data_5NVN
# 
_entry.id   5NVN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NVN         
WWPDB D_1200004617 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NVN 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Peter, D.'    1 0000-0003-1156-1033 
'Sandmeir, F.' 2 ?                   
'Valkov, E.'   3 0000-0002-3721-1739 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_id_ASTM           GEDEEP 
_citation.journal_id_CSD            2056 
_citation.journal_id_ISSN           1549-5477 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                1147 
_citation.page_last                 1161 
_citation.title                     
'GIGYF1/2 proteins use auxiliary sequences to selectively bind to 4EHP and repress target mRNA expression.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1101/gad.299420.117 
_citation.pdbx_database_id_PubMed   28698298 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Peter, D.'      1 
primary 'Weber, R.'      2 
primary 'Sandmeir, F.'   3 
primary 'Wohlbold, L.'   4 
primary 'Helms, S.'      5 
primary 'Bawankar, P.'   6 
primary 'Valkov, E.'     7 
primary 'Igreja, C.'     8 
primary 'Izaurralde, E.' 9 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   104.28 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NVN 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     38.400 
_cell.length_a_esd                 ? 
_cell.length_b                     83.390 
_cell.length_b_esd                 ? 
_cell.length_c                     70.500 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NVN 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Eukaryotic translation initiation factor 4E type 2'            21979.102 2   ? ? ? 
'The first six residues of the coordinate sequence belong to the expression tag' 
2 polymer     man 'Eukaryotic translation initiation factor 4E-binding protein 1' 4333.087  2   ? ? ? 
'The first residue of the coordinate sequence belongs to the expression tag'     
3 non-polymer syn 'FORMIC ACID'                                                   46.025    7   ? ? ? ? 
4 water       nat water                                                           18.015    221 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;eIF4E type 2,Eukaryotic translation initiation factor 4E homologous protein,Eukaryotic translation initiation factor 4E-like 3,eIF4E-like protein 4E-LP,mRNA cap-binding protein 4EHP,h4EHP,mRNA cap-binding protein type 3
;
2 'eIF4E-binding protein 1,Phosphorylated heat- and acid-stable protein regulated by insulin 1,PHAS-I' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPHMLEAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWE
DDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLN
LPPNTIMEYKTHTDSIKMPGRLGPQRLLF
;
;GPHMLEAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWE
DDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLN
LPPNTIMEYKTHTDSIKMPGRLGPQRLLF
;
A,C ? 
2 'polypeptide(L)' no no GPHMTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTS GPHMTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTS B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   LEU n 
1 6   GLU n 
1 7   ALA n 
1 8   GLU n 
1 9   HIS n 
1 10  PRO n 
1 11  LEU n 
1 12  GLN n 
1 13  TYR n 
1 14  ASN n 
1 15  TYR n 
1 16  THR n 
1 17  PHE n 
1 18  TRP n 
1 19  TYR n 
1 20  SER n 
1 21  ARG n 
1 22  ARG n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  ARG n 
1 27  PRO n 
1 28  THR n 
1 29  SER n 
1 30  SER n 
1 31  GLN n 
1 32  SER n 
1 33  TYR n 
1 34  GLU n 
1 35  GLN n 
1 36  ASN n 
1 37  ILE n 
1 38  LYS n 
1 39  GLN n 
1 40  ILE n 
1 41  GLY n 
1 42  THR n 
1 43  PHE n 
1 44  ALA n 
1 45  SER n 
1 46  VAL n 
1 47  GLU n 
1 48  GLN n 
1 49  PHE n 
1 50  TRP n 
1 51  ARG n 
1 52  PHE n 
1 53  TYR n 
1 54  SER n 
1 55  HIS n 
1 56  MET n 
1 57  VAL n 
1 58  ARG n 
1 59  PRO n 
1 60  GLY n 
1 61  ASP n 
1 62  LEU n 
1 63  THR n 
1 64  GLY n 
1 65  HIS n 
1 66  SER n 
1 67  ASP n 
1 68  PHE n 
1 69  HIS n 
1 70  LEU n 
1 71  PHE n 
1 72  LYS n 
1 73  GLU n 
1 74  GLY n 
1 75  ILE n 
1 76  LYS n 
1 77  PRO n 
1 78  MET n 
1 79  TRP n 
1 80  GLU n 
1 81  ASP n 
1 82  ASP n 
1 83  ALA n 
1 84  ASN n 
1 85  LYS n 
1 86  ASN n 
1 87  GLY n 
1 88  GLY n 
1 89  LYS n 
1 90  TRP n 
1 91  ILE n 
1 92  ILE n 
1 93  ARG n 
1 94  LEU n 
1 95  ARG n 
1 96  LYS n 
1 97  GLY n 
1 98  LEU n 
1 99  ALA n 
1 100 SER n 
1 101 ARG n 
1 102 CYS n 
1 103 TRP n 
1 104 GLU n 
1 105 ASN n 
1 106 LEU n 
1 107 ILE n 
1 108 LEU n 
1 109 ALA n 
1 110 MET n 
1 111 LEU n 
1 112 GLY n 
1 113 GLU n 
1 114 GLN n 
1 115 PHE n 
1 116 MET n 
1 117 VAL n 
1 118 GLY n 
1 119 GLU n 
1 120 GLU n 
1 121 ILE n 
1 122 CYS n 
1 123 GLY n 
1 124 ALA n 
1 125 VAL n 
1 126 VAL n 
1 127 SER n 
1 128 VAL n 
1 129 ARG n 
1 130 PHE n 
1 131 GLN n 
1 132 GLU n 
1 133 ASP n 
1 134 ILE n 
1 135 ILE n 
1 136 SER n 
1 137 ILE n 
1 138 TRP n 
1 139 ASN n 
1 140 LYS n 
1 141 THR n 
1 142 ALA n 
1 143 SER n 
1 144 ASP n 
1 145 GLN n 
1 146 ALA n 
1 147 THR n 
1 148 THR n 
1 149 ALA n 
1 150 ARG n 
1 151 ILE n 
1 152 ARG n 
1 153 ASP n 
1 154 THR n 
1 155 LEU n 
1 156 ARG n 
1 157 ARG n 
1 158 VAL n 
1 159 LEU n 
1 160 ASN n 
1 161 LEU n 
1 162 PRO n 
1 163 PRO n 
1 164 ASN n 
1 165 THR n 
1 166 ILE n 
1 167 MET n 
1 168 GLU n 
1 169 TYR n 
1 170 LYS n 
1 171 THR n 
1 172 HIS n 
1 173 THR n 
1 174 ASP n 
1 175 SER n 
1 176 ILE n 
1 177 LYS n 
1 178 MET n 
1 179 PRO n 
1 180 GLY n 
1 181 ARG n 
1 182 LEU n 
1 183 GLY n 
1 184 PRO n 
1 185 GLN n 
1 186 ARG n 
1 187 LEU n 
1 188 LEU n 
1 189 PHE n 
2 1   GLY n 
2 2   PRO n 
2 3   HIS n 
2 4   MET n 
2 5   THR n 
2 6   ARG n 
2 7   ILE n 
2 8   ILE n 
2 9   TYR n 
2 10  ASP n 
2 11  ARG n 
2 12  LYS n 
2 13  PHE n 
2 14  LEU n 
2 15  MET n 
2 16  GLU n 
2 17  CYS n 
2 18  ARG n 
2 19  ASN n 
2 20  SER n 
2 21  PRO n 
2 22  VAL n 
2 23  THR n 
2 24  LYS n 
2 25  THR n 
2 26  PRO n 
2 27  PRO n 
2 28  ARG n 
2 29  ASP n 
2 30  LEU n 
2 31  PRO n 
2 32  THR n 
2 33  ILE n 
2 34  PRO n 
2 35  GLY n 
2 36  VAL n 
2 37  THR n 
2 38  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 189 Human ? 'EIF4E2, EIF4EL3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? STAR ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 38  Human ? EIF4EBP1          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? STAR ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP IF4E2_HUMAN O60573 ? 1 
;AEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKN
GGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTI
MEYKTHTDSIKMPGRLGPQRLLF
;
52 
2 UNP 4EBP1_HUMAN Q13541 ? 2 TRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTS 50 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5NVN A 7 ? 189 ? O60573 52 ? 234 ? 52 234 
2 2 5NVN B 5 ? 38  ? Q13541 50 ? 83  ? 50 83  
3 1 5NVN C 7 ? 189 ? O60573 52 ? 234 ? 52 234 
4 2 5NVN D 5 ? 38  ? Q13541 50 ? 83  ? 50 83  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5NVN GLY A 1 ? UNP O60573 ? ? 'expression tag' 46 1  
1 5NVN PRO A 2 ? UNP O60573 ? ? 'expression tag' 47 2  
1 5NVN HIS A 3 ? UNP O60573 ? ? 'expression tag' 48 3  
1 5NVN MET A 4 ? UNP O60573 ? ? 'expression tag' 49 4  
1 5NVN LEU A 5 ? UNP O60573 ? ? 'expression tag' 50 5  
1 5NVN GLU A 6 ? UNP O60573 ? ? 'expression tag' 51 6  
2 5NVN GLY B 1 ? UNP Q13541 ? ? 'expression tag' 46 7  
2 5NVN PRO B 2 ? UNP Q13541 ? ? 'expression tag' 47 8  
2 5NVN HIS B 3 ? UNP Q13541 ? ? 'expression tag' 48 9  
2 5NVN MET B 4 ? UNP Q13541 ? ? 'expression tag' 49 10 
3 5NVN GLY C 1 ? UNP O60573 ? ? 'expression tag' 46 11 
3 5NVN PRO C 2 ? UNP O60573 ? ? 'expression tag' 47 12 
3 5NVN HIS C 3 ? UNP O60573 ? ? 'expression tag' 48 13 
3 5NVN MET C 4 ? UNP O60573 ? ? 'expression tag' 49 14 
3 5NVN LEU C 5 ? UNP O60573 ? ? 'expression tag' 50 15 
3 5NVN GLU C 6 ? UNP O60573 ? ? 'expression tag' 51 16 
4 5NVN GLY D 1 ? UNP Q13541 ? ? 'expression tag' 46 17 
4 5NVN PRO D 2 ? UNP Q13541 ? ? 'expression tag' 47 18 
4 5NVN HIS D 3 ? UNP Q13541 ? ? 'expression tag' 48 19 
4 5NVN MET D 4 ? UNP Q13541 ? ? 'expression tag' 49 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'   ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NVN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.08 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.83 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M sodium acetate pH 4.6
1.7 M sodium formate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99999 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5NVN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.9 
_reflns.d_resolution_low                 41.7 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33907 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.145 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.90 
_reflns_shell.d_res_low                   1.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.07 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           2495 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.7 
_reflns_shell.pdbx_Rsym_value             1.138 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5NVN 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.900 
_refine.ls_d_res_low                             41.695 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33898 
_refine.ls_number_reflns_R_free                  1696 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2277 
_refine.ls_R_factor_R_free                       0.2506 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2264 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2JGB 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.85 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.27 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3273 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             221 
_refine_hist.number_atoms_total               3515 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        41.695 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 3409 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.529  ? 4608 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.003 ? 2053 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.043  ? 493  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 587  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8999 1.9558  . . 141 2670 100.00 . . . 0.3553 . 0.3066 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9558 2.0189  . . 141 2684 100.00 . . . 0.3090 . 0.2677 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0189 2.0910  . . 139 2643 100.00 . . . 0.2895 . 0.2571 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0910 2.1748  . . 140 2664 100.00 . . . 0.2697 . 0.2459 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1748 2.2737  . . 142 2693 100.00 . . . 0.3087 . 0.2420 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2737 2.3936  . . 141 2667 100.00 . . . 0.3054 . 0.2363 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3936 2.5435  . . 141 2685 100.00 . . . 0.3002 . 0.2371 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5435 2.7399  . . 141 2684 100.00 . . . 0.2556 . 0.2344 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7399 3.0156  . . 141 2665 100.00 . . . 0.2473 . 0.2358 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0156 3.4517  . . 142 2703 100.00 . . . 0.2512 . 0.2189 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4517 4.3481  . . 142 2707 100.00 . . . 0.2160 . 0.1924 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3481 41.7050 . . 145 2737 100.00 . . . 0.2001 . 0.2134 . . . . . . . . . . 
# 
_struct.entry_id                     5NVN 
_struct.title                        'Crystal structure of the human 4EHP-4E-BP1 complex' 
_struct.pdbx_descriptor              
'Eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E-binding protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NVN 
_struct_keywords.text            
'translational regulation, translation initiation, cap-binding protein, eIF4E-binding protein 1, translation' 
_struct_keywords.pdbx_keywords   TRANSLATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 46  ? HIS A 55  ? VAL A 91  HIS A 100 1 ? 10 
HELX_P HELX_P2  AA2 ASP A 82  ? LYS A 85  ? ASP A 127 LYS A 130 5 ? 4  
HELX_P HELX_P3  AA3 ALA A 99  ? LEU A 111 ? ALA A 144 LEU A 156 1 ? 13 
HELX_P HELX_P4  AA4 GLN A 145 ? VAL A 158 ? GLN A 190 VAL A 203 1 ? 14 
HELX_P HELX_P5  AA5 HIS A 172 ? ILE A 176 ? HIS A 217 ILE A 221 1 ? 5  
HELX_P HELX_P6  AA6 ARG B 11  ? CYS B 17  ? ARG B 56  CYS B 62  1 ? 7  
HELX_P HELX_P7  AA7 VAL C 46  ? HIS C 55  ? VAL C 91  HIS C 100 1 ? 10 
HELX_P HELX_P8  AA8 ALA C 99  ? LEU C 111 ? ALA C 144 LEU C 156 1 ? 13 
HELX_P HELX_P9  AA9 GLN C 145 ? VAL C 158 ? GLN C 190 VAL C 203 1 ? 14 
HELX_P HELX_P10 AB1 THR C 173 ? ILE C 176 ? THR C 218 ILE C 221 5 ? 4  
HELX_P HELX_P11 AB2 ARG D 11  ? CYS D 17  ? ARG D 56  CYS D 62  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 4   ? GLU A 6   ? MET A 49  GLU A 51  
AA1 2 MET C 167 ? THR C 171 ? MET C 212 THR C 216 
AA1 3 GLY C 88  ? LEU C 94  ? GLY C 133 LEU C 139 
AA1 4 ASP C 133 ? ASN C 139 ? ASP C 178 ASN C 184 
AA1 5 ILE C 121 ? VAL C 128 ? ILE C 166 VAL C 173 
AA1 6 HIS C 65  ? LYS C 72  ? HIS C 110 LYS C 117 
AA1 7 LEU C 11  ? ARG C 22  ? LEU C 56  ARG C 67  
AA1 8 LYS C 38  ? SER C 45  ? LYS C 83  SER C 90  
AA2 1 LYS A 38  ? SER A 45  ? LYS A 83  SER A 90  
AA2 2 LEU A 11  ? SER A 20  ? LEU A 56  SER A 65  
AA2 3 SER A 66  ? LYS A 72  ? SER A 111 LYS A 117 
AA2 4 ILE A 121 ? VAL A 128 ? ILE A 166 VAL A 173 
AA2 5 ASP A 133 ? ASN A 139 ? ASP A 178 ASN A 184 
AA2 6 GLY A 88  ? LEU A 94  ? GLY A 133 LEU A 139 
AA2 7 MET A 167 ? THR A 171 ? MET A 212 THR A 216 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 6   ? N GLU A 51  O MET C 167 ? O MET C 212 
AA1 2 3 O GLU C 168 ? O GLU C 213 N ILE C 91  ? N ILE C 136 
AA1 3 4 N LEU C 94  ? N LEU C 139 O ASP C 133 ? O ASP C 178 
AA1 4 5 O ILE C 134 ? O ILE C 179 N SER C 127 ? N SER C 172 
AA1 5 6 O ALA C 124 ? O ALA C 169 N LEU C 70  ? N LEU C 115 
AA1 6 7 O HIS C 69  ? O HIS C 114 N TRP C 18  ? N TRP C 63  
AA1 7 8 N PHE C 17  ? N PHE C 62  O ILE C 40  ? O ILE C 85  
AA2 1 2 O ILE A 40  ? O ILE A 85  N PHE A 17  ? N PHE A 62  
AA2 2 3 N TRP A 18  ? N TRP A 63  O HIS A 69  ? O HIS A 114 
AA2 3 4 N LEU A 70  ? N LEU A 115 O ALA A 124 ? O ALA A 169 
AA2 4 5 N GLY A 123 ? N GLY A 168 O TRP A 138 ? O TRP A 183 
AA2 5 6 O ASP A 133 ? O ASP A 178 N LEU A 94  ? N LEU A 139 
AA2 6 7 N ILE A 91  ? N ILE A 136 O GLU A 168 ? O GLU A 213 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FMT 301 ? 6 'binding site for residue FMT A 301' 
AC2 Software C FMT 301 ? 3 'binding site for residue FMT C 301' 
AC3 Software C FMT 302 ? 5 'binding site for residue FMT C 302' 
AC4 Software C FMT 303 ? 4 'binding site for residue FMT C 303' 
AC5 Software C FMT 304 ? 2 'binding site for residue FMT C 304' 
AC6 Software C FMT 305 ? 5 'binding site for residue FMT C 305' 
AC7 Software C FMT 306 ? 1 'binding site for residue FMT C 306' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLN A 48  ? GLN A 93  . ? 1_555 ? 
2  AC1 6 ARG A 51  ? ARG A 96  . ? 1_555 ? 
3  AC1 6 HOH L .   ? HOH A 439 . ? 1_555 ? 
4  AC1 6 PRO B 27  ? PRO B 72  . ? 1_555 ? 
5  AC1 6 ASP B 29  ? ASP B 74  . ? 1_555 ? 
6  AC1 6 ASP C 153 ? ASP C 198 . ? 1_555 ? 
7  AC2 3 ARG B 28  ? ARG B 73  . ? 1_555 ? 
8  AC2 3 THR C 154 ? THR C 199 . ? 1_555 ? 
9  AC2 3 ARG C 157 ? ARG C 202 . ? 1_555 ? 
10 AC3 5 ARG B 28  ? ARG B 73  . ? 1_555 ? 
11 AC3 5 PHE C 115 ? PHE C 160 . ? 1_555 ? 
12 AC3 5 MET C 116 ? MET C 161 . ? 1_555 ? 
13 AC3 5 ARG C 150 ? ARG C 195 . ? 1_555 ? 
14 AC3 5 THR C 154 ? THR C 199 . ? 1_555 ? 
15 AC4 4 LEU C 94  ? LEU C 139 . ? 1_555 ? 
16 AC4 4 ARG C 95  ? ARG C 140 . ? 1_555 ? 
17 AC4 4 LEU C 98  ? LEU C 143 . ? 1_555 ? 
18 AC4 4 FMT I .   ? FMT C 304 . ? 1_555 ? 
19 AC5 2 GLU C 132 ? GLU C 177 . ? 1_555 ? 
20 AC5 2 FMT H .   ? FMT C 303 . ? 1_555 ? 
21 AC6 5 ARG C 101 ? ARG C 146 . ? 1_555 ? 
22 AC6 5 ASN C 105 ? ASN C 150 . ? 1_555 ? 
23 AC6 5 ASN C 160 ? ASN C 205 . ? 1_555 ? 
24 AC6 5 HOH N .   ? HOH C 416 . ? 1_555 ? 
25 AC6 5 ARG D 11  ? ARG D 56  . ? 1_555 ? 
26 AC7 1 LYS C 177 ? LYS C 222 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5NVN 
_atom_sites.fract_transf_matrix[1][1]   0.026042 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006626 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011992 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014636 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLY A 1 1   ? 1.259   46.497  41.802 1.00 41.30  ?  46  GLY A N    1 
ATOM   2    C CA   . GLY A 1 1   ? 2.708   46.564  41.855 1.00 36.81  ?  46  GLY A CA   1 
ATOM   3    C C    . GLY A 1 1   ? 3.237   46.612  43.274 1.00 32.53  ?  46  GLY A C    1 
ATOM   4    O O    . GLY A 1 1   ? 3.825   47.608  43.687 1.00 36.42  ?  46  GLY A O    1 
ATOM   5    H HA2  . GLY A 1 1   ? 3.083   45.786  41.414 1.00 44.18  ?  46  GLY A HA2  1 
ATOM   6    H HA3  . GLY A 1 1   ? 3.011   47.358  41.388 1.00 44.18  ?  46  GLY A HA3  1 
ATOM   7    N N    . PRO A 1 2   ? 3.037   45.535  44.024 1.00 29.32  ?  47  PRO A N    1 
ATOM   8    C CA   . PRO A 1 2   ? 3.456   45.516  45.426 1.00 30.38  ?  47  PRO A CA   1 
ATOM   9    C C    . PRO A 1 2   ? 4.945   45.230  45.579 1.00 23.22  ?  47  PRO A C    1 
ATOM   10   O O    . PRO A 1 2   ? 5.648   44.843  44.644 1.00 23.02  ?  47  PRO A O    1 
ATOM   11   C CB   . PRO A 1 2   ? 2.615   44.388  46.026 1.00 28.15  ?  47  PRO A CB   1 
ATOM   12   C CG   . PRO A 1 2   ? 2.417   43.449  44.892 1.00 32.93  ?  47  PRO A CG   1 
ATOM   13   C CD   . PRO A 1 2   ? 2.330   44.300  43.648 1.00 28.73  ?  47  PRO A CD   1 
ATOM   14   H HA   . PRO A 1 2   ? 3.237   46.355  45.861 1.00 36.46  ?  47  PRO A HA   1 
ATOM   15   H HB2  . PRO A 1 2   ? 3.101   43.961  46.748 1.00 33.78  ?  47  PRO A HB2  1 
ATOM   16   H HB3  . PRO A 1 2   ? 1.766   44.738  46.338 1.00 33.78  ?  47  PRO A HB3  1 
ATOM   17   H HG2  . PRO A 1 2   ? 3.173   42.844  44.838 1.00 39.51  ?  47  PRO A HG2  1 
ATOM   18   H HG3  . PRO A 1 2   ? 1.593   42.954  45.023 1.00 39.51  ?  47  PRO A HG3  1 
ATOM   19   H HD2  . PRO A 1 2   ? 2.781   43.864  42.908 1.00 34.47  ?  47  PRO A HD2  1 
ATOM   20   H HD3  . PRO A 1 2   ? 1.403   44.493  43.435 1.00 34.47  ?  47  PRO A HD3  1 
ATOM   21   N N    . HIS A 1 3   ? 5.412   45.441  46.802 1.00 22.47  ?  48  HIS A N    1 
ATOM   22   C CA   . HIS A 1 3   ? 6.780   45.144  47.206 1.00 19.84  ?  48  HIS A CA   1 
ATOM   23   C C    . HIS A 1 3   ? 6.664   44.424  48.541 1.00 18.49  ?  48  HIS A C    1 
ATOM   24   O O    . HIS A 1 3   ? 6.300   45.040  49.550 1.00 15.84  ?  48  HIS A O    1 
ATOM   25   C CB   . HIS A 1 3   ? 7.612   46.421  47.312 1.00 16.11  ?  48  HIS A CB   1 
ATOM   26   C CG   . HIS A 1 3   ? 9.076   46.183  47.510 1.00 18.04  ?  48  HIS A CG   1 
ATOM   27   N ND1  . HIS A 1 3   ? 9.996   47.208  47.547 1.00 17.29  ?  48  HIS A ND1  1 
ATOM   28   C CD2  . HIS A 1 3   ? 9.780   45.039  47.681 1.00 18.93  ?  48  HIS A CD2  1 
ATOM   29   C CE1  . HIS A 1 3   ? 11.203  46.707  47.733 1.00 17.78  ?  48  HIS A CE1  1 
ATOM   30   N NE2  . HIS A 1 3   ? 11.101  45.393  47.816 1.00 17.16  ?  48  HIS A NE2  1 
ATOM   31   H H    . HIS A 1 3   ? 4.937   45.767  47.440 1.00 26.97  ?  48  HIS A H    1 
ATOM   32   H HA   . HIS A 1 3   ? 7.195   44.549  46.561 1.00 23.81  ?  48  HIS A HA   1 
ATOM   33   H HB2  . HIS A 1 3   ? 7.504   46.933  46.495 1.00 19.34  ?  48  HIS A HB2  1 
ATOM   34   H HB3  . HIS A 1 3   ? 7.292   46.939  48.068 1.00 19.34  ?  48  HIS A HB3  1 
ATOM   35   H HD2  . HIS A 1 3   ? 9.435   44.176  47.702 1.00 22.71  ?  48  HIS A HD2  1 
ATOM   36   H HE1  . HIS A 1 3   ? 11.992  47.196  47.793 1.00 21.33  ?  48  HIS A HE1  1 
ATOM   37   H HE2  . HIS A 1 3   ? 11.755  44.848  47.937 1.00 20.59  ?  48  HIS A HE2  1 
ATOM   38   N N    . MET A 1 4   ? 6.934   43.119  48.538 1.00 15.82  ?  49  MET A N    1 
ATOM   39   C CA   . MET A 1 4   ? 6.585   42.246  49.649 1.00 18.57  ?  49  MET A CA   1 
ATOM   40   C C    . MET A 1 4   ? 7.804   41.484  50.144 1.00 14.85  ?  49  MET A C    1 
ATOM   41   O O    . MET A 1 4   ? 8.762   41.254  49.402 1.00 14.62  ?  49  MET A O    1 
ATOM   42   C CB   . MET A 1 4   ? 5.508   41.229  49.242 1.00 17.03  ?  49  MET A CB   1 
ATOM   43   C CG   . MET A 1 4   ? 4.230   41.848  48.715 1.00 24.38  ?  49  MET A CG   1 
ATOM   44   S SD   . MET A 1 4   ? 3.015   40.599  48.253 1.00 33.87  ?  49  MET A SD   1 
ATOM   45   C CE   . MET A 1 4   ? 3.794   39.872  46.808 1.00 28.21  ?  49  MET A CE   1 
ATOM   46   H H    . MET A 1 4   ? 7.326   42.711  47.890 1.00 18.98  ?  49  MET A H    1 
ATOM   47   H HA   . MET A 1 4   ? 6.232   42.784  50.375 1.00 22.29  ?  49  MET A HA   1 
ATOM   48   H HB2  . MET A 1 4   ? 5.867   40.657  48.546 1.00 20.44  ?  49  MET A HB2  1 
ATOM   49   H HB3  . MET A 1 4   ? 5.278   40.694  50.018 1.00 20.44  ?  49  MET A HB3  1 
ATOM   50   H HG2  . MET A 1 4   ? 3.840   42.409  49.404 1.00 29.26  ?  49  MET A HG2  1 
ATOM   51   H HG3  . MET A 1 4   ? 4.434   42.378  47.929 1.00 29.26  ?  49  MET A HG3  1 
ATOM   52   H HE1  . MET A 1 4   ? 3.222   39.170  46.461 1.00 33.86  ?  49  MET A HE1  1 
ATOM   53   H HE2  . MET A 1 4   ? 3.918   40.561  46.137 1.00 33.86  ?  49  MET A HE2  1 
ATOM   54   H HE3  . MET A 1 4   ? 4.653   39.502  47.066 1.00 33.86  ?  49  MET A HE3  1 
ATOM   55   N N    . LEU A 1 5   ? 7.749   41.098  51.414 1.00 15.24  ?  50  LEU A N    1 
ATOM   56   C CA   . LEU A 1 5   ? 8.631   40.091  51.980 1.00 18.01  ?  50  LEU A CA   1 
ATOM   57   C C    . LEU A 1 5   ? 7.773   38.958  52.525 1.00 16.61  ?  50  LEU A C    1 
ATOM   58   O O    . LEU A 1 5   ? 6.653   39.180  52.991 1.00 17.65  ?  50  LEU A O    1 
ATOM   59   C CB   . LEU A 1 5   ? 9.510   40.667  53.095 1.00 16.50  ?  50  LEU A CB   1 
ATOM   60   C CG   . LEU A 1 5   ? 10.567  41.694  52.679 1.00 19.12  ?  50  LEU A CG   1 
ATOM   61   C CD1  . LEU A 1 5   ? 11.136  42.407  53.900 1.00 15.96  ?  50  LEU A CD1  1 
ATOM   62   C CD2  . LEU A 1 5   ? 11.677  41.021  51.888 1.00 17.92  ?  50  LEU A CD2  1 
ATOM   63   H H    . LEU A 1 5   ? 7.189   41.418  51.984 1.00 18.29  ?  50  LEU A H    1 
ATOM   64   H HA   . LEU A 1 5   ? 9.207   39.737  51.284 1.00 21.62  ?  50  LEU A HA   1 
ATOM   65   H HB2  . LEU A 1 5   ? 8.931   41.098  53.744 1.00 19.80  ?  50  LEU A HB2  1 
ATOM   66   H HB3  . LEU A 1 5   ? 9.977   39.932  53.522 1.00 19.80  ?  50  LEU A HB3  1 
ATOM   67   H HG   . LEU A 1 5   ? 10.153  42.361  52.108 1.00 22.95  ?  50  LEU A HG   1 
ATOM   68   H HD11 . LEU A 1 5   ? 11.801  43.050  53.608 1.00 19.15  ?  50  LEU A HD11 1 
ATOM   69   H HD12 . LEU A 1 5   ? 10.417  42.862  54.364 1.00 19.15  ?  50  LEU A HD12 1 
ATOM   70   H HD13 . LEU A 1 5   ? 11.545  41.750  54.486 1.00 19.15  ?  50  LEU A HD13 1 
ATOM   71   H HD21 . LEU A 1 5   ? 12.334  41.689  51.636 1.00 21.50  ?  50  LEU A HD21 1 
ATOM   72   H HD22 . LEU A 1 5   ? 12.092  40.342  52.443 1.00 21.50  ?  50  LEU A HD22 1 
ATOM   73   H HD23 . LEU A 1 5   ? 11.296  40.614  51.094 1.00 21.50  ?  50  LEU A HD23 1 
ATOM   74   N N    . GLU A 1 6   ? 8.284   37.732  52.451 1.00 17.36  ?  51  GLU A N    1 
ATOM   75   C CA   . GLU A 1 6   ? 7.545   36.604  53.001 1.00 19.32  ?  51  GLU A CA   1 
ATOM   76   C C    . GLU A 1 6   ? 8.513   35.623  53.633 1.00 20.51  ?  51  GLU A C    1 
ATOM   77   O O    . GLU A 1 6   ? 9.492   35.209  53.005 1.00 17.44  ?  51  GLU A O    1 
ATOM   78   C CB   . GLU A 1 6   ? 6.696   35.906  51.935 1.00 18.74  ?  51  GLU A CB   1 
ATOM   79   C CG   . GLU A 1 6   ? 5.471   35.179  52.503 1.00 22.09  ?  51  GLU A CG   1 
ATOM   80   C CD   . GLU A 1 6   ? 5.711   33.698  52.794 1.00 26.07  ?  51  GLU A CD   1 
ATOM   81   O OE1  . GLU A 1 6   ? 6.800   33.175  52.468 1.00 21.29  ?  51  GLU A OE1  1 
ATOM   82   O OE2  . GLU A 1 6   ? 4.788   33.055  53.339 1.00 22.39  -1 51  GLU A OE2  1 
ATOM   83   H H    . GLU A 1 6   ? 9.040   37.531  52.096 1.00 20.83  ?  51  GLU A H    1 
ATOM   84   H HA   . GLU A 1 6   ? 6.949   36.926  53.695 1.00 23.18  ?  51  GLU A HA   1 
ATOM   85   H HB2  . GLU A 1 6   ? 6.380   36.570  51.302 1.00 22.48  ?  51  GLU A HB2  1 
ATOM   86   H HB3  . GLU A 1 6   ? 7.245   35.250  51.477 1.00 22.48  ?  51  GLU A HB3  1 
ATOM   87   H HG2  . GLU A 1 6   ? 5.213   35.607  53.335 1.00 26.51  ?  51  GLU A HG2  1 
ATOM   88   H HG3  . GLU A 1 6   ? 4.746   35.242  51.862 1.00 26.51  ?  51  GLU A HG3  1 
ATOM   89   N N    . ALA A 1 7   ? 8.234   35.277  54.884 1.00 18.33  ?  52  ALA A N    1 
ATOM   90   C CA   . ALA A 1 7   ? 8.988   34.278  55.619 1.00 22.52  ?  52  ALA A CA   1 
ATOM   91   C C    . ALA A 1 7   ? 8.024   33.633  56.598 1.00 23.84  ?  52  ALA A C    1 
ATOM   92   O O    . ALA A 1 7   ? 7.144   34.304  57.141 1.00 22.33  ?  52  ALA A O    1 
ATOM   93   C CB   . ALA A 1 7   ? 10.188  34.887  56.350 1.00 19.38  ?  52  ALA A CB   1 
ATOM   94   H H    . ALA A 1 7   ? 7.591   35.620  55.340 1.00 21.99  ?  52  ALA A H    1 
ATOM   95   H HA   . ALA A 1 7   ? 9.310   33.597  55.008 1.00 27.02  ?  52  ALA A HA   1 
ATOM   96   H HB1  . ALA A 1 7   ? 10.658  34.184  56.825 1.00 23.25  ?  52  ALA A HB1  1 
ATOM   97   H HB2  . ALA A 1 7   ? 10.777  35.299  55.699 1.00 23.25  ?  52  ALA A HB2  1 
ATOM   98   H HB3  . ALA A 1 7   ? 9.869   35.554  56.977 1.00 23.25  ?  52  ALA A HB3  1 
ATOM   99   N N    . GLU A 1 8   ? 8.180   32.334  56.805 1.00 22.41  ?  53  GLU A N    1 
ATOM   100  C CA   . GLU A 1 8   ? 7.238   31.570  57.604 1.00 22.57  ?  53  GLU A CA   1 
ATOM   101  C C    . GLU A 1 8   ? 7.940   30.983  58.819 1.00 22.56  ?  53  GLU A C    1 
ATOM   102  O O    . GLU A 1 8   ? 9.160   30.789  58.822 1.00 21.92  ?  53  GLU A O    1 
ATOM   103  C CB   . GLU A 1 8   ? 6.584   30.479  56.748 1.00 24.20  ?  53  GLU A CB   1 
ATOM   104  C CG   . GLU A 1 8   ? 5.796   31.078  55.589 1.00 22.41  ?  53  GLU A CG   1 
ATOM   105  C CD   . GLU A 1 8   ? 5.209   30.049  54.651 1.00 27.65  ?  53  GLU A CD   1 
ATOM   106  O OE1  . GLU A 1 8   ? 5.289   28.836  54.950 1.00 25.24  ?  53  GLU A OE1  1 
ATOM   107  O OE2  . GLU A 1 8   ? 4.664   30.465  53.606 1.00 21.72  -1 53  GLU A OE2  1 
ATOM   108  H H    . GLU A 1 8   ? 8.830   31.867  56.491 1.00 26.89  ?  53  GLU A H    1 
ATOM   109  H HA   . GLU A 1 8   ? 6.538   32.163  57.919 1.00 27.08  ?  53  GLU A HA   1 
ATOM   110  H HB2  . GLU A 1 8   ? 7.273   29.903  56.383 1.00 29.04  ?  53  GLU A HB2  1 
ATOM   111  H HB3  . GLU A 1 8   ? 5.973   29.964  57.298 1.00 29.04  ?  53  GLU A HB3  1 
ATOM   112  H HG2  . GLU A 1 8   ? 5.064   31.604  55.948 1.00 26.89  ?  53  GLU A HG2  1 
ATOM   113  H HG3  . GLU A 1 8   ? 6.387   31.647  55.072 1.00 26.89  ?  53  GLU A HG3  1 
ATOM   114  N N    . HIS A 1 9   ? 7.156   30.727  59.861 1.00 22.72  ?  54  HIS A N    1 
ATOM   115  C CA   . HIS A 1 9   ? 7.696   30.253  61.126 1.00 20.94  ?  54  HIS A CA   1 
ATOM   116  C C    . HIS A 1 9   ? 7.933   28.750  61.045 1.00 20.10  ?  54  HIS A C    1 
ATOM   117  O O    . HIS A 1 9   ? 6.971   27.979  60.926 1.00 17.23  ?  54  HIS A O    1 
ATOM   118  C CB   . HIS A 1 9   ? 6.747   30.598  62.273 1.00 23.21  ?  54  HIS A CB   1 
ATOM   119  C CG   . HIS A 1 9   ? 6.593   32.070  62.498 1.00 24.59  ?  54  HIS A CG   1 
ATOM   120  N ND1  . HIS A 1 9   ? 5.628   32.824  61.863 1.00 25.25  ?  54  HIS A ND1  1 
ATOM   121  C CD2  . HIS A 1 9   ? 7.294   32.931  63.273 1.00 27.62  ?  54  HIS A CD2  1 
ATOM   122  C CE1  . HIS A 1 9   ? 5.737   34.085  62.244 1.00 27.83  ?  54  HIS A CE1  1 
ATOM   123  N NE2  . HIS A 1 9   ? 6.740   34.177  63.098 1.00 29.16  ?  54  HIS A NE2  1 
ATOM   124  H H    . HIS A 1 9   ? 6.301   30.821  59.859 1.00 27.26  ?  54  HIS A H    1 
ATOM   125  H HA   . HIS A 1 9   ? 8.547   30.687  61.294 1.00 25.13  ?  54  HIS A HA   1 
ATOM   126  H HB2  . HIS A 1 9   ? 5.870   30.234  62.074 1.00 27.85  ?  54  HIS A HB2  1 
ATOM   127  H HB3  . HIS A 1 9   ? 7.088   30.206  63.091 1.00 27.85  ?  54  HIS A HB3  1 
ATOM   128  H HD1  . HIS A 1 9   ? 5.046   32.520  61.308 1.00 30.30  ?  54  HIS A HD1  1 
ATOM   129  H HD2  . HIS A 1 9   ? 8.013   32.719  63.822 1.00 33.14  ?  54  HIS A HD2  1 
ATOM   130  H HE1  . HIS A 1 9   ? 5.198   34.787  61.959 1.00 33.39  ?  54  HIS A HE1  1 
ATOM   131  N N    . PRO A 1 10  ? 9.182   28.290  61.095 1.00 19.79  ?  55  PRO A N    1 
ATOM   132  C CA   . PRO A 1 10  ? 9.432   26.852  60.973 1.00 18.69  ?  55  PRO A CA   1 
ATOM   133  C C    . PRO A 1 10  ? 8.954   26.097  62.199 1.00 18.42  ?  55  PRO A C    1 
ATOM   134  O O    . PRO A 1 10  ? 8.915   26.625  63.314 1.00 18.98  ?  55  PRO A O    1 
ATOM   135  C CB   . PRO A 1 10  ? 10.955  26.765  60.828 1.00 21.34  ?  55  PRO A CB   1 
ATOM   136  C CG   . PRO A 1 10  ? 11.462  27.980  61.520 1.00 24.64  ?  55  PRO A CG   1 
ATOM   137  C CD   . PRO A 1 10  ? 10.432  29.049  61.287 1.00 22.35  ?  55  PRO A CD   1 
ATOM   138  H HA   . PRO A 1 10  ? 9.006   26.495  60.179 1.00 22.42  ?  55  PRO A HA   1 
ATOM   139  H HB2  . PRO A 1 10  ? 11.281  25.961  61.260 1.00 25.61  ?  55  PRO A HB2  1 
ATOM   140  H HB3  . PRO A 1 10  ? 11.197  26.776  59.889 1.00 25.61  ?  55  PRO A HB3  1 
ATOM   141  H HG2  . PRO A 1 10  ? 11.556  27.798  62.468 1.00 29.57  ?  55  PRO A HG2  1 
ATOM   142  H HG3  . PRO A 1 10  ? 12.314  28.239  61.136 1.00 29.57  ?  55  PRO A HG3  1 
ATOM   143  H HD2  . PRO A 1 10  ? 10.362  29.624  62.065 1.00 26.82  ?  55  PRO A HD2  1 
ATOM   144  H HD3  . PRO A 1 10  ? 10.646  29.555  60.488 1.00 26.82  ?  55  PRO A HD3  1 
ATOM   145  N N    . LEU A 1 11  ? 8.579   24.846  61.975 1.00 18.31  ?  56  LEU A N    1 
ATOM   146  C CA   . LEU A 1 11  ? 8.253   23.921  63.047 1.00 19.75  ?  56  LEU A CA   1 
ATOM   147  C C    . LEU A 1 11  ? 9.462   23.046  63.350 1.00 20.67  ?  56  LEU A C    1 
ATOM   148  O O    . LEU A 1 11  ? 10.373  22.896  62.532 1.00 20.17  ?  56  LEU A O    1 
ATOM   149  C CB   . LEU A 1 11  ? 7.047   23.057  62.664 1.00 18.27  ?  56  LEU A CB   1 
ATOM   150  C CG   . LEU A 1 11  ? 5.762   23.840  62.374 1.00 16.80  ?  56  LEU A CG   1 
ATOM   151  C CD1  . LEU A 1 11  ? 4.743   22.974  61.655 1.00 17.46  ?  56  LEU A CD1  1 
ATOM   152  C CD2  . LEU A 1 11  ? 5.176   24.395  63.665 1.00 16.78  ?  56  LEU A CD2  1 
ATOM   153  H H    . LEU A 1 11  ? 8.505   24.501  61.191 1.00 21.97  ?  56  LEU A H    1 
ATOM   154  H HA   . LEU A 1 11  ? 8.029   24.422  63.847 1.00 23.70  ?  56  LEU A HA   1 
ATOM   155  H HB2  . LEU A 1 11  ? 7.270   22.553  61.865 1.00 21.92  ?  56  LEU A HB2  1 
ATOM   156  H HB3  . LEU A 1 11  ? 6.860   22.446  63.393 1.00 21.92  ?  56  LEU A HB3  1 
ATOM   157  H HG   . LEU A 1 11  ? 5.975   24.590  61.797 1.00 20.16  ?  56  LEU A HG   1 
ATOM   158  H HD11 . LEU A 1 11  ? 3.944   23.499  61.488 1.00 20.95  ?  56  LEU A HD11 1 
ATOM   159  H HD12 . LEU A 1 11  ? 5.122   22.672  60.815 1.00 20.95  ?  56  LEU A HD12 1 
ATOM   160  H HD13 . LEU A 1 11  ? 4.526   22.212  62.214 1.00 20.95  ?  56  LEU A HD13 1 
ATOM   161  H HD21 . LEU A 1 11  ? 4.365   24.886  63.458 1.00 20.13  ?  56  LEU A HD21 1 
ATOM   162  H HD22 . LEU A 1 11  ? 4.974   23.658  64.262 1.00 20.13  ?  56  LEU A HD22 1 
ATOM   163  H HD23 . LEU A 1 11  ? 5.825   24.987  64.077 1.00 20.13  ?  56  LEU A HD23 1 
ATOM   164  N N    . GLN A 1 12  ? 9.473   22.480  64.557 1.00 20.20  ?  57  GLN A N    1 
ATOM   165  C CA   . GLN A 1 12  ? 10.565  21.590  64.931 1.00 20.65  ?  57  GLN A CA   1 
ATOM   166  C C    . GLN A 1 12  ? 10.593  20.355  64.043 1.00 20.96  ?  57  GLN A C    1 
ATOM   167  O O    . GLN A 1 12  ? 11.667  19.805  63.776 1.00 20.23  ?  57  GLN A O    1 
ATOM   168  C CB   . GLN A 1 12  ? 10.436  21.193  66.403 1.00 25.63  ?  57  GLN A CB   1 
ATOM   169  C CG   . GLN A 1 12  ? 11.621  20.406  66.945 1.00 25.62  ?  57  GLN A CG   1 
ATOM   170  C CD   . GLN A 1 12  ? 12.899  21.224  66.984 1.00 26.21  ?  57  GLN A CD   1 
ATOM   171  O OE1  . GLN A 1 12  ? 12.872  22.445  66.839 1.00 28.50  ?  57  GLN A OE1  1 
ATOM   172  N NE2  . GLN A 1 12  ? 14.025  20.553  67.179 1.00 30.94  ?  57  GLN A NE2  1 
ATOM   173  H H    . GLN A 1 12  ? 8.873   22.592  65.163 1.00 24.24  ?  57  GLN A H    1 
ATOM   174  H HA   . GLN A 1 12  ? 11.407  22.059  64.820 1.00 24.78  ?  57  GLN A HA   1 
ATOM   175  H HB2  . GLN A 1 12  ? 10.348  21.998  66.936 1.00 30.76  ?  57  GLN A HB2  1 
ATOM   176  H HB3  . GLN A 1 12  ? 9.644   20.643  66.508 1.00 30.76  ?  57  GLN A HB3  1 
ATOM   177  H HG2  . GLN A 1 12  ? 11.422  20.117  67.849 1.00 30.75  ?  57  GLN A HG2  1 
ATOM   178  H HG3  . GLN A 1 12  ? 11.776  19.635  66.376 1.00 30.75  ?  57  GLN A HG3  1 
ATOM   179  H HE21 . GLN A 1 12  ? 14.005  19.699  67.275 1.00 37.13  ?  57  GLN A HE21 1 
ATOM   180  H HE22 . GLN A 1 12  ? 14.775  20.972  67.209 1.00 37.13  ?  57  GLN A HE22 1 
ATOM   181  N N    . TYR A 1 13  ? 9.428   19.909  63.576 1.00 21.35  ?  58  TYR A N    1 
ATOM   182  C CA   . TYR A 1 13  ? 9.330   18.794  62.648 1.00 19.90  ?  58  TYR A CA   1 
ATOM   183  C C    . TYR A 1 13  ? 8.318   19.132  61.566 1.00 17.66  ?  58  TYR A C    1 
ATOM   184  O O    . TYR A 1 13  ? 7.465   20.007  61.733 1.00 18.66  ?  58  TYR A O    1 
ATOM   185  C CB   . TYR A 1 13  ? 8.885   17.493  63.332 1.00 22.81  ?  58  TYR A CB   1 
ATOM   186  C CG   . TYR A 1 13  ? 9.639   17.140  64.587 1.00 23.79  ?  58  TYR A CG   1 
ATOM   187  C CD1  . TYR A 1 13  ? 9.298   17.711  65.802 1.00 22.59  ?  58  TYR A CD1  1 
ATOM   188  C CD2  . TYR A 1 13  ? 10.676  16.215  64.563 1.00 24.98  ?  58  TYR A CD2  1 
ATOM   189  C CE1  . TYR A 1 13  ? 9.973   17.389  66.957 1.00 26.48  ?  58  TYR A CE1  1 
ATOM   190  C CE2  . TYR A 1 13  ? 11.361  15.883  65.714 1.00 27.30  ?  58  TYR A CE2  1 
ATOM   191  C CZ   . TYR A 1 13  ? 11.004  16.476  66.909 1.00 29.63  ?  58  TYR A CZ   1 
ATOM   192  O OH   . TYR A 1 13  ? 11.675  16.155  68.065 1.00 29.13  ?  58  TYR A OH   1 
ATOM   193  H H    . TYR A 1 13  ? 8.666   20.245  63.790 1.00 25.62  ?  58  TYR A H    1 
ATOM   194  H HA   . TYR A 1 13  ? 10.192  18.644  62.229 1.00 23.89  ?  58  TYR A HA   1 
ATOM   195  H HB2  . TYR A 1 13  ? 7.947   17.573  63.568 1.00 27.37  ?  58  TYR A HB2  1 
ATOM   196  H HB3  . TYR A 1 13  ? 9.000   16.760  62.707 1.00 27.37  ?  58  TYR A HB3  1 
ATOM   197  H HD1  . TYR A 1 13  ? 8.604   18.329  65.836 1.00 27.11  ?  58  TYR A HD1  1 
ATOM   198  H HD2  . TYR A 1 13  ? 10.916  15.818  63.757 1.00 29.97  ?  58  TYR A HD2  1 
ATOM   199  H HE1  . TYR A 1 13  ? 9.735   17.786  67.764 1.00 31.78  ?  58  TYR A HE1  1 
ATOM   200  H HE2  . TYR A 1 13  ? 12.056  15.267  65.685 1.00 32.76  ?  58  TYR A HE2  1 
ATOM   201  H HH   . TYR A 1 13  ? 11.355  16.585  68.712 1.00 34.96  ?  58  TYR A HH   1 
ATOM   202  N N    . ASN A 1 14  ? 8.420   18.414  60.455 1.00 18.27  ?  59  ASN A N    1 
ATOM   203  C CA   . ASN A 1 14  ? 7.333   18.350  59.493 1.00 18.30  ?  59  ASN A CA   1 
ATOM   204  C C    . ASN A 1 14  ? 6.263   17.390  59.998 1.00 17.68  ?  59  ASN A C    1 
ATOM   205  O O    . ASN A 1 14  ? 6.571   16.368  60.617 1.00 16.11  ?  59  ASN A O    1 
ATOM   206  C CB   . ASN A 1 14  ? 7.849   17.887  58.132 1.00 21.31  ?  59  ASN A CB   1 
ATOM   207  C CG   . ASN A 1 14  ? 8.637   18.963  57.415 1.00 21.60  ?  59  ASN A CG   1 
ATOM   208  O OD1  . ASN A 1 14  ? 9.050   19.952  58.018 1.00 20.93  ?  59  ASN A OD1  1 
ATOM   209  N ND2  . ASN A 1 14  ? 8.841   18.777  56.122 1.00 24.12  ?  59  ASN A ND2  1 
ATOM   210  H H    . ASN A 1 14  ? 9.113   17.954  60.236 1.00 21.93  ?  59  ASN A H    1 
ATOM   211  H HA   . ASN A 1 14  ? 6.936   19.229  59.391 1.00 21.97  ?  59  ASN A HA   1 
ATOM   212  H HB2  . ASN A 1 14  ? 8.430   17.121  58.258 1.00 25.57  ?  59  ASN A HB2  1 
ATOM   213  H HB3  . ASN A 1 14  ? 7.094   17.644  57.573 1.00 25.57  ?  59  ASN A HB3  1 
ATOM   214  H HD21 . ASN A 1 14  ? 9.283   19.359  55.668 1.00 28.94  ?  59  ASN A HD21 1 
ATOM   215  H HD22 . ASN A 1 14  ? 8.532   18.075  55.734 1.00 28.94  ?  59  ASN A HD22 1 
ATOM   216  N N    . TYR A 1 15  ? 5.004   17.722  59.727 1.00 16.22  ?  60  TYR A N    1 
ATOM   217  C CA   . TYR A 1 15  ? 3.875   16.931  60.188 1.00 16.26  ?  60  TYR A CA   1 
ATOM   218  C C    . TYR A 1 15  ? 2.960   16.613  59.016 1.00 19.14  ?  60  TYR A C    1 
ATOM   219  O O    . TYR A 1 15  ? 2.923   17.332  58.015 1.00 19.77  ?  60  TYR A O    1 
ATOM   220  C CB   . TYR A 1 15  ? 3.084   17.659  61.279 1.00 17.86  ?  60  TYR A CB   1 
ATOM   221  C CG   . TYR A 1 15  ? 3.773   17.693  62.621 1.00 18.72  ?  60  TYR A CG   1 
ATOM   222  C CD1  . TYR A 1 15  ? 4.743   18.647  62.904 1.00 22.12  ?  60  TYR A CD1  1 
ATOM   223  C CD2  . TYR A 1 15  ? 3.447   16.780  63.608 1.00 19.75  ?  60  TYR A CD2  1 
ATOM   224  C CE1  . TYR A 1 15  ? 5.367   18.683  64.133 1.00 20.92  ?  60  TYR A CE1  1 
ATOM   225  C CE2  . TYR A 1 15  ? 4.065   16.808  64.839 1.00 24.83  ?  60  TYR A CE2  1 
ATOM   226  C CZ   . TYR A 1 15  ? 5.024   17.760  65.097 1.00 23.65  ?  60  TYR A CZ   1 
ATOM   227  O OH   . TYR A 1 15  ? 5.637   17.781  66.327 1.00 30.78  ?  60  TYR A OH   1 
ATOM   228  H H    . TYR A 1 15  ? 4.777   18.413  59.269 1.00 19.46  ?  60  TYR A H    1 
ATOM   229  H HA   . TYR A 1 15  ? 4.199   16.094  60.555 1.00 19.51  ?  60  TYR A HA   1 
ATOM   230  H HB2  . TYR A 1 15  ? 2.938   18.576  60.999 1.00 21.43  ?  60  TYR A HB2  1 
ATOM   231  H HB3  . TYR A 1 15  ? 2.231   17.212  61.397 1.00 21.43  ?  60  TYR A HB3  1 
ATOM   232  H HD1  . TYR A 1 15  ? 4.974   19.271  62.254 1.00 26.55  ?  60  TYR A HD1  1 
ATOM   233  H HD2  . TYR A 1 15  ? 2.798   16.135  63.438 1.00 23.70  ?  60  TYR A HD2  1 
ATOM   234  H HE1  . TYR A 1 15  ? 6.016   19.325  64.309 1.00 25.11  ?  60  TYR A HE1  1 
ATOM   235  H HE2  . TYR A 1 15  ? 3.836   16.186  65.492 1.00 29.80  ?  60  TYR A HE2  1 
ATOM   236  H HH   . TYR A 1 15  ? 5.332   17.166  66.811 1.00 36.94  ?  60  TYR A HH   1 
ATOM   237  N N    . THR A 1 16  ? 2.209   15.523  59.160 1.00 18.38  ?  61  THR A N    1 
ATOM   238  C CA   . THR A 1 16  ? 1.295   15.058  58.127 1.00 16.26  ?  61  THR A CA   1 
ATOM   239  C C    . THR A 1 16  ? -0.073  14.806  58.741 1.00 18.68  ?  61  THR A C    1 
ATOM   240  O O    . THR A 1 16  ? -0.190  14.066  59.723 1.00 17.94  ?  61  THR A O    1 
ATOM   241  C CB   . THR A 1 16  ? 1.815   13.777  57.466 1.00 18.30  ?  61  THR A CB   1 
ATOM   242  O OG1  . THR A 1 16  ? 3.146   13.994  56.984 1.00 21.88  ?  61  THR A OG1  1 
ATOM   243  C CG2  . THR A 1 16  ? 0.920   13.363  56.302 1.00 20.13  ?  61  THR A CG2  1 
ATOM   244  H H    . THR A 1 16  ? 2.213   15.028  59.863 1.00 22.06  ?  61  THR A H    1 
ATOM   245  H HA   . THR A 1 16  ? 1.204   15.741  57.444 1.00 19.51  ?  61  THR A HA   1 
ATOM   246  H HB   . THR A 1 16  ? 1.822   13.059  58.117 1.00 21.96  ?  61  THR A HB   1 
ATOM   247  H HG1  . THR A 1 16  ? 3.149   14.617  56.420 1.00 26.25  ?  61  THR A HG1  1 
ATOM   248  H HG21 . THR A 1 16  ? 1.261   12.552  55.894 1.00 24.15  ?  61  THR A HG21 1 
ATOM   249  H HG22 . THR A 1 16  ? 0.018   13.201  56.619 1.00 24.15  ?  61  THR A HG22 1 
ATOM   250  H HG23 . THR A 1 16  ? 0.897   14.067  55.635 1.00 24.15  ?  61  THR A HG23 1 
ATOM   251  N N    . PHE A 1 17  ? -1.100  15.426  58.164 1.00 18.71  ?  62  PHE A N    1 
ATOM   252  C CA   . PHE A 1 17  ? -2.478  15.101  58.501 1.00 19.21  ?  62  PHE A CA   1 
ATOM   253  C C    . PHE A 1 17  ? -2.895  13.824  57.784 1.00 19.64  ?  62  PHE A C    1 
ATOM   254  O O    . PHE A 1 17  ? -2.672  13.681  56.578 1.00 20.52  ?  62  PHE A O    1 
ATOM   255  C CB   . PHE A 1 17  ? -3.417  16.240  58.102 1.00 19.67  ?  62  PHE A CB   1 
ATOM   256  C CG   . PHE A 1 17  ? -3.577  17.302  59.150 1.00 19.52  ?  62  PHE A CG   1 
ATOM   257  C CD1  . PHE A 1 17  ? -4.138  17.002  60.379 1.00 18.05  ?  62  PHE A CD1  1 
ATOM   258  C CD2  . PHE A 1 17  ? -3.190  18.607  58.897 1.00 22.09  ?  62  PHE A CD2  1 
ATOM   259  C CE1  . PHE A 1 17  ? -4.293  17.976  61.340 1.00 22.39  ?  62  PHE A CE1  1 
ATOM   260  C CE2  . PHE A 1 17  ? -3.346  19.586  59.853 1.00 16.34  ?  62  PHE A CE2  1 
ATOM   261  C CZ   . PHE A 1 17  ? -3.895  19.273  61.075 1.00 19.29  ?  62  PHE A CZ   1 
ATOM   262  H H    . PHE A 1 17  ? -1.022  16.042  57.570 1.00 22.45  ?  62  PHE A H    1 
ATOM   263  H HA   . PHE A 1 17  ? -2.554  14.958  59.458 1.00 23.05  ?  62  PHE A HA   1 
ATOM   264  H HB2  . PHE A 1 17  ? -3.068  16.665  57.303 1.00 23.61  ?  62  PHE A HB2  1 
ATOM   265  H HB3  . PHE A 1 17  ? -4.295  15.871  57.920 1.00 23.61  ?  62  PHE A HB3  1 
ATOM   266  H HD1  . PHE A 1 17  ? -4.405  16.130  60.562 1.00 21.67  ?  62  PHE A HD1  1 
ATOM   267  H HD2  . PHE A 1 17  ? -2.816  18.825  58.073 1.00 26.51  ?  62  PHE A HD2  1 
ATOM   268  H HE1  . PHE A 1 17  ? -4.667  17.762  62.164 1.00 26.86  ?  62  PHE A HE1  1 
ATOM   269  H HE2  . PHE A 1 17  ? -3.077  20.458  59.674 1.00 19.61  ?  62  PHE A HE2  1 
ATOM   270  H HZ   . PHE A 1 17  ? -4.000  19.934  61.721 1.00 23.15  ?  62  PHE A HZ   1 
ATOM   271  N N    . TRP A 1 18  ? -3.508  12.903  58.523 1.00 20.64  ?  63  TRP A N    1 
ATOM   272  C CA   . TRP A 1 18  ? -4.096  11.703  57.947 1.00 22.86  ?  63  TRP A CA   1 
ATOM   273  C C    . TRP A 1 18  ? -5.577  11.648  58.294 1.00 24.85  ?  63  TRP A C    1 
ATOM   274  O O    . TRP A 1 18  ? -6.050  12.326  59.212 1.00 18.89  ?  63  TRP A O    1 
ATOM   275  C CB   . TRP A 1 18  ? -3.424  10.424  58.450 1.00 21.77  ?  63  TRP A CB   1 
ATOM   276  C CG   . TRP A 1 18  ? -1.935  10.378  58.321 1.00 22.31  ?  63  TRP A CG   1 
ATOM   277  C CD1  . TRP A 1 18  ? -1.030  11.163  58.971 1.00 20.05  ?  63  TRP A CD1  1 
ATOM   278  C CD2  . TRP A 1 18  ? -1.175  9.473   57.513 1.00 24.66  ?  63  TRP A CD2  1 
ATOM   279  N NE1  . TRP A 1 18  ? 0.249   10.810  58.611 1.00 20.43  ?  63  TRP A NE1  1 
ATOM   280  C CE2  . TRP A 1 18  ? 0.186   9.774   57.716 1.00 22.85  ?  63  TRP A CE2  1 
ATOM   281  C CE3  . TRP A 1 18  ? -1.513  8.438   56.634 1.00 28.63  ?  63  TRP A CE3  1 
ATOM   282  C CZ2  . TRP A 1 18  ? 1.208   9.083   57.070 1.00 23.96  ?  63  TRP A CZ2  1 
ATOM   283  C CZ3  . TRP A 1 18  ? -0.498  7.752   55.995 1.00 28.63  ?  63  TRP A CZ3  1 
ATOM   284  C CH2  . TRP A 1 18  ? 0.847   8.078   56.216 1.00 28.86  ?  63  TRP A CH2  1 
ATOM   285  H H    . TRP A 1 18  ? -3.596  12.954  59.377 1.00 24.77  ?  63  TRP A H    1 
ATOM   286  H HA   . TRP A 1 18  ? -4.009  11.735  56.981 1.00 27.43  ?  63  TRP A HA   1 
ATOM   287  H HB2  . TRP A 1 18  ? -3.637  10.316  59.390 1.00 26.12  ?  63  TRP A HB2  1 
ATOM   288  H HB3  . TRP A 1 18  ? -3.781  9.674   57.950 1.00 26.12  ?  63  TRP A HB3  1 
ATOM   289  H HD1  . TRP A 1 18  ? -1.246  11.840  59.571 1.00 24.06  ?  63  TRP A HD1  1 
ATOM   290  H HE1  . TRP A 1 18  ? 0.970   11.180  58.898 1.00 24.52  ?  63  TRP A HE1  1 
ATOM   291  H HE3  . TRP A 1 18  ? -2.403  8.217   56.483 1.00 34.36  ?  63  TRP A HE3  1 
ATOM   292  H HZ2  . TRP A 1 18  ? 2.102   9.296   57.214 1.00 28.75  ?  63  TRP A HZ2  1 
ATOM   293  H HZ3  . TRP A 1 18  ? -0.711  7.064   55.407 1.00 34.36  ?  63  TRP A HZ3  1 
ATOM   294  H HH2  . TRP A 1 18  ? 1.509   7.600   55.771 1.00 34.63  ?  63  TRP A HH2  1 
ATOM   295  N N    . TYR A 1 19  ? -6.298  10.809  57.553 1.00 22.44  ?  64  TYR A N    1 
ATOM   296  C CA   . TYR A 1 19  ? -7.729  10.628  57.738 1.00 26.76  ?  64  TYR A CA   1 
ATOM   297  C C    . TYR A 1 19  ? -8.067  9.152   57.600 1.00 28.66  ?  64  TYR A C    1 
ATOM   298  O O    . TYR A 1 19  ? -7.399  8.415   56.871 1.00 29.39  ?  64  TYR A O    1 
ATOM   299  C CB   . TYR A 1 19  ? -8.530  11.446  56.717 1.00 32.72  ?  64  TYR A CB   1 
ATOM   300  C CG   . TYR A 1 19  ? -10.017 11.199  56.760 1.00 37.44  ?  64  TYR A CG   1 
ATOM   301  C CD1  . TYR A 1 19  ? -10.757 11.519  57.888 1.00 41.36  ?  64  TYR A CD1  1 
ATOM   302  C CD2  . TYR A 1 19  ? -10.685 10.655  55.670 1.00 41.53  ?  64  TYR A CD2  1 
ATOM   303  C CE1  . TYR A 1 19  ? -12.120 11.298  57.937 1.00 43.39  ?  64  TYR A CE1  1 
ATOM   304  C CE2  . TYR A 1 19  ? -12.051 10.431  55.709 1.00 49.31  ?  64  TYR A CE2  1 
ATOM   305  C CZ   . TYR A 1 19  ? -12.761 10.751  56.848 1.00 49.08  ?  64  TYR A CZ   1 
ATOM   306  O OH   . TYR A 1 19  ? -14.120 10.541  56.900 1.00 55.89  ?  64  TYR A OH   1 
ATOM   307  H H    . TYR A 1 19  ? -5.970  10.325  56.923 1.00 26.93  ?  64  TYR A H    1 
ATOM   308  H HA   . TYR A 1 19  ? -7.979  10.919  58.629 1.00 32.12  ?  64  TYR A HA   1 
ATOM   309  H HB2  . TYR A 1 19  ? -8.382  12.389  56.889 1.00 39.27  ?  64  TYR A HB2  1 
ATOM   310  H HB3  . TYR A 1 19  ? -8.219  11.223  55.826 1.00 39.27  ?  64  TYR A HB3  1 
ATOM   311  H HD1  . TYR A 1 19  ? -10.328 11.884  58.628 1.00 49.63  ?  64  TYR A HD1  1 
ATOM   312  H HD2  . TYR A 1 19  ? -10.206 10.435  54.904 1.00 49.84  ?  64  TYR A HD2  1 
ATOM   313  H HE1  . TYR A 1 19  ? -12.601 11.516  58.702 1.00 52.07  ?  64  TYR A HE1  1 
ATOM   314  H HE2  . TYR A 1 19  ? -12.486 10.064  54.974 1.00 59.18  ?  64  TYR A HE2  1 
ATOM   315  H HH   . TYR A 1 19  ? -14.421 10.789  57.644 1.00 67.07  ?  64  TYR A HH   1 
ATOM   316  N N    . SER A 1 20  ? -9.109  8.725   58.312 1.00 32.18  ?  65  SER A N    1 
ATOM   317  C CA   . SER A 1 20  ? -9.596  7.358   58.200 1.00 37.03  ?  65  SER A CA   1 
ATOM   318  C C    . SER A 1 20  ? -11.089 7.333   58.493 1.00 38.93  ?  65  SER A C    1 
ATOM   319  O O    . SER A 1 20  ? -11.595 8.132   59.286 1.00 35.56  ?  65  SER A O    1 
ATOM   320  C CB   . SER A 1 20  ? -8.854  6.413   59.149 1.00 34.41  ?  65  SER A CB   1 
ATOM   321  O OG   . SER A 1 20  ? -9.114  6.737   60.503 1.00 33.34  ?  65  SER A OG   1 
ATOM   322  H H    . SER A 1 20  ? -9.550  9.211   58.868 1.00 38.62  ?  65  SER A H    1 
ATOM   323  H HA   . SER A 1 20  ? -9.460  7.044   57.292 1.00 44.43  ?  65  SER A HA   1 
ATOM   324  H HB2  . SER A 1 20  ? -9.148  5.504   58.981 1.00 41.29  ?  65  SER A HB2  1 
ATOM   325  H HB3  . SER A 1 20  ? -7.901  6.488   58.986 1.00 41.29  ?  65  SER A HB3  1 
ATOM   326  H HG   . SER A 1 20  ? -8.700  6.209   61.009 1.00 40.01  ?  65  SER A HG   1 
ATOM   327  N N    . ARG A 1 21  ? -11.784 6.404   57.844 1.00 42.31  ?  66  ARG A N    1 
ATOM   328  C CA   . ARG A 1 21  ? -13.228 6.259   58.007 1.00 50.22  ?  66  ARG A CA   1 
ATOM   329  C C    . ARG A 1 21  ? -13.572 4.982   58.769 1.00 49.09  ?  66  ARG A C    1 
ATOM   330  O O    . ARG A 1 21  ? -12.753 4.068   58.869 1.00 49.51  ?  66  ARG A O    1 
ATOM   331  C CB   . ARG A 1 21  ? -13.922 6.255   56.643 1.00 57.61  ?  66  ARG A CB   1 
ATOM   332  C CG   . ARG A 1 21  ? -13.768 7.554   55.872 1.00 59.53  ?  66  ARG A CG   1 
ATOM   333  C CD   . ARG A 1 21  ? -14.647 7.580   54.628 1.00 70.22  ?  66  ARG A CD   1 
ATOM   334  N NE   . ARG A 1 21  ? -14.590 8.865   53.934 1.00 68.97  ?  66  ARG A NE   1 
ATOM   335  C CZ   . ARG A 1 21  ? -15.304 9.937   54.268 1.00 65.91  ?  66  ARG A CZ   1 
ATOM   336  N NH1  . ARG A 1 21  ? -16.136 9.897   55.301 1.00 64.73  ?  66  ARG A NH1  1 
ATOM   337  N NH2  . ARG A 1 21  ? -15.183 11.059  53.571 1.00 65.69  ?  66  ARG A NH2  1 
ATOM   338  H H    . ARG A 1 21  ? -11.439 5.839   57.295 1.00 50.77  ?  66  ARG A H    1 
ATOM   339  H HA   . ARG A 1 21  ? -13.566 7.012   58.515 1.00 60.26  ?  66  ARG A HA   1 
ATOM   340  H HB2  . ARG A 1 21  ? -13.544 5.543   56.103 1.00 69.13  ?  66  ARG A HB2  1 
ATOM   341  H HB3  . ARG A 1 21  ? -14.870 6.099   56.776 1.00 69.13  ?  66  ARG A HB3  1 
ATOM   342  H HG2  . ARG A 1 21  ? -14.027 8.296   56.441 1.00 71.44  ?  66  ARG A HG2  1 
ATOM   343  H HG3  . ARG A 1 21  ? -12.845 7.652   55.592 1.00 71.44  ?  66  ARG A HG3  1 
ATOM   344  H HD2  . ARG A 1 21  ? -14.348 6.892   54.013 1.00 84.26  ?  66  ARG A HD2  1 
ATOM   345  H HD3  . ARG A 1 21  ? -15.568 7.418   54.887 1.00 84.26  ?  66  ARG A HD3  1 
ATOM   346  H HE   . ARG A 1 21  ? -14.057 8.934   53.262 1.00 82.77  ?  66  ARG A HE   1 
ATOM   347  H HH11 . ARG A 1 21  ? -16.221 9.173   55.757 1.00 77.68  ?  66  ARG A HH11 1 
ATOM   348  H HH12 . ARG A 1 21  ? -16.593 10.594  55.512 1.00 77.68  ?  66  ARG A HH12 1 
ATOM   349  H HH21 . ARG A 1 21  ? -14.644 11.093  52.902 1.00 78.82  ?  66  ARG A HH21 1 
ATOM   350  H HH22 . ARG A 1 21  ? -15.642 11.753  53.790 1.00 78.82  ?  66  ARG A HH22 1 
ATOM   351  N N    . ASN A 1 36  ? -8.749  1.871   56.312 1.00 54.18  ?  81  ASN A N    1 
ATOM   352  C CA   . ASN A 1 36  ? -7.737  2.472   55.450 1.00 50.06  ?  81  ASN A CA   1 
ATOM   353  C C    . ASN A 1 36  ? -7.473  3.925   55.838 1.00 44.94  ?  81  ASN A C    1 
ATOM   354  O O    . ASN A 1 36  ? -8.384  4.753   55.856 1.00 43.22  ?  81  ASN A O    1 
ATOM   355  C CB   . ASN A 1 36  ? -8.167  2.387   53.984 1.00 52.78  ?  81  ASN A CB   1 
ATOM   356  C CG   . ASN A 1 36  ? -9.592  2.861   53.763 1.00 56.00  ?  81  ASN A CG   1 
ATOM   357  O OD1  . ASN A 1 36  ? -10.192 3.495   54.631 1.00 52.80  ?  81  ASN A OD1  1 
ATOM   358  N ND2  . ASN A 1 36  ? -10.142 2.554   52.593 1.00 57.64  ?  81  ASN A ND2  1 
ATOM   359  H HA   . ASN A 1 36  ? -6.907  1.980   55.548 1.00 60.07  ?  81  ASN A HA   1 
ATOM   360  H HB2  . ASN A 1 36  ? -7.579  2.944   53.449 1.00 63.34  ?  81  ASN A HB2  1 
ATOM   361  H HB3  . ASN A 1 36  ? -8.109  1.464   53.690 1.00 63.34  ?  81  ASN A HB3  1 
ATOM   362  H HD21 . ASN A 1 36  ? -10.947 2.800   52.418 1.00 69.17  ?  81  ASN A HD21 1 
ATOM   363  H HD22 . ASN A 1 36  ? -9.692  2.109   52.010 1.00 69.17  ?  81  ASN A HD22 1 
ATOM   364  N N    . ILE A 1 37  ? -6.216  4.226   56.150 1.00 41.84  ?  82  ILE A N    1 
ATOM   365  C CA   . ILE A 1 37  ? -5.793  5.571   56.522 1.00 39.93  ?  82  ILE A CA   1 
ATOM   366  C C    . ILE A 1 37  ? -5.136  6.214   55.309 1.00 43.41  ?  82  ILE A C    1 
ATOM   367  O O    . ILE A 1 37  ? -4.271  5.605   54.668 1.00 49.62  ?  82  ILE A O    1 
ATOM   368  C CB   . ILE A 1 37  ? -4.831  5.540   57.722 1.00 41.11  ?  82  ILE A CB   1 
ATOM   369  C CG1  . ILE A 1 37  ? -5.441  4.732   58.876 1.00 45.03  ?  82  ILE A CG1  1 
ATOM   370  C CG2  . ILE A 1 37  ? -4.506  6.964   58.173 1.00 35.97  ?  82  ILE A CG2  1 
ATOM   371  C CD1  . ILE A 1 37  ? -4.506  4.508   60.051 1.00 40.78  ?  82  ILE A CD1  1 
ATOM   372  H H    . ILE A 1 37  ? -5.575  3.653   56.153 1.00 50.21  ?  82  ILE A H    1 
ATOM   373  H HA   . ILE A 1 37  ? -6.570  6.098   56.766 1.00 47.91  ?  82  ILE A HA   1 
ATOM   374  H HB   . ILE A 1 37  ? -4.007  5.109   57.446 1.00 49.33  ?  82  ILE A HB   1 
ATOM   375  H HG12 . ILE A 1 37  ? -6.221  5.204   59.207 1.00 54.04  ?  82  ILE A HG12 1 
ATOM   376  H HG13 . ILE A 1 37  ? -5.705  3.861   58.539 1.00 54.04  ?  82  ILE A HG13 1 
ATOM   377  H HG21 . ILE A 1 37  ? -3.899  6.925   58.929 1.00 43.17  ?  82  ILE A HG21 1 
ATOM   378  H HG22 . ILE A 1 37  ? -4.089  7.441   57.439 1.00 43.17  ?  82  ILE A HG22 1 
ATOM   379  H HG23 . ILE A 1 37  ? -5.329  7.408   58.432 1.00 43.17  ?  82  ILE A HG23 1 
ATOM   380  H HD11 . ILE A 1 37  ? -4.970  3.992   60.730 1.00 48.94  ?  82  ILE A HD11 1 
ATOM   381  H HD12 . ILE A 1 37  ? -3.724  4.023   59.744 1.00 48.94  ?  82  ILE A HD12 1 
ATOM   382  H HD13 . ILE A 1 37  ? -4.241  5.368   60.412 1.00 48.94  ?  82  ILE A HD13 1 
ATOM   383  N N    . LYS A 1 38  ? -5.548  7.440   54.988 1.00 37.69  ?  83  LYS A N    1 
ATOM   384  C CA   . LYS A 1 38  ? -5.042  8.157   53.828 1.00 40.30  ?  83  LYS A CA   1 
ATOM   385  C C    . LYS A 1 38  ? -4.471  9.505   54.247 1.00 31.68  ?  83  LYS A C    1 
ATOM   386  O O    . LYS A 1 38  ? -4.973  10.153  55.170 1.00 30.12  ?  83  LYS A O    1 
ATOM   387  C CB   . LYS A 1 38  ? -6.140  8.368   52.780 1.00 42.33  ?  83  LYS A CB   1 
ATOM   388  C CG   . LYS A 1 38  ? -7.217  9.368   53.186 1.00 37.86  ?  83  LYS A CG   1 
ATOM   389  C CD   . LYS A 1 38  ? -8.332  9.449   52.148 1.00 44.10  ?  83  LYS A CD   1 
ATOM   390  C CE   . LYS A 1 38  ? -7.818  9.936   50.797 1.00 47.88  ?  83  LYS A CE   1 
ATOM   391  N NZ   . LYS A 1 38  ? -8.913  10.116  49.807 1.00 51.37  1  83  LYS A NZ   1 
ATOM   392  H H    . LYS A 1 38  ? -6.132  7.883   55.439 1.00 45.22  ?  83  LYS A H    1 
ATOM   393  H HA   . LYS A 1 38  ? -4.329  7.640   53.420 1.00 48.36  ?  83  LYS A HA   1 
ATOM   394  H HB2  . LYS A 1 38  ? -5.731  8.692   51.962 1.00 50.80  ?  83  LYS A HB2  1 
ATOM   395  H HB3  . LYS A 1 38  ? -6.576  7.518   52.612 1.00 50.80  ?  83  LYS A HB3  1 
ATOM   396  H HG2  . LYS A 1 38  ? -7.607  9.092   54.030 1.00 45.43  ?  83  LYS A HG2  1 
ATOM   397  H HG3  . LYS A 1 38  ? -6.819  10.248  53.272 1.00 45.43  ?  83  LYS A HG3  1 
ATOM   398  H HD2  . LYS A 1 38  ? -8.718  8.567   52.025 1.00 52.92  ?  83  LYS A HD2  1 
ATOM   399  H HD3  . LYS A 1 38  ? -9.010  10.071  52.456 1.00 52.92  ?  83  LYS A HD3  1 
ATOM   400  H HE2  . LYS A 1 38  ? -7.375  10.790  50.915 1.00 57.46  ?  83  LYS A HE2  1 
ATOM   401  H HE3  . LYS A 1 38  ? -7.194  9.283   50.441 1.00 57.46  ?  83  LYS A HE3  1 
ATOM   402  H HZ1  . LYS A 1 38  ? -8.579  10.399  49.032 1.00 61.64  ?  83  LYS A HZ1  1 
ATOM   403  H HZ2  . LYS A 1 38  ? -9.333  9.342   49.674 1.00 61.64  ?  83  LYS A HZ2  1 
ATOM   404  H HZ3  . LYS A 1 38  ? -9.498  10.716  50.106 1.00 61.64  ?  83  LYS A HZ3  1 
ATOM   405  N N    . GLN A 1 39  ? -3.423  9.927   53.547 1.00 30.98  ?  84  GLN A N    1 
ATOM   406  C CA   . GLN A 1 39  ? -2.772  11.194  53.844 1.00 29.74  ?  84  GLN A CA   1 
ATOM   407  C C    . GLN A 1 39  ? -3.574  12.361  53.286 1.00 28.38  ?  84  GLN A C    1 
ATOM   408  O O    . GLN A 1 39  ? -4.065  12.314  52.155 1.00 29.47  ?  84  GLN A O    1 
ATOM   409  C CB   . GLN A 1 39  ? -1.362  11.223  53.258 1.00 25.78  ?  84  GLN A CB   1 
ATOM   410  C CG   . GLN A 1 39  ? -0.415  10.211  53.856 1.00 31.50  ?  84  GLN A CG   1 
ATOM   411  C CD   . GLN A 1 39  ? 0.996   10.366  53.331 1.00 32.11  ?  84  GLN A CD   1 
ATOM   412  O OE1  . GLN A 1 39  ? 1.419   11.465  52.974 1.00 29.39  ?  84  GLN A OE1  1 
ATOM   413  N NE2  . GLN A 1 39  ? 1.731   9.261   53.273 1.00 37.54  ?  84  GLN A NE2  1 
ATOM   414  H H    . GLN A 1 39  ? -3.069  9.495   52.893 1.00 37.17  ?  84  GLN A H    1 
ATOM   415  H HA   . GLN A 1 39  ? -2.704  11.303  54.806 1.00 35.68  ?  84  GLN A HA   1 
ATOM   416  H HB2  . GLN A 1 39  ? -1.419  11.046  52.306 1.00 30.94  ?  84  GLN A HB2  1 
ATOM   417  H HB3  . GLN A 1 39  ? -0.983  12.104  53.404 1.00 30.94  ?  84  GLN A HB3  1 
ATOM   418  H HG2  . GLN A 1 39  ? -0.393  10.328  54.819 1.00 37.79  ?  84  GLN A HG2  1 
ATOM   419  H HG3  . GLN A 1 39  ? -0.723  9.318   53.635 1.00 37.79  ?  84  GLN A HG3  1 
ATOM   420  H HE21 . GLN A 1 39  ? 1.399   8.509   53.527 1.00 45.05  ?  84  GLN A HE21 1 
ATOM   421  H HE22 . GLN A 1 39  ? 2.540   9.297   52.981 1.00 45.05  ?  84  GLN A HE22 1 
ATOM   422  N N    . ILE A 1 40  ? -3.703  13.413  54.090 1.00 24.58  ?  85  ILE A N    1 
ATOM   423  C CA   . ILE A 1 40  ? -4.273  14.667  53.612 1.00 27.16  ?  85  ILE A CA   1 
ATOM   424  C C    . ILE A 1 40  ? -3.188  15.582  53.060 1.00 28.54  ?  85  ILE A C    1 
ATOM   425  O O    . ILE A 1 40  ? -3.361  16.191  52.002 1.00 28.39  ?  85  ILE A O    1 
ATOM   426  C CB   . ILE A 1 40  ? -5.064  15.354  54.744 1.00 24.73  ?  85  ILE A CB   1 
ATOM   427  C CG1  . ILE A 1 40  ? -6.289  14.515  55.117 1.00 26.71  ?  85  ILE A CG1  1 
ATOM   428  C CG2  . ILE A 1 40  ? -5.486  16.774  54.334 1.00 32.32  ?  85  ILE A CG2  1 
ATOM   429  C CD1  . ILE A 1 40  ? -7.045  15.036  56.325 1.00 26.28  ?  85  ILE A CD1  1 
ATOM   430  H H    . ILE A 1 40  ? -3.466  13.425  54.917 1.00 29.50  ?  85  ILE A H    1 
ATOM   431  H HA   . ILE A 1 40  ? -4.893  14.475  52.892 1.00 32.60  ?  85  ILE A HA   1 
ATOM   432  H HB   . ILE A 1 40  ? -4.489  15.420  55.523 1.00 29.68  ?  85  ILE A HB   1 
ATOM   433  H HG12 . ILE A 1 40  ? -6.901  14.506  54.365 1.00 32.05  ?  85  ILE A HG12 1 
ATOM   434  H HG13 . ILE A 1 40  ? -5.999  13.611  55.316 1.00 32.05  ?  85  ILE A HG13 1 
ATOM   435  H HG21 . ILE A 1 40  ? -5.980  17.179  55.063 1.00 38.79  ?  85  ILE A HG21 1 
ATOM   436  H HG22 . ILE A 1 40  ? -4.692  17.296  54.141 1.00 38.79  ?  85  ILE A HG22 1 
ATOM   437  H HG23 . ILE A 1 40  ? -6.047  16.719  53.544 1.00 38.79  ?  85  ILE A HG23 1 
ATOM   438  H HD11 . ILE A 1 40  ? -7.803  14.455  56.497 1.00 31.53  ?  85  ILE A HD11 1 
ATOM   439  H HD12 . ILE A 1 40  ? -6.451  15.041  57.091 1.00 31.53  ?  85  ILE A HD12 1 
ATOM   440  H HD13 . ILE A 1 40  ? -7.354  15.937  56.139 1.00 31.53  ?  85  ILE A HD13 1 
ATOM   441  N N    . GLY A 1 41  ? -2.068  15.690  53.761 1.00 25.37  ?  86  GLY A N    1 
ATOM   442  C CA   . GLY A 1 41  ? -0.979  16.527  53.302 1.00 23.25  ?  86  GLY A CA   1 
ATOM   443  C C    . GLY A 1 41  ? 0.037   16.728  54.400 1.00 20.10  ?  86  GLY A C    1 
ATOM   444  O O    . GLY A 1 41  ? -0.192  16.398  55.567 1.00 19.98  ?  86  GLY A O    1 
ATOM   445  H H    . GLY A 1 41  ? -1.916  15.289  54.506 1.00 30.45  ?  86  GLY A H    1 
ATOM   446  H HA2  . GLY A 1 41  ? -0.542  16.111  52.543 1.00 27.89  ?  86  GLY A HA2  1 
ATOM   447  H HA3  . GLY A 1 41  ? -1.321  17.393  53.030 1.00 27.89  ?  86  GLY A HA3  1 
ATOM   448  N N    . THR A 1 42  ? 1.175   17.287  53.998 1.00 18.34  ?  87  THR A N    1 
ATOM   449  C CA   . THR A 1 42  ? 2.308   17.514  54.882 1.00 18.37  ?  87  THR A CA   1 
ATOM   450  C C    . THR A 1 42  ? 2.676   18.992  54.863 1.00 20.30  ?  87  THR A C    1 
ATOM   451  O O    . THR A 1 42  ? 2.568   19.655  53.825 1.00 20.37  ?  87  THR A O    1 
ATOM   452  C CB   . THR A 1 42  ? 3.506   16.660  54.459 1.00 19.32  ?  87  THR A CB   1 
ATOM   453  O OG1  . THR A 1 42  ? 3.115   15.282  54.442 1.00 19.53  ?  87  THR A OG1  1 
ATOM   454  C CG2  . THR A 1 42  ? 4.676   16.830  55.418 1.00 19.93  ?  87  THR A CG2  1 
ATOM   455  H H    . THR A 1 42  ? 1.317   17.551  53.192 1.00 22.00  ?  87  THR A H    1 
ATOM   456  H HA   . THR A 1 42  ? 2.063   17.272  55.789 1.00 22.05  ?  87  THR A HA   1 
