 13.423  61.177 1.00 50.73  ? 203 VAL C HA   1 
ATOM   6088 H HB   . VAL C 1 158 ? 51.723 10.978  62.550 1.00 50.77  ? 203 VAL C HB   1 
ATOM   6089 H HG11 . VAL C 1 158 ? 53.067 10.120  60.855 1.00 49.81  ? 203 VAL C HG11 1 
ATOM   6090 H HG12 . VAL C 1 158 ? 51.591 10.356  60.317 1.00 49.81  ? 203 VAL C HG12 1 
ATOM   6091 H HG13 . VAL C 1 158 ? 52.743 11.388  59.955 1.00 49.81  ? 203 VAL C HG13 1 
ATOM   6092 H HG21 . VAL C 1 158 ? 53.974 11.546  62.630 1.00 50.80  ? 203 VAL C HG21 1 
ATOM   6093 H HG22 . VAL C 1 158 ? 53.667 12.864  61.798 1.00 50.80  ? 203 VAL C HG22 1 
ATOM   6094 H HG23 . VAL C 1 158 ? 53.086 12.699  63.267 1.00 50.80  ? 203 VAL C HG23 1 
ATOM   6095 N N    . LEU C 1 159 ? 48.918 11.495  61.085 1.00 45.20  ? 204 LEU C N    1 
ATOM   6096 C CA   . LEU C 1 159 ? 47.913 10.948  60.183 1.00 47.30  ? 204 LEU C CA   1 
ATOM   6097 C C    . LEU C 1 159 ? 46.774 11.920  59.887 1.00 50.88  ? 204 LEU C C    1 
ATOM   6098 O O    . LEU C 1 159 ? 45.967 11.644  58.992 1.00 50.49  ? 204 LEU C O    1 
ATOM   6099 C CB   . LEU C 1 159 ? 47.358 9.638   60.754 1.00 48.57  ? 204 LEU C CB   1 
ATOM   6100 C CG   . LEU C 1 159 ? 48.401 8.545   61.053 1.00 49.08  ? 204 LEU C CG   1 
ATOM   6101 C CD1  . LEU C 1 159 ? 47.725 7.297   61.566 1.00 49.60  ? 204 LEU C CD1  1 
ATOM   6102 C CD2  . LEU C 1 159 ? 49.264 8.207   59.840 1.00 47.07  ? 204 LEU C CD2  1 
ATOM   6103 H H    . LEU C 1 159 ? 48.771 11.348  61.919 1.00 54.24  ? 204 LEU C H    1 
ATOM   6104 H HA   . LEU C 1 159 ? 48.342 10.738  59.338 1.00 56.75  ? 204 LEU C HA   1 
ATOM   6105 H HB2  . LEU C 1 159 ? 46.900 9.837   61.585 1.00 58.28  ? 204 LEU C HB2  1 
ATOM   6106 H HB3  . LEU C 1 159 ? 46.726 9.269   60.117 1.00 58.28  ? 204 LEU C HB3  1 
ATOM   6107 H HG   . LEU C 1 159 ? 48.992 8.866   61.752 1.00 58.90  ? 204 LEU C HG   1 
ATOM   6108 H HD11 . LEU C 1 159 ? 48.401 6.625   61.747 1.00 59.52  ? 204 LEU C HD11 1 
ATOM   6109 H HD12 . LEU C 1 159 ? 47.244 7.511   62.381 1.00 59.52  ? 204 LEU C HD12 1 
ATOM   6110 H HD13 . LEU C 1 159 ? 47.108 6.973   60.892 1.00 59.52  ? 204 LEU C HD13 1 
ATOM   6111 H HD21 . LEU C 1 159 ? 49.898 7.517   60.087 1.00 56.49  ? 204 LEU C HD21 1 
ATOM   6112 H HD22 . LEU C 1 159 ? 48.691 7.890   59.124 1.00 56.49  ? 204 LEU C HD22 1 
ATOM   6113 H HD23 . LEU C 1 159 ? 49.736 9.006   59.557 1.00 56.49  ? 204 LEU C HD23 1 
ATOM   6114 N N    . ASN C 1 160 ? 46.693 13.047  60.595 1.00 54.12  ? 205 ASN C N    1 
ATOM   6115 C CA   . ASN C 1 160 ? 45.715 14.099  60.298 1.00 59.20  ? 205 ASN C CA   1 
ATOM   6116 C C    . ASN C 1 160 ? 44.284 13.568  60.359 1.00 59.58  ? 205 ASN C C    1 
ATOM   6117 O O    . ASN C 1 160 ? 43.473 13.795  59.459 1.00 61.22  ? 205 ASN C O    1 
ATOM   6118 C CB   . ASN C 1 160 ? 45.990 14.737  58.933 1.00 64.14  ? 205 ASN C CB   1 
ATOM   6119 C CG   . ASN C 1 160 ? 47.015 15.839  59.003 1.00 68.26  ? 205 ASN C CG   1 
ATOM   6120 O OD1  . ASN C 1 160 ? 46.691 16.983  59.325 1.00 71.23  ? 205 ASN C OD1  1 
ATOM   6121 N ND2  . ASN C 1 160 ? 48.264 15.507  58.690 1.00 68.35  ? 205 ASN C ND2  1 
ATOM   6122 H H    . ASN C 1 160 ? 47.202 13.230  61.264 1.00 64.95  ? 205 ASN C H    1 
ATOM   6123 H HA   . ASN C 1 160 ? 45.797 14.795  60.969 1.00 71.05  ? 205 ASN C HA   1 
ATOM   6124 H HB2  . ASN C 1 160 ? 46.322 14.057  58.327 1.00 76.97  ? 205 ASN C HB2  1 
ATOM   6125 H HB3  . ASN C 1 160 ? 45.166 15.116  58.589 1.00 76.97  ? 205 ASN C HB3  1 
ATOM   6126 H HD21 . ASN C 1 160 ? 48.886 16.101  58.714 1.00 82.02  ? 205 ASN C HD21 1 
ATOM   6127 H HD22 . ASN C 1 160 ? 48.450 14.699  58.462 1.00 82.02  ? 205 ASN C HD22 1 
ATOM   6128 N N    . LEU C 1 161 ? 43.973 12.890  61.423 1.00 62.53  ? 206 LEU C N    1 
ATOM   6129 C CA   . LEU C 1 161 ? 42.667 12.254  61.473 1.00 66.43  ? 206 LEU C CA   1 
ATOM   6130 C C    . LEU C 1 161 ? 41.711 13.046  62.358 1.00 67.49  ? 206 LEU C C    1 
ATOM   6131 O O    . LEU C 1 161 ? 42.143 13.683  63.323 1.00 69.75  ? 206 LEU C O    1 
ATOM   6132 C CB   . LEU C 1 161 ? 42.789 10.825  62.006 1.00 65.22  ? 206 LEU C CB   1 
ATOM   6133 C CG   . LEU C 1 161 ? 43.712 9.918   61.189 1.00 64.61  ? 206 LEU C CG   1 
ATOM   6134 C CD1  . LEU C 1 161 ? 43.900 8.572   61.884 1.00 65.11  ? 206 LEU C CD1  1 
ATOM   6135 C CD2  . LEU C 1 161 ? 43.180 9.729   59.773 1.00 65.33  ? 206 LEU C CD2  1 
ATOM   6136 H H    . LEU C 1 161 ? 44.470 12.776  62.115 1.00 75.03  ? 206 LEU C H    1 
ATOM   6137 H HA   . LEU C 1 161 ? 42.294 12.215  60.578 1.00 79.71  ? 206 LEU C HA   1 
ATOM   6138 H HB2  . LEU C 1 161 ? 43.138 10.861  62.910 1.00 78.26  ? 206 LEU C HB2  1 
ATOM   6139 H HB3  . LEU C 1 161 ? 41.908 10.420  62.011 1.00 78.26  ? 206 LEU C HB3  1 
ATOM   6140 H HG   . LEU C 1 161 ? 44.583 10.340  61.123 1.00 77.53  ? 206 LEU C HG   1 
ATOM   6141 H HD11 . LEU C 1 161 ? 44.488 8.019   61.346 1.00 78.13  ? 206 LEU C HD11 1 
ATOM   6142 H HD12 . LEU C 1 161 ? 44.294 8.721   62.758 1.00 78.13  ? 206 LEU C HD12 1 
ATOM   6143 H HD13 . LEU C 1 161 ? 43.036 8.143   61.978 1.00 78.13  ? 206 LEU C HD13 1 
ATOM   6144 H HD21 . LEU C 1 161 ? 43.786 9.151   59.283 1.00 78.39  ? 206 LEU C HD21 1 
ATOM   6145 H HD22 . LEU C 1 161 ? 42.300 9.324   59.818 1.00 78.39  ? 206 LEU C HD22 1 
ATOM   6146 H HD23 . LEU C 1 161 ? 43.125 10.595  59.339 1.00 78.39  ? 206 LEU C HD23 1 
ATOM   6147 N N    . PRO C 1 162 ? 40.410 13.018  62.060 1.00 55.57  ? 207 PRO C N    1 
ATOM   6148 C CA   . PRO C 1 162 ? 39.440 13.747  62.886 1.00 54.25  ? 207 PRO C CA   1 
ATOM   6149 C C    . PRO C 1 162 ? 39.625 13.431  64.359 1.00 57.27  ? 207 PRO C C    1 
ATOM   6150 O O    . PRO C 1 162 ? 40.090 12.338  64.717 1.00 53.38  ? 207 PRO C O    1 
ATOM   6151 C CB   . PRO C 1 162 ? 38.082 13.246  62.364 1.00 56.56  ? 207 PRO C CB   1 
ATOM   6152 C CG   . PRO C 1 162 ? 38.342 12.898  60.939 1.00 54.11  ? 207 PRO C CG   1 
ATOM   6153 C CD   . PRO C 1 162 ? 39.763 12.365  60.905 1.00 52.11  ? 207 PRO C CD   1 
ATOM   6154 H HA   . PRO C 1 162 ? 39.514 14.703  62.742 1.00 65.10  ? 207 PRO C HA   1 
ATOM   6155 H HB2  . PRO C 1 162 ? 37.805 12.463  62.866 1.00 67.87  ? 207 PRO C HB2  1 
ATOM   6156 H HB3  . PRO C 1 162 ? 37.422 13.953  62.433 1.00 67.87  ? 207 PRO C HB3  1 
ATOM   6157 H HG2  . PRO C 1 162 ? 37.714 12.218  60.650 1.00 64.93  ? 207 PRO C HG2  1 
ATOM   6158 H HG3  . PRO C 1 162 ? 38.262 13.694  60.390 1.00 64.93  ? 207 PRO C HG3  1 
ATOM   6159 H HD2  . PRO C 1 162 ? 39.764 11.401  61.018 1.00 62.53  ? 207 PRO C HD2  1 
ATOM   6160 H HD3  . PRO C 1 162 ? 40.201 12.626  60.080 1.00 62.53  ? 207 PRO C HD3  1 
ATOM   6161 N N    . PRO C 1 163 ? 39.255 14.358  65.248 1.00 73.68  ? 208 PRO C N    1 
ATOM   6162 C CA   . PRO C 1 163 ? 39.673 14.228  66.658 1.00 79.64  ? 208 PRO C CA   1 
ATOM   6163 C C    . PRO C 1 163 ? 39.168 12.972  67.359 1.00 84.55  ? 208 PRO C C    1 
ATOM   6164 O O    . PRO C 1 163 ? 39.924 12.366  68.130 1.00 86.44  ? 208 PRO C O    1 
ATOM   6165 C CB   . PRO C 1 163 ? 39.115 15.508  67.304 1.00 80.34  ? 208 PRO C CB   1 
ATOM   6166 C CG   . PRO C 1 163 ? 38.034 15.984  66.374 1.00 82.06  ? 208 PRO C CG   1 
ATOM   6167 C CD   . PRO C 1 163 ? 38.474 15.583  65.004 1.00 78.01  ? 208 PRO C CD   1 
ATOM   6168 H HA   . PRO C 1 163 ? 40.641 14.247  66.716 1.00 95.57  ? 208 PRO C HA   1 
ATOM   6169 H HB2  . PRO C 1 163 ? 38.748 15.300  68.178 1.00 96.40  ? 208 PRO C HB2  1 
ATOM   6170 H HB3  . PRO C 1 163 ? 39.820 16.170  67.377 1.00 96.40  ? 208 PRO C HB3  1 
ATOM   6171 H HG2  . PRO C 1 163 ? 37.196 15.553  66.603 1.00 98.47  ? 208 PRO C HG2  1 
ATOM   6172 H HG3  . PRO C 1 163 ? 37.952 16.948  66.438 1.00 98.47  ? 208 PRO C HG3  1 
ATOM   6173 H HD2  . PRO C 1 163 ? 37.706 15.389  64.445 1.00 93.61  ? 208 PRO C HD2  1 
ATOM   6174 H HD3  . PRO C 1 163 ? 39.035 16.271  64.614 1.00 93.61  ? 208 PRO C HD3  1 
ATOM   6175 N N    . ASN C 1 164 ? 37.924 12.556  67.124 1.00 85.13  ? 209 ASN C N    1 
ATOM   6176 C CA   . ASN C 1 164 ? 37.348 11.462  67.900 1.00 87.04  ? 209 ASN C CA   1 
ATOM   6177 C C    . ASN C 1 164 ? 37.772 10.099  67.365 1.00 83.95  ? 209 ASN C C    1 
ATOM   6178 O O    . ASN C 1 164 ? 37.044 9.115   67.520 1.00 85.72  ? 209 ASN C O    1 
ATOM   6179 C CB   . ASN C 1 164 ? 35.822 11.563  67.910 1.00 90.57  ? 209 ASN C CB   1 
ATOM   6180 C CG   . ASN C 1 164 ? 35.323 12.827  68.597 1.00 94.04  ? 209 ASN C CG   1 
ATOM   6181 O OD1  . ASN C 1 164 ? 36.067 13.796  68.760 1.00 93.58  ? 209 ASN C OD1  1 
ATOM   6182 N ND2  . ASN C 1 164 ? 34.056 12.822  69.000 1.00 98.02  ? 209 ASN C ND2  1 
ATOM   6183 H H    . ASN C 1 164 ? 37.400 12.886  66.528 1.00 102.16 ? 209 ASN C H    1 
ATOM   6184 H HA   . ASN C 1 164 ? 37.657 11.531  68.817 1.00 104.45 ? 209 ASN C HA   1 
ATOM   6185 H HB2  . ASN C 1 164 ? 35.500 11.571  66.995 1.00 108.69 ? 209 ASN C HB2  1 
ATOM   6186 H HB3  . ASN C 1 164 ? 35.458 10.800  68.384 1.00 108.69 ? 209 ASN C HB3  1 
ATOM   6187 H HD21 . ASN C 1 164 ? 33.727 13.512  69.393 1.00 117.62 ? 209 ASN C HD21 1 
ATOM   6188 H HD22 . ASN C 1 164 ? 33.565 12.128  68.867 1.00 117.62 ? 209 ASN C HD22 1 
ATOM   6189 N N    . THR C 1 165 ? 38.944 10.022  66.745 1.00 72.00  ? 210 THR C N    1 
ATOM   6190 C CA   . THR C 1 165 ? 39.407 8.774   66.159 1.00 67.25  ? 210 THR C CA   1 
ATOM   6191 C C    . THR C 1 165 ? 39.899 7.837   67.253 1.00 66.95  ? 210 THR C C    1 
ATOM   6192 O O    . THR C 1 165 ? 40.641 8.246   68.150 1.00 65.56  ? 210 THR C O    1 
ATOM   6193 C CB   . THR C 1 165 ? 40.512 9.051   65.144 1.00 61.64  ? 210 THR C CB   1 
ATOM   6194 O OG1  . THR C 1 165 ? 40.038 10.012  64.191 1.00 60.59  ? 210 THR C OG1  1 
ATOM   6195 C CG2  . THR C 1 165 ? 40.922 7.770   64.418 1.00 58.41  ? 210 THR C CG2  1 
ATOM   6196 H H    . THR C 1 165 ? 39.490 10.680  66.651 1.00 86.41  ? 210 THR C H    1 
ATOM   6197 H HA   . THR C 1 165 ? 38.670 8.344   65.698 1.00 80.70  ? 210 THR C HA   1 
ATOM   6198 H HB   . THR C 1 165 ? 41.290 9.406   65.603 1.00 73.96  ? 210 THR C HB   1 
ATOM   6199 H HG1  . THR C 1 165 ? 39.832 10.726  64.582 1.00 72.71  ? 210 THR C HG1  1 
ATOM   6200 H HG21 . THR C 1 165 ? 41.625 7.963   63.777 1.00 70.09  ? 210 THR C HG21 1 
ATOM   6201 H HG22 . THR C 1 165 ? 41.249 7.117   65.057 1.00 70.09  ? 210 THR C HG22 1 
ATOM   6202 H HG23 . THR C 1 165 ? 40.160 7.397   63.947 1.00 70.09  ? 210 THR C HG23 1 
ATOM   6203 N N    . ILE C 1 166 ? 39.471 6.585   67.184 1.00 64.93  ? 211 ILE C N    1 
ATOM   6204 C CA   . ILE C 1 166 ? 39.822 5.597   68.195 1.00 64.61  ? 211 ILE C CA   1 
ATOM   6205 C C    . ILE C 1 166 ? 41.197 5.032   67.871 1.00 60.59  ? 211 ILE C C    1 
ATOM   6206 O O    . ILE C 1 166 ? 41.492 4.697   66.718 1.00 57.78  ? 211 ILE C O    1 
ATOM   6207 C CB   . ILE C 1 166 ? 38.760 4.486   68.260 1.00 70.14  ? 211 ILE C CB   1 
ATOM   6208 C CG1  . ILE C 1 166 ? 37.449 5.023   68.846 1.00 74.32  ? 211 ILE C CG1  1 
ATOM   6209 C CG2  . ILE C 1 166 ? 39.242 3.309   69.110 1.00 69.20  ? 211 ILE C CG2  1 
ATOM   6210 C CD1  . ILE C 1 166 ? 36.569 5.795   67.859 1.00 76.41  ? 211 ILE C CD1  1 
ATOM   6211 H H    . ILE C 1 166 ? 38.971 6.279   66.555 1.00 77.92  ? 211 ILE C H    1 
ATOM   6212 H HA   . ILE C 1 166 ? 39.866 6.028   69.063 1.00 77.53  ? 211 ILE C HA   1 
ATOM   6213 H HB   . ILE C 1 166 ? 38.589 4.168   67.360 1.00 84.17  ? 211 ILE C HB   1 
ATOM   6214 H HG12 . ILE C 1 166 ? 36.930 4.274   69.178 1.00 89.18  ? 211 ILE C HG12 1 
ATOM   6215 H HG13 . ILE C 1 166 ? 37.662 5.622   69.579 1.00 89.18  ? 211 ILE C HG13 1 
ATOM   6216 H HG21 . ILE C 1 166 ? 38.550 2.629   69.129 1.00 83.04  ? 211 ILE C HG21 1 
ATOM   6217 H HG22 . ILE C 1 166 ? 40.051 2.946   68.716 1.00 83.04  ? 211 ILE C HG22 1 
ATOM   6218 H HG23 . ILE C 1 166 ? 39.423 3.623   70.009 1.00 83.04  ? 211 ILE C HG23 1 
ATOM   6219 H HD11 . ILE C 1 166 ? 35.768 6.093   68.318 1.00 91.69  ? 211 ILE C HD11 1 
ATOM   6220 H HD12 . ILE C 1 166 ? 37.064 6.559   67.526 1.00 91.69  ? 211 ILE C HD12 1 
ATOM   6221 H HD13 . ILE C 1 166 ? 36.330 5.208   67.124 1.00 91.69  ? 211 ILE C HD13 1 
ATOM   6222 N N    . MET C 1 167 ? 42.047 4.945   68.891 1.00 67.79  ? 212 MET C N    1 
ATOM   6223 C CA   . MET C 1 167 ? 43.344 4.294   68.803 1.00 67.64  ? 212 MET C CA   1 
ATOM   6224 C C    . MET C 1 167 ? 43.475 3.326   69.965 1.00 67.35  ? 212 MET C C    1 
ATOM   6225 O O    . MET C 1 167 ? 42.974 3.584   71.062 1.00 71.76  ? 212 MET C O    1 
ATOM   6226 C CB   . MET C 1 167 ? 44.499 5.300   68.853 1.00 69.42  ? 212 MET C CB   1 
ATOM   6227 C CG   . MET C 1 167 ? 44.561 6.250   67.684 1.00 70.11  ? 212 MET C CG   1 
ATOM   6228 S SD   . MET C 1 167 ? 46.056 7.258   67.723 1.00 71.78  ? 212 MET C SD   1 
ATOM   6229 C CE   . MET C 1 167 ? 45.939 8.090   66.142 1.00 69.67  ? 212 MET C CE   1 
ATOM   6230 H H    . MET C 1 167 ? 41.884 5.268   69.671 1.00 81.35  ? 212 MET C H    1 
ATOM   6231 H HA   . MET C 1 167 ? 43.402 3.804   67.967 1.00 81.17  ? 212 MET C HA   1 
ATOM   6232 H HB2  . MET C 1 167 ? 44.411 5.832   69.659 1.00 83.30  ? 212 MET C HB2  1 
ATOM   6233 H HB3  . MET C 1 167 ? 45.336 4.810   68.876 1.00 83.30  ? 212 MET C HB3  1 
ATOM   6234 H HG2  . MET C 1 167 ? 44.559 5.741   66.859 1.00 84.13  ? 212 MET C HG2  1 
ATOM   6235 H HG3  . MET C 1 167 ? 43.794 6.843   67.714 1.00 84.13  ? 212 MET C HG3  1 
ATOM   6236 H HE1  . MET C 1 167 ? 46.704 8.677   66.037 1.00 83.61  ? 212 MET C HE1  1 
ATOM   6237 H HE2  . MET C 1 167 ? 45.933 7.425   65.436 1.00 83.61  ? 212 MET C HE2  1 
ATOM   6238 H HE3  . MET C 1 167 ? 45.119 8.606   66.117 1.00 83.61  ? 212 MET C HE3  1 
ATOM   6239 N N    . GLU C 1 168 ? 44.160 2.214   69.720 1.00 66.99  ? 213 GLU C N    1 
ATOM   6240 C CA   . GLU C 1 168 ? 44.299 1.154   70.709 1.00 67.56  ? 213 GLU C CA   1 
ATOM   6241 C C    . GLU C 1 168 ? 45.748 0.702   70.781 1.00 61.95  ? 213 GLU C C    1 
ATOM   6242 O O    . GLU C 1 168 ? 46.403 0.514   69.752 1.00 59.20  ? 213 GLU C O    1 
ATOM   6243 C CB   . GLU C 1 168 ? 43.397 -0.043  70.373 1.00 72.38  ? 213 GLU C CB   1 
ATOM   6244 C CG   . GLU C 1 168 ? 41.917 0.313   70.312 1.00 78.25  ? 213 GLU C CG   1 
ATOM   6245 C CD   . GLU C 1 168 ? 41.007 -0.895  70.149 1.00 83.02  ? 213 GLU C CD   1 
ATOM   6246 O OE1  . GLU C 1 168 ? 41.465 -1.939  69.632 1.00 84.24  ? 213 GLU C OE1  1 
ATOM   6247 O OE2  . GLU C 1 168 ? 39.827 -0.794  70.547 1.00 87.17  ? 213 GLU C OE2  1 
ATOM   6248 H H    . GLU C 1 168 ? 44.559 2.048   68.977 1.00 80.39  ? 213 GLU C H    1 
ATOM   6249 H HA   . GLU C 1 168 ? 44.042 1.493   71.580 1.00 81.07  ? 213 GLU C HA   1 
ATOM   6250 H HB2  . GLU C 1 168 ? 43.654 -0.397  69.507 1.00 86.85  ? 213 GLU C HB2  1 
ATOM   6251 H HB3  . GLU C 1 168 ? 43.512 -0.724  71.054 1.00 86.85  ? 213 GLU C HB3  1 
ATOM   6252 H HG2  . GLU C 1 168 ? 41.669 0.763   71.135 1.00 93.90  ? 213 GLU C HG2  1 
ATOM   6253 H HG3  . GLU C 1 168 ? 41.767 0.903   69.557 1.00 93.90  ? 213 GLU C HG3  1 
ATOM   6254 N N    . TYR C 1 169 ? 46.241 0.531   72.002 1.00 61.11  ? 214 TYR C N    1 
ATOM   6255 C CA   . TYR C 1 169 ? 47.562 -0.023  72.248 1.00 58.67  ? 214 TYR C CA   1 
ATOM   6256 C C    . TYR C 1 169 ? 47.411 -1.455  72.738 1.00 62.49  ? 214 TYR C C    1 
ATOM   6257 O O    . TYR C 1 169 ? 46.674 -1.711  73.696 1.00 65.65  ? 214 TYR C O    1 
ATOM   6258 C CB   . TYR C 1 169 ? 48.325 0.815   73.277 1.00 58.87  ? 214 TYR C CB   1 
ATOM   6259 C CG   . TYR C 1 169 ? 49.794 0.471   73.343 1.00 56.92  ? 214 TYR C CG   1 
ATOM   6260 C CD1  . TYR C 1 169 ? 50.683 0.969   72.400 1.00 53.98  ? 214 TYR C CD1  1 
ATOM   6261 C CD2  . TYR C 1 169 ? 50.290 -0.361  74.337 1.00 59.29  ? 214 TYR C CD2  1 
ATOM   6262 C CE1  . TYR C 1 169 ? 52.023 0.653   72.443 1.00 53.82  ? 214 TYR C CE1  1 
ATOM   6263 C CE2  . TYR C 1 169 ? 51.634 -0.681  74.395 1.00 59.32  ? 214 TYR C CE2  1 
ATOM   6264 C CZ   . TYR C 1 169 ? 52.497 -0.170  73.444 1.00 56.64  ? 214 TYR C CZ   1 
ATOM   6265 O OH   . TYR C 1 169 ? 53.837 -0.490  73.489 1.00 56.72  ? 214 TYR C OH   1 
ATOM   6266 H H    . TYR C 1 169 ? 45.815 0.734   72.721 1.00 73.34  ? 214 TYR C H    1 
ATOM   6267 H HA   . TYR C 1 169 ? 48.069 -0.032  71.422 1.00 70.41  ? 214 TYR C HA   1 
ATOM   6268 H HB2  . TYR C 1 169 ? 48.248 1.753   73.039 1.00 70.64  ? 214 TYR C HB2  1 
ATOM   6269 H HB3  . TYR C 1 169 ? 47.942 0.663   74.155 1.00 70.64  ? 214 TYR C HB3  1 
ATOM   6270 H HD1  . TYR C 1 169 ? 50.367 1.525   71.724 1.00 64.77  ? 214 TYR C HD1  1 
ATOM   6271 H HD2  . TYR C 1 169 ? 49.710 -0.705  74.977 1.00 71.14  ? 214 TYR C HD2  1 
ATOM   6272 H HE1  . TYR C 1 169 ? 52.605 0.997   71.805 1.00 64.58  ? 214 TYR C HE1  1 
ATOM   6273 H HE2  . TYR C 1 169 ? 51.954 -1.239  75.066 1.00 71.18  ? 214 TYR C HE2  1 
ATOM   6274 H HH   . TYR C 1 169 ? 54.243 -0.119  72.853 1.00 68.07  ? 214 TYR C HH   1 
ATOM   6275 N N    . LYS C 1 170 ? 48.097 -2.386  72.080 1.00 67.88  ? 215 LYS C N    1 
ATOM   6276 C CA   . LYS C 1 170 ? 48.034 -3.797  72.435 1.00 75.75  ? 215 LYS C CA   1 
ATOM   6277 C C    . LYS C 1 170 ? 49.433 -4.314  72.730 1.00 74.49  ? 215 LYS C C    1 
ATOM   6278 O O    . LYS C 1 170 ? 50.362 -4.084  71.950 1.00 70.36  ? 215 LYS C O    1 
ATOM   6279 C CB   . LYS C 1 170 ? 47.379 -4.621  71.320 1.00 80.73  ? 215 LYS C CB   1 
ATOM   6280 C CG   . LYS C 1 170 ? 45.863 -4.429  71.240 1.00 89.23  ? 215 LYS C CG   1 
ATOM   6281 C CD   . LYS C 1 170 ? 45.187 -5.458  70.333 1.00 94.08  ? 215 LYS C CD   1 
ATOM   6282 C CE   . LYS C 1 170 ? 43.698 -5.150  70.154 1.00 98.54  ? 215 LYS C CE   1 
ATOM   6283 N NZ   . LYS C 1 170 ? 43.035 -6.093  69.208 1.00 101.08 ? 215 LYS C NZ   1 
ATOM   6284 H H    . LYS C 1 170 ? 48.614 -2.220  71.413 1.00 81.46  ? 215 LYS C H    1 
ATOM   6285 H HA   . LYS C 1 170 ? 47.499 -3.899  73.238 1.00 90.90  ? 215 LYS C HA   1 
ATOM   6286 H HB2  . LYS C 1 170 ? 47.758 -4.355  70.467 1.00 96.88  ? 215 LYS C HB2  1 
ATOM   6287 H HB3  . LYS C 1 170 ? 47.552 -5.562  71.480 1.00 96.88  ? 215 LYS C HB3  1 
ATOM   6288 H HG2  . LYS C 1 170 ? 45.486 -4.518  72.129 1.00 107.07 ? 215 LYS C HG2  1 
ATOM   6289 H HG3  . LYS C 1 170 ? 45.675 -3.546  70.886 1.00 107.07 ? 215 LYS C HG3  1 
ATOM   6290 H HD2  . LYS C 1 170 ? 45.608 -5.441  69.460 1.00 112.89 ? 215 LYS C HD2  1 
ATOM   6291 H HD3  . LYS C 1 170 ? 45.270 -6.339  70.730 1.00 112.89 ? 215 LYS C HD3  1 
ATOM   6292 H HE2  . LYS C 1 170 ? 43.253 -5.223  71.013 1.00 118.25 ? 215 LYS C HE2  1 
ATOM   6293 H HE3  . LYS C 1 170 ? 43.599 -4.251  69.802 1.00 118.25 ? 215 LYS C HE3  1 
ATOM   6294 H HZ1  . LYS C 1 170 ? 42.173 -5.887  69.127 1.00 121.30 ? 215 LYS C HZ1  1 
ATOM   6295 H HZ2  . LYS C 1 170 ? 43.421 -6.043  68.408 1.00 121.30 ? 215 LYS C HZ2  1 
ATOM   6296 H HZ3  . LYS C 1 170 ? 43.106 -6.927  69.511 1.00 121.30 ? 215 LYS C HZ3  1 
ATOM   6297 N N    . THR C 1 171 ? 49.578 -4.996  73.862 1.00 73.68  ? 216 THR C N    1 
ATOM   6298 C CA   . THR C 1 171 ? 50.811 -5.658  74.252 1.00 73.67  ? 216 THR C CA   1 
ATOM   6299 C C    . THR C 1 171 ? 50.631 -7.164  74.089 1.00 86.56  ? 216 THR C C    1 
ATOM   6300 O O    . THR C 1 171 ? 49.644 -7.634  73.509 1.00 81.06  ? 216 THR C O    1 
ATOM   6301 C CB   . THR C 1 171 ? 51.190 -5.283  75.688 1.00 74.85  ? 216 THR C CB   1 
ATOM   6302 O OG1  . THR C 1 171 ? 50.236 -5.833  76.604 1.00 75.43  ? 216 THR C OG1  1 
ATOM   6303 C CG2  . THR C 1 171 ? 51.224 -3.777  75.855 1.00 70.41  ? 216 THR C CG2  1 
ATOM   6304 H H    . THR C 1 171 ? 48.949 -5.090  74.441 1.00 88.42  ? 216 THR C H    1 
ATOM   6305 H HA   . THR C 1 171 ? 51.527 -5.372  73.664 1.00 88.41  ? 216 THR C HA   1 
ATOM   6306 H HB   . THR C 1 171 ? 52.071 -5.634  75.890 1.00 89.82  ? 216 THR C HB   1 
ATOM   6307 H HG1  . THR C 1 171 ? 50.444 -5.628  77.392 1.00 90.52  ? 216 THR C HG1  1 
ATOM   6308 H HG21 . THR C 1 171 ? 51.465 -3.550  76.767 1.00 84.50  ? 216 THR C HG21 1 
ATOM   6309 H HG22 . THR C 1 171 ? 51.878 -3.391  75.252 1.00 84.50  ? 216 THR C HG22 1 
ATOM   6310 H HG23 . THR C 1 171 ? 50.352 -3.401  75.657 1.00 84.50  ? 216 THR C HG23 1 
ATOM   6311 N N    . HIS C 1 172 ? 51.590 -7.929  74.605 1.00 102.03 ? 217 HIS C N    1 
ATOM   6312 C CA   . HIS C 1 172 ? 51.507 -9.382  74.539 1.00 108.24 ? 217 HIS C CA   1 
ATOM   6313 C C    . HIS C 1 172 ? 50.903 -9.992  75.795 1.00 108.25 ? 217 HIS C C    1 
ATOM   6314 O O    . HIS C 1 172 ? 50.273 -11.053 75.717 1.00 112.01 ? 217 HIS C O    1 
ATOM   6315 C CB   . HIS C 1 172 ? 52.897 -9.971  74.295 1.00 104.38 ? 217 HIS C CB   1 
ATOM   6316 C CG   . HIS C 1 172 ? 53.549 -9.466  73.047 1.00 104.60 ? 217 HIS C CG   1 
ATOM   6317 N ND1  . HIS C 1 172 ? 54.063 -8.191  72.939 1.00 102.18 ? 217 HIS C ND1  1 
ATOM   6318 C CD2  . HIS C 1 172 ? 53.760 -10.059 71.848 1.00 103.70 ? 217 HIS C CD2  1 
ATOM   6319 C CE1  . HIS C 1 172 ? 54.567 -8.023  71.730 1.00 99.23  ? 217 HIS C CE1  1 
ATOM   6320 N NE2  . HIS C 1 172 ? 54.396 -9.141  71.048 1.00 99.82  ? 217 HIS C NE2  1 
ATOM   6321 H H    . HIS C 1 172 ? 52.295 -7.632  74.998 1.00 122.44 ? 217 HIS C H    1 
ATOM   6322 H HA   . HIS C 1 172 ? 50.944 -9.629  73.789 1.00 129.89 ? 217 HIS C HA   1 
ATOM   6323 H HB2  . HIS C 1 172 ? 53.470 -9.743  75.044 1.00 125.25 ? 217 HIS C HB2  1 
ATOM   6324 H HB3  . HIS C 1 172 ? 52.820 -10.935 74.221 1.00 125.25 ? 217 HIS C HB3  1 
ATOM   6325 H HD2  . HIS C 1 172 ? 53.521 -10.926 71.611 1.00 124.44 ? 217 HIS C HD2  1 
ATOM   6326 H HE1  . HIS C 1 172 ? 54.974 -7.249  71.413 1.00 119.08 ? 217 HIS C HE1  1 
ATOM   6327 H HE2  . HIS C 1 172 ? 54.644 -9.273  70.235 1.00 119.79 ? 217 HIS C HE2  1 
ATOM   6328 N N    . THR C 1 173 ? 51.072 -9.346  76.943 1.00 110.71 ? 218 THR C N    1 
ATOM   6329 C CA   . THR C 1 173 ? 50.513 -9.847  78.194 1.00 113.34 ? 218 THR C CA   1 
ATOM   6330 C C    . THR C 1 173 ? 49.059 -9.408  78.362 1.00 113.68 ? 218 THR C C    1 
ATOM   6331 O O    . THR C 1 173 ? 48.333 -9.235  77.382 1.00 110.76 ? 218 THR C O    1 
ATOM   6332 C CB   . THR C 1 173 ? 51.329 -9.366  79.413 1.00 113.52 ? 218 THR C CB   1 
ATOM   6333 O OG1  . THR C 1 173 ? 50.739 -9.872  80.616 1.00 116.78 ? 218 THR C OG1  1 
ATOM   6334 C CG2  . THR C 1 173 ? 51.379 -7.840  79.474 1.00 109.70 ? 218 THR C CG2  1 
ATOM   6335 H H    . THR C 1 173 ? 51.510 -8.610  77.026 1.00 132.86 ? 218 THR C H    1 
ATOM   6336 H HA   . THR C 1 173 ? 50.534 -10.817 78.183 1.00 136.01 ? 218 THR C HA   1 
ATOM   6337 H HB   . THR C 1 173 ? 52.238 -9.696  79.339 1.00 136.23 ? 218 THR C HB   1 
ATOM   6338 H HG1  . THR C 1 173 ? 51.180 -9.614  81.283 1.00 140.13 ? 218 THR C HG1  1 
ATOM   6339 H HG21 . THR C 1 173 ? 51.895 -7.556  80.244 1.00 131.64 ? 218 THR C HG21 1 
ATOM   6340 H HG22 . THR C 1 173 ? 51.793 -7.490  78.670 1.00 131.64 ? 218 THR C HG22 1 
ATOM   6341 H HG23 . THR C 1 173 ? 50.480 -7.482  79.547 1.00 131.64 ? 218 THR C HG23 1 
ATOM   6342 N N    . LYS D 2 7   ? 67.516 9.153   73.100 1.00 117.36 ? 37  LYS D N    1 
ATOM   6343 C CA   . LYS D 2 7   ? 68.580 9.390   72.129 1.00 115.72 ? 37  LYS D CA   1 
ATOM   6344 C C    . LYS D 2 7   ? 68.073 10.250  70.973 1.00 111.09 ? 37  LYS D C    1 
ATOM   6345 O O    . LYS D 2 7   ? 66.884 10.236  70.654 1.00 109.68 ? 37  LYS D O    1 
ATOM   6346 C CB   . LYS D 2 7   ? 69.131 8.063   71.598 1.00 114.93 ? 37  LYS D CB   1 
ATOM   6347 C CG   . LYS D 2 7   ? 70.256 8.223   70.583 1.00 113.10 ? 37  LYS D CG   1 
ATOM   6348 C CD   . LYS D 2 7   ? 70.879 6.892   70.212 1.00 113.20 ? 37  LYS D CD   1 
ATOM   6349 C CE   . LYS D 2 7   ? 72.005 7.071   69.205 1.00 112.04 ? 37  LYS D CE   1 
ATOM   6350 N NZ   . LYS D 2 7   ? 72.673 5.782   68.876 1.00 113.10 ? 37  LYS D NZ   1 
ATOM   6351 H H    . LYS D 2 7   ? 66.770 8.909   72.749 1.00 140.83 ? 37  LYS D H    1 
ATOM   6352 H HA   . LYS D 2 7   ? 69.305 9.866   72.563 1.00 138.87 ? 37  LYS D HA   1 
ATOM   6353 H HB2  . LYS D 2 7   ? 69.476 7.547   72.343 1.00 137.92 ? 37  LYS D HB2  1 
ATOM   6354 H HB3  . LYS D 2 7   ? 68.411 7.576   71.167 1.00 137.92 ? 37  LYS D HB3  1 
ATOM   6355 H HG2  . LYS D 2 7   ? 69.902 8.627   69.775 1.00 135.73 ? 37  LYS D HG2  1 
ATOM   6356 H HG3  . LYS D 2 7   ? 70.949 8.786   70.961 1.00 135.73 ? 37  LYS D HG3  1 
ATOM   6357 H HD2  . LYS D 2 7   ? 71.245 6.476   71.008 1.00 135.83 ? 37  LYS D HD2  1 
ATOM   6358 H HD3  . LYS D 2 7   ? 70.203 6.321   69.815 1.00 135.83 ? 37  LYS D HD3  1 
ATOM   6359 H HE2  . LYS D 2 7   ? 71.642 7.441   68.385 1.00 134.45 ? 37  LYS D HE2  1 
ATOM   6360 H HE3  . LYS D 2 7   ? 72.671 7.670   69.576 1.00 134.45 ? 37  LYS D HE3  1 
ATOM   6361 H HZ1  . LYS D 2 7   ? 73.325 5.919   68.286 1.00 135.72 ? 37  LYS D HZ1  1 
ATOM   6362 H HZ2  . LYS D 2 7   ? 73.020 5.423   69.613 1.00 135.72 ? 37  LYS D HZ2  1 
ATOM   6363 H HZ3  . LYS D 2 7   ? 72.083 5.214   68.528 1.00 135.72 ? 37  LYS D HZ3  1 
ATOM   6364 N N    . LEU D 2 8   ? 68.983 10.998  70.351 1.00 109.24 ? 38  LEU D N    1 
ATOM   6365 C CA   . LEU D 2 8   ? 68.664 11.864  69.223 1.00 102.99 ? 38  LEU D CA   1 
ATOM   6366 C C    . LEU D 2 8   ? 69.321 11.318  67.962 1.00 99.87  ? 38  LEU D C    1 
ATOM   6367 O O    . LEU D 2 8   ? 70.523 11.032  67.954 1.00 104.34 ? 38  LEU D O    1 
ATOM   6368 C CB   . LEU D 2 8   ? 69.127 13.302  69.485 1.00 103.15 ? 38  LEU D CB   1 
ATOM   6369 C CG   . LEU D 2 8   ? 68.496 14.023  70.682 1.00 103.21 ? 38  LEU D CG   1 
ATOM   6370 C CD1  . LEU D 2 8   ? 69.059 15.426  70.816 1.00 103.97 ? 38  LEU D CD1  1 
ATOM   6371 C CD2  . LEU D 2 8   ? 66.983 14.074  70.558 1.00 99.98  ? 38  LEU D CD2  1 
ATOM   6372 H H    . LEU D 2 8   ? 69.814 11.019  70.573 1.00 131.08 ? 38  LEU D H    1 
ATOM   6373 H HA   . LEU D 2 8   ? 67.704 11.873  69.088 1.00 123.59 ? 38  LEU D HA   1 
ATOM   6374 H HB2  . LEU D 2 8   ? 70.086 13.289  69.632 1.00 123.78 ? 38  LEU D HB2  1 
ATOM   6375 H HB3  . LEU D 2 8   ? 68.931 13.831  68.696 1.00 123.78 ? 38  LEU D HB3  1 
ATOM   6376 H HG   . LEU D 2 8   ? 68.713 13.537  71.492 1.00 123.85 ? 38  LEU D HG   1 
ATOM   6377 H HD11 . LEU D 2 8   ? 68.645 15.860  71.578 1.00 124.76 ? 38  LEU D HD11 1 
ATOM   6378 H HD12 . LEU D 2 8   ? 70.018 15.370  70.947 1.00 124.76 ? 38  LEU D HD12 1 
ATOM   6379 H HD13 . LEU D 2 8   ? 68.864 15.923  70.006 1.00 124.76 ? 38  LEU D HD13 1 
ATOM   6380 H HD21 . LEU D 2 8   ? 66.619 14.536  71.330 1.00 119.97 ? 38  LEU D HD21 1 
ATOM   6381 H HD22 . LEU D 2 8   ? 66.749 14.549  69.746 1.00 119.97 ? 38  LEU D HD22 1 
ATOM   6382 H HD23 . LEU D 2 8   ? 66.640 13.167  70.522 1.00 119.97 ? 38  LEU D HD23 1 
ATOM   6383 N N    . ALA D 2 9   ? 68.525 11.164  66.906 1.00 102.14 ? 39  ALA D N    1 
ATOM   6384 C CA   . ALA D 2 9   ? 69.027 10.696  65.624 1.00 95.84  ? 39  ALA D CA   1 
ATOM   6385 C C    . ALA D 2 9   ? 69.623 11.848  64.825 1.00 89.86  ? 39  ALA D C    1 
ATOM   6386 O O    . ALA D 2 9   ? 69.184 12.997  64.922 1.00 89.54  ? 39  ALA D O    1 
ATOM   6387 C CB   . ALA D 2 9   ? 67.907 10.038  64.818 1.00 92.79  ? 39  ALA D CB   1 
ATOM   6388 H H    . ALA D 2 9   ? 67.681 11.328  66.910 1.00 122.57 ? 39  ALA D H    1 
ATOM   6389 H HA   . ALA D 2 9   ? 69.722 10.037  65.773 1.00 115.00 ? 39  ALA D HA   1 
ATOM   6390 H HB1  . ALA D 2 9   ? 68.266 9.734   63.969 1.00 111.34 ? 39  ALA D HB1  1 
ATOM   6391 H HB2  . ALA D 2 9   ? 67.560 9.283   65.319 1.00 111.34 ? 39  ALA D HB2  1 
ATOM   6392 H HB3  . ALA D 2 9   ? 67.203 10.687  64.667 1.00 111.34 ? 39  ALA D HB3  1 
ATOM   6393 N N    . ASP D 2 10  ? 70.632 11.524  64.019 1.00 76.51  ? 40  ASP D N    1 
ATOM   6394 C CA   . ASP D 2 10  ? 71.336 12.529  63.239 1.00 70.63  ? 40  ASP D CA   1 
ATOM   6395 C C    . ASP D 2 10  ? 70.816 12.665  61.815 1.00 62.18  ? 40  ASP D C    1 
ATOM   6396 O O    . ASP D 2 10  ? 70.999 13.728  61.214 1.00 58.39  ? 40  ASP D O    1 
ATOM   6397 C CB   . ASP D 2 10  ? 72.832 12.203  63.194 1.00 72.95  ? 40  ASP D CB   1 
ATOM   6398 C CG   . ASP D 2 10  ? 73.410 11.911  64.570 1.00 77.09  ? 40  ASP D CG   1 
ATOM   6399 O OD1  . ASP D 2 10  ? 73.245 10.764  65.044 1.00 78.12  ? 40  ASP D OD1  1 
ATOM   6400 O OD2  . ASP D 2 10  ? 74.030 12.821  65.171 1.00 79.63  ? 40  ASP D OD2  1 
ATOM   6401 H H    . ASP D 2 10  ? 70.926 10.724  63.908 1.00 91.81  ? 40  ASP D H    1 
ATOM   6402 H HA   . ASP D 2 10  ? 71.233 13.390  63.675 1.00 84.76  ? 40  ASP D HA   1 
ATOM   6403 H HB2  . ASP D 2 10  ? 72.968 11.420  62.638 1.00 87.54  ? 40  ASP D HB2  1 
ATOM   6404 H HB3  . ASP D 2 10  ? 73.310 12.961  62.823 1.00 87.54  ? 40  ASP D HB3  1 
ATOM   6405 N N    . TYR D 2 11  ? 70.194 11.624  61.256 1.00 55.52  ? 41  TYR D N    1 
ATOM   6406 C CA   . TYR D 2 11  ? 69.610 11.673  59.915 1.00 51.90  ? 41  TYR D CA   1 
ATOM   6407 C C    . TYR D 2 11  ? 68.094 11.801  60.058 1.00 48.85  ? 41  TYR D C    1 
ATOM   6408 O O    . TYR D 2 11  ? 67.391 10.811  60.279 1.00 47.50  ? 41  TYR D O    1 
ATOM   6409 C CB   . TYR D 2 11  ? 69.988 10.439  59.100 1.00 52.50  ? 41  TYR D CB   1 
ATOM   6410 C CG   . TYR D 2 11  ? 71.408 10.469  58.585 1.00 56.38  ? 41  TYR D CG   1 
ATOM   6411 C CD1  . TYR D 2 11  ? 71.771 11.325  57.557 1.00 57.49  ? 41  TYR D CD1  1 
ATOM   6412 C CD2  . TYR D 2 11  ? 72.386 9.650   59.129 1.00 59.88  ? 41  TYR D CD2  1 
ATOM   6413 C CE1  . TYR D 2 11  ? 73.067 11.369  57.085 1.00 60.84  ? 41  TYR D CE1  1 
ATOM   6414 C CE2  . TYR D 2 11  ? 73.691 9.688   58.662 1.00 63.44  ? 41  TYR D CE2  1 
ATOM   6415 C CZ   . TYR D 2 11  ? 74.021 10.550  57.639 1.00 63.43  ? 41  TYR D CZ   1 
ATOM   6416 O OH   . TYR D 2 11  ? 75.306 10.598  57.161 1.00 65.83  ? 41  TYR D OH   1 
ATOM   6417 H H    . TYR D 2 11  ? 70.096 10.862  61.644 1.00 66.63  ? 41  TYR D H    1 
ATOM   6418 H HA   . TYR D 2 11  ? 69.940 12.458  59.450 1.00 62.29  ? 41  TYR D HA   1 
ATOM   6419 H HB2  . TYR D 2 11  ? 69.890 9.652   59.659 1.00 62.99  ? 41  TYR D HB2  1 
ATOM   6420 H HB3  . TYR D 2 11  ? 69.395 10.375  58.335 1.00 62.99  ? 41  TYR D HB3  1 
ATOM   6421 H HD1  . TYR D 2 11  ? 71.130 11.884  57.181 1.00 68.98  ? 41  TYR D HD1  1 
ATOM   6422 H HD2  . TYR D 2 11  ? 72.165 9.070   59.822 1.00 71.86  ? 41  TYR D HD2  1 
ATOM   6423 H HE1  . TYR D 2 11  ? 73.294 11.949  56.394 1.00 73.01  ? 41  TYR D HE1  1 
ATOM   6424 H HE2  . TYR D 2 11  ? 74.338 9.133   59.035 1.00 76.13  ? 41  TYR D HE2  1 
ATOM   6425 H HH   . TYR D 2 11  ? 75.789 10.053  57.580 1.00 78.99  ? 41  TYR D HH   1 
ATOM   6426 N N    . ARG D 2 12  ? 67.596 13.028  59.921 1.00 49.58  ? 42  ARG D N    1 
ATOM   6427 C CA   . ARG D 2 12  ? 66.179 13.332  60.015 1.00 49.62  ? 42  ARG D CA   1 
ATOM   6428 C C    . ARG D 2 12  ? 65.710 13.981  58.720 1.00 47.28  ? 42  ARG D C    1 
ATOM   6429 O O    . ARG D 2 12  ? 66.477 14.675  58.045 1.00 48.10  ? 42  ARG D O    1 
ATOM   6430 C CB   . ARG D 2 12  ? 65.897 14.264  61.190 1.00 56.24  ? 42  ARG D CB   1 
ATOM   6431 C CG   . ARG D 2 12  ? 66.299 13.702  62.534 1.00 64.73  ? 42  ARG D CG   1 
ATOM   6432 C CD   . ARG D 2 12  ? 65.885 14.635  63.652 1.00 72.69  ? 42  ARG D CD   1 
ATOM   6433 N NE   . ARG D 2 12  ? 66.268 14.136  64.972 1.00 82.57  ? 42  ARG D NE   1 
ATOM   6434 C CZ   . ARG D 2 12  ? 65.565 13.257  65.682 1.00 89.14  ? 42  ARG D CZ   1 
ATOM   6435 N NH1  . ARG D 2 12  ? 64.434 12.753  65.202 1.00 91.52  ? 42  ARG D NH1  1 
ATOM   6436 N NH2  . ARG D 2 12  ? 65.996 12.877  66.878 1.00 95.20  ? 42  ARG D NH2  1 
ATOM   6437 H H    . ARG D 2 12  ? 68.081 13.721  59.768 1.00 59.50  ? 42  ARG D H    1 
ATOM   6438 H HA   . ARG D 2 12  ? 65.679 12.511  60.146 1.00 59.54  ? 42  ARG D HA   1 
ATOM   6439 H HB2  . ARG D 2 12  ? 66.387 15.090  61.057 1.00 67.49  ? 42  ARG D HB2  1 
ATOM   6440 H HB3  . ARG D 2 12  ? 64.945 14.448  61.220 1.00 67.49  ? 42  ARG D HB3  1 
ATOM   6441 H HG2  . ARG D 2 12  ? 65.860 12.847  62.670 1.00 77.67  ? 42  ARG D HG2  1 
ATOM   6442 H HG3  . ARG D 2 12  ? 67.262 13.596  62.564 1.00 77.67  ? 42  ARG D HG3  1 
ATOM   6443 H HD2  . ARG D 2 12  ? 66.312 15.495  63.521 1.00 87.23  ? 42  ARG D HD2  1 
ATOM   6444 H HD3  . ARG D 2 12  ? 64.920 14.737  63.638 1.00 87.23  ? 42  ARG D HD3  1 
ATOM   6445 H HE   . ARG D 2 12  ? 66.999 14.433  65.314 1.00 99.08  ? 42  ARG D HE   1 
ATOM   6446 H HH11 . ARG D 2 12  ? 64.148 12.998  64.429 1.00 109.83 ? 42  ARG D HH11 1 
ATOM   6447 H HH12 . ARG D 2 12  ? 63.986 12.184  65.665 1.00 109.83 ? 42  ARG D HH12 1 
ATOM   6448 H HH21 . ARG D 2 12  ? 66.730 13.197  67.192 1.00 114.24 ? 42  ARG D HH21 1 
ATOM   6449 H HH22 . ARG D 2 12  ? 65.546 12.304  67.336 1.00 114.24 ? 42  ARG D HH22 1 
ATOM   6450 N N    . TYR D 2 13  ? 64.445 13.745  58.374 1.00 44.97  ? 43  TYR D N    1 
ATOM   6451 C CA   . TYR D 2 13  ? 63.839 14.309  57.171 1.00 44.05  ? 43  TYR D CA   1 
ATOM   6452 C C    . TYR D 2 13  ? 62.385 14.650  57.465 1.00 43.71  ? 43  TYR D C    1 
ATOM   6453 O O    . TYR D 2 13  ? 61.584 13.755  57.757 1.00 41.00  ? 43  TYR D O    1 
ATOM   6454 C CB   . TYR D 2 13  ? 63.913 13.336  55.994 1.00 42.74  ? 43  TYR D CB   1 
ATOM   6455 C CG   . TYR D 2 13  ? 65.306 12.849  55.681 1.00 45.45  ? 43  TYR D CG   1 
ATOM   6456 C CD1  . TYR D 2 13  ? 66.191 13.631  54.942 1.00 46.65  ? 43  TYR D CD1  1 
ATOM   6457 C CD2  . TYR D 2 13  ? 65.739 11.604  56.117 1.00 44.73  ? 43  TYR D CD2  1 
ATOM   6458 C CE1  . TYR D 2 13  ? 67.475 13.182  54.651 1.00 47.36  ? 43  TYR D CE1  1 
ATOM   6459 C CE2  . TYR D 2 13  ? 67.014 11.154  55.835 1.00 45.99  ? 43  TYR D CE2  1 
ATOM   6460 C CZ   . TYR D 2 13  ? 67.875 11.947  55.105 1.00 47.09  ? 43  TYR D CZ   1 
ATOM   6461 O OH   . TYR D 2 13  ? 69.142 11.495  54.829 1.00 49.31  ? 43  TYR D OH   1 
ATOM   6462 H H    . TYR D 2 13  ? 63.908 13.251  58.829 1.00 53.97  ? 43  TYR D H    1 
ATOM   6463 H HA   . TYR D 2 13  ? 64.304 15.125  56.926 1.00 52.86  ? 43  TYR D HA   1 
ATOM   6464 H HB2  . TYR D 2 13  ? 63.368 12.560  56.197 1.00 51.29  ? 43  TYR D HB2  1 
ATOM   6465 H HB3  . TYR D 2 13  ? 63.570 13.779  55.202 1.00 51.29  ? 43  TYR D HB3  1 
ATOM   6466 H HD1  . TYR D 2 13  ? 65.919 14.468  54.639 1.00 55.98  ? 43  TYR D HD1  1 
ATOM   6467 H HD2  . TYR D 2 13  ? 65.164 11.067  56.613 1.00 53.68  ? 43  TYR D HD2  1 
ATOM   6468 H HE1  . TYR D 2 13  ? 68.059 13.714  54.161 1.00 56.83  ? 43  TYR D HE1  1 
ATOM   6469 H HE2  . TYR D 2 13  ? 67.292 10.320  56.137 1.00 55.19  ? 43  TYR D HE2  1 
ATOM   6470 H HH   . TYR D 2 13  ? 69.254 10.733  55.163 1.00 59.17  ? 43  TYR D HH   1 
ATOM   6471 N N    . GLY D 2 14  ? 62.050 15.936  57.399 1.00 46.73  ? 44  GLY D N    1 
ATOM   6472 C CA   . GLY D 2 14  ? 60.658 16.344  57.451 1.00 46.12  ? 44  GLY D CA   1 
ATOM   6473 C C    . GLY D 2 14  ? 59.893 15.832  56.245 1.00 45.96  ? 44  GLY D C    1 
ATOM   6474 O O    . GLY D 2 14  ? 60.458 15.376  55.251 1.00 44.29  ? 44  GLY D O    1 
ATOM   6475 H H    . GLY D 2 14  ? 62.609 16.585  57.324 1.00 56.07  ? 44  GLY D H    1 
ATOM   6476 H HA2  . GLY D 2 14  ? 60.244 15.994  58.255 1.00 55.34  ? 44  GLY D HA2  1 
ATOM   6477 H HA3  . GLY D 2 14  ? 60.602 17.313  57.467 1.00 55.34  ? 44  GLY D HA3  1 
ATOM   6478 N N    . ARG D 2 15  ? 58.563 15.918  56.344 1.00 38.93  ? 45  ARG D N    1 
ATOM   6479 C CA   . ARG D 2 15  ? 57.696 15.370  55.304 1.00 35.22  ? 45  ARG D CA   1 
ATOM   6480 C C    . ARG D 2 15  ? 58.036 15.942  53.932 1.00 35.64  ? 45  ARG D C    1 
ATOM   6481 O O    . ARG D 2 15  ? 58.160 15.200  52.951 1.00 35.68  ? 45  ARG D O    1 
ATOM   6482 C CB   . ARG D 2 15  ? 56.230 15.639  55.651 1.00 35.72  ? 45  ARG D CB   1 
ATOM   6483 C CG   . ARG D 2 15  ? 55.233 14.848  54.802 1.00 35.13  ? 45  ARG D CG   1 
ATOM   6484 C CD   . ARG D 2 15  ? 53.825 15.016  55.347 1.00 37.41  ? 45  ARG D CD   1 
ATOM   6485 N NE   . ARG D 2 15  ? 52.832 14.211  54.639 1.00 38.82  ? 45  ARG D NE   1 
ATOM   6486 C CZ   . ARG D 2 15  ? 52.038 14.649  53.661 1.00 41.31  ? 45  ARG D CZ   1 
ATOM   6487 N NH1  . ARG D 2 15  ? 52.096 15.908  53.237 1.00 42.02  ? 45  ARG D NH1  1 
ATOM   6488 N NH2  . ARG D 2 15  ? 51.164 13.814  53.108 1.00 41.27  ? 45  ARG D NH2  1 
ATOM   6489 H H    . ARG D 2 15  ? 58.144 16.286  56.999 1.00 46.72  ? 45  ARG D H    1 
ATOM   6490 H HA   . ARG D 2 15  ? 57.822 14.409  55.265 1.00 42.26  ? 45  ARG D HA   1 
ATOM   6491 H HB2  . ARG D 2 15  ? 56.081 15.401  56.579 1.00 42.87  ? 45  ARG D HB2  1 
ATOM   6492 H HB3  . ARG D 2 15  ? 56.047 16.582  55.520 1.00 42.87  ? 45  ARG D HB3  1 
ATOM   6493 H HG2  . ARG D 2 15  ? 55.251 15.179  53.890 1.00 42.16  ? 45  ARG D HG2  1 
ATOM   6494 H HG3  . ARG D 2 15  ? 55.462 13.906  54.826 1.00 42.16  ? 45  ARG D HG3  1 
ATOM   6495 H HD2  . ARG D 2 15  ? 53.816 14.749  56.280 1.00 44.89  ? 45  ARG D HD2  1 
ATOM   6496 H HD3  . ARG D 2 15  ? 53.566 15.948  55.268 1.00 44.89  ? 45  ARG D HD3  1 
ATOM   6497 H HE   . ARG D 2 15  ? 52.753 13.387  54.872 1.00 46.58  ? 45  ARG D HE   1 
ATOM   6498 H HH11 . ARG D 2 15  ? 52.655 16.457  53.592 1.00 50.42  ? 45  ARG D HH11 1 
ATOM   6499 H HH12 . ARG D 2 15  ? 51.576 16.173  52.605 1.00 50.42  ? 45  ARG D HH12 1 
ATOM   6500 H HH21 . ARG D 2 15  ? 51.121 12.998  53.376 1.00 49.52  ? 45  ARG D HH21 1 
ATOM   6501 H HH22 . ARG D 2 15  ? 50.650 14.086  52.475 1.00 49.52  ? 45  ARG D HH22 1 
ATOM   6502 N N    . GLU D 2 16  ? 58.182 17.265  53.840 1.00 36.76  ? 46  GLU D N    1 
ATOM   6503 C CA   . GLU D 2 16  ? 58.520 17.890  52.565 1.00 37.70  ? 46  GLU D CA   1 
ATOM   6504 C C    . GLU D 2 16  ? 59.875 17.418  52.056 1.00 38.08  ? 46  GLU D C    1 
ATOM   6505 O O    . GLU D 2 16  ? 60.064 17.235  50.847 1.00 38.45  ? 46  GLU D O    1 
ATOM   6506 C CB   . GLU D 2 16  ? 58.505 19.410  52.713 1.00 39.35  ? 46  GLU D CB   1 
ATOM   6507 C CG   . GLU D 2 16  ? 57.096 19.994  52.840 1.00 39.47  ? 46  GLU D CG   1 
ATOM   6508 C CD   . GLU D 2 16  ? 56.263 19.749  51.598 1.00 39.35  ? 46  GLU D CD   1 
ATOM   6509 O OE1  . GLU D 2 16  ? 56.773 20.008  50.486 1.00 40.37  ? 46  GLU D OE1  1 
ATOM   6510 O OE2  . GLU D 2 16  ? 55.112 19.267  51.730 1.00 39.09  ? 46  GLU D OE2  1 
ATOM   6511 H H    . GLU D 2 16  ? 58.092 17.815  54.495 1.00 44.11  ? 46  GLU D H    1 
ATOM   6512 H HA   . GLU D 2 16  ? 57.851 17.646  51.906 1.00 45.24  ? 46  GLU D HA   1 
ATOM   6513 H HB2  . GLU D 2 16  ? 59.001 19.652  53.511 1.00 47.22  ? 46  GLU D HB2  1 
ATOM   6514 H HB3  . GLU D 2 16  ? 58.923 19.806  51.932 1.00 47.22  ? 46  GLU D HB3  1 
ATOM   6515 H HG2  . GLU D 2 16  ? 56.647 19.578  53.592 1.00 47.37  ? 46  GLU D HG2  1 
ATOM   6516 H HG3  . GLU D 2 16  ? 57.160 20.952  52.977 1.00 47.37  ? 46  GLU D HG3  1 
ATOM   6517 N N    . GLU D 2 17  ? 60.832 17.210  52.964 1.00 41.64  ? 47  GLU D N    1 
ATOM   6518 C CA   . GLU D 2 17  ? 62.157 16.753  52.548 1.00 44.32  ? 47  GLU D CA   1 
ATOM   6519 C C    . GLU D 2 17  ? 62.086 15.349  51.959 1.00 41.54  ? 47  GLU D C    1 
ATOM   6520 O O    . GLU D 2 17  ? 62.710 15.070  50.932 1.00 42.62  ? 47  GLU D O    1 
ATOM   6521 C CB   . GLU D 2 17  ? 63.130 16.784  53.726 1.00 49.61  ? 47  GLU D CB   1 
ATOM   6522 C CG   . GLU D 2 17  ? 63.110 18.059  54.539 1.00 54.20  ? 47  GLU D CG   1 
ATOM   6523 C CD   . GLU D 2 17  ? 64.133 18.040  55.663 1.00 59.63  ? 47  GLU D CD   1 
ATOM   6524 O OE1  . GLU D 2 17  ? 65.268 17.579  55.421 1.00 61.25  ? 47  GLU D OE1  1 
ATOM   6525 O OE2  . GLU D 2 17  ? 63.797 18.468  56.790 1.00 61.28  ? 47  GLU D OE2  1 
ATOM   6526 H H    . GLU D 2 17  ? 60.741 17.324  53.811 1.00 49.97  ? 47  GLU D H    1 
ATOM   6527 H HA   . GLU D 2 17  ? 62.496 17.349  51.863 1.00 53.19  ? 47  GLU D HA   1 
ATOM   6528 H HB2  . GLU D 2 17  ? 62.913 16.052  54.325 1.00 59.54  ? 47  GLU D HB2  1 
ATOM   6529 H HB3  . GLU D 2 17  ? 64.031 16.668  53.385 1.00 59.54  ? 47  GLU D HB3  1 
ATOM   6530 H HG2  . GLU D 2 17  ? 63.314 18.809  53.958 1.00 65.05  ? 47  GLU D HG2  1 
ATOM   6531 H HG3  . GLU D 2 17  ? 62.231 18.172  54.932 1.00 65.05  ? 47  GLU D HG3  1 
ATOM   6532 N N    . MET D 2 18  ? 61.324 14.452  52.587 1.00 44.17  ? 48  MET D N    1 
ATOM   6533 C CA   . MET D 2 18  ? 61.102 13.134  51.996 1.00 43.90  ? 48  MET D CA   1 
ATOM   6534 C C    . MET D 2 18  ? 60.538 13.252  50.586 1.00 44.25  ? 48  MET D C    1 
ATOM   6535 O O    . MET D 2 18  ? 60.983 12.551  49.671 1.00 44.95  ? 48  MET D O    1 
ATOM   6536 C CB   . MET D 2 18  ? 60.154 12.315  52.873 1.00 42.59  ? 48  MET D CB   1 
ATOM   6537 C CG   . MET D 2 18  ? 60.706 11.955  54.255 1.00 44.04  ? 48  MET D CG   1 
ATOM   6538 S SD   . MET D 2 18  ? 62.087 10.793  54.223 1.00 44.21  ? 48  MET D SD   1 
ATOM   6539 C CE   . MET D 2 18  ? 61.322 9.332   53.544 1.00 43.31  ? 48  MET D CE   1 
ATOM   6540 H H    . MET D 2 18  ? 60.931 14.579  53.341 1.00 53.00  ? 48  MET D H    1 
ATOM   6541 H HA   . MET D 2 18  ? 61.949 12.663  51.955 1.00 52.68  ? 48  MET D HA   1 
ATOM   6542 H HB2  . MET D 2 18  ? 59.339 12.824  53.007 1.00 51.11  ? 48  MET D HB2  1 
ATOM   6543 H HB3  . MET D 2 18  ? 59.948 11.485  52.415 1.00 51.11  ? 48  MET D HB3  1 
ATOM   6544 H HG2  . MET D 2 18  ? 61.014 12.767  54.687 1.00 52.85  ? 48  MET D HG2  1 
ATOM   6545 H HG3  . MET D 2 18  ? 59.995 11.554  54.779 1.00 52.85  ? 48  MET D HG3  1 
ATOM   6546 H HE1  . MET D 2 18  ? 61.987 8.629   53.482 1.00 51.97  ? 48  MET D HE1  1 
ATOM   6547 H HE2  . MET D 2 18  ? 60.600 9.054   54.129 1.00 51.97  ? 48  MET D HE2  1 
ATOM   6548 H HE3  . MET D 2 18  ? 60.974 9.538   52.663 1.00 51.97  ? 48  MET D HE3  1 
ATOM   6549 N N    . LEU D 2 19  ? 59.566 14.146  50.387 1.00 42.98  ? 49  LEU D N    1 
ATOM   6550 C CA   . LEU D 2 19  ? 58.917 14.260  49.084 1.00 42.47  ? 49  LEU D CA   1 
ATOM   6551 C C    . LEU D 2 19  ? 59.843 14.889  48.051 1.00 43.95  ? 49  LEU D C    1 
ATOM   6552 O O    . LEU D 2 19  ? 59.868 14.465  46.890 1.00 45.72  ? 49  LEU D O    1 
ATOM   6553 C CB   . LEU D 2 19  ? 57.629 15.073  49.219 1.00 41.82  ? 49  LEU D CB   1 
ATOM   6554 C CG   . LEU D 2 19  ? 56.580 14.485  50.169 1.00 39.62  ? 49  LEU D CG   1 
ATOM   6555 C CD1  . LEU D 2 19  ? 55.381 15.435  50.370 1.00 40.09  ? 49  LEU D CD1  1 
ATOM   6556 C CD2  . LEU D 2 19  ? 56.105 13.151  49.655 1.00 38.62  ? 49  LEU D CD2  1 
ATOM   6557 H H    . LEU D 2 19  ? 59.269 14.690  50.983 1.00 51.57  ? 49  LEU D H    1 
ATOM   6558 H HA   . LEU D 2 19  ? 58.680 13.373  48.771 1.00 50.97  ? 49  LEU D HA   1 
ATOM   6559 H HB2  . LEU D 2 19  ? 57.856 15.957  49.547 1.00 50.19  ? 49  LEU D HB2  1 
ATOM   6560 H HB3  . LEU D 2 19  ? 57.220 15.149  48.343 1.00 50.19  ? 49  LEU D HB3  1 
ATOM   6561 H HG   . LEU D 2 19  ? 56.991 14.339  51.035 1.00 47.54  ? 49  LEU D HG   1 
ATOM   6562 H HD11 . LEU D 2 19  ? 54.747 15.020  50.976 1.00 48.10  ? 49  LEU D HD11 1 
ATOM   6563 H HD12 . LEU D 2 19  ? 55.700 16.271  50.746 1.00 48.10  ? 49  LEU D HD12 1 
ATOM   6564 H HD13 . LEU D 2 19  ? 54.960 15.598  49.512 1.00 48.10  ? 49  LEU D HD13 1 
ATOM   6565 H HD21 . LEU D 2 19  ? 55.443 12.794  50.268 1.00 46.34  ? 49  LEU D HD21 1 
ATOM   6566 H HD22 . LEU D 2 19  ? 55.712 13.273  48.777 1.00 46.34  ? 49  LEU D HD22 1 
ATOM   6567 H HD23 . LEU D 2 19  ? 56.863 12.547  49.598 1.00 46.34  ? 49  LEU D HD23 1 
ATOM   6568 N N    . ALA D 2 20  ? 60.621 15.893  48.455 1.00 43.20  ? 50  ALA D N    1 
ATOM   6569 C CA   . ALA D 2 20  ? 61.518 16.552  47.515 1.00 44.76  ? 50  ALA D CA   1 
ATOM   6570 C C    . ALA D 2 20  ? 62.495 15.566  46.891 1.00 46.21  ? 50  ALA D C    1 
ATOM   6571 O O    . ALA D 2 20  ? 62.986 15.800  45.780 1.00 47.84  ? 50  ALA D O    1 
ATOM   6572 C CB   . ALA D 2 20  ? 62.278 17.677  48.220 1.00 44.94  ? 50  ALA D CB   1 
ATOM   6573 H H    . ALA D 2 20  ? 60.647 16.206  49.256 1.00 51.84  ? 50  ALA D H    1 
ATOM   6574 H HA   . ALA D 2 20  ? 60.993 16.946  46.801 1.00 53.71  ? 50  ALA D HA   1 
ATOM   6575 H HB1  . ALA D 2 20  ? 62.871 18.105  47.583 1.00 53.93  ? 50  ALA D HB1  1 
ATOM   6576 H HB2  . ALA D 2 20  ? 61.640 18.321  48.564 1.00 53.93  ? 50  ALA D HB2  1 
ATOM   6577 H HB3  . ALA D 2 20  ? 62.794 17.300  48.950 1.00 53.93  ? 50  ALA D HB3  1 
ATOM   6578 N N    . LEU D 2 21  ? 62.788 14.466  47.580 1.00 45.46  ? 51  LEU D N    1 
ATOM   6579 C CA   . LEU D 2 21  ? 63.788 13.512  47.120 1.00 48.36  ? 51  LEU D CA   1 
ATOM   6580 C C    . LEU D 2 21  ? 63.204 12.385  46.279 1.00 50.26  ? 51  LEU D C    1 
ATOM   6581 O O    . LEU D 2 21  ? 63.945 11.477  45.884 1.00 49.84  ? 51  LEU D O    1 
ATOM   6582 C CB   . LEU D 2 21  ? 64.533 12.927  48.322 1.00 46.71  ? 51  LEU D CB   1 
ATOM   6583 C CG   . LEU D 2 21  ? 65.319 13.945  49.149 1.00 46.48  ? 51  LEU D CG   1 
ATOM   6584 C CD1  . LEU D 2 21  ? 65.788 13.340  50.458 1.00 46.47  ? 51  LEU D CD1  1 
ATOM   6585 C CD2  . LEU D 2 21  ? 66.496 14.462  48.346 1.00 49.25  ? 51  LEU D CD2  1 
ATOM   6586 H H    . LEU D 2 21  ? 62.417 14.249  48.325 1.00 54.56  ? 51  LEU D H    1 
ATOM   6587 H HA   . LEU D 2 21  ? 64.436 13.983  46.572 1.00 58.03  ? 51  LEU D HA   1 
ATOM   6588 H HB2  . LEU D 2 21  ? 63.886 12.508  48.912 1.00 56.05  ? 51  LEU D HB2  1 
ATOM   6589 H HB3  . LEU D 2 21  ? 65.161 12.261  48.003 1.00 56.05  ? 51  LEU D HB3  1 
ATOM   6590 H HG   . LEU D 2 21  ? 64.744 14.698  49.355 1.00 55.78  ? 51  LEU D HG   1 
ATOM   6591 H HD11 . LEU D 2 21  ? 66.282 14.009  50.957 1.00 55.76  ? 51  LEU D HD11 1 
ATOM   6592 H HD12 . LEU D 2 21  ? 65.014 13.052  50.967 1.00 55.76  ? 51  LEU D HD12 1 
ATOM   6593 H HD13 . LEU D 2 21  ? 66.360 12.580  50.267 1.00 55.76  ? 51  LEU D HD13 1 
ATOM   6594 H HD21 . LEU D 2 21  ? 66.986 15.105  48.882 1.00 59.10  ? 51  LEU D HD21 1 
ATOM   6595 H HD22 . LEU D 2 21  ? 67.073 13.716  48.117 1.00 59.10  ? 51  LEU D HD22 1 
ATOM   6596 H HD23 . LEU D 2 21  ? 66.166 14.886  47.539 1.00 59.10  ? 51  LEU D HD23 1 
ATOM   6597 N N    . PHE D 2 22  ? 61.902 12.413  46.008 1.00 53.67  ? 52  PHE D N    1 
ATOM   6598 C CA   . PHE D 2 22  ? 61.298 11.443  45.109 1.00 56.17  ? 52  PHE D CA   1 
ATOM   6599 C C    . PHE D 2 22  ? 61.668 11.774  43.671 1.00 61.67  ? 52  PHE D C    1 
ATOM   6600 O O    . PHE D 2 22  ? 61.753 12.944  43.290 1.00 63.43  ? 52  PHE D O    1 
ATOM   6601 C CB   . PHE D 2 22  ? 59.780 11.443  45.287 1.00 55.53  ? 52  PHE D CB   1 
ATOM   6602 C CG   . PHE D 2 22  ? 59.038 10.686  44.222 1.00 55.70  ? 52  PHE D CG   1 
ATOM   6603 C CD1  . PHE D 2 22  ? 58.839 9.322   44.335 1.00 55.22  ? 52  PHE D CD1  1 
ATOM   6604 C CD2  . PHE D 2 22  ? 58.528 11.342  43.115 1.00 57.44  ? 52  PHE D CD2  1 
ATOM   6605 C CE1  . PHE D 2 22  ? 58.153 8.625   43.363 1.00 56.37  ? 52  PHE D CE1  1 
ATOM   6606 C CE2  . PHE D 2 22  ? 57.838 10.649  42.138 1.00 58.88  ? 52  PHE D CE2  1 
ATOM   6607 C CZ   . PHE D 2 22  ? 57.652 9.288   42.263 1.00 58.02  ? 52  PHE D CZ   1 
ATOM   6608 H H    . PHE D 2 22  ? 61.348 12.985  46.334 1.00 64.40  ? 52  PHE D H    1 
ATOM   6609 H HA   . PHE D 2 22  ? 61.632 10.556  45.317 1.00 67.41  ? 52  PHE D HA   1 
ATOM   6610 H HB2  . PHE D 2 22  ? 59.566 11.037  46.141 1.00 66.64  ? 52  PHE D HB2  1 
ATOM   6611 H HB3  . PHE D 2 22  ? 59.465 12.360  45.272 1.00 66.64  ? 52  PHE D HB3  1 
ATOM   6612 H HD1  . PHE D 2 22  ? 59.174 8.869   45.074 1.00 66.26  ? 52  PHE D HD1  1 
ATOM   6613 H HD2  . PHE D 2 22  ? 58.651 12.260  43.027 1.00 68.93  ? 52  PHE D HD2  1 
ATOM   6614 H HE1  . PHE D 2 22  ? 58.028 7.708   43.450 1.00 67.65  ? 52  PHE D HE1  1 
ATOM   6615 H HE2  . PHE D 2 22  ? 57.502 11.099  41.397 1.00 70.65  ? 52  PHE D HE2  1 
ATOM   6616 H HZ   . PHE D 2 22  ? 57.189 8.818   41.607 1.00 69.62  ? 52  PHE D HZ   1 
ATOM   6617 N N    . LEU D 2 23  ? 61.906 10.740  42.874 1.00 67.74  ? 53  LEU D N    1 
ATOM   6618 C CA   . LEU D 2 23  ? 62.259 10.901  41.469 1.00 74.57  ? 53  LEU D CA   1 
ATOM   6619 C C    . LEU D 2 23  ? 61.127 10.349  40.610 1.00 78.13  ? 53  LEU D C    1 
ATOM   6620 O O    . LEU D 2 23  ? 60.797 9.162   40.701 1.00 78.05  ? 53  LEU D O    1 
ATOM   6621 C CB   . LEU D 2 23  ? 63.579 10.199  41.159 1.00 78.05  ? 53  LEU D CB   1 
ATOM   6622 C CG   . LEU D 2 23  ? 64.775 10.678  41.992 1.00 79.83  ? 53  LEU D CG   1 
ATOM   6623 C CD1  . LEU D 2 23  ? 66.030 9.889   41.652 1.00 81.78  ? 53  LEU D CD1  1 
ATOM   6624 C CD2  . LEU D 2 23  ? 65.021 12.164  41.795 1.00 81.65  ? 53  LEU D CD2  1 
ATOM   6625 H H    . LEU D 2 23  ? 61.869 9.919   43.128 1.00 81.28  ? 53  LEU D H    1 
ATOM   6626 H HA   . LEU D 2 23  ? 62.361 11.844  41.269 1.00 89.48  ? 53  LEU D HA   1 
ATOM   6627 H HB2  . LEU D 2 23  ? 63.470 9.249   41.324 1.00 93.66  ? 53  LEU D HB2  1 
ATOM   6628 H HB3  . LEU D 2 23  ? 63.795 10.345  40.225 1.00 93.66  ? 53  LEU D HB3  1 
ATOM   6629 H HG   . LEU D 2 23  ? 64.579 10.533  42.930 1.00 95.80  ? 53  LEU D HG   1 
ATOM   6630 H HD11 . LEU D 2 23  ? 66.765 10.217  42.194 1.00 98.14  ? 53  LEU D HD11 1 
ATOM   6631 H HD12 . LEU D 2 23  ? 65.873 8.951   41.839 1.00 98.14  ? 53  LEU D HD12 1 
ATOM   6632 H HD13 . LEU D 2 23  ? 66.234 10.010  40.711 1.00 98.14  ? 53  LEU D HD13 1 
ATOM   6633 H HD21 . LEU D 2 23  ? 65.782 12.432  42.334 1.00 97.99  ? 53  LEU D HD21 1 
ATOM   6634 H HD22 . LEU D 2 23  ? 65.205 12.331  40.857 1.00 97.99  ? 53  LEU D HD22 1 
ATOM   6635 H HD23 . LEU D 2 23  ? 64.231 12.654  42.070 1.00 97.99  ? 53  LEU D HD23 1 
ATOM   6636 N N    . LYS D 2 24  ? 60.537 11.218  39.782 1.00 84.67  ? 54  LYS D N    1 
ATOM   6637 C CA   . LYS D 2 24  ? 59.402 10.825  38.949 1.00 88.90  ? 54  LYS D CA   1 
ATOM   6638 C C    . LYS D 2 24  ? 59.662 9.505   38.232 1.00 91.65  ? 54  LYS D C    1 
ATOM   6639 O O    . LYS D 2 24  ? 58.742 8.704   38.035 1.00 91.30  ? 54  LYS D O    1 
ATOM   6640 C CB   . LYS D 2 24  ? 59.089 11.929  37.934 1.00 93.18  ? 54  LYS D CB   1 
ATOM   6641 C CG   . LYS D 2 24  ? 58.798 13.293  38.558 1.00 94.00  ? 54  LYS D CG   1 
ATOM   6642 C CD   . LYS D 2 24  ? 58.396 14.326  37.509 1.00 98.58  ? 54  LYS D CD   1 
ATOM   6643 C CE   . LYS D 2 24  ? 58.243 15.718  38.121 1.00 98.13  ? 54  LYS D CE   1 
ATOM   6644 N NZ   . LYS D 2 24  ? 57.804 16.733  37.121 1.00 102.21 ? 54  LYS D NZ   1 
ATOM   6645 H H    . LYS D 2 24  ? 60.777 12.039  39.685 1.00 101.60 ? 54  LYS D H    1 
ATOM   6646 H HA   . LYS D 2 24  ? 58.622 10.709  39.514 1.00 106.68 ? 54  LYS D HA   1 
ATOM   6647 H HB2  . LYS D 2 24  ? 59.851 12.032  37.342 1.00 111.82 ? 54  LYS D HB2  1 
ATOM   6648 H HB3  . LYS D 2 24  ? 58.309 11.667  37.420 1.00 111.82 ? 54  LYS D HB3  1 
ATOM   6649 H HG2  . LYS D 2 24  ? 58.068 13.205  39.191 1.00 112.80 ? 54  LYS D HG2  1 
ATOM   6650 H HG3  . LYS D 2 24  ? 59.595 13.614  39.009 1.00 112.80 ? 54  LYS D HG3  1 
ATOM   6651 H HD2  . LYS D 2 24  ? 59.081 14.369  36.824 1.00 118.29 ? 54  LYS D HD2  1 
ATOM   6652 H HD3  . LYS D 2 24  ? 57.546 14.071  37.118 1.00 118.29 ? 54  LYS D HD3  1 
ATOM   6653 H HE2  . LYS D 2 24  ? 57.578 15.684  38.827 1.00 117.76 ? 54  LYS D HE2  1 
ATOM   6654 H HE3  . LYS D 2 24  ? 59.097 16.002  38.483 1.00 117.76 ? 54  LYS D HE3  1 
ATOM   6655 H HZ1  . LYS D 2 24  ? 57.725 17.530  37.510 1.00 122.65 ? 54  LYS D HZ1  1 
ATOM   6656 H HZ2  . LYS D 2 24  ? 58.401 16.790  36.463 1.00 122.65 ? 54  LYS D HZ2  1 
ATOM   6657 H HZ3  . LYS D 2 24  ? 57.017 16.500  36.777 1.00 122.65 ? 54  LYS D HZ3  1 
ATOM   6658 N N    . ASP D 2 25  ? 60.908 9.264   37.832 1.00 92.86  ? 55  ASP D N    1 
ATOM   6659 C CA   . ASP D 2 25  ? 61.312 8.013   37.204 1.00 94.38  ? 55  ASP D CA   1 
ATOM   6660 C C    . ASP D 2 25  ? 62.223 7.262   38.166 1.00 92.58  ? 55  ASP D C    1 
ATOM   6661 O O    . ASP D 2 25  ? 63.312 7.741   38.497 1.00 93.79  ? 55  ASP D O    1 
ATOM   6662 C CB   . ASP D 2 25  ? 62.023 8.269   35.874 1.00 99.83  ? 55  ASP D CB   1 
ATOM   6663 C CG   . ASP D 2 25  ? 61.135 8.970   34.861 1.00 102.39 ? 55  ASP D CG   1 
ATOM   6664 O OD1  . ASP D 2 25  ? 59.896 8.908   35.007 1.00 101.67 ? 55  ASP D OD1  1 
ATOM   6665 O OD2  . ASP D 2 25  ? 61.678 9.579   33.914 1.00 106.15 ? 55  ASP D OD2  1 
ATOM   6666 H H    . ASP D 2 25  ? 61.553 9.826   37.918 1.00 111.43 ? 55  ASP D H    1 
ATOM   6667 H HA   . ASP D 2 25  ? 60.528 7.468   37.034 1.00 113.25 ? 55  ASP D HA   1 
ATOM   6668 H HB2  . ASP D 2 25  ? 62.798 8.829   36.033 1.00 119.80 ? 55  ASP D HB2  1 
ATOM   6669 H HB3  . ASP D 2 25  ? 62.299 7.419   35.495 1.00 119.80 ? 55  ASP D HB3  1 
ATOM   6670 N N    . ASN D 2 26  ? 61.772 6.097   38.618 1.00 93.93  ? 56  ASN D N    1 
ATOM   6671 C CA   . ASN D 2 26  ? 62.533 5.253   39.527 1.00 93.41  ? 56  ASN D CA   1 
ATOM   6672 C C    . ASN D 2 26  ? 62.802 3.921   38.852 1.00 92.17  ? 56  ASN D C    1 
ATOM   6673 O O    . ASN D 2 26  ? 61.893 3.327   38.266 1.00 93.05  ? 56  ASN D O    1 
ATOM   6674 C CB   . ASN D 2 26  ? 61.778 5.017   40.836 1.00 93.44  ? 56  ASN D CB   1 
ATOM   6675 C CG   . ASN D 2 26  ? 61.511 6.291   41.592 1.00 95.04  ? 56  ASN D CG   1 
ATOM   6676 O OD1  . ASN D 2 26  ? 62.366 7.172   41.674 1.00 96.92  ? 56  ASN D OD1  1 
ATOM   6677 N ND2  . ASN D 2 26  ? 60.315 6.400   42.151 1.00 93.99  ? 56  ASN D ND2  1 
ATOM   6678 H H    . ASN D 2 26  ? 61.007 5.766   38.406 1.00 112.72 ? 56  ASN D H    1 
ATOM   6679 H HA   . ASN D 2 26  ? 63.382 5.676   39.731 1.00 112.09 ? 56  ASN D HA   1 
ATOM   6680 H HB2  . ASN D 2 26  ? 60.924 4.602   40.638 1.00 112.12 ? 56  ASN D HB2  1 
ATOM   6681 H HB3  . ASN D 2 26  ? 62.306 4.435   41.405 1.00 112.12 ? 56  ASN D HB3  1 
ATOM   6682 H HD21 . ASN D 2 26  ? 60.111 7.108   42.595 1.00 112.79 ? 56  ASN D HD21 1 
ATOM   6683 H HD22 . ASN D 2 26  ? 59.743 5.764   42.070 1.00 112.79 ? 56  ASN D HD22 1 
ATOM   6684 N N    . LYS D 2 27  ? 64.044 3.457   38.934 1.00 89.36  ? 57  LYS D N    1 
ATOM   6685 C CA   . LYS D 2 27  ? 64.357 2.104   38.503 1.00 86.28  ? 57  LYS D CA   1 
ATOM   6686 C C    . LYS D 2 27  ? 63.784 1.108   39.505 1.00 78.79  ? 57  LYS D C    1 
ATOM   6687 O O    . LYS D 2 27  ? 63.866 1.314   40.719 1.00 74.78  ? 57  LYS D O    1 
ATOM   6688 C CB   . LYS D 2 27  ? 65.870 1.927   38.372 1.00 88.85  ? 57  LYS D CB   1 
ATOM   6689 C CG   . LYS D 2 27  ? 66.304 0.553   37.877 1.00 92.32  ? 57  LYS D CG   1 
ATOM   6690 C CD   . LYS D 2 27  ? 67.818 0.462   37.747 1.00 95.44  ? 57  LYS D CD   1 
ATOM   6691 C CE   . LYS D 2 27  ? 68.255 -0.916  37.280 1.00 98.14  ? 57  LYS D CE   1 
ATOM   6692 N NZ   . LYS D 2 27  ? 69.729 -0.993  37.087 1.00 101.11 ? 57  LYS D NZ   1 
ATOM   6693 H H    . LYS D 2 27  ? 64.717 3.902   39.233 1.00 107.23 ? 57  LYS D H    1 
ATOM   6694 H HA   . LYS D 2 27  ? 63.952 1.938   37.637 1.00 103.53 ? 57  LYS D HA   1 
ATOM   6695 H HB2  . LYS D 2 27  ? 66.206 2.586   37.744 1.00 106.62 ? 57  LYS D HB2  1 
ATOM   6696 H HB3  . LYS D 2 27  ? 66.275 2.068   39.242 1.00 106.62 ? 57  LYS D HB3  1 
ATOM   6697 H HG2  . LYS D 2 27  ? 66.011 -0.122  38.509 1.00 110.78 ? 57  LYS D HG2  1 
ATOM   6698 H HG3  . LYS D 2 27  ? 65.913 0.389   37.004 1.00 110.78 ? 57  LYS D HG3  1 
ATOM   6699 H HD2  . LYS D 2 27  ? 68.123 1.114   37.097 1.00 114.52 ? 57  LYS D HD2  1 
ATOM   6700 H HD3  . LYS D 2 27  ? 68.224 0.633   38.611 1.00 114.52 ? 57  LYS D HD3  1 
ATOM   6701 H HE2  . LYS D 2 27  ? 68.001 -1.573  37.946 1.00 117.77 ? 57  LYS D HE2  1 
ATOM   6702 H HE3  . LYS D 2 27  ? 67.828 -1.115  36.432 1.00 117.77 ? 57  LYS D HE3  1 
ATOM   6703 H HZ1  . LYS D 2 27  ? 69.957 -1.809  36.814 1.00 121.33 ? 57  LYS D HZ1  1 
ATOM   6704 H HZ2  . LYS D 2 27  ? 69.987 -0.401  36.475 1.00 121.33 ? 57  LYS D HZ2  1 
ATOM   6705 H HZ3  . LYS D 2 27  ? 70.146 -0.818  37.854 1.00 121.33 ? 57  LYS D HZ3  1 
ATOM   6706 N N    . ILE D 2 28  ? 63.185 0.038   38.996 1.00 71.73  ? 58  ILE D N    1 
ATOM   6707 C CA   . ILE D 2 28  ? 62.589 -0.971  39.881 1.00 64.21  ? 58  ILE D CA   1 
ATOM   6708 C C    . ILE D 2 28  ? 63.700 -1.668  40.658 1.00 58.32  ? 58  ILE D C    1 
ATOM   6709 O O    . ILE D 2 28  ? 64.671 -2.134  40.046 1.00 59.22  ? 58  ILE D O    1 
ATOM   6710 C CB   . ILE D 2 28  ? 61.779 -1.985  39.071 1.00 67.42  ? 58  ILE D CB   1 
ATOM   6711 C CG1  . ILE D 2 28  ? 60.619 -1.290  38.358 1.00 67.80  ? 58  ILE D CG1  1 
ATOM   6712 C CG2  . ILE D 2 28  ? 61.247 -3.086  39.989 1.00 65.19  ? 58  ILE D CG2  1 
ATOM   6713 C CD1  . ILE D 2 28  ? 59.810 -2.202  37.436 1.00 70.02  ? 58  ILE D CD1  1 
ATOM   6714 H H    . ILE D 2 28  ? 63.107 -0.130  38.156 1.00 86.08  ? 58  ILE D H    1 
ATOM   6715 H HA   . ILE D 2 28  ? 61.995 -0.538  40.513 1.00 77.05  ? 58  ILE D HA   1 
ATOM   6716 H HB   . ILE D 2 28  ? 62.359 -2.387  38.405 1.00 80.91  ? 58  ILE D HB   1 
ATOM   6717 H HG12 . ILE D 2 28  ? 60.013 -0.934  39.026 1.00 81.36  ? 58  ILE D HG12 1 
ATOM   6718 H HG13 . ILE D 2 28  ? 60.974 -0.566  37.819 1.00 81.36  ? 58  ILE D HG13 1 
ATOM   6719 H HG21 . ILE D 2 28  ? 60.737 -3.719  39.459 1.00 78.23  ? 58  ILE D HG21 1 
ATOM   6720 H HG22 . ILE D 2 28  ? 61.997 -3.535  40.409 1.00 78.23  ? 58  ILE D HG22 1 
ATOM   6721 H HG23 . ILE D 2 28  ? 60.679 -2.686  40.665 1.00 78.23  ? 58  ILE D HG23 1 
ATOM   6722 H HD11 . ILE D 2 28  ? 59.098 -1.685  37.026 1.00 84.02  ? 58  ILE D HD11 1 
ATOM   6723 H HD12 . ILE D 2 28  ? 60.397 -2.558  36.750 1.00 84.02  ? 58  ILE D HD12 1 
ATOM   6724 H HD13 . ILE D 2 28  ? 59.433 -2.927  37.959 1.00 84.02  ? 58  ILE D HD13 1 
ATOM   6725 N N    . PRO D 2 29  ? 63.611 -1.778  41.983 1.00 44.77  ? 59  PRO D N    1 
ATOM   6726 C CA   . PRO D 2 29  ? 64.605 -2.575  42.711 1.00 45.57  ? 59  PRO D CA   1 
ATOM   6727 C C    . PRO D 2 29  ? 64.542 -4.029  42.288 1.00 47.13  ? 59  PRO D C    1 
ATOM   6728 O O    . PRO D 2 29  ? 63.465 -4.593  42.099 1.00 46.63  ? 59  PRO D O    1 
ATOM   6729 C CB   . PRO D 2 29  ? 64.204 -2.403  44.178 1.00 43.50  ? 59  PRO D CB   1 
ATOM   6730 C CG   . PRO D 2 29  ? 63.383 -1.163  44.208 1.00 41.71  ? 59  PRO D CG   1 
ATOM   6731 C CD   . PRO D 2 29  ? 62.663 -1.122  42.896 1.00 42.31  ? 59  PRO D CD   1 
ATOM   6732 H HA   . PRO D 2 29  ? 65.499 -2.227  42.569 1.00 54.69  ? 59  PRO D HA   1 
ATOM   6733 H HB2  . PRO D 2 29  ? 63.682 -3.167  44.467 1.00 52.19  ? 59  PRO D HB2  1 
ATOM   6734 H HB3  . PRO D 2 29  ? 64.999 -2.302  44.725 1.00 52.19  ? 59  PRO D HB3  1 
ATOM   6735 H HG2  . PRO D 2 29  ? 62.751 -1.208  44.942 1.00 50.05  ? 59  PRO D HG2  1 
ATOM   6736 H HG3  . PRO D 2 29  ? 63.963 -0.391  44.303 1.00 50.05  ? 59  PRO D HG3  1 
ATOM   6737 H HD2  . PRO D 2 29  ? 61.836 -1.626  42.946 1.00 50.77  ? 59  PRO D HD2  1 
ATOM   6738 H HD3  . PRO D 2 29  ? 62.507 -0.204  42.622 1.00 50.77  ? 59  PRO D HD3  1 