ATOM   457  H HB   . THR A 1 42  ? 3.795   16.925  53.572 1.00 23.19  ?  87  THR A HB   1 
ATOM   458  H HG1  . THR A 1 42  ? 2.485   15.169  53.898 1.00 23.44  ?  87  THR A HG1  1 
ATOM   459  H HG21 . THR A 1 42  ? 5.422   16.281  55.131 1.00 23.92  ?  87  THR A HG21 1 
ATOM   460  H HG22 . THR A 1 42  ? 4.956   17.759  55.437 1.00 23.92  ?  87  THR A HG22 1 
ATOM   461  H HG23 . THR A 1 42  ? 4.412   16.563  56.312 1.00 23.92  ?  87  THR A HG23 1 
ATOM   462  N N    . PHE A 1 43  ? 3.106   19.502  56.014 1.00 18.36  ?  88  PHE A N    1 
ATOM   463  C CA   . PHE A 1 43  ? 3.453   20.907  56.155 1.00 19.15  ?  88  PHE A CA   1 
ATOM   464  C C    . PHE A 1 43  ? 4.674   21.037  57.055 1.00 17.42  ?  88  PHE A C    1 
ATOM   465  O O    . PHE A 1 43  ? 5.002   20.133  57.828 1.00 14.19  ?  88  PHE A O    1 
ATOM   466  C CB   . PHE A 1 43  ? 2.282   21.717  56.720 1.00 17.75  ?  88  PHE A CB   1 
ATOM   467  C CG   . PHE A 1 43  ? 1.781   21.216  58.043 1.00 19.46  ?  88  PHE A CG   1 
ATOM   468  C CD1  . PHE A 1 43  ? 2.312   21.696  59.229 1.00 17.28  ?  88  PHE A CD1  1 
ATOM   469  C CD2  . PHE A 1 43  ? 0.775   20.267  58.101 1.00 17.35  ?  88  PHE A CD2  1 
ATOM   470  C CE1  . PHE A 1 43  ? 1.853   21.236  60.449 1.00 19.40  ?  88  PHE A CE1  1 
ATOM   471  C CE2  . PHE A 1 43  ? 0.312   19.803  59.319 1.00 17.32  ?  88  PHE A CE2  1 
ATOM   472  C CZ   . PHE A 1 43  ? 0.850   20.291  60.495 1.00 18.78  ?  88  PHE A CZ   1 
ATOM   473  H H    . PHE A 1 43  ? 3.204   19.047  56.737 1.00 22.03  ?  88  PHE A H    1 
ATOM   474  H HA   . PHE A 1 43  ? 3.679   21.269  55.284 1.00 22.98  ?  88  PHE A HA   1 
ATOM   475  H HB2  . PHE A 1 43  ? 2.566   22.637  56.841 1.00 21.30  ?  88  PHE A HB2  1 
ATOM   476  H HB3  . PHE A 1 43  ? 1.544   21.681  56.091 1.00 21.30  ?  88  PHE A HB3  1 
ATOM   477  H HD1  . PHE A 1 43  ? 2.988   22.334  59.204 1.00 20.74  ?  88  PHE A HD1  1 
ATOM   478  H HD2  . PHE A 1 43  ? 0.409   19.936  57.313 1.00 20.82  ?  88  PHE A HD2  1 
ATOM   479  H HE1  . PHE A 1 43  ? 2.217   21.566  61.238 1.00 23.28  ?  88  PHE A HE1  1 
ATOM   480  H HE2  . PHE A 1 43  ? -0.364  19.165  59.347 1.00 20.78  ?  88  PHE A HE2  1 
ATOM   481  H HZ   . PHE A 1 43  ? 0.539   19.979  61.314 1.00 22.54  ?  88  PHE A HZ   1 
ATOM   482  N N    . ALA A 1 44  ? 5.342   22.188  56.951 1.00 16.82  ?  89  ALA A N    1 
ATOM   483  C CA   . ALA A 1 44  ? 6.576   22.428  57.683 1.00 17.11  ?  89  ALA A CA   1 
ATOM   484  C C    . ALA A 1 44  ? 6.617   23.772  58.395 1.00 17.33  ?  89  ALA A C    1 
ATOM   485  O O    . ALA A 1 44  ? 7.643   24.091  59.006 1.00 18.30  ?  89  ALA A O    1 
ATOM   486  C CB   . ALA A 1 44  ? 7.782   22.335  56.737 1.00 20.88  ?  89  ALA A CB   1 
ATOM   487  H H    . ALA A 1 44  ? 5.096   22.847  56.458 1.00 20.19  ?  89  ALA A H    1 
ATOM   488  H HA   . ALA A 1 44  ? 6.676   21.736  58.356 1.00 20.53  ?  89  ALA A HA   1 
ATOM   489  H HB1  . ALA A 1 44  ? 8.594   22.498  57.243 1.00 25.06  ?  89  ALA A HB1  1 
ATOM   490  H HB2  . ALA A 1 44  ? 7.809   21.448  56.345 1.00 25.06  ?  89  ALA A HB2  1 
ATOM   491  H HB3  . ALA A 1 44  ? 7.688   23.002  56.039 1.00 25.06  ?  89  ALA A HB3  1 
ATOM   492  N N    . SER A 1 45  ? 5.546   24.563  58.343 1.00 17.36  ?  90  SER A N    1 
ATOM   493  C CA   . SER A 1 45  ? 5.539   25.892  58.937 1.00 18.63  ?  90  SER A CA   1 
ATOM   494  C C    . SER A 1 45  ? 4.212   26.128  59.641 1.00 18.92  ?  90  SER A C    1 
ATOM   495  O O    . SER A 1 45  ? 3.196   25.509  59.316 1.00 17.23  ?  90  SER A O    1 
ATOM   496  C CB   . SER A 1 45  ? 5.761   26.982  57.880 1.00 19.06  ?  90  SER A CB   1 
ATOM   497  O OG   . SER A 1 45  ? 4.613   27.129  57.061 1.00 17.51  ?  90  SER A OG   1 
ATOM   498  H H    . SER A 1 45  ? 4.805   24.347  57.963 1.00 20.83  ?  90  SER A H    1 
ATOM   499  H HA   . SER A 1 45  ? 6.249   25.955  59.594 1.00 22.35  ?  90  SER A HA   1 
ATOM   500  H HB2  . SER A 1 45  ? 5.940   27.823  58.328 1.00 22.87  ?  90  SER A HB2  1 
ATOM   501  H HB3  . SER A 1 45  ? 6.516   26.733  57.325 1.00 22.87  ?  90  SER A HB3  1 
ATOM   502  H HG   . SER A 1 45  ? 4.745   27.728  56.486 1.00 21.02  ?  90  SER A HG   1 
ATOM   503  N N    . VAL A 1 46  ? 4.230   27.048  60.611 1.00 17.65  ?  91  VAL A N    1 
ATOM   504  C CA   . VAL A 1 46  ? 3.002   27.409  61.312 1.00 19.36  ?  91  VAL A CA   1 
ATOM   505  C C    . VAL A 1 46  ? 1.949   27.868  60.316 1.00 19.42  ?  91  VAL A C    1 
ATOM   506  O O    . VAL A 1 46  ? 0.775   27.487  60.407 1.00 17.43  ?  91  VAL A O    1 
ATOM   507  C CB   . VAL A 1 46  ? 3.282   28.494  62.372 1.00 20.88  ?  91  VAL A CB   1 
ATOM   508  C CG1  . VAL A 1 46  ? 1.992   28.908  63.069 1.00 20.17  ?  91  VAL A CG1  1 
ATOM   509  C CG2  . VAL A 1 46  ? 4.298   28.005  63.394 1.00 19.39  ?  91  VAL A CG2  1 
ATOM   510  H H    . VAL A 1 46  ? 4.931   27.469  60.876 1.00 21.18  ?  91  VAL A H    1 
ATOM   511  H HA   . VAL A 1 46  ? 2.659   26.626  61.770 1.00 23.24  ?  91  VAL A HA   1 
ATOM   512  H HB   . VAL A 1 46  ? 3.651   29.277  61.933 1.00 25.06  ?  91  VAL A HB   1 
ATOM   513  H HG11 . VAL A 1 46  ? 2.196   29.589  63.729 1.00 24.20  ?  91  VAL A HG11 1 
ATOM   514  H HG12 . VAL A 1 46  ? 1.376   29.260  62.409 1.00 24.20  ?  91  VAL A HG12 1 
ATOM   515  H HG13 . VAL A 1 46  ? 1.606   28.131  63.503 1.00 24.20  ?  91  VAL A HG13 1 
ATOM   516  H HG21 . VAL A 1 46  ? 4.453   28.707  64.046 1.00 23.26  ?  91  VAL A HG21 1 
ATOM   517  H HG22 . VAL A 1 46  ? 3.946   27.215  63.835 1.00 23.26  ?  91  VAL A HG22 1 
ATOM   518  H HG23 . VAL A 1 46  ? 5.126   27.788  62.938 1.00 23.26  ?  91  VAL A HG23 1 
ATOM   519  N N    . GLU A 1 47  ? 2.353   28.688  59.343 1.00 20.40  ?  92  GLU A N    1 
ATOM   520  C CA   . GLU A 1 47  ? 1.405   29.224  58.373 1.00 21.24  ?  92  GLU A CA   1 
ATOM   521  C C    . GLU A 1 47  ? 0.820   28.115  57.507 1.00 21.69  ?  92  GLU A C    1 
ATOM   522  O O    . GLU A 1 47  ? -0.399  28.046  57.306 1.00 22.87  ?  92  GLU A O    1 
ATOM   523  C CB   . GLU A 1 47  ? 2.088   30.288  57.510 1.00 23.75  ?  92  GLU A CB   1 
ATOM   524  C CG   . GLU A 1 47  ? 2.396   31.590  58.249 1.00 23.48  ?  92  GLU A CG   1 
ATOM   525  C CD   . GLU A 1 47  ? 3.549   31.465  59.230 1.00 25.40  ?  92  GLU A CD   1 
ATOM   526  O OE1  . GLU A 1 47  ? 4.418   30.588  59.030 1.00 25.26  ?  92  GLU A OE1  1 
ATOM   527  O OE2  . GLU A 1 47  ? 3.586   32.244  60.207 1.00 27.01  -1 92  GLU A OE2  1 
ATOM   528  H H    . GLU A 1 47  ? 3.165   28.946  59.226 1.00 24.49  ?  92  GLU A H    1 
ATOM   529  H HA   . GLU A 1 47  ? 0.674   29.649  58.848 1.00 25.49  ?  92  GLU A HA   1 
ATOM   530  H HB2  . GLU A 1 47  ? 2.927   29.930  57.181 1.00 28.50  ?  92  GLU A HB2  1 
ATOM   531  H HB3  . GLU A 1 47  ? 1.508   30.503  56.763 1.00 28.50  ?  92  GLU A HB3  1 
ATOM   532  H HG2  . GLU A 1 47  ? 2.629   32.273  57.600 1.00 28.18  ?  92  GLU A HG2  1 
ATOM   533  H HG3  . GLU A 1 47  ? 1.609   31.863  58.746 1.00 28.18  ?  92  GLU A HG3  1 
ATOM   534  N N    . GLN A 1 48  ? 1.671   27.231  56.985 1.00 18.44  ?  93  GLN A N    1 
ATOM   535  C CA   . GLN A 1 48  ? 1.161   26.108  56.208 1.00 20.52  ?  93  GLN A CA   1 
ATOM   536  C C    . GLN A 1 48  ? 0.229   25.233  57.039 1.00 18.61  ?  93  GLN A C    1 
ATOM   537  O O    . GLN A 1 48  ? -0.740  24.682  56.507 1.00 20.86  ?  93  GLN A O    1 
ATOM   538  C CB   . GLN A 1 48  ? 2.324   25.285  55.650 1.00 19.77  ?  93  GLN A CB   1 
ATOM   539  C CG   . GLN A 1 48  ? 1.917   24.304  54.552 1.00 24.86  ?  93  GLN A CG   1 
ATOM   540  C CD   . GLN A 1 48  ? 1.494   24.997  53.263 1.00 31.29  ?  93  GLN A CD   1 
ATOM   541  O OE1  . GLN A 1 48  ? 1.507   26.229  53.167 1.00 22.80  ?  93  GLN A OE1  1 
ATOM   542  N NE2  . GLN A 1 48  ? 1.116   24.204  52.263 1.00 26.28  ?  93  GLN A NE2  1 
ATOM   543  H H    . GLN A 1 48  ? 2.527   27.258  57.066 1.00 22.12  ?  93  GLN A H    1 
ATOM   544  H HA   . GLN A 1 48  ? 0.654   26.453  55.456 1.00 24.63  ?  93  GLN A HA   1 
ATOM   545  H HB2  . GLN A 1 48  ? 2.983   25.891  55.276 1.00 23.72  ?  93  GLN A HB2  1 
ATOM   546  H HB3  . GLN A 1 48  ? 2.719   24.774  56.372 1.00 23.72  ?  93  GLN A HB3  1 
ATOM   547  H HG2  . GLN A 1 48  ? 2.670   23.728  54.348 1.00 29.83  ?  93  GLN A HG2  1 
ATOM   548  H HG3  . GLN A 1 48  ? 1.168   23.773  54.865 1.00 29.83  ?  93  GLN A HG3  1 
ATOM   549  H HE21 . GLN A 1 48  ? 1.120   23.350  52.366 1.00 31.54  ?  93  GLN A HE21 1 
ATOM   550  H HE22 . GLN A 1 48  ? 0.867   24.546  51.513 1.00 31.54  ?  93  GLN A HE22 1 
ATOM   551  N N    . PHE A 1 49  ? 0.489   25.101  58.341 1.00 18.56  ?  94  PHE A N    1 
ATOM   552  C CA   . PHE A 1 49  ? -0.418  24.343  59.198 1.00 17.84  ?  94  PHE A CA   1 
ATOM   553  C C    . PHE A 1 49  ? -1.820  24.935  59.168 1.00 19.06  ?  94  PHE A C    1 
ATOM   554  O O    . PHE A 1 49  ? -2.810  24.214  58.998 1.00 18.01  ?  94  PHE A O    1 
ATOM   555  C CB   . PHE A 1 49  ? 0.104   24.309  60.634 1.00 17.47  ?  94  PHE A CB   1 
ATOM   556  C CG   . PHE A 1 49  ? -0.962  24.001  61.646 1.00 17.62  ?  94  PHE A CG   1 
ATOM   557  C CD1  . PHE A 1 49  ? -1.476  22.718  61.764 1.00 18.93  ?  94  PHE A CD1  1 
ATOM   558  C CD2  . PHE A 1 49  ? -1.467  24.997  62.462 1.00 17.87  ?  94  PHE A CD2  1 
ATOM   559  C CE1  . PHE A 1 49  ? -2.465  22.435  62.685 1.00 20.49  ?  94  PHE A CE1  1 
ATOM   560  C CE2  . PHE A 1 49  ? -2.455  24.719  63.389 1.00 21.34  ?  94  PHE A CE2  1 
ATOM   561  C CZ   . PHE A 1 49  ? -2.955  23.436  63.498 1.00 21.00  ?  94  PHE A CZ   1 
ATOM   562  H H    . PHE A 1 49  ? 1.172   25.435  58.744 1.00 22.27  ?  94  PHE A H    1 
ATOM   563  H HA   . PHE A 1 49  ? -0.469  23.430  58.875 1.00 21.41  ?  94  PHE A HA   1 
ATOM   564  H HB2  . PHE A 1 49  ? 0.787   23.624  60.703 1.00 20.97  ?  94  PHE A HB2  1 
ATOM   565  H HB3  . PHE A 1 49  ? 0.481   25.175  60.852 1.00 20.97  ?  94  PHE A HB3  1 
ATOM   566  H HD1  . PHE A 1 49  ? -1.149  22.040  61.218 1.00 22.71  ?  94  PHE A HD1  1 
ATOM   567  H HD2  . PHE A 1 49  ? -1.134  25.862  62.392 1.00 21.44  ?  94  PHE A HD2  1 
ATOM   568  H HE1  . PHE A 1 49  ? -2.799  21.570  62.759 1.00 24.59  ?  94  PHE A HE1  1 
ATOM   569  H HE2  . PHE A 1 49  ? -2.785  25.396  63.935 1.00 25.61  ?  94  PHE A HE2  1 
ATOM   570  H HZ   . PHE A 1 49  ? -3.620  23.247  64.121 1.00 25.20  ?  94  PHE A HZ   1 
ATOM   571  N N    . TRP A 1 50  ? -1.927  26.253  59.342 1.00 19.51  ?  95  TRP A N    1 
ATOM   572  C CA   . TRP A 1 50  ? -3.246  26.873  59.372 1.00 22.16  ?  95  TRP A CA   1 
ATOM   573  C C    . TRP A 1 50  ? -3.962  26.726  58.037 1.00 21.49  ?  95  TRP A C    1 
ATOM   574  O O    . TRP A 1 50  ? -5.194  26.614  58.004 1.00 23.90  ?  95  TRP A O    1 
ATOM   575  C CB   . TRP A 1 50  ? -3.127  28.345  59.764 1.00 21.42  ?  95  TRP A CB   1 
ATOM   576  C CG   . TRP A 1 50  ? -2.812  28.549  61.214 1.00 22.50  ?  95  TRP A CG   1 
ATOM   577  C CD1  . TRP A 1 50  ? -1.671  29.079  61.739 1.00 21.03  ?  95  TRP A CD1  1 
ATOM   578  C CD2  . TRP A 1 50  ? -3.651  28.222  62.328 1.00 23.94  ?  95  TRP A CD2  1 
ATOM   579  N NE1  . TRP A 1 50  ? -1.748  29.104  63.108 1.00 21.65  ?  95  TRP A NE1  1 
ATOM   580  C CE2  . TRP A 1 50  ? -2.954  28.586  63.495 1.00 23.28  ?  95  TRP A CE2  1 
ATOM   581  C CE3  . TRP A 1 50  ? -4.924  27.659  62.450 1.00 24.66  ?  95  TRP A CE3  1 
ATOM   582  C CZ2  . TRP A 1 50  ? -3.486  28.404  64.769 1.00 25.44  ?  95  TRP A CZ2  1 
ATOM   583  C CZ3  . TRP A 1 50  ? -5.452  27.483  63.715 1.00 26.28  ?  95  TRP A CZ3  1 
ATOM   584  C CH2  . TRP A 1 50  ? -4.734  27.851  64.858 1.00 27.57  ?  95  TRP A CH2  1 
ATOM   585  H H    . TRP A 1 50  ? -1.268  26.796  59.443 1.00 23.41  ?  95  TRP A H    1 
ATOM   586  H HA   . TRP A 1 50  ? -3.784  26.430  60.047 1.00 26.59  ?  95  TRP A HA   1 
ATOM   587  H HB2  . TRP A 1 50  ? -2.416  28.751  59.244 1.00 25.71  ?  95  TRP A HB2  1 
ATOM   588  H HB3  . TRP A 1 50  ? -3.969  28.789  59.576 1.00 25.71  ?  95  TRP A HB3  1 
ATOM   589  H HD1  . TRP A 1 50  ? -0.946  29.380  61.241 1.00 25.24  ?  95  TRP A HD1  1 
ATOM   590  H HE1  . TRP A 1 50  ? -1.137  29.400  63.637 1.00 25.97  ?  95  TRP A HE1  1 
ATOM   591  H HE3  . TRP A 1 50  ? -5.408  27.413  61.695 1.00 29.59  ?  95  TRP A HE3  1 
ATOM   592  H HZ2  . TRP A 1 50  ? -3.012  28.648  65.531 1.00 30.53  ?  95  TRP A HZ2  1 
ATOM   593  H HZ3  . TRP A 1 50  ? -6.298  27.109  63.808 1.00 31.53  ?  95  TRP A HZ3  1 
ATOM   594  H HH2  . TRP A 1 50  ? -5.114  27.719  65.696 1.00 33.09  ?  95  TRP A HH2  1 
ATOM   595  N N    . ARG A 1 51  ? -3.216  26.706  56.931 1.00 18.18  ?  96  ARG A N    1 
ATOM   596  C CA   . ARG A 1 51  ? -3.832  26.483  55.627 1.00 25.02  ?  96  ARG A CA   1 
ATOM   597  C C    . ARG A 1 51  ? -4.494  25.113  55.554 1.00 23.72  ?  96  ARG A C    1 
ATOM   598  O O    . ARG A 1 51  ? -5.610  24.980  55.040 1.00 26.27  ?  96  ARG A O    1 
ATOM   599  C CB   . ARG A 1 51  ? -2.786  26.625  54.523 1.00 23.61  ?  96  ARG A CB   1 
ATOM   600  C CG   . ARG A 1 51  ? -2.344  28.046  54.300 1.00 31.32  ?  96  ARG A CG   1 
ATOM   601  C CD   . ARG A 1 51  ? -1.300  28.152  53.215 1.00 31.64  ?  96  ARG A CD   1 
ATOM   602  N NE   . ARG A 1 51  ? -1.844  27.849  51.896 1.00 29.49  ?  96  ARG A NE   1 
ATOM   603  C CZ   . ARG A 1 51  ? -1.220  28.131  50.758 1.00 33.13  ?  96  ARG A CZ   1 
ATOM   604  N NH1  . ARG A 1 51  ? -0.037  28.728  50.786 1.00 32.15  1  96  ARG A NH1  1 
ATOM   605  N NH2  . ARG A 1 51  ? -1.776  27.821  49.594 1.00 34.79  ?  96  ARG A NH2  1 
ATOM   606  H H    . ARG A 1 51  ? -2.364  26.818  56.910 1.00 21.81  ?  96  ARG A H    1 
ATOM   607  H HA   . ARG A 1 51  ? -4.516  27.155  55.481 1.00 30.03  ?  96  ARG A HA   1 
ATOM   608  H HB2  . ARG A 1 51  ? -2.003  26.104  54.763 1.00 28.33  ?  96  ARG A HB2  1 
ATOM   609  H HB3  . ARG A 1 51  ? -3.160  26.295  53.691 1.00 28.33  ?  96  ARG A HB3  1 
ATOM   610  H HG2  . ARG A 1 51  ? -3.110  28.579  54.035 1.00 37.59  ?  96  ARG A HG2  1 
ATOM   611  H HG3  . ARG A 1 51  ? -1.963  28.393  55.121 1.00 37.59  ?  96  ARG A HG3  1 
ATOM   612  H HD2  . ARG A 1 51  ? -0.951  29.057  53.197 1.00 37.96  ?  96  ARG A HD2  1 
ATOM   613  H HD3  . ARG A 1 51  ? -0.585  27.523  53.399 1.00 37.96  ?  96  ARG A HD3  1 
ATOM   614  H HE   . ARG A 1 51  ? -2.560  27.374  51.855 1.00 35.39  ?  96  ARG A HE   1 
ATOM   615  H HH11 . ARG A 1 51  ? 0.325   28.929  51.539 1.00 38.58  ?  96  ARG A HH11 1 
ATOM   616  H HH12 . ARG A 1 51  ? 0.369   28.913  50.050 1.00 38.58  ?  96  ARG A HH12 1 
ATOM   617  H HH21 . ARG A 1 51  ? -2.544  27.435  49.573 1.00 41.75  ?  96  ARG A HH21 1 
ATOM   618  H HH22 . ARG A 1 51  ? -1.369  28.008  48.860 1.00 41.75  ?  96  ARG A HH22 1 
ATOM   619  N N    . PHE A 1 52  ? -3.813  24.078  56.047 1.00 21.63  ?  97  PHE A N    1 
ATOM   620  C CA   . PHE A 1 52  ? -4.414  22.749  56.085 1.00 22.40  ?  97  PHE A CA   1 
ATOM   621  C C    . PHE A 1 52  ? -5.536  22.686  57.113 1.00 23.31  ?  97  PHE A C    1 
ATOM   622  O O    . PHE A 1 52  ? -6.630  22.186  56.826 1.00 26.25  ?  97  PHE A O    1 
ATOM   623  C CB   . PHE A 1 52  ? -3.346  21.700  56.395 1.00 23.30  ?  97  PHE A CB   1 
ATOM   624  C CG   . PHE A 1 52  ? -2.597  21.230  55.190 1.00 24.23  ?  97  PHE A CG   1 
ATOM   625  C CD1  . PHE A 1 52  ? -3.138  20.263  54.361 1.00 23.44  ?  97  PHE A CD1  1 
ATOM   626  C CD2  . PHE A 1 52  ? -1.352  21.752  54.883 1.00 18.12  ?  97  PHE A CD2  1 
ATOM   627  C CE1  . PHE A 1 52  ? -2.454  19.825  53.249 1.00 27.00  ?  97  PHE A CE1  1 
ATOM   628  C CE2  . PHE A 1 52  ? -0.664  21.317  53.771 1.00 23.40  ?  97  PHE A CE2  1 
ATOM   629  C CZ   . PHE A 1 52  ? -1.215  20.351  52.953 1.00 26.40  ?  97  PHE A CZ   1 
ATOM   630  H H    . PHE A 1 52  ? -3.014  24.118  56.362 1.00 25.95  ?  97  PHE A H    1 
ATOM   631  H HA   . PHE A 1 52  ? -4.792  22.546  55.214 1.00 26.88  ?  97  PHE A HA   1 
ATOM   632  H HB2  . PHE A 1 52  ? -2.704  22.082  57.014 1.00 27.96  ?  97  PHE A HB2  1 
ATOM   633  H HB3  . PHE A 1 52  ? -3.774  20.929  56.798 1.00 27.96  ?  97  PHE A HB3  1 
ATOM   634  H HD1  . PHE A 1 52  ? -3.974  19.905  54.557 1.00 28.13  ?  97  PHE A HD1  1 
ATOM   635  H HD2  . PHE A 1 52  ? -0.977  22.402  55.431 1.00 21.75  ?  97  PHE A HD2  1 
ATOM   636  H HE1  . PHE A 1 52  ? -2.827  19.175  52.699 1.00 32.40  ?  97  PHE A HE1  1 
ATOM   637  H HE2  . PHE A 1 52  ? 0.172   21.673  53.573 1.00 28.08  ?  97  PHE A HE2  1 
ATOM   638  H HZ   . PHE A 1 52  ? -0.752  20.057  52.202 1.00 31.68  ?  97  PHE A HZ   1 
ATOM   639  N N    . TYR A 1 53  ? -5.282  23.197  58.317 1.00 24.24  ?  98  TYR A N    1 
ATOM   640  C CA   . TYR A 1 53  ? -6.258  23.082  59.397 1.00 25.41  ?  98  TYR A CA   1 
ATOM   641  C C    . TYR A 1 53  ? -7.544  23.823  59.056 1.00 26.15  ?  98  TYR A C    1 
ATOM   642  O O    . TYR A 1 53  ? -8.646  23.280  59.200 1.00 22.93  ?  98  TYR A O    1 
ATOM   643  C CB   . TYR A 1 53  ? -5.653  23.615  60.696 1.00 23.95  ?  98  TYR A CB   1 
ATOM   644  C CG   . TYR A 1 53  ? -6.583  23.528  61.886 1.00 25.47  ?  98  TYR A CG   1 
ATOM   645  C CD1  . TYR A 1 53  ? -6.781  22.324  62.551 1.00 27.57  ?  98  TYR A CD1  1 
ATOM   646  C CD2  . TYR A 1 53  ? -7.261  24.648  62.345 1.00 26.94  ?  98  TYR A CD2  1 
ATOM   647  C CE1  . TYR A 1 53  ? -7.629  22.239  63.638 1.00 26.56  ?  98  TYR A CE1  1 
ATOM   648  C CE2  . TYR A 1 53  ? -8.109  24.574  63.431 1.00 29.73  ?  98  TYR A CE2  1 
ATOM   649  C CZ   . TYR A 1 53  ? -8.289  23.365  64.075 1.00 29.07  ?  98  TYR A CZ   1 
ATOM   650  O OH   . TYR A 1 53  ? -9.136  23.284  65.157 1.00 34.31  ?  98  TYR A OH   1 
ATOM   651  H H    . TYR A 1 53  ? -4.560  23.612  58.532 1.00 29.09  ?  98  TYR A H    1 
ATOM   652  H HA   . TYR A 1 53  ? -6.476  22.146  59.528 1.00 30.49  ?  98  TYR A HA   1 
ATOM   653  H HB2  . TYR A 1 53  ? -4.857  23.101  60.904 1.00 28.73  ?  98  TYR A HB2  1 
ATOM   654  H HB3  . TYR A 1 53  ? -5.419  24.548  60.571 1.00 28.73  ?  98  TYR A HB3  1 
ATOM   655  H HD1  . TYR A 1 53  ? -6.336  21.561  62.258 1.00 33.08  ?  98  TYR A HD1  1 
ATOM   656  H HD2  . TYR A 1 53  ? -7.141  25.463  61.914 1.00 32.33  ?  98  TYR A HD2  1 
ATOM   657  H HE1  . TYR A 1 53  ? -7.752  21.426  64.073 1.00 31.88  ?  98  TYR A HE1  1 
ATOM   658  H HE2  . TYR A 1 53  ? -8.557  25.333  63.727 1.00 35.67  ?  98  TYR A HE2  1 
ATOM   659  H HH   . TYR A 1 53  ? -9.472  24.037  65.317 1.00 41.17  ?  98  TYR A HH   1 
ATOM   660  N N    . SER A 1 54  ? -7.423  25.068  58.593 1.00 24.46  ?  99  SER A N    1 
ATOM   661  C CA   . SER A 1 54  ? -8.598  25.882  58.307 1.00 26.39  ?  99  SER A CA   1 
ATOM   662  C C    . SER A 1 54  ? -9.428  25.338  57.153 1.00 27.47  ?  99  SER A C    1 
ATOM   663  O O    . SER A 1 54  ? -10.553 25.805  56.951 1.00 29.47  ?  99  SER A O    1 
ATOM   664  C CB   . SER A 1 54  ? -8.178  27.321  58.000 1.00 24.84  ?  99  SER A CB   1 
ATOM   665  O OG   . SER A 1 54  ? -7.445  27.383  56.788 1.00 31.59  ?  99  SER A OG   1 
ATOM   666  H H    . SER A 1 54  ? -6.674  25.461  58.437 1.00 29.36  ?  99  SER A H    1 
ATOM   667  H HA   . SER A 1 54  ? -9.164  25.900  59.095 1.00 31.67  ?  99  SER A HA   1 
ATOM   668  H HB2  . SER A 1 54  ? -8.972  27.872  57.916 1.00 29.81  ?  99  SER A HB2  1 
ATOM   669  H HB3  . SER A 1 54  ? -7.621  27.649  58.723 1.00 29.81  ?  99  SER A HB3  1 
ATOM   670  H HG   . SER A 1 54  ? -6.753  26.909  56.847 1.00 37.91  ?  99  SER A HG   1 
ATOM   671  N N    . HIS A 1 55  ? -8.905  24.376  56.392 1.00 27.82  ?  100 HIS A N    1 
ATOM   672  C CA   . HIS A 1 55  ? -9.637  23.765  55.291 1.00 32.67  ?  100 HIS A CA   1 
ATOM   673  C C    . HIS A 1 55  ? -10.005 22.315  55.583 1.00 29.90  ?  100 HIS A C    1 
ATOM   674  O O    . HIS A 1 55  ? -10.252 21.539  54.654 1.00 32.69  ?  100 HIS A O    1 
ATOM   675  C CB   . HIS A 1 55  ? -8.825  23.870  54.000 1.00 30.41  ?  100 HIS A CB   1 
ATOM   676  C CG   . HIS A 1 55  ? -8.659  25.276  53.513 1.00 28.01  ?  100 HIS A CG   1 
ATOM   677  N ND1  . HIS A 1 55  ? -7.684  26.122  53.997 1.00 28.98  ?  100 HIS A ND1  1 
ATOM   678  C CD2  . HIS A 1 55  ? -9.357  25.991  52.600 1.00 31.43  ?  100 HIS A CD2  1 
ATOM   679  C CE1  . HIS A 1 55  ? -7.781  27.293  53.394 1.00 33.11  ?  100 HIS A CE1  1 
ATOM   680  N NE2  . HIS A 1 55  ? -8.788  27.239  52.540 1.00 34.35  ?  100 HIS A NE2  1 
ATOM   681  H H    . HIS A 1 55  ? -8.114  24.056  56.499 1.00 33.39  ?  100 HIS A H    1 
ATOM   682  H HA   . HIS A 1 55  ? -10.463 24.256  55.158 1.00 39.20  ?  100 HIS A HA   1 
ATOM   683  H HB2  . HIS A 1 55  ? -7.941  23.502  54.154 1.00 36.49  ?  100 HIS A HB2  1 
ATOM   684  H HB3  . HIS A 1 55  ? -9.275  23.366  53.304 1.00 36.49  ?  100 HIS A HB3  1 
ATOM   685  H HD1  . HIS A 1 55  ? -7.100  25.917  54.594 1.00 34.77  ?  100 HIS A HD1  1 
ATOM   686  H HD2  . HIS A 1 55  ? -10.081 25.690  52.100 1.00 37.71  ?  100 HIS A HD2  1 
ATOM   687  H HE1  . HIS A 1 55  ? -7.234  28.030  53.544 1.00 39.73  ?  100 HIS A HE1  1 
ATOM   688  H HE2  . HIS A 1 55  ? -9.047  27.883  52.032 1.00 41.22  ?  100 HIS A HE2  1 
ATOM   689  N N    . MET A 1 56  ? -10.039 21.938  56.857 1.00 30.50  ?  101 MET A N    1 
ATOM   690  C CA   . MET A 1 56  ? -10.549 20.649  57.297 1.00 32.59  ?  101 MET A CA   1 
ATOM   691  C C    . MET A 1 56  ? -11.753 20.879  58.195 1.00 32.94  ?  101 MET A C    1 
ATOM   692  O O    . MET A 1 56  ? -11.790 21.849  58.960 1.00 31.14  ?  101 MET A O    1 
ATOM   693  C CB   . MET A 1 56  ? -9.493  19.853  58.066 1.00 31.90  ?  101 MET A CB   1 
ATOM   694  C CG   . MET A 1 56  ? -8.307  19.399  57.239 1.00 32.16  ?  101 MET A CG   1 
ATOM   695  S SD   . MET A 1 56  ? -7.011  18.695  58.279 1.00 34.10  ?  101 MET A SD   1 
ATOM   696  C CE   . MET A 1 56  ? -7.862  17.286  58.984 1.00 30.30  ?  101 MET A CE   1 
ATOM   697  H H    . MET A 1 56  ? -9.762  22.431  57.505 1.00 36.60  ?  101 MET A H    1 
ATOM   698  H HA   . MET A 1 56  ? -10.820 20.130  56.523 1.00 39.11  ?  101 MET A HA   1 
ATOM   699  H HB2  . MET A 1 56  ? -9.152  20.407  58.786 1.00 38.28  ?  101 MET A HB2  1 
ATOM   700  H HB3  . MET A 1 56  ? -9.912  19.060  58.436 1.00 38.28  ?  101 MET A HB3  1 
ATOM   701  H HG2  . MET A 1 56  ? -8.597  18.719  56.611 1.00 38.59  ?  101 MET A HG2  1 
ATOM   702  H HG3  . MET A 1 56  ? -7.937  20.159  56.765 1.00 38.59  ?  101 MET A HG3  1 
ATOM   703  H HE1  . MET A 1 56  ? -7.254  16.815  59.576 1.00 36.35  ?  101 MET A HE1  1 
ATOM   704  H HE2  . MET A 1 56  ? -8.632  17.600  59.483 1.00 36.35  ?  101 MET A HE2  1 
ATOM   705  H HE3  . MET A 1 56  ? -8.147  16.699  58.267 1.00 36.35  ?  101 MET A HE3  1 
ATOM   706  N N    . VAL A 1 57  ? -12.739 19.986  58.099 1.00 30.64  ?  102 VAL A N    1 
ATOM   707  C CA   . VAL A 1 57  ? -13.851 20.024  59.036 1.00 35.14  ?  102 VAL A CA   1 
ATOM   708  C C    . VAL A 1 57  ? -13.325 19.741  60.435 1.00 34.17  ?  102 VAL A C    1 
ATOM   709  O O    . VAL A 1 57  ? -12.456 18.882  60.633 1.00 33.10  ?  102 VAL A O    1 
ATOM   710  C CB   . VAL A 1 57  ? -14.937 19.014  58.626 1.00 36.80  ?  102 VAL A CB   1 
ATOM   711  C CG1  . VAL A 1 57  ? -16.053 18.973  59.663 1.00 40.76  ?  102 VAL A CG1  1 
ATOM   712  C CG2  . VAL A 1 57  ? -15.506 19.370  57.257 1.00 39.42  ?  102 VAL A CG2  1 
ATOM   713  H H    . VAL A 1 57  ? -12.784 19.360  57.511 1.00 36.77  ?  102 VAL A H    1 
ATOM   714  H HA   . VAL A 1 57  ? -14.243 20.911  59.032 1.00 42.17  ?  102 VAL A HA   1 
ATOM   715  H HB   . VAL A 1 57  ? -14.544 18.129  58.570 1.00 44.16  ?  102 VAL A HB   1 
ATOM   716  H HG11 . VAL A 1 57  ? -16.722 18.330  59.380 1.00 48.91  ?  102 VAL A HG11 1 
ATOM   717  H HG12 . VAL A 1 57  ? -15.680 18.708  60.518 1.00 48.91  ?  102 VAL A HG12 1 
ATOM   718  H HG13 . VAL A 1 57  ? -16.450 19.855  59.734 1.00 48.91  ?  102 VAL A HG13 1 
ATOM   719  H HG21 . VAL A 1 57  ? -16.187 18.721  57.020 1.00 47.30  ?  102 VAL A HG21 1 
ATOM   720  H HG22 . VAL A 1 57  ? -15.894 20.258  57.298 1.00 47.30  ?  102 VAL A HG22 1 
ATOM   721  H HG23 . VAL A 1 57  ? -14.789 19.352  56.603 1.00 47.30  ?  102 VAL A HG23 1 
ATOM   722  N N    . ARG A 1 58  ? -13.837 20.478  61.414 1.00 34.71  ?  103 ARG A N    1 
ATOM   723  C CA   . ARG A 1 58  ? -13.457 20.230  62.792 1.00 34.54  ?  103 ARG A CA   1 
ATOM   724  C C    . ARG A 1 58  ? -14.046 18.898  63.260 1.00 36.45  ?  103 ARG A C    1 
ATOM   725  O O    . ARG A 1 58  ? -15.139 18.513  62.836 1.00 35.95  ?  103 ARG A O    1 
ATOM   726  C CB   . ARG A 1 58  ? -13.935 21.366  63.691 1.00 34.38  ?  103 ARG A CB   1 
ATOM   727  C CG   . ARG A 1 58  ? -13.449 22.739  63.245 1.00 38.76  ?  103 ARG A CG   1 
ATOM   728  C CD   . ARG A 1 58  ? -13.828 23.832  64.235 1.00 43.07  ?  103 ARG A CD   1 
ATOM   729  N NE   . ARG A 1 58  ? -13.063 23.743  65.477 1.00 45.16  ?  103 ARG A NE   1 
ATOM   730  C CZ   . ARG A 1 58  ? -13.035 24.690  66.411 1.00 46.11  ?  103 ARG A CZ   1 
ATOM   731  N NH1  . ARG A 1 58  ? -13.727 25.811  66.251 1.00 59.18  1  103 ARG A NH1  1 
ATOM   732  N NH2  . ARG A 1 58  ? -12.309 24.519  67.508 1.00 36.70  ?  103 ARG A NH2  1 
ATOM   733  H H    . ARG A 1 58  ? -14.401 21.119  61.307 1.00 41.65  ?  103 ARG A H    1 
ATOM   734  H HA   . ARG A 1 58  ? -12.490 20.176  62.855 1.00 41.45  ?  103 ARG A HA   1 
ATOM   735  H HB2  . ARG A 1 58  ? -14.905 21.379  63.691 1.00 41.26  ?  103 ARG A HB2  1 
ATOM   736  H HB3  . ARG A 1 58  ? -13.608 21.213  64.591 1.00 41.26  ?  103 ARG A HB3  1 
ATOM   737  H HG2  . ARG A 1 58  ? -12.483 22.724  63.166 1.00 46.51  ?  103 ARG A HG2  1 
ATOM   738  H HG3  . ARG A 1 58  ? -13.850 22.955  62.388 1.00 46.51  ?  103 ARG A HG3  1 
ATOM   739  H HD2  . ARG A 1 58  ? -13.652 24.698  63.834 1.00 51.68  ?  103 ARG A HD2  1 
ATOM   740  H HD3  . ARG A 1 58  ? -14.769 23.751  64.453 1.00 51.68  ?  103 ARG A HD3  1 
ATOM   741  H HE   . ARG A 1 58  ? -12.601 23.031  65.613 1.00 54.20  ?  103 ARG A HE   1 
ATOM   742  H HH11 . ARG A 1 58  ? -14.199 25.927  65.542 1.00 71.02  ?  103 ARG A HH11 1 
ATOM   743  H HH12 . ARG A 1 58  ? -13.705 26.420  66.858 1.00 71.02  ?  103 ARG A HH12 1 
ATOM   744  H HH21 . ARG A 1 58  ? -11.858 23.795  67.617 1.00 44.04  ?  103 ARG A HH21 1 
ATOM   745  H HH22 . ARG A 1 58  ? -12.291 25.132  68.111 1.00 44.04  ?  103 ARG A HH22 1 
ATOM   746  N N    . PRO A 1 59  ? -13.340 18.171  64.130 1.00 35.31  ?  104 PRO A N    1 
ATOM   747  C CA   . PRO A 1 59  ? -13.826 16.833  64.509 1.00 35.88  ?  104 PRO A CA   1 
ATOM   748  C C    . PRO A 1 59  ? -15.200 16.854  65.153 1.00 37.21  ?  104 PRO A C    1 
ATOM   749  O O    . PRO A 1 59  ? -15.940 15.868  65.041 1.00 41.58  ?  104 PRO A O    1 
ATOM   750  C CB   . PRO A 1 59  ? -12.747 16.326  65.476 1.00 33.63  ?  104 PRO A CB   1 
ATOM   751  C CG   . PRO A 1 59  ? -12.089 17.549  65.994 1.00 33.07  ?  104 PRO A CG   1 
ATOM   752  C CD   . PRO A 1 59  ? -12.135 18.554  64.884 1.00 32.34  ?  104 PRO A CD   1 
ATOM   753  H HA   . PRO A 1 59  ? -13.850 16.255  63.730 1.00 43.05  ?  104 PRO A HA   1 
ATOM   754  H HB2  . PRO A 1 59  ? -13.162 15.827  66.197 1.00 40.36  ?  104 PRO A HB2  1 
ATOM   755  H HB3  . PRO A 1 59  ? -12.112 15.772  64.995 1.00 40.36  ?  104 PRO A HB3  1 
ATOM   756  H HG2  . PRO A 1 59  ? -12.575 17.875  66.768 1.00 39.68  ?  104 PRO A HG2  1 
ATOM   757  H HG3  . PRO A 1 59  ? -11.170 17.347  66.231 1.00 39.68  ?  104 PRO A HG3  1 
ATOM   758  H HD2  . PRO A 1 59  ? -12.232 19.451  65.243 1.00 38.81  ?  104 PRO A HD2  1 
ATOM   759  H HD3  . PRO A 1 59  ? -11.347 18.477  64.324 1.00 38.81  ?  104 PRO A HD3  1 
ATOM   760  N N    . GLY A 1 60  ? -15.568 17.947  65.822 1.00 34.50  ?  105 GLY A N    1 
ATOM   761  C CA   . GLY A 1 60  ? -16.910 18.044  66.369 1.00 40.07  ?  105 GLY A CA   1 
ATOM   762  C C    . GLY A 1 60  ? -17.976 17.993  65.291 1.00 44.89  ?  105 GLY A C    1 
ATOM   763  O O    . GLY A 1 60  ? -19.035 17.387  65.478 1.00 48.84  ?  105 GLY A O    1 
ATOM   764  H H    . GLY A 1 60  ? -15.067 18.630  65.968 1.00 41.40  ?  105 GLY A H    1 
ATOM   765  H HA2  . GLY A 1 60  ? -17.062 17.312  66.986 1.00 48.09  ?  105 GLY A HA2  1 
ATOM   766  H HA3  . GLY A 1 60  ? -17.002 18.880  66.853 1.00 48.09  ?  105 GLY A HA3  1 
ATOM   767  N N    . ASP A 1 61  ? -17.710 18.621  64.147 1.00 43.50  ?  106 ASP A N    1 
ATOM   768  C CA   . ASP A 1 61  ? -18.636 18.638  63.024 1.00 44.82  ?  106 ASP A CA   1 
ATOM   769  C C    . ASP A 1 61  ? -18.464 17.431  62.109 1.00 45.56  ?  106 ASP A C    1 
ATOM   770  O O    . ASP A 1 61  ? -18.963 17.445  60.978 1.00 47.68  ?  106 ASP A O    1 
ATOM   771  C CB   . ASP A 1 61  ? -18.463 19.932  62.226 1.00 47.44  ?  106 ASP A CB   1 
ATOM   772  C CG   . ASP A 1 61  ? -18.509 21.170  63.105 1.00 50.10  ?  106 ASP A CG   1 
ATOM   773  O OD1  . ASP A 1 61  ? -19.283 21.179  64.086 1.00 51.16  ?  106 ASP A OD1  1 
ATOM   774  O OD2  . ASP A 1 61  ? -17.765 22.132  62.819 1.00 51.32  -1 106 ASP A OD2  1 
ATOM   775  H H    . ASP A 1 61  ? -16.982 19.054  63.997 1.00 52.21  ?  106 ASP A H    1 
ATOM   776  H HA   . ASP A 1 61  ? -19.543 18.621  63.369 1.00 53.78  ?  106 ASP A HA   1 
ATOM   777  H HB2  . ASP A 1 61  ? -17.604 19.914  61.776 1.00 56.93  ?  106 ASP A HB2  1 
ATOM   778  H HB3  . ASP A 1 61  ? -19.179 20.000  61.574 1.00 56.93  ?  106 ASP A HB3  1 
ATOM   779  N N    . LEU A 1 62  ? -17.773 16.395  62.572 1.00 47.21  ?  107 LEU A N    1 
ATOM   780  C CA   . LEU A 1 62  ? -17.547 15.190  61.791 1.00 47.83  ?  107 LEU A CA   1 
ATOM   781  C C    . LEU A 1 62  ? -18.671 14.187  62.041 1.00 51.81  ?  107 LEU A C    1 
ATOM   782  O O    . LEU A 1 62  ? -19.406 14.278  63.027 1.00 50.38  ?  107 LEU A O    1 
ATOM   783  C CB   . LEU A 1 62  ? -16.190 14.580  62.148 1.00 46.96  ?  107 LEU A CB   1 
ATOM   784  C CG   . LEU A 1 62  ? -15.469 13.728  61.103 1.00 46.78  ?  107 LEU A CG   1 
ATOM   785  C CD1  . LEU A 1 62  ? -15.248 14.489  59.803 1.00 49.34  ?  107 LEU A CD1  1 
ATOM   786  C CD2  . LEU A 1 62  ? -14.137 13.265  61.673 1.00 42.84  ?  107 LEU A CD2  1 
ATOM   787  H H    . LEU A 1 62  ? -17.418 16.368  63.354 1.00 56.66  ?  107 LEU A H    1 
ATOM   788  H HA   . LEU A 1 62  ? -17.543 15.414  60.847 1.00 57.40  ?  107 LEU A HA   1 
ATOM   789  H HB2  . LEU A 1 62  ? -15.590 15.307  62.377 1.00 56.35  ?  107 LEU A HB2  1 
ATOM   790  H HB3  . LEU A 1 62  ? -16.315 14.018  62.929 1.00 56.35  ?  107 LEU A HB3  1 
ATOM   791  H HG   . LEU A 1 62  ? -16.004 12.943  60.907 1.00 56.13  ?  107 LEU A HG   1 
ATOM   792  H HD11 . LEU A 1 62  ? -14.789 13.912  59.173 1.00 59.21  ?  107 LEU A HD11 1 
ATOM   793  H HD12 . LEU A 1 62  ? -16.108 14.755  59.443 1.00 59.21  ?  107 LEU A HD12 1 
ATOM   794  H HD13 . LEU A 1 62  ? -14.708 15.275  59.986 1.00 59.21  ?  107 LEU A HD13 1 
ATOM   795  H HD21 . LEU A 1 62  ? -13.681 12.725  61.009 1.00 51.41  ?  107 LEU A HD21 1 
ATOM   796  H HD22 . LEU A 1 62  ? -13.600 14.043  61.892 1.00 51.41  ?  107 LEU A HD22 1 
ATOM   797  H HD23 . LEU A 1 62  ? -14.301 12.740  62.472 1.00 51.41  ?  107 LEU A HD23 1 
ATOM   798  N N    . THR A 1 63  ? -18.796 13.221  61.133 1.00 53.43  ?  108 THR A N    1 
ATOM   799  C CA   . THR A 1 63  ? -19.929 12.305  61.125 1.00 56.65  ?  108 THR A CA   1 
ATOM   800  C C    . THR A 1 63  ? -19.463 10.860  61.237 1.00 57.24  ?  108 THR A C    1 
ATOM   801  O O    . THR A 1 63  ? -18.429 10.482  60.676 1.00 56.99  ?  108 THR A O    1 
ATOM   802  C CB   . THR A 1 63  ? -20.760 12.463  59.845 1.00 54.50  ?  108 THR A CB   1 
ATOM   803  O OG1  . THR A 1 63  ? -20.034 11.930  58.731 1.00 54.08  ?  108 THR A OG1  1 
ATOM   804  C CG2  . THR A 1 63  ? -21.082 13.930  59.585 1.00 56.68  ?  108 THR A CG2  1 
ATOM   805  H H    . THR A 1 63  ? -18.229 13.076  60.504 1.00 64.12  ?  108 THR A H    1 
ATOM   806  H HA   . THR A 1 63  ? -20.502 12.498  61.884 1.00 67.98  ?  108 THR A HA   1 
ATOM   807  H HB   . THR A 1 63  ? -21.596 11.980  59.943 1.00 65.40  ?  108 THR A HB   1 
ATOM   808  H HG1  . THR A 1 63  ? -20.485 12.014  58.027 1.00 64.89  ?  108 THR A HG1  1 
ATOM   809  H HG21 . THR A 1 63  ? -21.607 14.016  58.774 1.00 68.02  ?  108 THR A HG21 1 
ATOM   810  H HG22 . THR A 1 63  ? -21.588 14.295  60.328 1.00 68.02  ?  108 THR A HG22 1 
ATOM   811  H HG23 . THR A 1 63  ? -20.261 14.436  59.484 1.00 68.02  ?  108 THR A HG23 1 
ATOM   812  N N    . GLY A 1 64  ? -20.238 10.060  61.967 1.00 58.62  ?  109 GLY A N    1 
ATOM   813  C CA   . GLY A 1 64  ? -20.072 8.619   61.974 1.00 58.46  ?  109 GLY A CA   1 
ATOM   814  C C    . GLY A 1 64  ? -18.896 8.100   62.775 1.00 52.82  ?  109 GLY A C    1 
ATOM   815  O O    . GLY A 1 64  ? -18.810 8.312   63.988 1.00 48.57  ?  109 GLY A O    1 
ATOM   816  H H    . GLY A 1 64  ? -20.876 10.338  62.472 1.00 70.34  ?  109 GLY A H    1 
ATOM   817  H HA2  . GLY A 1 64  ? -20.877 8.215   62.334 1.00 70.16  ?  109 GLY A HA2  1 
ATOM   818  H HA3  . GLY A 1 64  ? -19.968 8.312   61.060 1.00 70.16  ?  109 GLY A HA3  1 
ATOM   819  N N    . HIS A 1 65  ? -17.985 7.399   62.092 1.00 52.35  ?  110 HIS A N    1 
ATOM   820  C CA   . HIS A 1 65  ? -16.857 6.704   62.717 1.00 50.47  ?  110 HIS A CA   1 
ATOM   821  C C    . HIS A 1 65  ? -15.600 7.103   61.946 1.00 46.86  ?  110 HIS A C    1 
ATOM   822  O O    . HIS A 1 65  ? -15.088 6.335   61.128 1.00 48.89  ?  110 HIS A O    1 
ATOM   823  C CB   . HIS A 1 65  ? -17.092 5.183   62.707 1.00 55.18  ?  110 HIS A CB   1 
ATOM   824  C CG   . HIS A 1 65  ? -16.047 4.394   63.435 1.00 56.14  ?  110 HIS A CG   1 
ATOM   825  N ND1  . HIS A 1 65  ? -16.363 3.387   64.322 1.00 58.57  ?  110 HIS A ND1  1 
ATOM   826  C CD2  . HIS A 1 65  ? -14.694 4.449   63.395 1.00 54.03  ?  110 HIS A CD2  1 
ATOM   827  C CE1  . HIS A 1 65  ? -15.250 2.862   64.805 1.00 58.67  ?  110 HIS A CE1  1 
ATOM   828  N NE2  . HIS A 1 65  ? -14.224 3.489   64.259 1.00 57.22  ?  110 HIS A NE2  1 
ATOM   829  H H    . HIS A 1 65  ? -18.002 7.311   61.237 1.00 62.82  ?  110 HIS A H    1 
ATOM   830  H HA   . HIS A 1 65  ? -16.762 6.997   63.637 1.00 60.57  ?  110 HIS A HA   1 
ATOM   831  H HB2  . HIS A 1 65  ? -17.947 4.998   63.127 1.00 66.22  ?  110 HIS A HB2  1 
ATOM   832  H HB3  . HIS A 1 65  ? -17.106 4.877   61.787 1.00 66.22  ?  110 HIS A HB3  1 
ATOM   833  H HD2  . HIS A 1 65  ? -14.180 5.031   62.884 1.00 64.84  ?  110 HIS A HD2  1 
ATOM   834  H HE1  . HIS A 1 65  ? -15.199 2.170   65.423 1.00 70.41  ?  110 HIS A HE1  1 
ATOM   835  H HE2  . HIS A 1 65  ? -13.395 3.323   64.417 1.00 68.66  ?  110 HIS A HE2  1 
ATOM   836  N N    . SER A 1 66  ? -15.106 8.310   62.214 1.00 45.43  ?  111 SER A N    1 
ATOM   837  C CA   . SER A 1 66  ? -13.974 8.872   61.494 1.00 38.85  ?  111 SER A CA   1 
ATOM   838  C C    . SER A 1 66  ? -12.902 9.314   62.481 1.00 31.93  ?  111 SER A C    1 
ATOM   839  O O    . SER A 1 66  ? -13.178 9.595   63.649 1.00 30.01  ?  111 SER A O    1 
ATOM   840  C CB   . SER A 1 66  ? -14.406 10.058  60.623 1.00 40.51  ?  111 SER A CB   1 
ATOM   841  O OG   . SER A 1 66  ? -15.373 9.665   59.666 1.00 45.84  ?  111 SER A OG   1 
ATOM   842  H H    . SER A 1 66  ? -15.419 8.831   62.822 1.00 54.52  ?  111 SER A H    1 
ATOM   843  H HA   . SER A 1 66  ? -13.594 8.193   60.915 1.00 46.62  ?  111 SER A HA   1 
ATOM   844  H HB2  . SER A 1 66  ? -14.788 10.744  61.193 1.00 48.62  ?  111 SER A HB2  1 
ATOM   845  H HB3  . SER A 1 66  ? -13.629 10.408  60.160 1.00 48.62  ?  111 SER A HB3  1 
ATOM   846  H HG   . SER A 1 66  ? -15.599 10.325  59.198 1.00 55.01  ?  111 SER A HG   1 
ATOM   847  N N    . ASP A 1 67  ? -11.665 9.366   61.994 1.00 30.07  ?  112 ASP A N    1 
ATOM   848  C CA   . ASP A 1 67  ? -10.526 9.756   62.812 1.00 26.98  ?  112 ASP A CA   1 
ATOM   849  C C    . ASP A 1 67  ? -9.652  10.736  62.042 1.00 25.95  ?  112 ASP A C    1 
ATOM   850  O O    . ASP A 1 67  ? -9.458  10.588  60.832 1.00 26.00  ?  112 ASP A O    1 
ATOM   851  C CB   . ASP A 1 67  ? -9.676  8.545   63.219 1.00 26.74  ?  112 ASP A CB   1 
ATOM   852  C CG   . ASP A 1 67  ? -10.435 7.545   64.078 1.00 31.23  ?  112 ASP A CG   1 
ATOM   853  O OD1  . ASP A 1 67  ? -11.675 7.464   63.968 1.00 35.93  -1 112 ASP A OD1  1 
ATOM   854  O OD2  . ASP A 1 67  ? -9.781  6.832   64.865 1.00 29.31  -1 112 ASP A OD2  1 
ATOM   855  H H    . ASP A 1 67  ? -11.458 9.177   61.181 1.00 36.08  ?  112 ASP A H    1 
ATOM   856  H HA   . ASP A 1 67  ? -10.842 10.194  63.618 1.00 32.37  ?  112 ASP A HA   1 
ATOM   857  H HB2  . ASP A 1 67  ? -9.378  8.086   62.418 1.00 32.09  ?  112 ASP A HB2  1 
ATOM   858  H HB3  . ASP A 1 67  ? -8.909  8.855   63.727 1.00 32.09  ?  112 ASP A HB3  1 
ATOM   859  N N    . PHE A 1 68  ? -9.128  11.731  62.749 1.00 20.96  ?  113 PHE A N    1 
ATOM   860  C CA   . PHE A 1 68  ? -8.034  12.553  62.249 1.00 22.59  ?  113 PHE A CA   1 
ATOM   861  C C    . PHE A 1 68  ? -6.742  12.129  62.933 1.00 20.20  ?  113 PHE A C    1 
ATOM   862  O O    . PHE A 1 68  ? -6.742  11.755  64.109 1.00 21.27  ?  113 PHE A O    1 
ATOM   863  C CB   . PHE A 1 68  ? -8.277  14.045  62.507 1.00 23.32  ?  113 PHE A CB   1 
ATOM   864  C CG   . PHE A 1 68  ? -9.312  14.674  61.613 1.00 29.23  ?  113 PHE A CG   1 
ATOM   865  C CD1  . PHE A 1 68  ? -9.508  14.230  60.317 1.00 32.22  ?  113 PHE A CD1  1 
ATOM   866  C CD2  . PHE A 1 68  ? -10.080 15.734  62.073 1.00 30.28  ?  113 PHE A CD2  1 
ATOM   867  C CE1  . PHE A 1 68  ? -10.454 14.821  59.502 1.00 34.67  ?  113 PHE A CE1  1 
ATOM   868  C CE2  . PHE A 1 68  ? -11.027 16.330  61.261 1.00 30.14  ?  113 PHE A CE2  1 
ATOM   869  C CZ   . PHE A 1 68  ? -11.213 15.872  59.974 1.00 31.71  ?  113 PHE A CZ   1 
ATOM   870  H H    . PHE A 1 68  ? -9.395  11.954  63.536 1.00 25.16  ?  113 PHE A H    1 
ATOM   871  H HA   . PHE A 1 68  ? -7.936  12.417  61.294 1.00 27.11  ?  113 PHE A HA   1 
ATOM   872  H HB2  . PHE A 1 68  ? -8.574  14.157  63.424 1.00 27.98  ?  113 PHE A HB2  1 
ATOM   873  H HB3  . PHE A 1 68  ? -7.444  14.522  62.373 1.00 27.98  ?  113 PHE A HB3  1 
ATOM   874  H HD1  . PHE A 1 68  ? -9.000  13.522  59.992 1.00 38.66  ?  113 PHE A HD1  1 
ATOM   875  H HD2  . PHE A 1 68  ? -9.957  16.047  62.940 1.00 36.33  ?  113 PHE A HD2  1 
ATOM   876  H HE1  . PHE A 1 68  ? -10.579 14.511  58.634 1.00 41.61  ?  113 PHE A HE1  1 
ATOM   877  H HE2  . PHE A 1 68  ? -11.539 17.038  61.582 1.00 36.17  ?  113 PHE A HE2  1 
ATOM   878  H HZ   . PHE A 1 68  ? -11.851 16.269  59.425 1.00 38.05  ?  113 PHE A HZ   1 
ATOM   879  N N    . HIS A 1 69  ? -5.641  12.195  62.195 1.00 19.27  ?  114 HIS A N    1 
ATOM   880  C CA   . HIS A 1 69  ? -4.325  11.890  62.733 1.00 19.87  ?  114 HIS A CA   1 
ATOM   881  C C    . HIS A 1 69  ? -3.359  12.980  62.298 1.00 17.32  ?  114 HIS A C    1 
ATOM   882  O O    . HIS A 1 69  ? -3.433  13.466  61.165 1.00 17.64  ?  114 HIS A O    1 
ATOM   883  C CB   . HIS A 1 69  ? -3.810  10.524  62.256 1.00 19.11  ?  114 HIS A CB   1 
ATOM   884  C CG   . HIS A 1 69  ? -4.879  9.483   62.106 1.00 23.39  ?  114 HIS A CG   1 
ATOM   885  N ND1  . HIS A 1 69  ? -4.905  8.333   62.865 1.00 24.24  ?  114 HIS A ND1  1 
ATOM   886  C CD2  . HIS A 1 69  ? -5.951  9.412   61.281 1.00 22.04  ?  114 HIS A CD2  1 
ATOM   887  C CE1  . HIS A 1 69  ? -5.950  7.602   62.519 1.00 23.19  ?  114 HIS A CE1  1 
ATOM   888  N NE2  . HIS A 1 69  ? -6.602  8.235   61.561 1.00 26.07  ?  114 HIS A NE2  1 
ATOM   889  H H    . HIS A 1 69  ? -5.631  12.419  61.364 1.00 23.13  ?  114 HIS A H    1 
ATOM   890  H HA   . HIS A 1 69  ? -4.365  11.883  63.702 1.00 23.85  ?  114 HIS A HA   1 
ATOM   891  H HB2  . HIS A 1 69  ? -3.385  10.637  61.391 1.00 22.93  ?  114 HIS A HB2  1 
ATOM   892  H HB3  . HIS A 1 69  ? -3.164  10.193  62.898 1.00 22.93  ?  114 HIS A HB3  1 
ATOM   893  H HD1  . HIS A 1 69  ? -4.332  8.125   63.472 1.00 29.08  ?  114 HIS A HD1  1 
ATOM   894  H HD2  . HIS A 1 69  ? -6.203  10.045  60.648 1.00 26.44  ?  114 HIS A HD2  1 
ATOM   895  H HE1  . HIS A 1 69  ? -6.186  6.781   62.888 1.00 27.83  ?  114 HIS A HE1  1 
ATOM   896  N N    . LEU A 1 70  ? -2.457  13.362  63.199 1.00 17.06  ?  115 LEU A N    1 
ATOM   897  C CA   . LEU A 1 70  ? -1.426  14.354  62.890 1.00 17.64  ?  115 LEU A CA   1 
ATOM   898  C C    . LEU A 1 70  ? -0.104  13.841  63.451 1.00 15.28  ?  115 LEU A C    1 
ATOM   899  O O    . LEU A 1 70  ? 0.175   14.004  64.642 1.00 16.50  ?  115 LEU A O    1 
ATOM   900  C CB   . LEU A 1 70  ? -1.778  15.720  63.464 1.00 14.43  ?  115 LEU A CB   1 
ATOM   901  C CG   . LEU A 1 70  ? -0.747  16.821  63.193 1.00 15.15  ?  115 LEU A CG   1 
ATOM   902  C CD1  . LEU A 1 70  ? -0.538  17.016  61.687 1.00 16.58  ?  115 LEU A CD1  1 
ATOM   903  C CD2  . LEU A 1 70  ? -1.166  18.128  63.850 1.00 16.50  ?  115 LEU A CD2  1 
ATOM   904  H H    . LEU A 1 70  ? -2.419  13.060  64.003 1.00 20.47  ?  115 LEU A H    1 
ATOM   905  H HA   . LEU A 1 70  ? -1.339  14.440  61.928 1.00 21.17  ?  115 LEU A HA   1 
ATOM   906  H HB2  . LEU A 1 70  ? -2.621  16.008  63.081 1.00 17.31  ?  115 LEU A HB2  1 
ATOM   907  H HB3  . LEU A 1 70  ? -1.870  15.636  64.426 1.00 17.31  ?  115 LEU A HB3  1 
ATOM   908  H HG   . LEU A 1 70  ? 0.103   16.555  63.578 1.00 18.18  ?  115 LEU A HG   1 
ATOM   909  H HD11 . LEU A 1 70  ? 0.118   17.717  61.548 1.00 19.90  ?  115 LEU A HD11 1 
ATOM   910  H HD12 . LEU A 1 70  ? -0.221  16.185  61.302 1.00 19.90  ?  115 LEU A HD12 1 
ATOM   911  H HD13 . LEU A 1 70  ? -1.383  17.268  61.282 1.00 19.90  ?  115 LEU A HD13 1 
ATOM   912  H HD21 . LEU A 1 70  ? -0.497  18.804  63.663 1.00 19.80  ?  115 LEU A HD21 1 
ATOM   913  H HD22 . LEU A 1 70  ? -2.024  18.401  63.489 1.00 19.80  ?  115 LEU A HD22 1 
ATOM   914  H HD23 . LEU A 1 70  ? -1.239  17.990  64.808 1.00 19.80  ?  115 LEU A HD23 1 
ATOM   915  N N    . PHE A 1 71  ? 0.712   13.246  62.587 1.00 16.13  ?  116 PHE A N    1 
ATOM   916  C CA   . PHE A 1 71  ? 1.948   12.600  62.998 1.00 17.06  ?  116 PHE A CA   1 
ATOM   917  C C    . PHE A 1 71  ? 3.145   13.238  62.310 1.00 18.03  ?  116 PHE A C    1 
ATOM   918  O O    . PHE A 1 71  ? 3.032   13.837  61.237 1.00 17.24  ?  116 PHE A O    1 
ATOM   919  C CB   . PHE A 1 71  ? 1.915   11.098  62.679 1.00 16.56  ?  116 PHE A CB   1 
ATOM   920  C CG   . PHE A 1 71  ? 1.122   10.293  63.663 1.00 15.76  ?  116 PHE A CG   1 
ATOM   921  C CD1  . PHE A 1 71  ? -0.228  10.535  63.841 1.00 15.40  ?  116 PHE A CD1  1 
ATOM   922  C CD2  . PHE A 1 71  ? 1.726   9.296   64.412 1.00 18.66  ?  116 PHE A CD2  1 
ATOM   923  C CE1  . PHE A 1 71  ? -0.963  9.801   64.751 1.00 20.15  ?  116 PHE A CE1  1 
ATOM   924  C CE2  . PHE A 1 71  ? 0.995   8.556   65.323 1.00 16.33  ?  116 PHE A CE2  1 
ATOM   925  C CZ   . PHE A 1 71  ? -0.351  8.806   65.489 1.00 18.76  ?  116 PHE A CZ   1 
ATOM   926  H H    . PHE A 1 71  ? 0.566   13.203  61.741 1.00 19.36  ?  116 PHE A H    1 
ATOM   927  H HA   . PHE A 1 71  ? 2.058   12.703  63.956 1.00 20.48  ?  116 PHE A HA   1 
ATOM   928  H HB2  . PHE A 1 71  ? 1.518   10.972  61.803 1.00 19.87  ?  116 PHE A HB2  1 
ATOM   929  H HB3  . PHE A 1 71  ? 2.824   10.758  62.680 1.00 19.87  ?  116 PHE A HB3  1 
ATOM   930  H HD1  . PHE A 1 71  ? -0.644  11.203  63.346 1.00 18.48  ?  116 PHE A HD1  1 
ATOM   931  H HD2  . PHE A 1 71  ? 2.633   9.123   64.301 1.00 22.39  ?  116 PHE A HD2  1 
ATOM   932  H HE1  . PHE A 1 71  ? -1.871  9.972   64.862 1.00 24.18  ?  116 PHE A HE1  1 
ATOM   933  H HE2  . PHE A 1 71  ? 1.410   7.887   65.819 1.00 19.59  ?  116 PHE A HE2  1 
ATOM   934  H HZ   . PHE A 1 71  ? -0.844  8.310   66.102 1.00 22.51  ?  116 PHE A HZ   1 
ATOM   935  N N    . LYS A 1 72  ? 4.301   13.094  62.952 1.00 17.82  ?  117 LYS A N    1 
ATOM   936  C CA   . LYS A 1 72  ? 5.554   13.494  62.332 1.00 17.90  ?  117 LYS A CA   1 
ATOM   937  C C    . LYS A 1 72  ? 5.672   12.873  60.948 1.00 19.82  ?  117 LYS A C    1 
ATOM   938  O O    . LYS A 1 72  ? 5.307   11.712  60.736 1.00 20.59  ?  117 LYS A O    1 
ATOM   939  C CB   . LYS A 1 72  ? 6.735   13.063  63.202 1.00 16.77  ?  117 LYS A CB   1 
ATOM   940  C CG   . LYS A 1 72  ? 6.847   13.817  64.510 1.00 24.23  ?  117 LYS A CG   1 
ATOM   941  C CD   . LYS A 1 72  ? 7.999   13.297  65.347 1.00 23.41  ?  117 LYS A CD   1 
ATOM   942  C CE   . LYS A 1 72  ? 8.267   14.209  66.530 1.00 24.13  ?  117 LYS A CE   1 
ATOM   943  N NZ   . LYS A 1 72  ? 9.327   13.660  67.421 1.00 30.25  1  117 LYS A NZ   1 
ATOM   944  H H    . LYS A 1 72  ? 4.385   12.768  63.743 1.00 21.39  ?  117 LYS A H    1 
ATOM   945  H HA   . LYS A 1 72  ? 5.576   14.459  62.239 1.00 21.48  ?  117 LYS A HA   1 
ATOM   946  H HB2  . LYS A 1 72  ? 6.640   12.120  63.411 1.00 20.13  ?  117 LYS A HB2  1 
ATOM   947  H HB3  . LYS A 1 72  ? 7.556   13.207  62.706 1.00 20.13  ?  117 LYS A HB3  1 
ATOM   948  H HG2  . LYS A 1 72  ? 7.003   14.756  64.327 1.00 29.08  ?  117 LYS A HG2  1 
ATOM   949  H HG3  . LYS A 1 72  ? 6.028   13.704  65.016 1.00 29.08  ?  117 LYS A HG3  1 
ATOM   950  H HD2  . LYS A 1 72  ? 7.779   12.415  65.685 1.00 28.09  ?  117 LYS A HD2  1 
ATOM   951  H HD3  . LYS A 1 72  ? 8.801   13.260  64.803 1.00 28.09  ?  117 LYS A HD3  1 
ATOM   952  H HE2  . LYS A 1 72  ? 8.562   15.075  66.206 1.00 28.96  ?  117 LYS A HE2  1 
ATOM   953  H HE3  . LYS A 1 72  ? 7.454   14.306  67.050 1.00 28.96  ?  117 LYS A HE3  1 
ATOM   954  H HZ1  . LYS A 1 72  ? 9.465   14.213  68.105 1.00 36.31  ?  117 LYS A HZ1  1 
ATOM   955  H HZ2  . LYS A 1 72  ? 9.078   12.866  67.736 1.00 36.31  ?  117 LYS A HZ2  1 
ATOM   956  H HZ3  . LYS A 1 72  ? 10.087  13.566  66.968 1.00 36.31  ?  117 LYS A HZ3  1 
ATOM   957  N N    . GLU A 1 73  ? 6.181   13.655  59.999 1.00 19.76  ?  118 GLU A N    1 
ATOM   958  C CA   . GLU A 1 73  ? 6.372   13.140  58.652 1.00 18.53  ?  118 GLU A CA   1 
ATOM   959  C C    . GLU A 1 73  ? 7.283   11.923  58.702 1.00 21.51  ?  118 GLU A C    1 
ATOM   960  O O    . GLU A 1 73  ? 8.355   11.959  59.313 1.00 23.90  ?  118 GLU A O    1 
ATOM   961  C CB   . GLU A 1 73  ? 6.968   14.211  57.740 1.00 23.42  ?  118 GLU A CB   1 
ATOM   962  C CG   . GLU A 1 73  ? 6.888   13.848  56.265 1.00 23.35  ?  118 GLU A CG   1 
ATOM   963  C CD   . GLU A 1 73  ? 7.740   14.742  55.384 1.00 26.08  ?  118 GLU A CD   1 
ATOM   964  O OE1  . GLU A 1 73  ? 8.636   15.428  55.915 1.00 21.19  ?  118 GLU A OE1  1 
ATOM   965  O OE2  . GLU A 1 73  ? 7.514   14.746  54.155 1.00 29.01  -1 118 GLU A OE2  1 
ATOM   966  H H    . GLU A 1 73  ? 6.420   14.474  60.109 1.00 23.71  ?  118 GLU A H    1 
ATOM   967  H HA   . GLU A 1 73  ? 5.516   12.867  58.287 1.00 22.23  ?  118 GLU A HA   1 
ATOM   968  H HB2  . GLU A 1 73  ? 6.484   15.041  57.870 1.00 28.11  ?  118 GLU A HB2  1 
ATOM   969  H HB3  . GLU A 1 73  ? 7.903   14.334  57.967 1.00 28.11  ?  118 GLU A HB3  1 
ATOM   970  H HG2  . GLU A 1 73  ? 7.194   12.935  56.149 1.00 28.02  ?  118 GLU A HG2  1 
ATOM   971  H HG3  . GLU A 1 73  ? 5.967   13.928  55.971 1.00 28.02  ?  118 GLU A HG3  1 
ATOM   972  N N    . GLY A 1 74  ? 6.848   10.839  58.064 1.00 21.50  ?  119 GLY A N    1 
ATOM   973  C CA   . GLY A 1 74  ? 7.559   9.589   58.075 1.00 27.95  ?  119 GLY A CA   1 
ATOM   974  C C    . GLY A 1 74  ? 6.983   8.564   59.034 1.00 27.05  ?  119 GLY A C    1 
ATOM   975  O O    . GLY A 1 74  ? 7.125   7.360   58.795 1.00 29.47  ?  119 GLY A O    1 
ATOM   976  H H    . GLY A 1 74  ? 6.119   10.814  57.607 1.00 25.80  ?  119 GLY A H    1 
ATOM   977  H HA2  . GLY A 1 74  ? 7.548   9.208   57.183 1.00 33.53  ?  119 GLY A HA2  1 
ATOM   978  H HA3  . GLY A 1 74  ? 8.482   9.750   58.324 1.00 33.53  ?  119 GLY A HA3  1 
ATOM   979  N N    . ILE A 1 75  ? 6.335   9.011   60.108 1.00 24.82  ?  120 ILE A N    1 
ATOM   980  C CA   . ILE A 1 75  ? 5.697   8.111   61.061 1.00 24.09  ?  120 ILE A CA   1 
ATOM   981  C C    . ILE A 1 75  ? 4.257   7.904   60.614 1.00 26.15  ?  120 ILE A C    1 
ATOM   982  O O    . ILE A 1 75  ? 3.452   8.838   60.620 1.00 23.69  ?  120 ILE A O    1 
ATOM   983  C CB   . ILE A 1 75  ? 5.755   8.655   62.493 1.00 25.05  ?  120 ILE A CB   1 
ATOM   984  C CG1  . ILE A 1 75  ? 7.206   8.935   62.893 1.00 21.43  ?  120 ILE A CG1  1 
ATOM   985  C CG2  . ILE A 1 75  ? 5.096   7.653   63.460 1.00 23.29  ?  120 ILE A CG2  1 
ATOM   986  C CD1  . ILE A 1 75  ? 7.386   9.400   64.323 1.00 22.31  ?  120 ILE A CD1  1 
ATOM   987  H H    . ILE A 1 75  ? 6.250   9.844   60.307 1.00 29.78  ?  120 ILE A H    1 
ATOM   988  H HA   . ILE A 1 75  ? 6.148   7.253   61.043 1.00 28.91  ?  120 ILE A HA   1 
ATOM   989  H HB   . ILE A 1 75  ? 5.259   9.488   62.527 1.00 30.06  ?  120 ILE A HB   1 
ATOM   990  H HG12 . ILE A 1 75  ? 7.720   8.120   62.782 1.00 25.71  ?  120 ILE A HG12 1 
ATOM   991  H HG13 . ILE A 1 75  ? 7.560   9.626   62.313 1.00 25.71  ?  120 ILE A HG13 1 
ATOM   992  H HG21 . ILE A 1 75  ? 5.140   8.010   64.361 1.00 27.95  ?  120 ILE A HG21 1 
ATOM   993  H HG22 . ILE A 1 75  ? 4.171   7.525   63.199 1.00 27.95  ?  120 ILE A HG22 1 
ATOM   994  H HG23 . ILE A 1 75  ? 5.573   6.810   63.414 1.00 27.95  ?  120 ILE A HG23 1 
ATOM   995  H HD11 . ILE A 1 75  ? 8.330   9.552   64.489 1.00 26.77  ?  120 ILE A HD11 1 
ATOM   996  H HD12 . ILE A 1 75  ? 6.890   10.223  64.452 1.00 26.77  ?  120 ILE A HD12 1 
ATOM   997  H HD13 . ILE A 1 75  ? 7.051   8.714   64.922 1.00 26.77  ?  120 ILE A HD13 1 
ATOM   998  N N    . LYS A 1 76  ? 3.931   6.681   60.234 1.00 25.19  ?  121 LYS A N    1 
ATOM   999  C CA   . LYS A 1 76  ? 2.552   6.374   59.899 1.00 24.29  ?  121 LYS A CA   1 
ATOM   1000 C C    . LYS A 1 76  ? 1.746   6.177   61.183 1.00 23.28  ?  121 LYS A C    1 
ATOM   1001 O O    . LYS A 1 76  ? 2.275   5.664   62.170 1.00 24.33  ?  121 LYS A O    1 
ATOM   1002 C CB   . LYS A 1 76  ? 2.480   5.115   59.036 1.00 30.13  ?  121 LYS A CB   1 
ATOM   1003 C CG   . LYS A 1 76  ? 3.244   5.230   57.722 1.00 30.33  ?  121 LYS A CG   1 
ATOM   1004 C CD   . LYS A 1 76  ? 3.218   3.923   56.945 1.00 41.12  ?  121 LYS A CD   1 
ATOM   1005 C CE   . LYS A 1 76  ? 3.929   4.053   55.602 1.00 47.43  ?  121 LYS A CE   1 
ATOM   1006 N NZ   . LYS A 1 76  ? 5.379   4.368   55.749 1.00 46.96  1  121 LYS A NZ   1 
ATOM   1007 H H    . LYS A 1 76  ? 4.477   6.021   60.163 1.00 30.23  ?  121 LYS A H    1 
ATOM   1008 H HA   . LYS A 1 76  ? 2.166   7.112   59.402 1.00 29.14  ?  121 LYS A HA   1 
ATOM   1009 H HB2  . LYS A 1 76  ? 2.856   4.372   59.534 1.00 36.16  ?  121 LYS A HB2  1 
ATOM   1010 H HB3  . LYS A 1 76  ? 1.551   4.933   58.825 1.00 36.16  ?  121 LYS A HB3  1 
ATOM   1011 H HG2  . LYS A 1 76  ? 2.835   5.917   57.173 1.00 36.40  ?  121 LYS A HG2  1 
ATOM   1012 H HG3  . LYS A 1 76  ? 4.169   5.455   57.908 1.00 36.40  ?  121 LYS A HG3  1 
ATOM   1013 H HD2  . LYS A 1 76  ? 3.668   3.235   57.461 1.00 49.34  ?  121 LYS A HD2  1 
ATOM   1014 H HD3  . LYS A 1 76  ? 2.297   3.668   56.777 1.00 49.34  ?  121 LYS A HD3  1 
ATOM   1015 H HE2  . LYS A 1 76  ? 3.851   3.215   55.121 1.00 56.92  ?  121 LYS A HE2  1 
ATOM   1016 H HE3  . LYS A 1 76  ? 3.516   4.768   55.094 1.00 56.92  ?  121 LYS A HE3  1 
ATOM   1017 H HZ1  . LYS A 1 76  ? 5.758   4.436   54.947 1.00 56.35  ?  121 LYS A HZ1  1 
ATOM   1018 H HZ2  . LYS A 1 76  ? 5.480   5.139   56.183 1.00 56.35  ?  121 LYS A HZ2  1 
ATOM   1019 H HZ3  . LYS A 1 76  ? 5.785   3.723   56.208 1.00 56.35  ?  121 LYS A HZ3  1 
ATOM   1020 N N    . PRO A 1 77  ? 0.471   6.577   61.206 1.00 20.85  ?  122 PRO A N    1 
ATOM   1021 C CA   . PRO A 1 77  ? -0.337  6.431   62.431 1.00 21.04  ?  122 PRO A CA   1 
ATOM   1022 C C    . PRO A 1 77  ? -0.823  4.998   62.639 1.00 23.72  ?  122 PRO A C    1 
ATOM   1023 O O    . PRO A 1 77  ? -2.022  4.718   62.683 1.00 25.05  ?  122 PRO A O    1 
ATOM   1024 C CB   . PRO A 1 77  ? -1.482  7.421   62.183 1.00 19.63  ?  122 PRO A CB   1 
ATOM   1025 C CG   . PRO A 1 77  ? -1.659  7.412   60.707 1.00 25.42  ?  122 PRO A CG   1 
ATOM   1026 C CD   . PRO A 1 77  ? -0.288  7.219   60.118 1.00 22.96  ?  122 PRO A CD   1 
ATOM   1027 H HA   . PRO A 1 77  ? 0.172   6.715   63.207 1.00 25.25  ?  122 PRO A HA   1 
ATOM   1028 H HB2  . PRO A 1 77  ? -2.286  7.113   62.629 1.00 23.56  ?  122 PRO A HB2  1 
ATOM   1029 H HB3  . PRO A 1 77  ? -1.229  8.303   62.496 1.00 23.56  ?  122 PRO A HB3  1 
ATOM   1030 H HG2  . PRO A 1 77  ? -2.243  6.680   60.455 1.00 30.50  ?  122 PRO A HG2  1 
ATOM   1031 H HG3  . PRO A 1 77  ? -2.035  8.260   60.421 1.00 30.50  ?  122 PRO A HG3  1 
ATOM   1032 H HD2  . PRO A 1 77  ? -0.331  6.634   59.346 1.00 27.56  ?  122 PRO A HD2  1 
ATOM   1033 H HD3  . PRO A 1 77  ? 0.106   8.076   59.893 1.00 27.56  ?  122 PRO A HD3  1 
ATOM   1034 N N    . MET A 1 78  ? 0.131   4.075   62.766 1.00 22.29  ?  123 MET A N    1 
ATOM   1035 C CA   . MET A 1 78  ? -0.140  2.653   62.931 1.00 25.19  ?  123 MET A CA   1 
ATOM   1036 C C    . MET A 1 78  ? 0.871   2.073   63.908 1.00 23.54  ?  123 MET A C    1 
ATOM   1037 O O    . MET A 1 78  ? 2.045   2.450   63.888 1.00 22.92  ?  123 MET A O    1 
ATOM   1038 C CB   . MET A 1 78  ? -0.044  1.897   61.599 1.00 29.86  ?  123 MET A CB   1 
ATOM   1039 C CG   . MET A 1 78  ? -0.942  2.427   60.492 1.00 32.48  ?  123 MET A CG   1 
ATOM   1040 S SD   . MET A 1 78  ? -0.496  1.755   58.878 1.00 46.51  ?  123 MET A SD   1 
ATOM   1041 C CE   . MET A 1 78  ? -0.684  -0.003  59.169 1.00 43.51  ?  123 MET A CE   1 
ATOM   1042 H H    . MET A 1 78  ? 0.971   4.260   62.759 1.00 26.75  ?  123 MET A H    1 
ATOM   1043 H HA   . MET A 1 78  ? -1.035  2.535   63.286 1.00 30.23  ?  123 MET A HA   1 
ATOM   1044 H HB2  . MET A 1 78  ? 0.872   1.947   61.282 1.00 35.84  ?  123 MET A HB2  1 
ATOM   1045 H HB3  . MET A 1 78  ? -0.284  0.970   61.752 1.00 35.84  ?  123 MET A HB3  1 
ATOM   1046 H HG2  . MET A 1 78  ? -1.860  2.177   60.681 1.00 38.97  ?  123 MET A HG2  1 
ATOM   1047 H HG3  . MET A 1 78  ? -0.861  3.393   60.451 1.00 38.97  ?  123 MET A HG3  1 
ATOM   1048 H HE1  . MET A 1 78  ? -0.467  -0.482  58.355 1.00 52.22  ?  123 MET A HE1  1 
ATOM   1049 H HE2  . MET A 1 78  ? -0.083  -0.271  59.882 1.00 52.22  ?  123 MET A HE2  1 
ATOM   1050 H HE3  . MET A 1 78  ? -1.602  -0.183  59.425 1.00 52.22  ?  123 MET A HE3  1 
ATOM   1051 N N    . TRP A 1 79  ? 0.421   1.145   64.757 1.00 27.55  ?  124 TRP A N    1 
ATOM   1052 C CA   . TRP A 1 79  ? 1.331   0.575   65.744 1.00 25.56  ?  124 TRP A CA   1 
ATOM   1053 C C    . TRP A 1 79  ? 2.487   -0.151  65.072 1.00 26.79  ?  124 TRP A C    1 
ATOM   1054 O O    . TRP A 1 79  ? 3.581   -0.231  65.642 1.00 27.85  ?  124 TRP A O    1 
ATOM   1055 C CB   . TRP A 1 79  ? 0.581   -0.369  66.687 1.00 26.10  ?  124 TRP A CB   1 
ATOM   1056 C CG   . TRP A 1 79  ? 0.180   -1.670  66.068 1.00 27.36  ?  124 TRP A CG   1 
ATOM   1057 C CD1  . TRP A 1 79  ? -1.033  -1.981  65.528 1.00 28.74  ?  124 TRP A CD1  1 
ATOM   1058 C CD2  . TRP A 1 79  ? 0.995   -2.840  65.926 1.00 28.57  ?  124 TRP A CD2  1 
ATOM   1059 N NE1  . TRP A 1 79  ? -1.024  -3.273  65.058 1.00 35.77  ?  124 TRP A NE1  1 
ATOM   1060 C CE2  . TRP A 1 79  ? 0.210   -3.822  65.290 1.00 32.00  ?  124 TRP A CE2  1 
ATOM   1061 C CE3  . TRP A 1 79  ? 2.314   -3.152  66.273 1.00 31.90  ?  124 TRP A CE3  1 
ATOM   1062 C CZ2  . TRP A 1 79  ? 0.698   -5.093  64.994 1.00 32.94  ?  124 TRP A CZ2  1 
ATOM   1063 C CZ3  . TRP A 1 79  ? 2.796   -4.414  65.979 1.00 34.18  ?  124 TRP A CZ3  1 
ATOM   1064 C CH2  . TRP A 1 79  ? 1.991   -5.368  65.345 1.00 32.38  ?  124 TRP A CH2  1 
ATOM   1065 H H    . TRP A 1 79  ? -0.383  0.839   64.781 1.00 33.06  ?  124 TRP A H    1 
ATOM   1066 H HA   . TRP A 1 79  ? 1.703   1.294   66.278 1.00 30.67  ?  124 TRP A HA   1 
ATOM   1067 H HB2  . TRP A 1 79  ? 1.151   -0.567  67.446 1.00 31.32  ?  124 TRP A HB2  1 
ATOM   1068 H HB3  . TRP A 1 79  ? -0.227  0.074   66.991 1.00 31.32  ?  124 TRP A HB3  1 
ATOM   1069 H HD1  . TRP A 1 79  ? -1.760  -1.404  65.486 1.00 34.49  ?  124 TRP A HD1  1 
ATOM   1070 H HE1  . TRP A 1 79  ? -1.685  -3.672  64.679 1.00 42.92  ?  124 TRP A HE1  1 
ATOM   1071 H HE3  . TRP A 1 79  ? 2.855   -2.524  66.693 1.00 38.28  ?  124 TRP A HE3  1 
ATOM   1072 H HZ2  . TRP A 1 79  ? 0.166   -5.729  64.574 1.00 39.53  ?  124 TRP A HZ2  1 
ATOM   1073 H HZ3  . TRP A 1 79  ? 3.671   -4.633  66.205 1.00 41.02  ?  124 TRP A HZ3  1 
ATOM   1074 H HH2  . TRP A 1 79  ? 2.342   -6.209  65.160 1.00 38.86  ?  124 TRP A HH2  1 
ATOM   1075 N N    . GLU A 1 80  ? 2.270   -0.669  63.859 1.00 31.12  ?  125 GLU A N    1 
ATOM   1076 C CA   . GLU A 1 80  ? 3.301   -1.422  63.153 1.00 31.31  ?  125 GLU A CA   1 
ATOM   1077 C C    . GLU A 1 80  ? 4.492   -0.562  62.759 1.00 34.46  ?  125 GLU A C    1 
ATOM   1078 O O    . GLU A 1 80  ? 5.586   -1.102  62.558 1.00 30.19  ?  125 GLU A O    1 
ATOM   1079 C CB   . GLU A 1 80  ? 2.720   -2.070  61.896 1.00 34.35  ?  125 GLU A CB   1 
ATOM   1080 C CG   . GLU A 1 80  ? 1.670   -3.130  62.159 1.00 35.53  ?  125 GLU A CG   1 
ATOM   1081 C CD   . GLU A 1 80  ? 0.261   -2.573  62.161 1.00 37.61  ?  125 GLU A CD   1 
ATOM   1082 O OE1  . GLU A 1 80  ? 0.096   -1.354  62.378 1.00 36.66  ?  125 GLU A OE1  1 
ATOM   1083 O OE2  . GLU A 1 80  ? -0.684  -3.359  61.938 1.00 44.78  -1 125 GLU A OE2  1 
ATOM   1084 H H    . GLU A 1 80  ? 1.531   -0.595  63.425 1.00 37.34  ?  125 GLU A H    1 
ATOM   1085 H HA   . GLU A 1 80  ? 3.623   -2.130  63.733 1.00 37.57  ?  125 GLU A HA   1 
ATOM   1086 H HB2  . GLU A 1 80  ? 2.310   -1.379  61.352 1.00 41.22  ?  125 GLU A HB2  1 
ATOM   1087 H HB3  . GLU A 1 80  ? 3.442   -2.489  61.401 1.00 41.22  ?  125 GLU A HB3  1 
ATOM   1088 H HG2  . GLU A 1 80  ? 1.723   -3.807  61.466 1.00 42.63  ?  125 GLU A HG2  1 
ATOM   1089 H HG3  . GLU A 1 80  ? 1.835   -3.530  63.027 1.00 42.63  ?  125 GLU A HG3  1 
ATOM   1090 N N    . ASP A 1 81  ? 4.308   0.750   62.627 1.00 26.23  ?  126 ASP A N    1 
ATOM   1091 C CA   . ASP A 1 81  ? 5.402   1.615   62.212 1.00 30.53  ?  126 ASP A CA   1 
ATOM   1092 C C    . ASP A 1 81  ? 6.567   1.488   63.183 1.00 29.19  ?  126 ASP A C    1 