ATOM   6739 N N    . SER D 2 30  ? 65.719 -4.633  42.144 1.00 56.35  ? 60  SER D N    1 
ATOM   6740 C CA   . SER D 2 30  ? 65.802 -6.031  41.743 1.00 58.85  ? 60  SER D CA   1 
ATOM   6741 C C    . SER D 2 30  ? 64.924 -6.928  42.607 1.00 58.00  ? 60  SER D C    1 
ATOM   6742 O O    . SER D 2 30  ? 64.353 -7.903  42.108 1.00 59.78  ? 60  SER D O    1 
ATOM   6743 C CB   . SER D 2 30  ? 67.259 -6.487  41.810 1.00 62.18  ? 60  SER D CB   1 
ATOM   6744 O OG   . SER D 2 30  ? 67.350 -7.893  41.733 1.00 65.35  ? 60  SER D OG   1 
ATOM   6745 H H    . SER D 2 30  ? 66.481 -4.256  42.273 1.00 67.62  ? 60  SER D H    1 
ATOM   6746 H HA   . SER D 2 30  ? 65.504 -6.114  40.824 1.00 70.62  ? 60  SER D HA   1 
ATOM   6747 H HB2  . SER D 2 30  ? 67.746 -6.098  41.067 1.00 74.62  ? 60  SER D HB2  1 
ATOM   6748 H HB3  . SER D 2 30  ? 67.644 -6.192  42.650 1.00 74.62  ? 60  SER D HB3  1 
ATOM   6749 H HG   . SER D 2 30  ? 68.155 -8.132  41.771 1.00 78.42  ? 60  SER D HG   1 
ATOM   6750 N N    . ASP D 2 31  ? 64.790 -6.611  43.895 1.00 57.40  ? 61  ASP D N    1 
ATOM   6751 C CA   . ASP D 2 31  ? 64.074 -7.492  44.812 1.00 56.86  ? 61  ASP D CA   1 
ATOM   6752 C C    . ASP D 2 31  ? 62.598 -7.607  44.465 1.00 55.64  ? 61  ASP D C    1 
ATOM   6753 O O    . ASP D 2 31  ? 61.981 -8.650  44.723 1.00 55.63  ? 61  ASP D O    1 
ATOM   6754 C CB   . ASP D 2 31  ? 64.227 -6.985  46.242 1.00 56.05  ? 61  ASP D CB   1 
ATOM   6755 C CG   . ASP D 2 31  ? 65.639 -7.130  46.764 1.00 59.05  ? 61  ASP D CG   1 
ATOM   6756 O OD1  . ASP D 2 31  ? 66.297 -8.151  46.456 1.00 62.36  ? 61  ASP D OD1  1 
ATOM   6757 O OD2  . ASP D 2 31  ? 66.090 -6.220  47.486 1.00 58.27  ? 61  ASP D OD2  1 
ATOM   6758 H H    . ASP D 2 31  ? 65.101 -5.896  44.258 1.00 68.88  ? 61  ASP D H    1 
ATOM   6759 H HA   . ASP D 2 31  ? 64.463 -8.379  44.765 1.00 68.23  ? 61  ASP D HA   1 
ATOM   6760 H HB2  . ASP D 2 31  ? 63.991 -6.045  46.271 1.00 67.26  ? 61  ASP D HB2  1 
ATOM   6761 H HB3  . ASP D 2 31  ? 63.639 -7.494  46.822 1.00 67.26  ? 61  ASP D HB3  1 
ATOM   6762 N N    . LEU D 2 32  ? 62.008 -6.551  43.900 1.00 50.55  ? 62  LEU D N    1 
ATOM   6763 C CA   . LEU D 2 32  ? 60.593 -6.575  43.559 1.00 49.14  ? 62  LEU D CA   1 
ATOM   6764 C C    . LEU D 2 32  ? 60.304 -7.265  42.233 1.00 51.30  ? 62  LEU D C    1 
ATOM   6765 O O    . LEU D 2 32  ? 59.131 -7.491  41.916 1.00 49.74  ? 62  LEU D O    1 
ATOM   6766 C CB   . LEU D 2 32  ? 60.042 -5.150  43.530 1.00 46.95  ? 62  LEU D CB   1 
ATOM   6767 C CG   . LEU D 2 32  ? 59.705 -4.567  44.902 1.00 45.17  ? 62  LEU D CG   1 
ATOM   6768 C CD1  . LEU D 2 32  ? 59.436 -3.071  44.807 1.00 44.57  ? 62  LEU D CD1  1 
ATOM   6769 C CD2  . LEU D 2 32  ? 58.498 -5.281  45.485 1.00 44.33  ? 62  LEU D CD2  1 
ATOM   6770 H H    . LEU D 2 32  ? 62.407 -5.814  43.706 1.00 60.66  ? 62  LEU D H    1 
ATOM   6771 H HA   . LEU D 2 32  ? 60.117 -7.060  44.251 1.00 58.97  ? 62  LEU D HA   1 
ATOM   6772 H HB2  . LEU D 2 32  ? 60.703 -4.571  43.120 1.00 56.34  ? 62  LEU D HB2  1 
ATOM   6773 H HB3  . LEU D 2 32  ? 59.229 -5.144  43.001 1.00 56.34  ? 62  LEU D HB3  1 
ATOM   6774 H HG   . LEU D 2 32  ? 60.456 -4.703  45.500 1.00 54.20  ? 62  LEU D HG   1 
ATOM   6775 H HD11 . LEU D 2 32  ? 59.226 -2.732  45.692 1.00 53.49  ? 62  LEU D HD11 1 
ATOM   6776 H HD12 . LEU D 2 32  ? 60.228 -2.629  44.463 1.00 53.49  ? 62  LEU D HD12 1 
ATOM   6777 H HD13 . LEU D 2 32  ? 58.687 -2.922  44.209 1.00 53.49  ? 62  LEU D HD13 1 
ATOM   6778 H HD21 . LEU D 2 32  ? 58.296 -4.901  46.354 1.00 53.20  ? 62  LEU D HD21 1 
ATOM   6779 H HD22 . LEU D 2 32  ? 57.743 -5.163  44.888 1.00 53.20  ? 62  LEU D HD22 1 
ATOM   6780 H HD23 . LEU D 2 32  ? 58.704 -6.225  45.576 1.00 53.20  ? 62  LEU D HD23 1 
ATOM   6781 N N    . LEU D 2 33  ? 61.331 -7.612  41.455 1.00 52.04  ? 63  LEU D N    1 
ATOM   6782 C CA   . LEU D 2 33  ? 61.126 -8.386  40.238 1.00 55.41  ? 63  LEU D CA   1 
ATOM   6783 C C    . LEU D 2 33  ? 61.047 -9.879  40.508 1.00 58.16  ? 63  LEU D C    1 
ATOM   6784 O O    . LEU D 2 33  ? 60.770 -10.647 39.582 1.00 55.60  ? 63  LEU D O    1 
ATOM   6785 C CB   . LEU D 2 33  ? 62.244 -8.092  39.235 1.00 57.92  ? 63  LEU D CB   1 
ATOM   6786 C CG   . LEU D 2 33  ? 62.338 -6.631  38.786 1.00 57.39  ? 63  LEU D CG   1 
ATOM   6787 C CD1  . LEU D 2 33  ? 63.507 -6.423  37.835 1.00 60.56  ? 63  LEU D CD1  1 
ATOM   6788 C CD2  . LEU D 2 33  ? 61.040 -6.168  38.136 1.00 57.30  ? 63  LEU D CD2  1 
ATOM   6789 H H    . LEU D 2 33  ? 62.152 -7.411  41.612 1.00 62.45  ? 63  LEU D H    1 
ATOM   6790 H HA   . LEU D 2 33  ? 60.287 -8.114  39.834 1.00 66.49  ? 63  LEU D HA   1 
ATOM   6791 H HB2  . LEU D 2 33  ? 63.092 -8.330  39.640 1.00 69.50  ? 63  LEU D HB2  1 
ATOM   6792 H HB3  . LEU D 2 33  ? 62.098 -8.633  38.443 1.00 69.50  ? 63  LEU D HB3  1 
ATOM   6793 H HG   . LEU D 2 33  ? 62.491 -6.075  39.567 1.00 68.87  ? 63  LEU D HG   1 
ATOM   6794 H HD11 . LEU D 2 33  ? 63.538 -5.490  37.571 1.00 72.68  ? 63  LEU D HD11 1 
ATOM   6795 H HD12 . LEU D 2 33  ? 64.330 -6.667  38.288 1.00 72.68  ? 63  LEU D HD12 1 
ATOM   6796 H HD13 . LEU D 2 33  ? 63.381 -6.984  37.053 1.00 72.68  ? 63  LEU D HD13 1 
ATOM   6797 H HD21 . LEU D 2 33  ? 61.135 -5.241  37.865 1.00 68.77  ? 63  LEU D HD21 1 
ATOM   6798 H HD22 . LEU D 2 33  ? 60.860 -6.723  37.361 1.00 68.77  ? 63  LEU D HD22 1 
ATOM   6799 H HD23 . LEU D 2 33  ? 60.318 -6.252  38.778 1.00 68.77  ? 63  LEU D HD23 1 
ATOM   6800 N N    . ASP D 2 34  ? 61.286 -10.300 41.746 1.00 62.38  ? 64  ASP D N    1 
ATOM   6801 C CA   . ASP D 2 34  ? 61.008 -11.670 42.145 1.00 66.09  ? 64  ASP D CA   1 
ATOM   6802 C C    . ASP D 2 34  ? 59.558 -12.006 41.824 1.00 66.83  ? 64  ASP D C    1 
ATOM   6803 O O    . ASP D 2 34  ? 58.652 -11.203 42.066 1.00 64.14  ? 64  ASP D O    1 
ATOM   6804 C CB   . ASP D 2 34  ? 61.287 -11.829 43.641 1.00 66.83  ? 64  ASP D CB   1 
ATOM   6805 C CG   . ASP D 2 34  ? 61.153 -13.255 44.117 1.00 70.64  ? 64  ASP D CG   1 
ATOM   6806 O OD1  . ASP D 2 34  ? 60.482 -14.058 43.440 1.00 72.91  ? 64  ASP D OD1  1 
ATOM   6807 O OD2  . ASP D 2 34  ? 61.708 -13.568 45.191 1.00 71.87  ? 64  ASP D OD2  1 
ATOM   6808 H H    . ASP D 2 34  ? 61.610 -9.809  42.374 1.00 74.86  ? 64  ASP D H    1 
ATOM   6809 H HA   . ASP D 2 34  ? 61.584 -12.277 41.655 1.00 79.30  ? 64  ASP D HA   1 
ATOM   6810 H HB2  . ASP D 2 34  ? 62.193 -11.536 43.825 1.00 80.20  ? 64  ASP D HB2  1 
ATOM   6811 H HB3  . ASP D 2 34  ? 60.656 -11.286 44.139 1.00 80.20  ? 64  ASP D HB3  1 
ATOM   6812 N N    . LYS D 2 35  ? 59.340 -13.202 41.269 1.00 71.76  ? 65  LYS D N    1 
ATOM   6813 C CA   . LYS D 2 35  ? 58.024 -13.545 40.738 1.00 73.84  ? 65  LYS D CA   1 
ATOM   6814 C C    . LYS D 2 35  ? 56.960 -13.702 41.820 1.00 71.55  ? 65  LYS D C    1 
ATOM   6815 O O    . LYS D 2 35  ? 55.769 -13.590 41.512 1.00 71.03  ? 65  LYS D O    1 
ATOM   6816 C CB   . LYS D 2 35  ? 58.105 -14.824 39.906 1.00 79.37  ? 65  LYS D CB   1 
ATOM   6817 C CG   . LYS D 2 35  ? 58.628 -14.604 38.489 1.00 83.47  ? 65  LYS D CG   1 
ATOM   6818 C CD   . LYS D 2 35  ? 58.003 -15.582 37.492 1.00 87.81  ? 65  LYS D CD   1 
ATOM   6819 C CE   . LYS D 2 35  ? 58.547 -16.993 37.652 1.00 93.05  ? 65  LYS D CE   1 
ATOM   6820 N NZ   . LYS D 2 35  ? 59.942 -17.126 37.137 1.00 95.69  ? 65  LYS D NZ   1 
ATOM   6821 H H    . LYS D 2 35  ? 59.930 -13.823 41.191 1.00 86.11  ? 65  LYS D H    1 
ATOM   6822 H HA   . LYS D 2 35  ? 57.736 -12.831 40.148 1.00 88.61  ? 65  LYS D HA   1 
ATOM   6823 H HB2  . LYS D 2 35  ? 58.701 -15.448 40.350 1.00 95.24  ? 65  LYS D HB2  1 
ATOM   6824 H HB3  . LYS D 2 35  ? 57.217 -15.209 39.838 1.00 95.24  ? 65  LYS D HB3  1 
ATOM   6825 H HG2  . LYS D 2 35  ? 58.412 -13.702 38.206 1.00 100.17 ? 65  LYS D HG2  1 
ATOM   6826 H HG3  . LYS D 2 35  ? 59.589 -14.736 38.480 1.00 100.17 ? 65  LYS D HG3  1 
ATOM   6827 H HD2  . LYS D 2 35  ? 57.044 -15.611 37.634 1.00 105.38 ? 65  LYS D HD2  1 
ATOM   6828 H HD3  . LYS D 2 35  ? 58.198 -15.283 36.590 1.00 105.38 ? 65  LYS D HD3  1 
ATOM   6829 H HE2  . LYS D 2 35  ? 58.550 -17.227 38.593 1.00 111.66 ? 65  LYS D HE2  1 
ATOM   6830 H HE3  . LYS D 2 35  ? 57.984 -17.608 37.157 1.00 111.66 ? 65  LYS D HE3  1 
ATOM   6831 H HZ1  . LYS D 2 35  ? 60.228 -17.961 37.246 1.00 114.83 ? 65  LYS D HZ1  1 
ATOM   6832 H HZ2  . LYS D 2 35  ? 59.967 -16.922 36.271 1.00 114.83 ? 65  LYS D HZ2  1 
ATOM   6833 H HZ3  . LYS D 2 35  ? 60.483 -16.575 37.579 1.00 114.83 ? 65  LYS D HZ3  1 
ATOM   6834 N N    . GLU D 2 36  ? 57.346 -13.949 43.074 1.00 72.19  ? 66  GLU D N    1 
ATOM   6835 C CA   . GLU D 2 36  ? 56.344 -14.066 44.128 1.00 72.48  ? 66  GLU D CA   1 
ATOM   6836 C C    . GLU D 2 36  ? 55.747 -12.721 44.530 1.00 65.64  ? 66  GLU D C    1 
ATOM   6837 O O    . GLU D 2 36  ? 54.713 -12.706 45.205 1.00 62.06  ? 66  GLU D O    1 
ATOM   6838 C CB   . GLU D 2 36  ? 56.939 -14.766 45.357 1.00 78.15  ? 66  GLU D CB   1 
ATOM   6839 C CG   . GLU D 2 36  ? 58.138 -14.067 45.986 1.00 82.46  ? 66  GLU D CG   1 
ATOM   6840 C CD   . GLU D 2 36  ? 58.769 -14.883 47.113 1.00 88.14  ? 66  GLU D CD   1 
ATOM   6841 O OE1  . GLU D 2 36  ? 59.009 -14.316 48.203 1.00 87.19  ? 66  GLU D OE1  1 
ATOM   6842 O OE2  . GLU D 2 36  ? 59.020 -16.093 46.910 1.00 90.99  ? 66  GLU D OE2  1 
ATOM   6843 H H    . GLU D 2 36  ? 58.160 -14.051 43.333 1.00 86.63  ? 66  GLU D H    1 
ATOM   6844 H HA   . GLU D 2 36  ? 55.618 -14.620 43.801 1.00 86.97  ? 66  GLU D HA   1 
ATOM   6845 H HB2  . GLU D 2 36  ? 56.250 -14.832 46.037 1.00 93.78  ? 66  GLU D HB2  1 
ATOM   6846 H HB3  . GLU D 2 36  ? 57.224 -15.656 45.097 1.00 93.78  ? 66  GLU D HB3  1 
ATOM   6847 H HG2  . GLU D 2 36  ? 58.813 -13.922 45.305 1.00 98.96  ? 66  GLU D HG2  1 
ATOM   6848 H HG3  . GLU D 2 36  ? 57.851 -13.217 46.355 1.00 98.96  ? 66  GLU D HG3  1 
ATOM   6849 N N    . PHE D 2 37  ? 56.353 -11.603 44.127 1.00 58.07  ? 67  PHE D N    1 
ATOM   6850 C CA   . PHE D 2 37  ? 55.812 -10.277 44.399 1.00 46.59  ? 67  PHE D CA   1 
ATOM   6851 C C    . PHE D 2 37  ? 55.111 -9.670  43.188 1.00 46.53  ? 67  PHE D C    1 
ATOM   6852 O O    . PHE D 2 37  ? 54.676 -8.520  43.251 1.00 46.22  ? 67  PHE D O    1 
ATOM   6853 C CB   . PHE D 2 37  ? 56.924 -9.340  44.891 1.00 45.40  ? 67  PHE D CB   1 
ATOM   6854 C CG   . PHE D 2 37  ? 57.672 -9.867  46.089 1.00 45.86  ? 67  PHE D CG   1 
ATOM   6855 C CD1  . PHE D 2 37  ? 56.988 -10.269 47.230 1.00 45.64  ? 67  PHE D CD1  1 
ATOM   6856 C CD2  . PHE D 2 37  ? 59.058 -9.994  46.063 1.00 46.94  ? 67  PHE D CD2  1 
ATOM   6857 C CE1  . PHE D 2 37  ? 57.672 -10.776 48.325 1.00 46.56  ? 67  PHE D CE1  1 
ATOM   6858 C CE2  . PHE D 2 37  ? 59.750 -10.498 47.156 1.00 47.80  ? 67  PHE D CE2  1 
ATOM   6859 C CZ   . PHE D 2 37  ? 59.059 -10.892 48.287 1.00 47.67  ? 67  PHE D CZ   1 
ATOM   6860 H H    . PHE D 2 37  ? 57.091 -11.589 43.686 1.00 69.68  ? 67  PHE D H    1 
ATOM   6861 H HA   . PHE D 2 37  ? 55.155 -10.352 45.109 1.00 55.91  ? 67  PHE D HA   1 
ATOM   6862 H HB2  . PHE D 2 37  ? 57.565 -9.211  44.174 1.00 54.48  ? 67  PHE D HB2  1 
ATOM   6863 H HB3  . PHE D 2 37  ? 56.530 -8.489  45.138 1.00 54.48  ? 67  PHE D HB3  1 
ATOM   6864 H HD1  . PHE D 2 37  ? 56.061 -10.198 47.259 1.00 54.77  ? 67  PHE D HD1  1 
ATOM   6865 H HD2  . PHE D 2 37  ? 59.528 -9.734  45.303 1.00 56.33  ? 67  PHE D HD2  1 
ATOM   6866 H HE1  . PHE D 2 37  ? 57.204 -11.037 49.086 1.00 55.88  ? 67  PHE D HE1  1 
ATOM   6867 H HE2  . PHE D 2 37  ? 60.677 -10.572 47.127 1.00 57.37  ? 67  PHE D HE2  1 
ATOM   6868 H HZ   . PHE D 2 37  ? 59.519 -11.226 49.023 1.00 57.20  ? 67  PHE D HZ   1 
ATOM   6869 N N    . LEU D 2 38  ? 54.978 -10.411 42.095 1.00 53.64  ? 68  LEU D N    1 
ATOM   6870 C CA   . LEU D 2 38  ? 54.239 -9.903  40.941 1.00 56.11  ? 68  LEU D CA   1 
ATOM   6871 C C    . LEU D 2 38  ? 52.857 -9.363  41.289 1.00 55.91  ? 68  LEU D C    1 
ATOM   6872 O O    . LEU D 2 38  ? 52.450 -8.358  40.683 1.00 55.80  ? 68  LEU D O    1 
ATOM   6873 C CB   . LEU D 2 38  ? 54.106 -11.007 39.883 1.00 61.21  ? 68  LEU D CB   1 
ATOM   6874 C CG   . LEU D 2 38  ? 55.086 -10.951 38.716 1.00 64.59  ? 68  LEU D CG   1 
ATOM   6875 C CD1  . LEU D 2 38  ? 54.920 -12.196 37.837 1.00 68.11  ? 68  LEU D CD1  1 
ATOM   6876 C CD2  . LEU D 2 38  ? 54.893 -9.677  37.900 1.00 64.38  ? 68  LEU D CD2  1 
ATOM   6877 H H    . LEU D 2 38  ? 55.300 -11.202 41.994 1.00 64.37  ? 68  LEU D H    1 
ATOM   6878 H HA   . LEU D 2 38  ? 54.746 -9.177  40.546 1.00 67.33  ? 68  LEU D HA   1 
ATOM   6879 H HB2  . LEU D 2 38  ? 54.228 -11.863 40.321 1.00 73.45  ? 68  LEU D HB2  1 
ATOM   6880 H HB3  . LEU D 2 38  ? 53.212 -10.962 39.510 1.00 73.45  ? 68  LEU D HB3  1 
ATOM   6881 H HG   . LEU D 2 38  ? 55.991 -10.949 39.065 1.00 77.51  ? 68  LEU D HG   1 
ATOM   6882 H HD11 . LEU D 2 38  ? 55.549 -12.147 37.100 1.00 81.73  ? 68  LEU D HD11 1 
ATOM   6883 H HD12 . LEU D 2 38  ? 55.097 -12.985 38.372 1.00 81.73  ? 68  LEU D HD12 1 
ATOM   6884 H HD13 . LEU D 2 38  ? 54.012 -12.223 37.497 1.00 81.73  ? 68  LEU D HD13 1 
ATOM   6885 H HD21 . LEU D 2 38  ? 55.529 -9.672  37.168 1.00 77.25  ? 68  LEU D HD21 1 
ATOM   6886 H HD22 . LEU D 2 38  ? 53.987 -9.659  37.552 1.00 77.25  ? 68  LEU D HD22 1 
ATOM   6887 H HD23 . LEU D 2 38  ? 55.042 -8.909  38.474 1.00 77.25  ? 68  LEU D HD23 1 
ATOM   6888 N N    . PRO D 2 39  ? 52.089 -9.966  42.200 1.00 61.17  ? 69  PRO D N    1 
ATOM   6889 C CA   . PRO D 2 39  ? 50.779 -9.389  42.546 1.00 61.70  ? 69  PRO D CA   1 
ATOM   6890 C C    . PRO D 2 39  ? 50.862 -8.000  43.153 1.00 58.85  ? 69  PRO D C    1 
ATOM   6891 O O    . PRO D 2 39  ? 49.878 -7.251  43.074 1.00 58.78  ? 69  PRO D O    1 
ATOM   6892 C CB   . PRO D 2 39  ? 50.203 -10.403 43.543 1.00 62.09  ? 69  PRO D CB   1 
ATOM   6893 C CG   . PRO D 2 39  ? 50.914 -11.678 43.242 1.00 64.12  ? 69  PRO D CG   1 
ATOM   6894 C CD   . PRO D 2 39  ? 52.293 -11.279 42.833 1.00 63.38  ? 69  PRO D CD   1 
ATOM   6895 H HA   . PRO D 2 39  ? 50.211 -9.358  41.760 1.00 74.05  ? 69  PRO D HA   1 
ATOM   6896 H HB2  . PRO D 2 39  ? 50.387 -10.112 44.450 1.00 74.51  ? 69  PRO D HB2  1 
ATOM   6897 H HB3  . PRO D 2 39  ? 49.248 -10.499 43.399 1.00 74.51  ? 69  PRO D HB3  1 
ATOM   6898 H HG2  . PRO D 2 39  ? 50.940 -12.233 44.037 1.00 76.95  ? 69  PRO D HG2  1 
ATOM   6899 H HG3  . PRO D 2 39  ? 50.463 -12.140 42.517 1.00 76.95  ? 69  PRO D HG3  1 
ATOM   6900 H HD2  . PRO D 2 39  ? 52.866 -11.195 43.612 1.00 76.06  ? 69  PRO D HD2  1 
ATOM   6901 H HD3  . PRO D 2 39  ? 52.653 -11.912 42.193 1.00 76.06  ? 69  PRO D HD3  1 
ATOM   6902 N N    . ILE D 2 40  ? 51.993 -7.627  43.754 1.00 55.36  ? 70  ILE D N    1 
ATOM   6903 C CA   . ILE D 2 40  ? 52.153 -6.318  44.377 1.00 52.52  ? 70  ILE D CA   1 
ATOM   6904 C C    . ILE D 2 40  ? 53.075 -5.407  43.589 1.00 51.27  ? 70  ILE D C    1 
ATOM   6905 O O    . ILE D 2 40  ? 53.308 -4.261  44.012 1.00 48.91  ? 70  ILE D O    1 
ATOM   6906 C CB   . ILE D 2 40  ? 52.651 -6.442  45.830 1.00 50.88  ? 70  ILE D CB   1 
ATOM   6907 C CG1  . ILE D 2 40  ? 54.068 -7.022  45.874 1.00 51.63  ? 70  ILE D CG1  1 
ATOM   6908 C CG2  . ILE D 2 40  ? 51.698 -7.302  46.642 1.00 50.99  ? 70  ILE D CG2  1 
ATOM   6909 C CD1  . ILE D 2 40  ? 54.712 -6.944  47.243 1.00 51.16  ? 70  ILE D CD1  1 
ATOM   6910 H H    . ILE D 2 40  ? 52.692 -8.125  43.813 1.00 66.44  ? 70  ILE D H    1 
ATOM   6911 H HA   . ILE D 2 40  ? 51.283 -5.889  44.408 1.00 63.03  ? 70  ILE D HA   1 
ATOM   6912 H HB   . ILE D 2 40  ? 52.672 -5.556  46.223 1.00 61.05  ? 70  ILE D HB   1 
ATOM   6913 H HG12 . ILE D 2 40  ? 54.033 -7.956  45.614 1.00 61.95  ? 70  ILE D HG12 1 
ATOM   6914 H HG13 . ILE D 2 40  ? 54.627 -6.528  45.254 1.00 61.95  ? 70  ILE D HG13 1 
ATOM   6915 H HG21 . ILE D 2 40  ? 52.029 -7.368  47.552 1.00 61.19  ? 70  ILE D HG21 1 
ATOM   6916 H HG22 . ILE D 2 40  ? 50.820 -6.890  46.638 1.00 61.19  ? 70  ILE D HG22 1 
ATOM   6917 H HG23 . ILE D 2 40  ? 51.651 -8.185  46.242 1.00 61.19  ? 70  ILE D HG23 1 
ATOM   6918 H HD11 . ILE D 2 40  ? 55.602 -7.327  47.195 1.00 61.39  ? 70  ILE D HD11 1 
ATOM   6919 H HD12 . ILE D 2 40  ? 54.766 -6.014  47.514 1.00 61.39  ? 70  ILE D HD12 1 
ATOM   6920 H HD13 . ILE D 2 40  ? 54.171 -7.443  47.875 1.00 61.39  ? 70  ILE D HD13 1 
ATOM   6921 N N    . LEU D 2 41  ? 53.608 -5.865  42.464 1.00 50.97  ? 71  LEU D N    1 
ATOM   6922 C CA   . LEU D 2 41  ? 54.530 -5.049  41.687 1.00 50.91  ? 71  LEU D CA   1 
ATOM   6923 C C    . LEU D 2 41  ? 53.775 -3.927  40.985 1.00 52.84  ? 71  LEU D C    1 
ATOM   6924 O O    . LEU D 2 41  ? 52.834 -4.177  40.225 1.00 51.84  ? 71  LEU D O    1 
ATOM   6925 C CB   . LEU D 2 41  ? 55.269 -5.912  40.667 1.00 51.28  ? 71  LEU D CB   1 
ATOM   6926 C CG   . LEU D 2 41  ? 56.263 -5.188  39.750 1.00 53.86  ? 71  LEU D CG   1 
ATOM   6927 C CD1  . LEU D 2 41  ? 57.365 -4.539  40.551 1.00 51.63  ? 71  LEU D CD1  1 
ATOM   6928 C CD2  . LEU D 2 41  ? 56.847 -6.155  38.719 1.00 54.61  ? 71  LEU D CD2  1 
ATOM   6929 H H    . LEU D 2 41  ? 53.453 -6.643  42.130 1.00 61.16  ? 71  LEU D H    1 
ATOM   6930 H HA   . LEU D 2 41  ? 55.185 -4.651  42.281 1.00 61.09  ? 71  LEU D HA   1 
ATOM   6931 H HB2  . LEU D 2 41  ? 55.766 -6.592  41.148 1.00 61.53  ? 71  LEU D HB2  1 
ATOM   6932 H HB3  . LEU D 2 41  ? 54.611 -6.339  40.097 1.00 61.53  ? 71  LEU D HB3  1 
ATOM   6933 H HG   . LEU D 2 41  ? 55.793 -4.488  39.269 1.00 64.64  ? 71  LEU D HG   1 
ATOM   6934 H HD11 . LEU D 2 41  ? 57.974 -4.091  39.944 1.00 61.95  ? 71  LEU D HD11 1 
ATOM   6935 H HD12 . LEU D 2 41  ? 56.973 -3.895  41.162 1.00 61.95  ? 71  LEU D HD12 1 
ATOM   6936 H HD13 . LEU D 2 41  ? 57.837 -5.224  41.050 1.00 61.95  ? 71  LEU D HD13 1 
ATOM   6937 H HD21 . LEU D 2 41  ? 57.471 -5.674  38.153 1.00 65.54  ? 71  LEU D HD21 1 
ATOM   6938 H HD22 . LEU D 2 41  ? 57.307 -6.872  39.183 1.00 65.54  ? 71  LEU D HD22 1 
ATOM   6939 H HD23 . LEU D 2 41  ? 56.125 -6.518  38.182 1.00 65.54  ? 71  LEU D HD23 1 
ATOM   6940 N N    . GLN D 2 42  ? 54.194 -2.694  41.234 1.00 51.09  ? 72  GLN D N    1 
ATOM   6941 C CA   . GLN D 2 42  ? 53.721 -1.530  40.492 1.00 53.81  ? 72  GLN D CA   1 
ATOM   6942 C C    . GLN D 2 42  ? 54.788 -1.211  39.447 1.00 57.04  ? 72  GLN D C    1 
ATOM   6943 O O    . GLN D 2 42  ? 55.848 -0.669  39.769 1.00 54.39  ? 72  GLN D O    1 
ATOM   6944 C CB   . GLN D 2 42  ? 53.469 -0.357  41.434 1.00 53.34  ? 72  GLN D CB   1 
ATOM   6945 C CG   . GLN D 2 42  ? 52.973 0.907   40.753 1.00 55.59  ? 72  GLN D CG   1 
ATOM   6946 C CD   . GLN D 2 42  ? 51.624 0.727   40.093 1.00 58.69  ? 72  GLN D CD   1 
ATOM   6947 O OE1  . GLN D 2 42  ? 50.758 0.015   40.604 1.00 59.55  ? 72  GLN D OE1  1 
ATOM   6948 N NE2  . GLN D 2 42  ? 51.439 1.367   38.944 1.00 61.27  ? 72  GLN D NE2  1 
ATOM   6949 H H    . GLN D 2 42  ? 54.768 -2.500  41.844 1.00 61.31  ? 72  GLN D H    1 
ATOM   6950 H HA   . GLN D 2 42  ? 52.893 -1.747  40.035 1.00 64.58  ? 72  GLN D HA   1 
ATOM   6951 H HB2  . GLN D 2 42  ? 52.800 -0.621  42.085 1.00 64.00  ? 72  GLN D HB2  1 
ATOM   6952 H HB3  . GLN D 2 42  ? 54.298 -0.140  41.889 1.00 64.00  ? 72  GLN D HB3  1 
ATOM   6953 H HG2  . GLN D 2 42  ? 52.891 1.612   41.415 1.00 66.71  ? 72  GLN D HG2  1 
ATOM   6954 H HG3  . GLN D 2 42  ? 53.610 1.168   40.069 1.00 66.71  ? 72  GLN D HG3  1 
ATOM   6955 H HE21 . GLN D 2 42  ? 52.070 1.851   38.616 1.00 73.52  ? 72  GLN D HE21 1 
ATOM   6956 H HE22 . GLN D 2 42  ? 50.690 1.297   38.529 1.00 73.52  ? 72  GLN D HE22 1 
ATOM   6957 N N    . GLU D 2 43  ? 54.510 -1.564  38.191 1.00 61.96  ? 73  GLU D N    1 
ATOM   6958 C CA   . GLU D 2 43  ? 55.485 -1.364  37.125 1.00 67.29  ? 73  GLU D CA   1 
ATOM   6959 C C    . GLU D 2 43  ? 55.822 0.114   36.968 1.00 68.83  ? 73  GLU D C    1 
ATOM   6960 O O    . GLU D 2 43  ? 56.987 0.517   37.070 1.00 68.32  ? 73  GLU D O    1 
ATOM   6961 C CB   . GLU D 2 43  ? 54.944 -1.938  35.813 1.00 73.10  ? 73  GLU D CB   1 
ATOM   6962 C CG   . GLU D 2 43  ? 54.609 -3.433  35.864 1.00 76.02  ? 73  GLU D CG   1 
ATOM   6963 C CD   . GLU D 2 43  ? 55.720 -4.319  35.317 1.00 81.02  ? 73  GLU D CD   1 
ATOM   6964 O OE1  . GLU D 2 43  ? 56.857 -3.828  35.154 1.00 82.67  ? 73  GLU D OE1  1 
ATOM   6965 O OE2  . GLU D 2 43  ? 55.452 -5.511  35.043 1.00 83.59  ? 73  GLU D OE2  1 
ATOM   6966 H H    . GLU D 2 43  ? 53.770 -1.920  37.934 1.00 74.35  ? 73  GLU D H    1 
ATOM   6967 H HA   . GLU D 2 43  ? 56.301 -1.838  37.348 1.00 80.75  ? 73  GLU D HA   1 
ATOM   6968 H HB2  . GLU D 2 43  ? 54.132 -1.462  35.578 1.00 87.72  ? 73  GLU D HB2  1 
ATOM   6969 H HB3  . GLU D 2 43  ? 55.611 -1.809  35.120 1.00 87.72  ? 73  GLU D HB3  1 
ATOM   6970 H HG2  . GLU D 2 43  ? 54.450 -3.688  36.786 1.00 91.22  ? 73  GLU D HG2  1 
ATOM   6971 H HG3  . GLU D 2 43  ? 53.812 -3.594  35.335 1.00 91.22  ? 73  GLU D HG3  1 
ATOM   6972 N N    . GLU D 2 44  ? 54.810 0.934   36.715 1.00 70.73  ? 74  GLU D N    1 
ATOM   6973 C CA   . GLU D 2 44  ? 55.017 2.364   36.532 1.00 73.92  ? 74  GLU D CA   1 
ATOM   6974 C C    . GLU D 2 44  ? 55.050 3.054   37.890 1.00 68.70  ? 74  GLU D C    1 
ATOM   6975 O O    . GLU D 2 44  ? 54.070 2.969   38.637 1.00 66.98  ? 74  GLU D O    1 
ATOM   6976 C CB   . GLU D 2 44  ? 53.906 2.955   35.677 1.00 80.82  ? 74  GLU D CB   1 
ATOM   6977 C CG   . GLU D 2 44  ? 54.093 4.428   35.342 1.00 86.47  ? 74  GLU D CG   1 
ATOM   6978 C CD   . GLU D 2 44  ? 55.275 4.670   34.420 1.00 92.92  ? 74  GLU D CD   1 
ATOM   6979 O OE1  . GLU D 2 44  ? 55.746 3.700   33.785 1.00 95.20  ? 74  GLU D OE1  1 
ATOM   6980 O OE2  . GLU D 2 44  ? 55.732 5.831   34.329 1.00 94.51  ? 74  GLU D OE2  1 
ATOM   6981 H H    . GLU D 2 44  ? 53.989 0.687   36.645 1.00 84.87  ? 74  GLU D H    1 
ATOM   6982 H HA   . GLU D 2 44  ? 55.865 2.516   36.086 1.00 88.70  ? 74  GLU D HA   1 
ATOM   6983 H HB2  . GLU D 2 44  ? 53.862 2.466   34.841 1.00 96.99  ? 74  GLU D HB2  1 
ATOM   6984 H HB3  . GLU D 2 44  ? 53.065 2.866   36.153 1.00 96.99  ? 74  GLU D HB3  1 
ATOM   6985 H HG2  . GLU D 2 44  ? 53.295 4.756   34.899 1.00 103.76 ? 74  GLU D HG2  1 
ATOM   6986 H HG3  . GLU D 2 44  ? 54.245 4.922   36.162 1.00 103.76 ? 74  GLU D HG3  1 
ATOM   6987 N N    . PRO D 2 45  ? 56.127 3.757   38.242 1.00 64.69  ? 75  PRO D N    1 
ATOM   6988 C CA   . PRO D 2 45  ? 56.201 4.380   39.573 1.00 61.26  ? 75  PRO D CA   1 
ATOM   6989 C C    . PRO D 2 45  ? 55.177 5.498   39.707 1.00 61.90  ? 75  PRO D C    1 
ATOM   6990 O O    . PRO D 2 45  ? 55.192 6.465   38.944 1.00 64.35  ? 75  PRO D O    1 
ATOM   6991 C CB   . PRO D 2 45  ? 57.636 4.913   39.632 1.00 61.17  ? 75  PRO D CB   1 
ATOM   6992 C CG   . PRO D 2 45  ? 57.980 5.185   38.217 1.00 63.39  ? 75  PRO D CG   1 
ATOM   6993 C CD   . PRO D 2 45  ? 57.289 4.114   37.410 1.00 65.30  ? 75  PRO D CD   1 
ATOM   6994 H HA   . PRO D 2 45  ? 56.066 3.721   40.271 1.00 73.51  ? 75  PRO D HA   1 
ATOM   6995 H HB2  . PRO D 2 45  ? 57.663 5.729   40.157 1.00 73.40  ? 75  PRO D HB2  1 
ATOM   6996 H HB3  . PRO D 2 45  ? 58.223 4.239   40.008 1.00 73.40  ? 75  PRO D HB3  1 
ATOM   6997 H HG2  . PRO D 2 45  ? 57.654 6.063   37.967 1.00 76.07  ? 75  PRO D HG2  1 
ATOM   6998 H HG3  . PRO D 2 45  ? 58.941 5.131   38.101 1.00 76.07  ? 75  PRO D HG3  1 
ATOM   6999 H HD2  . PRO D 2 45  ? 56.997 4.469   36.556 1.00 78.36  ? 75  PRO D HD2  1 
ATOM   7000 H HD3  . PRO D 2 45  ? 57.872 3.347   37.296 1.00 78.36  ? 75  PRO D HD3  1 
ATOM   7001 N N    . LEU D 2 46  ? 54.292 5.360   40.675 1.00 65.81  ? 76  LEU D N    1 
ATOM   7002 C CA   . LEU D 2 46  ? 53.293 6.394   40.869 1.00 67.52  ? 76  LEU D CA   1 
ATOM   7003 C C    . LEU D 2 46  ? 53.819 7.464   41.814 1.00 66.00  ? 76  LEU D C    1 
ATOM   7004 O O    . LEU D 2 46  ? 54.614 7.169   42.714 1.00 66.21  ? 76  LEU D O    1 
ATOM   7005 C CB   . LEU D 2 46  ? 52.011 5.799   41.442 1.00 67.20  ? 76  LEU D CB   1 
ATOM   7006 C CG   . LEU D 2 46  ? 51.213 4.893   40.505 1.00 69.72  ? 76  LEU D CG   1 
ATOM   7007 C CD1  . LEU D 2 46  ? 50.090 4.225   41.270 1.00 68.92  ? 76  LEU D CD1  1 
ATOM   7008 C CD2  . LEU D 2 46  ? 50.668 5.680   39.322 1.00 72.62  ? 76  LEU D CD2  1 
ATOM   7009 H H    . LEU D 2 46  ? 54.246 4.697   41.221 1.00 78.97  ? 76  LEU D H    1 
ATOM   7010 H HA   . LEU D 2 46  ? 53.086 6.809   40.017 1.00 81.03  ? 76  LEU D HA   1 
ATOM   7011 H HB2  . LEU D 2 46  ? 52.242 5.274   42.225 1.00 80.63  ? 76  LEU D HB2  1 
ATOM   7012 H HB3  . LEU D 2 46  ? 51.428 6.529   41.705 1.00 80.63  ? 76  LEU D HB3  1 
ATOM   7013 H HG   . LEU D 2 46  ? 51.798 4.199   40.161 1.00 83.66  ? 76  LEU D HG   1 
ATOM   7014 H HD11 . LEU D 2 46  ? 49.592 3.653   40.665 1.00 82.71  ? 76  LEU D HD11 1 
ATOM   7015 H HD12 . LEU D 2 46  ? 50.470 3.696   41.989 1.00 82.71  ? 76  LEU D HD12 1 
ATOM   7016 H HD13 . LEU D 2 46  ? 49.507 4.909   41.635 1.00 82.71  ? 76  LEU D HD13 1 
ATOM   7017 H HD21 . LEU D 2 46  ? 50.168 5.079   38.747 1.00 87.15  ? 76  LEU D HD21 1 
ATOM   7018 H HD22 . LEU D 2 46  ? 50.086 6.383   39.652 1.00 87.15  ? 76  LEU D HD22 1 
ATOM   7019 H HD23 . LEU D 2 46  ? 51.409 6.067   38.831 1.00 87.15  ? 76  LEU D HD23 1 
ATOM   7020 N N    . PRO D 2 47  ? 53.392 8.714   41.634 1.00 61.81  ? 77  PRO D N    1 
ATOM   7021 C CA   . PRO D 2 47  ? 53.864 9.770   42.520 1.00 58.94  ? 77  PRO D CA   1 
ATOM   7022 C C    . PRO D 2 47  ? 53.370 9.529   43.936 1.00 55.20  ? 77  PRO D C    1 
ATOM   7023 O O    . PRO D 2 47  ? 52.351 8.850   44.142 1.00 54.02  ? 77  PRO D O    1 
ATOM   7024 C CB   . PRO D 2 47  ? 53.252 11.046  41.914 1.00 60.76  ? 77  PRO D CB   1 
ATOM   7025 C CG   . PRO D 2 47  ? 52.057 10.579  41.181 1.00 62.49  ? 77  PRO D CG   1 
ATOM   7026 C CD   . PRO D 2 47  ? 52.401 9.209   40.662 1.00 63.50  ? 77  PRO D CD   1 
ATOM   7027 H HA   . PRO D 2 47  ? 54.833 9.827   42.509 1.00 70.73  ? 77  PRO D HA   1 
ATOM   7028 H HB2  . PRO D 2 47  ? 53.004 11.659  42.623 1.00 72.91  ? 77  PRO D HB2  1 
ATOM   7029 H HB3  . PRO D 2 47  ? 53.888 11.458  41.308 1.00 72.91  ? 77  PRO D HB3  1 
ATOM   7030 H HG2  . PRO D 2 47  ? 51.301 10.534  41.788 1.00 74.99  ? 77  PRO D HG2  1 
ATOM   7031 H HG3  . PRO D 2 47  ? 51.869 11.185  40.447 1.00 74.99  ? 77  PRO D HG3  1 
ATOM   7032 H HD2  . PRO D 2 47  ? 51.616 8.640   40.660 1.00 76.20  ? 77  PRO D HD2  1 
ATOM   7033 H HD3  . PRO D 2 47  ? 52.797 9.272   39.778 1.00 76.20  ? 77  PRO D HD3  1 
ATOM   7034 N N    . PRO D 2 48  ? 54.074 10.037  44.941 1.00 53.26  ? 78  PRO D N    1 
ATOM   7035 C CA   . PRO D 2 48  ? 53.563 9.906   46.307 1.00 51.07  ? 78  PRO D CA   1 
ATOM   7036 C C    . PRO D 2 48  ? 52.175 10.519  46.423 1.00 51.72  ? 78  PRO D C    1 
ATOM   7037 O O    . PRO D 2 48  ? 51.882 11.566  45.839 1.00 52.69  ? 78  PRO D O    1 
ATOM   7038 C CB   . PRO D 2 48  ? 54.596 10.663  47.148 1.00 51.66  ? 78  PRO D CB   1 
ATOM   7039 C CG   . PRO D 2 48  ? 55.839 10.663  46.319 1.00 51.72  ? 78  PRO D CG   1 
ATOM   7040 C CD   . PRO D 2 48  ? 55.383 10.709  44.900 1.00 53.98  ? 78  PRO D CD   1 
ATOM   7041 H HA   . PRO D 2 48  ? 53.537 8.975   46.578 1.00 61.29  ? 78  PRO D HA   1 
ATOM   7042 H HB2  . PRO D 2 48  ? 54.289 11.570  47.307 1.00 61.99  ? 78  PRO D HB2  1 
ATOM   7043 H HB3  . PRO D 2 48  ? 54.742 10.197  47.986 1.00 61.99  ? 78  PRO D HB3  1 
ATOM   7044 H HG2  . PRO D 2 48  ? 56.371 11.446  46.531 1.00 62.06  ? 78  PRO D HG2  1 
ATOM   7045 H HG3  . PRO D 2 48  ? 56.343 9.852   46.489 1.00 62.06  ? 78  PRO D HG3  1 
ATOM   7046 H HD2  . PRO D 2 48  ? 55.283 11.628  44.606 1.00 64.78  ? 78  PRO D HD2  1 
ATOM   7047 H HD3  . PRO D 2 48  ? 55.998 10.219  44.331 1.00 64.78  ? 78  PRO D HD3  1 
ATOM   7048 N N    . LEU D 2 49  ? 51.308 9.838   47.175 1.00 51.82  ? 79  LEU D N    1 
ATOM   7049 C CA   . LEU D 2 49  ? 49.963 10.351  47.397 1.00 51.62  ? 79  LEU D CA   1 
ATOM   7050 C C    . LEU D 2 49  ? 49.987 11.757  47.978 1.00 49.84  ? 79  LEU D C    1 
ATOM   7051 O O    . LEU D 2 49  ? 49.111 12.570  47.665 1.00 50.67  ? 79  LEU D O    1 
ATOM   7052 C CB   . LEU D 2 49  ? 49.202 9.406   48.322 1.00 52.23  ? 79  LEU D CB   1 
ATOM   7053 C CG   . LEU D 2 49  ? 48.868 8.047   47.708 1.00 53.26  ? 79  LEU D CG   1 
ATOM   7054 C CD1  . LEU D 2 49  ? 48.452 7.061   48.786 1.00 52.25  ? 79  LEU D CD1  1 
ATOM   7055 C CD2  . LEU D 2 49  ? 47.778 8.209   46.660 1.00 54.78  ? 79  LEU D CD2  1 
ATOM   7056 H H    . LEU D 2 49  ? 51.474 9.087   47.560 1.00 62.18  ? 79  LEU D H    1 
ATOM   7057 H HA   . LEU D 2 49  ? 49.494 10.384  46.549 1.00 61.95  ? 79  LEU D HA   1 
ATOM   7058 H HB2  . LEU D 2 49  ? 49.740 9.247   49.114 1.00 62.68  ? 79  LEU D HB2  1 
ATOM   7059 H HB3  . LEU D 2 49  ? 48.366 9.828   48.576 1.00 62.68  ? 79  LEU D HB3  1 
ATOM   7060 H HG   . LEU D 2 49  ? 49.658 7.695   47.268 1.00 63.92  ? 79  LEU D HG   1 
ATOM   7061 H HD11 . LEU D 2 49  ? 48.245 6.209   48.372 1.00 62.70  ? 79  LEU D HD11 1 
ATOM   7062 H HD12 . LEU D 2 49  ? 49.182 6.955   49.416 1.00 62.70  ? 79  LEU D HD12 1 
ATOM   7063 H HD13 . LEU D 2 49  ? 47.668 7.405   49.243 1.00 62.70  ? 79  LEU D HD13 1 
ATOM   7064 H HD21 . LEU D 2 49  ? 47.575 7.340   46.278 1.00 65.74  ? 79  LEU D HD21 1 
ATOM   7065 H HD22 . LEU D 2 49  ? 46.986 8.578   47.082 1.00 65.74  ? 79  LEU D HD22 1 
ATOM   7066 H HD23 . LEU D 2 49  ? 48.094 8.810   45.967 1.00 65.74  ? 79  LEU D HD23 1 
ATOM   7067 N N    . ALA D 2 50  ? 50.978 12.058  48.825 1.00 44.33  ? 80  ALA D N    1 
ATOM   7068 C CA   . ALA D 2 50  ? 51.107 13.398  49.390 1.00 42.04  ? 80  ALA D CA   1 
ATOM   7069 C C    . ALA D 2 50  ? 51.098 14.468  48.311 1.00 43.02  ? 80  ALA D C    1 
ATOM   7070 O O    . ALA D 2 50  ? 50.596 15.575  48.539 1.00 43.43  ? 80  ALA D O    1 
ATOM   7071 C CB   . ALA D 2 50  ? 52.391 13.499  50.213 1.00 40.18  ? 80  ALA D CB   1 
ATOM   7072 H H    . ALA D 2 50  ? 51.583 11.505  49.084 1.00 53.19  ? 80  ALA D H    1 
ATOM   7073 H HA   . ALA D 2 50  ? 50.357 13.564  49.982 1.00 50.45  ? 80  ALA D HA   1 
ATOM   7074 H HB1  . ALA D 2 50  ? 52.461 14.394  50.580 1.00 48.21  ? 80  ALA D HB1  1 
ATOM   7075 H HB2  . ALA D 2 50  ? 52.357 12.848  50.932 1.00 48.21  ? 80  ALA D HB2  1 
ATOM   7076 H HB3  . ALA D 2 50  ? 53.150 13.318  49.638 1.00 48.21  ? 80  ALA D HB3  1 
ATOM   7077 N N    . LEU D 2 51  ? 51.647 14.165  47.137 1.00 44.75  ? 81  LEU D N    1 
ATOM   7078 C CA   . LEU D 2 51  ? 51.651 15.086  46.009 1.00 47.43  ? 81  LEU D CA   1 
ATOM   7079 C C    . LEU D 2 51  ? 50.410 14.954  45.137 1.00 50.51  ? 81  LEU D C    1 
ATOM   7080 O O    . LEU D 2 51  ? 50.355 15.562  44.065 1.00 52.87  ? 81  LEU D O    1 
ATOM   7081 C CB   . LEU D 2 51  ? 52.900 14.864  45.150 1.00 47.29  ? 81  LEU D CB   1 
ATOM   7082 C CG   . LEU D 2 51  ? 54.255 14.996  45.855 1.00 45.27  ? 81  LEU D CG   1 
ATOM   7083 C CD1  . LEU D 2 51  ? 55.395 14.844  44.857 1.00 46.68  ? 81  LEU D CD1  1 
ATOM   7084 C CD2  . LEU D 2 51  ? 54.372 16.317  46.591 1.00 45.11  ? 81  LEU D CD2  1 
ATOM   7085 H H    . LEU D 2 51  ? 52.031 13.415  46.968 1.00 53.70  ? 81  LEU D H    1 
ATOM   7086 H HA   . LEU D 2 51  ? 51.681 15.994  46.347 1.00 56.92  ? 81  LEU D HA   1 
ATOM   7087 H HB2  . LEU D 2 51  ? 52.856 13.969  44.779 1.00 56.75  ? 81  LEU D HB2  1 
ATOM   7088 H HB3  . LEU D 2 51  ? 52.889 15.511  44.428 1.00 56.75  ? 81  LEU D HB3  1 
ATOM   7089 H HG   . LEU D 2 51  ? 54.338 14.284  46.509 1.00 54.33  ? 81  LEU D HG   1 
ATOM   7090 H HD11 . LEU D 2 51  ? 56.239 14.931  45.327 1.00 56.02  ? 81  LEU D HD11 1 
ATOM   7091 H HD12 . LEU D 2 51  ? 55.336 13.969  44.442 1.00 56.02  ? 81  LEU D HD12 1 
ATOM   7092 H HD13 . LEU D 2 51  ? 55.318 15.537  44.183 1.00 56.02  ? 81  LEU D HD13 1 
ATOM   7093 H HD21 . LEU D 2 51  ? 55.240 16.363  47.022 1.00 54.14  ? 81  LEU D HD21 1 
ATOM   7094 H HD22 . LEU D 2 51  ? 54.281 17.042  45.953 1.00 54.14  ? 81  LEU D HD22 1 
ATOM   7095 H HD23 . LEU D 2 51  ? 53.668 16.371  47.256 1.00 54.14  ? 81  LEU D HD23 1 
ATOM   7096 N N    . VAL D 2 52  ? 49.422 14.178  45.566 1.00 50.95  ? 82  VAL D N    1 
ATOM   7097 C CA   . VAL D 2 52  ? 48.187 13.971  44.822 1.00 53.68  ? 82  VAL D CA   1 
ATOM   7098 C C    . VAL D 2 52  ? 47.052 14.613  45.620 1.00 55.32  ? 82  VAL D C    1 
ATOM   7099 O O    . VAL D 2 52  ? 46.711 14.123  46.707 1.00 53.78  ? 82  VAL D O    1 
ATOM   7100 C CB   . VAL D 2 52  ? 47.926 12.479  44.580 1.00 53.45  ? 82  VAL D CB   1 
ATOM   7101 C CG1  . VAL D 2 52  ? 46.564 12.268  43.923 1.00 54.31  ? 82  VAL D CG1  1 
ATOM   7102 C CG2  . VAL D 2 52  ? 49.037 11.892  43.726 1.00 52.90  ? 82  VAL D CG2  1 
ATOM   7103 H H    . VAL D 2 52  ? 49.446 13.747  46.310 1.00 61.14  ? 82  VAL D H    1 
ATOM   7104 H HA   . VAL D 2 52  ? 48.248 14.416  43.962 1.00 64.42  ? 82  VAL D HA   1 
ATOM   7105 H HB   . VAL D 2 52  ? 47.924 12.015  45.432 1.00 64.14  ? 82  VAL D HB   1 
ATOM   7106 H HG11 . VAL D 2 52  ? 46.426 11.318  43.782 1.00 65.17  ? 82  VAL D HG11 1 
ATOM   7107 H HG12 . VAL D 2 52  ? 45.874 12.621  44.506 1.00 65.17  ? 82  VAL D HG12 1 
ATOM   7108 H HG13 . VAL D 2 52  ? 46.549 12.735  43.072 1.00 65.17  ? 82  VAL D HG13 1 
ATOM   7109 H HG21 . VAL D 2 52  ? 48.860 10.949  43.581 1.00 63.48  ? 82  VAL D HG21 1 
ATOM   7110 H HG22 . VAL D 2 52  ? 49.062 12.359  42.876 1.00 63.48  ? 82  VAL D HG22 1 
ATOM   7111 H HG23 . VAL D 2 52  ? 49.883 12.003  44.189 1.00 63.48  ? 82  VAL D HG23 1 
ATOM   7112 N N    . PRO D 2 53  ? 46.453 15.707  45.148 1.00 62.64  ? 83  PRO D N    1 
ATOM   7113 C CA   . PRO D 2 53  ? 45.325 16.293  45.882 1.00 65.61  ? 83  PRO D CA   1 
ATOM   7114 C C    . PRO D 2 53  ? 44.193 15.293  46.065 1.00 64.99  ? 83  PRO D C    1 
ATOM   7115 O O    . PRO D 2 53  ? 44.013 14.370  45.268 1.00 65.76  ? 83  PRO D O    1 
ATOM   7116 C CB   . PRO D 2 53  ? 44.897 17.468  44.995 1.00 69.21  ? 83  PRO D CB   1 
ATOM   7117 C CG   . PRO D 2 53  ? 46.131 17.833  44.238 1.00 69.97  ? 83  PRO D CG   1 
ATOM   7118 C CD   . PRO D 2 53  ? 46.852 16.539  44.000 1.00 66.62  ? 83  PRO D CD   1 
ATOM   7119 H HA   . PRO D 2 53  ? 45.613 16.625  46.746 1.00 78.73  ? 83  PRO D HA   1 
ATOM   7120 H HB2  . PRO D 2 53  ? 44.193 17.184  44.391 1.00 83.05  ? 83  PRO D HB2  1 
ATOM   7121 H HB3  . PRO D 2 53  ? 44.600 18.207  45.549 1.00 83.05  ? 83  PRO D HB3  1 
ATOM   7122 H HG2  . PRO D 2 53  ? 45.886 18.248  43.396 1.00 83.96  ? 83  PRO D HG2  1 
ATOM   7123 H HG3  . PRO D 2 53  ? 46.674 18.434  44.771 1.00 83.96  ? 83  PRO D HG3  1 
ATOM   7124 H HD2  . PRO D 2 53  ? 46.556 16.135  43.170 1.00 79.94  ? 83  PRO D HD2  1 
ATOM   7125 H HD3  . PRO D 2 53  ? 47.812 16.682  44.004 1.00 79.94  ? 83  PRO D HD3  1 
ATOM   7126 N N    . PHE D 2 54  ? 43.435 15.479  47.141 1.00 61.66  ? 84  PHE D N    1 
ATOM   7127 C CA   . PHE D 2 54  ? 42.303 14.607  47.418 1.00 60.84  ? 84  PHE D CA   1 
ATOM   7128 C C    . PHE D 2 54  ? 41.276 14.687  46.300 1.00 61.04  ? 84  PHE D C    1 
ATOM   7129 O O    . PHE D 2 54  ? 40.851 15.776  45.908 1.00 62.79  ? 84  PHE D O    1 
ATOM   7130 C CB   . PHE D 2 54  ? 41.631 14.997  48.737 1.00 61.65  ? 84  PHE D CB   1 
ATOM   7131 C CG   . PHE D 2 54  ? 42.369 14.555  49.965 1.00 60.17  ? 84  PHE D CG   1 
ATOM   7132 C CD1  . PHE D 2 54  ? 43.613 13.951  49.880 1.00 58.89  ? 84  PHE D CD1  1 
ATOM   7133 C CD2  . PHE D 2 54  ? 41.807 14.747  51.216 1.00 60.61  ? 84  PHE D CD2  1 
ATOM   7134 C CE1  . PHE D 2 54  ? 44.280 13.558  51.017 1.00 58.01  ? 84  PHE D CE1  1 
ATOM   7135 C CE2  . PHE D 2 54  ? 42.469 14.348  52.356 1.00 60.05  ? 84  PHE D CE2  1 
ATOM   7136 C CZ   . PHE D 2 54  ? 43.709 13.753  52.257 1.00 57.95  ? 84  PHE D CZ   1 
ATOM   7137 H H    . PHE D 2 54  ? 43.555 16.101  47.723 1.00 73.99  ? 84  PHE D H    1 
ATOM   7138 H HA   . PHE D 2 54  ? 42.610 13.690  47.489 1.00 73.00  ? 84  PHE D HA   1 
ATOM   7139 H HB2  . PHE D 2 54  ? 41.554 15.963  48.772 1.00 73.99  ? 84  PHE D HB2  1 
ATOM   7140 H HB3  . PHE D 2 54  ? 40.748 14.597  48.765 1.00 73.99  ? 84  PHE D HB3  1 
ATOM   7141 H HD1  . PHE D 2 54  ? 44.004 13.819  49.047 1.00 70.66  ? 84  PHE D HD1  1 
ATOM   7142 H HD2  . PHE D 2 54  ? 40.972 15.149  51.288 1.00 72.73  ? 84  PHE D HD2  1 
ATOM   7143 H HE1  . PHE D 2 54  ? 45.114 13.153  50.948 1.00 69.61  ? 84  PHE D HE1  1 
ATOM   7144 H HE2  . PHE D 2 54  ? 42.083 14.483  53.191 1.00 72.06  ? 84  PHE D HE2  1 
ATOM   7145 H HZ   . PHE D 2 54  ? 44.159 13.483  53.025 1.00 69.54  ? 84  PHE D HZ   1 
ATOM   7146 N N    . THR D 2 55  ? 40.863 13.527  45.803 1.00 58.26  ? 85  THR D N    1 
ATOM   7147 C CA   . THR D 2 55  ? 39.679 13.466  44.969 1.00 59.93  ? 85  THR D CA   1 
ATOM   7148 C C    . THR D 2 55  ? 38.432 13.691  45.825 1.00 61.38  ? 85  THR D C    1 
ATOM   7149 O O    . THR D 2 55  ? 38.474 13.645  47.059 1.00 59.13  ? 85  THR D O    1 
ATOM   7150 C CB   . THR D 2 55  ? 39.585 12.118  44.262 1.00 59.36  ? 85  THR D CB   1 
ATOM   7151 O OG1  . THR D 2 55  ? 39.399 11.081  45.235 1.00 57.37  ? 85  THR D OG1  1 
ATOM   7152 C CG2  . THR D 2 55  ? 40.854 11.845  43.461 1.00 58.43  ? 85  THR D CG2  1 
ATOM   7153 H H    . THR D 2 55  ? 41.249 12.769  45.934 1.00 69.91  ? 85  THR D H    1 
ATOM   7154 H HA   . THR D 2 55  ? 39.720 14.164  44.296 1.00 71.92  ? 85  THR D HA   1 
ATOM   7155 H HB   . THR D 2 55  ? 38.832 12.125  43.650 1.00 71.23  ? 85  THR D HB   1 
ATOM   7156 H HG1  . THR D 2 55  ? 39.346 10.335  44.853 1.00 68.85  ? 85  THR D HG1  1 
ATOM   7157 H HG21 . THR D 2 55  ? 40.786 10.986  43.015 1.00 70.11  ? 85  THR D HG21 1 
ATOM   7158 H HG22 . THR D 2 55  ? 40.980 12.537  42.794 1.00 70.11  ? 85  THR D HG22 1 
ATOM   7159 H HG23 . THR D 2 55  ? 41.623 11.833  44.052 1.00 70.11  ? 85  THR D HG23 1 
ATOM   7160 N N    . GLU D 2 56  ? 37.305 13.945  45.153 1.00 67.47  ? 86  GLU D N    1 
ATOM   7161 C CA   . GLU D 2 56  ? 36.039 14.053  45.870 1.00 71.35  ? 86  GLU D CA   1 
ATOM   7162 C C    . GLU D 2 56  ? 35.785 12.809  46.714 1.00 70.34  ? 86  GLU D C    1 
ATOM   7163 O O    . GLU D 2 56  ? 35.309 12.905  47.850 1.00 70.25  ? 86  GLU D O    1 
ATOM   7164 C CB   . GLU D 2 56  ? 34.893 14.282  44.885 1.00 76.57  ? 86  GLU D CB   1 
ATOM   7165 C CG   . GLU D 2 56  ? 34.835 15.689  44.321 1.00 80.67  ? 86  GLU D CG   1 
ATOM   7166 C CD   . GLU D 2 56  ? 33.600 15.931  43.469 1.00 86.00  ? 86  GLU D CD   1 
ATOM   7167 O OE1  . GLU D 2 56  ? 33.181 15.007  42.738 1.00 87.06  ? 86  GLU D OE1  1 
ATOM   7168 O OE2  . GLU D 2 56  ? 33.042 17.047  43.534 1.00 88.78  ? 86  GLU D OE2  1 
ATOM   7169 H H    . GLU D 2 56  ? 37.250 14.056  44.302 1.00 80.97  ? 86  GLU D H    1 
ATOM   7170 H HA   . GLU D 2 56  ? 36.078 14.817  46.467 1.00 85.62  ? 86  GLU D HA   1 
ATOM   7171 H HB2  . GLU D 2 56  ? 34.995 13.668  44.140 1.00 91.88  ? 86  GLU D HB2  1 
ATOM   7172 H HB3  . GLU D 2 56  ? 34.052 14.110  45.338 1.00 91.88  ? 86  GLU D HB3  1 
ATOM   7173 H HG2  . GLU D 2 56  ? 34.822 16.323  45.055 1.00 96.80  ? 86  GLU D HG2  1 
ATOM   7174 H HG3  . GLU D 2 56  ? 35.617 15.839  43.767 1.00 96.80  ? 86  GLU D HG3  1 
ATOM   7175 N N    . GLU D 2 57  ? 36.099 11.629  46.173 1.00 73.24  ? 87  GLU D N    1 
ATOM   7176 C CA   . GLU D 2 57  ? 36.018 10.399  46.953 1.00 74.81  ? 87  GLU D CA   1 
ATOM   7177 C C    . GLU D 2 57  ? 36.836 10.512  48.237 1.00 69.62  ? 87  GLU D C    1 
ATOM   7178 O O    . GLU D 2 57  ? 36.302 10.419  49.348 1.00 68.71  ? 87  GLU D O    1 
ATOM   7179 C CB   . GLU D 2 57  ? 36.512 9.220   46.111 1.00 78.62  ? 87  GLU D CB   1 
ATOM   7180 C CG   . GLU D 2 57  ? 35.602 8.833   44.952 1.00 86.56  ? 87  GLU D CG   1 
ATOM   7181 C CD   . GLU D 2 57  ? 34.770 7.591   45.234 1.00 90.50  ? 87  GLU D CD   1 
ATOM   7182 O OE1  . GLU D 2 57  ? 34.924 6.995   46.322 1.00 89.48  ? 87  GLU D OE1  1 
ATOM   7183 O OE2  . GLU D 2 57  ? 33.962 7.212   44.360 1.00 93.53  ? 87  GLU D OE2  1 
ATOM   7184 H H    . GLU D 2 57  ? 36.359 11.517  45.361 1.00 87.89  ? 87  GLU D H    1 
ATOM   7185 H HA   . GLU D 2 57  ? 35.094 10.233  47.196 1.00 89.78  ? 87  GLU D HA   1 
ATOM   7186 H HB2  . GLU D 2 57  ? 37.379 9.447   45.739 1.00 94.34  ? 87  GLU D HB2  1 
ATOM   7187 H HB3  . GLU D 2 57  ? 36.598 8.444   46.687 1.00 94.34  ? 87  GLU D HB3  1 
ATOM   7188 H HG2  . GLU D 2 57  ? 34.992 9.566   44.773 1.00 103.88 ? 87  GLU D HG2  1 
ATOM   7189 H HG3  . GLU D 2 57  ? 36.146 8.657   44.169 1.00 103.88 ? 87  GLU D HG3  1 
ATOM   7190 N N    . GLU D 2 58  ? 38.149 10.711  48.094 1.00 61.13  ? 88  GLU D N    1 
ATOM   7191 C CA   . GLU D 2 58  ? 39.022 10.780  49.261 1.00 56.54  ? 88  GLU D CA   1 
ATOM   7192 C C    . GLU D 2 58  ? 38.627 11.932  50.175 1.00 54.98  ? 88  GLU D C    1 
ATOM   7193 O O    . GLU D 2 58  ? 38.561 11.769  51.399 1.00 52.86  ? 88  GLU D O    1 
ATOM   7194 C CB   . GLU D 2 58  ? 40.479 10.912  48.811 1.00 54.83  ? 88  GLU D CB   1 
ATOM   7195 C CG   . GLU D 2 58  ? 40.972 9.717   48.004 1.00 53.75  ? 88  GLU D CG   1 
ATOM   7196 C CD   . GLU D 2 58  ? 42.356 9.915   47.419 1.00 53.37  ? 88  GLU D CD   1 
ATOM   7197 O OE1  . GLU D 2 58  ? 42.732 11.065  47.127 1.00 53.93  ? 88  GLU D OE1  1 
ATOM   7198 O OE2  . GLU D 2 58  ? 43.070 8.906   47.242 1.00 52.92  ? 88  GLU D OE2  1 
ATOM   7199 H H    . GLU D 2 58  ? 38.552 10.807  47.340 1.00 73.35  ? 88  GLU D H    1 
ATOM   7200 H HA   . GLU D 2 58  ? 38.938 9.956   49.765 1.00 67.85  ? 88  GLU D HA   1 
ATOM   7201 H HB2  . GLU D 2 58  ? 40.566 11.703  48.256 1.00 65.79  ? 88  GLU D HB2  1 
ATOM   7202 H HB3  . GLU D 2 58  ? 41.043 10.995  49.596 1.00 65.79  ? 88  GLU D HB3  1 
ATOM   7203 H HG2  . GLU D 2 58  ? 41.002 8.938   48.583 1.00 64.50  ? 88  GLU D HG2  1 
ATOM   7204 H HG3  . GLU D 2 58  ? 40.358 9.559   47.270 1.00 64.50  ? 88  GLU D HG3  1 
ATOM   7205 N N    . GLN D 2 59  ? 38.340 13.100  49.602 1.00 54.08  ? 89  GLN D N    1 
ATOM   7206 C CA   . GLN D 2 59  ? 37.938 14.245  50.416 1.00 56.11  ? 89  GLN D CA   1 
ATOM   7207 C C    . GLN D 2 59  ? 36.779 13.887  51.338 1.00 55.64  ? 89  GLN D C    1 
ATOM   7208 O O    . GLN D 2 59  ? 36.787 14.231  52.524 1.00 55.01  ? 89  GLN D O    1 
ATOM   7209 C CB   . GLN D 2 59  ? 37.563 15.418  49.507 1.00 61.06  ? 89  GLN D CB   1 
ATOM   7210 C CG   . GLN D 2 59  ? 37.358 16.731  50.228 1.00 64.76  ? 89  GLN D CG   1 
ATOM   7211 C CD   . GLN D 2 59  ? 37.140 17.875  49.265 1.00 68.85  ? 89  GLN D CD   1 
ATOM   7212 O OE1  . GLN D 2 59  ? 37.059 17.669  48.053 1.00 70.76  ? 89  GLN D OE1  1 
ATOM   7213 N NE2  . GLN D 2 59  ? 37.040 19.091  49.795 1.00 70.78  ? 89  GLN D NE2  1 
ATOM   7214 H H    . GLN D 2 59  ? 38.370 13.255  48.757 1.00 64.90  ? 89  GLN D H    1 
ATOM   7215 H HA   . GLN D 2 59  ? 38.687 14.520  50.967 1.00 67.33  ? 89  GLN D HA   1 
ATOM   7216 H HB2  . GLN D 2 59  ? 38.273 15.547  48.858 1.00 73.28  ? 89  GLN D HB2  1 
ATOM   7217 H HB3  . GLN D 2 59  ? 36.736 15.203  49.048 1.00 73.28  ? 89  GLN D HB3  1 
ATOM   7218 H HG2  . GLN D 2 59  ? 36.577 16.663  50.799 1.00 77.71  ? 89  GLN D HG2  1 
ATOM   7219 H HG3  . GLN D 2 59  ? 38.145 16.929  50.759 1.00 77.71  ? 89  GLN D HG3  1 
ATOM   7220 H HE21 . GLN D 2 59  ? 37.101 19.194  50.647 1.00 84.94  ? 89  GLN D HE21 1 
ATOM   7221 H HE22 . GLN D 2 59  ? 36.915 19.773  49.287 1.00 84.94  ? 89  GLN D HE22 1 
ATOM   7222 N N    . ARG D 2 60  ? 35.777 13.181  50.815 1.00 59.01  ? 90  ARG D N    1 
ATOM   7223 C CA   . ARG D 2 60  ? 34.652 12.761  51.646 1.00 60.36  ? 90  ARG D CA   1 
ATOM   7224 C C    . ARG D 2 60  ? 35.084 11.704  52.660 1.00 60.65  ? 90  ARG D C    1 
ATOM   7225 O O    . ARG D 2 60  ? 34.756 11.800  53.849 1.00 60.29  ? 90  ARG D O    1 
ATOM   7226 C CB   . ARG D 2 60  ? 33.524 12.235  50.755 1.00 61.39  ? 90  ARG D CB   1 
ATOM   7227 C CG   . ARG D 2 60  ? 32.332 11.674  51.518 1.00 61.17  ? 90  ARG D CG   1 
ATOM   7228 C CD   . ARG D 2 60  ? 31.224 11.199  50.589 1.00 62.96  ? 90  ARG D CD   1 
ATOM   7229 N NE   . ARG D 2 60  ? 31.655 10.120  49.700 1.00 59.71  ? 90  ARG D NE   1 
ATOM   7230 C CZ   . ARG D 2 60  ? 30.826 9.351   49.002 1.00 60.35  ? 90  ARG D CZ   1 
ATOM   7231 N NH1  . ARG D 2 60  ? 29.517 9.521   49.095 1.00 63.59  ? 90  ARG D NH1  1 
ATOM   7232 N NH2  . ARG D 2 60  ? 31.306 8.403   48.215 1.00 59.25  ? 90  ARG D NH2  1 
ATOM   7233 H H    . ARG D 2 60  ? 35.725 12.936  49.993 1.00 70.81  ? 90  ARG D H    1 
ATOM   7234 H HA   . ARG D 2 60  ? 34.316 13.527  52.136 1.00 72.43  ? 90  ARG D HA   1 
ATOM   7235 H HB2  . ARG D 2 60  ? 33.203 12.962  50.199 1.00 73.67  ? 90  ARG D HB2  1 
ATOM   7236 H HB3  . ARG D 2 60  ? 33.875 11.526  50.195 1.00 73.67  ? 90  ARG D HB3  1 
ATOM   7237 H HG2  . ARG D 2 60  ? 32.623 10.918  52.051 1.00 73.41  ? 90  ARG D HG2  1 
ATOM   7238 H HG3  . ARG D 2 60  ? 31.968 12.366  52.092 1.00 73.41  ? 90  ARG D HG3  1 
ATOM   7239 H HD2  . ARG D 2 60  ? 30.483 10.870  51.122 1.00 75.55  ? 90  ARG D HD2  1 
ATOM   7240 H HD3  . ARG D 2 60  ? 30.932 11.942  50.038 1.00 75.55  ? 90  ARG D HD3  1 
ATOM   7241 H HE   . ARG D 2 60  ? 32.499 9.974   49.624 1.00 71.65  ? 90  ARG D HE   1 
ATOM   7242 H HH11 . ARG D 2 60  ? 29.198 10.137  49.604 1.00 76.31  ? 90  ARG D HH11 1 
ATOM   7243 H HH12 . ARG D 2 60  ? 28.985 9.018   48.643 1.00 76.31  ? 90  ARG D HH12 1 
ATOM   7244 H HH21 . ARG D 2 60  ? 32.156 8.285   48.153 1.00 71.11  ? 90  ARG D HH21 1 
ATOM   7245 H HH22 . ARG D 2 60  ? 30.769 7.902   47.768 1.00 71.11  ? 90  ARG D HH22 1 
ATOM   7246 N N    . ASN D 2 61  ? 35.843 10.696  52.208 1.00 62.40  ? 91  ASN D N    1 
ATOM   7247 C CA   . ASN D 2 61  ? 36.218 9.587   53.083 1.00 64.22  ? 91  ASN D CA   1 
ATOM   7248 C C    . ASN D 2 61  ? 37.068 10.042  54.264 1.00 61.76  ? 91  ASN D C    1 
ATOM   7249 O O    . ASN D 2 61  ? 36.992 9.442   55.343 1.00 60.16  ? 91  ASN D O    1 
ATOM   7250 C CB   . ASN D 2 61  ? 36.972 8.521   52.290 1.00 66.35  ? 91  ASN D CB   1 
ATOM   7251 C CG   . ASN D 2 61  ? 36.074 7.750   51.345 1.00 72.02  ? 91  ASN D CG   1 
ATOM   7252 O OD1  . ASN D 2 61  ? 34.958 8.175   51.035 1.00 75.31  ? 91  ASN D OD1  1 
ATOM   7253 N ND2  . ASN D 2 61  ? 36.560 6.607   50.877 1.00 72.18  ? 91  ASN D ND2  1 
ATOM   7254 H H    . ASN D 2 61  ? 36.148 10.634  51.406 1.00 74.88  ? 91  ASN D H    1 
ATOM   7255 H HA   . ASN D 2 61  ? 35.412 9.180   53.437 1.00 77.06  ? 91  ASN D HA   1 
ATOM   7256 H HB2  . ASN D 2 61  ? 37.664 8.950   51.763 1.00 79.62  ? 91  ASN D HB2  1 
ATOM   7257 H HB3  . ASN D 2 61  ? 37.370 7.889   52.909 1.00 79.62  ? 91  ASN D HB3  1 
ATOM   7258 H HD21 . ASN D 2 61  ? 36.092 6.129   50.336 1.00 86.61  ? 91  ASN D HD21 1 
ATOM   7259 H HD22 . ASN D 2 61  ? 37.344 6.344   51.114 1.00 86.61  ? 91  ASN D HD22 1 
ATOM   7260 N N    . PHE D 2 62  ? 37.886 11.085  54.086 1.00 56.93  ? 92  PHE D N    1 
ATOM   7261 C CA   . PHE D 2 62  ? 38.801 11.527  55.132 1.00 56.30  ? 92  PHE D CA   1 
ATOM   7262 C C    . PHE D 2 62  ? 38.205 12.574  56.066 1.00 61.81  ? 92  PHE D C    1 
ATOM   7263 O O    . PHE D 2 62  ? 38.750 12.789  57.154 1.00 61.09  ? 92  PHE D O    1 
ATOM   7264 C CB   . PHE D 2 62  ? 40.090 12.097  54.510 1.00 52.48  ? 92  PHE D CB   1 
ATOM   7265 C CG   . PHE D 2 62  ? 41.080 11.039  54.069 1.00 48.72  ? 92  PHE D CG   1 
ATOM   7266 C CD1  . PHE D 2 62  ? 42.110 10.636  54.910 1.00 47.24  ? 92  PHE D CD1  1 
ATOM   7267 C CD2  . PHE D 2 62  ? 40.975 10.443  52.819 1.00 47.84  ? 92  PHE D CD2  1 
ATOM   7268 C CE1  . PHE D 2 62  ? 43.017 9.662   54.512 1.00 45.08  ? 92  PHE D CE1  1 
ATOM   7269 C CE2  . PHE D 2 62  ? 41.882 9.470   52.413 1.00 46.62  ? 92  PHE D CE2  1 
ATOM   7270 C CZ   . PHE D 2 62  ? 42.901 9.078   53.266 1.00 45.13  ? 92  PHE D CZ   1 
ATOM   7271 H H    . PHE D 2 62  ? 37.926 11.551  53.365 1.00 68.31  ? 92  PHE D H    1 
ATOM   7272 H HA   . PHE D 2 62  ? 39.049 10.760  55.671 1.00 67.56  ? 92  PHE D HA   1 
ATOM   7273 H HB2  . PHE D 2 62  ? 39.854 12.625  53.732 1.00 62.98  ? 92  PHE D HB2  1 
ATOM   7274 H HB3  . PHE D 2 62  ? 40.531 12.659  55.167 1.00 62.98  ? 92  PHE D HB3  1 
ATOM   7275 H HD1  . PHE D 2 62  ? 42.193 11.023  55.751 1.00 56.68  ? 92  PHE D HD1  1 
ATOM   7276 H HD2  . PHE D 2 62  ? 40.291 10.701  52.244 1.00 57.41  ? 92  PHE D HD2  1 
ATOM   7277 H HE1  . PHE D 2 62  ? 43.702 9.403   55.085 1.00 54.09  ? 92  PHE D HE1  1 
ATOM   7278 H HE2  . PHE D 2 62  ? 41.800 9.078   51.573 1.00 55.95  ? 92  PHE D HE2  1 
ATOM   7279 H HZ   . PHE D 2 62  ? 43.509 8.428   52.997 1.00 54.16  ? 92  PHE D HZ   1 
ATOM   7280 N N    . SER D 2 63  ? 37.107 13.225  55.689 1.00 71.07  ? 93  SER D N    1 
ATOM   7281 C CA   . SER D 2 63  ? 36.655 14.394  56.435 1.00 78.14  ? 93  SER D CA   1 
ATOM   7282 C C    . SER D 2 63  ? 35.734 14.046  57.597 1.00 81.45  ? 93  SER D C    1 
ATOM   7283 O O    . SER D 2 63  ? 35.872 14.619  58.683 1.00 82.59  ? 93  SER D O    1 
ATOM   7284 C CB   . SER D 2 63  ? 35.946 15.371  55.494 1.00 81.94  ? 93  SER D CB   1 
ATOM   7285 O OG   . SER D 2 63  ? 36.848 15.875  54.523 1.00 83.06  ? 93  SER D OG   1 
ATOM   7286 H H    . SER D 2 63  ? 36.614 13.013  55.016 1.00 85.29  ? 93  SER D H    1 
ATOM   7287 H HA   . SER D 2 63  ? 37.430 14.847  56.800 1.00 93.77  ? 93  SER D HA   1 
ATOM   7288 H HB2  . SER D 2 63  ? 35.222 14.908  55.044 1.00 98.32  ? 93  SER D HB2  1 
ATOM   7289 H HB3  . SER D 2 63  ? 35.595 16.112  56.013 1.00 98.32  ? 93  SER D HB3  1 
ATOM   7290 H HG   . SER D 2 63  ? 37.161 15.242  54.066 1.00 99.68  ? 93  SER D HG   1 
ATOM   7291 N N    . MET D 2 64  ? 34.791 13.129  57.396 1.00 81.99  ? 94  MET D N    1 
ATOM   7292 C CA   . MET D 2 64  ? 33.781 12.856  58.410 1.00 85.17  ? 94  MET D CA   1 
ATOM   7293 C C    . MET D 2 64  ? 34.347 11.964  59.510 1.00 82.08  ? 94  MET D C    1 
ATOM   7294 O O    . MET D 2 64  ? 34.693 12.450  60.592 1.00 83.35  ? 94  MET D O    1 
ATOM   7295 C CB   . MET D 2 64  ? 32.545 12.213  57.772 1.00 90.94  ? 94  MET D CB   1 
ATOM   7296 C CG   . MET D 2 64  ? 31.323 12.148  58.686 1.00 95.33  ? 94  MET D CG   1 
ATOM   7297 S SD   . MET D 2 64  ? 30.428 13.713  58.792 1.00 102.05 ? 94  MET D SD   1 
ATOM   7298 C CE   . MET D 2 64  ? 29.149 13.312  59.984 1.00 105.62 ? 94  MET D CE   1 
ATOM   7299 H H    . MET D 2 64  ? 34.716 12.653  56.683 1.00 98.39  ? 94  MET D H    1 
ATOM   7300 H HA   . MET D 2 64  ? 33.504 13.697  58.806 1.00 102.20 ? 94  MET D HA   1 
ATOM   7301 H HB2  . MET D 2 64  ? 32.299 12.727  56.987 1.00 109.13 ? 94  MET D HB2  1 
ATOM   7302 H HB3  . MET D 2 64  ? 32.767 11.305  57.512 1.00 109.13 ? 94  MET D HB3  1 
ATOM   7303 H HG2  . MET D 2 64  ? 30.711 11.477  58.345 1.00 114.40 ? 94  MET D HG2  1 
ATOM   7304 H HG3  . MET D 2 64  ? 31.612 11.908  59.580 1.00 114.40 ? 94  MET D HG3  1 
ATOM   7305 H HE1  . MET D 2 64  ? 28.592 14.094  60.125 1.00 126.74 ? 94  MET D HE1  1 
ATOM   7306 H HE2  . MET D 2 64  ? 28.612 12.582  59.637 1.00 126.74 ? 94  MET D HE2  1 
ATOM   7307 H HE3  . MET D 2 64  ? 29.567 13.047  60.818 1.00 126.74 ? 94  MET D HE3  1 
ATOM   7308 N N    . SER D 2 65  ? 34.450 10.662  59.249 1.00 83.20  ? 95  SER D N    1 
ATOM   7309 C CA   . SER D 2 65  ? 34.931 9.715   60.242 1.00 82.49  ? 95  SER D CA   1 
ATOM   7310 C C    . SER D 2 65  ? 35.737 8.633   59.545 1.00 78.55  ? 95  SER D C    1 
ATOM   7311 O O    . SER D 2 65  ? 35.469 8.286   58.391 1.00 80.12  ? 95  SER D O    1 
ATOM   7312 C CB   . SER D 2 65  ? 33.782 9.084   61.028 1.00 86.39  ? 95  SER D CB   1 
ATOM   7313 O OG   . SER D 2 65  ? 34.282 8.177   61.993 1.00 87.40  ? 95  SER D OG   1 
ATOM   7314 H H    . SER D 2 65  ? 34.245 10.302  58.495 1.00 99.84  ? 95  SER D H    1 
ATOM   7315 H HA   . SER D 2 65  ? 35.513 10.174  60.868 1.00 98.99  ? 95  SER D HA   1 
ATOM   7316 H HB2  . SER D 2 65  ? 33.285 9.784   61.479 1.00 103.67 ? 95  SER D HB2  1 
ATOM   7317 H HB3  . SER D 2 65  ? 33.203 8.606   60.414 1.00 103.67 ? 95  SER D HB3  1 
ATOM   7318 H HG   . SER D 2 65  ? 33.646 7.834   62.421 1.00 104.88 ? 95  SER D HG   1 
ATOM   7319 N N    . VAL D 2 66  ? 36.716 8.087   60.266 1.00 73.77  ? 96  VAL D N    1 
ATOM   7320 C CA   . VAL D 2 66  ? 37.703 7.199   59.656 1.00 68.07  ? 96  VAL D CA   1 
ATOM   7321 C C    . VAL D 2 66  ? 37.646 5.804   60.264 1.00 65.48  ? 96  VAL D C    1 
ATOM   7322 O O    . VAL D 2 66  ? 38.018 4.823   59.613 1.00 63.08  ? 96  VAL D O    1 
ATOM   7323 C CB   . VAL D 2 66  ? 39.124 7.781   59.784 1.00 64.97  ? 96  VAL D CB   1 
ATOM   7324 C CG1  . VAL D 2 66  ? 39.208 9.124   59.075 1.00 65.41  ? 96  VAL D CG1  1 
ATOM   7325 C CG2  . VAL D 2 66  ? 39.534 7.907   61.247 1.00 66.58  ? 96  VAL D CG2  1 
ATOM   7326 H H    . VAL D 2 66  ? 36.831 8.215   61.109 1.00 88.52  ? 96  VAL D H    1 
ATOM   7327 H HA   . VAL D 2 66  ? 37.502 7.117   58.710 1.00 81.68  ? 96  VAL D HA   1 
ATOM   7328 H HB   . VAL D 2 66  ? 39.749 7.177   59.352 1.00 77.96  ? 96  VAL D HB   1 
ATOM   7329 H HG11 . VAL D 2 66  ? 40.108 9.474   59.166 1.00 78.50  ? 96  VAL D HG11 1 
ATOM   7330 H HG12 . VAL D 2 66  ? 38.994 8.999   58.137 1.00 78.50  ? 96  VAL D HG12 1 
ATOM   7331 H HG13 . VAL D 2 66  ? 38.573 9.735   59.480 1.00 78.50  ? 96  VAL D HG13 1 
ATOM   7332 H HG21 . VAL D 2 66  ? 40.430 8.275   61.293 1.00 79.90  ? 96  VAL D HG21 1 
ATOM   7333 H HG22 . VAL D 2 66  ? 38.910 8.497   61.699 1.00 79.90  ? 96  VAL D HG22 1 
ATOM   7334 H HG23 . VAL D 2 66  ? 39.515 7.028   61.657 1.00 79.90  ? 96  VAL D HG23 1 
ATOM   7335 N N    . ASN D 2 67  ? 37.210 5.702   61.514 1.00 63.55  ? 97  ASN D N    1 
ATOM   7336 C CA   . ASN D 2 67  ? 37.181 4.405   62.174 1.00 63.33  ? 97  ASN D CA   1 
ATOM   7337 C C    . ASN D 2 67  ? 36.237 3.455   61.450 1.00 60.62  ? 97  ASN D C    1 
ATOM   7338 O O    . ASN D 2 67  ? 35.211 3.861   60.900 1.00 60.74  ? 97  ASN D O    1 
ATOM   7339 C CB   . ASN D 2 67  ? 36.754 4.554   63.632 1.00 67.77  ? 97  ASN D CB   1 
ATOM   7340 C CG   . ASN D 2 67  ? 37.887 5.017   64.519 1.00 68.59  ? 97  ASN D CG   1 
ATOM   7341 O OD1  . ASN D 2 67  ? 37.797 6.054   65.169 1.00 71.25  ? 97  ASN D OD1  1 
ATOM   7342 N ND2  . ASN D 2 67  ? 38.965 4.248   64.545 1.00 68.56  ? 97  ASN D ND2  1 
ATOM   7343 H H    . ASN D 2 67  ? 36.931 6.358   61.996 1.00 76.26  ? 97  ASN D H    1 
ATOM   7344 H HA   . ASN D 2 67  ? 38.070 4.019   62.157 1.00 75.99  ? 97  ASN D HA   1 
ATOM   7345 H HB2  . ASN D 2 67  ? 36.040 5.208   63.689 1.00 81.32  ? 97  ASN D HB2  1 
ATOM   7346 H HB3  . ASN D 2 67  ? 36.446 3.695   63.962 1.00 81.32  ? 97  ASN D HB3  1 
ATOM   7347 H HD21 . ASN D 2 67  ? 39.638 4.468   65.034 1.00 82.27  ? 97  ASN D HD21 1 
ATOM   7348 H HD22 . ASN D 2 67  ? 38.993 3.530   64.074 1.00 82.27  ? 97  ASN D HD22 1 
ATOM   7349 N N    . SER D 2 68  ? 36.607 2.178   61.446 1.00 60.00  ? 98  SER D N    1 
ATOM   7350 C CA   . SER D 2 68  ? 35.791 1.148   60.826 1.00 60.75  ? 98  SER D CA   1 
ATOM   7351 C C    . SER D 2 68  ? 34.562 0.855   61.678 1.00 66.48  ? 98  SER D C    1 
ATOM   7352 O O    . SER D 2 68  ? 34.524 1.129   62.881 1.00 69.05  ? 98  SER D O    1 
ATOM   7353 C CB   . SER D 2 68  ? 36.597 -0.137  60.643 1.00 59.44  ? 98  SER D CB   1 
ATOM   7354 O OG   . SER D 2 68  ? 36.966 -0.668  61.902 1.00 60.22  ? 98  SER D OG   1 
ATOM   7355 H H    . SER D 2 68  ? 37.333 1.882   61.800 1.00 72.00  ? 98  SER D H    1 
ATOM   7356 H HA   . SER D 2 68  ? 35.495 1.452   59.953 1.00 72.90  ? 98  SER D HA   1 
ATOM   7357 H HB2  . SER D 2 68  ? 36.055 -0.787  60.171 1.00 71.33  ? 98  SER D HB2  1 
ATOM   7358 H HB3  . SER D 2 68  ? 37.399 0.061   60.135 1.00 71.33  ? 98  SER D HB3  1 
ATOM   7359 H HG   . SER D 2 68  ? 37.409 -1.374  61.797 1.00 72.26  ? 98  SER D HG   1 
ATOM   7360 N N    . ALA D 2 69  ? 33.548 0.272   61.035 1.00 78.16  ? 99  ALA D N    1 
ATOM   7361 C CA   . ALA D 2 69  ? 32.325 -0.073  61.751 1.00 86.21  ? 99  ALA D CA   1 
ATOM   7362 C C    . ALA D 2 69  ? 32.588 -1.103  62.839 1.00 90.34  ? 99  ALA D C    1 
ATOM   7363 O O    . ALA D 2 69  ? 31.920 -1.092  63.881 1.00 93.31  ? 99  ALA D O    1 
ATOM   7364 C CB   . ALA D 2 69  ? 31.278 -0.597  60.771 1.00 88.13  ? 99  ALA D CB   1 
ATOM   7365 H H    . ALA D 2 69  ? 33.544 0.069   60.199 1.00 93.80  ? 99  ALA D H    1 
ATOM   7366 H HA   . ALA D 2 69  ? 31.970 0.725   62.172 1.00 103.45 ? 99  ALA D HA   1 
ATOM   7367 H HB1  . ALA D 2 69  ? 30.471 -0.821  61.261 1.00 105.75 ? 99  ALA D HB1  1 
ATOM   7368 H HB2  . ALA D 2 69  ? 31.086 0.092   60.116 1.00 105.75 ? 99  ALA D HB2  1 
ATOM   7369 H HB3  . ALA D 2 69  ? 31.627 -1.386  60.328 1.00 105.75 ? 99  ALA D HB3  1 
ATOM   7370 N N    . ALA D 2 70  ? 33.557 -1.994  62.620 1.00 82.39  ? 100 ALA D N    1 
ATOM   7371 C CA   . ALA D 2 70  ? 33.840 -3.046  63.588 1.00 83.72  ? 100 ALA D CA   1 
ATOM   7372 C C    . ALA D 2 70  ? 34.238 -2.457  64.935 1.00 85.11  ? 100 ALA D C    1 
ATOM   7373 O O    . ALA D 2 70  ? 33.601 -2.726  65.960 1.00 88.79  ? 100 ALA D O    1 
ATOM   7374 C CB   . ALA D 2 70  ? 34.939 -3.962  63.050 1.00 81.45  ? 100 ALA D CB   1 
ATOM   7375 H H    . ALA D 2 70  ? 34.060 -2.009  61.922 1.00 98.87  ? 100 ALA D H    1 
ATOM   7376 H HA   . ALA D 2 70  ? 33.041 -3.580  63.718 1.00 100.47 ? 100 ALA D HA   1 
ATOM   7377 H HB1  . ALA D 2 70  ? 35.118 -4.657  63.703 1.00 97.74  ? 100 ALA D HB1  1 
ATOM   7378 H HB2  . ALA D 2 70  ? 34.640 -4.359  62.217 1.00 97.74  ? 100 ALA D HB2  1 
ATOM   7379 H HB3  . ALA D 2 70  ? 35.740 -3.437  62.898 1.00 97.74  ? 100 ALA D HB3  1 
ATOM   7380 N N    . VAL D 2 71  ? 35.292 -1.635  64.950 1.00 85.83  ? 101 VAL D N    1 
ATOM   7381 C CA   . VAL D 2 71  ? 35.785 -1.070  66.202 1.00 87.05  ? 101 VAL D CA   1 
ATOM   7382 C C    . VAL D 2 71  ? 34.748 -0.162  66.853 1.00 89.26  ? 101 VAL D C    1 
ATOM   7383 O O    . VAL D 2 71  ? 34.814 0.086   68.062 1.00 91.13  ? 101 VAL D O    1 
ATOM   7384 C CB   . VAL D 2 71  ? 37.117 -0.319  65.958 1.00 84.09  ? 101 VAL D CB   1 
ATOM   7385 C CG1  . VAL D 2 71  ? 36.899 0.939   65.115 1.00 83.68  ? 101 VAL D CG1  1 
ATOM   7386 C CG2  . VAL D 2 71  ? 37.798 0.021   67.280 1.00 87.66  ? 101 VAL D CG2  1 
ATOM   7387 H H    . VAL D 2 71  ? 35.734 -1.393  64.253 1.00 102.99 ? 101 VAL D H    1 
ATOM   7388 H HA   . VAL D 2 71  ? 35.966 -1.796  66.819 1.00 104.47 ? 101 VAL D HA   1 
ATOM   7389 H HB   . VAL D 2 71  ? 37.713 -0.903  65.464 1.00 100.90 ? 101 VAL D HB   1 