ATOM   1093 O O    . ASP A 1 81  ? 6.379   1.391   64.398 1.00 28.88  ?  126 ASP A O    1 
ATOM   1094 C CB   . ASP A 1 81  ? 4.930   3.069   62.136 1.00 29.16  ?  126 ASP A CB   1 
ATOM   1095 C CG   . ASP A 1 81  ? 5.930   3.970   61.435 1.00 30.57  ?  126 ASP A CG   1 
ATOM   1096 O OD1  . ASP A 1 81  ? 6.925   4.368   62.077 1.00 33.63  ?  126 ASP A OD1  1 
ATOM   1097 O OD2  . ASP A 1 81  ? 5.719   4.284   60.245 1.00 30.58  -1 126 ASP A OD2  1 
ATOM   1098 H H    . ASP A 1 81  ? 3.564   1.158   62.771 1.00 31.47  ?  126 ASP A H    1 
ATOM   1099 H HA   . ASP A 1 81  ? 5.707   1.347   61.331 1.00 36.63  ?  126 ASP A HA   1 
ATOM   1100 H HB2  . ASP A 1 81  ? 4.096   3.106   61.644 1.00 34.99  ?  126 ASP A HB2  1 
ATOM   1101 H HB3  . ASP A 1 81  ? 4.801   3.407   63.036 1.00 34.99  ?  126 ASP A HB3  1 
ATOM   1102 N N    . ASP A 1 82  ? 7.784   1.489   62.636 1.00 29.48  ?  127 ASP A N    1 
ATOM   1103 C CA   . ASP A 1 82  ? 8.966   1.283   63.465 1.00 32.31  ?  127 ASP A CA   1 
ATOM   1104 C C    . ASP A 1 82  ? 9.076   2.324   64.571 1.00 31.05  ?  127 ASP A C    1 
ATOM   1105 O O    . ASP A 1 82  ? 9.610   2.031   65.647 1.00 29.18  ?  127 ASP A O    1 
ATOM   1106 C CB   . ASP A 1 82  ? 10.226  1.303   62.599 1.00 39.81  ?  127 ASP A CB   1 
ATOM   1107 C CG   . ASP A 1 82  ? 10.284  0.141   61.627 1.00 44.73  ?  127 ASP A CG   1 
ATOM   1108 O OD1  . ASP A 1 82  ? 9.511   -0.825  61.807 1.00 41.00  ?  127 ASP A OD1  1 
ATOM   1109 O OD2  . ASP A 1 82  ? 11.107  0.191   60.687 1.00 49.02  -1 127 ASP A OD2  1 
ATOM   1110 H H    . ASP A 1 82  ? 7.949   1.605   61.800 1.00 35.38  ?  127 ASP A H    1 
ATOM   1111 H HA   . ASP A 1 82  ? 8.907   0.410   63.883 1.00 38.77  ?  127 ASP A HA   1 
ATOM   1112 H HB2  . ASP A 1 82  ? 10.245  2.125   62.085 1.00 47.77  ?  127 ASP A HB2  1 
ATOM   1113 H HB3  . ASP A 1 82  ? 11.006  1.253   63.174 1.00 47.77  ?  127 ASP A HB3  1 
ATOM   1114 N N    . ALA A 1 83  ? 8.596   3.546   64.328 1.00 30.04  ?  128 ALA A N    1 
ATOM   1115 C CA   . ALA A 1 83  ? 8.651   4.578   65.356 1.00 27.43  ?  128 ALA A CA   1 
ATOM   1116 C C    . ALA A 1 83  ? 7.747   4.258   66.537 1.00 26.08  ?  128 ALA A C    1 
ATOM   1117 O O    . ALA A 1 83  ? 7.981   4.767   67.640 1.00 23.57  ?  128 ALA A O    1 
ATOM   1118 C CB   . ALA A 1 83  ? 8.266   5.934   64.761 1.00 25.85  ?  128 ALA A CB   1 
ATOM   1119 H H    . ALA A 1 83  ? 8.239   3.797   63.587 1.00 36.05  ?  128 ALA A H    1 
ATOM   1120 H HA   . ALA A 1 83  ? 9.561   4.644   65.686 1.00 32.91  ?  128 ALA A HA   1 
ATOM   1121 H HB1  . ALA A 1 83  ? 8.308   6.608   65.457 1.00 31.02  ?  128 ALA A HB1  1 
ATOM   1122 H HB2  . ALA A 1 83  ? 8.888   6.154   64.049 1.00 31.02  ?  128 ALA A HB2  1 
ATOM   1123 H HB3  . ALA A 1 83  ? 7.364   5.879   64.407 1.00 31.02  ?  128 ALA A HB3  1 
ATOM   1124 N N    . ASN A 1 84  ? 6.736   3.416   66.337 1.00 24.38  ?  129 ASN A N    1 
ATOM   1125 C CA   . ASN A 1 84  ? 5.769   3.089   67.374 1.00 28.67  ?  129 ASN A CA   1 
ATOM   1126 C C    . ASN A 1 84  ? 6.023   1.734   68.027 1.00 30.79  ?  129 ASN A C    1 
ATOM   1127 O O    . ASN A 1 84  ? 5.218   1.306   68.860 1.00 28.38  ?  129 ASN A O    1 
ATOM   1128 C CB   . ASN A 1 84  ? 4.356   3.142   66.786 1.00 24.86  ?  129 ASN A CB   1 
ATOM   1129 C CG   . ASN A 1 84  ? 4.003   4.523   66.257 1.00 22.82  ?  129 ASN A CG   1 
ATOM   1130 O OD1  . ASN A 1 84  ? 4.361   5.534   66.859 1.00 23.08  ?  129 ASN A OD1  1 
ATOM   1131 N ND2  . ASN A 1 84  ? 3.312   4.574   65.124 1.00 23.48  ?  129 ASN A ND2  1 
ATOM   1132 H H    . ASN A 1 84  ? 6.589   3.014   65.591 1.00 29.26  ?  129 ASN A H    1 
ATOM   1133 H HA   . ASN A 1 84  ? 5.823   3.763   68.069 1.00 34.41  ?  129 ASN A HA   1 
ATOM   1134 H HB2  . ASN A 1 84  ? 4.294   2.512   66.051 1.00 29.83  ?  129 ASN A HB2  1 
ATOM   1135 H HB3  . ASN A 1 84  ? 3.716   2.911   67.478 1.00 29.83  ?  129 ASN A HB3  1 
ATOM   1136 H HD21 . ASN A 1 84  ? 3.090   5.334   64.789 1.00 28.18  ?  129 ASN A HD21 1 
ATOM   1137 H HD22 . ASN A 1 84  ? 3.086   3.846   64.726 1.00 28.18  ?  129 ASN A HD22 1 
ATOM   1138 N N    . LYS A 1 85  ? 7.113   1.050   67.674 1.00 30.83  ?  130 LYS A N    1 
ATOM   1139 C CA   . LYS A 1 85  ? 7.536   -0.115  68.442 1.00 36.63  ?  130 LYS A CA   1 
ATOM   1140 C C    . LYS A 1 85  ? 7.821   0.298   69.879 1.00 33.57  ?  130 LYS A C    1 
ATOM   1141 O O    . LYS A 1 85  ? 8.363   1.376   70.136 1.00 41.46  ?  130 LYS A O    1 
ATOM   1142 C CB   . LYS A 1 85  ? 8.797   -0.748  67.847 1.00 36.57  ?  130 LYS A CB   1 
ATOM   1143 C CG   . LYS A 1 85  ? 8.734   -1.110  66.381 1.00 39.98  ?  130 LYS A CG   1 
ATOM   1144 C CD   . LYS A 1 85  ? 9.989   -1.889  65.981 1.00 46.65  ?  130 LYS A CD   1 
ATOM   1145 C CE   . LYS A 1 85  ? 10.178  -1.964  64.472 1.00 52.11  ?  130 LYS A CE   1 
ATOM   1146 N NZ   . LYS A 1 85  ? 11.323  -2.837  64.085 1.00 57.05  ?  130 LYS A NZ   1 
ATOM   1147 H H    . LYS A 1 85  ? 7.617   1.239   67.003 1.00 36.99  ?  130 LYS A H    1 
ATOM   1148 H HA   . LYS A 1 85  ? 6.828   -0.778  68.445 1.00 43.96  ?  130 LYS A HA   1 
ATOM   1149 H HB2  . LYS A 1 85  ? 9.532   -0.126  67.959 1.00 43.88  ?  130 LYS A HB2  1 
ATOM   1150 H HB3  . LYS A 1 85  ? 8.988   -1.563  68.337 1.00 43.88  ?  130 LYS A HB3  1 
ATOM   1151 H HG2  . LYS A 1 85  ? 7.958   -1.668  66.217 1.00 47.98  ?  130 LYS A HG2  1 
ATOM   1152 H HG3  . LYS A 1 85  ? 8.690   -0.301  65.848 1.00 47.98  ?  130 LYS A HG3  1 
ATOM   1153 H HD2  . LYS A 1 85  ? 10.767  -1.451  66.360 1.00 55.98  ?  130 LYS A HD2  1 
ATOM   1154 H HD3  . LYS A 1 85  ? 9.919   -2.795  66.320 1.00 55.98  ?  130 LYS A HD3  1 
ATOM   1155 H HE2  . LYS A 1 85  ? 9.374   -2.326  64.069 1.00 62.53  ?  130 LYS A HE2  1 
ATOM   1156 H HE3  . LYS A 1 85  ? 10.350  -1.072  64.130 1.00 62.53  ?  130 LYS A HE3  1 
ATOM   1157 H HZ1  . LYS A 1 85  ? 11.404  -2.857  63.199 1.00 68.46  ?  130 LYS A HZ1  1 
ATOM   1158 H HZ2  . LYS A 1 85  ? 12.078  -2.522  64.437 1.00 68.46  ?  130 LYS A HZ2  1 
ATOM   1159 H HZ3  . LYS A 1 85  ? 11.188  -3.665  64.382 1.00 68.46  ?  130 LYS A HZ3  1 
ATOM   1160 N N    . ASN A 1 86  ? 7.464   -0.570  70.822 1.00 37.89  ?  131 ASN A N    1 
ATOM   1161 C CA   . ASN A 1 86  ? 7.659   -0.286  72.241 1.00 34.19  ?  131 ASN A CA   1 
ATOM   1162 C C    . ASN A 1 86  ? 7.020   1.039   72.637 1.00 28.94  ?  131 ASN A C    1 
ATOM   1163 O O    . ASN A 1 86  ? 7.417   1.655   73.629 1.00 26.33  ?  131 ASN A O    1 
ATOM   1164 C CB   . ASN A 1 86  ? 9.148   -0.282  72.603 1.00 37.04  ?  131 ASN A CB   1 
ATOM   1165 C CG   . ASN A 1 86  ? 9.810   -1.624  72.356 1.00 46.99  ?  131 ASN A CG   1 
ATOM   1166 O OD1  . ASN A 1 86  ? 9.271   -2.473  71.645 1.00 49.71  ?  131 ASN A OD1  1 
ATOM   1167 N ND2  . ASN A 1 86  ? 10.985  -1.822  72.943 1.00 46.42  ?  131 ASN A ND2  1 
ATOM   1168 H H    . ASN A 1 86  ? 7.105   -1.335  70.665 1.00 45.47  ?  131 ASN A H    1 
ATOM   1169 H HA   . ASN A 1 86  ? 7.231   -0.985  72.759 1.00 41.02  ?  131 ASN A HA   1 
ATOM   1170 H HB2  . ASN A 1 86  ? 9.603   0.382   72.062 1.00 44.44  ?  131 ASN A HB2  1 
ATOM   1171 H HB3  . ASN A 1 86  ? 9.245   -0.067  73.544 1.00 44.44  ?  131 ASN A HB3  1 
ATOM   1172 H HD21 . ASN A 1 86  ? 11.400  -2.567  72.834 1.00 55.71  ?  131 ASN A HD21 1 
ATOM   1173 H HD22 . ASN A 1 86  ? 11.330  -1.205  73.433 1.00 55.71  ?  131 ASN A HD22 1 
ATOM   1174 N N    . GLY A 1 87  ? 6.030   1.490   71.865 1.00 28.48  ?  132 GLY A N    1 
ATOM   1175 C CA   . GLY A 1 87  ? 5.385   2.761   72.099 1.00 22.53  ?  132 GLY A CA   1 
ATOM   1176 C C    . GLY A 1 87  ? 4.039   2.607   72.794 1.00 22.05  ?  132 GLY A C    1 
ATOM   1177 O O    . GLY A 1 87  ? 3.539   1.511   73.033 1.00 20.38  ?  132 GLY A O    1 
ATOM   1178 H H    . GLY A 1 87  ? 5.714   1.063   71.189 1.00 34.18  ?  132 GLY A H    1 
ATOM   1179 H HA2  . GLY A 1 87  ? 5.955   3.316   72.654 1.00 27.03  ?  132 GLY A HA2  1 
ATOM   1180 H HA3  . GLY A 1 87  ? 5.244   3.213   71.253 1.00 27.03  ?  132 GLY A HA3  1 
ATOM   1181 N N    . GLY A 1 88  ? 3.457   3.752   73.119 1.00 18.94  ?  133 GLY A N    1 
ATOM   1182 C CA   . GLY A 1 88  ? 2.174   3.792   73.780 1.00 18.53  ?  133 GLY A CA   1 
ATOM   1183 C C    . GLY A 1 88  ? 1.517   5.135   73.568 1.00 17.99  ?  133 GLY A C    1 
ATOM   1184 O O    . GLY A 1 88  ? 1.988   5.962   72.785 1.00 16.14  ?  133 GLY A O    1 
ATOM   1185 H H    . GLY A 1 88  ? 3.794   4.528   72.964 1.00 22.73  ?  133 GLY A H    1 
ATOM   1186 H HA2  . GLY A 1 88  ? 1.597   3.100   73.422 1.00 22.23  ?  133 GLY A HA2  1 
ATOM   1187 H HA3  . GLY A 1 88  ? 2.288   3.645   74.732 1.00 22.23  ?  133 GLY A HA3  1 
ATOM   1188 N N    . LYS A 1 89  ? 0.418   5.353   74.283 1.00 16.91  ?  134 LYS A N    1 
ATOM   1189 C CA   . LYS A 1 89  ? -0.348  6.574   74.092 1.00 15.69  ?  134 LYS A CA   1 
ATOM   1190 C C    . LYS A 1 89  ? -1.137  6.910   75.345 1.00 16.76  ?  134 LYS A C    1 
ATOM   1191 O O    . LYS A 1 89  ? -1.626  6.014   76.039 1.00 16.08  ?  134 LYS A O    1 
ATOM   1192 C CB   . LYS A 1 89  ? -1.301  6.435   72.898 1.00 16.43  ?  134 LYS A CB   1 
ATOM   1193 C CG   . LYS A 1 89  ? -2.195  5.205   72.957 1.00 19.43  ?  134 LYS A CG   1 
ATOM   1194 C CD   . LYS A 1 89  ? -3.020  5.070   71.688 1.00 19.11  ?  134 LYS A CD   1 
ATOM   1195 C CE   . LYS A 1 89  ? -3.917  3.843   71.721 1.00 28.89  ?  134 LYS A CE   1 
ATOM   1196 N NZ   . LYS A 1 89  ? -4.850  3.805   70.563 1.00 30.96  1  134 LYS A NZ   1 
ATOM   1197 H H    . LYS A 1 89  ? 0.100   4.818   74.876 1.00 20.30  ?  134 LYS A H    1 
ATOM   1198 H HA   . LYS A 1 89  ? 0.260   7.308   73.910 1.00 18.83  ?  134 LYS A HA   1 
ATOM   1199 H HB2  . LYS A 1 89  ? -1.875  7.216   72.866 1.00 19.71  ?  134 LYS A HB2  1 
ATOM   1200 H HB3  . LYS A 1 89  ? -0.776  6.380   72.085 1.00 19.71  ?  134 LYS A HB3  1 
ATOM   1201 H HG2  . LYS A 1 89  ? -1.644  4.411   73.049 1.00 23.32  ?  134 LYS A HG2  1 
ATOM   1202 H HG3  . LYS A 1 89  ? -2.802  5.283   73.709 1.00 23.32  ?  134 LYS A HG3  1 
ATOM   1203 H HD2  . LYS A 1 89  ? -3.583  5.854   71.589 1.00 22.94  ?  134 LYS A HD2  1 
ATOM   1204 H HD3  . LYS A 1 89  ? -2.424  4.989   70.927 1.00 22.94  ?  134 LYS A HD3  1 
ATOM   1205 H HE2  . LYS A 1 89  ? -3.366  3.045   71.693 1.00 34.67  ?  134 LYS A HE2  1 
ATOM   1206 H HE3  . LYS A 1 89  ? -4.445  3.856   72.535 1.00 34.67  ?  134 LYS A HE3  1 
ATOM   1207 H HZ1  . LYS A 1 89  ? -5.361  3.078   70.608 1.00 37.15  ?  134 LYS A HZ1  1 
ATOM   1208 H HZ2  . LYS A 1 89  ? -5.371  4.526   70.569 1.00 37.15  ?  134 LYS A HZ2  1 
ATOM   1209 H HZ3  . LYS A 1 89  ? -4.389  3.788   69.802 1.00 37.15  ?  134 LYS A HZ3  1 
ATOM   1210 N N    . TRP A 1 90  ? -1.243  8.206   75.631 1.00 16.52  ?  135 TRP A N    1 
ATOM   1211 C CA   . TRP A 1 90  ? -2.237  8.697   76.570 1.00 16.37  ?  135 TRP A CA   1 
ATOM   1212 C C    . TRP A 1 90  ? -3.558  8.885   75.837 1.00 16.37  ?  135 TRP A C    1 
ATOM   1213 O O    . TRP A 1 90  ? -3.584  9.302   74.675 1.00 18.17  ?  135 TRP A O    1 
ATOM   1214 C CB   . TRP A 1 90  ? -1.793  10.020  77.206 1.00 17.54  ?  135 TRP A CB   1 
ATOM   1215 C CG   . TRP A 1 90  ? -0.829  9.860   78.350 1.00 17.42  ?  135 TRP A CG   1 
ATOM   1216 C CD1  . TRP A 1 90  ? 0.512   10.121  78.340 1.00 18.86  ?  135 TRP A CD1  1 
ATOM   1217 C CD2  . TRP A 1 90  ? -1.138  9.410   79.675 1.00 15.48  ?  135 TRP A CD2  1 
ATOM   1218 N NE1  . TRP A 1 90  ? 1.054   9.860   79.576 1.00 18.92  ?  135 TRP A NE1  1 
ATOM   1219 C CE2  . TRP A 1 90  ? 0.061   9.418   80.411 1.00 15.71  ?  135 TRP A CE2  1 
ATOM   1220 C CE3  . TRP A 1 90  ? -2.315  8.999   80.307 1.00 18.12  ?  135 TRP A CE3  1 
ATOM   1221 C CZ2  . TRP A 1 90  ? 0.119   9.029   81.746 1.00 16.85  ?  135 TRP A CZ2  1 
ATOM   1222 C CZ3  . TRP A 1 90  ? -2.256  8.614   81.633 1.00 16.02  ?  135 TRP A CZ3  1 
ATOM   1223 C CH2  . TRP A 1 90  ? -1.050  8.638   82.340 1.00 13.63  ?  135 TRP A CH2  1 
ATOM   1224 H H    . TRP A 1 90  ? -0.746  8.820   75.291 1.00 19.82  ?  135 TRP A H    1 
ATOM   1225 H HA   . TRP A 1 90  ? -2.367  8.045   77.276 1.00 19.65  ?  135 TRP A HA   1 
ATOM   1226 H HB2  . TRP A 1 90  ? -1.359  10.561  76.528 1.00 21.05  ?  135 TRP A HB2  1 
ATOM   1227 H HB3  . TRP A 1 90  ? -2.576  10.483  77.542 1.00 21.05  ?  135 TRP A HB3  1 
ATOM   1228 H HD1  . TRP A 1 90  ? 0.989   10.431  77.604 1.00 22.63  ?  135 TRP A HD1  1 
ATOM   1229 H HE1  . TRP A 1 90  ? 1.882   9.952   79.788 1.00 22.71  ?  135 TRP A HE1  1 
ATOM   1230 H HE3  . TRP A 1 90  ? -3.121  8.982   79.844 1.00 21.75  ?  135 TRP A HE3  1 
ATOM   1231 H HZ2  . TRP A 1 90  ? 0.919   9.044   82.220 1.00 20.22  ?  135 TRP A HZ2  1 
ATOM   1232 H HZ3  . TRP A 1 90  ? -3.032  8.339   82.064 1.00 19.22  ?  135 TRP A HZ3  1 
ATOM   1233 H HH2  . TRP A 1 90  ? -1.040  8.371   83.231 1.00 16.35  ?  135 TRP A HH2  1 
ATOM   1234 N N    . ILE A 1 91  ? -4.653  8.575   76.523 1.00 16.82  ?  136 ILE A N    1 
ATOM   1235 C CA   . ILE A 1 91  ? -5.992  8.571   75.947 1.00 18.93  ?  136 ILE A CA   1 
ATOM   1236 C C    . ILE A 1 91  ? -6.906  9.409   76.827 1.00 18.65  ?  136 ILE A C    1 
ATOM   1237 O O    . ILE A 1 91  ? -6.853  9.312   78.058 1.00 21.29  ?  136 ILE A O    1 
ATOM   1238 C CB   . ILE A 1 91  ? -6.546  7.136   75.830 1.00 22.43  ?  136 ILE A CB   1 
ATOM   1239 C CG1  . ILE A 1 91  ? -5.699  6.317   74.861 1.00 22.85  ?  136 ILE A CG1  1 
ATOM   1240 C CG2  . ILE A 1 91  ? -8.012  7.150   75.392 1.00 25.12  ?  136 ILE A CG2  1 
ATOM   1241 C CD1  . ILE A 1 91  ? -5.952  4.834   74.972 1.00 31.16  ?  136 ILE A CD1  1 
ATOM   1242 H H    . ILE A 1 91  ? -4.643  8.355   77.355 1.00 20.18  ?  136 ILE A H    1 
ATOM   1243 H HA   . ILE A 1 91  ? -5.967  8.967   75.062 1.00 22.72  ?  136 ILE A HA   1 
ATOM   1244 H HB   . ILE A 1 91  ? -6.495  6.719   76.704 1.00 26.91  ?  136 ILE A HB   1 
ATOM   1245 H HG12 . ILE A 1 91  ? -5.906  6.589   73.953 1.00 27.41  ?  136 ILE A HG12 1 
ATOM   1246 H HG13 . ILE A 1 91  ? -4.761  6.476   75.050 1.00 27.41  ?  136 ILE A HG13 1 
ATOM   1247 H HG21 . ILE A 1 91  ? -8.330  6.237   75.327 1.00 30.14  ?  136 ILE A HG21 1 
ATOM   1248 H HG22 . ILE A 1 91  ? -8.533  7.637   76.049 1.00 30.14  ?  136 ILE A HG22 1 
ATOM   1249 H HG23 . ILE A 1 91  ? -8.078  7.586   74.528 1.00 30.14  ?  136 ILE A HG23 1 
ATOM   1250 H HD11 . ILE A 1 91  ? -5.388  4.370   74.334 1.00 37.39  ?  136 ILE A HD11 1 
ATOM   1251 H HD12 . ILE A 1 91  ? -5.742  4.545   75.873 1.00 37.39  ?  136 ILE A HD12 1 
ATOM   1252 H HD13 . ILE A 1 91  ? -6.886  4.658   74.777 1.00 37.39  ?  136 ILE A HD13 1 
ATOM   1253 N N    . ILE A 1 92  ? -7.762  10.210  76.195 1.00 20.36  ?  137 ILE A N    1 
ATOM   1254 C CA   . ILE A 1 92  ? -8.806  10.956  76.887 1.00 21.90  ?  137 ILE A CA   1 
ATOM   1255 C C    . ILE A 1 92  ? -10.128 10.647  76.206 1.00 21.89  ?  137 ILE A C    1 
ATOM   1256 O O    . ILE A 1 92  ? -10.290 10.922  75.012 1.00 21.92  ?  137 ILE A O    1 
ATOM   1257 C CB   . ILE A 1 92  ? -8.560  12.474  76.869 1.00 21.90  ?  137 ILE A CB   1 
ATOM   1258 C CG1  . ILE A 1 92  ? -7.078  12.802  77.055 1.00 26.80  ?  137 ILE A CG1  1 
ATOM   1259 C CG2  . ILE A 1 92  ? -9.419  13.138  77.929 1.00 24.85  ?  137 ILE A CG2  1 
ATOM   1260 C CD1  . ILE A 1 92  ? -6.547  12.479  78.407 1.00 24.79  ?  137 ILE A CD1  1 
ATOM   1261 H H    . ILE A 1 92  ? -7.755  10.339  75.345 1.00 24.43  ?  137 ILE A H    1 
ATOM   1262 H HA   . ILE A 1 92  ? -8.858  10.663  77.810 1.00 26.28  ?  137 ILE A HA   1 
ATOM   1263 H HB   . ILE A 1 92  ? -8.836  12.813  76.003 1.00 26.28  ?  137 ILE A HB   1 
ATOM   1264 H HG12 . ILE A 1 92  ? -6.564  12.296  76.407 1.00 32.16  ?  137 ILE A HG12 1 
ATOM   1265 H HG13 . ILE A 1 92  ? -6.949  13.752  76.906 1.00 32.16  ?  137 ILE A HG13 1 
ATOM   1266 H HG21 . ILE A 1 92  ? -9.258  14.095  77.912 1.00 29.82  ?  137 ILE A HG21 1 
ATOM   1267 H HG22 . ILE A 1 92  ? -10.352 12.956  77.739 1.00 29.82  ?  137 ILE A HG22 1 
ATOM   1268 H HG23 . ILE A 1 92  ? -9.181  12.779  78.798 1.00 29.82  ?  137 ILE A HG23 1 
ATOM   1269 H HD11 . ILE A 1 92  ? -5.607  12.716  78.441 1.00 29.75  ?  137 ILE A HD11 1 
ATOM   1270 H HD12 . ILE A 1 92  ? -7.041  12.986  79.070 1.00 29.75  ?  137 ILE A HD12 1 
ATOM   1271 H HD13 . ILE A 1 92  ? -6.655  11.528  78.569 1.00 29.75  ?  137 ILE A HD13 1 
ATOM   1272 N N    . ARG A 1 93  ? -11.074 10.097  76.959 1.00 25.16  ?  138 ARG A N    1 
ATOM   1273 C CA   . ARG A 1 93  ? -12.427 9.897   76.463 1.00 25.50  ?  138 ARG A CA   1 
ATOM   1274 C C    . ARG A 1 93  ? -13.257 11.129  76.795 1.00 27.32  ?  138 ARG A C    1 
ATOM   1275 O O    . ARG A 1 93  ? -13.301 11.562  77.952 1.00 29.23  ?  138 ARG A O    1 
ATOM   1276 C CB   . ARG A 1 93  ? -13.051 8.642   77.074 1.00 27.72  ?  138 ARG A CB   1 
ATOM   1277 C CG   . ARG A 1 93  ? -12.359 7.359   76.656 1.00 28.66  ?  138 ARG A CG   1 
ATOM   1278 C CD   . ARG A 1 93  ? -12.893 6.160   77.416 1.00 35.36  ?  138 ARG A CD   1 
ATOM   1279 N NE   . ARG A 1 93  ? -12.228 4.925   77.009 1.00 38.61  ?  138 ARG A NE   1 
ATOM   1280 C CZ   . ARG A 1 93  ? -11.056 4.510   77.483 1.00 41.61  ?  138 ARG A CZ   1 
ATOM   1281 N NH1  . ARG A 1 93  ? -10.402 5.233   78.386 1.00 36.78  1  138 ARG A NH1  1 
ATOM   1282 N NH2  . ARG A 1 93  ? -10.535 3.369   77.051 1.00 46.69  ?  138 ARG A NH2  1 
ATOM   1283 H H    . ARG A 1 93  ? -10.954 9.829   77.767 1.00 30.20  ?  138 ARG A H    1 
ATOM   1284 H HA   . ARG A 1 93  ? -12.406 9.791   75.499 1.00 30.60  ?  138 ARG A HA   1 
ATOM   1285 H HB2  . ARG A 1 93  ? -13.000 8.706   78.041 1.00 33.27  ?  138 ARG A HB2  1 
ATOM   1286 H HB3  . ARG A 1 93  ? -13.978 8.585   76.796 1.00 33.27  ?  138 ARG A HB3  1 
ATOM   1287 H HG2  . ARG A 1 93  ? -12.509 7.210   75.709 1.00 34.39  ?  138 ARG A HG2  1 
ATOM   1288 H HG3  . ARG A 1 93  ? -11.409 7.435   76.837 1.00 34.39  ?  138 ARG A HG3  1 
ATOM   1289 H HD2  . ARG A 1 93  ? -12.739 6.290   78.365 1.00 42.43  ?  138 ARG A HD2  1 
ATOM   1290 H HD3  . ARG A 1 93  ? -13.842 6.067   77.239 1.00 42.43  ?  138 ARG A HD3  1 
ATOM   1291 H HE   . ARG A 1 93  ? -12.621 4.432   76.425 1.00 46.33  ?  138 ARG A HE   1 
ATOM   1292 H HH11 . ARG A 1 93  ? -10.736 5.973   78.669 1.00 44.14  ?  138 ARG A HH11 1 
ATOM   1293 H HH12 . ARG A 1 93  ? -9.644  4.960   78.688 1.00 44.14  ?  138 ARG A HH12 1 
ATOM   1294 H HH21 . ARG A 1 93  ? -10.955 2.898   76.466 1.00 56.03  ?  138 ARG A HH21 1 
ATOM   1295 H HH22 . ARG A 1 93  ? -9.777  3.100   77.355 1.00 56.03  ?  138 ARG A HH22 1 
ATOM   1296 N N    . LEU A 1 94  ? -13.901 11.695  75.780 1.00 26.03  ?  139 LEU A N    1 
ATOM   1297 C CA   . LEU A 1 94  ? -14.583 12.974  75.902 1.00 30.31  ?  139 LEU A CA   1 
ATOM   1298 C C    . LEU A 1 94  ? -16.058 12.822  75.568 1.00 31.35  ?  139 LEU A C    1 
ATOM   1299 O O    . LEU A 1 94  ? -16.424 12.112  74.626 1.00 31.58  ?  139 LEU A O    1 
ATOM   1300 C CB   . LEU A 1 94  ? -13.955 14.021  74.974 1.00 28.81  ?  139 LEU A CB   1 
ATOM   1301 C CG   . LEU A 1 94  ? -12.477 14.341  75.204 1.00 30.12  ?  139 LEU A CG   1 
ATOM   1302 C CD1  . LEU A 1 94  ? -11.966 15.302  74.138 1.00 33.18  ?  139 LEU A CD1  1 
ATOM   1303 C CD2  . LEU A 1 94  ? -12.259 14.922  76.591 1.00 34.01  ?  139 LEU A CD2  1 
ATOM   1304 H H    . LEU A 1 94  ? -13.957 11.349  74.995 1.00 31.24  ?  139 LEU A H    1 
ATOM   1305 H HA   . LEU A 1 94  ? -14.508 13.292  76.816 1.00 36.38  ?  139 LEU A HA   1 
ATOM   1306 H HB2  . LEU A 1 94  ? -14.042 13.707  74.060 1.00 34.57  ?  139 LEU A HB2  1 
ATOM   1307 H HB3  . LEU A 1 94  ? -14.448 14.851  75.076 1.00 34.57  ?  139 LEU A HB3  1 
ATOM   1308 H HG   . LEU A 1 94  ? -11.963 13.521  75.139 1.00 36.15  ?  139 LEU A HG   1 
ATOM   1309 H HD11 . LEU A 1 94  ? -11.029 15.489  74.305 1.00 39.81  ?  139 LEU A HD11 1 
ATOM   1310 H HD12 . LEU A 1 94  ? -12.072 14.890  73.266 1.00 39.81  ?  139 LEU A HD12 1 
ATOM   1311 H HD13 . LEU A 1 94  ? -12.481 16.123  74.181 1.00 39.81  ?  139 LEU A HD13 1 
ATOM   1312 H HD21 . LEU A 1 94  ? -11.315 15.114  76.708 1.00 40.81  ?  139 LEU A HD21 1 
ATOM   1313 H HD22 . LEU A 1 94  ? -12.776 15.738  76.676 1.00 40.81  ?  139 LEU A HD22 1 
ATOM   1314 H HD23 . LEU A 1 94  ? -12.549 14.275  77.253 1.00 40.81  ?  139 LEU A HD23 1 
ATOM   1315 N N    . ARG A 1 95  ? -16.901 13.492  76.349 1.00 36.62  ?  140 ARG A N    1 
ATOM   1316 C CA   . ARG A 1 95  ? -18.300 13.625  75.983 1.00 37.78  ?  140 ARG A CA   1 
ATOM   1317 C C    . ARG A 1 95  ? -18.417 14.438  74.698 1.00 36.02  ?  140 ARG A C    1 
ATOM   1318 O O    . ARG A 1 95  ? -17.532 15.222  74.345 1.00 38.29  ?  140 ARG A O    1 
ATOM   1319 C CB   . ARG A 1 95  ? -19.089 14.292  77.111 1.00 41.46  ?  140 ARG A CB   1 
ATOM   1320 C CG   . ARG A 1 95  ? -18.567 15.668  77.508 1.00 49.56  ?  140 ARG A CG   1 
ATOM   1321 C CD   . ARG A 1 95  ? -19.436 16.316  78.578 1.00 61.47  ?  140 ARG A CD   1 
ATOM   1322 N NE   . ARG A 1 95  ? -19.321 15.648  79.873 1.00 69.70  ?  140 ARG A NE   1 
ATOM   1323 C CZ   . ARG A 1 95  ? -18.439 15.972  80.815 1.00 69.68  ?  140 ARG A CZ   1 
ATOM   1324 N NH1  . ARG A 1 95  ? -17.575 16.961  80.621 1.00 69.07  1  140 ARG A NH1  1 
ATOM   1325 N NH2  . ARG A 1 95  ? -18.419 15.304  81.961 1.00 71.85  ?  140 ARG A NH2  1 
ATOM   1326 H H    . ARG A 1 95  ? -16.687 13.875  77.089 1.00 43.94  ?  140 ARG A H    1 
ATOM   1327 H HA   . ARG A 1 95  ? -18.677 12.745  75.825 1.00 45.34  ?  140 ARG A HA   1 
ATOM   1328 H HB2  . ARG A 1 95  ? -20.011 14.397  76.827 1.00 49.75  ?  140 ARG A HB2  1 
ATOM   1329 H HB3  . ARG A 1 95  ? -19.051 13.724  77.897 1.00 49.75  ?  140 ARG A HB3  1 
ATOM   1330 H HG2  . ARG A 1 95  ? -17.668 15.578  77.862 1.00 59.47  ?  140 ARG A HG2  1 
ATOM   1331 H HG3  . ARG A 1 95  ? -18.564 16.245  76.729 1.00 59.47  ?  140 ARG A HG3  1 
ATOM   1332 H HD2  . ARG A 1 95  ? -19.163 17.240  78.690 1.00 73.77  ?  140 ARG A HD2  1 
ATOM   1333 H HD3  . ARG A 1 95  ? -20.365 16.275  78.299 1.00 73.77  ?  140 ARG A HD3  1 
ATOM   1334 H HE   . ARG A 1 95  ? -19.862 15.000  80.038 1.00 83.63  ?  140 ARG A HE   1 
ATOM   1335 H HH11 . ARG A 1 95  ? -17.582 17.399  79.881 1.00 82.88  ?  140 ARG A HH11 1 
ATOM   1336 H HH12 . ARG A 1 95  ? -17.008 17.163  81.234 1.00 82.88  ?  140 ARG A HH12 1 
ATOM   1337 H HH21 . ARG A 1 95  ? -18.976 14.662  82.093 1.00 86.22  ?  140 ARG A HH21 1 
ATOM   1338 H HH22 . ARG A 1 95  ? -17.849 15.511  82.570 1.00 86.22  ?  140 ARG A HH22 1 
ATOM   1339 N N    . LYS A 1 96  ? -19.521 14.235  73.986 1.00 38.19  ?  141 LYS A N    1 
ATOM   1340 C CA   . LYS A 1 96  ? -19.737 14.957  72.740 1.00 40.24  ?  141 LYS A CA   1 
ATOM   1341 C C    . LYS A 1 96  ? -19.712 16.458  72.990 1.00 40.25  ?  141 LYS A C    1 
ATOM   1342 O O    . LYS A 1 96  ? -20.221 16.945  74.003 1.00 42.84  ?  141 LYS A O    1 
ATOM   1343 C CB   . LYS A 1 96  ? -21.070 14.546  72.114 1.00 41.03  ?  141 LYS A CB   1 
ATOM   1344 C CG   . LYS A 1 96  ? -21.095 13.110  71.611 1.00 42.71  ?  141 LYS A CG   1 
ATOM   1345 C CD   . LYS A 1 96  ? -20.232 12.942  70.371 1.00 41.06  ?  141 LYS A CD   1 
ATOM   1346 C CE   . LYS A 1 96  ? -20.327 11.533  69.808 1.00 40.48  ?  141 LYS A CE   1 
ATOM   1347 N NZ   . LYS A 1 96  ? -19.588 11.405  68.522 1.00 37.66  1  141 LYS A NZ   1 
ATOM   1348 H H    . LYS A 1 96  ? -20.152 13.691  74.199 1.00 45.83  ?  141 LYS A H    1 
ATOM   1349 H HA   . LYS A 1 96  ? -19.027 14.740  72.116 1.00 48.28  ?  141 LYS A HA   1 
ATOM   1350 H HB2  . LYS A 1 96  ? -21.769 14.639  72.779 1.00 49.23  ?  141 LYS A HB2  1 
ATOM   1351 H HB3  . LYS A 1 96  ? -21.253 15.127  71.360 1.00 49.23  ?  141 LYS A HB3  1 
ATOM   1352 H HG2  . LYS A 1 96  ? -20.753 12.522  72.302 1.00 51.25  ?  141 LYS A HG2  1 
ATOM   1353 H HG3  . LYS A 1 96  ? -22.006 12.866  71.383 1.00 51.25  ?  141 LYS A HG3  1 
ATOM   1354 H HD2  . LYS A 1 96  ? -20.530 13.562  69.687 1.00 49.27  ?  141 LYS A HD2  1 
ATOM   1355 H HD3  . LYS A 1 96  ? -19.306 13.115  70.600 1.00 49.27  ?  141 LYS A HD3  1 
ATOM   1356 H HE2  . LYS A 1 96  ? -19.941 10.908  70.443 1.00 48.58  ?  141 LYS A HE2  1 
ATOM   1357 H HE3  . LYS A 1 96  ? -21.258 11.315  69.646 1.00 48.58  ?  141 LYS A HE3  1 
ATOM   1358 H HZ1  . LYS A 1 96  ? -19.657 10.574  68.213 1.00 45.19  ?  141 LYS A HZ1  1 
ATOM   1359 H HZ2  . LYS A 1 96  ? -19.926 11.967  67.920 1.00 45.19  ?  141 LYS A HZ2  1 
ATOM   1360 H HZ3  . LYS A 1 96  ? -18.727 11.597  68.646 1.00 45.19  ?  141 LYS A HZ3  1 
ATOM   1361 N N    . GLY A 1 97  ? -19.099 17.192  72.063 1.00 38.37  ?  142 GLY A N    1 
ATOM   1362 C CA   . GLY A 1 97  ? -19.023 18.637  72.135 1.00 39.44  ?  142 GLY A CA   1 
ATOM   1363 C C    . GLY A 1 97  ? -17.671 19.180  72.542 1.00 38.29  ?  142 GLY A C    1 
ATOM   1364 O O    . GLY A 1 97  ? -17.454 20.393  72.421 1.00 40.29  ?  142 GLY A O    1 
ATOM   1365 H H    . GLY A 1 97  ? -18.712 16.861  71.370 1.00 46.05  ?  142 GLY A H    1 
ATOM   1366 H HA2  . GLY A 1 97  ? -19.247 19.008  71.267 1.00 47.33  ?  142 GLY A HA2  1 
ATOM   1367 H HA3  . GLY A 1 97  ? -19.679 18.955  72.776 1.00 47.33  ?  142 GLY A HA3  1 
ATOM   1368 N N    . LEU A 1 98  ? -16.756 18.335  73.018 1.00 35.57  ?  143 LEU A N    1 
ATOM   1369 C CA   . LEU A 1 98  ? -15.440 18.780  73.454 1.00 34.17  ?  143 LEU A CA   1 
ATOM   1370 C C    . LEU A 1 98  ? -14.334 18.463  72.456 1.00 32.50  ?  143 LEU A C    1 
ATOM   1371 O O    . LEU A 1 98  ? -13.211 18.948  72.630 1.00 33.44  ?  143 LEU A O    1 
ATOM   1372 C CB   . LEU A 1 98  ? -15.081 18.136  74.799 1.00 33.80  ?  143 LEU A CB   1 
ATOM   1373 C CG   . LEU A 1 98  ? -16.057 18.328  75.960 1.00 35.75  ?  143 LEU A CG   1 
ATOM   1374 C CD1  . LEU A 1 98  ? -15.536 17.608  77.193 1.00 36.92  ?  143 LEU A CD1  1 
ATOM   1375 C CD2  . LEU A 1 98  ? -16.275 19.800  76.249 1.00 33.29  ?  143 LEU A CD2  1 
ATOM   1376 H H    . LEU A 1 98  ? -16.880 17.487  73.097 1.00 42.68  ?  143 LEU A H    1 
ATOM   1377 H HA   . LEU A 1 98  ? -15.460 19.741  73.580 1.00 41.00  ?  143 LEU A HA   1 
ATOM   1378 H HB2  . LEU A 1 98  ? -14.992 17.180  74.659 1.00 40.56  ?  143 LEU A HB2  1 
ATOM   1379 H HB3  . LEU A 1 98  ? -14.227 18.495  75.085 1.00 40.56  ?  143 LEU A HB3  1 
ATOM   1380 H HG   . LEU A 1 98  ? -16.913 17.938  75.722 1.00 42.90  ?  143 LEU A HG   1 
ATOM   1381 H HD11 . LEU A 1 98  ? -16.163 17.737  77.922 1.00 44.30  ?  143 LEU A HD11 1 
ATOM   1382 H HD12 . LEU A 1 98  ? -15.449 16.663  76.993 1.00 44.30  ?  143 LEU A HD12 1 
ATOM   1383 H HD13 . LEU A 1 98  ? -14.671 17.977  77.431 1.00 44.30  ?  143 LEU A HD13 1 
ATOM   1384 H HD21 . LEU A 1 98  ? -16.897 19.888  76.988 1.00 39.94  ?  143 LEU A HD21 1 
ATOM   1385 H HD22 . LEU A 1 98  ? -15.424 20.204  76.482 1.00 39.94  ?  143 LEU A HD22 1 
ATOM   1386 H HD23 . LEU A 1 98  ? -16.638 20.226  75.457 1.00 39.94  ?  143 LEU A HD23 1 
ATOM   1387 N N    . ALA A 1 99  ? -14.622 17.677  71.417 1.00 29.95  ?  144 ALA A N    1 
ATOM   1388 C CA   . ALA A 1 99  ? -13.559 17.148  70.568 1.00 31.61  ?  144 ALA A CA   1 
ATOM   1389 C C    . ALA A 1 99  ? -12.877 18.247  69.762 1.00 29.55  ?  144 ALA A C    1 
ATOM   1390 O O    . ALA A 1 99  ? -11.650 18.240  69.612 1.00 27.58  ?  144 ALA A O    1 
ATOM   1391 C CB   . ALA A 1 99  ? -14.123 16.076  69.636 1.00 34.33  ?  144 ALA A CB   1 
ATOM   1392 H H    . ALA A 1 99  ? -15.416 17.439  71.186 1.00 35.94  ?  144 ALA A H    1 
ATOM   1393 H HA   . ALA A 1 99  ? -12.888 16.730  71.130 1.00 37.93  ?  144 ALA A HA   1 
ATOM   1394 H HB1  . ALA A 1 99  ? -13.406 15.734  69.079 1.00 41.19  ?  144 ALA A HB1  1 
ATOM   1395 H HB2  . ALA A 1 99  ? -14.498 15.359  70.171 1.00 41.19  ?  144 ALA A HB2  1 
ATOM   1396 H HB3  . ALA A 1 99  ? -14.813 16.471  69.082 1.00 41.19  ?  144 ALA A HB3  1 
ATOM   1397 N N    . SER A 1 100 ? -13.648 19.194  69.229 1.00 32.57  ?  145 SER A N    1 
ATOM   1398 C CA   . SER A 1 100 ? -13.063 20.227  68.379 1.00 29.93  ?  145 SER A CA   1 
ATOM   1399 C C    . SER A 1 100 ? -12.073 21.088  69.154 1.00 30.58  ?  145 SER A C    1 
ATOM   1400 O O    . SER A 1 100 ? -10.948 21.324  68.696 1.00 27.43  ?  145 SER A O    1 
ATOM   1401 C CB   . SER A 1 100 ? -14.170 21.087  67.769 1.00 34.18  ?  145 SER A CB   1 
ATOM   1402 O OG   . SER A 1 100 ? -14.900 20.351  66.801 1.00 33.15  ?  145 SER A OG   1 
ATOM   1403 H H    . SER A 1 100 ? -14.498 19.259  69.342 1.00 39.08  ?  145 SER A H    1 
ATOM   1404 H HA   . SER A 1 100 ? -12.582 19.801  67.652 1.00 35.91  ?  145 SER A HA   1 
ATOM   1405 H HB2  . SER A 1 100 ? -14.774 21.370  68.473 1.00 41.02  ?  145 SER A HB2  1 
ATOM   1406 H HB3  . SER A 1 100 ? -13.770 21.861  67.342 1.00 41.02  ?  145 SER A HB3  1 
ATOM   1407 H HG   . SER A 1 100 ? -15.506 20.831  66.472 1.00 39.78  ?  145 SER A HG   1 
ATOM   1408 N N    . ARG A 1 101 ? -12.473 21.569  70.333 1.00 30.62  ?  146 ARG A N    1 
ATOM   1409 C CA   . ARG A 1 101 ? -11.588 22.426  71.115 1.00 30.34  ?  146 ARG A CA   1 
ATOM   1410 C C    . ARG A 1 101 ? -10.378 21.654  71.624 1.00 26.78  ?  146 ARG A C    1 
ATOM   1411 O O    . ARG A 1 101 ? -9.248  22.152  71.567 1.00 23.57  ?  146 ARG A O    1 
ATOM   1412 C CB   . ARG A 1 101 ? -12.351 23.050  72.283 1.00 30.72  ?  146 ARG A CB   1 
ATOM   1413 C CG   . ARG A 1 101 ? -11.538 24.074  73.070 1.00 37.54  ?  146 ARG A CG   1 
ATOM   1414 C CD   . ARG A 1 101 ? -12.419 24.943  73.966 1.00 45.33  ?  146 ARG A CD   1 
ATOM   1415 N NE   . ARG A 1 101 ? -12.806 24.269  75.204 1.00 56.14  ?  146 ARG A NE   1 
ATOM   1416 C CZ   . ARG A 1 101 ? -12.142 24.358  76.355 1.00 50.08  ?  146 ARG A CZ   1 
ATOM   1417 N NH1  . ARG A 1 101 ? -11.041 25.094  76.446 1.00 43.31  1  146 ARG A NH1  1 
ATOM   1418 N NH2  . ARG A 1 101 ? -12.581 23.707  77.423 1.00 48.37  ?  146 ARG A NH2  1 
ATOM   1419 H H    . ARG A 1 101 ? -13.238 21.416  70.695 1.00 36.74  ?  146 ARG A H    1 
ATOM   1420 H HA   . ARG A 1 101 ? -11.266 23.146  70.549 1.00 36.41  ?  146 ARG A HA   1 
ATOM   1421 H HB2  . ARG A 1 101 ? -13.139 23.499  71.937 1.00 36.86  ?  146 ARG A HB2  1 
ATOM   1422 H HB3  . ARG A 1 101 ? -12.616 22.346  72.895 1.00 36.86  ?  146 ARG A HB3  1 
ATOM   1423 H HG2  . ARG A 1 101 ? -10.901 23.608  73.634 1.00 45.04  ?  146 ARG A HG2  1 
ATOM   1424 H HG3  . ARG A 1 101 ? -11.072 24.655  72.450 1.00 45.04  ?  146 ARG A HG3  1 
ATOM   1425 H HD2  . ARG A 1 101 ? -11.932 25.748  74.202 1.00 54.39  ?  146 ARG A HD2  1 
ATOM   1426 H HD3  . ARG A 1 101 ? -13.228 25.174  73.484 1.00 54.39  ?  146 ARG A HD3  1 
ATOM   1427 H HE   . ARG A 1 101 ? -13.513 23.780  75.188 1.00 67.36  ?  146 ARG A HE   1 
ATOM   1428 H HH11 . ARG A 1 101 ? -10.749 25.520  75.758 1.00 51.97  ?  146 ARG A HH11 1 
ATOM   1429 H HH12 . ARG A 1 101 ? -10.618 25.145  77.194 1.00 51.97  ?  146 ARG A HH12 1 
ATOM   1430 H HH21 . ARG A 1 101 ? -13.294 23.227  77.372 1.00 58.05  ?  146 ARG A HH21 1 
ATOM   1431 H HH22 . ARG A 1 101 ? -12.153 23.762  78.167 1.00 58.05  ?  146 ARG A HH22 1 
ATOM   1432 N N    . CYS A 1 102 ? -10.592 20.438  72.128 1.00 25.91  ?  147 CYS A N    1 
ATOM   1433 C CA   . CYS A 1 102 ? -9.481  19.652  72.652 1.00 25.22  ?  147 CYS A CA   1 
ATOM   1434 C C    . CYS A 1 102 ? -8.487  19.302  71.552 1.00 21.90  ?  147 CYS A C    1 
ATOM   1435 O O    . CYS A 1 102 ? -7.271  19.419  71.743 1.00 23.55  ?  147 CYS A O    1 
ATOM   1436 C CB   . CYS A 1 102 ? -10.007 18.383  73.323 1.00 29.60  ?  147 CYS A CB   1 
ATOM   1437 S SG   . CYS A 1 102 ? -10.952 18.671  74.841 1.00 38.17  ?  147 CYS A SG   1 
ATOM   1438 H H    . CYS A 1 102 ? -11.360 20.053  72.178 1.00 31.09  ?  147 CYS A H    1 
ATOM   1439 H HA   . CYS A 1 102 ? -9.013  20.174  73.323 1.00 30.27  ?  147 CYS A HA   1 
ATOM   1440 H HB2  . CYS A 1 102 ? -10.587 17.920  72.699 1.00 35.51  ?  147 CYS A HB2  1 
ATOM   1441 H HB3  . CYS A 1 102 ? -9.252  17.816  73.549 1.00 35.51  ?  147 CYS A HB3  1 
ATOM   1442 H HG   . CYS A 1 102 ? -11.903 19.356  74.585 1.00 45.81  ?  147 CYS A HG   1 
ATOM   1443 N N    . TRP A 1 103 ? -8.987  18.868  70.393 1.00 21.66  ?  148 TRP A N    1 
ATOM   1444 C CA   . TRP A 1 103 ? -8.107  18.537  69.276 1.00 23.46  ?  148 TRP A CA   1 
ATOM   1445 C C    . TRP A 1 103 ? -7.237  19.729  68.900 1.00 22.30  ?  148 TRP A C    1 
ATOM   1446 O O    . TRP A 1 103 ? -6.026  19.594  68.701 1.00 19.94  ?  148 TRP A O    1 
ATOM   1447 C CB   . TRP A 1 103 ? -8.944  18.079  68.084 1.00 20.64  ?  148 TRP A CB   1 
ATOM   1448 C CG   . TRP A 1 103 ? -8.162  17.810  66.839 1.00 22.20  ?  148 TRP A CG   1 
ATOM   1449 C CD1  . TRP A 1 103 ? -8.280  18.455  65.643 1.00 20.13  ?  148 TRP A CD1  1 
ATOM   1450 C CD2  . TRP A 1 103 ? -7.145  16.818  66.662 1.00 17.82  ?  148 TRP A CD2  1 
ATOM   1451 N NE1  . TRP A 1 103 ? -7.404  17.922  64.730 1.00 21.37  ?  148 TRP A NE1  1 
ATOM   1452 C CE2  . TRP A 1 103 ? -6.694  16.917  65.330 1.00 19.53  ?  148 TRP A CE2  1 
ATOM   1453 C CE3  . TRP A 1 103 ? -6.575  15.853  67.497 1.00 22.44  ?  148 TRP A CE3  1 
ATOM   1454 C CZ2  . TRP A 1 103 ? -5.699  16.088  64.816 1.00 21.36  ?  148 TRP A CZ2  1 
ATOM   1455 C CZ3  . TRP A 1 103 ? -5.587  15.028  66.984 1.00 15.98  ?  148 TRP A CZ3  1 
ATOM   1456 C CH2  . TRP A 1 103 ? -5.156  15.153  65.658 1.00 15.86  ?  148 TRP A CH2  1 
ATOM   1457 H H    . TRP A 1 103 ? -9.824  18.759  70.230 1.00 25.99  ?  148 TRP A H    1 
ATOM   1458 H HA   . TRP A 1 103 ? -7.524  17.807  69.536 1.00 28.15  ?  148 TRP A HA   1 
ATOM   1459 H HB2  . TRP A 1 103 ? -9.404  17.259  68.325 1.00 24.77  ?  148 TRP A HB2  1 
ATOM   1460 H HB3  . TRP A 1 103 ? -9.594  18.769  67.878 1.00 24.77  ?  148 TRP A HB3  1 
ATOM   1461 H HD1  . TRP A 1 103 ? -8.873  19.150  65.469 1.00 24.15  ?  148 TRP A HD1  1 
ATOM   1462 H HE1  . TRP A 1 103 ? -7.312  18.182  63.915 1.00 25.65  ?  148 TRP A HE1  1 
ATOM   1463 H HE3  . TRP A 1 103 ? -6.857  15.762  68.379 1.00 26.93  ?  148 TRP A HE3  1 
ATOM   1464 H HZ2  . TRP A 1 103 ? -5.410  16.170  63.936 1.00 25.63  ?  148 TRP A HZ2  1 
ATOM   1465 H HZ3  . TRP A 1 103 ? -5.199  14.384  67.531 1.00 19.17  ?  148 TRP A HZ3  1 
ATOM   1466 H HH2  . TRP A 1 103 ? -4.489  14.588  65.341 1.00 19.03  ?  148 TRP A HH2  1 
ATOM   1467 N N    . GLU A 1 104 ? -7.842  20.912  68.814 1.00 21.36  ?  149 GLU A N    1 
ATOM   1468 C CA   . GLU A 1 104 ? -7.085  22.109  68.467 1.00 25.18  ?  149 GLU A CA   1 
ATOM   1469 C C    . GLU A 1 104 ? -5.993  22.384  69.494 1.00 23.52  ?  149 GLU A C    1 
ATOM   1470 O O    . GLU A 1 104 ? -4.829  22.597  69.139 1.00 22.76  ?  149 GLU A O    1 
ATOM   1471 C CB   . GLU A 1 104 ? -8.031  23.304  68.352 1.00 27.25  ?  149 GLU A CB   1 
ATOM   1472 C CG   . GLU A 1 104 ? -7.379  24.559  67.794 1.00 27.09  ?  149 GLU A CG   1 
ATOM   1473 C CD   . GLU A 1 104 ? -8.365  25.700  67.634 1.00 33.81  ?  149 GLU A CD   1 
ATOM   1474 O OE1  . GLU A 1 104 ? -8.458  26.545  68.550 1.00 34.86  ?  149 GLU A OE1  1 
ATOM   1475 O OE2  . GLU A 1 104 ? -9.056  25.745  66.596 1.00 35.86  -1 149 GLU A OE2  1 
ATOM   1476 H H    . GLU A 1 104 ? -8.681  21.047  68.950 1.00 25.64  ?  149 GLU A H    1 
ATOM   1477 H HA   . GLU A 1 104 ? -6.660  21.977  67.605 1.00 30.21  ?  149 GLU A HA   1 
ATOM   1478 H HB2  . GLU A 1 104 ? -8.764  23.066  67.764 1.00 32.71  ?  149 GLU A HB2  1 
ATOM   1479 H HB3  . GLU A 1 104 ? -8.374  23.517  69.234 1.00 32.71  ?  149 GLU A HB3  1 
ATOM   1480 H HG2  . GLU A 1 104 ? -6.678  24.848  68.400 1.00 32.51  ?  149 GLU A HG2  1 
ATOM   1481 H HG3  . GLU A 1 104 ? -7.004  24.360  66.922 1.00 32.51  ?  149 GLU A HG3  1 
ATOM   1482 N N    . ASN A 1 105 ? -6.353  22.384  70.780 1.00 23.41  ?  150 ASN A N    1 
ATOM   1483 C CA   . ASN A 1 105 ? -5.373  22.670  71.823 1.00 20.90  ?  150 ASN A CA   1 
ATOM   1484 C C    . ASN A 1 105 ? -4.260  21.632  71.836 1.00 20.55  ?  150 ASN A C    1 
ATOM   1485 O O    . ASN A 1 105 ? -3.090  21.964  72.071 1.00 17.33  ?  150 ASN A O    1 
ATOM   1486 C CB   . ASN A 1 105 ? -6.063  22.729  73.185 1.00 22.50  ?  150 ASN A CB   1 
ATOM   1487 C CG   . ASN A 1 105 ? -6.953  23.950  73.336 1.00 25.72  ?  150 ASN A CG   1 
ATOM   1488 O OD1  . ASN A 1 105 ? -6.641  25.024  72.823 1.00 29.03  ?  150 ASN A OD1  1 
ATOM   1489 N ND2  . ASN A 1 105 ? -8.067  23.789  74.039 1.00 27.86  ?  150 ASN A ND2  1 
ATOM   1490 H H    . ASN A 1 105 ? -7.148  22.224  71.068 1.00 28.09  ?  150 ASN A H    1 
ATOM   1491 H HA   . ASN A 1 105 ? -4.973  23.537  71.652 1.00 25.08  ?  150 ASN A HA   1 
ATOM   1492 H HB2  . ASN A 1 105 ? -6.616  21.939  73.293 1.00 27.00  ?  150 ASN A HB2  1 
ATOM   1493 H HB3  . ASN A 1 105 ? -5.388  22.760  73.880 1.00 27.00  ?  150 ASN A HB3  1 
ATOM   1494 H HD21 . ASN A 1 105 ? -8.603  24.452  74.153 1.00 33.43  ?  150 ASN A HD21 1 
ATOM   1495 H HD22 . ASN A 1 105 ? -8.253  23.022  74.381 1.00 33.43  ?  150 ASN A HD22 1 
ATOM   1496 N N    . LEU A 1 106 ? -4.601  20.366  71.595 1.00 21.79  ?  151 LEU A N    1 
ATOM   1497 C CA   . LEU A 1 106 ? -3.591  19.316  71.619 1.00 19.07  ?  151 LEU A CA   1 
ATOM   1498 C C    . LEU A 1 106 ? -2.562  19.521  70.515 1.00 16.87  ?  151 LEU A C    1 
ATOM   1499 O O    . LEU A 1 106 ? -1.352  19.520  70.771 1.00 18.09  ?  151 LEU A O    1 
ATOM   1500 C CB   . LEU A 1 106 ? -4.256  17.945  71.485 1.00 20.02  ?  151 LEU A CB   1 
ATOM   1501 C CG   . LEU A 1 106 ? -3.312  16.748  71.367 1.00 16.51  ?  151 LEU A CG   1 
ATOM   1502 C CD1  . LEU A 1 106 ? -2.348  16.693  72.537 1.00 19.60  ?  151 LEU A CD1  1 
ATOM   1503 C CD2  . LEU A 1 106 ? -4.110  15.454  71.275 1.00 20.05  ?  151 LEU A CD2  1 
ATOM   1504 H H    . LEU A 1 106 ? -5.398  20.095  71.417 1.00 26.15  ?  151 LEU A H    1 
ATOM   1505 H HA   . LEU A 1 106 ? -3.127  19.343  72.471 1.00 22.88  ?  151 LEU A HA   1 
ATOM   1506 H HB2  . LEU A 1 106 ? -4.812  17.798  72.266 1.00 24.02  ?  151 LEU A HB2  1 
ATOM   1507 H HB3  . LEU A 1 106 ? -4.813  17.952  70.690 1.00 24.02  ?  151 LEU A HB3  1 
ATOM   1508 H HG   . LEU A 1 106 ? -2.791  16.837  70.554 1.00 19.82  ?  151 LEU A HG   1 
ATOM   1509 H HD11 . LEU A 1 106 ? -1.766  15.924  72.431 1.00 23.52  ?  151 LEU A HD11 1 
ATOM   1510 H HD12 . LEU A 1 106 ? -1.822  17.508  72.551 1.00 23.52  ?  151 LEU A HD12 1 
ATOM   1511 H HD13 . LEU A 1 106 ? -2.855  16.613  73.360 1.00 23.52  ?  151 LEU A HD13 1 
ATOM   1512 H HD21 . LEU A 1 106 ? -3.494  14.708  71.202 1.00 24.06  ?  151 LEU A HD21 1 
ATOM   1513 H HD22 . LEU A 1 106 ? -4.651  15.359  72.075 1.00 24.06  ?  151 LEU A HD22 1 
ATOM   1514 H HD23 . LEU A 1 106 ? -4.681  15.490  70.492 1.00 24.06  ?  151 LEU A HD23 1 
ATOM   1515 N N    . ILE A 1 107 ? -3.025  19.699  69.276 1.00 15.37  ?  152 ILE A N    1 
ATOM   1516 C CA   . ILE A 1 107 ? -2.101  19.759  68.147 1.00 17.84  ?  152 ILE A CA   1 
ATOM   1517 C C    . ILE A 1 107 ? -1.318  21.065  68.163 1.00 17.99  ?  152 ILE A C    1 
ATOM   1518 O O    . ILE A 1 107 ? -0.139  21.096  67.794 1.00 15.99  ?  152 ILE A O    1 
ATOM   1519 C CB   . ILE A 1 107 ? -2.852  19.557  66.817 1.00 16.45  ?  152 ILE A CB   1 
ATOM   1520 C CG1  . ILE A 1 107 ? -3.888  20.668  66.597 1.00 20.16  ?  152 ILE A CG1  1 
ATOM   1521 C CG2  . ILE A 1 107 ? -3.488  18.165  66.777 1.00 18.09  ?  152 ILE A CG2  1 
ATOM   1522 C CD1  . ILE A 1 107 ? -4.644  20.551  65.286 1.00 21.11  ?  152 ILE A CD1  1 
ATOM   1523 H H    . ILE A 1 107 ? -3.855  19.786  69.067 1.00 18.44  ?  152 ILE A H    1 
ATOM   1524 H HA   . ILE A 1 107 ? -1.462  19.034  68.234 1.00 21.41  ?  152 ILE A HA   1 
ATOM   1525 H HB   . ILE A 1 107 ? -2.203  19.609  66.098 1.00 19.75  ?  152 ILE A HB   1 
ATOM   1526 H HG12 . ILE A 1 107 ? -4.537  20.636  67.317 1.00 24.19  ?  152 ILE A HG12 1 
ATOM   1527 H HG13 . ILE A 1 107 ? -3.434  21.524  66.603 1.00 24.19  ?  152 ILE A HG13 1 
ATOM   1528 H HG21 . ILE A 1 107 ? -3.955  18.056  65.935 1.00 21.71  ?  152 ILE A HG21 1 
ATOM   1529 H HG22 . ILE A 1 107 ? -2.789  17.497  66.858 1.00 21.71  ?  152 ILE A HG22 1 
ATOM   1530 H HG23 . ILE A 1 107 ? -4.112  18.082  67.515 1.00 21.71  ?  152 ILE A HG23 1 
ATOM   1531 H HD11 . ILE A 1 107 ? -5.276  21.284  65.221 1.00 25.33  ?  152 ILE A HD11 1 
ATOM   1532 H HD12 . ILE A 1 107 ? -4.011  20.594  64.553 1.00 25.33  ?  152 ILE A HD12 1 
ATOM   1533 H HD13 . ILE A 1 107 ? -5.116  19.704  65.268 1.00 25.33  ?  152 ILE A HD13 1 
ATOM   1534 N N    . LEU A 1 108 ? -1.946  22.161  68.595 1.00 18.09  ?  153 LEU A N    1 
ATOM   1535 C CA   . LEU A 1 108 ? -1.193  23.397  68.777 1.00 17.16  ?  153 LEU A CA   1 
ATOM   1536 C C    . LEU A 1 108 ? -0.099  23.215  69.822 1.00 18.51  ?  153 LEU A C    1 
ATOM   1537 O O    . LEU A 1 108 ? 1.000   23.764  69.685 1.00 19.31  ?  153 LEU A O    1 
ATOM   1538 C CB   . LEU A 1 108 ? -2.133  24.539  69.167 1.00 19.91  ?  153 LEU A CB   1 
ATOM   1539 C CG   . LEU A 1 108 ? -3.081  25.043  68.075 1.00 21.83  ?  153 LEU A CG   1 
ATOM   1540 C CD1  . LEU A 1 108 ? -4.005  26.115  68.634 1.00 24.89  ?  153 LEU A CD1  1 
ATOM   1541 C CD2  . LEU A 1 108 ? -2.316  25.583  66.868 1.00 20.31  ?  153 LEU A CD2  1 
ATOM   1542 H H    . LEU A 1 108 ? -2.784  22.213  68.783 1.00 21.70  ?  153 LEU A H    1 
ATOM   1543 H HA   . LEU A 1 108 ? -0.767  23.633  67.938 1.00 20.59  ?  153 LEU A HA   1 
ATOM   1544 H HB2  . LEU A 1 108 ? -2.681  24.241  69.910 1.00 23.89  ?  153 LEU A HB2  1 
ATOM   1545 H HB3  . LEU A 1 108 ? -1.592  25.294  69.450 1.00 23.89  ?  153 LEU A HB3  1 
ATOM   1546 H HG   . LEU A 1 108 ? -3.631  24.304  67.772 1.00 26.20  ?  153 LEU A HG   1 
ATOM   1547 H HD11 . LEU A 1 108 ? -4.596  26.421  67.928 1.00 29.86  ?  153 LEU A HD11 1 
ATOM   1548 H HD12 . LEU A 1 108 ? -4.524  25.736  69.360 1.00 29.86  ?  153 LEU A HD12 1 
ATOM   1549 H HD13 . LEU A 1 108 ? -3.469  26.855  68.960 1.00 29.86  ?  153 LEU A HD13 1 
ATOM   1550 H HD21 . LEU A 1 108 ? -2.952  25.890  66.203 1.00 24.38  ?  153 LEU A HD21 1 
ATOM   1551 H HD22 . LEU A 1 108 ? -1.754  26.320  67.154 1.00 24.38  ?  153 LEU A HD22 1 
ATOM   1552 H HD23 . LEU A 1 108 ? -1.768  24.873  66.499 1.00 24.38  ?  153 LEU A HD23 1 
ATOM   1553 N N    . ALA A 1 109 ? -0.376  22.429  70.867 1.00 18.49  ?  154 ALA A N    1 
ATOM   1554 C CA   . ALA A 1 109 ? 0.637   22.158  71.882 1.00 18.09  ?  154 ALA A CA   1 
ATOM   1555 C C    . ALA A 1 109 ? 1.726   21.243  71.339 1.00 16.87  ?  154 ALA A C    1 
ATOM   1556 O O    . ALA A 1 109 ? 2.914   21.445  71.619 1.00 17.72  ?  154 ALA A O    1 
ATOM   1557 C CB   . ALA A 1 109 ? -0.012  21.540  73.121 1.00 22.12  ?  154 ALA A CB   1 
ATOM   1558 H H    . ALA A 1 109 ? -1.133  22.047  71.007 1.00 22.19  ?  154 ALA A H    1 
ATOM   1559 H HA   . ALA A 1 109 ? 1.052   22.994  72.146 1.00 21.71  ?  154 ALA A HA   1 
ATOM   1560 H HB1  . ALA A 1 109 ? 0.675   21.367  73.784 1.00 26.54  ?  154 ALA A HB1  1 
ATOM   1561 H HB2  . ALA A 1 109 ? -0.667  22.160  73.477 1.00 26.54  ?  154 ALA A HB2  1 
ATOM   1562 H HB3  . ALA A 1 109 ? -0.446  20.709  72.869 1.00 26.54  ?  154 ALA A HB3  1 
ATOM   1563 N N    . MET A 1 110 ? 1.338   20.228  70.564 1.00 19.41  ?  155 MET A N    1 
ATOM   1564 C CA   . MET A 1 110 ? 2.315   19.334  69.951 1.00 18.06  ?  155 MET A CA   1 
ATOM   1565 C C    . MET A 1 110 ? 3.197   20.085  68.955 1.00 20.14  ?  155 MET A C    1 
ATOM   1566 O O    . MET A 1 110 ? 4.429   19.978  68.992 1.00 18.55  ?  155 MET A O    1 
ATOM   1567 C CB   . MET A 1 110 ? 1.588   18.176  69.268 1.00 14.66  ?  155 MET A CB   1 
ATOM   1568 C CG   . MET A 1 110 ? 2.498   17.164  68.583 1.00 17.11  ?  155 MET A CG   1 
ATOM   1569 S SD   . MET A 1 110 ? 1.588   15.728  67.982 1.00 15.98  ?  155 MET A SD   1 
ATOM   1570 C CE   . MET A 1 110 ? 0.480   16.467  66.782 1.00 17.44  ?  155 MET A CE   1 
ATOM   1571 H H    . MET A 1 110 ? 0.520   20.039  70.379 1.00 23.29  ?  155 MET A H    1 
ATOM   1572 H HA   . MET A 1 110 ? 2.878   18.961  70.647 1.00 21.68  ?  155 MET A HA   1 
ATOM   1573 H HB2  . MET A 1 110 ? 1.070   17.699  69.935 1.00 17.59  ?  155 MET A HB2  1 
ATOM   1574 H HB3  . MET A 1 110 ? 0.994   18.539  68.593 1.00 17.59  ?  155 MET A HB3  1 
ATOM   1575 H HG2  . MET A 1 110 ? 2.930   17.587  67.824 1.00 20.53  ?  155 MET A HG2  1 
ATOM   1576 H HG3  . MET A 1 110 ? 3.164   16.856  69.217 1.00 20.53  ?  155 MET A HG3  1 
ATOM   1577 H HE1  . MET A 1 110 ? -0.069  15.771  66.388 1.00 20.92  ?  155 MET A HE1  1 
ATOM   1578 H HE2  . MET A 1 110 ? -0.083  17.117  67.232 1.00 20.92  ?  155 MET A HE2  1 
ATOM   1579 H HE3  . MET A 1 110 ? 1.006   16.904  66.094 1.00 20.92  ?  155 MET A HE3  1 
ATOM   1580 N N    . LEU A 1 111 ? 2.581   20.865  68.062 1.00 16.45  ?  156 LEU A N    1 
ATOM   1581 C CA   . LEU A 1 111 ? 3.355   21.583  67.052 1.00 20.23  ?  156 LEU A CA   1 
ATOM   1582 C C    . LEU A 1 111 ? 4.272   22.621  67.687 1.00 21.40  ?  156 LEU A C    1 
ATOM   1583 O O    . LEU A 1 111 ? 5.385   22.857  67.201 1.00 19.21  ?  156 LEU A O    1 
ATOM   1584 C CB   . LEU A 1 111 ? 2.418   22.247  66.043 1.00 20.98  ?  156 LEU A CB   1 
ATOM   1585 C CG   . LEU A 1 111 ? 1.578   21.317  65.163 1.00 23.80  ?  156 LEU A CG   1 
ATOM   1586 C CD1  . LEU A 1 111 ? 0.691   22.125  64.231 1.00 22.05  ?  156 LEU A CD1  1 
ATOM   1587 C CD2  . LEU A 1 111 ? 2.451   20.372  64.364 1.00 24.57  ?  156 LEU A CD2  1 
ATOM   1588 H H    . LEU A 1 111 ? 1.731   20.992  68.021 1.00 19.74  ?  156 LEU A H    1 
ATOM   1589 H HA   . LEU A 1 111 ? 3.910   20.949  66.572 1.00 24.28  ?  156 LEU A HA   1 
ATOM   1590 H HB2  . LEU A 1 111 ? 1.800   22.813  66.532 1.00 25.18  ?  156 LEU A HB2  1 
ATOM   1591 H HB3  . LEU A 1 111 ? 2.953   22.797  65.449 1.00 25.18  ?  156 LEU A HB3  1 
ATOM   1592 H HG   . LEU A 1 111 ? 1.002   20.781  65.731 1.00 28.56  ?  156 LEU A HG   1 
ATOM   1593 H HD11 . LEU A 1 111 ? 0.170   21.517  63.684 1.00 26.46  ?  156 LEU A HD11 1 
ATOM   1594 H HD12 . LEU A 1 111 ? 0.101   22.682  64.761 1.00 26.46  ?  156 LEU A HD12 1 
ATOM   1595 H HD13 . LEU A 1 111 ? 1.251   22.681  63.666 1.00 26.46  ?  156 LEU A HD13 1 
ATOM   1596 H HD21 . LEU A 1 111 ? 1.884   19.802  63.821 1.00 29.48  ?  156 LEU A HD21 1 
ATOM   1597 H HD22 . LEU A 1 111 ? 3.039   20.892  63.794 1.00 29.48  ?  156 LEU A HD22 1 
ATOM   1598 H HD23 . LEU A 1 111 ? 2.975   19.833  64.976 1.00 29.48  ?  156 LEU A HD23 1 
ATOM   1599 N N    . GLY A 1 112 ? 3.821   23.255  68.769 1.00 20.65  ?  157 GLY A N    1 
ATOM   1600 C CA   . GLY A 1 112 ? 4.613   24.226  69.489 1.00 21.77  ?  157 GLY A CA   1 
ATOM   1601 C C    . GLY A 1 112 ? 5.648   23.650  70.426 1.00 20.19  ?  157 GLY A C    1 
ATOM   1602 O O    . GLY A 1 112 ? 6.287   24.403  71.164 1.00 25.17  ?  157 GLY A O    1 
ATOM   1603 H H    . GLY A 1 112 ? 3.039   23.131  69.106 1.00 24.78  ?  157 GLY A H    1 
ATOM   1604 H HA2  . GLY A 1 112 ? 5.073   24.791  68.849 1.00 26.13  ?  157 GLY A HA2  1 
ATOM   1605 H HA3  . GLY A 1 112 ? 4.020   24.788  70.012 1.00 26.13  ?  157 GLY A HA3  1 
ATOM   1606 N N    . GLU A 1 113 ? 5.830   22.332  70.429 1.00 18.64  ?  158 GLU A N    1 
ATOM   1607 C CA   . GLU A 1 113 ? 6.856   21.687  71.247 1.00 22.39  ?  158 GLU A CA   1 
ATOM   1608 C C    . GLU A 1 113 ? 6.637   21.961  72.733 1.00 25.61  ?  158 GLU A C    1 
ATOM   1609 O O    . GLU A 1 113 ? 7.586   22.111  73.504 1.00 28.47  ?  158 GLU A O    1 
ATOM   1610 C CB   . GLU A 1 113 ? 8.256   22.124  70.812 1.00 25.68  ?  158 GLU A CB   1 
ATOM   1611 C CG   . GLU A 1 113 ? 8.639   21.639  69.425 1.00 27.15  ?  158 GLU A CG   1 
ATOM   1612 C CD   . GLU A 1 113 ? 8.642   20.124  69.321 1.00 29.34  ?  158 GLU A CD   1 
ATOM   1613 O OE1  . GLU A 1 113 ? 9.161   19.464  70.246 1.00 29.99  ?  158 GLU A OE1  1 
ATOM   1614 O OE2  . GLU A 1 113 ? 8.115   19.593  68.321 1.00 27.81  -1 158 GLU A OE2  1 
ATOM   1615 H H    . GLU A 1 113 ? 5.366   21.781  69.960 1.00 22.37  ?  158 GLU A H    1 
ATOM   1616 H HA   . GLU A 1 113 ? 6.796   20.728  71.115 1.00 26.87  ?  158 GLU A HA   1 
ATOM   1617 H HB2  . GLU A 1 113 ? 8.294   23.094  70.809 1.00 30.82  ?  158 GLU A HB2  1 
ATOM   1618 H HB3  . GLU A 1 113 ? 8.904   21.771  71.440 1.00 30.82  ?  158 GLU A HB3  1 
ATOM   1619 H HG2  . GLU A 1 113 ? 8.001   21.984  68.781 1.00 32.58  ?  158 GLU A HG2  1 
ATOM   1620 H HG3  . GLU A 1 113 ? 9.530   21.957  69.213 1.00 32.58  ?  158 GLU A HG3  1 
ATOM   1621 N N    . GLN A 1 114 ? 5.370   22.014  73.140 1.00 22.11  ?  159 GLN A N    1 
ATOM   1622 C CA   . GLN A 1 114 ? 5.036   22.245  74.538 1.00 26.53  ?  159 GLN A CA   1 
ATOM   1623 C C    . GLN A 1 114 ? 5.295   21.031  75.417 1.00 26.26  ?  159 GLN A C    1 
ATOM   1624 O O    . GLN A 1 114 ? 5.314   21.172  76.643 1.00 30.90  ?  159 GLN A O    1 
ATOM   1625 C CB   . GLN A 1 114 ? 3.566   22.656  74.664 1.00 21.83  ?  159 GLN A CB   1 
ATOM   1626 C CG   . GLN A 1 114 ? 3.256   24.018  74.081 1.00 23.79  ?  159 GLN A CG   1 
ATOM   1627 C CD   . GLN A 1 114 ? 3.916   25.139  74.853 1.00 27.61  ?  159 GLN A CD   1 
ATOM   1628 O OE1  . GLN A 1 114 ? 3.893   25.156  76.083 1.00 29.32  ?  159 GLN A OE1  1 
ATOM   1629 N NE2  . GLN A 1 114 ? 4.517   26.081  74.134 1.00 26.41  ?  159 GLN A NE2  1 
ATOM   1630 H H    . GLN A 1 114 ? 4.688   21.919  72.625 1.00 26.53  ?  159 GLN A H    1 
ATOM   1631 H HA   . GLN A 1 114 ? 5.579   22.976  74.873 1.00 31.83  ?  159 GLN A HA   1 
ATOM   1632 H HB2  . GLN A 1 114 ? 3.019   22.003  74.199 1.00 26.20  ?  159 GLN A HB2  1 
ATOM   1633 H HB3  . GLN A 1 114 ? 3.327   22.674  75.604 1.00 26.20  ?  159 GLN A HB3  1 
ATOM   1634 H HG2  . GLN A 1 114 ? 3.577   24.052  73.166 1.00 28.55  ?  159 GLN A HG2  1 
ATOM   1635 H HG3  . GLN A 1 114 ? 2.296   24.161  74.103 1.00 28.55  ?  159 GLN A HG3  1 
ATOM   1636 H HE21 . GLN A 1 114 ? 4.516   26.032  73.275 1.00 31.69  ?  159 GLN A HE21 1 
ATOM   1637 H HE22 . GLN A 1 114 ? 4.906   26.739  74.527 1.00 31.69  ?  159 GLN A HE22 1 
ATOM   1638 N N    . PHE A 1 115 ? 5.502   19.850  74.835 1.00 26.70  ?  160 PHE A N    1 
ATOM   1639 C CA   . PHE A 1 115 ? 5.629   18.650  75.652 1.00 28.24  ?  160 PHE A CA   1 
ATOM   1640 C C    . PHE A 1 115 ? 7.030   18.491  76.233 1.00 31.06  ?  160 PHE A C    1 
ATOM   1641 O O    . PHE A 1 115 ? 7.174   17.980  77.350 1.00 36.23  ?  160 PHE A O    1 
ATOM   1642 C CB   . PHE A 1 115 ? 5.225   17.429  74.831 1.00 25.01  ?  160 PHE A CB   1 
ATOM   1643 C CG   . PHE A 1 115 ? 3.745   17.337  74.594 1.00 22.99  ?  160 PHE A CG   1 
ATOM   1644 C CD1  . PHE A 1 115 ? 3.157   17.982  73.520 1.00 24.56  ?  160 PHE A CD1  1 
ATOM   1645 C CD2  . PHE A 1 115 ? 2.938   16.615  75.455 1.00 27.06  ?  160 PHE A CD2  1 
ATOM   1646 C CE1  . PHE A 1 115 ? 1.794   17.903  73.306 1.00 22.56  ?  160 PHE A CE1  1 
ATOM   1647 C CE2  . PHE A 1 115 ? 1.571   16.534  75.247 1.00 23.87  ?  160 PHE A CE2  1 
ATOM   1648 C CZ   . PHE A 1 115 ? 1.000   17.178  74.173 1.00 22.12  ?  160 PHE A CZ   1 
ATOM   1649 H H    . PHE A 1 115 ? 5.571   19.721  73.988 1.00 32.03  ?  160 PHE A H    1 
ATOM   1650 H HA   . PHE A 1 115 ? 5.011   18.718  76.396 1.00 33.89  ?  160 PHE A HA   1 
ATOM   1651 H HB2  . PHE A 1 115 ? 5.664   17.472  73.967 1.00 30.01  ?  160 PHE A HB2  1 
ATOM   1652 H HB3  . PHE A 1 115 ? 5.503   16.627  75.302 1.00 30.01  ?  160 PHE A HB3  1 
ATOM   1653 H HD1  . PHE A 1 115 ? 3.687   18.473  72.934 1.00 29.48  ?  160 PHE A HD1  1 
ATOM   1654 H HD2  . PHE A 1 115 ? 3.318   16.179  76.183 1.00 32.47  ?  160 PHE A HD2  1 
ATOM   1655 H HE1  . PHE A 1 115 ? 1.411   18.339  72.579 1.00 27.07  ?  160 PHE A HE1  1 
ATOM   1656 H HE2  . PHE A 1 115 ? 1.040   16.043  75.832 1.00 28.65  ?  160 PHE A HE2  1 
ATOM   1657 H HZ   . PHE A 1 115 ? 0.083   17.123  74.029 1.00 26.55  ?  160 PHE A HZ   1 
ATOM   1658 N N    . MET A 1 116 ? 8.063   18.927  75.513 1.00 28.39  ?  161 MET A N    1 
ATOM   1659 C CA   . MET A 1 116 ? 9.425   18.963  76.047 1.00 29.97  ?  161 MET A CA   1 
ATOM   1660 C C    . MET A 1 116 ? 9.903   17.564  76.441 1.00 32.66  ?  161 MET A C    1 
ATOM   1661 O O    . MET A 1 116 ? 10.342  17.326  77.569 1.00 34.62  ?  161 MET A O    1 
ATOM   1662 C CB   . MET A 1 116 ? 9.515   19.914  77.243 1.00 34.53  ?  161 MET A CB   1 
ATOM   1663 C CG   . MET A 1 116 ? 8.777   21.241  77.079 1.00 37.51  ?  161 MET A CG   1 
ATOM   1664 S SD   . MET A 1 116 ? 9.581   22.391  75.948 1.00 62.70  ?  161 MET A SD   1 
ATOM   1665 C CE   . MET A 1 116 ? 8.493   23.808  76.097 1.00 36.17  ?  161 MET A CE   1 
ATOM   1666 H H    . MET A 1 116 ? 8.000   19.210  74.704 1.00 34.07  ?  161 MET A H    1 
ATOM   1667 H HA   . MET A 1 116 ? 10.015  19.305  75.358 1.00 35.96  ?  161 MET A HA   1 
ATOM   1668 H HB2  . MET A 1 116 ? 9.143   19.468  78.020 1.00 41.44  ?  161 MET A HB2  1 
ATOM   1669 H HB3  . MET A 1 116 ? 10.449  20.119  77.404 1.00 41.44  ?  161 MET A HB3  1 
ATOM   1670 H HG2  . MET A 1 116 ? 7.887   21.062  76.735 1.00 45.01  ?  161 MET A HG2  1 
ATOM   1671 H HG3  . MET A 1 116 ? 8.714   21.672  77.945 1.00 45.01  ?  161 MET A HG3  1 
ATOM   1672 H HE1  . MET A 1 116 ? 8.821   24.519  75.524 1.00 43.40  ?  161 MET A HE1  1 
ATOM   1673 H HE2  . MET A 1 116 ? 7.599   23.549  75.824 1.00 43.40  ?  161 MET A HE2  1 
ATOM   1674 H HE3  . MET A 1 116 ? 8.485   24.104  77.020 1.00 43.40  ?  161 MET A HE3  1 
ATOM   1675 N N    . VAL A 1 117 ? 9.819   16.629  75.496 1.00 29.17  ?  162 VAL A N    1 
ATOM   1676 C CA   . VAL A 1 117 ? 10.251  15.256  75.737 1.00 27.80  ?  162 VAL A CA   1 
ATOM   1677 C C    . VAL A 1 117 ? 11.204  14.825  74.631 1.00 24.50  ?  162 VAL A C    1 
ATOM   1678 O O    . VAL A 1 117 ? 11.235  13.652  74.244 1.00 21.78  ?  162 VAL A O    1 
ATOM   1679 C CB   . VAL A 1 117 ? 9.051   14.294  75.833 1.00 27.92  ?  162 VAL A CB   1 
ATOM   1680 C CG1  . VAL A 1 117 ? 8.231   14.587  77.076 1.00 27.68  ?  162 VAL A CG1  1 
ATOM   1681 C CG2  . VAL A 1 117 ? 8.186   14.383  74.584 1.00 27.49  ?  162 VAL A CG2  1 
ATOM   1682 H H    . VAL A 1 117 ? 9.515   16.767  74.703 1.00 35.00  ?  162 VAL A H    1 
ATOM   1683 H HA   . VAL A 1 117 ? 10.732  15.219  76.578 1.00 33.36  ?  162 VAL A HA   1 
ATOM   1684 H HB   . VAL A 1 117 ? 9.382   13.385  75.902 1.00 33.51  ?  162 VAL A HB   1 
ATOM   1685 H HG11 . VAL A 1 117 ? 7.483   13.970  77.113 1.00 33.21  ?  162 VAL A HG11 1 
ATOM   1686 H HG12 . VAL A 1 117 ? 8.793   14.474  77.859 1.00 33.21  ?  162 VAL A HG12 1 
ATOM   1687 H HG13 . VAL A 1 117 ? 7.905   15.500  77.032 1.00 33.21  ?  162 VAL A HG13 1 
ATOM   1688 H HG21 . VAL A 1 117 ? 7.441   13.769  74.673 1.00 32.99  ?  162 VAL A HG21 1 
ATOM   1689 H HG22 . VAL A 1 117 ? 7.858   15.291  74.492 1.00 32.99  ?  162 VAL A HG22 1 
ATOM   1690 H HG23 . VAL A 1 117 ? 8.722   14.144  73.812 1.00 32.99  ?  162 VAL A HG23 1 
ATOM   1691 N N    . GLY A 1 118 ? 11.991  15.764  74.120 1.00 26.69  ?  163 GLY A N    1 
ATOM   1692 C CA   . GLY A 1 118 ? 12.916  15.429  73.050 1.00 27.24  ?  163 GLY A CA   1 
ATOM   1693 C C    . GLY A 1 118 ? 12.177  14.911  71.832 1.00 27.21  ?  163 GLY A C    1 
ATOM   1694 O O    . GLY A 1 118 ? 11.207  15.513  71.361 1.00 25.14  ?  163 GLY A O    1 
ATOM   1695 H H    . GLY A 1 118 ? 12.009  16.586  74.370 1.00 32.03  ?  163 GLY A H    1 
ATOM   1696 H HA2  . GLY A 1 118 ? 13.422  16.217  72.796 1.00 32.69  ?  163 GLY A HA2  1 
ATOM   1697 H HA3  . GLY A 1 118 ? 13.534  14.746  73.354 1.00 32.69  ?  163 GLY A HA3  1 
ATOM   1698 N N    . GLU A 1 119 ? 12.631  13.770  71.318 1.00 25.21  ?  164 GLU A N    1 
ATOM   1699 C CA   . GLU A 1 119 ? 12.089  13.181  70.101 1.00 29.50  ?  164 GLU A CA   1 
ATOM   1700 C C    . GLU A 1 119 ? 10.945  12.209  70.365 1.00 21.77  ?  164 GLU A C    1 
ATOM   1701 O O    . GLU A 1 119 ? 10.520  11.511  69.440 1.00 24.81  ?  164 GLU A O    1 
ATOM   1702 C CB   . GLU A 1 119 ? 13.197  12.450  69.337 1.00 30.34  ?  164 GLU A CB   1 
ATOM   1703 C CG   . GLU A 1 119 ? 14.476  13.250  69.173 1.00 35.47  ?  164 GLU A CG   1 
ATOM   1704 C CD   . GLU A 1 119 ? 14.287  14.465  68.299 1.00 32.92  ?  164 GLU A CD   1 
ATOM   1705 O OE1  . GLU A 1 119 ? 13.607  14.345  67.258 1.00 30.10  ?  164 GLU A OE1  1 
ATOM   1706 O OE2  . GLU A 1 119 ? 14.803  15.547  68.658 1.00 36.96  -1 164 GLU A OE2  1 
ATOM   1707 H H    . GLU A 1 119 ? 13.268  13.309  71.667 1.00 30.25  ?  164 GLU A H    1 
ATOM   1708 H HA   . GLU A 1 119 ? 11.751  13.891  69.532 1.00 35.40  ?  164 GLU A HA   1 
ATOM   1709 H HB2  . GLU A 1 119 ? 13.419  11.635  69.814 1.00 36.41  ?  164 GLU A HB2  1 
ATOM   1710 H HB3  . GLU A 1 119 ? 12.871  12.232  68.450 1.00 36.41  ?  164 GLU A HB3  1 
ATOM   1711 H HG2  . GLU A 1 119 ? 14.775  13.550  70.046 1.00 42.56  ?  164 GLU A HG2  1 
ATOM   1712 H HG3  . GLU A 1 119 ? 15.152  12.687  68.764 1.00 42.56  ?  164 GLU A HG3  1 
ATOM   1713 N N    . GLU A 1 120 ? 10.427  12.158  71.595 1.00 24.13  ?  165 GLU A N    1 
ATOM   1714 C CA   . GLU A 1 120 ? 9.562   11.054  72.000 1.00 22.16  ?  165 GLU A CA   1 
ATOM   1715 C C    . GLU A 1 120 ? 8.167   11.117  71.387 1.00 20.22  ?  165 GLU A C    1 
ATOM   1716 O O    . GLU A 1 120 ? 7.502   10.079  71.302 1.00 18.29  ?  165 GLU A O    1 
ATOM   1717 C CB   . GLU A 1 120 ? 9.452   11.015  73.525 1.00 21.90  ?  165 GLU A CB   1 
ATOM   1718 C CG   . GLU A 1 120 ? 10.447  10.077  74.187 1.00 24.10  ?  165 GLU A CG   1 
ATOM   1719 C CD   . GLU A 1 120 ? 10.103  8.619   73.954 1.00 26.60  ?  165 GLU A CD   1 
ATOM   1720 O OE1  . GLU A 1 120 ? 10.965  7.869   73.446 1.00 25.86  ?  165 GLU A OE1  1 
ATOM   1721 O OE2  . GLU A 1 120 ? 8.959   8.227   74.265 1.00 24.30  -1 165 GLU A OE2  1 
ATOM   1722 H H    . GLU A 1 120 ? 10.562  12.747  72.207 1.00 28.95  ?  165 GLU A H    1 
ATOM   1723 H HA   . GLU A 1 120 ? 9.970   10.222  71.714 1.00 26.59  ?  165 GLU A HA   1 
ATOM   1724 H HB2  . GLU A 1 120 ? 9.610   11.907  73.872 1.00 26.28  ?  165 GLU A HB2  1 
ATOM   1725 H HB3  . GLU A 1 120 ? 8.560   10.721  73.767 1.00 26.28  ?  165 GLU A HB3  1 
ATOM   1726 H HG2  . GLU A 1 120 ? 11.330  10.241  73.821 1.00 28.92  ?  165 GLU A HG2  1 
ATOM   1727 H HG3  . GLU A 1 120 ? 10.446  10.237  75.144 1.00 28.92  ?  165 GLU A HG3  1 
ATOM   1728 N N    . ILE A 1 121 ? 7.705   12.286  70.959 1.00 21.23  ?  166 ILE A N    1 
ATOM   1729 C CA   . ILE A 1 121 ? 6.356   12.404  70.415 1.00 18.82  ?  166 ILE A CA   1 