ATOM   7390 H HG11 . VAL D 2 71  ? 37.752 1.381   64.983 1.00 100.41 ? 101 VAL D HG11 1 
ATOM   7391 H HG12 . VAL D 2 71  ? 36.522 0.683   64.258 1.00 100.41 ? 101 VAL D HG12 1 
ATOM   7392 H HG13 . VAL D 2 71  ? 36.288 1.529   65.582 1.00 100.41 ? 101 VAL D HG13 1 
ATOM   7393 H HG21 . VAL D 2 71  ? 38.627 0.489   67.097 1.00 105.20 ? 101 VAL D HG21 1 
ATOM   7394 H HG22 . VAL D 2 71  ? 37.207 0.585   67.803 1.00 105.20 ? 101 VAL D HG22 1 
ATOM   7395 H HG23 . VAL D 2 71  ? 37.981 -0.802  67.761 1.00 105.20 ? 101 VAL D HG23 1 
ATOM   7396 N N    . LEU D 2 72  ? 33.777 0.327   66.085 1.00 87.87  ? 102 LEU D N    1 
ATOM   7397 C CA   . LEU D 2 72  ? 32.774 1.249   66.601 1.00 89.96  ? 102 LEU D CA   1 
ATOM   7398 C C    . LEU D 2 72  ? 31.611 0.546   67.303 1.00 96.37  ? 102 LEU D C    1 
ATOM   7399 O O    . LEU D 2 72  ? 30.580 1.186   67.546 1.00 99.22  ? 102 LEU D O    1 
ATOM   7400 C CB   . LEU D 2 72  ? 32.242 2.126   65.462 1.00 86.08  ? 102 LEU D CB   1 
ATOM   7401 C CG   . LEU D 2 72  ? 33.236 3.109   64.838 1.00 79.19  ? 102 LEU D CG   1 
ATOM   7402 C CD1  . LEU D 2 72  ? 32.663 3.709   63.563 1.00 77.95  ? 102 LEU D CD1  1 
ATOM   7403 C CD2  . LEU D 2 72  ? 33.608 4.209   65.822 1.00 80.09  ? 102 LEU D CD2  1 
ATOM   7404 H H    . LEU D 2 72  ? 33.678 0.137   65.252 1.00 105.44 ? 102 LEU D H    1 
ATOM   7405 H HA   . LEU D 2 72  ? 33.196 1.834   67.250 1.00 107.95 ? 102 LEU D HA   1 
ATOM   7406 H HB2  . LEU D 2 72  ? 31.929 1.543   64.752 1.00 103.29 ? 102 LEU D HB2  1 
ATOM   7407 H HB3  . LEU D 2 72  ? 31.497 2.646   65.802 1.00 103.29 ? 102 LEU D HB3  1 
ATOM   7408 H HG   . LEU D 2 72  ? 34.047 2.630   64.604 1.00 95.03  ? 102 LEU D HG   1 
ATOM   7409 H HD11 . LEU D 2 72  ? 33.310 4.326   63.187 1.00 93.54  ? 102 LEU D HD11 1 
ATOM   7410 H HD12 . LEU D 2 72  ? 32.482 2.994   62.932 1.00 93.54  ? 102 LEU D HD12 1 
ATOM   7411 H HD13 . LEU D 2 72  ? 31.842 4.178   63.777 1.00 93.54  ? 102 LEU D HD13 1 
ATOM   7412 H HD21 . LEU D 2 72  ? 34.238 4.813   65.397 1.00 96.11  ? 102 LEU D HD21 1 
ATOM   7413 H HD22 . LEU D 2 72  ? 32.805 4.691   66.074 1.00 96.11  ? 102 LEU D HD22 1 
ATOM   7414 H HD23 . LEU D 2 72  ? 34.013 3.806   66.606 1.00 96.11  ? 102 LEU D HD23 1 
ATOM   7415 N N    . ARG D 2 73  ? 31.744 -0.734  67.641 1.00 100.89 ? 103 ARG D N    1 
ATOM   7416 C CA   . ARG D 2 73  ? 30.699 -1.433  68.384 1.00 107.98 ? 103 ARG D CA   1 
ATOM   7417 C C    . ARG D 2 73  ? 30.829 -1.153  69.879 1.00 111.49 ? 103 ARG D C    1 
ATOM   7418 O O    . ARG D 2 73  ? 31.935 -0.995  70.398 1.00 111.11 ? 103 ARG D O    1 
ATOM   7419 C CB   . ARG D 2 73  ? 30.758 -2.940  68.128 1.00 110.07 ? 103 ARG D CB   1 
ATOM   7420 C CG   . ARG D 2 73  ? 30.481 -3.345  66.688 1.00 109.00 ? 103 ARG D CG   1 
ATOM   7421 C CD   . ARG D 2 73  ? 30.284 -4.853  66.560 1.00 110.71 ? 103 ARG D CD   1 
ATOM   7422 N NE   . ARG D 2 73  ? 30.411 -5.304  65.175 1.00 107.55 ? 103 ARG D NE   1 
ATOM   7423 C CZ   . ARG D 2 73  ? 31.558 -5.649  64.593 1.00 103.93 ? 103 ARG D CZ   1 
ATOM   7424 N NH1  . ARG D 2 73  ? 32.700 -5.606  65.270 1.00 102.72 ? 103 ARG D NH1  1 
ATOM   7425 N NH2  . ARG D 2 73  ? 31.567 -6.041  63.325 1.00 101.64 ? 103 ARG D NH2  1 
ATOM   7426 H H    . ARG D 2 73  ? 32.427 -1.220  67.451 1.00 121.07 ? 103 ARG D H    1 
ATOM   7427 H HA   . ARG D 2 73  ? 29.832 -1.111  68.092 1.00 129.58 ? 103 ARG D HA   1 
ATOM   7428 H HB2  . ARG D 2 73  ? 31.645 -3.259  68.358 1.00 132.08 ? 103 ARG D HB2  1 
ATOM   7429 H HB3  . ARG D 2 73  ? 30.098 -3.377  68.689 1.00 132.08 ? 103 ARG D HB3  1 
ATOM   7430 H HG2  . ARG D 2 73  ? 29.673 -2.905  66.382 1.00 130.80 ? 103 ARG D HG2  1 
ATOM   7431 H HG3  . ARG D 2 73  ? 31.234 -3.088  66.133 1.00 130.80 ? 103 ARG D HG3  1 
ATOM   7432 H HD2  . ARG D 2 73  ? 30.957 -5.309  67.090 1.00 132.85 ? 103 ARG D HD2  1 
ATOM   7433 H HD3  . ARG D 2 73  ? 29.396 -5.086  66.875 1.00 132.85 ? 103 ARG D HD3  1 
ATOM   7434 H HE   . ARG D 2 73  ? 29.693 -5.349  64.702 1.00 129.06 ? 103 ARG D HE   1 
ATOM   7435 H HH11 . ARG D 2 73  ? 32.704 -5.352  66.091 1.00 123.27 ? 103 ARG D HH11 1 
ATOM   7436 H HH12 . ARG D 2 73  ? 33.436 -5.832  64.886 1.00 123.27 ? 103 ARG D HH12 1 
ATOM   7437 H HH21 . ARG D 2 73  ? 30.833 -6.073  62.880 1.00 121.97 ? 103 ARG D HH21 1 
ATOM   7438 H HH22 . ARG D 2 73  ? 32.308 -6.266  62.950 1.00 121.97 ? 103 ARG D HH22 1 
HETATM 7439 O O    . HOH E 3 .   ? 40.627 34.438  62.887 1.00 42.66  ? 301 HOH A O    1 
HETATM 7440 O O    . HOH E 3 .   ? 62.844 41.541  59.234 1.00 52.28  ? 302 HOH A O    1 
HETATM 7441 O O    . HOH E 3 .   ? 41.188 32.923  59.621 1.00 36.70  ? 303 HOH A O    1 
HETATM 7442 O O    . HOH E 3 .   ? 49.957 24.497  64.054 1.00 47.84  ? 304 HOH A O    1 
HETATM 7443 O O    . HOH E 3 .   ? 46.895 25.137  58.154 1.00 47.86  ? 305 HOH A O    1 
HETATM 7444 O O    . HOH E 3 .   ? 42.705 33.767  48.817 1.00 54.49  ? 306 HOH A O    1 
HETATM 7445 O O    . HOH E 3 .   ? 56.056 33.523  47.493 1.00 46.64  ? 307 HOH A O    1 
HETATM 7446 O O    . HOH E 3 .   ? 49.415 31.382  65.683 1.00 36.57  ? 308 HOH A O    1 
HETATM 7447 O O    . HOH E 3 .   ? 64.978 29.177  58.504 1.00 49.32  ? 309 HOH A O    1 
HETATM 7448 O O    . HOH E 3 .   ? 49.060 38.532  54.808 1.00 38.50  ? 310 HOH A O    1 
HETATM 7449 O O    . HOH E 3 .   ? 58.906 22.647  60.304 1.00 29.79  ? 311 HOH A O    1 
HETATM 7450 O O    . HOH E 3 .   ? 47.266 23.229  63.952 1.00 53.79  ? 312 HOH A O    1 
HETATM 7451 O O    . HOH E 3 .   ? 66.234 26.298  60.087 1.00 37.39  ? 313 HOH A O    1 
HETATM 7452 O O    . HOH E 3 .   ? 54.040 23.168  59.601 1.00 31.47  ? 314 HOH A O    1 
HETATM 7453 O O    . HOH E 3 .   ? 51.247 40.979  52.963 1.00 49.94  ? 315 HOH A O    1 
HETATM 7454 O O    . HOH E 3 .   ? 53.035 35.127  66.155 1.00 40.34  ? 316 HOH A O    1 
HETATM 7455 O O    . HOH E 3 .   ? 65.043 24.985  52.342 1.00 40.99  ? 317 HOH A O    1 
HETATM 7456 O O    . HOH E 3 .   ? 51.179 34.293  67.772 1.00 42.99  ? 318 HOH A O    1 
HETATM 7457 O O    . HOH E 3 .   ? 46.763 22.110  61.574 1.00 38.27  ? 319 HOH A O    1 
HETATM 7458 O O    . HOH E 3 .   ? 43.022 29.010  63.992 1.00 31.65  ? 320 HOH A O    1 
HETATM 7459 O O    . HOH E 3 .   ? 42.179 32.013  64.293 1.00 209.74 ? 321 HOH A O    1 
HETATM 7460 O O    . HOH E 3 .   ? 56.561 22.153  59.127 1.00 39.39  ? 322 HOH A O    1 
HETATM 7461 O O    . HOH E 3 .   ? 45.259 23.475  59.839 1.00 45.14  ? 323 HOH A O    1 
HETATM 7462 O O    . HOH E 3 .   ? 51.496 42.982  54.112 1.00 47.48  ? 324 HOH A O    1 
HETATM 7463 O O    . HOH E 3 .   ? 53.794 19.803  56.965 1.00 50.16  ? 325 HOH A O    1 
HETATM 7464 O O    . HOH E 3 .   ? 56.111 21.104  56.957 1.00 36.63  ? 326 HOH A O    1 
HETATM 7465 O O    . HOH F 3 .   ? 53.365 17.193  62.760 1.00 44.78  ? 201 HOH B O    1 
HETATM 7466 O O    . HOH F 3 .   ? 48.295 19.486  64.953 1.00 47.56  ? 202 HOH B O    1 
HETATM 7467 O O    . HOH F 3 .   ? 45.822 19.725  65.937 1.00 39.42  ? 203 HOH B O    1 
HETATM 7468 O O    . HOH F 3 .   ? 69.563 20.322  59.945 1.00 42.91  ? 204 HOH B O    1 
HETATM 7469 O O    . HOH F 3 .   ? 65.748 17.888  65.659 1.00 52.96  ? 205 HOH B O    1 
HETATM 7470 O O    . HOH F 3 .   ? 34.530 37.750  54.293 1.00 43.20  ? 206 HOH B O    1 
HETATM 7471 O O    . HOH F 3 .   ? 54.211 17.697  58.516 1.00 40.69  ? 207 HOH B O    1 
HETATM 7472 O O    . HOH G 3 .   ? 52.277 0.403   48.681 1.00 44.85  ? 301 HOH C O    1 
HETATM 7473 O O    . HOH G 3 .   ? 62.820 -6.251  59.543 1.00 33.84  ? 302 HOH C O    1 
HETATM 7474 O O    . HOH G 3 .   ? 46.394 10.439  56.874 1.00 44.67  ? 303 HOH C O    1 
HETATM 7475 O O    . HOH G 3 .   ? 45.420 -8.726  57.356 1.00 53.76  ? 304 HOH C O    1 
HETATM 7476 O O    . HOH G 3 .   ? 41.476 2.115   54.781 1.00 50.61  ? 305 HOH C O    1 
HETATM 7477 O O    . HOH G 3 .   ? 59.101 12.551  57.341 1.00 39.93  ? 306 HOH C O    1 
HETATM 7478 O O    . HOH G 3 .   ? 69.660 0.005   60.591 1.00 41.63  ? 307 HOH C O    1 
HETATM 7479 O O    . HOH G 3 .   ? 52.088 13.626  58.141 1.00 32.01  ? 308 HOH C O    1 
HETATM 7480 O O    . HOH G 3 .   ? 56.720 4.267   81.918 1.00 52.72  ? 309 HOH C O    1 
HETATM 7481 O O    . HOH G 3 .   ? 53.849 2.102   69.220 1.00 39.92  ? 310 HOH C O    1 
HETATM 7482 O O    . HOH G 3 .   ? 54.006 12.060  57.017 1.00 32.57  ? 311 HOH C O    1 
HETATM 7483 O O    . HOH G 3 .   ? 64.848 6.157   60.012 1.00 47.44  ? 312 HOH C O    1 
HETATM 7484 O O    . HOH G 3 .   ? 60.982 7.592   63.569 1.00 53.77  ? 313 HOH C O    1 
HETATM 7485 O O    . HOH G 3 .   ? 50.467 10.744  52.040 1.00 39.81  ? 314 HOH C O    1 
HETATM 7486 O O    . HOH G 3 .   ? 50.343 3.649   50.453 1.00 33.48  ? 315 HOH C O    1 
HETATM 7487 O O    . HOH G 3 .   ? 50.229 15.348  56.672 1.00 44.29  ? 316 HOH C O    1 
HETATM 7488 O O    . HOH G 3 .   ? 53.027 2.486   47.181 1.00 41.21  ? 317 HOH C O    1 
HETATM 7489 O O    . HOH G 3 .   ? 57.292 16.200  61.093 1.00 43.17  ? 318 HOH C O    1 
HETATM 7490 O O    . HOH G 3 .   ? 51.564 2.417   43.664 1.00 52.81  ? 319 HOH C O    1 
HETATM 7491 O O    . HOH G 3 .   ? 65.379 -7.475  58.407 1.00 41.68  ? 320 HOH C O    1 
HETATM 7492 O O    . HOH G 3 .   ? 54.949 13.303  70.715 1.00 47.79  ? 321 HOH C O    1 
HETATM 7493 O O    . HOH G 3 .   ? 67.999 -1.606  62.412 1.00 41.32  ? 322 HOH C O    1 
HETATM 7494 O O    . HOH G 3 .   ? 54.228 0.137   50.595 1.00 40.99  ? 323 HOH C O    1 
HETATM 7495 O O    . HOH G 3 .   ? 43.121 3.086   51.134 1.00 38.30  ? 324 HOH C O    1 
HETATM 7496 O O    . HOH G 3 .   ? 57.436 13.272  70.254 1.00 62.96  ? 325 HOH C O    1 
HETATM 7497 O O    . HOH G 3 .   ? 45.662 12.021  54.882 1.00 47.96  ? 326 HOH C O    1 
HETATM 7498 O O    . HOH G 3 .   ? 56.310 13.210  57.926 1.00 57.73  ? 327 HOH C O    1 
HETATM 7499 O O    . HOH G 3 .   ? 53.455 15.175  59.800 1.00 34.37  ? 328 HOH C O    1 
HETATM 7500 O O    . HOH G 3 .   ? 55.830 14.219  60.357 1.00 33.36  ? 329 HOH C O    1 
HETATM 7501 O O    . HOH H 3 .   ? 33.200 13.652  54.374 1.00 40.77  ? 201 HOH D O    1 
HETATM 7502 O O    . HOH H 3 .   ? 57.766 -9.168  40.682 1.00 35.64  ? 202 HOH D O    1 
HETATM 7503 O O    . HOH H 3 .   ? 50.081 16.325  51.024 1.00 40.06  ? 203 HOH D O    1 
HETATM 7504 O O    . HOH H 3 .   ? 66.413 9.001   58.452 1.00 28.58  ? 204 HOH D O    1 
HETATM 7505 O O    . HOH H 3 .   ? 65.148 17.386  59.009 1.00 42.80  ? 205 HOH D O    1 
HETATM 7506 O O    . HOH H 3 .   ? 46.904 15.513  49.195 1.00 50.86  ? 206 HOH D O    1 
HETATM 7507 O O    . HOH H 3 .   ? 66.954 -4.783  45.051 1.00 54.33  ? 207 HOH D O    1 
HETATM 7508 O O    . HOH H 3 .   ? 57.413 17.671  58.631 1.00 64.43  ? 208 HOH D O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
15   N N   . HIS A 3   ? 2.7656 3.0094 3.3733 -0.1144 -0.2564 -0.0618 48  HIS A N   
16   C CA  . HIS A 3   ? 2.2197 2.4977 2.8513 -0.1015 -0.2747 -0.0604 48  HIS A CA  
17   C C   . HIS A 3   ? 2.1488 2.4223 2.7349 -0.0759 -0.2598 -0.0547 48  HIS A C   
18   O O   . HIS A 3   ? 2.1426 2.3759 2.6584 -0.0682 -0.2479 -0.0584 48  HIS A O   
19   C CB  . HIS A 3   ? 1.7213 1.9801 2.3264 -0.1026 -0.3140 -0.0775 48  HIS A CB  
20   C CG  . HIS A 3   ? 1.4124 1.6619 2.0403 -0.1246 -0.3237 -0.0839 48  HIS A CG  
21   N ND1 . HIS A 3   ? 1.3479 1.5564 1.9494 -0.1377 -0.3189 -0.0923 48  HIS A ND1 
22   C CD2 . HIS A 3   ? 1.3624 1.6375 2.0384 -0.1355 -0.3390 -0.0835 48  HIS A CD2 
23   C CE1 . HIS A 3   ? 1.3169 1.5227 1.9478 -0.1555 -0.3312 -0.0965 48  HIS A CE1 
24   N NE2 . HIS A 3   ? 1.3224 1.5695 1.9995 -0.1558 -0.3436 -0.0913 48  HIS A NE2 
32   N N   . MET A 4   ? 1.9371 2.2513 2.5640 -0.0621 -0.2592 -0.0454 49  MET A N   
33   C CA  . MET A 4   ? 1.4699 1.7779 2.0589 -0.0370 -0.2434 -0.0387 49  MET A CA  
34   C C   . MET A 4   ? 1.2322 1.5566 1.8309 -0.0195 -0.2749 -0.0407 49  MET A C   
35   O O   . MET A 4   ? 1.1994 1.5698 1.8693 -0.0217 -0.2925 -0.0394 49  MET A O   
36   C CB  . MET A 4   ? 1.2292 1.5668 1.8535 -0.0314 -0.2044 -0.0243 49  MET A CB  
37   C CG  . MET A 4   ? 1.0417 1.3683 1.6275 -0.0056 -0.1885 -0.0196 49  MET A CG  
38   S SD  . MET A 4   ? 0.9318 1.2636 1.5151 -0.0019 -0.1391 -0.0089 49  MET A SD  
39   C CE  . MET A 4   ? 0.8624 1.2604 1.5438 -0.0125 -0.1264 0.0016  49  MET A CE  
49   N N   . LEU A 5   ? 1.3239 1.6114 1.8528 -0.0025 -0.2820 -0.0425 50  LEU A N   
50   C CA  . LEU A 5   ? 1.2964 1.5892 1.8207 0.0171  -0.3124 -0.0420 50  LEU A CA  
51   C C   . LEU A 5   ? 1.1617 1.4696 1.7003 0.0412  -0.2930 -0.0303 50  LEU A C   
52   O O   . LEU A 5   ? 1.1342 1.4334 1.6600 0.0437  -0.2568 -0.0246 50  LEU A O   
53   C CB  . LEU A 5   ? 1.2631 1.5030 1.6985 0.0218  -0.3317 -0.0484 50  LEU A CB  
54   C CG  . LEU A 5   ? 1.3243 1.5598 1.7403 0.0408  -0.3692 -0.0472 50  LEU A CG  
55   C CD1 . LEU A 5   ? 1.3199 1.5928 1.7940 0.0344  -0.4098 -0.0558 50  LEU A CD1 
56   C CD2 . LEU A 5   ? 1.3430 1.5224 1.6607 0.0441  -0.3778 -0.0499 50  LEU A CD2 
68   N N   . GLU A 6   ? 1.1479 1.4771 1.7126 0.0604  -0.3197 -0.0278 51  GLU A N   
69   C CA  . GLU A 6   ? 1.0956 1.4386 1.6783 0.0870  -0.3051 -0.0188 51  GLU A CA  
70   C C   . GLU A 6   ? 1.0615 1.3457 1.5603 0.1012  -0.2944 -0.0145 51  GLU A C   
71   O O   . GLU A 6   ? 1.0570 1.3378 1.5560 0.1172  -0.2692 -0.0091 51  GLU A O   
72   C CB  . GLU A 6   ? 1.1512 1.5336 1.7882 0.1056  -0.3400 -0.0176 51  GLU A CB  
73   C CG  . GLU A 6   ? 1.1726 1.5724 1.8361 0.1374  -0.3275 -0.0099 51  GLU A CG  
74   C CD  . GLU A 6   ? 1.2559 1.6037 1.8512 0.1619  -0.3455 -0.0052 51  GLU A CD  
75   O OE1 . GLU A 6   ? 1.3071 1.6226 1.8519 0.1578  -0.3779 -0.0063 51  GLU A OE1 
76   O OE2 . GLU A 6   ? 1.2771 1.6141 1.8672 0.1856  -0.3273 -0.0001 51  GLU A OE2 
83   N N   . ALA A 7   ? 1.1492 1.3865 1.5758 0.0951  -0.3121 -0.0169 52  ALA A N   
84   C CA  . ALA A 7   ? 1.1566 1.3392 1.5067 0.1060  -0.3037 -0.0103 52  ALA A CA  
85   C C   . ALA A 7   ? 1.0643 1.2230 1.3824 0.0936  -0.2643 -0.0105 52  ALA A C   
86   O O   . ALA A 7   ? 1.0875 1.2127 1.3661 0.1037  -0.2490 -0.0043 52  ALA A O   
87   C CB  . ALA A 7   ? 1.1843 1.3284 1.4667 0.1033  -0.3333 -0.0110 52  ALA A CB  
93   N N   . GLU A 8   ? 0.8698 1.0432 1.2049 0.0721  -0.2494 -0.0173 53  GLU A N   
94   C CA  . GLU A 8   ? 0.7337 0.8852 1.0370 0.0606  -0.2163 -0.0178 53  GLU A CA  
95   C C   . GLU A 8   ? 0.5938 0.7709 0.9394 0.0664  -0.1863 -0.0144 53  GLU A C   
96   O O   . GLU A 8   ? 0.5503 0.7679 0.9557 0.0769  -0.1880 -0.0124 53  GLU A O   
97   C CB  . GLU A 8   ? 0.7527 0.9015 1.0475 0.0375  -0.2157 -0.0264 53  GLU A CB  
98   C CG  . GLU A 8   ? 0.7603 0.9503 1.1222 0.0254  -0.2231 -0.0309 53  GLU A CG  
99   C CD  . GLU A 8   ? 0.8188 0.9940 1.1635 0.0047  -0.2283 -0.0412 53  GLU A CD  
100  O OE1 . GLU A 8   ? 0.8594 0.9977 1.1406 0.0035  -0.2349 -0.0467 53  GLU A OE1 
101  O OE2 . GLU A 8   ? 0.8319 1.0312 1.2261 -0.0099 -0.2245 -0.0433 53  GLU A OE2 
108  N N   . HIS A 9   ? 0.5198 0.6748 0.8329 0.0601  -0.1586 -0.0143 54  HIS A N   
109  C CA  . HIS A 9   ? 0.4556 0.6218 0.7863 0.0690  -0.1303 -0.0119 54  HIS A CA  
110  C C   . HIS A 9   ? 0.4063 0.5989 0.7676 0.0533  -0.1089 -0.0124 54  HIS A C   
111  O O   . HIS A 9   ? 0.4204 0.5926 0.7503 0.0379  -0.0999 -0.0147 54  HIS A O   
112  C CB  . HIS A 9   ? 0.4510 0.5724 0.7231 0.0731  -0.1171 -0.0113 54  HIS A CB  
113  C CG  . HIS A 9   ? 0.4816 0.5729 0.7253 0.0897  -0.1345 -0.0074 54  HIS A CG  
114  N ND1 . HIS A 9   ? 0.5031 0.5750 0.7183 0.0878  -0.1606 -0.0045 54  HIS A ND1 
115  C CD2 . HIS A 9   ? 0.4930 0.5672 0.7302 0.1096  -0.1303 -0.0054 54  HIS A CD2 
116  C CE1 . HIS A 9   ? 0.5331 0.5768 0.7254 0.1050  -0.1717 0.0016  54  HIS A CE1 
117  N NE2 . HIS A 9   ? 0.5315 0.5747 0.7384 0.1186  -0.1542 0.0006  54  HIS A NE2 
125  N N   . PRO A 10  ? 0.3799 0.6172 0.8012 0.0570  -0.0989 -0.0092 55  PRO A N   
126  C CA  . PRO A 10  ? 0.3489 0.6084 0.7975 0.0398  -0.0793 -0.0062 55  PRO A CA  
127  C C   . PRO A 10  ? 0.3318 0.5708 0.7427 0.0391  -0.0508 -0.0052 55  PRO A C   
128  O O   . PRO A 10  ? 0.3312 0.5544 0.7151 0.0549  -0.0400 -0.0069 55  PRO A O   
129  C CB  . PRO A 10  ? 0.3289 0.6436 0.8503 0.0469  -0.0721 -0.0005 55  PRO A CB  
130  C CG  . PRO A 10  ? 0.3442 0.6688 0.8838 0.0642  -0.0980 -0.0030 55  PRO A CG  
131  C CD  . PRO A 10  ? 0.3756 0.6483 0.8468 0.0765  -0.1057 -0.0069 55  PRO A CD  
139  N N   . LEU A 11  ? 0.3247 0.5625 0.7345 0.0208  -0.0407 -0.0029 56  LEU A N   
140  C CA  . LEU A 11  ? 0.3347 0.5637 0.7205 0.0198  -0.0141 0.0001  56  LEU A CA  
141  C C   . LEU A 11  ? 0.3481 0.6178 0.7793 0.0219  0.0086  0.0095  56  LEU A C   
142  O O   . LEU A 11  ? 0.3418 0.6471 0.8288 0.0158  0.0041  0.0149  56  LEU A O   
143  C CB  . LEU A 11  ? 0.3252 0.5305 0.6848 0.0018  -0.0150 -0.0009 56  LEU A CB  
144  C CG  . LEU A 11  ? 0.3389 0.5077 0.6521 -0.0006 -0.0324 -0.0098 56  LEU A CG  
145  C CD1 . LEU A 11  ? 0.3382 0.4927 0.6409 -0.0167 -0.0362 -0.0123 56  LEU A CD1 
146  C CD2 . LEU A 11  ? 0.3420 0.4861 0.6098 0.0094  -0.0223 -0.0126 56  LEU A CD2 
158  N N   . GLN A 12  ? 0.3387 0.6043 0.7453 0.0300  0.0334  0.0115  57  GLN A N   
159  C CA  . GLN A 12  ? 0.3522 0.6563 0.7939 0.0334  0.0593  0.0216  57  GLN A CA  
160  C C   . GLN A 12  ? 0.3672 0.6881 0.8423 0.0104  0.0634  0.0340  57  GLN A C   
161  O O   . GLN A 12  ? 0.3591 0.7209 0.8832 0.0073  0.0793  0.0454  57  GLN A O   
162  C CB  . GLN A 12  ? 0.3564 0.6472 0.7542 0.0457  0.0834  0.0204  57  GLN A CB  
163  C CG  . GLN A 12  ? 0.3621 0.6936 0.7884 0.0535  0.1137  0.0306  57  GLN A CG  
164  C CD  . GLN A 12  ? 0.3733 0.7428 0.8458 0.0721  0.1169  0.0281  57  GLN A CD  
165  O OE1 . GLN A 12  ? 0.3920 0.7492 0.8432 0.0950  0.1161  0.0163  57  GLN A OE1 
166  N NE2 . GLN A 12  ? 0.3700 0.7859 0.9093 0.0624  0.1195  0.0390  57  GLN A NE2 
175  N N   . TYR A 13  ? 0.4318 0.7213 0.8828 -0.0058 0.0500  0.0322  58  TYR A N   
176  C CA  . TYR A 13  ? 0.4663 0.7614 0.9462 -0.0278 0.0496  0.0425  58  TYR A CA  
177  C C   . TYR A 13  ? 0.4783 0.7462 0.9503 -0.0398 0.0199  0.0321  58  TYR A C   
178  O O   . TYR A 13  ? 0.4946 0.7339 0.9238 -0.0324 0.0067  0.0199  58  TYR A O   
179  C CB  . TYR A 13  ? 0.4855 0.7645 0.9347 -0.0327 0.0702  0.0526  58  TYR A CB  
180  C CG  . TYR A 13  ? 0.5128 0.8091 0.9479 -0.0174 0.0993  0.0595  58  TYR A CG  
181  C CD1 . TYR A 13  ? 0.5112 0.7868 0.8946 0.0004  0.1030  0.0485  58  TYR A CD1 
182  C CD2 . TYR A 13  ? 0.5235 0.8561 0.9956 -0.0213 0.1236  0.0767  58  TYR A CD2 
183  C CE1 . TYR A 13  ? 0.5282 0.8158 0.8930 0.0159  0.1278  0.0515  58  TYR A CE1 
184  C CE2 . TYR A 13  ? 0.5391 0.8873 0.9919 -0.0052 0.1519  0.0816  58  TYR A CE2 
185  C CZ  . TYR A 13  ? 0.5469 0.8710 0.9440 0.0144  0.1529  0.0676  58  TYR A CZ  
186  O OH  . TYR A 13  ? 0.5711 0.9075 0.9440 0.0318  0.1794  0.0694  58  TYR A OH  
196  N N   . ASN A 14  ? 0.4006 0.6768 0.9134 -0.0589 0.0099  0.0370  59  ASN A N   
197  C CA  . ASN A 14  ? 0.3815 0.6241 0.8771 -0.0709 -0.0139 0.0267  59  ASN A CA  
198  C C   . ASN A 14  ? 0.3684 0.5773 0.8198 -0.0729 -0.0026 0.0287  59  ASN A C   
199  O O   . ASN A 14  ? 0.3708 0.5855 0.8235 -0.0745 0.0198  0.0430  59  ASN A O   
200  C CB  . ASN A 14  ? 0.3783 0.6341 0.9295 -0.0916 -0.0292 0.0297  59  ASN A CB  
201  C CG  . ASN A 14  ? 0.3715 0.6626 0.9694 -0.0896 -0.0466 0.0256  59  ASN A CG  
202  O OD1 . ASN A 14  ? 0.3724 0.6666 0.9511 -0.0719 -0.0543 0.0174  59  ASN A OD1 
203  N ND2 . ASN A 14  ? 0.3760 0.6931 1.0374 -0.1081 -0.0545 0.0320  59  ASN A ND2 
210  N N   . TYR A 15  ? 0.4119 0.5876 0.8228 -0.0711 -0.0178 0.0148  60  TYR A N   
211  C CA  . TYR A 15  ? 0.4280 0.5743 0.8020 -0.0715 -0.0108 0.0147  60  TYR A CA  
212  C C   . TYR A 15  ? 0.4334 0.5523 0.8046 -0.0815 -0.0309 0.0038  60  TYR A C   
213  O O   . TYR A 15  ? 0.4421 0.5590 0.8214 -0.0848 -0.0522 -0.0082 60  TYR A O   
214  C CB  . TYR A 15  ? 0.4367 0.5706 0.7609 -0.0567 -0.0049 0.0073  60  TYR A CB  
215  C CG  . TYR A 15  ? 0.4613 0.6121 0.7782 -0.0457 0.0157  0.0157  60  TYR A CG  
216  C CD1 . TYR A 15  ? 0.4676 0.6383 0.7963 -0.0361 0.0169  0.0144  60  TYR A CD1 
217  C CD2 . TYR A 15  ? 0.4689 0.6134 0.7641 -0.0427 0.0324  0.0237  60  TYR A CD2 
218  C CE1 . TYR A 15  ? 0.4679 0.6503 0.7861 -0.0236 0.0357  0.0188  60  TYR A CE1 
219  C CE2 . TYR A 15  ? 0.4748 0.6318 0.7569 -0.0315 0.0500  0.0286  60  TYR A CE2 
220  C CZ  . TYR A 15  ? 0.4798 0.6548 0.7729 -0.0217 0.0522  0.0251  60  TYR A CZ  
221  O OH  . TYR A 15  ? 0.4876 0.6716 0.7645 -0.0082 0.0696  0.0269  60  TYR A OH  
231  N N   . THR A 16  ? 0.3815 0.4775 0.7382 -0.0843 -0.0250 0.0072  61  THR A N   
232  C CA  . THR A 16  ? 0.3954 0.4610 0.7489 -0.0914 -0.0418 -0.0035 61  THR A CA  
233  C C   . THR A 16  ? 0.3945 0.4366 0.7035 -0.0799 -0.0378 -0.0115 61  THR A C   
234  O O   . THR A 16  ? 0.3821 0.4236 0.6789 -0.0747 -0.0219 -0.0002 61  THR A O   
235  C CB  . THR A 16  ? 0.3997 0.4587 0.7916 -0.1074 -0.0406 0.0104  61  THR A CB  
236  O OG1 . THR A 16  ? 0.3971 0.4854 0.8378 -0.1194 -0.0438 0.0177  61  THR A OG1 
237  C CG2 . THR A 16  ? 0.4218 0.4420 0.8097 -0.1136 -0.0597 -0.0029 61  THR A CG2 
245  N N   . PHE A 17  ? 0.4512 0.4764 0.7358 -0.0754 -0.0521 -0.0308 62  PHE A N   
246  C CA  . PHE A 17  ? 0.4856 0.4919 0.7359 -0.0650 -0.0488 -0.0401 62  PHE A CA  
247  C C   . PHE A 17  ? 0.4872 0.4649 0.7473 -0.0683 -0.0553 -0.0420 62  PHE A C   
248  O O   . PHE A 17  ? 0.5036 0.4659 0.7828 -0.0780 -0.0713 -0.0490 62  PHE A O   
249  C CB  . PHE A 17  ? 0.5409 0.5423 0.7596 -0.0580 -0.0581 -0.0594 62  PHE A CB  
250  C CG  . PHE A 17  ? 0.5479 0.5661 0.7418 -0.0504 -0.0474 -0.0575 62  PHE A CG  
251  C CD1 . PHE A 17  ? 0.5644 0.5855 0.7402 -0.0430 -0.0333 -0.0546 62  PHE A CD1 
252  C CD2 . PHE A 17  ? 0.5708 0.5997 0.7599 -0.0508 -0.0538 -0.0590 62  PHE A CD2 
253  C CE1 . PHE A 17  ? 0.5518 0.5849 0.7070 -0.0388 -0.0252 -0.0535 62  PHE A CE1 
254  C CE2 . PHE A 17  ? 0.5738 0.6112 0.7391 -0.0447 -0.0450 -0.0566 62  PHE A CE2 
255  C CZ  . PHE A 17  ? 0.5497 0.5884 0.6988 -0.0401 -0.0306 -0.0542 62  PHE A CZ  
265  N N   . TRP A 18  ? 0.4593 0.4277 0.7063 -0.0597 -0.0452 -0.0365 63  TRP A N   
266  C CA  . TRP A 18  ? 0.4931 0.4297 0.7436 -0.0578 -0.0516 -0.0393 63  TRP A CA  
267  C C   . TRP A 18  ? 0.4912 0.4219 0.7121 -0.0402 -0.0486 -0.0525 63  TRP A C   
268  O O   . TRP A 18  ? 0.4430 0.3966 0.6455 -0.0326 -0.0382 -0.0526 63  TRP A O   
269  C CB  . TRP A 18  ? 0.5022 0.4321 0.7713 -0.0633 -0.0427 -0.0148 63  TRP A CB  
270  C CG  . TRP A 18  ? 0.5230 0.4687 0.8245 -0.0802 -0.0384 0.0031  63  TRP A CG  
271  C CD1 . TRP A 18  ? 0.4956 0.4764 0.8026 -0.0824 -0.0274 0.0111  63  TRP A CD1 
272  C CD2 . TRP A 18  ? 0.5602 0.4885 0.8965 -0.0972 -0.0437 0.0156  63  TRP A CD2 
273  N NE1 . TRP A 18  ? 0.5107 0.5024 0.8557 -0.0983 -0.0241 0.0273  63  TRP A NE1 
274  C CE2 . TRP A 18  ? 0.5460 0.5067 0.9108 -0.1095 -0.0337 0.0314  63  TRP A CE2 
275  C CE3 . TRP A 18  ? 0.5961 0.4834 0.9441 -0.1033 -0.0559 0.0149  63  TRP A CE3 
276  C CZ2 . TRP A 18  ? 0.5754 0.5340 0.9832 -0.1299 -0.0340 0.0481  63  TRP A CZ2 
277  C CZ3 . TRP A 18  ? 0.6296 0.5083 1.0177 -0.1249 -0.0582 0.0316  63  TRP A CZ3 
278  C CH2 . TRP A 18  ? 0.6119 0.5286 1.0310 -0.1390 -0.0466 0.0487  63  TRP A CH2 
289  N N   . TYR A 19  ? 0.5091 0.4091 0.7288 -0.0339 -0.0579 -0.0639 64  TYR A N   
290  C CA  . TYR A 19  ? 0.5301 0.4261 0.7282 -0.0152 -0.0552 -0.0786 64  TYR A CA  
291  C C   . TYR A 19  ? 0.5559 0.4183 0.7632 -0.0069 -0.0609 -0.0764 64  TYR A C   
292  O O   . TYR A 19  ? 0.5578 0.3871 0.7803 -0.0153 -0.0734 -0.0776 64  TYR A O   
293  C CB  . TYR A 19  ? 0.5691 0.4617 0.7466 -0.0100 -0.0622 -0.1049 64  TYR A CB  
294  C CG  . TYR A 19  ? 0.6153 0.5009 0.7760 0.0100  -0.0591 -0.1225 64  TYR A CG  
295  C CD1 . TYR A 19  ? 0.6041 0.5184 0.7566 0.0214  -0.0446 -0.1196 64  TYR A CD1 
296  C CD2 . TYR A 19  ? 0.6666 0.5184 0.8213 0.0180  -0.0711 -0.1436 64  TYR A CD2 
297  C CE1 . TYR A 19  ? 0.6258 0.5411 0.7695 0.0406  -0.0401 -0.1356 64  TYR A CE1 
298  C CE2 . TYR A 19  ? 0.7029 0.5512 0.8435 0.0396  -0.0661 -0.1613 64  TYR A CE2 
299  C CZ  . TYR A 19  ? 0.6791 0.5624 0.8166 0.0510  -0.0497 -0.1564 64  TYR A CZ  
300  O OH  . TYR A 19  ? 0.7042 0.5913 0.8344 0.0731  -0.0432 -0.1736 64  TYR A OH  
310  N N   . SER A 20  ? 0.5976 0.4675 0.7976 0.0093  -0.0535 -0.0730 65  SER A N   
311  C CA  . SER A 20  ? 0.6658 0.5035 0.8729 0.0215  -0.0597 -0.0697 65  SER A CA  
312  C C   . SER A 20  ? 0.6830 0.5324 0.8791 0.0456  -0.0561 -0.0851 65  SER A C   
313  O O   . SER A 20  ? 0.6255 0.5141 0.8133 0.0500  -0.0454 -0.0858 65  SER A O   
314  C CB  . SER A 20  ? 0.6880 0.5227 0.9046 0.0163  -0.0555 -0.0390 65  SER A CB  
315  O OG  . SER A 20  ? 0.6853 0.5565 0.8907 0.0233  -0.0445 -0.0303 65  SER A OG  
321  N N   . ARG A 21  ? 0.6692 0.4845 0.8681 0.0612  -0.0653 -0.0980 66  ARG A N   
322  C CA  . ARG A 21  ? 0.6976 0.5243 0.8934 0.0876  -0.0619 -0.1120 66  ARG A CA  
323  C C   . ARG A 21  ? 0.7294 0.5145 0.9364 0.1036  -0.0731 -0.1067 66  ARG A C   
324  O O   . ARG A 21  ? 0.7415 0.4775 0.9528 0.0982  -0.0854 -0.1089 66  ARG A O   
325  C CB  . ARG A 21  ? 0.7380 0.5699 0.9191 0.0977  -0.0592 -0.1439 66  ARG A CB  
326  C CG  . ARG A 21  ? 0.7740 0.6342 0.9560 0.1238  -0.0497 -0.1575 66  ARG A CG  
327  C CD  . ARG A 21  ? 0.8597 0.7216 1.0236 0.1360  -0.0444 -0.1891 66  ARG A CD  
328  N NE  . ARG A 21  ? 0.9047 0.8049 1.0746 0.1595  -0.0307 -0.2005 66  ARG A NE  
329  C CZ  . ARG A 21  ? 0.9962 0.8852 1.1801 0.1873  -0.0336 -0.2108 66  ARG A CZ  
330  N NH1 . ARG A 21  ? 1.0536 0.8869 1.2429 0.1950  -0.0508 -0.2106 66  ARG A NH1 
331  N NH2 . ARG A 21  ? 1.0029 0.9369 1.1982 0.2075  -0.0195 -0.2207 66  ARG A NH2 
345  N N   . ARG A 22  ? 0.7223 0.5255 0.9350 0.1232  -0.0707 -0.0996 67  ARG A N   
346  C CA  . ARG A 22  ? 0.8035 0.5684 1.0257 0.1440  -0.0824 -0.0948 67  ARG A CA  
347  C C   . ARG A 22  ? 0.9585 0.7124 1.1816 0.1700  -0.0846 -0.1273 67  ARG A C   
348  O O   . ARG A 22  ? 0.8863 0.6846 1.1114 0.1864  -0.0742 -0.1425 67  ARG A O   
349  C CB  . ARG A 22  ? 0.8362 0.6275 1.0639 0.1560  -0.0819 -0.0737 67  ARG A CB  
350  C CG  . ARG A 22  ? 0.9103 0.6602 1.1459 0.1784  -0.0962 -0.0634 67  ARG A CG  
351  C CD  . ARG A 22  ? 0.9473 0.7285 1.1860 0.1925  -0.0986 -0.0445 67  ARG A CD  
352  N NE  . ARG A 22  ? 0.9714 0.8114 1.2213 0.2085  -0.0914 -0.0638 67  ARG A NE  
353  C CZ  . ARG A 22  ? 0.9913 0.8685 1.2500 0.2226  -0.0954 -0.0546 67  ARG A CZ  
354  N NH1 . ARG A 22  ? 1.0229 0.8821 1.2734 0.2250  -0.1073 -0.0265 67  ARG A NH1 
355  N NH2 . ARG A 22  ? 0.9692 0.9027 1.2446 0.2336  -0.0880 -0.0729 67  ARG A NH2 
369  N N   . THR A 23  ? 1.2817 0.9765 1.5039 0.1734  -0.0974 -0.1386 68  THR A N   
370  C CA  . THR A 23  ? 1.3851 1.0610 1.6031 0.1992  -0.1001 -0.1729 68  THR A CA  
371  C C   . THR A 23  ? 1.3850 1.0128 1.6153 0.2255  -0.1142 -0.1705 68  THR A C   
372  O O   . THR A 23  ? 1.4182 0.9876 1.6517 0.2142  -0.1290 -0.1549 68  THR A O   
373  C CB  . THR A 23  ? 1.3800 1.0211 1.5823 0.1839  -0.1068 -0.1947 68  THR A CB  
374  O OG1 . THR A 23  ? 1.3819 1.0668 1.5721 0.1609  -0.0955 -0.1944 68  THR A OG1 
375  C CG2 . THR A 23  ? 1.4887 1.1090 1.6789 0.2130  -0.1086 -0.2339 68  THR A CG2 
383  N N   . PRO A 24  ? 1.2364 0.8859 1.4765 0.2606  -0.1106 -0.1837 69  PRO A N   
384  C CA  . PRO A 24  ? 1.2581 0.8560 1.5094 0.2904  -0.1262 -0.1852 69  PRO A CA  
385  C C   . PRO A 24  ? 1.3330 0.8642 1.5717 0.2953  -0.1370 -0.2114 69  PRO A C   
386  O O   . PRO A 24  ? 1.3503 0.8219 1.5854 0.2760  -0.1512 -0.1960 69  PRO A O   
387  C CB  . PRO A 24  ? 1.2353 0.8874 1.5029 0.3266  -0.1165 -0.1996 69  PRO A CB  
388  C CG  . PRO A 24  ? 1.1628 0.8933 1.4324 0.3084  -0.0991 -0.1892 69  PRO A CG  
389  C CD  . PRO A 24  ? 1.1626 0.8888 1.4095 0.2729  -0.0927 -0.1919 69  PRO A CD  
397  N N   . GLU A 34  ? 1.5208 1.0960 1.7582 0.1045  -0.1244 -0.0899 79  GLU A N   
398  C CA  . GLU A 34  ? 1.5701 1.1666 1.8077 0.1193  -0.1183 -0.0660 79  GLU A CA  
399  C C   . GLU A 34  ? 1.7756 1.4046 2.0125 0.0952  -0.1073 -0.0339 79  GLU A C   
400  O O   . GLU A 34  ? 1.7681 1.3711 2.0086 0.0850  -0.1095 -0.0031 79  GLU A O   
401  C CB  . GLU A 34  ? 1.5599 1.0970 1.8038 0.1356  -0.1327 -0.0532 79  GLU A CB  
402  C CG  . GLU A 34  ? 1.4646 1.0216 1.7060 0.1564  -0.1310 -0.0311 79  GLU A CG  
403  C CD  . GLU A 34  ? 1.5065 1.0009 1.7520 0.1765  -0.1473 -0.0192 79  GLU A CD  
404  O OE1 . GLU A 34  ? 1.5766 1.0135 1.8276 0.1793  -0.1594 -0.0356 79  GLU A OE1 
405  O OE2 . GLU A 34  ? 1.5343 1.0340 1.7757 0.1898  -0.1499 0.0063  79  GLU A OE2 
411  N N   . GLN A 35  ? 2.0651 1.7493 2.2953 0.0867  -0.0944 -0.0411 80  GLN A N   
412  C CA  . GLN A 35  ? 2.0129 1.7326 2.2398 0.0671  -0.0825 -0.0170 80  GLN A CA  
413  C C   . GLN A 35  ? 1.9192 1.6199 2.1577 0.0375  -0.0827 -0.0028 80  GLN A C   
414  O O   . GLN A 35  ? 1.9049 1.6269 2.1433 0.0220  -0.0721 0.0216  80  GLN A O   
415  C CB  . GLN A 35  ? 2.0086 1.7350 2.2283 0.0775  -0.0804 0.0105  80  GLN A CB  
416  C CG  . GLN A 35  ? 2.0284 1.8039 2.2367 0.0674  -0.0670 0.0247  80  GLN A CG  
417  C CD  . GLN A 35  ? 2.0680 1.8499 2.2630 0.0805  -0.0681 0.0478  80  GLN A CD  
418  O OE1 . GLN A 35  ? 2.1042 1.8535 2.2995 0.0970  -0.0792 0.0569  80  GLN A OE1 
419  N NE2 . GLN A 35  ? 2.0209 1.8426 2.2019 0.0744  -0.0584 0.0568  80  GLN A NE2 
428  N N   . ASN A 36  ? 1.7006 1.3632 1.9505 0.0293  -0.0946 -0.0182 81  ASN A N   
429  C CA  . ASN A 36  ? 1.3778 1.0292 1.6462 -0.0008 -0.0967 -0.0081 81  ASN A CA  
430  C C   . ASN A 36  ? 1.1168 0.8162 1.3833 -0.0126 -0.0893 -0.0204 81  ASN A C   
431  O O   . ASN A 36  ? 1.0001 0.7116 1.2539 -0.0027 -0.0925 -0.0493 81  ASN A O   
432  C CB  . ASN A 36  ? 1.3563 0.9498 1.6380 -0.0060 -0.1161 -0.0240 81  ASN A CB  
433  C CG  . ASN A 36  ? 1.3506 0.9274 1.6609 -0.0396 -0.1207 -0.0074 81  ASN A CG  
434  O OD1 . ASN A 36  ? 1.3369 0.9302 1.6587 -0.0557 -0.1081 0.0253  81  ASN A OD1 
435  N ND2 . ASN A 36  ? 1.4035 0.9488 1.7259 -0.0503 -0.1389 -0.0305 81  ASN A ND2 
442  N N   . ILE A 37  ? 1.1165 0.8428 1.3941 -0.0321 -0.0784 0.0022  82  ILE A N   
443  C CA  . ILE A 37  ? 1.0028 0.7751 1.2782 -0.0402 -0.0709 -0.0061 82  ILE A CA  
444  C C   . ILE A 37  ? 0.9367 0.6981 1.2312 -0.0579 -0.0846 -0.0214 82  ILE A C   
445  O O   . ILE A 37  ? 1.0049 0.7382 1.3261 -0.0759 -0.0931 -0.0112 82  ILE A O   
446  C CB  . ILE A 37  ? 0.9457 0.7526 1.2243 -0.0498 -0.0532 0.0220  82  ILE A CB  
447  C CG1 . ILE A 37  ? 0.9522 0.7673 1.2076 -0.0318 -0.0438 0.0354  82  ILE A CG1 
448  C CG2 . ILE A 37  ? 0.9266 0.7772 1.2030 -0.0551 -0.0466 0.0126  82  ILE A CG2 
449  C CD1 . ILE A 37  ? 0.9926 0.7754 1.2508 -0.0328 -0.0431 0.0632  82  ILE A CD1 
461  N N   . LYS A 38  ? 0.7673 0.5502 1.0477 -0.0535 -0.0881 -0.0455 83  LYS A N   
462  C CA  . LYS A 38  ? 0.7107 0.4859 1.0018 -0.0667 -0.1046 -0.0640 83  LYS A CA  
463  C C   . LYS A 38  ? 0.5856 0.4070 0.8792 -0.0752 -0.0983 -0.0611 83  LYS A C   
464  O O   . LYS A 38  ? 0.5163 0.3668 0.7853 -0.0629 -0.0867 -0.0645 83  LYS A O   
465  C CB  . LYS A 38  ? 0.7598 0.5116 1.0240 -0.0505 -0.1175 -0.0980 83  LYS A CB  
466  C CG  . LYS A 38  ? 0.8388 0.5449 1.0978 -0.0355 -0.1235 -0.1053 83  LYS A CG  
467  C CD  . LYS A 38  ? 0.9269 0.5872 1.2168 -0.0534 -0.1380 -0.0946 83  LYS A CD  
468  C CE  . LYS A 38  ? 1.0299 0.6325 1.3103 -0.0379 -0.1528 -0.1148 83  LYS A CE  
469  N NZ  . LYS A 38  ? 1.0554 0.6574 1.3173 -0.0095 -0.1411 -0.1125 83  LYS A NZ  
483  N N   . GLN A 39  ? 0.6043 0.4314 0.9302 -0.0963 -0.1072 -0.0553 84  GLN A N   
484  C CA  . GLN A 39  ? 0.5520 0.4214 0.8866 -0.1034 -0.1042 -0.0524 84  GLN A CA  
485  C C   . GLN A 39  ? 0.5483 0.4188 0.8573 -0.0963 -0.1196 -0.0805 84  GLN A C   
486  O O   . GLN A 39  ? 0.5922 0.4330 0.9000 -0.0997 -0.1409 -0.1007 84  GLN A O   
487  C CB  . GLN A 39  ? 0.5708 0.4496 0.9559 -0.1277 -0.1094 -0.0364 84  GLN A CB  
488  C CG  . GLN A 39  ? 0.5478 0.4714 0.9505 -0.1337 -0.1086 -0.0337 84  GLN A CG  
489  C CD  . GLN A 39  ? 0.5831 0.5240 1.0442 -0.1575 -0.1105 -0.0160 84  GLN A CD  
490  O OE1 . GLN A 39  ? 0.6143 0.5320 1.1016 -0.1720 -0.1106 -0.0029 84  GLN A OE1 
491  N NE2 . GLN A 39  ? 0.5652 0.5473 1.0493 -0.1615 -0.1121 -0.0145 84  GLN A NE2 
500  N N   . ILE A 40  ? 0.5767 0.4782 0.8622 -0.0865 -0.1096 -0.0817 85  ILE A N   
501  C CA  . ILE A 40  ? 0.6165 0.5197 0.8724 -0.0798 -0.1223 -0.1041 85  ILE A CA  
502  C C   . ILE A 40  ? 0.6274 0.5509 0.9084 -0.0930 -0.1369 -0.1024 85  ILE A C   
503  O O   . ILE A 40  ? 0.6666 0.5747 0.9488 -0.0989 -0.1611 -0.1198 85  ILE A O   
504  C CB  . ILE A 40  ? 0.5929 0.5152 0.8101 -0.0638 -0.1056 -0.1055 85  ILE A CB  
505  C CG1 . ILE A 40  ? 0.6092 0.5171 0.8076 -0.0500 -0.0934 -0.1090 85  ILE A CG1 
506  C CG2 . ILE A 40  ? 0.6315 0.5540 0.8150 -0.0584 -0.1175 -0.1249 85  ILE A CG2 
507  C CD1 . ILE A 40  ? 0.5798 0.5110 0.7502 -0.0379 -0.0756 -0.1072 85  ILE A CD1 
519  N N   . GLY A 41  ? 0.6188 0.5769 0.9197 -0.0962 -0.1239 -0.0830 86  GLY A N   
520  C CA  . GLY A 41  ? 0.6164 0.5992 0.9472 -0.1059 -0.1372 -0.0804 86  GLY A CA  
521  C C   . GLY A 41  ? 0.5840 0.6043 0.9319 -0.1037 -0.1177 -0.0598 86  GLY A C   
522  O O   . GLY A 41  ? 0.5446 0.5699 0.8716 -0.0938 -0.0958 -0.0505 86  GLY A O   
526  N N   . THR A 42  ? 0.4735 0.5210 0.8604 -0.1119 -0.1273 -0.0546 87  THR A N   
527  C CA  . THR A 42  ? 0.4331 0.5182 0.8432 -0.1087 -0.1097 -0.0368 87  THR A CA  
528  C C   . THR A 42  ? 0.4148 0.5169 0.8119 -0.0978 -0.1209 -0.0438 87  THR A C   
529  O O   . THR A 42  ? 0.4351 0.5304 0.8277 -0.0994 -0.1471 -0.0582 87  THR A O   
530  C CB  . THR A 42  ? 0.4469 0.5570 0.9222 -0.1257 -0.1075 -0.0214 87  THR A CB  
531  O OG1 . THR A 42  ? 0.4415 0.5293 0.9249 -0.1364 -0.0977 -0.0122 87  THR A OG1 
532  C CG2 . THR A 42  ? 0.3923 0.5439 0.8901 -0.1189 -0.0854 -0.0042 87  THR A CG2 
540  N N   . PHE A 43  ? 0.4640 0.5849 0.8518 -0.0857 -0.1022 -0.0338 88  PHE A N   
541  C CA  . PHE A 43  ? 0.4680 0.6016 0.8438 -0.0736 -0.1111 -0.0371 88  PHE A CA  
542  C C   . PHE A 43  ? 0.4462 0.6142 0.8541 -0.0669 -0.0936 -0.0225 88  PHE A C   
543  O O   . PHE A 43  ? 0.4410 0.6191 0.8629 -0.0690 -0.0701 -0.0104 88  PHE A O   
544  C CB  . PHE A 43  ? 0.4873 0.5954 0.7995 -0.0614 -0.1080 -0.0451 88  PHE A CB  
545  C CG  . PHE A 43  ? 0.5040 0.6062 0.7932 -0.0559 -0.0816 -0.0379 88  PHE A CG  
546  C CD1 . PHE A 43  ? 0.4952 0.6121 0.7838 -0.0462 -0.0661 -0.0287 88  PHE A CD1 
547  C CD2 . PHE A 43  ? 0.5064 0.5874 0.7732 -0.0588 -0.0745 -0.0420 88  PHE A CD2 
548  C CE1 . PHE A 43  ? 0.4757 0.5859 0.7410 -0.0417 -0.0455 -0.0242 88  PHE A CE1 
549  C CE2 . PHE A 43  ? 0.4864 0.5644 0.7337 -0.0535 -0.0539 -0.0360 88  PHE A CE2 
550  C CZ  . PHE A 43  ? 0.4794 0.5718 0.7250 -0.0459 -0.0402 -0.0273 88  PHE A CZ  
560  N N   . ALA A 44  ? 0.4216 0.6064 0.8378 -0.0567 -0.1057 -0.0240 89  ALA A N   
561  C CA  . ALA A 44  ? 0.4008 0.6225 0.8564 -0.0479 -0.0932 -0.0131 89  ALA A CA  
562  C C   . ALA A 44  ? 0.4059 0.6243 0.8326 -0.0272 -0.0922 -0.0142 89  ALA A C   
563  O O   . ALA A 44  ? 0.4028 0.6470 0.8545 -0.0157 -0.0778 -0.0070 89  ALA A O   
564  C CB  . ALA A 44  ? 0.3966 0.6543 0.9185 -0.0563 -0.1114 -0.0116 89  ALA A CB  
570  N N   . SER A 45  ? 0.4342 0.6206 0.8091 -0.0218 -0.1062 -0.0226 90  SER A N   
571  C CA  . SER A 45  ? 0.4617 0.6373 0.8069 -0.0041 -0.1078 -0.0220 90  SER A CA  
572  C C   . SER A 45  ? 0.4686 0.6062 0.7510 -0.0038 -0.0983 -0.0250 90  SER A C   
573  O O   . SER A 45  ? 0.4684 0.5904 0.7303 -0.0150 -0.0949 -0.0296 90  SER A O   
574  C CB  . SER A 45  ? 0.4993 0.6760 0.8467 0.0024  -0.1390 -0.0258 90  SER A CB  
575  O OG  . SER A 45  ? 0.5307 0.6775 0.8338 -0.0053 -0.1558 -0.0344 90  SER A OG  
581  N N   . VAL A 46  ? 0.4824 0.6053 0.7373 0.0095  -0.0946 -0.0225 91  VAL A N   
582  C CA  . VAL A 46  ? 0.4911 0.5803 0.6912 0.0080  -0.0865 -0.0241 91  VAL A CA  
583  C C   . VAL A 46  ? 0.5176 0.5861 0.6822 0.0013  -0.1034 -0.0293 91  VAL A C   
584  O O   . VAL A 46  ? 0.4990 0.5515 0.6329 -0.0071 -0.0950 -0.0332 91  VAL A O   
585  C CB  . VAL A 46  ? 0.5041 0.5777 0.6851 0.0221  -0.0821 -0.0198 91  VAL A CB  
586  C CG1 . VAL A 46  ? 0.5203 0.5596 0.6489 0.0166  -0.0752 -0.0201 91  VAL A CG1 
587  C CG2 . VAL A 46  ? 0.4936 0.5859 0.7028 0.0309  -0.0635 -0.0179 91  VAL A CG2 
597  N N   . GLU A 47  ? 0.5259 0.5957 0.6930 0.0066  -0.1276 -0.0297 92  GLU A N   
598  C CA  . GLU A 47  ? 0.5711 0.6211 0.6987 0.0022  -0.1450 -0.0355 92  GLU A CA  
599  C C   . GLU A 47  ? 0.5913 0.6459 0.7272 -0.0108 -0.1463 -0.0462 92  GLU A C   
600  O O   . GLU A 47  ? 0.5952 0.6299 0.6901 -0.0155 -0.1454 -0.0532 92  GLU A O   
601  C CB  . GLU A 47  ? 0.5888 0.6421 0.7205 0.0116  -0.1746 -0.0341 92  GLU A CB  
602  C CG  . GLU A 47  ? 0.6028 0.6422 0.7179 0.0272  -0.1777 -0.0232 92  GLU A CG  
603  C CD  . GLU A 47  ? 0.5695 0.6331 0.7351 0.0383  -0.1687 -0.0183 92  GLU A CD  
604  O OE1 . GLU A 47  ? 0.5356 0.6274 0.7451 0.0324  -0.1547 -0.0211 92  GLU A OE1 
605  O OE2 . GLU A 47  ? 0.5974 0.6504 0.7569 0.0542  -0.1751 -0.0113 92  GLU A OE2 
612  N N   . GLN A 48  ? 0.5483 0.6284 0.7379 -0.0164 -0.1478 -0.0473 93  GLN A N   
613  C CA  . GLN A 48  ? 0.5643 0.6435 0.7657 -0.0293 -0.1495 -0.0565 93  GLN A CA  
614  C C   . GLN A 48  ? 0.4932 0.5588 0.6723 -0.0332 -0.1248 -0.0570 93  GLN A C   
615  O O   . GLN A 48  ? 0.4817 0.5311 0.6393 -0.0384 -0.1264 -0.0672 93  GLN A O   
616  C CB  . GLN A 48  ? 0.6232 0.7328 0.8912 -0.0364 -0.1529 -0.0530 93  GLN A CB  
617  C CG  . GLN A 48  ? 0.7147 0.8229 1.0034 -0.0494 -0.1742 -0.0640 93  GLN A CG  
618  C CD  . GLN A 48  ? 0.7727 0.9161 1.1340 -0.0578 -0.1820 -0.0582 93  GLN A CD  
619  O OE1 . GLN A 48  ? 0.8063 0.9524 1.2003 -0.0729 -0.1814 -0.0593 93  GLN A OE1 
620  N NE2 . GLN A 48  ? 0.7915 0.9622 1.1803 -0.0481 -0.1894 -0.0514 93  GLN A NE2 
629  N N   . PHE A 49  ? 0.4943 0.5663 0.6777 -0.0291 -0.1031 -0.0474 94  PHE A N   
630  C CA  . PHE A 49  ? 0.4770 0.5388 0.6403 -0.0318 -0.0825 -0.0476 94  PHE A CA  
631  C C   . PHE A 49  ? 0.4954 0.5353 0.6083 -0.0310 -0.0827 -0.0543 94  PHE A C   
632  O O   . PHE A 49  ? 0.4992 0.5310 0.5991 -0.0347 -0.0773 -0.0618 94  PHE A O   
633  C CB  . PHE A 49  ? 0.4510 0.5209 0.6200 -0.0262 -0.0637 -0.0380 94  PHE A CB  
634  C CG  . PHE A 49  ? 0.4432 0.5002 0.5811 -0.0269 -0.0480 -0.0388 94  PHE A CG  
635  C CD1 . PHE A 49  ? 0.4281 0.4857 0.5699 -0.0318 -0.0383 -0.0406 94  PHE A CD1 
636  C CD2 . PHE A 49  ? 0.4454 0.4892 0.5527 -0.0230 -0.0444 -0.0369 94  PHE A CD2 
637  C CE1 . PHE A 49  ? 0.4231 0.4740 0.5419 -0.0319 -0.0262 -0.0417 94  PHE A CE1 
638  C CE2 . PHE A 49  ? 0.4389 0.4750 0.5244 -0.0261 -0.0314 -0.0378 94  PHE A CE2 
639  C CZ  . PHE A 49  ? 0.4190 0.4614 0.5118 -0.0301 -0.0228 -0.0408 94  PHE A CZ  
649  N N   . TRP A 50  ? 0.5096 0.5396 0.5940 -0.0254 -0.0879 -0.0508 95  TRP A N   
650  C CA  . TRP A 50  ? 0.5429 0.5545 0.5789 -0.0261 -0.0836 -0.0536 95  TRP A CA  
651  C C   . TRP A 50  ? 0.5824 0.5858 0.5983 -0.0279 -0.0957 -0.0663 95  TRP A C   
652  O O   . TRP A 50  ? 0.5851 0.5799 0.5697 -0.0291 -0.0855 -0.0721 95  TRP A O   
653  C CB  . TRP A 50  ? 0.5466 0.5447 0.5548 -0.0208 -0.0885 -0.0443 95  TRP A CB  
654  C CG  . TRP A 50  ? 0.5255 0.5218 0.5396 -0.0190 -0.0744 -0.0350 95  TRP A CG  
655  C CD1 . TRP A 50  ? 0.5271 0.5229 0.5558 -0.0105 -0.0796 -0.0277 95  TRP A CD1 
656  C CD2 . TRP A 50  ? 0.5159 0.5100 0.5220 -0.0247 -0.0545 -0.0339 95  TRP A CD2 
657  N NE1 . TRP A 50  ? 0.5122 0.5011 0.5380 -0.0106 -0.0642 -0.0235 95  TRP A NE1 
658  C CE2 . TRP A 50  ? 0.5081 0.4966 0.5209 -0.0205 -0.0498 -0.0270 95  TRP A CE2 
659  C CE3 . TRP A 50  ? 0.5019 0.4992 0.4976 -0.0318 -0.0415 -0.0392 95  TRP A CE3 
660  C CZ2 . TRP A 50  ? 0.4979 0.4823 0.5055 -0.0253 -0.0348 -0.0259 95  TRP A CZ2 
661  C CZ3 . TRP A 50  ? 0.4938 0.4920 0.4893 -0.0362 -0.0264 -0.0366 95  TRP A CZ3 
662  C CH2 . TRP A 50  ? 0.4954 0.4863 0.4959 -0.0341 -0.0242 -0.0303 95  TRP A CH2 
673  N N   . ARG A 51  ? 0.5989 0.6058 0.6330 -0.0278 -0.1178 -0.0720 96  ARG A N   
674  C CA  . ARG A 51  ? 0.6512 0.6463 0.6643 -0.0292 -0.1325 -0.0875 96  ARG A CA  
675  C C   . ARG A 51  ? 0.5941 0.5869 0.6173 -0.0332 -0.1205 -0.0975 96  ARG A C   
676  O O   . ARG A 51  ? 0.6151 0.5942 0.6045 -0.0308 -0.1192 -0.1104 96  ARG A O   
677  C CB  . ARG A 51  ? 0.7328 0.7339 0.7721 -0.0305 -0.1616 -0.0926 96  ARG A CB  
678  C CG  . ARG A 51  ? 0.8068 0.8085 0.8326 -0.0231 -0.1789 -0.0844 96  ARG A CG  
679  C CD  . ARG A 51  ? 0.9022 0.9130 0.9547 -0.0243 -0.2118 -0.0918 96  ARG A CD  
680  N NE  . ARG A 51  ? 0.9518 0.9805 1.0332 -0.0173 -0.2227 -0.0791 96  ARG A NE  
681  C CZ  . ARG A 51  ? 1.0243 1.0421 1.0705 -0.0061 -0.2293 -0.0697 96  ARG A CZ  
682  N NH1 . ARG A 51  ? 1.0719 1.0621 1.0512 -0.0032 -0.2245 -0.0697 96  ARG A NH1 
683  N NH2 . ARG A 51  ? 1.0399 1.0743 1.1186 0.0028  -0.2397 -0.0593 96  ARG A NH2 
697  N N   . PHE A 52  ? 0.5518 0.5572 0.6195 -0.0378 -0.1113 -0.0914 97  PHE A N   
698  C CA  . PHE A 52  ? 0.5326 0.5331 0.6098 -0.0399 -0.1001 -0.0976 97  PHE A CA  
699  C C   . PHE A 52  ? 0.5151 0.5158 0.5662 -0.0354 -0.0776 -0.0955 97  PHE A C   
700  O O   . PHE A 52  ? 0.5179 0.5094 0.5448 -0.0314 -0.0727 -0.1071 97  PHE A O   
701  C CB  . PHE A 52  ? 0.5089 0.5219 0.6369 -0.0462 -0.0960 -0.0877 97  PHE A CB  
702  C CG  . PHE A 52  ? 0.5371 0.5473 0.6980 -0.0545 -0.1158 -0.0933 97  PHE A CG  
703  C CD1 . PHE A 52  ? 0.5475 0.5712 0.7320 -0.0580 -0.1333 -0.0904 97  PHE A CD1 
704  C CD2 . PHE A 52  ? 0.5529 0.5466 0.7247 -0.0589 -0.1182 -0.1015 97  PHE A CD2 
705  C CE1 . PHE A 52  ? 0.5649 0.5892 0.7863 -0.0686 -0.1532 -0.0958 97  PHE A CE1 
706  C CE2 . PHE A 52  ? 0.5770 0.5645 0.7818 -0.0697 -0.1379 -0.1067 97  PHE A CE2 
707  C CZ  . PHE A 52  ? 0.5755 0.5800 0.8067 -0.0759 -0.1554 -0.1039 97  PHE A CZ  
717  N N   . TYR A 53  ? 0.4942 0.5063 0.5512 -0.0354 -0.0643 -0.0818 98  TYR A N   
718  C CA  . TYR A 53  ? 0.4928 0.5090 0.5367 -0.0340 -0.0447 -0.0791 98  TYR A CA  
719  C C   . TYR A 53  ? 0.5245 0.5345 0.5271 -0.0319 -0.0397 -0.0853 98  TYR A C   
720  O O   . TYR A 53  ? 0.5416 0.5553 0.5363 -0.0295 -0.0276 -0.0918 98  TYR A O   
721  C CB  . TYR A 53  ? 0.4803 0.5053 0.5341 -0.0351 -0.0360 -0.0656 98  TYR A CB  
722  C CG  . TYR A 53  ? 0.4727 0.5025 0.5151 -0.0360 -0.0197 -0.0630 98  TYR A CG  
723  C CD1 . TYR A 53  ? 0.4687 0.5070 0.5271 -0.0351 -0.0108 -0.0640 98  TYR A CD1 
724  C CD2 . TYR A 53  ? 0.4883 0.5136 0.5057 -0.0384 -0.0147 -0.0584 98  TYR A CD2 
725  C CE1 . TYR A 53  ? 0.4642 0.5108 0.5167 -0.0364 0.0011  -0.0625 98  TYR A CE1 
726  C CE2 . TYR A 53  ? 0.4936 0.5253 0.5064 -0.0422 -0.0012 -0.0562 98  TYR A CE2 
727  C CZ  . TYR A 53  ? 0.4762 0.5208 0.5082 -0.0411 0.0058  -0.0591 98  TYR A CZ  
728  O OH  . TYR A 53  ? 0.4839 0.5387 0.5158 -0.0454 0.0161  -0.0578 98  TYR A OH  
738  N N   . SER A 54  ? 0.5917 0.5935 0.5675 -0.0317 -0.0481 -0.0824 99  SER A N   
739  C CA  . SER A 54  ? 0.6323 0.6279 0.5640 -0.0306 -0.0408 -0.0849 99  SER A CA  
740  C C   . SER A 54  ? 0.6647 0.6544 0.5765 -0.0251 -0.0434 -0.1027 99  SER A C   
741  O O   . SER A 54  ? 0.7114 0.7004 0.5868 -0.0227 -0.0319 -0.1063 99  SER A O   
742  C CB  . SER A 54  ? 0.6743 0.6575 0.5772 -0.0305 -0.0520 -0.0757 99  SER A CB  
743  O OG  . SER A 54  ? 0.7127 0.6867 0.6070 -0.0264 -0.0749 -0.0844 99  SER A OG  
749  N N   . HIS A 55  ? 0.6508 0.6351 0.5850 -0.0233 -0.0574 -0.1140 100 HIS A N   
750  C CA  . HIS A 55  ? 0.6689 0.6420 0.5858 -0.0167 -0.0617 -0.1341 100 HIS A CA  
751  C C   . HIS A 55  ? 0.6320 0.6081 0.5802 -0.0137 -0.0530 -0.1406 100 HIS A C   
752  O O   . HIS A 55  ? 0.6516 0.6131 0.5961 -0.0076 -0.0604 -0.1582 100 HIS A O   
753  C CB  . HIS A 55  ? 0.6881 0.6446 0.6006 -0.0171 -0.0898 -0.1448 100 HIS A CB  
754  C CG  . HIS A 55  ? 0.7186 0.6674 0.5858 -0.0151 -0.1008 -0.1436 100 HIS A CG  
755  N ND1 . HIS A 55  ? 0.7551 0.6952 0.5666 -0.0078 -0.0939 -0.1532 100 HIS A ND1 
756  C CD2 . HIS A 55  ? 0.7136 0.6620 0.5811 -0.0179 -0.1183 -0.1330 100 HIS A CD2 
757  C CE1 . HIS A 55  ? 0.7836 0.7154 0.5590 -0.0071 -0.1074 -0.1471 100 HIS A CE1 
758  N NE2 . HIS A 55  ? 0.7618 0.6981 0.5717 -0.0126 -0.1238 -0.1351 100 HIS A NE2 
767  N N   . MET A 56  ? 0.5911 0.5830 0.5672 -0.0168 -0.0392 -0.1273 101 MET A N   
768  C CA  . MET A 56  ? 0.5745 0.5706 0.5764 -0.0124 -0.0306 -0.1301 101 MET A CA  
769  C C   . MET A 56  ? 0.5515 0.5670 0.5443 -0.0080 -0.0092 -0.1288 101 MET A C   
770  O O   . MET A 56  ? 0.5240 0.5528 0.5104 -0.0144 0.0002  -0.1167 101 MET A O   
771  C CB  . MET A 56  ? 0.5376 0.5383 0.5784 -0.0187 -0.0331 -0.1156 101 MET A CB  
772  C CG  . MET A 56  ? 0.5467 0.5334 0.6077 -0.0244 -0.0520 -0.1165 101 MET A CG  
773  S SD  . MET A 56  ? 0.5347 0.5313 0.6388 -0.0321 -0.0498 -0.0969 101 MET A SD  
774  C CE  . MET A 56  ? 0.5210 0.5156 0.6364 -0.0253 -0.0380 -0.0954 101 MET A CE  
784  N N   . VAL A 57  ? 0.5584 0.5754 0.5529 0.0029  -0.0023 -0.1419 102 VAL A N   
785  C CA  . VAL A 57  ? 0.5539 0.5962 0.5513 0.0078  0.0176  -0.1412 102 VAL A CA  
786  C C   . VAL A 57  ? 0.5090 0.5672 0.5350 0.0000  0.0213  -0.1240 102 VAL A C   
787  O O   . VAL A 57  ? 0.4589 0.5072 0.5055 -0.0030 0.0109  -0.1166 102 VAL A O   
788  C CB  . VAL A 57  ? 0.5981 0.6395 0.6030 0.0244  0.0215  -0.1582 102 VAL A CB  
789  C CG1 . VAL A 57  ? 0.5967 0.6713 0.6196 0.0299  0.0397  -0.1557 102 VAL A CG1 
790  C CG2 . VAL A 57  ? 0.6616 0.6890 0.6294 0.0338  0.0211  -0.1782 102 VAL A CG2 
800  N N   . ARG A 58  ? 0.4681 0.5507 0.4943 -0.0044 0.0360  -0.1175 103 ARG A N   
801  C CA  . ARG A 58  ? 0.4460 0.5427 0.4960 -0.0111 0.0377  -0.1046 103 ARG A CA  
802  C C   . ARG A 58  ? 0.4263 0.5299 0.5045 -0.0006 0.0354  -0.1075 103 ARG A C   
803  O O   . ARG A 58  ? 0.4439 0.5518 0.5262 0.0122  0.0389  -0.1196 103 ARG A O   
804  C CB  . ARG A 58  ? 0.4990 0.6196 0.5463 -0.0199 0.0521  -0.0989 103 ARG A CB  
805  C CG  . ARG A 58  ? 0.5615 0.6732 0.5769 -0.0296 0.0564  -0.0937 103 ARG A CG  
806  C CD  . ARG A 58  ? 0.5997 0.6867 0.6061 -0.0354 0.0422  -0.0852 103 ARG A CD  
807  N NE  . ARG A 58  ? 0.6870 0.7661 0.6675 -0.0455 0.0456  -0.0755 103 ARG A NE  
808  C CZ  . ARG A 58  ? 0.7262 0.7834 0.6913 -0.0477 0.0337  -0.0691 103 ARG A CZ  
809  N NH1 . ARG A 58  ? 0.7335 0.7799 0.7104 -0.0421 0.0191  -0.0718 103 ARG A NH1 
810  N NH2 . ARG A 58  ? 0.7641 0.8109 0.7040 -0.0556 0.0364  -0.0588 103 ARG A NH2 
824  N N   . PRO A 59  ? 0.4381 0.5420 0.5333 -0.0040 0.0294  -0.0965 104 PRO A N   
825  C CA  . PRO A 59  ? 0.4517 0.5605 0.5694 0.0069  0.0258  -0.0964 104 PRO A CA  
826  C C   . PRO A 59  ? 0.4465 0.5845 0.5782 0.0157  0.0347  -0.1041 104 PRO A C   
827  O O   . PRO A 59  ? 0.4288 0.5661 0.5726 0.0313  0.0329  -0.1122 104 PRO A O   
828  C CB  . PRO A 59  ? 0.4334 0.5429 0.5575 -0.0002 0.0210  -0.0823 104 PRO A CB  
829  C CG  . PRO A 59  ? 0.4453 0.5409 0.5539 -0.0114 0.0196  -0.0769 104 PRO A CG  
830  C CD  . PRO A 59  ? 0.4502 0.5485 0.5417 -0.0154 0.0258  -0.0842 104 PRO A CD  
838  N N   . GLY A 60  ? 0.3641 0.5279 0.4971 0.0060  0.0442  -0.1015 105 GLY A N   
839  C CA  . GLY A 60  ? 0.3738 0.5739 0.5284 0.0119  0.0536  -0.1073 105 GLY A CA  
840  C C   . GLY A 60  ? 0.4304 0.6377 0.5806 0.0250  0.0650  -0.1218 105 GLY A C   
841  O O   . GLY A 60  ? 0.4032 0.6422 0.5773 0.0360  0.0729  -0.1288 105 GLY A O   
845  N N   . ASP A 61  ? 0.5510 0.7314 0.6713 0.0253  0.0653  -0.1278 106 ASP A N   
846  C CA  . ASP A 61  ? 0.6381 0.8192 0.7452 0.0396  0.0750  -0.1445 106 ASP A CA  
847  C C   . ASP A 61  ? 0.6511 0.8011 0.7588 0.0569  0.0620  -0.1561 106 ASP A C   
848  O O   . ASP A 61  ? 0.6915 0.8299 0.7805 0.0693  0.0658  -0.1730 106 ASP A O   
849  C CB  . ASP A 61  ? 0.7362 0.9056 0.8034 0.0299  0.0820  -0.1455 106 ASP A CB  
850  C CG  . ASP A 61  ? 0.7847 0.9758 0.8484 0.0109  0.0938  -0.1314 106 ASP A CG  
851  O OD1 . ASP A 61  ? 0.8075 1.0317 0.9018 0.0068  0.1013  -0.1260 106 ASP A OD1 
852  O OD2 . ASP A 61  ? 0.8308 1.0042 0.8620 -0.0001 0.0937  -0.1254 106 ASP A OD2 
857  N N   . LEU A 62  ? 0.5912 0.7247 0.7171 0.0577  0.0469  -0.1474 107 LEU A N   
858  C CA  . LEU A 62  ? 0.5967 0.6979 0.7274 0.0723  0.0342  -0.1554 107 LEU A CA  
859  C C   . LEU A 62  ? 0.6560 0.7746 0.8122 0.0945  0.0374  -0.1637 107 LEU A C   
860  O O   . LEU A 62  ? 0.6491 0.8018 0.8296 0.0955  0.0411  -0.1556 107 LEU A O   
861  C CB  . LEU A 62  ? 0.5605 0.6366 0.6992 0.0630  0.0189  -0.1391 107 LEU A CB  
862  C CG  . LEU A 62  ? 0.5268 0.5834 0.6480 0.0446  0.0129  -0.1315 107 LEU A CG  
863  C CD1 . LEU A 62  ? 0.4973 0.5375 0.6322 0.0376  0.0023  -0.1143 107 LEU A CD1 
864  C CD2 . LEU A 62  ? 0.5467 0.5759 0.6476 0.0467  0.0070  -0.1472 107 LEU A CD2 
876  N N   . THR A 63  ? 0.8236 0.9173 0.9755 0.1131  0.0336  -0.1807 108 THR A N   
877  C CA  . THR A 63  ? 0.8483 0.9529 1.0246 0.1390  0.0350  -0.1908 108 THR A CA  
878  C C   . THR A 63  ? 0.8824 0.9521 1.0742 0.1461  0.0155  -0.1807 108 THR A C   
879  O O   . THR A 63  ? 0.9507 0.9749 1.1292 0.1383  0.0027  -0.1781 108 THR A O   
880  C CB  . THR A 63  ? 0.9199 1.0144 1.0797 0.1591  0.0431  -0.2176 108 THR A CB  
881  O OG1 . THR A 63  ? 0.9372 1.0629 1.0761 0.1514  0.0631  -0.2239 108 THR A OG1 
882  C CG2 . THR A 63  ? 0.9583 1.0687 1.1473 0.1895  0.0461  -0.2292 108 THR A CG2 
890  N N   . GLY A 64  ? 0.7832 0.8751 1.0040 0.1600  0.0127  -0.1738 109 GLY A N   
891  C CA  . GLY A 64  ? 0.7775 0.8353 1.0103 0.1712  -0.0051 -0.1636 109 GLY A CA  
892  C C   . GLY A 64  ? 0.7170 0.7614 0.9450 0.1504  -0.0151 -0.1377 109 GLY A C   
893  O O   . GLY A 64  ? 0.6722 0.7401 0.8932 0.1300  -0.0092 -0.1278 109 GLY A O   
897  N N   . HIS A 65  ? 0.8734 0.8762 1.1040 0.1568  -0.0299 -0.1264 110 HIS A N   
898  C CA  . HIS A 65  ? 0.8775 0.8641 1.1027 0.1415  -0.0383 -0.1001 110 HIS A CA  
899  C C   . HIS A 65  ? 0.8251 0.7852 1.0333 0.1176  -0.0370 -0.0966 110 HIS A C   
900  O O   . HIS A 65  ? 0.8656 0.7808 1.0719 0.1147  -0.0457 -0.0936 110 HIS A O   
901  C CB  . HIS A 65  ? 0.9858 0.9370 1.2194 0.1587  -0.0530 -0.0880 110 HIS A CB  
902  C CG  . HIS A 65  ? 1.0482 0.9894 1.2742 0.1480  -0.0597 -0.0588 110 HIS A CG  
903  N ND1 . HIS A 65  ? 1.0778 0.9857 1.2914 0.1278  -0.0604 -0.0428 110 HIS A ND1 
904  C CD2 . HIS A 65  ? 1.0695 1.0301 1.2974 0.1559  -0.0662 -0.0428 110 HIS A CD2 
905  C CE1 . HIS A 65  ? 1.0826 0.9903 1.2879 0.1240  -0.0637 -0.0176 110 HIS A CE1 
906  N NE2 . HIS A 65  ? 1.0830 1.0201 1.2937 0.1412  -0.0686 -0.0176 110 HIS A NE2 
914  N N   . SER A 66  ? 0.6822 0.6709 0.8806 0.1001  -0.0271 -0.0969 111 SER A N   
915  C CA  . SER A 66  ? 0.6183 0.5915 0.8034 0.0798  -0.0259 -0.0969 111 SER A CA  
916  C C   . SER A 66  ? 0.5680 0.5562 0.7483 0.0616  -0.0225 -0.0773 111 SER A C   
917  O O   . SER A 66  ? 0.5329 0.5503 0.7142 0.0628  -0.0186 -0.0701 111 SER A O   
918  C CB  . SER A 66  ? 0.5976 0.5867 0.7700 0.0783  -0.0173 -0.1180 111 SER A CB  
919  O OG  . SER A 66  ? 0.6136 0.5877 0.7854 0.0967  -0.0187 -0.1391 111 SER A OG  
925  N N   . ASP A 67  ? 0.6216 0.5908 0.7984 0.0454  -0.0246 -0.0703 112 ASP A N   
926  C CA  . ASP A 67  ? 0.6244 0.6059 0.7975 0.0302  -0.0201 -0.0532 112 ASP A CA  
927  C C   . ASP A 67  ? 0.5884 0.5651 0.7589 0.0149  -0.0201 -0.0575 112 ASP A C   
928  O O   . ASP A 67  ? 0.6009 0.5530 0.7762 0.0124  -0.0280 -0.0658 112 ASP A O   
929  C CB  . ASP A 67  ? 0.6910 0.6547 0.8694 0.0283  -0.0229 -0.0305 112 ASP A CB  
930  C CG  . ASP A 67  ? 0.7573 0.7175 0.9372 0.0456  -0.0278 -0.0248 112 ASP A CG  
931  O OD1 . ASP A 67  ? 0.7780 0.7662 0.9557 0.0552  -0.0262 -0.0314 112 ASP A OD1 
932  O OD2 . ASP A 67  ? 0.8068 0.7358 0.9918 0.0494  -0.0343 -0.0126 112 ASP A OD2 
937  N N   . PHE A 68  ? 0.5277 0.5265 0.6908 0.0057  -0.0134 -0.0526 113 PHE A N   
938  C CA  . PHE A 68  ? 0.5084 0.5058 0.6733 -0.0078 -0.0145 -0.0505 113 PHE A CA  
939  C C   . PHE A 68  ? 0.4887 0.4903 0.6619 -0.0149 -0.0096 -0.0301 113 PHE A C   
940  O O   . PHE A 68  ? 0.4869 0.5009 0.6521 -0.0105 -0.0033 -0.0209 113 PHE A O   
941  C CB  . PHE A 68  ? 0.4973 0.5137 0.6469 -0.0110 -0.0102 -0.0590 113 PHE A CB  
942  C CG  . PHE A 68  ? 0.5119 0.5247 0.6485 -0.0067 -0.0128 -0.0778 113 PHE A CG  
943  C CD1 . PHE A 68  ? 0.5444 0.5341 0.6836 -0.0038 -0.0223 -0.0893 113 PHE A CD1 
944  C CD2 . PHE A 68  ? 0.5131 0.5443 0.6328 -0.0059 -0.0052 -0.0839 113 PHE A CD2 
945  C CE1 . PHE A 68  ? 0.5751 0.5610 0.6956 0.0023  -0.0236 -0.1083 113 PHE A CE1 
946  C CE2 . PHE A 68  ? 0.5443 0.5740 0.6474 -0.0015 -0.0043 -0.0995 113 PHE A CE2 
947  C CZ  . PHE A 68  ? 0.5581 0.5659 0.6593 0.0039  -0.0131 -0.1126 113 PHE A CZ  
957  N N   . HIS A 69  ? 0.4841 0.4773 0.6735 -0.0257 -0.0126 -0.0236 114 HIS A N   
958  C CA  . HIS A 69  ? 0.4838 0.4865 0.6833 -0.0328 -0.0043 -0.0044 114 HIS A CA  
959  C C   . HIS A 69  ? 0.4741 0.4910 0.6841 -0.0416 -0.0048 -0.0069 114 HIS A C   
960  O O   . HIS A 69  ? 0.4881 0.4980 0.7052 -0.0462 -0.0160 -0.0190 114 HIS A O   
961  C CB  . HIS A 69  ? 0.5130 0.4960 0.7314 -0.0387 -0.0053 0.0115  114 HIS A CB  
962  C CG  . HIS A 69  ? 0.5392 0.4975 0.7520 -0.0292 -0.0115 0.0107  114 HIS A CG  
963  N ND1 . HIS A 69  ? 0.5559 0.5082 0.7605 -0.0228 -0.0065 0.0283  114 HIS A ND1 
964  C CD2 . HIS A 69  ? 0.5611 0.4980 0.7742 -0.0230 -0.0228 -0.0059 114 HIS A CD2 
965  C CE1 . HIS A 69  ? 0.5844 0.5128 0.7877 -0.0125 -0.0156 0.0235  114 HIS A CE1 
966  N NE2 . HIS A 69  ? 0.5876 0.5064 0.7969 -0.0120 -0.0247 0.0019  114 HIS A NE2 
974  N N   . LEU A 70  ? 0.4698 0.5062 0.6787 -0.0419 0.0061  0.0035  115 LEU A N   
975  C CA  . LEU A 70  ? 0.4538 0.5067 0.6762 -0.0469 0.0064  0.0029  115 LEU A CA  
976  C C   . LEU A 70  ? 0.4446 0.5130 0.6817 -0.0492 0.0208  0.0214  115 LEU A C   
977  O O   . LEU A 70  ? 0.4406 0.5191 0.6587 -0.0414 0.0323  0.0259  115 LEU A O   
978  C CB  . LEU A 70  ? 0.4470 0.5081 0.6462 -0.0404 0.0062  -0.0081 115 LEU A CB  
979  C CG  . LEU A 70  ? 0.4554 0.5287 0.6654 -0.0422 0.0022  -0.0108 115 LEU A CG  
980  C CD1 . LEU A 70  ? 0.4598 0.5280 0.6910 -0.0502 -0.0134 -0.0169 115 LEU A CD1 
981  C CD2 . LEU A 70  ? 0.4434 0.5156 0.6253 -0.0362 0.0010  -0.0201 115 LEU A CD2 
993  N N   . PHE A 71  ? 0.4203 0.4907 0.6911 -0.0603 0.0203  0.0315  116 PHE A N   
994  C CA  . PHE A 71  ? 0.4248 0.5132 0.7145 -0.0643 0.0371  0.0514  116 PHE A CA  
995  C C   . PHE A 71  ? 0.3990 0.5123 0.7284 -0.0721 0.0359  0.0523  116 PHE A C   
996  O O   . PHE A 71  ? 0.3738 0.4842 0.7192 -0.0775 0.0179  0.0395  116 PHE A O   
997  C CB  . PHE A 71  ? 0.4471 0.5178 0.7472 -0.0730 0.0407  0.0688  116 PHE A CB  
998  C CG  . PHE A 71  ? 0.4666 0.5203 0.7297 -0.0624 0.0455  0.0743  116 PHE A CG  
999  C CD1 . PHE A 71  ? 0.4716 0.5084 0.7104 -0.0531 0.0330  0.0582  116 PHE A CD1 
1000 C CD2 . PHE A 71  ? 0.4970 0.5544 0.7498 -0.0609 0.0623  0.0962  116 PHE A CD2 
1001 C CE1 . PHE A 71  ? 0.4824 0.5083 0.6927 -0.0425 0.0348  0.0629  116 PHE A CE1 
1002 C CE2 . PHE A 71  ? 0.5122 0.5542 0.7293 -0.0499 0.0630  0.1014  116 PHE A CE2 
1003 C CZ  . PHE A 71  ? 0.5020 0.5293 0.7007 -0.0406 0.0479  0.0843  116 PHE A CZ  
1013 N N   . LYS A 72  ? 0.4021 0.5421 0.7467 -0.0711 0.0549  0.0669  117 LYS A N   
1014 C CA  . LYS A 72  ? 0.4063 0.5772 0.7980 -0.0780 0.0557  0.0701  117 LYS A CA  
1015 C C   . LYS A 72  ? 0.4189 0.5834 0.8535 -0.0984 0.0433  0.0754  117 LYS A C   
1016 O O   . LYS A 72  ? 0.4556 0.5985 0.8894 -0.1078 0.0462  0.0873  117 LYS A O   
1017 C CB  . LYS A 72  ? 0.4280 0.6308 0.8303 -0.0727 0.0830  0.0866  117 LYS A CB  
1018 C CG  . LYS A 72  ? 0.4039 0.6131 0.7681 -0.0519 0.0928  0.0777  117 LYS A CG  
1019 C CD  . LYS A 72  ? 0.4512 0.6874 0.8165 -0.0443 0.1219  0.0927  117 LYS A CD  
1020 C CE  . LYS A 72  ? 0.4439 0.6824 0.7717 -0.0226 0.1289  0.0799  117 LYS A CE  
1021 N NZ  . LYS A 72  ? 0.4826 0.7448 0.8032 -0.0123 0.1584  0.0920  117 LYS A NZ  
1035 N N   . GLU A 73  ? 0.4017 0.5819 0.8727 -0.1050 0.0266  0.0660  118 GLU A N   
1036 C CA  . GLU A 73  ? 0.4029 0.5799 0.9209 -0.1266 0.0123  0.0695  118 GLU A CA  
1037 C C   . GLU A 73  ? 0.4308 0.6206 0.9807 -0.1407 0.0345  0.0964  118 GLU A C   
1038 O O   . GLU A 73  ? 0.4449 0.6681 1.0030 -0.1347 0.0599  0.1109  118 GLU A O   
1039 C CB  . GLU A 73  ? 0.4052 0.6113 0.9654 -0.1306 -0.0055 0.0594  118 GLU A CB  
1040 C CG  . GLU A 73  ? 0.4205 0.6202 1.0275 -0.1536 -0.0286 0.0567  118 GLU A CG  
1041 C CD  . GLU A 73  ? 0.4300 0.6691 1.0877 -0.1576 -0.0451 0.0504  118 GLU A CD  
1042 O OE1 . GLU A 73  ? 0.4160 0.6925 1.0825 -0.1432 -0.0323 0.0540  118 GLU A OE1 
1043 O OE2 . GLU A 73  ? 0.4513 0.6833 1.1402 -0.1738 -0.0726 0.0408  118 GLU A OE2 
1050 N N   . GLY A 74  ? 0.5814 0.7417 1.1460 -0.1587 0.0258  0.1033  119 GLY A N   
1051 C CA  . GLY A 74  ? 0.5936 0.7587 1.1880 -0.1757 0.0452  0.1318  119 GLY A CA  
1052 C C   . GLY A 74  ? 0.6402 0.7808 1.1870 -0.1667 0.0653  0.1486  119 GLY A C   
1053 O O   . GLY A 74  ? 0.6736 0.8041 1.2360 -0.1817 0.0780  0.1737  119 GLY A O   
1057 N N   . ILE A 75  ? 0.6067 0.7374 1.0967 -0.1436 0.0676  0.1368  120 ILE A N   
1058 C CA  . ILE A 75  ? 0.6262 0.7322 1.0682 -0.1333 0.0804  0.1495  120 ILE A CA  
1059 C C   . ILE A 75  ? 0.6233 0.6807 1.0419 -0.1312 0.0576  0.1366  120 ILE A C   
1060 O O   . ILE A 75  ? 0.5935 0.6426 0.9960 -0.1217 0.0397  0.1109  120 ILE A O   
1061 C CB  . ILE A 75  ? 0.6253 0.7490 1.0219 -0.1101 0.0941  0.1431  120 ILE A CB  
1062 C CG1 . ILE A 75  ? 0.6352 0.8038 1.0506 -0.1087 0.1204  0.1570  120 ILE A CG1 
1063 C CG2 . ILE A 75  ? 0.6421 0.7369 0.9863 -0.0985 0.0988  0.1512  120 ILE A CG2 
1064 C CD1 . ILE A 75  ? 0.6296 0.8119 0.9998 -0.0856 0.1333  0.1487  120 ILE A CD1 
1076 N N   . LYS A 76  ? 0.6430 0.6683 1.0583 -0.1386 0.0595  0.1552  121 LYS A N   
1077 C CA  . LYS A 76  ? 0.6606 0.6385 1.0557 -0.1336 0.0389  0.1435  121 LYS A CA  
1078 C C   . LYS A 76  ? 0.6272 0.5974 0.9680 -0.1098 0.0425  0.1393  121 LYS A C   
1079 O O   . LYS A 76  ? 0.6206 0.6012 0.9384 -0.1033 0.0610  0.1589  121 LYS A O   
1080 C CB  . LYS A 76  ? 0.7290 0.6703 1.1452 -0.1508 0.0370  0.1657  121 LYS A CB  
1081 C CG  . LYS A 76  ? 0.7280 0.6807 1.2049 -0.1786 0.0343  0.1730  121 LYS A CG  
1082 C CD  . LYS A 76  ? 0.8229 0.7407 1.3219 -0.1989 0.0373  0.2015  121 LYS A CD  
1083 C CE  . LYS A 76  ? 0.8666 0.7218 1.3546 -0.1970 0.0112  0.1884  121 LYS A CE  
1084 N NZ  . LYS A 76  ? 0.9970 0.8126 1.5151 -0.2211 0.0100  0.2149  121 LYS A NZ  
1098 N N   . PRO A 77  ? 0.6069 0.5613 0.9262 -0.0963 0.0253  0.1139  122 PRO A N   
1099 C CA  . PRO A 77  ? 0.6173 0.5719 0.8927 -0.0752 0.0278  0.1090  122 PRO A CA  
1100 C C   . PRO A 77  ? 0.7054 0.6274 0.9617 -0.0677 0.0260  0.1252  122 PRO A C   
1101 O O   . PRO A 77  ? 0.6532 0.5685 0.8816 -0.0501 0.0191  0.1156  122 PRO A O   
1102 C CB  . PRO A 77  ? 0.5739 0.5266 0.8412 -0.0661 0.0116  0.0778  122 PRO A CB  
1103 C CG  . PRO A 77  ? 0.5836 0.5379 0.8832 -0.0806 0.0016  0.0661  122 PRO A CG  
1104 C CD  . PRO A 77  ? 0.6004 0.5417 0.9335 -0.0991 0.0040  0.0873  122 PRO A CD  
1112 N N   . MET A 78  ? 0.7287 0.6305 1.0012 -0.0810 0.0314  0.1508  123 MET A N   
1113 C CA  . MET A 78  ? 0.8737 0.7410 1.1260 -0.0739 0.0300  0.1717  123 MET A CA  
1114 C C   . MET A 78  ? 1.0412 0.9230 1.2753 -0.0764 0.0526  0.2038  123 MET A C   
1115 O O   . MET A 78  ? 0.9694 0.8855 1.2160 -0.0866 0.0706  0.2110  123 MET A O   
1116 C CB  . MET A 78  ? 1.0006 0.8216 1.2811 -0.0871 0.0167  0.1776  123 MET A CB  
1117 C CG  . MET A 78  ? 1.0099 0.8097 1.2986 -0.0800 -0.0061 0.1444  123 MET A CG  
1118 S SD  . MET A 78  ? 1.2015 0.9607 1.5352 -0.1041 -0.0219 0.1412  123 MET A SD  
1119 C CE  . MET A 78  ? 1.1859 0.9951 1.5550 -0.1260 -0.0138 0.1357  123 MET A CE  
1129 N N   . TRP A 79  ? 1.4304 1.2859 1.6329 -0.0650 0.0514  0.2232  124 TRP A N   
1130 C CA  . TRP A 79  ? 1.5441 1.4090 1.7166 -0.0638 0.0719  0.2542  124 TRP A CA  
1131 C C   . TRP A 79  ? 1.5520 1.3999 1.7470 -0.0863 0.0867  0.2891  124 TRP A C   
1132 O O   . TRP A 79  ? 1.5861 1.4430 1.7558 -0.0871 0.1078  0.3181  124 TRP A O   
1133 C CB  . TRP A 79  ? 1.5545 1.3993 1.6793 -0.0406 0.0618  0.2610  124 TRP A CB  
1134 C CG  . TRP A 79  ? 1.6094 1.4834 1.7080 -0.0211 0.0547  0.2339  124 TRP A CG  
1135 C CD1 . TRP A 79  ? 1.5682 1.4756 1.6805 -0.0223 0.0555  0.2054  124 TRP A CD1 
1136 C CD2 . TRP A 79  ? 1.6484 1.5199 1.7045 0.0010  0.0443  0.2341  124 TRP A CD2 
1137 N NE1 . TRP A 79  ? 1.5522 1.4762 1.6346 -0.0044 0.0476  0.1884  124 TRP A NE1 
1138 C CE2 . TRP A 79  ? 1.6051 1.5100 1.6547 0.0098  0.0399  0.2044  124 TRP A CE2 
1139 C CE3 . TRP A 79  ? 1.7144 1.5579 1.7377 0.0141  0.0365  0.2572  124 TRP A CE3 
1140 C CZ2 . TRP A 79  ? 1.6134 1.5274 1.6299 0.0290  0.0277  0.1957  124 TRP A CZ2 
1141 C CZ3 . TRP A 79  ? 1.7219 1.5760 1.7102 0.0357  0.0229  0.2481  124 TRP A CZ3 
1142 C CH2 . TRP A 79  ? 1.6734 1.5638 1.6609 0.0419  0.0185  0.2169  124 TRP A CH2 
1153 N N   . GLU A 80  ? 1.5400 1.3637 1.7808 -0.1053 0.0764  0.2871  125 GLU A N   
1154 C CA  . GLU A 80  ? 1.5917 1.4043 1.8646 -0.1322 0.0908  0.3194  125 GLU A CA  
1155 C C   . GLU A 80  ? 1.4484 1.3148 1.7573 -0.1496 0.1122  0.3204  125 GLU A C   
1156 O O   . GLU A 80  ? 1.4719 1.3478 1.7997 -0.1688 0.1346  0.3525  125 GLU A O   
1157 C CB  . GLU A 80  ? 1.5582 1.3210 1.8689 -0.1473 0.0685  0.3150  125 GLU A CB  
1158 C CG  . GLU A 80  ? 1.6323 1.3342 1.9140 -0.1326 0.0509  0.3243  125 GLU A CG  
1159 C CD  . GLU A 80  ? 1.6101 1.3143 1.8546 -0.0998 0.0346  0.2957  125 GLU A CD  
1160 O OE1 . GLU A 80  ? 1.5558 1.3042 1.7975 -0.0914 0.0361  0.2680  125 GLU A OE1 
1161 O OE2 . GLU A 80  ? 1.6505 1.3128 1.8708 -0.0826 0.0201  0.3018  125 GLU A OE2 
1168 N N   . ASP A 81  ? 1.2341 1.1363 1.5543 -0.1427 0.1062  0.2871  126 ASP A N   
1169 C CA  . ASP A 81  ? 1.0877 1.0436 1.4414 -0.1536 0.1243  0.2851  126 ASP A CA  
1170 C C   . ASP A 81  ? 1.0926 1.0788 1.4196 -0.1491 0.1575  0.3123  126 ASP A C   
1171 O O   . ASP A 81  ? 1.0434 1.0202 1.3128 -0.1290 0.1623  0.3183  126 ASP A O   
1172 C CB  . ASP A 81  ? 1.0363 1.0192 1.3870 -0.1389 0.1118  0.2464  126 ASP A CB  
1173 C CG  . ASP A 81  ? 0.9890 1.0219 1.3839 -0.1495 0.1223  0.2397  126 ASP A CG  
1174 O OD1 . ASP A 81  ? 0.9933 1.0264 1.4358 -0.1656 0.1063  0.2276  126 ASP A OD1 
1175 O OD2 . ASP A 81  ? 0.9909 1.0624 1.3719 -0.1399 0.1448  0.2446  126 ASP A OD2 
1180 N N   . ASP A 82  ? 1.2415 1.2663 1.6114 -0.1672 0.1804  0.3281  127 ASP A N   
1181 C CA  . ASP A 82  ? 1.3307 1.3874 1.6770 -0.1630 0.2163  0.3547  127 ASP A CA  
1182 C C   . ASP A 82  ? 1.2875 1.3772 1.5924 -0.1356 0.2236  0.3317  127 ASP A C   
1183 O O   . ASP A 82  ? 1.3618 1.4523 1.6093 -0.1189 0.2397  0.3435  127 ASP A O   
1184 C CB  . ASP A 82  ? 1.3439 1.4370 1.7423 -0.1846 0.2334  0.3646  127 ASP A CB  
1185 C CG  . ASP A 82  ? 1.4245 1.5335 1.7899 -0.1831 0.2660  0.3918  127 ASP A CG  
1186 O OD1 . ASP A 82  ? 1.4644 1.5450 1.7687 -0.1703 0.2725  0.4099  127 ASP A OD1 
1187 O OD2 . ASP A 82  ? 1.4354 1.5852 1.8350 -0.1942 0.2840  0.3950  127 ASP A OD2 
1192 N N   . ALA A 83  ? 1.2415 1.3548 1.5714 -0.1304 0.2099  0.2987  128 ALA A N   
1193 C CA  . ALA A 83  ? 1.2097 1.3483 1.5033 -0.1058 0.2142  0.2756  128 ALA A CA  
1194 C C   . ALA A 83  ? 1.1988 1.3052 1.4246 -0.0846 0.2004  0.2659  128 ALA A C   
1195 O O   . ALA A 83  ? 1.1996 1.3214 1.3852 -0.0649 0.2066  0.2524  128 ALA A O   
1196 C CB  . ALA A 83  ? 1.1743 1.3330 1.5053 -0.1051 0.1966  0.2435  128 ALA A CB  
1202 N N   . ASN A 84  ? 1.1804 1.2429 1.3951 -0.0878 0.1807  0.2714  129 ASN A N   
1203 C CA  . ASN A 84  ? 1.1488 1.1843 1.3081 -0.0679 0.1646  0.2622  129 ASN A CA  
1204 C C   . ASN A 84  ? 1.1211 1.1323 1.2358 -0.0631 0.1738  0.2938  129 ASN A C   
1205 O O   . ASN A 84  ? 1.0886 1.0849 1.1534 -0.0442 0.1622  0.2880  129 ASN A O   
1206 C CB  . ASN A 84  ? 1.1557 1.1606 1.3312 -0.0686 0.1333  0.2417  129 ASN A CB  
1207 C CG  . ASN A 84  ? 1.1512 1.1757 1.3645 -0.0733 0.1225  0.2121  129 ASN A CG  
1208 O OD1 . ASN A 84  ? 1.1568 1.1655 1.4070 -0.0859 0.1073  0.2047  129 ASN A OD1 
1209 N ND2 . ASN A 84  ? 1.1300 1.1856 1.3308 -0.0626 0.1291  0.1950  129 ASN A ND2 
1216 N N   . LYS A 85  ? 1.0198 1.0271 1.1514 -0.0801 0.1935  0.3279  130 LYS A N   
1217 C CA  . LYS A 85  ? 1.0126 0.9933 1.0967 -0.0757 0.2030  0.3620  130 LYS A CA  
1218 C C   . LYS A 85  ? 0.9976 0.9997 1.0172 -0.0542 0.2190  0.3627  130 LYS A C   
1219 O O   . LYS A 85  ? 1.0149 0.9918 0.9769 -0.0390 0.2117  0.3744  130 LYS A O   
1220 C CB  . LYS A 85  ? 1.0333 1.0103 1.1505 -0.1013 0.2259  0.4008  130 LYS A CB  
1221 C CG  . LYS A 85  ? 1.0836 1.0301 1.1489 -0.0985 0.2383  0.4419  130 LYS A CG  
1222 C CD  . LYS A 85  ? 1.1298 1.0709 1.2288 -0.1262 0.2566  0.4723  130 LYS A CD  
1223 C CE  . LYS A 85  ? 1.2218 1.1282 1.2601 -0.1220 0.2633  0.5047  130 LYS A CE  
1224 N NZ  . LYS A 85  ? 1.2748 1.1737 1.3402 -0.1496 0.2780  0.5275  130 LYS A NZ  
1238 N N   . ASN A 86  ? 1.0068 1.0536 1.0340 -0.0510 0.2392  0.3491  131 ASN A N   
1239 C CA  . ASN A 86  ? 1.0289 1.0954 0.9949 -0.0297 0.2548  0.3448  131 ASN A CA  
1240 C C   . ASN A 86  ? 0.9810 1.0592 0.9344 -0.0124 0.2361  0.3027  131 ASN A C   
1241 O O   . ASN A 86  ? 1.0291 1.1268 0.9417 0.0041  0.2485  0.2917  131 ASN A O   
1242 C CB  . ASN A 86  ? 1.0631 1.1706 1.0410 -0.0354 0.2956  0.3621  131 ASN A CB  
1243 C CG  . ASN A 86  ? 1.1061 1.2043 1.0922 -0.0541 0.3186  0.4079  131 ASN A CG  
1244 O OD1 . ASN A 86  ? 1.1639 1.2218 1.1110 -0.0531 0.3097  0.4312  131 ASN A OD1 
1245 N ND2 . ASN A 86  ? 1.1169 1.2486 1.1538 -0.0709 0.3391  0.4110  131 ASN A ND2 
1252 N N   . GLY A 87  ? 0.8997 0.9649 0.8857 -0.0160 0.2073  0.2790  132 GLY A N   
1253 C CA  . GLY A 87  ? 0.8268 0.9015 0.8066 -0.0036 0.1899  0.2419  132 GLY A CA  
1254 C C   . GLY A 87  ? 0.8273 0.8753 0.7707 0.0092  0.1613  0.2299  132 GLY A C   
1255 O O   . GLY A 87  ? 0.8576 0.8783 0.7841 0.0102  0.1515  0.2485  132 GLY A O   
1259 N N   . GLY A 88  ? 0.8304 0.8877 0.7642 0.0192  0.1475  0.1986  133 GLY A N   
1260 C CA  . GLY A 88  ? 0.8087 0.8499 0.7188 0.0297  0.1200  0.1832  133 GLY A CA  
1261 C C   . GLY A 88  ? 0.7546 0.8034 0.6958 0.0270  0.1037  0.1522  133 GLY A C   
1262 O O   . GLY A 88  ? 0.7064 0.7684 0.6859 0.0173  0.1114  0.1442  133 GLY A O   
1266 N N   . LYS A 89  ? 0.7024 0.7447 0.6285 0.0354  0.0810  0.1358  134 LYS A N   
1267 C CA  . LYS A 89  ? 0.6493 0.6990 0.6016 0.0321  0.0670  0.1086  134 LYS A CA  
1268 C C   . LYS A 89  ? 0.6395 0.6918 0.5621 0.0424  0.0494  0.0912  134 LYS A C   
1269 O O   . LYS A 89  ? 0.6541 0.6983 0.5494 0.0518  0.0380  0.0995  134 LYS A O   
1270 C CB  . LYS A 89  ? 0.6449 0.6835 0.6371 0.0247  0.0555  0.1080  134 LYS A CB  
1271 C CG  . LYS A 89  ? 0.6898 0.7106 0.6722 0.0330  0.0396  0.1177  134 LYS A CG  
1272 C CD  . LYS A 89  ? 0.6968 0.7032 0.7181 0.0276  0.0307  0.1154  134 LYS A CD  
1273 C CE  . LYS A 89  ? 0.7465 0.7349 0.7612 0.0397  0.0137  0.1227  134 LYS A CE  
1274 N NZ  . LYS A 89  ? 0.7414 0.7120 0.7912 0.0375  0.0052  0.1178  134 LYS A NZ  
1288 N N   . TRP A 90  ? 0.5930 0.6558 0.5221 0.0400  0.0458  0.0679  135 TRP A N   
1289 C CA  . TRP A 90  ? 0.5774 0.6436 0.4915 0.0445  0.0267  0.0490  135 TRP A CA  
1290 C C   . TRP A 90  ? 0.5749 0.6440 0.5246 0.0396  0.0120  0.0408  135 TRP A C   
1291 O O   . TRP A 90  ? 0.5511 0.6208 0.5339 0.0310  0.0172  0.0378  135 TRP A O   
1292 C CB  . TRP A 90  ? 0.5532 0.6246 0.4581 0.0428  0.0296  0.0290  135 TRP A CB  
1293 C CG  . TRP A 90  ? 0.5728 0.6411 0.4312 0.0531  0.0377  0.0295  135 TRP A CG  
1294 C CD1 . TRP A 90  ? 0.5831 0.6537 0.4319 0.0566  0.0595  0.0329  135 TRP A CD1 
1295 C CD2 . TRP A 90  ? 0.6072 0.6708 0.4208 0.0632  0.0239  0.0251  135 TRP A CD2 
1296 N NE1 . TRP A 90  ? 0.6275 0.6938 0.4247 0.0692  0.0624  0.0303  135 TRP A NE1 
1297 C CE2 . TRP A 90  ? 0.6470 0.7071 0.4194 0.0729  0.0394  0.0252  135 TRP A CE2 
1298 C CE3 . TRP A 90  ? 0.6095 0.6736 0.4148 0.0659  -0.0010 0.0202  135 TRP A CE3 
1299 C CZ2 . TRP A 90  ? 0.6997 0.7526 0.4165 0.0850  0.0299  0.0196  135 TRP A CZ2 
1300 C CZ3 . TRP A 90  ? 0.6585 0.7176 0.4136 0.0768  -0.0127 0.0157  135 TRP A CZ3 
1301 C CH2 . TRP A 90  ? 0.7070 0.7585 0.4152 0.0861  0.0022  0.0148  135 TRP A CH2 
1312 N N   . ILE A 91  ? 0.6691 0.7418 0.6116 0.0463  -0.0067 0.0368  136 ILE A N   
1313 C CA  . ILE A 91  ? 0.6872 0.7669 0.6632 0.0455  -0.0194 0.0299  136 ILE A CA  
1314 C C   . ILE A 91  ? 0.6659 0.7633 0.6457 0.0431  -0.0337 0.0096  136 ILE A C   
1315 O O   . ILE A 91  ? 0.6948 0.7958 0.6476 0.0485  -0.0457 0.0061  136 ILE A O   
1316 C CB  . ILE A 91  ? 0.7581 0.8291 0.7323 0.0573  -0.0296 0.0458  136 ILE A CB  
1317 C CG1 . ILE A 91  ? 0.8155 0.8651 0.7898 0.0559  -0.0152 0.0676  136 ILE A CG1 
1318 C CG2 . ILE A 91  ? 0.7726 0.8543 0.7827 0.0605  -0.0423 0.0355  136 ILE A CG2 
1319 C CD1 . ILE A 91  ? 0.8675 0.9003 0.8262 0.0681  -0.0240 0.0886  136 ILE A CD1 
1331 N N   . ILE A 92  ? 0.5789 0.6872 0.5912 0.0343  -0.0330 -0.0032 137 ILE A N   
1332 C CA  . ILE A 92  ? 0.5473 0.6753 0.5731 0.0288  -0.0450 -0.0200 137 ILE A CA  
1333 C C   . ILE A 92  ? 0.5047 0.6486 0.5672 0.0319  -0.0497 -0.0226 137 ILE A C   
1334 O O   . ILE A 92  ? 0.4653 0.6060 0.5474 0.0280  -0.0386 -0.0237 137 ILE A O   
1335 C CB  . ILE A 92  ? 0.5391 0.6662 0.5673 0.0147  -0.0371 -0.0324 137 ILE A CB  
1336 C CG1 . ILE A 92  ? 0.5554 0.6648 0.5492 0.0155  -0.0298 -0.0308 137 ILE A CG1 
1337 C CG2 . ILE A 92  ? 0.5310 0.6770 0.5730 0.0062  -0.0501 -0.0471 137 ILE A CG2 
1338 C CD1 . ILE A 92  ? 0.5514 0.6536 0.5479 0.0046  -0.0217 -0.0409 137 ILE A CD1 
1350 N N   . ARG A 93  ? 0.4856 0.6472 0.5567 0.0404  -0.0667 -0.0245 138 ARG A N   
1351 C CA  . ARG A 93  ? 0.4706 0.6530 0.5797 0.0468  -0.0713 -0.0289 138 ARG A CA  
1352 C C   . ARG A 93  ? 0.4493 0.6623 0.5850 0.0340  -0.0731 -0.0451 138 ARG A C   
1353 O O   . ARG A 93  ? 0.4553 0.6860 0.5917 0.0306  -0.0883 -0.0515 138 ARG A O   
1354 C CB  . ARG A 93  ? 0.4904 0.6773 0.5988 0.0655  -0.0894 -0.0204 138 ARG A CB  
1355 C CG  . ARG A 93  ? 0.5040 0.6569 0.5858 0.0762  -0.0859 -0.0007 138 ARG A CG  
1356 C CD  . ARG A 93  ? 0.5319 0.6840 0.6046 0.0954  -0.1059 0.0108  138 ARG A CD  
1357 N NE  . ARG A 93  ? 0.5168 0.6890 0.6302 0.1085  -0.1160 0.0048  138 ARG A NE  
1358 C CZ  . ARG A 93  ? 0.5449 0.7172 0.6600 0.1288  -0.1349 0.0141  138 ARG A CZ  
1359 N NH1 . ARG A 93  ? 0.5811 0.7326 0.6548 0.1369  -0.1459 0.0315  138 ARG A NH1 
1360 N NH2 . ARG A 93  ? 0.5361 0.7297 0.6930 0.1429  -0.1426 0.0064  138 ARG A NH2 
1374 N N   . LEU A 94  ? 0.4517 0.6696 0.6077 0.0258  -0.0580 -0.0512 139 LEU A N   
1375 C CA  . LEU A 94  ? 0.4378 0.6795 0.6152 0.0099  -0.0537 -0.0627 139 LEU A CA  
1376 C C   . LEU A 94  ? 0.4318 0.7105 0.6514 0.0159  -0.0537 -0.0692 139 LEU A C   
1377 O O   . LEU A 94  ? 0.4322 0.7101 0.6629 0.0320  -0.0507 -0.0673 139 LEU A O   
1378 C CB  . LEU A 94  ? 0.4274 0.6503 0.5943 -0.0026 -0.0356 -0.0636 139 LEU A CB  
1379 C CG  . LEU A 94  ? 0.4364 0.6274 0.5680 -0.0076 -0.0331 -0.0586 139 LEU A CG  
1380 C CD1 . LEU A 94  ? 0.4207 0.5939 0.5464 -0.0145 -0.0176 -0.0577 139 LEU A CD1 
1381 C CD2 . LEU A 94  ? 0.4437 0.6368 0.5649 -0.0189 -0.0425 -0.0651 139 LEU A CD2 
1393 N N   . ARG A 95  ? 0.4175 0.7287 0.6625 0.0026  -0.0567 -0.0774 140 ARG A N   
1394 C CA  . ARG A 95  ? 0.4117 0.7642 0.7007 0.0043  -0.0493 -0.0841 140 ARG A CA  
1395 C C   . ARG A 95  ? 0.3761 0.7190 0.6613 -0.0004 -0.0252 -0.0856 140 ARG A C   
1396 O O   . ARG A 95  ? 0.3454 0.6582 0.6015 -0.0129 -0.0166 -0.0827 140 ARG A O   
1397 C CB  . ARG A 95  ? 0.4340 0.8247 0.7540 -0.0139 -0.0563 -0.0907 140 ARG A CB  
1398 C CG  . ARG A 95  ? 0.4716 0.8444 0.7743 -0.0404 -0.0482 -0.0913 140 ARG A CG  
1399 C CD  . ARG A 95  ? 0.5214 0.9292 0.8584 -0.0613 -0.0572 -0.0972 140 ARG A CD  
1400 N NE  . ARG A 95  ? 0.5521 1.0081 0.9375 -0.0663 -0.0418 -0.0994 140 ARG A NE  
1401 C CZ  . ARG A 95  ? 0.6025 1.1029 1.0337 -0.0834 -0.0469 -0.1035 140 ARG A CZ  
1402 N NH1 . ARG A 95  ? 0.6288 1.1281 1.0625 -0.0977 -0.0708 -0.1076 140 ARG A NH1 
1403 N NH2 . ARG A 95  ? 0.6136 1.1610 1.0889 -0.0865 -0.0280 -0.1041 140 ARG A NH2 
1417 N N   . LYS A 96  ? 0.3195 0.6885 0.6330 0.0116  -0.0153 -0.0910 141 LYS A N   
1418 C CA  . LYS A 96  ? 0.3006 0.6614 0.6061 0.0102  0.0065  -0.0943 141 LYS A CA  
1419 C C   . LYS A 96  ? 0.2814 0.6458 0.5801 -0.0155 0.0193  -0.0933 141 LYS A C   
1420 O O   . LYS A 96  ? 0.2810 0.6720 0.6011 -0.0315 0.0157  -0.0934 141 LYS A O   
1421 C CB  . LYS A 96  ? 0.3386 0.7344 0.6779 0.0280  0.0160  -0.1032 141 LYS A CB  
1422 C CG  . LYS A 96  ? 0.3563 0.7321 0.6932 0.0558  0.0080  -0.1048 141 LYS A CG  
1423 C CD  . LYS A 96  ? 0.3966 0.7201 0.6935 0.0568  0.0131  -0.1028 141 LYS A CD  
1424 C CE  . LYS A 96  ? 0.4323 0.7363 0.7316 0.0825  0.0096  -0.1075 141 LYS A CE  
1425 N NZ  . LYS A 96  ? 0.4502 0.7090 0.7170 0.0804  0.0154  -0.1088 141 LYS A NZ  
1439 N N   . GLY A 97  ? 0.3295 0.6642 0.5979 -0.0200 0.0323  -0.0919 142 GLY A N   
1440 C CA  . GLY A 97  ? 0.3261 0.6585 0.5830 -0.0416 0.0455  -0.0888 142 GLY A CA  
1441 C C   . GLY A 97  ? 0.3359 0.6294 0.5610 -0.0554 0.0380  -0.0819 142 GLY A C   
1442 O O   . GLY A 97  ? 0.3497 0.6327 0.5606 -0.0719 0.0473  -0.0778 142 GLY A O   
1446 N N   . LEU A 98  ? 0.3686 0.6399 0.5809 -0.0478 0.0224  -0.0798 143 LEU A N   
1447 C CA  . LEU A 98  ? 0.3875 0.6251 0.5715 -0.0572 0.0160  -0.0751 143 LEU A CA  
1448 C C   . LEU A 98  ? 0.4082 0.6118 0.5656 -0.0470 0.0165  -0.0712 143 LEU A C   
1449 O O   . LEU A 98  ? 0.4292 0.6069 0.5646 -0.0535 0.0156  -0.0675 143 LEU A O   
1450 C CB  . LEU A 98  ? 0.3816 0.6222 0.5687 -0.0579 -0.0014 -0.0761 143 LEU A CB  
1451 C CG  . LEU A 98  ? 0.3690 0.6455 0.5880 -0.0691 -0.0080 -0.0810 143 LEU A CG  
1452 C CD1 . LEU A 98  ? 0.3807 0.6542 0.5943 -0.0669 -0.0293 -0.0837 143 LEU A CD1 
1453 C CD2 . LEU A 98  ? 0.3818 0.6587 0.6049 -0.0928 0.0011  -0.0800 143 LEU A CD2 
1465 N N   . ALA A 99  ? 0.3865 0.5894 0.5481 -0.0313 0.0172  -0.0721 144 ALA A N   
1466 C CA  . ALA A 99  ? 0.3703 0.5436 0.5139 -0.0236 0.0147  -0.0672 144 ALA A CA  
1467 C C   . ALA A 99  ? 0.3509 0.5041 0.4767 -0.0305 0.0218  -0.0663 144 ALA A C   
1468 O O   . ALA A 99  ? 0.3444 0.4760 0.4565 -0.0307 0.0191  -0.0611 144 ALA A O   
1469 C CB  . ALA A 99  ? 0.3821 0.5553 0.5367 -0.0072 0.0124  -0.0684 144 ALA A CB  
1475 N N   . SER A 100 ? 0.3408 0.5022 0.4662 -0.0349 0.0310  -0.0709 145 SER A N   
1476 C CA  . SER A 100 ? 0.3516 0.4925 0.4560 -0.0391 0.0347  -0.0698 145 SER A CA  
1477 C C   . SER A 100 ? 0.3462 0.4703 0.4360 -0.0495 0.0318  -0.0630 145 SER A C   
1478 O O   . SER A 100 ? 0.3459 0.4495 0.4236 -0.0477 0.0280  -0.0598 145 SER A O   
1479 C CB  . SER A 100 ? 0.3419 0.4950 0.4413 -0.0421 0.0463  -0.0748 145 SER A CB  
1480 O OG  . SER A 100 ? 0.3377 0.4994 0.4457 -0.0283 0.0489  -0.0839 145 SER A OG  
1486 N N   . ARG A 101 ? 0.3818 0.5141 0.4752 -0.0601 0.0323  -0.0616 146 ARG A N   
1487 C CA  . ARG A 101 ? 0.4079 0.5188 0.4863 -0.0684 0.0285  -0.0571 146 ARG A CA  
1488 C C   . ARG A 101 ? 0.4199 0.5192 0.4952 -0.0602 0.0204  -0.0562 146 ARG A C   
1489 O O   . ARG A 101 ? 0.4152 0.4936 0.4769 -0.0591 0.0184  -0.0532 146 ARG A O   
1490 C CB  . ARG A 101 ? 0.4170 0.5361 0.5014 -0.0838 0.0297  -0.0569 146 ARG A CB  
1491 C CG  . ARG A 101 ? 0.4304 0.5536 0.5104 -0.0958 0.0409  -0.0530 146 ARG A CG  
1492 C CD  . ARG A 101 ? 0.4584 0.5823 0.5452 -0.1151 0.0410  -0.0500 146 ARG A CD  
1493 N NE  . ARG A 101 ? 0.4727 0.6053 0.5576 -0.1287 0.0551  -0.0431 146 ARG A NE  
1494 C CZ  . ARG A 101 ? 0.4963 0.6013 0.5542 -0.1357 0.0595  -0.0335 146 ARG A CZ  
1495 N NH1 . ARG A 101 ? 0.5188 0.6342 0.5725 -0.1481 0.0746  -0.0255 146 ARG A NH1 
1496 N NH2 . ARG A 101 ? 0.5035 0.5720 0.5387 -0.1293 0.0493  -0.0310 146 ARG A NH2 
1510 N N   . CYS A 102 ? 0.4215 0.5347 0.5081 -0.0532 0.0162  -0.0581 147 CYS A N   
1511 C CA  . CYS A 102 ? 0.4581 0.5614 0.5366 -0.0449 0.0111  -0.0555 147 CYS A CA  
1512 C C   . CYS A 102 ? 0.4358 0.5282 0.5125 -0.0368 0.0142  -0.0502 147 CYS A C   
1513 O O   . CYS A 102 ? 0.4037 0.4846 0.4717 -0.0330 0.0147  -0.0465 147 CYS A O   
1514 C CB  . CYS A 102 ? 0.4669 0.5863 0.5538 -0.0386 0.0047  -0.0566 147 CYS A CB  
1515 S SG  . CYS A 102 ? 0.5173 0.6531 0.6117 -0.0493 -0.0040 -0.0641 147 CYS A SG  
1521 N N   . TRP A 103 ? 0.3668 0.4639 0.4538 -0.0339 0.0162  -0.0506 148 TRP A N   
1522 C CA  . TRP A 103 ? 0.3690 0.4552 0.4585 -0.0296 0.0165  -0.0468 148 TRP A CA  
1523 C C   . TRP A 103 ? 0.3957 0.4699 0.4763 -0.0336 0.0168  -0.0455 148 TRP A C   
1524 O O   . TRP A 103 ? 0.3857 0.4543 0.4688 -0.0303 0.0167  -0.0404 148 TRP A O   
1525 C CB  . TRP A 103 ? 0.3583 0.4468 0.4565 -0.0267 0.0163  -0.0516 148 TRP A CB  
1526 C CG  . TRP A 103 ? 0.3591 0.4348 0.4631 -0.0245 0.0132  -0.0499 148 TRP A CG  
1527 C CD1 . TRP A 103 ? 0.3497 0.4180 0.4502 -0.0260 0.0106  -0.0562 148 TRP A CD1 
1528 C CD2 . TRP A 103 ? 0.3539 0.4231 0.4687 -0.0217 0.0115  -0.0414 148 TRP A CD2 
1529 N NE1 . TRP A 103 ? 0.3620 0.4196 0.4739 -0.0253 0.0048  -0.0538 148 TRP A NE1 
1530 C CE2 . TRP A 103 ? 0.3607 0.4195 0.4839 -0.0237 0.0067  -0.0435 148 TRP A CE2 
1531 C CE3 . TRP A 103 ? 0.3374 0.4085 0.4538 -0.0184 0.0137  -0.0315 148 TRP A CE3 
1532 C CZ2 . TRP A 103 ? 0.3715 0.4231 0.5112 -0.0250 0.0046  -0.0351 148 TRP A CZ2 
1533 C CZ3 . TRP A 103 ? 0.3794 0.4432 0.5073 -0.0183 0.0144  -0.0215 148 TRP A CZ3 
1534 C CH2 . TRP A 103 ? 0.3669 0.4218 0.5097 -0.0228 0.0102  -0.0228 148 TRP A CH2 
1545 N N   . GLU A 104 ? 0.4454 0.5169 0.5163 -0.0402 0.0176  -0.0488 149 GLU A N   
1546 C CA  . GLU A 104 ? 0.4801 0.5373 0.5403 -0.0423 0.0154  -0.0463 149 GLU A CA  
1547 C C   . GLU A 104 ? 0.4919 0.5403 0.5477 -0.0400 0.0148  -0.0435 149 GLU A C   
1548 O O   . GLU A 104 ? 0.4918 0.5350 0.5512 -0.0341 0.0131  -0.0403 149 GLU A O   
1549 C CB  . GLU A 104 ? 0.5029 0.5559 0.5482 -0.0504 0.0176  -0.0474 149 GLU A CB  
1550 C CG  . GLU A 104 ? 0.5294 0.5646 0.5597 -0.0506 0.0127  -0.0433 149 GLU A CG  
1551 C CD  . GLU A 104 ? 0.5528 0.5811 0.5624 -0.0592 0.0163  -0.0409 149 GLU A CD  
1552 O OE1 . GLU A 104 ? 0.5637 0.5782 0.5629 -0.0660 0.0169  -0.0357 149 GLU A OE1 
1553 O OE2 . GLU A 104 ? 0.5507 0.5855 0.5527 -0.0591 0.0191  -0.0441 149 GLU A OE2 
1560 N N   . ASN A 105 ? 0.4530 0.5008 0.5024 -0.0439 0.0155  -0.0460 150 ASN A N   
1561 C CA  . ASN A 105 ? 0.4536 0.4891 0.4939 -0.0400 0.0143  -0.0468 150 ASN A CA  
1562 C C   . ASN A 105 ? 0.4486 0.4908 0.4947 -0.0288 0.0173  -0.0442 150 ASN A C   
1563 O O   . ASN A 105 ? 0.4490 0.4835 0.4916 -0.0211 0.0191  -0.0436 150 ASN A O   
1564 C CB  . ASN A 105 ? 0.4416 0.4759 0.4751 -0.0472 0.0116  -0.0523 150 ASN A CB  
1565 C CG  . ASN A 105 ? 0.4437 0.4676 0.4720 -0.0607 0.0104  -0.0524 150 ASN A CG  
1566 O OD1 . ASN A 105 ? 0.4402 0.4486 0.4606 -0.0619 0.0107  -0.0479 150 ASN A OD1 
1567 N ND2 . ASN A 105 ? 0.4407 0.4738 0.4742 -0.0715 0.0085  -0.0562 150 ASN A ND2 
1574 N N   . LEU A 106 ? 0.4059 0.4624 0.4612 -0.0269 0.0190  -0.0418 151 LEU A N   
1575 C CA  . LEU A 106 ? 0.4219 0.4843 0.4814 -0.0183 0.0240  -0.0357 151 LEU A CA  
1576 C C   . LEU A 106 ? 0.4224 0.4866 0.4981 -0.0158 0.0268  -0.0301 151 LEU A C   
1577 O O   . LEU A 106 ? 0.4224 0.4890 0.5003 -0.0088 0.0326  -0.0268 151 LEU A O   
1578 C CB  . LEU A 106 ? 0.4193 0.4915 0.4849 -0.0174 0.0234  -0.0318 151 LEU A CB  
1579 C CG  . LEU A 106 ? 0.4499 0.5260 0.5203 -0.0110 0.0299  -0.0209 151 LEU A CG  
1580 C CD1 . LEU A 106 ? 0.4572 0.5323 0.5097 -0.0036 0.0366  -0.0198 151 LEU A CD1 
1581 C CD2 . LEU A 106 ? 0.4421 0.5215 0.5144 -0.0089 0.0270  -0.0157 151 LEU A CD2 
1593 N N   . ILE A 107 ? 0.4475 0.5126 0.5356 -0.0209 0.0222  -0.0301 152 ILE A N   
1594 C CA  . ILE A 107 ? 0.4541 0.5231 0.5616 -0.0201 0.0211  -0.0257 152 ILE A CA  
1595 C C   . ILE A 107 ? 0.4746 0.5389 0.5801 -0.0163 0.0185  -0.0271 152 ILE A C   
1596 O O   . ILE A 107 ? 0.4603 0.5338 0.5847 -0.0117 0.0199  -0.0228 152 ILE A O   
1597 C CB  . ILE A 107 ? 0.4633 0.5306 0.5805 -0.0257 0.0137  -0.0282 152 ILE A CB  
1598 C CG1 . ILE A 107 ? 0.4726 0.5314 0.5723 -0.0292 0.0082  -0.0358 152 ILE A CG1 
1599 C CG2 . ILE A 107 ? 0.4683 0.5371 0.5900 -0.0261 0.0157  -0.0264 152 ILE A CG2 
1600 C CD1 . ILE A 107 ? 0.4816 0.5370 0.5835 -0.0322 0.0014  -0.0412 152 ILE A CD1 
1612 N N   . LEU A 108 ? 0.4150 0.4653 0.5001 -0.0182 0.0148  -0.0322 153 LEU A N   
1613 C CA  . LEU A 108 ? 0.4323 0.4719 0.5126 -0.0123 0.0113  -0.0325 153 LEU A CA  
1614 C C   . LEU A 108 ? 0.4488 0.4918 0.5314 -0.0012 0.0192  -0.0324 153 LEU A C   
1615 O O   . LEU A 108 ? 0.4232 0.4711 0.5196 0.0082  0.0193  -0.0306 153 LEU A O   
1616 C CB  . LEU A 108 ? 0.4096 0.4284 0.4655 -0.0182 0.0070  -0.0356 153 LEU A CB  
1617 C CG  . LEU A 108 ? 0.3996 0.4133 0.4469 -0.0266 0.0011  -0.0346 153 LEU A CG  
1618 C CD1 . LEU A 108 ? 0.4166 0.4099 0.4405 -0.0341 0.0003  -0.0340 153 LEU A CD1 
1619 C CD2 . LEU A 108 ? 0.4022 0.4163 0.4573 -0.0217 -0.0081 -0.0317 153 LEU A CD2 
1631 N N   . ALA A 109 ? 0.4555 0.4974 0.5241 -0.0007 0.0256  -0.0353 154 ALA A N   
1632 C CA  . ALA A 109 ? 0.4661 0.5096 0.5288 0.0116  0.0343  -0.0372 154 ALA A CA  
1633 C C   . ALA A 109 ? 0.4578 0.5259 0.5435 0.0172  0.0450  -0.0285 154 ALA A C   
1634 O O   . ALA A 109 ? 0.4655 0.5424 0.5594 0.0294  0.0535  -0.0279 154 ALA A O   
1635 C CB  . ALA A 109 ? 0.4970 0.5318 0.5340 0.0103  0.0351  -0.0435 154 ALA A CB  
1641 N N   . MET A 110 ? 0.4312 0.5107 0.5295 0.0086  0.0457  -0.0213 155 MET A N   
1642 C CA  . MET A 110 ? 0.4138 0.5144 0.5376 0.0097  0.0556  -0.0103 155 MET A CA  
1643 C C   . MET A 110 ? 0.4166 0.5303 0.5733 0.0109  0.0524  -0.0080 155 MET A C   
1644 O O   . MET A 110 ? 0.4177 0.5507 0.5941 0.0190  0.0634  -0.0031 155 MET A O   
1645 C CB  . MET A 110 ? 0.3911 0.4930 0.5217 -0.0006 0.0536  -0.0034 155 MET A CB  
1646 C CG  . MET A 110 ? 0.3873 0.5067 0.5471 -0.0037 0.0629  0.0106  155 MET A CG  
1647 S SD  . MET A 110 ? 0.3631 0.4740 0.5282 -0.0144 0.0586  0.0189  155 MET A SD  
1648 C CE  . MET A 110 ? 0.3688 0.4700 0.5485 -0.0228 0.0400  0.0079  155 MET A CE  
1658 N N   . LEU A 111 ? 0.4106 0.5163 0.5738 0.0036  0.0374  -0.0115 156 LEU A N   
1659 C CA  . LEU A 111 ? 0.4380 0.5557 0.6310 0.0051  0.0293  -0.0102 156 LEU A CA  
1660 C C   . LEU A 111 ? 0.4446 0.5627 0.6364 0.0202  0.0309  -0.0137 156 LEU A C   
1661 O O   . LEU A 111 ? 0.4374 0.5776 0.6621 0.0272  0.0318  -0.0102 156 LEU A O   
1662 C CB  . LEU A 111 ? 0.4605 0.5647 0.6484 -0.0036 0.0114  -0.0150 156 LEU A CB  
1663 C CG  . LEU A 111 ? 0.4843 0.5858 0.6758 -0.0158 0.0074  -0.0147 156 LEU A CG  
1664 C CD1 . LEU A 111 ? 0.5021 0.5891 0.6801 -0.0205 -0.0088 -0.0223 156 LEU A CD1 
1665 C CD2 . LEU A 111 ? 0.4961 0.6168 0.7266 -0.0214 0.0097  -0.0067 156 LEU A CD2 
1677 N N   . GLY A 112 ? 0.3632 0.4571 0.5203 0.0255  0.0304  -0.0208 157 GLY A N   
1678 C CA  . GLY A 112 ? 0.3882 0.4736 0.5397 0.0413  0.0307  -0.0257 157 GLY A CA  
1679 C C   . GLY A 112 ? 0.3757 0.4782 0.5344 0.0561  0.0487  -0.0262 157 GLY A C   
1680 O O   . GLY A 112 ? 0.3891 0.4868 0.5477 0.0730  0.0500  -0.0316 157 GLY A O   
1684 N N   . GLU A 113 ? 0.4306 0.5512 0.5931 0.0517  0.0632  -0.0202 158 GLU A N   
1685 C CA  . GLU A 113 ? 0.4669 0.6047 0.6285 0.0656  0.0840  -0.0193 158 GLU A CA  
1686 C C   . GLU A 113 ? 0.5117 0.6219 0.6291 0.0777  0.0863  -0.0326 158 GLU A C   
1687 O O   . GLU A 113 ? 0.5515 0.6664 0.6643 0.0967  0.0984  -0.0387 158 GLU A O   
1688 C CB  . GLU A 113 ? 0.4656 0.6351 0.6700 0.0785  0.0916  -0.0157 158 GLU A CB  
1689 C CG  . GLU A 113 ? 0.4596 0.6622 0.7128 0.0651  0.0920  -0.0021 158 GLU A CG  
1690 C CD  . GLU A 113 ? 0.4481 0.6636 0.7003 0.0539  0.1084  0.0100  158 GLU A CD  
1691 O OE1 . GLU A 113 ? 0.4633 0.6852 0.6955 0.0645  0.1290  0.0114  158 GLU A OE1 
1692 O OE2 . GLU A 113 ? 0.4355 0.6509 0.7029 0.0356  0.0999  0.0177  158 GLU A OE2 
1699 N N   . GLN A 114 ? 0.4845 0.5665 0.5702 0.0669  0.0748  -0.0383 159 GLN A N   
1700 C CA  . GLN A 114 ? 0.5137 0.5669 0.5590 0.0743  0.0729  -0.0521 159 GLN A CA  
1701 C C   . GLN A 114 ? 0.5212 0.5786 0.5387 0.0760  0.0835  -0.0530 159 GLN A C   
1702 O O   . GLN A 114 ? 0.5406 0.5751 0.5223 0.0825  0.0807  -0.0663 159 GLN A O   
1703 C CB  . GLN A 114 ? 0.5062 0.5286 0.5354 0.0603  0.0541  -0.0576 159 GLN A CB  
1704 C CG  . GLN A 114 ? 0.5025 0.5130 0.5473 0.0600  0.0424  -0.0560 159 GLN A CG  
1705 C CD  . GLN A 114 ? 0.5333 0.5306 0.5772 0.0808  0.0434  -0.0634 159 GLN A CD  
1706 O OE1 . GLN A 114 ? 0.5663 0.5325 0.5820 0.0875  0.0404  -0.0754 159 GLN A OE1 
1707 N NE2 . GLN A 114 ? 0.5298 0.5504 0.6071 0.0916  0.0461  -0.0573 159 GLN A NE2 
1716 N N   . PHE A 115 ? 0.5100 0.5934 0.5412 0.0703  0.0941  -0.0389 160 PHE A N   
1717 C CA  . PHE A 115 ? 0.5342 0.6210 0.5352 0.0737  0.1043  -0.0364 160 PHE A CA  
1718 C C   . PHE A 115 ? 0.5926 0.6932 0.5820 0.0939  0.1259  -0.0380 160 PHE A C   
1719 O O   . PHE A 115 ? 0.6185 0.7119 0.5665 0.1022  0.1322  -0.0428 160 PHE A O   
1720 C CB  . PHE A 115 ? 0.4976 0.6011 0.5152 0.0600  0.1067  -0.0186 160 PHE A CB  
1721 C CG  . PHE A 115 ? 0.4504 0.5390 0.4643 0.0449  0.0879  -0.0204 160 PHE A CG  
1722 C CD1 . PHE A 115 ? 0.4166 0.5030 0.4578 0.0338  0.0763  -0.0204 160 PHE A CD1 
1723 C CD2 . PHE A 115 ? 0.4604 0.5390 0.4428 0.0434  0.0815  -0.0228 160 PHE A CD2 
1724 C CE1 . PHE A 115 ? 0.3945 0.4710 0.4327 0.0218  0.0624  -0.0227 160 PHE A CE1 
1725 C CE2 . PHE A 115 ? 0.4334 0.5042 0.4185 0.0313  0.0654  -0.0250 160 PHE A CE2 
1726 C CZ  . PHE A 115 ? 0.3970 0.4676 0.4103 0.0208  0.0577  -0.0251 160 PHE A CZ  
1736 N N   . MET A 116 ? 0.6541 0.7763 0.6786 0.1030  0.1373  -0.0345 161 MET A N   
1737 C CA  . MET A 116 ? 0.7188 0.8558 0.7355 0.1259  0.1592  -0.0395 161 MET A CA  
1738 C C   . MET A 116 ? 0.7494 0.9107 0.7521 0.1282  0.1832  -0.0251 161 MET A C   
1739 O O   . MET A 116 ? 0.7960 0.9556 0.7599 0.1462  0.1985  -0.0331 161 MET A O   
1740 C CB  . MET A 116 ? 0.7844 0.8859 0.7555 0.1422  0.1520  -0.0634 161 MET A CB  
1741 C CG  . MET A 116 ? 0.7966 0.8660 0.7740 0.1393  0.1285  -0.0760 161 MET A CG  
1742 S SD  . MET A 116 ? 0.8076 0.8891 0.8292 0.1569  0.1311  -0.0781 161 MET A SD  
1743 C CE  . MET A 116 ? 0.8643 0.9583 0.8667 0.1903  0.1579  -0.0906 161 MET A CE  
1753 N N   . VAL A 117 ? 0.7384 0.9193 0.7691 0.1103  0.1866  -0.0037 162 VAL A N   
1754 C CA  . VAL A 117 ? 0.7638 0.9631 0.7795 0.1098  0.2088  0.0145  162 VAL A CA  
1755 C C   . VAL A 117 ? 0.7328 0.9729 0.8066 0.1016  0.2274  0.0360  162 VAL A C   
1756 O O   . VAL A 117 ? 0.7406 0.9904 0.8218 0.0876  0.2360  0.0578  162 VAL A O   
1757 C CB  . VAL A 117 ? 0.7790 0.9564 0.7653 0.0951  0.1945  0.0224  162 VAL A CB  
1758 C CG1 . VAL A 117 ? 0.8049 0.9493 0.7345 0.1036  0.1787  0.0019  162 VAL A CG1 
1759 C CG2 . VAL A 117 ? 0.7344 0.9066 0.7604 0.0740  0.1741  0.0284  162 VAL A CG2 
1769 N N   . GLY A 118 ? 0.6433 0.9070 0.7605 0.1102  0.2326  0.0305  163 GLY A N   
1770 C CA  . GLY A 118 ? 0.6061 0.9147 0.7857 0.1024  0.2497  0.0496  163 GLY A CA  
1771 C C   . GLY A 118 ? 0.5610 0.8669 0.7786 0.0750  0.2313  0.0629  163 GLY A C   
1772 O O   . GLY A 118 ? 0.5108 0.7946 0.7358 0.0676  0.2036  0.0519  163 GLY A O   
1776 N N   . GLU A 119 ? 0.6237 0.9501 0.8640 0.0598  0.2473  0.0871  164 GLU A N   
1777 C CA  . GLU A 119 ? 0.6246 0.9444 0.8992 0.0338  0.2310  0.1000  164 GLU A CA  
1778 C C   . GLU A 119 ? 0.6151 0.9016 0.8464 0.0238  0.2259  0.1103  164 GLU A C   
1779 O O   . GLU A 119 ? 0.5990 0.8778 0.8548 0.0037  0.2171  0.1239  164 GLU A O   
1780 C CB  . GLU A 119 ? 0.6873 1.0510 1.0289 0.0203  0.2483  0.1207  164 GLU A CB  
1781 C CG  . GLU A 119 ? 0.7367 1.1410 1.1298 0.0318  0.2528  0.1118  164 GLU A CG  
1782 C CD  . GLU A 119 ? 0.7824 1.2299 1.2553 0.0126  0.2588  0.1293  164 GLU A CD  
1783 O OE1 . GLU A 119 ? 0.8217 1.2801 1.3076 -0.0046 0.2771  0.1535  164 GLU A OE1 
1784 O OE2 . GLU A 119 ? 0.7831 1.2528 1.3064 0.0141  0.2435  0.1195  164 GLU A OE2 
1791 N N   . GLU A 120 ? 0.6131 0.8778 0.7808 0.0382  0.2286  0.1028  165 GLU A N   
1792 C CA  . GLU A 120 ? 0.6154 0.8532 0.7415 0.0321  0.2246  0.1143  165 GLU A CA  
1793 C C   . GLU A 120 ? 0.6058 0.8136 0.7367 0.0188  0.1942  0.1083  165 GLU A C   
1794 O O   . GLU A 120 ? 0.6387 0.8277 0.7532 0.0110  0.1896  0.1218  165 GLU A O   
1795 C CB  . GLU A 120 ? 0.6352 0.8575 0.6924 0.0518  0.2290  0.1032  165 GLU A CB  
1796 C CG  . GLU A 120 ? 0.6617 0.9054 0.6939 0.0635  0.2624  0.1177  165 GLU A CG  
1797 C CD  . GLU A 120 ? 0.6798 0.9195 0.7001 0.0516  0.2736  0.1484  165 GLU A CD  
1798 O OE1 . GLU A 120 ? 0.6757 0.8863 0.6855 0.0412  0.2514  0.1528  165 GLU A OE1 
1799 O OE2 . GLU A 120 ? 0.7205 0.9862 0.7426 0.0532  0.3052  0.1690  165 GLU A OE2 
1806 N N   . ILE A 121 ? 0.6307 0.8332 0.7816 0.0175  0.1743  0.0891  166 ILE A N   
1807 C CA  . ILE A 121 ? 0.6186 0.7945 0.7685 0.0077  0.1482  0.0809  166 ILE A CA  
1808 C C   . ILE A 121 ? 0.5828 0.7607 0.7783 -0.0109 0.1427  0.0940  166 ILE A C   
1809 O O   . ILE A 121 ? 0.6156 0.8164 0.8571 -0.0177 0.1472  0.0978  166 ILE A O   
1810 C CB  . ILE A 121 ? 0.6238 0.7920 0.7730 0.0127  0.1310  0.0574  166 ILE A CB  
1811 C CG1 . ILE A 121 ? 0.6428 0.8043 0.7490 0.0298  0.1352  0.0435  166 ILE A CG1 
1812 C CG2 . ILE A 121 ? 0.6095 0.7542 0.7549 0.0035  0.1081  0.0493  166 ILE A CG2 
1813 C CD1 . ILE A 121 ? 0.6665 0.8082 0.7247 0.0333  0.1305  0.0422  166 ILE A CD1 
1825 N N   . CYS A 122 ? 0.5417 0.6951 0.7264 -0.0185 0.1312  0.0997  167 CYS A N   
1826 C CA  . CYS A 122 ? 0.4929 0.6377 0.7154 -0.0354 0.1215  0.1081  167 CYS A CA  
1827 C C   . CYS A 122 ? 0.4444 0.5723 0.6734 -0.0385 0.0967  0.0879  167 CYS A C   
1828 O O   . CYS A 122 ? 0.4193 0.5507 0.6855 -0.0492 0.0869  0.0841  167 CYS A O   
1829 C CB  . CYS A 122 ? 0.4965 0.6204 0.7035 -0.0401 0.1248  0.1282  167 CYS A CB  
1830 S SG  . CYS A 122 ? 0.5367 0.6775 0.7309 -0.0387 0.1564  0.1577  167 CYS A SG  
1836 N N   . GLY A 123 ? 0.4692 0.5805 0.6625 -0.0296 0.0863  0.0749  168 GLY A N   
1837 C CA  . GLY A 123 ? 0.4504 0.5485 0.6456 -0.0314 0.0669  0.0569  168 GLY A CA  
1838 C C   . GLY A 123 ? 0.4662 0.5514 0.6254 -0.0225 0.0598  0.0474  168 GLY A C   
1839 O O   . GLY A 123 ? 0.4820 0.5680 0.6135 -0.0144 0.0668  0.0527  168 GLY A O   
1843 N N   . ALA A 124 ? 0.4264 0.5016 0.5869 -0.0240 0.0455  0.0330  169 ALA A N   
1844 C CA  . ALA A 124 ? 0.4143 0.4837 0.5509 -0.0174 0.0383  0.0225  169 ALA A CA  
1845 C C   . ALA A 124 ? 0.4153 0.4706 0.5607 -0.0186 0.0274  0.0177  169 ALA A C   
1846 O O   . ALA A 124 ? 0.3987 0.4461 0.5648 -0.0252 0.0224  0.0157  169 ALA A O   
1847 C CB  . ALA A 124 ? 0.4026 0.4780 0.5291 -0.0165 0.0352  0.0073  169 ALA A CB  
1853 N N   . VAL A 125 ? 0.4401 0.4930 0.5709 -0.0111 0.0226  0.0143  170 VAL A N   
1854 C CA  . VAL A 125 ? 0.4750 0.5164 0.6138 -0.0075 0.0134  0.0082  170 VAL A CA  
1855 C C   . VAL A 125 ? 0.4680 0.5214 0.5964 -0.0011 0.0090  -0.0050 170 VAL A C   
1856 O O   . VAL A 125 ? 0.4795 0.5432 0.5934 0.0030  0.0093  -0.0028 170 VAL A O   
1857 C CB  . VAL A 125 ? 0.4958 0.5208 0.6365 -0.0029 0.0117  0.0239  170 VAL A CB  
1858 C CG1 . VAL A 125 ? 0.5156 0.5276 0.6636 0.0056  0.0013  0.0153  170 VAL A CG1 
1859 C CG2 . VAL A 125 ? 0.5156 0.5292 0.6728 -0.0131 0.0170  0.0384  170 VAL A CG2 
1869 N N   . VAL A 126 ? 0.4506 0.5037 0.5867 -0.0003 0.0050  -0.0189 171 VAL A N   
1870 C CA  . VAL A 126 ? 0.4328 0.5009 0.5673 0.0059  0.0026  -0.0299 171 VAL A CA  
1871 C C   . VAL A 126 ? 0.4748 0.5332 0.6212 0.0168  -0.0030 -0.0337 171 VAL A C   
1872 O O   . VAL A 126 ? 0.4783 0.5200 0.6312 0.0163  -0.0047 -0.0397 171 VAL A O   
1873 C CB  . VAL A 126 ? 0.3974 0.4769 0.5281 -0.0009 0.0064  -0.0427 171 VAL A CB  
1874 C CG1 . VAL A 126 ? 0.3912 0.4574 0.5245 -0.0036 0.0056  -0.0500 171 VAL A CG1 
1875 C CG2 . VAL A 126 ? 0.3832 0.4834 0.5182 0.0036  0.0067  -0.0521 171 VAL A CG2 
1885 N N   . SER A 127 ? 0.5054 0.5727 0.6543 0.0277  -0.0078 -0.0313 172 SER A N   
1886 C CA  . SER A 127 ? 0.5432 0.6008 0.7045 0.0423  -0.0143 -0.0341 172 SER A CA  
1887 C C   . SER A 127 ? 0.5370 0.6238 0.7096 0.0511  -0.0143 -0.0484 172 SER A C   
1888 O O   . SER A 127 ? 0.5364 0.6480 0.7099 0.0513  -0.0165 -0.0467 172 SER A O   
1889 C CB  . SER A 127 ? 0.5630 0.6062 0.7206 0.0508  -0.0217 -0.0162 172 SER A CB  
1890 O OG  . SER A 127 ? 0.5796 0.5948 0.7327 0.0429  -0.0196 -0.0017 172 SER A OG  
1896 N N   . VAL A 128 ? 0.5292 0.6142 0.7110 0.0582  -0.0116 -0.0631 173 VAL A N   
1897 C CA  . VAL A 128 ? 0.5307 0.6472 0.7274 0.0679  -0.0076 -0.0772 173 VAL A CA  
1898 C C   . VAL A 128 ? 0.5470 0.6601 0.7610 0.0903  -0.0165 -0.0781 173 VAL A C   
1899 O O   . VAL A 128 ? 0.5477 0.6276 0.7612 0.1000  -0.0210 -0.0801 173 VAL A O   
1900 C CB  . VAL A 128 ? 0.5328 0.6507 0.7243 0.0652  0.0031  -0.0936 173 VAL A CB  
1901 C CG1 . VAL A 128 ? 0.5525 0.7080 0.7610 0.0753  0.0118  -0.1069 173 VAL A CG1 
1902 C CG2 . VAL A 128 ? 0.5347 0.6515 0.7076 0.0448  0.0091  -0.0904 173 VAL A CG2 
1912 N N   . ARG A 129 ? 0.4995 0.6456 0.7302 0.0988  -0.0210 -0.0772 174 ARG A N   
1913 C CA  . ARG A 129 ? 0.5239 0.6717 0.7738 0.1227  -0.0321 -0.0768 174 ARG A CA  
1914 C C   . ARG A 129 ? 0.5065 0.7028 0.7867 0.1340  -0.0264 -0.0924 174 ARG A C   
1915 O O   . ARG A 129 ? 0.4862 0.7104 0.7697 0.1217  -0.0122 -0.1021 174 ARG A O   
1916 C CB  . ARG A 129 ? 0.5701 0.7130 0.8129 0.1251  -0.0472 -0.0577 174 ARG A CB  
1917 C CG  . ARG A 129 ? 0.6019 0.7028 0.8159 0.1132  -0.0487 -0.0398 174 ARG A CG  
1918 C CD  . ARG A 129 ? 0.6940 0.7493 0.9069 0.1236  -0.0529 -0.0350 174 ARG A CD  
1919 N NE  . ARG A 129 ? 0.7606 0.7807 0.9521 0.1108  -0.0530 -0.0150 174 ARG A NE  
1920 C CZ  . ARG A 129 ? 0.8194 0.8154 1.0051 0.0955  -0.0454 -0.0150 174 ARG A CZ  
1921 N NH1 . ARG A 129 ? 0.8177 0.8157 1.0107 0.0918  -0.0391 -0.0347 174 ARG A NH1 
1922 N NH2 . ARG A 129 ? 0.8399 0.8114 1.0123 0.0839  -0.0441 0.0051  174 ARG A NH2 
1936 N N   . PHE A 130 ? 0.6244 0.8316 0.9284 0.1582  -0.0372 -0.0935 175 PHE A N   
1937 C CA  . PHE A 130 ? 0.6537 0.9092 0.9938 0.1733  -0.0302 -0.1097 175 PHE A CA  
1938 C C   . PHE A 130 ? 0.6384 0.9487 0.9966 0.1562  -0.0257 -0.1098 175 PHE A C   
1939 O O   . PHE A 130 ? 0.6299 0.9728 1.0002 0.1475  -0.0074 -0.1212 175 PHE A O   
1940 C CB  . PHE A 130 ? 0.6879 0.9444 1.0530 0.2051  -0.0460 -0.1093 175 PHE A CB  
1941 C CG  . PHE A 130 ? 0.7203 1.0330 1.1298 0.2240  -0.0387 -0.1258 175 PHE A CG  
1942 C CD1 . PHE A 130 ? 0.7212 1.0505 1.1367 0.2261  -0.0157 -0.1450 175 PHE A CD1 
1943 C CD2 . PHE A 130 ? 0.7274 1.0791 1.1729 0.2407  -0.0548 -0.1222 175 PHE A CD2 
1944 C CE1 . PHE A 130 ? 0.7192 1.1058 1.1780 0.2441  -0.0050 -0.1598 175 PHE A CE1 
1945 C CE2 . PHE A 130 ? 0.7204 1.1311 1.2146 0.2585  -0.0470 -0.1374 175 PHE A CE2 
1946 C CZ  . PHE A 130 ? 0.7238 1.1532 1.2256 0.2601  -0.0203 -0.1559 175 PHE A CZ  
1956 N N   . GLN A 131 ? 0.4956 0.8145 0.8538 0.1502  -0.0427 -0.0970 176 GLN A N   
1957 C CA  . GLN A 131 ? 0.4375 0.8064 0.8174 0.1344  -0.0438 -0.0985 176 GLN A CA  
1958 C C   . GLN A 131 ? 0.3948 0.7447 0.7422 0.1104  -0.0507 -0.0871 176 GLN A C   
1959 O O   . GLN A 131 ? 0.3699 0.7502 0.7299 0.0994  -0.0607 -0.0865 176 GLN A O   
1960 C CB  . GLN A 131 ? 0.4653 0.8768 0.8869 0.1542  -0.0615 -0.0997 176 GLN A CB  
1961 C CG  . GLN A 131 ? 0.4931 0.8735 0.8992 0.1730  -0.0867 -0.0861 176 GLN A CG  
1962 C CD  . GLN A 131 ? 0.5481 0.9590 0.9962 0.2045  -0.1015 -0.0900 176 GLN A CD  
1963 O OE1 . GLN A 131 ? 0.5634 1.0239 1.0571 0.2130  -0.0914 -0.1043 176 GLN A OE1 
1964 N NE2 . GLN A 131 ? 0.5915 0.9733 1.0245 0.2230  -0.1248 -0.0761 176 GLN A NE2 
1973 N N   . GLU A 132 ? 0.4740 0.7750 0.7817 0.1025  -0.0460 -0.0796 177 GLU A N   
1974 C CA  . GLU A 132 ? 0.4799 0.7622 0.7559 0.0821  -0.0485 -0.0707 177 GLU A CA  
1975 C C   . GLU A 132 ? 0.4804 0.7200 0.7262 0.0741  -0.0363 -0.0669 177 GLU A C   
1976 O O   . GLU A 132 ? 0.4984 0.7147 0.7432 0.0856  -0.0326 -0.0681 177 GLU A O   
1977 C CB  . GLU A 132 ? 0.5113 0.7828 0.7713 0.0895  -0.0693 -0.0583 177 GLU A CB  
1978 C CG  . GLU A 132 ? 0.5622 0.7940 0.8048 0.1069  -0.0753 -0.0456 177 GLU A CG  
1979 C CD  . GLU A 132 ? 0.5891 0.8071 0.8053 0.1121  -0.0930 -0.0301 177 GLU A CD  
1980 O OE1 . GLU A 132 ? 0.5911 0.8179 0.7898 0.0986  -0.0971 -0.0300 177 GLU A OE1 
1981 O OE2 . GLU A 132 ? 0.6275 0.8229 0.8372 0.1303  -0.1032 -0.0180 177 GLU A OE2 
1988 N N   . ASP A 133 ? 0.4355 0.6647 0.6585 0.0547  -0.0318 -0.0634 178 ASP A N   
1989 C CA  . ASP A 133 ? 0.4231 0.6161 0.6200 0.0465  -0.0232 -0.0582 178 ASP A CA  
1990 C C   . ASP A 133 ? 0.4184 0.5920 0.5891 0.0425  -0.0302 -0.0452 178 ASP A C   
1991 O O   . ASP A 133 ? 0.3910 0.5792 0.5570 0.0402  -0.0395 -0.0442 178 ASP A O   
1992 C CB  . ASP A 133 ? 0.4214 0.6190 0.6139 0.0296  -0.0096 -0.0658 178 ASP A CB  
1993 C CG  . ASP A 133 ? 0.4410 0.6585 0.6527 0.0338  0.0007  -0.0780 178 ASP A CG  
1994 O OD1 . ASP A 133 ? 0.4480 0.6569 0.6674 0.0498  0.0005  -0.0821 178 ASP A OD1 
1995 O OD2 . ASP A 133 ? 0.4361 0.6764 0.6540 0.0214  0.0096  -0.0832 178 ASP A OD2 
2000 N N   . ILE A 134 ? 0.4250 0.5670 0.5790 0.0415  -0.0256 -0.0359 179 ILE A N   
2001 C CA  . ILE A 134 ? 0.4636 0.5880 0.5926 0.0403  -0.0282 -0.0216 179 ILE A CA  
2002 C C   . ILE A 134 ? 0.4780 0.5864 0.5946 0.0275  -0.0163 -0.0193 179 ILE A C   
2003 O O   . ILE A 134 ? 0.4736 0.5658 0.5973 0.0257  -0.0108 -0.0179 179 ILE A O   
2004 C CB  . ILE A 134 ? 0.4962 0.5998 0.6214 0.0540  -0.0349 -0.0069 179 ILE A CB  
2005 C CG1 . ILE A 134 ? 0.5094 0.6300 0.6513 0.0703  -0.0487 -0.0103 179 ILE A CG1 
2006 C CG2 . ILE A 134 ? 0.5070 0.5969 0.6022 0.0531  -0.0351 0.0095  179 ILE A CG2 
2007 C CD1 . ILE A 134 ? 0.5417 0.6371 0.6823 0.0863  -0.0569 0.0038  179 ILE A CD1 
2019 N N   . ILE A 135 ? 0.5223 0.6351 0.6222 0.0194  -0.0140 -0.0203 180 ILE A N   
2020 C CA  . ILE A 135 ? 0.5505 0.6509 0.6391 0.0107  -0.0038 -0.0173 180 ILE A CA  
2021 C C   . ILE A 135 ? 0.5551 0.6443 0.6230 0.0153  -0.0013 -0.0026 180 ILE A C   
2022 O O   . ILE A 135 ? 0.5679 0.6611 0.6172 0.0215  -0.0081 0.0001  180 ILE A O   
2023 C CB  . ILE A 135 ? 0.5860 0.6946 0.6683 0.0010  -0.0022 -0.0282 180 ILE A CB  
2024 C CG1 . ILE A 135 ? 0.6046 0.7244 0.7048 -0.0054 -0.0010 -0.0392 180 ILE A CG1 
2025 C CG2 . ILE A 135 ? 0.6006 0.6967 0.6711 -0.0036 0.0067  -0.0249 180 ILE A CG2 
2026 C CD1 . ILE A 135 ? 0.6133 0.7222 0.7200 -0.0084 0.0060  -0.0399 180 ILE A CD1 
2038 N N   . SER A 136 ? 0.5226 0.5997 0.5932 0.0120  0.0086  0.0069  181 SER A N   
2039 C CA  . SER A 136 ? 0.5276 0.5979 0.5794 0.0151  0.0161  0.0225  181 SER A CA  
2040 C C   . SER A 136 ? 0.4853 0.5552 0.5443 0.0079  0.0293  0.0255  181 SER A C   
2041 O O   . SER A 136 ? 0.4517 0.5218 0.5319 0.0009  0.0297  0.0183  181 SER A O   
2042 C CB  . SER A 136 ? 0.5625 0.6193 0.6155 0.0208  0.0141  0.0400  181 SER A CB  
2043 O OG  . SER A 136 ? 0.5581 0.6032 0.6381 0.0150  0.0157  0.0427  181 SER A OG  
2049 N N   . ILE A 137 ? 0.5040 0.5751 0.5442 0.0112  0.0400  0.0359  182 ILE A N   
2050 C CA  . ILE A 137 ? 0.4985 0.5751 0.5498 0.0069  0.0545  0.0408  182 ILE A CA  
2051 C C   . ILE A 137 ? 0.5251 0.6013 0.5647 0.0100  0.0683  0.0621  182 ILE A C   
2052 O O   . ILE A 137 ? 0.5676 0.6417 0.5725 0.0189  0.0694  0.0671  182 ILE A O   
2053 C CB  . ILE A 137 ? 0.4959 0.5794 0.5351 0.0095  0.0574  0.0264  182 ILE A CB  
2054 C CG1 . ILE A 137 ? 0.4949 0.5883 0.5491 0.0089  0.0728  0.0323  182 ILE A CG1 
2055 C CG2 . ILE A 137 ? 0.5098 0.5913 0.5100 0.0188  0.0549  0.0214  182 ILE A CG2 
2056 C CD1 . ILE A 137 ? 0.4960 0.5920 0.5446 0.0131  0.0738  0.0175  182 ILE A CD1 
2068 N N   . TRP A 138 ? 0.5056 0.5844 0.5736 0.0017  0.0785  0.0752  183 TRP A N   
2069 C CA  . TRP A 138 ? 0.5269 0.6057 0.5902 0.0008  0.0941  0.0997  183 TRP A CA  
2070 C C   . TRP A 138 ? 0.5121 0.6126 0.5786 0.0021  0.1151  0.1037  183 TRP A C   
2071 O O   . TRP A 138 ? 0.4781 0.5919 0.5716 -0.0012 0.1161  0.0923  183 TRP A O   
2072 C CB  . TRP A 138 ? 0.5542 0.6209 0.6524 -0.0118 0.0919  0.1141  183 TRP A CB  
2073 C CG  . TRP A 138 ? 0.5657 0.6098 0.6666 -0.0111 0.0724  0.1089  183 TRP A CG  
2074 C CD1 . TRP A 138 ? 0.5603 0.6018 0.6483 -0.0030 0.0568  0.0901  183 TRP A CD1 
2075 C CD2 . TRP A 138 ? 0.6025 0.6237 0.7231 -0.0182 0.0669  0.1225  183 TRP A CD2 
2076 N NE1 . TRP A 138 ? 0.5696 0.5917 0.6685 -0.0022 0.0435  0.0902  183 TRP A NE1 
2077 C CE2 . TRP A 138 ? 0.6027 0.6085 0.7195 -0.0107 0.0483  0.1092  183 TRP A CE2 
2078 C CE3 . TRP A 138 ? 0.6360 0.6477 0.7792 -0.0309 0.0762  0.1448  183 TRP A CE3 
2079 C CZ2 . TRP A 138 ? 0.6268 0.6047 0.7582 -0.0121 0.0379  0.1154  183 TRP A CZ2 
2080 C CZ3 . TRP A 138 ? 0.6674 0.6477 0.8251 -0.0355 0.0644  0.1521  183 TRP A CZ3 
2081 C CH2 . TRP A 138 ? 0.6590 0.6211 0.8091 -0.0246 0.0450  0.1364  183 TRP A CH2 
2092 N N   . ASN A 139 ? 0.5695 0.6744 0.6080 0.0083  0.1324  0.1206  184 ASN A N   
2093 C CA  . ASN A 139 ? 0.6112 0.7404 0.6526 0.0120  0.1568  0.1258  184 ASN A CA  
2094 C C   . ASN A 139 ? 0.6844 0.8196 0.7323 0.0049  0.1782  0.1570  184 ASN A C   
2095 O O   . ASN A 139 ? 0.7009 0.8153 0.7340 0.0011  0.1735  0.1748  184 ASN A O   
2096 C CB  . ASN A 139 ? 0.6059 0.7379 0.5978 0.0300  0.1615  0.1114  184 ASN A CB  
2097 C CG  . ASN A 139 ? 0.6451 0.7648 0.5825 0.0393  0.1646  0.1239  184 ASN A CG  
2098 O OD1 . ASN A 139 ? 0.6448 0.7450 0.5603 0.0411  0.1439  0.1203  184 ASN A OD1 
2099 N ND2 . ASN A 139 ? 0.6829 0.8159 0.5968 0.0466  0.1906  0.1385  184 ASN A ND2 
2106 N N   . LYS A 140 ? 0.7156 0.8804 0.7881 0.0033  0.2022  0.1645  185 LYS A N   
2107 C CA  . LYS A 140 ? 0.7718 0.9490 0.8694 -0.0097 0.2245  0.1955  185 LYS A CA  
2108 C C   . LYS A 140 ? 0.8121 0.9775 0.8547 -0.0026 0.2395  0.2187  185 LYS A C   
2109 O O   . LYS A 140 ? 0.8334 0.9803 0.8785 -0.0145 0.2402  0.2445  185 LYS A O   
2110 C CB  . LYS A 140 ? 0.8288 1.0488 0.9663 -0.0101 0.2488  0.1967  185 LYS A CB  
2111 C CG  . LYS A 140 ? 0.8576 1.0951 1.0682 -0.0331 0.2516  0.2109  185 LYS A CG  
2112 C CD  . LYS A 140 ? 0.8584 1.0994 1.1114 -0.0370 0.2271  0.1858  185 LYS A CD  
2113 C CE  . LYS A 140 ? 0.8852 1.1527 1.2131 -0.0575 0.2301  0.1963  185 LYS A CE  
2114 N NZ  . LYS A 140 ? 0.8573 1.1310 1.2202 -0.0580 0.2061  0.1714  185 LYS A NZ  
2128 N N   . THR A 141 ? 0.8592 1.0325 0.8495 0.0171  0.2514  0.2102  186 THR A N   
2129 C CA  . THR A 141 ? 0.9297 1.0971 0.8611 0.0264  0.2696  0.2320  186 THR A CA  
2130 C C   . THR A 141 ? 0.9088 1.0477 0.7762 0.0426  0.2455  0.2160  186 THR A C   
2131 O O   . THR A 141 ? 0.8894 1.0314 0.7341 0.0567  0.2371  0.1871  186 THR A O   
2132 C CB  . THR A 141 ? 0.9905 1.1931 0.9090 0.0381  0.3056  0.2350  186 THR A CB  
2133 O OG1 . THR A 141 ? 0.9943 1.2316 0.9855 0.0240  0.3236  0.2427  186 THR A OG1 
2134 C CG2 . THR A 141 ? 1.0849 1.2838 0.9468 0.0437  0.3301  0.2652  186 THR A CG2 
2142 N N   . ALA A 142 ? 0.8711 0.9819 0.7118 0.0403  0.2327  0.2349  187 ALA A N   
2143 C CA  . ALA A 142 ? 0.8572 0.9450 0.6424 0.0553  0.2070  0.2211  187 ALA A CA  
2144 C C   . ALA A 142 ? 0.9110 1.0034 0.6237 0.0746  0.2215  0.2206  187 ALA A C   
2145 O O   . ALA A 142 ? 0.9041 0.9897 0.5778 0.0888  0.2031  0.1944  187 ALA A O   
2146 C CB  . ALA A 142 ? 0.8558 0.9132 0.6352 0.0504  0.1882  0.2422  187 ALA A CB  
2152 N N   . SER A 143 ? 0.9814 1.0849 0.6741 0.0749  0.2546  0.2490  188 SER A N   
2153 C CA  . SER A 143 ? 1.0640 1.1719 0.6812 0.0951  0.2718  0.2490  188 SER A CA  
2154 C C   . SER A 143 ? 1.0830 1.2112 0.6955 0.1088  0.2794  0.2140  188 SER A C   
2155 O O   . SER A 143 ? 1.1554 1.2807 0.6996 0.1289  0.2844  0.2019  188 SER A O   
2156 C CB  . SER A 143 ? 1.1195 1.2401 0.7226 0.0908  0.3115  0.2889  188 SER A CB  
2157 O OG  . SER A 143 ? 1.0751 1.2301 0.7467 0.0775  0.3397  0.2944  188 SER A OG  
2163 N N   . ASP A 144 ? 1.0903 1.2361 0.7708 0.0997  0.2791  0.1971  189 ASP A N   
2164 C CA  . ASP A 144 ? 1.1177 1.2787 0.7996 0.1133  0.2846  0.1646  189 ASP A CA  
2165 C C   . ASP A 144 ? 1.1086 1.2428 0.7531 0.1232  0.2491  0.1319  189 ASP A C   
2166 O O   . ASP A 144 ? 1.0543 1.1813 0.7374 0.1152  0.2247  0.1118  189 ASP A O   
2167 C CB  . ASP A 144 ? 1.1108 1.2949 0.8761 0.1003  0.2892  0.1587  189 ASP A CB  
2168 C CG  . ASP A 144 ? 1.1523 1.3535 0.9225 0.1165  0.2992  0.1304  189 ASP A CG  
2169 O OD1 . ASP A 144 ? 1.1400 1.3711 0.9695 0.1118  0.3160  0.1329  189 ASP A OD1 
2170 O OD2 . ASP A 144 ? 1.1967 1.3803 0.9126 0.1342  0.2885  0.1052  189 ASP A OD2 
2175 N N   . GLN A 145 ? 1.1854 1.3050 0.7519 0.1402  0.2462  0.1271  190 GLN A N   
2176 C CA  . GLN A 145 ? 1.2022 1.2981 0.7317 0.1491  0.2122  0.0952  190 GLN A CA  
2177 C C   . GLN A 145 ? 1.1487 1.2473 0.6983 0.1549  0.2098  0.0606  190 GLN A C   
2178 O O   . GLN A 145 ? 1.0813 1.1621 0.6351 0.1519  0.1789  0.0353  190 GLN A O   
2179 C CB  . GLN A 145 ? 1.3094 1.3908 0.7475 0.1680  0.2111  0.0948  190 GLN A CB  
2180 C CG  . GLN A 145 ? 1.3946 1.4673 0.8032 0.1647  0.2096  0.1304  190 GLN A CG  
2181 C CD  . GLN A 145 ? 1.5283 1.5911 0.8406 0.1854  0.2177  0.1356  190 GLN A CD  
2182 O OE1 . GLN A 145 ? 1.5656 1.6214 0.8312 0.2012  0.2120  0.1049  190 GLN A OE1 
2183 N NE2 . GLN A 145 ? 1.5733 1.6315 0.8601 0.1829  0.2281  0.1731  190 GLN A NE2 
2192 N N   . ALA A 146 ? 1.0277 1.1486 0.5925 0.1634  0.2421  0.0600  191 ALA A N   
2193 C CA  . ALA A 146 ? 0.9601 1.0811 0.5460 0.1714  0.2399  0.0290  191 ALA A CA  
2194 C C   . ALA A 146 ? 0.9753 1.0960 0.6336 0.1522  0.2200  0.0244  191 ALA A C   
2195 O O   . ALA A 146 ? 0.8962 0.9984 0.5591 0.1525  0.1974  -0.0023 191 ALA A O   
2196 C CB  . ALA A 146 ? 0.9680 1.1187 0.5619 0.1866  0.2802  0.0321  191 ALA A CB  
2202 N N   . THR A 147 ? 1.0661 1.2052 0.7793 0.1349  0.2281  0.0503  192 THR A N   
2203 C CA  . THR A 147 ? 0.9979 1.1364 0.7744 0.1176  0.2095  0.0461  192 THR A CA  
2204 C C   . THR A 147 ? 0.9191 1.0328 0.6874 0.1066  0.1757  0.0404  192 THR A C   
2205 O O   . THR A 147 ? 0.9137 1.0172 0.7068 0.0994  0.1549  0.0229  192 THR A O   
2206 C CB  . THR A 147 ? 0.8896 1.0533 0.7249 0.1025  0.2264  0.0731  192 THR A CB  
2207 O OG1 . THR A 147 ? 0.9358 1.1301 0.7884 0.1123  0.2582  0.0777  192 THR A OG1 
2208 C CG2 . THR A 147 ? 0.8589 1.0200 0.7528 0.0860  0.2057  0.0673  192 THR A CG2 
2216 N N   . THR A 148 ? 0.9427 1.0478 0.6771 0.1058  0.1706  0.0564  193 THR A N   
2217 C CA  . THR A 148 ? 0.8866 0.9739 0.6180 0.0978  0.1389  0.0519  193 THR A CA  
2218 C C   . THR A 148 ? 0.8684 0.9397 0.5741 0.1034  0.1156  0.0205  193 THR A C   
2219 O O   . THR A 148 ? 0.8301 0.8941 0.5595 0.0928  0.0915  0.0097  193 THR A O   
2220 C CB  . THR A 148 ? 0.9361 1.0160 0.6285 0.1011  0.1370  0.0744  193 THR A CB  
2221 O OG1 . THR A 148 ? 0.9160 1.0061 0.6374 0.0922  0.1576  0.1052  193 THR A OG1 
2222 C CG2 . THR A 148 ? 0.9083 0.9741 0.6024 0.0957  0.1035  0.0692  193 THR A CG2 
2230 N N   . ALA A 149 ? 0.9909 1.0562 0.6485 0.1196  0.1231  0.0052  194 ALA A N   
2231 C CA  . ALA A 149 ? 0.9994 1.0445 0.6314 0.1235  0.0993  -0.0258 194 ALA A CA  
2232 C C   . ALA A 149 ? 0.9439 0.9854 0.6192 0.1168  0.0960  -0.0434 194 ALA A C   
2233 O O   . ALA A 149 ? 0.9213 0.9491 0.6085 0.1067  0.0712  -0.0596 194 ALA A O   
2234 C CB  . ALA A 149 ? 1.0883 1.1230 0.6510 0.1445  0.1072  -0.0392 194 ALA A CB  
2240 N N   . ARG A 150 ? 0.8527 0.9076 0.5533 0.1222  0.1207  -0.0392 195 ARG A N   
2241 C CA  . ARG A 150 ? 0.7937 0.8438 0.5341 0.1177  0.1165  -0.0531 195 ARG A CA  
2242 C C   . ARG A 150 ? 0.6900 0.7419 0.4782 0.0966  0.0994  -0.0462 195 ARG A C   
2243 O O   . ARG A 150 ? 0.6579 0.6939 0.4578 0.0885  0.0810  -0.0617 195 ARG A O   
2244 C CB  . ARG A 150 ? 0.8126 0.8840 0.5795 0.1279  0.1450  -0.0459 195 ARG A CB  
2245 C CG  . ARG A 150 ? 0.9083 0.9764 0.6331 0.1524  0.1626  -0.0607 195 ARG A CG  
2246 C CD  . ARG A 150 ? 0.9523 1.0489 0.7151 0.1629  0.1908  -0.0534 195 ARG A CD  
2247 N NE  . ARG A 150 ? 1.0671 1.1617 0.7919 0.1899  0.2094  -0.0703 195 ARG A NE  
2248 C CZ  . ARG A 150 ? 1.1735 1.2792 0.8518 0.2046  0.2319  -0.0648 195 ARG A CZ  
2249 N NH1 . ARG A 150 ? 1.1889 1.3059 0.8526 0.1939  0.2371  -0.0404 195 ARG A NH1 
2250 N NH2 . ARG A 150 ? 1.2365 1.3399 0.8796 0.2316  0.2495  -0.0835 195 ARG A NH2 
2264 N N   . ILE A 151 ? 0.6689 0.7383 0.4837 0.0873  0.1059  -0.0230 196 ILE A N   
2265 C CA  . ILE A 151 ? 0.6188 0.6894 0.4753 0.0698  0.0911  -0.0179 196 ILE A CA  
2266 C C   . ILE A 151 ? 0.6424 0.6986 0.4841 0.0632  0.0653  -0.0307 196 ILE A C   
2267 O O   . ILE A 151 ? 0.6050 0.6563 0.4724 0.0519  0.0520  -0.0396 196 ILE A O   
2268 C CB  . ILE A 151 ? 0.6090 0.6944 0.4890 0.0629  0.1006  0.0076  196 ILE A CB  
2269 C CG1 . ILE A 151 ? 0.6048 0.7092 0.5142 0.0645  0.1244  0.0195  196 ILE A CG1 
2270 C CG2 . ILE A 151 ? 0.5666 0.6497 0.4808 0.0480  0.0837  0.0095  196 ILE A CG2 
2271 C CD1 . ILE A 151 ? 0.5979 0.7144 0.5308 0.0557  0.1354  0.0459  196 ILE A CD1 
2283 N N   . ARG A 152 ? 0.7749 0.8262 0.5758 0.0699  0.0576  -0.0312 197 ARG A N   
2284 C CA  . ARG A 152 ? 0.8573 0.9008 0.6497 0.0635  0.0312  -0.0435 197 ARG A CA  
2285 C C   . ARG A 152 ? 0.8460 0.8736 0.6375 0.0591  0.0192  -0.0677 197 ARG A C   
2286 O O   . ARG A 152 ? 0.8035 0.8307 0.6237 0.0449  0.0050  -0.0740 197 ARG A O   
2287 C CB  . ARG A 152 ? 0.9899 1.0300 0.7331 0.0742  0.0227  -0.0416 197 ARG A CB  
2288 C CG  . ARG A 152 ? 1.0887 1.1280 0.8318 0.0673  -0.0072 -0.0518 197 ARG A CG  
2289 C CD  . ARG A 152 ? 1.2271 1.2610 0.9158 0.0796  -0.0204 -0.0537 197 ARG A CD  
2290 N NE  . ARG A 152 ? 1.2838 1.3239 0.9820 0.0731  -0.0508 -0.0611 197 ARG A NE  
2291 C CZ  . ARG A 152 ? 1.3937 1.4328 1.0528 0.0823  -0.0705 -0.0621 197 ARG A CZ  
2292 N NH1 . ARG A 152 ? 1.4693 1.4980 1.0695 0.0986  -0.0616 -0.0554 197 ARG A NH1 
2293 N NH2 . ARG A 152 ? 1.4099 1.4606 1.0887 0.0758  -0.0992 -0.0692 197 ARG A NH2 
2307 N N   . ASP A 153 ? 0.8288 0.8417 0.5867 0.0714  0.0257  -0.0813 198 ASP A N   
2308 C CA  . ASP A 153 ? 0.8079 0.7981 0.5628 0.0677  0.0134  -0.1043 198 ASP A CA  
2309 C C   . ASP A 153 ? 0.7509 0.7407 0.5516 0.0566  0.0174  -0.1015 198 ASP A C   
2310 O O   . ASP A 153 ? 0.7344 0.7087 0.5465 0.0444  0.0024  -0.1133 198 ASP A O   
2311 C CB  . ASP A 153 ? 0.8590 0.8311 0.5697 0.0870  0.0226  -0.1196 198 ASP A CB  
2312 C CG  . ASP A 153 ? 0.9038 0.8739 0.5594 0.0994  0.0182  -0.1233 198 ASP A CG  
2313 O OD1 . ASP A 153 ? 0.9029 0.8811 0.5554 0.0914  0.0009  -0.1175 198 ASP A OD1 
2314 O OD2 . ASP A 153 ? 0.9481 0.9092 0.5623 0.1188  0.0318  -0.1322 198 ASP A OD2 
2319 N N   . THR A 154 ? 0.6884 0.6950 0.5156 0.0596  0.0365  -0.0853 199 THR A N   
2320 C CA  . THR A 154 ? 0.6321 0.6383 0.4986 0.0506  0.0379  -0.0825 199 THR A CA  
2321 C C   . THR A 154 ? 0.5755 0.5889 0.4696 0.0320  0.0249  -0.0770 199 THR A C   
2322 O O   . THR A 154 ? 0.5659 0.5681 0.4748 0.0209  0.0161  -0.0832 199 THR A O   
2323 C CB  . THR A 154 ? 0.6225 0.6478 0.5129 0.0580  0.0585  -0.0677 199 THR A CB  
2324 O OG1 . THR A 154 ? 0.6618 0.6847 0.5302 0.0770  0.0733  -0.0740 199 THR A OG1 
2325 C CG2 . THR A 154 ? 0.5869 0.6116 0.5145 0.0498  0.0562  -0.0653 199 THR A CG2 
2333 N N   . LEU A 155 ? 0.5835 0.6148 0.4841 0.0294  0.0246  -0.0647 200 LEU A N   
2334 C CA  . LEU A 155 ? 0.5660 0.6063 0.4916 0.0154  0.0132  -0.0619 200 LEU A CA  
2335 C C   . LEU A 155 ? 0.5863 0.6166 0.5060 0.0054  -0.0044 -0.0772 200 LEU A C   
2336 O O   . LEU A 155 ? 0.5584 0.5889 0.5013 -0.0079 -0.0092 -0.0793 200 LEU A O   
2337 C CB  . LEU A 155 ? 0.5670 0.6227 0.4931 0.0184  0.0122  -0.0492 200 LEU A CB  
2338 C CG  . LEU A 155 ? 0.5564 0.6220 0.5021 0.0206  0.0262  -0.0312 200 LEU A CG  
2339 C CD1 . LEU A 155 ? 0.5714 0.6429 0.5063 0.0261  0.0239  -0.0184 200 LEU A CD1 
2340 C CD2 . LEU A 155 ? 0.5209 0.5911 0.5033 0.0100  0.0251  -0.0295 200 LEU A CD2 
2352 N N   . ARG A 156 ? 0.6648 0.6862 0.5525 0.0111  -0.0141 -0.0881 201 ARG A N   
2353 C CA  . ARG A 156 ? 0.7164 0.7281 0.6008 -0.0005 -0.0335 -0.1038 201 ARG A CA  
2354 C C   . ARG A 156 ? 0.6713 0.6631 0.5689 -0.0115 -0.0332 -0.1107 201 ARG A C   
2355 O O   . ARG A 156 ? 0.6530 0.6488 0.5751 -0.0289 -0.0411 -0.1118 201 ARG A O   
2356 C CB  . ARG A 156 ? 0.8329 0.8302 0.6733 0.0098  -0.0441 -0.1177 201 ARG A CB  
2357 C CG  . ARG A 156 ? 0.9237 0.9152 0.7621 -0.0034 -0.0696 -0.1342 201 ARG A CG  
2358 C CD  . ARG A 156 ? 1.0135 0.9704 0.8410 -0.0101 -0.0762 -0.1523 201 ARG A CD  
2359 N NE  . ARG A 156 ? 1.0950 1.0261 0.8774 0.0096  -0.0696 -0.1633 201 ARG A NE  
2360 C CZ  . ARG A 156 ? 1.1711 1.0656 0.9351 0.0105  -0.0750 -0.1813 201 ARG A CZ  
2361 N NH1 . ARG A 156 ? 1.1805 1.0571 0.9672 -0.0099 -0.0878 -0.1881 201 ARG A NH1 
2362 N NH2 . ARG A 156 ? 1.2166 1.0910 0.9390 0.0325  -0.0665 -0.1922 201 ARG A NH2 
2376 N N   . ARG A 157 ? 0.6259 0.5971 0.5085 -0.0008 -0.0229 -0.1139 202 ARG A N   
2377 C CA  . ARG A 157 ? 0.5970 0.5426 0.4871 -0.0085 -0.0247 -0.1196 202 ARG A CA  
2378 C C   . ARG A 157 ? 0.5683 0.5256 0.4910 -0.0172 -0.0163 -0.1050 202 ARG A C   
2379 O O   . ARG A 157 ? 0.5623 0.5078 0.4975 -0.0323 -0.0217 -0.1050 202 ARG A O   
2380 C CB  . ARG A 157 ? 0.5869 0.5074 0.4518 0.0099  -0.0173 -0.1285 202 ARG A CB  
2381 C CG  . ARG A 157 ? 0.6111 0.5161 0.4354 0.0214  -0.0246 -0.1459 202 ARG A CG  
2382 C CD  . ARG A 157 ? 0.6446 0.5204 0.4452 0.0407  -0.0173 -0.1584 202 ARG A CD  
2383 N NE  . ARG A 157 ? 0.6231 0.5199 0.4304 0.0592  0.0057  -0.1465 202 ARG A NE  
2384 C CZ  . ARG A 157 ? 0.6471 0.5586 0.4301 0.0774  0.0195  -0.1462 202 ARG A CZ  
2385 N NH1 . ARG A 157 ? 0.6801 0.5848 0.4231 0.0822  0.0113  -0.1580 202 ARG A NH1 
2386 N NH2 . ARG A 157 ? 0.6298 0.5643 0.4288 0.0904  0.0414  -0.1333 202 ARG A NH2 
2400 N N   . VAL A 158 ? 0.5507 0.5299 0.4859 -0.0087 -0.0036 -0.0921 203 VAL A N   
2401 C CA  . VAL A 158 ? 0.5334 0.5199 0.4940 -0.0140 0.0029  -0.0809 203 VAL A CA  
2402 C C   . VAL A 158 ? 0.5000 0.5029 0.4806 -0.0299 -0.0018 -0.0764 203 VAL A C   
2403 O O   . VAL A 158 ? 0.4811 0.4809 0.4741 -0.0393 -0.0008 -0.0720 203 VAL A O   
2404 C CB  . VAL A 158 ? 0.5421 0.5456 0.5120 -0.0013 0.0160  -0.0704 203 VAL A CB  
2405 C CG1 . VAL A 158 ? 0.5146 0.5320 0.5109 -0.0087 0.0183  -0.0599 203 VAL A CG1 
2406 C CG2 . VAL A 158 ? 0.5682 0.5587 0.5301 0.0134  0.0232  -0.0737 203 VAL A CG2 
2416 N N   . LEU A 159 ? 0.4920 0.5137 0.4749 -0.0310 -0.0063 -0.0769 204 LEU A N   
2417 C CA  . LEU A 159 ? 0.4875 0.5289 0.4923 -0.0432 -0.0103 -0.0747 204 LEU A CA  
2418 C C   . LEU A 159 ? 0.5575 0.5965 0.5647 -0.0580 -0.0222 -0.0841 204 LEU A C   
2419 O O   . LEU A 159 ? 0.5412 0.6013 0.5712 -0.0690 -0.0241 -0.0828 204 LEU A O   
2420 C CB  . LEU A 159 ? 0.4549 0.5193 0.4669 -0.0351 -0.0105 -0.0692 204 LEU A CB  
2421 C CG  . LEU A 159 ? 0.4367 0.5027 0.4489 -0.0231 0.0003  -0.0586 204 LEU A CG  
2422 C CD1 . LEU A 159 ? 0.4149 0.4975 0.4349 -0.0171 -0.0017 -0.0517 204 LEU A CD1 
2423 C CD2 . LEU A 159 ? 0.3981 0.4612 0.4255 -0.0269 0.0079  -0.0539 204 LEU A CD2 
2435 N N   . ASN A 160 ? 0.6787 0.6929 0.6651 -0.0587 -0.0300 -0.0942 205 ASN A N   
2436 C CA  . ASN A 160 ? 0.7596 0.7675 0.7499 -0.0754 -0.0440 -0.1042 205 ASN A CA  
2437 C C   . ASN A 160 ? 0.7465 0.7865 0.7523 -0.0788 -0.0550 -0.1071 205 ASN A C   
2438 O O   . ASN A 160 ? 0.7499 0.8109 0.7846 -0.0949 -0.0590 -0.1066 205 ASN A O   
2439 C CB  . ASN A 160 ? 0.8196 0.8202 0.8278 -0.0943 -0.0398 -0.0988 205 ASN A CB  
2440 C CG  . ASN A 160 ? 0.9084 0.8658 0.8966 -0.0947 -0.0397 -0.1011 205 ASN A CG  
2441 O OD1 . ASN A 160 ? 0.9144 0.8607 0.8968 -0.0853 -0.0296 -0.0932 205 ASN A OD1 
2442 N ND2 . ASN A 160 ? 0.9620 0.8933 0.9409 -0.1051 -0.0532 -0.1127 205 ASN A ND2 
2449 N N   . LEU A 161 ? 0.6832 0.7283 0.6694 -0.0625 -0.0595 -0.1091 206 LEU A N   
2450 C CA  . LEU A 161 ? 0.6411 0.7148 0.6381 -0.0613 -0.0726 -0.1106 206 LEU A CA  
2451 C C   . LEU A 161 ? 0.6395 0.7064 0.6286 -0.0712 -0.0949 -0.1267 206 LEU A C   
2452 O O   . LEU A 161 ? 0.6753 0.7107 0.6295 -0.0665 -0.1005 -0.1376 206 LEU A O   
2453 C CB  . LEU A 161 ? 0.6303 0.7088 0.6051 -0.0400 -0.0695 -0.1034 206 LEU A CB  
2454 C CG  . LEU A 161 ? 0.5921 0.6751 0.5750 -0.0307 -0.0502 -0.0881 206 LEU A CG  