ATOM   1730 C C    . ILE A 1 121 ? 6.313   11.826  69.007 1.00 20.26  ?  166 ILE A C    1 
ATOM   1731 O O    . ILE A 1 121 ? 7.190   12.093  68.177 1.00 18.81  ?  166 ILE A O    1 
ATOM   1732 C CB   . ILE A 1 121 ? 5.893   13.872  70.420 1.00 21.87  ?  166 ILE A CB   1 
ATOM   1733 C CG1  . ILE A 1 121 ? 5.943   14.454  71.837 1.00 21.57  ?  166 ILE A CG1  1 
ATOM   1734 C CG2  . ILE A 1 121 ? 4.481   13.985  69.841 1.00 21.41  ?  166 ILE A CG2  1 
ATOM   1735 C CD1  . ILE A 1 121 ? 5.077   13.717  72.848 1.00 23.65  ?  166 ILE A CD1  1 
ATOM   1736 H H    . ILE A 1 121 ? 8.148   13.023  70.972 1.00 25.48  ?  166 ILE A H    1 
ATOM   1737 H HA   . ILE A 1 121 ? 5.744   11.894  70.969 1.00 22.59  ?  166 ILE A HA   1 
ATOM   1738 H HB   . ILE A 1 121 ? 6.495   14.384  69.858 1.00 26.24  ?  166 ILE A HB   1 
ATOM   1739 H HG12 . ILE A 1 121 ? 6.859   14.421  72.154 1.00 25.89  ?  166 ILE A HG12 1 
ATOM   1740 H HG13 . ILE A 1 121 ? 5.640   15.375  71.806 1.00 25.89  ?  166 ILE A HG13 1 
ATOM   1741 H HG21 . ILE A 1 121 ? 4.209   14.916  69.853 1.00 25.70  ?  166 ILE A HG21 1 
ATOM   1742 H HG22 . ILE A 1 121 ? 4.487   13.653  68.929 1.00 25.70  ?  166 ILE A HG22 1 
ATOM   1743 H HG23 . ILE A 1 121 ? 3.875   13.455  70.382 1.00 25.70  ?  166 ILE A HG23 1 
ATOM   1744 H HD11 . ILE A 1 121 ? 5.166   14.148  73.713 1.00 28.38  ?  166 ILE A HD11 1 
ATOM   1745 H HD12 . ILE A 1 121 ? 4.152   13.751  72.556 1.00 28.38  ?  166 ILE A HD12 1 
ATOM   1746 H HD13 . ILE A 1 121 ? 5.373   12.795  72.905 1.00 28.38  ?  166 ILE A HD13 1 
ATOM   1747 N N    . CYS A 1 122 ? 5.266   11.048  68.726 1.00 14.55  ?  167 CYS A N    1 
ATOM   1748 C CA   . CYS A 1 122 ? 4.994   10.548  67.385 1.00 16.72  ?  167 CYS A CA   1 
ATOM   1749 C C    . CYS A 1 122 ? 3.859   11.301  66.702 1.00 17.33  ?  167 CYS A C    1 
ATOM   1750 O O    . CYS A 1 122 ? 3.997   11.709  65.546 1.00 17.58  ?  167 CYS A O    1 
ATOM   1751 C CB   . CYS A 1 122 ? 4.661   9.054   67.436 1.00 18.87  ?  167 CYS A CB   1 
ATOM   1752 S SG   . CYS A 1 122 ? 5.982   8.062   68.128 1.00 20.67  ?  167 CYS A SG   1 
ATOM   1753 H H    . CYS A 1 122 ? 4.688   10.793  69.310 1.00 17.46  ?  167 CYS A H    1 
ATOM   1754 H HA   . CYS A 1 122 ? 5.791   10.657  66.843 1.00 20.06  ?  167 CYS A HA   1 
ATOM   1755 H HB2  . CYS A 1 122 ? 3.872   8.925   67.985 1.00 22.65  ?  167 CYS A HB2  1 
ATOM   1756 H HB3  . CYS A 1 122 ? 4.491   8.738   66.535 1.00 22.65  ?  167 CYS A HB3  1 
ATOM   1757 H HG   . CYS A 1 122 ? 5.645   6.911   68.133 1.00 24.81  ?  167 CYS A HG   1 
ATOM   1758 N N    . GLY A 1 123 ? 2.740   11.492  67.389 1.00 17.56  ?  168 GLY A N    1 
ATOM   1759 C CA   . GLY A 1 123 ? 1.617   12.178  66.786 1.00 16.89  ?  168 GLY A CA   1 
ATOM   1760 C C    . GLY A 1 123 ? 0.403   12.154  67.689 1.00 16.74  ?  168 GLY A C    1 
ATOM   1761 O O    . GLY A 1 123 ? 0.430   11.625  68.805 1.00 15.59  ?  168 GLY A O    1 
ATOM   1762 H H    . GLY A 1 123 ? 2.610   11.234  68.199 1.00 21.07  ?  168 GLY A H    1 
ATOM   1763 H HA2  . GLY A 1 123 ? 1.855   13.102  66.611 1.00 20.27  ?  168 GLY A HA2  1 
ATOM   1764 H HA3  . GLY A 1 123 ? 1.387   11.751  65.946 1.00 20.27  ?  168 GLY A HA3  1 
ATOM   1765 N N    . ALA A 1 124 ? -0.675  12.738  67.167 1.00 13.86  ?  169 ALA A N    1 
ATOM   1766 C CA   . ALA A 1 124 ? -1.925  12.895  67.892 1.00 14.49  ?  169 ALA A CA   1 
ATOM   1767 C C    . ALA A 1 124 ? -3.074  12.368  67.045 1.00 15.86  ?  169 ALA A C    1 
ATOM   1768 O O    . ALA A 1 124 ? -3.042  12.444  65.815 1.00 15.67  ?  169 ALA A O    1 
ATOM   1769 C CB   . ALA A 1 124 ? -2.180  14.367  68.250 1.00 16.23  ?  169 ALA A CB   1 
ATOM   1770 H H    . ALA A 1 124 ? -0.702  13.060  66.370 1.00 16.63  ?  169 ALA A H    1 
ATOM   1771 H HA   . ALA A 1 124 ? -1.888  12.381  68.714 1.00 17.39  ?  169 ALA A HA   1 
ATOM   1772 H HB1  . ALA A 1 124 ? -3.020  14.433  68.731 1.00 19.47  ?  169 ALA A HB1  1 
ATOM   1773 H HB2  . ALA A 1 124 ? -1.453  14.687  68.807 1.00 19.47  ?  169 ALA A HB2  1 
ATOM   1774 H HB3  . ALA A 1 124 ? -2.225  14.887  67.433 1.00 19.47  ?  169 ALA A HB3  1 
ATOM   1775 N N    . VAL A 1 125 ? -4.094  11.835  67.720 1.00 16.50  ?  170 VAL A N    1 
ATOM   1776 C CA   . VAL A 1 125 ? -5.289  11.316  67.067 1.00 14.41  ?  170 VAL A CA   1 
ATOM   1777 C C    . VAL A 1 125 ? -6.516  11.884  67.765 1.00 15.80  ?  170 VAL A C    1 
ATOM   1778 O O    . VAL A 1 125 ? -6.510  12.126  68.976 1.00 17.25  ?  170 VAL A O    1 
ATOM   1779 C CB   . VAL A 1 125 ? -5.333  9.767   67.085 1.00 19.77  ?  170 VAL A CB   1 
ATOM   1780 C CG1  . VAL A 1 125 ? -6.532  9.247   66.296 1.00 21.18  ?  170 VAL A CG1  1 
ATOM   1781 C CG2  . VAL A 1 125 ? -4.048  9.183   66.535 1.00 18.72  ?  170 VAL A CG2  1 
ATOM   1782 H H    . VAL A 1 125 ? -4.114  11.763  68.576 1.00 19.80  ?  170 VAL A H    1 
ATOM   1783 H HA   . VAL A 1 125 ? -5.301  11.609  66.142 1.00 17.29  ?  170 VAL A HA   1 
ATOM   1784 H HB   . VAL A 1 125 ? -5.427  9.467   68.003 1.00 23.73  ?  170 VAL A HB   1 
ATOM   1785 H HG11 . VAL A 1 125 ? -6.532  8.278   66.326 1.00 25.42  ?  170 VAL A HG11 1 
ATOM   1786 H HG12 . VAL A 1 125 ? -7.346  9.591   66.697 1.00 25.42  ?  170 VAL A HG12 1 
ATOM   1787 H HG13 . VAL A 1 125 ? -6.461  9.550   65.378 1.00 25.42  ?  170 VAL A HG13 1 
ATOM   1788 H HG21 . VAL A 1 125 ? -4.106  8.215   66.559 1.00 22.46  ?  170 VAL A HG21 1 
ATOM   1789 H HG22 . VAL A 1 125 ? -3.931  9.485   65.621 1.00 22.46  ?  170 VAL A HG22 1 
ATOM   1790 H HG23 . VAL A 1 125 ? -3.305  9.485   67.081 1.00 22.46  ?  170 VAL A HG23 1 
ATOM   1791 N N    . VAL A 1 126 ? -7.572  12.107  66.987 1.00 16.13  ?  171 VAL A N    1 
ATOM   1792 C CA   . VAL A 1 126 ? -8.911  12.342  67.514 1.00 19.97  ?  171 VAL A CA   1 
ATOM   1793 C C    . VAL A 1 126 ? -9.864  11.430  66.756 1.00 19.09  ?  171 VAL A C    1 
ATOM   1794 O O    . VAL A 1 126 ? -9.813  11.358  65.524 1.00 18.20  ?  171 VAL A O    1 
ATOM   1795 C CB   . VAL A 1 126 ? -9.345  13.817  67.392 1.00 21.45  ?  171 VAL A CB   1 
ATOM   1796 C CG1  . VAL A 1 126 ? -9.247  14.300  65.952 1.00 22.60  ?  171 VAL A CG1  1 
ATOM   1797 C CG2  . VAL A 1 126 ? -10.759 14.012  67.936 1.00 21.56  ?  171 VAL A CG2  1 
ATOM   1798 H H    . VAL A 1 126 ? -7.535  12.128  66.128 1.00 19.35  ?  171 VAL A H    1 
ATOM   1799 H HA   . VAL A 1 126 ? -8.934  12.096  68.452 1.00 23.96  ?  171 VAL A HA   1 
ATOM   1800 H HB   . VAL A 1 126 ? -8.746  14.362  67.926 1.00 25.74  ?  171 VAL A HB   1 
ATOM   1801 H HG11 . VAL A 1 126 ? -9.527  15.228  65.911 1.00 27.12  ?  171 VAL A HG11 1 
ATOM   1802 H HG12 . VAL A 1 126 ? -8.328  14.217  65.654 1.00 27.12  ?  171 VAL A HG12 1 
ATOM   1803 H HG13 . VAL A 1 126 ? -9.826  13.755  65.397 1.00 27.12  ?  171 VAL A HG13 1 
ATOM   1804 H HG21 . VAL A 1 126 ? -11.006 14.946  67.847 1.00 25.87  ?  171 VAL A HG21 1 
ATOM   1805 H HG22 . VAL A 1 126 ? -11.372 13.457  67.428 1.00 25.87  ?  171 VAL A HG22 1 
ATOM   1806 H HG23 . VAL A 1 126 ? -10.776 13.753  68.871 1.00 25.87  ?  171 VAL A HG23 1 
ATOM   1807 N N    . SER A 1 127 ? -10.721 10.728  67.493 1.00 23.07  ?  172 SER A N    1 
ATOM   1808 C CA   . SER A 1 127 ? -11.620 9.730   66.924 1.00 26.00  ?  172 SER A CA   1 
ATOM   1809 C C    . SER A 1 127 ? -13.036 10.038  67.377 1.00 27.08  ?  172 SER A C    1 
ATOM   1810 O O    . SER A 1 127 ? -13.316 10.034  68.580 1.00 27.83  ?  172 SER A O    1 
ATOM   1811 C CB   . SER A 1 127 ? -11.221 8.317   67.360 1.00 29.47  ?  172 SER A CB   1 
ATOM   1812 O OG   . SER A 1 127 ? -9.822  8.124   67.262 1.00 33.60  ?  172 SER A OG   1 
ATOM   1813 H H    . SER A 1 127 ? -10.802 10.814  68.345 1.00 27.69  ?  172 SER A H    1 
ATOM   1814 H HA   . SER A 1 127 ? -11.587 9.777   65.956 1.00 31.20  ?  172 SER A HA   1 
ATOM   1815 H HB2  . SER A 1 127 ? -11.493 8.184   68.282 1.00 35.37  ?  172 SER A HB2  1 
ATOM   1816 H HB3  . SER A 1 127 ? -11.668 7.674   66.788 1.00 35.37  ?  172 SER A HB3  1 
ATOM   1817 H HG   . SER A 1 127 ? -9.572  8.235   66.468 1.00 40.32  ?  172 SER A HG   1 
ATOM   1818 N N    . VAL A 1 128 ? -13.923 10.305  66.426 1.00 32.21  ?  173 VAL A N    1 
ATOM   1819 C CA   . VAL A 1 128 ? -15.332 10.514  66.732 1.00 32.77  ?  173 VAL A CA   1 
ATOM   1820 C C    . VAL A 1 128 ? -16.032 9.162   66.703 1.00 36.28  ?  173 VAL A C    1 
ATOM   1821 O O    . VAL A 1 128 ? -15.897 8.399   65.738 1.00 36.08  ?  173 VAL A O    1 
ATOM   1822 C CB   . VAL A 1 128 ? -15.979 11.505  65.747 1.00 36.50  ?  173 VAL A CB   1 
ATOM   1823 C CG1  . VAL A 1 128 ? -15.231 12.834  65.762 1.00 37.28  ?  173 VAL A CG1  1 
ATOM   1824 C CG2  . VAL A 1 128 ? -16.029 10.938  64.332 1.00 43.89  ?  173 VAL A CG2  1 
ATOM   1825 H H    . VAL A 1 128 ? -13.732 10.370  65.590 1.00 38.65  ?  173 VAL A H    1 
ATOM   1826 H HA   . VAL A 1 128 ? -15.415 10.879  67.627 1.00 39.33  ?  173 VAL A HA   1 
ATOM   1827 H HB   . VAL A 1 128 ? -16.891 11.676  66.030 1.00 43.80  ?  173 VAL A HB   1 
ATOM   1828 H HG11 . VAL A 1 128 ? -15.654 13.441  65.136 1.00 44.74  ?  173 VAL A HG11 1 
ATOM   1829 H HG12 . VAL A 1 128 ? -15.264 13.204  66.658 1.00 44.74  ?  173 VAL A HG12 1 
ATOM   1830 H HG13 . VAL A 1 128 ? -14.309 12.679  65.502 1.00 44.74  ?  173 VAL A HG13 1 
ATOM   1831 H HG21 . VAL A 1 128 ? -16.442 11.591  63.745 1.00 52.67  ?  173 VAL A HG21 1 
ATOM   1832 H HG22 . VAL A 1 128 ? -15.125 10.751  64.035 1.00 52.67  ?  173 VAL A HG22 1 
ATOM   1833 H HG23 . VAL A 1 128 ? -16.552 10.121  64.338 1.00 52.67  ?  173 VAL A HG23 1 
ATOM   1834 N N    . ARG A 1 129 ? -16.759 8.854   67.769 1.00 37.07  ?  174 ARG A N    1 
ATOM   1835 C CA   . ARG A 1 129 ? -17.466 7.589   67.899 1.00 38.22  ?  174 ARG A CA   1 
ATOM   1836 C C    . ARG A 1 129 ? -18.950 7.868   68.138 1.00 40.57  ?  174 ARG A C    1 
ATOM   1837 O O    . ARG A 1 129 ? -19.418 9.002   68.012 1.00 41.91  ?  174 ARG A O    1 
ATOM   1838 C CB   . ARG A 1 129 ? -16.840 6.747   69.014 1.00 36.18  ?  174 ARG A CB   1 
ATOM   1839 C CG   . ARG A 1 129 ? -15.408 6.307   68.730 1.00 38.63  ?  174 ARG A CG   1 
ATOM   1840 C CD   . ARG A 1 129 ? -15.346 5.315   67.570 1.00 46.45  ?  174 ARG A CD   1 
ATOM   1841 N NE   . ARG A 1 129 ? -13.978 4.900   67.263 1.00 45.01  ?  174 ARG A NE   1 
ATOM   1842 C CZ   . ARG A 1 129 ? -13.198 5.472   66.348 1.00 44.96  ?  174 ARG A CZ   1 
ATOM   1843 N NH1  . ARG A 1 129 ? -13.636 6.501   65.628 1.00 42.27  1  174 ARG A NH1  1 
ATOM   1844 N NH2  . ARG A 1 129 ? -11.970 5.013   66.149 1.00 44.31  ?  174 ARG A NH2  1 
ATOM   1845 H H    . ARG A 1 129 ? -16.861 9.375   68.446 1.00 44.49  ?  174 ARG A H    1 
ATOM   1846 H HA   . ARG A 1 129 ? -17.384 7.094   67.068 1.00 45.86  ?  174 ARG A HA   1 
ATOM   1847 H HB2  . ARG A 1 129 ? -16.832 7.268   69.832 1.00 43.42  ?  174 ARG A HB2  1 
ATOM   1848 H HB3  . ARG A 1 129 ? -17.375 5.948   69.140 1.00 43.42  ?  174 ARG A HB3  1 
ATOM   1849 H HG2  . ARG A 1 129 ? -14.876 7.083   68.494 1.00 46.36  ?  174 ARG A HG2  1 
ATOM   1850 H HG3  . ARG A 1 129 ? -15.043 5.876   69.518 1.00 46.36  ?  174 ARG A HG3  1 
ATOM   1851 H HD2  . ARG A 1 129 ? -15.855 4.523   67.803 1.00 55.75  ?  174 ARG A HD2  1 
ATOM   1852 H HD3  . ARG A 1 129 ? -15.720 5.730   66.777 1.00 55.75  ?  174 ARG A HD3  1 
ATOM   1853 H HE   . ARG A 1 129 ? -13.653 4.238   67.706 1.00 54.01  ?  174 ARG A HE   1 
ATOM   1854 H HH11 . ARG A 1 129 ? -14.431 6.804   65.750 1.00 50.72  ?  174 ARG A HH11 1 
ATOM   1855 H HH12 . ARG A 1 129 ? -13.123 6.863   65.040 1.00 50.72  ?  174 ARG A HH12 1 
ATOM   1856 H HH21 . ARG A 1 129 ? -11.679 4.348   66.611 1.00 53.17  ?  174 ARG A HH21 1 
ATOM   1857 H HH22 . ARG A 1 129 ? -11.464 5.381   65.559 1.00 53.17  ?  174 ARG A HH22 1 
ATOM   1858 N N    . PHE A 1 130 ? -19.692 6.816   68.485 1.00 45.84  ?  175 PHE A N    1 
ATOM   1859 C CA   . PHE A 1 130 ? -21.144 6.927   68.588 1.00 47.01  ?  175 PHE A CA   1 
ATOM   1860 C C    . PHE A 1 130 ? -21.550 7.746   69.809 1.00 48.24  ?  175 PHE A C    1 
ATOM   1861 O O    . PHE A 1 130 ? -22.273 8.743   69.693 1.00 46.85  ?  175 PHE A O    1 
ATOM   1862 C CB   . PHE A 1 130 ? -21.762 5.528   68.638 1.00 51.50  ?  175 PHE A CB   1 
ATOM   1863 C CG   . PHE A 1 130 ? -23.243 5.509   68.384 1.00 55.51  ?  175 PHE A CG   1 
ATOM   1864 C CD1  . PHE A 1 130 ? -23.742 5.667   67.100 1.00 56.79  ?  175 PHE A CD1  1 
ATOM   1865 C CD2  . PHE A 1 130 ? -24.136 5.321   69.425 1.00 54.36  ?  175 PHE A CD2  1 
ATOM   1866 C CE1  . PHE A 1 130 ? -25.105 5.647   66.862 1.00 49.96  ?  175 PHE A CE1  1 
ATOM   1867 C CE2  . PHE A 1 130 ? -25.498 5.300   69.194 1.00 48.16  ?  175 PHE A CE2  1 
ATOM   1868 C CZ   . PHE A 1 130 ? -25.983 5.461   67.910 1.00 46.70  ?  175 PHE A CZ   1 
ATOM   1869 H H    . PHE A 1 130 ? -19.381 6.034   68.663 1.00 55.01  ?  175 PHE A H    1 
ATOM   1870 H HA   . PHE A 1 130 ? -21.483 7.377   67.799 1.00 56.41  ?  175 PHE A HA   1 
ATOM   1871 H HB2  . PHE A 1 130 ? -21.339 4.976   67.963 1.00 61.79  ?  175 PHE A HB2  1 
ATOM   1872 H HB3  . PHE A 1 130 ? -21.608 5.149   69.517 1.00 61.79  ?  175 PHE A HB3  1 
ATOM   1873 H HD1  . PHE A 1 130 ? -23.153 5.793   66.391 1.00 68.14  ?  175 PHE A HD1  1 
ATOM   1874 H HD2  . PHE A 1 130 ? -23.816 5.212   70.291 1.00 65.23  ?  175 PHE A HD2  1 
ATOM   1875 H HE1  . PHE A 1 130 ? -25.429 5.756   65.997 1.00 59.95  ?  175 PHE A HE1  1 
ATOM   1876 H HE2  . PHE A 1 130 ? -26.088 5.175   69.902 1.00 57.80  ?  175 PHE A HE2  1 
ATOM   1877 H HZ   . PHE A 1 130 ? -26.900 5.447   67.753 1.00 56.05  ?  175 PHE A HZ   1 
ATOM   1878 N N    . GLN A 1 131 ? -21.089 7.342   70.994 1.00 44.84  ?  176 GLN A N    1 
ATOM   1879 C CA   . GLN A 1 131 ? -21.504 7.969   72.241 1.00 44.65  ?  176 GLN A CA   1 
ATOM   1880 C C    . GLN A 1 131 ? -20.442 8.860   72.866 1.00 41.17  ?  176 GLN A C    1 
ATOM   1881 O O    . GLN A 1 131 ? -20.735 9.539   73.855 1.00 40.40  ?  176 GLN A O    1 
ATOM   1882 C CB   . GLN A 1 131 ? -21.913 6.892   73.256 1.00 47.68  ?  176 GLN A CB   1 
ATOM   1883 C CG   . GLN A 1 131 ? -23.244 6.229   72.934 1.00 50.10  ?  176 GLN A CG   1 
ATOM   1884 C CD   . GLN A 1 131 ? -23.336 4.801   73.442 1.00 57.14  ?  176 GLN A CD   1 
ATOM   1885 O OE1  . GLN A 1 131 ? -22.321 4.133   73.645 1.00 61.62  ?  176 GLN A OE1  1 
ATOM   1886 N NE2  . GLN A 1 131 ? -24.559 4.325   73.649 1.00 48.38  ?  176 GLN A NE2  1 
ATOM   1887 H H    . GLN A 1 131 ? -20.527 6.699   71.099 1.00 53.81  ?  176 GLN A H    1 
ATOM   1888 H HA   . GLN A 1 131 ? -22.283 8.520   72.066 1.00 53.58  ?  176 GLN A HA   1 
ATOM   1889 H HB2  . GLN A 1 131 ? -21.233 6.201   73.271 1.00 57.22  ?  176 GLN A HB2  1 
ATOM   1890 H HB3  . GLN A 1 131 ? -21.989 7.299   74.133 1.00 57.22  ?  176 GLN A HB3  1 
ATOM   1891 H HG2  . GLN A 1 131 ? -23.958 6.739   73.346 1.00 60.12  ?  176 GLN A HG2  1 
ATOM   1892 H HG3  . GLN A 1 131 ? -23.363 6.212   71.971 1.00 60.12  ?  176 GLN A HG3  1 
ATOM   1893 H HE21 . GLN A 1 131 ? -25.245 4.821   73.495 1.00 58.05  ?  176 GLN A HE21 1 
ATOM   1894 H HE22 . GLN A 1 131 ? -24.665 3.521   73.936 1.00 58.05  ?  176 GLN A HE22 1 
ATOM   1895 N N    . GLU A 1 132 ? -19.228 8.884   72.325 1.00 40.25  ?  177 GLU A N    1 
ATOM   1896 C CA   . GLU A 1 132 ? -18.157 9.677   72.910 1.00 35.92  ?  177 GLU A CA   1 
ATOM   1897 C C    . GLU A 1 132 ? -17.107 9.944   71.843 1.00 35.44  ?  177 GLU A C    1 
ATOM   1898 O O    . GLU A 1 132 ? -17.177 9.427   70.726 1.00 32.55  ?  177 GLU A O    1 
ATOM   1899 C CB   . GLU A 1 132 ? -17.535 8.970   74.120 1.00 35.26  ?  177 GLU A CB   1 
ATOM   1900 C CG   . GLU A 1 132 ? -17.051 7.558   73.829 1.00 38.62  ?  177 GLU A CG   1 
ATOM   1901 C CD   . GLU A 1 132 ? -16.294 6.946   74.994 1.00 42.01  ?  177 GLU A CD   1 
ATOM   1902 O OE1  . GLU A 1 132 ? -15.209 6.372   74.763 1.00 45.49  ?  177 GLU A OE1  1 
ATOM   1903 O OE2  . GLU A 1 132 ? -16.779 7.047   76.142 1.00 43.60  -1 177 GLU A OE2  1 
ATOM   1904 H H    . GLU A 1 132 ? -19.000 8.449   71.619 1.00 48.30  ?  177 GLU A H    1 
ATOM   1905 H HA   . GLU A 1 132 ? -18.515 10.529  73.206 1.00 43.10  ?  177 GLU A HA   1 
ATOM   1906 H HB2  . GLU A 1 132 ? -16.773 9.487   74.426 1.00 42.31  ?  177 GLU A HB2  1 
ATOM   1907 H HB3  . GLU A 1 132 ? -18.199 8.915   74.825 1.00 42.31  ?  177 GLU A HB3  1 
ATOM   1908 H HG2  . GLU A 1 132 ? -17.817 6.994   73.639 1.00 46.34  ?  177 GLU A HG2  1 
ATOM   1909 H HG3  . GLU A 1 132 ? -16.456 7.579   73.063 1.00 46.34  ?  177 GLU A HG3  1 
ATOM   1910 N N    . ASP A 1 133 ? -16.133 10.771  72.206 1.00 32.56  ?  178 ASP A N    1 
ATOM   1911 C CA   . ASP A 1 133 ? -14.968 11.023  71.379 1.00 29.70  ?  178 ASP A CA   1 
ATOM   1912 C C    . ASP A 1 133 ? -13.717 10.663  72.167 1.00 25.55  ?  178 ASP A C    1 
ATOM   1913 O O    . ASP A 1 133 ? -13.729 10.595  73.399 1.00 25.36  ?  178 ASP A O    1 
ATOM   1914 C CB   . ASP A 1 133 ? -14.909 12.487  70.922 1.00 27.88  ?  178 ASP A CB   1 
ATOM   1915 C CG   . ASP A 1 133 ? -16.118 12.888  70.099 1.00 32.31  ?  178 ASP A CG   1 
ATOM   1916 O OD1  . ASP A 1 133 ? -16.636 12.037  69.347 1.00 33.23  ?  178 ASP A OD1  1 
ATOM   1917 O OD2  . ASP A 1 133 ? -16.552 14.053  70.207 1.00 35.36  -1 178 ASP A OD2  1 
ATOM   1918 H H    . ASP A 1 133 ? -16.128 11.207  72.948 1.00 39.08  ?  178 ASP A H    1 
ATOM   1919 H HA   . ASP A 1 133 ? -15.005 10.459  70.591 1.00 35.65  ?  178 ASP A HA   1 
ATOM   1920 H HB2  . ASP A 1 133 ? -14.873 13.061  71.703 1.00 33.45  ?  178 ASP A HB2  1 
ATOM   1921 H HB3  . ASP A 1 133 ? -14.117 12.616  70.376 1.00 33.45  ?  178 ASP A HB3  1 
ATOM   1922 N N    . ILE A 1 134 ? -12.633 10.422  71.440 1.00 21.94  ?  179 ILE A N    1 
ATOM   1923 C CA   . ILE A 1 134 ? -11.373 10.008  72.041 1.00 22.00  ?  179 ILE A CA   1 
ATOM   1924 C C    . ILE A 1 134 ? -10.255 10.806  71.395 1.00 21.21  ?  179 ILE A C    1 
ATOM   1925 O O    . ILE A 1 134 ? -10.162 10.870  70.166 1.00 21.21  ?  179 ILE A O    1 
ATOM   1926 C CB   . ILE A 1 134 ? -11.127 8.496   71.869 1.00 23.84  ?  179 ILE A CB   1 
ATOM   1927 C CG1  . ILE A 1 134 ? -12.277 7.701   72.497 1.00 27.44  ?  179 ILE A CG1  1 
ATOM   1928 C CG2  . ILE A 1 134 ? -9.793  8.101   72.497 1.00 22.22  ?  179 ILE A CG2  1 
ATOM   1929 C CD1  . ILE A 1 134 ? -12.208 6.205   72.256 1.00 28.10  ?  179 ILE A CD1  1 
ATOM   1930 H H    . ILE A 1 134 ? -12.602 10.492  70.584 1.00 26.32  ?  179 ILE A H    1 
ATOM   1931 H HA   . ILE A 1 134 ? -11.386 10.210  72.989 1.00 26.40  ?  179 ILE A HA   1 
ATOM   1932 H HB   . ILE A 1 134 ? -11.093 8.294   70.920 1.00 28.61  ?  179 ILE A HB   1 
ATOM   1933 H HG12 . ILE A 1 134 ? -12.268 7.846   73.456 1.00 32.93  ?  179 ILE A HG12 1 
ATOM   1934 H HG13 . ILE A 1 134 ? -13.114 8.021   72.126 1.00 32.93  ?  179 ILE A HG13 1 
ATOM   1935 H HG21 . ILE A 1 134 ? -9.658  7.147   72.377 1.00 26.66  ?  179 ILE A HG21 1 
ATOM   1936 H HG22 . ILE A 1 134 ? -9.080  8.593   72.060 1.00 26.66  ?  179 ILE A HG22 1 
ATOM   1937 H HG23 . ILE A 1 134 ? -9.814  8.316   73.442 1.00 26.66  ?  179 ILE A HG23 1 
ATOM   1938 H HD11 . ILE A 1 134 ? -12.968 5.781   72.685 1.00 33.72  ?  179 ILE A HD11 1 
ATOM   1939 H HD12 . ILE A 1 134 ? -12.230 6.037   71.301 1.00 33.72  ?  179 ILE A HD12 1 
ATOM   1940 H HD13 . ILE A 1 134 ? -11.382 5.863   72.633 1.00 33.72  ?  179 ILE A HD13 1 
ATOM   1941 N N    . ILE A 1 135 ? -9.412  11.417  72.221 1.00 19.28  ?  180 ILE A N    1 
ATOM   1942 C CA   . ILE A 1 135 ? -8.199  12.075  71.760 1.00 23.20  ?  180 ILE A CA   1 
ATOM   1943 C C    . ILE A 1 135 ? -7.018  11.374  72.406 1.00 18.84  ?  180 ILE A C    1 
ATOM   1944 O O    . ILE A 1 135 ? -7.081  10.980  73.576 1.00 19.93  ?  180 ILE A O    1 
ATOM   1945 C CB   . ILE A 1 135 ? -8.186  13.583  72.089 1.00 19.94  ?  180 ILE A CB   1 
ATOM   1946 C CG1  . ILE A 1 135 ? -8.301  13.805  73.598 1.00 25.83  ?  180 ILE A CG1  1 
ATOM   1947 C CG2  . ILE A 1 135 ? -9.312  14.284  71.345 1.00 23.56  ?  180 ILE A CG2  1 
ATOM   1948 C CD1  . ILE A 1 135 ? -8.108  15.242  74.021 1.00 30.46  ?  180 ILE A CD1  1 
ATOM   1949 H H    . ILE A 1 135 ? -9.525  11.463  73.072 1.00 23.13  ?  180 ILE A H    1 
ATOM   1950 H HA   . ILE A 1 135 ? -8.125  11.973  70.799 1.00 27.83  ?  180 ILE A HA   1 
ATOM   1951 H HB   . ILE A 1 135 ? -7.342  13.954  71.788 1.00 23.92  ?  180 ILE A HB   1 
ATOM   1952 H HG12 . ILE A 1 135 ? -9.183  13.527  73.889 1.00 30.99  ?  180 ILE A HG12 1 
ATOM   1953 H HG13 . ILE A 1 135 ? -7.625  13.272  74.045 1.00 30.99  ?  180 ILE A HG13 1 
ATOM   1954 H HG21 . ILE A 1 135 ? -9.291  15.229  71.560 1.00 28.27  ?  180 ILE A HG21 1 
ATOM   1955 H HG22 . ILE A 1 135 ? -9.185  14.159  70.391 1.00 28.27  ?  180 ILE A HG22 1 
ATOM   1956 H HG23 . ILE A 1 135 ? -10.159 13.899  71.620 1.00 28.27  ?  180 ILE A HG23 1 
ATOM   1957 H HD11 . ILE A 1 135 ? -8.196  15.301  74.986 1.00 36.55  ?  180 ILE A HD11 1 
ATOM   1958 H HD12 . ILE A 1 135 ? -7.224  15.535  73.750 1.00 36.55  ?  180 ILE A HD12 1 
ATOM   1959 H HD13 . ILE A 1 135 ? -8.785  15.790  73.594 1.00 36.55  ?  180 ILE A HD13 1 
ATOM   1960 N N    . SER A 1 136 ? -5.943  11.220  71.643 1.00 17.12  ?  181 SER A N    1 
ATOM   1961 C CA   . SER A 1 136 ? -4.763  10.530  72.127 1.00 13.69  ?  181 SER A CA   1 
ATOM   1962 C C    . SER A 1 136 ? -3.517  11.192  71.563 1.00 16.46  ?  181 SER A C    1 
ATOM   1963 O O    . SER A 1 136 ? -3.548  11.848  70.519 1.00 15.31  ?  181 SER A O    1 
ATOM   1964 C CB   . SER A 1 136 ? -4.787  9.044   71.741 1.00 18.68  ?  181 SER A CB   1 
ATOM   1965 O OG   . SER A 1 136 ? -4.819  8.889   70.334 1.00 21.99  ?  181 SER A OG   1 
ATOM   1966 H H    . SER A 1 136 ? -5.874  11.509  70.836 1.00 20.54  ?  181 SER A H    1 
ATOM   1967 H HA   . SER A 1 136 ? -4.730  10.593  73.094 1.00 16.43  ?  181 SER A HA   1 
ATOM   1968 H HB2  . SER A 1 136 ? -3.990  8.614   72.089 1.00 22.42  ?  181 SER A HB2  1 
ATOM   1969 H HB3  . SER A 1 136 ? -5.579  8.632   72.122 1.00 22.42  ?  181 SER A HB3  1 
ATOM   1970 H HG   . SER A 1 136 ? -4.138  9.242   69.991 1.00 26.39  ?  181 SER A HG   1 
ATOM   1971 N N    . ILE A 1 137 ? -2.412  11.012  72.276 1.00 14.01  ?  182 ILE A N    1 
ATOM   1972 C CA   . ILE A 1 137 ? -1.100  11.406  71.791 1.00 15.12  ?  182 ILE A CA   1 
ATOM   1973 C C    . ILE A 1 137 ? -0.167  10.222  71.983 1.00 15.58  ?  182 ILE A C    1 
ATOM   1974 O O    . ILE A 1 137 ? -0.152  9.606   73.055 1.00 15.46  ?  182 ILE A O    1 
ATOM   1975 C CB   . ILE A 1 137 ? -0.567  12.661  72.506 1.00 16.58  ?  182 ILE A CB   1 
ATOM   1976 C CG1  . ILE A 1 137 ? 0.754   13.097  71.874 1.00 17.74  ?  182 ILE A CG1  1 
ATOM   1977 C CG2  . ILE A 1 137 ? -0.410  12.418  74.009 1.00 18.40  ?  182 ILE A CG2  1 
ATOM   1978 C CD1  . ILE A 1 137 ? 1.112   14.532  72.141 1.00 19.92  ?  182 ILE A CD1  1 
ATOM   1979 H H    . ILE A 1 137 ? -2.398  10.657  73.059 1.00 16.81  ?  182 ILE A H    1 
ATOM   1980 H HA   . ILE A 1 137 ? -1.155  11.598  70.842 1.00 18.14  ?  182 ILE A HA   1 
ATOM   1981 H HB   . ILE A 1 137 ? -1.211  13.376  72.382 1.00 19.90  ?  182 ILE A HB   1 
ATOM   1982 H HG12 . ILE A 1 137 ? 1.468   12.543  72.227 1.00 21.29  ?  182 ILE A HG12 1 
ATOM   1983 H HG13 . ILE A 1 137 ? 0.693   12.981  70.913 1.00 21.29  ?  182 ILE A HG13 1 
ATOM   1984 H HG21 . ILE A 1 137 ? -0.074  13.226  74.426 1.00 22.08  ?  182 ILE A HG21 1 
ATOM   1985 H HG22 . ILE A 1 137 ? -1.275  12.187  74.382 1.00 22.08  ?  182 ILE A HG22 1 
ATOM   1986 H HG23 . ILE A 1 137 ? 0.215   11.689  74.146 1.00 22.08  ?  182 ILE A HG23 1 
ATOM   1987 H HD11 . ILE A 1 137 ? 1.958   14.731  71.709 1.00 23.90  ?  182 ILE A HD11 1 
ATOM   1988 H HD12 . ILE A 1 137 ? 0.415   15.103  71.782 1.00 23.90  ?  182 ILE A HD12 1 
ATOM   1989 H HD13 . ILE A 1 137 ? 1.190   14.664  73.098 1.00 23.90  ?  182 ILE A HD13 1 
ATOM   1990 N N    . TRP A 1 138 ? 0.583   9.892   70.937 1.00 14.78  ?  183 TRP A N    1 
ATOM   1991 C CA   . TRP A 1 138 ? 1.467   8.739   70.920 1.00 15.43  ?  183 TRP A CA   1 
ATOM   1992 C C    . TRP A 1 138 ? 2.901   9.171   71.186 1.00 16.97  ?  183 TRP A C    1 
ATOM   1993 O O    . TRP A 1 138 ? 3.333   10.244  70.757 1.00 15.22  ?  183 TRP A O    1 
ATOM   1994 C CB   . TRP A 1 138 ? 1.414   8.022   69.568 1.00 15.03  ?  183 TRP A CB   1 
ATOM   1995 C CG   . TRP A 1 138 ? 0.083   7.467   69.177 1.00 17.96  ?  183 TRP A CG   1 
ATOM   1996 C CD1  . TRP A 1 138 ? -1.144  7.839   69.646 1.00 19.47  ?  183 TRP A CD1  1 
ATOM   1997 C CD2  . TRP A 1 138 ? -0.153  6.433   68.218 1.00 17.37  ?  183 TRP A CD2  1 
ATOM   1998 N NE1  . TRP A 1 138 ? -2.128  7.097   69.039 1.00 17.09  ?  183 TRP A NE1  1 
ATOM   1999 C CE2  . TRP A 1 138 ? -1.544  6.225   68.158 1.00 17.92  ?  183 TRP A CE2  1 
ATOM   2000 C CE3  . TRP A 1 138 ? 0.681   5.658   67.405 1.00 17.84  ?  183 TRP A CE3  1 
ATOM   2001 C CZ2  . TRP A 1 138 ? -2.121  5.276   67.319 1.00 17.94  ?  183 TRP A CZ2  1 
ATOM   2002 C CZ3  . TRP A 1 138 ? 0.107   4.716   66.576 1.00 19.34  ?  183 TRP A CZ3  1 
ATOM   2003 C CH2  . TRP A 1 138 ? -1.281  4.534   66.538 1.00 20.49  ?  183 TRP A CH2  1 
ATOM   2004 H H    . TRP A 1 138 ? 0.595   10.339  70.203 1.00 17.73  ?  183 TRP A H    1 
ATOM   2005 H HA   . TRP A 1 138 ? 1.199   8.114   71.612 1.00 18.52  ?  183 TRP A HA   1 
ATOM   2006 H HB2  . TRP A 1 138 ? 1.679   8.651   68.879 1.00 18.04  ?  183 TRP A HB2  1 
ATOM   2007 H HB3  . TRP A 1 138 ? 2.042   7.283   69.589 1.00 18.04  ?  183 TRP A HB3  1 
ATOM   2008 H HD1  . TRP A 1 138 ? -1.292  8.501   70.283 1.00 23.36  ?  183 TRP A HD1  1 
ATOM   2009 H HE1  . TRP A 1 138 ? -2.972  7.168   69.188 1.00 20.51  ?  183 TRP A HE1  1 
ATOM   2010 H HE3  . TRP A 1 138 ? 1.603   5.772   67.426 1.00 21.40  ?  183 TRP A HE3  1 
ATOM   2011 H HZ2  . TRP A 1 138 ? -3.042  5.152   67.291 1.00 21.52  ?  183 TRP A HZ2  1 
ATOM   2012 H HZ3  . TRP A 1 138 ? 0.651   4.196   66.030 1.00 23.21  ?  183 TRP A HZ3  1 
ATOM   2013 H HH2  . TRP A 1 138 ? -1.640  3.893   65.967 1.00 24.58  ?  183 TRP A HH2  1 
ATOM   2014 N N    . ASN A 1 139 ? 3.648   8.311   71.876 1.00 15.68  ?  184 ASN A N    1 
ATOM   2015 C CA   . ASN A 1 139 ? 5.079   8.505   72.055 1.00 14.63  ?  184 ASN A CA   1 
ATOM   2016 C C    . ASN A 1 139 ? 5.805   7.196   71.771 1.00 16.26  ?  184 ASN A C    1 
ATOM   2017 O O    . ASN A 1 139 ? 5.201   6.122   71.689 1.00 18.72  ?  184 ASN A O    1 
ATOM   2018 C CB   . ASN A 1 139 ? 5.414   9.043   73.459 1.00 16.47  ?  184 ASN A CB   1 
ATOM   2019 C CG   . ASN A 1 139 ? 5.127   8.045   74.568 1.00 18.16  ?  184 ASN A CG   1 
ATOM   2020 O OD1  . ASN A 1 139 ? 3.973   7.751   74.873 1.00 18.23  ?  184 ASN A OD1  1 
ATOM   2021 N ND2  . ASN A 1 139 ? 6.182   7.548   75.201 1.00 18.74  ?  184 ASN A ND2  1 
ATOM   2022 H H    . ASN A 1 139 ? 3.344   7.601   72.254 1.00 18.82  ?  184 ASN A H    1 
ATOM   2023 H HA   . ASN A 1 139 ? 5.387   9.160   71.408 1.00 17.56  ?  184 ASN A HA   1 
ATOM   2024 H HB2  . ASN A 1 139 ? 6.358   9.264   73.494 1.00 19.77  ?  184 ASN A HB2  1 
ATOM   2025 H HB3  . ASN A 1 139 ? 4.883   9.837   73.627 1.00 19.77  ?  184 ASN A HB3  1 
ATOM   2026 H HD21 . ASN A 1 139 ? 6.074   6.979   75.837 1.00 22.48  ?  184 ASN A HD21 1 
ATOM   2027 H HD22 . ASN A 1 139 ? 6.975   7.795   74.976 1.00 22.48  ?  184 ASN A HD22 1 
ATOM   2028 N N    . LYS A 1 140 ? 7.126   7.303   71.610 1.00 17.79  ?  185 LYS A N    1 
ATOM   2029 C CA   . LYS A 1 140 ? 7.915   6.205   71.060 1.00 20.94  ?  185 LYS A CA   1 
ATOM   2030 C C    . LYS A 1 140 ? 8.198   5.114   72.088 1.00 20.87  ?  185 LYS A C    1 
ATOM   2031 O O    . LYS A 1 140 ? 8.180   3.926   71.749 1.00 23.48  ?  185 LYS A O    1 
ATOM   2032 C CB   . LYS A 1 140 ? 9.230   6.745   70.499 1.00 20.57  ?  185 LYS A CB   1 
ATOM   2033 C CG   . LYS A 1 140 ? 9.056   7.677   69.310 1.00 26.36  ?  185 LYS A CG   1 
ATOM   2034 C CD   . LYS A 1 140 ? 10.369  8.318   68.902 1.00 26.78  ?  185 LYS A CD   1 
ATOM   2035 C CE   . LYS A 1 140 ? 10.211  9.142   67.633 1.00 26.90  ?  185 LYS A CE   1 
ATOM   2036 N NZ   . LYS A 1 140 ? 9.170   10.200  67.779 1.00 31.10  1  185 LYS A NZ   1 
ATOM   2037 H H    . LYS A 1 140 ? 7.587   8.000   71.813 1.00 21.35  ?  185 LYS A H    1 
ATOM   2038 H HA   . LYS A 1 140 ? 7.423   5.802   70.327 1.00 25.13  ?  185 LYS A HA   1 
ATOM   2039 H HB2  . LYS A 1 140 ? 9.688   7.239   71.197 1.00 24.68  ?  185 LYS A HB2  1 
ATOM   2040 H HB3  . LYS A 1 140 ? 9.778   5.998   70.211 1.00 24.68  ?  185 LYS A HB3  1 
ATOM   2041 H HG2  . LYS A 1 140 ? 8.717   7.171   68.555 1.00 31.63  ?  185 LYS A HG2  1 
ATOM   2042 H HG3  . LYS A 1 140 ? 8.434   8.383   69.547 1.00 31.63  ?  185 LYS A HG3  1 
ATOM   2043 H HD2  . LYS A 1 140 ? 10.673  8.906   69.611 1.00 32.13  ?  185 LYS A HD2  1 
ATOM   2044 H HD3  . LYS A 1 140 ? 11.026  7.625   68.735 1.00 32.13  ?  185 LYS A HD3  1 
ATOM   2045 H HE2  . LYS A 1 140 ? 11.054  9.574   67.427 1.00 32.28  ?  185 LYS A HE2  1 
ATOM   2046 H HE3  . LYS A 1 140 ? 9.947   8.557   66.905 1.00 32.28  ?  185 LYS A HE3  1 
ATOM   2047 H HZ1  . LYS A 1 140 ? 9.100   10.664  67.023 1.00 37.33  ?  185 LYS A HZ1  1 
ATOM   2048 H HZ2  . LYS A 1 140 ? 8.382   9.829   67.965 1.00 37.33  ?  185 LYS A HZ2  1 
ATOM   2049 H HZ3  . LYS A 1 140 ? 9.390   10.755  68.440 1.00 37.33  ?  185 LYS A HZ3  1 
ATOM   2050 N N    . THR A 1 141 ? 8.470   5.489   73.335 1.00 21.36  ?  186 THR A N    1 
ATOM   2051 C CA   . THR A 1 141 ? 8.921   4.552   74.364 1.00 25.30  ?  186 THR A CA   1 
ATOM   2052 C C    . THR A 1 141 ? 7.867   4.493   75.467 1.00 23.52  ?  186 THR A C    1 
ATOM   2053 O O    . THR A 1 141 ? 7.763   5.408   76.291 1.00 22.50  ?  186 THR A O    1 
ATOM   2054 C CB   . THR A 1 141 ? 10.281  4.968   74.917 1.00 26.15  ?  186 THR A CB   1 
ATOM   2055 O OG1  . THR A 1 141 ? 11.201  5.151   73.834 1.00 28.27  ?  186 THR A OG1  1 
ATOM   2056 C CG2  . THR A 1 141 ? 10.826  3.905   75.859 1.00 29.32  ?  186 THR A CG2  1 
ATOM   2057 H H    . THR A 1 141 ? 8.399   6.298   73.617 1.00 25.63  ?  186 THR A H    1 
ATOM   2058 H HA   . THR A 1 141 ? 9.007   3.667   73.977 1.00 30.36  ?  186 THR A HA   1 
ATOM   2059 H HB   . THR A 1 141 ? 10.190  5.799   75.410 1.00 31.38  ?  186 THR A HB   1 
ATOM   2060 H HG1  . THR A 1 141 ? 10.919  5.749   73.315 1.00 33.92  ?  186 THR A HG1  1 
ATOM   2061 H HG21 . THR A 1 141 ? 11.690  4.179   76.204 1.00 35.19  ?  186 THR A HG21 1 
ATOM   2062 H HG22 . THR A 1 141 ? 10.216  3.776   76.602 1.00 35.19  ?  186 THR A HG22 1 
ATOM   2063 H HG23 . THR A 1 141 ? 10.929  3.064   75.385 1.00 35.19  ?  186 THR A HG23 1 
ATOM   2064 N N    . ALA A 1 142 ? 7.089   3.411   75.482 1.00 22.18  ?  187 ALA A N    1 
ATOM   2065 C CA   . ALA A 1 142 ? 6.049   3.267   76.493 1.00 22.89  ?  187 ALA A CA   1 
ATOM   2066 C C    . ALA A 1 142 ? 6.638   3.147   77.891 1.00 25.89  ?  187 ALA A C    1 
ATOM   2067 O O    . ALA A 1 142 ? 6.034   3.623   78.860 1.00 25.50  ?  187 ALA A O    1 
ATOM   2068 C CB   . ALA A 1 142 ? 5.177   2.052   76.182 1.00 23.97  ?  187 ALA A CB   1 
ATOM   2069 H H    . ALA A 1 142 ? 7.144   2.756   74.927 1.00 26.62  ?  187 ALA A H    1 
ATOM   2070 H HA   . ALA A 1 142 ? 5.482   4.054   76.475 1.00 27.47  ?  187 ALA A HA   1 
ATOM   2071 H HB1  . ALA A 1 142 ? 4.492   1.972   76.864 1.00 28.76  ?  187 ALA A HB1  1 
ATOM   2072 H HB2  . ALA A 1 142 ? 4.767   2.173   75.312 1.00 28.76  ?  187 ALA A HB2  1 
ATOM   2073 H HB3  . ALA A 1 142 ? 5.734   1.258   76.178 1.00 28.76  ?  187 ALA A HB3  1 
ATOM   2074 N N    . SER A 1 143 ? 7.810   2.529   78.015 1.00 28.68  ?  188 SER A N    1 
ATOM   2075 C CA   . SER A 1 143 ? 8.409   2.257   79.314 1.00 31.06  ?  188 SER A CA   1 
ATOM   2076 C C    . SER A 1 143 ? 9.170   3.445   79.889 1.00 30.47  ?  188 SER A C    1 
ATOM   2077 O O    . SER A 1 143 ? 9.673   3.347   81.013 1.00 33.64  ?  188 SER A O    1 
ATOM   2078 C CB   . SER A 1 143 ? 9.343   1.050   79.207 1.00 30.44  ?  188 SER A CB   1 
ATOM   2079 O OG   . SER A 1 143 ? 10.321  1.248   78.201 1.00 37.74  ?  188 SER A OG   1 
ATOM   2080 H H    . SER A 1 143 ? 8.283   2.255   77.351 1.00 34.41  ?  188 SER A H    1 
ATOM   2081 H HA   . SER A 1 143 ? 7.703   2.029   79.940 1.00 37.28  ?  188 SER A HA   1 
ATOM   2082 H HB2  . SER A 1 143 ? 9.789   0.920   80.059 1.00 36.53  ?  188 SER A HB2  1 
ATOM   2083 H HB3  . SER A 1 143 ? 8.819   0.264   78.985 1.00 36.53  ?  188 SER A HB3  1 
ATOM   2084 H HG   . SER A 1 143 ? 9.949   1.361   77.457 1.00 45.29  ?  188 SER A HG   1 
ATOM   2085 N N    . ASP A 1 144 ? 9.268   4.557   79.162 1.00 26.42  ?  189 ASP A N    1 
ATOM   2086 C CA   . ASP A 1 144 ? 9.951   5.752   79.660 1.00 27.44  ?  189 ASP A CA   1 
ATOM   2087 C C    . ASP A 1 144 ? 8.984   6.516   80.555 1.00 29.53  ?  189 ASP A C    1 
ATOM   2088 O O    . ASP A 1 144 ? 8.202   7.351   80.098 1.00 28.68  ?  189 ASP A O    1 
ATOM   2089 C CB   . ASP A 1 144 ? 10.440  6.615   78.503 1.00 29.75  ?  189 ASP A CB   1 
ATOM   2090 C CG   . ASP A 1 144 ? 11.144  7.875   78.972 1.00 31.69  ?  189 ASP A CG   1 
ATOM   2091 O OD1  . ASP A 1 144 ? 11.249  8.081   80.199 1.00 32.92  ?  189 ASP A OD1  1 
ATOM   2092 O OD2  . ASP A 1 144 ? 11.584  8.669   78.112 1.00 31.49  -1 189 ASP A OD2  1 
ATOM   2093 H H    . ASP A 1 144 ? 8.945   4.646   78.370 1.00 31.71  ?  189 ASP A H    1 
ATOM   2094 H HA   . ASP A 1 144 ? 10.718  5.488   80.191 1.00 32.93  ?  189 ASP A HA   1 
ATOM   2095 H HB2  . ASP A 1 144 ? 11.067  6.102   77.968 1.00 35.71  ?  189 ASP A HB2  1 
ATOM   2096 H HB3  . ASP A 1 144 ? 9.680   6.879   77.962 1.00 35.71  ?  189 ASP A HB3  1 
ATOM   2097 N N    . GLN A 1 145 ? 9.054   6.237   81.859 1.00 32.92  ?  190 GLN A N    1 
ATOM   2098 C CA   . GLN A 1 145 ? 8.094   6.813   82.796 1.00 31.53  ?  190 GLN A CA   1 
ATOM   2099 C C    . GLN A 1 145 ? 8.258   8.324   82.908 1.00 27.70  ?  190 GLN A C    1 
ATOM   2100 O O    . GLN A 1 145 ? 7.267   9.052   83.037 1.00 27.62  ?  190 GLN A O    1 
ATOM   2101 C CB   . GLN A 1 145 ? 8.246   6.152   84.166 1.00 38.04  ?  190 GLN A CB   1 
ATOM   2102 C CG   . GLN A 1 145 ? 7.176   6.553   85.168 1.00 42.54  ?  190 GLN A CG   1 
ATOM   2103 C CD   . GLN A 1 145 ? 7.302   5.807   86.482 1.00 50.86  ?  190 GLN A CD   1 
ATOM   2104 O OE1  . GLN A 1 145 ? 8.097   4.875   86.605 1.00 51.91  ?  190 GLN A OE1  1 
ATOM   2105 N NE2  . GLN A 1 145 ? 6.518   6.218   87.474 1.00 57.44  ?  190 GLN A NE2  1 
ATOM   2106 H H    . GLN A 1 145 ? 9.641   5.723   82.221 1.00 39.51  ?  190 GLN A H    1 
ATOM   2107 H HA   . GLN A 1 145 ? 7.196   6.633   82.476 1.00 37.83  ?  190 GLN A HA   1 
ATOM   2108 H HB2  . GLN A 1 145 ? 8.201   5.190   84.055 1.00 45.65  ?  190 GLN A HB2  1 
ATOM   2109 H HB3  . GLN A 1 145 ? 9.107   6.400   84.538 1.00 45.65  ?  190 GLN A HB3  1 
ATOM   2110 H HG2  . GLN A 1 145 ? 7.254   7.502   85.353 1.00 51.05  ?  190 GLN A HG2  1 
ATOM   2111 H HG3  . GLN A 1 145 ? 6.303   6.358   84.794 1.00 51.05  ?  190 GLN A HG3  1 
ATOM   2112 H HE21 . GLN A 1 145 ? 5.977   6.875   87.350 1.00 68.93  ?  190 GLN A HE21 1 
ATOM   2113 H HE22 . GLN A 1 145 ? 6.552   5.827   88.239 1.00 68.93  ?  190 GLN A HE22 1 
ATOM   2114 N N    . ALA A 1 146 ? 9.497   8.819   82.867 1.00 30.60  ?  191 ALA A N    1 
ATOM   2115 C CA   . ALA A 1 146 ? 9.711   10.261  82.938 1.00 32.02  ?  191 ALA A CA   1 
ATOM   2116 C C    . ALA A 1 146 ? 9.050   10.970  81.762 1.00 28.14  ?  191 ALA A C    1 
ATOM   2117 O O    . ALA A 1 146 ? 8.495   12.065  81.920 1.00 31.26  ?  191 ALA A O    1 
ATOM   2118 C CB   . ALA A 1 146 ? 11.206  10.575  82.981 1.00 37.38  ?  191 ALA A CB   1 
ATOM   2119 H H    . ALA A 1 146 ? 10.215  8.350   82.800 1.00 36.72  ?  191 ALA A H    1 
ATOM   2120 H HA   . ALA A 1 146 ? 9.311   10.599  83.754 1.00 38.42  ?  191 ALA A HA   1 
ATOM   2121 H HB1  . ALA A 1 146 ? 11.326  11.536  83.028 1.00 44.85  ?  191 ALA A HB1  1 
ATOM   2122 H HB2  . ALA A 1 146 ? 11.594  10.154  83.764 1.00 44.85  ?  191 ALA A HB2  1 
ATOM   2123 H HB3  . ALA A 1 146 ? 11.625  10.227  82.178 1.00 44.85  ?  191 ALA A HB3  1 
ATOM   2124 N N    . THR A 1 147 ? 9.090   10.357  80.577 1.00 26.13  ?  192 THR A N    1 
ATOM   2125 C CA   . THR A 1 147 ? 8.447   10.954  79.409 1.00 27.72  ?  192 THR A CA   1 
ATOM   2126 C C    . THR A 1 147 ? 6.929   10.865  79.512 1.00 26.72  ?  192 THR A C    1 
ATOM   2127 O O    . THR A 1 147 ? 6.222   11.846  79.253 1.00 27.14  ?  192 THR A O    1 
ATOM   2128 C CB   . THR A 1 147 ? 8.941   10.272  78.130 1.00 26.11  ?  192 THR A CB   1 
ATOM   2129 O OG1  . THR A 1 147 ? 10.317  10.607  77.910 1.00 27.60  ?  192 THR A OG1  1 
ATOM   2130 C CG2  . THR A 1 147 ? 8.114   10.706  76.913 1.00 25.77  ?  192 THR A CG2  1 
ATOM   2131 H H    . THR A 1 147 ? 9.478   9.605   80.425 1.00 31.36  ?  192 THR A H    1 
ATOM   2132 H HA   . THR A 1 147 ? 8.690   11.892  79.361 1.00 33.27  ?  192 THR A HA   1 
ATOM   2133 H HB   . THR A 1 147 ? 8.857   9.311   78.228 1.00 31.34  ?  192 THR A HB   1 
ATOM   2134 H HG1  . THR A 1 147 ? 10.594  10.236  77.209 1.00 33.11  ?  192 THR A HG1  1 
ATOM   2135 H HG21 . THR A 1 147 ? 8.442   10.263  76.115 1.00 30.92  ?  192 THR A HG21 1 
ATOM   2136 H HG22 . THR A 1 147 ? 7.182   10.470  77.044 1.00 30.92  ?  192 THR A HG22 1 
ATOM   2137 H HG23 . THR A 1 147 ? 8.182   11.666  76.792 1.00 30.92  ?  192 THR A HG23 1 
ATOM   2138 N N    . THR A 1 148 ? 6.404   9.693   79.880 1.00 24.15  ?  193 THR A N    1 
ATOM   2139 C CA   . THR A 1 148 ? 4.954   9.529   79.931 1.00 22.84  ?  193 THR A CA   1 
ATOM   2140 C C    . THR A 1 148 ? 4.332   10.413  81.002 1.00 23.43  ?  193 THR A C    1 
ATOM   2141 O O    . THR A 1 148 ? 3.191   10.862  80.845 1.00 25.33  ?  193 THR A O    1 
ATOM   2142 C CB   . THR A 1 148 ? 4.583   8.063   80.177 1.00 22.98  ?  193 THR A CB   1 
ATOM   2143 O OG1  . THR A 1 148 ? 5.149   7.616   81.414 1.00 27.84  ?  193 THR A OG1  1 
ATOM   2144 C CG2  . THR A 1 148 ? 5.079   7.181   79.037 1.00 20.05  ?  193 THR A CG2  1 
ATOM   2145 H H    . THR A 1 148 ? 6.855   8.994   80.099 1.00 28.98  ?  193 THR A H    1 
ATOM   2146 H HA   . THR A 1 148 ? 4.580   9.791   79.075 1.00 27.41  ?  193 THR A HA   1 
ATOM   2147 H HB   . THR A 1 148 ? 3.617   7.983   80.222 1.00 27.58  ?  193 THR A HB   1 
ATOM   2148 H HG1  . THR A 1 148 ? 4.857   8.081   82.049 1.00 33.41  ?  193 THR A HG1  1 
ATOM   2149 H HG21 . THR A 1 148 ? 4.838   6.257   79.204 1.00 24.06  ?  193 THR A HG21 1 
ATOM   2150 H HG22 . THR A 1 148 ? 4.679   7.465   78.200 1.00 24.06  ?  193 THR A HG22 1 
ATOM   2151 H HG23 . THR A 1 148 ? 6.044   7.247   78.963 1.00 24.06  ?  193 THR A HG23 1 
ATOM   2152 N N    . ALA A 1 149 ? 5.058   10.677  82.090 1.00 23.54  ?  194 ALA A N    1 
ATOM   2153 C CA   . ALA A 1 149 ? 4.541   11.575  83.118 1.00 27.78  ?  194 ALA A CA   1 
ATOM   2154 C C    . ALA A 1 149 ? 4.570   13.021  82.645 1.00 25.45  ?  194 ALA A C    1 
ATOM   2155 O O    . ALA A 1 149 ? 3.606   13.766  82.850 1.00 25.34  ?  194 ALA A O    1 
ATOM   2156 C CB   . ALA A 1 149 ? 5.344   11.419  84.409 1.00 25.88  ?  194 ALA A CB   1 
ATOM   2157 H H    . ALA A 1 149 ? 5.838   10.355  82.252 1.00 28.24  ?  194 ALA A H    1 
ATOM   2158 H HA   . ALA A 1 149 ? 3.620   11.340  83.308 1.00 33.33  ?  194 ALA A HA   1 
ATOM   2159 H HB1  . ALA A 1 149 ? 4.986   12.023  85.078 1.00 31.05  ?  194 ALA A HB1  1 
ATOM   2160 H HB2  . ALA A 1 149 ? 5.271   10.502  84.717 1.00 31.05  ?  194 ALA A HB2  1 
ATOM   2161 H HB3  . ALA A 1 149 ? 6.273   11.635  84.231 1.00 31.05  ?  194 ALA A HB3  1 
ATOM   2162 N N    . ARG A 1 150 ? 5.665   13.438  82.006 1.00 24.63  ?  195 ARG A N    1 
ATOM   2163 C CA   . ARG A 1 150 ? 5.728   14.799  81.483 1.00 30.12  ?  195 ARG A CA   1 
ATOM   2164 C C    . ARG A 1 150 ? 4.653   15.023  80.426 1.00 23.46  ?  195 ARG A C    1 
ATOM   2165 O O    . ARG A 1 150 ? 4.011   16.081  80.398 1.00 21.17  ?  195 ARG A O    1 
ATOM   2166 C CB   . ARG A 1 150 ? 7.118   15.084  80.913 1.00 31.24  ?  195 ARG A CB   1 
ATOM   2167 C CG   . ARG A 1 150 ? 7.330   16.543  80.538 1.00 36.72  ?  195 ARG A CG   1 
ATOM   2168 C CD   . ARG A 1 150 ? 8.729   16.803  80.008 1.00 37.35  ?  195 ARG A CD   1 
ATOM   2169 N NE   . ARG A 1 150 ? 9.744   16.777  81.058 1.00 44.50  ?  195 ARG A NE   1 
ATOM   2170 C CZ   . ARG A 1 150 ? 10.412  15.691  81.439 1.00 47.90  ?  195 ARG A CZ   1 
ATOM   2171 N NH1  . ARG A 1 150 ? 10.178  14.518  80.865 1.00 47.90  1  195 ARG A NH1  1 
ATOM   2172 N NH2  . ARG A 1 150 ? 11.320  15.778  82.401 1.00 53.15  ?  195 ARG A NH2  1 
ATOM   2173 H H    . ARG A 1 150 ? 6.369   12.964  81.866 1.00 29.56  ?  195 ARG A H    1 
ATOM   2174 H HA   . ARG A 1 150 ? 5.568   15.423  82.208 1.00 36.14  ?  195 ARG A HA   1 
ATOM   2175 H HB2  . ARG A 1 150 ? 7.784   14.846  81.577 1.00 37.49  ?  195 ARG A HB2  1 
ATOM   2176 H HB3  . ARG A 1 150 ? 7.245   14.549  80.113 1.00 37.49  ?  195 ARG A HB3  1 
ATOM   2177 H HG2  . ARG A 1 150 ? 6.695   16.789  79.848 1.00 44.06  ?  195 ARG A HG2  1 
ATOM   2178 H HG3  . ARG A 1 150 ? 7.198   17.095  81.325 1.00 44.06  ?  195 ARG A HG3  1 
ATOM   2179 H HD2  . ARG A 1 150 ? 8.953   16.120  79.357 1.00 44.83  ?  195 ARG A HD2  1 
ATOM   2180 H HD3  . ARG A 1 150 ? 8.751   17.679  79.591 1.00 44.83  ?  195 ARG A HD3  1 
ATOM   2181 H HE   . ARG A 1 150 ? 9.923   17.516  81.459 1.00 53.40  ?  195 ARG A HE   1 
ATOM   2182 H HH11 . ARG A 1 150 ? 9.592   14.454  80.239 1.00 57.48  ?  195 ARG A HH11 1 
ATOM   2183 H HH12 . ARG A 1 150 ? 10.614  13.821  81.118 1.00 57.48  ?  195 ARG A HH12 1 
ATOM   2184 H HH21 . ARG A 1 150 ? 11.476  16.535  82.778 1.00 63.77  ?  195 ARG A HH21 1 
ATOM   2185 H HH22 . ARG A 1 150 ? 11.751  15.077  82.651 1.00 63.77  ?  195 ARG A HH22 1 
ATOM   2186 N N    . ILE A 1 151 ? 4.437   14.035  79.552 1.00 22.62  ?  196 ILE A N    1 
ATOM   2187 C CA   . ILE A 1 151 ? 3.339   14.114  78.589 1.00 20.60  ?  196 ILE A CA   1 
ATOM   2188 C C    . ILE A 1 151 ? 2.013   14.265  79.323 1.00 21.34  ?  196 ILE A C    1 
ATOM   2189 O O    . ILE A 1 151 ? 1.184   15.116  78.983 1.00 21.25  ?  196 ILE A O    1 
ATOM   2190 C CB   . ILE A 1 151 ? 3.337   12.875  77.671 1.00 20.31  ?  196 ILE A CB   1 
ATOM   2191 C CG1  . ILE A 1 151 ? 4.576   12.872  76.772 1.00 22.09  ?  196 ILE A CG1  1 
ATOM   2192 C CG2  . ILE A 1 151 ? 2.063   12.827  76.820 1.00 17.71  ?  196 ILE A CG2  1 
ATOM   2193 C CD1  . ILE A 1 151 ? 4.759   11.580  75.974 1.00 20.45  ?  196 ILE A CD1  1 
ATOM   2194 H H    . ILE A 1 151 ? 4.907   13.317  79.497 1.00 27.14  ?  196 ILE A H    1 
ATOM   2195 H HA   . ILE A 1 151 ? 3.463   14.898  78.032 1.00 24.72  ?  196 ILE A HA   1 
ATOM   2196 H HB   . ILE A 1 151 ? 3.362   12.082  78.229 1.00 24.38  ?  196 ILE A HB   1 
ATOM   2197 H HG12 . ILE A 1 151 ? 4.504   13.603  76.139 1.00 26.51  ?  196 ILE A HG12 1 
ATOM   2198 H HG13 . ILE A 1 151 ? 5.364   12.992  77.325 1.00 26.51  ?  196 ILE A HG13 1 
ATOM   2199 H HG21 . ILE A 1 151 ? 2.091   12.040  76.254 1.00 21.26  ?  196 ILE A HG21 1 
ATOM   2200 H HG22 . ILE A 1 151 ? 1.293   12.786  77.408 1.00 21.26  ?  196 ILE A HG22 1 
ATOM   2201 H HG23 . ILE A 1 151 ? 2.020   13.627  76.272 1.00 21.26  ?  196 ILE A HG23 1 
ATOM   2202 H HD11 . ILE A 1 151 ? 5.560   11.655  75.432 1.00 24.54  ?  196 ILE A HD11 1 
ATOM   2203 H HD12 . ILE A 1 151 ? 4.845   10.837  76.592 1.00 24.54  ?  196 ILE A HD12 1 
ATOM   2204 H HD13 . ILE A 1 151 ? 3.985   11.449  75.404 1.00 24.54  ?  196 ILE A HD13 1 
ATOM   2205 N N    . ARG A 1 152 ? 1.795   13.430  80.342 1.00 22.39  ?  197 ARG A N    1 
ATOM   2206 C CA   . ARG A 1 152 ? 0.596   13.537  81.165 1.00 21.76  ?  197 ARG A CA   1 
ATOM   2207 C C    . ARG A 1 152 ? 0.429   14.945  81.722 1.00 21.99  ?  197 ARG A C    1 
ATOM   2208 O O    . ARG A 1 152 ? -0.649  15.543  81.626 1.00 18.16  ?  197 ARG A O    1 
ATOM   2209 C CB   . ARG A 1 152 ? 0.673   12.522  82.304 1.00 23.70  ?  197 ARG A CB   1 
ATOM   2210 C CG   . ARG A 1 152 ? -0.485  12.568  83.288 1.00 20.79  ?  197 ARG A CG   1 
ATOM   2211 C CD   . ARG A 1 152 ? -0.086  11.907  84.583 1.00 23.15  ?  197 ARG A CD   1 
ATOM   2212 N NE   . ARG A 1 152 ? 1.012   12.622  85.231 1.00 26.01  ?  197 ARG A NE   1 
ATOM   2213 C CZ   . ARG A 1 152 ? 1.960   12.052  85.968 1.00 29.15  ?  197 ARG A CZ   1 
ATOM   2214 N NH1  . ARG A 1 152 ? 1.968   10.738  86.162 1.00 34.90  1  197 ARG A NH1  1 
ATOM   2215 N NH2  . ARG A 1 152 ? 2.912   12.800  86.507 1.00 34.02  ?  197 ARG A NH2  1 
ATOM   2216 H H    . ARG A 1 152 ? 2.327   12.795  80.574 1.00 26.87  ?  197 ARG A H    1 
ATOM   2217 H HA   . ARG A 1 152 ? -0.183  13.329  80.625 1.00 26.11  ?  197 ARG A HA   1 
ATOM   2218 H HB2  . ARG A 1 152 ? 0.696   11.631  81.921 1.00 28.45  ?  197 ARG A HB2  1 
ATOM   2219 H HB3  . ARG A 1 152 ? 1.488   12.682  82.804 1.00 28.45  ?  197 ARG A HB3  1 
ATOM   2220 H HG2  . ARG A 1 152 ? -0.719  13.491  83.472 1.00 24.94  ?  197 ARG A HG2  1 
ATOM   2221 H HG3  . ARG A 1 152 ? -1.244  12.091  82.919 1.00 24.94  ?  197 ARG A HG3  1 
ATOM   2222 H HD2  . ARG A 1 152 ? -0.845  11.902  85.188 1.00 27.78  ?  197 ARG A HD2  1 
ATOM   2223 H HD3  . ARG A 1 152 ? 0.206   10.999  84.403 1.00 27.78  ?  197 ARG A HD3  1 
ATOM   2224 H HE   . ARG A 1 152 ? 1.047   13.475  85.127 1.00 31.21  ?  197 ARG A HE   1 
ATOM   2225 H HH11 . ARG A 1 152 ? 1.354   10.248  85.813 1.00 41.88  ?  197 ARG A HH11 1 
ATOM   2226 H HH12 . ARG A 1 152 ? 2.586   10.378  86.639 1.00 41.88  ?  197 ARG A HH12 1 
ATOM   2227 H HH21 . ARG A 1 152 ? 2.912   13.651  86.383 1.00 40.82  ?  197 ARG A HH21 1 
ATOM   2228 H HH22 . ARG A 1 152 ? 3.528   12.435  86.984 1.00 40.82  ?  197 ARG A HH22 1 
ATOM   2229 N N    . ASP A 1 153 ? 1.491   15.486  82.324 1.00 24.14  ?  198 ASP A N    1 
ATOM   2230 C CA   . ASP A 1 153 ? 1.395   16.791  82.970 1.00 26.19  ?  198 ASP A CA   1 
ATOM   2231 C C    . ASP A 1 153 ? 1.084   17.893  81.966 1.00 24.36  ?  198 ASP A C    1 
ATOM   2232 O O    . ASP A 1 153 ? 0.367   18.846  82.293 1.00 23.81  ?  198 ASP A O    1 
ATOM   2233 C CB   . ASP A 1 153 ? 2.695   17.093  83.718 1.00 29.46  ?  198 ASP A CB   1 
ATOM   2234 C CG   . ASP A 1 153 ? 3.074   15.993  84.700 1.00 40.04  ?  198 ASP A CG   1 
ATOM   2235 O OD1  . ASP A 1 153 ? 2.161   15.331  85.242 1.00 37.44  ?  198 ASP A OD1  1 
ATOM   2236 O OD2  . ASP A 1 153 ? 4.287   15.786  84.930 1.00 44.67  -1 198 ASP A OD2  1 
ATOM   2237 H H    . ASP A 1 153 ? 2.268   15.120  82.372 1.00 28.97  ?  198 ASP A H    1 
ATOM   2238 H HA   . ASP A 1 153 ? 0.675   16.767  83.620 1.00 31.43  ?  198 ASP A HA   1 
ATOM   2239 H HB2  . ASP A 1 153 ? 3.416   17.185  83.076 1.00 35.36  ?  198 ASP A HB2  1 
ATOM   2240 H HB3  . ASP A 1 153 ? 2.588   17.918  84.217 1.00 35.36  ?  198 ASP A HB3  1 
ATOM   2241 N N    . THR A 1 154 ? 1.603   17.783  80.742 1.00 25.29  ?  199 THR A N    1 
ATOM   2242 C CA   A THR A 1 154 ? 1.339   18.797  79.725 0.50 23.49  ?  199 THR A CA   1 
ATOM   2243 C CA   B THR A 1 154 ? 1.333   18.807  79.739 0.50 23.52  ?  199 THR A CA   1 
ATOM   2244 C C    . THR A 1 154 ? -0.095  18.707  79.218 1.00 22.05  ?  199 THR A C    1 
ATOM   2245 O O    . THR A 1 154 ? -0.724  19.729  78.926 1.00 20.04  ?  199 THR A O    1 
ATOM   2246 C CB   A THR A 1 154 ? 2.322   18.644  78.563 0.50 24.13  ?  199 THR A CB   1 
ATOM   2247 C CB   B THR A 1 154 ? 2.329   18.688  78.590 0.50 23.83  ?  199 THR A CB   1 
ATOM   2248 O OG1  A THR A 1 154 ? 3.666   18.747  79.050 0.50 25.92  ?  199 THR A OG1  1 
ATOM   2249 O OG1  B THR A 1 154 ? 2.237   17.378  78.023 0.50 25.73  ?  199 THR A OG1  1 
ATOM   2250 C CG2  A THR A 1 154 ? 2.088   19.713  77.504 0.50 24.36  ?  199 THR A CG2  1 
ATOM   2251 C CG2  B THR A 1 154 ? 3.742   18.923  79.090 0.50 26.05  ?  199 THR A CG2  1 
ATOM   2252 H H    A THR A 1 154 ? 2.106   17.137  80.479 0.50 30.35  ?  199 THR A H    1 
ATOM   2253 H H    B THR A 1 154 ? 2.104   17.138  80.473 0.50 30.35  ?  199 THR A H    1 
ATOM   2254 H HA   A THR A 1 154 ? 1.466   19.677  80.114 0.50 28.19  ?  199 THR A HA   1 
ATOM   2255 H HA   B THR A 1 154 ? 1.444   19.682  80.143 0.50 28.23  ?  199 THR A HA   1 
ATOM   2256 H HB   A THR A 1 154 ? 2.197   17.775  78.151 0.50 28.96  ?  199 THR A HB   1 
ATOM   2257 H HB   B THR A 1 154 ? 2.125   19.351  77.913 0.50 28.60  ?  199 THR A HB   1 
ATOM   2258 H HG1  A THR A 1 154 ? 3.813   18.144  79.616 0.50 31.11  ?  199 THR A HG1  1 
ATOM   2259 H HG1  B THR A 1 154 ? 1.459   17.244  77.733 0.50 30.88  ?  199 THR A HG1  1 
ATOM   2260 H HG21 A THR A 1 154 ? 2.718   19.601  76.776 0.50 29.23  ?  199 THR A HG21 1 
ATOM   2261 H HG21 B THR A 1 154 ? 4.370   18.846  78.355 0.50 31.26  ?  199 THR A HG21 1 
ATOM   2262 H HG22 A THR A 1 154 ? 1.186   19.641  77.154 0.50 29.23  ?  199 THR A HG22 1 
ATOM   2263 H HG22 B THR A 1 154 ? 3.814   19.811  79.474 0.50 31.26  ?  199 THR A HG22 1 
ATOM   2264 H HG23 A THR A 1 154 ? 2.206   20.594  77.892 0.50 29.23  ?  199 THR A HG23 1 
ATOM   2265 H HG23 B THR A 1 154 ? 3.967   18.267  79.768 0.50 31.26  ?  199 THR A HG23 1 
ATOM   2266 N N    . LEU A 1 155 ? -0.625  17.488  79.095 1.00 20.08  ?  200 LEU A N    1 
ATOM   2267 C CA   . LEU A 1 155 ? -1.995  17.333  78.626 1.00 17.69  ?  200 LEU A CA   1 
ATOM   2268 C C    . LEU A 1 155 ? -2.980  18.015  79.565 1.00 22.42  ?  200 LEU A C    1 
ATOM   2269 O O    . LEU A 1 155 ? -3.921  18.678  79.113 1.00 24.06  ?  200 LEU A O    1 
ATOM   2270 C CB   . LEU A 1 155 ? -2.340  15.849  78.479 1.00 21.68  ?  200 LEU A CB   1 
ATOM   2271 C CG   . LEU A 1 155 ? -1.822  15.138  77.228 1.00 20.87  ?  200 LEU A CG   1 
ATOM   2272 C CD1  . LEU A 1 155 ? -2.041  13.631  77.344 1.00 22.22  ?  200 LEU A CD1  1 
ATOM   2273 C CD2  . LEU A 1 155 ? -2.501  15.679  75.974 1.00 22.36  ?  200 LEU A CD2  1 
ATOM   2274 H H    . LEU A 1 155 ? -0.218  16.751  79.274 1.00 24.10  ?  200 LEU A H    1 
ATOM   2275 H HA   . LEU A 1 155 ? -2.078  17.747  77.753 1.00 21.22  ?  200 LEU A HA   1 
ATOM   2276 H HB2  . LEU A 1 155 ? -1.978  15.378  79.246 1.00 26.02  ?  200 LEU A HB2  1 
ATOM   2277 H HB3  . LEU A 1 155 ? -3.306  15.762  78.477 1.00 26.02  ?  200 LEU A HB3  1 
ATOM   2278 H HG   . LEU A 1 155 ? -0.869  15.297  77.146 1.00 25.05  ?  200 LEU A HG   1 
ATOM   2279 H HD11 . LEU A 1 155 ? -1.706  13.201  76.541 1.00 26.67  ?  200 LEU A HD11 1 
ATOM   2280 H HD12 . LEU A 1 155 ? -1.563  13.302  78.120 1.00 26.67  ?  200 LEU A HD12 1 
ATOM   2281 H HD13 . LEU A 1 155 ? -2.990  13.457  77.441 1.00 26.67  ?  200 LEU A HD13 1 
ATOM   2282 H HD21 . LEU A 1 155 ? -2.153  15.210  75.200 1.00 26.83  ?  200 LEU A HD21 1 
ATOM   2283 H HD22 . LEU A 1 155 ? -3.458  15.535  76.047 1.00 26.83  ?  200 LEU A HD22 1 
ATOM   2284 H HD23 . LEU A 1 155 ? -2.314  16.628  75.899 1.00 26.83  ?  200 LEU A HD23 1 
ATOM   2285 N N    . ARG A 1 156 ? -2.786  17.868  80.877 1.00 20.80  ?  201 ARG A N    1 
ATOM   2286 C CA   . ARG A 1 156 ? -3.710  18.489  81.818 1.00 23.50  ?  201 ARG A CA   1 
ATOM   2287 C C    . ARG A 1 156 ? -3.638  20.009  81.746 1.00 26.48  ?  201 ARG A C    1 
ATOM   2288 O O    . ARG A 1 156 ? -4.636  20.688  82.008 1.00 30.81  ?  201 ARG A O    1 
ATOM   2289 C CB   . ARG A 1 156 ? -3.429  18.003  83.240 1.00 22.87  ?  201 ARG A CB   1 
ATOM   2290 C CG   . ARG A 1 156 ? -3.817  16.546  83.473 1.00 22.53  ?  201 ARG A CG   1 
ATOM   2291 C CD   . ARG A 1 156 ? -4.227  16.287  84.914 1.00 19.10  ?  201 ARG A CD   1 
ATOM   2292 N NE   . ARG A 1 156 ? -4.655  14.903  85.118 1.00 20.44  ?  201 ARG A NE   1 
ATOM   2293 C CZ   . ARG A 1 156 ? -5.895  14.456  84.932 1.00 21.39  ?  201 ARG A CZ   1 
ATOM   2294 N NH1  . ARG A 1 156 ? -6.179  13.176  85.144 1.00 17.33  1  201 ARG A NH1  1 
ATOM   2295 N NH2  . ARG A 1 156 ? -6.855  15.281  84.536 1.00 21.81  ?  201 ARG A NH2  1 
ATOM   2296 H H    . ARG A 1 156 ? -2.143  17.425  81.238 1.00 24.96  ?  201 ARG A H    1 
ATOM   2297 H HA   . ARG A 1 156 ? -4.615  18.224  81.588 1.00 28.20  ?  201 ARG A HA   1 
ATOM   2298 H HB2  . ARG A 1 156 ? -2.479  18.089  83.419 1.00 27.45  ?  201 ARG A HB2  1 
ATOM   2299 H HB3  . ARG A 1 156 ? -3.933  18.549  83.863 1.00 27.45  ?  201 ARG A HB3  1 
ATOM   2300 H HG2  . ARG A 1 156 ? -4.568  16.322  82.900 1.00 27.03  ?  201 ARG A HG2  1 
ATOM   2301 H HG3  . ARG A 1 156 ? -3.059  15.978  83.267 1.00 27.03  ?  201 ARG A HG3  1 
ATOM   2302 H HD2  . ARG A 1 156 ? -3.471  16.460  85.496 1.00 22.92  ?  201 ARG A HD2  1 
ATOM   2303 H HD3  . ARG A 1 156 ? -4.967  16.870  85.145 1.00 22.92  ?  201 ARG A HD3  1 
ATOM   2304 H HE   . ARG A 1 156 ? -4.062  14.336  85.376 1.00 24.52  ?  201 ARG A HE   1 
ATOM   2305 H HH11 . ARG A 1 156 ? -5.561  12.636  85.402 1.00 20.79  ?  201 ARG A HH11 1 
ATOM   2306 H HH12 . ARG A 1 156 ? -6.980  12.888  85.025 1.00 20.79  ?  201 ARG A HH12 1 
ATOM   2307 H HH21 . ARG A 1 156 ? -6.679  16.111  84.396 1.00 26.17  ?  201 ARG A HH21 1 
ATOM   2308 H HH22 . ARG A 1 156 ? -7.655  14.986  84.418 1.00 26.17  ?  201 ARG A HH22 1 
ATOM   2309 N N    . ARG A 1 157 ? -2.481  20.557  81.374 1.00 26.39  ?  202 ARG A N    1 
ATOM   2310 C CA   A ARG A 1 157 ? -2.340  22.008  81.245 0.50 28.69  ?  202 ARG A CA   1 
ATOM   2311 C CA   B ARG A 1 157 ? -2.343  22.008  81.247 0.50 28.69  ?  202 ARG A CA   1 
ATOM   2312 C C    . ARG A 1 157 ? -2.932  22.499  79.926 1.00 30.04  ?  202 ARG A C    1 
ATOM   2313 O O    . ARG A 1 157 ? -3.938  23.215  79.911 1.00 30.56  ?  202 ARG A O    1 
ATOM   2314 C CB   A ARG A 1 157 ? -0.864  22.403  81.360 0.50 28.52  ?  202 ARG A CB   1 
ATOM   2315 C CB   B ARG A 1 157 ? -0.868  22.408  81.373 0.50 28.52  ?  202 ARG A CB   1 
ATOM   2316 C CG   A ARG A 1 157 ? -0.614  23.905  81.259 0.50 29.73  ?  202 ARG A CG   1 
ATOM   2317 C CG   B ARG A 1 157 ? -0.611  23.894  81.148 0.50 29.69  ?  202 ARG A CG   1 
ATOM   2318 C CD   A ARG A 1 157 ? 0.867   24.235  81.324 0.50 30.59  ?  202 ARG A CD   1 
ATOM   2319 C CD   B ARG A 1 157 ? 0.806   24.299  81.527 0.50 30.59  ?  202 ARG A CD   1 
ATOM   2320 N NE   A ARG A 1 157 ? 1.607   23.700  80.183 0.50 30.89  ?  202 ARG A NE   1 
ATOM   2321 N NE   B ARG A 1 157 ? 1.821   23.519  80.823 0.50 31.43  ?  202 ARG A NE   1 
ATOM   2322 C CZ   A ARG A 1 157 ? 1.719   24.308  79.005 0.50 29.04  ?  202 ARG A CZ   1 
ATOM   2323 C CZ   B ARG A 1 157 ? 2.591   22.586  81.379 0.50 30.64  ?  202 ARG A CZ   1 
ATOM   2324 N NH1  A ARG A 1 157 ? 1.134   25.479  78.794 0.50 27.72  1  202 ARG A NH1  1 
ATOM   2325 N NH1  B ARG A 1 157 ? 2.490   22.294  82.669 0.50 31.79  1  202 ARG A NH1  1 
ATOM   2326 N NH2  A ARG A 1 157 ? 2.417   23.741  78.031 0.50 28.20  ?  202 ARG A NH2  1 
ATOM   2327 N NH2  B ARG A 1 157 ? 3.481   21.943  80.638 0.50 32.16  ?  202 ARG A NH2  1 
ATOM   2328 H H    A ARG A 1 157 ? -1.766  20.115  81.192 0.50 31.67  ?  202 ARG A H    1 
ATOM   2329 H H    B ARG A 1 157 ? -1.766  20.115  81.191 0.50 31.67  ?  202 ARG A H    1 
ATOM   2330 H HA   A ARG A 1 157 ? -2.823  22.438  81.968 0.50 34.43  ?  202 ARG A HA   1 
ATOM   2331 H HA   B ARG A 1 157 ? -2.831  22.435  81.968 0.50 34.43  ?  202 ARG A HA   1 
ATOM   2332 H HB2  A ARG A 1 157 ? -0.527  22.105  82.219 0.50 34.22  ?  202 ARG A HB2  1 
ATOM   2333 H HB2  B ARG A 1 157 ? -0.560  22.186  82.266 0.50 34.23  ?  202 ARG A HB2  1 
ATOM   2334 H HB3  A ARG A 1 157 ? -0.369  21.972  80.646 0.50 34.22  ?  202 ARG A HB3  1 
ATOM   2335 H HB3  B ARG A 1 157 ? -0.353  21.915  80.716 0.50 34.23  ?  202 ARG A HB3  1 
ATOM   2336 H HG2  A ARG A 1 157 ? -0.960  24.230  80.413 0.50 35.68  ?  202 ARG A HG2  1 
ATOM   2337 H HG2  B ARG A 1 157 ? -0.742  24.100  80.209 0.50 35.63  ?  202 ARG A HG2  1 
ATOM   2338 H HG3  A ARG A 1 157 ? -1.058  24.353  81.996 0.50 35.68  ?  202 ARG A HG3  1 
ATOM   2339 H HG3  B ARG A 1 157 ? -1.228  24.409  81.691 0.50 35.63  ?  202 ARG A HG3  1 
ATOM   2340 H HD2  A ARG A 1 157 ? 0.978   25.199  81.330 0.50 36.70  ?  202 ARG A HD2  1 
ATOM   2341 H HD2  B ARG A 1 157 ? 0.938   25.234  81.305 0.50 36.71  ?  202 ARG A HD2  1 
ATOM   2342 H HD3  A ARG A 1 157 ? 1.242   23.852  82.133 0.50 36.70  ?  202 ARG A HD3  1 
ATOM   2343 H HD3  B ARG A 1 157 ? 0.929   24.163  82.480 0.50 36.71  ?  202 ARG A HD3  1 
ATOM   2344 H HE   A ARG A 1 157 ? 1.996   22.940  80.280 0.50 37.07  ?  202 ARG A HE   1 
ATOM   2345 H HE   B ARG A 1 157 ? 1.929   23.674  79.984 0.50 37.71  ?  202 ARG A HE   1 
ATOM   2346 H HH11 A ARG A 1 157 ? 0.681   25.852  79.422 0.50 33.27  ?  202 ARG A HH11 1 
ATOM   2347 H HH11 B ARG A 1 157 ? 1.916   22.706  83.160 0.50 38.15  ?  202 ARG A HH11 1 
ATOM   2348 H HH12 A ARG A 1 157 ? 1.210   25.866  78.030 0.50 33.27  ?  202 ARG A HH12 1 
ATOM   2349 H HH12 B ARG A 1 157 ? 2.995   21.690  83.014 0.50 38.15  ?  202 ARG A HH12 1 
ATOM   2350 H HH21 A ARG A 1 157 ? 2.797   22.981  78.161 0.50 33.85  ?  202 ARG A HH21 1 
ATOM   2351 H HH21 B ARG A 1 157 ? 3.556   22.126  79.801 0.50 38.59  ?  202 ARG A HH21 1 
ATOM   2352 H HH22 A ARG A 1 157 ? 2.487   24.133  77.269 0.50 33.85  ?  202 ARG A HH22 1 
ATOM   2353 H HH22 B ARG A 1 157 ? 3.982   21.341  80.993 0.50 38.59  ?  202 ARG A HH22 1 
ATOM   2354 N N    . VAL A 1 158 ? -2.317  22.112  78.803 1.00 25.43  ?  203 VAL A N    1 
ATOM   2355 C CA   . VAL A 1 158 ? -2.728  22.653  77.507 1.00 26.44  ?  203 VAL A CA   1 
ATOM   2356 C C    . VAL A 1 158 ? -4.182  22.325  77.216 1.00 26.82  ?  203 VAL A C    1 
ATOM   2357 O O    . VAL A 1 158 ? -4.877  23.095  76.543 1.00 27.40  ?  203 VAL A O    1 
ATOM   2358 C CB   . VAL A 1 158 ? -1.803  22.148  76.382 1.00 23.74  ?  203 VAL A CB   1 
ATOM   2359 C CG1  . VAL A 1 158 ? -0.346  22.416  76.734 1.00 24.85  ?  203 VAL A CG1  1 
ATOM   2360 C CG2  . VAL A 1 158 ? -2.041  20.671  76.086 1.00 23.86  ?  203 VAL A CG2  1 
ATOM   2361 H H    . VAL A 1 158 ? -1.670  21.547  78.766 1.00 30.51  ?  203 VAL A H    1 
ATOM   2362 H HA   . VAL A 1 158 ? -2.649  23.619  77.538 1.00 31.72  ?  203 VAL A HA   1 
ATOM   2363 H HB   . VAL A 1 158 ? -2.004  22.644  75.573 1.00 28.48  ?  203 VAL A HB   1 
ATOM   2364 H HG11 . VAL A 1 158 ? 0.217   22.092  76.014 1.00 29.82  ?  203 VAL A HG11 1 
ATOM   2365 H HG12 . VAL A 1 158 ? -0.220  23.371  76.849 1.00 29.82  ?  203 VAL A HG12 1 
ATOM   2366 H HG13 . VAL A 1 158 ? -0.130  21.953  77.558 1.00 29.82  ?  203 VAL A HG13 1 