2455 C CD1 . LEU A 161 ? 0.6018 0.6887 0.5642 -0.0131 -0.0491 -0.0791 206 LEU A CD1 
2456 C CD2 . LEU A 161 ? 0.5541 0.6601 0.5760 -0.0392 -0.0456 -0.0822 206 LEU A CD2 
2468 N N   . PRO A 162 ? 0.5769 0.6731 0.5987 -0.0845 -0.1087 -0.1298 207 PRO A N   
2469 C CA  . PRO A 162 ? 0.5892 0.6828 0.6065 -0.0943 -0.1345 -0.1461 207 PRO A CA  
2470 C C   . PRO A 162 ? 0.6301 0.7109 0.6008 -0.0739 -0.1471 -0.1533 207 PRO A C   
2471 O O   . PRO A 162 ? 0.5994 0.6891 0.5550 -0.0543 -0.1380 -0.1418 207 PRO A O   
2472 C CB  . PRO A 162 ? 0.5638 0.7055 0.6318 -0.1056 -0.1444 -0.1438 207 PRO A CB  
2473 C CG  . PRO A 162 ? 0.5261 0.6843 0.6254 -0.1103 -0.1202 -0.1297 207 PRO A CG  
2474 C CD  . PRO A 162 ? 0.5139 0.6482 0.5816 -0.0918 -0.1010 -0.1202 207 PRO A CD  
2482 N N   . PRO A 163 ? 0.7556 0.8140 0.7004 -0.0784 -0.1685 -0.1719 208 PRO A N   
2483 C CA  . PRO A 163 ? 0.8393 0.8786 0.7268 -0.0567 -0.1769 -0.1798 208 PRO A CA  
2484 C C   . PRO A 163 ? 0.8688 0.9378 0.7495 -0.0400 -0.1841 -0.1697 208 PRO A C   
2485 O O   . PRO A 163 ? 0.9063 0.9641 0.7438 -0.0185 -0.1743 -0.1627 208 PRO A O   
2486 C CB  . PRO A 163 ? 0.8833 0.8986 0.7532 -0.0687 -0.2050 -0.2049 208 PRO A CB  
2487 C CG  . PRO A 163 ? 0.8535 0.8892 0.7827 -0.0984 -0.2157 -0.2066 208 PRO A CG  
2488 C CD  . PRO A 163 ? 0.7979 0.8457 0.7627 -0.1041 -0.1864 -0.1870 208 PRO A CD  
2496 N N   . ASN A 164 ? 0.8360 0.9432 0.7592 -0.0487 -0.2004 -0.1674 209 ASN A N   
2497 C CA  . ASN A 164 ? 0.8464 0.9791 0.7631 -0.0315 -0.2131 -0.1587 209 ASN A CA  
2498 C C   . ASN A 164 ? 0.7602 0.9134 0.7019 -0.0208 -0.1911 -0.1358 209 ASN A C   
2499 O O   . ASN A 164 ? 0.7467 0.9239 0.6972 -0.0085 -0.2021 -0.1268 209 ASN A O   
2500 C CB  . ASN A 164 ? 0.9042 1.0698 0.8559 -0.0432 -0.2462 -0.1698 209 ASN A CB  
2501 C CG  . ASN A 164 ? 0.9977 1.1419 0.9079 -0.0449 -0.2769 -0.1920 209 ASN A CG  
2502 O OD1 . ASN A 164 ? 1.0524 1.1543 0.9128 -0.0414 -0.2713 -0.2026 209 ASN A OD1 
2503 N ND2 . ASN A 164 ? 1.0409 1.2149 0.9716 -0.0489 -0.3108 -0.2006 209 ASN A ND2 
2510 N N   . THR A 165 ? 0.6824 0.8240 0.6343 -0.0241 -0.1626 -0.1270 210 THR A N   
2511 C CA  . THR A 165 ? 0.6316 0.7882 0.6063 -0.0152 -0.1439 -0.1082 210 THR A CA  
2512 C C   . THR A 165 ? 0.6668 0.8147 0.6035 0.0074  -0.1422 -0.0945 210 THR A C   
2513 O O   . THR A 165 ? 0.6914 0.8133 0.5790 0.0164  -0.1370 -0.0948 210 THR A O   
2514 C CB  . THR A 165 ? 0.5661 0.7071 0.5501 -0.0223 -0.1168 -0.1030 210 THR A CB  
2515 O OG1 . THR A 165 ? 0.5523 0.7001 0.5696 -0.0438 -0.1175 -0.1120 210 THR A OG1 
2516 C CG2 . THR A 165 ? 0.5259 0.6780 0.5300 -0.0134 -0.0998 -0.0862 210 THR A CG2 
2524 N N   . ILE A 166 ? 0.6336 0.8026 0.5930 0.0173  -0.1452 -0.0817 211 ILE A N   
2525 C CA  . ILE A 166 ? 0.6659 0.8254 0.5930 0.0376  -0.1447 -0.0646 211 ILE A CA  
2526 C C   . ILE A 166 ? 0.6296 0.7719 0.5550 0.0407  -0.1157 -0.0489 211 ILE A C   
2527 O O   . ILE A 166 ? 0.5711 0.7221 0.5363 0.0344  -0.1035 -0.0462 211 ILE A O   
2528 C CB  . ILE A 166 ? 0.7092 0.8948 0.6628 0.0483  -0.1639 -0.0578 211 ILE A CB  
2529 C CG1 . ILE A 166 ? 0.7617 0.9667 0.7147 0.0468  -0.1969 -0.0725 211 ILE A CG1 
2530 C CG2 . ILE A 166 ? 0.7246 0.8939 0.6473 0.0683  -0.1605 -0.0355 211 ILE A CG2 
2531 C CD1 . ILE A 166 ? 0.7742 1.0102 0.7835 0.0270  -0.2048 -0.0893 211 ILE A CD1 
2543 N N   . MET A 167 ? 0.7257 0.8454 0.6052 0.0505  -0.1048 -0.0387 212 MET A N   
2544 C CA  . MET A 167 ? 0.7469 0.8526 0.6255 0.0529  -0.0788 -0.0221 212 MET A CA  
2545 C C   . MET A 167 ? 0.7650 0.8587 0.6052 0.0684  -0.0771 -0.0014 212 MET A C   
2546 O O   . MET A 167 ? 0.8071 0.8955 0.6024 0.0775  -0.0893 -0.0032 212 MET A O   
2547 C CB  . MET A 167 ? 0.7959 0.8877 0.6616 0.0462  -0.0601 -0.0295 212 MET A CB  
2548 C CG  . MET A 167 ? 0.8111 0.9072 0.7034 0.0310  -0.0632 -0.0488 212 MET A CG  
2549 S SD  . MET A 167 ? 0.8833 0.9580 0.7550 0.0281  -0.0458 -0.0581 212 MET A SD  
2550 C CE  . MET A 167 ? 0.8496 0.9231 0.7366 0.0316  -0.0192 -0.0379 212 MET A CE  
2560 N N   . GLU A 168 ? 0.7459 0.8328 0.6013 0.0708  -0.0628 0.0183  213 GLU A N   
2561 C CA  . GLU A 168 ? 0.8128 0.8849 0.6353 0.0829  -0.0583 0.0429  213 GLU A CA  
2562 C C   . GLU A 168 ? 0.7699 0.8299 0.5932 0.0779  -0.0291 0.0583  213 GLU A C   
2563 O O   . GLU A 168 ? 0.7045 0.7669 0.5690 0.0675  -0.0182 0.0559  213 GLU A O   
2564 C CB  . GLU A 168 ? 0.8847 0.9570 0.7285 0.0913  -0.0732 0.0559  213 GLU A CB  
2565 C CG  . GLU A 168 ? 0.9675 1.0582 0.8174 0.0983  -0.1035 0.0428  213 GLU A CG  
2566 C CD  . GLU A 168 ? 1.0354 1.1256 0.9042 0.1116  -0.1184 0.0570  213 GLU A CD  
2567 O OE1 . GLU A 168 ? 1.0745 1.1428 0.9433 0.1153  -0.1060 0.0784  213 GLU A OE1 
2568 O OE2 . GLU A 168 ? 1.0671 1.1785 0.9534 0.1185  -0.1434 0.0466  213 GLU A OE2 
2575 N N   . TYR A 169 ? 0.8419 0.8911 0.6198 0.0853  -0.0167 0.0743  214 TYR A N   
2576 C CA  . TYR A 169 ? 0.8419 0.8842 0.6227 0.0806  0.0120  0.0933  214 TYR A CA  
2577 C C   . TYR A 169 ? 0.9060 0.9324 0.6771 0.0856  0.0134  0.1241  214 TYR A C   
2578 O O   . TYR A 169 ? 0.9610 0.9785 0.6823 0.0976  0.0085  0.1379  214 TYR A O   
2579 C CB  . TYR A 169 ? 0.8512 0.8957 0.5908 0.0850  0.0306  0.0904  214 TYR A CB  
2580 C CG  . TYR A 169 ? 0.8268 0.8741 0.5835 0.0783  0.0617  0.1067  214 TYR A CG  
2581 C CD1 . TYR A 169 ? 0.7674 0.8253 0.5681 0.0677  0.0720  0.0942  214 TYR A CD1 
2582 C CD2 . TYR A 169 ? 0.8625 0.9035 0.5937 0.0817  0.0802  0.1361  214 TYR A CD2 
2583 C CE1 . TYR A 169 ? 0.7593 0.8249 0.5826 0.0613  0.0977  0.1085  214 TYR A CE1 
2584 C CE2 . TYR A 169 ? 0.8527 0.9019 0.6078 0.0732  0.1090  0.1518  214 TYR A CE2 
2585 C CZ  . TYR A 169 ? 0.7979 0.8611 0.6014 0.0632  0.1165  0.1369  214 TYR A CZ  
2586 O OH  . TYR A 169 ? 0.7895 0.8658 0.6231 0.0545  0.1426  0.1516  214 TYR A OH  
2596 N N   . LYS A 170 ? 0.9076 0.9270 0.7230 0.0767  0.0188  0.1350  215 LYS A N   
2597 C CA  . LYS A 170 ? 0.9760 0.9735 0.7886 0.0793  0.0197  0.1647  215 LYS A CA  
2598 C C   . LYS A 170 ? 0.9698 0.9616 0.7873 0.0682  0.0492  0.1875  215 LYS A C   
2599 O O   . LYS A 170 ? 0.9067 0.9118 0.7573 0.0561  0.0644  0.1779  215 LYS A O   
2600 C CB  . LYS A 170 ? 1.0117 1.0002 0.8705 0.0778  0.0034  0.1608  215 LYS A CB  
2601 C CG  . LYS A 170 ? 1.0740 1.0691 0.9304 0.0916  -0.0256 0.1469  215 LYS A CG  
2602 C CD  . LYS A 170 ? 1.1111 1.0963 1.0111 0.0941  -0.0382 0.1453  215 LYS A CD  
2603 C CE  . LYS A 170 ? 1.1368 1.1419 1.0499 0.1060  -0.0636 0.1251  215 LYS A CE  
2604 N NZ  . LYS A 170 ? 1.1384 1.1390 1.0971 0.1105  -0.0724 0.1184  215 LYS A NZ  
2618 N N   . THR A 171 ? 1.0265 0.9998 0.8119 0.0723  0.0567  0.2190  216 THR A N   
2619 C CA  . THR A 171 ? 1.0633 1.0301 0.8576 0.0598  0.0845  0.2470  216 THR A CA  
2620 C C   . THR A 171 ? 1.2224 1.1557 1.0316 0.0564  0.0764  0.2738  216 THR A C   
2621 O O   . THR A 171 ? 1.1641 1.0810 0.9765 0.0665  0.0501  0.2686  216 THR A O   
2622 C CB  . THR A 171 ? 1.1354 1.1095 0.8722 0.0665  0.1069  0.2641  216 THR A CB  
2623 O OG1 . THR A 171 ? 1.1776 1.1299 0.8588 0.0813  0.0936  0.2836  216 THR A OG1 
2624 C CG2 . THR A 171 ? 1.1056 1.1058 0.8220 0.0741  0.1100  0.2337  216 THR A CG2 
2632 N N   . HIS A 172 ? 1.4130 1.3359 1.2339 0.0420  0.0995  0.3030  217 HIS A N   
2633 C CA  . HIS A 172 ? 1.5393 1.4238 1.3747 0.0360  0.0937  0.3312  217 HIS A CA  
2634 C C   . HIS A 172 ? 1.5864 1.4463 1.3624 0.0456  0.0978  0.3684  217 HIS A C   
2635 O O   . HIS A 172 ? 1.6620 1.4826 1.4409 0.0449  0.0879  0.3933  217 HIS A O   
2636 C CB  . HIS A 172 ? 1.4980 1.3815 1.3876 0.0106  0.1136  0.3428  217 HIS A CB  
2637 C CG  . HIS A 172 ? 1.4750 1.3829 1.4175 0.0012  0.1102  0.3087  217 HIS A CG  
2638 N ND1 . HIS A 172 ? 1.4380 1.3842 1.3768 0.0051  0.1180  0.2832  217 HIS A ND1 
2639 C CD2 . HIS A 172 ? 1.4513 1.3476 1.4476 -0.0108 0.0987  0.2958  217 HIS A CD2 
2640 C CE1 . HIS A 172 ? 1.3860 1.3436 1.3736 -0.0043 0.1115  0.2587  217 HIS A CE1 
2641 N NE2 . HIS A 172 ? 1.3891 1.3182 1.4107 -0.0139 0.0999  0.2650  217 HIS A NE2 
2649 N N   . THR A 173 ? 1.6262 1.5051 1.3455 0.0558  0.1112  0.3725  218 THR A N   
2650 C CA  . THR A 173 ? 1.7238 1.5805 1.3756 0.0670  0.1153  0.4076  218 THR A CA  
2651 C C   . THR A 173 ? 1.7440 1.5983 1.3443 0.0928  0.0840  0.3922  218 THR A C   
2652 O O   . THR A 173 ? 1.6889 1.5578 1.3141 0.0996  0.0598  0.3566  218 THR A O   
2653 C CB  . THR A 173 ? 1.7733 1.6520 1.3881 0.0620  0.1546  0.4261  218 THR A CB  
2654 O OG1 . THR A 173 ? 1.8652 1.7200 1.4062 0.0739  0.1585  0.4618  218 THR A OG1 
2655 C CG2 . THR A 173 ? 1.7392 1.6579 1.3377 0.0715  0.1599  0.3892  218 THR A CG2 
2663 N N   . LYS B 7   ? 1.1756 1.5490 1.3620 0.2430  0.3707  -0.0082 37  LYS B N   
2664 C CA  . LYS B 7   ? 1.1232 1.5265 1.3814 0.2260  0.3607  -0.0088 37  LYS B CA  
2665 C C   . LYS B 7   ? 1.0675 1.4545 1.3238 0.2304  0.3309  -0.0272 37  LYS B C   
2666 O O   . LYS B 7   ? 1.0662 1.4203 1.2779 0.2330  0.3169  -0.0331 37  LYS B O   
2667 C CB  . LYS B 7   ? 1.0985 1.5128 1.3939 0.1966  0.3656  0.0104  37  LYS B CB  
2668 C CG  . LYS B 7   ? 1.1427 1.5564 1.4204 0.1917  0.3922  0.0312  37  LYS B CG  
2669 C CD  . LYS B 7   ? 1.1193 1.5413 1.4395 0.1619  0.3940  0.0492  37  LYS B CD  
2670 C CE  . LYS B 7   ? 1.1530 1.5656 1.4483 0.1576  0.4187  0.0714  37  LYS B CE  
2671 N NZ  . LYS B 7   ? 1.1996 1.6337 1.4967 0.1697  0.4451  0.0792  37  LYS B NZ  
2685 N N   . LEU B 8   ? 0.9527 1.3632 1.2583 0.2317  0.3207  -0.0357 38  LEU B N   
2686 C CA  . LEU B 8   ? 0.8652 1.2617 1.1720 0.2381  0.2928  -0.0515 38  LEU B CA  
2687 C C   . LEU B 8   ? 0.7830 1.1935 1.1455 0.2107  0.2748  -0.0470 38  LEU B C   
2688 O O   . LEU B 8   ? 0.7698 1.2177 1.1915 0.1996  0.2878  -0.0358 38  LEU B O   
2689 C CB  . LEU B 8   ? 0.8645 1.2663 1.1750 0.2620  0.2872  -0.0676 38  LEU B CB  
2690 C CG  . LEU B 8   ? 0.8896 1.2717 1.1448 0.2859  0.2990  -0.0755 38  LEU B CG  
2691 C CD1 . LEU B 8   ? 0.9074 1.2917 1.1719 0.3081  0.2903  -0.0921 38  LEU B CD1 
2692 C CD2 . LEU B 8   ? 0.9051 1.2417 1.0891 0.2923  0.2873  -0.0822 38  LEU B CD2 
2704 N N   . ALA B 9   ? 0.7103 1.0882 1.0519 0.1984  0.2422  -0.0568 39  ALA B N   
2705 C CA  . ALA B 9   ? 0.6435 1.0258 1.0244 0.1727  0.2209  -0.0548 39  ALA B CA  
2706 C C   . ALA B 9   ? 0.5967 0.9926 1.0135 0.1792  0.2022  -0.0653 39  ALA B C   
2707 O O   . ALA B 9   ? 0.6098 0.9886 1.0011 0.1984  0.1904  -0.0785 39  ALA B O   
2708 C CB  . ALA B 9   ? 0.6298 0.9722 0.9700 0.1572  0.1972  -0.0591 39  ALA B CB  
2714 N N   . ASP B 10  ? 0.4930 0.9179 0.9693 0.1638  0.1977  -0.0597 40  ASP B N   
2715 C CA  . ASP B 10  ? 0.4350 0.8739 0.9493 0.1686  0.1769  -0.0687 40  ASP B CA  
2716 C C   . ASP B 10  ? 0.4006 0.8097 0.9003 0.1536  0.1415  -0.0756 40  ASP B C   
2717 O O   . ASP B 10  ? 0.3764 0.7832 0.8871 0.1616  0.1199  -0.0847 40  ASP B O   
2718 C CB  . ASP B 10  ? 0.4233 0.9114 1.0139 0.1609  0.1879  -0.0602 40  ASP B CB  
2719 C CG  . ASP B 10  ? 0.4520 0.9762 1.0657 0.1777  0.2249  -0.0524 40  ASP B CG  
2720 O OD1 . ASP B 10  ? 0.4583 0.9891 1.0643 0.2037  0.2291  -0.0612 40  ASP B OD1 
2721 O OD2 . ASP B 10  ? 0.4663 1.0044 1.0895 0.1623  0.2438  -0.0374 40  ASP B OD2 
2726 N N   . TYR B 11  ? 0.4013 0.7881 0.8766 0.1333  0.1359  -0.0709 41  TYR B N   
2727 C CA  . TYR B 11  ? 0.4086 0.7681 0.8672 0.1187  0.1063  -0.0759 41  TYR B CA  
2728 C C   . TYR B 11  ? 0.4514 0.7717 0.8485 0.1174  0.1037  -0.0782 41  TYR B C   
2729 O O   . TYR B 11  ? 0.4642 0.7780 0.8455 0.1063  0.1149  -0.0714 41  TYR B O   
2730 C CB  . TYR B 11  ? 0.3952 0.7681 0.8893 0.0954  0.1005  -0.0695 41  TYR B CB  
2731 C CG  . TYR B 11  ? 0.3905 0.8015 0.9497 0.0959  0.0970  -0.0693 41  TYR B CG  
2732 C CD1 . TYR B 11  ? 0.3797 0.7888 0.9541 0.0961  0.0681  -0.0774 41  TYR B CD1 
2733 C CD2 . TYR B 11  ? 0.3860 0.8354 0.9923 0.0971  0.1226  -0.0604 41  TYR B CD2 
2734 C CE1 . TYR B 11  ? 0.3854 0.8307 1.0225 0.0978  0.0618  -0.0786 41  TYR B CE1 
2735 C CE2 . TYR B 11  ? 0.3811 0.8694 1.0547 0.0972  0.1190  -0.0606 41  TYR B CE2 
2736 C CZ  . TYR B 11  ? 0.3924 0.8787 1.0819 0.0978  0.0870  -0.0706 41  TYR B CZ  
2737 O OH  . TYR B 11  ? 0.3901 0.9159 1.1490 0.0986  0.0800  -0.0720 41  TYR B OH  
2747 N N   . ARG B 12  ? 0.5584 0.8523 0.9234 0.1289  0.0880  -0.0877 42  ARG B N   
2748 C CA  . ARG B 12  ? 0.5869 0.8451 0.8987 0.1295  0.0839  -0.0914 42  ARG B CA  
2749 C C   . ARG B 12  ? 0.5539 0.7836 0.8478 0.1209  0.0569  -0.0960 42  ARG B C   
2750 O O   . ARG B 12  ? 0.5534 0.7815 0.8593 0.1279  0.0416  -0.1004 42  ARG B O   
2751 C CB  . ARG B 12  ? 0.6949 0.9451 0.9817 0.1539  0.0934  -0.0987 42  ARG B CB  
2752 C CG  . ARG B 12  ? 0.7774 1.0527 1.0717 0.1642  0.1236  -0.0926 42  ARG B CG  
2753 C CD  . ARG B 12  ? 0.8612 1.1288 1.1282 0.1920  0.1325  -0.1017 42  ARG B CD  
2754 N NE  . ARG B 12  ? 0.9109 1.2049 1.2132 0.2097  0.1375  -0.1054 42  ARG B NE  
2755 C CZ  . ARG B 12  ? 0.9436 1.2264 1.2497 0.2206  0.1172  -0.1159 42  ARG B CZ  
2756 N NH1 . ARG B 12  ? 0.9589 1.2029 1.2348 0.2143  0.0911  -0.1225 42  ARG B NH1 
2757 N NH2 . ARG B 12  ? 0.9629 1.2736 1.3048 0.2383  0.1233  -0.1191 42  ARG B NH2 
2771 N N   . TYR B 13  ? 0.4333 0.6411 0.6990 0.1063  0.0518  -0.0941 43  TYR B N   
2772 C CA  . TYR B 13  ? 0.3898 0.5709 0.6362 0.0966  0.0303  -0.0961 43  TYR B CA  
2773 C C   . TYR B 13  ? 0.3753 0.5290 0.5829 0.0938  0.0294  -0.0983 43  TYR B C   
2774 O O   . TYR B 13  ? 0.3656 0.5214 0.5647 0.0850  0.0392  -0.0947 43  TYR B O   
2775 C CB  . TYR B 13  ? 0.3781 0.5660 0.6393 0.0778  0.0230  -0.0908 43  TYR B CB  
2776 C CG  . TYR B 13  ? 0.3620 0.5789 0.6661 0.0784  0.0223  -0.0893 43  TYR B CG  
2777 C CD1 . TYR B 13  ? 0.3894 0.6070 0.7073 0.0859  0.0053  -0.0927 43  TYR B CD1 
2778 C CD2 . TYR B 13  ? 0.3595 0.6023 0.6926 0.0715  0.0374  -0.0841 43  TYR B CD2 
2779 C CE1 . TYR B 13  ? 0.3878 0.6339 0.7495 0.0868  0.0021  -0.0925 43  TYR B CE1 
2780 C CE2 . TYR B 13  ? 0.3666 0.6377 0.7458 0.0704  0.0355  -0.0830 43  TYR B CE2 
2781 C CZ  . TYR B 13  ? 0.3578 0.6318 0.7522 0.0783  0.0172  -0.0879 43  TYR B CZ  
2782 O OH  . TYR B 13  ? 0.3841 0.6880 0.8283 0.0776  0.0128  -0.0880 43  TYR B OH  
2792 N N   . GLY B 14  ? 0.4085 0.5362 0.5950 0.1014  0.0162  -0.1043 44  GLY B N   
2793 C CA  . GLY B 14  ? 0.4027 0.5033 0.5585 0.0955  0.0101  -0.1067 44  GLY B CA  
2794 C C   . GLY B 14  ? 0.4133 0.5076 0.5659 0.0744  0.0034  -0.1003 44  GLY B C   
2795 O O   . GLY B 14  ? 0.3917 0.4965 0.5598 0.0659  0.0001  -0.0953 44  GLY B O   
2799 N N   . ARG B 15  ? 0.4442 0.5210 0.5762 0.0671  0.0007  -0.1015 45  ARG B N   
2800 C CA  . ARG B 15  ? 0.4271 0.4999 0.5557 0.0485  -0.0027 -0.0957 45  ARG B CA  
2801 C C   . ARG B 15  ? 0.4352 0.4975 0.5650 0.0419  -0.0151 -0.0911 45  ARG B C   
2802 O O   . ARG B 15  ? 0.4155 0.4874 0.5518 0.0322  -0.0148 -0.0859 45  ARG B O   
2803 C CB  . ARG B 15  ? 0.4535 0.5093 0.5645 0.0436  -0.0059 -0.0986 45  ARG B CB  
2804 C CG  . ARG B 15  ? 0.4509 0.5104 0.5615 0.0266  -0.0036 -0.0935 45  ARG B CG  
2805 C CD  . ARG B 15  ? 0.4601 0.5083 0.5598 0.0244  -0.0067 -0.0979 45  ARG B CD  
2806 N NE  . ARG B 15  ? 0.4688 0.5237 0.5715 0.0101  -0.0037 -0.0937 45  ARG B NE  
2807 C CZ  . ARG B 15  ? 0.4779 0.5240 0.5816 -0.0026 -0.0094 -0.0899 45  ARG B CZ  
2808 N NH1 . ARG B 15  ? 0.4899 0.5169 0.5908 -0.0045 -0.0194 -0.0883 45  ARG B NH1 
2809 N NH2 . ARG B 15  ? 0.4637 0.5201 0.5721 -0.0131 -0.0042 -0.0869 45  ARG B NH2 
2823 N N   . GLU B 16  ? 0.4385 0.4785 0.5597 0.0484  -0.0270 -0.0932 46  GLU B N   
2824 C CA  . GLU B 16  ? 0.4505 0.4760 0.5679 0.0431  -0.0392 -0.0869 46  GLU B CA  
2825 C C   . GLU B 16  ? 0.4561 0.4995 0.5896 0.0482  -0.0411 -0.0852 46  GLU B C   
2826 O O   . GLU B 16  ? 0.4492 0.4892 0.5785 0.0406  -0.0479 -0.0790 46  GLU B O   
2827 C CB  . GLU B 16  ? 0.4793 0.4748 0.5856 0.0508  -0.0522 -0.0892 46  GLU B CB  
2828 C CG  . GLU B 16  ? 0.4918 0.4666 0.5855 0.0423  -0.0547 -0.0903 46  GLU B CG  
2829 C CD  . GLU B 16  ? 0.4847 0.4557 0.5735 0.0221  -0.0533 -0.0800 46  GLU B CD  
2830 O OE1 . GLU B 16  ? 0.5007 0.4625 0.5841 0.0169  -0.0586 -0.0708 46  GLU B OE1 
2831 O OE2 . GLU B 16  ? 0.4615 0.4393 0.5511 0.0127  -0.0466 -0.0809 46  GLU B OE2 
2838 N N   . GLU B 17  ? 0.4775 0.5406 0.6297 0.0617  -0.0353 -0.0907 47  GLU B N   
2839 C CA  . GLU B 17  ? 0.4831 0.5674 0.6589 0.0660  -0.0380 -0.0900 47  GLU B CA  
2840 C C   . GLU B 17  ? 0.4504 0.5520 0.6347 0.0518  -0.0326 -0.0861 47  GLU B C   
2841 O O   . GLU B 17  ? 0.4427 0.5466 0.6314 0.0477  -0.0428 -0.0837 47  GLU B O   
2842 C CB  . GLU B 17  ? 0.5054 0.6119 0.7047 0.0823  -0.0289 -0.0958 47  GLU B CB  
2843 C CG  . GLU B 17  ? 0.5459 0.6358 0.7360 0.0999  -0.0335 -0.1021 47  GLU B CG  
2844 C CD  . GLU B 17  ? 0.5670 0.6828 0.7800 0.1178  -0.0209 -0.1077 47  GLU B CD  
2845 O OE1 . GLU B 17  ? 0.5444 0.6882 0.7898 0.1200  -0.0189 -0.1061 47  GLU B OE1 
2846 O OE2 . GLU B 17  ? 0.5669 0.6756 0.7660 0.1298  -0.0129 -0.1138 47  GLU B OE2 
2853 N N   . MET B 18  ? 0.3759 0.4880 0.5609 0.0455  -0.0180 -0.0862 48  MET B N   
2854 C CA  . MET B 18  ? 0.3747 0.4985 0.5653 0.0323  -0.0136 -0.0834 48  MET B CA  
2855 C C   . MET B 18  ? 0.3565 0.4628 0.5258 0.0219  -0.0238 -0.0798 48  MET B C   
2856 O O   . MET B 18  ? 0.3676 0.4795 0.5410 0.0165  -0.0297 -0.0790 48  MET B O   
2857 C CB  . MET B 18  ? 0.4178 0.5471 0.6045 0.0279  0.0017  -0.0832 48  MET B CB  
2858 C CG  . MET B 18  ? 0.4594 0.6061 0.6625 0.0381  0.0154  -0.0846 48  MET B CG  
2859 S SD  . MET B 18  ? 0.4783 0.6553 0.7222 0.0368  0.0202  -0.0823 48  MET B SD  
2860 C CE  . MET B 18  ? 0.5353 0.7145 0.7787 0.0204  0.0259  -0.0788 48  MET B CE  
2870 N N   . LEU B 19  ? 0.4156 0.5002 0.5620 0.0191  -0.0258 -0.0776 49  LEU B N   
2871 C CA  . LEU B 19  ? 0.4207 0.4895 0.5460 0.0089  -0.0312 -0.0719 49  LEU B CA  
2872 C C   . LEU B 19  ? 0.4473 0.5045 0.5652 0.0132  -0.0460 -0.0685 49  LEU B C   
2873 O O   . LEU B 19  ? 0.4759 0.5287 0.5801 0.0074  -0.0506 -0.0647 49  LEU B O   
2874 C CB  . LEU B 19  ? 0.4212 0.4717 0.5307 0.0037  -0.0289 -0.0693 49  LEU B CB  
2875 C CG  . LEU B 19  ? 0.3962 0.4557 0.5094 -0.0003 -0.0174 -0.0727 49  LEU B CG  
2876 C CD1 . LEU B 19  ? 0.4137 0.4546 0.5168 -0.0043 -0.0197 -0.0718 49  LEU B CD1 
2877 C CD2 . LEU B 19  ? 0.3866 0.4585 0.4996 -0.0099 -0.0099 -0.0711 49  LEU B CD2 
2889 N N   . ALA B 20  ? 0.4618 0.5121 0.5858 0.0251  -0.0543 -0.0703 50  ALA B N   
2890 C CA  . ALA B 20  ? 0.4967 0.5353 0.6145 0.0318  -0.0706 -0.0673 50  ALA B CA  
2891 C C   . ALA B 20  ? 0.5086 0.5656 0.6387 0.0319  -0.0767 -0.0696 50  ALA B C   
2892 O O   . ALA B 20  ? 0.5355 0.5803 0.6494 0.0328  -0.0902 -0.0659 50  ALA B O   
2893 C CB  . ALA B 20  ? 0.4930 0.5271 0.6228 0.0477  -0.0781 -0.0713 50  ALA B CB  
2899 N N   . LEU B 21  ? 0.5039 0.5881 0.6613 0.0308  -0.0678 -0.0755 51  LEU B N   
2900 C CA  . LEU B 21  ? 0.5251 0.6282 0.7029 0.0304  -0.0752 -0.0793 51  LEU B CA  
2901 C C   . LEU B 21  ? 0.5388 0.6416 0.7030 0.0182  -0.0725 -0.0792 51  LEU B C   
2902 O O   . LEU B 21  ? 0.5347 0.6511 0.7159 0.0166  -0.0796 -0.0839 51  LEU B O   
2903 C CB  . LEU B 21  ? 0.5029 0.6356 0.7222 0.0349  -0.0662 -0.0843 51  LEU B CB  
2904 C CG  . LEU B 21  ? 0.5076 0.6461 0.7451 0.0503  -0.0685 -0.0865 51  LEU B CG  
2905 C CD1 . LEU B 21  ? 0.4941 0.6611 0.7657 0.0538  -0.0514 -0.0891 51  LEU B CD1 
2906 C CD2 . LEU B 21  ? 0.5202 0.6609 0.7704 0.0593  -0.0897 -0.0885 51  LEU B CD2 
2918 N N   . PHE B 22  ? 0.5727 0.6608 0.7092 0.0101  -0.0632 -0.0747 52  PHE B N   
2919 C CA  . PHE B 22  ? 0.5956 0.6818 0.7153 0.0012  -0.0607 -0.0750 52  PHE B CA  
2920 C C   . PHE B 22  ? 0.6579 0.7274 0.7495 0.0036  -0.0758 -0.0724 52  PHE B C   
2921 O O   . PHE B 22  ? 0.6911 0.7414 0.7620 0.0077  -0.0821 -0.0655 52  PHE B O   
2922 C CB  . PHE B 22  ? 0.5957 0.6746 0.6981 -0.0070 -0.0453 -0.0708 52  PHE B CB  
2923 C CG  . PHE B 22  ? 0.5987 0.6737 0.6793 -0.0137 -0.0420 -0.0704 52  PHE B CG  
2924 C CD1 . PHE B 22  ? 0.5841 0.6723 0.6763 -0.0175 -0.0367 -0.0769 52  PHE B CD1 
2925 C CD2 . PHE B 22  ? 0.6195 0.6763 0.6672 -0.0154 -0.0434 -0.0632 52  PHE B CD2 
2926 C CE1 . PHE B 22  ? 0.5917 0.6754 0.6625 -0.0212 -0.0338 -0.0784 52  PHE B CE1 
2927 C CE2 . PHE B 22  ? 0.6319 0.6865 0.6576 -0.0194 -0.0381 -0.0632 52  PHE B CE2 
2928 C CZ  . PHE B 22  ? 0.6214 0.6897 0.6585 -0.0215 -0.0338 -0.0720 52  PHE B CZ  
2938 N N   . LEU B 23  ? 0.7285 0.8024 0.8166 0.0018  -0.0824 -0.0781 53  LEU B N   
2939 C CA  . LEU B 23  ? 0.7966 0.8532 0.8507 0.0056  -0.0967 -0.0768 53  LEU B CA  
2940 C C   . LEU B 23  ? 0.8076 0.8645 0.8452 0.0004  -0.0924 -0.0820 53  LEU B C   
2941 O O   . LEU B 23  ? 0.7853 0.8578 0.8489 -0.0031 -0.0913 -0.0908 53  LEU B O   
2942 C CB  . LEU B 23  ? 0.8324 0.8924 0.9014 0.0152  -0.1202 -0.0823 53  LEU B CB  
2943 C CG  . LEU B 23  ? 0.8473 0.9294 0.9538 0.0138  -0.1284 -0.0942 53  LEU B CG  
2944 C CD1 . LEU B 23  ? 0.8798 0.9517 0.9614 0.0151  -0.1443 -0.1014 53  LEU B CD1 
2945 C CD2 . LEU B 23  ? 0.8451 0.9442 0.9934 0.0213  -0.1409 -0.0975 53  LEU B CD2 
2957 N N   . LYS B 24  ? 0.7947 0.8337 0.7892 0.0002  -0.0886 -0.0760 54  LYS B N   
2958 C CA  . LYS B 24  ? 0.8161 0.8533 0.7888 -0.0014 -0.0851 -0.0820 54  LYS B CA  
2959 C C   . LYS B 24  ? 0.8091 0.8462 0.7836 0.0050  -0.1076 -0.0943 54  LYS B C   
2960 O O   . LYS B 24  ? 0.8079 0.8310 0.7586 0.0136  -0.1257 -0.0937 54  LYS B O   
2961 C CB  . LYS B 24  ? 0.8768 0.8956 0.8011 -0.0006 -0.0759 -0.0718 54  LYS B CB  
2962 C CG  . LYS B 24  ? 0.9021 0.9263 0.8281 -0.0096 -0.0513 -0.0643 54  LYS B CG  
2963 C CD  . LYS B 24  ? 0.9737 0.9831 0.8553 -0.0093 -0.0404 -0.0535 54  LYS B CD  
2964 C CE  . LYS B 24  ? 0.9835 1.0017 0.8743 -0.0192 -0.0167 -0.0457 54  LYS B CE  
2965 N NZ  . LYS B 24  ? 1.0387 1.0442 0.8919 -0.0204 -0.0038 -0.0316 54  LYS B NZ  
2979 N N   . ASP B 25  ? 0.7700 0.8213 0.7735 0.0009  -0.1081 -0.1055 55  ASP B N   
2980 C CA  . ASP B 25  ? 0.7810 0.8327 0.7932 0.0047  -0.1304 -0.1191 55  ASP B CA  
2981 C C   . ASP B 25  ? 0.7807 0.8279 0.7768 0.0026  -0.1248 -0.1283 55  ASP B C   
2982 O O   . ASP B 25  ? 0.7511 0.8101 0.7753 -0.0049 -0.1125 -0.1311 55  ASP B O   
2983 C CB  . ASP B 25  ? 0.7712 0.8443 0.8421 0.0009  -0.1378 -0.1237 55  ASP B CB  
2984 C CG  . ASP B 25  ? 0.7930 0.8687 0.8826 0.0017  -0.1610 -0.1383 55  ASP B CG  
2985 O OD1 . ASP B 25  ? 0.8409 0.8992 0.8945 0.0096  -0.1797 -0.1450 55  ASP B OD1 
2986 O OD2 . ASP B 25  ? 0.7848 0.8787 0.9245 -0.0055 -0.1608 -0.1427 55  ASP B OD2 
2991 N N   . ASN B 26  ? 0.8774 0.9059 0.8254 0.0109  -0.1336 -0.1328 56  ASN B N   
2992 C CA  . ASN B 26  ? 0.9158 0.9377 0.8436 0.0121  -0.1293 -0.1435 56  ASN B CA  
2993 C C   . ASN B 26  ? 0.9549 0.9817 0.9182 0.0092  -0.1463 -0.1597 56  ASN B C   
2994 O O   . ASN B 26  ? 0.9843 1.0063 0.9411 0.0089  -0.1420 -0.1694 56  ASN B O   
2995 C CB  . ASN B 26  ? 0.9627 0.9623 0.8267 0.0244  -0.1359 -0.1455 56  ASN B CB  
2996 C CG  . ASN B 26  ? 0.9646 0.9585 0.7925 0.0253  -0.1136 -0.1277 56  ASN B CG  
2997 O OD1 . ASN B 26  ? 0.9229 0.9293 0.7716 0.0163  -0.0915 -0.1172 56  ASN B OD1 
2998 N ND2 . ASN B 26  ? 1.0060 0.9798 0.7790 0.0362  -0.1199 -0.1240 56  ASN B ND2 
3005 N N   . LYS B 27  ? 1.0122 1.0485 1.0152 0.0069  -0.1653 -0.1629 57  LYS B N   
3006 C CA  . LYS B 27  ? 1.0297 1.0723 1.0749 0.0013  -0.1812 -0.1765 57  LYS B CA  
3007 C C   . LYS B 27  ? 0.9740 1.0319 1.0600 -0.0105 -0.1594 -0.1719 57  LYS B C   
3008 O O   . LYS B 27  ? 0.9507 1.0257 1.0669 -0.0160 -0.1452 -0.1601 57  LYS B O   
3009 C CB  . LYS B 27  ? 1.0601 1.1136 1.1431 0.0017  -0.2055 -0.1793 57  LYS B CB  
3010 C CG  . LYS B 27  ? 1.0919 1.1495 1.2174 -0.0040 -0.2274 -0.1947 57  LYS B CG  
3011 C CD  . LYS B 27  ? 1.1206 1.1822 1.2659 0.0011  -0.2602 -0.2023 57  LYS B CD  
3012 C CE  . LYS B 27  ? 1.1352 1.1962 1.3176 -0.0046 -0.2860 -0.2201 57  LYS B CE  
3013 N NZ  . LYS B 27  ? 1.1629 1.2277 1.3645 0.0015  -0.3220 -0.2298 57  LYS B NZ  
3027 N N   . ILE B 28  ? 0.9107 0.9600 0.9940 -0.0127 -0.1575 -0.1815 58  ILE B N   
3028 C CA  . ILE B 28  ? 0.8311 0.8896 0.9452 -0.0221 -0.1377 -0.1772 58  ILE B CA  
3029 C C   . ILE B 28  ? 0.7570 0.8271 0.9309 -0.0322 -0.1487 -0.1801 58  ILE B C   
3030 O O   . ILE B 28  ? 0.7721 0.8340 0.9571 -0.0325 -0.1733 -0.1937 58  ILE B O   
3031 C CB  . ILE B 28  ? 0.8527 0.8951 0.9377 -0.0185 -0.1313 -0.1861 58  ILE B CB  
3032 C CG1 . ILE B 28  ? 0.8738 0.9086 0.9032 -0.0087 -0.1181 -0.1821 58  ILE B CG1 
3033 C CG2 . ILE B 28  ? 0.8260 0.8757 0.9414 -0.0270 -0.1125 -0.1807 58  ILE B CG2 
3034 C CD1 . ILE B 28  ? 0.9041 0.9235 0.8997 -0.0010 -0.1145 -0.1934 58  ILE B CD1 
3046 N N   . PRO B 29  ? 0.5944 0.6832 0.8079 -0.0406 -0.1314 -0.1679 59  PRO B N   
3047 C CA  . PRO B 29  ? 0.5441 0.6454 0.8167 -0.0512 -0.1377 -0.1683 59  PRO B CA  
3048 C C   . PRO B 29  ? 0.5532 0.6381 0.8342 -0.0566 -0.1464 -0.1794 59  PRO B C   
3049 O O   . PRO B 29  ? 0.5376 0.6102 0.7967 -0.0556 -0.1326 -0.1791 59  PRO B O   
3050 C CB  . PRO B 29  ? 0.4946 0.6142 0.7913 -0.0562 -0.1107 -0.1517 59  PRO B CB  
3051 C CG  . PRO B 29  ? 0.4908 0.6106 0.7486 -0.0476 -0.0985 -0.1444 59  PRO B CG  
3052 C CD  . PRO B 29  ? 0.5382 0.6371 0.7441 -0.0402 -0.1056 -0.1530 59  PRO B CD  
3060 N N   . SER B 30  ? 0.6530 0.7372 0.9684 -0.0620 -0.1709 -0.1898 60  SER B N   
3061 C CA  . SER B 30  ? 0.6915 0.7559 1.0166 -0.0674 -0.1842 -0.2025 60  SER B CA  
3062 C C   . SER B 30  ? 0.6887 0.7506 1.0297 -0.0754 -0.1606 -0.1925 60  SER B C   
3063 O O   . SER B 30  ? 0.7287 0.7675 1.0498 -0.0736 -0.1621 -0.2010 60  SER B O   
3064 C CB  . SER B 30  ? 0.7304 0.8008 1.1093 -0.0765 -0.2114 -0.2112 60  SER B CB  
3065 O OG  . SER B 30  ? 0.7002 0.7990 1.1394 -0.0883 -0.1979 -0.1958 60  SER B OG  
3071 N N   . ASP B 31  ? 0.6883 0.7725 1.0626 -0.0826 -0.1388 -0.1745 61  ASP B N   
3072 C CA  . ASP B 31  ? 0.6760 0.7570 1.0616 -0.0888 -0.1161 -0.1629 61  ASP B CA  
3073 C C   . ASP B 31  ? 0.6819 0.7450 1.0146 -0.0788 -0.1045 -0.1654 61  ASP B C   
3074 O O   . ASP B 31  ? 0.7033 0.7508 1.0364 -0.0811 -0.0981 -0.1650 61  ASP B O   
3075 C CB  . ASP B 31  ? 0.6509 0.7583 1.0631 -0.0925 -0.0924 -0.1433 61  ASP B CB  
3076 C CG  . ASP B 31  ? 0.6584 0.7869 1.1328 -0.1036 -0.0983 -0.1384 61  ASP B CG  
3077 O OD1 . ASP B 31  ? 0.6657 0.7861 1.1754 -0.1142 -0.1136 -0.1447 61  ASP B OD1 
3078 O OD2 . ASP B 31  ? 0.6350 0.7886 1.1253 -0.1015 -0.0878 -0.1287 61  ASP B OD2 
3083 N N   . LEU B 32  ? 0.6744 0.7400 0.9637 -0.0675 -0.1014 -0.1671 62  LEU B N   
3084 C CA  . LEU B 32  ? 0.6735 0.7281 0.9178 -0.0582 -0.0881 -0.1682 62  LEU B CA  
3085 C C   . LEU B 32  ? 0.7237 0.7548 0.9351 -0.0502 -0.1035 -0.1864 62  LEU B C   
3086 O O   . LEU B 32  ? 0.7327 0.7552 0.9119 -0.0421 -0.0924 -0.1887 62  LEU B O   
3087 C CB  . LEU B 32  ? 0.6449 0.7123 0.8597 -0.0510 -0.0762 -0.1606 62  LEU B CB  
3088 C CG  . LEU B 32  ? 0.6044 0.6893 0.8335 -0.0538 -0.0547 -0.1439 62  LEU B CG  
3089 C CD1 . LEU B 32  ? 0.5921 0.6855 0.7943 -0.0474 -0.0490 -0.1389 62  LEU B CD1 
3090 C CD2 . LEU B 32  ? 0.5973 0.6763 0.8216 -0.0534 -0.0381 -0.1390 62  LEU B CD2 
3102 N N   . LEU B 33  ? 0.8289 0.8499 1.0470 -0.0510 -0.1293 -0.2002 63  LEU B N   
3103 C CA  . LEU B 33  ? 0.8995 0.8949 1.0841 -0.0417 -0.1459 -0.2198 63  LEU B CA  
3104 C C   . LEU B 33  ? 0.9390 0.9145 1.1457 -0.0470 -0.1518 -0.2272 63  LEU B C   
3105 O O   . LEU B 33  ? 0.9849 0.9359 1.1669 -0.0387 -0.1677 -0.2457 63  LEU B O   
3106 C CB  . LEU B 33  ? 0.9357 0.9254 1.1120 -0.0379 -0.1748 -0.2335 63  LEU B CB  
3107 C CG  . LEU B 33  ? 0.9268 0.9287 1.0713 -0.0298 -0.1723 -0.2276 63  LEU B CG  
3108 C CD1 . LEU B 33  ? 0.9713 0.9660 1.1109 -0.0257 -0.2042 -0.2410 63  LEU B CD1 
3109 C CD2 . LEU B 33  ? 0.9464 0.9413 1.0321 -0.0164 -0.1554 -0.2273 63  LEU B CD2 
3121 N N   . ASP B 34  ? 0.8976 0.8808 1.1477 -0.0595 -0.1394 -0.2132 64  ASP B N   
3122 C CA  . ASP B 34  ? 0.9262 0.8874 1.1938 -0.0642 -0.1414 -0.2166 64  ASP B CA  
3123 C C   . ASP B 34  ? 0.8923 0.8390 1.1160 -0.0501 -0.1297 -0.2222 64  ASP B C   
3124 O O   . ASP B 34  ? 0.8535 0.8152 1.0502 -0.0422 -0.1100 -0.2140 64  ASP B O   
3125 C CB  . ASP B 34  ? 0.9353 0.9090 1.2506 -0.0788 -0.1249 -0.1959 64  ASP B CB  
3126 C CG  . ASP B 34  ? 0.9890 0.9376 1.3307 -0.0869 -0.1302 -0.1971 64  ASP B CG  
3127 O OD1 . ASP B 34  ? 1.0103 0.9640 1.4029 -0.1028 -0.1310 -0.1865 64  ASP B OD1 
3128 O OD2 . ASP B 34  ? 1.0324 0.9560 1.3451 -0.0772 -0.1329 -0.2080 64  ASP B OD2 
3133 N N   . LYS B 35  ? 0.8138 0.7311 1.0332 -0.0466 -0.1427 -0.2368 65  LYS B N   
3134 C CA  . LYS B 35  ? 0.7935 0.6970 0.9727 -0.0306 -0.1336 -0.2450 65  LYS B CA  
3135 C C   . LYS B 35  ? 0.8126 0.7261 0.9990 -0.0313 -0.1076 -0.2270 65  LYS B C   
3136 O O   . LYS B 35  ? 0.7529 0.6720 0.9076 -0.0182 -0.0930 -0.2278 65  LYS B O   
3137 C CB  . LYS B 35  ? 0.8617 0.7285 1.0371 -0.0257 -0.1550 -0.2657 65  LYS B CB  
3138 C CG  . LYS B 35  ? 0.8985 0.7508 1.0503 -0.0183 -0.1824 -0.2888 65  LYS B CG  
3139 C CD  . LYS B 35  ? 0.9770 0.7943 1.0973 -0.0025 -0.1961 -0.3127 65  LYS B CD  
3140 C CE  . LYS B 35  ? 1.0434 0.8305 1.2031 -0.0131 -0.2119 -0.3173 65  LYS B CE  
3141 N NZ  . LYS B 35  ? 1.0751 0.8529 1.2713 -0.0281 -0.2415 -0.3250 65  LYS B NZ  
3155 N N   . GLU B 36  ? 0.9786 0.8953 1.2062 -0.0457 -0.1014 -0.2105 66  GLU B N   
3156 C CA  . GLU B 36  ? 1.0348 0.9574 1.2653 -0.0448 -0.0791 -0.1937 66  GLU B CA  
3157 C C   . GLU B 36  ? 0.9342 0.8878 1.1505 -0.0416 -0.0594 -0.1810 66  GLU B C   
3158 O O   . GLU B 36  ? 0.9281 0.8877 1.1419 -0.0387 -0.0425 -0.1689 66  GLU B O   
3159 C CB  . GLU B 36  ? 1.0635 0.9792 1.3379 -0.0605 -0.0764 -0.1779 66  GLU B CB  
3160 C CG  . GLU B 36  ? 1.1529 1.0931 1.4607 -0.0747 -0.0730 -0.1644 66  GLU B CG  
3161 C CD  . GLU B 36  ? 1.2081 1.1420 1.5608 -0.0903 -0.0681 -0.1479 66  GLU B CD  
3162 O OE1 . GLU B 36  ? 1.2103 1.1597 1.6004 -0.1035 -0.0711 -0.1414 66  GLU B OE1 
3163 O OE2 . GLU B 36  ? 1.2285 1.1423 1.5798 -0.0891 -0.0607 -0.1405 66  GLU B OE2 
3170 N N   . PHE B 37  ? 0.8085 0.7795 1.0148 -0.0416 -0.0629 -0.1837 67  PHE B N   
3171 C CA  . PHE B 37  ? 0.6911 0.6878 0.8833 -0.0386 -0.0465 -0.1728 67  PHE B CA  
3172 C C   . PHE B 37  ? 0.7320 0.7324 0.8831 -0.0259 -0.0454 -0.1832 67  PHE B C   
3173 O O   . PHE B 37  ? 0.6789 0.6985 0.8180 -0.0246 -0.0349 -0.1755 67  PHE B O   
3174 C CB  . PHE B 37  ? 0.6044 0.6194 0.8206 -0.0489 -0.0481 -0.1633 67  PHE B CB  
3175 C CG  . PHE B 37  ? 0.5135 0.5305 0.7711 -0.0611 -0.0434 -0.1499 67  PHE B CG  
3176 C CD1 . PHE B 37  ? 0.4887 0.5049 0.7503 -0.0610 -0.0264 -0.1367 67  PHE B CD1 
3177 C CD2 . PHE B 37  ? 0.5114 0.5310 0.8045 -0.0722 -0.0561 -0.1502 67  PHE B CD2 
3178 C CE1 . PHE B 37  ? 0.4812 0.4981 0.7769 -0.0714 -0.0195 -0.1223 67  PHE B CE1 
3179 C CE2 . PHE B 37  ? 0.4961 0.5197 0.8300 -0.0840 -0.0487 -0.1360 67  PHE B CE2 
3180 C CZ  . PHE B 37  ? 0.4849 0.5063 0.8179 -0.0834 -0.0291 -0.1213 67  PHE B CZ  
3190 N N   . LEU B 38  ? 0.8906 0.8723 1.0196 -0.0162 -0.0552 -0.2001 68  LEU B N   
3191 C CA  . LEU B 38  ? 0.9196 0.9058 1.0080 -0.0026 -0.0495 -0.2085 68  LEU B CA  
3192 C C   . LEU B 38  ? 0.8782 0.8832 0.9595 0.0020  -0.0271 -0.1977 68  LEU B C   
3193 O O   . LEU B 38  ? 0.9008 0.9211 0.9607 0.0059  -0.0180 -0.1947 68  LEU B O   
3194 C CB  . LEU B 38  ? 0.9870 0.9486 1.0532 0.0097  -0.0612 -0.2289 68  LEU B CB  
3195 C CG  . LEU B 38  ? 1.0696 1.0144 1.1214 0.0116  -0.0849 -0.2451 68  LEU B CG  
3196 C CD1 . LEU B 38  ? 1.1225 1.0380 1.1574 0.0236  -0.0982 -0.2663 68  LEU B CD1 
3197 C CD2 . LEU B 38  ? 1.0841 1.0413 1.0991 0.0186  -0.0817 -0.2454 68  LEU B CD2 
3209 N N   . PRO B 39  ? 0.7263 0.7304 0.8247 0.0019  -0.0185 -0.1913 69  PRO B N   
3210 C CA  . PRO B 39  ? 0.6535 0.6769 0.7477 0.0065  -0.0003 -0.1824 69  PRO B CA  
3211 C C   . PRO B 39  ? 0.6153 0.6604 0.7147 -0.0015 0.0083  -0.1681 69  PRO B C   
3212 O O   . PRO B 39  ? 0.5864 0.6482 0.6779 0.0022  0.0208  -0.1634 69  PRO B O   
3213 C CB  . PRO B 39  ? 0.6456 0.6594 0.7595 0.0068  0.0020  -0.1773 69  PRO B CB  
3214 C CG  . PRO B 39  ? 0.6760 0.6619 0.7954 0.0067  -0.0132 -0.1881 69  PRO B CG  
3215 C CD  . PRO B 39  ? 0.7083 0.6913 0.8289 -0.0015 -0.0262 -0.1925 69  PRO B CD  
3223 N N   . ILE B 40  ? 0.6373 0.6829 0.7522 -0.0121 0.0016  -0.1616 70  ILE B N   
3224 C CA  . ILE B 40  ? 0.6147 0.6782 0.7356 -0.0182 0.0088  -0.1489 70  ILE B CA  
3225 C C   . ILE B 40  ? 0.6348 0.7015 0.7451 -0.0208 0.0008  -0.1506 70  ILE B C   
3226 O O   . ILE B 40  ? 0.6276 0.7067 0.7414 -0.0249 0.0050  -0.1410 70  ILE B O   
3227 C CB  . ILE B 40  ? 0.5882 0.6533 0.7368 -0.0261 0.0113  -0.1372 70  ILE B CB  
3228 C CG1 . ILE B 40  ? 0.5951 0.6512 0.7647 -0.0341 -0.0011 -0.1390 70  ILE B CG1 
3229 C CG2 . ILE B 40  ? 0.5904 0.6491 0.7445 -0.0221 0.0183  -0.1340 70  ILE B CG2 
3230 C CD1 . ILE B 40  ? 0.5792 0.6419 0.7769 -0.0421 0.0047  -0.1253 70  ILE B CD1 
3242 N N   . LEU B 41  ? 0.6476 0.7016 0.7430 -0.0171 -0.0120 -0.1631 71  LEU B N   
3243 C CA  . LEU B 41  ? 0.6466 0.7012 0.7296 -0.0179 -0.0225 -0.1649 71  LEU B CA  
3244 C C   . LEU B 41  ? 0.6510 0.7144 0.7034 -0.0125 -0.0120 -0.1608 71  LEU B C   
3245 O O   . LEU B 41  ? 0.6702 0.7328 0.7002 -0.0043 -0.0033 -0.1656 71  LEU B O   
3246 C CB  . LEU B 41  ? 0.6622 0.6981 0.7343 -0.0140 -0.0420 -0.1810 71  LEU B CB  
3247 C CG  . LEU B 41  ? 0.6639 0.6976 0.7156 -0.0117 -0.0557 -0.1846 71  LEU B CG  
3248 C CD1 . LEU B 41  ? 0.6427 0.6882 0.7244 -0.0213 -0.0613 -0.1745 71  LEU B CD1 
3249 C CD2 . LEU B 41  ? 0.7017 0.7143 0.7386 -0.0057 -0.0774 -0.2032 71  LEU B CD2 
3261 N N   . GLN B 42  ? 0.6151 0.6868 0.6684 -0.0169 -0.0121 -0.1512 72  GLN B N   
3262 C CA  . GLN B 42  ? 0.6232 0.6993 0.6483 -0.0137 -0.0046 -0.1453 72  GLN B CA  
3263 C C   . GLN B 42  ? 0.6763 0.7414 0.6800 -0.0104 -0.0212 -0.1502 72  GLN B C   
3264 O O   . GLN B 42  ? 0.6722 0.7386 0.6920 -0.0149 -0.0325 -0.1467 72  GLN B O   
3265 C CB  . GLN B 42  ? 0.5857 0.6749 0.6255 -0.0201 0.0055  -0.1310 72  GLN B CB  
3266 C CG  . GLN B 42  ? 0.5843 0.6754 0.5996 -0.0192 0.0121  -0.1227 72  GLN B CG  
3267 C CD  . GLN B 42  ? 0.5906 0.6856 0.5854 -0.0144 0.0270  -0.1233 72  GLN B CD  
3268 O OE1 . GLN B 42  ? 0.5891 0.6903 0.5952 -0.0125 0.0349  -0.1276 72  GLN B OE1 
3269 N NE2 . GLN B 42  ? 0.6161 0.7078 0.5808 -0.0118 0.0314  -0.1181 72  GLN B NE2 
3278 N N   . GLU B 43  ? 0.7911 0.8456 0.7579 -0.0009 -0.0231 -0.1588 73  GLU B N   
3279 C CA  . GLU B 43  ? 0.8775 0.9179 0.8180 0.0048  -0.0420 -0.1655 73  GLU B CA  
3280 C C   . GLU B 43  ? 0.9039 0.9468 0.8301 0.0035  -0.0409 -0.1521 73  GLU B C   
3281 O O   . GLU B 43  ? 0.9081 0.9491 0.8468 0.0009  -0.0571 -0.1508 73  GLU B O   
3282 C CB  . GLU B 43  ? 0.9511 0.9777 0.8483 0.0179  -0.0426 -0.1781 73  GLU B CB  
3283 C CG  . GLU B 43  ? 0.9867 1.0058 0.8957 0.0212  -0.0468 -0.1935 73  GLU B CG  
3284 C CD  . GLU B 43  ? 1.0538 1.0541 0.9183 0.0366  -0.0548 -0.2106 73  GLU B CD  
3285 O OE1 . GLU B 43  ? 1.0916 1.0769 0.9323 0.0419  -0.0756 -0.2186 73  GLU B OE1 
3286 O OE2 . GLU B 43  ? 1.0690 1.0694 0.9213 0.0448  -0.0412 -0.2168 73  GLU B OE2 
3293 N N   . GLU B 44  ? 0.9399 0.9870 0.8424 0.0051  -0.0220 -0.1416 74  GLU B N   
3294 C CA  . GLU B 44  ? 0.9777 1.0240 0.8674 0.0028  -0.0198 -0.1269 74  GLU B CA  
3295 C C   . GLU B 44  ? 0.8509 0.9093 0.7820 -0.0076 -0.0173 -0.1175 74  GLU B C   
3296 O O   . GLU B 44  ? 0.8178 0.8887 0.7718 -0.0130 -0.0027 -0.1144 74  GLU B O   
3297 C CB  . GLU B 44  ? 1.0821 1.1301 0.9405 0.0054  0.0017  -0.1167 74  GLU B CB  
3298 C CG  . GLU B 44  ? 1.1849 1.2267 1.0254 0.0028  0.0042  -0.0999 74  GLU B CG  
3299 C CD  . GLU B 44  ? 1.2988 1.3204 1.1022 0.0119  -0.0155 -0.1022 74  GLU B CD  
3300 O OE1 . GLU B 44  ? 1.3421 1.3543 1.1245 0.0215  -0.0281 -0.1171 74  GLU B OE1 
3301 O OE2 . GLU B 44  ? 1.3261 1.3395 1.1209 0.0102  -0.0203 -0.0896 74  GLU B OE2 
3308 N N   . PRO B 45  ? 0.7635 0.8188 0.7046 -0.0091 -0.0315 -0.1137 75  PRO B N   
3309 C CA  . PRO B 45  ? 0.6787 0.7454 0.6574 -0.0165 -0.0284 -0.1066 75  PRO B CA  
3310 C C   . PRO B 45  ? 0.6457 0.7162 0.6209 -0.0211 -0.0109 -0.0935 75  PRO B C   
3311 O O   . PRO B 45  ? 0.6527 0.7147 0.5984 -0.0197 -0.0059 -0.0852 75  PRO B O   
3312 C CB  . PRO B 45  ? 0.6866 0.7481 0.6705 -0.0139 -0.0479 -0.1061 75  PRO B CB  
3313 C CG  . PRO B 45  ? 0.7351 0.7798 0.6748 -0.0058 -0.0579 -0.1072 75  PRO B CG  
3314 C CD  . PRO B 45  ? 0.7733 0.8145 0.6910 -0.0022 -0.0518 -0.1165 75  PRO B CD  
3322 N N   . LEU B 46  ? 0.5648 0.6472 0.5704 -0.0266 -0.0022 -0.0915 76  LEU B N   
3323 C CA  . LEU B 46  ? 0.5571 0.6436 0.5656 -0.0316 0.0116  -0.0814 76  LEU B CA  
3324 C C   . LEU B 46  ? 0.5468 0.6309 0.5702 -0.0336 0.0060  -0.0749 76  LEU B C   
3325 O O   . LEU B 46  ? 0.5116 0.6006 0.5576 -0.0322 -0.0012 -0.0792 76  LEU B O   
3326 C CB  . LEU B 46  ? 0.5406 0.6400 0.5694 -0.0344 0.0234  -0.0847 76  LEU B CB  
3327 C CG  . LEU B 46  ? 0.5482 0.6511 0.5652 -0.0312 0.0313  -0.0914 76  LEU B CG  
3328 C CD1 . LEU B 46  ? 0.5315 0.6451 0.5730 -0.0320 0.0377  -0.0959 76  LEU B CD1 
3329 C CD2 . LEU B 46  ? 0.5776 0.6812 0.5723 -0.0317 0.0440  -0.0840 76  LEU B CD2 
3341 N N   . PRO B 47  ? 0.6436 0.7201 0.6564 -0.0366 0.0098  -0.0645 77  PRO B N   
3342 C CA  . PRO B 47  ? 0.6524 0.7245 0.6796 -0.0372 0.0043  -0.0600 77  PRO B CA  
3343 C C   . PRO B 47  ? 0.5694 0.6530 0.6230 -0.0396 0.0109  -0.0633 77  PRO B C   
3344 O O   . PRO B 47  ? 0.5590 0.6524 0.6182 -0.0424 0.0207  -0.0661 77  PRO B O   
3345 C CB  . PRO B 47  ? 0.6787 0.7367 0.6866 -0.0413 0.0078  -0.0476 77  PRO B CB  
3346 C CG  . PRO B 47  ? 0.7137 0.7771 0.7081 -0.0453 0.0218  -0.0449 77  PRO B CG  
3347 C CD  . PRO B 47  ? 0.7045 0.7750 0.6921 -0.0394 0.0200  -0.0557 77  PRO B CD  
3355 N N   . PRO B 48  ? 0.4451 0.5271 0.5133 -0.0368 0.0053  -0.0636 78  PRO B N   
3356 C CA  . PRO B 48  ? 0.4121 0.5022 0.4988 -0.0369 0.0110  -0.0667 78  PRO B CA  
3357 C C   . PRO B 48  ? 0.4222 0.5114 0.5075 -0.0434 0.0184  -0.0631 78  PRO B C   
3358 O O   . PRO B 48  ? 0.3955 0.4741 0.4710 -0.0481 0.0180  -0.0558 78  PRO B O   
3359 C CB  . PRO B 48  ? 0.3958 0.4805 0.4908 -0.0308 0.0034  -0.0669 78  PRO B CB  
3360 C CG  . PRO B 48  ? 0.4227 0.5037 0.5131 -0.0266 -0.0067 -0.0665 78  PRO B CG  
3361 C CD  . PRO B 48  ? 0.4525 0.5256 0.5201 -0.0310 -0.0070 -0.0621 78  PRO B CD  
3369 N N   . LEU B 49  ? 0.3811 0.4811 0.4783 -0.0437 0.0246  -0.0676 79  LEU B N   
3370 C CA  . LEU B 49  ? 0.4117 0.5135 0.5148 -0.0490 0.0288  -0.0659 79  LEU B CA  
3371 C C   . LEU B 49  ? 0.4031 0.4918 0.5086 -0.0498 0.0216  -0.0636 79  LEU B C   
3372 O O   . LEU B 49  ? 0.3813 0.4670 0.4919 -0.0572 0.0223  -0.0599 79  LEU B O   
3373 C CB  . LEU B 49  ? 0.4443 0.5579 0.5592 -0.0461 0.0329  -0.0723 79  LEU B CB  
3374 C CG  . LEU B 49  ? 0.4696 0.5942 0.5839 -0.0460 0.0402  -0.0750 79  LEU B CG  
3375 C CD1 . LEU B 49  ? 0.4802 0.6124 0.6049 -0.0415 0.0422  -0.0803 79  LEU B CD1 
3376 C CD2 . LEU B 49  ? 0.5167 0.6462 0.6277 -0.0523 0.0473  -0.0710 79  LEU B CD2 
3388 N N   . ALA B 50  ? 0.3962 0.4773 0.5007 -0.0423 0.0143  -0.0660 80  ALA B N   
3389 C CA  . ALA B 50  ? 0.4070 0.4725 0.5117 -0.0405 0.0060  -0.0656 80  ALA B CA  
3390 C C   . ALA B 50  ? 0.4462 0.4965 0.5434 -0.0490 0.0030  -0.0563 80  ALA B C   
3391 O O   . ALA B 50  ? 0.4621 0.4985 0.5632 -0.0526 -0.0028 -0.0550 80  ALA B O   
3392 C CB  . ALA B 50  ? 0.4119 0.4737 0.5160 -0.0290 0.0003  -0.0694 80  ALA B CB  
3398 N N   . LEU B 51  ? 0.4646 0.5149 0.5496 -0.0519 0.0063  -0.0497 81  LEU B N   
3399 C CA  . LEU B 51  ? 0.4919 0.5261 0.5649 -0.0593 0.0056  -0.0380 81  LEU B CA  
3400 C C   . LEU B 51  ? 0.5198 0.5612 0.5988 -0.0715 0.0166  -0.0317 81  LEU B C   
3401 O O   . LEU B 51  ? 0.5606 0.5887 0.6339 -0.0799 0.0183  -0.0200 81  LEU B O   
3402 C CB  . LEU B 51  ? 0.5015 0.5311 0.5535 -0.0554 0.0040  -0.0333 81  LEU B CB  
3403 C CG  . LEU B 51  ? 0.4937 0.5214 0.5455 -0.0435 -0.0073 -0.0396 81  LEU B CG  
3404 C CD1 . LEU B 51  ? 0.5009 0.5215 0.5312 -0.0400 -0.0126 -0.0349 81  LEU B CD1 
3405 C CD2 . LEU B 51  ? 0.4936 0.5058 0.5518 -0.0383 -0.0175 -0.0406 81  LEU B CD2 
3417 N N   . VAL B 52  ? 0.5353 0.5975 0.6269 -0.0723 0.0245  -0.0382 82  VAL B N   
3418 C CA  . VAL B 52  ? 0.5434 0.6180 0.6470 -0.0824 0.0355  -0.0337 82  VAL B CA  
3419 C C   . VAL B 52  ? 0.5457 0.6174 0.6725 -0.0879 0.0286  -0.0363 82  VAL B C   
3420 O O   . VAL B 52  ? 0.5256 0.6005 0.6604 -0.0807 0.0214  -0.0474 82  VAL B O   
3421 C CB  . VAL B 52  ? 0.5226 0.6202 0.6302 -0.0786 0.0450  -0.0407 82  VAL B CB  
3422 C CG1 . VAL B 52  ? 0.5464 0.6601 0.6692 -0.0875 0.0574  -0.0360 82  VAL B CG1 
3423 C CG2 . VAL B 52  ? 0.5412 0.6382 0.6256 -0.0719 0.0475  -0.0413 82  VAL B CG2 
3433 N N   . PRO B 53  ? 0.5484 0.6123 0.6854 -0.1002 0.0299  -0.0265 83  PRO B N   
3434 C CA  . PRO B 53  ? 0.5478 0.6094 0.7108 -0.1064 0.0209  -0.0309 83  PRO B CA  
3435 C C   . PRO B 53  ? 0.5305 0.6184 0.7155 -0.1064 0.0249  -0.0395 83  PRO B C   
3436 O O   . PRO B 53  ? 0.4940 0.6029 0.6794 -0.1058 0.0384  -0.0383 83  PRO B O   
3437 C CB  . PRO B 53  ? 0.5684 0.6187 0.7408 -0.1223 0.0245  -0.0156 83  PRO B CB  
3438 C CG  . PRO B 53  ? 0.5997 0.6346 0.7414 -0.1201 0.0296  -0.0040 83  PRO B CG  
3439 C CD  . PRO B 53  ? 0.5850 0.6370 0.7085 -0.1085 0.0373  -0.0103 83  PRO B CD  
3447 N N   . PHE B 54  ? 0.5183 0.6032 0.7201 -0.1052 0.0114  -0.0494 84  PHE B N   
3448 C CA  . PHE B 54  ? 0.5216 0.6290 0.7465 -0.1049 0.0112  -0.0576 84  PHE B CA  
3449 C C   . PHE B 54  ? 0.5348 0.6604 0.7893 -0.1202 0.0214  -0.0485 84  PHE B C   
3450 O O   . PHE B 54  ? 0.5474 0.6625 0.8119 -0.1336 0.0225  -0.0374 84  PHE B O   
3451 C CB  . PHE B 54  ? 0.5428 0.6392 0.7766 -0.1000 -0.0085 -0.0701 84  PHE B CB  
3452 C CG  . PHE B 54  ? 0.5471 0.6335 0.7553 -0.0824 -0.0154 -0.0805 84  PHE B CG  
3453 C CD1 . PHE B 54  ? 0.5449 0.6364 0.7320 -0.0736 -0.0047 -0.0788 84  PHE B CD1 
3454 C CD2 . PHE B 54  ? 0.5640 0.6358 0.7700 -0.0745 -0.0327 -0.0920 84  PHE B CD2 
3455 C CE1 . PHE B 54  ? 0.5478 0.6325 0.7162 -0.0588 -0.0087 -0.0864 84  PHE B CE1 
3456 C CE2 . PHE B 54  ? 0.5717 0.6358 0.7531 -0.0575 -0.0358 -0.1000 84  PHE B CE2 
3457 C CZ  . PHE B 54  ? 0.5595 0.6315 0.7242 -0.0505 -0.0226 -0.0962 84  PHE B CZ  
3467 N N   . THR B 55  ? 0.5681 0.7215 0.8386 -0.1178 0.0293  -0.0529 85  THR B N   
3468 C CA  . THR B 55  ? 0.6020 0.7785 0.9108 -0.1305 0.0366  -0.0477 85  THR B CA  
3469 C C   . THR B 55  ? 0.6371 0.8122 0.9771 -0.1347 0.0163  -0.0571 85  THR B C   
3470 O O   . THR B 55  ? 0.6182 0.7731 0.9443 -0.1258 -0.0022 -0.0679 85  THR B O   
3471 C CB  . THR B 55  ? 0.5916 0.7988 0.9071 -0.1239 0.0515  -0.0504 85  THR B CB  
3472 O OG1 . THR B 55  ? 0.6050 0.8171 0.9212 -0.1106 0.0391  -0.0654 85  THR B OG1 
3473 C CG2 . THR B 55  ? 0.6047 0.8091 0.8847 -0.1173 0.0675  -0.0448 85  THR B CG2 
3481 N N   . GLU B 56  ? 0.6915 0.8891 1.0751 -0.1475 0.0194  -0.0535 86  GLU B N   
3482 C CA  . GLU B 56  ? 0.7443 0.9433 1.1619 -0.1511 -0.0027 -0.0645 86  GLU B CA  
3483 C C   . GLU B 56  ? 0.6834 0.8916 1.0941 -0.1330 -0.0145 -0.0813 86  GLU B C   
3484 O O   . GLU B 56  ? 0.6825 0.8753 1.0915 -0.1265 -0.0378 -0.0941 86  GLU B O   
3485 C CB  . GLU B 56  ? 0.8411 1.0673 1.3139 -0.1696 0.0042  -0.0564 86  GLU B CB  
3486 C CG  . GLU B 56  ? 0.9488 1.1603 1.4328 -0.1899 0.0118  -0.0387 86  GLU B CG  
3487 C CD  . GLU B 56  ? 1.0478 1.2206 1.5269 -0.1941 -0.0137 -0.0438 86  GLU B CD  
3488 O OE1 . GLU B 56  ? 1.0663 1.2304 1.5450 -0.1837 -0.0380 -0.0621 86  GLU B OE1 
3489 O OE2 . GLU B 56  ? 1.0954 1.2445 1.5684 -0.2064 -0.0099 -0.0298 86  GLU B OE2 
3496 N N   . GLU B 57  ? 0.5734 0.8038 0.9770 -0.1234 0.0009  -0.0816 87  GLU B N   
3497 C CA  . GLU B 57  ? 0.5228 0.7591 0.9173 -0.1058 -0.0092 -0.0953 87  GLU B CA  
3498 C C   . GLU B 57  ? 0.5191 0.7256 0.8671 -0.0917 -0.0180 -0.1011 87  GLU B C   
3499 O O   . GLU B 57  ? 0.5378 0.7331 0.8778 -0.0811 -0.0368 -0.1126 87  GLU B O   
3500 C CB  . GLU B 57  ? 0.4806 0.7439 0.8776 -0.0988 0.0098  -0.0935 87  GLU B CB  
3501 C CG  . GLU B 57  ? 0.4466 0.7457 0.8935 -0.1082 0.0184  -0.0905 87  GLU B CG  
3502 C CD  . GLU B 57  ? 0.4387 0.7503 0.9231 -0.1066 -0.0040 -0.1023 87  GLU B CD  
3503 O OE1 . GLU B 57  ? 0.4319 0.7241 0.8950 -0.0942 -0.0247 -0.1137 87  GLU B OE1 
3504 O OE2 . GLU B 57  ? 0.4428 0.7842 0.9784 -0.1174 -0.0011 -0.1001 87  GLU B OE2 
3511 N N   . GLU B 58  ? 0.5326 0.7268 0.8496 -0.0904 -0.0044 -0.0933 88  GLU B N   
3512 C CA  . GLU B 58  ? 0.5393 0.7090 0.8178 -0.0780 -0.0104 -0.0976 88  GLU B CA  
3513 C C   . GLU B 58  ? 0.5239 0.6702 0.7992 -0.0772 -0.0307 -0.1044 88  GLU B C   
3514 O O   . GLU B 58  ? 0.5359 0.6694 0.7898 -0.0629 -0.0418 -0.1138 88  GLU B O   
3515 C CB  . GLU B 58  ? 0.5688 0.7294 0.8232 -0.0800 0.0042  -0.0878 88  GLU B CB  
3516 C CG  . GLU B 58  ? 0.5886 0.7664 0.8369 -0.0769 0.0217  -0.0841 88  GLU B CG  
3517 C CD  . GLU B 58  ? 0.6208 0.7882 0.8454 -0.0790 0.0324  -0.0755 88  GLU B CD  
3518 O OE1 . GLU B 58  ? 0.6374 0.7961 0.8640 -0.0896 0.0338  -0.0668 88  GLU B OE1 
3519 O OE2 . GLU B 58  ? 0.6010 0.7673 0.8056 -0.0702 0.0377  -0.0773 88  GLU B OE2 
3526 N N   . GLN B 59  ? 0.4980 0.6369 0.7932 -0.0919 -0.0357 -0.0997 89  GLN B N   
3527 C CA  . GLN B 59  ? 0.4942 0.6073 0.7873 -0.0913 -0.0572 -0.1076 89  GLN B CA  
3528 C C   . GLN B 59  ? 0.4918 0.6086 0.7964 -0.0831 -0.0772 -0.1226 89  GLN B C   
3529 O O   . GLN B 59  ? 0.4957 0.5916 0.7754 -0.0691 -0.0927 -0.1339 89  GLN B O   
3530 C CB  . GLN B 59  ? 0.5112 0.6159 0.8299 -0.1110 -0.0590 -0.0985 89  GLN B CB  
3531 C CG  . GLN B 59  ? 0.5452 0.6209 0.8676 -0.1121 -0.0841 -0.1080 89  GLN B CG  
3532 C CD  . GLN B 59  ? 0.5601 0.6053 0.8400 -0.0968 -0.0904 -0.1136 89  GLN B CD  
3533 O OE1 . GLN B 59  ? 0.5495 0.5951 0.8025 -0.0894 -0.0750 -0.1072 89  GLN B OE1 
3534 N NE2 . GLN B 59  ? 0.5870 0.6063 0.8622 -0.0911 -0.1136 -0.1264 89  GLN B NE2 
3543 N N   . ARG B 60  ? 0.5487 0.6925 0.8903 -0.0901 -0.0774 -0.1232 90  ARG B N   
3544 C CA  . ARG B 60  ? 0.5944 0.7428 0.9487 -0.0815 -0.0992 -0.1379 90  ARG B CA  
3545 C C   . ARG B 60  ? 0.5651 0.7081 0.8797 -0.0587 -0.1004 -0.1453 90  ARG B C   
3546 O O   . ARG B 60  ? 0.5676 0.6916 0.8611 -0.0451 -0.1200 -0.1576 90  ARG B O   
3547 C CB  . ARG B 60  ? 0.6525 0.8361 1.0576 -0.0921 -0.0968 -0.1362 90  ARG B CB  
3548 C CG  . ARG B 60  ? 0.7568 0.9461 1.1830 -0.0850 -0.1238 -0.1519 90  ARG B CG  
3549 C CD  . ARG B 60  ? 0.8288 1.0572 1.3129 -0.0958 -0.1213 -0.1502 90  ARG B CD  
3550 N NE  . ARG B 60  ? 0.8864 1.1407 1.3675 -0.0900 -0.0965 -0.1427 90  ARG B NE  
3551 C CZ  . ARG B 60  ? 0.9463 1.2054 1.4063 -0.0706 -0.0983 -0.1494 90  ARG B CZ  
3552 N NH1 . ARG B 60  ? 0.9869 1.2277 1.4240 -0.0546 -0.1224 -0.1625 90  ARG B NH1 
3553 N NH2 . ARG B 60  ? 0.9489 1.2286 1.4079 -0.0664 -0.0763 -0.1428 90  ARG B NH2 
3567 N N   . ASN B 61  ? 0.5236 0.6807 0.8254 -0.0540 -0.0793 -0.1376 91  ASN B N   
3568 C CA  . ASN B 61  ? 0.5326 0.6854 0.8013 -0.0344 -0.0784 -0.1420 91  ASN B CA  
3569 C C   . ASN B 61  ? 0.5407 0.6645 0.7667 -0.0226 -0.0818 -0.1446 91  ASN B C   
3570 O O   . ASN B 61  ? 0.5446 0.6548 0.7469 -0.0068 -0.0954 -0.1538 91  ASN B O   
3571 C CB  . ASN B 61  ? 0.5340 0.7043 0.8000 -0.0340 -0.0554 -0.1328 91  ASN B CB  
3572 C CG  . ASN B 61  ? 0.5541 0.7544 0.8573 -0.0385 -0.0521 -0.1329 91  ASN B CG  
3573 O OD1 . ASN B 61  ? 0.5734 0.7855 0.9104 -0.0442 -0.0659 -0.1385 91  ASN B OD1 
3574 N ND2 . ASN B 61  ? 0.5513 0.7648 0.8506 -0.0356 -0.0341 -0.1275 91  ASN B ND2 
3581 N N   . PHE B 62  ? 0.5359 0.6504 0.7506 -0.0287 -0.0692 -0.1365 92  PHE B N   
3582 C CA  . PHE B 62  ? 0.5604 0.6510 0.7393 -0.0168 -0.0708 -0.1390 92  PHE B CA  
3583 C C   . PHE B 62  ? 0.6019 0.6705 0.7741 -0.0112 -0.0938 -0.1512 92  PHE B C   
3584 O O   . PHE B 62  ? 0.6447 0.6946 0.7833 0.0047  -0.0976 -0.1569 92  PHE B O   
3585 C CB  . PHE B 62  ? 0.5774 0.6632 0.7513 -0.0248 -0.0564 -0.1289 92  PHE B CB  
3586 C CG  . PHE B 62  ? 0.5603 0.6603 0.7280 -0.0245 -0.0362 -0.1198 92  PHE B CG  
3587 C CD1 . PHE B 62  ? 0.5690 0.6662 0.7120 -0.0105 -0.0294 -0.1199 92  PHE B CD1 
3588 C CD2 . PHE B 62  ? 0.5531 0.6681 0.7391 -0.0379 -0.0241 -0.1110 92  PHE B CD2 
3589 C CE1 . PHE B 62  ? 0.5673 0.6754 0.7079 -0.0115 -0.0132 -0.1124 92  PHE B CE1 
3590 C CE2 . PHE B 62  ? 0.5565 0.6816 0.7349 -0.0366 -0.0084 -0.1049 92  PHE B CE2 
3591 C CZ  . PHE B 62  ? 0.5456 0.6667 0.7032 -0.0240 -0.0042 -0.1062 92  PHE B CZ  
3601 N N   . SER B 63  ? 0.7351 0.8056 0.9393 -0.0235 -0.1092 -0.1557 93  SER B N   
3602 C CA  . SER B 63  ? 0.7552 0.8019 0.9559 -0.0194 -0.1345 -0.1691 93  SER B CA  
3603 C C   . SER B 63  ? 0.7438 0.7893 0.9371 -0.0050 -0.1549 -0.1833 93  SER B C   
3604 O O   . SER B 63  ? 0.7567 0.7771 0.9260 0.0080  -0.1746 -0.1967 93  SER B O   
3605 C CB  . SER B 63  ? 0.7966 0.8429 1.0391 -0.0414 -0.1434 -0.1668 93  SER B CB  
3606 O OG  . SER B 63  ? 0.8342 0.8748 1.0767 -0.0526 -0.1276 -0.1538 93  SER B OG  
3612 N N   . MET B 64  ? 0.6348 0.7052 0.8457 -0.0053 -0.1518 -0.1814 94  MET B N   
3613 C CA  . MET B 64  ? 0.6351 0.7060 0.8452 0.0071  -0.1746 -0.1947 94  MET B CA  
3614 C C   . MET B 64  ? 0.6193 0.6975 0.8011 0.0248  -0.1652 -0.1920 94  MET B C   
3615 O O   . MET B 64  ? 0.6336 0.6943 0.7787 0.0451  -0.1788 -0.2012 94  MET B O   
3616 C CB  . MET B 64  ? 0.6295 0.7240 0.8979 -0.0097 -0.1870 -0.1972 94  MET B CB  
3617 C CG  . MET B 64  ? 0.6264 0.7148 0.9300 -0.0310 -0.1945 -0.1966 94  MET B CG  
3618 S SD  . MET B 64  ? 0.6993 0.7439 0.9766 -0.0222 -0.2250 -0.2139 94  MET B SD  
3619 C CE  . MET B 64  ? 0.7320 0.7762 1.0112 -0.0066 -0.2602 -0.2345 94  MET B CE  
3629 N N   . SER B 65  ? 0.6903 0.7916 0.8862 0.0185  -0.1430 -0.1798 95  SER B N   
3630 C CA  . SER B 65  ? 0.7254 0.8328 0.9013 0.0335  -0.1367 -0.1772 95  SER B CA  
3631 C C   . SER B 65  ? 0.6774 0.7966 0.8517 0.0278  -0.1076 -0.1627 95  SER B C   
3632 O O   . SER B 65  ? 0.6679 0.8079 0.8762 0.0122  -0.0962 -0.1566 95  SER B O   
3633 C CB  . SER B 65  ? 0.7772 0.9047 0.9857 0.0345  -0.1523 -0.1838 95  SER B CB  
3634 O OG  . SER B 65  ? 0.7914 0.9477 1.0507 0.0152  -0.1424 -0.1782 95  SER B OG  
3640 N N   . VAL B 66  ? 0.5926 0.6983 0.7275 0.0407  -0.0958 -0.1574 96  VAL B N   
3641 C CA  . VAL B 66  ? 0.5131 0.6269 0.6454 0.0363  -0.0712 -0.1451 96  VAL B CA  
3642 C C   . VAL B 66  ? 0.4838 0.5981 0.6001 0.0491  -0.0659 -0.1411 96  VAL B C   
3643 O O   . VAL B 66  ? 0.4397 0.5625 0.5617 0.0445  -0.0488 -0.1327 96  VAL B O   
3644 C CB  . VAL B 66  ? 0.4856 0.5851 0.5940 0.0363  -0.0584 -0.1395 96  VAL B CB  
3645 C CG1 . VAL B 66  ? 0.4702 0.5662 0.5941 0.0238  -0.0638 -0.1423 96  VAL B CG1 
3646 C CG2 . VAL B 66  ? 0.4996 0.5783 0.5662 0.0556  -0.0619 -0.1418 96  VAL B CG2 
3656 N N   . ASN B 67  ? 0.5114 0.6141 0.6058 0.0657  -0.0810 -0.1468 97  ASN B N   
3657 C CA  . ASN B 67  ? 0.5450 0.6423 0.6185 0.0791  -0.0758 -0.1409 97  ASN B CA  
3658 C C   . ASN B 67  ? 0.4939 0.6117 0.6003 0.0756  -0.0773 -0.1415 97  ASN B C   
3659 O O   . ASN B 67  ? 0.4776 0.6133 0.6193 0.0684  -0.0892 -0.1494 97  ASN B O   
3660 C CB  . ASN B 67  ? 0.6315 0.7083 0.6674 0.0999  -0.0926 -0.1464 97  ASN B CB  
3661 C CG  . ASN B 67  ? 0.6889 0.7445 0.6844 0.1083  -0.0859 -0.1440 97  ASN B CG  
3662 O OD1 . ASN B 67  ? 0.7415 0.7839 0.7190 0.1169  -0.1024 -0.1545 97  ASN B OD1 
3663 N ND2 . ASN B 67  ? 0.7079 0.7606 0.6906 0.1064  -0.0619 -0.1311 97  ASN B ND2 
3670 N N   . SER B 68  ? 0.4640 0.5792 0.5606 0.0807  -0.0645 -0.1329 98  SER B N   
3671 C CA  . SER B 68  ? 0.4347 0.5661 0.5575 0.0817  -0.0660 -0.1343 98  SER B CA  
3672 C C   . SER B 68  ? 0.4414 0.5718 0.5635 0.0969  -0.0896 -0.1427 98  SER B C   
3673 O O   . SER B 68  ? 0.4677 0.5779 0.5561 0.1103  -0.1024 -0.1448 98  SER B O   
3674 C CB  . SER B 68  ? 0.4463 0.5685 0.5549 0.0855  -0.0496 -0.1239 98  SER B CB  
3675 O OG  . SER B 68  ? 0.4698 0.5675 0.5398 0.1020  -0.0536 -0.1185 98  SER B OG  
3681 N N   . ALA B 69  ? 0.5325 0.6854 0.6915 0.0962  -0.0958 -0.1481 99  ALA B N   
3682 C CA  . ALA B 69  ? 0.5626 0.7168 0.7251 0.1122  -0.1198 -0.1563 99  ALA B CA  
3683 C C   . ALA B 69  ? 0.5881 0.7152 0.7067 0.1319  -0.1211 -0.1491 99  ALA B C   
3684 O O   . ALA B 69  ? 0.6259 0.7387 0.7213 0.1488  -0.1421 -0.1537 99  ALA B O   
3685 C CB  . ALA B 69  ? 0.5590 0.7465 0.7743 0.1085  -0.1230 -0.1626 99  ALA B CB  
3691 N N   . ALA B 70  ? 0.4694 0.5868 0.5746 0.1300  -0.0997 -0.1375 100 ALA B N   
3692 C CA  . ALA B 70  ? 0.5003 0.5903 0.5669 0.1467  -0.0988 -0.1279 100 ALA B CA  
3693 C C   . ALA B 70  ? 0.5340 0.5961 0.5500 0.1573  -0.1027 -0.1229 100 ALA B C   
3694 O O   . ALA B 70  ? 0.5731 0.6152 0.5569 0.1767  -0.1162 -0.1211 100 ALA B O   
3695 C CB  . ALA B 70  ? 0.4858 0.5697 0.5520 0.1390  -0.0749 -0.1166 100 ALA B CB  
3701 N N   . VAL B 71  ? 0.5555 0.6152 0.5616 0.1466  -0.0907 -0.1207 101 VAL B N   
3702 C CA  . VAL B 71  ? 0.6006 0.6352 0.5573 0.1584  -0.0915 -0.1164 101 VAL B CA  
3703 C C   . VAL B 71  ? 0.6316 0.6636 0.5787 0.1702  -0.1197 -0.1310 101 VAL B C   
3704 O O   . VAL B 71  ? 0.6812 0.6889 0.5807 0.1892  -0.1288 -0.1297 101 VAL B O   
3705 C CB  . VAL B 71  ? 0.5986 0.6328 0.5500 0.1456  -0.0709 -0.1108 101 VAL B CB  
3706 C CG1 . VAL B 71  ? 0.5797 0.6336 0.5642 0.1307  -0.0772 -0.1230 101 VAL B CG1 
3707 C CG2 . VAL B 71  ? 0.6412 0.6502 0.5397 0.1604  -0.0669 -0.1047 101 VAL B CG2 
3717 N N   . LEU B 72  ? 0.6487 0.7046 0.6399 0.1595  -0.1342 -0.1448 102 LEU B N   
3718 C CA  . LEU B 72  ? 0.7038 0.7583 0.6939 0.1692  -0.1648 -0.1604 102 LEU B CA  
3719 C C   . LEU B 72  ? 0.7581 0.8083 0.7416 0.1883  -0.1862 -0.1638 102 LEU B C   
3720 O O   . LEU B 72  ? 0.7949 0.8335 0.7583 0.2036  -0.2135 -0.1748 102 LEU B O   
3721 C CB  . LEU B 72  ? 0.6819 0.7647 0.7286 0.1499  -0.1734 -0.1723 102 LEU B CB  
3722 C CG  . LEU B 72  ? 0.6805 0.7648 0.7330 0.1322  -0.1572 -0.1702 102 LEU B CG  
3723 C CD1 . LEU B 72  ? 0.6437 0.7581 0.7563 0.1104  -0.1571 -0.1753 102 LEU B CD1 
3724 C CD2 . LEU B 72  ? 0.7087 0.7694 0.7242 0.1413  -0.1706 -0.1782 102 LEU B CD2 
3736 N N   . ARG B 73  ? 0.7745 0.8319 0.7729 0.1891  -0.1761 -0.1555 103 ARG B N   
3737 C CA  . ARG B 73  ? 0.8301 0.8833 0.8248 0.2084  -0.1966 -0.1583 103 ARG B CA  
3738 C C   . ARG B 73  ? 0.9040 0.9182 0.8295 0.2322  -0.2018 -0.1495 103 ARG B C   
3739 O O   . ARG B 73  ? 0.9310 0.9355 0.8419 0.2523  -0.2260 -0.1539 103 ARG B O   
3740 C CB  . ARG B 73  ? 0.8009 0.8695 0.8286 0.2035  -0.1825 -0.1518 103 ARG B CB  
3741 C CG  . ARG B 73  ? 0.8240 0.9021 0.8726 0.2194  -0.2056 -0.1594 103 ARG B CG  
3742 C CD  . ARG B 73  ? 0.7973 0.8953 0.8858 0.2129  -0.1902 -0.1563 103 ARG B CD  
3743 N NE  . ARG B 73  ? 0.7587 0.8923 0.9000 0.1898  -0.1768 -0.1623 103 ARG B NE  
3744 C CZ  . ARG B 73  ? 0.7447 0.8840 0.8957 0.1741  -0.1491 -0.1547 103 ARG B CZ  
3745 N NH1 . ARG B 73  ? 0.7555 0.8688 0.8731 0.1769  -0.1319 -0.1415 103 ARG B NH1 
3746 N NH2 . ARG B 73  ? 0.7092 0.8798 0.9043 0.1552  -0.1392 -0.1601 103 ARG B NH2 
3760 N N   . LEU B 74  ? 0.8914 0.8839 0.7744 0.2310  -0.1794 -0.1366 104 LEU B N   
3761 C CA  . LEU B 74  ? 0.9644 0.9200 0.7788 0.2528  -0.1785 -0.1251 104 LEU B CA  
3762 C C   . LEU B 74  ? 1.0469 0.9872 0.8216 0.2672  -0.1987 -0.1367 104 LEU B C   
3763 O O   . LEU B 74  ? 1.1102 1.0267 0.8394 0.2916  -0.2187 -0.1379 104 LEU B O   
3764 C CB  . LEU B 74  ? 0.9414 0.8840 0.7334 0.2446  -0.1424 -0.1047 104 LEU B CB  
3765 C CG  . LEU B 74  ? 0.8893 0.8454 0.7211 0.2276  -0.1216 -0.0950 104 LEU B CG  
3766 C CD1 . LEU B 74  ? 0.8707 0.8143 0.6832 0.2186  -0.0890 -0.0763 104 LEU B CD1 
3767 C CD2 . LEU B 74  ? 0.9031 0.8503 0.7365 0.2408  -0.1332 -0.0911 104 LEU B CD2 
3779 N N   . THR B 75  ? 1.1146 1.0657 0.9034 0.2536  -0.1948 -0.1457 105 THR B N   
3780 C CA  . THR B 75  ? 1.1883 1.1235 0.9407 0.2663  -0.2134 -0.1589 105 THR B CA  
3781 C C   . THR B 75  ? 1.2539 1.1848 1.0032 0.2836  -0.2551 -0.1765 105 THR B C   
3782 O O   . THR B 75  ? 1.3075 1.2275 1.0366 0.2930  -0.2784 -0.1927 105 THR B O   
3783 C CB  . THR B 75  ? 1.1535 1.1060 0.9409 0.2457  -0.2097 -0.1698 105 THR B CB  
3784 O OG1 . THR B 75  ? 1.1114 1.0949 0.9674 0.2282  -0.2246 -0.1816 105 THR B OG1 
3785 C CG2 . THR B 75  ? 1.1198 1.0773 0.9114 0.2297  -0.1713 -0.1538 105 THR B CG2 
3807 N N   . ALA C 7   ? 1.4834 1.7000 1.6092 -0.1052 0.2609  -0.0455 52  ALA C N   
3808 C CA  . ALA C 7   ? 1.3617 1.5581 1.4780 -0.1238 0.2446  -0.0366 52  ALA C CA  
3809 C C   . ALA C 7   ? 0.9568 1.1155 1.0382 -0.1154 0.2181  -0.0400 52  ALA C C   
3810 O O   . ALA C 7   ? 0.7933 0.9173 0.8402 -0.1241 0.2102  -0.0337 52  ALA C O   
3811 C CB  . ALA C 7   ? 1.2118 1.3890 1.2985 -0.1418 0.2642  -0.0246 52  ALA C CB  
3817 N N   . GLU C 8   ? 1.3763 1.5418 1.4691 -0.0979 0.2052  -0.0493 53  GLU C N   
3818 C CA  . GLU C 8   ? 1.0570 1.1921 1.1231 -0.0897 0.1829  -0.0533 53  GLU C CA  
3819 C C   . GLU C 8   ? 0.7606 0.9002 0.8481 -0.0973 0.1616  -0.0517 53  GLU C C   
3820 O O   . GLU C 8   ? 0.7409 0.9054 0.8613 -0.1101 0.1617  -0.0483 53  GLU C O   
3821 C CB  . GLU C 8   ? 0.9138 1.0495 0.9793 -0.0693 0.1819  -0.0636 53  GLU C CB  
3822 C CG  . GLU C 8   ? 0.8783 1.0027 0.9135 -0.0620 0.2008  -0.0692 53  GLU C CG  
3823 C CD  . GLU C 8   ? 0.8076 0.9264 0.8419 -0.0436 0.1990  -0.0819 53  GLU C CD  
3824 O OE1 . GLU C 8   ? 0.7525 0.8863 0.8216 -0.0351 0.1905  -0.0833 53  GLU C OE1 
3825 O OE2 . GLU C 8   ? 0.8014 0.8992 0.7988 -0.0382 0.2056  -0.0902 53  GLU C OE2 
3832 N N   . HIS C 9   ? 0.6941 0.8107 0.7629 -0.0902 0.1434  -0.0556 54  HIS C N   
3833 C CA  . HIS C 9   ? 0.5671 0.6818 0.6456 -0.0966 0.1242  -0.0559 54  HIS C CA  
3834 C C   . HIS C 9   ? 0.4928 0.6188 0.5852 -0.0825 0.1120  -0.0606 54  HIS C C   
3835 O O   . HIS C 9   ? 0.4535 0.5586 0.5253 -0.0715 0.1069  -0.0645 54  HIS C O   
3836 C CB  . HIS C 9   ? 0.5703 0.6460 0.6141 -0.1012 0.1154  -0.0550 54  HIS C CB  
3837 C CG  . HIS C 9   ? 0.5933 0.6534 0.6239 -0.1164 0.1252  -0.0470 54  HIS C CG  
3838 N ND1 . HIS C 9   ? 0.6151 0.6620 0.6193 -0.1149 0.1399  -0.0414 54  HIS C ND1 
3839 C CD2 . HIS C 9   ? 0.6038 0.6571 0.6423 -0.1341 0.1231  -0.0432 54  HIS C CD2 
3840 C CE1 . HIS C 9   ? 0.6349 0.6669 0.6307 -0.1306 0.1473  -0.0317 54  HIS C CE1 
3841 N NE2 . HIS C 9   ? 0.6356 0.6702 0.6542 -0.1429 0.1376  -0.0332 54  HIS C NE2 
3849 N N   . PRO C 10  ? 0.4594 0.6178 0.5863 -0.0828 0.1062  -0.0596 55  PRO C N   
3850 C CA  . PRO C 10  ? 0.4452 0.6127 0.5825 -0.0673 0.0965  -0.0605 55  PRO C CA  
3851 C C   . PRO C 10  ? 0.4686 0.6111 0.5813 -0.0661 0.0816  -0.0628 55  PRO C C   
3852 O O   . PRO C 10  ? 0.4514 0.5798 0.5501 -0.0781 0.0741  -0.0647 55  PRO C O   
3853 C CB  . PRO C 10  ? 0.4291 0.6379 0.6066 -0.0702 0.0897  -0.0569 55  PRO C CB  
3854 C CG  . PRO C 10  ? 0.4469 0.6737 0.6429 -0.0850 0.1025  -0.0557 55  PRO C CG  
3855 C CD  . PRO C 10  ? 0.4573 0.6472 0.6171 -0.0971 0.1078  -0.0566 55  PRO C CD  
3863 N N   . LEU C 11  ? 0.4737 0.6095 0.5828 -0.0514 0.0792  -0.0631 56  LEU C N   
3864 C CA  . LEU C 11  ? 0.4906 0.6121 0.5845 -0.0490 0.0670  -0.0636 56  LEU C CA  
3865 C C   . LEU C 11  ? 0.4770 0.6236 0.5884 -0.0464 0.0553  -0.0581 56  LEU C C   
3866 O O   . LEU C 11  ? 0.4770 0.6504 0.6160 -0.0398 0.0568  -0.0530 56  LEU C O   
3867 C CB  . LEU C 11  ? 0.5276 0.6282 0.6097 -0.0368 0.0716  -0.0656 56  LEU C CB  
3868 C CG  . LEU C 11  ? 0.5446 0.6227 0.6077 -0.0381 0.0794  -0.0720 56  LEU C CG  
3869 C CD1 . LEU C 11  ? 0.5624 0.6263 0.6221 -0.0273 0.0836  -0.0760 56  LEU C CD1 
3870 C CD2 . LEU C 11  ? 0.5694 0.6291 0.6122 -0.0470 0.0723  -0.0747 56  LEU C CD2 
3882 N N   . GLN C 12  ? 0.4543 0.5932 0.5488 -0.0508 0.0433  -0.0592 57  GLN C N   
3883 C CA  . GLN C 12  ? 0.4480 0.6096 0.5509 -0.0480 0.0296  -0.0535 57  GLN C CA  
3884 C C   . GLN C 12  ? 0.4407 0.6081 0.5550 -0.0296 0.0317  -0.0435 57  GLN C C   
3885 O O   . GLN C 12  ? 0.4388 0.6328 0.5715 -0.0231 0.0219  -0.0353 57  GLN C O   
3886 C CB  . GLN C 12  ? 0.4442 0.5909 0.5180 -0.0542 0.0193  -0.0578 57  GLN C CB  
3887 C CG  . GLN C 12  ? 0.4542 0.6229 0.5269 -0.0525 0.0028  -0.0524 57  GLN C CG  
3888 C CD  . GLN C 12  ? 0.4846 0.6879 0.5837 -0.0627 -0.0085 -0.0539 57  GLN C CD  
3889 O OE1 . GLN C 12  ? 0.4740 0.6758 0.5776 -0.0788 -0.0074 -0.0632 57  GLN C OE1 
3890 N NE2 . GLN C 12  ? 0.4831 0.7181 0.6028 -0.0532 -0.0197 -0.0439 57  GLN C NE2 
3899 N N   . TYR C 13  ? 0.4621 0.6046 0.5673 -0.0211 0.0433  -0.0441 58  TYR C N   
3900 C CA  . TYR C 13  ? 0.4838 0.6234 0.6000 -0.0044 0.0480  -0.0356 58  TYR C CA  
3901 C C   . TYR C 13  ? 0.4646 0.5895 0.5873 0.0005  0.0641  -0.0423 58  TYR C C   
3902 O O   . TYR C 13  ? 0.4683 0.5779 0.5763 -0.0080 0.0698  -0.0520 58  TYR C O   
3903 C CB  . TYR C 13  ? 0.5128 0.6305 0.6066 0.0000  0.0456  -0.0299 58  TYR C CB  
3904 C CG  . TYR C 13  ? 0.5465 0.6739 0.6228 -0.0049 0.0310  -0.0249 58  TYR C CG  
3905 C CD1 . TYR C 13  ? 0.5714 0.7152 0.6521 0.0050  0.0201  -0.0108 58  TYR C CD1 
3906 C CD2 . TYR C 13  ? 0.5596 0.6786 0.6128 -0.0184 0.0275  -0.0348 58  TYR C CD2 
3907 C CE1 . TYR C 13  ? 0.5946 0.7474 0.6528 0.0001  0.0053  -0.0074 58  TYR C CE1 
3908 C CE2 . TYR C 13  ? 0.5787 0.7046 0.6115 -0.0233 0.0150  -0.0336 58  TYR C CE2 
3909 C CZ  . TYR C 13  ? 0.5980 0.7413 0.6310 -0.0148 0.0035  -0.0203 58  TYR C CZ  
3910 O OH  . TYR C 13  ? 0.6262 0.7764 0.6327 -0.0200 -0.0102 -0.0201 58  TYR C OH  
3920 N N   . ASN C 14  ? 0.4651 0.5938 0.6086 0.0152  0.0707  -0.0374 59  ASN C N   
3921 C CA  . ASN C 14  ? 0.4681 0.5752 0.6115 0.0211  0.0856  -0.0457 59  ASN C CA  
3922 C C   . ASN C 14  ? 0.4662 0.5415 0.5900 0.0206  0.0863  -0.0471 59  ASN C C   
3923 O O   . ASN C 14  ? 0.4481 0.5190 0.5652 0.0222  0.0792  -0.0372 59  ASN C O   
3924 C CB  . ASN C 14  ? 0.4677 0.5838 0.6403 0.0384  0.0939  -0.0417 59  ASN C CB  
3925 C CG  . ASN C 14  ? 0.4654 0.6186 0.6653 0.0393  0.0957  -0.0410 59  ASN C CG  
3926 O OD1 . ASN C 14  ? 0.4568 0.6216 0.6512 0.0255  0.0971  -0.0470 59  ASN C OD1 
3927 N ND2 . ASN C 14  ? 0.4822 0.6542 0.7146 0.0560  0.0965  -0.0327 59  ASN C ND2 
3934 N N   . TYR C 15  ? 0.4748 0.5296 0.5889 0.0176  0.0949  -0.0595 60  TYR C N   
3935 C CA  . TYR C 15  ? 0.5267 0.5547 0.6300 0.0158  0.0966  -0.0630 60  TYR C CA  
3936 C C   . TYR C 15  ? 0.5126 0.5214 0.6229 0.0219  0.1078  -0.0733 60  TYR C C   
3937 O O   . TYR C 15  ? 0.5114 0.5255 0.6255 0.0253  0.1150  -0.0817 60  TYR C O   
3938 C CB  . TYR C 15  ? 0.5667 0.5887 0.6500 0.0029  0.0914  -0.0708 60  TYR C CB  
3939 C CG  . TYR C 15  ? 0.6084 0.6397 0.6819 -0.0031 0.0821  -0.0634 60  TYR C CG  
3940 C CD1 . TYR C 15  ? 0.6416 0.6921 0.7135 -0.0080 0.0756  -0.0614 60  TYR C CD1 
3941 C CD2 . TYR C 15  ? 0.6495 0.6699 0.7153 -0.0051 0.0812  -0.0597 60  TYR C CD2 
3942 C CE1 . TYR C 15  ? 0.6610 0.7172 0.7216 -0.0143 0.0669  -0.0581 60  TYR C CE1 
3943 C CE2 . TYR C 15  ? 0.6748 0.7023 0.7273 -0.0101 0.0744  -0.0555 60  TYR C CE2 
3944 C CZ  . TYR C 15  ? 0.6666 0.7109 0.7155 -0.0145 0.0664  -0.0557 60  TYR C CZ  
3945 O OH  . TYR C 15  ? 0.7028 0.7514 0.7363 -0.0203 0.0593  -0.0547 60  TYR C OH  
3955 N N   . THR C 16  ? 0.5167 0.5020 0.6280 0.0222  0.1105  -0.0735 61  THR C N   
3956 C CA  . THR C 16  ? 0.5354 0.4969 0.6542 0.0263  0.1204  -0.0849 61  THR C CA  
3957 C C   . THR C 16  ? 0.5293 0.4729 0.6399 0.0144  0.1188  -0.0958 61  THR C C   
3958 O O   . THR C 16  ? 0.5212 0.4608 0.6318 0.0091  0.1162  -0.0872 61  THR C O   
3959 C CB  . THR C 16  ? 0.5778 0.5258 0.7156 0.0397  0.1268  -0.0726 61  THR C CB  
3960 O OG1 . THR C 16  ? 0.5804 0.5512 0.7318 0.0523  0.1263  -0.0629 61  THR C OG1 
3961 C CG2 . THR C 16  ? 0.6042 0.5213 0.7509 0.0431  0.1382  -0.0869 61  THR C CG2 
3969 N N   . PHE C 17  ? 0.5348 0.4701 0.6384 0.0102  0.1204  -0.1149 62  PHE C N   
3970 C CA  . PHE C 17  ? 0.5396 0.4603 0.6420 -0.0006 0.1173  -0.1277 62  PHE C CA  
3971 C C   . PHE C 17  ? 0.5650 0.4578 0.6843 0.0009  0.1266  -0.1326 62  PHE C C   
3972 O O   . PHE C 17  ? 0.5833 0.4636 0.7081 0.0105  0.1354  -0.1374 62  PHE C O   
3973 C CB  . PHE C 17  ? 0.5503 0.4742 0.6346 -0.0060 0.1117  -0.1465 62  PHE C CB  
3974 C CG  . PHE C 17  ? 0.5336 0.4748 0.6037 -0.0127 0.0998  -0.1440 62  PHE C CG  
3975 C CD1 . PHE C 17  ? 0.5233 0.4660 0.6007 -0.0206 0.0927  -0.1437 62  PHE C CD1 
3976 C CD2 . PHE C 17  ? 0.5251 0.4799 0.5766 -0.0110 0.0974  -0.1419 62  PHE C CD2 
3977 C CE1 . PHE C 17  ? 0.5090 0.4655 0.5760 -0.0241 0.0824  -0.1418 62  PHE C CE1 
3978 C CE2 . PHE C 17  ? 0.5168 0.4817 0.5555 -0.0163 0.0870  -0.1388 62  PHE C CE2 
3979 C CZ  . PHE C 17  ? 0.5072 0.4724 0.5539 -0.0216 0.0789  -0.1390 62  PHE C CZ  
3989 N N   . TRP C 18  ? 0.5827 0.4648 0.7124 -0.0090 0.1260  -0.1318 63  TRP C N   
3990 C CA  . TRP C 18  ? 0.6174 0.4694 0.7650 -0.0122 0.1350  -0.1377 63  TRP C CA  
3991 C C   . TRP C 18  ? 0.6443 0.4937 0.7984 -0.0287 0.1291  -0.1559 63  TRP C C   
3992 O O   . TRP C 18  ? 0.6051 0.4753 0.7570 -0.0363 0.1204  -0.1544 63  TRP C O   
3993 C CB  . TRP C 18  ? 0.6209 0.4601 0.7810 -0.0092 0.1433  -0.1143 63  TRP C CB  
3994 C CG  . TRP C 18  ? 0.6273 0.4743 0.7831 0.0071  0.1449  -0.0930 63  TRP C CG  
3995 C CD1 . TRP C 18  ? 0.5863 0.4629 0.7287 0.0113  0.1366  -0.0817 63  TRP C CD1 
3996 C CD2 . TRP C 18  ? 0.6470 0.4725 0.8147 0.0213  0.1539  -0.0803 63  TRP C CD2 
3997 N NE1 . TRP C 18  ? 0.6003 0.4793 0.7466 0.0263  0.1382  -0.0637 63  TRP C NE1 
3998 C CE2 . TRP C 18  ? 0.6190 0.4676 0.7810 0.0343  0.1485  -0.0614 63  TRP C CE2 
3999 C CE3 . TRP C 18  ? 0.6796 0.4675 0.8639 0.0247  0.1654  -0.0836 63  TRP C CE3 
4000 C CZ2 . TRP C 18  ? 0.6410 0.4803 0.8146 0.0522  0.1526  -0.0443 63  TRP C CZ2 
4001 C CZ3 . TRP C 18  ? 0.6943 0.4676 0.8888 0.0434  0.1715  -0.0660 63  TRP C CZ3 
4002 C CH2 . TRP C 18  ? 0.6853 0.4862 0.8751 0.0579  0.1643  -0.0459 63  TRP C CH2 
4013 N N   . TYR C 19  ? 0.6650 0.4889 0.8302 -0.0341 0.1336  -0.1737 64  TYR C N   
4014 C CA  . TYR C 19  ? 0.6711 0.4938 0.8476 -0.0512 0.1263  -0.1937 64  TYR C CA  
4015 C C   . TYR C 19  ? 0.6979 0.4880 0.9017 -0.0603 0.1381  -0.1959 64  TYR C C   
4016 O O   . TYR C 19  ? 0.7069 0.4665 0.9138 -0.0525 0.1494  -0.1965 64  TYR C O   
4017 C CB  . TYR C 19  ? 0.6893 0.5147 0.8468 -0.0526 0.1159  -0.2205 64  TYR C CB  
4018 C CG  . TYR C 19  ? 0.7189 0.5401 0.8894 -0.0699 0.1062  -0.2451 64  TYR C CG  
4019 C CD1 . TYR C 19  ? 0.6977 0.5445 0.8815 -0.0812 0.0935  -0.2455 64  TYR C CD1 
4020 C CD2 . TYR C 19  ? 0.7607 0.5538 0.9323 -0.0747 0.1092  -0.2696 64  TYR C CD2 
4021 C CE1 . TYR C 19  ? 0.7253 0.5741 0.9266 -0.0974 0.0821  -0.2686 64  TYR C CE1 
4022 C CE2 . TYR C 19  ? 0.7888 0.5801 0.9735 -0.0924 0.0977  -0.2944 64  TYR C CE2 
4023 C CZ  . TYR C 19  ? 0.7762 0.5978 0.9774 -0.1040 0.0832  -0.2933 64  TYR C CZ  
4024 O OH  . TYR C 19  ? 0.8004 0.6259 1.0203 -0.1222 0.0695  -0.3184 64  TYR C OH  
4034 N N   . SER C 20  ? 0.6906 0.4867 0.9169 -0.0765 0.1368  -0.1965 65  SER C N   
4035 C CA  . SER C 20  ? 0.7335 0.4990 0.9891 -0.0897 0.1489  -0.1990 65  SER C CA  
4036 C C   . SER C 20  ? 0.7660 0.5453 1.0450 -0.1111 0.1386  -0.2216 65  SER C C   
4037 O O   . SER C 20  ? 0.7466 0.5627 1.0252 -0.1143 0.1255  -0.2237 65  SER C O   
4038 C CB  . SER C 20  ? 0.7324 0.4901 0.9982 -0.0886 0.1644  -0.1677 65  SER C CB  
4039 O OG  . SER C 20  ? 0.7010 0.4903 0.9755 -0.0982 0.1611  -0.1612 65  SER C OG  
4045 N N   . ARG C 21  ? 0.9034 0.6528 1.2055 -0.1254 0.1439  -0.2390 66  ARG C N   
4046 C CA  . ARG C 21  ? 0.9535 0.7157 1.2852 -0.1483 0.1334  -0.2628 66  ARG C CA  
4047 C C   . ARG C 21  ? 1.0266 0.7505 1.3938 -0.1659 0.1503  -0.2651 66  ARG C C   
4048 O O   . ARG C 21  ? 1.0723 0.7517 1.4340 -0.1606 0.1620  -0.2671 66  ARG C O   
4049 C CB  . ARG C 21  ? 0.9848 0.7543 1.2979 -0.1497 0.1126  -0.2961 66  ARG C CB  
4050 C CG  . ARG C 21  ? 1.0219 0.8074 1.3660 -0.1734 0.0969  -0.3234 66  ARG C CG  
4051 C CD  . ARG C 21  ? 1.0411 0.8472 1.3557 -0.1709 0.0707  -0.3496 66  ARG C CD  
4052 N NE  . ARG C 21  ? 1.0958 0.8710 1.3724 -0.1602 0.0728  -0.3623 66  ARG C NE  
4053 C CZ  . ARG C 21  ? 1.1566 0.9097 1.4325 -0.1686 0.0701  -0.3806 66  ARG C CZ  
4054 N NH1 . ARG C 21  ? 1.1922 0.9182 1.4320 -0.1567 0.0742  -0.3918 66  ARG C NH1 
4055 N NH2 . ARG C 21  ? 1.1823 0.9404 1.4944 -0.1888 0.0644  -0.3884 66  ARG C NH2 
4069 N N   . ARG C 22  ? 1.0908 0.8315 1.4971 -0.1865 0.1528  -0.2644 67  ARG C N   
4070 C CA  . ARG C 22  ? 1.1827 0.8931 1.6202 -0.2023 0.1705  -0.2578 67  ARG C CA  
4071 C C   . ARG C 22  ? 1.3680 1.0561 1.8049 -0.2087 0.1617  -0.2826 67  ARG C C   
4072 O O   . ARG C 22  ? 1.3695 1.0142 1.8098 -0.2089 0.1770  -0.2752 67  ARG C O   
4073 C CB  . ARG C 22  ? 1.2093 0.9541 1.6870 -0.2216 0.1737  -0.2521 67  ARG C CB  
4074 C CG  . ARG C 22  ? 1.2559 0.9773 1.7642 -0.2384 0.1913  -0.2432 67  ARG C CG  
4075 C CD  . ARG C 22  ? 1.2859 1.0498 1.8359 -0.2567 0.1933  -0.2416 67  ARG C CD  
4076 N NE  . ARG C 22  ? 1.3117 1.1196 1.8777 -0.2641 0.1651  -0.2715 67  ARG C NE  
4077 C CZ  . ARG C 22  ? 1.3212 1.1779 1.9236 -0.2749 0.1593  -0.2751 67  ARG C CZ  
4078 N NH1 . ARG C 22  ? 1.3223 1.1908 1.9476 -0.2803 0.1823  -0.2520 67  ARG C NH1 
4079 N NH2 . ARG C 22  ? 1.3234 1.2178 1.9376 -0.2789 0.1306  -0.3011 67  ARG C NH2 
4093 N N   . THR C 23  ? 1.4865 1.2023 1.9173 -0.2135 0.1367  -0.3114 68  THR C N   
4094 C CA  . THR C 23  ? 1.6224 1.3205 2.0494 -0.2217 0.1255  -0.3382 68  THR C CA  
4095 C C   . THR C 23  ? 1.6216 1.2867 2.0801 -0.2379 0.1416  -0.3336 68  THR C C   
4096 O O   . THR C 23  ? 1.6571 1.3380 2.1533 -0.2541 0.1491  -0.3228 68  THR C O   
4097 C CB  . THR C 23  ? 1.6274 1.2958 2.0096 -0.2023 0.1244  -0.3486 68  THR C CB  
4098 O OG1 . THR C 23  ? 1.7195 1.3733 2.0946 -0.2115 0.1122  -0.3774 68  THR C OG1 
4099 C CG2 . THR C 23  ? 1.6808 1.3041 2.0577 -0.1874 0.1503  -0.3248 68  THR C CG2 
4107 N N   . ASN C 36  ? 1.1278 0.7169 1.4670 -0.1129 0.2157  -0.1761 81  ASN C N   
4108 C CA  . ASN C 36  ? 1.1327 0.7106 1.4477 -0.0847 0.2175  -0.1636 81  ASN C CA  
4109 C C   . ASN C 36  ? 1.0779 0.7046 1.3646 -0.0716 0.2009  -0.1671 81  ASN C C   
4110 O O   . ASN C 36  ? 1.0659 0.7135 1.3454 -0.0780 0.1873  -0.1949 81  ASN C O   
4111 C CB  . ASN C 36  ? 1.2131 0.7459 1.5340 -0.0797 0.2233  -0.1868 81  ASN C CB  
4112 C CG  . ASN C 36  ? 1.2459 0.7697 1.5492 -0.0489 0.2270  -0.1753 81  ASN C CG  
4113 O OD1 . ASN C 36  ? 1.2200 0.7675 1.5096 -0.0323 0.2251  -0.1467 81  ASN C OD1 
4114 N ND2 . ASN C 36  ? 1.2878 0.7787 1.5933 -0.0414 0.2322  -0.1993 81  ASN C ND2 
4121 N N   . ILE C 37  ? 1.0878 0.7314 1.3577 -0.0542 0.2013  -0.1383 82  ILE C N   
4122 C CA  . ILE C 37  ? 1.0653 0.7525 1.3108 -0.0433 0.1873  -0.1388 82  ILE C CA  
4123 C C   . ILE C 37  ? 1.0527 0.7334 1.2866 -0.0239 0.1870  -0.1483 82  ILE C C   
4124 O O   . ILE C 37  ? 1.1039 0.7521 1.3462 -0.0104 0.1982  -0.1404 82  ILE C O   
4125 C CB  . ILE C 37  ? 1.0670 0.7781 1.3001 -0.0359 0.1868  -0.1069 82  ILE C CB  
4126 C CG1 . ILE C 37  ? 1.0626 0.8176 1.2741 -0.0303 0.1718  -0.1112 82  ILE C CG1 
4127 C CG2 . ILE C 37  ? 1.1266 0.8152 1.3569 -0.0164 0.1957  -0.0797 82  ILE C CG2 
4128 C CD1 . ILE C 37  ? 1.0462 0.8262 1.2454 -0.0290 0.1694  -0.0881 82  ILE C CD1 
4140 N N   . LYS C 38  ? 0.9061 0.6180 1.1214 -0.0218 0.1752  -0.1643 83  LYS C N   
4141 C CA  . LYS C 38  ? 0.8581 0.5691 1.0612 -0.0063 0.1767  -0.1776 83  LYS C CA  
4142 C C   . LYS C 38  ? 0.7544 0.5070 0.9381 0.0037  0.1682  -0.1661 83  LYS C C   
4143 O O   . LYS C 38  ? 0.6908 0.4719 0.8620 -0.0065 0.1563  -0.1683 83  LYS C O   
4144 C CB  . LYS C 38  ? 0.9024 0.6046 1.0974 -0.0170 0.1726  -0.2143 83  LYS C CB  
4145 C CG  . LYS C 38  ? 0.9815 0.6459 1.1971 -0.0332 0.1775  -0.2318 83  LYS C CG  
4146 C CD  . LYS C 38  ? 1.0541 0.6720 1.2826 -0.0208 0.1945  -0.2347 83  LYS C CD  
4147 C CE  . LYS C 38  ? 1.1595 0.7365 1.4067 -0.0395 0.1990  -0.2585 83  LYS C CE  
4148 N NZ  . LYS C 38  ? 1.1833 0.7734 1.4126 -0.0533 0.1848  -0.2945 83  LYS C NZ  
4162 N N   . GLN C 39  ? 0.7639 0.5202 0.9484 0.0234  0.1743  -0.1543 84  GLN C N   
4163 C CA  . GLN C 39  ? 0.7327 0.5278 0.9026 0.0313  0.1675  -0.1469 84  GLN C CA  
4164 C C   . GLN C 39  ? 0.7153 0.5205 0.8657 0.0279  0.1657  -0.1730 84  GLN C C   
4165 O O   . GLN C 39  ? 0.7401 0.5243 0.8903 0.0332  0.1753  -0.1927 84  GLN C O   
4166 C CB  . GLN C 39  ? 0.7530 0.5532 0.9358 0.0529  0.1742  -0.1282 84  GLN C CB  
4167 C CG  . GLN C 39  ? 0.7580 0.5996 0.9315 0.0591  0.1686  -0.1229 84  GLN C CG  
4168 C CD  . GLN C 39  ? 0.7658 0.6218 0.9580 0.0787  0.1707  -0.1013 84  GLN C CD  
4169 O OE1 . GLN C 39  ? 0.8059 0.6397 1.0154 0.0902  0.1753  -0.0873 84  GLN C OE1 
4170 N NE2 . GLN C 39  ? 0.7536 0.6472 0.9438 0.0825  0.1666  -0.0976 84  GLN C NE2 
4179 N N   . ILE C 40  ? 0.6226 0.4573 0.7539 0.0195  0.1540  -0.1731 85  ILE C N   
4180 C CA  . ILE C 40  ? 0.6217 0.4675 0.7279 0.0168  0.1514  -0.1926 85  ILE C CA  
4181 C C   . ILE C 40  ? 0.6048 0.4715 0.7077 0.0306  0.1594  -0.1846 85  ILE C C   
4182 O O   . ILE C 40  ? 0.6148 0.4741 0.7136 0.0393  0.1716  -0.1989 85  ILE C O   
4183 C CB  . ILE C 40  ? 0.6042 0.4693 0.6924 0.0026  0.1352  -0.1943 85  ILE C CB  
4184 C CG1 . ILE C 40  ? 0.6193 0.4696 0.7182 -0.0114 0.1277  -0.2040 85  ILE C CG1 
4185 C CG2 . ILE C 40  ? 0.6138 0.4882 0.6707 0.0014  0.1324  -0.2104 85  ILE C CG2 
4186 C CD1 . ILE C 40  ? 0.6064 0.4769 0.6940 -0.0229 0.1111  -0.2066 85  ILE C CD1 
4198 N N   . GLY C 41  ? 0.5486 0.4422 0.6545 0.0320  0.1534  -0.1635 86  GLY C N   
4199 C CA  . GLY C 41  ? 0.5410 0.4591 0.6500 0.0424  0.1601  -0.1557 86  GLY C CA  
4200 C C   . GLY C 41  ? 0.5077 0.4536 0.6200 0.0393  0.1497  -0.1343 86  GLY C C   
4201 O O   . GLY C 41  ? 0.4911 0.4373 0.5963 0.0290  0.1380  -0.1280 86  GLY C O   
4205 N N   . THR C 42  ? 0.5408 0.5112 0.6661 0.0482  0.1546  -0.1248 87  THR C N   
4206 C CA  . THR C 42  ? 0.5395 0.5374 0.6713 0.0456  0.1445  -0.1062 87  THR C CA  
4207 C C   . THR C 42  ? 0.5455 0.5669 0.6652 0.0382  0.1457  -0.1088 87  THR C C   
4208 O O   . THR C 42  ? 0.5712 0.5959 0.6873 0.0415  0.1587  -0.1195 87  THR C O   
4209 C CB  . THR C 42  ? 0.5422 0.5529 0.7048 0.0609  0.1459  -0.0905 87  THR C CB  
4210 O OG1 . THR C 42  ? 0.5620 0.5473 0.7307 0.0658  0.1436  -0.0830 87  THR C OG1 
4211 C CG2 . THR C 42  ? 0.5313 0.5752 0.7004 0.0572  0.1340  -0.0746 87  THR C CG2 
4219 N N   . PHE C 43  ? 0.5444 0.5793 0.6559 0.0275  0.1336  -0.0994 88  PHE C N   
4220 C CA  . PHE C 43  ? 0.5594 0.6127 0.6604 0.0184  0.1343  -0.0991 88  PHE C CA  
4221 C C   . PHE C 43  ? 0.5177 0.5947 0.6323 0.0137  0.1238  -0.0847 88  PHE C C   
4222 O O   . PHE C 43  ? 0.5075 0.5832 0.6284 0.0156  0.1134  -0.0761 88  PHE C O   
4223 C CB  . PHE C 43  ? 0.5838 0.6203 0.6513 0.0069  0.1292  -0.1074 88  PHE C CB  
4224 C CG  . PHE C 43  ? 0.5961 0.6204 0.6564 0.0010  0.1151  -0.1046 88  PHE C CG  
4225 C CD1 . PHE C 43  ? 0.5900 0.6241 0.6486 -0.0065 0.1051  -0.0951 88  PHE C CD1 
4226 C CD2 . PHE C 43  ? 0.6222 0.6256 0.6791 0.0023  0.1131  -0.1130 88  PHE C CD2 
4227 C CE1 . PHE C 43  ? 0.5861 0.6099 0.6386 -0.0106 0.0952  -0.0939 88  PHE C CE1 
4228 C CE2 . PHE C 43  ? 0.6089 0.6048 0.6636 -0.0033 0.1030  -0.1106 88  PHE C CE2 
4229 C CZ  . PHE C 43  ? 0.5978 0.6043 0.6497 -0.0087 0.0949  -0.1010 88  PHE C CZ  
4239 N N   . ALA C 44  ? 0.4575 0.5552 0.5745 0.0062  0.1270  -0.0826 89  ALA C N   
4240 C CA  . ALA C 44  ? 0.4365 0.5603 0.5710 0.0003  0.1176  -0.0719 89  ALA C CA  
4241 C C   . ALA C 44  ? 0.4342 0.5594 0.5525 -0.0168 0.1137  -0.0715 89  ALA C C   
4242 O O   . ALA C 44  ? 0.4249 0.5675 0.5548 -0.0248 0.1039  -0.0653 89  ALA C O   
4243 C CB  . ALA C 44  ? 0.4228 0.5798 0.5948 0.0087  0.1258  -0.0677 89  ALA C CB  
4249 N N   . SER C 45  ? 0.4728 0.5791 0.5640 -0.0227 0.1203  -0.0776 90  SER C N   
4250 C CA  . SER C 45  ? 0.4869 0.5883 0.5611 -0.0376 0.1178  -0.0750 90  SER C CA  
4251 C C   . SER C 45  ? 0.4834 0.5537 0.5243 -0.0394 0.1106  -0.0792 90  SER C C   
4252 O O   . SER C 45  ? 0.4791 0.5350 0.5109 -0.0312 0.1094  -0.0859 90  SER C O   
4253 C CB  . SER C 45  ? 0.5112 0.6236 0.5854 -0.0430 0.1349  -0.0741 90  SER C CB  
4254 O OG  . SER C 45  ? 0.5454 0.6409 0.5949 -0.0364 0.1457  -0.0817 90  SER C OG  
4260 N N   . VAL C 46  ? 0.5060 0.5664 0.5318 -0.0506 0.1055  -0.0755 91  VAL C N   
4261 C CA  . VAL C 46  ? 0.5212 0.5548 0.5190 -0.0510 0.0977  -0.0779 91  VAL C CA  
4262 C C   . VAL C 46  ? 0.5404 0.5627 0.5138 -0.0469 0.1052  -0.0821 91  VAL C C   
4263 O O   . VAL C 46  ? 0.5335 0.5408 0.4916 -0.0413 0.0978  -0.0885 91  VAL C O   
4264 C CB  . VAL C 46  ? 0.5482 0.5712 0.5372 -0.0625 0.0921  -0.0718 91  VAL C CB  
4265 C CG1 . VAL C 46  ? 0.5727 0.5688 0.5355 -0.0599 0.0836  -0.0727 91  VAL C CG1 
4266 C CG2 . VAL C 46  ? 0.5350 0.5678 0.5434 -0.0671 0.0834  -0.0714 91  VAL C CG2 
4276 N N   . GLU C 47  ? 0.5364 0.5675 0.5057 -0.0501 0.1202  -0.0793 92  GLU C N   
4277 C CA  . GLU C 47  ? 0.5743 0.5943 0.5130 -0.0466 0.1289  -0.0839 92  GLU C CA  
4278 C C   . GLU C 47  ? 0.6095 0.6304 0.5524 -0.0351 0.1318  -0.0974 92  GLU C C   
4279 O O   . GLU C 47  ? 0.6052 0.6103 0.5205 -0.0313 0.1287  -0.1062 92  GLU C O   
4280 C CB  . GLU C 47  ? 0.5894 0.6202 0.5234 -0.0534 0.1486  -0.0776 92  GLU C CB  
4281 C CG  . GLU C 47  ? 0.6042 0.6273 0.5290 -0.0672 0.1487  -0.0638 92  GLU C CG  
4282 C CD  . GLU C 47  ? 0.5716 0.6132 0.5351 -0.0762 0.1459  -0.0587 92  GLU C CD  
4283 O OE1 . GLU C 47  ? 0.5521 0.6095 0.5443 -0.0702 0.1383  -0.0642 92  GLU C OE1 
4284 O OE2 . GLU C 47  ? 0.5913 0.6304 0.5550 -0.0901 0.1510  -0.0489 92  GLU C OE2 
4291 N N   . GLN C 48  ? 0.6396 0.6775 0.6166 -0.0293 0.1368  -0.0992 93  GLN C N   
4292 C CA  . GLN C 48  ? 0.6972 0.7302 0.6806 -0.0182 0.1403  -0.1114 93  GLN C CA  
4293 C C   . GLN C 48  ? 0.6623 0.6786 0.6433 -0.0167 0.1239  -0.1162 93  GLN C C   
4294 O O   . GLN C 48  ? 0.6782 0.6804 0.6490 -0.0124 0.1232  -0.1289 93  GLN C O   
4295 C CB  . GLN C 48  ? 0.7675 0.8214 0.7896 -0.0102 0.1495  -0.1091 93  GLN C CB  
4296 C CG  . GLN C 48  ? 0.8543 0.8998 0.8827 0.0024  0.1592  -0.1219 93  GLN C CG  
4297 C CD  . GLN C 48  ? 0.9079 0.9745 0.9762 0.0136  0.1697  -0.1181 93  GLN C CD  
4298 O OE1 . GLN C 48  ? 0.9093 0.9995 1.0034 0.0117  0.1651  -0.1054 93  GLN C OE1 
4299 N NE2 . GLN C 48  ? 0.9425 1.0007 1.0170 0.0259  0.1829  -0.1299 93  GLN C NE2 
4308 N N   . PHE C 49  ? 0.6125 0.6307 0.6035 -0.0211 0.1116  -0.1077 94  PHE C N   
4309 C CA  . PHE C 49  ? 0.5695 0.5744 0.5588 -0.0209 0.0984  -0.1117 94  PHE C CA  
4310 C C   . PHE C 49  ? 0.5838 0.5741 0.5446 -0.0228 0.0914  -0.1194 94  PHE C C   
4311 O O   . PHE C 49  ? 0.5969 0.5781 0.5569 -0.0206 0.0856  -0.1302 94  PHE C O   
4312 C CB  . PHE C 49  ? 0.5203 0.5290 0.5185 -0.0257 0.0888  -0.1024 94  PHE C CB  
4313 C CG  . PHE C 49  ? 0.4964 0.4931 0.4888 -0.0267 0.0771  -0.1062 94  PHE C CG  
4314 C CD1 . PHE C 49  ? 0.4826 0.4746 0.4873 -0.0234 0.0753  -0.1126 94  PHE C CD1 
4315 C CD2 . PHE C 49  ? 0.4919 0.4818 0.4698 -0.0307 0.0689  -0.1031 94  PHE C CD2 
4316 C CE1 . PHE C 49  ? 0.4608 0.4470 0.4666 -0.0248 0.0660  -0.1167 94  PHE C CE1 
4317 C CE2 . PHE C 49  ? 0.4783 0.4610 0.4567 -0.0294 0.0586  -0.1070 94  PHE C CE2 
4318 C CZ  . PHE C 49  ? 0.4745 0.4580 0.4684 -0.0268 0.0574  -0.1142 94  PHE C CZ  
4328 N N   . TRP C 50  ? 0.5975 0.5853 0.5350 -0.0273 0.0909  -0.1134 95  TRP C N   
4329 C CA  . TRP C 50  ? 0.6228 0.5972 0.5300 -0.0275 0.0809  -0.1175 95  TRP C CA  
4330 C C   . TRP C 50  ? 0.6353 0.6046 0.5238 -0.0239 0.0857  -0.1319 95  TRP C C   
4331 O O   . TRP C 50  ? 0.6422 0.6033 0.5163 -0.0229 0.0730  -0.1417 95  TRP C O   
4332 C CB  . TRP C 50  ? 0.6444 0.6131 0.5275 -0.0324 0.0812  -0.1047 95  TRP C CB  
4333 C CG  . TRP C 50  ? 0.6524 0.6170 0.5464 -0.0356 0.0712  -0.0948 95  TRP C CG  
4334 C CD1 . TRP C 50  ? 0.6552 0.6214 0.5564 -0.0425 0.0765  -0.0837 95  TRP C CD1 
4335 C CD2 . TRP C 50  ? 0.6528 0.6113 0.5539 -0.0321 0.0552  -0.0972 95  TRP C CD2 
4336 N NE1 . TRP C 50  ? 0.6458 0.6033 0.5542 -0.0431 0.0651  -0.0803 95  TRP C NE1 
4337 C CE2 . TRP C 50  ? 0.6431 0.5969 0.5523 -0.0358 0.0529  -0.0880 95  TRP C CE2 
4338 C CE3 . TRP C 50  ? 0.6612 0.6192 0.5654 -0.0269 0.0432  -0.1075 95  TRP C CE3 
4339 C CZ2 . TRP C 50  ? 0.6430 0.5908 0.5618 -0.0322 0.0410  -0.0888 95  TRP C CZ2 
4340 C CZ3 . TRP C 50  ? 0.6523 0.6085 0.5704 -0.0242 0.0310  -0.1070 95  TRP C CZ3 
4341 C CH2 . TRP C 50  ? 0.6403 0.5911 0.5648 -0.0258 0.0309  -0.0977 95  TRP C CH2 
4352 N N   . ARG C 51  ? 0.6160 0.5913 0.5059 -0.0218 0.1038  -0.1349 96  ARG C N   
4353 C CA  . ARG C 51  ? 0.6534 0.6212 0.5239 -0.0178 0.1107  -0.1517 96  ARG C CA  
4354 C C   . ARG C 51  ? 0.6188 0.5793 0.5096 -0.0150 0.1035  -0.1664 96  ARG C C   
4355 O O   . ARG C 51  ? 0.6383 0.5877 0.5096 -0.0151 0.0975  -0.1829 96  ARG C O   
4356 C CB  . ARG C 51  ? 0.6930 0.6701 0.5674 -0.0143 0.1347  -0.1526 96  ARG C CB  
4357 C CG  . ARG C 51  ? 0.7491 0.7324 0.6000 -0.0195 0.1456  -0.1400 96  ARG C CG  
4358 C CD  . ARG C 51  ? 0.8480 0.8410 0.6967 -0.0154 0.1720  -0.1461 96  ARG C CD  
4359 N NE  . ARG C 51  ? 0.8739 0.8862 0.7719 -0.0099 0.1831  -0.1438 96  ARG C NE  
4360 C CZ  . ARG C 51  ? 0.9124 0.9467 0.8379 -0.0141 0.1902  -0.1290 96  ARG C CZ  
4361 N NH1 . ARG C 51  ? 0.9257 0.9616 0.8348 -0.0254 0.1897  -0.1152 96  ARG C NH1 
4362 N NH2 . ARG C 51  ? 0.9038 0.9579 0.8744 -0.0072 0.1968  -0.1275 96  ARG C NH2 
4376 N N   . PHE C 52  ? 0.6218 0.5877 0.5503 -0.0134 0.1040  -0.1606 97  PHE C N   
4377 C CA  . PHE C 52  ? 0.6325 0.5889 0.5817 -0.0126 0.0987  -0.1711 97  PHE C CA  
4378 C C   . PHE C 52  ? 0.6493 0.6030 0.5955 -0.0184 0.0792  -0.1739 97  PHE C C   
4379 O O   . PHE C 52  ? 0.6817 0.6270 0.6218 -0.0210 0.0712  -0.1900 97  PHE C O   
4380 C CB  . PHE C 52  ? 0.5950 0.5570 0.5804 -0.0088 0.1050  -0.1604 97  PHE C CB  
4381 C CG  . PHE C 52  ? 0.5861 0.5461 0.5855 0.0001  0.1218  -0.1641 97  PHE C CG  
4382 C CD1 . PHE C 52  ? 0.5870 0.5627 0.5894 0.0049  0.1340  -0.1562 97  PHE C CD1 
4383 C CD2 . PHE C 52  ? 0.5946 0.5369 0.6082 0.0037  0.1260  -0.1757 97  PHE C CD2 
4384 C CE1 . PHE C 52  ? 0.5977 0.5744 0.6186 0.0157  0.1499  -0.1598 97  PHE C CE1 
4385 C CE2 . PHE C 52  ? 0.6074 0.5448 0.6362 0.0145  0.1420  -0.1791 97  PHE C CE2 
4386 C CZ  . PHE C 52  ? 0.5939 0.5500 0.6272 0.0218  0.1538  -0.1712 97  PHE C CZ  
4396 N N   . TYR C 53  ? 0.6426 0.6047 0.5950 -0.0206 0.0712  -0.1596 98  TYR C N   
4397 C CA  . TYR C 53  ? 0.6504 0.6134 0.6096 -0.0238 0.0547  -0.1615 98  TYR C CA  
4398 C C   . TYR C 53  ? 0.6783 0.6381 0.6085 -0.0246 0.0406  -0.1705 98  TYR C C   
4399 O O   . TYR C 53  ? 0.6896 0.6499 0.6276 -0.0271 0.0279  -0.1828 98  TYR C O   
4400 C CB  . TYR C 53  ? 0.6313 0.6014 0.5997 -0.0242 0.0512  -0.1459 98  TYR C CB  
4401 C CG  . TYR C 53  ? 0.6381 0.6113 0.6152 -0.0250 0.0359  -0.1474 98  TYR C CG  
4402 C CD1 . TYR C 53  ? 0.6282 0.6058 0.6354 -0.0270 0.0349  -0.1519 98  TYR C CD1 
4403 C CD2 . TYR C 53  ? 0.6477 0.6195 0.6048 -0.0230 0.0238  -0.1429 98  TYR C CD2 
4404 C CE1 . TYR C 53  ? 0.6212 0.6062 0.6424 -0.0270 0.0228  -0.1541 98  TYR C CE1 
4405 C CE2 . TYR C 53  ? 0.6453 0.6223 0.6156 -0.0210 0.0096  -0.1440 98  TYR C CE2 
4406 C CZ  . TYR C 53  ? 0.6407 0.6266 0.6451 -0.0229 0.0095  -0.1505 98  TYR C CZ  
4407 O OH  . TYR C 53  ? 0.6310 0.6264 0.6539 -0.0201 -0.0029 -0.1524 98  TYR C OH  
4417 N N   . SER C 54  ? 0.7291 0.6865 0.6257 -0.0231 0.0422  -0.1637 99  SER C N   
4418 C CA  . SER C 54  ? 0.7800 0.7335 0.6424 -0.0225 0.0270  -0.1683 99  SER C CA  
4419 C C   . SER C 54  ? 0.8038 0.7516 0.6489 -0.0238 0.0253  -0.1899 99  SER C C   
4420 O O   . SER C 54  ? 0.8311 0.7780 0.6506 -0.0240 0.0077  -0.1977 99  SER C O   
4421 C CB  . SER C 54  ? 0.8157 0.7642 0.6424 -0.0214 0.0322  -0.1531 99  SER C CB  
4422 O OG  . SER C 54  ? 0.8557 0.8020 0.6661 -0.0218 0.0526  -0.1559 99  SER C OG  
4428 N N   . HIS C 55  ? 0.7596 0.7028 0.6176 -0.0240 0.0421  -0.2002 100 HIS C N   
4429 C CA  . HIS C 55  ? 0.7729 0.7063 0.6191 -0.0257 0.0419  -0.2242 100 HIS C CA  
4430 C C   . HIS C 55  ? 0.7451 0.6757 0.6335 -0.0301 0.0393  -0.2361 100 HIS C C   
4431 O O   . HIS C 55  ? 0.7695 0.6872 0.6591 -0.0320 0.0454  -0.2557 100 HIS C O   
4432 C CB  . HIS C 55  ? 0.8041 0.7295 0.6307 -0.0215 0.0653  -0.2296 100 HIS C CB  
4433 C CG  . HIS C 55  ? 0.8264 0.7530 0.6063 -0.0196 0.0701  -0.2211 100 HIS C CG  
4434 N ND1 . HIS C 55  ? 0.8825 0.8030 0.6136 -0.0209 0.0582  -0.2311 100 HIS C ND1 
4435 C CD2 . HIS C 55  ? 0.8165 0.7494 0.5903 -0.0177 0.0858  -0.2025 100 HIS C CD2 
4436 C CE1 . HIS C 55  ? 0.8979 0.8183 0.5918 -0.0193 0.0682  -0.2173 100 HIS C CE1 
4437 N NE2 . HIS C 55  ? 0.8690 0.7973 0.5908 -0.0182 0.0858  -0.2004 100 HIS C NE2 
4446 N N   . MET C 56  ? 0.7102 0.6507 0.6325 -0.0321 0.0321  -0.2246 101 MET C N   
4447 C CA  . MET C 56  ? 0.6986 0.6383 0.6603 -0.0383 0.0287  -0.2335 101 MET C CA  
4448 C C   . MET C 56  ? 0.6970 0.6509 0.6679 -0.0431 0.0054  -0.2377 101 MET C C   
4449 O O   . MET C 56  ? 0.6831 0.6489 0.6483 -0.0389 -0.0041 -0.2235 101 MET C O   
4450 C CB  . MET C 56  ? 0.6571 0.5985 0.6523 -0.0366 0.0421  -0.2166 101 MET C CB  
4451 C CG  . MET C 56  ? 0.6870 0.6163 0.6859 -0.0313 0.0627  -0.2138 101 MET C CG  
4452 S SD  . MET C 56  ? 0.6336 0.5683 0.6632 -0.0281 0.0733  -0.1908 101 MET C SD  
4453 C CE  . MET C 56  ? 0.6468 0.5744 0.7114 -0.0372 0.0708  -0.1976 101 MET C CE  
4463 N N   . VAL C 57  ? 0.7035 0.6564 0.6917 -0.0517 -0.0039 -0.2579 102 VAL C N   
4464 C CA  . VAL C 57  ? 0.6839 0.6563 0.6945 -0.0569 -0.0258 -0.2630 102 VAL C CA  
4465 C C   . VAL C 57  ? 0.6434 0.6290 0.6904 -0.0551 -0.0206 -0.2444 102 VAL C C   
4466 O O   . VAL C 57  ? 0.6209 0.5982 0.6833 -0.0544 -0.0009 -0.2333 102 VAL C O   
4467 C CB  . VAL C 57  ? 0.7045 0.6738 0.7388 -0.0699 -0.0325 -0.2885 102 VAL C CB  
4468 C CG1 . VAL C 57  ? 0.6914 0.6872 0.7629 -0.0766 -0.0534 -0.2935 102 VAL C CG1 
4469 C CG2 . VAL C 57  ? 0.7368 0.6934 0.7284 -0.0714 -0.0405 -0.3101 102 VAL C CG2 
4479 N N   . ARG C 58  ? 0.6665 0.6731 0.7261 -0.0530 -0.0386 -0.2408 103 ARG C N   
4480 C CA  . ARG C 58  ? 0.6331 0.6524 0.7266 -0.0506 -0.0325 -0.2264 103 ARG C CA  
4481 C C   . ARG C 58  ? 0.6246 0.6483 0.7653 -0.0619 -0.0228 -0.2340 103 ARG C C   
4482 O O   . ARG C 58  ? 0.6534 0.6785 0.8095 -0.0723 -0.0303 -0.2527 103 ARG C O   
4483 C CB  . ARG C 58  ? 0.6714 0.7118 0.7715 -0.0436 -0.0534 -0.2222 103 ARG C CB  
4484 C CG  . ARG C 58  ? 0.7169 0.7515 0.7696 -0.0336 -0.0674 -0.2151 103 ARG C CG  
4485 C CD  . ARG C 58  ? 0.7294 0.7471 0.7543 -0.0270 -0.0510 -0.1963 103 ARG C CD  
4486 N NE  . ARG C 58  ? 0.7780 0.7913 0.7661 -0.0179 -0.0644 -0.1856 103 ARG C NE  
4487 C CZ  . ARG C 58  ? 0.8036 0.8007 0.7585 -0.0141 -0.0537 -0.1711 103 ARG C CZ  
4488 N NH1 . ARG C 58  ? 0.7911 0.7791 0.7471 -0.0179 -0.0314 -0.1666 103 ARG C NH1 
4489 N NH2 . ARG C 58  ? 0.8335 0.8240 0.7556 -0.0067 -0.0657 -0.1600 103 ARG C NH2 
4503 N N   . PRO C 59  ? 0.5919 0.6167 0.7547 -0.0613 -0.0056 -0.2201 104 PRO C N   
4504 C CA  . PRO C 59  ? 0.5955 0.6245 0.8025 -0.0729 0.0057  -0.2246 104 PRO C CA  
4505 C C   . PRO C 59  ? 0.5864 0.6423 0.8326 -0.0805 -0.0107 -0.2387 104 PRO C C   
4506 O O   . PRO C 59  ? 0.6203 0.6771 0.8987 -0.0948 -0.0078 -0.2517 104 PRO C O   
4507 C CB  . PRO C 59  ? 0.5667 0.5964 0.7807 -0.0680 0.0239  -0.2052 104 PRO C CB  
4508 C CG  . PRO C 59  ? 0.5620 0.5806 0.7346 -0.0564 0.0248  -0.1928 104 PRO C CG  
4509 C CD  . PRO C 59  ? 0.5867 0.6092 0.7347 -0.0515 0.0042  -0.2005 104 PRO C CD  
4517 N N   . GLY C 60  ? 0.5308 0.6091 0.7784 -0.0712 -0.0282 -0.2365 105 GLY C N   
4518 C CA  . GLY C 60  ? 0.5342 0.6443 0.8245 -0.0761 -0.0463 -0.2493 105 GLY C CA  
4519 C C   . GLY C 60  ? 0.5518 0.6646 0.8405 -0.0863 -0.0670 -0.2714 105 GLY C C   
4520 O O   . GLY C 60  ? 0.5449 0.6837 0.8787 -0.0966 -0.0793 -0.2859 105 GLY C O   
4524 N N   . ASP C 61  ? 0.6436 0.7313 0.8818 -0.0843 -0.0706 -0.2759 106 ASP C N   
4525 C CA  . ASP C 61  ? 0.7186 0.8043 0.9443 -0.0934 -0.0897 -0.2994 106 ASP C CA  
4526 C C   . ASP C 61  ? 0.7338 0.7940 0.9684 -0.1088 -0.0726 -0.3134 106 ASP C C   
4527 O O   . ASP C 61  ? 0.7625 0.8128 0.9804 -0.1170 -0.0844 -0.3356 106 ASP C O   
4528 C CB  . ASP C 61  ? 0.7781 0.8511 0.9392 -0.0815 -0.1030 -0.2974 106 ASP C CB  
4529 C CG  . ASP C 61  ? 0.8269 0.9213 0.9785 -0.0666 -0.1234 -0.2839 106 ASP C CG  
4530 O OD1 . ASP C 61  ? 0.8333 0.9595 1.0265 -0.0674 -0.1420 -0.2889 106 ASP C OD1 
4531 O OD2 . ASP C 61  ? 0.8285 0.9080 0.9348 -0.0540 -0.1201 -0.2677 106 ASP C OD2 
4536 N N   . LEU C 62  ? 0.6647 0.7117 0.9228 -0.1124 -0.0452 -0.3012 107 LEU C N   
4537 C CA  . LEU C 62  ? 0.6486 0.6689 0.9218 -0.1264 -0.0280 -0.3115 107 LEU C CA  
4538 C C   . LEU C 62  ? 0.7265 0.7649 1.0588 -0.1462 -0.0327 -0.3269 107 LEU C C   
4539 O O   . LEU C 62  ? 0.6971 0.7721 1.0657 -0.1475 -0.0436 -0.3252 107 LEU C O   
4540 C CB  . LEU C 62  ? 0.5971 0.5950 0.8692 -0.1213 0.0021  -0.2889 107 LEU C CB  
4541 C CG  . LEU C 62  ? 0.5468 0.5286 0.7703 -0.1040 0.0100  -0.2728 107 LEU C CG  
4542 C CD1 . LEU C 62  ? 0.5191 0.4873 0.7500 -0.1001 0.0354  -0.2503 107 LEU C CD1 
4543 C CD2 . LEU C 62  ? 0.5703 0.5265 0.7579 -0.1026 0.0086  -0.2883 107 LEU C CD2 
4555 N N   . THR C 63  ? 0.8976 0.9094 1.2432 -0.1618 -0.0227 -0.3421 108 THR C N   
4556 C CA  . THR C 63  ? 0.9433 0.9666 1.3476 -0.1847 -0.0236 -0.3577 108 THR C CA  
4557 C C   . THR C 63  ? 0.9712 0.9590 1.3958 -0.1948 0.0087  -0.3481 108 THR C C   
4558 O O   . THR C 63  ? 1.0024 0.9522 1.3921 -0.1852 0.0253  -0.3385 108 THR C O   
4559 C CB  . THR C 63  ? 0.9722 0.9965 1.3726 -0.1971 -0.0487 -0.3895 108 THR C CB  
4560 O OG1 . THR C 63  ? 0.9983 1.0447 1.3620 -0.1848 -0.0782 -0.3976 108 THR C OG1 
4561 C CG2 . THR C 63  ? 1.0069 1.0587 1.4655 -0.2151 -0.0553 -0.3964 108 THR C CG2 
4569 N N   . GLY C 64  ? 1.0115 1.0130 1.4946 -0.2137 0.0178  -0.3494 109 GLY C N   
4570 C CA  . GLY C 64  ? 1.0308 0.9981 1.5323 -0.2237 0.0482  -0.3364 109 GLY C CA  
4571 C C   . GLY C 64  ? 1.0097 0.9701 1.5016 -0.2112 0.0737  -0.3038 109 GLY C C   
4572 O O   . GLY C 64  ? 0.9670 0.9579 1.4506 -0.1973 0.0700  -0.2895 109 GLY C O   
4576 N N   . HIS C 65  ? 0.9849 0.9024 1.4736 -0.2145 0.0995  -0.2903 110 HIS C N   
4577 C CA  . HIS C 65  ? 0.9574 0.8635 1.4305 -0.2024 0.1239  -0.2568 110 HIS C CA  
4578 C C   . HIS C 65  ? 0.9067 0.7890 1.3234 -0.1791 0.1223  -0.2468 110 HIS C C   
4579 O O   . HIS C 65  ? 0.9155 0.7563 1.3173 -0.1753 0.1358  -0.2399 110 HIS C O   
4580 C CB  . HIS C 65  ? 1.0106 0.8849 1.5135 -0.2192 0.1516  -0.2450 110 HIS C CB  
4581 C CG  . HIS C 65  ? 1.0260 0.8925 1.5149 -0.2098 0.1764  -0.2101 110 HIS C CG  
4582 N ND1 . HIS C 65  ? 1.0522 0.8822 1.5009 -0.1931 0.1875  -0.1890 110 HIS C ND1 
4583 C CD2 . HIS C 65  ? 1.0281 0.9190 1.5372 -0.2148 0.1922  -0.1934 110 HIS C CD2 
4584 C CE1 . HIS C 65  ? 1.0484 0.8805 1.4892 -0.1886 0.2066  -0.1604 110 HIS C CE1 
4585 N NE2 . HIS C 65  ? 1.0437 0.9110 1.5185 -0.2017 0.2114  -0.1629 110 HIS C NE2 
4593 N N   . SER C 66  ? 0.7940 0.7039 1.1822 -0.1631 0.1058  -0.2456 111 SER C N   
4594 C CA  . SER C 66  ? 0.7611 0.6572 1.1000 -0.1432 0.1009  -0.2407 111 SER C CA  
4595 C C   . SER C 66  ? 0.7387 0.6500 1.0542 -0.1268 0.1060  -0.2153 111 SER C C   
4596 O O   . SER C 66  ? 0.7165 0.6585 1.0450 -0.1272 0.1029  -0.2100 111 SER C O   
4597 C CB  . SER C 66  ? 0.7422 0.6524 1.0609 -0.1402 0.0752  -0.2646 111 SER C CB  
4598 O OG  . SER C 66  ? 0.7640 0.6611 1.1005 -0.1563 0.0677  -0.2919 111 SER C OG  
4604 N N   . ASP C 67  ? 0.7930 0.6836 1.0758 -0.1120 0.1133  -0.2015 112 ASP C N   
4605 C CA  . ASP C 67  ? 0.7922 0.6936 1.0519 -0.0980 0.1180  -0.1784 112 ASP C CA  
4606 C C   . ASP C 67  ? 0.7551 0.6519 0.9780 -0.0822 0.1109  -0.1773 112 ASP C C   
4607 O O   . ASP C 67  ? 0.7826 0.6555 0.9975 -0.0784 0.1144  -0.1833 112 ASP C O   
4608 C CB  . ASP C 67  ? 0.8608 0.7431 1.1245 -0.0976 0.1395  -0.1544 112 ASP C CB  
4609 C CG  . ASP C 67  ? 0.9338 0.8171 1.2342 -0.1150 0.1522  -0.1531 112 ASP C CG  
4610 O OD1 . ASP C 67  ? 0.9430 0.8539 1.2676 -0.1246 0.1444  -0.1664 112 ASP C OD1 
4611 O OD2 . ASP C 67  ? 0.9802 0.8369 1.2868 -0.1188 0.1707  -0.1375 112 ASP C OD2 
4616 N N   . PHE C 68  ? 0.6751 0.5942 0.8782 -0.0733 0.1024  -0.1704 113 PHE C N   
4617 C CA  . PHE C 68  ? 0.6233 0.5411 0.7953 -0.0595 0.1004  -0.1626 113 PHE C CA  
4618 C C   . PHE C 68  ? 0.5824 0.5012 0.7473 -0.0526 0.1105  -0.1389 113 PHE C C   
4619 O O   . PHE C 68  ? 0.5842 0.5164 0.7547 -0.0558 0.1125  -0.1310 113 PHE C O   
4620 C CB  . PHE C 68  ? 0.6332 0.5714 0.7855 -0.0554 0.0844  -0.1694 113 PHE C CB  
4621 C CG  . PHE C 68  ? 0.6402 0.5774 0.7862 -0.0591 0.0718  -0.1910 113 PHE C CG  
4622 C CD1 . PHE C 68  ? 0.6729 0.5888 0.8210 -0.0623 0.0762  -0.2050 113 PHE C CD1 
4623 C CD2 . PHE C 68  ? 0.6456 0.6015 0.7804 -0.0583 0.0549  -0.1975 113 PHE C CD2 
4624 C CE1 . PHE C 68  ? 0.7024 0.6174 0.8387 -0.0662 0.0637  -0.2271 113 PHE C CE1 
4625 C CE2 . PHE C 68  ? 0.6763 0.6321 0.7989 -0.0612 0.0411  -0.2164 113 PHE C CE2 
4626 C CZ  . PHE C 68  ? 0.6905 0.6266 0.8121 -0.0657 0.0454  -0.2322 113 PHE C CZ  
4636 N N   . HIS C 69  ? 0.5797 0.4859 0.7327 -0.0426 0.1164  -0.1285 114 HIS C N   
4637 C CA  . HIS C 69  ? 0.5592 0.4691 0.7015 -0.0348 0.1216  -0.1066 114 HIS C CA  
4638 C C   . HIS C 69  ? 0.5329 0.4546 0.6559 -0.0244 0.1147  -0.1041 114 HIS C C   
4639 O O   . HIS C 69  ? 0.5594 0.4756 0.6799 -0.0197 0.1140  -0.1136 114 HIS C O   
4640 C CB  . HIS C 69  ? 0.6008 0.4868 0.7515 -0.0313 0.1346  -0.0918 114 HIS C CB  
4641 C CG  . HIS C 69  ? 0.6374 0.5032 0.8113 -0.0431 0.1441  -0.0974 114 HIS C CG  
4642 N ND1 . HIS C 69  ? 0.6484 0.5070 0.8303 -0.0496 0.1559  -0.0823 114 HIS C ND1 
4643 C CD2 . HIS C 69  ? 0.6590 0.5095 0.8497 -0.0510 0.1443  -0.1170 114 HIS C CD2 
4644 C CE1 . HIS C 69  ? 0.6823 0.5225 0.8891 -0.0620 0.1638  -0.0914 114 HIS C CE1 
4645 N NE2 . HIS C 69  ? 0.6768 0.5117 0.8899 -0.0633 0.1557  -0.1136 114 HIS C NE2 
4653 N N   . LEU C 70  ? 0.5494 0.4874 0.6593 -0.0217 0.1108  -0.0926 115 LEU C N   
4654 C CA  . LEU C 70  ? 0.5321 0.4841 0.6278 -0.0147 0.1045  -0.0891 115 LEU C CA  
4655 C C   . LEU C 70  ? 0.5335 0.4926 0.6221 -0.0100 0.1050  -0.0705 115 LEU C C   
4656 O O   . LEU C 70  ? 0.5399 0.5070 0.6189 -0.0144 0.1027  -0.0665 115 LEU C O   
4657 C CB  . LEU C 70  ? 0.5108 0.4764 0.5951 -0.0193 0.0950  -0.0986 115 LEU C CB  
4658 C CG  . LEU C 70  ? 0.4961 0.4751 0.5672 -0.0157 0.0900  -0.0950 115 LEU C CG  
4659 C CD1 . LEU C 70  ? 0.5094 0.4864 0.5828 -0.0096 0.0944  -0.0989 115 LEU C CD1 
4660 C CD2 . LEU C 70  ? 0.4953 0.4809 0.5544 -0.0207 0.0816  -0.1018 115 LEU C CD2 
4672 N N   . PHE C 71  ? 0.5350 0.4914 0.6281 -0.0002 0.1074  -0.0600 116 PHE C N   
4673 C CA  . PHE C 71  ? 0.5449 0.5079 0.6311 0.0059  0.1053  -0.0409 116 PHE C CA  
4674 C C   . PHE C 71  ? 0.5248 0.5069 0.6141 0.0147  0.0984  -0.0366 116 PHE C C   
4675 O O   . PHE C 71  ? 0.5064 0.4912 0.6064 0.0184  0.1006  -0.0459 116 PHE C O   
4676 C CB  . PHE C 71  ? 0.5666 0.5072 0.6601 0.0114  0.1144  -0.0268 116 PHE C CB  
4677 C CG  . PHE C 71  ? 0.5839 0.5111 0.6737 0.0014  0.1226  -0.0247 116 PHE C CG  
4678 C CD1 . PHE C 71  ? 0.5810 0.5007 0.6830 -0.0091 0.1273  -0.0415 116 PHE C CD1 
4679 C CD2 . PHE C 71  ? 0.6019 0.5266 0.6761 0.0022  0.1256  -0.0060 116 PHE C CD2 
4680 C CE1 . PHE C 71  ? 0.5930 0.5056 0.6985 -0.0192 0.1362  -0.0400 116 PHE C CE1 
4681 C CE2 . PHE C 71  ? 0.6056 0.5199 0.6775 -0.0077 0.1369  -0.0038 116 PHE C CE2 
4682 C CZ  . PHE C 71  ? 0.6010 0.5105 0.6920 -0.0187 0.1429  -0.0210 116 PHE C CZ  
4692 N N   . LYS C 72  ? 0.5248 0.5221 0.6048 0.0176  0.0904  -0.0230 117 LYS C N   
4693 C CA  . LYS C 72  ? 0.5237 0.5441 0.6135 0.0255  0.0826  -0.0176 117 LYS C CA  
4694 C C   . LYS C 72  ? 0.5232 0.5357 0.6354 0.0406  0.0890  -0.0112 117 LYS C C   
4695 O O   . LYS C 72  ? 0.5243 0.5124 0.6388 0.0463  0.0960  -0.0026 117 LYS C O   
4696 C CB  . LYS C 72  ? 0.5435 0.5812 0.6190 0.0259  0.0702  -0.0043 117 LYS C CB  
4697 C CG  . LYS C 72  ? 0.5288 0.5751 0.5837 0.0120  0.0639  -0.0137 117 LYS C CG  
4698 C CD  . LYS C 72  ? 0.5642 0.6255 0.6009 0.0119  0.0512  -0.0031 117 LYS C CD  
4699 C CE  . LYS C 72  ? 0.5598 0.6263 0.5765 -0.0015 0.0459  -0.0153 117 LYS C CE  
4700 N NZ  . LYS C 72  ? 0.5930 0.6687 0.5841 -0.0025 0.0348  -0.0075 117 LYS C NZ  
4714 N N   . GLU C 73  ? 0.5363 0.5681 0.6669 0.0468  0.0885  -0.0157 118 GLU C N   
4715 C CA  . GLU C 73  ? 0.5746 0.6021 0.7302 0.0638  0.0954  -0.0108 118 GLU C CA  
4716 C C   . GLU C 73  ? 0.6009 0.6245 0.7593 0.0767  0.0891  0.0123  118 GLU C C   
4717 O O   . GLU C 73  ? 0.5934 0.6365 0.7399 0.0750  0.0752  0.0244  118 GLU C O   
4718 C CB  . GLU C 73  ? 0.5694 0.6285 0.7466 0.0690  0.0951  -0.0160 118 GLU C CB  
4719 C CG  . GLU C 73  ? 0.6048 0.6602 0.8114 0.0880  0.1059  -0.0154 118 GLU C CG  
4720 C CD  . GLU C 73  ? 0.5908 0.6824 0.8229 0.0929  0.1088  -0.0207 118 GLU C CD  
4721 O OE1 . GLU C 73  ? 0.5699 0.6919 0.7999 0.0816  0.0993  -0.0204 118 GLU C OE1 
4722 O OE2 . GLU C 73  ? 0.6105 0.6994 0.8662 0.1076  0.1220  -0.0259 118 GLU C OE2 
4729 N N   . GLY C 74  ? 0.5851 0.5802 0.7559 0.0892  0.0991  0.0183  119 GLY C N   
4730 C CA  . GLY C 74  ? 0.6163 0.6014 0.7891 0.1038  0.0945  0.0433  119 GLY C CA  
4731 C C   . GLY C 74  ? 0.6234 0.5801 0.7692 0.0953  0.0970  0.0550  119 GLY C C   
4732 O O   . GLY C 74  ? 0.6542 0.5915 0.7986 0.1074  0.0974  0.0772  119 GLY C O   
4736 N N   . ILE C 75  ? 0.6262 0.5797 0.7517 0.0759  0.0997  0.0420  120 ILE C N   
4737 C CA  . ILE C 75  ? 0.6553 0.5858 0.7585 0.0662  0.1056  0.0510  120 ILE C CA  
4738 C C   . ILE C 75  ? 0.6872 0.5828 0.8032 0.0597  0.1223  0.0394  120 ILE C C   
4739 O O   . ILE C 75  ? 0.6812 0.5788 0.8057 0.0507  0.1257  0.0158  120 ILE C O   
4740 C CB  . ILE C 75  ? 0.6413 0.5908 0.7193 0.0501  0.0996  0.0429  120 ILE C CB  
4741 C CG1 . ILE C 75  ? 0.6292 0.6092 0.6920 0.0551  0.0821  0.0543  120 ILE C CG1 
4742 C CG2 . ILE C 75  ? 0.6507 0.5773 0.7112 0.0393  0.1110  0.0482  120 ILE C CG2 
4743 C CD1 . ILE C 75  ? 0.6172 0.6110 0.6518 0.0408  0.0766  0.0471  120 ILE C CD1 
4755 N N   . LYS C 76  ? 0.7926 0.6554 0.9089 0.0635  0.1321  0.0564  121 LYS C N   
4756 C CA  . LYS C 76  ? 0.8325 0.6592 0.9639 0.0553  0.1480  0.0461  121 LYS C CA  
4757 C C   . LYS C 76  ? 0.8136 0.6393 0.9340 0.0340  0.1541  0.0377  121 LYS C C   
4758 O O   . LYS C 76  ? 0.8231 0.6525 0.9221 0.0298  0.1551  0.0541  121 LYS C O   
4759 C CB  . LYS C 76  ? 0.8819 0.6702 1.0205 0.0669  0.1575  0.0692  121 LYS C CB  
4760 C CG  . LYS C 76  ? 0.9333 0.7228 1.0882 0.0916  0.1516  0.0793  121 LYS C CG  
4761 C CD  . LYS C 76  ? 0.9934 0.7381 1.1569 0.1047  0.1617  0.1029  121 LYS C CD  
4762 C CE  . LYS C 76  ? 1.0052 0.7511 1.1920 0.1321  0.1567  0.1109  121 LYS C CE  
4763 N NZ  . LYS C 76  ? 1.0704 0.7666 1.2669 0.1469  0.1669  0.1350  121 LYS C NZ  
4777 N N   . PRO C 77  ? 0.6885 0.5105 0.8228 0.0211  0.1585  0.0126  122 PRO C N   
4778 C CA  . PRO C 77  ? 0.6314 0.4626 0.7607 0.0027  0.1615  0.0028  122 PRO C CA  
4779 C C   . PRO C 77  ? 0.7921 0.5944 0.9317 -0.0089 0.1780  0.0102  122 PRO C C   
4780 O O   . PRO C 77  ? 0.7125 0.5199 0.8624 -0.0252 0.1829  -0.0036 122 PRO C O   
4781 C CB  . PRO C 77  ? 0.6003 0.4435 0.7413 -0.0040 0.1554  -0.0266 122 PRO C CB  
4782 C CG  . PRO C 77  ? 0.5931 0.4125 0.7504 0.0044  0.1596  -0.0336 122 PRO C CG  
4783 C CD  . PRO C 77  ? 0.6225 0.4344 0.7767 0.0231  0.1600  -0.0096 122 PRO C CD  
4791 N N   . MET C 78  ? 1.0745 0.8468 1.2141 -0.0006 0.1868  0.0329  123 MET C N   
4792 C CA  . MET C 78  ? 1.1996 0.9398 1.3485 -0.0125 0.2051  0.0438  123 MET C CA  
4793 C C   . MET C 78  ? 1.1637 0.9125 1.2854 -0.0162 0.2114  0.0671  123 MET C C   
4794 O O   . MET C 78  ? 1.1749 0.9311 1.2687 -0.0019 0.2039  0.0884  123 MET C O   
4795 C CB  . MET C 78  ? 1.2495 0.9462 1.4106 -0.0016 0.2134  0.0584  123 MET C CB  
4796 C CG  . MET C 78  ? 1.3457 1.0241 1.5353 -0.0025 0.2138  0.0317  123 MET C CG  
4797 S SD  . MET C 78  ? 1.3654 1.0599 1.5540 0.0221  0.1989  0.0236  123 MET C SD  
4798 C CE  . MET C 78  ? 1.4209 1.0816 1.6086 0.0459  0.2042  0.0597  123 MET C CE  
4808 N N   . TRP C 79  ? 1.0848 0.8346 1.2150 -0.0354 0.2253  0.0618  124 TRP C N   
4809 C CA  . TRP C 79  ? 1.0504 0.8091 1.1537 -0.0404 0.2355  0.0806  124 TRP C CA  
4810 C C   . TRP C 79  ? 1.0784 0.8019 1.1625 -0.0347 0.2489  0.1160  124 TRP C C   
4811 O O   . TRP C 79  ? 1.0706 0.8011 1.1174 -0.0313 0.2522  0.1369  124 TRP C O   
4812 C CB  . TRP C 79  ? 1.0462 0.8171 1.1714 -0.0620 0.2496  0.0647  124 TRP C CB  
4813 C CG  . TRP C 79  ? 1.0531 0.8373 1.1517 -0.0674 0.2632  0.0792  124 TRP C CG  
4814 C CD1 . TRP C 79  ? 1.1061 0.8733 1.2061 -0.0804 0.2890  0.0958  124 TRP C CD1 
4815 C CD2 . TRP C 79  ? 1.0512 0.8665 1.1162 -0.0605 0.2539  0.0773  124 TRP C CD2 
4816 N NE1 . TRP C 79  ? 1.1276 0.9151 1.1945 -0.0810 0.2972  0.1040  124 TRP C NE1 
4817 C CE2 . TRP C 79  ? 1.0883 0.9043 1.1330 -0.0687 0.2751  0.0917  124 TRP C CE2 
4818 C CE3 . TRP C 79  ? 1.0217 0.8627 1.0719 -0.0494 0.2310  0.0642  124 TRP C CE3 
4819 C CZ2 . TRP C 79  ? 1.0949 0.9353 1.1031 -0.0650 0.2735  0.0910  124 TRP C CZ2 
4820 C CZ3 . TRP C 79  ? 1.0237 0.8876 1.0408 -0.0471 0.2283  0.0643  124 TRP C CZ3 
4821 C CH2 . TRP C 79  ? 1.0613 0.9241 1.0566 -0.0543 0.2490  0.0764  124 TRP C CH2 
4832 N N   . GLU C 80  ? 1.1910 0.8746 1.2970 -0.0330 0.2566  0.1232  125 GLU C N   
4833 C CA  . GLU C 80  ? 1.2945 0.9375 1.3845 -0.0268 0.2702  0.1592  125 GLU C CA  
4834 C C   . GLU C 80  ? 1.3156 0.9469 1.3916 0.0003  0.2542  0.1779  125 GLU C C   
4835 O O   . GLU C 80  ? 1.3733 0.9659 1.4398 0.0096  0.2626  0.2088  125 GLU C O   
4836 C CB  . GLU C 80  ? 1.3690 0.9687 1.4950 -0.0432 0.2916  0.1578  125 GLU C CB  
4837 C CG  . GLU C 80  ? 1.4185 1.0244 1.5572 -0.0702 0.3136  0.1530  125 GLU C CG  
4838 C CD  . GLU C 80  ? 1.3832 1.0319 1.5483 -0.0839 0.3054  0.1144  125 GLU C CD  
4839 O OE1 . GLU C 80  ? 1.3466 1.0105 1.5236 -0.0759 0.2851  0.0898  125 GLU C OE1 
4840 O OE2 . GLU C 80  ? 1.3839 1.0515 1.5580 -0.1020 0.3200  0.1097  125 GLU C OE2 
4847 N N   . ASP C 81  ? 1.2150 0.8792 1.2914 0.0135  0.2319  0.1613  126 ASP C N   
4848 C CA  . ASP C 81  ? 1.2227 0.8837 1.2941 0.0396  0.2163  0.1769  126 ASP C CA  
4849 C C   . ASP C 81  ? 1.2463 0.9241 1.2731 0.0516  0.2056  0.2065  126 ASP C C   
4850 O O   . ASP C 81  ? 1.2251 0.9327 1.2243 0.0419  0.2028  0.2025  126 ASP C O   
4851 C CB  . ASP C 81  ? 1.1759 0.8686 1.2672 0.0473  0.1988  0.1479  126 ASP C CB  
4852 C CG  . ASP C 81  ? 1.1988 0.8802 1.3054 0.0728  0.1898  0.1573  126 ASP C CG  
4853 O OD1 . ASP C 81  ? 1.1962 0.9027 1.2871 0.0903  0.1728  0.1731  126 ASP C OD1 
4854 O OD2 . ASP C 81  ? 1.2155 0.8639 1.3518 0.0753  0.1995  0.1474  126 ASP C OD2 
4859 N N   . ASP C 82  ? 1.2977 0.9557 1.3175 0.0740  0.1987  0.2355  127 ASP C N   
4860 C CA  . ASP C 82  ? 1.3416 1.0124 1.3162 0.0868  0.1861  0.2668  127 ASP C CA  
4861 C C   . ASP C 82  ? 1.2895 1.0165 1.2483 0.0896  0.1620  0.2509  127 ASP C C   
4862 O O   . ASP C 82  ? 1.3103 1.0557 1.2251 0.0897  0.1536  0.2653  127 ASP C O   
4863 C CB  . ASP C 82  ? 1.4018 1.0447 1.3800 0.1140  0.1786  0.2990  127 ASP C CB  
4864 C CG  . ASP C 82  ? 1.4600 1.1054 1.3865 0.1264  0.1678  0.3377  127 ASP C CG  
4865 O OD1 . ASP C 82  ? 1.4949 1.1304 1.3821 0.1111  0.1820  0.3506  127 ASP C OD1 
4866 O OD2 . ASP C 82  ? 1.4828 1.1416 1.4077 0.1517  0.1450  0.3552  127 ASP C OD2 
4871 N N   . ALA C 83  ? 1.2529 1.0061 1.2450 0.0909  0.1516  0.2211  128 ALA C N   
4872 C CA  . ALA C 83  ? 1.1956 0.9992 1.1775 0.0927  0.1294  0.2067  128 ALA C CA  
4873 C C   . ALA C 83  ? 1.1739 0.9969 1.1249 0.0724  0.1331  0.1938  128 ALA C C   
4874 O O   . ALA C 83  ? 1.1938 1.0448 1.1119 0.0741  0.1176  0.1981  128 ALA C O   
4875 C CB  . ALA C 83  ? 1.1448 0.9676 1.1683 0.0951  0.1232  0.1775  128 ALA C CB  
4881 N N   . ASN C 84  ? 1.2147 1.0241 1.1776 0.0535  0.1530  0.1764  129 ASN C N   
4882 C CA  . ASN C 84  ? 1.1887 1.0159 1.1303 0.0358  0.1593  0.1619  129 ASN C CA  
4883 C C   . ASN C 84  ? 1.2166 1.0252 1.1200 0.0296  0.1758  0.1855  129 ASN C C   
4884 O O   . ASN C 84  ? 1.2069 1.0194 1.1039 0.0131  0.1918  0.1739  129 ASN C O   
4885 C CB  . ASN C 84  ? 1.1643 0.9912 1.1409 0.0197  0.1712  0.1321  129 ASN C CB  
4886 C CG  . ASN C 84  ? 1.1436 0.9865 1.1515 0.0248  0.1573  0.1090  129 ASN C CG  
4887 O OD1 . ASN C 84  ? 1.1077 0.9819 1.1099 0.0246  0.1428  0.0940  129 ASN C OD1 
4888 N ND2 . ASN C 84  ? 1.1459 0.9650 1.1857 0.0284  0.1635  0.1054  129 ASN C ND2 
4895 N N   . LYS C 85  ? 1.1894 0.9790 1.0670 0.0434  0.1730  0.2191  130 LYS C N   
4896 C CA  . LYS C 85  ? 1.2097 0.9737 1.0502 0.0374  0.1930  0.2457  130 LYS C CA  
4897 C C   . LYS C 85  ? 1.1758 0.9648 0.9710 0.0273  0.1952  0.2389  130 LYS C C   
4898 O O   . LYS C 85  ? 1.1889 0.9650 0.9667 0.0135  0.2205  0.2444  130 LYS C O   
4899 C CB  . LYS C 85  ? 1.2692 1.0094 1.0853 0.0575  0.1848  0.2854  130 LYS C CB  
4900 C CG  . LYS C 85  ? 1.3427 1.0466 1.1213 0.0522  0.2086  0.3184  130 LYS C CG  
4901 C CD  . LYS C 85  ? 1.4100 1.0803 1.1760 0.0738  0.2018  0.3592  130 LYS C CD  
4902 C CE  . LYS C 85  ? 1.5010 1.1297 1.2278 0.0673  0.2283  0.3951  130 LYS C CE  
4903 N NZ  . LYS C 85  ? 1.5707 1.1611 1.2852 0.0899  0.2217  0.4379  130 LYS C NZ  
4917 N N   . ASN C 86  ? 1.1341 0.9586 0.9114 0.0332  0.1704  0.2258  131 ASN C N   
4918 C CA  . ASN C 86  ? 1.1240 0.9706 0.8562 0.0249  0.1701  0.2160  131 ASN C CA  
4919 C C   . ASN C 86  ? 1.0324 0.9036 0.7902 0.0119  0.1715  0.1772  131 ASN C C   
4920 O O   . ASN C 86  ? 1.0304 0.9223 0.7570 0.0072  0.1665  0.1631  131 ASN C O   
4921 C CB  . ASN C 86  ? 1.1580 1.0259 0.8487 0.0385  0.1402  0.2270  131 ASN C CB  
4922 C CG  . ASN C 86  ? 1.2376 1.0826 0.8942 0.0532  0.1367  0.2685  131 ASN C CG  
4923 O OD1 . ASN C 86  ? 1.3007 1.1360 0.9001 0.0512  0.1455  0.2873  131 ASN C OD1 
4924 N ND2 . ASN C 86  ? 1.2385 1.0735 0.9287 0.0693  0.1244  0.2836  131 ASN C ND2 
4931 N N   . GLY C 87  ? 0.9226 0.7899 0.7346 0.0066  0.1778  0.1597  132 GLY C N   
4932 C CA  . GLY C 87  ? 0.8298 0.7195 0.6675 -0.0027 0.1753  0.1258  132 GLY C CA  
4933 C C   . GLY C 87  ? 0.7970 0.6845 0.6416 -0.0180 0.2009  0.1133  132 GLY C C   
4934 O O   . GLY C 87  ? 0.8300 0.6998 0.6607 -0.0238 0.2238  0.1299  132 GLY C O   
4938 N N   . GLY C 88  ? 0.7570 0.6642 0.6255 -0.0242 0.1971  0.0841  133 GLY C N   
4939 C CA  . GLY C 88  ? 0.7421 0.6545 0.6278 -0.0365 0.2180  0.0682  133 GLY C CA  
4940 C C   . GLY C 88  ? 0.6918 0.6209 0.6163 -0.0389 0.2068  0.0399  133 GLY C C   
4941 O O   . GLY C 88  ? 0.6663 0.6027 0.5965 -0.0322 0.1851  0.0328  133 GLY C O   
4945 N N   . LYS C 89  ? 0.6576 0.5941 0.6096 -0.0483 0.2222  0.0247  134 LYS C N   
4946 C CA  . LYS C 89  ? 0.6155 0.5670 0.6038 -0.0498 0.2114  -0.0001 134 LYS C CA  
4947 C C   . LYS C 89  ? 0.6060 0.5733 0.6084 -0.0559 0.2262  -0.0161 134 LYS C C   
4948 O O   . LYS C 89  ? 0.6110 0.5766 0.6199 -0.0633 0.2501  -0.0097 134 LYS C O   
4949 C CB  . LYS C 89  ? 0.6010 0.5430 0.6316 -0.0534 0.2090  -0.0028 134 LYS C CB  
4950 C CG  . LYS C 89  ? 0.6587 0.5918 0.7178 -0.0654 0.2324  0.0018  134 LYS C CG  
4951 C CD  . LYS C 89  ? 0.6527 0.5721 0.7495 -0.0698 0.2283  -0.0023 134 LYS C CD  
4952 C CE  . LYS C 89  ? 0.7016 0.6103 0.8287 -0.0845 0.2515  0.0026  134 LYS C CE  
4953 N NZ  . LYS C 89  ? 0.6996 0.5880 0.8588 -0.0898 0.2480  -0.0014 134 LYS C NZ  
4967 N N   . TRP C 90  ? 0.5582 0.5404 0.5675 -0.0523 0.2130  -0.0361 135 TRP C N   
4968 C CA  . TRP C 90  ? 0.5476 0.5462 0.5836 -0.0550 0.2234  -0.0537 135 TRP C CA  
4969 C C   . TRP C 90  ? 0.5304 0.5359 0.6194 -0.0600 0.2196  -0.0632 135 TRP C C   
4970 O O   . TRP C 90  ? 0.4996 0.4997 0.5981 -0.0582 0.2013  -0.0654 135 TRP C O   
4971 C CB  . TRP C 90  ? 0.5351 0.5421 0.5561 -0.0478 0.2104  -0.0700 135 TRP C CB  
4972 C CG  . TRP C 90  ? 0.5685 0.5731 0.5434 -0.0454 0.2196  -0.0689 135 TRP C CG  
4973 C CD1 . TRP C 90  ? 0.5825 0.5800 0.5133 -0.0418 0.2057  -0.0648 135 TRP C CD1 
4974 C CD2 . TRP C 90  ? 0.5963 0.6072 0.5645 -0.0469 0.2448  -0.0736 135 TRP C CD2 
4975 N NE1 . TRP C 90  ? 0.6199 0.6167 0.5123 -0.0415 0.2191  -0.0678 135 TRP C NE1 
4976 C CE2 . TRP C 90  ? 0.6296 0.6337 0.5427 -0.0440 0.2448  -0.0731 135 TRP C CE2 
4977 C CE3 . TRP C 90  ? 0.5985 0.6226 0.6036 -0.0508 0.2679  -0.0793 135 TRP C CE3 
4978 C CZ2 . TRP C 90  ? 0.6677 0.6743 0.5561 -0.0441 0.2687  -0.0787 135 TRP C CZ2 
4979 C CZ3 . TRP C 90  ? 0.6333 0.6625 0.6194 -0.0507 0.2933  -0.0835 135 TRP C CZ3 
4980 C CH2 . TRP C 90  ? 0.6688 0.6878 0.5942 -0.0470 0.2943  -0.0835 135 TRP C CH2 
4991 N N   . ILE C 91  ? 0.6058 0.6251 0.7294 -0.0667 0.2373  -0.0699 136 ILE C N   
4992 C CA  . ILE C 91  ? 0.6384 0.6673 0.8150 -0.0741 0.2346  -0.0791 136 ILE C CA  
4993 C C   . ILE C 91  ? 0.5826 0.6386 0.7936 -0.0712 0.2336  -0.0982 136 ILE C C   
4994 O O   . ILE C 91  ? 0.5952 0.6628 0.8033 -0.0688 0.2511  -0.1011 136 ILE C O   
4995 C CB  . ILE C 91  ? 0.7445 0.7662 0.9424 -0.0878 0.2574  -0.0673 136 ILE C CB  
4996 C CG1 . ILE C 91  ? 0.7871 0.7781 0.9502 -0.0878 0.2584  -0.0456 136 ILE C CG1 
4997 C CG2 . ILE C 91  ? 0.7309 0.7636 0.9861 -0.0979 0.2520  -0.0803 136 ILE C CG2 
4998 C CD1 . ILE C 91  ? 0.8659 0.8434 1.0356 -0.0999 0.2859  -0.0282 136 ILE C CD1 
5010 N N   . ILE C 92  ? 0.5394 0.6055 0.7822 -0.0702 0.2133  -0.1112 137 ILE C N   
5011 C CA  . ILE C 92  ? 0.5278 0.6213 0.8104 -0.0659 0.2082  -0.1278 137 ILE C CA  
5012 C C   . ILE C 92  ? 0.5095 0.6164 0.8424 -0.0763 0.2008  -0.1357 137 ILE C C   
5013 O O   . ILE C 92  ? 0.4786 0.5751 0.8078 -0.0773 0.1801  -0.1386 137 ILE C O   
5014 C CB  . ILE C 92  ? 0.5178 0.6103 0.7827 -0.0519 0.1850  -0.1362 137 ILE C CB  
5015 C CG1 . ILE C 92  ? 0.5505 0.6247 0.7620 -0.0449 0.1884  -0.1293 137 ILE C CG1 
5016 C CG2 . ILE C 92  ? 0.5204 0.6398 0.8256 -0.0442 0.1827  -0.1505 137 ILE C CG2 
5017 C CD1 . ILE C 92  ? 0.5463 0.6133 0.7383 -0.0341 0.1664  -0.1356 137 ILE C CD1 
5029 N N   . ARG C 93  ? 0.5118 0.6423 0.8916 -0.0850 0.2184  -0.1403 138 ARG C N   
5030 C CA  . ARG C 93  ? 0.5171 0.6658 0.9523 -0.0974 0.2115  -0.1507 138 ARG C CA  
5031 C C   . ARG C 93  ? 0.4964 0.6785 0.9697 -0.0876 0.1916  -0.1676 138 ARG C C   
5032 O O   . ARG C 93  ? 0.4915 0.6984 0.9889 -0.0805 0.2036  -0.1722 138 ARG C O   
5033 C CB  . ARG C 93  ? 0.5664 0.7247 1.0373 -0.1144 0.2423  -0.1454 138 ARG C CB  
5034 C CG  . ARG C 93  ? 0.6178 0.7400 1.0476 -0.1222 0.2629  -0.1246 138 ARG C CG  
5035 C CD  . ARG C 93  ? 0.6960 0.8245 1.1571 -0.1397 0.2970  -0.1162 138 ARG C CD  
5036 N NE  . ARG C 93  ? 0.7380 0.8782 1.2594 -0.1581 0.2938  -0.1264 138 ARG C NE  
5037 C CZ  . ARG C 93  ? 0.8092 0.9596 1.3739 -0.1775 0.3212  -0.1227 138 ARG C CZ  
5038 N NH1 . ARG C 93  ? 0.8481 0.9979 1.3989 -0.1799 0.3559  -0.1073 138 ARG C NH1 
5039 N NH2 . ARG C 93  ? 0.8178 0.9788 1.4390 -0.1958 0.3145  -0.1349 138 ARG C NH2 
5053 N N   . LEU C 94  ? 0.5322 0.7141 1.0093 -0.0862 0.1617  -0.1765 139 LEU C N   
5054 C CA  . LEU C 94  ? 0.5299 0.7360 1.0276 -0.0731 0.1366  -0.1886 139 LEU C CA  
5055 C C   . LEU C 94  ? 0.5610 0.7972 1.1163 -0.0835 0.1204  -0.2032 139 LEU C C   
5056 O O   . LEU C 94  ? 0.5964 0.8239 1.1615 -0.1008 0.1200  -0.2061 139 LEU C O   
5057 C CB  . LEU C 94  ? 0.5202 0.7012 0.9659 -0.0611 0.1123  -0.1860 139 LEU C CB  
5058 C CG  . LEU C 94  ? 0.4919 0.6459 0.8834 -0.0518 0.1236  -0.1738 139 LEU C CG  
5059 C CD1 . LEU C 94  ? 0.4907 0.6192 0.8362 -0.0467 0.1034  -0.1701 139 LEU C CD1 
5060 C CD2 . LEU C 94  ? 0.4981 0.6655 0.8967 -0.0370 0.1288  -0.1766 139 LEU C CD2 
5072 N N   . ARG C 95  ? 0.5910 0.8625 1.1859 -0.0725 0.1063  -0.2129 140 ARG C N   
5073 C CA  . ARG C 95  ? 0.6012 0.9042 1.2453 -0.0789 0.0810  -0.2278 140 ARG C CA  
5074 C C   . ARG C 95  ? 0.5428 0.8237 1.1441 -0.0758 0.0489  -0.2308 140 ARG C C   
5075 O O   . ARG C 95  ? 0.5272 0.7770 1.0702 -0.0639 0.0445  -0.2214 140 ARG C O   
5076 C CB  . ARG C 95  ? 0.6642 1.0116 1.3600 -0.0637 0.0712  -0.2353 140 ARG C CB  
5077 C CG  . ARG C 95  ? 0.7338 1.0681 1.3910 -0.0377 0.0560  -0.2294 140 ARG C CG  
5078 C CD  . ARG C 95  ? 0.8020 1.1772 1.5128 -0.0194 0.0480  -0.2356 140 ARG C CD  
5079 N NE  . ARG C 95  ? 0.8584 1.2661 1.6071 -0.0178 0.0114  -0.2459 140 ARG C NE  
5080 C CZ  . ARG C 95  ? 0.9104 1.3462 1.6899 0.0036  -0.0110 -0.2485 140 ARG C CZ  
5081 N NH1 . ARG C 95  ? 0.9319 1.3981 1.7421 0.0038  -0.0470 -0.2574 140 ARG C NH1 
5082 N NH2 . ARG C 95  ? 0.9260 1.3581 1.7044 0.0255  0.0017  -0.2427 140 ARG C NH2 
5096 N N   . LYS C 96  ? 0.4192 0.7172 1.0500 -0.0877 0.0273  -0.2451 141 LYS C N   
5097 C CA  . LYS C 96  ? 0.4109 0.6890 0.9991 -0.0860 -0.0015 -0.2503 141 LYS C CA  
5098 C C   . LYS C 96  ? 0.4095 0.6899 0.9692 -0.0621 -0.0253 -0.2453 141 LYS C C   
5099 O O   . LYS C 96  ? 0.4052 0.7155 0.9993 -0.0484 -0.0309 -0.2450 141 LYS C O   
5100 C CB  . LYS C 96  ? 0.4261 0.7267 1.0538 -0.1030 -0.0229 -0.2701 141 LYS C CB  
5101 C CG  . LYS C 96  ? 0.4668 0.7522 1.1130 -0.1288 -0.0023 -0.2757 141 LYS C CG  
5102 C CD  . LYS C 96  ? 0.4994 0.7320 1.0807 -0.1305 0.0065  -0.2685 141 LYS C CD  
5103 C CE  . LYS C 96  ? 0.5719 0.7843 1.1712 -0.1547 0.0226  -0.2754 141 LYS C CE  
5104 N NZ  . LYS C 96  ? 0.5872 0.7491 1.1274 -0.1531 0.0308  -0.2683 141 LYS C NZ  
5118 N N   . GLY C 97  ? 0.4163 0.6634 0.9135 -0.0567 -0.0372 -0.2405 142 GLY C N   
5119 C CA  . GLY C 97  ? 0.4230 0.6662 0.8870 -0.0369 -0.0606 -0.2345 142 GLY C CA  
5120 C C   . GLY C 97  ? 0.4143 0.6299 0.8370 -0.0226 -0.0457 -0.2177 142 GLY C C   
5121 O O   . GLY C 97  ? 0.4237 0.6294 0.8154 -0.0073 -0.0627 -0.2106 142 GLY C O   
5125 N N   . LEU C 98  ? 0.4075 0.6094 0.8274 -0.0280 -0.0152 -0.2110 143 LEU C N   
5126 C CA  . LEU C 98  ? 0.4087 0.5848 0.7891 -0.0172 -0.0014 -0.1976 143 LEU C CA  
5127 C C   . LEU C 98  ? 0.4151 0.5567 0.7464 -0.0250 0.0108  -0.1899 143 LEU C C   
5128 O O   . LEU C 98  ? 0.4100 0.5299 0.7036 -0.0172 0.0157  -0.1798 143 LEU C O   
5129 C CB  . LEU C 98  ? 0.4123 0.6011 0.8229 -0.0144 0.0235  -0.1958 143 LEU C CB  
5130 C CG  . LEU C 98  ? 0.4277 0.6560 0.8980 -0.0059 0.0172  -0.2041 143 LEU C CG  
5131 C CD1 . LEU C 98  ? 0.4288 0.6669 0.9234 -0.0043 0.0477  -0.2032 143 LEU C CD1 
5132 C CD2 . LEU C 98  ? 0.4379 0.6673 0.9005 0.0147  -0.0080 -0.2017 143 LEU C CD2 
5144 N N   . ALA C 99  ? 0.4461 0.5820 0.7798 -0.0400 0.0154  -0.1948 144 ALA C N   
5145 C CA  . ALA C 99  ? 0.4556 0.5618 0.7522 -0.0455 0.0303  -0.1864 144 ALA C CA  
5146 C C   . ALA C 99  ? 0.4664 0.5516 0.7141 -0.0383 0.0177  -0.1817 144 ALA C C   
5147 O O   . ALA C 99  ? 0.4732 0.5388 0.6892 -0.0360 0.0286  -0.1712 144 ALA C O   
5148 C CB  . ALA C 99  ? 0.4720 0.5738 0.7859 -0.0616 0.0377  -0.1932 144 ALA C CB  
5154 N N   . SER C 100 ? 0.4966 0.5871 0.7374 -0.0354 -0.0052 -0.1893 145 SER C N   
5155 C CA  . SER C 100 ? 0.5197 0.5906 0.7126 -0.0299 -0.0148 -0.1846 145 SER C CA  
5156 C C   . SER C 100 ? 0.5025 0.5614 0.6705 -0.0196 -0.0097 -0.1705 145 SER C C   
5157 O O   . SER C 100 ? 0.4876 0.5276 0.6250 -0.0204 0.0001  -0.1624 145 SER C O   
5158 C CB  . SER C 100 ? 0.5433 0.6243 0.7305 -0.0267 -0.0414 -0.1936 145 SER C CB  
5159 O OG  . SER C 100 ? 0.5782 0.6648 0.7793 -0.0387 -0.0470 -0.2095 145 SER C OG  
5165 N N   . ARG C 101 ? 0.4505 0.5202 0.6344 -0.0097 -0.0164 -0.1682 146 ARG C N   
5166 C CA  . ARG C 101 ? 0.4500 0.5040 0.6111 -0.0007 -0.0121 -0.1569 146 ARG C CA  
5167 C C   . ARG C 101 ? 0.4652 0.5118 0.6257 -0.0051 0.0107  -0.1526 146 ARG C C   
5168 O O   . ARG C 101 ? 0.4615 0.4899 0.5920 -0.0049 0.0167  -0.1446 146 ARG C O   
5169 C CB  . ARG C 101 ? 0.4394 0.5036 0.6200 0.0129  -0.0244 -0.1564 146 ARG C CB  
5170 C CG  . ARG C 101 ? 0.4533 0.5198 0.6215 0.0201  -0.0504 -0.1557 146 ARG C CG  
5171 C CD  . ARG C 101 ? 0.4806 0.5522 0.6647 0.0370  -0.0636 -0.1512 146 ARG C CD  
5172 N NE  . ARG C 101 ? 0.5233 0.5954 0.6893 0.0450  -0.0906 -0.1473 146 ARG C NE  