ATOM   2367 H HG21 . VAL A 1 158 ? -1.443  20.392  75.375 1.00 28.63  ?  203 VAL A HG21 1 
ATOM   2368 H HG22 . VAL A 1 158 ? -1.865  20.156  76.889 1.00 28.63  ?  203 VAL A HG22 1 
ATOM   2369 H HG23 . VAL A 1 158 ? -2.963  20.549  75.810 1.00 28.63  ?  203 VAL A HG23 1 
ATOM   2370 N N    . LEU A 1 159 ? -4.663  21.185  77.694 1.00 27.54  ?  204 LEU A N    1 
ATOM   2371 C CA   . LEU A 1 159 ? -6.089  20.911  77.679 1.00 27.12  ?  204 LEU A CA   1 
ATOM   2372 C C    . LEU A 1 159 ? -6.711  21.508  78.935 1.00 30.86  ?  204 LEU A C    1 
ATOM   2373 O O    . LEU A 1 159 ? -6.067  21.617  79.981 1.00 31.83  ?  204 LEU A O    1 
ATOM   2374 C CB   . LEU A 1 159 ? -6.364  19.407  77.602 1.00 27.46  ?  204 LEU A CB   1 
ATOM   2375 C CG   . LEU A 1 159 ? -5.610  18.645  76.505 1.00 24.78  ?  204 LEU A CG   1 
ATOM   2376 C CD1  . LEU A 1 159 ? -5.994  17.169  76.511 1.00 25.24  ?  204 LEU A CD1  1 
ATOM   2377 C CD2  . LEU A 1 159 ? -5.863  19.255  75.134 1.00 28.16  ?  204 LEU A CD2  1 
ATOM   2378 H H    . LEU A 1 159 ? -4.185  20.555  78.031 1.00 33.05  ?  204 LEU A H    1 
ATOM   2379 H HA   . LEU A 1 159 ? -6.491  21.335  76.906 1.00 32.54  ?  204 LEU A HA   1 
ATOM   2380 H HB2  . LEU A 1 159 ? -6.120  19.007  78.452 1.00 32.95  ?  204 LEU A HB2  1 
ATOM   2381 H HB3  . LEU A 1 159 ? -7.312  19.277  77.446 1.00 32.95  ?  204 LEU A HB3  1 
ATOM   2382 H HG   . LEU A 1 159 ? -4.658  18.703  76.683 1.00 29.74  ?  204 LEU A HG   1 
ATOM   2383 H HD11 . LEU A 1 159 ? -5.504  16.713  75.809 1.00 30.28  ?  204 LEU A HD11 1 
ATOM   2384 H HD12 . LEU A 1 159 ? -5.769  16.788  77.374 1.00 30.28  ?  204 LEU A HD12 1 
ATOM   2385 H HD13 . LEU A 1 159 ? -6.948  17.092  76.353 1.00 30.28  ?  204 LEU A HD13 1 
ATOM   2386 H HD21 . LEU A 1 159 ? -5.372  18.749  74.468 1.00 33.79  ?  204 LEU A HD21 1 
ATOM   2387 H HD22 . LEU A 1 159 ? -6.814  19.218  74.944 1.00 33.79  ?  204 LEU A HD22 1 
ATOM   2388 H HD23 . LEU A 1 159 ? -5.562  20.177  75.139 1.00 33.79  ?  204 LEU A HD23 1 
ATOM   2389 N N    . ASN A 1 160 ? -7.964  21.920  78.817 1.00 31.99  ?  205 ASN A N    1 
ATOM   2390 C CA   . ASN A 1 160 ? -8.651  22.600  79.916 1.00 33.82  ?  205 ASN A CA   1 
ATOM   2391 C C    . ASN A 1 160 ? -9.645  21.669  80.591 1.00 31.06  ?  205 ASN A C    1 
ATOM   2392 O O    . ASN A 1 160 ? -10.794 22.023  80.857 1.00 35.54  ?  205 ASN A O    1 
ATOM   2393 C CB   . ASN A 1 160 ? -9.329  23.858  79.395 1.00 34.10  ?  205 ASN A CB   1 
ATOM   2394 C CG   . ASN A 1 160 ? -8.378  24.737  78.606 1.00 35.76  ?  205 ASN A CG   1 
ATOM   2395 O OD1  . ASN A 1 160 ? -8.605  25.022  77.431 1.00 39.69  ?  205 ASN A OD1  1 
ATOM   2396 N ND2  . ASN A 1 160 ? -7.291  25.154  79.248 1.00 35.39  ?  205 ASN A ND2  1 
ATOM   2397 H H    . ASN A 1 160 ? -8.445  21.819  78.111 1.00 38.39  ?  205 ASN A H    1 
ATOM   2398 H HA   . ASN A 1 160 ? -7.995  22.867  80.578 1.00 40.59  ?  205 ASN A HA   1 
ATOM   2399 H HB2  . ASN A 1 160 ? -10.061 23.606  78.811 1.00 40.92  ?  205 ASN A HB2  1 
ATOM   2400 H HB3  . ASN A 1 160 ? -9.663  24.374  80.146 1.00 40.92  ?  205 ASN A HB3  1 
ATOM   2401 H HD21 . ASN A 1 160 ? -6.720  25.654  78.845 1.00 42.46  ?  205 ASN A HD21 1 
ATOM   2402 H HD22 . ASN A 1 160 ? -7.159  24.922  80.066 1.00 42.46  ?  205 ASN A HD22 1 
ATOM   2403 N N    . LEU A 1 161 ? -9.195  20.469  80.880 1.00 27.46  ?  206 LEU A N    1 
ATOM   2404 C CA   . LEU A 1 161 ? -10.078 19.440  81.399 1.00 29.15  ?  206 LEU A CA   1 
ATOM   2405 C C    . LEU A 1 161 ? -10.072 19.440  82.925 1.00 24.35  ?  206 LEU A C    1 
ATOM   2406 O O    . LEU A 1 161 ? -9.051  19.751  83.548 1.00 23.45  ?  206 LEU A O    1 
ATOM   2407 C CB   . LEU A 1 161 ? -9.652  18.070  80.880 1.00 31.18  ?  206 LEU A CB   1 
ATOM   2408 C CG   . LEU A 1 161 ? -9.489  18.000  79.357 1.00 31.76  ?  206 LEU A CG   1 
ATOM   2409 C CD1  . LEU A 1 161 ? -8.957  16.651  78.928 1.00 31.08  ?  206 LEU A CD1  1 
ATOM   2410 C CD2  . LEU A 1 161 ? -10.807 18.306  78.652 1.00 35.82  ?  206 LEU A CD2  1 
ATOM   2411 H H    . LEU A 1 161 ? -8.377  20.218  80.786 1.00 32.95  ?  206 LEU A H    1 
ATOM   2412 H HA   . LEU A 1 161 ? -10.984 19.612  81.097 1.00 34.98  ?  206 LEU A HA   1 
ATOM   2413 H HB2  . LEU A 1 161 ? -8.799  17.837  81.280 1.00 37.42  ?  206 LEU A HB2  1 
ATOM   2414 H HB3  . LEU A 1 161 ? -10.322 17.417  81.136 1.00 37.42  ?  206 LEU A HB3  1 
ATOM   2415 H HG   . LEU A 1 161 ? -8.845  18.672  79.083 1.00 38.11  ?  206 LEU A HG   1 
ATOM   2416 H HD11 . LEU A 1 161 ? -8.866  16.641  77.962 1.00 37.30  ?  206 LEU A HD11 1 
ATOM   2417 H HD12 . LEU A 1 161 ? -8.093  16.506  79.344 1.00 37.30  ?  206 LEU A HD12 1 
ATOM   2418 H HD13 . LEU A 1 161 ? -9.581  15.963  79.209 1.00 37.30  ?  206 LEU A HD13 1 
ATOM   2419 H HD21 . LEU A 1 161 ? -10.672 18.255  77.693 1.00 42.98  ?  206 LEU A HD21 1 
ATOM   2420 H HD22 . LEU A 1 161 ? -11.471 17.655  78.928 1.00 42.98  ?  206 LEU A HD22 1 
ATOM   2421 H HD23 . LEU A 1 161 ? -11.097 19.199  78.898 1.00 42.98  ?  206 LEU A HD23 1 
ATOM   2422 N N    . PRO A 1 162 ? -11.198 19.104  83.554 1.00 25.73  ?  207 PRO A N    1 
ATOM   2423 C CA   . PRO A 1 162 ? -11.225 19.054  85.011 1.00 24.75  ?  207 PRO A CA   1 
ATOM   2424 C C    . PRO A 1 162 ? -10.165 18.108  85.533 1.00 21.93  ?  207 PRO A C    1 
ATOM   2425 O O    . PRO A 1 162 ? -9.755  17.161  84.835 1.00 24.13  ?  207 PRO A O    1 
ATOM   2426 C CB   . PRO A 1 162 ? -12.640 18.542  85.319 1.00 25.58  ?  207 PRO A CB   1 
ATOM   2427 C CG   . PRO A 1 162 ? -13.442 18.915  84.132 1.00 25.80  ?  207 PRO A CG   1 
ATOM   2428 C CD   . PRO A 1 162 ? -12.517 18.816  82.966 1.00 25.69  ?  207 PRO A CD   1 
ATOM   2429 H HA   . PRO A 1 162 ? -11.101 19.937  85.392 1.00 29.70  ?  207 PRO A HA   1 
ATOM   2430 H HB2  . PRO A 1 162 ? -12.623 17.579  85.434 1.00 30.69  ?  207 PRO A HB2  1 
ATOM   2431 H HB3  . PRO A 1 162 ? -12.980 18.979  86.115 1.00 30.69  ?  207 PRO A HB3  1 
ATOM   2432 H HG2  . PRO A 1 162 ? -14.182 18.296  84.033 1.00 30.96  ?  207 PRO A HG2  1 
ATOM   2433 H HG3  . PRO A 1 162 ? -13.768 19.823  84.232 1.00 30.96  ?  207 PRO A HG3  1 
ATOM   2434 H HD2  . PRO A 1 162 ? -12.534 17.919  82.596 1.00 30.82  ?  207 PRO A HD2  1 
ATOM   2435 H HD3  . PRO A 1 162 ? -12.742 19.481  82.297 1.00 30.82  ?  207 PRO A HD3  1 
ATOM   2436 N N    . PRO A 1 163 ? -9.684  18.322  86.763 1.00 21.96  ?  208 PRO A N    1 
ATOM   2437 C CA   . PRO A 1 163 ? -8.666  17.407  87.310 1.00 25.23  ?  208 PRO A CA   1 
ATOM   2438 C C    . PRO A 1 163 ? -9.134  15.966  87.422 1.00 21.03  ?  208 PRO A C    1 
ATOM   2439 O O    . PRO A 1 163 ? -8.319  15.047  87.272 1.00 21.44  ?  208 PRO A O    1 
ATOM   2440 C CB   . PRO A 1 163 ? -8.362  18.007  88.689 1.00 24.17  ?  208 PRO A CB   1 
ATOM   2441 C CG   . PRO A 1 163 ? -8.738  19.439  88.572 1.00 23.01  ?  208 PRO A CG   1 
ATOM   2442 C CD   . PRO A 1 163 ? -9.930  19.462  87.661 1.00 27.55  ?  208 PRO A CD   1 
ATOM   2443 H HA   . PRO A 1 163 ? -7.863  17.439  86.766 1.00 30.27  ?  208 PRO A HA   1 
ATOM   2444 H HB2  . PRO A 1 163 ? -8.899  17.565  89.365 1.00 29.00  ?  208 PRO A HB2  1 
ATOM   2445 H HB3  . PRO A 1 163 ? -7.416  17.915  88.886 1.00 29.00  ?  208 PRO A HB3  1 
ATOM   2446 H HG2  . PRO A 1 163 ? -8.969  19.788  89.447 1.00 27.61  ?  208 PRO A HG2  1 
ATOM   2447 H HG3  . PRO A 1 163 ? -8.003  19.939  88.186 1.00 27.61  ?  208 PRO A HG3  1 
ATOM   2448 H HD2  . PRO A 1 163 ? -10.747 19.325  88.167 1.00 33.06  ?  208 PRO A HD2  1 
ATOM   2449 H HD3  . PRO A 1 163 ? -9.957  20.291  87.158 1.00 33.06  ?  208 PRO A HD3  1 
ATOM   2450 N N    . ASN A 1 164 ? -10.416 15.734  87.691 1.00 20.68  ?  209 ASN A N    1 
ATOM   2451 C CA   . ASN A 1 164 ? -10.919 14.374  87.840 1.00 23.03  ?  209 ASN A CA   1 
ATOM   2452 C C    . ASN A 1 164 ? -11.143 13.680  86.502 1.00 22.88  ?  209 ASN A C    1 
ATOM   2453 O O    . ASN A 1 164 ? -11.538 12.508  86.488 1.00 21.21  ?  209 ASN A O    1 
ATOM   2454 C CB   . ASN A 1 164 ? -12.217 14.375  88.657 1.00 26.30  ?  209 ASN A CB   1 
ATOM   2455 C CG   . ASN A 1 164 ? -13.233 15.373  88.143 1.00 25.68  ?  209 ASN A CG   1 
ATOM   2456 O OD1  . ASN A 1 164 ? -12.890 16.500  87.790 1.00 30.17  ?  209 ASN A OD1  1 
ATOM   2457 N ND2  . ASN A 1 164 ? -14.493 14.965  88.103 1.00 30.30  ?  209 ASN A ND2  1 
ATOM   2458 H H    . ASN A 1 164 ? -11.013 16.346  87.791 1.00 24.82  ?  209 ASN A H    1 
ATOM   2459 H HA   . ASN A 1 164 ? -10.264 13.855  88.332 1.00 27.64  ?  209 ASN A HA   1 
ATOM   2460 H HB2  . ASN A 1 164 ? -12.617 13.492  88.616 1.00 31.56  ?  209 ASN A HB2  1 
ATOM   2461 H HB3  . ASN A 1 164 ? -12.011 14.603  89.576 1.00 31.56  ?  209 ASN A HB3  1 
ATOM   2462 H HD21 . ASN A 1 164 ? -15.107 15.495  87.819 1.00 36.36  ?  209 ASN A HD21 1 
ATOM   2463 H HD22 . ASN A 1 164 ? -14.696 14.171  88.362 1.00 36.36  ?  209 ASN A HD22 1 
ATOM   2464 N N    . THR A 1 165 ? -10.894 14.364  85.387 1.00 20.81  ?  210 THR A N    1 
ATOM   2465 C CA   . THR A 1 165 ? -10.917 13.711  84.086 1.00 22.72  ?  210 THR A CA   1 
ATOM   2466 C C    . THR A 1 165 ? -9.903  12.581  84.075 1.00 21.66  ?  210 THR A C    1 
ATOM   2467 O O    . THR A 1 165 ? -8.713  12.800  84.323 1.00 18.76  ?  210 THR A O    1 
ATOM   2468 C CB   . THR A 1 165 ? -10.603 14.716  82.976 1.00 24.55  ?  210 THR A CB   1 
ATOM   2469 O OG1  . THR A 1 165 ? -11.574 15.767  82.990 1.00 28.88  ?  210 THR A OG1  1 
ATOM   2470 C CG2  . THR A 1 165 ? -10.617 14.038  81.606 1.00 27.94  ?  210 THR A CG2  1 
ATOM   2471 H H    . THR A 1 165 ? -10.709 15.203  85.359 1.00 24.97  ?  210 THR A H    1 
ATOM   2472 H HA   . THR A 1 165 ? -11.798 13.338  83.925 1.00 27.26  ?  210 THR A HA   1 
ATOM   2473 H HB   . THR A 1 165 ? -9.721  15.091  83.123 1.00 29.46  ?  210 THR A HB   1 
ATOM   2474 H HG1  . THR A 1 165 ? -11.559 16.163  83.731 1.00 34.66  ?  210 THR A HG1  1 
ATOM   2475 H HG21 . THR A 1 165 ? -10.416 14.686  80.914 1.00 33.53  ?  210 THR A HG21 1 
ATOM   2476 H HG22 . THR A 1 165 ? -9.952  13.332  81.579 1.00 33.53  ?  210 THR A HG22 1 
ATOM   2477 H HG23 . THR A 1 165 ? -11.491 13.654  81.435 1.00 33.53  ?  210 THR A HG23 1 
ATOM   2478 N N    . ILE A 1 166 ? -10.375 11.373  83.792 1.00 20.22  ?  211 ILE A N    1 
ATOM   2479 C CA   . ILE A 1 166 ? -9.513  10.199  83.804 1.00 20.74  ?  211 ILE A CA   1 
ATOM   2480 C C    . ILE A 1 166 ? -8.687  10.176  82.526 1.00 18.94  ?  211 ILE A C    1 
ATOM   2481 O O    . ILE A 1 166 ? -9.218  10.335  81.421 1.00 22.36  ?  211 ILE A O    1 
ATOM   2482 C CB   . ILE A 1 166 ? -10.343 8.914   83.951 1.00 19.34  ?  211 ILE A CB   1 
ATOM   2483 C CG1  . ILE A 1 166 ? -11.174 8.969   85.235 1.00 23.21  ?  211 ILE A CG1  1 
ATOM   2484 C CG2  . ILE A 1 166 ? -9.427  7.695   83.969 1.00 24.94  ?  211 ILE A CG2  1 
ATOM   2485 C CD1  . ILE A 1 166 ? -12.149 7.822   85.396 1.00 28.50  ?  211 ILE A CD1  1 
ATOM   2486 H H    . ILE A 1 166 ? -11.194 11.206  83.590 1.00 24.26  ?  211 ILE A H    1 
ATOM   2487 H HA   . ILE A 1 166 ? -8.905  10.256  84.557 1.00 24.89  ?  211 ILE A HA   1 
ATOM   2488 H HB   . ILE A 1 166 ? -10.944 8.842   83.193 1.00 23.21  ?  211 ILE A HB   1 
ATOM   2489 H HG12 . ILE A 1 166 ? -10.572 8.953   85.995 1.00 27.86  ?  211 ILE A HG12 1 
ATOM   2490 H HG13 . ILE A 1 166 ? -11.685 9.793   85.239 1.00 27.86  ?  211 ILE A HG13 1 
ATOM   2491 H HG21 . ILE A 1 166 ? -9.968  6.895   84.063 1.00 29.93  ?  211 ILE A HG21 1 
ATOM   2492 H HG22 . ILE A 1 166 ? -8.929  7.662   83.137 1.00 29.93  ?  211 ILE A HG22 1 
ATOM   2493 H HG23 . ILE A 1 166 ? -8.815  7.771   84.718 1.00 29.93  ?  211 ILE A HG23 1 
ATOM   2494 H HD11 . ILE A 1 166 ? -12.631 7.934   86.231 1.00 34.20  ?  211 ILE A HD11 1 
ATOM   2495 H HD12 . ILE A 1 166 ? -12.770 7.829   84.651 1.00 34.20  ?  211 ILE A HD12 1 
ATOM   2496 H HD13 . ILE A 1 166 ? -11.655 6.987   85.408 1.00 34.20  ?  211 ILE A HD13 1 
ATOM   2497 N N    . MET A 1 167 ? -7.383  9.984   82.678 1.00 17.94  ?  212 MET A N    1 
ATOM   2498 C CA   . MET A 1 167 ? -6.470  9.796   81.563 1.00 18.94  ?  212 MET A CA   1 
ATOM   2499 C C    . MET A 1 167 ? -5.919  8.379   81.639 1.00 18.52  ?  212 MET A C    1 
ATOM   2500 O O    . MET A 1 167 ? -5.510  7.930   82.715 1.00 18.91  ?  212 MET A O    1 
ATOM   2501 C CB   . MET A 1 167 ? -5.335  10.821  81.611 1.00 17.64  ?  212 MET A CB   1 
ATOM   2502 C CG   . MET A 1 167 ? -5.823  12.262  81.765 1.00 24.69  ?  212 MET A CG   1 
ATOM   2503 S SD   . MET A 1 167 ? -4.513  13.502  81.891 1.00 25.48  ?  212 MET A SD   1 
ATOM   2504 C CE   . MET A 1 167 ? -3.457  13.087  80.517 1.00 23.55  ?  212 MET A CE   1 
ATOM   2505 H H    . MET A 1 167 ? -6.993  9.960   83.444 1.00 21.52  ?  212 MET A H    1 
ATOM   2506 H HA   . MET A 1 167 ? -6.951  9.910   80.729 1.00 22.73  ?  212 MET A HA   1 
ATOM   2507 H HB2  . MET A 1 167 ? -4.761  10.619  82.367 1.00 21.17  ?  212 MET A HB2  1 
ATOM   2508 H HB3  . MET A 1 167 ? -4.827  10.765  80.787 1.00 21.17  ?  212 MET A HB3  1 
ATOM   2509 H HG2  . MET A 1 167 ? -6.366  12.488  80.994 1.00 29.62  ?  212 MET A HG2  1 
ATOM   2510 H HG3  . MET A 1 167 ? -6.361  12.321  82.570 1.00 29.62  ?  212 MET A HG3  1 
ATOM   2511 H HE1  . MET A 1 167 ? -2.709  13.705  80.496 1.00 28.26  ?  212 MET A HE1  1 
ATOM   2512 H HE2  . MET A 1 167 ? -3.133  12.180  80.630 1.00 28.26  ?  212 MET A HE2  1 
ATOM   2513 H HE3  . MET A 1 167 ? -3.967  13.157  79.695 1.00 28.26  ?  212 MET A HE3  1 
ATOM   2514 N N    . GLU A 1 168 ? -5.928  7.673   80.512 1.00 15.02  ?  213 GLU A N    1 
ATOM   2515 C CA   . GLU A 1 168 ? -5.436  6.303   80.445 1.00 16.74  ?  213 GLU A CA   1 
ATOM   2516 C C    . GLU A 1 168 ? -4.215  6.254   79.541 1.00 14.96  ?  213 GLU A C    1 
ATOM   2517 O O    . GLU A 1 168 ? -4.238  6.792   78.429 1.00 14.69  ?  213 GLU A O    1 
ATOM   2518 C CB   . GLU A 1 168 ? -6.523  5.355   79.928 1.00 18.23  ?  213 GLU A CB   1 
ATOM   2519 C CG   . GLU A 1 168 ? -6.143  3.878   79.961 1.00 15.90  ?  213 GLU A CG   1 
ATOM   2520 C CD   . GLU A 1 168 ? -7.254  2.983   79.446 1.00 23.46  ?  213 GLU A CD   1 
ATOM   2521 O OE1  . GLU A 1 168 ? -8.358  3.500   79.179 1.00 24.87  ?  213 GLU A OE1  1 
ATOM   2522 O OE2  . GLU A 1 168 ? -7.025  1.761   79.305 1.00 27.22  -1 213 GLU A OE2  1 
ATOM   2523 H H    . GLU A 1 168 ? -6.220  7.972   79.761 1.00 18.03  ?  213 GLU A H    1 
ATOM   2524 H HA   . GLU A 1 168 ? -5.173  6.012   81.332 1.00 20.09  ?  213 GLU A HA   1 
ATOM   2525 H HB2  . GLU A 1 168 ? -7.317  5.466   80.473 1.00 21.88  ?  213 GLU A HB2  1 
ATOM   2526 H HB3  . GLU A 1 168 ? -6.723  5.586   79.007 1.00 21.88  ?  213 GLU A HB3  1 
ATOM   2527 H HG2  . GLU A 1 168 ? -5.362  3.739   79.403 1.00 19.08  ?  213 GLU A HG2  1 
ATOM   2528 H HG3  . GLU A 1 168 ? -5.950  3.621   80.876 1.00 19.08  ?  213 GLU A HG3  1 
ATOM   2529 N N    . TYR A 1 169 ? -3.149  5.621   80.020 1.00 14.03  ?  214 TYR A N    1 
ATOM   2530 C CA   . TYR A 1 169 ? -1.991  5.326   79.194 1.00 15.89  ?  214 TYR A CA   1 
ATOM   2531 C C    . TYR A 1 169 ? -1.986  3.840   78.870 1.00 17.92  ?  214 TYR A C    1 
ATOM   2532 O O    . TYR A 1 169 ? -2.073  3.005   79.776 1.00 17.46  ?  214 TYR A O    1 
ATOM   2533 C CB   . TYR A 1 169 ? -0.681  5.709   79.880 1.00 15.31  ?  214 TYR A CB   1 
ATOM   2534 C CG   . TYR A 1 169 ? 0.475   5.606   78.920 1.00 17.70  ?  214 TYR A CG   1 
ATOM   2535 C CD1  . TYR A 1 169 ? 1.143   4.404   78.733 1.00 17.60  ?  214 TYR A CD1  1 
ATOM   2536 C CD2  . TYR A 1 169 ? 0.868   6.698   78.162 1.00 16.98  ?  214 TYR A CD2  1 
ATOM   2537 C CE1  . TYR A 1 169 ? 2.186   4.304   77.837 1.00 20.84  ?  214 TYR A CE1  1 
ATOM   2538 C CE2  . TYR A 1 169 ? 1.908   6.605   77.269 1.00 16.83  ?  214 TYR A CE2  1 
ATOM   2539 C CZ   . TYR A 1 169 ? 2.562   5.406   77.107 1.00 17.08  ?  214 TYR A CZ   1 
ATOM   2540 O OH   . TYR A 1 169 ? 3.601   5.317   76.211 1.00 16.74  ?  214 TYR A OH   1 
ATOM   2541 H H    . TYR A 1 169 ? -3.075  5.349   80.832 1.00 16.84  ?  214 TYR A H    1 
ATOM   2542 H HA   . TYR A 1 169 ? -2.055  5.820   78.362 1.00 19.07  ?  214 TYR A HA   1 
ATOM   2543 H HB2  . TYR A 1 169 ? -0.738  6.625   80.194 1.00 18.37  ?  214 TYR A HB2  1 
ATOM   2544 H HB3  . TYR A 1 169 ? -0.517  5.106   80.622 1.00 18.37  ?  214 TYR A HB3  1 
ATOM   2545 H HD1  . TYR A 1 169 ? 0.888   3.657   79.225 1.00 21.12  ?  214 TYR A HD1  1 
ATOM   2546 H HD2  . TYR A 1 169 ? 0.427   7.510   78.268 1.00 20.37  ?  214 TYR A HD2  1 
ATOM   2547 H HE1  . TYR A 1 169 ? 2.631   3.495   77.726 1.00 25.01  ?  214 TYR A HE1  1 
ATOM   2548 H HE2  . TYR A 1 169 ? 2.165   7.348   76.772 1.00 20.19  ?  214 TYR A HE2  1 
ATOM   2549 H HH   . TYR A 1 169 ? 3.722   6.059   75.837 1.00 20.09  ?  214 TYR A HH   1 
ATOM   2550 N N    . LYS A 1 170 ? -1.892  3.518   77.584 1.00 16.22  ?  215 LYS A N    1 
ATOM   2551 C CA   . LYS A 1 170 ? -1.882  2.139   77.120 1.00 19.71  ?  215 LYS A CA   1 
ATOM   2552 C C    . LYS A 1 170 ? -0.764  1.947   76.114 1.00 21.59  ?  215 LYS A C    1 
ATOM   2553 O O    . LYS A 1 170 ? -0.510  2.823   75.283 1.00 17.05  ?  215 LYS A O    1 
ATOM   2554 C CB   . LYS A 1 170 ? -3.204  1.749   76.439 1.00 20.13  ?  215 LYS A CB   1 
ATOM   2555 C CG   . LYS A 1 170 ? -4.450  2.083   77.217 1.00 23.28  ?  215 LYS A CG   1 
ATOM   2556 C CD   . LYS A 1 170 ? -5.695  1.889   76.369 1.00 24.65  ?  215 LYS A CD   1 
ATOM   2557 C CE   . LYS A 1 170 ? -6.013  0.428   76.135 1.00 29.53  ?  215 LYS A CE   1 
ATOM   2558 N NZ   . LYS A 1 170 ? -7.296  0.298   75.393 1.00 32.32  1  215 LYS A NZ   1 
ATOM   2559 H H    . LYS A 1 170 ? -1.831  4.095   76.949 1.00 19.46  ?  215 LYS A H    1 
ATOM   2560 H HA   . LYS A 1 170 ? -1.731  1.542   77.871 1.00 23.65  ?  215 LYS A HA   1 
ATOM   2561 H HB2  . LYS A 1 170 ? -3.259  2.211   75.588 1.00 24.16  ?  215 LYS A HB2  1 
ATOM   2562 H HB3  . LYS A 1 170 ? -3.202  0.791   76.289 1.00 24.16  ?  215 LYS A HB3  1 
ATOM   2563 H HG2  . LYS A 1 170 ? -4.513  1.499   77.989 1.00 27.94  ?  215 LYS A HG2  1 
ATOM   2564 H HG3  . LYS A 1 170 ? -4.415  3.010   77.499 1.00 27.94  ?  215 LYS A HG3  1 
ATOM   2565 H HD2  . LYS A 1 170 ? -6.453  2.293   76.820 1.00 29.59  ?  215 LYS A HD2  1 
ATOM   2566 H HD3  . LYS A 1 170 ? -5.559  2.309   75.505 1.00 29.59  ?  215 LYS A HD3  1 
ATOM   2567 H HE2  . LYS A 1 170 ? -5.308  0.023   75.605 1.00 35.43  ?  215 LYS A HE2  1 
ATOM   2568 H HE3  . LYS A 1 170 ? -6.102  -0.026  76.987 1.00 35.43  ?  215 LYS A HE3  1 
ATOM   2569 H HZ1  . LYS A 1 170 ? -7.482  -0.562  75.256 1.00 38.79  ?  215 LYS A HZ1  1 
ATOM   2570 H HZ2  . LYS A 1 170 ? -7.957  0.665   75.862 1.00 38.79  ?  215 LYS A HZ2  1 
ATOM   2571 H HZ3  . LYS A 1 170 ? -7.236  0.710   74.606 1.00 38.79  ?  215 LYS A HZ3  1 
ATOM   2572 N N    . THR A 1 171 ? -0.096  0.804   76.182 1.00 20.10  ?  216 THR A N    1 
ATOM   2573 C CA   A THR A 1 171 ? 0.757   0.424   75.071 0.50 21.15  ?  216 THR A CA   1 
ATOM   2574 C CA   B THR A 1 171 ? 0.758   0.391   75.085 0.50 21.43  ?  216 THR A CA   1 
ATOM   2575 C C    . THR A 1 171 ? -0.115  0.081   73.871 1.00 21.72  ?  216 THR A C    1 
ATOM   2576 O O    . THR A 1 171 ? -1.312  -0.190  73.992 1.00 24.40  ?  216 THR A O    1 
ATOM   2577 C CB   A THR A 1 171 ? 1.644   -0.771  75.418 0.50 25.09  ?  216 THR A CB   1 
ATOM   2578 C CB   B THR A 1 171 ? 1.592   -0.827  75.493 0.50 25.22  ?  216 THR A CB   1 
ATOM   2579 O OG1  A THR A 1 171 ? 0.856   -1.967  75.427 0.50 24.43  ?  216 THR A OG1  1 
ATOM   2580 O OG1  B THR A 1 171 ? 2.233   -0.566  76.748 0.50 28.14  ?  216 THR A OG1  1 
ATOM   2581 C CG2  A THR A 1 171 ? 2.304   -0.587  76.769 0.50 28.07  ?  216 THR A CG2  1 
ATOM   2582 C CG2  B THR A 1 171 ? 2.654   -1.139  74.466 0.50 24.11  ?  216 THR A CG2  1 
ATOM   2583 H H    A THR A 1 171 ? -0.117  0.248   76.838 0.50 24.12  ?  216 THR A H    1 
ATOM   2584 H H    B THR A 1 171 ? -0.119  0.257   76.845 0.50 24.12  ?  216 THR A H    1 
ATOM   2585 H HA   A THR A 1 171 ? 1.328   1.171   74.832 0.50 25.38  ?  216 THR A HA   1 
ATOM   2586 H HA   B THR A 1 171 ? 1.361   1.115   74.853 0.50 25.71  ?  216 THR A HA   1 
ATOM   2587 H HB   A THR A 1 171 ? 2.342   -0.854  74.750 0.50 30.11  ?  216 THR A HB   1 
ATOM   2588 H HB   B THR A 1 171 ? 1.013   -1.600  75.580 0.50 30.26  ?  216 THR A HB   1 
ATOM   2589 H HG1  A THR A 1 171 ? 1.339   -2.628  75.617 0.50 29.31  ?  216 THR A HG1  1 
ATOM   2590 H HG1  B THR A 1 171 ? 2.693   -1.230  76.979 0.50 33.77  ?  216 THR A HG1  1 
ATOM   2591 H HG21 A THR A 1 171 ? 2.862   -1.354  76.972 0.50 33.69  ?  216 THR A HG21 1 
ATOM   2592 H HG21 B THR A 1 171 ? 3.169   -1.912  74.746 0.50 28.93  ?  216 THR A HG21 1 
ATOM   2593 H HG22 A THR A 1 171 ? 2.856   0.211   76.762 0.50 33.69  ?  216 THR A HG22 1 
ATOM   2594 H HG22 B THR A 1 171 ? 2.241   -1.328  73.609 0.50 28.93  ?  216 THR A HG22 1 
ATOM   2595 H HG23 A THR A 1 171 ? 1.629   -0.497  77.459 0.50 33.69  ?  216 THR A HG23 1 
ATOM   2596 H HG23 B THR A 1 171 ? 3.253   -0.382  74.367 0.50 28.93  ?  216 THR A HG23 1 
ATOM   2597 N N    . HIS A 1 172 ? 0.489   0.123   72.689 1.00 20.57  ?  217 HIS A N    1 
ATOM   2598 C CA   . HIS A 1 172 ? -0.282  -0.195  71.495 1.00 20.89  ?  217 HIS A CA   1 
ATOM   2599 C C    . HIS A 1 172 ? -0.745  -1.646  71.519 1.00 21.15  ?  217 HIS A C    1 
ATOM   2600 O O    . HIS A 1 172 ? -1.858  -1.952  71.081 1.00 20.67  ?  217 HIS A O    1 
ATOM   2601 C CB   . HIS A 1 172 ? 0.538   0.117   70.248 1.00 20.89  ?  217 HIS A CB   1 
ATOM   2602 C CG   . HIS A 1 172 ? 0.869   1.569   70.119 1.00 18.88  ?  217 HIS A CG   1 
ATOM   2603 N ND1  . HIS A 1 172 ? -0.103  2.545   70.065 1.00 19.19  ?  217 HIS A ND1  1 
ATOM   2604 C CD2  . HIS A 1 172 ? 2.056   2.216   70.069 1.00 18.56  ?  217 HIS A CD2  1 
ATOM   2605 C CE1  . HIS A 1 172 ? 0.472   3.730   69.975 1.00 19.59  ?  217 HIS A CE1  1 
ATOM   2606 N NE2  . HIS A 1 172 ? 1.782   3.558   69.972 1.00 18.70  ?  217 HIS A NE2  1 
ATOM   2607 H H    . HIS A 1 172 ? 1.314   0.325   72.553 1.00 24.68  ?  217 HIS A H    1 
ATOM   2608 H HA   . HIS A 1 172 ? -1.073  0.366   71.477 1.00 25.06  ?  217 HIS A HA   1 
ATOM   2609 H HB2  . HIS A 1 172 ? 1.372   -0.378  70.287 1.00 25.06  ?  217 HIS A HB2  1 
ATOM   2610 H HB3  . HIS A 1 172 ? 0.032   -0.146  69.464 1.00 25.06  ?  217 HIS A HB3  1 
ATOM   2611 H HD1  . HIS A 1 172 ? -0.951  2.403   70.085 1.00 23.03  ?  217 HIS A HD1  1 
ATOM   2612 H HD2  . HIS A 1 172 ? 2.900   1.825   70.089 1.00 22.27  ?  217 HIS A HD2  1 
ATOM   2613 H HE1  . HIS A 1 172 ? 0.030   4.546   69.916 1.00 23.51  ?  217 HIS A HE1  1 
ATOM   2614 N N    . THR A 1 173 ? 0.076   -2.550  72.056 1.00 22.92  ?  218 THR A N    1 
ATOM   2615 C CA   . THR A 1 173 ? -0.357  -3.941  72.171 1.00 27.69  ?  218 THR A CA   1 
ATOM   2616 C C    . THR A 1 173 ? -1.549  -4.065  73.115 1.00 27.73  ?  218 THR A C    1 
ATOM   2617 O O    . THR A 1 173 ? -2.447  -4.884  72.886 1.00 26.82  ?  218 THR A O    1 
ATOM   2618 C CB   . THR A 1 173 ? 0.800   -4.829  72.639 1.00 24.53  ?  218 THR A CB   1 
ATOM   2619 O OG1  . THR A 1 173 ? 1.289   -4.370  73.904 1.00 28.24  ?  218 THR A OG1  1 
ATOM   2620 C CG2  . THR A 1 173 ? 1.933   -4.813  71.623 1.00 28.44  ?  218 THR A CG2  1 
ATOM   2621 H H    . THR A 1 173 ? 0.866   -2.388  72.354 1.00 27.50  ?  218 THR A H    1 
ATOM   2622 H HA   . THR A 1 173 ? -0.636  -4.255  71.297 1.00 33.23  ?  218 THR A HA   1 
ATOM   2623 H HB   . THR A 1 173 ? 0.486   -5.742  72.729 1.00 29.44  ?  218 THR A HB   1 
ATOM   2624 H HG1  . THR A 1 173 ? 0.676   -4.399  74.477 1.00 33.89  ?  218 THR A HG1  1 
ATOM   2625 H HG21 . THR A 1 173 ? 2.660   -5.377  71.928 1.00 34.13  ?  218 THR A HG21 1 
ATOM   2626 H HG22 . THR A 1 173 ? 1.615   -5.142  70.767 1.00 34.13  ?  218 THR A HG22 1 
ATOM   2627 H HG23 . THR A 1 173 ? 2.263   -3.908  71.508 1.00 34.13  ?  218 THR A HG23 1 
ATOM   2628 N N    . ASP A 1 174 ? -1.585  -3.249  74.174 1.00 26.67  ?  219 ASP A N    1 
ATOM   2629 C CA   . ASP A 1 174 ? -2.755  -3.219  75.046 1.00 24.51  ?  219 ASP A CA   1 
ATOM   2630 C C    . ASP A 1 174 ? -4.013  -2.799  74.299 1.00 28.68  ?  219 ASP A C    1 
ATOM   2631 O O    . ASP A 1 174 ? -5.121  -3.134  74.731 1.00 23.33  ?  219 ASP A O    1 
ATOM   2632 C CB   . ASP A 1 174 ? -2.528  -2.263  76.219 1.00 26.17  ?  219 ASP A CB   1 
ATOM   2633 C CG   . ASP A 1 174 ? -1.365  -2.671  77.098 1.00 28.82  ?  219 ASP A CG   1 
ATOM   2634 O OD1  . ASP A 1 174 ? -1.114  -3.887  77.240 1.00 29.00  ?  219 ASP A OD1  1 
ATOM   2635 O OD2  . ASP A 1 174 ? -0.707  -1.766  77.657 1.00 29.95  -1 219 ASP A OD2  1 
ATOM   2636 H H    . ASP A 1 174 ? -0.953  -2.713  74.403 1.00 32.00  ?  219 ASP A H    1 
ATOM   2637 H HA   . ASP A 1 174 ? -2.903  -4.108  75.407 1.00 29.41  ?  219 ASP A HA   1 
ATOM   2638 H HB2  . ASP A 1 174 ? -2.344  -1.376  75.872 1.00 31.41  ?  219 ASP A HB2  1 
ATOM   2639 H HB3  . ASP A 1 174 ? -3.327  -2.244  76.770 1.00 31.41  ?  219 ASP A HB3  1 
ATOM   2640 N N    . SER A 1 175 ? -3.870  -2.066  73.196 1.00 28.06  ?  220 SER A N    1 
ATOM   2641 C CA   . SER A 1 175 ? -5.014  -1.580  72.439 1.00 28.52  ?  220 SER A CA   1 
ATOM   2642 C C    . SER A 1 175 ? -5.474  -2.551  71.358 1.00 31.91  ?  220 SER A C    1 
ATOM   2643 O O    . SER A 1 175 ? -6.566  -2.366  70.811 1.00 34.41  ?  220 SER A O    1 
ATOM   2644 C CB   . SER A 1 175 ? -4.680  -0.230  71.790 1.00 28.61  ?  220 SER A CB   1 
ATOM   2645 O OG   . SER A 1 175 ? -4.301  0.728   72.764 1.00 28.77  ?  220 SER A OG   1 
ATOM   2646 H H    . SER A 1 175 ? -3.111  -1.835  72.865 1.00 33.68  ?  220 SER A H    1 
ATOM   2647 H HA   . SER A 1 175 ? -5.756  -1.441  73.048 1.00 34.22  ?  220 SER A HA   1 
ATOM   2648 H HB2  . SER A 1 175 ? -3.947  -0.353  71.168 1.00 34.33  ?  220 SER A HB2  1 
ATOM   2649 H HB3  . SER A 1 175 ? -5.463  0.094   71.318 1.00 34.33  ?  220 SER A HB3  1 
ATOM   2650 H HG   . SER A 1 175 ? -3.622  0.460   73.181 1.00 34.52  ?  220 SER A HG   1 
ATOM   2651 N N    . ILE A 1 176 ? -4.682  -3.576  71.044 1.00 32.93  ?  221 ILE A N    1 
ATOM   2652 C CA   . ILE A 1 176 ? -4.958  -4.479  69.931 1.00 32.90  ?  221 ILE A CA   1 
ATOM   2653 C C    . ILE A 1 176 ? -5.478  -5.801  70.481 1.00 36.66  ?  221 ILE A C    1 
ATOM   2654 O O    . ILE A 1 176 ? -4.910  -6.354  71.433 1.00 31.95  ?  221 ILE A O    1 
ATOM   2655 C CB   . ILE A 1 176 ? -3.698  -4.703  69.073 1.00 34.30  ?  221 ILE A CB   1 
ATOM   2656 C CG1  . ILE A 1 176 ? -3.141  -3.375  68.548 1.00 32.52  ?  221 ILE A CG1  1 
ATOM   2657 C CG2  . ILE A 1 176 ? -3.992  -5.650  67.916 1.00 38.38  ?  221 ILE A CG2  1 
ATOM   2658 C CD1  . ILE A 1 176 ? -4.077  -2.607  67.637 1.00 36.08  ?  221 ILE A CD1  1 
ATOM   2659 H H    . ILE A 1 176 ? -3.963  -3.772  71.473 1.00 39.51  ?  221 ILE A H    1 
ATOM   2660 H HA   . ILE A 1 176 ? -5.646  -4.093  69.367 1.00 39.48  ?  221 ILE A HA   1 
ATOM   2661 H HB   . ILE A 1 176 ? -3.021  -5.113  69.634 1.00 41.16  ?  221 ILE A HB   1 
ATOM   2662 H HG12 . ILE A 1 176 ? -2.936  -2.805  69.305 1.00 39.02  ?  221 ILE A HG12 1 
ATOM   2663 H HG13 . ILE A 1 176 ? -2.330  -3.557  68.048 1.00 39.02  ?  221 ILE A HG13 1 
ATOM   2664 H HG21 . ILE A 1 176 ? -3.183  -5.772  67.395 1.00 46.05  ?  221 ILE A HG21 1 
ATOM   2665 H HG22 . ILE A 1 176 ? -4.288  -6.502  68.273 1.00 46.05  ?  221 ILE A HG22 1 
ATOM   2666 H HG23 . ILE A 1 176 ? -4.688  -5.263  67.362 1.00 46.05  ?  221 ILE A HG23 1 
ATOM   2667 H HD11 . ILE A 1 176 ? -3.641  -1.787  67.357 1.00 43.30  ?  221 ILE A HD11 1 
ATOM   2668 H HD12 . ILE A 1 176 ? -4.283  -3.154  66.863 1.00 43.30  ?  221 ILE A HD12 1 
ATOM   2669 H HD13 . ILE A 1 176 ? -4.891  -2.401  68.123 1.00 43.30  ?  221 ILE A HD13 1 
ATOM   2670 N N    . LYS A 1 177 ? -6.550  -6.312  69.876 1.00 35.44  ?  222 LYS A N    1 
ATOM   2671 C CA   . LYS A 1 177 ? -7.116  -7.620  70.210 1.00 38.38  ?  222 LYS A CA   1 
ATOM   2672 C C    . LYS A 1 177 ? -7.382  -7.745  71.712 1.00 43.20  ?  222 LYS A C    1 
ATOM   2673 O O    . LYS A 1 177 ? -6.834  -8.604  72.406 1.00 38.96  ?  222 LYS A O    1 
ATOM   2674 C CB   . LYS A 1 177 ? -6.203  -8.749  69.722 1.00 34.71  ?  222 LYS A CB   1 
ATOM   2675 C CG   . LYS A 1 177 ? -6.501  -9.234  68.310 1.00 40.80  ?  222 LYS A CG   1 
ATOM   2676 C CD   . LYS A 1 177 ? -5.897  -8.326  67.263 1.00 36.89  ?  222 LYS A CD   1 
ATOM   2677 C CE   . LYS A 1 177 ? -6.215  -8.800  65.856 1.00 39.58  ?  222 LYS A CE   1 
ATOM   2678 N NZ   . LYS A 1 177 ? -5.572  -7.934  64.826 1.00 39.52  ?  222 LYS A NZ   1 
ATOM   2679 H H    . LYS A 1 177 ? -6.980  -5.907  69.251 1.00 42.52  ?  222 LYS A H    1 
ATOM   2680 H HA   . LYS A 1 177 ? -7.967  -7.714  69.753 1.00 46.05  ?  222 LYS A HA   1 
ATOM   2681 H HB2  . LYS A 1 177 ? -5.285  -8.435  69.738 1.00 41.65  ?  222 LYS A HB2  1 
ATOM   2682 H HB3  . LYS A 1 177 ? -6.299  -9.507  70.320 1.00 41.65  ?  222 LYS A HB3  1 
ATOM   2683 H HG2  . LYS A 1 177 ? -6.128  -10.122 68.193 1.00 48.96  ?  222 LYS A HG2  1 
ATOM   2684 H HG3  . LYS A 1 177 ? -7.461  -9.254  68.176 1.00 48.96  ?  222 LYS A HG3  1 
ATOM   2685 H HD2  . LYS A 1 177 ? -6.257  -7.431  67.370 1.00 44.26  ?  222 LYS A HD2  1 
ATOM   2686 H HD3  . LYS A 1 177 ? -4.933  -8.314  67.368 1.00 44.26  ?  222 LYS A HD3  1 
ATOM   2687 H HE2  . LYS A 1 177 ? -5.884  -9.705  65.742 1.00 47.49  ?  222 LYS A HE2  1 
ATOM   2688 H HE3  . LYS A 1 177 ? -7.175  -8.774  65.719 1.00 47.49  ?  222 LYS A HE3  1 
ATOM   2689 H HZ1  . LYS A 1 177 ? -5.772  -8.231  64.011 1.00 47.43  ?  222 LYS A HZ1  1 
ATOM   2690 H HZ2  . LYS A 1 177 ? -5.862  -7.097  64.908 1.00 47.43  ?  222 LYS A HZ2  1 
ATOM   2691 H HZ3  . LYS A 1 177 ? -4.688  -7.945  64.928 1.00 47.43  ?  222 LYS A HZ3  1 
ATOM   2692 N N    . MET A 1 178 ? -8.257  -6.874  72.202 1.00 43.83  ?  223 MET A N    1 
ATOM   2693 C CA   . MET A 1 178 ? -8.633  -6.861  73.607 1.00 48.96  ?  223 MET A CA   1 
ATOM   2694 C C    . MET A 1 178 ? -10.061 -6.354  73.718 1.00 52.32  ?  223 MET A C    1 
ATOM   2695 O O    . MET A 1 178 ? -10.559 -5.688  72.802 1.00 58.45  ?  223 MET A O    1 
ATOM   2696 C CB   . MET A 1 178 ? -7.684  -5.979  74.432 1.00 44.01  ?  223 MET A CB   1 
ATOM   2697 C CG   . MET A 1 178 ? -6.298  -6.572  74.618 1.00 39.96  ?  223 MET A CG   1 
ATOM   2698 S SD   . MET A 1 178 ? -6.334  -8.128  75.528 1.00 42.80  ?  223 MET A SD   1 
ATOM   2699 C CE   . MET A 1 178 ? -6.658  -7.545  77.188 1.00 34.02  ?  223 MET A CE   1 
ATOM   2700 H H    . MET A 1 178 ? -8.652  -6.272  71.732 1.00 52.60  ?  223 MET A H    1 
ATOM   2701 H HA   . MET A 1 178 ? -8.587  -7.764  73.958 1.00 58.76  ?  223 MET A HA   1 
ATOM   2702 H HB2  . MET A 1 178 ? -7.582  -5.125  73.983 1.00 52.82  ?  223 MET A HB2  1 
ATOM   2703 H HB3  . MET A 1 178 ? -8.069  -5.844  75.311 1.00 52.82  ?  223 MET A HB3  1 
ATOM   2704 H HG2  . MET A 1 178 ? -5.906  -6.741  73.747 1.00 47.95  ?  223 MET A HG2  1 
ATOM   2705 H HG3  . MET A 1 178 ? -5.749  -5.945  75.115 1.00 47.95  ?  223 MET A HG3  1 
ATOM   2706 H HE1  . MET A 1 178 ? -5.940  -6.951  77.459 1.00 40.82  ?  223 MET A HE1  1 
ATOM   2707 H HE2  . MET A 1 178 ? -7.503  -7.068  77.196 1.00 40.82  ?  223 MET A HE2  1 
ATOM   2708 H HE3  . MET A 1 178 ? -6.701  -8.306  77.787 1.00 40.82  ?  223 MET A HE3  1 
ATOM   2709 N N    . PRO A 1 179 ? -10.755 -6.655  74.829 1.00 55.06  ?  224 PRO A N    1 
ATOM   2710 C CA   . PRO A 1 179 ? -12.131 -6.180  75.024 1.00 56.32  ?  224 PRO A CA   1 
ATOM   2711 C C    . PRO A 1 179 ? -12.272 -4.673  74.844 1.00 59.60  ?  224 PRO A C    1 
ATOM   2712 O O    . PRO A 1 179 ? -12.831 -4.253  73.830 1.00 66.17  ?  224 PRO A O    1 
ATOM   2713 C CB   . PRO A 1 179 ? -12.446 -6.588  76.472 1.00 51.55  ?  224 PRO A CB   1 
ATOM   2714 C CG   . PRO A 1 179 ? -11.124 -6.947  77.090 1.00 43.04  ?  224 PRO A CG   1 
ATOM   2715 C CD   . PRO A 1 179 ? -10.301 -7.469  75.968 1.00 44.63  ?  224 PRO A CD   1 
ATOM   2716 H HA   . PRO A 1 179 ? -12.737 -6.638  74.420 1.00 67.59  ?  224 PRO A HA   1 
ATOM   2717 H HB2  . PRO A 1 179 ? -12.850 -5.840  76.940 1.00 61.86  ?  224 PRO A HB2  1 
ATOM   2718 H HB3  . PRO A 1 179 ? -13.042 -7.353  76.473 1.00 61.86  ?  224 PRO A HB3  1 
ATOM   2719 H HG2  . PRO A 1 179 ? -10.717 -6.154  77.475 1.00 51.65  ?  224 PRO A HG2  1 
ATOM   2720 H HG3  . PRO A 1 179 ? -11.254 -7.629  77.767 1.00 51.65  ?  224 PRO A HG3  1 
ATOM   2721 H HD2  . PRO A 1 179 ? -9.358  -7.319  76.138 1.00 53.56  ?  224 PRO A HD2  1 
ATOM   2722 H HD3  . PRO A 1 179 ? -10.492 -8.408  75.813 1.00 53.56  ?  224 PRO A HD3  1 
ATOM   2723 N N    . THR B 2 5   ? 18.001  24.295  71.701 1.00 56.94  ?  50  THR B N    1 
ATOM   2724 C CA   . THR B 2 5   ? 17.558  25.328  70.772 1.00 62.87  ?  50  THR B CA   1 
ATOM   2725 C C    . THR B 2 5   ? 16.269  24.904  70.074 1.00 56.39  ?  50  THR B C    1 
ATOM   2726 O O    . THR B 2 5   ? 16.036  25.243  68.914 1.00 53.12  ?  50  THR B O    1 
ATOM   2727 C CB   . THR B 2 5   ? 18.632  25.631  69.709 1.00 67.92  ?  50  THR B CB   1 
ATOM   2728 O OG1  . THR B 2 5   ? 18.831  24.478  68.880 1.00 64.13  ?  50  THR B OG1  1 
ATOM   2729 C CG2  . THR B 2 5   ? 19.949  26.009  70.372 1.00 76.31  ?  50  THR B CG2  1 
ATOM   2730 H HA   . THR B 2 5   ? 17.382  26.145  71.264 1.00 75.44  ?  50  THR B HA   1 
ATOM   2731 H HB   . THR B 2 5   ? 18.341  26.375  69.160 1.00 81.51  ?  50  THR B HB   1 
ATOM   2732 H HG1  . THR B 2 5   ? 19.083  23.828  69.348 1.00 76.95  ?  50  THR B HG1  1 
ATOM   2733 H HG21 . THR B 2 5   ? 20.618  26.197  69.696 1.00 91.57  ?  50  THR B HG21 1 
ATOM   2734 H HG22 . THR B 2 5   ? 19.827  26.797  70.924 1.00 91.57  ?  50  THR B HG22 1 
ATOM   2735 H HG23 . THR B 2 5   ? 20.261  25.279  70.930 1.00 91.57  ?  50  THR B HG23 1 
ATOM   2736 N N    . ARG B 2 6   ? 15.433  24.162  70.796 1.00 51.22  ?  51  ARG B N    1 
ATOM   2737 C CA   . ARG B 2 6   ? 14.191  23.661  70.227 1.00 41.20  ?  51  ARG B CA   1 
ATOM   2738 C C    . ARG B 2 6   ? 13.255  24.812  69.876 1.00 36.71  ?  51  ARG B C    1 
ATOM   2739 O O    . ARG B 2 6   ? 13.153  25.800  70.608 1.00 37.28  ?  51  ARG B O    1 
ATOM   2740 C CB   . ARG B 2 6   ? 13.514  22.711  71.216 1.00 37.09  ?  51  ARG B CB   1 
ATOM   2741 C CG   . ARG B 2 6   ? 12.189  22.143  70.737 1.00 34.57  ?  51  ARG B CG   1 
ATOM   2742 C CD   . ARG B 2 6   ? 11.742  20.985  71.624 1.00 39.03  ?  51  ARG B CD   1 
ATOM   2743 N NE   . ARG B 2 6   ? 12.707  19.889  71.599 1.00 29.68  ?  51  ARG B NE   1 
ATOM   2744 C CZ   . ARG B 2 6   ? 12.659  18.858  70.760 1.00 34.77  ?  51  ARG B CZ   1 
ATOM   2745 N NH1  . ARG B 2 6   ? 11.684  18.759  69.866 1.00 31.21  1  51  ARG B NH1  1 
ATOM   2746 N NH2  . ARG B 2 6   ? 13.592  17.918  70.820 1.00 34.35  ?  51  ARG B NH2  1 
ATOM   2747 H H    . ARG B 2 6   ? 15.564  23.936  71.615 1.00 61.46  ?  51  ARG B H    1 
ATOM   2748 H HA   . ARG B 2 6   ? 14.385  23.168  69.415 1.00 49.45  ?  51  ARG B HA   1 
ATOM   2749 H HB2  . ARG B 2 6   ? 14.110  21.965  71.386 1.00 44.51  ?  51  ARG B HB2  1 
ATOM   2750 H HB3  . ARG B 2 6   ? 13.348  23.191  72.042 1.00 44.51  ?  51  ARG B HB3  1 
ATOM   2751 H HG2  . ARG B 2 6   ? 11.511  22.836  70.773 1.00 41.48  ?  51  ARG B HG2  1 
ATOM   2752 H HG3  . ARG B 2 6   ? 12.289  21.814  69.830 1.00 41.48  ?  51  ARG B HG3  1 
ATOM   2753 H HD2  . ARG B 2 6   ? 11.658  21.296  72.539 1.00 46.84  ?  51  ARG B HD2  1 
ATOM   2754 H HD3  . ARG B 2 6   ? 10.890  20.648  71.304 1.00 46.84  ?  51  ARG B HD3  1 
ATOM   2755 H HE   . ARG B 2 6   ? 13.352  19.912  72.167 1.00 35.62  ?  51  ARG B HE   1 
ATOM   2756 H HH11 . ARG B 2 6   ? 11.077  19.367  69.822 1.00 37.45  ?  51  ARG B HH11 1 
ATOM   2757 H HH12 . ARG B 2 6   ? 11.660  18.088  69.328 1.00 37.45  ?  51  ARG B HH12 1 
ATOM   2758 H HH21 . ARG B 2 6   ? 14.225  17.976  71.399 1.00 41.22  ?  51  ARG B HH21 1 
ATOM   2759 H HH22 . ARG B 2 6   ? 13.562  17.248  70.281 1.00 41.22  ?  51  ARG B HH22 1 
ATOM   2760 N N    . ILE B 2 7   ? 12.569  24.678  68.746 1.00 31.51  ?  52  ILE B N    1 
ATOM   2761 C CA   . ILE B 2 7   ? 11.592  25.674  68.320 1.00 31.16  ?  52  ILE B CA   1 
ATOM   2762 C C    . ILE B 2 7   ? 10.324  25.486  69.144 1.00 30.75  ?  52  ILE B C    1 
ATOM   2763 O O    . ILE B 2 7   ? 9.664   24.445  69.057 1.00 28.08  ?  52  ILE B O    1 
ATOM   2764 C CB   . ILE B 2 7   ? 11.300  25.559  66.818 1.00 28.17  ?  52  ILE B CB   1 
ATOM   2765 C CG1  . ILE B 2 7   ? 12.574  25.819  66.010 1.00 29.49  ?  52  ILE B CG1  1 
ATOM   2766 C CG2  . ILE B 2 7   ? 10.206  26.540  66.419 1.00 24.66  ?  52  ILE B CG2  1 
ATOM   2767 C CD1  . ILE B 2 7   ? 12.410  25.640  64.507 1.00 27.92  ?  52  ILE B CD1  1 
ATOM   2768 H H    . ILE B 2 7   ? 12.651  24.015  68.204 1.00 37.82  ?  52  ILE B H    1 
ATOM   2769 H HA   . ILE B 2 7   ? 11.941  26.562  68.496 1.00 37.40  ?  52  ILE B HA   1 
ATOM   2770 H HB   . ILE B 2 7   ? 10.992  24.658  66.630 1.00 33.80  ?  52  ILE B HB   1 
ATOM   2771 H HG12 . ILE B 2 7   ? 12.862  26.732  66.169 1.00 35.39  ?  52  ILE B HG12 1 
ATOM   2772 H HG13 . ILE B 2 7   ? 13.262  25.202  66.307 1.00 35.39  ?  52  ILE B HG13 1 
ATOM   2773 H HG21 . ILE B 2 7   ? 10.036  26.453  65.468 1.00 29.59  ?  52  ILE B HG21 1 
ATOM   2774 H HG22 . ILE B 2 7   ? 9.401   26.336  66.920 1.00 29.59  ?  52  ILE B HG22 1 
ATOM   2775 H HG23 . ILE B 2 7   ? 10.502  27.441  66.622 1.00 29.59  ?  52  ILE B HG23 1 
ATOM   2776 H HD11 . ILE B 2 7   ? 13.258  25.823  64.073 1.00 33.50  ?  52  ILE B HD11 1 
ATOM   2777 H HD12 . ILE B 2 7   ? 12.135  24.728  64.327 1.00 33.50  ?  52  ILE B HD12 1 
ATOM   2778 H HD13 . ILE B 2 7   ? 11.734  26.259  64.188 1.00 33.50  ?  52  ILE B HD13 1 
ATOM   2779 N N    . ILE B 2 8   ? 9.976   26.498  69.935 1.00 26.61  ?  53  ILE B N    1 
ATOM   2780 C CA   . ILE B 2 8   ? 8.855   26.433  70.865 1.00 24.93  ?  53  ILE B CA   1 
ATOM   2781 C C    . ILE B 2 8   ? 7.910   27.588  70.569 1.00 26.67  ?  53  ILE B C    1 
ATOM   2782 O O    . ILE B 2 8   ? 8.351   28.733  70.413 1.00 31.57  ?  53  ILE B O    1 
ATOM   2783 C CB   . ILE B 2 8   ? 9.336   26.482  72.328 1.00 31.55  ?  53  ILE B CB   1 
ATOM   2784 C CG1  . ILE B 2 8   ? 10.360  25.373  72.591 1.00 27.36  ?  53  ILE B CG1  1 
ATOM   2785 C CG2  . ILE B 2 8   ? 8.155   26.351  73.284 1.00 30.34  ?  53  ILE B CG2  1 
ATOM   2786 C CD1  . ILE B 2 8   ? 11.155  25.562  73.862 1.00 36.08  ?  53  ILE B CD1  1 
ATOM   2787 H H    . ILE B 2 8   ? 10.386  27.254  69.950 1.00 31.93  ?  53  ILE B H    1 
ATOM   2788 H HA   . ILE B 2 8   ? 8.373   25.602  70.730 1.00 29.92  ?  53  ILE B HA   1 
ATOM   2789 H HB   . ILE B 2 8   ? 9.764   27.339  72.482 1.00 37.86  ?  53  ILE B HB   1 
ATOM   2790 H HG12 . ILE B 2 8   ? 9.892   24.526  72.657 1.00 32.83  ?  53  ILE B HG12 1 
ATOM   2791 H HG13 . ILE B 2 8   ? 10.987  25.345  71.851 1.00 32.83  ?  53  ILE B HG13 1 
ATOM   2792 H HG21 . ILE B 2 8   ? 8.483   26.385  74.196 1.00 36.41  ?  53  ILE B HG21 1 
ATOM   2793 H HG22 . ILE B 2 8   ? 7.539   27.083  73.126 1.00 36.41  ?  53  ILE B HG22 1 
ATOM   2794 H HG23 . ILE B 2 8   ? 7.712   25.504  73.122 1.00 36.41  ?  53  ILE B HG23 1 
ATOM   2795 H HD11 . ILE B 2 8   ? 11.777  24.824  73.957 1.00 43.30  ?  53  ILE B HD11 1 
ATOM   2796 H HD12 . ILE B 2 8   ? 11.640  26.400  73.809 1.00 43.30  ?  53  ILE B HD12 1 
ATOM   2797 H HD13 . ILE B 2 8   ? 10.544  25.580  74.616 1.00 43.30  ?  53  ILE B HD13 1 
ATOM   2798 N N    . TYR B 2 9   ? 6.616   27.288  70.496 1.00 23.70  ?  54  TYR B N    1 
ATOM   2799 C CA   . TYR B 2 9   ? 5.582   28.294  70.293 1.00 24.48  ?  54  TYR B CA   1 
ATOM   2800 C C    . TYR B 2 9   ? 4.489   28.097  71.331 1.00 26.45  ?  54  TYR B C    1 
ATOM   2801 O O    . TYR B 2 9   ? 3.982   26.983  71.492 1.00 25.01  ?  54  TYR B O    1 
ATOM   2802 C CB   . TYR B 2 9   ? 4.970   28.203  68.889 1.00 25.30  ?  54  TYR B CB   1 
ATOM   2803 C CG   . TYR B 2 9   ? 5.954   28.359  67.751 1.00 21.78  ?  54  TYR B CG   1 
ATOM   2804 C CD1  . TYR B 2 9   ? 6.565   29.579  67.497 1.00 24.31  ?  54  TYR B CD1  1 
ATOM   2805 C CD2  . TYR B 2 9   ? 6.250   27.292  66.914 1.00 18.96  ?  54  TYR B CD2  1 
ATOM   2806 C CE1  . TYR B 2 9   ? 7.455   29.729  66.452 1.00 23.11  ?  54  TYR B CE1  1 
ATOM   2807 C CE2  . TYR B 2 9   ? 7.138   27.430  65.866 1.00 19.79  ?  54  TYR B CE2  1 
ATOM   2808 C CZ   . TYR B 2 9   ? 7.740   28.652  65.638 1.00 24.86  ?  54  TYR B CZ   1 
ATOM   2809 O OH   . TYR B 2 9   ? 8.628   28.800  64.595 1.00 22.19  ?  54  TYR B OH   1 
ATOM   2810 H H    . TYR B 2 9   ? 6.306   26.489  70.563 1.00 28.44  ?  54  TYR B H    1 
ATOM   2811 H HA   . TYR B 2 9   ? 5.962   29.179  70.408 1.00 29.38  ?  54  TYR B HA   1 
ATOM   2812 H HB2  . TYR B 2 9   ? 4.547   27.336  68.793 1.00 30.36  ?  54  TYR B HB2  1 
ATOM   2813 H HB3  . TYR B 2 9   ? 4.304   28.903  68.798 1.00 30.36  ?  54  TYR B HB3  1 
ATOM   2814 H HD1  . TYR B 2 9   ? 6.376   30.307  68.044 1.00 29.17  ?  54  TYR B HD1  1 
ATOM   2815 H HD2  . TYR B 2 9   ? 5.847   26.467  67.065 1.00 22.75  ?  54  TYR B HD2  1 
ATOM   2816 H HE1  . TYR B 2 9   ? 7.861   30.551  66.298 1.00 27.73  ?  54  TYR B HE1  1 
ATOM   2817 H HE2  . TYR B 2 9   ? 7.330   26.704  65.317 1.00 23.75  ?  54  TYR B HE2  1 
ATOM   2818 H HH   . TYR B 2 9   ? 8.711   28.074  64.182 1.00 26.63  ?  54  TYR B HH   1 
ATOM   2819 N N    . ASP B 2 10  ? 4.119   29.172  72.022 1.00 26.11  ?  55  ASP B N    1 
ATOM   2820 C CA   . ASP B 2 10  ? 2.958   29.107  72.894 1.00 27.95  ?  55  ASP B CA   1 
ATOM   2821 C C    . ASP B 2 10  ? 1.681   29.253  72.071 1.00 26.45  ?  55  ASP B C    1 
ATOM   2822 O O    . ASP B 2 10  ? 1.702   29.669  70.909 1.00 25.40  ?  55  ASP B O    1 
ATOM   2823 C CB   . ASP B 2 10  ? 3.025   30.179  73.988 1.00 34.18  ?  55  ASP B CB   1 
ATOM   2824 C CG   . ASP B 2 10  ? 3.082   31.588  73.436 1.00 37.02  ?  55  ASP B CG   1 
ATOM   2825 O OD1  . ASP B 2 10  ? 2.384   31.874  72.441 1.00 40.80  -1 55  ASP B OD1  1 
ATOM   2826 O OD2  . ASP B 2 10  ? 3.823   32.417  74.007 1.00 40.18  ?  55  ASP B OD2  1 
ATOM   2827 H H    . ASP B 2 10  ? 4.516   29.934  72.004 1.00 31.34  ?  55  ASP B H    1 
ATOM   2828 H HA   . ASP B 2 10  ? 2.937   28.240  73.327 1.00 33.54  ?  55  ASP B HA   1 
ATOM   2829 H HB2  . ASP B 2 10  ? 2.236   30.108  74.548 1.00 41.02  ?  55  ASP B HB2  1 
ATOM   2830 H HB3  . ASP B 2 10  ? 3.823   30.035  74.522 1.00 41.02  ?  55  ASP B HB3  1 
ATOM   2831 N N    . ARG B 2 11  ? 0.557   28.895  72.694 1.00 26.74  ?  56  ARG B N    1 
ATOM   2832 C CA   . ARG B 2 11  ? -0.705  28.805  71.966 1.00 26.62  ?  56  ARG B CA   1 
ATOM   2833 C C    . ARG B 2 11  ? -1.128  30.156  71.405 1.00 28.76  ?  56  ARG B C    1 
ATOM   2834 O O    . ARG B 2 11  ? -1.583  30.246  70.257 1.00 23.05  ?  56  ARG B O    1 
ATOM   2835 C CB   . ARG B 2 11  ? -1.793  28.248  72.883 1.00 24.44  ?  56  ARG B CB   1 
ATOM   2836 C CG   . ARG B 2 11  ? -3.145  28.078  72.211 1.00 27.60  ?  56  ARG B CG   1 
ATOM   2837 C CD   . ARG B 2 11  ? -4.203  27.617  73.199 1.00 26.77  ?  56  ARG B CD   1 
ATOM   2838 N NE   . ARG B 2 11  ? -5.432  27.221  72.519 1.00 29.55  ?  56  ARG B NE   1 
ATOM   2839 C CZ   . ARG B 2 11  ? -6.410  28.055  72.178 1.00 35.07  ?  56  ARG B CZ   1 
ATOM   2840 N NH1  . ARG B 2 11  ? -6.318  29.352  72.451 1.00 35.51  1  56  ARG B NH1  1 
ATOM   2841 N NH2  . ARG B 2 11  ? -7.486  27.590  71.558 1.00 37.94  ?  56  ARG B NH2  1 
ATOM   2842 H H    . ARG B 2 11  ? 0.500   28.701  73.530 1.00 32.09  ?  56  ARG B H    1 
ATOM   2843 H HA   . ARG B 2 11  ? -0.597  28.192  71.222 1.00 31.95  ?  56  ARG B HA   1 
ATOM   2844 H HB2  . ARG B 2 11  ? -1.512  27.378  73.207 1.00 29.32  ?  56  ARG B HB2  1 
ATOM   2845 H HB3  . ARG B 2 11  ? -1.909  28.855  73.631 1.00 29.32  ?  56  ARG B HB3  1 
ATOM   2846 H HG2  . ARG B 2 11  ? -3.426  28.928  71.839 1.00 33.13  ?  56  ARG B HG2  1 
ATOM   2847 H HG3  . ARG B 2 11  ? -3.072  27.412  71.511 1.00 33.13  ?  56  ARG B HG3  1 
ATOM   2848 H HD2  . ARG B 2 11  ? -3.868  26.852  73.693 1.00 32.12  ?  56  ARG B HD2  1 
ATOM   2849 H HD3  . ARG B 2 11  ? -4.412  28.344  73.807 1.00 32.12  ?  56  ARG B HD3  1 
ATOM   2850 H HE   . ARG B 2 11  ? -5.531  26.389  72.326 1.00 35.46  ?  56  ARG B HE   1 
ATOM   2851 H HH11 . ARG B 2 11  ? -5.622  29.659  72.852 1.00 42.61  ?  56  ARG B HH11 1 
ATOM   2852 H HH12 . ARG B 2 11  ? -6.955  29.885  72.227 1.00 42.61  ?  56  ARG B HH12 1 
ATOM   2853 H HH21 . ARG B 2 11  ? -7.550  26.751  71.379 1.00 45.52  ?  56  ARG B HH21 1 
ATOM   2854 H HH22 . ARG B 2 11  ? -8.121  28.126  71.337 1.00 45.52  ?  56  ARG B HH22 1 
ATOM   2855 N N    . LYS B 2 12  ? -1.007  31.216  72.205 1.00 29.64  ?  57  LYS B N    1 
ATOM   2856 C CA   . LYS B 2 12  ? -1.466  32.527  71.761 1.00 29.83  ?  57  LYS B CA   1 
ATOM   2857 C C    . LYS B 2 12  ? -0.734  32.968  70.500 1.00 27.94  ?  57  LYS B C    1 
ATOM   2858 O O    . LYS B 2 12  ? -1.346  33.524  69.580 1.00 30.92  ?  57  LYS B O    1 
ATOM   2859 C CB   . LYS B 2 12  ? -1.281  33.553  72.881 1.00 35.25  ?  57  LYS B CB   1 
ATOM   2860 C CG   . LYS B 2 12  ? -1.743  34.954  72.517 1.00 35.76  ?  57  LYS B CG   1 
ATOM   2861 C CD   . LYS B 2 12  ? -1.711  35.883  73.719 1.00 38.02  ?  57  LYS B CD   1 
ATOM   2862 C CE   . LYS B 2 12  ? -2.053  37.311  73.324 1.00 44.82  ?  57  LYS B CE   1 
ATOM   2863 N NZ   . LYS B 2 12  ? -3.402  37.421  72.702 1.00 45.55  1  57  LYS B NZ   1 
ATOM   2864 H H    . LYS B 2 12  ? -0.668  31.202  72.995 1.00 35.57  ?  57  LYS B H    1 
ATOM   2865 H HA   . LYS B 2 12  ? -2.413  32.476  71.555 1.00 35.80  ?  57  LYS B HA   1 
ATOM   2866 H HB2  . LYS B 2 12  ? -1.789  33.265  73.655 1.00 42.30  ?  57  LYS B HB2  1 
ATOM   2867 H HB3  . LYS B 2 12  ? -0.339  33.601  73.106 1.00 42.30  ?  57  LYS B HB3  1 
ATOM   2868 H HG2  . LYS B 2 12  ? -1.156  35.318  71.836 1.00 42.91  ?  57  LYS B HG2  1 
ATOM   2869 H HG3  . LYS B 2 12  ? -2.655  34.914  72.187 1.00 42.91  ?  57  LYS B HG3  1 
ATOM   2870 H HD2  . LYS B 2 12  ? -2.363  35.584  74.373 1.00 45.62  ?  57  LYS B HD2  1 
ATOM   2871 H HD3  . LYS B 2 12  ? -0.821  35.878  74.105 1.00 45.62  ?  57  LYS B HD3  1 
ATOM   2872 H HE2  . LYS B 2 12  ? -2.040  37.871  74.116 1.00 53.78  ?  57  LYS B HE2  1 
ATOM   2873 H HE3  . LYS B 2 12  ? -1.398  37.627  72.682 1.00 53.78  ?  57  LYS B HE3  1 
ATOM   2874 H HZ1  . LYS B 2 12  ? -3.568  38.268  72.484 1.00 54.66  ?  57  LYS B HZ1  1 
ATOM   2875 H HZ2  . LYS B 2 12  ? -3.440  36.921  71.967 1.00 54.66  ?  57  LYS B HZ2  1 
ATOM   2876 H HZ3  . LYS B 2 12  ? -4.024  37.143  73.274 1.00 54.66  ?  57  LYS B HZ3  1 
ATOM   2877 N N    . PHE B 2 13  ? 0.575   32.726  70.438 1.00 27.25  ?  58  PHE B N    1 
ATOM   2878 C CA   . PHE B 2 13  ? 1.341   33.084  69.249 1.00 27.06  ?  58  PHE B CA   1 
ATOM   2879 C C    . PHE B 2 13  ? 0.835   32.335  68.020 1.00 29.17  ?  58  PHE B C    1 
ATOM   2880 O O    . PHE B 2 13  ? 0.563   32.942  66.978 1.00 25.94  ?  58  PHE B O    1 
ATOM   2881 C CB   . PHE B 2 13  ? 2.825   32.802  69.483 1.00 29.65  ?  58  PHE B CB   1 
ATOM   2882 C CG   . PHE B 2 13  ? 3.692   33.104  68.293 1.00 32.53  ?  58  PHE B CG   1 
ATOM   2883 C CD1  . PHE B 2 13  ? 3.913   34.411  67.897 1.00 35.17  ?  58  PHE B CD1  1 
ATOM   2884 C CD2  . PHE B 2 13  ? 4.288   32.081  67.575 1.00 26.18  ?  58  PHE B CD2  1 
ATOM   2885 C CE1  . PHE B 2 13  ? 4.708   34.691  66.804 1.00 34.58  ?  58  PHE B CE1  1 
ATOM   2886 C CE2  . PHE B 2 13  ? 5.084   32.355  66.482 1.00 30.05  ?  58  PHE B CE2  1 
ATOM   2887 C CZ   . PHE B 2 13  ? 5.295   33.661  66.097 1.00 32.64  ?  58  PHE B CZ   1 
ATOM   2888 H H    . PHE B 2 13  ? 1.037   32.359  71.063 1.00 32.70  ?  58  PHE B H    1 
ATOM   2889 H HA   . PHE B 2 13  ? 1.240   34.035  69.083 1.00 32.48  ?  58  PHE B HA   1 
ATOM   2890 H HB2  . PHE B 2 13  ? 3.135   33.349  70.222 1.00 35.58  ?  58  PHE B HB2  1 
ATOM   2891 H HB3  . PHE B 2 13  ? 2.935   31.863  69.700 1.00 35.58  ?  58  PHE B HB3  1 
ATOM   2892 H HD1  . PHE B 2 13  ? 3.519   35.108  68.370 1.00 42.20  ?  58  PHE B HD1  1 
ATOM   2893 H HD2  . PHE B 2 13  ? 4.148   31.198  67.831 1.00 31.42  ?  58  PHE B HD2  1 
ATOM   2894 H HE1  . PHE B 2 13  ? 4.849   35.573  66.546 1.00 41.49  ?  58  PHE B HE1  1 
ATOM   2895 H HE2  . PHE B 2 13  ? 5.479   31.660  66.007 1.00 36.06  ?  58  PHE B HE2  1 
ATOM   2896 H HZ   . PHE B 2 13  ? 5.832   33.849  65.361 1.00 39.16  ?  58  PHE B HZ   1 
ATOM   2897 N N    . LEU B 2 14  ? 0.700   31.010  68.123 1.00 26.80  ?  59  LEU B N    1 
ATOM   2898 C CA   . LEU B 2 14  ? 0.206   30.234  66.989 1.00 24.93  ?  59  LEU B CA   1 
ATOM   2899 C C    . LEU B 2 14  ? -1.162  30.729  66.539 1.00 24.68  ?  59  LEU B C    1 
ATOM   2900 O O    . LEU B 2 14  ? -1.428  30.835  65.336 1.00 25.55  ?  59  LEU B O    1 
ATOM   2901 C CB   . LEU B 2 14  ? 0.146   28.749  67.351 1.00 23.70  ?  59  LEU B CB   1 
ATOM   2902 C CG   . LEU B 2 14  ? 1.484   28.068  67.657 1.00 23.99  ?  59  LEU B CG   1 
ATOM   2903 C CD1  . LEU B 2 14  ? 1.259   26.629  68.096 1.00 17.62  ?  59  LEU B CD1  1 
ATOM   2904 C CD2  . LEU B 2 14  ? 2.417   28.113  66.454 1.00 22.63  ?  59  LEU B CD2  1 
ATOM   2905 H H    . LEU B 2 14  ? 0.884   30.547  68.824 1.00 32.16  ?  59  LEU B H    1 
ATOM   2906 H HA   . LEU B 2 14  ? 0.820   30.337  66.246 1.00 29.92  ?  59  LEU B HA   1 
ATOM   2907 H HB2  . LEU B 2 14  ? -0.413  28.651  68.138 1.00 28.44  ?  59  LEU B HB2  1 
ATOM   2908 H HB3  . LEU B 2 14  ? -0.257  28.272  66.609 1.00 28.44  ?  59  LEU B HB3  1 
ATOM   2909 H HG   . LEU B 2 14  ? 1.917   28.538  68.387 1.00 28.79  ?  59  LEU B HG   1 
ATOM   2910 H HD11 . LEU B 2 14  ? 2.117   26.219  68.284 1.00 21.14  ?  59  LEU B HD11 1 
ATOM   2911 H HD12 . LEU B 2 14  ? 0.708   26.626  68.894 1.00 21.14  ?  59  LEU B HD12 1 
ATOM   2912 H HD13 . LEU B 2 14  ? 0.811   26.149  67.382 1.00 21.14  ?  59  LEU B HD13 1 
ATOM   2913 H HD21 . LEU B 2 14  ? 3.250   27.674  66.685 1.00 27.16  ?  59  LEU B HD21 1 
ATOM   2914 H HD22 . LEU B 2 14  ? 1.995   27.654  65.711 1.00 27.16  ?  59  LEU B HD22 1 
ATOM   2915 H HD23 . LEU B 2 14  ? 2.584   29.039  66.220 1.00 27.16  ?  59  LEU B HD23 1 
ATOM   2916 N N    . MET B 2 15  ? -2.045  31.038  67.490 1.00 27.44  ?  60  MET B N    1 
ATOM   2917 C CA   . MET B 2 15  ? -3.362  31.554  67.134 1.00 30.19  ?  60  MET B CA   1 
ATOM   2918 C C    . MET B 2 15  ? -3.252  32.840  66.326 1.00 28.80  ?  60  MET B C    1 
ATOM   2919 O O    . MET B 2 15  ? -3.963  33.021  65.330 1.00 30.69  ?  60  MET B O    1 
ATOM   2920 C CB   . MET B 2 15  ? -4.189  31.791  68.398 1.00 31.01  ?  60  MET B CB   1 
ATOM   2921 C CG   . MET B 2 15  ? -4.670  30.520  69.079 1.00 34.56  ?  60  MET B CG   1 
ATOM   2922 S SD   . MET B 2 15  ? -5.679  29.477  68.009 1.00 43.18  ?  60  MET B SD   1 
ATOM   2923 C CE   . MET B 2 15  ? -6.966  30.613  67.493 1.00 46.35  ?  60  MET B CE   1 
ATOM   2924 H H    . MET B 2 15  ? -1.907  30.959  68.335 1.00 32.92  ?  60  MET B H    1 
ATOM   2925 H HA   . MET B 2 15  ? -3.824  30.889  66.599 1.00 36.22  ?  60  MET B HA   1 
ATOM   2926 H HB2  . MET B 2 15  ? -3.646  32.280  69.036 1.00 37.21  ?  60  MET B HB2  1 
ATOM   2927 H HB3  . MET B 2 15  ? -4.971  32.315  68.164 1.00 37.21  ?  60  MET B HB3  1 
ATOM   2928 H HG2  . MET B 2 15  ? -3.900  30.003  69.360 1.00 41.48  ?  60  MET B HG2  1 
ATOM   2929 H HG3  . MET B 2 15  ? -5.206  30.761  69.851 1.00 41.48  ?  60  MET B HG3  1 
ATOM   2930 H HE1  . MET B 2 15  ? -7.578  30.149  66.902 1.00 55.62  ?  60  MET B HE1  1 
ATOM   2931 H HE2  . MET B 2 15  ? -7.439  30.930  68.278 1.00 55.62  ?  60  MET B HE2  1 
ATOM   2932 H HE3  . MET B 2 15  ? -6.559  31.361  67.028 1.00 55.62  ?  60  MET B HE3  1 
ATOM   2933 N N    . GLU B 2 16  ? -2.368  33.746  66.738 1.00 25.83  ?  61  GLU B N    1 
ATOM   2934 C CA   . GLU B 2 16  ? -2.246  35.020  66.041 1.00 33.56  ?  61  GLU B CA   1 
ATOM   2935 C C    . GLU B 2 16  ? -1.580  34.868  64.680 1.00 34.04  ?  61  GLU B C    1 
ATOM   2936 O O    . GLU B 2 16  ? -1.771  35.727  63.813 1.00 33.59  ?  61  GLU B O    1 
ATOM   2937 C CB   . GLU B 2 16  ? -1.473  36.015  66.906 1.00 33.85  ?  61  GLU B CB   1 
ATOM   2938 C CG   . GLU B 2 16  ? -1.633  37.463  66.464 1.00 42.90  ?  61  GLU B CG   1 
ATOM   2939 C CD   . GLU B 2 16  ? -1.601  38.443  67.621 1.00 41.64  ?  61  GLU B CD   1 
ATOM   2940 O OE1  . GLU B 2 16  ? -1.998  38.063  68.745 1.00 41.69  ?  61  GLU B OE1  1 
ATOM   2941 O OE2  . GLU B 2 16  ? -1.181  39.600  67.403 1.00 43.29  -1 61  GLU B OE2  1 
ATOM   2942 H H    . GLU B 2 16  ? -1.835  33.649  67.406 1.00 31.00  ?  61  GLU B H    1 
ATOM   2943 H HA   . GLU B 2 16  ? -3.134  35.382  65.896 1.00 40.27  ?  61  GLU B HA   1 
ATOM   2944 H HB2  . GLU B 2 16  ? -1.789  35.947  67.821 1.00 40.62  ?  61  GLU B HB2  1 
ATOM   2945 H HB3  . GLU B 2 16  ? -0.529  35.796  66.868 1.00 40.62  ?  61  GLU B HB3  1 
ATOM   2946 H HG2  . GLU B 2 16  ? -0.910  37.690  65.859 1.00 51.48  ?  61  GLU B HG2  1 
ATOM   2947 H HG3  . GLU B 2 16  ? -2.486  37.561  66.012 1.00 51.48  ?  61  GLU B HG3  1 
ATOM   2948 N N    . CYS B 2 17  ? -0.814  33.794  64.468 1.00 30.35  ?  62  CYS B N    1 
ATOM   2949 C CA   . CYS B 2 17  ? -0.212  33.554  63.162 1.00 29.36  ?  62  CYS B CA   1 
ATOM   2950 C C    . CYS B 2 17  ? -1.251  33.226  62.101 1.00 31.62  ?  62  CYS B C    1 
ATOM   2951 O O    . CYS B 2 17  ? -0.949  33.316  60.907 1.00 32.93  ?  62  CYS B O    1 
ATOM   2952 C CB   . CYS B 2 17  ? 0.810   32.422  63.248 1.00 22.58  ?  62  CYS B CB   1 
ATOM   2953 S SG   . CYS B 2 17  ? 2.367   32.895  64.029 1.00 25.84  ?  62  CYS B SG   1 
ATOM   2954 H H    . CYS B 2 17  ? -0.631  33.197  65.060 1.00 36.42  ?  62  CYS B H    1 
ATOM   2955 H HA   . CYS B 2 17  ? 0.256   34.356  62.881 1.00 35.23  ?  62  CYS B HA   1 
ATOM   2956 H HB2  . CYS B 2 17  ? 0.428   31.696  63.766 1.00 27.09  ?  62  CYS B HB2  1 
ATOM   2957 H HB3  . CYS B 2 17  ? 1.010   32.114  62.350 1.00 27.09  ?  62  CYS B HB3  1 
ATOM   2958 H HG   . CYS B 2 17  ? 2.146   33.265  65.149 1.00 31.01  ?  62  CYS B HG   1 
ATOM   2959 N N    . ARG B 2 18  ? -2.464  32.846  62.506 1.00 34.35  ?  63  ARG B N    1 
ATOM   2960 C CA   . ARG B 2 18  ? -3.521  32.600  61.536 1.00 35.17  ?  63  ARG B CA   1 
ATOM   2961 C C    . ARG B 2 18  ? -3.986  33.884  60.859 1.00 36.33  ?  63  ARG B C    1 
ATOM   2962 O O    . ARG B 2 18  ? -4.593  33.819  59.785 1.00 38.66  ?  63  ARG B O    1 
ATOM   2963 C CB   . ARG B 2 18  ? -4.706  31.907  62.214 1.00 32.77  ?  63  ARG B CB   1 
ATOM   2964 C CG   . ARG B 2 18  ? -5.885  31.666  61.283 1.00 39.70  ?  63  ARG B CG   1 
ATOM   2965 C CD   . ARG B 2 18  ? -6.841  30.613  61.822 1.00 41.04  ?  63  ARG B CD   1 
ATOM   2966 N NE   . ARG B 2 18  ? -7.511  31.030  63.051 1.00 50.68  ?  63  ARG B NE   1 
ATOM   2967 C CZ   . ARG B 2 18  ? -8.418  30.299  63.694 1.00 49.63  ?  63  ARG B CZ   1 
ATOM   2968 N NH1  . ARG B 2 18  ? -8.772  29.105  63.231 1.00 48.92  ?  63  ARG B NH1  1 
ATOM   2969 N NH2  . ARG B 2 18  ? -8.975  30.762  64.805 1.00 47.82  ?  63  ARG B NH2  1 
ATOM   2970 H H    . ARG B 2 18  ? -2.694  32.725  63.325 1.00 41.22  ?  63  ARG B H    1 
ATOM   2971 H HA   . ARG B 2 18  ? -3.183  32.007  60.847 1.00 42.21  ?  63  ARG B HA   1 
ATOM   2972 H HB2  . ARG B 2 18  ? -4.413  31.046  62.551 1.00 39.32  ?  63  ARG B HB2  1 
ATOM   2973 H HB3  . ARG B 2 18  ? -5.015  32.461  62.948 1.00 39.32  ?  63  ARG B HB3  1 
ATOM   2974 H HG2  . ARG B 2 18  ? -6.379  32.494  61.176 1.00 47.63  ?  63  ARG B HG2  1 
ATOM   2975 H HG3  . ARG B 2 18  ? -5.555  31.361  60.424 1.00 47.63  ?  63  ARG B HG3  1 
ATOM   2976 H HD2  . ARG B 2 18  ? -7.523  30.435  61.155 1.00 49.25  ?  63  ARG B HD2  1 
ATOM   2977 H HD3  . ARG B 2 18  ? -6.344  29.802  62.011 1.00 49.25  ?  63  ARG B HD3  1 
ATOM   2978 H HE   . ARG B 2 18  ? -7.305  31.797  63.381 1.00 60.82  ?  63  ARG B HE   1 
ATOM   2979 H HH11 . ARG B 2 18  ? -8.415  28.800  62.510 1.00 58.70  ?  63  ARG B HH11 1 
ATOM   2980 H HH12 . ARG B 2 18  ? -9.359  28.638  63.651 1.00 58.70  ?  63  ARG B HH12 1 
ATOM   2981 H HH21 . ARG B 2 18  ? -8.750  31.534  65.110 1.00 57.39  ?  63  ARG B HH21 1 
ATOM   2982 H HH22 . ARG B 2 18  ? -9.561  30.290  65.222 1.00 57.39  ?  63  ARG B HH22 1 
ATOM   2983 N N    . ASN B 2 19  ? -3.703  35.044  61.454 1.00 42.29  ?  64  ASN B N    1 
ATOM   2984 C CA   . ASN B 2 19  ? -4.158  36.331  60.924 1.00 38.53  ?  64  ASN B CA   1 
ATOM   2985 C C    . ASN B 2 19  ? -3.186  36.817  59.848 1.00 44.96  ?  64  ASN B C    1 
ATOM   2986 O O    . ASN B 2 19  ? -2.492  37.826  59.989 1.00 43.09  ?  64  ASN B O    1 
ATOM   2987 C CB   . ASN B 2 19  ? -4.292  37.349  62.047 1.00 41.27  ?  64  ASN B CB   1 
ATOM   2988 C CG   . ASN B 2 19  ? -5.252  36.901  63.126 1.00 40.93  ?  64  ASN B CG   1 
ATOM   2989 O OD1  . ASN B 2 19  ? -6.259  36.251  62.846 1.00 38.27  ?  64  ASN B OD1  1 
ATOM   2990 N ND2  . ASN B 2 19  ? -4.944  37.246  64.372 1.00 42.49  ?  64  ASN B ND2  1 
ATOM   2991 H H    . ASN B 2 19  ? -3.243  35.113  62.177 1.00 50.75  ?  64  ASN B H    1 
ATOM   2992 H HA   . ASN B 2 19  ? -5.030  36.216  60.514 1.00 46.24  ?  64  ASN B HA   1 
ATOM   2993 H HB2  . ASN B 2 19  ? -3.423  37.485  62.456 1.00 49.52  ?  64  ASN B HB2  1 
ATOM   2994 H HB3  . ASN B 2 19  ? -4.621  38.184  61.679 1.00 49.52  ?  64  ASN B HB3  1 
ATOM   2995 H HD21 . ASN B 2 19  ? -5.459  37.015  65.022 1.00 50.99  ?  64  ASN B HD21 1 
ATOM   2996 H HD22 . ASN B 2 19  ? -4.231  37.699  64.529 1.00 50.99  ?  64  ASN B HD22 1 
ATOM   2997 N N    . SER B 2 20  ? -3.156  36.072  58.742 1.00 43.21  ?  65  SER B N    1 
ATOM   2998 C CA   . SER B 2 20  ? -2.311  36.418  57.613 1.00 44.53  ?  65  SER B CA   1 
ATOM   2999 C C    . SER B 2 20  ? -2.984  35.929  56.340 1.00 43.70  ?  65  SER B C    1 
ATOM   3000 O O    . SER B 2 20  ? -3.579  34.840  56.346 1.00 43.35  ?  65  SER B O    1 
ATOM   3001 C CB   . SER B 2 20  ? -0.916  35.797  57.730 1.00 44.36  ?  65  SER B CB   1 
ATOM   3002 O OG   . SER B 2 20  ? -0.978  34.389  57.582 1.00 42.81  ?  65  SER B OG   1 
ATOM   3003 H H    . SER B 2 20  ? -3.621  35.358  58.625 1.00 51.85  ?  65  SER B H    1 
ATOM   3004 H HA   . SER B 2 20  ? -2.216  37.381  57.561 1.00 53.43  ?  65  SER B HA   1 
ATOM   3005 H HB2  . SER B 2 20  ? -0.348  36.163  57.034 1.00 53.24  ?  65  SER B HB2  1 
ATOM   3006 H HB3  . SER B 2 20  ? -0.549  36.007  58.603 1.00 53.24  ?  65  SER B HB3  1 
ATOM   3007 H HG   . SER B 2 20  ? -0.208  34.059  57.647 1.00 51.37  ?  65  SER B HG   1 
ATOM   3008 N N    . PRO B 2 21  ? -2.898  36.684  55.241 1.00 43.66  ?  66  PRO B N    1 
ATOM   3009 C CA   . PRO B 2 21  ? -3.538  36.231  53.997 1.00 43.78  ?  66  PRO B CA   1 
ATOM   3010 C C    . PRO B 2 21  ? -2.946  34.948  53.448 1.00 39.21  ?  66  PRO B C    1 
ATOM   3011 O O    . PRO B 2 21  ? -3.598  34.285  52.634 1.00 38.76  ?  66  PRO B O    1 
ATOM   3012 C CB   . PRO B 2 21  ? -3.314  37.409  53.040 1.00 45.15  ?  66  PRO B CB   1 
ATOM   3013 C CG   . PRO B 2 21  ? -2.088  38.076  53.554 1.00 47.34  ?  66  PRO B CG   1 
ATOM   3014 C CD   . PRO B 2 21  ? -2.144  37.933  55.047 1.00 45.03  ?  66  PRO B CD   1 
ATOM   3015 H HA   . PRO B 2 21  ? -4.490  36.109  54.135 1.00 52.54  ?  66  PRO B HA   1 
ATOM   3016 H HB2  . PRO B 2 21  ? -3.176  37.079  52.139 1.00 54.17  ?  66  PRO B HB2  1 
ATOM   3017 H HB3  . PRO B 2 21  ? -4.075  38.011  53.076 1.00 54.17  ?  66  PRO B HB3  1 
ATOM   3018 H HG2  . PRO B 2 21  ? -1.303  37.631  53.197 1.00 56.81  ?  66  PRO B HG2  1 
ATOM   3019 H HG3  . PRO B 2 21  ? -2.096  39.012  53.300 1.00 56.81  ?  66  PRO B HG3  1 
ATOM   3020 H HD2  . PRO B 2 21  ? -1.249  37.849  55.412 1.00 54.04  ?  66  PRO B HD2  1 
ATOM   3021 H HD3  . PRO B 2 21  ? -2.620  38.681  55.441 1.00 54.04  ?  66  PRO B HD3  1 
ATOM   3022 N N    . VAL B 2 22  ? -1.730  34.580  53.860 1.00 38.08  ?  67  VAL B N    1 
ATOM   3023 C CA   . VAL B 2 22  ? -1.145  33.311  53.436 1.00 38.27  ?  67  VAL B CA   1 
ATOM   3024 C C    . VAL B 2 22  ? -2.068  32.153  53.785 1.00 32.94  ?  67  VAL B C    1 
ATOM   3025 O O    . VAL B 2 22  ? -2.134  31.159  53.053 1.00 37.00  ?  67  VAL B O    1 
ATOM   3026 C CB   . VAL B 2 22  ? 0.250   33.137  54.072 1.00 33.81  ?  67  VAL B CB   1 
ATOM   3027 C CG1  . VAL B 2 22  ? 0.688   31.672  54.069 1.00 31.19  ?  67  VAL B CG1  1 
ATOM   3028 C CG2  . VAL B 2 22  ? 1.273   33.986  53.336 1.00 38.30  ?  67  VAL B CG2  1 
ATOM   3029 H H    . VAL B 2 22  ? -1.228  35.046  54.380 1.00 45.70  ?  67  VAL B H    1 
ATOM   3030 H HA   . VAL B 2 22  ? -1.034  33.323  52.473 1.00 45.92  ?  67  VAL B HA   1 
ATOM   3031 H HB   . VAL B 2 22  ? 0.218   33.438  54.994 1.00 40.57  ?  67  VAL B HB   1 
ATOM   3032 H HG11 . VAL B 2 22  ? 1.567   31.604  54.475 1.00 37.43  ?  67  VAL B HG11 1 
ATOM   3033 H HG12 . VAL B 2 22  ? 0.048   31.150  54.577 1.00 37.43  ?  67  VAL B HG12 1 
ATOM   3034 H HG13 . VAL B 2 22  ? 0.722   31.355  53.153 1.00 37.43  ?  67  VAL B HG13 1 
ATOM   3035 H HG21 . VAL B 2 22  ? 2.141   33.863  53.750 1.00 45.96  ?  67  VAL B HG21 1 
ATOM   3036 H HG22 . VAL B 2 22  ? 1.305   33.707  52.408 1.00 45.96  ?  67  VAL B HG22 1 
ATOM   3037 H HG23 . VAL B 2 22  ? 1.008   34.918  53.392 1.00 45.96  ?  67  VAL B HG23 1 
ATOM   3038 N N    . THR B 2 23  ? -2.790  32.255  54.901 1.00 37.57  ?  68  THR B N    1 
ATOM   3039 C CA   . THR B 2 23  ? -3.637  31.163  55.364 1.00 32.83  ?  68  THR B CA   1 
ATOM   3040 C C    . THR B 2 23  ? -4.999  31.127  54.680 1.00 38.56  ?  68  THR B C    1 
ATOM   3041 O O    . THR B 2 23  ? -5.759  30.178  54.904 1.00 38.80  ?  68  THR B O    1 
ATOM   3042 C CB   . THR B 2 23  ? -3.840  31.258  56.879 1.00 35.35  ?  68  THR B CB   1 
ATOM   3043 O OG1  . THR B 2 23  ? -4.599  32.431  57.192 1.00 41.40  ?  68  THR B OG1  1 
ATOM   3044 C CG2  . THR B 2 23  ? -2.497  31.317  57.601 1.00 34.29  ?  68  THR B CG2  1 
ATOM   3045 H H    . THR B 2 23  ? -2.806  32.950  55.408 1.00 45.08  ?  68  THR B H    1 
ATOM   3046 H HA   . THR B 2 23  ? -3.190  30.323  55.177 1.00 39.39  ?  68  THR B HA   1 
ATOM   3047 H HB   . THR B 2 23  ? -4.318  30.473  57.189 1.00 42.42  ?  68  THR B HB   1 
ATOM   3048 H HG1  . THR B 2 23  ? -4.192  33.116  56.927 1.00 49.68  ?  68  THR B HG1  1 
ATOM   3049 H HG21 . THR B 2 23  ? -2.638  31.377  58.558 1.00 41.15  ?  68  THR B HG21 1 
ATOM   3050 H HG22 . THR B 2 23  ? -1.981  30.519  57.407 1.00 41.15  ?  68  THR B HG22 1 
ATOM   3051 H HG23 . THR B 2 23  ? -1.997  32.094  57.307 1.00 41.15  ?  68  THR B HG23 1 
ATOM   3052 N N    . LYS B 2 24  ? -5.321  32.116  53.850 1.00 38.84  ?  69  LYS B N    1 
ATOM   3053 C CA   . LYS B 2 24  ? -6.658  32.257  53.289 1.00 40.95  ?  69  LYS B CA   1 
ATOM   3054 C C    . LYS B 2 24  ? -6.860  31.468  52.002 1.00 37.20  ?  69  LYS B C    1 
ATOM   3055 O O    . LYS B 2 24  ? -7.941  31.548  51.408 1.00 37.05  ?  69  LYS B O    1 
ATOM   3056 C CB   . LYS B 2 24  ? -6.962  33.736  53.031 1.00 43.68  ?  69  LYS B CB   1 
ATOM   3057 C CG   . LYS B 2 24  ? -6.988  34.588  54.288 1.00 46.80  ?  69  LYS B CG   1 
ATOM   3058 C CD   . LYS B 2 24  ? -7.285  36.042  53.961 1.00 51.42  ?  69  LYS B CD   1 
ATOM   3059 C CE   . LYS B 2 24  ? -7.169  36.926  55.191 1.00 56.37  ?  69  LYS B CE   1 
ATOM   3060 N NZ   . LYS B 2 24  ? -7.280  38.370  54.846 1.00 57.60  ?  69  LYS B NZ   1 
ATOM   3061 H H    . LYS B 2 24  ? -4.772  32.727  53.594 1.00 46.60  ?  69  LYS B H    1 
ATOM   3062 H HA   . LYS B 2 24  ? -7.302  31.932  53.937 1.00 49.14  ?  69  LYS B HA   1 
ATOM   3063 H HB2  . LYS B 2 24  ? -6.280  34.097  52.443 1.00 52.42  ?  69  LYS B HB2  1 
ATOM   3064 H HB3  . LYS B 2 24  ? -7.832  33.807  52.607 1.00 52.42  ?  69  LYS B HB3  1 
ATOM   3065 H HG2  . LYS B 2 24  ? -7.682  34.262  54.883 1.00 56.16  ?  69  LYS B HG2  1 
ATOM   3066 H HG3  . LYS B 2 24  ? -6.123  34.544  54.724 1.00 56.16  ?  69  LYS B HG3  1 
ATOM   3067 H HD2  . LYS B 2 24  ? -6.649  36.357  53.299 1.00 61.71  ?  69  LYS B HD2  1 
ATOM   3068 H HD3  . LYS B 2 24  ? -8.189  36.115  53.618 1.00 61.71  ?  69  LYS B HD3  1 
ATOM   3069 H HE2  . LYS B 2 24  ? -7.883  36.707  55.810 1.00 67.65  ?  69  LYS B HE2  1 
ATOM   3070 H HE3  . LYS B 2 24  ? -6.306  36.780  55.609 1.00 67.65  ?  69  LYS B HE3  1 
ATOM   3071 H HZ1  . LYS B 2 24  ? -7.209  38.865  55.583 1.00 69.12  ?  69  LYS B HZ1  1 
ATOM   3072 H HZ2  . LYS B 2 24  ? -6.632  38.598  54.281 1.00 69.12  ?  69  LYS B HZ2  1 
ATOM   3073 H HZ3  . LYS B 2 24  ? -8.067  38.531  54.464 1.00 69.12  ?  69  LYS B HZ3  1 
ATOM   3074 N N    . THR B 2 25  ? -5.859  30.718  51.554 1.00 31.43  ?  70  THR B N    1 
ATOM   3075 C CA   . THR B 2 25  ? -6.005  29.885  50.375 1.00 33.97  ?  70  THR B CA   1 
ATOM   3076 C C    . THR B 2 25  ? -5.665  28.441  50.724 1.00 30.30  ?  70  THR B C    1 
ATOM   3077 O O    . THR B 2 25  ? -4.784  28.195  51.554 1.00 30.12  ?  70  THR B O    1 
ATOM   3078 C CB   . THR B 2 25  ? -5.095  30.358  49.234 1.00 36.86  ?  70  THR B CB   1 
ATOM   3079 O OG1  . THR B 2 25  ? -3.726  30.106  49.575 1.00 37.06  ?  70  THR B OG1  1 
ATOM   3080 C CG2  . THR B 2 25  ? -5.286  31.850  48.973 1.00 38.14  ?  70  THR B CG2  1 
ATOM   3081 H H    . THR B 2 25  ? -5.082  30.676  51.920 1.00 37.72  ?  70  THR B H    1 
ATOM   3082 H HA   . THR B 2 25  ? -6.924  29.919  50.068 1.00 40.76  ?  70  THR B HA   1 
ATOM   3083 H HB   . THR B 2 25  ? -5.318  29.875  48.423 1.00 44.23  ?  70  THR B HB   1 
ATOM   3084 H HG1  . THR B 2 25  ? -3.223  30.363  48.953 1.00 44.47  ?  70  THR B HG1  1 
ATOM   3085 H HG21 . THR B 2 25  ? -4.706  32.137  48.251 1.00 45.77  ?  70  THR B HG21 1 
ATOM   3086 H HG22 . THR B 2 25  ? -6.207  32.028  48.728 1.00 45.77  ?  70  THR B HG22 1 
ATOM   3087 H HG23 . THR B 2 25  ? -5.069  32.356  49.772 1.00 45.77  ?  70  THR B HG23 1 
ATOM   3088 N N    . PRO B 2 26  ? -6.344  27.468  50.122 1.00 32.37  ?  71  PRO B N    1 
ATOM   3089 C CA   . PRO B 2 26  ? -6.047  26.066  50.428 1.00 33.67  ?  71  PRO B CA   1 
ATOM   3090 C C    . PRO B 2 26  ? -4.727  25.649  49.809 1.00 31.88  ?  71  PRO B C    1 
ATOM   3091 O O    . PRO B 2 26  ? -4.269  26.263  48.835 1.00 31.08  ?  71  PRO B O    1 
ATOM   3092 C CB   . PRO B 2 26  ? -7.222  25.309  49.793 1.00 30.68  ?  71  PRO B CB   1 
ATOM   3093 C CG   . PRO B 2 26  ? -7.645  26.176  48.662 1.00 33.49  ?  71  PRO B CG   1 
ATOM   3094 C CD   . PRO B 2 26  ? -7.403  27.597  49.105 1.00 32.58  ?  71  PRO B CD   1 
ATOM   3095 H HA   . PRO B 2 26  ? -6.031  25.914  51.386 1.00 40.41  ?  71  PRO B HA   1 
ATOM   3096 H HB2  . PRO B 2 26  ? -6.922  24.444  49.473 1.00 36.81  ?  71  PRO B HB2  1 
ATOM   3097 H HB3  . PRO B 2 26  ? -7.938  25.210  50.440 1.00 36.81  ?  71  PRO B HB3  1 
ATOM   3098 H HG2  . PRO B 2 26  ? -7.113  25.968  47.879 1.00 40.19  ?  71  PRO B HG2  1 
ATOM   3099 H HG3  . PRO B 2 26  ? -8.587  26.033  48.480 1.00 40.19  ?  71  PRO B HG3  1 
ATOM   3100 H HD2  . PRO B 2 26  ? -7.092  28.134  48.360 1.00 39.10  ?  71  PRO B HD2  1 
ATOM   3101 H HD3  . PRO B 2 26  ? -8.207  27.969  49.500 1.00 39.10  ?  71  PRO B HD3  1 
ATOM   3102 N N    . PRO B 2 27  ? -4.077  24.620  50.346 1.00 33.93  ?  72  PRO B N    1 
ATOM   3103 C CA   . PRO B 2 27  ? -2.922  24.051  49.646 1.00 33.76  ?  72  PRO B CA   1 
ATOM   3104 C C    . PRO B 2 27  ? -3.359  23.463  48.314 1.00 38.25  ?  72  PRO B C    1 
ATOM   3105 O O    . PRO B 2 27  ? -4.414  22.835  48.213 1.00 36.76  ?  72  PRO B O    1 
ATOM   3106 C CB   . PRO B 2 27  ? -2.414  22.970  50.608 1.00 35.57  ?  72  PRO B CB   1 
ATOM   3107 C CG   . PRO B 2 27  ? -3.008  23.309  51.932 1.00 30.15  ?  72  PRO B CG   1 
ATOM   3108 C CD   . PRO B 2 27  ? -4.318  23.960  51.639 1.00 29.83  ?  72  PRO B CD   1 
ATOM   3109 H HA   . PRO B 2 27  ? -2.235  24.721  49.505 1.00 40.52  ?  72  PRO B HA   1 
ATOM   3110 H HB2  . PRO B 2 27  ? -2.718  22.099  50.309 1.00 42.69  ?  72  PRO B HB2  1 
ATOM   3111 H HB3  . PRO B 2 27  ? -1.445  23.000  50.650 1.00 42.69  ?  72  PRO B HB3  1 
ATOM   3112 H HG2  . PRO B 2 27  ? -3.138  22.497  52.446 1.00 36.18  ?  72  PRO B HG2  1 
ATOM   3113 H HG3  . PRO B 2 27  ? -2.421  23.920  52.404 1.00 36.18  ?  72  PRO B HG3  1 
ATOM   3114 H HD2  . PRO B 2 27  ? -5.018  23.293  51.555 1.00 35.79  ?  72  PRO B HD2  1 
ATOM   3115 H HD3  . PRO B 2 27  ? -4.531  24.617  52.321 1.00 35.79  ?  72  PRO B HD3  1 
ATOM   3116 N N    . ARG B 2 28  ? -2.545  23.685  47.279 1.00 40.47  ?  73  ARG B N    1 
ATOM   3117 C CA   . ARG B 2 28  ? -2.877  23.146  45.963 1.00 41.44  ?  73  ARG B CA   1 
ATOM   3118 C C    . ARG B 2 28  ? -3.098  21.643  46.030 1.00 43.49  ?  73  ARG B C    1 
ATOM   3119 O O    . ARG B 2 28  ? -3.972  21.101  45.343 1.00 47.02  ?  73  ARG B O    1 
ATOM   3120 C CB   . ARG B 2 28  ? -1.770  23.468  44.958 1.00 46.06  ?  73  ARG B CB   1 
ATOM   3121 C CG   . ARG B 2 28  ? -2.080  22.998  43.537 1.00 45.74  ?  73  ARG B CG   1 
ATOM   3122 C CD   . ARG B 2 28  ? -0.824  22.640  42.763 1.00 43.27  ?  73  ARG B CD   1 
ATOM   3123 N NE   . ARG B 2 28  ? -0.038  23.816  42.409 1.00 37.36  ?  73  ARG B NE   1 
ATOM   3124 C CZ   . ARG B 2 28  ? 1.096   23.779  41.715 1.00 36.90  ?  73  ARG B CZ   1 
ATOM   3125 N NH1  . ARG B 2 28  ? 1.589   22.620  41.293 1.00 34.86  ?  73  ARG B NH1  1 
ATOM   3126 N NH2  . ARG B 2 28  ? 1.738   24.905  41.439 1.00 31.26  ?  73  ARG B NH2  1 
ATOM   3127 H H    . ARG B 2 28  ? -1.812  24.134  47.312 1.00 48.56  ?  73  ARG B H    1 
ATOM   3128 H HA   . ARG B 2 28  ? -3.697  23.558  45.649 1.00 49.73  ?  73  ARG B HA   1 
ATOM   3129 H HB2  . ARG B 2 28  ? -1.639  24.428  44.932 1.00 55.28  ?  73  ARG B HB2  1 
ATOM   3130 H HB3  . ARG B 2 28  ? -0.952  23.031  45.243 1.00 55.28  ?  73  ARG B HB3  1 
ATOM   3131 H HG2  . ARG B 2 28  ? -2.644  22.210  43.578 1.00 54.89  ?  73  ARG B HG2  1 
ATOM   3132 H HG3  . ARG B 2 28  ? -2.536  23.709  43.060 1.00 54.89  ?  73  ARG B HG3  1 
ATOM   3133 H HD2  . ARG B 2 28  ? -0.269  22.060  43.308 1.00 51.93  ?  73  ARG B HD2  1 
ATOM   3134 H HD3  . ARG B 2 28  ? -1.074  22.187  41.943 1.00 51.93  ?  73  ARG B HD3  1 
ATOM   3135 H HE   . ARG B 2 28  ? -0.327  24.584  42.665 1.00 44.83  ?  73  ARG B HE   1 
ATOM   3136 H HH11 . ARG B 2 28  ? 1.174   21.887  41.469 1.00 41.83  ?  73  ARG B HH11 1 
ATOM   3137 H HH12 . ARG B 2 28  ? 2.322   22.602  40.845 1.00 41.83  ?  73  ARG B HH12 1 
ATOM   3138 H HH21 . ARG B 2 28  ? 1.422   25.657  41.711 1.00 37.51  ?  73  ARG B HH21 1 
ATOM   3139 H HH22 . ARG B 2 28  ? 2.472   24.882  40.991 1.00 37.51  ?  73  ARG B HH22 1 
ATOM   3140 N N    . ASP B 2 29  ? -2.314  20.953  46.853 1.00 43.36  ?  74  ASP B N    1 
ATOM   3141 C CA   . ASP B 2 29  ? -2.364  19.500  46.950 1.00 43.90  ?  74  ASP B CA   1 
ATOM   3142 C C    . ASP B 2 29  ? -3.523  18.992  47.797 1.00 42.15  ?  74  ASP B C    1 
ATOM   3143 O O    . ASP B 2 29  ? -3.638  17.777  47.985 1.00 42.94  ?  74  ASP B O    1 
ATOM   3144 C CB   . ASP B 2 29  ? -1.045  18.977  47.528 1.00 43.40  ?  74  ASP B CB   1 
ATOM   3145 C CG   . ASP B 2 29  ? -0.662  19.671  48.824 1.00 44.94  ?  74  ASP B CG   1 
ATOM   3146 O OD1  . ASP B 2 29  ? -0.809  20.910  48.895 1.00 45.96  ?  74  ASP B OD1  1 
ATOM   3147 O OD2  . ASP B 2 29  ? -0.225  18.983  49.771 1.00 45.03  ?  74  ASP B OD2  1 
ATOM   3148 H H    . ASP B 2 29  ? -1.734  21.313  47.377 1.00 52.03  ?  74  ASP B H    1 
ATOM   3149 H HA   . ASP B 2 29  ? -2.464  19.132  46.058 1.00 52.68  ?  74  ASP B HA   1 
ATOM   3150 H HB2  . ASP B 2 29  ? -1.133  18.028  47.709 1.00 52.08  ?  74  ASP B HB2  1 
ATOM   3151 H HB3  . ASP B 2 29  ? -0.335  19.128  46.885 1.00 52.08  ?  74  ASP B HB3  1 
ATOM   3152 N N    . LEU B 2 30  ? -4.375  19.871  48.309 1.00 42.87  ?  75  LEU B N    1 
ATOM   3153 C CA   . LEU B 2 30  ? -5.429  19.452  49.222 1.00 37.51  ?  75  LEU B CA   1 
ATOM   3154 C C    . LEU B 2 30  ? -6.390  18.493  48.523 1.00 39.00  ?  75  LEU B C    1 
ATOM   3155 O O    . LEU B 2 30  ? -7.041  18.890  47.545 1.00 37.71  ?  75  LEU B O    1 
ATOM   3156 C CB   . LEU B 2 30  ? -6.191  20.665  49.748 1.00 35.79  ?  75  LEU B CB   1 
ATOM   3157 C CG   . LEU B 2 30  ? -7.190  20.377  50.873 1.00 34.35  ?  75  LEU B CG   1 
ATOM   3158 C CD1  . LEU B 2 30  ? -6.482  19.865  52.122 1.00 35.00  ?  75  LEU B CD1  1 
ATOM   3159 C CD2  . LEU B 2 30  ? -8.001  21.616  51.194 1.00 34.40  ?  75  LEU B CD2  1 
ATOM   3160 H H    . LEU B 2 30  ? -4.364  20.715  48.144 1.00 51.44  ?  75  LEU B H    1 
ATOM   3161 H HA   . LEU B 2 30  ? -5.033  18.990  49.978 1.00 45.01  ?  75  LEU B HA   1 
ATOM   3162 H HB2  . LEU B 2 30  ? -5.549  21.308  50.087 1.00 42.94  ?  75  LEU B HB2  1 
ATOM   3163 H HB3  . LEU B 2 30  ? -6.686  21.059  49.013 1.00 42.94  ?  75  LEU B HB3  1 
ATOM   3164 H HG   . LEU B 2 30  ? -7.805  19.688  50.576 1.00 41.22  ?  75  LEU B HG   1 
ATOM   3165 H HD11 . LEU B 2 30  ? -7.143  19.694  52.811 1.00 42.00  ?  75  LEU B HD11 1 
ATOM   3166 H HD12 . LEU B 2 30  ? -6.010  19.046  51.903 1.00 42.00  ?  75  LEU B HD12 1 
ATOM   3167 H HD13 . LEU B 2 30  ? -5.853  20.539  52.426 1.00 42.00  ?  75  LEU B HD13 1 
ATOM   3168 H HD21 . LEU B 2 30  ? -8.625  21.409  51.907 1.00 41.28  ?  75  LEU B HD21 1 
ATOM   3169 H HD22 . LEU B 2 30  ? -7.399  22.323  51.476 1.00 41.28  ?  75  LEU B HD22 1 
ATOM   3170 H HD23 . LEU B 2 30  ? -8.485  21.891  50.400 1.00 41.28  ?  75  LEU B HD23 1 
ATOM   3171 N N    . PRO B 2 31  ? -6.511  17.244  48.972 1.00 39.10  ?  76  PRO B N    1 
ATOM   3172 C CA   . PRO B 2 31  ? -7.497  16.345  48.363 1.00 39.86  ?  76  PRO B CA   1 
ATOM   3173 C C    . PRO B 2 31  ? -8.917  16.773  48.691 1.00 39.85  ?  76  PRO B C    1 
ATOM   3174 O O    . PRO B 2 31  ? -9.201  17.316  49.762 1.00 38.89  ?  76  PRO B O    1 
ATOM   3175 C CB   . PRO B 2 31  ? -7.172  14.978  48.980 1.00 42.82  ?  76  PRO B CB   1 
ATOM   3176 C CG   . PRO B 2 31  ? -5.799  15.113  49.545 1.00 41.38  ?  76  PRO B CG   1 
ATOM   3177 C CD   . PRO B 2 31  ? -5.672  16.541  49.957 1.00 38.15  ?  76  PRO B CD   1 
ATOM   3178 H HA   . PRO B 2 31  ? -7.379  16.307  47.401 1.00 47.83  ?  76  PRO B HA   1 
ATOM   3179 H HB2  . PRO B 2 31  ? -7.812  14.777  49.681 1.00 51.38  ?  76  PRO B HB2  1 
ATOM   3180 H HB3  . PRO B 2 31  ? -7.193  14.296  48.291 1.00 51.38  ?  76  PRO B HB3  1 
ATOM   3181 H HG2  . PRO B 2 31  ? -5.704  14.526  50.312 1.00 49.65  ?  76  PRO B HG2  1 
ATOM   3182 H HG3  . PRO B 2 31  ? -5.144  14.894  48.864 1.00 49.65  ?  76  PRO B HG3  1 
ATOM   3183 H HD2  . PRO B 2 31  ? -6.022  16.668  50.853 1.00 45.78  ?  76  PRO B HD2  1 
ATOM   3184 H HD3  . PRO B 2 31  ? -4.750  16.834  49.887 1.00 45.78  ?  76  PRO B HD3  1 
ATOM   3185 N N    . THR B 2 32  ? -9.818  16.519  47.745 1.00 43.26  ?  77  THR B N    1 
ATOM   3186 C CA   . THR B 2 32  ? -11.241 16.789  47.933 1.00 48.74  ?  77  THR B CA   1 
ATOM   3187 C C    . THR B 2 32  ? -11.886 15.519  48.476 1.00 51.05  ?  77  THR B C    1 
ATOM   3188 O O    . THR B 2 32  ? -12.214 14.601  47.720 1.00 52.35  ?  77  THR B O    1 
ATOM   3189 C CB   . THR B 2 32  ? -11.886 17.234  46.625 1.00 50.63  ?  77  THR B CB   1 
ATOM   3190 O OG1  . THR B 2 32  ? -11.228 18.414  46.144 1.00 49.99  ?  77  THR B OG1  1 
ATOM   3191 C CG2  . THR B 2 32  ? -13.369 17.532  46.825 1.00 52.04  ?  77  THR B CG2  1 
ATOM   3192 H H    . THR B 2 32  ? -9.627  16.187  46.976 1.00 51.91  ?  77  THR B H    1 
ATOM   3193 H HA   . THR B 2 32  ? -11.354 17.496  48.588 1.00 58.49  ?  77  THR B HA   1 
ATOM   3194 H HB   . THR B 2 32  ? -11.802 16.527  45.967 1.00 60.76  ?  77  THR B HB   1 
ATOM   3195 H HG1  . THR B 2 32  ? -11.579 18.665  45.423 1.00 59.99  ?  77  THR B HG1  1 
ATOM   3196 H HG21 . THR B 2 32  ? -13.766 17.814  45.987 1.00 62.45  ?  77  THR B HG21 1 
ATOM   3197 H HG22 . THR B 2 32  ? -13.827 16.738  47.140 1.00 62.45  ?  77  THR B HG22 1 
ATOM   3198 H HG23 . THR B 2 32  ? -13.478 18.240  47.480 1.00 62.45  ?  77  THR B HG23 1 
ATOM   3199 N N    . ILE B 2 33  ? -12.056 15.462  49.790 1.00 48.26  ?  78  ILE B N    1 
ATOM   3200 C CA   . ILE B 2 33  ? -12.716 14.351  50.470 1.00 50.63  ?  78  ILE B CA   1 
ATOM   3201 C C    . ILE B 2 33  ? -14.068 14.857  50.964 1.00 52.41  ?  78  ILE B C    1 
ATOM   3202 O O    . ILE B 2 33  ? -14.113 15.835  51.722 1.00 50.11  ?  78  ILE B O    1 
ATOM   3203 C CB   . ILE B 2 33  ? -11.870 13.811  51.636 1.00 52.37  ?  78  ILE B CB   1 
ATOM   3204 C CG1  . ILE B 2 33  ? -10.513 13.317  51.124 1.00 49.47  ?  78  ILE B CG1  1 
ATOM   3205 C CG2  . ILE B 2 33  ? -12.611 12.679  52.353 1.00 53.53  ?  78  ILE B CG2  1 
ATOM   3206 C CD1  . ILE B 2 33  ? -9.546  12.910  52.219 1.00 43.87  ?  78  ILE B CD1  1 
ATOM   3207 H H    . ILE B 2 33  ? -11.787 16.076  50.329 1.00 57.92  ?  78  ILE B H    1 
ATOM   3208 H HA   . ILE B 2 33  ? -12.868 13.630  49.840 1.00 60.76  ?  78  ILE B HA   1 
ATOM   3209 H HB   . ILE B 2 33  ? -11.719 14.531  52.268 1.00 62.85  ?  78  ILE B HB   1 
ATOM   3210 H HG12 . ILE B 2 33  ? -10.657 12.545  50.555 1.00 59.36  ?  78  ILE B HG12 1 
ATOM   3211 H HG13 . ILE B 2 33  ? -10.097 14.028  50.611 1.00 59.36  ?  78  ILE B HG13 1 
ATOM   3212 H HG21 . ILE B 2 33  ? -12.060 12.355  53.083 1.00 64.24  ?  78  ILE B HG21 1 
ATOM   3213 H HG22 . ILE B 2 33  ? -13.450 13.021  52.698 1.00 64.24  ?  78  ILE B HG22 1 
ATOM   3214 H HG23 . ILE B 2 33  ? -12.779 11.963  51.721 1.00 64.24  ?  78  ILE B HG23 1 
ATOM   3215 H HD11 . ILE B 2 33  ? -8.717  12.612  51.813 1.00 52.65  ?  78  ILE B HD11 1 
ATOM   3216 H HD12 . ILE B 2 33  ? -9.378  13.675  52.791 1.00 52.65  ?  78  ILE B HD12 1 
ATOM   3217 H HD13 . ILE B 2 33  ? -9.939  12.190  52.736 1.00 52.65  ?  78  ILE B HD13 1 
ATOM   3218 N N    . PRO B 2 34  ? -15.182 14.233  50.580 1.00 55.46  ?  79  PRO B N    1 
ATOM   3219 C CA   . PRO B 2 34  ? -16.494 14.780  50.954 1.00 55.35  ?  79  PRO B CA   1 
ATOM   3220 C C    . PRO B 2 34  ? -16.709 14.721  52.460 1.00 54.66  ?  79  PRO B C    1 
ATOM   3221 O O    . PRO B 2 34  ? -16.561 13.668  53.083 1.00 57.84  ?  79  PRO B O    1 
ATOM   3222 C CB   . PRO B 2 34  ? -17.481 13.879  50.203 1.00 57.18  ?  79  PRO B CB   1 
ATOM   3223 C CG   . PRO B 2 34  ? -16.755 12.586  50.047 1.00 58.74  ?  79  PRO B CG   1 
ATOM   3224 C CD   . PRO B 2 34  ? -15.306 12.946  49.871 1.00 56.75  ?  79  PRO B CD   1 
ATOM   3225 H HA   . PRO B 2 34  ? -16.585 15.695  50.644 1.00 66.41  ?  79  PRO B HA   1 
ATOM   3226 H HB2  . PRO B 2 34  ? -18.286 13.762  50.731 1.00 68.62  ?  79  PRO B HB2  1 
ATOM   3227 H HB3  . PRO B 2 34  ? -17.688 14.266  49.338 1.00 68.62  ?  79  PRO B HB3  1 
ATOM   3228 H HG2  . PRO B 2 34  ? -16.878 12.046  50.843 1.00 70.48  ?  79  PRO B HG2  1 
ATOM   3229 H HG3  . PRO B 2 34  ? -17.088 12.120  49.264 1.00 70.48  ?  79  PRO B HG3  1 
ATOM   3230 H HD2  . PRO B 2 34  ? -14.739 12.276  50.284 1.00 68.10  ?  79  PRO B HD2  1 
ATOM   3231 H HD3  . PRO B 2 34  ? -15.097 13.057  48.930 1.00 68.10  ?  79  PRO B HD3  1 
ATOM   3232 N N    . GLY B 2 35  ? -17.057 15.868  53.040 1.00 54.15  ?  80  GLY B N    1 
ATOM   3233 C CA   . GLY B 2 35  ? -17.350 15.953  54.455 1.00 55.88  ?  80  GLY B CA   1 
ATOM   3234 C C    . GLY B 2 35  ? -16.149 16.117  55.358 1.00 52.71  ?  80  GLY B C    1 
ATOM   3235 O O    . GLY B 2 35  ? -16.323 16.170  56.582 1.00 51.14  ?  80  GLY B O    1 
ATOM   3236 H H    . GLY B 2 35  ? -17.130 16.617  52.624 1.00 64.98  ?  80  GLY B H    1 
ATOM   3237 H HA2  . GLY B 2 35  ? -17.942 16.707  54.606 1.00 67.05  ?  80  GLY B HA2  1 
ATOM   3238 H HA3  . GLY B 2 35  ? -17.818 15.148  54.726 1.00 67.05  ?  80  GLY B HA3  1 
ATOM   3239 N N    . VAL B 2 36  ? -14.940 16.205  54.804 1.00 49.33  ?  81  VAL B N    1 
ATOM   3240 C CA   . VAL B 2 36  ? -13.727 16.306  55.609 1.00 47.87  ?  81  VAL B CA   1 
ATOM   3241 C C    . VAL B 2 36  ? -12.954 17.562  55.235 1.00 43.97  ?  81  VAL B C    1 
ATOM   3242 O O    . VAL B 2 36  ? -12.783 18.468  56.058 1.00 41.91  ?  81  VAL B O    1 
ATOM   3243 C CB   . VAL B 2 36  ? -12.847 15.057  55.433 1.00 45.53  ?  81  VAL B CB   1 
ATOM   3244 C CG1  . VAL B 2 36  ? -11.563 15.189  56.244 1.00 44.75  ?  81  VAL B CG1  1 
ATOM   3245 C CG2  . VAL B 2 36  ? -13.612 13.820  55.843 1.00 50.77  ?  81  VAL B CG2  1 
ATOM   3246 H H    . VAL B 2 36  ? -14.796 16.207  53.957 1.00 59.19  ?  81  VAL B H    1 
ATOM   3247 H HA   . VAL B 2 36  ? -13.972 16.371  56.545 1.00 57.44  ?  81  VAL B HA   1 
ATOM   3248 H HB   . VAL B 2 36  ? -12.606 14.967  54.498 1.00 54.63  ?  81  VAL B HB   1 
ATOM   3249 H HG11 . VAL B 2 36  ? -11.026 14.391  56.117 1.00 53.70  ?  81  VAL B HG11 1 
ATOM   3250 H HG12 . VAL B 2 36  ? -11.074 15.969  55.937 1.00 53.70  ?  81  VAL B HG12 1 
ATOM   3251 H HG13 . VAL B 2 36  ? -11.790 15.289  57.182 1.00 53.70  ?  81  VAL B HG13 1 
ATOM   3252 H HG21 . VAL B 2 36  ? -13.042 13.044  55.725 1.00 60.93  ?  81  VAL B HG21 1 
ATOM   3253 H HG22 . VAL B 2 36  ? -13.871 13.903  56.774 1.00 60.93  ?  81  VAL B HG22 1 
ATOM   3254 H HG23 . VAL B 2 36  ? -14.402 13.738  55.286 1.00 60.93  ?  81  VAL B HG23 1 
ATOM   3255 N N    . THR B 2 37  ? -12.459 17.614  54.002 1.00 45.62  ?  82  THR B N    1 
ATOM   3256 C CA   . THR B 2 37  ? -11.679 18.753  53.530 1.00 44.98  ?  82  THR B CA   1 
ATOM   3257 C C    . THR B 2 37  ? -12.626 19.764  52.898 1.00 45.65  ?  82  THR B C    1 
ATOM   3258 O O    . THR B 2 37  ? -13.168 19.527  51.813 1.00 49.28  ?  82  THR B O    1 
ATOM   3259 C CB   . THR B 2 37  ? -10.608 18.313  52.535 1.00 42.77  ?  82  THR B CB   1 
ATOM   3260 O OG1  . THR B 2 37  ? -11.216 17.594  51.456 1.00 43.83  ?  82  THR B OG1  1 
ATOM   3261 C CG2  . THR B 2 37  ? -9.572  17.434  53.216 1.00 39.45  ?  82  THR B CG2  1 
ATOM   3262 H H    . THR B 2 37  ? -12.562 16.995  53.414 1.00 54.75  ?  82  THR B H    1 
ATOM   3263 H HA   . THR B 2 37  ? -11.239 19.176  54.284 1.00 53.97  ?  82  THR B HA   1 
ATOM   3264 H HB   . THR B 2 37  ? -10.158 19.096  52.183 1.00 51.32  ?  82  THR B HB   1 
ATOM   3265 H HG1  . THR B 2 37  ? -10.629 17.350  50.906 1.00 52.59  ?  82  THR B HG1  1 
ATOM   3266 H HG21 . THR B 2 37  ? -8.898  17.160  52.575 1.00 47.34  ?  82  THR B HG21 1 
ATOM   3267 H HG22 . THR B 2 37  ? -9.144  17.923  53.935 1.00 47.34  ?  82  THR B HG22 1 
ATOM   3268 H HG23 . THR B 2 37  ? -9.998  16.643  53.583 1.00 47.34  ?  82  THR B HG23 1 
ATOM   3269 N N    . SER B 2 38  ? -12.824 20.887  53.577 1.00 42.73  ?  83  SER B N    1 
ATOM   3270 C CA   . SER B 2 38  ? -13.656 21.963  53.061 1.00 46.18  ?  83  SER B CA   1 
ATOM   3271 C C    . SER B 2 38  ? -12.912 22.732  51.973 1.00 47.44  ?  83  SER B C    1 
ATOM   3272 O O    . SER B 2 38  ? -11.706 22.963  52.072 1.00 43.50  ?  83  SER B O    1 
ATOM   3273 C CB   . SER B 2 38  ? -14.070 22.904  54.195 1.00 47.95  ?  83  SER B CB   1 
ATOM   3274 O OG   . SER B 2 38  ? -12.969 23.201  55.038 1.00 40.47  ?  83  SER B OG   1 
ATOM   3275 O OXT  . SER B 2 38  ? -13.499 23.138  50.969 1.00 53.01  ?  83  SER B OXT  1 
ATOM   3276 H H    . SER B 2 38  ? -12.483 21.050  54.350 1.00 51.28  ?  83  SER B H    1 
ATOM   3277 H HA   . SER B 2 38  ? -14.460 21.586  52.671 1.00 55.41  ?  83  SER B HA   1 
ATOM   3278 H HB2  . SER B 2 38  ? -14.405 23.729  53.813 1.00 57.53  ?  83  SER B HB2  1 
ATOM   3279 H HB3  . SER B 2 38  ? -14.764 22.477  54.721 1.00 57.53  ?  83  SER B HB3  1 
ATOM   3280 H HG   . SER B 2 38  ? -13.211 23.717  55.655 1.00 48.56  ?  83  SER B HG   1 
ATOM   3281 N N    . GLY C 1 1   ? 23.568  -1.488  10.851 1.00 44.98  ?  46  GLY C N    1 
ATOM   3282 C CA   . GLY C 1 1   ? 22.256  -1.480  10.230 1.00 38.05  ?  46  GLY C CA   1 
ATOM   3283 C C    . GLY C 1 1   ? 21.123  -1.353  11.231 1.00 33.65  ?  46  GLY C C    1 
ATOM   3284 O O    . GLY C 1 1   ? 20.304  -2.261  11.361 1.00 39.92  ?  46  GLY C O    1 
ATOM   3285 H HA2  . GLY C 1 1   ? 22.199  -0.737  9.610  1.00 45.66  ?  46  GLY C HA2  1 
ATOM   3286 H HA3  . GLY C 1 1   ? 22.132  -2.304  9.733  1.00 45.66  ?  46  GLY C HA3  1 
ATOM   3287 N N    . PRO C 1 2   ? 21.060  -0.223  11.927 1.00 32.01  ?  47  PRO C N    1 
ATOM   3288 C CA   . PRO C 1 2   ? 20.089  -0.065  13.013 1.00 30.55  ?  47  PRO C CA   1 
ATOM   3289 C C    . PRO C 1 2   ? 18.685  0.228   12.498 1.00 24.65  ?  47  PRO C C    1 
ATOM   3290 O O    . PRO C 1 2   ? 18.456  0.509   11.322 1.00 21.90  ?  47  PRO C O    1 
ATOM   3291 C CB   . PRO C 1 2   ? 20.643  1.122   13.802 1.00 31.41  ?  47  PRO C CB   1 
ATOM   3292 C CG   . PRO C 1 2   ? 21.331  1.944   12.769 1.00 32.52  ?  47  PRO C CG   1 
ATOM   3293 C CD   . PRO C 1 2   ? 21.912  0.970   11.776 1.00 32.76  ?  47  PRO C CD   1 
ATOM   3294 H HA   . PRO C 1 2   ? 20.074  -0.855  13.577 1.00 36.66  ?  47  PRO C HA   1 
ATOM   3295 H HB2  . PRO C 1 2   ? 19.915  1.617   14.210 1.00 37.69  ?  47  PRO C HB2  1 
ATOM   3296 H HB3  . PRO C 1 2   ? 21.270  0.810   14.472 1.00 37.69  ?  47  PRO C HB3  1 
ATOM   3297 H HG2  . PRO C 1 2   ? 20.688  2.528   12.337 1.00 39.03  ?  47  PRO C HG2  1 
ATOM   3298 H HG3  . PRO C 1 2   ? 22.036  2.465   13.187 1.00 39.03  ?  47  PRO C HG3  1 
ATOM   3299 H HD2  . PRO C 1 2   ? 21.842  1.323   10.876 1.00 39.31  ?  47  PRO C HD2  1 
ATOM   3300 H HD3  . PRO C 1 2   ? 22.830  0.760   12.006 1.00 39.31  ?  47  PRO C HD3  1 
ATOM   3301 N N    . HIS C 1 3   ? 17.736  0.157   13.427 1.00 20.82  ?  48  HIS C N    1 
ATOM   3302 C CA   . HIS C 1 3   ? 16.335  0.460   13.156 1.00 18.85  ?  48  HIS C CA   1 
ATOM   3303 C C    . HIS C 1 3   ? 15.807  1.176   14.391 1.00 20.87  ?  48  HIS C C    1 
ATOM   3304 O O    . HIS C 1 3   ? 15.644  0.555   15.447 1.00 15.54  ?  48  HIS C O    1 
ATOM   3305 C CB   . HIS C 1 3   ? 15.542  -0.812  12.852 1.00 18.69  ?  48  HIS C CB   1 
ATOM   3306 C CG   . HIS C 1 3   ? 14.148  -0.560  12.372 1.00 18.22  ?  48  HIS C CG   1 
ATOM   3307 N ND1  . HIS C 1 3   ? 13.286  -1.578  12.025 1.00 19.85  ?  48  HIS C ND1  1 
ATOM   3308 C CD2  . HIS C 1 3   ? 13.463  0.593   12.182 1.00 18.86  ?  48  HIS C CD2  1 
ATOM   3309 C CE1  . HIS C 1 3   ? 12.131  -1.064  11.642 1.00 19.71  ?  48  HIS C CE1  1 
ATOM   3310 N NE2  . HIS C 1 3   ? 12.213  0.252   11.728 1.00 21.73  ?  48  HIS C NE2  1 
ATOM   3311 H H    . HIS C 1 3   ? 17.884  -0.071  14.243 1.00 24.99  ?  48  HIS C H    1 
ATOM   3312 H HA   . HIS C 1 3   ? 16.269  1.058   12.396 1.00 22.62  ?  48  HIS C HA   1 
ATOM   3313 H HB2  . HIS C 1 3   ? 16.007  -1.311  12.163 1.00 22.43  ?  48  HIS C HB2  1 
ATOM   3314 H HB3  . HIS C 1 3   ? 15.485  -1.344  13.661 1.00 22.43  ?  48  HIS C HB3  1 
ATOM   3315 H HD2  . HIS C 1 3   ? 13.781  1.454   12.331 1.00 22.63  ?  48  HIS C HD2  1 
ATOM   3316 H HE1  . HIS C 1 3   ? 11.388  -1.546  11.360 1.00 23.65  ?  48  HIS C HE1  1 
ATOM   3317 H HE2  . HIS C 1 3   ? 11.584  0.805   11.531 1.00 26.07  ?  48  HIS C HE2  1 
ATOM   3318 N N    . MET C 1 4   ? 15.565  2.481   14.267 1.00 17.12  ?  49  MET C N    1 
ATOM   3319 C CA   . MET C 1 4   ? 15.345  3.347   15.416 1.00 19.81  ?  49  MET C CA   1 
ATOM   3320 C C    . MET C 1 4   ? 14.043  4.121   15.268 1.00 15.31  ?  49  MET C C    1 
ATOM   3321 O O    . MET C 1 4   ? 13.537  4.334   14.166 1.00 17.65  ?  49  MET C O    1 
ATOM   3322 C CB   . MET C 1 4   ? 16.499  4.346   15.591 1.00 21.85  ?  49  MET C CB   1 
ATOM   3323 C CG   . MET C 1 4   ? 17.858  3.702   15.802 1.00 31.83  ?  49  MET C CG   1 
ATOM   3324 S SD   . MET C 1 4   ? 19.181  4.919   15.942 1.00 46.33  ?  49  MET C SD   1 
ATOM   3325 C CE   . MET C 1 4   ? 19.290  5.512   14.253 1.00 32.31  ?  49  MET C CE   1 
ATOM   3326 H H    . MET C 1 4   ? 15.524  2.892   13.513 1.00 20.55  ?  49  MET C H    1 
ATOM   3327 H HA   . MET C 1 4   ? 15.298  2.801   16.217 1.00 23.77  ?  49  MET C HA   1 
ATOM   3328 H HB2  . MET C 1 4   ? 16.555  4.898   14.795 1.00 26.22  ?  49  MET C HB2  1 
ATOM   3329 H HB3  . MET C 1 4   ? 16.314  4.903   16.363 1.00 26.22  ?  49  MET C HB3  1 
ATOM   3330 H HG2  . MET C 1 4   ? 17.839  3.182   16.621 1.00 38.19  ?  49  MET C HG2  1 
ATOM   3331 H HG3  . MET C 1 4   ? 18.057  3.127   15.047 1.00 38.19  ?  49  MET C HG3  1 
ATOM   3332 H HE1  . MET C 1 4   ? 19.985  6.187   14.200 1.00 38.77  ?  49  MET C HE1  1 
ATOM   3333 H HE2  . MET C 1 4   ? 19.508  4.767   13.671 1.00 38.77  ?  49  MET C HE2  1 
ATOM   3334 H HE3  . MET C 1 4   ? 18.437  5.894   13.997 1.00 38.77  ?  49  MET C HE3  1 
ATOM   3335 N N    . LEU C 1 5   ? 13.507  4.531   16.411 1.00 18.22  ?  50  LEU C N    1 
ATOM   3336 C CA   . LEU C 1 5   ? 12.437  5.511   16.483 1.00 17.51  ?  50  LEU C CA   1 
ATOM   3337 C C    . LEU C 1 5   ? 12.910  6.660   17.358 1.00 17.23  ?  50  LEU C C    1 
ATOM   3338 O O    . LEU C 1 5   ? 13.729  6.470   18.261 1.00 19.71  ?  50  LEU C O    1 
ATOM   3339 C CB   . LEU C 1 5   ? 11.149  4.914   17.064 1.00 20.90  ?  50  LEU C CB   1 
ATOM   3340 C CG   . LEU C 1 5   ? 10.457  3.813   16.260 1.00 22.16  ?  50  LEU C CG   1 
ATOM   3341 C CD1  . LEU C 1 5   ? 9.432   3.099   17.130 1.00 16.31  ?  50  LEU C CD1  1 
ATOM   3342 C CD2  . LEU C 1 5   ? 9.796   4.390   15.023 1.00 22.06  ?  50  LEU C CD2  1 
ATOM   3343 H H    . LEU C 1 5   ? 13.757  4.245   17.182 1.00 21.87  ?  50  LEU C H    1 
ATOM   3344 H HA   . LEU C 1 5   ? 12.247  5.854   15.596 1.00 21.01  ?  50  LEU C HA   1 
ATOM   3345 H HB2  . LEU C 1 5   ? 11.357  4.542   17.935 1.00 25.08  ?  50  LEU C HB2  1 
ATOM   3346 H HB3  . LEU C 1 5   ? 10.507  5.633   17.172 1.00 25.08  ?  50  LEU C HB3  1 
ATOM   3347 H HG   . LEU C 1 5   ? 11.118  3.162   15.975 1.00 26.59  ?  50  LEU C HG   1 
ATOM   3348 H HD11 . LEU C 1 5   ? 9.003   2.405   16.606 1.00 19.57  ?  50  LEU C HD11 1 
ATOM   3349 H HD12 . LEU C 1 5   ? 9.884   2.707   17.893 1.00 19.57  ?  50  LEU C HD12 1 
ATOM   3350 H HD13 . LEU C 1 5   ? 8.771   3.743   17.431 1.00 19.57  ?  50  LEU C HD13 1 
ATOM   3351 H HD21 . LEU C 1 5   ? 9.365   3.673   14.532 1.00 26.48  ?  50  LEU C HD21 1 
ATOM   3352 H HD22 . LEU C 1 5   ? 9.136   5.047   15.295 1.00 26.48  ?  50  LEU C HD22 1 
ATOM   3353 H HD23 . LEU C 1 5   ? 10.473  4.810   14.470 1.00 26.48  ?  50  LEU C HD23 1 
ATOM   3354 N N    . GLU C 1 6   ? 12.411  7.859   17.079 1.00 16.21  ?  51  GLU C N    1 
ATOM   3355 C CA   . GLU C 1 6   ? 12.779  9.004   17.894 1.00 19.26  ?  51  GLU C CA   1 
ATOM   3356 C C    . GLU C 1 6   ? 11.611  9.969   17.956 1.00 18.56  ?  51  GLU C C    1 
ATOM   3357 O O    . GLU C 1 6   ? 11.056  10.352  16.922 1.00 17.82  ?  51  GLU C O    1 
ATOM   3358 C CB   . GLU C 1 6   ? 14.024  9.707   17.348 1.00 18.00  ?  51  GLU C CB   1 
ATOM   3359 C CG   . GLU C 1 6   ? 14.782  10.497  18.406 1.00 19.28  ?  51  GLU C CG   1 
ATOM   3360 C CD   . GLU C 1 6   ? 14.385  11.964  18.472 1.00 23.86  ?  51  GLU C CD   1 
ATOM   3361 O OE1  . GLU C 1 6   ? 13.598  12.425  17.615 1.00 21.50  ?  51  GLU C OE1  1 
ATOM   3362 O OE2  . GLU C 1 6   ? 14.876  12.660  19.386 1.00 25.36  -1 51  GLU C OE2  1 
ATOM   3363 H H    . GLU C 1 6   ? 11.867  8.032   16.436 1.00 19.45  ?  51  GLU C H    1 
ATOM   3364 H HA   . GLU C 1 6   ? 12.972  8.705   18.797 1.00 23.11  ?  51  GLU C HA   1 
ATOM   3365 H HB2  . GLU C 1 6   ? 14.627  9.041   16.983 1.00 21.60  ?  51  GLU C HB2  1 
ATOM   3366 H HB3  . GLU C 1 6   ? 13.755  10.326  16.650 1.00 21.60  ?  51  GLU C HB3  1 
ATOM   3367 H HG2  . GLU C 1 6   ? 14.608  10.102  19.275 1.00 23.13  ?  51  GLU C HG2  1 
ATOM   3368 H HG3  . GLU C 1 6   ? 15.731  10.454  18.209 1.00 23.13  ?  51  GLU C HG3  1 
ATOM   3369 N N    . ALA C 1 7   ? 11.238  10.334  19.177 1.00 17.72  ?  52  ALA C N    1 
ATOM   3370 C CA   . ALA C 1 7   ? 10.235  11.350  19.424 1.00 19.01  ?  52  ALA C CA   1 
ATOM   3371 C C    . ALA C 1 7   ? 10.566  11.988  20.760 1.00 21.61  ?  52  ALA C C    1 
ATOM   3372 O O    . ALA C 1 7   ? 11.075  11.327  21.668 1.00 18.45  ?  52  ALA C O    1 
ATOM   3373 C CB   . ALA C 1 7   ? 8.820   10.771  19.423 1.00 19.11  ?  52  ALA C CB   1 
ATOM   3374 H H    . ALA C 1 7   ? 11.565  9.995   19.896 1.00 21.26  ?  52  ALA C H    1 
ATOM   3375 H HA   . ALA C 1 7   ? 10.289  12.032  18.736 1.00 22.81  ?  52  ALA C HA   1 
ATOM   3376 H HB1  . ALA C 1 7   ? 8.187   11.487  19.592 1.00 22.93  ?  52  ALA C HB1  1 
ATOM   3377 H HB2  . ALA C 1 7   ? 8.644   10.371  18.557 1.00 22.93  ?  52  ALA C HB2  1 
ATOM   3378 H HB3  . ALA C 1 7   ? 8.754   10.099  20.119 1.00 22.93  ?  52  ALA C HB3  1 
ATOM   3379 N N    . GLU C 1 8   ? 10.285  13.281  20.867 1.00 18.58  ?  53  GLU C N    1 
ATOM   3380 C CA   . GLU C 1 8   ? 10.693  14.065  22.018 1.00 21.11  ?  53  GLU C CA   1 
ATOM   3381 C C    . GLU C 1 8   ? 9.468   14.592  22.750 1.00 20.91  ?  53  GLU C C    1 
ATOM   3382 O O    . GLU C 1 8   ? 8.399   14.775  22.160 1.00 19.21  ?  53  GLU C O    1 
ATOM   3383 C CB   . GLU C 1 8   ? 11.605  15.217  21.584 1.00 21.65  ?  53  GLU C CB   1 
ATOM   3384 C CG   . GLU C 1 8   ? 12.856  14.723  20.865 1.00 23.24  ?  53  GLU C CG   1 
ATOM   3385 C CD   . GLU C 1 8   ? 13.801  15.837  20.471 1.00 23.40  ?  53  GLU C CD   1 
ATOM   3386 O OE1  . GLU C 1 8   ? 13.437  17.017  20.628 1.00 23.62  ?  53  GLU C OE1  1 
ATOM   3387 O OE2  . GLU C 1 8   ? 14.914  15.527  20.002 1.00 30.71  -1 53  GLU C OE2  1 
ATOM   3388 H H    . GLU C 1 8   ? 9.853   13.731  20.275 1.00 22.30  ?  53  GLU C H    1 
ATOM   3389 H HA   . GLU C 1 8   ? 11.190  13.500  22.629 1.00 25.33  ?  53  GLU C HA   1 
ATOM   3390 H HB2  . GLU C 1 8   ? 11.118  15.798  20.978 1.00 25.98  ?  53  GLU C HB2  1 
ATOM   3391 H HB3  . GLU C 1 8   ? 11.885  15.714  22.369 1.00 25.98  ?  53  GLU C HB3  1 
ATOM   3392 H HG2  . GLU C 1 8   ? 13.337  14.117  21.451 1.00 27.89  ?  53  GLU C HG2  1 
ATOM   3393 H HG3  . GLU C 1 8   ? 12.590  14.258  20.056 1.00 27.89  ?  53  GLU C HG3  1 
ATOM   3394 N N    . HIS C 1 9   ? 9.633   14.815  24.047 1.00 19.82  ?  54  HIS C N    1 
ATOM   3395 C CA   . HIS C 1 9   ? 8.533   15.279  24.876 1.00 16.81  ?  54  HIS C CA   1 
ATOM   3396 C C    . HIS C 1 9   ? 8.361   16.782  24.692 1.00 18.10  ?  54  HIS C C    1 
ATOM   3397 O O    . HIS C 1 9   ? 9.285   17.540  25.004 1.00 15.30  ?  54  HIS C O    1 
ATOM   3398 C CB   . HIS C 1 9   ? 8.796   14.956  26.337 1.00 17.03  ?  54  HIS C CB   1 
ATOM   3399 C CG   . HIS C 1 9   ? 8.898   13.490  26.621 1.00 20.11  ?  54  HIS C CG   1 
ATOM   3400 N ND1  . HIS C 1 9   ? 10.081  12.793  26.511 1.00 19.48  ?  54  HIS C ND1  1 
ATOM   3401 C CD2  . HIS C 1 9   ? 7.963   12.589  27.007 1.00 22.09  ?  54  HIS C CD2  1 
ATOM   3402 C CE1  . HIS C 1 9   ? 9.872   11.525  26.820 1.00 23.24  ?  54  HIS C CE1  1 
ATOM   3403 N NE2  . HIS C 1 9   ? 8.595   11.375  27.125 1.00 21.98  ?  54  HIS C NE2  1 
ATOM   3404 H H    . HIS C 1 9   ? 10.373  14.704  24.471 1.00 23.78  ?  54  HIS C H    1 
ATOM   3405 H HA   . HIS C 1 9   ? 7.713   14.838  24.604 1.00 20.17  ?  54  HIS C HA   1 
ATOM   3406 H HB2  . HIS C 1 9   ? 9.632   15.368  26.604 1.00 20.43  ?  54  HIS C HB2  1 
ATOM   3407 H HB3  . HIS C 1 9   ? 8.068   15.311  26.872 1.00 20.43  ?  54  HIS C HB3  1 
ATOM   3408 H HD1  . HIS C 1 9   ? 10.837  13.130  26.279 1.00 23.37  ?  54  HIS C HD1  1 
ATOM   3409 H HD2  . HIS C 1 9   ? 7.063   12.761  27.165 1.00 26.51  ?  54  HIS C HD2  1 
ATOM   3410 H HE1  . HIS C 1 9   ? 10.515  10.852  26.822 1.00 27.89  ?  54  HIS C HE1  1 
ATOM   3411 N N    . PRO C 1 10  ? 7.217   17.253  24.202 1.00 15.62  ?  55  PRO C N    1 
ATOM   3412 C CA   . PRO C 1 10  ? 7.048   18.693  23.988 1.00 18.45  ?  55  PRO C CA   1 
ATOM   3413 C C    . PRO C 1 10  ? 6.910   19.447  25.301 1.00 16.98  ?  55  PRO C C    1 
ATOM   3414 O O    . PRO C 1 10  ? 6.582   18.888  26.351 1.00 18.28  ?  55  PRO C O    1 
ATOM   3415 C CB   . PRO C 1 10  ? 5.763   18.781  23.158 1.00 19.05  ?  55  PRO C CB   1 
ATOM   3416 C CG   . PRO C 1 10  ? 5.002   17.562  23.520 1.00 22.65  ?  55  PRO C CG   1 
ATOM   3417 C CD   . PRO C 1 10  ? 6.007   16.495  23.833 1.00 20.44  ?  55  PRO C CD   1 
ATOM   3418 H HA   . PRO C 1 10  ? 7.791   19.054  23.479 1.00 22.14  ?  55  PRO C HA   1 
ATOM   3419 H HB2  . PRO C 1 10  ? 5.269   19.580  23.400 1.00 22.87  ?  55  PRO C HB2  1 
ATOM   3420 H HB3  . PRO C 1 10  ? 5.982   18.783  22.213 1.00 22.87  ?  55  PRO C HB3  1 
ATOM   3421 H HG2  . PRO C 1 10  ? 4.451   17.746  24.297 1.00 27.18  ?  55  PRO C HG2  1 
ATOM   3422 H HG3  . PRO C 1 10  ? 4.449   17.294  22.769 1.00 27.18  ?  55  PRO C HG3  1 
ATOM   3423 H HD2  . PRO C 1 10  ? 5.705   15.957  24.582 1.00 24.53  ?  55  PRO C HD2  1 
ATOM   3424 H HD3  . PRO C 1 10  ? 6.176   15.950  23.049 1.00 24.53  ?  55  PRO C HD3  1 
ATOM   3425 N N    . LEU C 1 11  ? 7.174   20.746  25.227 1.00 16.81  ?  56  LEU C N    1 
ATOM   3426 C CA   . LEU C 1 11  ? 7.009   21.645  26.355 1.00 16.34  ?  56  LEU C CA   1 
ATOM   3427 C C    . LEU C 1 11  ? 5.812   22.552  26.112 1.00 14.89  ?  56  LEU C C    1 
ATOM   3428 O O    . LEU C 1 11  ? 5.424   22.803  24.969 1.00 15.74  ?  56  LEU C O    1 
ATOM   3429 C CB   . LEU C 1 11  ? 8.263   22.493  26.577 1.00 15.74  ?  56  LEU C CB   1 
ATOM   3430 C CG   . LEU C 1 11  ? 9.499   21.719  27.030 1.00 12.98  ?  56  LEU C CG   1 
ATOM   3431 C CD1  . LEU C 1 11  ? 10.758  22.502  26.731 1.00 16.25  ?  56  LEU C CD1  1 
ATOM   3432 C CD2  . LEU C 1 11  ? 9.408   21.404  28.508 1.00 14.18  ?  56  LEU C CD2  1 
ATOM   3433 H H    . LEU C 1 11  ? 7.458   21.137  24.515 1.00 20.18  ?  56  LEU C H    1 
ATOM   3434 H HA   . LEU C 1 11  ? 6.843   21.128  27.159 1.00 19.61  ?  56  LEU C HA   1 
ATOM   3435 H HB2  . LEU C 1 11  ? 8.486   22.937  25.744 1.00 18.88  ?  56  LEU C HB2  1 
ATOM   3436 H HB3  . LEU C 1 11  ? 8.069   23.157  27.257 1.00 18.88  ?  56  LEU C HB3  1 
ATOM   3437 H HG   . LEU C 1 11  ? 9.543   20.880  26.545 1.00 15.57  ?  56  LEU C HG   1 
ATOM   3438 H HD11 . LEU C 1 11  ? 11.526  21.989  27.028 1.00 19.50  ?  56  LEU C HD11 1 
ATOM   3439 H HD12 . LEU C 1 11  ? 10.813  22.657  25.775 1.00 19.50  ?  56  LEU C HD12 1 
ATOM   3440 H HD13 . LEU C 1 11  ? 10.723  23.348  27.203 1.00 19.50  ?  56  LEU C HD13 1 
ATOM   3441 H HD21 . LEU C 1 11  ? 10.201  20.913  28.775 1.00 17.02  ?  56  LEU C HD21 1 
ATOM   3442 H HD22 . LEU C 1 11  ? 9.351   22.235  29.005 1.00 17.02  ?  56  LEU C HD22 1 
ATOM   3443 H HD23 . LEU C 1 11  ? 8.617   20.867  28.668 1.00 17.02  ?  56  LEU C HD23 1 
ATOM   3444 N N    . GLN C 1 12  ? 5.219   23.033  27.205 1.00 15.25  ?  57  GLN C N    1 
ATOM   3445 C CA   . GLN C 1 12  ? 4.097   23.957  27.078 1.00 15.73  ?  57  GLN C CA   1 
ATOM   3446 C C    . GLN C 1 12  ? 4.492   25.194  26.285 1.00 16.71  ?  57  GLN C C    1 
ATOM   3447 O O    . GLN C 1 12  ? 3.676   25.737  25.530 1.00 16.22  ?  57  GLN C O    1 
ATOM   3448 C CB   . GLN C 1 12  ? 3.587   24.349  28.463 1.00 15.58  ?  57  GLN C CB   1 
ATOM   3449 C CG   . GLN C 1 12  ? 2.324   25.203  28.445 1.00 18.83  ?  57  GLN C CG   1 
ATOM   3450 C CD   . GLN C 1 12  ? 1.116   24.446  27.926 1.00 20.45  ?  57  GLN C CD   1 
ATOM   3451 O OE1  . GLN C 1 12  ? 1.126   23.221  27.845 1.00 17.95  ?  57  GLN C OE1  1 
ATOM   3452 N NE2  . GLN C 1 12  ? 0.067   25.177  27.569 1.00 20.86  ?  57  GLN C NE2  1 
ATOM   3453 H H    . GLN C 1 12  ? 5.442   22.844  28.013 1.00 18.31  ?  57  GLN C H    1 
ATOM   3454 H HA   . GLN C 1 12  ? 3.375   23.514  26.606 1.00 18.87  ?  57  GLN C HA   1 
ATOM   3455 H HB2  . GLN C 1 12  ? 3.390   23.541  28.963 1.00 18.70  ?  57  GLN C HB2  1 
ATOM   3456 H HB3  . GLN C 1 12  ? 4.278   24.855  28.918 1.00 18.70  ?  57  GLN C HB3  1 
ATOM   3457 H HG2  . GLN C 1 12  ? 2.128   25.498  29.348 1.00 22.60  ?  57  GLN C HG2  1 
ATOM   3458 H HG3  . GLN C 1 12  ? 2.468   25.970  27.868 1.00 22.60  ?  57  GLN C HG3  1 
ATOM   3459 H HE21 . GLN C 1 12  ? 0.096   26.033  27.638 1.00 25.03  ?  57  GLN C HE21 1 
ATOM   3460 H HE22 . GLN C 1 12  ? -0.642  24.793  27.269 1.00 25.03  ?  57  GLN C HE22 1 
ATOM   3461 N N    . TYR C 1 13  ? 5.734   25.644  26.432 1.00 16.24  ?  58  TYR C N    1 
ATOM   3462 C CA   . TYR C 1 13  ? 6.237   26.794  25.696 1.00 16.84  ?  58  TYR C CA   1 
ATOM   3463 C C    . TYR C 1 13  ? 7.626   26.478  25.168 1.00 16.90  ?  58  TYR C C    1 
ATOM   3464 O O    . TYR C 1 13  ? 8.311   25.579  25.660 1.00 16.72  ?  58  TYR C O    1 
ATOM   3465 C CB   . TYR C 1 13  ? 6.317   28.051  26.571 1.00 20.86  ?  58  TYR C CB   1 
ATOM   3466 C CG   . TYR C 1 13  ? 5.060   28.364  27.344 1.00 20.57  ?  58  TYR C CG   1 
ATOM   3467 C CD1  . TYR C 1 13  ? 4.031   29.094  26.766 1.00 23.94  ?  58  TYR C CD1  1 
ATOM   3468 C CD2  . TYR C 1 13  ? 4.909   27.944  28.657 1.00 19.38  ?  58  TYR C CD2  1 
ATOM   3469 C CE1  . TYR C 1 13  ? 2.883   29.389  27.472 1.00 24.42  ?  58  TYR C CE1  1 
ATOM   3470 C CE2  . TYR C 1 13  ? 3.766   28.233  29.370 1.00 20.22  ?  58  TYR C CE2  1 
ATOM   3471 C CZ   . TYR C 1 13  ? 2.756   28.956  28.772 1.00 22.65  ?  58  TYR C CZ   1 
ATOM   3472 O OH   . TYR C 1 13  ? 1.613   29.249  29.475 1.00 23.97  ?  58  TYR C OH   1 
ATOM   3473 H H    . TYR C 1 13  ? 6.313   25.293  26.961 1.00 19.49  ?  58  TYR C H    1 
ATOM   3474 H HA   . TYR C 1 13  ? 5.654   26.978  24.943 1.00 20.21  ?  58  TYR C HA   1 
ATOM   3475 H HB2  . TYR C 1 13  ? 7.035   27.936  27.213 1.00 25.03  ?  58  TYR C HB2  1 
ATOM   3476 H HB3  . TYR C 1 13  ? 6.508   28.813  26.002 1.00 25.03  ?  58  TYR C HB3  1 
ATOM   3477 H HD1  . TYR C 1 13  ? 4.116   29.387  25.887 1.00 28.73  ?  58  TYR C HD1  1 
ATOM   3478 H HD2  . TYR C 1 13  ? 5.589   27.456  29.062 1.00 23.26  ?  58  TYR C HD2  1 
ATOM   3479 H HE1  . TYR C 1 13  ? 2.199   29.877  27.072 1.00 29.31  ?  58  TYR C HE1  1 
ATOM   3480 H HE2  . TYR C 1 13  ? 3.676   27.943  30.249 1.00 24.26  ?  58  TYR C HE2  1 
ATOM   3481 H HH   . TYR C 1 13  ? 1.085   29.691  28.994 1.00 28.76  ?  58  TYR C HH   1 
ATOM   3482 N N    . ASN C 1 14  ? 8.032   27.235  24.155 1.00 15.92  ?  59  ASN C N    1 
ATOM   3483 C CA   . ASN C 1 14  ? 9.434   27.302  23.778 1.00 18.56  ?  59  ASN C CA   1 
ATOM   3484 C C    . ASN C 1 14  ? 10.152  28.279  24.695 1.00 18.00  ?  59  ASN C C    1 
ATOM   3485 O O    . ASN C 1 14  ? 9.595   29.310  25.085 1.00 15.50  ?  59  ASN C O    1 
ATOM   3486 C CB   . ASN C 1 14  ? 9.582   27.744  22.321 1.00 19.92  ?  59  ASN C CB   1 
ATOM   3487 C CG   . ASN C 1 14  ? 9.115   26.687  21.339 1.00 24.24  ?  59  ASN C CG   1 
ATOM   3488 O OD1  . ASN C 1 14  ? 8.561   25.658  21.727 1.00 22.00  ?  59  ASN C OD1  1 
ATOM   3489 N ND2  . ASN C 1 14  ? 9.336   26.940  20.057 1.00 26.37  ?  59  ASN C ND2  1 
ATOM   3490 H H    . ASN C 1 14  ? 7.513   27.719  23.670 1.00 19.10  ?  59  ASN C H    1 
ATOM   3491 H HA   . ASN C 1 14  ? 9.840   26.427  23.878 1.00 22.28  ?  59  ASN C HA   1 
ATOM   3492 H HB2  . ASN C 1 14  ? 9.050   28.543  22.178 1.00 23.90  ?  59  ASN C HB2  1 
ATOM   3493 H HB3  . ASN C 1 14  ? 10.516  27.930  22.141 1.00 23.90  ?  59  ASN C HB3  1 
ATOM   3494 H HD21 . ASN C 1 14  ? 9.091   26.373  19.459 1.00 31.65  ?  59  ASN C HD21 1 
ATOM   3495 H HD22 . ASN C 1 14  ? 9.725   27.671  19.824 1.00 31.65  ?  59  ASN C HD22 1 
ATOM   3496 N N    . TYR C 1 15  ? 11.390  27.949  25.049 1.00 16.93  ?  60  TYR C N    1 
ATOM   3497 C CA   . TYR C 1 15  ? 12.173  28.766  25.961 1.00 15.70  ?  60  TYR C CA   1 
ATOM   3498 C C    . TYR C 1 15  ? 13.519  29.089  25.336 1.00 17.27  ?  60  TYR C C    1 
ATOM   3499 O O    . TYR C 1 15  ? 14.036  28.335  24.508 1.00 15.70  ?  60  TYR C O    1 
ATOM   3500 C CB   . TYR C 1 15  ? 12.394  28.071  27.303 1.00 17.16  ?  60  TYR C CB   1 
ATOM   3501 C CG   . TYR C 1 15  ? 11.174  28.043  28.189 1.00 18.23  ?  60  TYR C CG   1 
ATOM   3502 C CD1  . TYR C 1 15  ? 10.192  27.075  28.022 1.00 21.58  ?  60  TYR C CD1  1 
ATOM   3503 C CD2  . TYR C 1 15  ? 11.009  28.976  29.202 1.00 17.02  ?  60  TYR C CD2  1 
ATOM   3504 C CE1  . TYR C 1 15  ? 9.076   27.043  28.836 1.00 21.92  ?  60  TYR C CE1  1 
ATOM   3505 C CE2  . TYR C 1 15  ? 9.897   28.950  30.023 1.00 19.30  ?  60  TYR C CE2  1 
ATOM   3506 C CZ   . TYR C 1 15  ? 8.934   27.981  29.833 1.00 20.82  ?  60  TYR C CZ   1 
ATOM   3507 O OH   . TYR C 1 15  ? 7.824   27.952  30.645 1.00 29.65  ?  60  TYR C OH   1 
ATOM   3508 H H    . TYR C 1 15  ? 11.801  27.247  24.770 1.00 20.31  ?  60  TYR C H    1 
ATOM   3509 H HA   . TYR C 1 15  ? 11.706  29.600  26.124 1.00 18.84  ?  60  TYR C HA   1 
ATOM   3510 H HB2  . TYR C 1 15  ? 12.660  27.153  27.138 1.00 20.60  ?  60  TYR C HB2  1 
ATOM   3511 H HB3  . TYR C 1 15  ? 13.097  28.536  27.782 1.00 20.60  ?  60  TYR C HB3  1 
ATOM   3512 H HD1  . TYR C 1 15  ? 10.285  26.440  27.349 1.00 25.90  ?  60  TYR C HD1  1 
ATOM   3513 H HD2  . TYR C 1 15  ? 11.658  29.630  29.332 1.00 20.43  ?  60  TYR C HD2  1 
ATOM   3514 H HE1  . TYR C 1 15  ? 8.425   26.391  28.711 1.00 26.31  ?  60  TYR C HE1  1 
ATOM   3515 H HE2  . TYR C 1 15  ? 9.798   29.583  30.697 1.00 23.16  ?  60  TYR C HE2  1 
ATOM   3516 H HH   . TYR C 1 15  ? 7.862   28.575  31.207 1.00 35.57  ?  60  TYR C HH   1 
ATOM   3517 N N    . THR C 1 16  ? 14.082  30.218  25.757 1.00 13.33  ?  61  THR C N    1 
ATOM   3518 C CA   . THR C 1 16  ? 15.352  30.701  25.241 1.00 14.73  ?  61  THR C CA   1 
ATOM   3519 C C    . THR C 1 16  ? 16.303  30.946  26.402 1.00 14.64  ?  61  THR C C    1 
ATOM   3520 O O    . THR C 1 16  ? 15.956  31.653  27.352 1.00 13.36  ?  61  THR C O    1 
ATOM   3521 C CB   . THR C 1 16  ? 15.158  31.990  24.435 1.00 16.19  ?  61  THR C CB   1 
ATOM   3522 O OG1  . THR C 1 16  ? 14.253  31.749  23.349 1.00 16.54  ?  61  THR C OG1  1 
ATOM   3523 C CG2  . THR C 1 16  ? 16.487  32.492  23.888 1.00 17.77  ?  61  THR C CG2  1 
ATOM   3524 H H    . THR C 1 16  ? 13.737  30.731  26.355 1.00 15.99  ?  61  THR C H    1 
ATOM   3525 H HA   . THR C 1 16  ? 15.742  30.030  24.659 1.00 17.68  ?  61  THR C HA   1 
ATOM   3526 H HB   . THR C 1 16  ? 14.788  32.676  25.013 1.00 19.43  ?  61  THR C HB   1 
ATOM   3527 H HG1  . THR C 1 16  ? 14.563  31.153  22.844 1.00 19.85  ?  61  THR C HG1  1 
ATOM   3528 H HG21 . THR C 1 16  ? 16.349  33.308  23.381 1.00 21.32  ?  61  THR C HG21 1 
ATOM   3529 H HG22 . THR C 1 16  ? 17.098  32.675  24.619 1.00 21.32  ?  61  THR C HG22 1 
ATOM   3530 H HG23 . THR C 1 16  ? 16.880  31.822  23.308 1.00 21.32  ?  61  THR C HG23 1 
ATOM   3531 N N    . PHE C 1 17  ? 17.495  30.358  26.324 1.00 15.86  ?  62  PHE C N    1 
ATOM   3532 C CA   . PHE C 1 17  ? 18.563  30.676  27.260 1.00 16.35  ?  62  PHE C CA   1 
ATOM   3533 C C    . PHE C 1 17  ? 19.237  31.982  26.868 1.00 16.79  ?  62  PHE C C    1 
ATOM   3534 O O    . PHE C 1 17  ? 19.529  32.217  25.692 1.00 18.01  ?  62  PHE C O    1 
ATOM   3535 C CB   . PHE C 1 17  ? 19.614  29.565  27.286 1.00 13.55  ?  62  PHE C CB   1 
ATOM   3536 C CG   . PHE C 1 17  ? 19.326  28.470  28.271 1.00 18.18  ?  62  PHE C CG   1 
ATOM   3537 C CD1  . PHE C 1 17  ? 19.319  28.728  29.632 1.00 14.74  ?  62  PHE C CD1  1 
ATOM   3538 C CD2  . PHE C 1 17  ? 19.089  27.177  27.837 1.00 19.09  ?  62  PHE C CD2  1 
ATOM   3539 C CE1  . PHE C 1 17  ? 19.063  27.722  30.540 1.00 17.78  ?  62  PHE C CE1  1 
ATOM   3540 C CE2  . PHE C 1 17  ? 18.834  26.167  28.740 1.00 16.30  ?  62  PHE C CE2  1 
ATOM   3541 C CZ   . PHE C 1 17  ? 18.822  26.437  30.092 1.00 17.89  ?  62  PHE C CZ   1 
ATOM   3542 H H    . PHE C 1 17  ? 17.709  29.770  25.734 1.00 19.03  ?  62  PHE C H    1 
ATOM   3543 H HA   . PHE C 1 17  ? 18.195  30.774  28.152 1.00 19.62  ?  62  PHE C HA   1 
ATOM   3544 H HB2  . PHE C 1 17  ? 19.665  29.164  26.405 1.00 16.26  ?  62  PHE C HB2  1 
ATOM   3545 H HB3  . PHE C 1 17  ? 20.472  29.954  27.519 1.00 16.26  ?  62  PHE C HB3  1 
ATOM   3546 H HD1  . PHE C 1 17  ? 19.480  29.591  29.937 1.00 17.68  ?  62  PHE C HD1  1 
ATOM   3547 H HD2  . PHE C 1 17  ? 19.096  26.989  26.926 1.00 22.91  ?  62  PHE C HD2  1 
ATOM   3548 H HE1  . PHE C 1 17  ? 19.055  27.908  31.451 1.00 21.33  ?  62  PHE C HE1  1 
ATOM   3549 H HE2  . PHE C 1 17  ? 18.671  25.303  28.437 1.00 19.56  ?  62  PHE C HE2  1 
ATOM   3550 H HZ   . PHE C 1 17  ? 18.649  25.756  30.701 1.00 21.47  ?  62  PHE C HZ   1 
ATOM   3551 N N    . TRP C 1 18  ? 19.502  32.824  27.865 1.00 16.87  ?  63  TRP C N    1 
ATOM   3552 C CA   . TRP C 1 18  ? 20.287  34.032  27.671 1.00 16.57  ?  63  TRP C CA   1 
ATOM   3553 C C    . TRP C 1 18  ? 21.442  34.048  28.660 1.00 16.68  ?  63  TRP C C    1 
ATOM   3554 O O    . TRP C 1 18  ? 21.436  33.350  29.676 1.00 15.88  ?  63  TRP C O    1 
ATOM   3555 C CB   . TRP C 1 18  ? 19.465  35.309  27.859 1.00 18.36  ?  63  TRP C CB   1 
ATOM   3556 C CG   . TRP C 1 18  ? 18.205  35.391  27.058 1.00 18.48  ?  63  TRP C CG   1 
ATOM   3557 C CD1  . TRP C 1 18  ? 17.070  34.658  27.235 1.00 18.35  ?  63  TRP C CD1  1 
ATOM   3558 C CD2  . TRP C 1 18  ? 17.943  36.283  25.970 1.00 20.64  ?  63  TRP C CD2  1 
ATOM   3559 N NE1  . TRP C 1 18  ? 16.116  35.033  26.317 1.00 18.16  ?  63  TRP C NE1  1 
ATOM   3560 C CE2  . TRP C 1 18  ? 16.630  36.028  25.529 1.00 19.71  ?  63  TRP C CE2  1 
ATOM   3561 C CE3  . TRP C 1 18  ? 18.693  37.268  25.323 1.00 23.00  ?  63  TRP C CE3  1 
ATOM   3562 C CZ2  . TRP C 1 18  ? 16.052  36.723  24.469 1.00 22.44  ?  63  TRP C CZ2  1 
ATOM   3563 C CZ3  . TRP C 1 18  ? 18.118  37.958  24.274 1.00 25.84  ?  63  TRP C CZ3  1 
ATOM   3564 C CH2  . TRP C 1 18  ? 16.809  37.684  23.857 1.00 24.89  ?  63  TRP C CH2  1 
ATOM   3565 H H    . TRP C 1 18  ? 19.232  32.712  28.674 1.00 20.24  ?  63  TRP C H    1 
ATOM   3566 H HA   . TRP C 1 18  ? 20.654  34.035  26.773 1.00 19.89  ?  63  TRP C HA   1 
ATOM   3567 H HB2  . TRP C 1 18  ? 19.219  35.381  28.794 1.00 22.03  ?  63  TRP C HB2  1 
ATOM   3568 H HB3  . TRP C 1 18  ? 20.016  36.068  27.610 1.00 22.03  ?  63  TRP C HB3  1 
ATOM   3569 H HD1  . TRP C 1 18  ? 16.956  34.000  27.882 1.00 22.02  ?  63  TRP C HD1  1 
ATOM   3570 H HE1  . TRP C 1 18  ? 15.328  34.695  26.248 1.00 21.80  ?  63  TRP C HE1  1 
ATOM   3571 H HE3  . TRP C 1 18  ? 19.562  37.458  25.596 1.00 27.60  ?  63  TRP C HE3  1 
ATOM   3572 H HZ2  . TRP C 1 18  ? 15.183  36.543  24.189 1.00 26.92  ?  63  TRP C HZ2  1 
ATOM   3573 H HZ3  . TRP C 1 18  ? 18.609  38.616  23.836 1.00 31.01  ?  63  TRP C HZ3  1 
ATOM   3574 H HH2  . TRP C 1 18  ? 16.449  38.162  23.145 1.00 29.87  ?  63  TRP C HH2  1 
ATOM   3575 N N    . TYR C 1 19  ? 22.431  34.878  28.356 1.00 17.53  ?  64  TYR C N    1 
ATOM   3576 C CA   . TYR C 1 19  ? 23.585  35.059  29.218 1.00 19.81  ?  64  TYR C CA   1 
ATOM   3577 C C    . TYR C 1 19  ? 23.991  36.522  29.179 1.00 21.66  ?  64  TYR C C    1 
ATOM   3578 O O    . TYR C 1 19  ? 23.983  37.146  28.115 1.00 21.86  ?  64  TYR C O    1 
ATOM   3579 C CB   . TYR C 1 19  ? 24.749  34.164  28.780 1.00 25.92  ?  64  TYR C CB   1 
ATOM   3580 C CG   . TYR C 1 19  ? 26.103  34.663  29.210 1.00 26.28  ?  64  TYR C CG   1 
ATOM   3581 C CD1  . TYR C 1 19  ? 26.555  34.471  30.508 1.00 30.93  ?  64  TYR C CD1  1 
ATOM   3582 C CD2  . TYR C 1 19  ? 26.932  35.326  28.317 1.00 31.54  ?  64  TYR C CD2  1 
ATOM   3583 C CE1  . TYR C 1 19  ? 27.798  34.931  30.907 1.00 32.19  ?  64  TYR C CE1  1 
ATOM   3584 C CE2  . TYR C 1 19  ? 28.172  35.789  28.704 1.00 34.86  ?  64  TYR C CE2  1 
ATOM   3585 C CZ   . TYR C 1 19  ? 28.602  35.590  30.000 1.00 36.48  ?  64  TYR C CZ   1 
ATOM   3586 O OH   . TYR C 1 19  ? 29.842  36.050  30.384 1.00 40.42  ?  64  TYR C OH   1 
ATOM   3587 H H    . TYR C 1 19  ? 22.455  35.356  27.641 1.00 21.04  ?  64  TYR C H    1 
ATOM   3588 H HA   . TYR C 1 19  ? 23.347  34.830  30.130 1.00 23.77  ?  64  TYR C HA   1 
ATOM   3589 H HB2  . TYR C 1 19  ? 24.625  33.281  29.162 1.00 31.10  ?  64  TYR C HB2  1 
ATOM   3590 H HB3  . TYR C 1 19  ? 24.750  34.105  27.811 1.00 31.10  ?  64  TYR C HB3  1 
ATOM   3591 H HD1  . TYR C 1 19  ? 26.013  34.029  31.120 1.00 37.12  ?  64  TYR C HD1  1 
ATOM   3592 H HD2  . TYR C 1 19  ? 26.646  35.464  27.443 1.00 37.85  ?  64  TYR C HD2  1 
ATOM   3593 H HE1  . TYR C 1 19  ? 28.089  34.797  31.780 1.00 38.62  ?  64  TYR C HE1  1 
ATOM   3594 H HE2  . TYR C 1 19  ? 28.717  36.232  28.094 1.00 41.83  ?  64  TYR C HE2  1 
ATOM   3595 H HH   . TYR C 1 19  ? 30.221  36.429  29.738 1.00 48.50  ?  64  TYR C HH   1 
ATOM   3596 N N    . SER C 1 20  ? 24.324  37.069  30.344 1.00 21.70  ?  65  SER C N    1 
ATOM   3597 C CA   . SER C 1 20  ? 24.798  38.439  30.437 1.00 25.03  ?  65  SER C CA   1 
ATOM   3598 C C    . SER C 1 20  ? 25.972  38.495  31.400 1.00 27.43  ?  65  SER C C    1 
ATOM   3599 O O    . SER C 1 20  ? 26.104  37.657  32.296 1.00 24.39  ?  65  SER C O    1 
ATOM   3600 C CB   . SER C 1 20  ? 23.691  39.395  30.897 1.00 26.48  ?  65  SER C CB   1 
ATOM   3601 O OG   . SER C 1 20  ? 23.309  39.129  32.233 1.00 25.39  ?  65  SER C OG   1 
ATOM   3602 H H    . SER C 1 20  ? 24.283  36.661  31.100 1.00 26.04  ?  65  SER C H    1 
ATOM   3603 H HA   . SER C 1 20  ? 25.107  38.730  29.565 1.00 30.04  ?  65  SER C HA   1 
ATOM   3604 H HB2  . SER C 1 20  ? 24.018  40.306  30.839 1.00 31.78  ?  65  SER C HB2  1 
ATOM   3605 H HB3  . SER C 1 20  ? 22.919  39.283  30.321 1.00 31.78  ?  65  SER C HB3  1 
ATOM   3606 H HG   . SER C 1 20  ? 22.703  39.660  32.469 1.00 30.47  ?  65  SER C HG   1 
ATOM   3607 N N    . ARG C 1 21  ? 26.826  39.494  31.199 1.00 28.68  ?  66  ARG C N    1 
ATOM   3608 C CA   . ARG C 1 21  ? 28.000  39.686  32.037 1.00 34.75  ?  66  ARG C CA   1 
ATOM   3609 C C    . ARG C 1 21  ? 28.319  41.172  32.087 1.00 36.34  ?  66  ARG C C    1 
ATOM   3610 O O    . ARG C 1 21  ? 28.342  41.837  31.048 1.00 39.47  ?  66  ARG C O    1 
ATOM   3611 C CB   . ARG C 1 21  ? 29.194  38.892  31.496 1.00 36.96  ?  66  ARG C CB   1 
ATOM   3612 C CG   . ARG C 1 21  ? 30.498  39.117  32.250 1.00 42.12  ?  66  ARG C CG   1 
ATOM   3613 C CD   . ARG C 1 21  ? 31.629  38.312  31.631 1.00 42.72  ?  66  ARG C CD   1 
ATOM   3614 N NE   . ARG C 1 21  ? 32.944  38.793  32.052 1.00 49.10  ?  66  ARG C NE   1 
ATOM   3615 C CZ   . ARG C 1 21  ? 33.625  38.335  33.099 1.00 45.11  ?  66  ARG C CZ   1 
ATOM   3616 N NH1  . ARG C 1 21  ? 33.127  37.369  33.861 1.00 41.06  ?  66  ARG C NH1  1 
ATOM   3617 N NH2  . ARG C 1 21  ? 34.814  38.847  33.387 1.00 48.19  ?  66  ARG C NH2  1 
ATOM   3618 H H    . ARG C 1 21  ? 26.744  40.081  30.576 1.00 34.41  ?  66  ARG C H    1 
ATOM   3619 H HA   . ARG C 1 21  ? 27.810  39.380  32.937 1.00 41.70  ?  66  ARG C HA   1 
ATOM   3620 H HB2  . ARG C 1 21  ? 28.985  37.946  31.545 1.00 44.35  ?  66  ARG C HB2  1 
ATOM   3621 H HB3  . ARG C 1 21  ? 29.342  39.146  30.572 1.00 44.35  ?  66  ARG C HB3  1 
ATOM   3622 H HG2  . ARG C 1 21  ? 30.734  40.057  32.212 1.00 50.54  ?  66  ARG C HG2  1 
ATOM   3623 H HG3  . ARG C 1 21  ? 30.390  38.833  33.172 1.00 50.54  ?  66  ARG C HG3  1 
ATOM   3624 H HD2  . ARG C 1 21  ? 31.545  37.385  31.904 1.00 51.26  ?  66  ARG C HD2  1 
ATOM   3625 H HD3  . ARG C 1 21  ? 31.576  38.382  30.665 1.00 51.26  ?  66  ARG C HD3  1 
ATOM   3626 H HE   . ARG C 1 21  ? 33.305  39.420  31.586 1.00 58.92  ?  66  ARG C HE   1 
ATOM   3627 H HH11 . ARG C 1 21  ? 32.357  37.032  33.680 1.00 49.28  ?  66  ARG C HH11 1 
ATOM   3628 H HH12 . ARG C 1 21  ? 33.575  37.080  34.535 1.00 49.28  ?  66  ARG C HH12 1 
ATOM   3629 H HH21 . ARG C 1 21  ? 35.143  39.473  32.898 1.00 57.83  ?  66  ARG C HH21 1 
ATOM   3630 H HH22 . ARG C 1 21  ? 35.257  38.553  34.064 1.00 57.83  ?  66  ARG C HH22 1 
ATOM   3631 N N    . ARG C 1 22  ? 28.550  41.683  33.290 1.00 38.68  ?  67  ARG C N    1 
ATOM   3632 C CA   . ARG C 1 22  ? 28.886  43.089  33.479 1.00 40.42  ?  67  ARG C CA   1 
ATOM   3633 C C    . ARG C 1 22  ? 30.389  43.249  33.667 1.00 45.07  ?  67  ARG C C    1 
ATOM   3634 O O    . ARG C 1 22  ? 30.938  42.840  34.689 1.00 46.47  ?  67  ARG C O    1 
ATOM   3635 C CB   . ARG C 1 22  ? 28.135  43.656  34.683 1.00 44.28  ?  67  ARG C CB   1 
ATOM   3636 C CG   . ARG C 1 22  ? 28.491  45.087  35.048 1.00 52.30  ?  67  ARG C CG   1 
ATOM   3637 C CD   . ARG C 1 22  ? 27.808  45.492  36.344 1.00 57.88  ?  67  ARG C CD   1 
ATOM   3638 N NE   . ARG C 1 22  ? 28.199  46.827  36.787 1.00 77.36  ?  67  ARG C NE   1 
ATOM   3639 C CZ   . ARG C 1 22  ? 27.802  47.383  37.928 1.00 78.99  ?  67  ARG C CZ   1 