5173 C CZ  . ARG C 101 ? 0.5609 0.6063 0.6826 0.0515  -0.0982 -0.1337 146 ARG C CZ  
5174 N NH1 . ARG C 101 ? 0.5958 0.6431 0.6985 0.0591  -0.1232 -0.1293 146 ARG C NH1 
5175 N NH2 . ARG C 101 ? 0.5597 0.5767 0.6549 0.0495  -0.0814 -0.1241 146 ARG C NH2 
5189 N N   . CYS C 102 ? 0.4858 0.5474 0.6785 -0.0099 0.0236  -0.1576 147 CYS C N   
5190 C CA  . CYS C 102 ? 0.4985 0.5529 0.6846 -0.0141 0.0448  -0.1525 147 CYS C CA  
5191 C C   . CYS C 102 ? 0.4961 0.5343 0.6536 -0.0213 0.0503  -0.1460 147 CYS C C   
5192 O O   . CYS C 102 ? 0.5016 0.5288 0.6374 -0.0216 0.0598  -0.1387 147 CYS C O   
5193 C CB  . CYS C 102 ? 0.5091 0.5817 0.7326 -0.0196 0.0596  -0.1573 147 CYS C CB  
5194 S SG  . CYS C 102 ? 0.5280 0.6252 0.7931 -0.0094 0.0587  -0.1652 147 CYS C SG  
5200 N N   . TRP C 103 ? 0.4936 0.5309 0.6522 -0.0266 0.0440  -0.1499 148 TRP C N   
5201 C CA  . TRP C 103 ? 0.4745 0.4971 0.6113 -0.0311 0.0500  -0.1448 148 TRP C CA  
5202 C C   . TRP C 103 ? 0.4971 0.5083 0.6003 -0.0264 0.0441  -0.1384 148 TRP C C   
5203 O O   . TRP C 103 ? 0.4903 0.4938 0.5774 -0.0273 0.0523  -0.1304 148 TRP C O   
5204 C CB  . TRP C 103 ? 0.4645 0.4869 0.6121 -0.0373 0.0454  -0.1540 148 TRP C CB  
5205 C CG  . TRP C 103 ? 0.4524 0.4588 0.5810 -0.0394 0.0514  -0.1512 148 TRP C CG  
5206 C CD1 . TRP C 103 ? 0.4484 0.4473 0.5588 -0.0386 0.0436  -0.1573 148 TRP C CD1 
5207 C CD2 . TRP C 103 ? 0.4316 0.4281 0.5578 -0.0408 0.0667  -0.1415 148 TRP C CD2 
5208 N NE1 . TRP C 103 ? 0.4519 0.4380 0.5534 -0.0389 0.0545  -0.1533 148 TRP C NE1 
5209 C CE2 . TRP C 103 ? 0.4378 0.4222 0.5498 -0.0396 0.0673  -0.1425 148 TRP C CE2 
5210 C CE3 . TRP C 103 ? 0.4241 0.4208 0.5569 -0.0420 0.0799  -0.1314 148 TRP C CE3 
5211 C CZ2 . TRP C 103 ? 0.4475 0.4211 0.5567 -0.0380 0.0791  -0.1331 148 TRP C CZ2 
5212 C CZ3 . TRP C 103 ? 0.4327 0.4174 0.5571 -0.0414 0.0903  -0.1208 148 TRP C CZ3 
5213 C CH2 . TRP C 103 ? 0.4298 0.4037 0.5453 -0.0387 0.0890  -0.1214 148 TRP C CH2 
5224 N N   . GLU C 104 ? 0.5360 0.5469 0.6295 -0.0218 0.0296  -0.1409 149 GLU C N   
5225 C CA  . GLU C 104 ? 0.5474 0.5462 0.6102 -0.0190 0.0261  -0.1334 149 GLU C CA  
5226 C C   . GLU C 104 ? 0.5483 0.5416 0.6053 -0.0174 0.0326  -0.1265 149 GLU C C   
5227 O O   . GLU C 104 ? 0.5603 0.5467 0.6003 -0.0204 0.0381  -0.1200 149 GLU C O   
5228 C CB  . GLU C 104 ? 0.5784 0.5755 0.6296 -0.0137 0.0096  -0.1348 149 GLU C CB  
5229 C CG  . GLU C 104 ? 0.5867 0.5688 0.6046 -0.0125 0.0080  -0.1254 149 GLU C CG  
5230 C CD  . GLU C 104 ? 0.6128 0.5904 0.6134 -0.0067 -0.0082 -0.1238 149 GLU C CD  
5231 O OE1 . GLU C 104 ? 0.6323 0.5995 0.6247 -0.0009 -0.0135 -0.1155 149 GLU C OE1 
5232 O OE2 . GLU C 104 ? 0.6324 0.6151 0.6259 -0.0076 -0.0162 -0.1311 149 GLU C OE2 
5239 N N   . ASN C 105 ? 0.5122 0.5097 0.5851 -0.0126 0.0317  -0.1292 150 ASN C N   
5240 C CA  . ASN C 105 ? 0.5047 0.4943 0.5704 -0.0112 0.0384  -0.1263 150 ASN C CA  
5241 C C   . ASN C 105 ? 0.4881 0.4788 0.5475 -0.0177 0.0512  -0.1234 150 ASN C C   
5242 O O   . ASN C 105 ? 0.4882 0.4707 0.5294 -0.0205 0.0532  -0.1195 150 ASN C O   
5243 C CB  . ASN C 105 ? 0.5034 0.4992 0.5917 -0.0038 0.0392  -0.1325 150 ASN C CB  
5244 C CG  . ASN C 105 ? 0.5295 0.5196 0.6199 0.0061  0.0247  -0.1321 150 ASN C CG  
5245 O OD1 . ASN C 105 ? 0.5257 0.5013 0.5927 0.0064  0.0159  -0.1253 150 ASN C OD1 
5246 N ND2 . ASN C 105 ? 0.5223 0.5242 0.6416 0.0150  0.0228  -0.1381 150 ASN C ND2 
5253 N N   . LEU C 106 ? 0.4319 0.4323 0.5063 -0.0207 0.0590  -0.1246 151 LEU C N   
5254 C CA  . LEU C 106 ? 0.4359 0.4361 0.5021 -0.0249 0.0703  -0.1189 151 LEU C CA  
5255 C C   . LEU C 106 ? 0.4246 0.4203 0.4736 -0.0275 0.0676  -0.1119 151 LEU C C   
5256 O O   . LEU C 106 ? 0.4158 0.4106 0.4505 -0.0293 0.0698  -0.1066 151 LEU C O   
5257 C CB  . LEU C 106 ? 0.4053 0.4125 0.4913 -0.0280 0.0803  -0.1191 151 LEU C CB  
5258 C CG  . LEU C 106 ? 0.4007 0.4048 0.4756 -0.0310 0.0914  -0.1094 151 LEU C CG  
5259 C CD1 . LEU C 106 ? 0.4141 0.4174 0.4694 -0.0302 0.0963  -0.1074 151 LEU C CD1 
5260 C CD2 . LEU C 106 ? 0.4069 0.4132 0.5025 -0.0352 0.1034  -0.1077 151 LEU C CD2 
5272 N N   . ILE C 107 ? 0.4942 0.4891 0.5455 -0.0275 0.0628  -0.1127 152 ILE C N   
5273 C CA  . ILE C 107 ? 0.5444 0.5384 0.5859 -0.0285 0.0639  -0.1069 152 ILE C CA  
5274 C C   . ILE C 107 ? 0.5634 0.5552 0.5889 -0.0298 0.0587  -0.1040 152 ILE C C   
5275 O O   . ILE C 107 ? 0.5184 0.5146 0.5390 -0.0316 0.0606  -0.0982 152 ILE C O   
5276 C CB  . ILE C 107 ? 0.5620 0.5540 0.6098 -0.0279 0.0637  -0.1112 152 ILE C CB  
5277 C CG1 . ILE C 107 ? 0.5151 0.5049 0.5563 -0.0270 0.0539  -0.1182 152 ILE C CG1 
5278 C CG2 . ILE C 107 ? 0.5174 0.5088 0.5843 -0.0294 0.0700  -0.1140 152 ILE C CG2 
5279 C CD1 . ILE C 107 ? 0.5392 0.5260 0.5793 -0.0271 0.0526  -0.1256 152 ILE C CD1 
5291 N N   . LEU C 108 ? 0.4869 0.4722 0.5067 -0.0290 0.0522  -0.1071 153 LEU C N   
5292 C CA  . LEU C 108 ? 0.5021 0.4807 0.5076 -0.0322 0.0492  -0.1032 153 LEU C CA  
5293 C C   . LEU C 108 ? 0.4623 0.4415 0.4649 -0.0360 0.0515  -0.1024 153 LEU C C   
5294 O O   . LEU C 108 ? 0.4400 0.4211 0.4362 -0.0420 0.0510  -0.0987 153 LEU C O   
5295 C CB  . LEU C 108 ? 0.4935 0.4600 0.4930 -0.0288 0.0417  -0.1046 153 LEU C CB  
5296 C CG  . LEU C 108 ? 0.5070 0.4720 0.5000 -0.0258 0.0360  -0.1047 153 LEU C CG  
5297 C CD1 . LEU C 108 ? 0.5281 0.4801 0.5126 -0.0208 0.0265  -0.1026 153 LEU C CD1 
5298 C CD2 . LEU C 108 ? 0.5196 0.4860 0.4992 -0.0304 0.0411  -0.1000 153 LEU C CD2 
5310 N N   . ALA C 109 ? 0.4328 0.4122 0.4404 -0.0334 0.0545  -0.1068 154 ALA C N   
5311 C CA  . ALA C 109 ? 0.4526 0.4318 0.4512 -0.0368 0.0569  -0.1082 154 ALA C CA  
5312 C C   . ALA C 109 ? 0.4629 0.4547 0.4586 -0.0396 0.0586  -0.1015 154 ALA C C   
5313 O O   . ALA C 109 ? 0.4642 0.4597 0.4504 -0.0451 0.0547  -0.1003 154 ALA C O   
5314 C CB  . ALA C 109 ? 0.4450 0.4222 0.4480 -0.0323 0.0630  -0.1150 154 ALA C CB  
5320 N N   . MET C 110 ? 0.5274 0.5254 0.5328 -0.0358 0.0633  -0.0971 155 MET C N   
5321 C CA  . MET C 110 ? 0.5648 0.5724 0.5692 -0.0353 0.0645  -0.0882 155 MET C CA  
5322 C C   . MET C 110 ? 0.5595 0.5758 0.5667 -0.0373 0.0592  -0.0841 155 MET C C   
5323 O O   . MET C 110 ? 0.5744 0.6015 0.5775 -0.0399 0.0544  -0.0797 155 MET C O   
5324 C CB  . MET C 110 ? 0.5339 0.5401 0.5506 -0.0309 0.0720  -0.0843 155 MET C CB  
5325 C CG  . MET C 110 ? 0.5562 0.5676 0.5736 -0.0273 0.0737  -0.0726 155 MET C CG  
5326 S SD  . MET C 110 ? 0.5347 0.5358 0.5670 -0.0237 0.0847  -0.0680 155 MET C SD  
5327 C CE  . MET C 110 ? 0.5244 0.5219 0.5718 -0.0227 0.0831  -0.0776 155 MET C CE  
5337 N N   . LEU C 111 ? 0.5124 0.5261 0.5267 -0.0364 0.0600  -0.0859 156 LEU C N   
5338 C CA  . LEU C 111 ? 0.5023 0.5262 0.5216 -0.0381 0.0592  -0.0822 156 LEU C CA  
5339 C C   . LEU C 111 ? 0.4661 0.4931 0.4796 -0.0471 0.0538  -0.0829 156 LEU C C   
5340 O O   . LEU C 111 ? 0.4523 0.4956 0.4741 -0.0507 0.0518  -0.0788 156 LEU C O   
5341 C CB  . LEU C 111 ? 0.5183 0.5364 0.5392 -0.0359 0.0631  -0.0854 156 LEU C CB  
5342 C CG  . LEU C 111 ? 0.5110 0.5242 0.5392 -0.0291 0.0681  -0.0880 156 LEU C CG  
5343 C CD1 . LEU C 111 ? 0.5375 0.5472 0.5618 -0.0279 0.0712  -0.0929 156 LEU C CD1 
5344 C CD2 . LEU C 111 ? 0.5383 0.5588 0.5784 -0.0238 0.0719  -0.0812 156 LEU C CD2 
5356 N N   . GLY C 112 ? 0.4395 0.4512 0.4422 -0.0509 0.0514  -0.0886 157 GLY C N   
5357 C CA  . GLY C 112 ? 0.4243 0.4310 0.4208 -0.0606 0.0470  -0.0912 157 GLY C CA  
5358 C C   . GLY C 112 ? 0.4320 0.4459 0.4236 -0.0659 0.0415  -0.0941 157 GLY C C   
5359 O O   . GLY C 112 ? 0.4348 0.4436 0.4221 -0.0760 0.0370  -0.0988 157 GLY C O   
5363 N N   . GLU C 113 ? 0.4587 0.4825 0.4485 -0.0599 0.0414  -0.0915 158 GLU C N   
5364 C CA  . GLU C 113 ? 0.4904 0.5222 0.4684 -0.0636 0.0348  -0.0934 158 GLU C CA  
5365 C C   . GLU C 113 ? 0.5188 0.5319 0.4785 -0.0677 0.0350  -0.1055 158 GLU C C   
5366 O O   . GLU C 113 ? 0.5235 0.5383 0.4707 -0.0757 0.0278  -0.1122 158 GLU C O   
5367 C CB  . GLU C 113 ? 0.5104 0.5630 0.4981 -0.0722 0.0253  -0.0911 158 GLU C CB  
5368 C CG  . GLU C 113 ? 0.5263 0.6021 0.5332 -0.0648 0.0251  -0.0792 158 GLU C CG  
5369 C CD  . GLU C 113 ? 0.5269 0.6073 0.5251 -0.0544 0.0240  -0.0714 158 GLU C CD  
5370 O OE1 . GLU C 113 ? 0.5500 0.6304 0.5274 -0.0568 0.0175  -0.0736 158 GLU C OE1 
5371 O OE2 . GLU C 113 ? 0.5214 0.6030 0.5314 -0.0441 0.0306  -0.0630 158 GLU C OE2 
5378 N N   . GLN C 114 ? 0.5308 0.5268 0.4901 -0.0616 0.0428  -0.1095 159 GLN C N   
5379 C CA  . GLN C 114 ? 0.5637 0.5412 0.5104 -0.0621 0.0455  -0.1217 159 GLN C CA  
5380 C C   . GLN C 114 ? 0.6018 0.5816 0.5333 -0.0575 0.0519  -0.1250 159 GLN C C   
5381 O O   . GLN C 114 ? 0.6282 0.5940 0.5505 -0.0557 0.0579  -0.1363 159 GLN C O   
5382 C CB  . GLN C 114 ? 0.5709 0.5321 0.5282 -0.0559 0.0499  -0.1238 159 GLN C CB  
5383 C CG  . GLN C 114 ? 0.5673 0.5205 0.5313 -0.0606 0.0452  -0.1197 159 GLN C CG  
5384 C CD  . GLN C 114 ? 0.6038 0.5479 0.5604 -0.0732 0.0400  -0.1248 159 GLN C CD  
5385 O OE1 . GLN C 114 ? 0.6152 0.5391 0.5628 -0.0750 0.0403  -0.1355 159 GLN C OE1 
5386 N NE2 . GLN C 114 ? 0.5834 0.5428 0.5465 -0.0823 0.0359  -0.1185 159 GLN C NE2 
5395 N N   . PHE C 115 ? 0.6039 0.5994 0.5321 -0.0550 0.0524  -0.1148 160 PHE C N   
5396 C CA  . PHE C 115 ? 0.6452 0.6414 0.5550 -0.0513 0.0607  -0.1147 160 PHE C CA  
5397 C C   . PHE C 115 ? 0.7195 0.7205 0.5993 -0.0572 0.0531  -0.1185 160 PHE C C   
5398 O O   . PHE C 115 ? 0.7972 0.7931 0.6524 -0.0557 0.0613  -0.1237 160 PHE C O   
5399 C CB  . PHE C 115 ? 0.5979 0.6029 0.5181 -0.0449 0.0670  -0.0997 160 PHE C CB  
5400 C CG  . PHE C 115 ? 0.5727 0.5715 0.5137 -0.0398 0.0787  -0.1012 160 PHE C CG  
5401 C CD1 . PHE C 115 ? 0.5316 0.5297 0.4963 -0.0383 0.0754  -0.1007 160 PHE C CD1 
5402 C CD2 . PHE C 115 ? 0.5648 0.5604 0.5015 -0.0373 0.0930  -0.1042 160 PHE C CD2 
5403 C CE1 . PHE C 115 ? 0.5071 0.5026 0.4915 -0.0345 0.0825  -0.1035 160 PHE C CE1 
5404 C CE2 . PHE C 115 ? 0.5507 0.5456 0.5131 -0.0339 0.1022  -0.1067 160 PHE C CE2 
5405 C CZ  . PHE C 115 ? 0.5146 0.5100 0.5012 -0.0326 0.0951  -0.1067 160 PHE C CZ  
5415 N N   . MET C 116 ? 0.7415 0.7538 0.6224 -0.0643 0.0378  -0.1171 161 MET C N   
5416 C CA  . MET C 116 ? 0.7714 0.7888 0.6254 -0.0726 0.0261  -0.1254 161 MET C CA  
5417 C C   . MET C 116 ? 0.8194 0.8464 0.6444 -0.0674 0.0263  -0.1160 161 MET C C   
5418 O O   . MET C 116 ? 0.8272 0.8479 0.6169 -0.0702 0.0271  -0.1263 161 MET C O   
5419 C CB  . MET C 116 ? 0.8512 0.8462 0.6894 -0.0786 0.0299  -0.1469 161 MET C CB  
5420 C CG  . MET C 116 ? 0.8253 0.8015 0.6881 -0.0795 0.0349  -0.1536 161 MET C CG  
5421 S SD  . MET C 116 ? 0.8728 0.8546 0.7608 -0.0915 0.0216  -0.1506 161 MET C SD  
5422 C CE  . MET C 116 ? 0.9292 0.9134 0.7954 -0.1080 0.0064  -0.1668 161 MET C CE  
5432 N N   . VAL C 117 ? 0.8522 0.8920 0.6895 -0.0594 0.0261  -0.0962 162 VAL C N   
5433 C CA  . VAL C 117 ? 0.8820 0.9275 0.6918 -0.0532 0.0267  -0.0822 162 VAL C CA  
5434 C C   . VAL C 117 ? 0.8414 0.9088 0.6644 -0.0484 0.0110  -0.0642 162 VAL C C   
5435 O O   . VAL C 117 ? 0.8697 0.9382 0.6876 -0.0387 0.0147  -0.0451 162 VAL C O   
5436 C CB  . VAL C 117 ? 0.8365 0.8683 0.6474 -0.0454 0.0488  -0.0736 162 VAL C CB  
5437 C CG1 . VAL C 117 ? 0.8844 0.9001 0.6819 -0.0481 0.0645  -0.0911 162 VAL C CG1 
5438 C CG2 . VAL C 117 ? 0.8299 0.8608 0.6828 -0.0407 0.0542  -0.0660 162 VAL C CG2 
5448 N N   . GLY C 118 ? 0.7725 0.8571 0.6150 -0.0550 -0.0056 -0.0696 163 GLY C N   
5449 C CA  . GLY C 118 ? 0.7471 0.8580 0.6084 -0.0494 -0.0211 -0.0541 163 GLY C CA  
5450 C C   . GLY C 118 ? 0.7007 0.8087 0.5921 -0.0371 -0.0097 -0.0381 163 GLY C C   
5451 O O   . GLY C 118 ? 0.6552 0.7543 0.5727 -0.0383 0.0013  -0.0439 163 GLY C O   
5455 N N   . GLU C 119 ? 0.8172 0.9305 0.7029 -0.0249 -0.0126 -0.0179 164 GLU C N   
5456 C CA  . GLU C 119 ? 0.8330 0.9413 0.7470 -0.0123 -0.0030 -0.0027 164 GLU C CA  
5457 C C   . GLU C 119 ? 0.8172 0.8976 0.7156 -0.0073 0.0165  0.0059  164 GLU C C   
5458 O O   . GLU C 119 ? 0.8067 0.8781 0.7240 0.0028  0.0247  0.0193  164 GLU C O   
5459 C CB  . GLU C 119 ? 0.9121 1.0436 0.8384 -0.0002 -0.0192 0.0160  164 GLU C CB  
5460 C CG  . GLU C 119 ? 0.9692 1.1359 0.9178 -0.0057 -0.0396 0.0088  164 GLU C CG  
5461 C CD  . GLU C 119 ? 1.0203 1.2147 0.9793 0.0078  -0.0591 0.0279  164 GLU C CD  
5462 O OE1 . GLU C 119 ? 1.0623 1.2446 1.0020 0.0215  -0.0581 0.0480  164 GLU C OE1 
5463 O OE2 . GLU C 119 ? 1.0292 1.2584 1.0176 0.0049  -0.0754 0.0238  164 GLU C OE2 
5470 N N   . GLU C 120 ? 0.7368 0.8031 0.6038 -0.0145 0.0255  -0.0027 165 GLU C N   
5471 C CA  . GLU C 120 ? 0.7083 0.7527 0.5594 -0.0113 0.0447  0.0072  165 GLU C CA  
5472 C C   . GLU C 120 ? 0.6481 0.6771 0.5325 -0.0109 0.0620  0.0038  165 GLU C C   
5473 O O   . GLU C 120 ? 0.6517 0.6642 0.5358 -0.0076 0.0769  0.0158  165 GLU C O   
5474 C CB  . GLU C 120 ? 0.7212 0.7581 0.5336 -0.0191 0.0523  -0.0041 165 GLU C CB  
5475 C CG  . GLU C 120 ? 0.7587 0.8017 0.5241 -0.0171 0.0419  0.0069  165 GLU C CG  
5476 C CD  . GLU C 120 ? 0.7855 0.8156 0.5350 -0.0079 0.0521  0.0339  165 GLU C CD  
5477 O OE1 . GLU C 120 ? 0.7763 0.7880 0.5407 -0.0081 0.0747  0.0377  165 GLU C OE1 
5478 O OE2 . GLU C 120 ? 0.8231 0.8611 0.5465 -0.0007 0.0370  0.0519  165 GLU C OE2 
5485 N N   . ILE C 121 ? 0.5958 0.6289 0.5075 -0.0151 0.0602  -0.0118 166 ILE C N   
5486 C CA  . ILE C 121 ? 0.5624 0.5826 0.5017 -0.0155 0.0735  -0.0175 166 ILE C CA  
5487 C C   . ILE C 121 ? 0.5508 0.5678 0.5139 -0.0065 0.0742  -0.0050 166 ILE C C   
5488 O O   . ILE C 121 ? 0.5335 0.5647 0.5083 -0.0011 0.0626  -0.0012 166 ILE C O   
5489 C CB  . ILE C 121 ? 0.5288 0.5531 0.4828 -0.0218 0.0700  -0.0366 166 ILE C CB  
5490 C CG1 . ILE C 121 ? 0.5456 0.5682 0.4781 -0.0289 0.0707  -0.0496 166 ILE C CG1 
5491 C CG2 . ILE C 121 ? 0.5181 0.5318 0.4978 -0.0216 0.0799  -0.0426 166 ILE C CG2 
5492 C CD1 . ILE C 121 ? 0.5592 0.5701 0.4836 -0.0297 0.0876  -0.0513 166 ILE C CD1 
5504 N N   . CYS C 122 ? 0.5559 0.5541 0.5295 -0.0053 0.0888  -0.0001 167 CYS C N   
5505 C CA  . CYS C 122 ? 0.5417 0.5296 0.5390 0.0028  0.0924  0.0085  167 CYS C CA  
5506 C C   . CYS C 122 ? 0.5024 0.4847 0.5262 -0.0008 0.0973  -0.0082 167 CYS C C   
5507 O O   . CYS C 122 ? 0.4832 0.4670 0.5251 0.0055  0.0945  -0.0098 167 CYS C O   
5508 C CB  . CYS C 122 ? 0.5789 0.5449 0.5697 0.0054  0.1054  0.0261  167 CYS C CB  
5509 S SG  . CYS C 122 ? 0.6197 0.5894 0.5698 0.0109  0.0995  0.0492  167 CYS C SG  
5515 N N   . GLY C 123 ? 0.5192 0.4970 0.5453 -0.0100 0.1042  -0.0212 168 GLY C N   
5516 C CA  . GLY C 123 ? 0.5052 0.4792 0.5523 -0.0135 0.1058  -0.0371 168 GLY C CA  
5517 C C   . GLY C 123 ? 0.5191 0.4900 0.5716 -0.0223 0.1132  -0.0473 168 GLY C C   
5518 O O   . GLY C 123 ? 0.5421 0.5139 0.5829 -0.0255 0.1199  -0.0427 168 GLY C O   
5522 N N   . ALA C 124 ? 0.4858 0.4550 0.5562 -0.0257 0.1118  -0.0618 169 ALA C N   
5523 C CA  . ALA C 124 ? 0.4725 0.4436 0.5568 -0.0331 0.1159  -0.0731 169 ALA C CA  
5524 C C   . ALA C 124 ? 0.4724 0.4328 0.5810 -0.0374 0.1195  -0.0810 169 ALA C C   
5525 O O   . ALA C 124 ? 0.4664 0.4177 0.5776 -0.0338 0.1167  -0.0833 169 ALA C O   
5526 C CB  . ALA C 124 ? 0.4641 0.4476 0.5448 -0.0333 0.1053  -0.0856 169 ALA C CB  
5532 N N   . VAL C 125 ? 0.5205 0.4830 0.6487 -0.0455 0.1265  -0.0871 170 VAL C N   
5533 C CA  . VAL C 125 ? 0.5456 0.4999 0.7007 -0.0531 0.1288  -0.0976 170 VAL C CA  
5534 C C   . VAL C 125 ? 0.5595 0.5321 0.7358 -0.0595 0.1233  -0.1129 170 VAL C C   
5535 O O   . VAL C 125 ? 0.5652 0.5524 0.7424 -0.0592 0.1265  -0.1115 170 VAL C O   
5536 C CB  . VAL C 125 ? 0.5540 0.4901 0.7212 -0.0591 0.1461  -0.0857 170 VAL C CB  
5537 C CG1 . VAL C 125 ? 0.5802 0.5063 0.7788 -0.0700 0.1483  -0.0996 170 VAL C CG1 
5538 C CG2 . VAL C 125 ? 0.5747 0.4929 0.7226 -0.0497 0.1494  -0.0685 170 VAL C CG2 
5548 N N   . VAL C 126 ? 0.5307 0.5032 0.7243 -0.0644 0.1144  -0.1287 171 VAL C N   
5549 C CA  . VAL C 126 ? 0.5112 0.5027 0.7333 -0.0714 0.1076  -0.1433 171 VAL C CA  
5550 C C   . VAL C 126 ? 0.5282 0.5104 0.7802 -0.0843 0.1119  -0.1531 171 VAL C C   
5551 O O   . VAL C 126 ? 0.5226 0.4875 0.7677 -0.0851 0.1069  -0.1608 171 VAL C O   
5552 C CB  . VAL C 126 ? 0.4917 0.4958 0.7029 -0.0650 0.0865  -0.1549 171 VAL C CB  
5553 C CG1 . VAL C 126 ? 0.4914 0.4801 0.6808 -0.0621 0.0783  -0.1605 171 VAL C CG1 
5554 C CG2 . VAL C 126 ? 0.4870 0.5131 0.7313 -0.0707 0.0757  -0.1698 171 VAL C CG2 
5564 N N   . SER C 127 ? 0.5531 0.5460 0.8391 -0.0952 0.1230  -0.1537 172 SER C N   
5565 C CA  . SER C 127 ? 0.5922 0.5760 0.9128 -0.1112 0.1299  -0.1623 172 SER C CA  
5566 C C   . SER C 127 ? 0.5901 0.6043 0.9502 -0.1204 0.1170  -0.1819 172 SER C C   
5567 O O   . SER C 127 ? 0.5731 0.6145 0.9550 -0.1204 0.1211  -0.1801 172 SER C O   
5568 C CB  . SER C 127 ? 0.6153 0.5863 0.9477 -0.1193 0.1563  -0.1450 172 SER C CB  
5569 O OG  . SER C 127 ? 0.6366 0.5794 0.9341 -0.1102 0.1655  -0.1258 172 SER C OG  
5575 N N   . VAL C 128 ? 0.6110 0.6216 0.9813 -0.1276 0.1014  -0.2012 173 VAL C N   
5576 C CA  . VAL C 128 ? 0.6280 0.6691 1.0358 -0.1367 0.0836  -0.2217 173 VAL C CA  
5577 C C   . VAL C 128 ? 0.6582 0.6961 1.1140 -0.1590 0.0962  -0.2297 173 VAL C C   
5578 O O   . VAL C 128 ? 0.6609 0.6679 1.1142 -0.1685 0.0998  -0.2366 173 VAL C O   
5579 C CB  . VAL C 128 ? 0.6375 0.6776 1.0213 -0.1318 0.0565  -0.2394 173 VAL C CB  
5580 C CG1 . VAL C 128 ? 0.6654 0.7407 1.0854 -0.1392 0.0335  -0.2594 173 VAL C CG1 
5581 C CG2 . VAL C 128 ? 0.6437 0.6814 0.9792 -0.1118 0.0488  -0.2283 173 VAL C CG2 
5591 N N   . ARG C 129 ? 0.6008 0.6697 1.1028 -0.1677 0.1046  -0.2291 174 ARG C N   
5592 C CA  . ARG C 129 ? 0.6299 0.7000 1.1838 -0.1911 0.1206  -0.2342 174 ARG C CA  
5593 C C   . ARG C 129 ? 0.6036 0.7163 1.2121 -0.2033 0.0998  -0.2584 174 ARG C C   
5594 O O   . ARG C 129 ? 0.5856 0.7248 1.1878 -0.1917 0.0721  -0.2694 174 ARG C O   
5595 C CB  . ARG C 129 ? 0.6840 0.7570 1.2505 -0.1935 0.1531  -0.2120 174 ARG C CB  
5596 C CG  . ARG C 129 ? 0.7312 0.7684 1.2426 -0.1799 0.1705  -0.1866 174 ARG C CG  
5597 C CD  . ARG C 129 ? 0.8383 0.8275 1.3374 -0.1886 0.1824  -0.1800 174 ARG C CD  
5598 N NE  . ARG C 129 ? 0.9061 0.8662 1.3579 -0.1749 0.1982  -0.1535 174 ARG C NE  
5599 C CZ  . ARG C 129 ? 0.9726 0.9230 1.4222 -0.1787 0.2255  -0.1308 174 ARG C CZ  
5600 N NH1 . ARG C 129 ? 1.0013 0.9677 1.4953 -0.1967 0.2441  -0.1307 174 ARG C NH1 
5601 N NH2 . ARG C 129 ? 0.9981 0.9241 1.4006 -0.1646 0.2342  -0.1076 174 ARG C NH2 
5615 N N   . PHE C 130 ? 0.6747 0.7947 1.3391 -0.2275 0.1131  -0.2655 175 PHE C N   
5616 C CA  . PHE C 130 ? 0.6918 0.8526 1.4108 -0.2407 0.0917  -0.2890 175 PHE C CA  
5617 C C   . PHE C 130 ? 0.6468 0.8636 1.3951 -0.2284 0.0789  -0.2910 175 PHE C C   
5618 O O   . PHE C 130 ? 0.6377 0.8825 1.3911 -0.2215 0.0449  -0.3076 175 PHE C O   
5619 C CB  . PHE C 130 ? 0.7478 0.9035 1.5049 -0.2604 0.1122  -0.2854 175 PHE C CB  
5620 C CG  . PHE C 130 ? 0.7917 0.9919 1.5997 -0.2698 0.0923  -0.3029 175 PHE C CG  
5621 C CD1 . PHE C 130 ? 0.8202 1.0243 1.6240 -0.2736 0.0584  -0.3263 175 PHE C CD1 
5622 C CD2 . PHE C 130 ? 0.7997 1.0377 1.6578 -0.2746 0.1081  -0.2958 175 PHE C CD2 
5623 C CE1 . PHE C 130 ? 0.8397 1.0862 1.6903 -0.2827 0.0383  -0.3417 175 PHE C CE1 
5624 C CE2 . PHE C 130 ? 0.8175 1.0984 1.7263 -0.2832 0.0894  -0.3116 175 PHE C CE2 
5625 C CZ  . PHE C 130 ? 0.8348 1.1207 1.7408 -0.2876 0.0534  -0.3342 175 PHE C CZ  
5635 N N   . GLN C 131 ? 0.6157 0.8469 1.3769 -0.2223 0.1057  -0.2725 176 GLN C N   
5636 C CA  . GLN C 131 ? 0.5994 0.8822 1.3939 -0.2091 0.0987  -0.2737 176 GLN C CA  
5637 C C   . GLN C 131 ? 0.5713 0.8439 1.3160 -0.1833 0.1101  -0.2537 176 GLN C C   
5638 O O   . GLN C 131 ? 0.5329 0.8406 1.3040 -0.1719 0.1156  -0.2511 176 GLN C O   
5639 C CB  . GLN C 131 ? 0.6283 0.9405 1.4815 -0.2216 0.1192  -0.2717 176 GLN C CB  
5640 C CG  . GLN C 131 ? 0.6720 0.9534 1.5150 -0.2323 0.1623  -0.2509 176 GLN C CG  
5641 C CD  . GLN C 131 ? 0.7239 1.0282 1.6178 -0.2466 0.1806  -0.2491 176 GLN C CD  
5642 O OE1 . GLN C 131 ? 0.7357 1.0764 1.6756 -0.2518 0.1600  -0.2651 176 GLN C OE1 
5643 N NE2 . GLN C 131 ? 0.7486 1.0321 1.6327 -0.2531 0.2191  -0.2288 176 GLN C NE2 
5652 N N   . GLU C 132 ? 0.5113 0.7373 1.1869 -0.1737 0.1133  -0.2409 177 GLU C N   
5653 C CA  . GLU C 132 ? 0.4950 0.7097 1.1225 -0.1519 0.1224  -0.2237 177 GLU C CA  
5654 C C   . GLU C 132 ? 0.4713 0.6411 1.0302 -0.1432 0.1146  -0.2158 177 GLU C C   
5655 O O   . GLU C 132 ? 0.4854 0.6271 1.0340 -0.1546 0.1139  -0.2190 177 GLU C O   
5656 C CB  . GLU C 132 ? 0.5473 0.7602 1.1813 -0.1557 0.1609  -0.2071 177 GLU C CB  
5657 C CG  . GLU C 132 ? 0.6002 0.7721 1.2136 -0.1704 0.1850  -0.1933 177 GLU C CG  
5658 C CD  . GLU C 132 ? 0.6575 0.8259 1.2657 -0.1723 0.2223  -0.1742 177 GLU C CD  
5659 O OE1 . GLU C 132 ? 0.6626 0.8597 1.2809 -0.1617 0.2306  -0.1740 177 GLU C OE1 
5660 O OE2 . GLU C 132 ? 0.7011 0.8363 1.2931 -0.1836 0.2439  -0.1592 177 GLU C OE2 
5667 N N   . ASP C 133 ? 0.4912 0.6548 1.0066 -0.1230 0.1096  -0.2065 178 ASP C N   
5668 C CA  . ASP C 133 ? 0.4924 0.6187 0.9460 -0.1137 0.1066  -0.1963 178 ASP C CA  
5669 C C   . ASP C 133 ? 0.4855 0.5990 0.9091 -0.1057 0.1299  -0.1772 178 ASP C C   
5670 O O   . ASP C 133 ? 0.4750 0.6096 0.9117 -0.0992 0.1390  -0.1751 178 ASP C O   
5671 C CB  . ASP C 133 ? 0.4890 0.6181 0.9142 -0.0990 0.0775  -0.2029 178 ASP C CB  
5672 C CG  . ASP C 133 ? 0.5211 0.6626 0.9669 -0.1063 0.0520  -0.2223 178 ASP C CG  
5673 O OD1 . ASP C 133 ? 0.5338 0.6661 0.9988 -0.1231 0.0561  -0.2310 178 ASP C OD1 
5674 O OD2 . ASP C 133 ? 0.5135 0.6720 0.9546 -0.0953 0.0274  -0.2288 178 ASP C OD2 
5679 N N   . ILE C 134 ? 0.4316 0.5113 0.8160 -0.1056 0.1391  -0.1642 179 ILE C N   
5680 C CA  . ILE C 134 ? 0.4362 0.5023 0.7883 -0.0996 0.1591  -0.1457 179 ILE C CA  
5681 C C   . ILE C 134 ? 0.4300 0.4766 0.7307 -0.0861 0.1468  -0.1389 179 ILE C C   
5682 O O   . ILE C 134 ? 0.4315 0.4590 0.7172 -0.0864 0.1375  -0.1396 179 ILE C O   
5683 C CB  . ILE C 134 ? 0.4610 0.5066 0.8170 -0.1122 0.1838  -0.1322 179 ILE C CB  
5684 C CG1 . ILE C 134 ? 0.4707 0.5370 0.8837 -0.1289 0.1973  -0.1399 179 ILE C CG1 
5685 C CG2 . ILE C 134 ? 0.4719 0.5062 0.7897 -0.1053 0.2023  -0.1126 179 ILE C CG2 
5686 C CD1 . ILE C 134 ? 0.5014 0.5430 0.9240 -0.1449 0.2212  -0.1272 179 ILE C CD1 
5698 N N   . ILE C 135 ? 0.5278 0.5800 0.8043 -0.0750 0.1479  -0.1337 180 ILE C N   
5699 C CA  . ILE C 135 ? 0.5542 0.5909 0.7850 -0.0644 0.1392  -0.1261 180 ILE C CA  
5700 C C   . ILE C 135 ? 0.5525 0.5770 0.7554 -0.0636 0.1572  -0.1098 180 ILE C C   
5701 O O   . ILE C 135 ? 0.5723 0.6060 0.7813 -0.0657 0.1742  -0.1071 180 ILE C O   
5702 C CB  . ILE C 135 ? 0.5818 0.6304 0.8041 -0.0535 0.1249  -0.1336 180 ILE C CB  
5703 C CG1 . ILE C 135 ? 0.5998 0.6606 0.8447 -0.0525 0.1046  -0.1473 180 ILE C CG1 
5704 C CG2 . ILE C 135 ? 0.5900 0.6230 0.7684 -0.0457 0.1179  -0.1258 180 ILE C CG2 
5705 C CD1 . ILE C 135 ? 0.6182 0.6641 0.8414 -0.0519 0.0894  -0.1487 180 ILE C CD1 
5717 N N   . SER C 136 ? 0.5311 0.5371 0.7028 -0.0599 0.1534  -0.0989 181 SER C N   
5718 C CA  . SER C 136 ? 0.5459 0.5416 0.6868 -0.0578 0.1657  -0.0822 181 SER C CA  
5719 C C   . SER C 136 ? 0.5127 0.5005 0.6200 -0.0491 0.1519  -0.0761 181 SER C C   
5720 O O   . SER C 136 ? 0.4547 0.4396 0.5647 -0.0463 0.1380  -0.0813 181 SER C O   
5721 C CB  . SER C 136 ? 0.5664 0.5461 0.7146 -0.0652 0.1823  -0.0685 181 SER C CB  
5722 O OG  . SER C 136 ? 0.5804 0.5444 0.7362 -0.0654 0.1740  -0.0682 181 SER C OG  
5728 N N   . ILE C 137 ? 0.4744 0.4606 0.5500 -0.0456 0.1562  -0.0657 182 ILE C N   
5729 C CA  . ILE C 137 ? 0.4890 0.4720 0.5356 -0.0390 0.1435  -0.0587 182 ILE C CA  
5730 C C   . ILE C 137 ? 0.5136 0.4883 0.5333 -0.0375 0.1522  -0.0397 182 ILE C C   
5731 O O   . ILE C 137 ? 0.5216 0.4980 0.5253 -0.0400 0.1650  -0.0365 182 ILE C O   
5732 C CB  . ILE C 137 ? 0.4938 0.4867 0.5254 -0.0362 0.1328  -0.0697 182 ILE C CB  
5733 C CG1 . ILE C 137 ? 0.4849 0.4778 0.4922 -0.0322 0.1195  -0.0630 182 ILE C CG1 
5734 C CG2 . ILE C 137 ? 0.4955 0.4930 0.5148 -0.0375 0.1449  -0.0738 182 ILE C CG2 
5735 C CD1 . ILE C 137 ? 0.4905 0.4892 0.4878 -0.0320 0.1080  -0.0744 182 ILE C CD1 
5747 N N   . TRP C 138 ? 0.5954 0.5613 0.6095 -0.0324 0.1458  -0.0266 183 TRP C N   
5748 C CA  . TRP C 138 ? 0.6616 0.6177 0.6512 -0.0285 0.1512  -0.0047 183 TRP C CA  
5749 C C   . TRP C 138 ? 0.6608 0.6277 0.6193 -0.0221 0.1353  0.0001  183 TRP C C   
5750 O O   . TRP C 138 ? 0.6356 0.6133 0.6007 -0.0194 0.1199  -0.0088 183 TRP C O   
5751 C CB  . TRP C 138 ? 0.7107 0.6487 0.7167 -0.0244 0.1533  0.0085  183 TRP C CB  
5752 C CG  . TRP C 138 ? 0.7361 0.6613 0.7769 -0.0322 0.1652  0.0012  183 TRP C CG  
5753 C CD1 . TRP C 138 ? 0.7278 0.6620 0.7922 -0.0414 0.1695  -0.0175 183 TRP C CD1 
5754 C CD2 . TRP C 138 ? 0.7706 0.6715 0.8284 -0.0315 0.1729  0.0116  183 TRP C CD2 
5755 N NE1 . TRP C 138 ? 0.7419 0.6617 0.8369 -0.0483 0.1780  -0.0206 183 TRP C NE1 
5756 C CE2 . TRP C 138 ? 0.7697 0.6663 0.8605 -0.0430 0.1813  -0.0036 183 TRP C CE2 
5757 C CE3 . TRP C 138 ? 0.8098 0.6914 0.8598 -0.0215 0.1727  0.0321  183 TRP C CE3 
5758 C CZ2 . TRP C 138 ? 0.7917 0.6631 0.9064 -0.0472 0.1903  -0.0011 183 TRP C CZ2 
5759 C CZ3 . TRP C 138 ? 0.8270 0.6810 0.9007 -0.0234 0.1829  0.0363  183 TRP C CZ3 
5760 C CH2 . TRP C 138 ? 0.8270 0.6747 0.9320 -0.0373 0.1920  0.0187  183 TRP C CH2 
5771 N N   . ASN C 139 ? 0.6920 0.6565 0.6160 -0.0205 0.1393  0.0148  184 ASN C N   
5772 C CA  . ASN C 139 ? 0.7149 0.6911 0.6076 -0.0153 0.1222  0.0202  184 ASN C CA  
5773 C C   . ASN C 139 ? 0.7785 0.7453 0.6491 -0.0072 0.1212  0.0475  184 ASN C C   
5774 O O   . ASN C 139 ? 0.8057 0.7534 0.6757 -0.0075 0.1383  0.0627  184 ASN C O   
5775 C CB  . ASN C 139 ? 0.7140 0.6989 0.5754 -0.0209 0.1229  0.0071  184 ASN C CB  
5776 C CG  . ASN C 139 ? 0.7439 0.7189 0.5762 -0.0239 0.1433  0.0161  184 ASN C CG  
5777 O OD1 . ASN C 139 ? 0.7378 0.7052 0.5895 -0.0288 0.1637  0.0137  184 ASN C OD1 
5778 N ND2 . ASN C 139 ? 0.7822 0.7591 0.5675 -0.0215 0.1379  0.0261  184 ASN C ND2 
5785 N N   . LYS C 140 ? 0.8359 0.8169 0.6898 0.0000  0.1004  0.0545  185 LYS C N   
5786 C CA  . LYS C 140 ? 0.9145 0.8895 0.7527 0.0116  0.0937  0.0820  185 LYS C CA  
5787 C C   . LYS C 140 ? 0.9422 0.9037 0.7339 0.0103  0.1059  0.0994  185 LYS C C   
5788 O O   . LYS C 140 ? 0.9724 0.9119 0.7601 0.0156  0.1174  0.1233  185 LYS C O   
5789 C CB  . LYS C 140 ? 0.9812 0.9820 0.8148 0.0189  0.0660  0.0835  185 LYS C CB  
5790 C CG  . LYS C 140 ? 1.0168 1.0281 0.8969 0.0256  0.0565  0.0790  185 LYS C CG  
5791 C CD  . LYS C 140 ? 1.0605 1.1041 0.9424 0.0291  0.0306  0.0761  185 LYS C CD  
5792 C CE  . LYS C 140 ? 1.1488 1.2008 1.0036 0.0410  0.0142  0.1007  185 LYS C CE  
5793 N NZ  . LYS C 140 ? 1.1694 1.2589 1.0347 0.0436  -0.0133 0.0967  185 LYS C NZ  
5807 N N   . THR C 141 ? 0.9674 0.9392 0.7215 0.0034  0.1049  0.0881  186 THR C N   
5808 C CA  . THR C 141 ? 1.0187 0.9815 0.7174 0.0033  0.1136  0.1042  186 THR C CA  
5809 C C   . THR C 141 ? 1.0017 0.9558 0.6925 -0.0084 0.1418  0.0904  186 THR C C   
5810 O O   . THR C 141 ? 0.9746 0.9407 0.6607 -0.0152 0.1413  0.0647  186 THR C O   
5811 C CB  . THR C 141 ? 1.0434 1.0264 0.6984 0.0055  0.0887  0.1012  186 THR C CB  
5812 O OG1 . THR C 141 ? 1.0377 1.0371 0.7144 0.0156  0.0612  0.1093  186 THR C OG1 
5813 C CG2 . THR C 141 ? 1.1290 1.1013 0.7199 0.0079  0.0950  0.1225  186 THR C CG2 
5821 N N   . ALA C 142 ? 0.9783 0.9112 0.6694 -0.0106 0.1674  0.1079  187 ALA C N   
5822 C CA  . ALA C 142 ? 0.9569 0.8855 0.6474 -0.0216 0.1969  0.0964  187 ALA C CA  
5823 C C   . ALA C 142 ? 0.9910 0.9236 0.6184 -0.0238 0.2041  0.0945  187 ALA C C   
5824 O O   . ALA C 142 ? 0.9794 0.9176 0.6059 -0.0312 0.2227  0.0741  187 ALA C O   
5825 C CB  . ALA C 142 ? 0.9494 0.8552 0.6610 -0.0258 0.2232  0.1164  187 ALA C CB  
5831 N N   . SER C 143 ? 0.9925 0.9229 0.5666 -0.0165 0.1892  0.1145  188 SER C N   
5832 C CA  . SER C 143 ? 1.0383 0.9704 0.5427 -0.0184 0.1948  0.1135  188 SER C CA  
5833 C C   . SER C 143 ? 1.0156 0.9680 0.5026 -0.0203 0.1733  0.0827  188 SER C C   
5834 O O   . SER C 143 ? 1.0836 1.0372 0.5115 -0.0228 0.1772  0.0751  188 SER C O   
5835 C CB  . SER C 143 ? 1.1145 1.0358 0.5643 -0.0093 0.1846  0.1492  188 SER C CB  
5836 O OG  . SER C 143 ? 1.0828 1.0156 0.5459 0.0013  0.1480  0.1570  188 SER C OG  
5842 N N   . ASP C 144 ? 1.0054 0.9714 0.5397 -0.0201 0.1522  0.0644  189 ASP C N   
5843 C CA  . ASP C 144 ? 1.0062 0.9879 0.5299 -0.0238 0.1322  0.0353  189 ASP C CA  
5844 C C   . ASP C 144 ? 0.9779 0.9570 0.5202 -0.0312 0.1545  0.0063  189 ASP C C   
5845 O O   . ASP C 144 ? 0.9096 0.8921 0.5068 -0.0329 0.1540  -0.0081 189 ASP C O   
5846 C CB  . ASP C 144 ? 0.9787 0.9753 0.5449 -0.0208 0.1020  0.0318  189 ASP C CB  
5847 C CG  . ASP C 144 ? 1.0108 1.0224 0.5663 -0.0269 0.0800  0.0046  189 ASP C CG  
5848 O OD1 . ASP C 144 ? 1.0470 1.0540 0.5677 -0.0331 0.0894  -0.0159 189 ASP C OD1 
5849 O OD2 . ASP C 144 ? 0.9805 1.0077 0.5646 -0.0258 0.0548  0.0028  189 ASP C OD2 
5854 N N   . GLN C 145 ? 0.9500 0.9233 0.4447 -0.0344 0.1746  -0.0022 190 GLN C N   
5855 C CA  . GLN C 145 ? 0.9446 0.9162 0.4583 -0.0387 0.1984  -0.0291 190 GLN C CA  
5856 C C   . GLN C 145 ? 0.8949 0.8727 0.4313 -0.0408 0.1788  -0.0590 190 GLN C C   
5857 O O   . GLN C 145 ? 0.8532 0.8312 0.4375 -0.0413 0.1883  -0.0753 190 GLN C O   
5858 C CB  . GLN C 145 ? 1.0404 1.0054 0.4931 -0.0407 0.2234  -0.0347 190 GLN C CB  
5859 C CG  . GLN C 145 ? 1.0967 1.0532 0.5360 -0.0409 0.2542  -0.0077 190 GLN C CG  
5860 C CD  . GLN C 145 ? 1.2076 1.1587 0.5846 -0.0431 0.2824  -0.0150 190 GLN C CD  
5861 O OE1 . GLN C 145 ? 1.2397 1.1933 0.6055 -0.0441 0.2890  -0.0465 190 GLN C OE1 
5862 N NE2 . GLN C 145 ? 1.2893 1.2307 0.6232 -0.0434 0.3005  0.0144  190 GLN C NE2 
5871 N N   . ALA C 146 ? 0.9775 0.9606 0.4808 -0.0425 0.1508  -0.0661 191 ALA C N   
5872 C CA  . ALA C 146 ? 0.9531 0.9392 0.4788 -0.0468 0.1320  -0.0927 191 ALA C CA  
5873 C C   . ALA C 146 ? 0.9006 0.8913 0.4952 -0.0453 0.1247  -0.0891 191 ALA C C   
5874 O O   . ALA C 146 ? 0.8789 0.8656 0.5062 -0.0471 0.1270  -0.1092 191 ALA C O   
5875 C CB  . ALA C 146 ? 0.9961 0.9914 0.4839 -0.0509 0.0999  -0.0964 191 ALA C CB  
5881 N N   . THR C 147 ? 0.8943 0.8913 0.5095 -0.0412 0.1167  -0.0634 192 THR C N   
5882 C CA  . THR C 147 ? 0.8330 0.8340 0.5079 -0.0397 0.1098  -0.0608 192 THR C CA  
5883 C C   . THR C 147 ? 0.7773 0.7710 0.4900 -0.0385 0.1346  -0.0633 192 THR C C   
5884 O O   . THR C 147 ? 0.7188 0.7126 0.4705 -0.0393 0.1330  -0.0771 192 THR C O   
5885 C CB  . THR C 147 ? 0.8328 0.8413 0.5179 -0.0343 0.0951  -0.0347 192 THR C CB  
5886 O OG1 . THR C 147 ? 0.8612 0.8832 0.5202 -0.0350 0.0684  -0.0337 192 THR C OG1 
5887 C CG2 . THR C 147 ? 0.7851 0.7962 0.5283 -0.0324 0.0914  -0.0337 192 THR C CG2 
5895 N N   . THR C 148 ? 0.7317 0.7195 0.4343 -0.0372 0.1572  -0.0490 193 THR C N   
5896 C CA  . THR C 148 ? 0.7065 0.6920 0.4518 -0.0377 0.1794  -0.0509 193 THR C CA  
5897 C C   . THR C 148 ? 0.7026 0.6892 0.4581 -0.0386 0.1923  -0.0769 193 THR C C   
5898 O O   . THR C 148 ? 0.6676 0.6577 0.4706 -0.0379 0.1988  -0.0850 193 THR C O   
5899 C CB  . THR C 148 ? 0.7385 0.7173 0.4716 -0.0385 0.2029  -0.0295 193 THR C CB  
5900 O OG1 . THR C 148 ? 0.7936 0.7694 0.4727 -0.0397 0.2178  -0.0312 193 THR C OG1 
5901 C CG2 . THR C 148 ? 0.7444 0.7177 0.4725 -0.0352 0.1901  -0.0022 193 THR C CG2 
5909 N N   . ALA C 149 ? 0.7416 0.7250 0.4535 -0.0392 0.1953  -0.0910 194 ALA C N   
5910 C CA  . ALA C 149 ? 0.7462 0.7277 0.4689 -0.0378 0.2070  -0.1173 194 ALA C CA  
5911 C C   . ALA C 149 ? 0.7227 0.7021 0.4746 -0.0371 0.1850  -0.1323 194 ALA C C   
5912 O O   . ALA C 149 ? 0.7109 0.6894 0.4983 -0.0334 0.1919  -0.1466 194 ALA C O   
5913 C CB  . ALA C 149 ? 0.8011 0.7759 0.4650 -0.0386 0.2169  -0.1306 194 ALA C CB  
5919 N N   . ARG C 150 ? 0.7076 0.6872 0.4466 -0.0405 0.1589  -0.1281 195 ARG C N   
5920 C CA  . ARG C 150 ? 0.7063 0.6832 0.4725 -0.0418 0.1400  -0.1391 195 ARG C CA  
5921 C C   . ARG C 150 ? 0.6282 0.6100 0.4464 -0.0386 0.1389  -0.1304 195 ARG C C   
5922 O O   . ARG C 150 ? 0.5956 0.5728 0.4424 -0.0364 0.1366  -0.1420 195 ARG C O   
5923 C CB  . ARG C 150 ? 0.7843 0.7652 0.5293 -0.0477 0.1142  -0.1355 195 ARG C CB  
5924 C CG  . ARG C 150 ? 0.9274 0.9025 0.6241 -0.0530 0.1087  -0.1516 195 ARG C CG  
5925 C CD  . ARG C 150 ? 1.0153 1.0012 0.6964 -0.0597 0.0811  -0.1464 195 ARG C CD  
5926 N NE  . ARG C 150 ? 1.1576 1.1378 0.7940 -0.0671 0.0726  -0.1663 195 ARG C NE  
5927 C CZ  . ARG C 150 ? 1.2608 1.2290 0.9013 -0.0747 0.0646  -0.1897 195 ARG C CZ  
5928 N NH1 . ARG C 150 ? 1.2561 1.2167 0.9418 -0.0749 0.0642  -0.1932 195 ARG C NH1 
5929 N NH2 . ARG C 150 ? 1.3481 1.3096 0.9453 -0.0826 0.0568  -0.2096 195 ARG C NH2 
5943 N N   . ILE C 151 ? 0.6071 0.5962 0.4362 -0.0381 0.1399  -0.1101 196 ILE C N   
5944 C CA  . ILE C 151 ? 0.5931 0.5857 0.4678 -0.0360 0.1393  -0.1045 196 ILE C CA  
5945 C C   . ILE C 151 ? 0.5909 0.5848 0.4945 -0.0331 0.1564  -0.1152 196 ILE C C   
5946 O O   . ILE C 151 ? 0.5457 0.5410 0.4834 -0.0306 0.1504  -0.1216 196 ILE C O   
5947 C CB  . ILE C 151 ? 0.5766 0.5722 0.4562 -0.0360 0.1408  -0.0828 196 ILE C CB  
5948 C CG1 . ILE C 151 ? 0.5926 0.5913 0.4563 -0.0359 0.1206  -0.0722 196 ILE C CG1 
5949 C CG2 . ILE C 151 ? 0.5557 0.5530 0.4808 -0.0352 0.1438  -0.0809 196 ILE C CG2 
5950 C CD1 . ILE C 151 ? 0.6018 0.5998 0.4665 -0.0329 0.1224  -0.0493 196 ILE C CD1 
5962 N N   . ARG C 152 ? 0.6115 0.6067 0.5023 -0.0328 0.1782  -0.1165 197 ARG C N   
5963 C CA  . ARG C 152 ? 0.6452 0.6472 0.5694 -0.0294 0.1960  -0.1274 197 ARG C CA  
5964 C C   . ARG C 152 ? 0.6399 0.6368 0.5732 -0.0234 0.1894  -0.1476 197 ARG C C   
5965 O O   . ARG C 152 ? 0.5815 0.5837 0.5559 -0.0185 0.1862  -0.1536 197 ARG C O   
5966 C CB  . ARG C 152 ? 0.7381 0.7432 0.6427 -0.0307 0.2238  -0.1256 197 ARG C CB  
5967 C CG  . ARG C 152 ? 0.7896 0.8085 0.7369 -0.0279 0.2464  -0.1345 197 ARG C CG  
5968 C CD  . ARG C 152 ? 0.8889 0.9063 0.8227 -0.0213 0.2608  -0.1550 197 ARG C CD  
5969 N NE  . ARG C 152 ? 0.9979 1.0059 0.8712 -0.0242 0.2734  -0.1540 197 ARG C NE  
5970 C CZ  . ARG C 152 ? 1.0822 1.0798 0.9207 -0.0202 0.2773  -0.1728 197 ARG C CZ  
5971 N NH1 . ARG C 152 ? 1.0942 1.0865 0.9551 -0.0125 0.2707  -0.1930 197 ARG C NH1 
5972 N NH2 . ARG C 152 ? 1.1494 1.1394 0.9280 -0.0238 0.2874  -0.1714 197 ARG C NH2 
5986 N N   . ASP C 153 ? 0.6891 0.6740 0.5835 -0.0238 0.1859  -0.1582 198 ASP C N   
5987 C CA  . ASP C 153 ? 0.7395 0.7125 0.6398 -0.0186 0.1802  -0.1774 198 ASP C CA  
5988 C C   . ASP C 153 ? 0.6728 0.6419 0.5997 -0.0182 0.1580  -0.1741 198 ASP C C   
5989 O O   . ASP C 153 ? 0.6458 0.6112 0.6023 -0.0106 0.1562  -0.1822 198 ASP C O   
5990 C CB  . ASP C 153 ? 0.8746 0.8326 0.7251 -0.0227 0.1771  -0.1894 198 ASP C CB  
5991 C CG  . ASP C 153 ? 0.9972 0.9381 0.8501 -0.0165 0.1810  -0.2126 198 ASP C CG  
5992 O OD1 . ASP C 153 ? 1.0336 0.9784 0.9137 -0.0066 0.1990  -0.2211 198 ASP C OD1 
5993 O OD2 . ASP C 153 ? 1.0495 0.9732 0.8805 -0.0215 0.1663  -0.2225 198 ASP C OD2 
5998 N N   . THR C 154 ? 0.6451 0.6153 0.5615 -0.0251 0.1415  -0.1612 199 THR C N   
5999 C CA  . THR C 154 ? 0.6146 0.5814 0.5514 -0.0257 0.1232  -0.1574 199 THR C CA  
6000 C C   . THR C 154 ? 0.5914 0.5685 0.5683 -0.0204 0.1247  -0.1519 199 THR C C   
6001 O O   . THR C 154 ? 0.5797 0.5520 0.5776 -0.0154 0.1164  -0.1559 199 THR C O   
6002 C CB  . THR C 154 ? 0.6008 0.5716 0.5217 -0.0334 0.1086  -0.1450 199 THR C CB  
6003 O OG1 . THR C 154 ? 0.6361 0.5994 0.5241 -0.0396 0.1018  -0.1525 199 THR C OG1 
6004 C CG2 . THR C 154 ? 0.5681 0.5380 0.5107 -0.0341 0.0944  -0.1396 199 THR C CG2 
6012 N N   . LEU C 155 ? 0.5799 0.5701 0.5666 -0.0220 0.1344  -0.1424 200 LEU C N   
6013 C CA  . LEU C 155 ? 0.5826 0.5840 0.6083 -0.0196 0.1349  -0.1394 200 LEU C CA  
6014 C C   . LEU C 155 ? 0.5684 0.5744 0.6227 -0.0110 0.1401  -0.1520 200 LEU C C   
6015 O O   . LEU C 155 ? 0.5216 0.5318 0.6035 -0.0065 0.1288  -0.1534 200 LEU C O   
6016 C CB  . LEU C 155 ? 0.6088 0.6197 0.6398 -0.0246 0.1486  -0.1289 200 LEU C CB  
6017 C CG  . LEU C 155 ? 0.6274 0.6491 0.6971 -0.0265 0.1492  -0.1254 200 LEU C CG  
6018 C CD1 . LEU C 155 ? 0.6211 0.6386 0.6959 -0.0270 0.1295  -0.1222 200 LEU C CD1 
6019 C CD2 . LEU C 155 ? 0.6435 0.6672 0.7114 -0.0333 0.1657  -0.1137 200 LEU C CD2 
6031 N N   . ARG C 156 ? 0.6087 0.6141 0.6551 -0.0074 0.1566  -0.1616 201 ARG C N   
6032 C CA  . ARG C 156 ? 0.6670 0.6781 0.7444 0.0034  0.1635  -0.1743 201 ARG C CA  
6033 C C   . ARG C 156 ? 0.6247 0.6215 0.7087 0.0111  0.1442  -0.1787 201 ARG C C   
6034 O O   . ARG C 156 ? 0.5916 0.5980 0.7117 0.0192  0.1364  -0.1796 201 ARG C O   
6035 C CB  . ARG C 156 ? 0.7709 0.7783 0.8297 0.0067  0.1854  -0.1861 201 ARG C CB  
6036 C CG  . ARG C 156 ? 0.8729 0.8931 0.9714 0.0193  0.2000  -0.1992 201 ARG C CG  
6037 C CD  . ARG C 156 ? 0.9646 0.9645 1.0618 0.0313  0.1925  -0.2127 201 ARG C CD  
6038 N NE  . ARG C 156 ? 1.0602 1.0349 1.1072 0.0276  0.1970  -0.2219 201 ARG C NE  
6039 C CZ  . ARG C 156 ? 1.1287 1.0773 1.1648 0.0344  0.1914  -0.2348 201 ARG C CZ  
6040 N NH1 . ARG C 156 ? 1.1386 1.0814 1.2095 0.0474  0.1816  -0.2371 201 ARG C NH1 
6041 N NH2 . ARG C 156 ? 1.1778 1.1046 1.1675 0.0280  0.1945  -0.2452 201 ARG C NH2 
6055 N N   . ARG C 157 ? 0.5899 0.5639 0.6394 0.0079  0.1356  -0.1806 202 ARG C N   
6056 C CA  . ARG C 157 ? 0.5781 0.5329 0.6307 0.0138  0.1201  -0.1830 202 ARG C CA  
6057 C C   . ARG C 157 ? 0.5506 0.5088 0.6125 0.0110  0.1017  -0.1701 202 ARG C C   
6058 O O   . ARG C 157 ? 0.5442 0.4957 0.6219 0.0193  0.0902  -0.1688 202 ARG C O   
6059 C CB  . ARG C 157 ? 0.5898 0.5189 0.6052 0.0077  0.1173  -0.1895 202 ARG C CB  
6060 C CG  . ARG C 157 ? 0.6194 0.5397 0.6191 0.0109  0.1343  -0.2061 202 ARG C CG  
6061 C CD  . ARG C 157 ? 0.6738 0.5672 0.6378 0.0027  0.1280  -0.2150 202 ARG C CD  
6062 N NE  . ARG C 157 ? 0.6781 0.5791 0.6141 -0.0121 0.1198  -0.2062 202 ARG C NE  
6063 C CZ  . ARG C 157 ? 0.7180 0.6255 0.6230 -0.0186 0.1274  -0.2099 202 ARG C CZ  
6064 N NH1 . ARG C 157 ? 0.7469 0.6529 0.6407 -0.0129 0.1462  -0.2235 202 ARG C NH1 
6065 N NH2 . ARG C 157 ? 0.7196 0.6361 0.6041 -0.0298 0.1164  -0.1997 202 ARG C NH2 
6079 N N   . VAL C 158 ? 0.5260 0.4933 0.5764 0.0005  0.0991  -0.1602 203 VAL C N   
6080 C CA  . VAL C 158 ? 0.5286 0.4966 0.5810 -0.0029 0.0840  -0.1500 203 VAL C CA  
6081 C C   . VAL C 158 ? 0.5162 0.4996 0.6012 0.0035  0.0787  -0.1489 203 VAL C C   
6082 O O   . VAL C 158 ? 0.5110 0.4903 0.5980 0.0058  0.0642  -0.1444 203 VAL C O   
6083 C CB  . VAL C 158 ? 0.5328 0.5070 0.5679 -0.0135 0.0847  -0.1412 203 VAL C CB  
6084 C CG1 . VAL C 158 ? 0.5177 0.4977 0.5617 -0.0154 0.0747  -0.1331 203 VAL C CG1 
6085 C CG2 . VAL C 158 ? 0.5472 0.5085 0.5528 -0.0202 0.0814  -0.1413 203 VAL C CG2 
6095 N N   . LEU C 159 ? 0.5350 0.5374 0.6451 0.0051  0.0901  -0.1530 204 LEU C N   
6096 C CA  . LEU C 159 ? 0.5434 0.5646 0.6890 0.0087  0.0833  -0.1540 204 LEU C CA  
6097 C C   . LEU C 159 ? 0.5771 0.6045 0.7515 0.0228  0.0792  -0.1613 204 LEU C C   
6098 O O   . LEU C 159 ? 0.5564 0.6010 0.7609 0.0272  0.0678  -0.1623 204 LEU C O   
6099 C CB  . LEU C 159 ? 0.5466 0.5870 0.7118 0.0009  0.0976  -0.1540 204 LEU C CB  
6100 C CG  . LEU C 159 ? 0.5635 0.5970 0.7045 -0.0105 0.1017  -0.1448 204 LEU C CG  
6101 C CD1 . LEU C 159 ? 0.5580 0.6056 0.7208 -0.0178 0.1166  -0.1432 204 LEU C CD1 
6102 C CD2 . LEU C 159 ? 0.5444 0.5703 0.6739 -0.0131 0.0847  -0.1397 204 LEU C CD2 
6114 N N   . ASN C 160 ? 0.6254 0.6390 0.7921 0.0306  0.0869  -0.1673 205 ASN C N   
6115 C CA  . ASN C 160 ? 0.6804 0.6948 0.8743 0.0473  0.0826  -0.1734 205 ASN C CA  
6116 C C   . ASN C 160 ? 0.6565 0.7059 0.9013 0.0532  0.0890  -0.1797 205 ASN C C   
6117 O O   . ASN C 160 ? 0.6615 0.7256 0.9391 0.0640  0.0739  -0.1798 205 ASN C O   
6118 C CB  . ASN C 160 ? 0.7500 0.7497 0.9374 0.0541  0.0587  -0.1653 205 ASN C CB  
6119 C CG  . ASN C 160 ? 0.8267 0.7894 0.9774 0.0537  0.0563  -0.1623 205 ASN C CG  
6120 O OD1 . ASN C 160 ? 0.8690 0.8139 1.0234 0.0652  0.0597  -0.1679 205 ASN C OD1 
6121 N ND2 . ASN C 160 ? 0.8428 0.7935 0.9607 0.0404  0.0513  -0.1542 205 ASN C ND2 
6128 N N   . LEU C 161 ? 0.6866 0.7505 0.9385 0.0459  0.1112  -0.1843 206 LEU C N   
6129 C CA  . LEU C 161 ? 0.7065 0.8066 1.0107 0.0474  0.1195  -0.1895 206 LEU C CA  
6130 C C   . LEU C 161 ? 0.7080 0.8181 1.0384 0.0606  0.1395  -0.2012 206 LEU C C   
6131 O O   . LEU C 161 ? 0.7543 0.8429 1.0528 0.0626  0.1550  -0.2062 206 LEU C O   
6132 C CB  . LEU C 161 ? 0.6879 0.7998 0.9902 0.0294  0.1342  -0.1853 206 LEU C CB  
6133 C CG  . LEU C 161 ? 0.6910 0.7930 0.9708 0.0172  0.1178  -0.1755 206 LEU C CG  
6134 C CD1 . LEU C 161 ? 0.6977 0.8037 0.9725 0.0013  0.1350  -0.1700 206 LEU C CD1 
6135 C CD2 . LEU C 161 ? 0.6846 0.8024 0.9950 0.0202  0.0936  -0.1767 206 LEU C CD2 
6147 N N   . PRO C 162 ? 0.5259 0.6702 0.9155 0.0700  0.1398  -0.2072 207 PRO C N   
6148 C CA  . PRO C 162 ? 0.4939 0.6518 0.9153 0.0845  0.1616  -0.2195 207 PRO C CA  
6149 C C   . PRO C 162 ? 0.5429 0.6954 0.9376 0.0747  0.1956  -0.2241 207 PRO C C   
6150 O O   . PRO C 162 ? 0.5007 0.6538 0.8738 0.0560  0.2037  -0.2163 207 PRO C O   
6151 C CB  . PRO C 162 ? 0.4824 0.6890 0.9775 0.0885  0.1581  -0.2232 207 PRO C CB  
6152 C CG  . PRO C 162 ? 0.4503 0.6586 0.9470 0.0855  0.1227  -0.2144 207 PRO C CG  
6153 C CD  . PRO C 162 ? 0.4581 0.6318 0.8901 0.0684  0.1185  -0.2046 207 PRO C CD  
6161 N N   . PRO C 163 ? 0.7533 0.8991 1.1470 0.0876  0.2166  -0.2366 208 PRO C N   
6162 C CA  . PRO C 163 ? 0.8488 0.9800 1.1974 0.0786  0.2460  -0.2412 208 PRO C CA  
6163 C C   . PRO C 163 ? 0.8968 1.0563 1.2595 0.0633  0.2715  -0.2369 208 PRO C C   
6164 O O   . PRO C 163 ? 0.9426 1.0863 1.2553 0.0486  0.2828  -0.2299 208 PRO C O   
6165 C CB  . PRO C 163 ? 0.8577 0.9806 1.2141 0.0985  0.2635  -0.2592 208 PRO C CB  
6166 C CG  . PRO C 163 ? 0.8476 0.9964 1.2738 0.1178  0.2507  -0.2625 208 PRO C CG  
6167 C CD  . PRO C 163 ? 0.7951 0.9435 1.2254 0.1123  0.2140  -0.2475 208 PRO C CD  
6175 N N   . ASN C 164 ? 0.8677 1.0689 1.2981 0.0658  0.2807  -0.2399 209 ASN C N   
6176 C CA  . ASN C 164 ? 0.8777 1.1044 1.3250 0.0506  0.3108  -0.2364 209 ASN C CA  
6177 C C   . ASN C 164 ? 0.8387 1.0676 1.2834 0.0295  0.2977  -0.2206 209 ASN C C   
6178 O O   . ASN C 164 ? 0.8388 1.0956 1.3226 0.0167  0.3142  -0.2170 209 ASN C O   
6179 C CB  . ASN C 164 ? 0.8806 1.1538 1.4070 0.0597  0.3276  -0.2466 209 ASN C CB  
6180 C CG  . ASN C 164 ? 0.9294 1.1948 1.4490 0.0797  0.3398  -0.2577 209 ASN C CG  
6181 O OD1 . ASN C 164 ? 0.9505 1.1800 1.4251 0.0907  0.3341  -0.2646 209 ASN C OD1 
6182 N ND2 . ASN C 164 ? 0.9536 1.2516 1.5190 0.0839  0.3570  -0.2602 209 ASN C ND2 
6189 N N   . THR C 165 ? 0.7121 0.9108 1.1129 0.0254  0.2701  -0.2116 210 THR C N   
6190 C CA  . THR C 165 ? 0.6536 0.8505 1.0511 0.0080  0.2568  -0.1984 210 THR C CA  
6191 C C   . THR C 165 ? 0.6679 0.8509 1.0249 -0.0078 0.2812  -0.1869 210 THR C C   
6192 O O   . THR C 165 ? 0.6773 0.8358 0.9777 -0.0058 0.2908  -0.1851 210 THR C O   
6193 C CB  . THR C 165 ? 0.6023 0.7728 0.9667 0.0105  0.2222  -0.1933 210 THR C CB  
6194 O OG1 . THR C 165 ? 0.5756 0.7553 0.9713 0.0268  0.2007  -0.2015 210 THR C OG1 
6195 C CG2 . THR C 165 ? 0.5613 0.7307 0.9274 -0.0052 0.2085  -0.1828 210 THR C CG2 
6203 N N   . ILE C 166 ? 0.6279 0.8257 1.0137 -0.0236 0.2905  -0.1789 211 ILE C N   
6204 C CA  . ILE C 166 ? 0.6398 0.8236 0.9916 -0.0383 0.3149  -0.1645 211 ILE C CA  
6205 C C   . ILE C 166 ? 0.6163 0.7673 0.9185 -0.0442 0.2939  -0.1508 211 ILE C C   
6206 O O   . ILE C 166 ? 0.5760 0.7251 0.8943 -0.0463 0.2678  -0.1505 211 ILE C O   
6207 C CB  . ILE C 166 ? 0.6824 0.8927 1.0899 -0.0541 0.3359  -0.1609 211 ILE C CB  
6208 C CG1 . ILE C 166 ? 0.7079 0.9535 1.1622 -0.0486 0.3643  -0.1732 211 ILE C CG1 
6209 C CG2 . ILE C 166 ? 0.6905 0.8784 1.0604 -0.0704 0.3568  -0.1411 211 ILE C CG2 
6210 C CD1 . ILE C 166 ? 0.7011 0.9806 1.2216 -0.0354 0.3453  -0.1906 211 ILE C CD1 
6222 N N   . MET C 167 ? 0.7359 0.8627 0.9773 -0.0459 0.3049  -0.1401 212 MET C N   
6223 C CA  . MET C 167 ? 0.7581 0.8572 0.9549 -0.0509 0.2895  -0.1249 212 MET C CA  
6224 C C   . MET C 167 ? 0.7687 0.8559 0.9344 -0.0611 0.3150  -0.1068 212 MET C C   
6225 O O   . MET C 167 ? 0.8281 0.9205 0.9779 -0.0609 0.3422  -0.1073 212 MET C O   
6226 C CB  . MET C 167 ? 0.8037 0.8834 0.9504 -0.0406 0.2698  -0.1283 212 MET C CB  
6227 C CG  . MET C 167 ? 0.8042 0.8875 0.9721 -0.0309 0.2438  -0.1416 212 MET C CG  
6228 S SD  . MET C 167 ? 0.8530 0.9104 0.9641 -0.0240 0.2222  -0.1428 212 MET C SD  
6229 C CE  . MET C 167 ? 0.8140 0.8750 0.9583 -0.0152 0.1948  -0.1531 212 MET C CE  
6239 N N   . GLU C 168 ? 0.7736 0.8432 0.9287 -0.0691 0.3071  -0.0903 213 GLU C N   
6240 C CA  . GLU C 168 ? 0.7950 0.8490 0.9229 -0.0784 0.3293  -0.0688 213 GLU C CA  
6241 C C   . GLU C 168 ? 0.7493 0.7759 0.8286 -0.0753 0.3107  -0.0524 213 GLU C C   
6242 O O   . GLU C 168 ? 0.7126 0.7330 0.8037 -0.0731 0.2856  -0.0543 213 GLU C O   
6243 C CB  . GLU C 168 ? 0.8365 0.8967 1.0167 -0.0934 0.3448  -0.0627 213 GLU C CB  
6244 C CG  . GLU C 168 ? 0.8803 0.9744 1.1183 -0.0976 0.3639  -0.0784 213 GLU C CG  
6245 C CD  . GLU C 168 ? 0.9206 1.0224 1.2113 -0.1161 0.3825  -0.0722 213 GLU C CD  
6246 O OE1 . GLU C 168 ? 0.9417 1.0224 1.2364 -0.1247 0.3722  -0.0619 213 GLU C OE1 
6247 O OE2 . GLU C 168 ? 0.9509 1.0798 1.2813 -0.1223 0.4088  -0.0785 213 GLU C OE2 
6254 N N   . TYR C 169 ? 0.7617 0.7738 0.7865 -0.0746 0.3231  -0.0364 214 TYR C N   
6255 C CA  . TYR C 169 ? 0.7532 0.7423 0.7338 -0.0709 0.3075  -0.0172 214 TYR C CA  
6256 C C   . TYR C 169 ? 0.8086 0.7792 0.7867 -0.0797 0.3267  0.0086  214 TYR C C   
6257 O O   . TYR C 169 ? 0.8528 0.8231 0.8187 -0.0863 0.3564  0.0179  214 TYR C O   
6258 C CB  . TYR C 169 ? 0.7782 0.7636 0.6950 -0.0630 0.3026  -0.0164 214 TYR C CB  
6259 C CG  . TYR C 169 ? 0.7708 0.7410 0.6509 -0.0570 0.2782  -0.0010 214 TYR C CG  
6260 C CD1 . TYR C 169 ? 0.7287 0.7024 0.6198 -0.0511 0.2486  -0.0115 214 TYR C CD1 
6261 C CD2 . TYR C 169 ? 0.8209 0.7745 0.6572 -0.0566 0.2851  0.0253  214 TYR C CD2 
6262 C CE1 . TYR C 169 ? 0.7381 0.7033 0.6035 -0.0452 0.2273  0.0018  214 TYR C CE1 
6263 C CE2 . TYR C 169 ? 0.8338 0.7776 0.6423 -0.0490 0.2609  0.0398  214 TYR C CE2 
6264 C CZ  . TYR C 169 ? 0.7913 0.7431 0.6176 -0.0435 0.2324  0.0270  214 TYR C CZ  
6265 O OH  . TYR C 169 ? 0.8007 0.7479 0.6067 -0.0356 0.2094  0.0407  214 TYR C OH  
6275 N N   . LYS C 170 ? 0.8789 0.8321 0.8683 -0.0797 0.3118  0.0202  215 LYS C N   
6276 C CA  . LYS C 170 ? 0.9866 0.9152 0.9764 -0.0871 0.3280  0.0455  215 LYS C CA  
6277 C C   . LYS C 170 ? 0.9925 0.8980 0.9398 -0.0763 0.3103  0.0673  215 LYS C C   
6278 O O   . LYS C 170 ? 0.9381 0.8454 0.8900 -0.0674 0.2830  0.0597  215 LYS C O   
6279 C CB  . LYS C 170 ? 1.0292 0.9553 1.0830 -0.0980 0.3299  0.0380  215 LYS C CB  
6280 C CG  . LYS C 170 ? 1.1132 1.0627 1.2143 -0.1112 0.3525  0.0230  215 LYS C CG  
6281 C CD  . LYS C 170 ? 1.1560 1.1006 1.3178 -0.1259 0.3566  0.0186  215 LYS C CD  
6282 C CE  . LYS C 170 ? 1.1831 1.1602 1.4007 -0.1384 0.3740  0.0005  215 LYS C CE  
6283 N NZ  . LYS C 170 ? 1.1950 1.1710 1.4746 -0.1546 0.3737  -0.0077 215 LYS C NZ  
6297 N N   . THR C 171 ? 1.0025 0.8880 0.9090 -0.0765 0.3263  0.0953  216 THR C N   
6298 C CA  . THR C 171 ? 1.0225 0.8853 0.8914 -0.0652 0.3113  0.1210  216 THR C CA  
6299 C C   . THR C 171 ? 1.1888 1.0189 1.0811 -0.0709 0.3253  0.1436  216 THR C C   
6300 O O   . THR C 171 ? 1.1036 0.9310 1.0452 -0.0850 0.3422  0.1347  216 THR C O   
6301 C CB  . THR C 171 ? 1.0614 0.9233 0.8593 -0.0592 0.3152  0.1379  216 THR C CB  
6302 O OG1 . THR C 171 ? 1.0785 0.9274 0.8601 -0.0697 0.3505  0.1557  216 THR C OG1 
6303 C CG2 . THR C 171 ? 1.0023 0.8929 0.7803 -0.0562 0.3048  0.1114  216 THR C CG2 
6311 N N   . HIS C 172 ? 1.4045 1.2092 1.2630 -0.0598 0.3174  0.1728  217 HIS C N   
6312 C CA  . HIS C 172 ? 1.4900 1.2563 1.3662 -0.0632 0.3310  0.1972  217 HIS C CA  
6313 C C   . HIS C 172 ? 1.5097 1.2533 1.3499 -0.0710 0.3621  0.2281  217 HIS C C   
6314 O O   . HIS C 172 ? 1.5580 1.2726 1.4253 -0.0831 0.3851  0.2420  217 HIS C O   
6315 C CB  . HIS C 172 ? 1.4503 1.1983 1.3173 -0.0442 0.3054  0.2133  217 HIS C CB  
6316 C CG  . HIS C 172 ? 1.4349 1.2032 1.3363 -0.0369 0.2784  0.1854  217 HIS C CG  
6317 N ND1 . HIS C 172 ? 1.3976 1.2010 1.2837 -0.0305 0.2570  0.1657  217 HIS C ND1 
6318 C CD2 . HIS C 172 ? 1.4118 1.1685 1.3599 -0.0358 0.2710  0.1735  217 HIS C CD2 
6319 C CE1 . HIS C 172 ? 1.3451 1.1583 1.2670 -0.0259 0.2386  0.1453  217 HIS C CE1 
6320 N NE2 . HIS C 172 ? 1.3496 1.1357 1.3076 -0.0285 0.2466  0.1489  217 HIS C NE2 
6328 N N   . THR C 173 ? 1.5579 1.3127 1.3361 -0.0657 0.3643  0.2384  218 THR C N   
6329 C CA  . THR C 173 ? 1.6127 1.3470 1.3467 -0.0728 0.3956  0.2686  218 THR C CA  
6330 C C   . THR C 173 ? 1.6035 1.3569 1.3592 -0.0926 0.4299  0.2512  218 THR C C   
6331 O O   . THR C 173 ? 1.5390 1.3094 1.3601 -0.1037 0.4335  0.2236  218 THR C O   
6332 C CB  . THR C 173 ? 1.6417 1.3797 1.2920 -0.0583 0.3830  0.2871  218 THR C CB  
6333 O OG1 . THR C 173 ? 1.7063 1.4226 1.3080 -0.0657 0.4159  0.3175  218 THR C OG1 
6334 C CG2 . THR C 173 ? 1.5852 1.3646 1.2184 -0.0561 0.3690  0.2533  218 THR C CG2 
6342 N N   . LYS D 7   ? 1.4318 1.9070 1.1203 -0.0290 -0.2655 -0.2232 37  LYS D N   
6343 C CA  . LYS D 7   ? 1.3748 1.8761 1.1461 -0.0192 -0.2724 -0.2425 37  LYS D CA  
6344 C C   . LYS D 7   ? 1.3004 1.8008 1.1198 -0.0282 -0.2328 -0.2636 37  LYS D C   
6345 O O   . LYS D 7   ? 1.3005 1.7756 1.0914 -0.0360 -0.2056 -0.2526 37  LYS D O   
6346 C CB  . LYS D 7   ? 1.3624 1.8579 1.1467 0.0017  -0.2992 -0.2145 37  LYS D CB  
6347 C CG  . LYS D 7   ? 1.3002 1.8223 1.1750 0.0128  -0.3047 -0.2359 37  LYS D CG  
6348 C CD  . LYS D 7   ? 1.2964 1.8146 1.1899 0.0357  -0.3343 -0.2103 37  LYS D CD  
6349 C CE  . LYS D 7   ? 1.2408 1.7855 1.2309 0.0455  -0.3355 -0.2354 37  LYS D CE  
6350 N NZ  . LYS D 7   ? 1.2457 1.7867 1.2648 0.0695  -0.3642 -0.2136 37  LYS D NZ  
6364 N N   . LEU D 8   ? 1.2435 1.7698 1.1371 -0.0278 -0.2295 -0.2934 38  LEU D N   
6365 C CA  . LEU D 8   ? 1.1489 1.6727 1.0917 -0.0369 -0.1941 -0.3134 38  LEU D CA  
6366 C C   . LEU D 8   ? 1.0898 1.6181 1.0867 -0.0251 -0.1972 -0.3115 38  LEU D C   
6367 O O   . LEU D 8   ? 1.1239 1.6758 1.1648 -0.0141 -0.2207 -0.3191 38  LEU D O   
6368 C CB  . LEU D 8   ? 1.1282 1.6745 1.1165 -0.0495 -0.1807 -0.3514 38  LEU D CB  
6369 C CG  . LEU D 8   ? 1.1429 1.6892 1.0893 -0.0624 -0.1736 -0.3611 38  LEU D CG  
6370 C CD1 . LEU D 8   ? 1.1254 1.6961 1.1288 -0.0728 -0.1607 -0.4005 38  LEU D CD1 
6371 C CD2 . LEU D 8   ? 1.1265 1.6417 1.0306 -0.0714 -0.1450 -0.3467 38  LEU D CD2 
6383 N N   . ALA D 9   ? 1.1314 1.6214 1.1282 -0.0258 -0.1662 -0.2925 39  ALA D N   
6384 C CA  . ALA D 9   ? 1.0407 1.5155 1.0851 -0.0153 -0.1557 -0.2822 39  ALA D CA  
6385 C C   . ALA D 9   ? 0.9389 1.4248 1.0504 -0.0249 -0.1307 -0.3113 39  ALA D C   
6386 O O   . ALA D 9   ? 0.9332 1.4199 1.0491 -0.0402 -0.1103 -0.3304 39  ALA D O   
6387 C CB  . ALA D 9   ? 1.0280 1.4576 1.0399 -0.0125 -0.1346 -0.2509 39  ALA D CB  
6393 N N   . ASP D 10  ? 0.7493 1.2420 0.9158 -0.0162 -0.1304 -0.3146 40  ASP D N   
6394 C CA  . ASP D 10  ? 0.6493 1.1522 0.8823 -0.0259 -0.1051 -0.3407 40  ASP D CA  
6395 C C   . ASP D 10  ? 0.5540 1.0175 0.7911 -0.0293 -0.0669 -0.3259 40  ASP D C   
6396 O O   . ASP D 10  ? 0.4950 0.9553 0.7684 -0.0419 -0.0389 -0.3424 40  ASP D O   
6397 C CB  . ASP D 10  ? 0.6451 1.1831 0.9436 -0.0168 -0.1238 -0.3586 40  ASP D CB  
6398 C CG  . ASP D 10  ? 0.6864 1.2638 0.9788 -0.0096 -0.1694 -0.3701 40  ASP D CG  
6399 O OD1 . ASP D 10  ? 0.7152 1.2864 0.9667 0.0055  -0.1983 -0.3446 40  ASP D OD1 
6400 O OD2 . ASP D 10  ? 0.6947 1.3082 1.0228 -0.0191 -0.1771 -0.4043 40  ASP D OD2 
6405 N N   . TYR D 11  ? 0.4921 0.9247 0.6928 -0.0188 -0.0657 -0.2956 41  TYR D N   
6406 C CA  . TYR D 11  ? 0.4609 0.8558 0.6554 -0.0212 -0.0335 -0.2807 41  TYR D CA  
6407 C C   . TYR D 11  ? 0.4514 0.8165 0.5881 -0.0258 -0.0262 -0.2626 41  TYR D C   
6408 O O   . TYR D 11  ? 0.4537 0.8034 0.5477 -0.0173 -0.0389 -0.2402 41  TYR D O   
6409 C CB  . TYR D 11  ? 0.4698 0.8532 0.6715 -0.0070 -0.0359 -0.2651 41  TYR D CB  
6410 C CG  . TYR D 11  ? 0.4884 0.8960 0.7576 -0.0049 -0.0305 -0.2856 41  TYR D CG  
6411 C CD1 . TYR D 11  ? 0.4939 0.8941 0.7962 -0.0165 0.0046  -0.2979 41  TYR D CD1 
6412 C CD2 . TYR D 11  ? 0.5122 0.9493 0.8139 0.0085  -0.0600 -0.2924 41  TYR D CD2 
6413 C CE1 . TYR D 11  ? 0.5069 0.9303 0.8745 -0.0169 0.0142  -0.3188 41  TYR D CE1 
6414 C CE2 . TYR D 11  ? 0.5250 0.9876 0.8980 0.0103  -0.0540 -0.3148 41  TYR D CE2 
6415 C CZ  . TYR D 11  ? 0.5158 0.9721 0.9220 -0.0035 -0.0148 -0.3291 41  TYR D CZ  
6416 O OH  . TYR D 11  ? 0.5131 0.9951 0.9928 -0.0040 -0.0040 -0.3530 41  TYR D OH  
6426 N N   . ARG D 12  ? 0.4620 0.8186 0.6033 -0.0394 -0.0047 -0.2731 42  ARG D N   
6427 C CA  . ARG D 12  ? 0.4847 0.8158 0.5847 -0.0445 0.0045  -0.2612 42  ARG D CA  
6428 C C   . ARG D 12  ? 0.4635 0.7615 0.5716 -0.0492 0.0337  -0.2534 42  ARG D C   
6429 O O   . ARG D 12  ? 0.4605 0.7595 0.6077 -0.0549 0.0511  -0.2644 42  ARG D O   
6430 C CB  . ARG D 12  ? 0.5625 0.9138 0.6605 -0.0559 0.0005  -0.2825 42  ARG D CB  
6431 C CG  . ARG D 12  ? 0.6658 1.0491 0.7444 -0.0524 -0.0299 -0.2897 42  ARG D CG  
6432 C CD  . ARG D 12  ? 0.7639 1.1656 0.8326 -0.0654 -0.0306 -0.3129 42  ARG D CD  
6433 N NE  . ARG D 12  ? 0.8881 1.3206 0.9285 -0.0630 -0.0610 -0.3196 42  ARG D NE  
6434 C CZ  . ARG D 12  ? 0.9936 1.4190 0.9742 -0.0590 -0.0750 -0.2995 42  ARG D CZ  
6435 N NH1 . ARG D 12  ? 1.0456 1.4365 0.9954 -0.0571 -0.0608 -0.2742 42  ARG D NH1 
6436 N NH2 . ARG D 12  ? 1.0711 1.5237 1.0224 -0.0574 -0.1036 -0.3046 42  ARG D NH2 
6450 N N   . TYR D 13  ? 0.4565 0.7249 0.5274 -0.0471 0.0387  -0.2339 43  TYR D N   
6451 C CA  . TYR D 13  ? 0.4565 0.6910 0.5263 -0.0497 0.0609  -0.2229 43  TYR D CA  
6452 C C   . TYR D 13  ? 0.4662 0.6835 0.5111 -0.0524 0.0622  -0.2164 43  TYR D C   
6453 O O   . TYR D 13  ? 0.4448 0.6562 0.4567 -0.0464 0.0508  -0.2033 43  TYR D O   
6454 C CB  . TYR D 13  ? 0.4521 0.6657 0.5061 -0.0400 0.0639  -0.2036 43  TYR D CB  
6455 C CG  . TYR D 13  ? 0.4710 0.7026 0.5534 -0.0362 0.0638  -0.2115 43  TYR D CG  
6456 C CD1 . TYR D 13  ? 0.4745 0.7062 0.5917 -0.0437 0.0855  -0.2220 43  TYR D CD1 
6457 C CD2 . TYR D 13  ? 0.4578 0.7053 0.5364 -0.0254 0.0431  -0.2084 43  TYR D CD2 
6458 C CE1 . TYR D 13  ? 0.4658 0.7169 0.6167 -0.0410 0.0879  -0.2327 43  TYR D CE1 
6459 C CE2 . TYR D 13  ? 0.4560 0.7218 0.5696 -0.0207 0.0422  -0.2180 43  TYR D CE2 
6460 C CZ  . TYR D 13  ? 0.4562 0.7255 0.6074 -0.0288 0.0652  -0.2318 43  TYR D CZ  
6461 O OH  . TYR D 13  ? 0.4634 0.7536 0.6564 -0.0249 0.0665  -0.2446 43  TYR D OH  
6471 N N   . GLY D 14  ? 0.5002 0.7091 0.5661 -0.0615 0.0771  -0.2263 44  GLY D N   
6472 C CA  . GLY D 14  ? 0.5033 0.6927 0.5562 -0.0629 0.0808  -0.2208 44  GLY D CA  
6473 C C   . GLY D 14  ? 0.5205 0.6762 0.5494 -0.0542 0.0828  -0.1954 44  GLY D C   
6474 O O   . GLY D 14  ? 0.5055 0.6495 0.5278 -0.0491 0.0860  -0.1835 44  GLY D O   
6478 N N   . ARG D 15  ? 0.4400 0.5818 0.4575 -0.0530 0.0810  -0.1899 45  ARG D N   
6479 C CA  . ARG D 15  ? 0.4099 0.5234 0.4049 -0.0442 0.0780  -0.1685 45  ARG D CA  
6480 C C   . ARG D 15  ? 0.4231 0.5096 0.4214 -0.0424 0.0887  -0.1564 45  ARG D C   
6481 O O   . ARG D 15  ? 0.4364 0.5084 0.4107 -0.0355 0.0865  -0.1414 45  ARG D O   
6482 C CB  . ARG D 15  ? 0.4184 0.5239 0.4151 -0.0444 0.0757  -0.1694 45  ARG D CB  
6483 C CG  . ARG D 15  ? 0.4255 0.5092 0.4002 -0.0350 0.0672  -0.1511 45  ARG D CG  
6484 C CD  . ARG D 15  ? 0.4509 0.5344 0.4359 -0.0363 0.0650  -0.1568 45  ARG D CD  
6485 N NE  . ARG D 15  ? 0.4791 0.5463 0.4495 -0.0280 0.0550  -0.1431 45  ARG D NE  
6486 C CZ  . ARG D 15  ? 0.5159 0.5599 0.4938 -0.0214 0.0503  -0.1343 45  ARG D CZ  
6487 N NH1 . ARG D 15  ? 0.5227 0.5524 0.5213 -0.0216 0.0556  -0.1340 45  ARG D NH1 
6488 N NH2 . ARG D 15  ? 0.5225 0.5569 0.4887 -0.0143 0.0387  -0.1257 45  ARG D NH2 
6502 N N   . GLU D 16  ? 0.4307 0.5087 0.4574 -0.0493 0.1014  -0.1629 46  GLU D N   
6503 C CA  . GLU D 16  ? 0.4527 0.5009 0.4787 -0.0493 0.1140  -0.1483 46  GLU D CA  
6504 C C   . GLU D 16  ? 0.4568 0.5124 0.4775 -0.0511 0.1229  -0.1478 46  GLU D C   
6505 O O   . GLU D 16  ? 0.4771 0.5093 0.4745 -0.0482 0.1301  -0.1313 46  GLU D O   
6506 C CB  . GLU D 16  ? 0.4644 0.5019 0.5287 -0.0576 0.1274  -0.1562 46  GLU D CB  
6507 C CG  . GLU D 16  ? 0.4682 0.4891 0.5425 -0.0538 0.1207  -0.1533 46  GLU D CG  
6508 C CD  . GLU D 16  ? 0.4884 0.4748 0.5319 -0.0429 0.1121  -0.1262 46  GLU D CD  
6509 O OE1 . GLU D 16  ? 0.5156 0.4761 0.5422 -0.0426 0.1206  -0.1082 46  GLU D OE1 
6510 O OE2 . GLU D 16  ? 0.4881 0.4743 0.5229 -0.0354 0.0970  -0.1236 46  GLU D OE2 
6517 N N   . GLU D 17  ? 0.4835 0.5728 0.5261 -0.0558 0.1223  -0.1673 47  GLU D N   
6518 C CA  . GLU D 17  ? 0.5113 0.6123 0.5604 -0.0570 0.1303  -0.1708 47  GLU D CA  
6519 C C   . GLU D 17  ? 0.4889 0.5862 0.5032 -0.0464 0.1207  -0.1579 47  GLU D C   
6520 O O   . GLU D 17  ? 0.5092 0.5954 0.5146 -0.0457 0.1328  -0.1515 47  GLU D O   
6521 C CB  . GLU D 17  ? 0.5533 0.6945 0.6373 -0.0624 0.1254  -0.1959 47  GLU D CB  
6522 C CG  . GLU D 17  ? 0.5962 0.7473 0.7160 -0.0732 0.1314  -0.2150 47  GLU D CG  
6523 C CD  . GLU D 17  ? 0.6401 0.8340 0.7915 -0.0782 0.1233  -0.2421 47  GLU D CD  
6524 O OE1 . GLU D 17  ? 0.6499 0.8600 0.8174 -0.0772 0.1246  -0.2474 47  GLU D OE1 
6525 O OE2 . GLU D 17  ? 0.6516 0.8645 0.8124 -0.0828 0.1147  -0.2595 47  GLU D OE2 
6532 N N   . MET D 18  ? 0.5259 0.6313 0.5211 -0.0390 0.1011  -0.1552 48  MET D N   
6533 C CA  . MET D 18  ? 0.5350 0.6325 0.5005 -0.0290 0.0921  -0.1432 48  MET D CA  
6534 C C   . MET D 18  ? 0.5602 0.6235 0.4977 -0.0263 0.0999  -0.1268 48  MET D C   
6535 O O   . MET D 18  ? 0.5772 0.6331 0.4978 -0.0225 0.1048  -0.1222 48  MET D O   
6536 C CB  . MET D 18  ? 0.5208 0.6258 0.4715 -0.0237 0.0729  -0.1406 48  MET D CB  
6537 C CG  . MET D 18  ? 0.5240 0.6610 0.4885 -0.0250 0.0616  -0.1528 48  MET D CG  