ATOM   3640 N NH1  . ARG C 1 22  ? 27.000  46.718  38.751 1.00 65.29  ?  67  ARG C NH1  1 
ATOM   3641 N NH2  . ARG C 1 22  ? 28.208  48.604  38.248 1.00 87.54  ?  67  ARG C NH2  1 
ATOM   3642 H H    . ARG C 1 22  ? 28.518  41.232  34.021 1.00 46.42  ?  67  ARG C H    1 
ATOM   3643 H HA   . ARG C 1 22  ? 28.622  43.591  32.691 1.00 48.50  ?  67  ARG C HA   1 
ATOM   3644 H HB2  . ARG C 1 22  ? 27.184  43.630  34.493 1.00 53.14  ?  67  ARG C HB2  1 
ATOM   3645 H HB3  . ARG C 1 22  ? 28.327  43.100  35.455 1.00 53.14  ?  67  ARG C HB3  1 
ATOM   3646 H HG2  . ARG C 1 22  ? 29.451  45.160  35.172 1.00 62.76  ?  67  ARG C HG2  1 
ATOM   3647 H HG3  . ARG C 1 22  ? 28.193  45.684  34.344 1.00 62.76  ?  67  ARG C HG3  1 
ATOM   3648 H HD2  . ARG C 1 22  ? 26.847  45.488  36.210 1.00 69.46  ?  67  ARG C HD2  1 
ATOM   3649 H HD3  . ARG C 1 22  ? 28.049  44.861  37.040 1.00 69.46  ?  67  ARG C HD3  1 
ATOM   3650 H HE   . ARG C 1 22  ? 28.720  47.284  36.277 1.00 92.83  ?  67  ARG C HE   1 
ATOM   3651 H HH11 . ARG C 1 22  ? 26.734  45.926  38.546 1.00 78.35  ?  67  ARG C HH11 1 
ATOM   3652 H HH12 . ARG C 1 22  ? 26.745  47.080  39.488 1.00 78.35  ?  67  ARG C HH12 1 
ATOM   3653 H HH21 . ARG C 1 22  ? 28.728  49.037  37.718 1.00 105.04 ?  67  ARG C HH21 1 
ATOM   3654 H HH22 . ARG C 1 22  ? 27.952  48.962  38.986 1.00 105.04 ?  67  ARG C HH22 1 
ATOM   3655 N N    . ASN C 1 36  ? 24.921  43.590  26.536 1.00 44.79  ?  81  ASN C N    1 
ATOM   3656 C CA   . ASN C 1 36  ? 25.351  42.721  27.626 1.00 48.44  ?  81  ASN C CA   1 
ATOM   3657 C C    . ASN C 1 36  ? 24.643  41.372  27.570 1.00 36.80  ?  81  ASN C C    1 
ATOM   3658 O O    . ASN C 1 36  ? 25.271  40.330  27.729 1.00 38.78  ?  81  ASN C O    1 
ATOM   3659 C CB   . ASN C 1 36  ? 25.091  43.388  28.979 1.00 47.23  ?  81  ASN C CB   1 
ATOM   3660 C CG   . ASN C 1 36  ? 26.222  44.304  29.404 1.00 55.79  ?  81  ASN C CG   1 
ATOM   3661 O OD1  . ASN C 1 36  ? 27.114  44.616  28.614 1.00 63.65  ?  81  ASN C OD1  1 
ATOM   3662 N ND2  . ASN C 1 36  ? 26.192  44.740  30.660 1.00 53.12  ?  81  ASN C ND2  1 
ATOM   3663 H HA   . ASN C 1 36  ? 26.304  42.563  27.547 1.00 58.12  ?  81  ASN C HA   1 
ATOM   3664 H HB2  . ASN C 1 36  ? 24.281  43.919  28.920 1.00 56.67  ?  81  ASN C HB2  1 
ATOM   3665 H HB3  . ASN C 1 36  ? 24.990  42.701  29.656 1.00 56.67  ?  81  ASN C HB3  1 
ATOM   3666 H HD21 . ASN C 1 36  ? 26.811  45.262  30.950 1.00 63.74  ?  81  ASN C HD21 1 
ATOM   3667 H HD22 . ASN C 1 36  ? 25.553  44.500  31.184 1.00 63.74  ?  81  ASN C HD22 1 
ATOM   3668 N N    . ILE C 1 37  ? 23.334  41.403  27.345 1.00 37.13  ?  82  ILE C N    1 
ATOM   3669 C CA   . ILE C 1 37  ? 22.516  40.195  27.309 1.00 34.45  ?  82  ILE C CA   1 
ATOM   3670 C C    . ILE C 1 37  ? 22.576  39.609  25.904 1.00 35.49  ?  82  ILE C C    1 
ATOM   3671 O O    . ILE C 1 37  ? 22.386  40.327  24.915 1.00 39.81  ?  82  ILE C O    1 
ATOM   3672 C CB   . ILE C 1 37  ? 21.066  40.504  27.722 1.00 37.40  ?  82  ILE C CB   1 
ATOM   3673 C CG1  . ILE C 1 37  ? 21.037  41.266  29.056 1.00 38.06  ?  82  ILE C CG1  1 
ATOM   3674 C CG2  . ILE C 1 37  ? 20.259  39.217  27.837 1.00 29.76  ?  82  ILE C CG2  1 
ATOM   3675 C CD1  . ILE C 1 37  ? 19.665  41.799  29.447 1.00 37.64  ?  82  ILE C CD1  1 
ATOM   3676 H H    . ILE C 1 37  ? 22.887  42.125  27.206 1.00 44.55  ?  82  ILE C H    1 
ATOM   3677 H HA   . ILE C 1 37  ? 22.878  39.542  27.929 1.00 41.35  ?  82  ILE C HA   1 
ATOM   3678 H HB   . ILE C 1 37  ? 20.662  41.062  27.039 1.00 44.88  ?  82  ILE C HB   1 
ATOM   3679 H HG12 . ILE C 1 37  ? 21.332  40.669  29.761 1.00 45.68  ?  82  ILE C HG12 1 
ATOM   3680 H HG13 . ILE C 1 37  ? 21.640  42.023  28.994 1.00 45.68  ?  82  ILE C HG13 1 
ATOM   3681 H HG21 . ILE C 1 37  ? 19.350  39.436  28.098 1.00 35.72  ?  82  ILE C HG21 1 
ATOM   3682 H HG22 . ILE C 1 37  ? 20.257  38.768  26.977 1.00 35.72  ?  82  ILE C HG22 1 
ATOM   3683 H HG23 . ILE C 1 37  ? 20.667  38.647  28.508 1.00 35.72  ?  82  ILE C HG23 1 
ATOM   3684 H HD11 . ILE C 1 37  ? 19.737  42.263  30.296 1.00 45.17  ?  82  ILE C HD11 1 
ATOM   3685 H HD12 . ILE C 1 37  ? 19.357  42.410  28.760 1.00 45.17  ?  82  ILE C HD12 1 
ATOM   3686 H HD13 . ILE C 1 37  ? 19.049  41.054  29.528 1.00 45.17  ?  82  ILE C HD13 1 
ATOM   3687 N N    . LYS C 1 38  ? 22.846  38.305  25.812 1.00 30.78  ?  83  LYS C N    1 
ATOM   3688 C CA   . LYS C 1 38  ? 22.971  37.630  24.528 1.00 28.86  ?  83  LYS C CA   1 
ATOM   3689 C C    . LYS C 1 38  ? 22.219  36.307  24.556 1.00 24.89  ?  83  LYS C C    1 
ATOM   3690 O O    . LYS C 1 38  ? 22.151  35.635  25.587 1.00 20.79  ?  83  LYS C O    1 
ATOM   3691 C CB   . LYS C 1 38  ? 24.435  37.364  24.168 1.00 31.43  ?  83  LYS C CB   1 
ATOM   3692 C CG   . LYS C 1 38  ? 25.206  36.614  25.235 1.00 29.59  ?  83  LYS C CG   1 
ATOM   3693 C CD   . LYS C 1 38  ? 26.380  35.850  24.642 1.00 41.59  ?  83  LYS C CD   1 
ATOM   3694 C CE   . LYS C 1 38  ? 27.354  36.762  23.913 1.00 47.87  ?  83  LYS C CE   1 
ATOM   3695 N NZ   . LYS C 1 38  ? 28.475  35.991  23.301 1.00 45.17  ?  83  LYS C NZ   1 
ATOM   3696 H H    . LYS C 1 38  ? 22.962  37.788  26.489 1.00 36.94  ?  83  LYS C H    1 
ATOM   3697 H HA   . LYS C 1 38  ? 22.584  38.186  23.835 1.00 34.63  ?  83  LYS C HA   1 
ATOM   3698 H HB2  . LYS C 1 38  ? 24.465  36.837  23.355 1.00 37.71  ?  83  LYS C HB2  1 
ATOM   3699 H HB3  . LYS C 1 38  ? 24.880  38.214  24.024 1.00 37.71  ?  83  LYS C HB3  1 
ATOM   3700 H HG2  . LYS C 1 38  ? 25.553  37.247  25.884 1.00 35.51  ?  83  LYS C HG2  1 
ATOM   3701 H HG3  . LYS C 1 38  ? 24.617  35.977  25.668 1.00 35.51  ?  83  LYS C HG3  1 
ATOM   3702 H HD2  . LYS C 1 38  ? 26.861  35.404  25.356 1.00 49.91  ?  83  LYS C HD2  1 
ATOM   3703 H HD3  . LYS C 1 38  ? 26.045  35.197  24.007 1.00 49.91  ?  83  LYS C HD3  1 
ATOM   3704 H HE2  . LYS C 1 38  ? 26.885  37.230  23.204 1.00 57.44  ?  83  LYS C HE2  1 
ATOM   3705 H HE3  . LYS C 1 38  ? 27.731  37.397  24.542 1.00 57.44  ?  83  LYS C HE3  1 
ATOM   3706 H HZ1  . LYS C 1 38  ? 29.031  36.545  22.881 1.00 54.21  ?  83  LYS C HZ1  1 
ATOM   3707 H HZ2  . LYS C 1 38  ? 28.924  35.555  23.933 1.00 54.21  ?  83  LYS C HZ2  1 
ATOM   3708 H HZ3  . LYS C 1 38  ? 28.154  35.403  22.715 1.00 54.21  ?  83  LYS C HZ3  1 
ATOM   3709 N N    . GLN C 1 39  ? 21.674  35.932  23.401 1.00 26.26  ?  84  GLN C N    1 
ATOM   3710 C CA   . GLN C 1 39  ? 20.955  34.671  23.275 1.00 26.15  ?  84  GLN C CA   1 
ATOM   3711 C C    . GLN C 1 39  ? 21.923  33.505  23.157 1.00 22.87  ?  84  GLN C C    1 
ATOM   3712 O O    . GLN C 1 39  ? 22.906  33.565  22.413 1.00 25.58  ?  84  GLN C O    1 
ATOM   3713 C CB   . GLN C 1 39  ? 20.041  34.684  22.050 1.00 23.93  ?  84  GLN C CB   1 
ATOM   3714 C CG   . GLN C 1 39  ? 18.702  35.359  22.262 1.00 29.24  ?  84  GLN C CG   1 
ATOM   3715 C CD   . GLN C 1 39  ? 17.672  34.918  21.243 1.00 25.96  ?  84  GLN C CD   1 
ATOM   3716 O OE1  . GLN C 1 39  ? 17.869  33.934  20.535 1.00 29.95  ?  84  GLN C OE1  1 
ATOM   3717 N NE2  . GLN C 1 39  ? 16.565  35.645  21.164 1.00 34.40  ?  84  GLN C NE2  1 
ATOM   3718 H H    . GLN C 1 39  ? 21.708  36.392  22.675 1.00 31.52  ?  84  GLN C H    1 
ATOM   3719 H HA   . GLN C 1 39  ? 20.407  34.534  24.063 1.00 31.38  ?  84  GLN C HA   1 
ATOM   3720 H HB2  . GLN C 1 39  ? 20.494  35.152  21.331 1.00 28.72  ?  84  GLN C HB2  1 
ATOM   3721 H HB3  . GLN C 1 39  ? 19.868  33.767  21.784 1.00 28.72  ?  84  GLN C HB3  1 
ATOM   3722 H HG2  . GLN C 1 39  ? 18.369  35.134  23.144 1.00 35.09  ?  84  GLN C HG2  1 
ATOM   3723 H HG3  . GLN C 1 39  ? 18.814  36.319  22.182 1.00 35.09  ?  84  GLN C HG3  1 
ATOM   3724 H HE21 . GLN C 1 39  ? 16.461  36.327  21.677 1.00 41.28  ?  84  GLN C HE21 1 
ATOM   3725 H HE22 . GLN C 1 39  ? 15.951  35.433  20.600 1.00 41.28  ?  84  GLN C HE22 1 
ATOM   3726 N N    . ILE C 1 40  ? 21.631  32.438  23.893 1.00 21.51  ?  85  ILE C N    1 
ATOM   3727 C CA   . ILE C 1 40  ? 22.350  31.177  23.738 1.00 19.31  ?  85  ILE C CA   1 
ATOM   3728 C C    . ILE C 1 40  ? 21.615  30.244  22.784 1.00 24.21  ?  85  ILE C C    1 
ATOM   3729 O O    . ILE C 1 40  ? 22.224  29.636  21.902 1.00 24.12  ?  85  ILE C O    1 
ATOM   3730 C CB   . ILE C 1 40  ? 22.571  30.524  25.120 1.00 21.27  ?  85  ILE C CB   1 
ATOM   3731 C CG1  . ILE C 1 40  ? 23.485  31.408  25.975 1.00 24.74  ?  85  ILE C CG1  1 
ATOM   3732 C CG2  . ILE C 1 40  ? 23.170  29.122  24.972 1.00 26.88  ?  85  ILE C CG2  1 
ATOM   3733 C CD1  . ILE C 1 40  ? 23.610  30.954  27.416 1.00 27.64  ?  85  ILE C CD1  1 
ATOM   3734 H H    . ILE C 1 40  ? 21.017  32.418  24.494 1.00 25.81  ?  85  ILE C H    1 
ATOM   3735 H HA   . ILE C 1 40  ? 23.222  31.362  23.357 1.00 23.17  ?  85  ILE C HA   1 
ATOM   3736 H HB   . ILE C 1 40  ? 21.712  30.447  25.565 1.00 25.52  ?  85  ILE C HB   1 
ATOM   3737 H HG12 . ILE C 1 40  ? 24.373  31.406  25.586 1.00 29.69  ?  85  ILE C HG12 1 
ATOM   3738 H HG13 . ILE C 1 40  ? 23.130  32.311  25.979 1.00 29.69  ?  85  ILE C HG13 1 
ATOM   3739 H HG21 . ILE C 1 40  ? 23.297  28.738  25.854 1.00 32.26  ?  85  ILE C HG21 1 
ATOM   3740 H HG22 . ILE C 1 40  ? 22.561  28.571  24.456 1.00 32.26  ?  85  ILE C HG22 1 
ATOM   3741 H HG23 . ILE C 1 40  ? 24.023  29.190  24.515 1.00 32.26  ?  85  ILE C HG23 1 
ATOM   3742 H HD11 . ILE C 1 40  ? 24.202  31.562  27.887 1.00 33.17  ?  85  ILE C HD11 1 
ATOM   3743 H HD12 . ILE C 1 40  ? 22.732  30.962  27.827 1.00 33.17  ?  85  ILE C HD12 1 
ATOM   3744 H HD13 . ILE C 1 40  ? 23.976  30.056  27.433 1.00 33.17  ?  85  ILE C HD13 1 
ATOM   3745 N N    . GLY C 1 41  ? 20.302  30.119  22.934 1.00 22.09  ?  86  GLY C N    1 
ATOM   3746 C CA   . GLY C 1 41  ? 19.528  29.318  22.006 1.00 19.09  ?  86  GLY C CA   1 
ATOM   3747 C C    . GLY C 1 41  ? 18.147  29.043  22.550 1.00 18.56  ?  86  GLY C C    1 
ATOM   3748 O O    . GLY C 1 41  ? 17.856  29.266  23.729 1.00 16.03  ?  86  GLY C O    1 
ATOM   3749 H H    . GLY C 1 41  ? 19.841  30.485  23.561 1.00 26.50  ?  86  GLY C H    1 
ATOM   3750 H HA2  . GLY C 1 41  ? 19.443  29.786  21.161 1.00 22.91  ?  86  GLY C HA2  1 
ATOM   3751 H HA3  . GLY C 1 41  ? 19.976  28.471  21.850 1.00 22.91  ?  86  GLY C HA3  1 
ATOM   3752 N N    . THR C 1 42  ? 17.299  28.531  21.660 1.00 16.66  ?  87  THR C N    1 
ATOM   3753 C CA   . THR C 1 42  ? 15.897  28.263  21.950 1.00 16.79  ?  87  THR C CA   1 
ATOM   3754 C C    . THR C 1 42  ? 15.602  26.784  21.743 1.00 17.64  ?  87  THR C C    1 
ATOM   3755 O O    . THR C 1 42  ? 16.145  26.156  20.829 1.00 18.38  ?  87  THR C O    1 
ATOM   3756 C CB   . THR C 1 42  ? 14.989  29.111  21.051 1.00 18.13  ?  87  THR C CB   1 
ATOM   3757 O OG1  . THR C 1 42  ? 15.334  30.492  21.204 1.00 20.07  ?  87  THR C OG1  1 
ATOM   3758 C CG2  . THR C 1 42  ? 13.523  28.907  21.401 1.00 18.01  ?  87  THR C CG2  1 
ATOM   3759 H H    . THR C 1 42  ? 17.523  28.325  20.856 1.00 19.99  ?  87  THR C H    1 
ATOM   3760 H HA   . THR C 1 42  ? 15.709  28.488  22.874 1.00 20.15  ?  87  THR C HA   1 
ATOM   3761 H HB   . THR C 1 42  ? 15.120  28.849  20.126 1.00 21.75  ?  87  THR C HB   1 
ATOM   3762 H HG1  . THR C 1 42  ? 14.843  30.966  20.715 1.00 24.09  ?  87  THR C HG1  1 
ATOM   3763 H HG21 . THR C 1 42  ? 12.966  29.450  20.823 1.00 21.61  ?  87  THR C HG21 1 
ATOM   3764 H HG22 . THR C 1 42  ? 13.282  27.974  21.287 1.00 21.61  ?  87  THR C HG22 1 
ATOM   3765 H HG23 . THR C 1 42  ? 13.364  29.163  22.323 1.00 21.61  ?  87  THR C HG23 1 
ATOM   3766 N N    . PHE C 1 43  ? 14.727  26.233  22.585 1.00 16.99  ?  88  PHE C N    1 
ATOM   3767 C CA   . PHE C 1 43  ? 14.397  24.814  22.542 1.00 18.04  ?  88  PHE C CA   1 
ATOM   3768 C C    . PHE C 1 43  ? 12.902  24.634  22.767 1.00 16.83  ?  88  PHE C C    1 
ATOM   3769 O O    . PHE C 1 43  ? 12.219  25.509  23.308 1.00 14.63  ?  88  PHE C O    1 
ATOM   3770 C CB   . PHE C 1 43  ? 15.193  24.020  23.586 1.00 15.46  ?  88  PHE C CB   1 
ATOM   3771 C CG   . PHE C 1 43  ? 15.031  24.533  24.988 1.00 18.67  ?  88  PHE C CG   1 
ATOM   3772 C CD1  . PHE C 1 43  ? 15.871  25.520  25.481 1.00 14.81  ?  88  PHE C CD1  1 
ATOM   3773 C CD2  . PHE C 1 43  ? 14.037  24.034  25.811 1.00 14.73  ?  88  PHE C CD2  1 
ATOM   3774 C CE1  . PHE C 1 43  ? 15.725  25.995  26.770 1.00 19.20  ?  88  PHE C CE1  1 
ATOM   3775 C CE2  . PHE C 1 43  ? 13.881  24.510  27.102 1.00 16.82  ?  88  PHE C CE2  1 
ATOM   3776 C CZ   . PHE C 1 43  ? 14.731  25.488  27.584 1.00 17.80  ?  88  PHE C CZ   1 
ATOM   3777 H H    . PHE C 1 43  ? 14.308  26.669  23.197 1.00 20.38  ?  88  PHE C H    1 
ATOM   3778 H HA   . PHE C 1 43  ? 14.615  24.464  21.665 1.00 21.64  ?  88  PHE C HA   1 
ATOM   3779 H HB2  . PHE C 1 43  ? 14.893  23.097  23.571 1.00 18.55  ?  88  PHE C HB2  1 
ATOM   3780 H HB3  . PHE C 1 43  ? 16.135  24.064  23.360 1.00 18.55  ?  88  PHE C HB3  1 
ATOM   3781 H HD1  . PHE C 1 43  ? 16.544  25.863  24.939 1.00 17.77  ?  88  PHE C HD1  1 
ATOM   3782 H HD2  . PHE C 1 43  ? 13.464  23.374  25.492 1.00 17.68  ?  88  PHE C HD2  1 
ATOM   3783 H HE1  . PHE C 1 43  ? 16.296  26.656  27.090 1.00 23.04  ?  88  PHE C HE1  1 
ATOM   3784 H HE2  . PHE C 1 43  ? 13.212  24.165  27.647 1.00 20.18  ?  88  PHE C HE2  1 
ATOM   3785 H HZ   . PHE C 1 43  ? 14.629  25.808  28.451 1.00 21.36  ?  88  PHE C HZ   1 
ATOM   3786 N N    . ALA C 1 44  ? 12.399  23.476  22.339 1.00 17.33  ?  89  ALA C N    1 
ATOM   3787 C CA   . ALA C 1 44  ? 10.970  23.197  22.370 1.00 18.49  ?  89  ALA C CA   1 
ATOM   3788 C C    . ALA C 1 44  ? 10.607  21.853  22.985 1.00 17.79  ?  89  ALA C C    1 
ATOM   3789 O O    . ALA C 1 44  ? 9.426   21.488  22.960 1.00 16.75  ?  89  ALA C O    1 
ATOM   3790 C CB   . ALA C 1 44  ? 10.387  23.256  20.951 1.00 20.06  ?  89  ALA C CB   1 
ATOM   3791 H H    . ALA C 1 44  ? 12.872  22.831  22.023 1.00 20.80  ?  89  ALA C H    1 
ATOM   3792 H HA   . ALA C 1 44  ? 10.534  23.886  22.896 1.00 22.19  ?  89  ALA C HA   1 
ATOM   3793 H HB1  . ALA C 1 44  ? 9.436   23.068  20.993 1.00 24.07  ?  89  ALA C HB1  1 
ATOM   3794 H HB2  . ALA C 1 44  ? 10.534  24.143  20.586 1.00 24.07  ?  89  ALA C HB2  1 
ATOM   3795 H HB3  . ALA C 1 44  ? 10.832  22.593  20.400 1.00 24.07  ?  89  ALA C HB3  1 
ATOM   3796 N N    . SER C 1 45  ? 11.571  21.107  23.523 1.00 14.74  ?  90  SER C N    1 
ATOM   3797 C CA   . SER C 1 45  ? 11.296  19.792  24.089 1.00 17.60  ?  90  SER C CA   1 
ATOM   3798 C C    . SER C 1 45  ? 12.196  19.564  25.291 1.00 17.86  ?  90  SER C C    1 
ATOM   3799 O O    . SER C 1 45  ? 13.226  20.224  25.454 1.00 15.34  ?  90  SER C O    1 
ATOM   3800 C CB   . SER C 1 45  ? 11.514  18.678  23.061 1.00 18.54  ?  90  SER C CB   1 
ATOM   3801 O OG   . SER C 1 45  ? 12.881  18.590  22.704 1.00 20.08  ?  90  SER C OG   1 
ATOM   3802 H H    . SER C 1 45  ? 12.397  21.343  23.572 1.00 17.69  ?  90  SER C H    1 
ATOM   3803 H HA   . SER C 1 45  ? 10.373  19.757  24.386 1.00 21.12  ?  90  SER C HA   1 
ATOM   3804 H HB2  . SER C 1 45  ? 11.232  17.833  23.445 1.00 22.25  ?  90  SER C HB2  1 
ATOM   3805 H HB3  . SER C 1 45  ? 10.992  18.872  22.267 1.00 22.25  ?  90  SER C HB3  1 
ATOM   3806 H HG   . SER C 1 45  ? 12.992  17.977  22.140 1.00 24.10  ?  90  SER C HG   1 
ATOM   3807 N N    . VAL C 1 46  ? 11.802  18.597  26.124 1.00 16.81  ?  91  VAL C N    1 
ATOM   3808 C CA   . VAL C 1 46  ? 12.608  18.245  27.289 1.00 15.95  ?  91  VAL C CA   1 
ATOM   3809 C C    . VAL C 1 46  ? 14.011  17.855  26.851 1.00 19.15  ?  91  VAL C C    1 
ATOM   3810 O O    . VAL C 1 46  ? 15.011  18.293  27.432 1.00 15.25  ?  91  VAL C O    1 
ATOM   3811 C CB   . VAL C 1 46  ? 11.938  17.110  28.085 1.00 16.75  ?  91  VAL C CB   1 
ATOM   3812 C CG1  . VAL C 1 46  ? 12.807  16.697  29.271 1.00 19.71  ?  91  VAL C CG1  1 
ATOM   3813 C CG2  . VAL C 1 46  ? 10.552  17.523  28.554 1.00 14.28  ?  91  VAL C CG2  1 
ATOM   3814 H H    . VAL C 1 46  ? 11.081  18.137  26.037 1.00 20.17  ?  91  VAL C H    1 
ATOM   3815 H HA   . VAL C 1 46  ? 12.679  19.018  27.871 1.00 19.14  ?  91  VAL C HA   1 
ATOM   3816 H HB   . VAL C 1 46  ? 11.838  16.338  27.507 1.00 20.09  ?  91  VAL C HB   1 
ATOM   3817 H HG11 . VAL C 1 46  ? 12.362  15.983  29.754 1.00 23.65  ?  91  VAL C HG11 1 
ATOM   3818 H HG12 . VAL C 1 46  ? 13.665  16.389  28.941 1.00 23.65  ?  91  VAL C HG12 1 
ATOM   3819 H HG13 . VAL C 1 46  ? 12.931  17.463  29.853 1.00 23.65  ?  91  VAL C HG13 1 
ATOM   3820 H HG21 . VAL C 1 46  ? 10.157  16.790  29.051 1.00 17.14  ?  91  VAL C HG21 1 
ATOM   3821 H HG22 . VAL C 1 46  ? 10.632  18.304  29.123 1.00 17.14  ?  91  VAL C HG22 1 
ATOM   3822 H HG23 . VAL C 1 46  ? 10.006  17.731  27.780 1.00 17.14  ?  91  VAL C HG23 1 
ATOM   3823 N N    . GLU C 1 47  ? 14.101  17.018  25.814 1.00 19.52  ?  92  GLU C N    1 
ATOM   3824 C CA   . GLU C 1 47  ? 15.391  16.496  25.382 1.00 18.12  ?  92  GLU C CA   1 
ATOM   3825 C C    . GLU C 1 47  ? 16.293  17.607  24.858 1.00 17.74  ?  92  GLU C C    1 
ATOM   3826 O O    . GLU C 1 47  ? 17.491  17.640  25.166 1.00 18.71  ?  92  GLU C O    1 
ATOM   3827 C CB   . GLU C 1 47  ? 15.181  15.419  24.318 1.00 20.53  ?  92  GLU C CB   1 
ATOM   3828 C CG   . GLU C 1 47  ? 14.563  14.119  24.852 1.00 20.02  ?  92  GLU C CG   1 
ATOM   3829 C CD   . GLU C 1 47  ? 13.072  14.232  25.151 1.00 22.30  ?  92  GLU C CD   1 
ATOM   3830 O OE1  . GLU C 1 47  ? 12.427  15.185  24.665 1.00 19.30  ?  92  GLU C OE1  1 
ATOM   3831 O OE2  . GLU C 1 47  ? 12.545  13.362  25.874 1.00 22.89  -1 92  GLU C OE2  1 
ATOM   3832 H H    . GLU C 1 47  ? 13.432  16.742  25.350 1.00 23.42  ?  92  GLU C H    1 
ATOM   3833 H HA   . GLU C 1 47  ? 15.834  16.084  26.140 1.00 21.74  ?  92  GLU C HA   1 
ATOM   3834 H HB2  . GLU C 1 47  ? 14.589  15.769  23.634 1.00 24.64  ?  92  GLU C HB2  1 
ATOM   3835 H HB3  . GLU C 1 47  ? 16.040  15.198  23.925 1.00 24.64  ?  92  GLU C HB3  1 
ATOM   3836 H HG2  . GLU C 1 47  ? 14.681  13.421  24.189 1.00 24.02  ?  92  GLU C HG2  1 
ATOM   3837 H HG3  . GLU C 1 47  ? 15.014  13.873  25.675 1.00 24.02  ?  92  GLU C HG3  1 
ATOM   3838 N N    . GLN C 1 48  ? 15.740  18.529  24.067 1.00 19.36  ?  93  GLN C N    1 
ATOM   3839 C CA   . GLN C 1 48  ? 16.532  19.661  23.591 1.00 21.85  ?  93  GLN C CA   1 
ATOM   3840 C C    . GLN C 1 48  ? 16.984  20.547  24.747 1.00 22.18  ?  93  GLN C C    1 
ATOM   3841 O O    . GLN C 1 48  ? 18.099  21.081  24.726 1.00 22.31  ?  93  GLN C O    1 
ATOM   3842 C CB   . GLN C 1 48  ? 15.736  20.476  22.571 1.00 21.61  ?  93  GLN C CB   1 
ATOM   3843 C CG   . GLN C 1 48  ? 15.873  19.987  21.139 1.00 37.64  ?  93  GLN C CG   1 
ATOM   3844 C CD   . GLN C 1 48  ? 17.275  20.182  20.582 1.00 37.99  ?  93  GLN C CD   1 
ATOM   3845 O OE1  . GLN C 1 48  ? 17.931  19.226  20.175 1.00 33.30  ?  93  GLN C OE1  1 
ATOM   3846 N NE2  . GLN C 1 48  ? 17.737  21.429  20.557 1.00 35.53  ?  93  GLN C NE2  1 
ATOM   3847 H H    . GLN C 1 48  ? 14.924  18.522  23.796 1.00 23.23  ?  93  GLN C H    1 
ATOM   3848 H HA   . GLN C 1 48  ? 17.326  19.323  23.148 1.00 26.22  ?  93  GLN C HA   1 
ATOM   3849 H HB2  . GLN C 1 48  ? 14.796  20.437  22.808 1.00 25.94  ?  93  GLN C HB2  1 
ATOM   3850 H HB3  . GLN C 1 48  ? 16.043  21.395  22.600 1.00 25.94  ?  93  GLN C HB3  1 
ATOM   3851 H HG2  . GLN C 1 48  ? 15.667  19.039  21.107 1.00 45.16  ?  93  GLN C HG2  1 
ATOM   3852 H HG3  . GLN C 1 48  ? 15.255  20.480  20.576 1.00 45.16  ?  93  GLN C HG3  1 
ATOM   3853 H HE21 . GLN C 1 48  ? 17.249  22.074  20.846 1.00 42.63  ?  93  GLN C HE21 1 
ATOM   3854 H HE22 . GLN C 1 48  ? 18.525  21.589  20.251 1.00 42.63  ?  93  GLN C HE22 1 
ATOM   3855 N N    . PHE C 1 49  ? 16.134  20.727  25.761 1.00 18.60  ?  94  PHE C N    1 
ATOM   3856 C CA   . PHE C 1 49  ? 16.554  21.476  26.941 1.00 17.09  ?  94  PHE C CA   1 
ATOM   3857 C C    . PHE C 1 49  ? 17.826  20.890  27.537 1.00 20.55  ?  94  PHE C C    1 
ATOM   3858 O O    . PHE C 1 49  ? 18.786  21.615  27.823 1.00 17.89  ?  94  PHE C O    1 
ATOM   3859 C CB   . PHE C 1 49  ? 15.455  21.486  28.003 1.00 18.50  ?  94  PHE C CB   1 
ATOM   3860 C CG   . PHE C 1 49  ? 15.973  21.759  29.384 1.00 18.92  ?  94  PHE C CG   1 
ATOM   3861 C CD1  . PHE C 1 49  ? 16.389  23.030  29.743 1.00 14.63  ?  94  PHE C CD1  1 
ATOM   3862 C CD2  . PHE C 1 49  ? 16.079  20.739  30.313 1.00 16.15  ?  94  PHE C CD2  1 
ATOM   3863 C CE1  . PHE C 1 49  ? 16.882  23.280  31.009 1.00 16.47  ?  94  PHE C CE1  1 
ATOM   3864 C CE2  . PHE C 1 49  ? 16.566  20.982  31.580 1.00 19.66  ?  94  PHE C CE2  1 
ATOM   3865 C CZ   . PHE C 1 49  ? 16.972  22.255  31.930 1.00 17.50  ?  94  PHE C CZ   1 
ATOM   3866 H H    . PHE C 1 49  ? 15.327  20.431  25.789 1.00 22.33  ?  94  PHE C H    1 
ATOM   3867 H HA   . PHE C 1 49  ? 16.735  22.394  26.686 1.00 20.51  ?  94  PHE C HA   1 
ATOM   3868 H HB2  . PHE C 1 49  ? 14.811  22.178  27.783 1.00 22.20  ?  94  PHE C HB2  1 
ATOM   3869 H HB3  . PHE C 1 49  ? 15.019  20.620  28.013 1.00 22.20  ?  94  PHE C HB3  1 
ATOM   3870 H HD1  . PHE C 1 49  ? 16.331  23.724  29.126 1.00 17.56  ?  94  PHE C HD1  1 
ATOM   3871 H HD2  . PHE C 1 49  ? 15.807  19.880  30.084 1.00 19.38  ?  94  PHE C HD2  1 
ATOM   3872 H HE1  . PHE C 1 49  ? 17.152  24.139  31.242 1.00 19.76  ?  94  PHE C HE1  1 
ATOM   3873 H HE2  . PHE C 1 49  ? 16.626  20.289  32.196 1.00 23.59  ?  94  PHE C HE2  1 
ATOM   3874 H HZ   . PHE C 1 49  ? 17.301  22.421  32.784 1.00 21.01  ?  94  PHE C HZ   1 
ATOM   3875 N N    . TRP C 1 50  ? 17.845  19.572  27.749 1.00 17.39  ?  95  TRP C N    1 
ATOM   3876 C CA   . TRP C 1 50  ? 19.004  18.956  28.381 1.00 19.63  ?  95  TRP C CA   1 
ATOM   3877 C C    . TRP C 1 50  ? 20.254  19.122  27.532 1.00 21.24  ?  95  TRP C C    1 
ATOM   3878 O O    . TRP C 1 50  ? 21.358  19.233  28.074 1.00 21.62  ?  95  TRP C O    1 
ATOM   3879 C CB   . TRP C 1 50  ? 18.732  17.476  28.655 1.00 18.93  ?  95  TRP C CB   1 
ATOM   3880 C CG   . TRP C 1 50  ? 17.840  17.255  29.830 1.00 21.05  ?  95  TRP C CG   1 
ATOM   3881 C CD1  . TRP C 1 50  ? 16.568  16.766  29.813 1.00 18.61  ?  95  TRP C CD1  1 
ATOM   3882 C CD2  . TRP C 1 50  ? 18.148  17.524  31.202 1.00 21.99  ?  95  TRP C CD2  1 
ATOM   3883 N NE1  . TRP C 1 50  ? 16.067  16.710  31.088 1.00 19.88  ?  95  TRP C NE1  1 
ATOM   3884 C CE2  . TRP C 1 50  ? 17.017  17.169  31.960 1.00 19.05  ?  95  TRP C CE2  1 
ATOM   3885 C CE3  . TRP C 1 50  ? 19.273  18.028  31.863 1.00 22.89  ?  95  TRP C CE3  1 
ATOM   3886 C CZ2  . TRP C 1 50  ? 16.975  17.304  33.347 1.00 22.98  ?  95  TRP C CZ2  1 
ATOM   3887 C CZ3  . TRP C 1 50  ? 19.230  18.160  33.239 1.00 21.74  ?  95  TRP C CZ3  1 
ATOM   3888 C CH2  . TRP C 1 50  ? 18.088  17.801  33.966 1.00 25.63  ?  95  TRP C CH2  1 
ATOM   3889 H H    . TRP C 1 50  ? 17.213  19.026  27.540 1.00 20.86  ?  95  TRP C H    1 
ATOM   3890 H HA   . TRP C 1 50  ? 19.164  19.392  29.233 1.00 23.55  ?  95  TRP C HA   1 
ATOM   3891 H HB2  . TRP C 1 50  ? 18.306  17.085  27.877 1.00 22.71  ?  95  TRP C HB2  1 
ATOM   3892 H HB3  . TRP C 1 50  ? 19.575  17.029  28.831 1.00 22.71  ?  95  TRP C HB3  1 
ATOM   3893 H HD1  . TRP C 1 50  ? 16.107  16.506  29.048 1.00 22.33  ?  95  TRP C HD1  1 
ATOM   3894 H HE1  . TRP C 1 50  ? 15.282  16.431  31.304 1.00 23.86  ?  95  TRP C HE1  1 
ATOM   3895 H HE3  . TRP C 1 50  ? 20.034  18.270  31.387 1.00 27.47  ?  95  TRP C HE3  1 
ATOM   3896 H HZ2  . TRP C 1 50  ? 16.219  17.065  33.833 1.00 27.58  ?  95  TRP C HZ2  1 
ATOM   3897 H HZ3  . TRP C 1 50  ? 19.971  18.495  33.689 1.00 26.08  ?  95  TRP C HZ3  1 
ATOM   3898 H HH2  . TRP C 1 50  ? 18.088  17.899  34.891 1.00 30.76  ?  95  TRP C HH2  1 
ATOM   3899 N N    . ARG C 1 51  ? 20.103  19.149  26.207 1.00 20.47  ?  96  ARG C N    1 
ATOM   3900 C CA   . ARG C 1 51  ? 21.255  19.341  25.334 1.00 27.93  ?  96  ARG C CA   1 
ATOM   3901 C C    . ARG C 1 51  ? 21.877  20.712  25.551 1.00 25.25  ?  96  ARG C C    1 
ATOM   3902 O O    . ARG C 1 51  ? 23.103  20.843  25.647 1.00 23.25  ?  96  ARG C O    1 
ATOM   3903 C CB   . ARG C 1 51  ? 20.838  19.162  23.877 1.00 28.88  ?  96  ARG C CB   1 
ATOM   3904 C CG   . ARG C 1 51  ? 20.440  17.744  23.535 1.00 33.37  ?  96  ARG C CG   1 
ATOM   3905 C CD   . ARG C 1 51  ? 19.921  17.643  22.124 1.00 37.03  ?  96  ARG C CD   1 
ATOM   3906 N NE   . ARG C 1 51  ? 20.911  18.072  21.143 1.00 40.54  ?  96  ARG C NE   1 
ATOM   3907 C CZ   . ARG C 1 51  ? 20.803  17.854  19.838 1.00 43.49  ?  96  ARG C CZ   1 
ATOM   3908 N NH1  . ARG C 1 51  ? 19.750  17.204  19.357 1.00 42.41  1  96  ARG C NH1  1 
ATOM   3909 N NH2  . ARG C 1 51  ? 21.750  18.281  19.012 1.00 49.21  ?  96  ARG C NH2  1 
ATOM   3910 H H    . ARG C 1 51  ? 19.353  19.060  25.796 1.00 24.56  ?  96  ARG C H    1 
ATOM   3911 H HA   . ARG C 1 51  ? 21.925  18.670  25.541 1.00 33.51  ?  96  ARG C HA   1 
ATOM   3912 H HB2  . ARG C 1 51  ? 20.078  19.737  23.696 1.00 34.65  ?  96  ARG C HB2  1 
ATOM   3913 H HB3  . ARG C 1 51  ? 21.582  19.408  23.305 1.00 34.65  ?  96  ARG C HB3  1 
ATOM   3914 H HG2  . ARG C 1 51  ? 21.214  17.165  23.617 1.00 40.04  ?  96  ARG C HG2  1 
ATOM   3915 H HG3  . ARG C 1 51  ? 19.738  17.454  24.139 1.00 40.04  ?  96  ARG C HG3  1 
ATOM   3916 H HD2  . ARG C 1 51  ? 19.690  16.720  21.936 1.00 44.44  ?  96  ARG C HD2  1 
ATOM   3917 H HD3  . ARG C 1 51  ? 19.139  18.209  22.032 1.00 44.44  ?  96  ARG C HD3  1 
ATOM   3918 H HE   . ARG C 1 51  ? 21.641  18.421  21.434 1.00 48.65  ?  96  ARG C HE   1 
ATOM   3919 H HH11 . ARG C 1 51  ? 19.135  16.926  19.890 1.00 50.89  ?  96  ARG C HH11 1 
ATOM   3920 H HH12 . ARG C 1 51  ? 19.681  17.062  18.511 1.00 50.89  ?  96  ARG C HH12 1 
ATOM   3921 H HH21 . ARG C 1 51  ? 22.433  18.701  19.322 1.00 59.05  ?  96  ARG C HH21 1 
ATOM   3922 H HH22 . ARG C 1 51  ? 21.680  18.138  18.167 1.00 59.05  ?  96  ARG C HH22 1 
ATOM   3923 N N    . PHE C 1 52  ? 21.041  21.750  25.620 1.00 20.58  ?  97  PHE C N    1 
ATOM   3924 C CA   . PHE C 1 52  ? 21.532  23.083  25.953 1.00 19.53  ?  97  PHE C CA   1 
ATOM   3925 C C    . PHE C 1 52  ? 22.092  23.118  27.368 1.00 22.76  ?  97  PHE C C    1 
ATOM   3926 O O    . PHE C 1 52  ? 23.234  23.538  27.586 1.00 26.95  ?  97  PHE C O    1 
ATOM   3927 C CB   . PHE C 1 52  ? 20.410  24.111  25.797 1.00 21.78  ?  97  PHE C CB   1 
ATOM   3928 C CG   . PHE C 1 52  ? 20.261  24.636  24.404 1.00 22.80  ?  97  PHE C CG   1 
ATOM   3929 C CD1  . PHE C 1 52  ? 21.106  25.626  23.930 1.00 24.38  ?  97  PHE C CD1  1 
ATOM   3930 C CD2  . PHE C 1 52  ? 19.275  24.147  23.568 1.00 22.05  ?  97  PHE C CD2  1 
ATOM   3931 C CE1  . PHE C 1 52  ? 20.975  26.113  22.649 1.00 25.75  ?  97  PHE C CE1  1 
ATOM   3932 C CE2  . PHE C 1 52  ? 19.136  24.632  22.283 1.00 22.81  ?  97  PHE C CE2  1 
ATOM   3933 C CZ   . PHE C 1 52  ? 19.986  25.618  21.822 1.00 25.97  ?  97  PHE C CZ   1 
ATOM   3934 H H    . PHE C 1 52  ? 20.194  21.708  25.479 1.00 24.69  ?  97  PHE C H    1 
ATOM   3935 H HA   . PHE C 1 52  ? 22.246  23.320  25.340 1.00 23.44  ?  97  PHE C HA   1 
ATOM   3936 H HB2  . PHE C 1 52  ? 19.570  23.698  26.050 1.00 26.14  ?  97  PHE C HB2  1 
ATOM   3937 H HB3  . PHE C 1 52  ? 20.594  24.865  26.380 1.00 26.14  ?  97  PHE C HB3  1 
ATOM   3938 H HD1  . PHE C 1 52  ? 21.774  25.963  24.483 1.00 29.26  ?  97  PHE C HD1  1 
ATOM   3939 H HD2  . PHE C 1 52  ? 18.700  23.483  23.875 1.00 26.46  ?  97  PHE C HD2  1 
ATOM   3940 H HE1  . PHE C 1 52  ? 21.549  26.777  22.343 1.00 30.90  ?  97  PHE C HE1  1 
ATOM   3941 H HE2  . PHE C 1 52  ? 18.469  24.295  21.728 1.00 27.37  ?  97  PHE C HE2  1 
ATOM   3942 H HZ   . PHE C 1 52  ? 19.895  25.945  20.956 1.00 31.16  ?  97  PHE C HZ   1 
ATOM   3943 N N    . TYR C 1 53  ? 21.303  22.659  28.343 1.00 21.93  ?  98  TYR C N    1 
ATOM   3944 C CA   . TYR C 1 53  ? 21.713  22.747  29.741 1.00 22.65  ?  98  TYR C CA   1 
ATOM   3945 C C    . TYR C 1 53  ? 23.006  21.982  29.996 1.00 25.76  ?  98  TYR C C    1 
ATOM   3946 O O    . TYR C 1 53  ? 23.891  22.465  30.713 1.00 25.00  ?  98  TYR C O    1 
ATOM   3947 C CB   . TYR C 1 53  ? 20.596  22.222  30.641 1.00 20.02  ?  98  TYR C CB   1 
ATOM   3948 C CG   . TYR C 1 53  ? 20.901  22.300  32.120 1.00 21.69  ?  98  TYR C CG   1 
ATOM   3949 C CD1  . TYR C 1 53  ? 20.896  23.518  32.786 1.00 22.33  ?  98  TYR C CD1  1 
ATOM   3950 C CD2  . TYR C 1 53  ? 21.184  21.157  32.852 1.00 22.43  ?  98  TYR C CD2  1 
ATOM   3951 C CE1  . TYR C 1 53  ? 21.170  23.594  34.139 1.00 22.82  ?  98  TYR C CE1  1 
ATOM   3952 C CE2  . TYR C 1 53  ? 21.457  21.222  34.204 1.00 25.04  ?  98  TYR C CE2  1 
ATOM   3953 C CZ   . TYR C 1 53  ? 21.448  22.444  34.843 1.00 22.60  ?  98  TYR C CZ   1 
ATOM   3954 O OH   . TYR C 1 53  ? 21.723  22.514  36.188 1.00 28.03  ?  98  TYR C OH   1 
ATOM   3955 H H    . TYR C 1 53  ? 20.533  22.296  28.220 1.00 26.32  ?  98  TYR C H    1 
ATOM   3956 H HA   . TYR C 1 53  ? 21.867  23.678  29.967 1.00 27.18  ?  98  TYR C HA   1 
ATOM   3957 H HB2  . TYR C 1 53  ? 19.794  22.742  30.477 1.00 24.02  ?  98  TYR C HB2  1 
ATOM   3958 H HB3  . TYR C 1 53  ? 20.432  21.291  30.422 1.00 24.02  ?  98  TYR C HB3  1 
ATOM   3959 H HD1  . TYR C 1 53  ? 20.707  24.296  32.313 1.00 26.79  ?  98  TYR C HD1  1 
ATOM   3960 H HD2  . TYR C 1 53  ? 21.190  20.331  32.424 1.00 26.91  ?  98  TYR C HD2  1 
ATOM   3961 H HE1  . TYR C 1 53  ? 21.165  24.417  34.572 1.00 27.38  ?  98  TYR C HE1  1 
ATOM   3962 H HE2  . TYR C 1 53  ? 21.647  20.447  34.681 1.00 30.04  ?  98  TYR C HE2  1 
ATOM   3963 H HH   . TYR C 1 53  ? 21.873  21.745  36.490 1.00 33.64  ?  98  TYR C HH   1 
ATOM   3964 N N    . SER C 1 54  ? 23.132  20.782  29.425 1.00 24.18  ?  99  SER C N    1 
ATOM   3965 C CA   . SER C 1 54  ? 24.307  19.957  29.676 1.00 25.51  ?  99  SER C CA   1 
ATOM   3966 C C    . SER C 1 54  ? 25.571  20.543  29.062 1.00 30.02  ?  99  SER C C    1 
ATOM   3967 O O    . SER C 1 54  ? 26.673  20.144  29.453 1.00 33.97  ?  99  SER C O    1 
ATOM   3968 C CB   . SER C 1 54  ? 24.078  18.541  29.140 1.00 30.29  ?  99  SER C CB   1 
ATOM   3969 O OG   . SER C 1 54  ? 23.865  18.554  27.738 1.00 31.03  ?  99  SER C OG   1 
ATOM   3970 H H    . SER C 1 54  ? 22.555  20.429  28.893 1.00 29.01  ?  99  SER C H    1 
ATOM   3971 H HA   . SER C 1 54  ? 24.444  19.893  30.634 1.00 30.61  ?  99  SER C HA   1 
ATOM   3972 H HB2  . SER C 1 54  ? 24.860  18.001  29.334 1.00 36.35  ?  99  SER C HB2  1 
ATOM   3973 H HB3  . SER C 1 54  ? 23.298  18.162  29.574 1.00 36.35  ?  99  SER C HB3  1 
ATOM   3974 H HG   . SER C 1 54  ? 23.189  19.018  27.554 1.00 37.23  ?  99  SER C HG   1 
ATOM   3975 N N    . HIS C 1 55  ? 25.441  21.474  28.117 1.00 28.93  ?  100 HIS C N    1 
ATOM   3976 C CA   . HIS C 1 55  ? 26.589  22.117  27.490 1.00 36.25  ?  100 HIS C CA   1 
ATOM   3977 C C    . HIS C 1 55  ? 26.729  23.574  27.910 1.00 31.51  ?  100 HIS C C    1 
ATOM   3978 O O    . HIS C 1 55  ? 27.309  24.381  27.175 1.00 33.15  ?  100 HIS C O    1 
ATOM   3979 C CB   . HIS C 1 55  ? 26.491  21.992  25.971 1.00 33.54  ?  100 HIS C CB   1 
ATOM   3980 C CG   . HIS C 1 55  ? 26.540  20.575  25.491 1.00 38.06  ?  100 HIS C CG   1 
ATOM   3981 N ND1  . HIS C 1 55  ? 25.406  19.828  25.257 1.00 39.29  ?  100 HIS C ND1  1 
ATOM   3982 C CD2  . HIS C 1 55  ? 27.589  19.758  25.234 1.00 40.46  ?  100 HIS C CD2  1 
ATOM   3983 C CE1  . HIS C 1 55  ? 25.753  18.617  24.859 1.00 42.05  ?  100 HIS C CE1  1 
ATOM   3984 N NE2  . HIS C 1 55  ? 27.072  18.548  24.837 1.00 42.75  ?  100 HIS C NE2  1 
ATOM   3985 H H    . HIS C 1 55  ? 24.685  21.754  27.819 1.00 34.71  ?  100 HIS C H    1 
ATOM   3986 H HA   . HIS C 1 55  ? 27.394  21.653  27.770 1.00 43.50  ?  100 HIS C HA   1 
ATOM   3987 H HB2  . HIS C 1 55  ? 25.650  22.377  25.677 1.00 40.25  ?  100 HIS C HB2  1 
ATOM   3988 H HB3  . HIS C 1 55  ? 27.232  22.470  25.567 1.00 40.25  ?  100 HIS C HB3  1 
ATOM   3989 H HD1  . HIS C 1 55  ? 24.598  20.109  25.348 1.00 47.15  ?  100 HIS C HD1  1 
ATOM   3990 H HD2  . HIS C 1 55  ? 28.490  19.977  25.304 1.00 48.55  ?  100 HIS C HD2  1 
ATOM   3991 H HE1  . HIS C 1 55  ? 25.169  17.930  24.634 1.00 50.46  ?  100 HIS C HE1  1 
ATOM   3992 N N    . MET C 1 56  ? 26.201  23.922  29.077 1.00 27.38  ?  101 MET C N    1 
ATOM   3993 C CA   . MET C 1 56  ? 26.422  25.212  29.707 1.00 26.72  ?  101 MET C CA   1 
ATOM   3994 C C    . MET C 1 56  ? 27.106  24.986  31.045 1.00 24.02  ?  101 MET C C    1 
ATOM   3995 O O    . MET C 1 56  ? 26.798  24.021  31.753 1.00 26.71  ?  101 MET C O    1 
ATOM   3996 C CB   . MET C 1 56  ? 25.105  25.963  29.925 1.00 22.14  ?  101 MET C CB   1 
ATOM   3997 C CG   . MET C 1 56  ? 24.396  26.380  28.649 1.00 26.73  ?  101 MET C CG   1 
ATOM   3998 S SD   . MET C 1 56  ? 22.770  27.089  28.986 1.00 28.58  ?  101 MET C SD   1 
ATOM   3999 C CE   . MET C 1 56  ? 23.212  28.509  29.987 1.00 25.38  ?  101 MET C CE   1 
ATOM   4000 H H    . MET C 1 56  ? 25.692  23.405  29.538 1.00 32.85  ?  101 MET C H    1 
ATOM   4001 H HA   . MET C 1 56  ? 26.993  25.754  29.141 1.00 32.06  ?  101 MET C HA   1 
ATOM   4002 H HB2  . MET C 1 56  ? 24.501  25.391  30.424 1.00 26.56  ?  101 MET C HB2  1 
ATOM   4003 H HB3  . MET C 1 56  ? 25.288  26.767  30.436 1.00 26.56  ?  101 MET C HB3  1 
ATOM   4004 H HG2  . MET C 1 56  ? 24.929  27.049  28.191 1.00 32.07  ?  101 MET C HG2  1 
ATOM   4005 H HG3  . MET C 1 56  ? 24.275  25.603  28.082 1.00 32.07  ?  101 MET C HG3  1 
ATOM   4006 H HE1  . MET C 1 56  ? 22.403  28.983  30.237 1.00 30.45  ?  101 MET C HE1  1 
ATOM   4007 H HE2  . MET C 1 56  ? 23.676  28.202  30.783 1.00 30.45  ?  101 MET C HE2  1 
ATOM   4008 H HE3  . MET C 1 56  ? 23.791  29.091  29.471 1.00 30.45  ?  101 MET C HE3  1 
ATOM   4009 N N    . VAL C 1 57  ? 28.040  25.874  31.390 1.00 22.80  ?  102 VAL C N    1 
ATOM   4010 C CA   . VAL C 1 57  ? 28.642  25.815  32.711 1.00 25.88  ?  102 VAL C CA   1 
ATOM   4011 C C    . VAL C 1 57  ? 27.549  26.004  33.757 1.00 26.13  ?  102 VAL C C    1 
ATOM   4012 O O    . VAL C 1 57  ? 26.539  26.680  33.520 1.00 23.17  ?  102 VAL C O    1 
ATOM   4013 C CB   . VAL C 1 57  ? 29.745  26.877  32.870 1.00 28.19  ?  102 VAL C CB   1 
ATOM   4014 C CG1  . VAL C 1 57  ? 30.820  26.694  31.807 1.00 30.26  ?  102 VAL C CG1  1 
ATOM   4015 C CG2  . VAL C 1 57  ? 29.157  28.272  32.793 1.00 25.89  ?  102 VAL C CG2  1 
ATOM   4016 H H    . VAL C 1 57  ? 28.334  26.505  30.886 1.00 27.37  ?  102 VAL C H    1 
ATOM   4017 H HA   . VAL C 1 57  ? 29.042  24.941  32.843 1.00 31.06  ?  102 VAL C HA   1 
ATOM   4018 H HB   . VAL C 1 57  ? 30.161  26.774  33.740 1.00 33.83  ?  102 VAL C HB   1 
ATOM   4019 H HG11 . VAL C 1 57  ? 31.502  27.374  31.928 1.00 36.31  ?  102 VAL C HG11 1 
ATOM   4020 H HG12 . VAL C 1 57  ? 31.212  25.812  31.904 1.00 36.31  ?  102 VAL C HG12 1 
ATOM   4021 H HG13 . VAL C 1 57  ? 30.416  26.783  30.930 1.00 36.31  ?  102 VAL C HG13 1 
ATOM   4022 H HG21 . VAL C 1 57  ? 29.870  28.921  32.895 1.00 31.06  ?  102 VAL C HG21 1 
ATOM   4023 H HG22 . VAL C 1 57  ? 28.727  28.386  31.931 1.00 31.06  ?  102 VAL C HG22 1 
ATOM   4024 H HG23 . VAL C 1 57  ? 28.507  28.380  33.505 1.00 31.06  ?  102 VAL C HG23 1 
ATOM   4025 N N    . ARG C 1 58  ? 27.746  25.396  34.922 1.00 26.30  ?  103 ARG C N    1 
ATOM   4026 C CA   . ARG C 1 58  ? 26.795  25.559  36.005 1.00 26.38  ?  103 ARG C CA   1 
ATOM   4027 C C    . ARG C 1 58  ? 26.903  26.970  36.585 1.00 27.52  ?  103 ARG C C    1 
ATOM   4028 O O    . ARG C 1 58  ? 27.993  27.548  36.633 1.00 25.98  ?  103 ARG C O    1 
ATOM   4029 C CB   . ARG C 1 58  ? 27.042  24.526  37.100 1.00 30.13  ?  103 ARG C CB   1 
ATOM   4030 C CG   . ARG C 1 58  ? 26.475  23.146  36.791 1.00 35.79  ?  103 ARG C CG   1 
ATOM   4031 C CD   . ARG C 1 58  ? 26.611  22.204  37.982 1.00 38.33  ?  103 ARG C CD   1 
ATOM   4032 N NE   . ARG C 1 58  ? 25.876  20.953  37.785 1.00 47.96  ?  103 ARG C NE   1 
ATOM   4033 C CZ   . ARG C 1 58  ? 24.595  20.769  38.100 1.00 41.58  ?  103 ARG C CZ   1 
ATOM   4034 N NH1  . ARG C 1 58  ? 24.022  19.593  37.881 1.00 41.78  1  103 ARG C NH1  1 
ATOM   4035 N NH2  . ARG C 1 58  ? 23.880  21.754  38.631 1.00 37.56  ?  103 ARG C NH2  1 
ATOM   4036 H H    . ARG C 1 58  ? 28.416  24.889  35.106 1.00 31.56  ?  103 ARG C H    1 
ATOM   4037 H HA   . ARG C 1 58  ? 25.895  25.436  35.665 1.00 31.66  ?  103 ARG C HA   1 
ATOM   4038 H HB2  . ARG C 1 58  ? 27.998  24.431  37.229 1.00 36.16  ?  103 ARG C HB2  1 
ATOM   4039 H HB3  . ARG C 1 58  ? 26.629  24.837  37.921 1.00 36.16  ?  103 ARG C HB3  1 
ATOM   4040 H HG2  . ARG C 1 58  ? 25.534  23.228  36.574 1.00 42.95  ?  103 ARG C HG2  1 
ATOM   4041 H HG3  . ARG C 1 58  ? 26.960  22.762  36.043 1.00 42.95  ?  103 ARG C HG3  1 
ATOM   4042 H HD2  . ARG C 1 58  ? 27.547  21.987  38.110 1.00 46.00  ?  103 ARG C HD2  1 
ATOM   4043 H HD3  . ARG C 1 58  ? 26.258  22.640  38.773 1.00 46.00  ?  103 ARG C HD3  1 
ATOM   4044 H HE   . ARG C 1 58  ? 26.302  20.290  37.442 1.00 57.56  ?  103 ARG C HE   1 
ATOM   4045 H HH11 . ARG C 1 58  ? 24.479  18.950  37.537 1.00 50.14  ?  103 ARG C HH11 1 
ATOM   4046 H HH12 . ARG C 1 58  ? 23.195  19.473  38.083 1.00 50.14  ?  103 ARG C HH12 1 
ATOM   4047 H HH21 . ARG C 1 58  ? 24.244  22.520  38.777 1.00 45.07  ?  103 ARG C HH21 1 
ATOM   4048 H HH22 . ARG C 1 58  ? 23.053  21.627  38.831 1.00 45.07  ?  103 ARG C HH22 1 
ATOM   4049 N N    . PRO C 1 59  ? 25.784  27.550  37.030 1.00 26.50  ?  104 PRO C N    1 
ATOM   4050 C CA   . PRO C 1 59  ? 25.839  28.920  37.576 1.00 25.55  ?  104 PRO C CA   1 
ATOM   4051 C C    . PRO C 1 59  ? 26.949  29.127  38.592 1.00 27.72  ?  104 PRO C C    1 
ATOM   4052 O O    . PRO C 1 59  ? 27.652  30.144  38.540 1.00 28.74  ?  104 PRO C O    1 
ATOM   4053 C CB   . PRO C 1 59  ? 24.452  29.093  38.210 1.00 25.19  ?  104 PRO C CB   1 
ATOM   4054 C CG   . PRO C 1 59  ? 23.572  28.181  37.449 1.00 24.96  ?  104 PRO C CG   1 
ATOM   4055 C CD   . PRO C 1 59  ? 24.417  26.999  37.061 1.00 23.41  ?  104 PRO C CD   1 
ATOM   4056 H HA   . PRO C 1 59  ? 25.943  29.562  36.857 1.00 30.66  ?  104 PRO C HA   1 
ATOM   4057 H HB2  . PRO C 1 59  ? 24.485  28.839  39.146 1.00 30.23  ?  104 PRO C HB2  1 
ATOM   4058 H HB3  . PRO C 1 59  ? 24.160  30.013  38.114 1.00 30.23  ?  104 PRO C HB3  1 
ATOM   4059 H HG2  . PRO C 1 59  ? 22.834  27.901  38.012 1.00 29.96  ?  104 PRO C HG2  1 
ATOM   4060 H HG3  . PRO C 1 59  ? 23.242  28.636  36.658 1.00 29.96  ?  104 PRO C HG3  1 
ATOM   4061 H HD2  . PRO C 1 59  ? 24.350  26.301  37.732 1.00 28.10  ?  104 PRO C HD2  1 
ATOM   4062 H HD3  . PRO C 1 59  ? 24.163  26.675  36.183 1.00 28.10  ?  104 PRO C HD3  1 
ATOM   4063 N N    . GLY C 1 60  ? 27.130  28.182  39.515 1.00 25.87  ?  105 GLY C N    1 
ATOM   4064 C CA   . GLY C 1 60  ? 28.156  28.300  40.535 1.00 28.94  ?  105 GLY C CA   1 
ATOM   4065 C C    . GLY C 1 60  ? 29.570  28.360  39.995 1.00 32.84  ?  105 GLY C C    1 
ATOM   4066 O O    . GLY C 1 60  ? 30.487  28.703  40.750 1.00 35.41  ?  105 GLY C O    1 
ATOM   4067 H H    . GLY C 1 60  ? 26.665  27.460  39.568 1.00 31.05  ?  105 GLY C H    1 
ATOM   4068 H HA2  . GLY C 1 60  ? 27.998  29.104  41.053 1.00 34.72  ?  105 GLY C HA2  1 
ATOM   4069 H HA3  . GLY C 1 60  ? 28.096  27.539  41.134 1.00 34.72  ?  105 GLY C HA3  1 
ATOM   4070 N N    . ASP C 1 61  ? 29.768  28.042  38.716 1.00 29.91  ?  106 ASP C N    1 
ATOM   4071 C CA   . ASP C 1 61  ? 31.085  28.069  38.096 1.00 30.23  ?  106 ASP C CA   1 
ATOM   4072 C C    . ASP C 1 61  ? 31.267  29.263  37.167 1.00 31.68  ?  106 ASP C C    1 
ATOM   4073 O O    . ASP C 1 61  ? 32.297  29.362  36.491 1.00 31.87  ?  106 ASP C O    1 
ATOM   4074 C CB   . ASP C 1 61  ? 31.327  26.762  37.339 1.00 33.47  ?  106 ASP C CB   1 
ATOM   4075 C CG   . ASP C 1 61  ? 31.287  25.548  38.252 1.00 40.24  ?  106 ASP C CG   1 
ATOM   4076 O OD1  . ASP C 1 61  ? 31.812  25.636  39.383 1.00 42.11  ?  106 ASP C OD1  1 
ATOM   4077 O OD2  . ASP C 1 61  ? 30.723  24.510  37.845 1.00 41.33  -1 106 ASP C OD2  1 
ATOM   4078 H H    . ASP C 1 61  ? 29.141  27.803  38.179 1.00 35.89  ?  106 ASP C H    1 
ATOM   4079 H HA   . ASP C 1 61  ? 31.756  28.135  38.794 1.00 36.28  ?  106 ASP C HA   1 
ATOM   4080 H HB2  . ASP C 1 61  ? 30.639  26.654  36.665 1.00 40.16  ?  106 ASP C HB2  1 
ATOM   4081 H HB3  . ASP C 1 61  ? 32.201  26.795  36.921 1.00 40.16  ?  106 ASP C HB3  1 
ATOM   4082 N N    . LEU C 1 62  ? 30.295  30.169  37.113 1.00 30.09  ?  107 LEU C N    1 
ATOM   4083 C CA   . LEU C 1 62  ? 30.451  31.386  36.331 1.00 30.53  ?  107 LEU C CA   1 
ATOM   4084 C C    . LEU C 1 62  ? 31.382  32.359  37.043 1.00 29.35  ?  107 LEU C C    1 
ATOM   4085 O O    . LEU C 1 62  ? 31.457  32.396  38.275 1.00 30.34  ?  107 LEU C O    1 
ATOM   4086 C CB   . LEU C 1 62  ? 29.094  32.050  36.094 1.00 29.87  ?  107 LEU C CB   1 
ATOM   4087 C CG   . LEU C 1 62  ? 28.170  31.392  35.070 1.00 29.89  ?  107 LEU C CG   1 
ATOM   4088 C CD1  . LEU C 1 62  ? 26.797  32.035  35.135 1.00 28.21  ?  107 LEU C CD1  1 
ATOM   4089 C CD2  . LEU C 1 62  ? 28.746  31.500  33.664 1.00 29.55  ?  107 LEU C CD2  1 
ATOM   4090 H H    . LEU C 1 62  ? 29.540  30.102  37.519 1.00 36.11  ?  107 LEU C H    1 
ATOM   4091 H HA   . LEU C 1 62  ? 30.839  31.166  35.470 1.00 36.63  ?  107 LEU C HA   1 
ATOM   4092 H HB2  . LEU C 1 62  ? 28.617  32.071  36.938 1.00 35.84  ?  107 LEU C HB2  1 
ATOM   4093 H HB3  . LEU C 1 62  ? 29.252  32.959  35.794 1.00 35.84  ?  107 LEU C HB3  1 
ATOM   4094 H HG   . LEU C 1 62  ? 28.073  30.451  35.286 1.00 35.87  ?  107 LEU C HG   1 
ATOM   4095 H HD11 . LEU C 1 62  ? 26.219  31.610  34.482 1.00 33.85  ?  107 LEU C HD11 1 
ATOM   4096 H HD12 . LEU C 1 62  ? 26.434  31.914  36.026 1.00 33.85  ?  107 LEU C HD12 1 
ATOM   4097 H HD13 . LEU C 1 62  ? 26.882  32.980  34.936 1.00 33.85  ?  107 LEU C HD13 1 
ATOM   4098 H HD21 . LEU C 1 62  ? 28.137  31.074  33.040 1.00 35.46  ?  107 LEU C HD21 1 
ATOM   4099 H HD22 . LEU C 1 62  ? 28.850  32.437  33.437 1.00 35.46  ?  107 LEU C HD22 1 
ATOM   4100 H HD23 . LEU C 1 62  ? 29.608  31.056  33.641 1.00 35.46  ?  107 LEU C HD23 1 
ATOM   4101 N N    . THR C 1 63  ? 32.092  33.157  36.252 1.00 32.59  ?  108 THR C N    1 
ATOM   4102 C CA   . THR C 1 63  ? 33.024  34.145  36.777 1.00 34.60  ?  108 THR C CA   1 
ATOM   4103 C C    . THR C 1 63  ? 32.396  35.532  36.751 1.00 36.44  ?  108 THR C C    1 
ATOM   4104 O O    . THR C 1 63  ? 31.752  35.917  35.770 1.00 34.58  ?  108 THR C O    1 
ATOM   4105 C CB   . THR C 1 63  ? 34.326  34.163  35.969 1.00 29.37  ?  108 THR C CB   1 
ATOM   4106 O OG1  . THR C 1 63  ? 34.064  34.624  34.637 1.00 29.18  ?  108 THR C OG1  1 
ATOM   4107 C CG2  . THR C 1 63  ? 34.946  32.780  35.912 1.00 26.20  ?  108 THR C CG2  1 
ATOM   4108 H H    . THR C 1 63  ? 32.050  33.144  35.393 1.00 39.11  ?  108 THR C H    1 
ATOM   4109 H HA   . THR C 1 63  ? 33.239  33.925  37.696 1.00 41.52  ?  108 THR C HA   1 
ATOM   4110 H HB   . THR C 1 63  ? 34.959  34.762  36.396 1.00 35.25  ?  108 THR C HB   1 
ATOM   4111 H HG1  . THR C 1 63  ? 33.515  34.113  34.259 1.00 35.02  ?  108 THR C HG1  1 
ATOM   4112 H HG21 . THR C 1 63  ? 35.769  32.806  35.399 1.00 31.44  ?  108 THR C HG21 1 
ATOM   4113 H HG22 . THR C 1 63  ? 35.144  32.468  36.810 1.00 31.44  ?  108 THR C HG22 1 
ATOM   4114 H HG23 . THR C 1 63  ? 34.332  32.158  35.491 1.00 31.44  ?  108 THR C HG23 1 
ATOM   4115 N N    . GLY C 1 64  ? 32.579  36.271  37.844 1.00 36.32  ?  109 GLY C N    1 
ATOM   4116 C CA   . GLY C 1 64  ? 32.274  37.689  37.852 1.00 37.46  ?  109 GLY C CA   1 
ATOM   4117 C C    . GLY C 1 64  ? 30.793  38.001  37.991 1.00 33.01  ?  109 GLY C C    1 
ATOM   4118 O O    . GLY C 1 64  ? 30.028  37.287  38.641 1.00 37.50  ?  109 GLY C O    1 
ATOM   4119 H H    . GLY C 1 64  ? 32.878  35.970  38.592 1.00 43.58  ?  109 GLY C H    1 
ATOM   4120 H HA2  . GLY C 1 64  ? 32.743  38.111  38.589 1.00 44.96  ?  109 GLY C HA2  1 
ATOM   4121 H HA3  . GLY C 1 64  ? 32.590  38.087  37.025 1.00 44.96  ?  109 GLY C HA3  1 
ATOM   4122 N N    . HIS C 1 65  ? 30.397  39.106  37.361 1.00 32.84  ?  110 HIS C N    1 
ATOM   4123 C CA   . HIS C 1 65  ? 29.042  39.647  37.467 1.00 33.28  ?  110 HIS C CA   1 
ATOM   4124 C C    . HIS C 1 65  ? 28.201  39.101  36.311 1.00 30.14  ?  110 HIS C C    1 
ATOM   4125 O O    . HIS C 1 65  ? 27.873  39.793  35.346 1.00 29.13  ?  110 HIS C O    1 
ATOM   4126 C CB   . HIS C 1 65  ? 29.097  41.170  37.465 1.00 38.09  ?  110 HIS C CB   1 
ATOM   4127 C CG   . HIS C 1 65  ? 27.841  41.832  37.937 1.00 38.84  ?  110 HIS C CG   1 
ATOM   4128 N ND1  . HIS C 1 65  ? 26.785  42.113  37.098 1.00 42.12  ?  110 HIS C ND1  1 
ATOM   4129 C CD2  . HIS C 1 65  ? 27.480  42.287  39.160 1.00 38.36  ?  110 HIS C CD2  1 
ATOM   4130 C CE1  . HIS C 1 65  ? 25.824  42.705  37.784 1.00 41.50  ?  110 HIS C CE1  1 
ATOM   4131 N NE2  . HIS C 1 65  ? 26.221  42.822  39.039 1.00 42.88  ?  110 HIS C NE2  1 
ATOM   4132 H H    . HIS C 1 65  ? 30.910  39.572  36.851 1.00 39.40  ?  110 HIS C H    1 
ATOM   4133 H HA   . HIS C 1 65  ? 28.642  39.355  38.301 1.00 39.93  ?  110 HIS C HA   1 
ATOM   4134 H HB2  . HIS C 1 65  ? 29.818  41.456  38.048 1.00 45.71  ?  110 HIS C HB2  1 
ATOM   4135 H HB3  . HIS C 1 65  ? 29.268  41.474  36.560 1.00 45.71  ?  110 HIS C HB3  1 
ATOM   4136 H HD2  . HIS C 1 65  ? 27.988  42.242  39.938 1.00 46.03  ?  110 HIS C HD2  1 
ATOM   4137 H HE1  . HIS C 1 65  ? 25.007  42.990  37.443 1.00 49.80  ?  110 HIS C HE1  1 
ATOM   4138 H HE2  . HIS C 1 65  ? 25.765  43.175  39.676 1.00 51.45  ?  110 HIS C HE2  1 
ATOM   4139 N N    . SER C 1 66  ? 27.862  37.817  36.426 1.00 28.24  ?  111 SER C N    1 
ATOM   4140 C CA   . SER C 1 66  ? 27.271  37.061  35.332 1.00 23.43  ?  111 SER C CA   1 
ATOM   4141 C C    . SER C 1 66  ? 25.872  36.591  35.699 1.00 22.12  ?  111 SER C C    1 
ATOM   4142 O O    . SER C 1 66  ? 25.577  36.310  36.864 1.00 22.28  ?  111 SER C O    1 
ATOM   4143 C CB   . SER C 1 66  ? 28.136  35.848  34.973 1.00 29.63  ?  111 SER C CB   1 
ATOM   4144 O OG   . SER C 1 66  ? 29.463  36.243  34.683 1.00 33.78  ?  111 SER C OG   1 
ATOM   4145 H H    . SER C 1 66  ? 27.969  37.356  37.144 1.00 33.88  ?  111 SER C H    1 
ATOM   4146 H HA   . SER C 1 66  ? 27.205  37.629  34.549 1.00 28.12  ?  111 SER C HA   1 
ATOM   4147 H HB2  . SER C 1 66  ? 28.146  35.235  35.725 1.00 35.55  ?  111 SER C HB2  1 
ATOM   4148 H HB3  . SER C 1 66  ? 27.758  35.411  34.194 1.00 35.55  ?  111 SER C HB3  1 
ATOM   4149 H HG   . SER C 1 66  ? 29.802  36.624  35.350 1.00 40.54  ?  111 SER C HG   1 
ATOM   4150 N N    . ASP C 1 67  ? 25.012  36.505  34.688 1.00 20.47  ?  112 ASP C N    1 
ATOM   4151 C CA   . ASP C 1 67  ? 23.650  36.029  34.863 1.00 16.98  ?  112 ASP C CA   1 
ATOM   4152 C C    . ASP C 1 67  ? 23.307  35.023  33.773 1.00 17.30  ?  112 ASP C C    1 
ATOM   4153 O O    . ASP C 1 67  ? 23.773  35.129  32.637 1.00 15.11  ?  112 ASP C O    1 
ATOM   4154 C CB   . ASP C 1 67  ? 22.622  37.174  34.809 1.00 18.11  ?  112 ASP C CB   1 
ATOM   4155 C CG   . ASP C 1 67  ? 22.804  38.195  35.922 1.00 24.86  ?  112 ASP C CG   1 
ATOM   4156 O OD1  . ASP C 1 67  ? 23.906  38.279  36.499 1.00 29.64  -1 112 ASP C OD1  1 
ATOM   4157 O OD2  . ASP C 1 67  ? 21.834  38.924  36.214 1.00 27.46  -1 112 ASP C OD2  1 
ATOM   4158 H H    . ASP C 1 67  ? 25.201  36.721  33.878 1.00 24.57  ?  112 ASP C H    1 
ATOM   4159 H HA   . ASP C 1 67  ? 23.570  35.588  35.723 1.00 20.38  ?  112 ASP C HA   1 
ATOM   4160 H HB2  . ASP C 1 67  ? 22.712  37.638  33.961 1.00 21.73  ?  112 ASP C HB2  1 
ATOM   4161 H HB3  . ASP C 1 67  ? 21.731  36.801  34.888 1.00 21.73  ?  112 ASP C HB3  1 
ATOM   4162 N N    . PHE C 1 68  ? 22.483  34.045  34.134 1.00 15.17  ?  113 PHE C N    1 
ATOM   4163 C CA   . PHE C 1 68  ? 21.773  33.219  33.171 1.00 13.98  ?  113 PHE C CA   1 
ATOM   4164 C C    . PHE C 1 68  ? 20.299  33.596  33.214 1.00 12.41  ?  113 PHE C C    1 
ATOM   4165 O O    . PHE C 1 68  ? 19.765  33.926  34.277 1.00 12.84  ?  113 PHE C O    1 
ATOM   4166 C CB   . PHE C 1 68  ? 21.919  31.721  33.471 1.00 14.43  ?  113 PHE C CB   1 
ATOM   4167 C CG   . PHE C 1 68  ? 23.238  31.112  33.051 1.00 19.78  ?  113 PHE C CG   1 
ATOM   4168 C CD1  . PHE C 1 68  ? 23.963  31.617  31.984 1.00 21.83  ?  113 PHE C CD1  1 
ATOM   4169 C CD2  . PHE C 1 68  ? 23.737  30.006  33.726 1.00 20.26  ?  113 PHE C CD2  1 
ATOM   4170 C CE1  . PHE C 1 68  ? 25.166  31.037  31.607 1.00 25.12  ?  113 PHE C CE1  1 
ATOM   4171 C CE2  . PHE C 1 68  ? 24.936  29.423  33.354 1.00 23.95  ?  113 PHE C CE2  1 
ATOM   4172 C CZ   . PHE C 1 68  ? 25.650  29.940  32.294 1.00 24.72  ?  113 PHE C CZ   1 
ATOM   4173 H H    . PHE C 1 68  ? 22.316  33.838  34.952 1.00 18.20  ?  113 PHE C H    1 
ATOM   4174 H HA   . PHE C 1 68  ? 22.112  33.392  32.279 1.00 16.77  ?  113 PHE C HA   1 
ATOM   4175 H HB2  . PHE C 1 68  ? 21.827  31.587  34.428 1.00 17.32  ?  113 PHE C HB2  1 
ATOM   4176 H HB3  . PHE C 1 68  ? 21.215  31.242  33.007 1.00 17.32  ?  113 PHE C HB3  1 
ATOM   4177 H HD1  . PHE C 1 68  ? 23.643  32.355  31.518 1.00 26.19  ?  113 PHE C HD1  1 
ATOM   4178 H HD2  . PHE C 1 68  ? 23.259  29.653  34.442 1.00 24.31  ?  113 PHE C HD2  1 
ATOM   4179 H HE1  . PHE C 1 68  ? 25.646  31.387  30.892 1.00 30.15  ?  113 PHE C HE1  1 
ATOM   4180 H HE2  . PHE C 1 68  ? 25.260  28.685  33.818 1.00 28.74  ?  113 PHE C HE2  1 
ATOM   4181 H HZ   . PHE C 1 68  ? 26.457  29.552  32.042 1.00 29.67  ?  113 PHE C HZ   1 
ATOM   4182 N N    . HIS C 1 69  ? 19.650  33.555  32.060 1.00 12.82  ?  114 HIS C N    1 
ATOM   4183 C CA   . HIS C 1 69  ? 18.226  33.822  31.972 1.00 13.60  ?  114 HIS C CA   1 
ATOM   4184 C C    . HIS C 1 69  ? 17.577  32.734  31.137 1.00 14.03  ?  114 HIS C C    1 
ATOM   4185 O O    . HIS C 1 69  ? 18.119  32.320  30.110 1.00 16.50  ?  114 HIS C O    1 
ATOM   4186 C CB   . HIS C 1 69  ? 17.930  35.191  31.347 1.00 14.63  ?  114 HIS C CB   1 
ATOM   4187 C CG   . HIS C 1 69  ? 18.919  36.255  31.707 1.00 15.44  ?  114 HIS C CG   1 
ATOM   4188 N ND1  . HIS C 1 69  ? 18.584  37.349  32.476 1.00 19.03  ?  114 HIS C ND1  1 
ATOM   4189 C CD2  . HIS C 1 69  ? 20.226  36.409  31.385 1.00 15.78  ?  114 HIS C CD2  1 
ATOM   4190 C CE1  . HIS C 1 69  ? 19.644  38.123  32.624 1.00 17.14  ?  114 HIS C CE1  1 
ATOM   4191 N NE2  . HIS C 1 69  ? 20.653  37.577  31.969 1.00 19.22  ?  114 HIS C NE2  1 
ATOM   4192 H H    . HIS C 1 69  ? 20.018  33.372  31.305 1.00 15.38  ?  114 HIS C H    1 
ATOM   4193 H HA   . HIS C 1 69  ? 17.837  33.800  32.861 1.00 16.32  ?  114 HIS C HA   1 
ATOM   4194 H HB2  . HIS C 1 69  ? 17.933  35.099  30.381 1.00 17.56  ?  114 HIS C HB2  1 
ATOM   4195 H HB3  . HIS C 1 69  ? 17.056  35.487  31.645 1.00 17.56  ?  114 HIS C HB3  1 
ATOM   4196 H HD1  . HIS C 1 69  ? 17.807  37.500  32.813 1.00 22.83  ?  114 HIS C HD1  1 
ATOM   4197 H HD2  . HIS C 1 69  ? 20.739  35.830  30.869 1.00 18.93  ?  114 HIS C HD2  1 
ATOM   4198 H HE1  . HIS C 1 69  ? 19.674  38.919  33.104 1.00 20.57  ?  114 HIS C HE1  1 
ATOM   4199 N N    . LEU C 1 70  ? 16.416  32.274  31.584 1.00 12.89  ?  115 LEU C N    1 
ATOM   4200 C CA   . LEU C 1 70  ? 15.613  31.330  30.819 1.00 11.65  ?  115 LEU C CA   1 
ATOM   4201 C C    . LEU C 1 70  ? 14.209  31.904  30.729 1.00 12.04  ?  115 LEU C C    1 
ATOM   4202 O O    . LEU C 1 70  ? 13.489  31.944  31.733 1.00 12.38  ?  115 LEU C O    1 
ATOM   4203 C CB   . LEU C 1 70  ? 15.611  29.943  31.463 1.00 13.60  ?  115 LEU C CB   1 
ATOM   4204 C CG   . LEU C 1 70  ? 14.889  28.854  30.669 1.00 13.38  ?  115 LEU C CG   1 
ATOM   4205 C CD1  . LEU C 1 70  ? 15.472  28.715  29.261 1.00 13.77  ?  115 LEU C CD1  1 
ATOM   4206 C CD2  . LEU C 1 70  ? 14.951  27.525  31.406 1.00 15.93  ?  115 LEU C CD2  1 
ATOM   4207 H H    . LEU C 1 70  ? 16.066  32.497  32.337 1.00 15.46  ?  115 LEU C H    1 
ATOM   4208 H HA   . LEU C 1 70  ? 15.972  31.252  29.921 1.00 13.98  ?  115 LEU C HA   1 
ATOM   4209 H HB2  . LEU C 1 70  ? 16.530  29.657  31.581 1.00 16.32  ?  115 LEU C HB2  1 
ATOM   4210 H HB3  . LEU C 1 70  ? 15.178  30.007  32.329 1.00 16.32  ?  115 LEU C HB3  1 
ATOM   4211 H HG   . LEU C 1 70  ? 13.955  29.100  30.580 1.00 16.06  ?  115 LEU C HG   1 
ATOM   4212 H HD11 . LEU C 1 70  ? 14.991  28.018  28.788 1.00 16.52  ?  115 LEU C HD11 1 
ATOM   4213 H HD12 . LEU C 1 70  ? 15.374  29.560  28.795 1.00 16.52  ?  115 LEU C HD12 1 
ATOM   4214 H HD13 . LEU C 1 70  ? 16.411  28.482  29.330 1.00 16.52  ?  115 LEU C HD13 1 
ATOM   4215 H HD21 . LEU C 1 70  ? 14.488  26.852  30.883 1.00 19.12  ?  115 LEU C HD21 1 
ATOM   4216 H HD22 . LEU C 1 70  ? 15.880  27.271  31.523 1.00 19.12  ?  115 LEU C HD22 1 
ATOM   4217 H HD23 . LEU C 1 70  ? 14.524  27.624  32.272 1.00 19.12  ?  115 LEU C HD23 1 
ATOM   4218 N N    . PHE C 1 71  ? 13.832  32.352  29.534 1.00 11.79  ?  116 PHE C N    1 
ATOM   4219 C CA   . PHE C 1 71  ? 12.569  33.037  29.314 1.00 12.89  ?  116 PHE C CA   1 
ATOM   4220 C C    . PHE C 1 71  ? 11.808  32.404  28.162 1.00 11.59  ?  116 PHE C C    1 
ATOM   4221 O O    . PHE C 1 71  ? 12.402  31.893  27.208 1.00 13.54  ?  116 PHE C O    1 
ATOM   4222 C CB   . PHE C 1 71  ? 12.799  34.526  29.025 1.00 13.96  ?  116 PHE C CB   1 
ATOM   4223 C CG   . PHE C 1 71  ? 12.919  35.358  30.258 1.00 15.10  ?  116 PHE C CG   1 
ATOM   4224 C CD1  . PHE C 1 71  ? 13.975  35.169  31.135 1.00 13.17  ?  116 PHE C CD1  1 
ATOM   4225 C CD2  . PHE C 1 71  ? 11.965  36.316  30.558 1.00 14.21  ?  116 PHE C CD2  1 
ATOM   4226 C CE1  . PHE C 1 71  ? 14.076  35.927  32.286 1.00 16.27  ?  116 PHE C CE1  1 
ATOM   4227 C CE2  . PHE C 1 71  ? 12.063  37.076  31.707 1.00 12.18  ?  116 PHE C CE2  1 
ATOM   4228 C CZ   . PHE C 1 71  ? 13.118  36.885  32.570 1.00 13.42  ?  116 PHE C CZ   1 
ATOM   4229 H H    . PHE C 1 71  ? 14.304  32.266  28.821 1.00 14.15  ?  116 PHE C H    1 
ATOM   4230 H HA   . PHE C 1 71  ? 12.024  32.965  30.113 1.00 15.47  ?  116 PHE C HA   1 
ATOM   4231 H HB2  . PHE C 1 71  ? 13.621  34.624  28.519 1.00 16.75  ?  116 PHE C HB2  1 
ATOM   4232 H HB3  . PHE C 1 71  ? 12.052  34.865  28.508 1.00 16.75  ?  116 PHE C HB3  1 
ATOM   4233 H HD1  . PHE C 1 71  ? 14.620  34.525  30.949 1.00 15.81  ?  116 PHE C HD1  1 
ATOM   4234 H HD2  . PHE C 1 71  ? 11.249  36.448  29.979 1.00 17.06  ?  116 PHE C HD2  1 
ATOM   4235 H HE1  . PHE C 1 71  ? 14.791  35.797  32.867 1.00 19.53  ?  116 PHE C HE1  1 
ATOM   4236 H HE2  . PHE C 1 71  ? 11.419  37.720  31.895 1.00 14.62  ?  116 PHE C HE2  1 
ATOM   4237 H HZ   . PHE C 1 71  ? 13.187  37.398  33.342 1.00 16.10  ?  116 PHE C HZ   1 
ATOM   4238 N N    . LYS C 1 72  ? 10.481  32.448  28.260 1.00 12.50  ?  117 LYS C N    1 
ATOM   4239 C CA   . LYS C 1 72  ? 9.639   32.031  27.149 1.00 14.30  ?  117 LYS C CA   1 
ATOM   4240 C C    . LYS C 1 72  ? 10.106  32.700  25.866 1.00 14.33  ?  117 LYS C C    1 
ATOM   4241 O O    . LYS C 1 72  ? 10.464  33.883  25.861 1.00 17.06  ?  117 LYS C O    1 
ATOM   4242 C CB   . LYS C 1 72  ? 8.180   32.400  27.415 1.00 13.25  ?  117 LYS C CB   1 
ATOM   4243 C CG   . LYS C 1 72  ? 7.526   31.655  28.549 1.00 15.56  ?  117 LYS C CG   1 
ATOM   4244 C CD   . LYS C 1 72  ? 6.123   32.191  28.778 1.00 18.97  ?  117 LYS C CD   1 
ATOM   4245 C CE   . LYS C 1 72  ? 5.383   31.382  29.824 1.00 20.28  ?  117 LYS C CE   1 
ATOM   4246 N NZ   . LYS C 1 72  ? 4.025   31.937  30.091 1.00 18.71  1  117 LYS C NZ   1 
ATOM   4247 H H    . LYS C 1 72  ? 10.049  32.714  28.954 1.00 15.01  ?  117 LYS C H    1 
ATOM   4248 H HA   . LYS C 1 72  ? 9.700   31.069  27.037 1.00 17.16  ?  117 LYS C HA   1 
ATOM   4249 H HB2  . LYS C 1 72  ? 8.136   33.347  27.623 1.00 15.90  ?  117 LYS C HB2  1 
ATOM   4250 H HB3  . LYS C 1 72  ? 7.666   32.220  26.612 1.00 15.90  ?  117 LYS C HB3  1 
ATOM   4251 H HG2  . LYS C 1 72  ? 7.464   30.713  28.326 1.00 18.67  ?  117 LYS C HG2  1 
ATOM   4252 H HG3  . LYS C 1 72  ? 8.041   31.781  29.361 1.00 18.67  ?  117 LYS C HG3  1 
ATOM   4253 H HD2  . LYS C 1 72  ? 6.177   33.109  29.086 1.00 22.77  ?  117 LYS C HD2  1 
ATOM   4254 H HD3  . LYS C 1 72  ? 5.623   32.144  27.948 1.00 22.77  ?  117 LYS C HD3  1 
ATOM   4255 H HE2  . LYS C 1 72  ? 5.281   30.470  29.510 1.00 24.34  ?  117 LYS C HE2  1 
ATOM   4256 H HE3  . LYS C 1 72  ? 5.885   31.397  30.654 1.00 24.34  ?  117 LYS C HE3  1 
ATOM   4257 H HZ1  . LYS C 1 72  ? 3.612   31.447  30.707 1.00 22.45  ?  117 LYS C HZ1  1 
ATOM   4258 H HZ2  . LYS C 1 72  ? 4.092   32.775  30.384 1.00 22.45  ?  117 LYS C HZ2  1 
ATOM   4259 H HZ3  . LYS C 1 72  ? 3.542   31.931  29.343 1.00 22.45  ?  117 LYS C HZ3  1 
ATOM   4260 N N    . GLU C 1 73  ? 10.090  31.943  24.770 1.00 14.08  ?  118 GLU C N    1 
ATOM   4261 C CA   . GLU C 1 73  ? 10.480  32.505  23.483 1.00 18.70  ?  118 GLU C CA   1 
ATOM   4262 C C    . GLU C 1 73  ? 9.640   33.738  23.182 1.00 19.63  ?  118 GLU C C    1 
ATOM   4263 O O    . GLU C 1 73  ? 8.415   33.728  23.346 1.00 17.55  ?  118 GLU C O    1 
ATOM   4264 C CB   . GLU C 1 73  ? 10.316  31.475  22.365 1.00 19.64  ?  118 GLU C CB   1 
ATOM   4265 C CG   . GLU C 1 73  ? 10.844  31.968  21.025 1.00 22.21  ?  118 GLU C CG   1 
ATOM   4266 C CD   . GLU C 1 73  ? 10.674  30.960  19.906 1.00 27.73  ?  118 GLU C CD   1 
ATOM   4267 O OE1  . GLU C 1 73  ? 11.449  31.033  18.927 1.00 30.49  ?  118 GLU C OE1  1 
ATOM   4268 O OE2  . GLU C 1 73  ? 9.768   30.102  19.998 1.00 25.66  -1 118 GLU C OE2  1 
ATOM   4269 H H    . GLU C 1 73  ? 9.860   31.114  24.746 1.00 16.90  ?  118 GLU C H    1 
ATOM   4270 H HA   . GLU C 1 73  ? 11.412  32.771  23.519 1.00 22.44  ?  118 GLU C HA   1 
ATOM   4271 H HB2  . GLU C 1 73  ? 10.805  30.671  22.603 1.00 23.57  ?  118 GLU C HB2  1 
ATOM   4272 H HB3  . GLU C 1 73  ? 9.374   31.270  22.260 1.00 23.57  ?  118 GLU C HB3  1 
ATOM   4273 H HG2  . GLU C 1 73  ? 10.365  32.774  20.776 1.00 26.65  ?  118 GLU C HG2  1 
ATOM   4274 H HG3  . GLU C 1 73  ? 11.791  32.160  21.112 1.00 26.65  ?  118 GLU C HG3  1 
ATOM   4275 N N    . GLY C 1 74  ? 10.302  34.803  22.744 1.00 19.40  ?  119 GLY C N    1 
ATOM   4276 C CA   . GLY C 1 74  ? 9.638   36.050  22.441 1.00 23.19  ?  119 GLY C CA   1 