6538 S SD  . MET D 18  ? 0.5163 0.6722 0.4914 -0.0177 0.0543  -0.1559 48  MET D SD  
6539 C CE  . MET D 18  ? 0.5222 0.6567 0.4667 -0.0068 0.0456  -0.1387 48  MET D CE  
6549 N N   . LEU D 19  ? 0.5526 0.5952 0.4851 -0.0279 0.1005  -0.1188 49  LEU D N   
6550 C CA  . LEU D 19  ? 0.5679 0.5771 0.4687 -0.0237 0.1019  -0.1011 49  LEU D CA  
6551 C C   . LEU D 19  ? 0.5943 0.5866 0.4889 -0.0298 0.1238  -0.0951 49  LEU D C   
6552 O O   . LEU D 19  ? 0.6351 0.6082 0.4938 -0.0267 0.1278  -0.0839 49  LEU D O   
6553 C CB  . LEU D 19  ? 0.5639 0.5566 0.4685 -0.0222 0.0935  -0.0944 49  LEU D CB  
6554 C CG  . LEU D 19  ? 0.5289 0.5365 0.4398 -0.0181 0.0761  -0.1007 49  LEU D CG  
6555 C CD1 . LEU D 19  ? 0.5333 0.5284 0.4614 -0.0175 0.0710  -0.0992 49  LEU D CD1 
6556 C CD2 . LEU D 19  ? 0.5272 0.5311 0.4091 -0.0096 0.0632  -0.0940 49  LEU D CD2 
6568 N N   . ALA D 20  ? 0.5713 0.5705 0.4998 -0.0398 0.1397  -0.1038 50  ALA D N   
6569 C CA  . ALA D 20  ? 0.5975 0.5791 0.5239 -0.0482 0.1650  -0.0980 50  ALA D CA  
6570 C C   . ALA D 20  ? 0.6169 0.6086 0.5300 -0.0478 0.1753  -0.1029 50  ALA D C   
6571 O O   . ALA D 20  ? 0.6519 0.6226 0.5431 -0.0532 0.1964  -0.0938 50  ALA D O   
6572 C CB  . ALA D 20  ? 0.5789 0.5727 0.5559 -0.0601 0.1806  -0.1123 50  ALA D CB  
6578 N N   . LEU D 21  ? 0.5931 0.6153 0.5190 -0.0418 0.1619  -0.1169 51  LEU D N   
6579 C CA  . LEU D 21  ? 0.6248 0.6607 0.5519 -0.0405 0.1710  -0.1260 51  LEU D CA  
6580 C C   . LEU D 21  ? 0.6683 0.6901 0.5513 -0.0310 0.1619  -0.1173 51  LEU D C   
6581 O O   . LEU D 21  ? 0.6585 0.6913 0.5438 -0.0286 0.1686  -0.1269 51  LEU D O   
6582 C CB  . LEU D 21  ? 0.5760 0.6521 0.5467 -0.0379 0.1594  -0.1458 51  LEU D CB  
6583 C CG  . LEU D 21  ? 0.5499 0.6469 0.5693 -0.0480 0.1678  -0.1612 51  LEU D CG  
6584 C CD1 . LEU D 21  ? 0.5259 0.6618 0.5778 -0.0430 0.1468  -0.1780 51  LEU D CD1 
6585 C CD2 . LEU D 21  ? 0.5784 0.6735 0.6194 -0.0587 0.1988  -0.1684 51  LEU D CD2 
6597 N N   . PHE D 22  ? 0.7303 0.7299 0.5789 -0.0253 0.1465  -0.1022 52  PHE D N   
6598 C CA  . PHE D 22  ? 0.7809 0.7658 0.5876 -0.0174 0.1376  -0.0959 52  PHE D CA  
6599 C C   . PHE D 22  ? 0.8720 0.8316 0.6395 -0.0229 0.1591  -0.0875 52  PHE D C   
6600 O O   . PHE D 22  ? 0.9038 0.8433 0.6629 -0.0306 0.1736  -0.0756 52  PHE D O   
6601 C CB  . PHE D 22  ? 0.7830 0.7548 0.5721 -0.0103 0.1134  -0.0848 52  PHE D CB  
6602 C CG  . PHE D 22  ? 0.8060 0.7594 0.5508 -0.0033 0.1030  -0.0782 52  PHE D CG  
6603 C CD1 . PHE D 22  ? 0.7958 0.7612 0.5410 0.0038  0.0905  -0.0878 52  PHE D CD1 
6604 C CD2 . PHE D 22  ? 0.8521 0.7752 0.5552 -0.0037 0.1044  -0.0625 52  PHE D CD2 
6605 C CE1 . PHE D 22  ? 0.8277 0.7782 0.5361 0.0094  0.0805  -0.0860 52  PHE D CE1 
6606 C CE2 . PHE D 22  ? 0.8895 0.7980 0.5496 0.0029  0.0917  -0.0591 52  PHE D CE2 
6607 C CZ  . PHE D 22  ? 0.8720 0.7958 0.5366 0.0090  0.0802  -0.0729 52  PHE D CZ  
6617 N N   . LEU D 23  ? 0.9573 0.9165 0.6999 -0.0195 0.1626  -0.0939 53  LEU D N   
6618 C CA  . LEU D 23  ? 1.0670 1.0034 0.7629 -0.0254 0.1845  -0.0882 53  LEU D CA  
6619 C C   . LEU D 23  ? 1.1375 1.0530 0.7781 -0.0173 0.1652  -0.0792 53  LEU D C   
6620 O O   . LEU D 23  ? 1.1315 1.0593 0.7747 -0.0091 0.1495  -0.0911 53  LEU D O   
6621 C CB  . LEU D 23  ? 1.0986 1.0541 0.8129 -0.0300 0.2088  -0.1087 53  LEU D CB  
6622 C CG  . LEU D 23  ? 1.0919 1.0729 0.8684 -0.0375 0.2258  -0.1216 53  LEU D CG  
6623 C CD1 . LEU D 23  ? 1.1009 1.1032 0.9033 -0.0401 0.2478  -0.1446 53  LEU D CD1 
6624 C CD2 . LEU D 23  ? 1.1220 1.0843 0.8963 -0.0503 0.2470  -0.1085 53  LEU D CD2 
6636 N N   . LYS D 24  ? 1.2470 1.1302 0.8399 -0.0195 0.1650  -0.0581 54  LYS D N   
6637 C CA  . LYS D 24  ? 1.3247 1.1884 0.8646 -0.0112 0.1420  -0.0492 54  LYS D CA  
6638 C C   . LYS D 24  ? 1.3648 1.2373 0.8799 -0.0090 0.1450  -0.0678 54  LYS D C   
6639 O O   . LYS D 24  ? 1.3653 1.2383 0.8652 0.0001  0.1198  -0.0728 54  LYS D O   
6640 C CB  . LYS D 24  ? 1.4104 1.2359 0.8941 -0.0151 0.1469  -0.0230 54  LYS D CB  
6641 C CG  . LYS D 24  ? 1.4159 1.2281 0.9277 -0.0170 0.1446  -0.0045 54  LYS D CG  
6642 C CD  . LYS D 24  ? 1.5073 1.2762 0.9620 -0.0186 0.1451  0.0255  54  LYS D CD  
6643 C CE  . LYS D 24  ? 1.4945 1.2480 0.9861 -0.0213 0.1472  0.0424  54  LYS D CE  
6644 N NZ  . LYS D 24  ? 1.5795 1.2862 1.0179 -0.0212 0.1448  0.0758  54  LYS D NZ  
6658 N N   . ASP D 25  ? 1.3771 1.2577 0.8933 -0.0177 0.1767  -0.0810 55  ASP D N   
6659 C CA  . ASP D 25  ? 1.3970 1.2886 0.9003 -0.0165 0.1844  -0.1038 55  ASP D CA  
6660 C C   . ASP D 25  ? 1.3391 1.2645 0.9141 -0.0148 0.1918  -0.1261 55  ASP D C   
6661 O O   . ASP D 25  ? 1.3389 1.2761 0.9487 -0.0228 0.2163  -0.1308 55  ASP D O   
6662 C CB  . ASP D 25  ? 1.4910 1.3651 0.9371 -0.0280 0.2171  -0.1039 55  ASP D CB  
6663 C CG  . ASP D 25  ? 1.5623 1.4000 0.9281 -0.0285 0.2065  -0.0788 55  ASP D CG  
6664 O OD1 . ASP D 25  ? 1.5592 1.3897 0.9143 -0.0175 0.1699  -0.0690 55  ASP D OD1 
6665 O OD2 . ASP D 25  ? 1.6310 1.4503 0.9520 -0.0394 0.2322  -0.0679 55  ASP D OD2 
6670 N N   . ASN D 26  ? 1.3432 1.2832 0.9425 -0.0044 0.1697  -0.1392 56  ASN D N   
6671 C CA  . ASN D 26  ? 1.3053 1.2740 0.9698 -0.0001 0.1706  -0.1574 56  ASN D CA  
6672 C C   . ASN D 26  ? 1.2883 1.2629 0.9511 0.0038  0.1755  -0.1810 56  ASN D C   
6673 O O   . ASN D 26  ? 1.3151 1.2775 0.9430 0.0084  0.1598  -0.1834 56  ASN D O   
6674 C CB  . ASN D 26  ? 1.2900 1.2688 0.9914 0.0086  0.1405  -0.1501 56  ASN D CB  
6675 C CG  . ASN D 26  ? 1.3085 1.2846 1.0182 0.0047  0.1363  -0.1319 56  ASN D CG  
6676 O OD1 . ASN D 26  ? 1.3266 1.3065 1.0494 -0.0036 0.1567  -0.1304 56  ASN D OD1 
6677 N ND2 . ASN D 26  ? 1.2980 1.2683 1.0049 0.0098  0.1112  -0.1205 56  ASN D ND2 
6684 N N   . LYS D 27  ? 1.2318 1.2261 0.9374 0.0022  0.1967  -0.2008 57  LYS D N   
6685 C CA  . LYS D 27  ? 1.1843 1.1875 0.9065 0.0077  0.2001  -0.2266 57  LYS D CA  
6686 C C   . LYS D 27  ? 1.0724 1.0839 0.8373 0.0207  0.1688  -0.2269 57  LYS D C   
6687 O O   . LYS D 27  ? 1.0042 1.0274 0.8096 0.0247  0.1548  -0.2157 57  LYS D O   
6688 C CB  . LYS D 27  ? 1.1950 1.2187 0.9621 0.0031  0.2314  -0.2489 57  LYS D CB  
6689 C CG  . LYS D 27  ? 1.2270 1.2600 1.0207 0.0092  0.2368  -0.2770 57  LYS D CG  
6690 C CD  . LYS D 27  ? 1.2413 1.2952 1.0898 0.0056  0.2624  -0.2932 57  LYS D CD  
6691 C CE  . LYS D 27  ? 1.2613 1.3234 1.1443 0.0123  0.2649  -0.3190 57  LYS D CE  
6692 N NZ  . LYS D 27  ? 1.2732 1.3563 1.2120 0.0077  0.2897  -0.3362 57  LYS D NZ  
6706 N N   . ILE D 28  ? 0.9892 0.9936 0.7427 0.0262  0.1583  -0.2398 58  ILE D N   
6707 C CA  . ILE D 28  ? 0.8796 0.8872 0.6727 0.0372  0.1311  -0.2390 58  ILE D CA  
6708 C C   . ILE D 28  ? 0.7747 0.8025 0.6386 0.0439  0.1349  -0.2501 58  ILE D C   
6709 O O   . ILE D 28  ? 0.7759 0.8131 0.6610 0.0434  0.1563  -0.2737 58  ILE D O   
6710 C CB  . ILE D 28  ? 0.9316 0.9271 0.7030 0.0403  0.1219  -0.2546 58  ILE D CB  
6711 C CG1 . ILE D 28  ? 0.9650 0.9423 0.6688 0.0356  0.1114  -0.2427 58  ILE D CG1 
6712 C CG2 . ILE D 28  ? 0.8872 0.8836 0.7062 0.0502  0.0982  -0.2537 58  ILE D CG2 
6713 C CD1 . ILE D 28  ? 1.0051 0.9726 0.6826 0.0376  0.1009  -0.2617 58  ILE D CD1 
6725 N N   . PRO D 29  ? 0.5878 0.6232 0.4899 0.0505  0.1146  -0.2348 59  PRO D N   
6726 C CA  . PRO D 29  ? 0.5701 0.6226 0.5388 0.0596  0.1117  -0.2438 59  PRO D CA  
6727 C C   . PRO D 29  ? 0.5835 0.6297 0.5777 0.0678  0.1087  -0.2627 59  PRO D C   
6728 O O   . PRO D 29  ? 0.5896 0.6189 0.5631 0.0692  0.0955  -0.2603 59  PRO D O   
6729 C CB  . PRO D 29  ? 0.5373 0.5931 0.5223 0.0641  0.0863  -0.2192 59  PRO D CB  
6730 C CG  . PRO D 29  ? 0.5337 0.5814 0.4697 0.0548  0.0852  -0.2018 59  PRO D CG  
6731 C CD  . PRO D 29  ? 0.5639 0.5935 0.4502 0.0496  0.0941  -0.2090 59  PRO D CD  
6739 N N   . SER D 30  ? 0.6780 0.7389 0.7242 0.0732  0.1214  -0.2840 60  SER D N   
6740 C CA  . SER D 30  ? 0.6995 0.7552 0.7814 0.0817  0.1207  -0.3058 60  SER D CA  
6741 C C   . SER D 30  ? 0.6880 0.7282 0.7875 0.0908  0.0913  -0.2888 60  SER D C   
6742 O O   . SER D 30  ? 0.7142 0.7398 0.8174 0.0934  0.0884  -0.3020 60  SER D O   
6743 C CB  . SER D 30  ? 0.7111 0.7880 0.8634 0.0889  0.1335  -0.3272 60  SER D CB  
6744 O OG  . SER D 30  ? 0.7368 0.8075 0.9389 0.1002  0.1270  -0.3441 60  SER D OG  
6750 N N   . ASP D 31  ? 0.6763 0.7190 0.7855 0.0944  0.0708  -0.2606 61  ASP D N   
6751 C CA  . ASP D 31  ? 0.6686 0.6957 0.7962 0.1021  0.0460  -0.2420 61  ASP D CA  
6752 C C   . ASP D 31  ? 0.6746 0.6808 0.7587 0.0954  0.0401  -0.2366 61  ASP D C   
6753 O O   . ASP D 31  ? 0.6733 0.6627 0.7778 0.1000  0.0281  -0.2337 61  ASP D O   
6754 C CB  . ASP D 31  ? 0.6534 0.6887 0.7875 0.1049  0.0277  -0.2132 61  ASP D CB  
6755 C CG  . ASP D 31  ? 0.6660 0.7221 0.8556 0.1148  0.0247  -0.2180 61  ASP D CG  
6756 O OD1 . ASP D 31  ? 0.6907 0.7467 0.9319 0.1251  0.0265  -0.2352 61  ASP D OD1 
6757 O OD2 . ASP D 31  ? 0.6514 0.7251 0.8374 0.1127  0.0198  -0.2066 61  ASP D OD2 
6762 N N   . LEU D 32  ? 0.6288 0.6351 0.6570 0.0848  0.0475  -0.2347 62  LEU D N   
6763 C CA  . LEU D 32  ? 0.6288 0.6186 0.6197 0.0792  0.0389  -0.2309 62  LEU D CA  
6764 C C   . LEU D 32  ? 0.6624 0.6439 0.6427 0.0779  0.0471  -0.2597 62  LEU D C   
6765 O O   . LEU D 32  ? 0.6538 0.6229 0.6130 0.0747  0.0369  -0.2612 62  LEU D O   
6766 C CB  . LEU D 32  ? 0.6173 0.6095 0.5569 0.0703  0.0393  -0.2159 62  LEU D CB  
6767 C CG  . LEU D 32  ? 0.5926 0.5881 0.5355 0.0694  0.0261  -0.1883 62  LEU D CG  
6768 C CD1 . LEU D 32  ? 0.5971 0.5971 0.4994 0.0613  0.0306  -0.1780 62  LEU D CD1 
6769 C CD2 . LEU D 32  ? 0.5846 0.5655 0.5344 0.0698  0.0099  -0.1777 62  LEU D CD2 
6781 N N   . LEU D 33  ? 0.6636 0.6534 0.6603 0.0798  0.0656  -0.2854 63  LEU D N   
6782 C CA  . LEU D 33  ? 0.7109 0.6942 0.7002 0.0784  0.0745  -0.3173 63  LEU D CA  
6783 C C   . LEU D 33  ? 0.7289 0.7025 0.7782 0.0870  0.0661  -0.3298 63  LEU D C   
6784 O O   . LEU D 33  ? 0.6982 0.6656 0.7488 0.0859  0.0712  -0.3592 63  LEU D O   
6785 C CB  . LEU D 33  ? 0.7419 0.7383 0.7205 0.0747  0.1027  -0.3426 63  LEU D CB  
6786 C CG  . LEU D 33  ? 0.7546 0.7556 0.6703 0.0644  0.1152  -0.3310 63  LEU D CG  
6787 C CD1 . LEU D 33  ? 0.7930 0.8059 0.7022 0.0588  0.1481  -0.3562 63  LEU D CD1 
6788 C CD2 . LEU D 33  ? 0.7808 0.7676 0.6289 0.0579  0.1035  -0.3248 63  LEU D CD2 
6800 N N   . ASP D 34  ? 0.7673 0.7381 0.8647 0.0953  0.0530  -0.3083 64  ASP D N   
6801 C CA  . ASP D 34  ? 0.8018 0.7561 0.9531 0.1030  0.0419  -0.3112 64  ASP D CA  
6802 C C   . ASP D 34  ? 0.8244 0.7623 0.9526 0.0962  0.0320  -0.3142 64  ASP D C   
6803 O O   . ASP D 34  ? 0.8051 0.7419 0.8899 0.0891  0.0231  -0.2953 64  ASP D O   
6804 C CB  . ASP D 34  ? 0.8008 0.7512 0.9873 0.1110  0.0258  -0.2773 64  ASP D CB  
6805 C CG  . ASP D 34  ? 0.8366 0.7658 1.0818 0.1199  0.0153  -0.2753 64  ASP D CG  
6806 O OD1 . ASP D 34  ? 0.8665 0.7815 1.1222 0.1173  0.0177  -0.2963 64  ASP D OD1 
6807 O OD2 . ASP D 34  ? 0.8415 0.7671 1.1223 0.1294  0.0034  -0.2517 64  ASP D OD2 
6812 N N   . LYS D 35  ? 0.8790 0.8051 1.0426 0.0986  0.0334  -0.3409 65  LYS D N   
6813 C CA  . LYS D 35  ? 0.9151 0.8297 1.0607 0.0913  0.0253  -0.3534 65  LYS D CA  
6814 C C   . LYS D 35  ? 0.8876 0.7867 1.0442 0.0890  0.0082  -0.3227 65  LYS D C   
6815 O O   . LYS D 35  ? 0.8900 0.7850 1.0238 0.0812  0.0000  -0.3272 65  LYS D O   
6816 C CB  . LYS D 35  ? 0.9737 0.8804 1.1615 0.0936  0.0321  -0.3934 65  LYS D CB  
6817 C CG  . LYS D 35  ? 1.0318 0.9540 1.1859 0.0897  0.0499  -0.4320 65  LYS D CG  
6818 C CD  . LYS D 35  ? 1.0859 1.0047 1.2460 0.0829  0.0483  -0.4567 65  LYS D CD  
6819 C CE  . LYS D 35  ? 1.1282 1.0389 1.3683 0.0892  0.0529  -0.4692 65  LYS D CE  
6820 N NZ  . LYS D 35  ? 1.1509 1.0773 1.4075 0.0920  0.0729  -0.4837 65  LYS D NZ  
6834 N N   . GLU D 36  ? 0.8873 0.7783 1.0773 0.0951  0.0027  -0.2922 66  GLU D N   
6835 C CA  . GLU D 36  ? 0.8948 0.7703 1.0887 0.0906  -0.0093 -0.2622 66  GLU D CA  
6836 C C   . GLU D 36  ? 0.8224 0.7100 0.9615 0.0828  -0.0137 -0.2402 66  GLU D C   
6837 O O   . GLU D 36  ? 0.7811 0.6592 0.9177 0.0762  -0.0206 -0.2223 66  GLU D O   
6838 C CB  . GLU D 36  ? 0.9568 0.8173 1.1953 0.0993  -0.0147 -0.2340 66  GLU D CB  
6839 C CG  . GLU D 36  ? 1.0087 0.8854 1.2392 0.1070  -0.0158 -0.2154 66  GLU D CG  
6840 C CD  . GLU D 36  ? 1.0706 0.9315 1.3467 0.1179  -0.0259 -0.1894 66  GLU D CD  
6841 O OE1 . GLU D 36  ? 1.0634 0.9290 1.3205 0.1191  -0.0349 -0.1575 66  GLU D OE1 
6842 O OE2 . GLU D 36  ? 1.0945 0.9375 1.4251 0.1256  -0.0259 -0.2010 66  GLU D OE2 
6849 N N   . PHE D 37  ? 0.7333 0.6406 0.8324 0.0826  -0.0080 -0.2424 67  PHE D N   
6850 C CA  . PHE D 37  ? 0.6005 0.5183 0.6515 0.0757  -0.0115 -0.2247 67  PHE D CA  
6851 C C   . PHE D 37  ? 0.6120 0.5355 0.6204 0.0696  -0.0116 -0.2448 67  PHE D C   
6852 O O   . PHE D 37  ? 0.6185 0.5494 0.5884 0.0650  -0.0149 -0.2323 67  PHE D O   
6853 C CB  . PHE D 37  ? 0.5849 0.5184 0.6218 0.0788  -0.0061 -0.2095 67  PHE D CB  
6854 C CG  . PHE D 37  ? 0.5791 0.5096 0.6537 0.0862  -0.0108 -0.1891 67  PHE D CG  
6855 C CD1 . PHE D 37  ? 0.5774 0.4938 0.6629 0.0844  -0.0208 -0.1639 67  PHE D CD1 
6856 C CD2 . PHE D 37  ? 0.5808 0.5221 0.6806 0.0950  -0.0056 -0.1955 67  PHE D CD2 
6857 C CE1 . PHE D 37  ? 0.5819 0.4928 0.6946 0.0918  -0.0279 -0.1422 67  PHE D CE1 
6858 C CE2 . PHE D 37  ? 0.5808 0.5195 0.7161 0.1038  -0.0150 -0.1761 67  PHE D CE2 
6859 C CZ  . PHE D 37  ? 0.5837 0.5059 0.7217 0.1026  -0.0274 -0.1479 67  PHE D CZ  
6869 N N   . LEU D 38  ? 0.7013 0.6210 0.7158 0.0700  -0.0096 -0.2760 68  LEU D N   
6870 C CA  . LEU D 38  ? 0.7462 0.6704 0.7154 0.0648  -0.0143 -0.2946 68  LEU D CA  
6871 C C   . LEU D 38  ? 0.7488 0.6713 0.7043 0.0593  -0.0301 -0.2806 68  LEU D C   
6872 O O   . LEU D 38  ? 0.7609 0.6900 0.6693 0.0568  -0.0360 -0.2802 68  LEU D O   
6873 C CB  . LEU D 38  ? 0.8069 0.7264 0.7922 0.0652  -0.0133 -0.3326 68  LEU D CB  
6874 C CG  . LEU D 38  ? 0.8560 0.7840 0.8141 0.0663  0.0023  -0.3596 68  LEU D CG  
6875 C CD1 . LEU D 38  ? 0.8935 0.8168 0.8774 0.0663  0.0037  -0.4003 68  LEU D CD1 
6876 C CD2 . LEU D 38  ? 0.8755 0.8116 0.7588 0.0615  0.0014  -0.3569 68  LEU D CD2 
6888 N N   . PRO D 39  ? 0.8053 0.7184 0.8006 0.0570  -0.0367 -0.2695 69  PRO D N   
6889 C CA  . PRO D 39  ? 0.8139 0.7287 0.8018 0.0509  -0.0488 -0.2589 69  PRO D CA  
6890 C C   . PRO D 39  ? 0.7856 0.7095 0.7410 0.0497  -0.0482 -0.2326 69  PRO D C   
6891 O O   . PRO D 39  ? 0.7881 0.7168 0.7283 0.0462  -0.0585 -0.2296 69  PRO D O   
6892 C CB  . PRO D 39  ? 0.8056 0.7068 0.8467 0.0472  -0.0483 -0.2502 69  PRO D CB  
6893 C CG  . PRO D 39  ? 0.8234 0.7133 0.8997 0.0519  -0.0417 -0.2669 69  PRO D CG  
6894 C CD  . PRO D 39  ? 0.8192 0.7180 0.8709 0.0591  -0.0328 -0.2692 69  PRO D CD  
6902 N N   . ILE D 40  ? 0.7422 0.6697 0.6918 0.0528  -0.0374 -0.2157 70  ILE D N   
6903 C CA  . ILE D 40  ? 0.7118 0.6484 0.6354 0.0510  -0.0356 -0.1935 70  ILE D CA  
6904 C C   . ILE D 40  ? 0.7061 0.6509 0.5911 0.0533  -0.0282 -0.1972 70  ILE D C   
6905 O O   . ILE D 40  ? 0.6804 0.6322 0.5458 0.0516  -0.0251 -0.1809 70  ILE D O   
6906 C CB  . ILE D 40  ? 0.6836 0.6201 0.6293 0.0509  -0.0304 -0.1699 70  ILE D CB  
6907 C CG1 . ILE D 40  ? 0.6877 0.6248 0.6491 0.0582  -0.0228 -0.1718 70  ILE D CG1 
6908 C CG2 . ILE D 40  ? 0.6781 0.6030 0.6562 0.0463  -0.0342 -0.1626 70  ILE D CG2 
6909 C CD1 . ILE D 40  ? 0.6765 0.6167 0.6507 0.0598  -0.0220 -0.1476 70  ILE D CD1 
6921 N N   . LEU D 41  ? 0.7062 0.6499 0.5804 0.0560  -0.0229 -0.2192 71  LEU D N   
6922 C CA  . LEU D 41  ? 0.7162 0.6659 0.5523 0.0561  -0.0109 -0.2228 71  LEU D CA  
6923 C C   . LEU D 41  ? 0.7575 0.7054 0.5447 0.0529  -0.0192 -0.2184 71  LEU D C   
6924 O O   . LEU D 41  ? 0.7514 0.6946 0.5238 0.0527  -0.0329 -0.2315 71  LEU D O   
6925 C CB  . LEU D 41  ? 0.7206 0.6698 0.5580 0.0585  0.0000  -0.2504 71  LEU D CB  
6926 C CG  . LEU D 41  ? 0.7650 0.7196 0.5620 0.0564  0.0180  -0.2577 71  LEU D CG  
6927 C CD1 . LEU D 41  ? 0.7283 0.6926 0.5407 0.0568  0.0313  -0.2411 71  LEU D CD1 
6928 C CD2 . LEU D 41  ? 0.7734 0.7282 0.5735 0.0574  0.0304  -0.2905 71  LEU D CD2 
6940 N N   . GLN D 42  ? 0.7416 0.6931 0.5066 0.0509  -0.0124 -0.2005 72  GLN D N   
6941 C CA  . GLN D 42  ? 0.7939 0.7400 0.5108 0.0489  -0.0178 -0.1932 72  GLN D CA  
6942 C C   . GLN D 42  ? 0.8487 0.7928 0.5257 0.0468  0.0008  -0.2009 72  GLN D C   
6943 O O   . GLN D 42  ? 0.8122 0.7616 0.4929 0.0445  0.0193  -0.1930 72  GLN D O   
6944 C CB  . GLN D 42  ? 0.7852 0.7338 0.5075 0.0469  -0.0200 -0.1695 72  GLN D CB  
6945 C CG  . GLN D 42  ? 0.8309 0.7706 0.5107 0.0461  -0.0268 -0.1585 72  GLN D CG  
6946 C CD  . GLN D 42  ? 0.8764 0.8098 0.5436 0.0493  -0.0512 -0.1654 72  GLN D CD  
6947 O OE1 . GLN D 42  ? 0.8737 0.8117 0.5771 0.0503  -0.0639 -0.1724 72  GLN D OE1 
6948 N NE2 . GLN D 42  ? 0.9300 0.8523 0.5456 0.0506  -0.0583 -0.1632 72  GLN D NE2 
6957 N N   . GLU D 43  ? 0.9258 0.8633 0.5650 0.0468  -0.0031 -0.2183 73  GLU D N   
6958 C CA  . GLU D 43  ? 1.0087 0.9434 0.6045 0.0429  0.0181  -0.2283 73  GLU D CA  
6959 C C   . GLU D 43  ? 1.0440 0.9712 0.6000 0.0385  0.0280  -0.2048 73  GLU D C   
6960 O O   . GLU D 43  ? 1.0349 0.9664 0.5944 0.0340  0.0534  -0.2018 73  GLU D O   
6961 C CB  . GLU D 43  ? 1.0987 1.0271 0.6515 0.0429  0.0087  -0.2510 73  GLU D CB  
6962 C CG  . GLU D 43  ? 1.1193 1.0537 0.7153 0.0463  0.0004  -0.2785 73  GLU D CG  
6963 C CD  . GLU D 43  ? 1.1779 1.1178 0.7827 0.0446  0.0249  -0.3065 73  GLU D CD  
6964 O OE1 . GLU D 43  ? 1.2024 1.1447 0.7939 0.0407  0.0508  -0.3027 73  GLU D OE1 
6965 O OE2 . GLU D 43  ? 1.2011 1.1409 0.8340 0.0457  0.0197  -0.3293 73  GLU D OE2 
6972 N N   . GLU D 44  ? 1.0827 0.9985 0.6061 0.0398  0.0079  -0.1886 74  GLU D N   
6973 C CA  . GLU D 44  ? 1.1392 1.0428 0.6265 0.0361  0.0152  -0.1641 74  GLU D CA  
6974 C C   . GLU D 44  ? 1.0547 0.9653 0.5903 0.0362  0.0158  -0.1460 74  GLU D C   
6975 O O   . GLU D 44  ? 1.0211 0.9358 0.5882 0.0406  -0.0052 -0.1418 74  GLU D O   
6976 C CB  . GLU D 44  ? 1.2498 1.1364 0.6847 0.0395  -0.0099 -0.1536 74  GLU D CB  
6977 C CG  . GLU D 44  ? 1.3417 1.2092 0.7346 0.0362  -0.0030 -0.1257 74  GLU D CG  
6978 C CD  . GLU D 44  ? 1.4438 1.3015 0.7852 0.0272  0.0289  -0.1266 74  GLU D CD  
6979 O OE1 . GLU D 44  ? 1.4752 1.3403 0.8016 0.0246  0.0407  -0.1511 74  GLU D OE1 
6980 O OE2 . GLU D 44  ? 1.4764 1.3190 0.7956 0.0218  0.0443  -0.1039 74  GLU D OE2 
6987 N N   . PRO D 45  ? 1.0004 0.9135 0.5439 0.0305  0.0399  -0.1372 75  PRO D N   
6988 C CA  . PRO D 45  ? 0.9384 0.8611 0.5281 0.0299  0.0400  -0.1243 75  PRO D CA  
6989 C C   . PRO D 45  ? 0.9545 0.8643 0.5331 0.0314  0.0230  -0.1044 75  PRO D C   
6990 O O   . PRO D 45  ? 1.0054 0.8967 0.5428 0.0290  0.0270  -0.0904 75  PRO D O   
6991 C CB  . PRO D 45  ? 0.9335 0.8614 0.5291 0.0225  0.0701  -0.1235 75  PRO D CB  
6992 C CG  . PRO D 45  ? 0.9871 0.8980 0.5234 0.0177  0.0851  -0.1240 75  PRO D CG  
6993 C CD  . PRO D 45  ? 1.0214 0.9289 0.5308 0.0229  0.0693  -0.1395 75  PRO D CD  
7001 N N   . LEU D 46  ? 0.9884 0.9068 0.6051 0.0352  0.0052  -0.1031 76  LEU D N   
7002 C CA  . LEU D 46  ? 1.0131 0.9219 0.6305 0.0374  -0.0105 -0.0879 76  LEU D CA  
7003 C C   . LEU D 46  ? 0.9834 0.8966 0.6277 0.0322  0.0037  -0.0772 76  LEU D C   
7004 O O   . LEU D 46  ? 0.9698 0.9004 0.6455 0.0285  0.0170  -0.0837 76  LEU D O   
7005 C CB  . LEU D 46  ? 0.9955 0.9127 0.6450 0.0423  -0.0337 -0.0946 76  LEU D CB  
7006 C CG  . LEU D 46  ? 1.0356 0.9484 0.6650 0.0477  -0.0534 -0.1069 76  LEU D CG  
7007 C CD1 . LEU D 46  ? 1.0065 0.9308 0.6814 0.0499  -0.0701 -0.1159 76  LEU D CD1 
7008 C CD2 . LEU D 46  ? 1.0950 0.9883 0.6761 0.0519  -0.0691 -0.0966 76  LEU D CD2 
7020 N N   . PRO D 47  ? 0.9387 0.8363 0.5734 0.0323  -0.0005 -0.0614 77  PRO D N   
7021 C CA  . PRO D 47  ? 0.8912 0.7927 0.5557 0.0266  0.0134  -0.0546 77  PRO D CA  
7022 C C   . PRO D 47  ? 0.8200 0.7431 0.5343 0.0265  0.0067  -0.0632 77  PRO D C   
7023 O O   . PRO D 47  ? 0.7994 0.7278 0.5254 0.0313  -0.0110 -0.0690 77  PRO D O   
7024 C CB  . PRO D 47  ? 0.9291 0.8048 0.5746 0.0289  0.0054  -0.0358 77  PRO D CB  
7025 C CG  . PRO D 47  ? 0.9614 0.8280 0.5851 0.0383  -0.0224 -0.0350 77  PRO D CG  
7026 C CD  . PRO D 47  ? 0.9787 0.8544 0.5796 0.0386  -0.0212 -0.0499 77  PRO D CD  
7034 N N   . PRO D 48  ? 0.7810 0.7178 0.5249 0.0202  0.0213  -0.0655 78  PRO D N   
7035 C CA  . PRO D 48  ? 0.7339 0.6899 0.5167 0.0188  0.0158  -0.0730 78  PRO D CA  
7036 C C   . PRO D 48  ? 0.7400 0.6883 0.5369 0.0222  0.0007  -0.0696 78  PRO D C   
7037 O O   . PRO D 48  ? 0.7607 0.6906 0.5507 0.0240  -0.0019 -0.0593 78  PRO D O   
7038 C CB  . PRO D 48  ? 0.7297 0.6985 0.5344 0.0110  0.0332  -0.0761 78  PRO D CB  
7039 C CG  . PRO D 48  ? 0.7392 0.7022 0.5237 0.0085  0.0490  -0.0744 78  PRO D CG  
7040 C CD  . PRO D 48  ? 0.7901 0.7271 0.5338 0.0129  0.0440  -0.0639 78  PRO D CD  
7048 N N   . LEU D 49  ? 0.7293 0.6908 0.5488 0.0229  -0.0089 -0.0779 79  LEU D N   
7049 C CA  . LEU D 49  ? 0.7194 0.6786 0.5635 0.0256  -0.0215 -0.0792 79  LEU D CA  
7050 C C   . LEU D 49  ? 0.6888 0.6474 0.5575 0.0216  -0.0129 -0.0780 79  LEU D C   
7051 O O   . LEU D 49  ? 0.6982 0.6450 0.5820 0.0264  -0.0232 -0.0743 79  LEU D O   
7052 C CB  . LEU D 49  ? 0.7130 0.6895 0.5820 0.0231  -0.0250 -0.0903 79  LEU D CB  
7053 C CG  . LEU D 49  ? 0.7313 0.7054 0.5870 0.0274  -0.0362 -0.0935 79  LEU D CG  
7054 C CD1 . LEU D 49  ? 0.7057 0.6948 0.5847 0.0220  -0.0325 -0.1015 79  LEU D CD1 
7055 C CD2 . LEU D 49  ? 0.7556 0.7170 0.6089 0.0355  -0.0571 -0.0931 79  LEU D CD2 
7067 N N   . ALA D 50  ? 0.6117 0.5836 0.4889 0.0136  0.0044  -0.0826 80  ALA D N   
7068 C CA  . ALA D 50  ? 0.5738 0.5462 0.4774 0.0085  0.0144  -0.0854 80  ALA D CA  
7069 C C   . ALA D 50  ? 0.5985 0.5427 0.4933 0.0129  0.0124  -0.0709 80  ALA D C   
7070 O O   . ALA D 50  ? 0.5964 0.5331 0.5206 0.0129  0.0125  -0.0712 80  ALA D O   
7071 C CB  . ALA D 50  ? 0.5428 0.5331 0.4507 -0.0004 0.0313  -0.0931 80  ALA D CB  
7077 N N   . LEU D 51  ? 0.6398 0.5667 0.4939 0.0163  0.0116  -0.0580 81  LEU D N   
7078 C CA  . LEU D 51  ? 0.6913 0.5868 0.5243 0.0201  0.0096  -0.0396 81  LEU D CA  
7079 C C   . LEU D 51  ? 0.7409 0.6191 0.5594 0.0318  -0.0165 -0.0301 81  LEU D C   
7080 O O   . LEU D 51  ? 0.7902 0.6394 0.5792 0.0367  -0.0230 -0.0112 81  LEU D O   
7081 C CB  . LEU D 51  ? 0.7067 0.5920 0.4980 0.0161  0.0250  -0.0312 81  LEU D CB  
7082 C CG  . LEU D 51  ? 0.6695 0.5726 0.4780 0.0051  0.0496  -0.0415 81  LEU D CG  
7083 C CD1 . LEU D 51  ? 0.7036 0.5949 0.4754 0.0010  0.0666  -0.0340 81  LEU D CD1 
7084 C CD2 . LEU D 51  ? 0.6542 0.5565 0.5034 -0.0013 0.0603  -0.0442 81  LEU D CD2 
7096 N N   . VAL D 52  ? 0.7342 0.6292 0.5725 0.0360  -0.0319 -0.0423 82  VAL D N   
7097 C CA  . VAL D 52  ? 0.7735 0.6582 0.6079 0.0472  -0.0595 -0.0384 82  VAL D CA  
7098 C C   . VAL D 52  ? 0.7719 0.6650 0.6652 0.0498  -0.0680 -0.0475 82  VAL D C   
7099 O O   . VAL D 52  ? 0.7325 0.6509 0.6600 0.0442  -0.0611 -0.0656 82  VAL D O   
7100 C CB  . VAL D 52  ? 0.7719 0.6700 0.5888 0.0491  -0.0694 -0.0488 82  VAL D CB  
7101 C CG1 . VAL D 52  ? 0.7825 0.6753 0.6058 0.0601  -0.1000 -0.0499 82  VAL D CG1 
7102 C CG2 . VAL D 52  ? 0.7858 0.6755 0.5485 0.0469  -0.0598 -0.0428 82  VAL D CG2 
7112 N N   . PRO D 53  ? 0.8667 0.7386 0.7746 0.0580  -0.0815 -0.0358 83  PRO D N   
7113 C CA  . PRO D 53  ? 0.8795 0.7611 0.8522 0.0614  -0.0895 -0.0482 83  PRO D CA  
7114 C C   . PRO D 53  ? 0.8569 0.7593 0.8531 0.0651  -0.1061 -0.0648 83  PRO D C   
7115 O O   . PRO D 53  ? 0.8785 0.7789 0.8413 0.0701  -0.1223 -0.0621 83  PRO D O   
7116 C CB  . PRO D 53  ? 0.9351 0.7840 0.9106 0.0733  -0.1082 -0.0277 83  PRO D CB  
7117 C CG  . PRO D 53  ? 0.9724 0.7954 0.8907 0.0695  -0.0952 -0.0052 83  PRO D CG  
7118 C CD  . PRO D 53  ? 0.9419 0.7785 0.8108 0.0635  -0.0870 -0.0100 83  PRO D CD  
7126 N N   . PHE D 54  ? 0.7877 0.7109 0.8441 0.0612  -0.0996 -0.0846 84  PHE D N   
7127 C CA  . PHE D 54  ? 0.7594 0.7033 0.8488 0.0625  -0.1108 -0.1025 84  PHE D CA  
7128 C C   . PHE D 54  ? 0.7633 0.6946 0.8614 0.0785  -0.1468 -0.0965 84  PHE D C   
7129 O O   . PHE D 54  ? 0.7833 0.6979 0.9046 0.0889  -0.1620 -0.0874 84  PHE D O   
7130 C CB  . PHE D 54  ? 0.7404 0.7070 0.8953 0.0546  -0.0943 -0.1252 84  PHE D CB  
7131 C CG  . PHE D 54  ? 0.7181 0.7045 0.8636 0.0381  -0.0632 -0.1360 84  PHE D CG  
7132 C CD1 . PHE D 54  ? 0.7215 0.7049 0.8111 0.0326  -0.0530 -0.1251 84  PHE D CD1 
7133 C CD2 . PHE D 54  ? 0.7004 0.7092 0.8932 0.0281  -0.0448 -0.1582 84  PHE D CD2 
7134 C CE1 . PHE D 54  ? 0.7071 0.7086 0.7885 0.0193  -0.0294 -0.1337 84  PHE D CE1 
7135 C CE2 . PHE D 54  ? 0.6929 0.7191 0.8695 0.0131  -0.0190 -0.1666 84  PHE D CE2 
7136 C CZ  . PHE D 54  ? 0.6863 0.7085 0.8071 0.0096  -0.0134 -0.1532 84  PHE D CZ  
7146 N N   . THR D 55  ? 0.7306 0.6698 0.8131 0.0809  -0.1621 -0.1023 85  THR D N   
7147 C CA  . THR D 55  ? 0.7449 0.6820 0.8503 0.0950  -0.1983 -0.1053 85  THR D CA  
7148 C C   . THR D 55  ? 0.7266 0.6865 0.9190 0.0946  -0.1990 -0.1289 85  THR D C   
7149 O O   . THR D 55  ? 0.6809 0.6596 0.9061 0.0812  -0.1690 -0.1444 85  THR D O   
7150 C CB  . THR D 55  ? 0.7474 0.6899 0.8179 0.0957  -0.2127 -0.1106 85  THR D CB  
7151 O OG1 . THR D 55  ? 0.7042 0.6720 0.8036 0.0828  -0.1920 -0.1316 85  THR D OG1 
7152 C CG2 . THR D 55  ? 0.7700 0.6928 0.7573 0.0945  -0.2071 -0.0917 85  THR D CG2 
7160 N N   . GLU D 56  ? 0.7916 0.7505 1.0217 0.1094  -0.2338 -0.1327 86  GLU D N   
7161 C CA  . GLU D 56  ? 0.8021 0.7859 1.1230 0.1094  -0.2354 -0.1592 86  GLU D CA  
7162 C C   . GLU D 56  ? 0.7736 0.7855 1.1137 0.0931  -0.2120 -0.1827 86  GLU D C   
7163 O O   . GLU D 56  ? 0.7464 0.7792 1.1435 0.0822  -0.1871 -0.2032 86  GLU D O   
7164 C CB  . GLU D 56  ? 0.8570 0.8383 1.2138 0.1290  -0.2822 -0.1610 86  GLU D CB  
7165 C CG  . GLU D 56  ? 0.9156 0.8700 1.2794 0.1458  -0.3048 -0.1399 86  GLU D CG  
7166 C CD  . GLU D 56  ? 0.9677 0.9225 1.3774 0.1668  -0.3547 -0.1431 86  GLU D CD  
7167 O OE1 . GLU D 56  ? 0.9844 0.9478 1.3757 0.1716  -0.3815 -0.1494 86  GLU D OE1 
7168 O OE2 . GLU D 56  ? 0.9860 0.9330 1.4542 0.1791  -0.3685 -0.1409 86  GLU D OE2 
7175 N N   . GLU D 57  ? 0.8263 0.8376 1.1190 0.0905  -0.2181 -0.1803 87  GLU D N   
7176 C CA  . GLU D 57  ? 0.8360 0.8672 1.1393 0.0744  -0.1938 -0.1973 87  GLU D CA  
7177 C C   . GLU D 57  ? 0.7728 0.8087 1.0637 0.0579  -0.1516 -0.1956 87  GLU D C   
7178 O O   . GLU D 57  ? 0.7389 0.7943 1.0776 0.0457  -0.1277 -0.2136 87  GLU D O   
7179 C CB  . GLU D 57  ? 0.9060 0.9295 1.1518 0.0750  -0.2051 -0.1915 87  GLU D CB  
7180 C CG  . GLU D 57  ? 1.0013 1.0266 1.2611 0.0881  -0.2463 -0.2005 87  GLU D CG  
7181 C CD  . GLU D 57  ? 1.0282 1.0754 1.3349 0.0793  -0.2439 -0.2265 87  GLU D CD  
7182 O OE1 . GLU D 57  ? 1.0067 1.0640 1.3290 0.0625  -0.2086 -0.2338 87  GLU D OE1 
7183 O OE2 . GLU D 57  ? 1.0577 1.1111 1.3849 0.0888  -0.2778 -0.2394 87  GLU D OE2 
7190 N N   . GLU D 58  ? 0.6926 0.7116 0.9183 0.0568  -0.1418 -0.1751 88  GLU D N   
7191 C CA  . GLU D 58  ? 0.6381 0.6628 0.8475 0.0422  -0.1064 -0.1736 88  GLU D CA  
7192 C C   . GLU D 58  ? 0.5984 0.6327 0.8580 0.0383  -0.0912 -0.1848 88  GLU D C   
7193 O O   . GLU D 58  ? 0.5595 0.6111 0.8377 0.0237  -0.0630 -0.1983 88  GLU D O   
7194 C CB  . GLU D 58  ? 0.6456 0.6519 0.7857 0.0436  -0.1025 -0.1519 88  GLU D CB  
7195 C CG  . GLU D 58  ? 0.6506 0.6495 0.7423 0.0456  -0.1120 -0.1447 88  GLU D CG  
7196 C CD  . GLU D 58  ? 0.6724 0.6537 0.7016 0.0477  -0.1082 -0.1257 88  GLU D CD  
7197 O OE1 . GLU D 58  ? 0.6873 0.6551 0.7070 0.0524  -0.1097 -0.1140 88  GLU D OE1 
7198 O OE2 . GLU D 58  ? 0.6789 0.6593 0.6724 0.0443  -0.1024 -0.1232 88  GLU D OE2 
7205 N N   . GLN D 59  ? 0.5837 0.6057 0.8654 0.0511  -0.1093 -0.1797 89  GLN D N   
7206 C CA  . GLN D 59  ? 0.5881 0.6181 0.9257 0.0486  -0.0954 -0.1931 89  GLN D CA  
7207 C C   . GLN D 59  ? 0.5506 0.6085 0.9549 0.0392  -0.0811 -0.2222 89  GLN D C   
7208 O O   . GLN D 59  ? 0.5298 0.6032 0.9573 0.0257  -0.0508 -0.2382 89  GLN D O   
7209 C CB  . GLN D 59  ? 0.6494 0.6592 1.0116 0.0668  -0.1236 -0.1827 89  GLN D CB  
7210 C CG  . GLN D 59  ? 0.6769 0.6887 1.0948 0.0658  -0.1095 -0.1942 89  GLN D CG  
7211 C CD  . GLN D 59  ? 0.7319 0.7164 1.1676 0.0849  -0.1386 -0.1773 89  GLN D CD  
7212 O OE1 . GLN D 59  ? 0.7735 0.7389 1.1763 0.0990  -0.1710 -0.1569 89  GLN D OE1 
7213 N NE2 . GLN D 59  ? 0.7406 0.7218 1.2271 0.0854  -0.1274 -0.1856 89  GLN D NE2 
7222 N N   . ARG D 60  ? 0.5802 0.6461 1.0158 0.0448  -0.1012 -0.2313 90  ARG D N   
7223 C CA  . ARG D 60  ? 0.5658 0.6587 1.0688 0.0341  -0.0849 -0.2601 90  ARG D CA  
7224 C C   . ARG D 60  ? 0.5768 0.6810 1.0467 0.0130  -0.0501 -0.2637 90  ARG D C   
7225 O O   . ARG D 60  ? 0.5563 0.6785 1.0560 -0.0026 -0.0180 -0.2821 90  ARG D O   
7226 C CB  . ARG D 60  ? 0.5621 0.6612 1.1092 0.0456  -0.1174 -0.2697 90  ARG D CB  
7227 C CG  . ARG D 60  ? 0.5249 0.6526 1.1468 0.0332  -0.0996 -0.3010 90  ARG D CG  
7228 C CD  . ARG D 60  ? 0.5275 0.6638 1.2008 0.0453  -0.1352 -0.3135 90  ARG D CD  
7229 N NE  . ARG D 60  ? 0.5100 0.6342 1.1244 0.0487  -0.1554 -0.2990 90  ARG D NE  
7230 C CZ  . ARG D 60  ? 0.5038 0.6378 1.1513 0.0540  -0.1811 -0.3125 90  ARG D CZ  
7231 N NH1 . ARG D 60  ? 0.5057 0.6627 1.2477 0.0566  -0.1904 -0.3402 90  ARG D NH1 
7232 N NH2 . ARG D 60  ? 0.5128 0.6351 1.1036 0.0562  -0.1971 -0.3014 90  ARG D NH2 
7246 N N   . ASN D 61  ? 0.6241 0.7163 1.0304 0.0122  -0.0558 -0.2458 91  ASN D N   
7247 C CA  . ASN D 61  ? 0.6550 0.7537 1.0313 -0.0056 -0.0277 -0.2455 91  ASN D CA  
7248 C C   . ASN D 61  ? 0.6328 0.7353 0.9785 -0.0185 0.0035  -0.2426 91  ASN D C   
7249 O O   . ASN D 61  ? 0.6103 0.7240 0.9517 -0.0357 0.0319  -0.2494 91  ASN D O   
7250 C CB  . ASN D 61  ? 0.7067 0.7897 1.0246 -0.0012 -0.0422 -0.2268 91  ASN D CB  
7251 C CG  . ASN D 61  ? 0.7683 0.8525 1.1156 0.0063  -0.0676 -0.2354 91  ASN D CG  
7252 O OD1 . ASN D 61  ? 0.7861 0.8806 1.1948 0.0130  -0.0833 -0.2519 91  ASN D OD1 
7253 N ND2 . ASN D 61  ? 0.7867 0.8612 1.0944 0.0057  -0.0730 -0.2265 91  ASN D ND2 
7260 N N   . PHE D 62  ? 0.5825 0.6752 0.9052 -0.0114 -0.0013 -0.2326 92  PHE D N   
7261 C CA  . PHE D 62  ? 0.5833 0.6807 0.8751 -0.0229 0.0243  -0.2315 92  PHE D CA  
7262 C C   . PHE D 62  ? 0.6306 0.7446 0.9735 -0.0307 0.0446  -0.2555 92  PHE D C   
7263 O O   . PHE D 62  ? 0.6252 0.7493 0.9467 -0.0443 0.0698  -0.2617 92  PHE D O   
7264 C CB  . PHE D 62  ? 0.5569 0.6364 0.8008 -0.0136 0.0125  -0.2112 92  PHE D CB  
7265 C CG  . PHE D 62  ? 0.5335 0.6019 0.7157 -0.0124 0.0063  -0.1909 92  PHE D CG  
7266 C CD1 . PHE D 62  ? 0.5273 0.6006 0.6669 -0.0228 0.0240  -0.1848 92  PHE D CD1 
7267 C CD2 . PHE D 62  ? 0.5315 0.5857 0.7004 -0.0004 -0.0183 -0.1799 92  PHE D CD2 
7268 C CE1 . PHE D 62  ? 0.5190 0.5827 0.6110 -0.0204 0.0178  -0.1679 92  PHE D CE1 
7269 C CE2 . PHE D 62  ? 0.5361 0.5811 0.6543 0.0005  -0.0219 -0.1651 92  PHE D CE2 
7270 C CZ  . PHE D 62  ? 0.5273 0.5768 0.6107 -0.0091 -0.0034 -0.1591 92  PHE D CZ  
7280 N N   . SER D 63  ? 0.7236 0.8419 1.1350 -0.0223 0.0336  -0.2711 93  SER D N   
7281 C CA  . SER D 63  ? 0.7908 0.9222 1.2561 -0.0268 0.0509  -0.2949 93  SER D CA  
7282 C C   . SER D 63  ? 0.8106 0.9682 1.3158 -0.0452 0.0828  -0.3233 93  SER D C   
7283 O O   . SER D 63  ? 0.8190 0.9904 1.3289 -0.0587 0.1116  -0.3412 93  SER D O   
7284 C CB  . SER D 63  ? 0.8216 0.9437 1.3480 -0.0074 0.0231  -0.2981 93  SER D CB  
7285 O OG  . SER D 63  ? 0.8585 0.9539 1.3437 0.0071  -0.0007 -0.2712 93  SER D OG  
7291 N N   . MET D 64  ? 0.8053 0.9702 1.3398 -0.0472 0.0800  -0.3296 94  MET D N   
7292 C CA  . MET D 64  ? 0.8213 1.0105 1.4042 -0.0652 0.1126  -0.3583 94  MET D CA  
7293 C C   . MET D 64  ? 0.8024 0.9957 1.3204 -0.0873 0.1453  -0.3519 94  MET D C   
7294 O O   . MET D 64  ? 0.8212 1.0251 1.3204 -0.1014 0.1737  -0.3633 94  MET D O   
7295 C CB  . MET D 64  ? 0.8710 1.0673 1.5170 -0.0600 0.0979  -0.3691 94  MET D CB  
7296 C CG  . MET D 64  ? 0.8933 1.1167 1.6121 -0.0771 0.1313  -0.4043 94  MET D CG  
7297 S SD  . MET D 64  ? 0.9381 1.1790 1.7605 -0.0683 0.1316  -0.4390 94  MET D SD  
7298 C CE  . MET D 64  ? 0.9679 1.2184 1.8268 -0.0925 0.1741  -0.4719 94  MET D CE  
7308 N N   . SER D 65  ? 0.8314 1.0155 1.3144 -0.0903 0.1406  -0.3340 95  SER D N   
7309 C CA  . SER D 65  ? 0.8428 1.0261 1.2653 -0.1099 0.1684  -0.3235 95  SER D CA  
7310 C C   . SER D 65  ? 0.8193 0.9809 1.1844 -0.1021 0.1468  -0.2921 95  SER D C   
7311 O O   . SER D 65  ? 0.8352 0.9876 1.2213 -0.0875 0.1181  -0.2864 95  SER D O   
7312 C CB  . SER D 65  ? 0.8736 1.0723 1.3366 -0.1301 0.2014  -0.3435 95  SER D CB  
7313 O OG  . SER D 65  ? 0.9104 1.1034 1.3070 -0.1488 0.2277  -0.3283 95  SER D OG  
7319 N N   . VAL D 66  ? 0.7849 0.9394 1.0786 -0.1118 0.1599  -0.2735 96  VAL D N   
7320 C CA  . VAL D 66  ? 0.7378 0.8718 0.9765 -0.1028 0.1394  -0.2445 96  VAL D CA  
7321 C C   . VAL D 66  ? 0.7173 0.8432 0.9275 -0.1172 0.1569  -0.2314 96  VAL D C   
7322 O O   . VAL D 66  ? 0.6990 0.8080 0.8897 -0.1101 0.1407  -0.2133 96  VAL D O   
7323 C CB  . VAL D 66  ? 0.7192 0.8484 0.9009 -0.0967 0.1314  -0.2300 96  VAL D CB  
7324 C CG1 . VAL D 66  ? 0.7144 0.8457 0.9254 -0.0823 0.1141  -0.2394 96  VAL D CG1 
7325 C CG2 . VAL D 66  ? 0.7490 0.8891 0.8917 -0.1144 0.1595  -0.2325 96  VAL D CG2 
7335 N N   . ASN D 67  ? 0.6911 0.8270 0.8967 -0.1379 0.1912  -0.2399 97  ASN D N   
7336 C CA  . ASN D 67  ? 0.7032 0.8269 0.8761 -0.1530 0.2104  -0.2233 97  ASN D CA  
7337 C C   . ASN D 67  ? 0.6544 0.7704 0.8785 -0.1527 0.2060  -0.2267 97  ASN D C   
7338 O O   . ASN D 67  ? 0.6280 0.7572 0.9226 -0.1492 0.2016  -0.2509 97  ASN D O   
7339 C CB  . ASN D 67  ? 0.7602 0.8962 0.9183 -0.1773 0.2511  -0.2336 97  ASN D CB  
7340 C CG  . ASN D 67  ? 0.7939 0.9324 0.8797 -0.1807 0.2551  -0.2229 97  ASN D CG  
7341 O OD1 . ASN D 67  ? 0.8199 0.9780 0.9092 -0.1878 0.2703  -0.2443 97  ASN D OD1 
7342 N ND2 . ASN D 67  ? 0.8202 0.9402 0.8444 -0.1753 0.2403  -0.1919 97  ASN D ND2 
7349 N N   . SER D 68  ? 0.6643 0.7590 0.8563 -0.1557 0.2055  -0.2032 98  SER D N   
7350 C CA  . SER D 68  ? 0.6613 0.7469 0.9000 -0.1575 0.2031  -0.2067 98  SER D CA  
7351 C C   . SER D 68  ? 0.7169 0.8115 0.9974 -0.1815 0.2419  -0.2230 98  SER D C   
7352 O O   . SER D 68  ? 0.7570 0.8576 1.0089 -0.1991 0.2741  -0.2230 98  SER D O   
7353 C CB  . SER D 68  ? 0.6686 0.7264 0.8635 -0.1546 0.1939  -0.1772 98  SER D CB  
7354 O OG  . SER D 68  ? 0.7001 0.7458 0.8420 -0.1715 0.2212  -0.1561 98  SER D OG  
7360 N N   . ALA D 69  ? 0.8416 0.9377 1.1905 -0.1830 0.2395  -0.2387 99  ALA D N   
7361 C CA  . ALA D 69  ? 0.9234 1.0287 1.3233 -0.2067 0.2782  -0.2569 99  ALA D CA  
7362 C C   . ALA D 69  ? 1.0016 1.0838 1.3472 -0.2287 0.3127  -0.2305 99  ALA D C   
7363 O O   . ALA D 69  ? 1.0347 1.1238 1.3868 -0.2527 0.3549  -0.2390 99  ALA D O   
7364 C CB  . ALA D 69  ? 0.9168 1.0280 1.4035 -0.2030 0.2645  -0.2789 99  ALA D CB  
7370 N N   . ALA D 70  ? 0.9285 0.9822 1.2199 -0.2210 0.2960  -0.1982 100 ALA D N   
7371 C CA  . ALA D 70  ? 0.9718 0.9980 1.2113 -0.2393 0.3238  -0.1680 100 ALA D CA  
7372 C C   . ALA D 70  ? 1.0105 1.0416 1.1816 -0.2534 0.3507  -0.1577 100 ALA D C   
7373 O O   . ALA D 70  ? 1.0603 1.0889 1.2243 -0.2791 0.3929  -0.1575 100 ALA D O   
7374 C CB  . ALA D 70  ? 0.9671 0.9635 1.1642 -0.2238 0.2950  -0.1364 100 ALA D CB  
7380 N N   . VAL D 71  ? 1.0342 1.0730 1.1538 -0.2380 0.3276  -0.1508 101 VAL D N   
7381 C CA  . VAL D 71  ? 1.0709 1.1159 1.1209 -0.2500 0.3479  -0.1428 101 VAL D CA  
7382 C C   . VAL D 71  ? 1.0770 1.1510 1.1635 -0.2680 0.3828  -0.1776 101 VAL D C   
7383 O O   . VAL D 71  ? 1.1168 1.1950 1.1507 -0.2866 0.4129  -0.1752 101 VAL D O   
7384 C CB  . VAL D 71  ? 1.0475 1.0984 1.0490 -0.2286 0.3132  -0.1340 101 VAL D CB  
7385 C CG1 . VAL D 71  ? 1.0152 1.0930 1.0712 -0.2132 0.2938  -0.1660 101 VAL D CG1 
7386 C CG2 . VAL D 71  ? 1.1191 1.1728 1.0389 -0.2404 0.3290  -0.1211 101 VAL D CG2 
7396 N N   . LEU D 72  ? 1.0226 1.1170 1.1989 -0.2630 0.3792  -0.2114 102 LEU D N   
7397 C CA  . LEU D 72  ? 1.0225 1.1469 1.2486 -0.2773 0.4099  -0.2490 102 LEU D CA  
7398 C C   . LEU D 72  ? 1.0964 1.2149 1.3503 -0.3022 0.4514  -0.2569 102 LEU D C   
7399 O O   . LEU D 72  ? 1.1103 1.2435 1.4161 -0.3050 0.4625  -0.2894 102 LEU D O   
7400 C CB  . LEU D 72  ? 0.9368 1.0837 1.2501 -0.2571 0.3814  -0.2805 102 LEU D CB  
7401 C CG  . LEU D 72  ? 0.8559 1.0075 1.1455 -0.2316 0.3416  -0.2773 102 LEU D CG  
7402 C CD1 . LEU D 72  ? 0.8084 0.9730 1.1805 -0.2109 0.3097  -0.3000 102 LEU D CD1 
7403 C CD2 . LEU D 72  ? 0.8736 1.0426 1.1268 -0.2395 0.3600  -0.2895 102 LEU D CD2 
7415 N N   . ARG D 73  ? 1.1761 1.2650 1.3922 -0.3151 0.4662  -0.2259 103 ARG D N   
7416 C CA  . ARG D 73  ? 1.2667 1.3407 1.4955 -0.3340 0.4990  -0.2278 103 ARG D CA  
7417 C C   . ARG D 73  ? 1.3396 1.4081 1.4882 -0.3493 0.5251  -0.2187 103 ARG D C   
7418 O O   . ARG D 73  ? 1.3652 1.4277 1.4285 -0.3472 0.5168  -0.1940 103 ARG D O   
7419 C CB  . ARG D 73  ? 1.3052 1.3462 1.5308 -0.3412 0.5038  -0.1972 103 ARG D CB  
7420 C CG  . ARG D 73  ? 1.2614 1.3068 1.5731 -0.3284 0.4781  -0.2100 103 ARG D CG  
7421 C CD  . ARG D 73  ? 1.2914 1.3021 1.6130 -0.3381 0.4875  -0.1867 103 ARG D CD  
7422 N NE  . ARG D 73  ? 1.2333 1.2417 1.6116 -0.3205 0.4506  -0.1921 103 ARG D NE  
7423 C CZ  . ARG D 73  ? 1.2104 1.1982 1.5401 -0.2982 0.4112  -0.1653 103 ARG D CZ  
7424 N NH1 . ARG D 73  ? 1.2328 1.2035 1.4668 -0.2948 0.4076  -0.1313 103 ARG D NH1 
7425 N NH2 . ARG D 73  ? 1.1660 1.1518 1.5442 -0.2793 0.3751  -0.1748 103 ARG D NH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   46  ?   ?   ?   A . n 
A 1 2   PRO 2   47  47  PRO PRO A . n 
A 1 3   HIS 3   48  48  HIS HIS A . n 
A 1 4   MET 4   49  49  MET MET A . n 
A 1 5   LEU 5   50  50  LEU LEU A . n 
A 1 6   GLU 6   51  51  GLU GLU A . n 
A 1 7   ALA 7   52  52  ALA ALA A . n 
A 1 8   GLU 8   53  53  GLU GLU A . n 
A 1 9   HIS 9   54  54  HIS HIS A . n 
A 1 10  PRO 10  55  55  PRO PRO A . n 
A 1 11  LEU 11  56  56  LEU LEU A . n 
A 1 12  GLN 12  57  57  GLN GLN A . n 
A 1 13  TYR 13  58  58  TYR TYR A . n 
A 1 14  ASN 14  59  59  ASN ASN A . n 
A 1 15  TYR 15  60  60  TYR TYR A . n 
A 1 16  THR 16  61  61  THR THR A . n 
A 1 17  PHE 17  62  62  PHE PHE A . n 
A 1 18  TRP 18  63  63  TRP TRP A . n 
A 1 19  TYR 19  64  64  TYR TYR A . n 
A 1 20  SER 20  65  65  SER SER A . n 
A 1 21  ARG 21  66  66  ARG ARG A . n 
A 1 22  ARG 22  67  67  ARG ARG A . n 
A 1 23  THR 23  68  68  THR THR A . n 
A 1 24  PRO 24  69  69  PRO PRO A . n 
A 1 25  GLY 25  70  ?   ?   ?   A . n 
A 1 26  ARG 26  71  ?   ?   ?   A . n 
A 1 27  PRO 27  72  ?   ?   ?   A . n 
A 1 28  THR 28  73  ?   ?   ?   A . n 
A 1 29  SER 29  74  ?   ?   ?   A . n 
A 1 30  SER 30  75  ?   ?   ?   A . n 
A 1 31  GLN 31  76  ?   ?   ?   A . n 
A 1 32  SER 32  77  ?   ?   ?   A . n 
A 1 33  TYR 33  78  ?   ?   ?   A . n 
A 1 34  GLU 34  79  79  GLU GLU A . n 
A 1 35  GLN 35  80  80  GLN GLN A . n 
A 1 36  ASN 36  81  81  ASN ASN A . n 
A 1 37  ILE 37  82  82  ILE ILE A . n 
A 1 38  LYS 38  83  83  LYS LYS A . n 
A 1 39  GLN 39  84  84  GLN GLN A . n 
A 1 40  ILE 40  85  85  ILE ILE A . n 
A 1 41  GLY 41  86  86  GLY GLY A . n 
A 1 42  THR 42  87  87  THR THR A . n 
A 1 43  PHE 43  88  88  PHE PHE A . n 
A 1 44  ALA 44  89  89  ALA ALA A . n 
A 1 45  SER 45  90  90  SER SER A . n 
A 1 46  VAL 46  91  91  VAL VAL A . n 
A 1 47  GLU 47  92  92  GLU GLU A . n 
A 1 48  GLN 48  93  93  GLN GLN A . n 
A 1 49  PHE 49  94  94  PHE PHE A . n 
A 1 50  TRP 50  95  95  TRP TRP A . n 
A 1 51  ARG 51  96  96  ARG ARG A . n 
A 1 52  PHE 52  97  97  PHE PHE A . n 
A 1 53  TYR 53  98  98  TYR TYR A . n 
A 1 54  SER 54  99  99  SER SER A . n 
A 1 55  HIS 55  100 100 HIS HIS A . n 
A 1 56  MET 56  101 101 MET MET A . n 
A 1 57  VAL 57  102 102 VAL VAL A . n 
A 1 58  ARG 58  103 103 ARG ARG A . n 
A 1 59  PRO 59  104 104 PRO PRO A . n 
A 1 60  GLY 60  105 105 GLY GLY A . n 
A 1 61  ASP 61  106 106 ASP ASP A . n 
A 1 62  LEU 62  107 107 LEU LEU A . n 
A 1 63  THR 63  108 108 THR THR A . n 
A 1 64  GLY 64  109 109 GLY GLY A . n 
A 1 65  HIS 65  110 110 HIS HIS A . n 
A 1 66  SER 66  111 111 SER SER A . n 
A 1 67  ASP 67  112 112 ASP ASP A . n 
A 1 68  PHE 68  113 113 PHE PHE A . n 
A 1 69  HIS 69  114 114 HIS HIS A . n 
A 1 70  LEU 70  115 115 LEU LEU A . n 
A 1 71  PHE 71  116 116 PHE PHE A . n 
A 1 72  LYS 72  117 117 LYS LYS A . n 
A 1 73  GLU 73  118 118 GLU GLU A . n 
A 1 74  GLY 74  119 119 GLY GLY A . n 
A 1 75  ILE 75  120 120 ILE ILE A . n 
A 1 76  LYS 76  121 121 LYS LYS A . n 
A 1 77  PRO 77  122 122 PRO PRO A . n 
A 1 78  MET 78  123 123 MET MET A . n 
A 1 79  TRP 79  124 124 TRP TRP A . n 
A 1 80  GLU 80  125 125 GLU GLU A . n 
A 1 81  ASP 81  126 126 ASP ASP A . n 
A 1 82  ASP 82  127 127 ASP ASP A . n 
A 1 83  ALA 83  128 128 ALA ALA A . n 
A 1 84  ASN 84  129 129 ASN ASN A . n 
A 1 85  LYS 85  130 130 LYS LYS A . n 
A 1 86  ASN 86  131 131 ASN ASN A . n 
A 1 87  GLY 87  132 132 GLY GLY A . n 
A 1 88  GLY 88  133 133 GLY GLY A . n 
A 1 89  LYS 89  134 134 LYS LYS A . n 
A 1 90  TRP 90  135 135 TRP TRP A . n 
A 1 91  ILE 91  136 136 ILE ILE A . n 
A 1 92  ILE 92  137 137 ILE ILE A . n 
A 1 93  ARG 93  138 138 ARG ARG A . n 
A 1 94  LEU 94  139 139 LEU LEU A . n 
A 1 95  ARG 95  140 140 ARG ARG A . n 
A 1 96  LYS 96  141 141 LYS LYS A . n 
A 1 97  GLY 97  142 142 GLY GLY A . n 
A 1 98  LEU 98  143 143 LEU LEU A . n 
A 1 99  ALA 99  144 144 ALA ALA A . n 
A 1 100 SER 100 145 145 SER SER A . n 
A 1 101 ARG 101 146 146 ARG ARG A . n 
A 1 102 CYS 102 147 147 CYS CYS A . n 
A 1 103 TRP 103 148 148 TRP TRP A . n 
A 1 104 GLU 104 149 149 GLU GLU A . n 
A 1 105 ASN 105 150 150 ASN ASN A . n 
A 1 106 LEU 106 151 151 LEU LEU A . n 
A 1 107 ILE 107 152 152 ILE ILE A . n 
A 1 108 LEU 108 153 153 LEU LEU A . n 
A 1 109 ALA 109 154 154 ALA ALA A . n 
A 1 110 MET 110 155 155 MET MET A . n 
A 1 111 LEU 111 156 156 LEU LEU A . n 
A 1 112 GLY 112 157 157 GLY GLY A . n 
A 1 113 GLU 113 158 158 GLU GLU A . n 
A 1 114 GLN 114 159 159 GLN GLN A . n 
A 1 115 PHE 115 160 160 PHE PHE A . n 
A 1 116 MET 116 161 161 MET MET A . n 
A 1 117 VAL 117 162 162 VAL VAL A . n 
A 1 118 GLY 118 163 163 GLY GLY A . n 
A 1 119 GLU 119 164 164 GLU GLU A . n 
A 1 120 GLU 120 165 165 GLU GLU A . n 
A 1 121 ILE 121 166 166 ILE ILE A . n 
A 1 122 CYS 122 167 167 CYS CYS A . n 
A 1 123 GLY 123 168 168 GLY GLY A . n 
A 1 124 ALA 124 169 169 ALA ALA A . n 
A 1 125 VAL 125 170 170 VAL VAL A . n 
A 1 126 VAL 126 171 171 VAL VAL A . n 
A 1 127 SER 127 172 172 SER SER A . n 
A 1 128 VAL 128 173 173 VAL VAL A . n 
A 1 129 ARG 129 174 174 ARG ARG A . n 
A 1 130 PHE 130 175 175 PHE PHE A . n 
A 1 131 GLN 131 176 176 GLN GLN A . n 
A 1 132 GLU 132 177 177 GLU GLU A . n 
A 1 133 ASP 133 178 178 ASP ASP A . n 
A 1 134 ILE 134 179 179 ILE ILE A . n 
A 1 135 ILE 135 180 180 ILE ILE A . n 
A 1 136 SER 136 181 181 SER SER A . n 
A 1 137 ILE 137 182 182 ILE ILE A . n 
A 1 138 TRP 138 183 183 TRP TRP A . n 
A 1 139 ASN 139 184 184 ASN ASN A . n 
A 1 140 LYS 140 185 185 LYS LYS A . n 
A 1 141 THR 141 186 186 THR THR A . n 
A 1 142 ALA 142 187 187 ALA ALA A . n 
A 1 143 SER 143 188 188 SER SER A . n 
A 1 144 ASP 144 189 189 ASP ASP A . n 
A 1 145 GLN 145 190 190 GLN GLN A . n 
A 1 146 ALA 146 191 191 ALA ALA A . n 
A 1 147 THR 147 192 192 THR THR A . n 
A 1 148 THR 148 193 193 THR THR A . n 
A 1 149 ALA 149 194 194 ALA ALA A . n 
A 1 150 ARG 150 195 195 ARG ARG A . n 
A 1 151 ILE 151 196 196 ILE ILE A . n 
A 1 152 ARG 152 197 197 ARG ARG A . n 
A 1 153 ASP 153 198 198 ASP ASP A . n 
A 1 154 THR 154 199 199 THR THR A . n 
A 1 155 LEU 155 200 200 LEU LEU A . n 
A 1 156 ARG 156 201 201 ARG ARG A . n 
A 1 157 ARG 157 202 202 ARG ARG A . n 
A 1 158 VAL 158 203 203 VAL VAL A . n 
A 1 159 LEU 159 204 204 LEU LEU A . n 
A 1 160 ASN 160 205 205 ASN ASN A . n 
A 1 161 LEU 161 206 206 LEU LEU A . n 
A 1 162 PRO 162 207 207 PRO PRO A . n 
A 1 163 PRO 163 208 208 PRO PRO A . n 
A 1 164 ASN 164 209 209 ASN ASN A . n 
A 1 165 THR 165 210 210 THR THR A . n 
A 1 166 ILE 166 211 211 ILE ILE A . n 
A 1 167 MET 167 212 212 MET MET A . n 
A 1 168 GLU 168 213 213 GLU GLU A . n 
A 1 169 TYR 169 214 214 TYR TYR A . n 
A 1 170 LYS 170 215 215 LYS LYS A . n 
A 1 171 THR 171 216 216 THR THR A . n 
A 1 172 HIS 172 217 217 HIS HIS A . n 
A 1 173 THR 173 218 218 THR THR A . n 
A 1 174 ASP 174 219 ?   ?   ?   A . n 
A 1 175 SER 175 220 ?   ?   ?   A . n 
A 1 176 ILE 176 221 ?   ?   ?   A . n 
A 1 177 LYS 177 222 ?   ?   ?   A . n 
A 1 178 MET 178 223 ?   ?   ?   A . n 
A 1 179 PRO 179 224 ?   ?   ?   A . n 
A 1 180 GLY 180 225 ?   ?   ?   A . n 
A 1 181 ARG 181 226 ?   ?   ?   A . n 
A 1 182 LEU 182 227 ?   ?   ?   A . n 
A 1 183 GLY 183 228 ?   ?   ?   A . n 
A 1 184 PRO 184 229 ?   ?   ?   A . n 
A 1 185 GLN 185 230 ?   ?   ?   A . n 
A 1 186 ARG 186 231 ?   ?   ?   A . n 
A 1 187 LEU 187 232 ?   ?   ?   A . n 
A 1 188 LEU 188 233 ?   ?   ?   A . n 
A 1 189 PHE 189 234 ?   ?   ?   A . n 
B 2 1   GLY 1   31  ?   ?   ?   B . n 
B 2 2   PRO 2   32  ?   ?   ?   B . n 
B 2 3   HIS 3   33  ?   ?   ?   B . n 
B 2 4   MET 4   34  ?   ?   ?   B . n 
B 2 5   LYS 5   35  ?   ?   ?   B . n 
B 2 6   TYR 6   36  ?   ?   ?   B . n 
B 2 7   LYS 7   37  37  LYS LYS B . n 
B 2 8   LEU 8   38  38  LEU LEU B . n 
B 2 9   ALA 9   39  39  ALA ALA B . n 
B 2 10  ASP 10  40  40  ASP ASP B . n 
B 2 11  TYR 11  41  41  TYR TYR B . n 
B 2 12  ARG 12  42  42  ARG ARG B . n 
B 2 13  TYR 13  43  43  TYR TYR B . n 
B 2 14  GLY 14  44  44  GLY GLY B . n 
B 2 15  ARG 15  45  45  ARG ARG B . n 
B 2 16  GLU 16  46  46  GLU GLU B . n 
B 2 17  GLU 17  47  47  GLU GLU B . n 
B 2 18  MET 18  48  48  MET MET B . n 
B 2 19  LEU 19  49  49  LEU LEU B . n 
B 2 20  ALA 20  50  50  ALA ALA B . n 
B 2 21  LEU 21  51  51  LEU LEU B . n 
B 2 22  PHE 22  52  52  PHE PHE B . n 
B 2 23  LEU 23  53  53  LEU LEU B . n 
B 2 24  LYS 24  54  54  LYS LYS B . n 
B 2 25  ASP 25  55  55  ASP ASP B . n 
B 2 26  ASN 26  56  56  ASN ASN B . n 
B 2 27  LYS 27  57  57  LYS LYS B . n 
B 2 28  ILE 28  58  58  ILE ILE B . n 
B 2 29  PRO 29  59  59  PRO PRO B . n 
B 2 30  SER 30  60  60  SER SER B . n 
B 2 31  ASP 31  61  61  ASP ASP B . n 
B 2 32  LEU 32  62  62  LEU LEU B . n 
B 2 33  LEU 33  63  63  LEU LEU B . n 
B 2 34  ASP 34  64  64  ASP ASP B . n 
B 2 35  LYS 35  65  65  LYS LYS B . n 
B 2 36  GLU 36  66  66  GLU GLU B . n 
B 2 37  PHE 37  67  67  PHE PHE B . n 
B 2 38  LEU 38  68  68  LEU LEU B . n 
B 2 39  PRO 39  69  69  PRO PRO B . n 
B 2 40  ILE 40  70  70  ILE ILE B . n 
B 2 41  LEU 41  71  71  LEU LEU B . n 
B 2 42  GLN 42  72  72  GLN GLN B . n 
B 2 43  GLU 43  73  73  GLU GLU B . n 
B 2 44  GLU 44  74  74  GLU GLU B . n 
B 2 45  PRO 45  75  75  PRO PRO B . n 
B 2 46  LEU 46  76  76  LEU LEU B . n 
B 2 47  PRO 47  77  77  PRO PRO B . n 
B 2 48  PRO 48  78  78  PRO PRO B . n 
B 2 49  LEU 49  79  79  LEU LEU B . n 
B 2 50  ALA 50  80  80  ALA ALA B . n 
B 2 51  LEU 51  81  81  LEU LEU B . n 
B 2 52  VAL 52  82  82  VAL VAL B . n 
B 2 53  PRO 53  83  83  PRO PRO B . n 
B 2 54  PHE 54  84  84  PHE PHE B . n 
B 2 55  THR 55  85  85  THR THR B . n 
B 2 56  GLU 56  86  86  GLU GLU B . n 
B 2 57  GLU 57  87  87  GLU GLU B . n 
B 2 58  GLU 58  88  88  GLU GLU B . n 
B 2 59  GLN 59  89  89  GLN GLN B . n 
B 2 60  ARG 60  90  90  ARG ARG B . n 
B 2 61  ASN 61  91  91  ASN ASN B . n 
B 2 62  PHE 62  92  92  PHE PHE B . n 
B 2 63  SER 63  93  93  SER SER B . n 
B 2 64  MET 64  94  94  MET MET B . n 
B 2 65  SER 65  95  95  SER SER B . n 
B 2 66  VAL 66  96  96  VAL VAL B . n 
B 2 67  ASN 67  97  97  ASN ASN B . n 
B 2 68  SER 68  98  98  SER SER B . n 
B 2 69  ALA 69  99  99  ALA ALA B . n 
B 2 70  ALA 70  100 100 ALA ALA B . n 
B 2 71  VAL 71  101 101 VAL VAL B . n 
B 2 72  LEU 72  102 102 LEU LEU B . n 
B 2 73  ARG 73  103 103 ARG ARG B . n 
B 2 74  LEU 74  104 104 LEU LEU B . n 
B 2 75  THR 75  105 105 THR THR B . n 
C 1 1   GLY 1   46  ?   ?   ?   C . n 
C 1 2   PRO 2   47  ?   ?   ?   C . n 
C 1 3   HIS 3   48  ?   ?   ?   C . n 
C 1 4   MET 4   49  ?   ?   ?   C . n 
C 1 5   LEU 5   50  ?   ?   ?   C . n 
C 1 6   GLU 6   51  51  GLU GLU C . n 
C 1 7   ALA 7   52  52  ALA ALA C . n 
C 1 8   GLU 8   53  53  GLU GLU C . n 
C 1 9   HIS 9   54  54  HIS HIS C . n 
C 1 10  PRO 10  55  55  PRO PRO C . n 
C 1 11  LEU 11  56  56  LEU LEU C . n 
C 1 12  GLN 12  57  57  GLN GLN C . n 
C 1 13  TYR 13  58  58  TYR TYR C . n 
C 1 14  ASN 14  59  59  ASN ASN C . n 
C 1 15  TYR 15  60  60  TYR TYR C . n 
C 1 16  THR 16  61  61  THR THR C . n 
C 1 17  PHE 17  62  62  PHE PHE C . n 
C 1 18  TRP 18  63  63  TRP TRP C . n 
C 1 19  TYR 19  64  64  TYR TYR C . n 
C 1 20  SER 20  65  65  SER SER C . n 
C 1 21  ARG 21  66  66  ARG ARG C . n 
C 1 22  ARG 22  67  67  ARG ARG C . n 
C 1 23  THR 23  68  68  THR THR C . n 
C 1 24  PRO 24  69  ?   ?   ?   C . n 
C 1 25  GLY 25  70  ?   ?   ?   C . n 
C 1 26  ARG 26  71  ?   ?   ?   C . n 
C 1 27  PRO 27  72  ?   ?   ?   C . n 
C 1 28  THR 28  73  ?   ?   ?   C . n 
C 1 29  SER 29  74  ?   ?   ?   C . n 
C 1 30  SER 30  75  ?   ?   ?   C . n 
C 1 31  GLN 31  76  ?   ?   ?   C . n 
C 1 32  SER 32  77  ?   ?   ?   C . n 
C 1 33  TYR 33  78  ?   ?   ?   C . n 
C 1 34  GLU 34  79  ?   ?   ?   C . n 
C 1 35  GLN 35  80  ?   ?   ?   C . n 
C 1 36  ASN 36  81  81  ASN ASN C . n 
C 1 37  ILE 37  82  82  ILE ILE C . n 
C 1 38  LYS 38  83  83  LYS LYS C . n 
C 1 39  GLN 39  84  84  GLN GLN C . n 
C 1 40  ILE 40  85  85  ILE ILE C . n 
C 1 41  GLY 41  86  86  GLY GLY C . n 
C 1 42  THR 42  87  87  THR THR C . n 
C 1 43  PHE 43  88  88  PHE PHE C . n 
C 1 44  ALA 44  89  89  ALA ALA C . n 
C 1 45  SER 45  90  90  SER SER C . n 
C 1 46  VAL 46  91  91  VAL VAL C . n 
C 1 47  GLU 47  92  92  GLU GLU C . n 
C 1 48  GLN 48  93  93  GLN GLN C . n 
C 1 49  PHE 49  94  94  PHE PHE C . n 
C 1 50  TRP 50  95  95  TRP TRP C . n 
C 1 51  ARG 51  96  96  ARG ARG C . n 
C 1 52  PHE 52  97  97  PHE PHE C . n 
C 1 53  TYR 53  98  98  TYR TYR C . n 
C 1 54  SER 54  99  99  SER SER C . n 
C 1 55  HIS 55  100 100 HIS HIS C . n 
C 1 56  MET 56  101 101 MET MET C . n 
C 1 57  VAL 57  102 102 VAL VAL C . n 
C 1 58  ARG 58  103 103 ARG ARG C . n 
C 1 59  PRO 59  104 104 PRO PRO C . n 
C 1 60  GLY 60  105 105 GLY GLY C . n 
C 1 61  ASP 61  106 106 ASP ASP C . n 
C 1 62  LEU 62  107 107 LEU LEU C . n 
C 1 63  THR 63  108 108 THR THR C . n 
C 1 64  GLY 64  109 109 GLY GLY C . n 
C 1 65  HIS 65  110 110 HIS HIS C . n 
C 1 66  SER 66  111 111 SER SER C . n 
C 1 67  ASP 67  112 112 ASP ASP C . n 
C 1 68  PHE 68  113 113 PHE PHE C . n 
C 1 69  HIS 69  114 114 HIS HIS C . n 
C 1 70  LEU 70  115 115 LEU LEU C . n 
C 1 71  PHE 71  116 116 PHE PHE C . n 
C 1 72  LYS 72  117 117 LYS LYS C . n 
C 1 73  GLU 73  118 118 GLU GLU C . n 
C 1 74  GLY 74  119 119 GLY GLY C . n 
C 1 75  ILE 75  120 120 ILE ILE C . n 
C 1 76  LYS 76  121 121 LYS LYS C . n 
C 1 77  PRO 77  122 122 PRO PRO C . n 
C 1 78  MET 78  123 123 MET MET C . n 
C 1 79  TRP 79  124 124 TRP TRP C . n 
C 1 80  GLU 80  125 125 GLU GLU C . n 
C 1 81  ASP 81  126 126 ASP ASP C . n 
C 1 82  ASP 82  127 127 ASP ASP C . n 
C 1 83  ALA 83  128 128 ALA ALA C . n 
C 1 84  ASN 84  129 129 ASN ASN C . n 
C 1 85  LYS 85  130 130 LYS LYS C . n 
C 1 86  ASN 86  131 131 ASN ASN C . n 
C 1 87  GLY 87  132 132 GLY GLY C . n 
C 1 88  GLY 88  133 133 GLY GLY C . n 
C 1 89  LYS 89  134 134 LYS LYS C . n 
C 1 90  TRP 90  135 135 TRP TRP C . n 
C 1 91  ILE 91  136 136 ILE ILE C . n 
C 1 92  ILE 92  137 137 ILE ILE C . n 
C 1 93  ARG 93  138 138 ARG ARG C . n 
C 1 94  LEU 94  139 139 LEU LEU C . n 
C 1 95  ARG 95  140 140 ARG ARG C . n 
C 1 96  LYS 96  141 141 LYS LYS C . n 
C 1 97  GLY 97  142 142 GLY GLY C . n 
C 1 98  LEU 98  143 143 LEU LEU C . n 
C 1 99  ALA 99  144 144 ALA ALA C . n 
C 1 100 SER 100 145 145 SER SER C . n 
C 1 101 ARG 101 146 146 ARG ARG C . n 
C 1 102 CYS 102 147 147 CYS CYS C . n 
C 1 103 TRP 103 148 148 TRP TRP C . n 
C 1 104 GLU 104 149 149 GLU GLU C . n 
C 1 105 ASN 105 150 150 ASN ASN C . n 
C 1 106 LEU 106 151 151 LEU LEU C . n 
C 1 107 ILE 107 152 152 ILE ILE C . n 
C 1 108 LEU 108 153 153 LEU LEU C . n 
C 1 109 ALA 109 154 154 ALA ALA C . n 
C 1 110 MET 110 155 155 MET MET C . n 
C 1 111 LEU 111 156 156 LEU LEU C . n 
C 1 112 GLY 112 157 157 GLY GLY C . n 
C 1 113 GLU 113 158 158 GLU GLU C . n 
C 1 114 GLN 114 159 159 GLN GLN C . n 
C 1 115 PHE 115 160 160 PHE PHE C . n 
C 1 116 MET 116 161 161 MET MET C . n 
C 1 117 VAL 117 162 162 VAL VAL C . n 
C 1 118 GLY 118 163 163 GLY GLY C . n 
C 1 119 GLU 119 164 164 GLU GLU C . n 
C 1 120 GLU 120 165 165 GLU GLU C . n 
C 1 121 ILE 121 166 166 ILE ILE C . n 
C 1 122 CYS 122 167 167 CYS CYS C . n 
C 1 123 GLY 123 168 168 GLY GLY C . n 
C 1 124 ALA 124 169 169 ALA ALA C . n 
C 1 125 VAL 125 170 170 VAL VAL C . n 
C 1 126 VAL 126 171 171 VAL VAL C . n 
C 1 127 SER 127 172 172 SER SER C . n 
C 1 128 VAL 128 173 173 VAL VAL C . n 
C 1 129 ARG 129 174 174 ARG ARG C . n 
C 1 130 PHE 130 175 175 PHE PHE C . n 
C 1 131 GLN 131 176 176 GLN GLN C . n 
C 1 132 GLU 132 177 177 GLU GLU C . n 
C 1 133 ASP 133 178 178 ASP ASP C . n 
C 1 134 ILE 134 179 179 ILE ILE C . n 
C 1 135 ILE 135 180 180 ILE ILE C . n 
C 1 136 SER 136 181 181 SER SER C . n 
C 1 137 ILE 137 182 182 ILE ILE C . n 
C 1 138 TRP 138 183 183 TRP TRP C . n 
C 1 139 ASN 139 184 184 ASN ASN C . n 
C 1 140 LYS 140 185 185 LYS LYS C . n 
C 1 141 THR 141 186 186 THR THR C . n 
C 1 142 ALA 142 187 187 ALA ALA C . n 
C 1 143 SER 143 188 188 SER SER C . n 
C 1 144 ASP 144 189 189 ASP ASP C . n 
C 1 145 GLN 145 190 190 GLN GLN C . n 
C 1 146 ALA 146 191 191 ALA ALA C . n 
C 1 147 THR 147 192 192 THR THR C . n 
C 1 148 THR 148 193 193 THR THR C . n 
C 1 149 ALA 149 194 194 ALA ALA C . n 
C 1 150 ARG 150 195 195 ARG ARG C . n 
C 1 151 ILE 151 196 196 ILE ILE C . n 
C 1 152 ARG 152 197 197 ARG ARG C . n 
C 1 153 ASP 153 198 198 ASP ASP C . n 
C 1 154 THR 154 199 199 THR THR C . n 
C 1 155 LEU 155 200 200 LEU LEU C . n 
C 1 156 ARG 156 201 201 ARG ARG C . n 
C 1 157 ARG 157 202 202 ARG ARG C . n 
C 1 158 VAL 158 203 203 VAL VAL C . n 
C 1 159 LEU 159 204 204 LEU LEU C . n 
C 1 160 ASN 160 205 205 ASN ASN C . n 
C 1 161 LEU 161 206 206 LEU LEU C . n 
C 1 162 PRO 162 207 207 PRO PRO C . n 
C 1 163 PRO 163 208 208 PRO PRO C . n 
C 1 164 ASN 164 209 209 ASN ASN C . n 
C 1 165 THR 165 210 210 THR THR C . n 
C 1 166 ILE 166 211 211 ILE ILE C . n 
C 1 167 MET 167 212 212 MET MET C . n 
C 1 168 GLU 168 213 213 GLU GLU C . n 
C 1 169 TYR 169 214 214 TYR TYR C . n 
C 1 170 LYS 170 215 215 LYS LYS C . n 
C 1 171 THR 171 216 216 THR THR C . n 
C 1 172 HIS 172 217 217 HIS HIS C . n 
C 1 173 THR 173 218 218 THR THR C . n 
C 1 174 ASP 174 219 ?   ?   ?   C . n 
C 1 175 SER 175 220 ?   ?   ?   C . n 
C 1 176 ILE 176 221 ?   ?   ?   C . n 
C 1 177 LYS 177 222 ?   ?   ?   C . n 
C 1 178 MET 178 223 ?   ?   ?   C . n 
C 1 179 PRO 179 224 ?   ?   ?   C . n 
C 1 180 GLY 180 225 ?   ?   ?   C . n 
C 1 181 ARG 181 226 ?   ?   ?   C . n 
C 1 182 LEU 182 227 ?   ?   ?   C . n 
C 1 183 GLY 183 228 ?   ?   ?   C . n 
C 1 184 PRO 184 229 ?   ?   ?   C . n 
C 1 185 GLN 185 230 ?   ?   ?   C . n 
C 1 186 ARG 186 231 ?   ?   ?   C . n 
C 1 187 LEU 187 232 ?   ?   ?   C . n 
C 1 188 LEU 188 233 ?   ?   ?   C . n 
C 1 189 PHE 189 234 ?   ?   ?   C . n 
D 2 1   GLY 1   31  ?   ?   ?   D . n 
D 2 2   PRO 2   32  ?   ?   ?   D . n 
D 2 3   HIS 3   33  ?   ?   ?   D . n 
D 2 4   MET 4   34  ?   ?   ?   D . n 
D 2 5   LYS 5   35  ?   ?   ?   D . n 
D 2 6   TYR 6   36  ?   ?   ?   D . n 
D 2 7   LYS 7   37  37  LYS LYS D . n 
D 2 8   LEU 8   38  38  LEU LEU D . n 
D 2 9   ALA 9   39  39  ALA ALA D . n 
D 2 10  ASP 10  40  40  ASP ASP D . n 
D 2 11  TYR 11  41  41  TYR TYR D . n 
D 2 12  ARG 12  42  42  ARG ARG D . n 
D 2 13  TYR 13  43  43  TYR TYR D . n 
D 2 14  GLY 14  44  44  GLY GLY D . n 
D 2 15  ARG 15  45  45  ARG ARG D . n 
D 2 16  GLU 16  46  46  GLU GLU D . n 
D 2 17  GLU 17  47  47  GLU GLU D . n 
D 2 18  MET 18  48  48  MET MET D . n 
D 2 19  LEU 19  49  49  LEU LEU D . n 
D 2 20  ALA 20  50  50  ALA ALA D . n 
D 2 21  LEU 21  51  51  LEU LEU D . n 
D 2 22  PHE 22  52  52  PHE PHE D . n 
D 2 23  LEU 23  53  53  LEU LEU D . n 
D 2 24  LYS 24  54  54  LYS LYS D . n 
D 2 25  ASP 25  55  55  ASP ASP D . n 
D 2 26  ASN 26  56  56  ASN ASN D . n 
D 2 27  LYS 27  57  57  LYS LYS D . n 
D 2 28  ILE 28  58  58  ILE ILE D . n 
D 2 29  PRO 29  59  59  PRO PRO D . n 
D 2 30  SER 30  60  60  SER SER D . n 
D 2 31  ASP 31  61  61  ASP ASP D . n 
D 2 32  LEU 32  62  62  LEU LEU D . n 
D 2 33  LEU 33  63  63  LEU LEU D . n 
D 2 34  ASP 34  64  64  ASP ASP D . n 
D 2 35  LYS 35  65  65  LYS LYS D . n 
D 2 36  GLU 36  66  66  GLU GLU D . n 
D 2 37  PHE 37  67  67  PHE PHE D . n 
D 2 38  LEU 38  68  68  LEU LEU D . n 
D 2 39  PRO 39  69  69  PRO PRO D . n 
D 2 40  ILE 40  70  70  ILE ILE D . n 
D 2 41  LEU 41  71  71  LEU LEU D . n 
D 2 42  GLN 42  72  72  GLN GLN D . n 
D 2 43  GLU 43  73  73  GLU GLU D . n 
D 2 44  GLU 44  74  74  GLU GLU D . n 
D 2 45  PRO 45  75  75  PRO PRO D . n 
D 2 46  LEU 46  76  76  LEU LEU D . n 
D 2 47  PRO 47  77  77  PRO PRO D . n 
D 2 48  PRO 48  78  78  PRO PRO D . n 
D 2 49  LEU 49  79  79  LEU LEU D . n 
D 2 50  ALA 50  80  80  ALA ALA D . n 
D 2 51  LEU 51  81  81  LEU LEU D . n 
D 2 52  VAL 52  82  82  VAL VAL D . n 
D 2 53  PRO 53  83  83  PRO PRO D . n 
D 2 54  PHE 54  84  84  PHE PHE D . n 
D 2 55  THR 55  85  85  THR THR D . n 
D 2 56  GLU 56  86  86  GLU GLU D . n 
D 2 57  GLU 57  87  87  GLU GLU D . n 
D 2 58  GLU 58  88  88  GLU GLU D . n 
D 2 59  GLN 59  89  89  GLN GLN D . n 
D 2 60  ARG 60  90  90  ARG ARG D . n 
D 2 61  ASN 61  91  91  ASN ASN D . n 
D 2 62  PHE 62  92  92  PHE PHE D . n 
D 2 63  SER 63  93  93  SER SER D . n 
D 2 64  MET 64  94  94  MET MET D . n 
D 2 65  SER 65  95  95  SER SER D . n 
D 2 66  VAL 66  96  96  VAL VAL D . n 
D 2 67  ASN 67  97  97  ASN ASN D . n 
D 2 68  SER 68  98  98  SER SER D . n 
D 2 69  ALA 69  99  99  ALA ALA D . n 
D 2 70  ALA 70  100 100 ALA ALA D . n 
D 2 71  VAL 71  101 101 VAL VAL D . n 
D 2 72  LEU 72  102 102 LEU LEU