ATOM   4277 C C    . GLY C 1 74  ? 9.659   37.064  23.563 1.00 23.34  ?  119 GLY C C    1 
ATOM   4278 O O    . GLY C 1 74  ? 9.324   38.230  23.321 1.00 23.70  ?  119 GLY C O    1 
ATOM   4279 H H    . GLY C 1 74  ? 11.152  34.822  22.613 1.00 23.28  ?  119 GLY C H    1 
ATOM   4280 H HA2  . GLY C 1 74  ? 10.060  36.452  21.666 1.00 27.83  ?  119 GLY C HA2  1 
ATOM   4281 H HA3  . GLY C 1 74  ? 8.712   35.868  22.220 1.00 27.83  ?  119 GLY C HA3  1 
ATOM   4282 N N    . ILE C 1 75  ? 10.030  36.661  24.777 1.00 21.04  ?  120 ILE C N    1 
ATOM   4283 C CA   . ILE C 1 75  ? 10.149  37.574  25.910 1.00 20.06  ?  120 ILE C CA   1 
ATOM   4284 C C    . ILE C 1 75  ? 11.626  37.800  26.174 1.00 21.76  ?  120 ILE C C    1 
ATOM   4285 O O    . ILE C 1 75  ? 12.349  36.866  26.545 1.00 17.57  ?  120 ILE C O    1 
ATOM   4286 C CB   . ILE C 1 75  ? 9.453   37.037  27.169 1.00 21.35  ?  120 ILE C CB   1 
ATOM   4287 C CG1  . ILE C 1 75  ? 7.991   36.708  26.866 1.00 19.61  ?  120 ILE C CG1  1 
ATOM   4288 C CG2  . ILE C 1 75  ? 9.569   38.071  28.307 1.00 17.28  ?  120 ILE C CG2  1 
ATOM   4289 C CD1  . ILE C 1 75  ? 7.216   36.187  28.054 1.00 17.59  ?  120 ILE C CD1  1 
ATOM   4290 H H    . ILE C 1 75  ? 10.221  35.846  24.973 1.00 25.24  ?  120 ILE C H    1 
ATOM   4291 H HA   . ILE C 1 75  ? 9.746   38.426  25.679 1.00 24.07  ?  120 ILE C HA   1 
ATOM   4292 H HB   . ILE C 1 75  ? 9.902   36.222  27.445 1.00 25.62  ?  120 ILE C HB   1 
ATOM   4293 H HG12 . ILE C 1 75  ? 7.549   37.513  26.555 1.00 23.53  ?  120 ILE C HG12 1 
ATOM   4294 H HG13 . ILE C 1 75  ? 7.962   36.030  26.174 1.00 23.53  ?  120 ILE C HG13 1 
ATOM   4295 H HG21 . ILE C 1 75  ? 9.127   37.721  29.097 1.00 20.74  ?  120 ILE C HG21 1 
ATOM   4296 H HG22 . ILE C 1 75  ? 10.507  38.229  28.496 1.00 20.74  ?  120 ILE C HG22 1 
ATOM   4297 H HG23 . ILE C 1 75  ? 9.143   38.896  28.028 1.00 20.74  ?  120 ILE C HG23 1 
ATOM   4298 H HD11 . ILE C 1 75  ? 6.304   36.004  27.780 1.00 21.11  ?  120 ILE C HD11 1 
ATOM   4299 H HD12 . ILE C 1 75  ? 7.636   35.372  28.372 1.00 21.11  ?  120 ILE C HD12 1 
ATOM   4300 H HD13 . ILE C 1 75  ? 7.223   36.858  28.754 1.00 21.11  ?  120 ILE C HD13 1 
ATOM   4301 N N    . LYS C 1 76  ? 12.068  39.031  25.994 1.00 19.75  ?  121 LYS C N    1 
ATOM   4302 C CA   . LYS C 1 76  ? 13.429  39.372  26.356 1.00 19.77  ?  121 LYS C CA   1 
ATOM   4303 C C    . LYS C 1 76  ? 13.531  39.567  27.868 1.00 17.09  ?  121 LYS C C    1 
ATOM   4304 O O    . LYS C 1 76  ? 12.587  40.043  28.504 1.00 19.00  ?  121 LYS C O    1 
ATOM   4305 C CB   . LYS C 1 76  ? 13.866  40.639  25.631 1.00 25.45  ?  121 LYS C CB   1 
ATOM   4306 C CG   . LYS C 1 76  ? 13.890  40.489  24.115 1.00 26.99  ?  121 LYS C CG   1 
ATOM   4307 C CD   . LYS C 1 76  ? 14.300  41.787  23.436 1.00 32.71  ?  121 LYS C CD   1 
ATOM   4308 C CE   . LYS C 1 76  ? 14.401  41.631  21.924 1.00 46.98  ?  121 LYS C CE   1 
ATOM   4309 N NZ   . LYS C 1 76  ? 13.083  41.348  21.288 1.00 49.37  1  121 LYS C NZ   1 
ATOM   4310 H H    . LYS C 1 76  ? 11.607  39.680  25.669 1.00 23.70  ?  121 LYS C H    1 
ATOM   4311 H HA   . LYS C 1 76  ? 14.023  38.650  26.098 1.00 23.73  ?  121 LYS C HA   1 
ATOM   4312 H HB2  . LYS C 1 76  ? 13.249  41.355  25.850 1.00 30.55  ?  121 LYS C HB2  1 
ATOM   4313 H HB3  . LYS C 1 76  ? 14.761  40.874  25.922 1.00 30.55  ?  121 LYS C HB3  1 
ATOM   4314 H HG2  . LYS C 1 76  ? 14.530  39.802  23.871 1.00 32.39  ?  121 LYS C HG2  1 
ATOM   4315 H HG3  . LYS C 1 76  ? 13.004  40.249  23.802 1.00 32.39  ?  121 LYS C HG3  1 
ATOM   4316 H HD2  . LYS C 1 76  ? 13.638  42.470  23.627 1.00 39.25  ?  121 LYS C HD2  1 
ATOM   4317 H HD3  . LYS C 1 76  ? 15.169  42.061  23.771 1.00 39.25  ?  121 LYS C HD3  1 
ATOM   4318 H HE2  . LYS C 1 76  ? 14.748  42.453  21.543 1.00 56.38  ?  121 LYS C HE2  1 
ATOM   4319 H HE3  . LYS C 1 76  ? 14.997  40.893  21.721 1.00 56.38  ?  121 LYS C HE3  1 
ATOM   4320 H HZ1  . LYS C 1 76  ? 12.743  40.593  21.615 1.00 59.25  ?  121 LYS C HZ1  1 
ATOM   4321 H HZ2  . LYS C 1 76  ? 12.517  42.015  21.452 1.00 59.25  ?  121 LYS C HZ2  1 
ATOM   4322 H HZ3  . LYS C 1 76  ? 13.182  41.264  20.408 1.00 59.25  ?  121 LYS C HZ3  1 
ATOM   4323 N N    . PRO C 1 77  ? 14.693  39.181  28.491 1.00 15.81  ?  122 PRO C N    1 
ATOM   4324 C CA   . PRO C 1 77  ? 14.837  39.300  29.953 1.00 18.36  ?  122 PRO C CA   1 
ATOM   4325 C C    . PRO C 1 77  ? 15.148  40.730  30.387 1.00 18.48  ?  122 PRO C C    1 
ATOM   4326 O O    . PRO C 1 77  ? 16.155  41.012  31.042 1.00 17.17  ?  122 PRO C O    1 
ATOM   4327 C CB   . PRO C 1 77  ? 15.978  38.318  30.249 1.00 15.71  ?  122 PRO C CB   1 
ATOM   4328 C CG   . PRO C 1 77  ? 16.807  38.326  29.022 1.00 19.54  ?  122 PRO C CG   1 
ATOM   4329 C CD   . PRO C 1 77  ? 15.877  38.568  27.865 1.00 18.01  ?  122 PRO C CD   1 
ATOM   4330 H HA   . PRO C 1 77  ? 14.029  38.997  30.397 1.00 22.03  ?  122 PRO C HA   1 
ATOM   4331 H HB2  . PRO C 1 77  ? 16.489  38.630  31.012 1.00 18.85  ?  122 PRO C HB2  1 
ATOM   4332 H HB3  . PRO C 1 77  ? 15.615  37.434  30.414 1.00 18.85  ?  122 PRO C HB3  1 
ATOM   4333 H HG2  . PRO C 1 77  ? 17.463  39.038  29.082 1.00 23.45  ?  122 PRO C HG2  1 
ATOM   4334 H HG3  . PRO C 1 77  ? 17.248  37.467  28.927 1.00 23.45  ?  122 PRO C HG3  1 
ATOM   4335 H HD2  . PRO C 1 77  ? 16.280  39.183  27.232 1.00 21.61  ?  122 PRO C HD2  1 
ATOM   4336 H HD3  . PRO C 1 77  ? 15.638  37.729  27.443 1.00 21.61  ?  122 PRO C HD3  1 
ATOM   4337 N N    . MET C 1 78  ? 14.266  41.649  30.006 1.00 19.61  ?  123 MET C N    1 
ATOM   4338 C CA   . MET C 1 78  ? 14.411  43.069  30.295 1.00 20.97  ?  123 MET C CA   1 
ATOM   4339 C C    . MET C 1 78  ? 13.049  43.612  30.689 1.00 20.54  ?  123 MET C C    1 
ATOM   4340 O O    . MET C 1 78  ? 12.027  43.186  30.143 1.00 17.84  ?  123 MET C O    1 
ATOM   4341 C CB   . MET C 1 78  ? 14.937  43.852  29.083 1.00 24.80  ?  123 MET C CB   1 
ATOM   4342 C CG   . MET C 1 78  ? 16.167  43.265  28.421 1.00 28.32  ?  123 MET C CG   1 
ATOM   4343 S SD   . MET C 1 78  ? 16.440  43.964  26.781 1.00 42.16  ?  123 MET C SD   1 
ATOM   4344 C CE   . MET C 1 78  ? 16.734  45.685  27.182 1.00 42.84  ?  123 MET C CE   1 
ATOM   4345 H H    . MET C 1 78  ? 13.551  41.466  29.564 1.00 23.53  ?  123 MET C H    1 
ATOM   4346 H HA   . MET C 1 78  ? 15.032  43.187  31.031 1.00 25.17  ?  123 MET C HA   1 
ATOM   4347 H HB2  . MET C 1 78  ? 14.236  43.891  28.413 1.00 29.76  ?  123 MET C HB2  1 
ATOM   4348 H HB3  . MET C 1 78  ? 15.161  44.751  29.371 1.00 29.76  ?  123 MET C HB3  1 
ATOM   4349 H HG2  . MET C 1 78  ? 16.946  43.457  28.967 1.00 33.98  ?  123 MET C HG2  1 
ATOM   4350 H HG3  . MET C 1 78  ? 16.052  42.306  28.327 1.00 33.98  ?  123 MET C HG3  1 
ATOM   4351 H HE1  . MET C 1 78  ? 16.897  46.177  26.362 1.00 51.41  ?  123 MET C HE1  1 
ATOM   4352 H HE2  . MET C 1 78  ? 15.951  46.042  27.631 1.00 51.41  ?  123 MET C HE2  1 
ATOM   4353 H HE3  . MET C 1 78  ? 17.507  45.746  27.764 1.00 51.41  ?  123 MET C HE3  1 
ATOM   4354 N N    . TRP C 1 79  ? 13.033  44.558  31.632 1.00 23.02  ?  124 TRP C N    1 
ATOM   4355 C CA   . TRP C 1 79  ? 11.759  45.117  32.070 1.00 23.36  ?  124 TRP C CA   1 
ATOM   4356 C C    . TRP C 1 79  ? 11.051  45.839  30.933 1.00 23.76  ?  124 TRP C C    1 
ATOM   4357 O O    . TRP C 1 79  ? 9.817   45.901  30.914 1.00 25.50  ?  124 TRP C O    1 
ATOM   4358 C CB   . TRP C 1 79  ? 11.969  46.060  33.260 1.00 25.75  ?  124 TRP C CB   1 
ATOM   4359 C CG   . TRP C 1 79  ? 12.787  47.278  32.957 1.00 24.56  ?  124 TRP C CG   1 
ATOM   4360 C CD1  . TRP C 1 79  ? 14.138  47.409  33.076 1.00 27.00  ?  124 TRP C CD1  1 
ATOM   4361 C CD2  . TRP C 1 79  ? 12.302  48.544  32.492 1.00 26.45  ?  124 TRP C CD2  1 
ATOM   4362 N NE1  . TRP C 1 79  ? 14.526  48.678  32.718 1.00 30.61  ?  124 TRP C NE1  1 
ATOM   4363 C CE2  . TRP C 1 79  ? 13.416  49.393  32.353 1.00 27.09  ?  124 TRP C CE2  1 
ATOM   4364 C CE3  . TRP C 1 79  ? 11.033  49.039  32.179 1.00 29.73  ?  124 TRP C CE3  1 
ATOM   4365 C CZ2  . TRP C 1 79  ? 13.300  50.711  31.911 1.00 29.79  ?  124 TRP C CZ2  1 
ATOM   4366 C CZ3  . TRP C 1 79  ? 10.920  50.349  31.742 1.00 27.99  ?  124 TRP C CZ3  1 
ATOM   4367 C CH2  . TRP C 1 79  ? 12.047  51.168  31.612 1.00 28.00  ?  124 TRP C CH2  1 
ATOM   4368 H H    . TRP C 1 79  ? 13.727  44.883  32.022 1.00 27.63  ?  124 TRP C H    1 
ATOM   4369 H HA   . TRP C 1 79  ? 11.185  44.392  32.364 1.00 28.03  ?  124 TRP C HA   1 
ATOM   4370 H HB2  . TRP C 1 79  ? 11.102  46.360  33.574 1.00 30.90  ?  124 TRP C HB2  1 
ATOM   4371 H HB3  . TRP C 1 79  ? 12.421  45.572  33.966 1.00 30.90  ?  124 TRP C HB3  1 
ATOM   4372 H HD1  . TRP C 1 79  ? 14.714  46.738  33.366 1.00 32.40  ?  124 TRP C HD1  1 
ATOM   4373 H HE1  . TRP C 1 79  ? 15.333  48.973  32.718 1.00 36.74  ?  124 TRP C HE1  1 
ATOM   4374 H HE3  . TRP C 1 79  ? 10.279  48.501  32.263 1.00 35.68  ?  124 TRP C HE3  1 
ATOM   4375 H HZ2  . TRP C 1 79  ? 14.047  51.258  31.824 1.00 35.75  ?  124 TRP C HZ2  1 
ATOM   4376 H HZ3  . TRP C 1 79  ? 10.081  50.690  31.531 1.00 33.58  ?  124 TRP C HZ3  1 
ATOM   4377 H HH2  . TRP C 1 79  ? 11.941  52.043  31.317 1.00 33.60  ?  124 TRP C HH2  1 
ATOM   4378 N N    . GLU C 1 80  ? 11.809  46.368  29.967 1.00 24.81  ?  125 GLU C N    1 
ATOM   4379 C CA   . GLU C 1 80  ? 11.211  47.141  28.884 1.00 28.51  ?  125 GLU C CA   1 
ATOM   4380 C C    . GLU C 1 80  ? 10.322  46.285  27.990 1.00 27.57  ?  125 GLU C C    1 
ATOM   4381 O O    . GLU C 1 80  ? 9.399   46.811  27.357 1.00 26.25  ?  125 GLU C O    1 
ATOM   4382 C CB   . GLU C 1 80  ? 12.302  47.805  28.043 1.00 30.78  ?  125 GLU C CB   1 
ATOM   4383 C CG   . GLU C 1 80  ? 13.128  48.842  28.786 1.00 28.77  ?  125 GLU C CG   1 
ATOM   4384 C CD   . GLU C 1 80  ? 14.338  48.249  29.483 1.00 35.64  ?  125 GLU C CD   1 
ATOM   4385 O OE1  . GLU C 1 80  ? 14.336  47.031  29.769 1.00 27.37  ?  125 GLU C OE1  1 
ATOM   4386 O OE2  . GLU C 1 80  ? 15.297  49.008  29.742 1.00 36.85  -1 125 GLU C OE2  1 
ATOM   4387 H H    . GLU C 1 80  ? 12.664  46.292  29.919 1.00 29.77  ?  125 GLU C H    1 
ATOM   4388 H HA   . GLU C 1 80  ? 10.661  47.842  29.266 1.00 34.21  ?  125 GLU C HA   1 
ATOM   4389 H HB2  . GLU C 1 80  ? 12.909  47.118  27.725 1.00 36.94  ?  125 GLU C HB2  1 
ATOM   4390 H HB3  . GLU C 1 80  ? 11.885  48.247  27.287 1.00 36.94  ?  125 GLU C HB3  1 
ATOM   4391 H HG2  . GLU C 1 80  ? 13.443  49.506  28.153 1.00 34.52  ?  125 GLU C HG2  1 
ATOM   4392 H HG3  . GLU C 1 80  ? 12.571  49.264  29.459 1.00 34.52  ?  125 GLU C HG3  1 
ATOM   4393 N N    . ASP C 1 81  ? 10.588  44.982  27.908 1.00 23.81  ?  126 ASP C N    1 
ATOM   4394 C CA   . ASP C 1 81  ? 9.790   44.101  27.066 1.00 23.40  ?  126 ASP C CA   1 
ATOM   4395 C C    . ASP C 1 81  ? 8.313   44.215  27.422 1.00 22.60  ?  126 ASP C C    1 
ATOM   4396 O O    . ASP C 1 81  ? 7.940   44.225  28.598 1.00 21.47  ?  126 ASP C O    1 
ATOM   4397 C CB   . ASP C 1 81  ? 10.265  42.654  27.228 1.00 22.51  ?  126 ASP C CB   1 
ATOM   4398 C CG   . ASP C 1 81  ? 9.610   41.705  26.239 1.00 24.25  ?  126 ASP C CG   1 
ATOM   4399 O OD1  . ASP C 1 81  ? 8.444   41.318  26.467 1.00 24.30  -1 126 ASP C OD1  1 
ATOM   4400 O OD2  . ASP C 1 81  ? 10.270  41.332  25.243 1.00 27.34  -1 126 ASP C OD2  1 
ATOM   4401 H H    . ASP C 1 81  ? 11.224  44.586  28.331 1.00 28.57  ?  126 ASP C H    1 
ATOM   4402 H HA   . ASP C 1 81  ? 9.902   44.357  26.137 1.00 28.08  ?  126 ASP C HA   1 
ATOM   4403 H HB2  . ASP C 1 81  ? 11.224  42.618  27.087 1.00 27.01  ?  126 ASP C HB2  1 
ATOM   4404 H HB3  . ASP C 1 81  ? 10.049  42.349  28.123 1.00 27.01  ?  126 ASP C HB3  1 
ATOM   4405 N N    . ASP C 1 82  ? 7.468   44.289  26.389 1.00 24.31  ?  127 ASP C N    1 
ATOM   4406 C CA   . ASP C 1 82  ? 6.040   44.494  26.609 1.00 24.75  ?  127 ASP C CA   1 
ATOM   4407 C C    . ASP C 1 82  ? 5.463   43.466  27.572 1.00 25.47  ?  127 ASP C C    1 
ATOM   4408 O O    . ASP C 1 82  ? 4.561   43.785  28.354 1.00 25.20  ?  127 ASP C O    1 
ATOM   4409 C CB   . ASP C 1 82  ? 5.287   44.442  25.277 1.00 26.89  ?  127 ASP C CB   1 
ATOM   4410 C CG   . ASP C 1 82  ? 5.621   45.610  24.368 1.00 39.15  ?  127 ASP C CG   1 
ATOM   4411 O OD1  . ASP C 1 82  ? 5.950   46.697  24.886 1.00 40.67  ?  127 ASP C OD1  1 
ATOM   4412 O OD2  . ASP C 1 82  ? 5.549   45.441  23.132 1.00 48.54  -1 127 ASP C OD2  1 
ATOM   4413 H H    . ASP C 1 82  ? 7.696   44.224  25.562 1.00 29.17  ?  127 ASP C H    1 
ATOM   4414 H HA   . ASP C 1 82  ? 5.904   45.374  26.995 1.00 29.70  ?  127 ASP C HA   1 
ATOM   4415 H HB2  . ASP C 1 82  ? 5.523   43.624  24.813 1.00 32.27  ?  127 ASP C HB2  1 
ATOM   4416 H HB3  . ASP C 1 82  ? 4.333   44.461  25.452 1.00 32.27  ?  127 ASP C HB3  1 
ATOM   4417 N N    . ALA C 1 83  ? 5.970   42.232  27.535 1.00 24.45  ?  128 ALA C N    1 
ATOM   4418 C CA   . ALA C 1 83  ? 5.478   41.196  28.433 1.00 23.69  ?  128 ALA C CA   1 
ATOM   4419 C C    . ALA C 1 83  ? 5.827   41.472  29.891 1.00 21.39  ?  128 ALA C C    1 
ATOM   4420 O O    . ALA C 1 83  ? 5.143   40.960  30.784 1.00 21.70  ?  128 ALA C O    1 
ATOM   4421 C CB   . ALA C 1 83  ? 6.040   39.836  28.013 1.00 25.58  ?  128 ALA C CB   1 
ATOM   4422 H H    . ALA C 1 83  ? 6.593   41.974  27.003 1.00 29.34  ?  128 ALA C H    1 
ATOM   4423 H HA   . ALA C 1 83  ? 4.512   41.153  28.362 1.00 28.43  ?  128 ALA C HA   1 
ATOM   4424 H HB1  . ALA C 1 83  ? 5.706   39.156  28.618 1.00 30.69  ?  128 ALA C HB1  1 
ATOM   4425 H HB2  . ALA C 1 83  ? 5.754   39.643  27.107 1.00 30.69  ?  128 ALA C HB2  1 
ATOM   4426 H HB3  . ALA C 1 83  ? 7.009   39.869  28.054 1.00 30.69  ?  128 ALA C HB3  1 
ATOM   4427 N N    . ASN C 1 84  ? 6.861   42.270  30.155 1.00 20.54  ?  129 ASN C N    1 
ATOM   4428 C CA   . ASN C 1 84  ? 7.327   42.517  31.514 1.00 20.14  ?  129 ASN C CA   1 
ATOM   4429 C C    . ASN C 1 84  ? 6.935   43.887  32.058 1.00 22.23  ?  129 ASN C C    1 
ATOM   4430 O O    . ASN C 1 84  ? 7.175   44.152  33.241 1.00 20.95  ?  129 ASN C O    1 
ATOM   4431 C CB   . ASN C 1 84  ? 8.854   42.377  31.574 1.00 20.09  ?  129 ASN C CB   1 
ATOM   4432 C CG   . ASN C 1 84  ? 9.325   40.981  31.214 1.00 19.95  ?  129 ASN C CG   1 
ATOM   4433 O OD1  . ASN C 1 84  ? 8.674   39.992  31.545 1.00 20.15  ?  129 ASN C OD1  1 
ATOM   4434 N ND2  . ASN C 1 84  ? 10.458  40.895  30.531 1.00 17.22  ?  129 ASN C ND2  1 
ATOM   4435 H H    . ASN C 1 84  ? 7.315   42.684  29.554 1.00 24.64  ?  129 ASN C H    1 
ATOM   4436 H HA   . ASN C 1 84  ? 6.944   41.846  32.101 1.00 24.16  ?  129 ASN C HA   1 
ATOM   4437 H HB2  . ASN C 1 84  ? 9.254   43.000  30.948 1.00 24.11  ?  129 ASN C HB2  1 
ATOM   4438 H HB3  . ASN C 1 84  ? 9.155   42.572  32.476 1.00 24.11  ?  129 ASN C HB3  1 
ATOM   4439 H HD21 . ASN C 1 84  ? 10.766  40.125  30.304 1.00 20.67  ?  129 ASN C HD21 1 
ATOM   4440 H HD22 . ASN C 1 84  ? 10.886  41.610  30.315 1.00 20.67  ?  129 ASN C HD22 1 
ATOM   4441 N N    . LYS C 1 85  ? 6.326   44.753  31.246 1.00 23.61  ?  130 LYS C N    1 
ATOM   4442 C CA   . LYS C 1 85  ? 6.172   46.152  31.645 1.00 31.72  ?  130 LYS C CA   1 
ATOM   4443 C C    . LYS C 1 85  ? 5.418   46.278  32.968 1.00 31.67  ?  130 LYS C C    1 
ATOM   4444 O O    . LYS C 1 85  ? 5.842   47.018  33.864 1.00 35.54  ?  130 LYS C O    1 
ATOM   4445 C CB   . LYS C 1 85  ? 5.481   46.950  30.536 1.00 29.45  ?  130 LYS C CB   1 
ATOM   4446 C CG   . LYS C 1 85  ? 4.085   46.484  30.156 1.00 32.91  ?  130 LYS C CG   1 
ATOM   4447 C CD   . LYS C 1 85  ? 3.523   47.349  29.033 1.00 35.37  ?  130 LYS C CD   1 
ATOM   4448 C CE   . LYS C 1 85  ? 2.161   46.858  28.562 1.00 41.68  ?  130 LYS C CE   1 
ATOM   4449 N NZ   . LYS C 1 85  ? 1.175   46.761  29.675 1.00 45.80  1  130 LYS C NZ   1 
ATOM   4450 H H    . LYS C 1 85  ? 6.000   44.561  30.474 1.00 28.33  ?  130 LYS C H    1 
ATOM   4451 H HA   . LYS C 1 85  ? 7.054   46.534  31.775 1.00 38.06  ?  130 LYS C HA   1 
ATOM   4452 H HB2  . LYS C 1 85  ? 5.410   47.874  30.822 1.00 35.34  ?  130 LYS C HB2  1 
ATOM   4453 H HB3  . LYS C 1 85  ? 6.030   46.901  29.737 1.00 35.34  ?  130 LYS C HB3  1 
ATOM   4454 H HG2  . LYS C 1 85  ? 4.124   45.565  29.847 1.00 39.50  ?  130 LYS C HG2  1 
ATOM   4455 H HG3  . LYS C 1 85  ? 3.499   46.559  30.925 1.00 39.50  ?  130 LYS C HG3  1 
ATOM   4456 H HD2  . LYS C 1 85  ? 3.422   48.259  29.353 1.00 42.45  ?  130 LYS C HD2  1 
ATOM   4457 H HD3  . LYS C 1 85  ? 4.131   47.325  28.278 1.00 42.45  ?  130 LYS C HD3  1 
ATOM   4458 H HE2  . LYS C 1 85  ? 1.812   47.478  27.903 1.00 50.02  ?  130 LYS C HE2  1 
ATOM   4459 H HE3  . LYS C 1 85  ? 2.261   45.976  28.170 1.00 50.02  ?  130 LYS C HE3  1 
ATOM   4460 H HZ1  . LYS C 1 85  ? 0.393   46.472  29.364 1.00 54.96  ?  130 LYS C HZ1  1 
ATOM   4461 H HZ2  . LYS C 1 85  ? 1.469   46.192  30.293 1.00 54.96  ?  130 LYS C HZ2  1 
ATOM   4462 H HZ3  . LYS C 1 85  ? 1.060   47.560  30.049 1.00 54.96  ?  130 LYS C HZ3  1 
ATOM   4463 N N    . ASN C 1 86  ? 4.305   45.558  33.119 1.00 30.67  ?  131 ASN C N    1 
ATOM   4464 C CA   . ASN C 1 86  ? 3.526   45.590  34.351 1.00 29.41  ?  131 ASN C CA   1 
ATOM   4465 C C    . ASN C 1 86  ? 3.917   44.481  35.325 1.00 23.71  ?  131 ASN C C    1 
ATOM   4466 O O    . ASN C 1 86  ? 3.148   44.173  36.244 1.00 19.72  ?  131 ASN C O    1 
ATOM   4467 C CB   . ASN C 1 86  ? 2.031   45.489  34.034 1.00 32.97  ?  131 ASN C CB   1 
ATOM   4468 C CG   . ASN C 1 86  ? 1.538   46.630  33.171 1.00 41.41  ?  131 ASN C CG   1 
ATOM   4469 O OD1  . ASN C 1 86  ? 0.991   46.413  32.088 1.00 45.97  ?  131 ASN C OD1  1 
ATOM   4470 N ND2  . ASN C 1 86  ? 1.723   47.856  33.647 1.00 41.17  ?  131 ASN C ND2  1 
ATOM   4471 H H    . ASN C 1 86  ? 3.980   45.040  32.515 1.00 36.80  ?  131 ASN C H    1 
ATOM   4472 H HA   . ASN C 1 86  ? 3.678   46.440  34.794 1.00 35.29  ?  131 ASN C HA   1 
ATOM   4473 H HB2  . ASN C 1 86  ? 1.865   44.659  33.560 1.00 39.57  ?  131 ASN C HB2  1 
ATOM   4474 H HB3  . ASN C 1 86  ? 1.530   45.502  34.865 1.00 39.57  ?  131 ASN C HB3  1 
ATOM   4475 H HD21 . ASN C 1 86  ? 1.460   48.538  33.193 1.00 49.40  ?  131 ASN C HD21 1 
ATOM   4476 H HD22 . ASN C 1 86  ? 2.106   47.968  34.409 1.00 49.40  ?  131 ASN C HD22 1 
ATOM   4477 N N    . GLY C 1 87  ? 5.095   43.884  35.155 1.00 19.82  ?  132 GLY C N    1 
ATOM   4478 C CA   . GLY C 1 87  ? 5.448   42.672  35.855 1.00 17.18  ?  132 GLY C CA   1 
ATOM   4479 C C    . GLY C 1 87  ? 6.299   42.902  37.096 1.00 16.93  ?  132 GLY C C    1 
ATOM   4480 O O    . GLY C 1 87  ? 6.594   44.022  37.504 1.00 16.66  ?  132 GLY C O    1 
ATOM   4481 H H    . GLY C 1 87  ? 5.711   44.173  34.629 1.00 23.78  ?  132 GLY C H    1 
ATOM   4482 H HA2  . GLY C 1 87  ? 4.637   42.213  36.126 1.00 20.61  ?  132 GLY C HA2  1 
ATOM   4483 H HA3  . GLY C 1 87  ? 5.939   42.089  35.255 1.00 20.61  ?  132 GLY C HA3  1 
ATOM   4484 N N    . GLY C 1 88  ? 6.685   41.786  37.701 1.00 13.62  ?  133 GLY C N    1 
ATOM   4485 C CA   . GLY C 1 88  ? 7.560   41.788  38.846 1.00 12.96  ?  133 GLY C CA   1 
ATOM   4486 C C    . GLY C 1 88  ? 8.233   40.443  38.971 1.00 13.01  ?  133 GLY C C    1 
ATOM   4487 O O    . GLY C 1 88  ? 8.200   39.627  38.048 1.00 13.53  ?  133 GLY C O    1 
ATOM   4488 H H    . GLY C 1 88  ? 6.442   40.998  37.454 1.00 16.35  ?  133 GLY C H    1 
ATOM   4489 H HA2  . GLY C 1 88  ? 8.239   42.474  38.744 1.00 15.55  ?  133 GLY C HA2  1 
ATOM   4490 H HA3  . GLY C 1 88  ? 7.052   41.964  39.653 1.00 15.55  ?  133 GLY C HA3  1 
ATOM   4491 N N    . LYS C 1 89  ? 8.842   40.211  40.132 1.00 12.93  ?  134 LYS C N    1 
ATOM   4492 C CA   . LYS C 1 89  ? 9.609   38.988  40.313 1.00 14.55  ?  134 LYS C CA   1 
ATOM   4493 C C    . LYS C 1 89  ? 9.735   38.649  41.790 1.00 14.90  ?  134 LYS C C    1 
ATOM   4494 O O    . LYS C 1 89  ? 9.850   39.540  42.637 1.00 15.10  ?  134 LYS C O    1 
ATOM   4495 C CB   . LYS C 1 89  ? 11.001  39.130  39.690 1.00 16.96  ?  134 LYS C CB   1 
ATOM   4496 C CG   . LYS C 1 89  ? 11.844  40.216  40.330 1.00 15.79  ?  134 LYS C CG   1 
ATOM   4497 C CD   . LYS C 1 89  ? 13.091  40.500  39.518 1.00 17.24  ?  134 LYS C CD   1 
ATOM   4498 C CE   . LYS C 1 89  ? 14.025  41.437  40.262 1.00 20.13  ?  134 LYS C CE   1 
ATOM   4499 N NZ   . LYS C 1 89  ? 15.181  41.856  39.429 1.00 24.74  1  134 LYS C NZ   1 
ATOM   4500 H H    . LYS C 1 89  ? 8.826   40.734  40.814 1.00 15.52  ?  134 LYS C H    1 
ATOM   4501 H HA   . LYS C 1 89  ? 9.152   38.256  39.871 1.00 17.46  ?  134 LYS C HA   1 
ATOM   4502 H HB2  . LYS C 1 89  ? 11.475  38.289  39.787 1.00 20.35  ?  134 LYS C HB2  1 
ATOM   4503 H HB3  . LYS C 1 89  ? 10.903  39.345  38.749 1.00 20.35  ?  134 LYS C HB3  1 
ATOM   4504 H HG2  . LYS C 1 89  ? 11.325  41.033  40.387 1.00 18.95  ?  134 LYS C HG2  1 
ATOM   4505 H HG3  . LYS C 1 89  ? 12.117  39.929  41.216 1.00 18.95  ?  134 LYS C HG3  1 
ATOM   4506 H HD2  . LYS C 1 89  ? 13.562  39.669  39.351 1.00 20.68  ?  134 LYS C HD2  1 
ATOM   4507 H HD3  . LYS C 1 89  ? 12.840  40.920  38.681 1.00 20.68  ?  134 LYS C HD3  1 
ATOM   4508 H HE2  . LYS C 1 89  ? 13.536  42.234  40.521 1.00 24.16  ?  134 LYS C HE2  1 
ATOM   4509 H HE3  . LYS C 1 89  ? 14.368  40.985  41.049 1.00 24.16  ?  134 LYS C HE3  1 
ATOM   4510 H HZ1  . LYS C 1 89  ? 15.707  42.403  39.894 1.00 29.69  ?  134 LYS C HZ1  1 
ATOM   4511 H HZ2  . LYS C 1 89  ? 15.652  41.142  39.182 1.00 29.69  ?  134 LYS C HZ2  1 
ATOM   4512 H HZ3  . LYS C 1 89  ? 14.893  42.279  38.701 1.00 29.69  ?  134 LYS C HZ3  1 
ATOM   4513 N N    . TRP C 1 90  ? 9.698   37.352  42.086 1.00 13.21  ?  135 TRP C N    1 
ATOM   4514 C CA   . TRP C 1 90  ? 10.193  36.850  43.355 1.00 12.72  ?  135 TRP C CA   1 
ATOM   4515 C C    . TRP C 1 90  ? 11.699  36.676  43.248 1.00 12.91  ?  135 TRP C C    1 
ATOM   4516 O O    . TRP C 1 90  ? 12.211  36.272  42.202 1.00 15.64  ?  135 TRP C O    1 
ATOM   4517 C CB   . TRP C 1 90  ? 9.540   35.514  43.712 1.00 12.98  ?  135 TRP C CB   1 
ATOM   4518 C CG   . TRP C 1 90  ? 8.153   35.637  44.259 1.00 15.62  ?  135 TRP C CG   1 
ATOM   4519 C CD1  . TRP C 1 90  ? 6.987   35.349  43.612 1.00 14.56  ?  135 TRP C CD1  1 
ATOM   4520 C CD2  . TRP C 1 90  ? 7.787   36.085  45.569 1.00 15.06  ?  135 TRP C CD2  1 
ATOM   4521 N NE1  . TRP C 1 90  ? 5.915   35.586  44.442 1.00 14.57  ?  135 TRP C NE1  1 
ATOM   4522 C CE2  . TRP C 1 90  ? 6.381   36.040  45.649 1.00 14.08  ?  135 TRP C CE2  1 
ATOM   4523 C CE3  . TRP C 1 90  ? 8.511   36.518  46.684 1.00 15.51  ?  135 TRP C CE3  1 
ATOM   4524 C CZ2  . TRP C 1 90  ? 5.686   36.418  46.798 1.00 14.61  ?  135 TRP C CZ2  1 
ATOM   4525 C CZ3  . TRP C 1 90  ? 7.819   36.887  47.824 1.00 13.53  ?  135 TRP C CZ3  1 
ATOM   4526 C CH2  . TRP C 1 90  ? 6.420   36.832  47.872 1.00 14.42  ?  135 TRP C CH2  1 
ATOM   4527 H H    . TRP C 1 90  ? 9.388   36.743  41.564 1.00 15.85  ?  135 TRP C H    1 
ATOM   4528 H HA   . TRP C 1 90  ? 10.001  37.490  44.059 1.00 15.26  ?  135 TRP C HA   1 
ATOM   4529 H HB2  . TRP C 1 90  ? 9.494   34.966  42.913 1.00 15.58  ?  135 TRP C HB2  1 
ATOM   4530 H HB3  . TRP C 1 90  ? 10.083  35.071  44.383 1.00 15.58  ?  135 TRP C HB3  1 
ATOM   4531 H HD1  . TRP C 1 90  ? 6.925   35.034  42.739 1.00 17.47  ?  135 TRP C HD1  1 
ATOM   4532 H HE1  . TRP C 1 90  ? 5.088   35.473  44.235 1.00 17.48  ?  135 TRP C HE1  1 
ATOM   4533 H HE3  . TRP C 1 90  ? 9.440   36.556  46.660 1.00 18.62  ?  135 TRP C HE3  1 
ATOM   4534 H HZ2  . TRP C 1 90  ? 4.757   36.380  46.834 1.00 17.54  ?  135 TRP C HZ2  1 
ATOM   4535 H HZ3  . TRP C 1 90  ? 8.291   37.177  48.571 1.00 16.23  ?  135 TRP C HZ3  1 
ATOM   4536 H HH2  . TRP C 1 90  ? 5.981   37.088  48.651 1.00 17.31  ?  135 TRP C HH2  1 
ATOM   4537 N N    . ILE C 1 91  ? 12.409  36.992  44.328 1.00 13.88  ?  136 ILE C N    1 
ATOM   4538 C CA   . ILE C 1 91  ? 13.860  36.871  44.371 1.00 15.17  ?  136 ILE C CA   1 
ATOM   4539 C C    . ILE C 1 91  ? 14.246  36.170  45.663 1.00 15.76  ?  136 ILE C C    1 
ATOM   4540 O O    . ILE C 1 91  ? 13.622  36.377  46.709 1.00 17.57  ?  136 ILE C O    1 
ATOM   4541 C CB   . ILE C 1 91  ? 14.566  38.242  44.259 1.00 18.74  ?  136 ILE C CB   1 
ATOM   4542 C CG1  . ILE C 1 91  ? 14.389  39.076  45.531 1.00 23.41  ?  136 ILE C CG1  1 
ATOM   4543 C CG2  . ILE C 1 91  ? 14.025  39.018  43.067 1.00 20.25  ?  136 ILE C CG2  1 
ATOM   4544 C CD1  . ILE C 1 91  ? 15.216  40.360  45.543 1.00 26.67  ?  136 ILE C CD1  1 
ATOM   4545 H H    . ILE C 1 91  ? 12.065  37.283  45.060 1.00 16.65  ?  136 ILE C H    1 
ATOM   4546 H HA   . ILE C 1 91  ? 14.154  36.319  43.629 1.00 18.21  ?  136 ILE C HA   1 
ATOM   4547 H HB   . ILE C 1 91  ? 15.514  38.089  44.121 1.00 22.48  ?  136 ILE C HB   1 
ATOM   4548 H HG12 . ILE C 1 91  ? 13.455  39.323  45.616 1.00 28.09  ?  136 ILE C HG12 1 
ATOM   4549 H HG13 . ILE C 1 91  ? 14.659  38.542  46.295 1.00 28.09  ?  136 ILE C HG13 1 
ATOM   4550 H HG21 . ILE C 1 91  ? 14.480  39.873  43.014 1.00 24.29  ?  136 ILE C HG21 1 
ATOM   4551 H HG22 . ILE C 1 91  ? 14.187  38.506  42.258 1.00 24.29  ?  136 ILE C HG22 1 
ATOM   4552 H HG23 . ILE C 1 91  ? 13.072  39.156  43.186 1.00 24.29  ?  136 ILE C HG23 1 
ATOM   4553 H HD11 . ILE C 1 91  ? 15.053  40.832  46.374 1.00 32.01  ?  136 ILE C HD11 1 
ATOM   4554 H HD12 . ILE C 1 91  ? 16.156  40.131  45.470 1.00 32.01  ?  136 ILE C HD12 1 
ATOM   4555 H HD13 . ILE C 1 91  ? 14.951  40.913  44.791 1.00 32.01  ?  136 ILE C HD13 1 
ATOM   4556 N N    . ILE C 1 92  ? 15.272  35.333  45.587 1.00 19.55  ?  137 ILE C N    1 
ATOM   4557 C CA   . ILE C 1 92  ? 15.821  34.657  46.752 1.00 19.65  ?  137 ILE C CA   1 
ATOM   4558 C C    . ILE C 1 92  ? 17.323  34.881  46.755 1.00 19.55  ?  137 ILE C C    1 
ATOM   4559 O O    . ILE C 1 92  ? 17.997  34.605  45.757 1.00 17.06  ?  137 ILE C O    1 
ATOM   4560 C CB   . ILE C 1 92  ? 15.500  33.151  46.752 1.00 17.76  ?  137 ILE C CB   1 
ATOM   4561 C CG1  . ILE C 1 92  ? 13.990  32.923  46.676 1.00 18.52  ?  137 ILE C CG1  1 
ATOM   4562 C CG2  . ILE C 1 92  ? 16.056  32.494  48.004 1.00 22.26  ?  137 ILE C CG2  1 
ATOM   4563 C CD1  . ILE C 1 92  ? 13.558  32.198  45.429 1.00 22.22  ?  137 ILE C CD1  1 
ATOM   4564 H H    . ILE C 1 92  ? 15.677  35.136  44.854 1.00 23.45  ?  137 ILE C H    1 
ATOM   4565 H HA   . ILE C 1 92  ? 15.449  35.050  47.557 1.00 23.59  ?  137 ILE C HA   1 
ATOM   4566 H HB   . ILE C 1 92  ? 15.916  32.744  45.976 1.00 21.31  ?  137 ILE C HB   1 
ATOM   4567 H HG12 . ILE C 1 92  ? 13.714  32.393  47.440 1.00 22.22  ?  137 ILE C HG12 1 
ATOM   4568 H HG13 . ILE C 1 92  ? 13.541  33.783  46.692 1.00 22.22  ?  137 ILE C HG13 1 
ATOM   4569 H HG21 . ILE C 1 92  ? 15.843  31.547  47.984 1.00 26.71  ?  137 ILE C HG21 1 
ATOM   4570 H HG22 . ILE C 1 92  ? 17.018  32.616  48.024 1.00 26.71  ?  137 ILE C HG22 1 
ATOM   4571 H HG23 . ILE C 1 92  ? 15.652  32.907  48.783 1.00 26.71  ?  137 ILE C HG23 1 
ATOM   4572 H HD11 . ILE C 1 92  ? 12.594  32.088  45.446 1.00 26.66  ?  137 ILE C HD11 1 
ATOM   4573 H HD12 . ILE C 1 92  ? 13.817  32.721  44.654 1.00 26.66  ?  137 ILE C HD12 1 
ATOM   4574 H HD13 . ILE C 1 92  ? 13.990  31.330  45.402 1.00 26.66  ?  137 ILE C HD13 1 
ATOM   4575 N N    . ARG C 1 93  ? 17.840  35.391  47.868 1.00 17.81  ?  138 ARG C N    1 
ATOM   4576 C CA   . ARG C 1 93  ? 19.274  35.529  48.063 1.00 22.58  ?  138 ARG C CA   1 
ATOM   4577 C C    . ARG C 1 93  ? 19.823  34.250  48.675 1.00 25.00  ?  138 ARG C C    1 
ATOM   4578 O O    . ARG C 1 93  ? 19.216  33.671  49.579 1.00 26.27  ?  138 ARG C O    1 
ATOM   4579 C CB   . ARG C 1 93  ? 19.583  36.719  48.968 1.00 30.48  ?  138 ARG C CB   1 
ATOM   4580 C CG   . ARG C 1 93  ? 19.114  38.049  48.420 1.00 28.80  ?  138 ARG C CG   1 
ATOM   4581 C CD   . ARG C 1 93  ? 19.272  39.138  49.460 1.00 37.06  ?  138 ARG C CD   1 
ATOM   4582 N NE   . ARG C 1 93  ? 19.385  40.464  48.868 1.00 45.72  ?  138 ARG C NE   1 
ATOM   4583 C CZ   . ARG C 1 93  ? 19.699  41.559  49.553 1.00 53.69  ?  138 ARG C CZ   1 
ATOM   4584 N NH1  . ARG C 1 93  ? 19.933  41.486  50.858 1.00 52.06  1  138 ARG C NH1  1 
ATOM   4585 N NH2  . ARG C 1 93  ? 19.782  42.730  48.934 1.00 58.43  ?  138 ARG C NH2  1 
ATOM   4586 H H    . ARG C 1 93  ? 17.371  35.669  48.533 1.00 21.37  ?  138 ARG C H    1 
ATOM   4587 H HA   . ARG C 1 93  ? 19.706  35.672  47.206 1.00 27.10  ?  138 ARG C HA   1 
ATOM   4588 H HB2  . ARG C 1 93  ? 19.148  36.582  49.823 1.00 36.57  ?  138 ARG C HB2  1 
ATOM   4589 H HB3  . ARG C 1 93  ? 20.544  36.774  49.094 1.00 36.57  ?  138 ARG C HB3  1 
ATOM   4590 H HG2  . ARG C 1 93  ? 19.647  38.286  47.645 1.00 34.56  ?  138 ARG C HG2  1 
ATOM   4591 H HG3  . ARG C 1 93  ? 18.176  37.987  48.180 1.00 34.56  ?  138 ARG C HG3  1 
ATOM   4592 H HD2  . ARG C 1 93  ? 18.496  39.134  50.043 1.00 44.48  ?  138 ARG C HD2  1 
ATOM   4593 H HD3  . ARG C 1 93  ? 20.076  38.969  49.976 1.00 44.48  ?  138 ARG C HD3  1 
ATOM   4594 H HE   . ARG C 1 93  ? 19.315  40.531  48.013 1.00 54.87  ?  138 ARG C HE   1 
ATOM   4595 H HH11 . ARG C 1 93  ? 19.880  40.729  51.263 1.00 62.48  ?  138 ARG C HH11 1 
ATOM   4596 H HH12 . ARG C 1 93  ? 20.136  42.196  51.299 1.00 62.48  ?  138 ARG C HH12 1 
ATOM   4597 H HH21 . ARG C 1 93  ? 19.632  42.781  48.089 1.00 70.11  ?  138 ARG C HH21 1 
ATOM   4598 H HH22 . ARG C 1 93  ? 19.985  43.437  49.378 1.00 70.11  ?  138 ARG C HH22 1 
ATOM   4599 N N    . LEU C 1 94  ? 20.975  33.812  48.177 1.00 27.27  ?  139 LEU C N    1 
ATOM   4600 C CA   . LEU C 1 94  ? 21.528  32.515  48.540 1.00 25.05  ?  139 LEU C CA   1 
ATOM   4601 C C    . LEU C 1 94  ? 23.008  32.645  48.853 1.00 25.82  ?  139 LEU C C    1 
ATOM   4602 O O    . LEU C 1 94  ? 23.760  33.243  48.078 1.00 25.97  ?  139 LEU C O    1 
ATOM   4603 C CB   . LEU C 1 94  ? 21.325  31.504  47.409 1.00 26.43  ?  139 LEU C CB   1 
ATOM   4604 C CG   . LEU C 1 94  ? 19.877  31.171  47.048 1.00 27.55  ?  139 LEU C CG   1 
ATOM   4605 C CD1  . LEU C 1 94  ? 19.849  30.269  45.832 1.00 31.37  ?  139 LEU C CD1  1 
ATOM   4606 C CD2  . LEU C 1 94  ? 19.160  30.510  48.217 1.00 33.62  ?  139 LEU C CD2  1 
ATOM   4607 H H    . LEU C 1 94  ? 21.460  34.253  47.620 1.00 32.73  ?  139 LEU C H    1 
ATOM   4608 H HA   . LEU C 1 94  ? 21.076  32.183  49.331 1.00 30.06  ?  139 LEU C HA   1 
ATOM   4609 H HB2  . LEU C 1 94  ? 21.748  31.854  46.609 1.00 31.72  ?  139 LEU C HB2  1 
ATOM   4610 H HB3  . LEU C 1 94  ? 21.757  30.673  47.663 1.00 31.72  ?  139 LEU C HB3  1 
ATOM   4611 H HG   . LEU C 1 94  ? 19.407  31.990  46.828 1.00 33.06  ?  139 LEU C HG   1 
ATOM   4612 H HD11 . LEU C 1 94  ? 18.926  30.065  45.613 1.00 37.65  ?  139 LEU C HD11 1 
ATOM   4613 H HD12 . LEU C 1 94  ? 20.272  30.728  45.090 1.00 37.65  ?  139 LEU C HD12 1 
ATOM   4614 H HD13 . LEU C 1 94  ? 20.330  29.452  46.035 1.00 37.65  ?  139 LEU C HD13 1 
ATOM   4615 H HD21 . LEU C 1 94  ? 18.247  30.312  47.956 1.00 40.35  ?  139 LEU C HD21 1 
ATOM   4616 H HD22 . LEU C 1 94  ? 19.623  29.690  48.448 1.00 40.35  ?  139 LEU C HD22 1 
ATOM   4617 H HD23 . LEU C 1 94  ? 19.164  31.117  48.974 1.00 40.35  ?  139 LEU C HD23 1 
ATOM   4618 N N    . ARG C 1 95  ? 23.420  32.086  49.985 1.00 27.55  ?  140 ARG C N    1 
ATOM   4619 C CA   . ARG C 1 95  ? 24.837  31.931  50.256 1.00 29.24  ?  140 ARG C CA   1 
ATOM   4620 C C    . ARG C 1 95  ? 25.491  31.158  49.112 1.00 30.60  ?  140 ARG C C    1 
ATOM   4621 O O    . ARG C 1 95  ? 24.831  30.444  48.351 1.00 27.95  ?  140 ARG C O    1 
ATOM   4622 C CB   . ARG C 1 95  ? 25.048  31.207  51.587 1.00 35.30  ?  140 ARG C CB   1 
ATOM   4623 C CG   . ARG C 1 95  ? 24.770  29.710  51.534 1.00 35.18  ?  140 ARG C CG   1 
ATOM   4624 C CD   . ARG C 1 95  ? 24.622  29.109  52.929 1.00 46.18  ?  140 ARG C CD   1 
ATOM   4625 N NE   . ARG C 1 95  ? 23.238  29.147  53.404 1.00 51.23  ?  140 ARG C NE   1 
ATOM   4626 C CZ   . ARG C 1 95  ? 22.393  28.115  53.382 1.00 48.30  ?  140 ARG C CZ   1 
ATOM   4627 N NH1  . ARG C 1 95  ? 22.772  26.932  52.910 1.00 46.11  1  140 ARG C NH1  1 
ATOM   4628 N NH2  . ARG C 1 95  ? 21.156  28.266  53.837 1.00 44.44  ?  140 ARG C NH2  1 
ATOM   4629 H H    . ARG C 1 95  ? 22.902  31.791  50.605 1.00 33.06  ?  140 ARG C H    1 
ATOM   4630 H HA   . ARG C 1 95  ? 25.253  32.805  50.312 1.00 35.09  ?  140 ARG C HA   1 
ATOM   4631 H HB2  . ARG C 1 95  ? 25.970  31.326  51.864 1.00 42.36  ?  140 ARG C HB2  1 
ATOM   4632 H HB3  . ARG C 1 95  ? 24.455  31.594  52.250 1.00 42.36  ?  140 ARG C HB3  1 
ATOM   4633 H HG2  . ARG C 1 95  ? 23.945  29.556  51.049 1.00 42.21  ?  140 ARG C HG2  1 
ATOM   4634 H HG3  . ARG C 1 95  ? 25.508  29.264  51.089 1.00 42.21  ?  140 ARG C HG3  1 
ATOM   4635 H HD2  . ARG C 1 95  ? 24.908  28.182  52.907 1.00 55.42  ?  140 ARG C HD2  1 
ATOM   4636 H HD3  . ARG C 1 95  ? 25.169  29.613  53.552 1.00 55.42  ?  140 ARG C HD3  1 
ATOM   4637 H HE   . ARG C 1 95  ? 22.947  29.892  53.722 1.00 61.48  ?  140 ARG C HE   1 
ATOM   4638 H HH11 . ARG C 1 95  ? 23.571  26.824  52.612 1.00 55.33  ?  140 ARG C HH11 1 
ATOM   4639 H HH12 . ARG C 1 95  ? 22.217  26.275  52.902 1.00 55.33  ?  140 ARG C HH12 1 
ATOM   4640 H HH21 . ARG C 1 95  ? 20.901  29.027  54.145 1.00 53.33  ?  140 ARG C HH21 1 
ATOM   4641 H HH22 . ARG C 1 95  ? 20.609  27.602  53.826 1.00 53.33  ?  140 ARG C HH22 1 
ATOM   4642 N N    . LYS C 1 96  ? 26.805  31.314  48.987 1.00 29.89  ?  141 LYS C N    1 
ATOM   4643 C CA   . LYS C 1 96  ? 27.523  30.668  47.899 1.00 28.80  ?  141 LYS C CA   1 
ATOM   4644 C C    . LYS C 1 96  ? 27.426  29.151  48.016 1.00 30.76  ?  141 LYS C C    1 
ATOM   4645 O O    . LYS C 1 96  ? 27.363  28.590  49.114 1.00 32.86  ?  141 LYS C O    1 
ATOM   4646 C CB   . LYS C 1 96  ? 28.990  31.098  47.897 1.00 30.60  ?  141 LYS C CB   1 
ATOM   4647 C CG   . LYS C 1 96  ? 29.200  32.604  47.795 1.00 35.81  ?  141 LYS C CG   1 
ATOM   4648 C CD   . LYS C 1 96  ? 28.625  33.187  46.511 1.00 34.11  ?  141 LYS C CD   1 
ATOM   4649 C CE   . LYS C 1 96  ? 29.335  32.646  45.278 1.00 36.97  ?  141 LYS C CE   1 
ATOM   4650 N NZ   . LYS C 1 96  ? 29.010  33.441  44.060 1.00 34.36  1  141 LYS C NZ   1 
ATOM   4651 H H    . LYS C 1 96  ? 27.298  31.783  49.513 1.00 35.87  ?  141 LYS C H    1 
ATOM   4652 H HA   . LYS C 1 96  ? 27.128  30.933  47.054 1.00 34.56  ?  141 LYS C HA   1 
ATOM   4653 H HB2  . LYS C 1 96  ? 29.403  30.798  48.722 1.00 36.72  ?  141 LYS C HB2  1 
ATOM   4654 H HB3  . LYS C 1 96  ? 29.434  30.686  47.140 1.00 36.72  ?  141 LYS C HB3  1 
ATOM   4655 H HG2  . LYS C 1 96  ? 28.762  33.037  48.545 1.00 42.97  ?  141 LYS C HG2  1 
ATOM   4656 H HG3  . LYS C 1 96  ? 30.151  32.794  47.812 1.00 42.97  ?  141 LYS C HG3  1 
ATOM   4657 H HD2  . LYS C 1 96  ? 27.685  32.953  46.447 1.00 40.94  ?  141 LYS C HD2  1 
ATOM   4658 H HD3  . LYS C 1 96  ? 28.730  34.151  46.522 1.00 40.94  ?  141 LYS C HD3  1 
ATOM   4659 H HE2  . LYS C 1 96  ? 30.294  32.685  45.420 1.00 44.36  ?  141 LYS C HE2  1 
ATOM   4660 H HE3  . LYS C 1 96  ? 29.056  31.730  45.126 1.00 44.36  ?  141 LYS C HE3  1 
ATOM   4661 H HZ1  . LYS C 1 96  ? 29.437  33.105  43.355 1.00 41.23  ?  141 LYS C HZ1  1 
ATOM   4662 H HZ2  . LYS C 1 96  ? 28.134  33.418  43.906 1.00 41.23  ?  141 LYS C HZ2  1 
ATOM   4663 H HZ3  . LYS C 1 96  ? 29.261  34.288  44.174 1.00 41.23  ?  141 LYS C HZ3  1 
ATOM   4664 N N    . GLY C 1 97  ? 27.413  28.488  46.861 1.00 28.32  ?  142 GLY C N    1 
ATOM   4665 C CA   . GLY C 1 97  ? 27.365  27.046  46.790 1.00 29.44  ?  142 GLY C CA   1 
ATOM   4666 C C    . GLY C 1 97  ? 25.994  26.468  46.516 1.00 29.77  ?  142 GLY C C    1 
ATOM   4667 O O    . GLY C 1 97  ? 25.883  25.251  46.323 1.00 27.26  ?  142 GLY C O    1 
ATOM   4668 H H    . GLY C 1 97  ? 27.432  28.869  46.090 1.00 33.98  ?  142 GLY C H    1 
ATOM   4669 H HA2  . GLY C 1 97  ? 27.962  26.745  46.086 1.00 35.33  ?  142 GLY C HA2  1 
ATOM   4670 H HA3  . GLY C 1 97  ? 27.682  26.679  47.630 1.00 35.33  ?  142 GLY C HA3  1 
ATOM   4671 N N    . LEU C 1 98  ? 24.950  27.300  46.487 1.00 27.99  ?  143 LEU C N    1 
ATOM   4672 C CA   . LEU C 1 98  ? 23.585  26.822  46.323 1.00 29.15  ?  143 LEU C CA   1 
ATOM   4673 C C    . LEU C 1 98  ? 22.978  27.142  44.968 1.00 27.36  ?  143 LEU C C    1 
ATOM   4674 O O    . LEU C 1 98  ? 21.977  26.520  44.601 1.00 27.63  ?  143 LEU C O    1 
ATOM   4675 C CB   . LEU C 1 98  ? 22.680  27.423  47.408 1.00 26.92  ?  143 LEU C CB   1 
ATOM   4676 C CG   . LEU C 1 98  ? 23.078  27.170  48.862 1.00 30.70  ?  143 LEU C CG   1 
ATOM   4677 C CD1  . LEU C 1 98  ? 22.104  27.869  49.783 1.00 33.20  ?  143 LEU C CD1  1 
ATOM   4678 C CD2  . LEU C 1 98  ? 23.125  25.685  49.169 1.00 31.69  ?  143 LEU C CD2  1 
ATOM   4679 H H    . LEU C 1 98  ? 25.012  28.155  46.561 1.00 33.59  ?  143 LEU C H    1 
ATOM   4680 H HA   . LEU C 1 98  ? 23.578  25.858  46.431 1.00 34.98  ?  143 LEU C HA   1 
ATOM   4681 H HB2  . LEU C 1 98  ? 22.655  28.385  47.282 1.00 32.30  ?  143 LEU C HB2  1 
ATOM   4682 H HB3  . LEU C 1 98  ? 21.787  27.063  47.289 1.00 32.30  ?  143 LEU C HB3  1 
ATOM   4683 H HG   . LEU C 1 98  ? 23.961  27.540  49.019 1.00 36.84  ?  143 LEU C HG   1 
ATOM   4684 H HD11 . LEU C 1 98  ? 22.365  27.702  50.702 1.00 39.84  ?  143 LEU C HD11 1 
ATOM   4685 H HD12 . LEU C 1 98  ? 22.124  28.821  49.600 1.00 39.84  ?  143 LEU C HD12 1 
ATOM   4686 H HD13 . LEU C 1 98  ? 21.213  27.520  49.623 1.00 39.84  ?  143 LEU C HD13 1 
ATOM   4687 H HD21 . LEU C 1 98  ? 23.380  25.562  50.097 1.00 38.03  ?  143 LEU C HD21 1 
ATOM   4688 H HD22 . LEU C 1 98  ? 22.247  25.303  49.013 1.00 38.03  ?  143 LEU C HD22 1 
ATOM   4689 H HD23 . LEU C 1 98  ? 23.777  25.263  48.588 1.00 38.03  ?  143 LEU C HD23 1 
ATOM   4690 N N    . ALA C 1 99  ? 23.560  28.078  44.215 1.00 23.04  ?  144 ALA C N    1 
ATOM   4691 C CA   . ALA C 1 99  ? 22.898  28.592  43.020 1.00 24.45  ?  144 ALA C CA   1 
ATOM   4692 C C    . ALA C 1 99  ? 22.741  27.516  41.954 1.00 22.30  ?  144 ALA C C    1 
ATOM   4693 O O    . ALA C 1 99  ? 21.682  27.411  41.324 1.00 20.19  ?  144 ALA C O    1 
ATOM   4694 C CB   . ALA C 1 99  ? 23.677  29.784  42.465 1.00 24.97  ?  144 ALA C CB   1 
ATOM   4695 H H    . ALA C 1 99  ? 24.329  28.427  44.374 1.00 27.65  ?  144 ALA C H    1 
ATOM   4696 H HA   . ALA C 1 99  ? 22.011  28.903  43.262 1.00 29.34  ?  144 ALA C HA   1 
ATOM   4697 H HB1  . ALA C 1 99  ? 23.225  30.114  41.673 1.00 29.97  ?  144 ALA C HB1  1 
ATOM   4698 H HB2  . ALA C 1 99  ? 23.712  30.479  43.140 1.00 29.97  ?  144 ALA C HB2  1 
ATOM   4699 H HB3  . ALA C 1 99  ? 24.575  29.495  42.239 1.00 29.97  ?  144 ALA C HB3  1 
ATOM   4700 N N    . SER C 1 100 ? 23.782  26.715  41.724 1.00 22.77  ?  145 SER C N    1 
ATOM   4701 C CA   . SER C 1 100 ? 23.687  25.664  40.717 1.00 24.10  ?  145 SER C CA   1 
ATOM   4702 C C    . SER C 1 100 ? 22.490  24.759  40.985 1.00 20.32  ?  145 SER C C    1 
ATOM   4703 O O    . SER C 1 100 ? 21.659  24.528  40.100 1.00 19.57  ?  145 SER C O    1 
ATOM   4704 C CB   . SER C 1 100 ? 24.986  24.856  40.680 1.00 24.53  ?  145 SER C CB   1 
ATOM   4705 O OG   . SER C 1 100 ? 26.048  25.639  40.161 1.00 23.92  ?  145 SER C OG   1 
ATOM   4706 H H    . SER C 1 100 ? 24.539  26.759  42.129 1.00 27.33  ?  145 SER C H    1 
ATOM   4707 H HA   . SER C 1 100 ? 23.564  26.072  39.846 1.00 28.92  ?  145 SER C HA   1 
ATOM   4708 H HB2  . SER C 1 100 ? 25.210  24.577  41.582 1.00 29.43  ?  145 SER C HB2  1 
ATOM   4709 H HB3  . SER C 1 100 ? 24.859  24.079  40.114 1.00 29.43  ?  145 SER C HB3  1 
ATOM   4710 H HG   . SER C 1 100 ? 26.756  25.187  40.144 1.00 28.71  ?  145 SER C HG   1 
ATOM   4711 N N    . ARG C 1 101 ? 22.372  24.257  42.216 1.00 23.81  ?  146 ARG C N    1 
ATOM   4712 C CA   . ARG C 1 101 ? 21.294  23.329  42.539 1.00 24.22  ?  146 ARG C CA   1 
ATOM   4713 C C    . ARG C 1 101 ? 19.931  24.012  42.484 1.00 20.44  ?  146 ARG C C    1 
ATOM   4714 O O    . ARG C 1 101 ? 18.970  23.448  41.948 1.00 17.98  ?  146 ARG C O    1 
ATOM   4715 C CB   . ARG C 1 101 ? 21.537  22.718  43.920 1.00 28.36  ?  146 ARG C CB   1 
ATOM   4716 C CG   . ARG C 1 101 ? 20.593  21.587  44.283 1.00 33.83  ?  146 ARG C CG   1 
ATOM   4717 C CD   . ARG C 1 101 ? 20.682  20.439  43.285 1.00 39.09  ?  146 ARG C CD   1 
ATOM   4718 N NE   . ARG C 1 101 ? 20.700  19.140  43.950 1.00 45.84  ?  146 ARG C NE   1 
ATOM   4719 C CZ   . ARG C 1 101 ? 19.632  18.554  44.481 1.00 48.28  ?  146 ARG C CZ   1 
ATOM   4720 N NH1  . ARG C 1 101 ? 18.448  19.150  44.438 1.00 42.36  ?  146 ARG C NH1  1 
ATOM   4721 N NH2  . ARG C 1 101 ? 19.749  17.369  45.066 1.00 61.63  ?  146 ARG C NH2  1 
ATOM   4722 H H    . ARG C 1 101 ? 22.898  24.437  42.873 1.00 28.58  ?  146 ARG C H    1 
ATOM   4723 H HA   . ARG C 1 101 ? 21.293  22.608  41.889 1.00 29.07  ?  146 ARG C HA   1 
ATOM   4724 H HB2  . ARG C 1 101 ? 22.441  22.368  43.950 1.00 34.03  ?  146 ARG C HB2  1 
ATOM   4725 H HB3  . ARG C 1 101 ? 21.434  23.413  44.589 1.00 34.03  ?  146 ARG C HB3  1 
ATOM   4726 H HG2  . ARG C 1 101 ? 20.826  21.245  45.160 1.00 40.59  ?  146 ARG C HG2  1 
ATOM   4727 H HG3  . ARG C 1 101 ? 19.681  21.919  44.284 1.00 40.59  ?  146 ARG C HG3  1 
ATOM   4728 H HD2  . ARG C 1 101 ? 19.911  20.468  42.697 1.00 46.91  ?  146 ARG C HD2  1 
ATOM   4729 H HD3  . ARG C 1 101 ? 21.499  20.527  42.770 1.00 46.91  ?  146 ARG C HD3  1 
ATOM   4730 H HE   . ARG C 1 101 ? 21.452  18.726  44.000 1.00 55.01  ?  146 ARG C HE   1 
ATOM   4731 H HH11 . ARG C 1 101 ? 18.368  19.918  44.061 1.00 50.84  ?  146 ARG C HH11 1 
ATOM   4732 H HH12 . ARG C 1 101 ? 17.761  18.767  44.785 1.00 50.84  ?  146 ARG C HH12 1 
ATOM   4733 H HH21 . ARG C 1 101 ? 20.515  16.979  45.098 1.00 73.96  ?  146 ARG C HH21 1 
ATOM   4734 H HH22 . ARG C 1 101 ? 19.058  16.990  45.411 1.00 73.96  ?  146 ARG C HH22 1 
ATOM   4735 N N    . CYS C 1 102 ? 19.825  25.222  43.038 1.00 24.59  ?  147 CYS C N    1 
ATOM   4736 C CA   . CYS C 1 102 ? 18.549  25.933  43.026 1.00 20.88  ?  147 CYS C CA   1 
ATOM   4737 C C    . CYS C 1 102 ? 18.122  26.279  41.604 1.00 17.41  ?  147 CYS C C    1 
ATOM   4738 O O    . CYS C 1 102 ? 16.951  26.112  41.242 1.00 18.16  ?  147 CYS C O    1 
ATOM   4739 C CB   . CYS C 1 102 ? 18.649  27.196  43.883 1.00 24.09  ?  147 CYS C CB   1 
ATOM   4740 S SG   . CYS C 1 102 ? 18.815  26.883  45.659 1.00 35.40  ?  147 CYS C SG   1 
ATOM   4741 H H    . CYS C 1 102 ? 20.467  25.646  43.421 1.00 29.51  ?  147 CYS C H    1 
ATOM   4742 H HA   . CYS C 1 102 ? 17.867  25.362  43.413 1.00 25.05  ?  147 CYS C HA   1 
ATOM   4743 H HB2  . CYS C 1 102 ? 19.425  27.703  43.599 1.00 28.91  ?  147 CYS C HB2  1 
ATOM   4744 H HB3  . CYS C 1 102 ? 17.846  27.725  43.751 1.00 28.91  ?  147 CYS C HB3  1 
ATOM   4745 H HG   . CYS C 1 102 ? 19.812  26.243  45.852 1.00 42.47  ?  147 CYS C HG   1 
ATOM   4746 N N    . TRP C 1 103 ? 19.059  26.765  40.786 1.00 16.55  ?  148 TRP C N    1 
ATOM   4747 C CA   . TRP C 1 103 ? 18.769  27.069  39.386 1.00 18.10  ?  148 TRP C CA   1 
ATOM   4748 C C    . TRP C 1 103 ? 18.172  25.864  38.670 1.00 18.42  ?  148 TRP C C    1 
ATOM   4749 O O    . TRP C 1 103 ? 17.135  25.967  38.006 1.00 15.50  ?  148 TRP C O    1 
ATOM   4750 C CB   . TRP C 1 103 ? 20.055  27.529  38.696 1.00 17.68  ?  148 TRP C CB   1 
ATOM   4751 C CG   . TRP C 1 103 ? 19.950  27.826  37.224 1.00 16.01  ?  148 TRP C CG   1 
ATOM   4752 C CD1  . TRP C 1 103 ? 20.639  27.215  36.219 1.00 16.33  ?  148 TRP C CD1  1 
ATOM   4753 C CD2  . TRP C 1 103 ? 19.133  28.823  36.598 1.00 14.19  ?  148 TRP C CD2  1 
ATOM   4754 N NE1  . TRP C 1 103 ? 20.300  27.762  35.008 1.00 14.87  ?  148 TRP C NE1  1 
ATOM   4755 C CE2  . TRP C 1 103 ? 19.374  28.751  35.212 1.00 13.96  ?  148 TRP C CE2  1 
ATOM   4756 C CE3  . TRP C 1 103 ? 18.214  29.763  37.074 1.00 14.95  ?  148 TRP C CE3  1 
ATOM   4757 C CZ2  . TRP C 1 103 ? 18.733  29.583  34.297 1.00 16.27  ?  148 TRP C CZ2  1 
ATOM   4758 C CZ3  . TRP C 1 103 ? 17.579  30.590  36.164 1.00 11.51  ?  148 TRP C CZ3  1 
ATOM   4759 C CH2  . TRP C 1 103 ? 17.841  30.496  34.793 1.00 12.63  ?  148 TRP C CH2  1 
ATOM   4760 H H    . TRP C 1 103 ? 19.871  26.926  41.019 1.00 19.86  ?  148 TRP C H    1 
ATOM   4761 H HA   . TRP C 1 103 ? 18.127  27.795  39.344 1.00 21.72  ?  148 TRP C HA   1 
ATOM   4762 H HB2  . TRP C 1 103 ? 20.362  28.340  39.132 1.00 21.22  ?  148 TRP C HB2  1 
ATOM   4763 H HB3  . TRP C 1 103 ? 20.723  26.834  38.803 1.00 21.22  ?  148 TRP C HB3  1 
ATOM   4764 H HD1  . TRP C 1 103 ? 21.255  26.528  36.338 1.00 19.59  ?  148 TRP C HD1  1 
ATOM   4765 H HE1  . TRP C 1 103 ? 20.615  27.522  34.244 1.00 17.84  ?  148 TRP C HE1  1 
ATOM   4766 H HE3  . TRP C 1 103 ? 18.036  29.834  37.984 1.00 17.94  ?  148 TRP C HE3  1 
ATOM   4767 H HZ2  . TRP C 1 103 ? 18.904  29.521  33.385 1.00 19.52  ?  148 TRP C HZ2  1 
ATOM   4768 H HZ3  . TRP C 1 103 ? 16.967  31.220  36.470 1.00 13.81  ?  148 TRP C HZ3  1 
ATOM   4769 H HH2  . TRP C 1 103 ? 17.397  31.063  34.205 1.00 15.16  ?  148 TRP C HH2  1 
ATOM   4770 N N    . GLU C 1 104 ? 18.820  24.706  38.799 1.00 16.55  ?  149 GLU C N    1 
ATOM   4771 C CA   . GLU C 1 104 ? 18.307  23.497  38.164 1.00 16.84  ?  149 GLU C CA   1 
ATOM   4772 C C    . GLU C 1 104 ? 16.903  23.178  38.660 1.00 15.08  ?  149 GLU C C    1 
ATOM   4773 O O    . GLU C 1 104 ? 16.006  22.874  37.866 1.00 18.68  ?  149 GLU C O    1 
ATOM   4774 C CB   . GLU C 1 104 ? 19.259  22.336  38.432 1.00 21.20  ?  149 GLU C CB   1 
ATOM   4775 C CG   . GLU C 1 104 ? 18.873  21.046  37.744 1.00 20.59  ?  149 GLU C CG   1 
ATOM   4776 C CD   . GLU C 1 104 ? 19.920  19.976  37.923 1.00 26.72  ?  149 GLU C CD   1 
ATOM   4777 O OE1  . GLU C 1 104 ? 20.956  20.040  37.228 1.00 29.09  ?  149 GLU C OE1  1 
ATOM   4778 O OE2  . GLU C 1 104 ? 19.714  19.085  38.770 1.00 29.78  -1 149 GLU C OE2  1 
ATOM   4779 H H    . GLU C 1 104 ? 19.549  24.596  39.242 1.00 19.86  ?  149 GLU C H    1 
ATOM   4780 H HA   . GLU C 1 104 ? 18.264  23.636  37.205 1.00 20.21  ?  149 GLU C HA   1 
ATOM   4781 H HB2  . GLU C 1 104 ? 20.145  22.581  38.123 1.00 25.44  ?  149 GLU C HB2  1 
ATOM   4782 H HB3  . GLU C 1 104 ? 19.281  22.165  39.387 1.00 25.44  ?  149 GLU C HB3  1 
ATOM   4783 H HG2  . GLU C 1 104 ? 18.040  20.721  38.122 1.00 24.71  ?  149 GLU C HG2  1 
ATOM   4784 H HG3  . GLU C 1 104 ? 18.767  21.211  36.794 1.00 24.71  ?  149 GLU C HG3  1 
ATOM   4785 N N    . ASN C 1 105 ? 16.688  23.258  39.975 1.00 15.38  ?  150 ASN C N    1 
ATOM   4786 C CA   . ASN C 1 105 ? 15.366  22.978  40.527 1.00 17.14  ?  150 ASN C CA   1 
ATOM   4787 C C    . ASN C 1 105 ? 14.325  23.953  39.998 1.00 17.39  ?  150 ASN C C    1 
ATOM   4788 O O    . ASN C 1 105 ? 13.188  23.563  39.701 1.00 14.44  ?  150 ASN C O    1 
ATOM   4789 C CB   . ASN C 1 105 ? 15.412  23.028  42.053 1.00 19.27  ?  150 ASN C CB   1 
ATOM   4790 C CG   . ASN C 1 105 ? 16.050  21.794  42.653 1.00 23.15  ?  150 ASN C CG   1 
ATOM   4791 O OD1  . ASN C 1 105 ? 16.137  20.760  41.998 1.00 21.37  ?  150 ASN C OD1  1 
ATOM   4792 N ND2  . ASN C 1 105 ? 16.497  21.896  43.901 1.00 23.81  ?  150 ASN C ND2  1 
ATOM   4793 H H    . ASN C 1 105 ? 17.283  23.469  40.560 1.00 18.46  ?  150 ASN C H    1 
ATOM   4794 H HA   . ASN C 1 105 ? 15.098  22.083  40.265 1.00 20.57  ?  150 ASN C HA   1 
ATOM   4795 H HB2  . ASN C 1 105 ? 15.931  23.799  42.329 1.00 23.13  ?  150 ASN C HB2  1 
ATOM   4796 H HB3  . ASN C 1 105 ? 14.507  23.096  42.396 1.00 23.13  ?  150 ASN C HB3  1 
ATOM   4797 H HD21 . ASN C 1 105 ? 16.867  21.219  44.281 1.00 28.58  ?  150 ASN C HD21 1 
ATOM   4798 H HD22 . ASN C 1 105 ? 16.416  22.638  44.327 1.00 28.58  ?  150 ASN C HD22 1 
ATOM   4799 N N    . LEU C 1 106 ? 14.690  25.229  39.880 1.00 15.24  ?  151 LEU C N    1 
ATOM   4800 C CA   . LEU C 1 106 ? 13.733  26.231  39.434 1.00 14.48  ?  151 LEU C CA   1 
ATOM   4801 C C    . LEU C 1 106 ? 13.341  26.013  37.978 1.00 12.98  ?  151 LEU C C    1 
ATOM   4802 O O    . LEU C 1 106 ? 12.150  25.968  37.647 1.00 14.27  ?  151 LEU C O    1 
ATOM   4803 C CB   . LEU C 1 106 ? 14.314  27.631  39.625 1.00 13.93  ?  151 LEU C CB   1 
ATOM   4804 C CG   . LEU C 1 106 ? 13.438  28.774  39.111 1.00 13.49  ?  151 LEU C CG   1 
ATOM   4805 C CD1  . LEU C 1 106 ? 12.026  28.702  39.688 1.00 15.90  ?  151 LEU C CD1  1 
ATOM   4806 C CD2  . LEU C 1 106 ? 14.076  30.098  39.450 1.00 15.15  ?  151 LEU C CD2  1 
ATOM   4807 H H    . LEU C 1 106 ? 15.476  25.534  40.051 1.00 18.28  ?  151 LEU C H    1 
ATOM   4808 H HA   . LEU C 1 106 ? 12.930  26.163  39.974 1.00 17.38  ?  151 LEU C HA   1 
ATOM   4809 H HB2  . LEU C 1 106 ? 14.458  27.778  40.573 1.00 16.72  ?  151 LEU C HB2  1 
ATOM   4810 H HB3  . LEU C 1 106 ? 15.162  27.680  39.157 1.00 16.72  ?  151 LEU C HB3  1 
ATOM   4811 H HG   . LEU C 1 106 ? 13.371  28.711  38.145 1.00 16.19  ?  151 LEU C HG   1 
ATOM   4812 H HD11 . LEU C 1 106 ? 11.504  29.441  39.338 1.00 19.08  ?  151 LEU C HD11 1 
ATOM   4813 H HD12 . LEU C 1 106 ? 11.622  27.859  39.428 1.00 19.08  ?  151 LEU C HD12 1 
ATOM   4814 H HD13 . LEU C 1 106 ? 12.077  28.761  40.655 1.00 19.08  ?  151 LEU C HD13 1 
ATOM   4815 H HD21 . LEU C 1 106 ? 13.511  30.814  39.118 1.00 18.18  ?  151 LEU C HD21 1 
ATOM   4816 H HD22 . LEU C 1 106 ? 14.167  30.167  40.413 1.00 18.18  ?  151 LEU C HD22 1 
ATOM   4817 H HD23 . LEU C 1 106 ? 14.949  30.144  39.030 1.00 18.18  ?  151 LEU C HD23 1 
ATOM   4818 N N    . ILE C 1 107 ? 14.327  25.871  37.091 1.00 11.67  ?  152 ILE C N    1 
ATOM   4819 C CA   . ILE C 1 107 ? 14.011  25.817  35.667 1.00 15.54  ?  152 ILE C CA   1 
ATOM   4820 C C    . ILE C 1 107 ? 13.290  24.521  35.325 1.00 15.77  ?  152 ILE C C    1 
ATOM   4821 O O    . ILE C 1 107 ? 12.411  24.508  34.456 1.00 15.59  ?  152 ILE C O    1 
ATOM   4822 C CB   . ILE C 1 107 ? 15.276  26.010  34.809 1.00 14.99  ?  152 ILE C CB   1 
ATOM   4823 C CG1  . ILE C 1 107 ? 16.319  24.922  35.108 1.00 13.49  ?  152 ILE C CG1  1 
ATOM   4824 C CG2  . ILE C 1 107 ? 15.830  27.417  35.013 1.00 15.09  ?  152 ILE C CG2  1 
ATOM   4825 C CD1  . ILE C 1 107 ? 17.621  25.099  34.359 1.00 14.95  ?  152 ILE C CD1  1 
ATOM   4826 H H    . ILE C 1 107 ? 15.163  25.806  37.281 1.00 14.01  ?  152 ILE C H    1 
ATOM   4827 H HA   . ILE C 1 107 ? 13.407  26.547  35.460 1.00 18.65  ?  152 ILE C HA   1 
ATOM   4828 H HB   . ILE C 1 107 ? 15.019  25.925  33.877 1.00 17.99  ?  152 ILE C HB   1 
ATOM   4829 H HG12 . ILE C 1 107 ? 16.519  24.934  36.057 1.00 16.19  ?  152 ILE C HG12 1 
ATOM   4830 H HG13 . ILE C 1 107 ? 15.950  24.060  34.861 1.00 16.19  ?  152 ILE C HG13 1 
ATOM   4831 H HG21 . ILE C 1 107 ? 16.625  27.525  34.468 1.00 18.10  ?  152 ILE C HG21 1 
ATOM   4832 H HG22 . ILE C 1 107 ? 15.156  28.062  34.748 1.00 18.10  ?  152 ILE C HG22 1 
ATOM   4833 H HG23 . ILE C 1 107 ? 16.052  27.535  35.950 1.00 18.10  ?  152 ILE C HG23 1 
ATOM   4834 H HD11 . ILE C 1 107 ? 18.223  24.377  34.600 1.00 17.94  ?  152 ILE C HD11 1 
ATOM   4835 H HD12 . ILE C 1 107 ? 17.443  25.077  33.406 1.00 17.94  ?  152 ILE C HD12 1 
ATOM   4836 H HD13 . ILE C 1 107 ? 18.012  25.952  34.603 1.00 17.94  ?  152 ILE C HD13 1 
ATOM   4837 N N    . LEU C 1 108 ? 13.628  23.420  36.001 1.00 16.05  ?  153 LEU C N    1 
ATOM   4838 C CA   . LEU C 1 108 ? 12.864  22.190  35.820 1.00 13.95  ?  153 LEU C CA   1 
ATOM   4839 C C    . LEU C 1 108 ? 11.421  22.374  36.266 1.00 14.44  ?  153 LEU C C    1 
ATOM   4840 O O    . LEU C 1 108 ? 10.498  21.856  35.626 1.00 16.85  ?  153 LEU C O    1 
ATOM   4841 C CB   . LEU C 1 108 ? 13.519  21.044  36.588 1.00 16.67  ?  153 LEU C CB   1 
ATOM   4842 C CG   . LEU C 1 108 ? 14.891  20.588  36.084 1.00 20.07  ?  153 LEU C CG   1 
ATOM   4843 C CD1  . LEU C 1 108 ? 15.430  19.483  36.968 1.00 22.11  ?  153 LEU C CD1  1 
ATOM   4844 C CD2  . LEU C 1 108 ? 14.831  20.121  34.639 1.00 20.07  ?  153 LEU C CD2  1 
ATOM   4845 H H    . LEU C 1 108 ? 14.280  23.362  36.558 1.00 19.26  ?  153 LEU C H    1 
ATOM   4846 H HA   . LEU C 1 108 ? 12.860  21.957  34.878 1.00 16.74  ?  153 LEU C HA   1 
ATOM   4847 H HB2  . LEU C 1 108 ? 13.627  21.319  37.511 1.00 20.00  ?  153 LEU C HB2  1 
ATOM   4848 H HB3  . LEU C 1 108 ? 12.928  20.275  36.549 1.00 20.00  ?  153 LEU C HB3  1 
ATOM   4849 H HG   . LEU C 1 108 ? 15.508  21.336  36.131 1.00 24.09  ?  153 LEU C HG   1 
ATOM   4850 H HD11 . LEU C 1 108 ? 16.298  19.208  36.635 1.00 26.53  ?  153 LEU C HD11 1 
ATOM   4851 H HD12 . LEU C 1 108 ? 15.514  19.818  37.875 1.00 26.53  ?  153 LEU C HD12 1 
ATOM   4852 H HD13 . LEU C 1 108 ? 14.814  18.734  36.947 1.00 26.53  ?  153 LEU C HD13 1 
ATOM   4853 H HD21 . LEU C 1 108 ? 15.717  19.843  34.360 1.00 24.08  ?  153 LEU C HD21 1 
ATOM   4854 H HD22 . LEU C 1 108 ? 14.214  19.375  34.574 1.00 24.08  ?  153 LEU C HD22 1 
ATOM   4855 H HD23 . LEU C 1 108 ? 14.524  20.854  34.083 1.00 24.08  ?  153 LEU C HD23 1 
ATOM   4856 N N    . ALA C 1 109 ? 11.207  23.111  37.360 1.00 15.07  ?  154 ALA C N    1 
ATOM   4857 C CA   . ALA C 1 109 ? 9.848   23.385  37.818 1.00 15.28  ?  154 ALA C CA   1 
ATOM   4858 C C    . ALA C 1 109 ? 9.110   24.273  36.830 1.00 14.33  ?  154 ALA C C    1 
ATOM   4859 O O    . ALA C 1 109 ? 7.941   24.022  36.511 1.00 15.01  ?  154 ALA C O    1 
ATOM   4860 C CB   . ALA C 1 109 ? 9.877   24.035  39.203 1.00 15.86  ?  154 ALA C CB   1 
ATOM   4861 H H    . ALA C 1 109 ? 11.825  23.458  37.848 1.00 18.09  ?  154 ALA C H    1 
ATOM   4862 H HA   . ALA C 1 109 ? 9.364   22.547  37.890 1.00 18.33  ?  154 ALA C HA   1 
ATOM   4863 H HB1  . ALA C 1 109 ? 8.966   24.208  39.489 1.00 19.03  ?  154 ALA C HB1  1 
ATOM   4864 H HB2  . ALA C 1 109 ? 10.310  23.430  39.826 1.00 19.03  ?  154 ALA C HB2  1 
ATOM   4865 H HB3  . ALA C 1 109 ? 10.372  24.867  39.150 1.00 19.03  ?  154 ALA C HB3  1 
ATOM   4866 N N    . MET C 1 110 ? 9.774   25.320  36.339 1.00 13.88  ?  155 MET C N    1 
ATOM   4867 C CA   . MET C 1 110 ? 9.153   26.203  35.360 1.00 15.97  ?  155 MET C CA   1 
ATOM   4868 C C    . MET C 1 110 ? 8.885   25.461  34.056 1.00 15.83  ?  155 MET C C    1 
ATOM   4869 O O    . MET C 1 110 ? 7.779   25.529  33.505 1.00 14.79  ?  155 MET C O    1 
ATOM   4870 C CB   . MET C 1 110 ? 10.051  27.416  35.124 1.00 11.35  ?  155 MET C CB   1 
ATOM   4871 C CG   . MET C 1 110 ? 9.539   28.389  34.082 1.00 16.49  ?  155 MET C CG   1 
ATOM   4872 S SD   . MET C 1 110 ? 10.611  29.828  33.937 1.00 14.94  ?  155 MET C SD   1 
ATOM   4873 C CE   . MET C 1 110 ? 12.151  29.099  33.371 1.00 13.40  ?  155 MET C CE   1 
ATOM   4874 H H    . MET C 1 110 ? 10.577  25.537  36.556 1.00 16.65  ?  155 MET C H    1 
ATOM   4875 H HA   . MET C 1 110 ? 8.310   26.522  35.717 1.00 19.16  ?  155 MET C HA   1 
ATOM   4876 H HB2  . MET C 1 110 ? 10.141  27.902  35.959 1.00 13.62  ?  155 MET C HB2  1 
ATOM   4877 H HB3  . MET C 1 110 ? 10.922  27.105  34.832 1.00 13.62  ?  155 MET C HB3  1 
ATOM   4878 H HG2  . MET C 1 110 ? 9.506   27.946  33.219 1.00 19.79  ?  155 MET C HG2  1 
ATOM   4879 H HG3  . MET C 1 110 ? 8.654   28.693  34.336 1.00 19.79  ?  155 MET C HG3  1 
ATOM   4880 H HE1  . MET C 1 110 ? 12.810  29.802  33.259 1.00 16.09  ?  155 MET C HE1  1 
ATOM   4881 H HE2  . MET C 1 110 ? 12.458  28.459  34.032 1.00 16.09  ?  155 MET C HE2  1 
ATOM   4882 H HE3  . MET C 1 110 ? 11.996  28.652  32.525 1.00 16.09  ?  155 MET C HE3  1 
ATOM   4883 N N    . LEU C 1 111 ? 9.884   24.739  33.548 1.00 14.53  ?  156 LEU C N    1 
ATOM   4884 C CA   . LEU C 1 111 ? 9.680   23.981  32.317 1.00 18.05  ?  156 LEU C CA   1 
ATOM   4885 C C    . LEU C 1 111 ? 8.594   22.924  32.495 1.00 15.15  ?  156 LEU C C    1 
ATOM   4886 O O    . LEU C 1 111 ? 7.784   22.696  31.589 1.00 12.63  ?  156 LEU C O    1 
ATOM   4887 C CB   . LEU C 1 111 ? 10.995  23.339  31.869 1.00 18.35  ?  156 LEU C CB   1 
ATOM   4888 C CG   . LEU C 1 111 ? 12.107  24.281  31.384 1.00 20.18  ?  156 LEU C CG   1 
ATOM   4889 C CD1  . LEU C 1 111 ? 13.313  23.488  30.900 1.00 20.26  ?  156 LEU C CD1  1 
ATOM   4890 C CD2  . LEU C 1 111 ? 11.623  25.207  30.289 1.00 22.32  ?  156 LEU C CD2  1 
ATOM   4891 H H    . LEU C 1 111 ? 10.670  24.671  33.889 1.00 17.44  ?  156 LEU C H    1 
ATOM   4892 H HA   . LEU C 1 111 ? 9.392   24.589  31.618 1.00 21.66  ?  156 LEU C HA   1 
ATOM   4893 H HB2  . LEU C 1 111 ? 11.354  22.836  32.617 1.00 22.02  ?  156 LEU C HB2  1 
ATOM   4894 H HB3  . LEU C 1 111 ? 10.799  22.730  31.140 1.00 22.02  ?  156 LEU C HB3  1 
ATOM   4895 H HG   . LEU C 1 111 ? 12.396  24.831  32.130 1.00 24.22  ?  156 LEU C HG   1 
ATOM   4896 H HD11 . LEU C 1 111 ? 13.998  24.106  30.600 1.00 24.31  ?  156 LEU C HD11 1 
ATOM   4897 H HD12 . LEU C 1 111 ? 13.651  22.949  31.632 1.00 24.31  ?  156 LEU C HD12 1 
ATOM   4898 H HD13 . LEU C 1 111 ? 13.040  22.915  30.166 1.00 24.31  ?  156 LEU C HD13 1 
ATOM   4899 H HD21 . LEU C 1 111 ? 12.355  25.781  30.015 1.00 26.79  ?  156 LEU C HD21 1 
ATOM   4900 H HD22 . LEU C 1 111 ? 11.320  24.675  29.537 1.00 26.79  ?  156 LEU C HD22 1 
ATOM   4901 H HD23 . LEU C 1 111 ? 10.891  25.744  30.631 1.00 26.79  ?  156 LEU C HD23 1 
ATOM   4902 N N    . GLY C 1 112 ? 8.554   22.277  33.659 1.00 18.22  ?  157 GLY C N    1 
ATOM   4903 C CA   . GLY C 1 112 ? 7.556   21.262  33.938 1.00 16.24  ?  157 GLY C CA   1 
ATOM   4904 C C    . GLY C 1 112 ? 6.170   21.778  34.241 1.00 18.64  ?  157 GLY C C    1 
ATOM   4905 O O    . GLY C 1 112 ? 5.276   20.980  34.543 1.00 17.21  ?  157 GLY C O    1 
ATOM   4906 H H    . GLY C 1 112 ? 9.102   22.414  34.308 1.00 21.86  ?  157 GLY C H    1 
ATOM   4907 H HA2  . GLY C 1 112 ? 7.491   20.669  33.172 1.00 19.49  ?  157 GLY C HA2  1 
ATOM   4908 H HA3  . GLY C 1 112 ? 7.849   20.735  34.698 1.00 19.49  ?  157 GLY C HA3  1 
ATOM   4909 N N    . GLU C 1 113 ? 5.969   23.095  34.174 1.00 16.28  ?  158 GLU C N    1 
ATOM   4910 C CA   . GLU C 1 113 ? 4.670   23.720  34.431 1.00 18.36  ?  158 GLU C CA   1 
ATOM   4911 C C    . GLU C 1 113 ? 4.190   23.454  35.858 1.00 21.32  ?  158 GLU C C    1 
ATOM   4912 O O    . GLU C 1 113 ? 3.009   23.199  36.102 1.00 21.96  ?  158 GLU C O    1 
ATOM   4913 C CB   . GLU C 1 113 ? 3.628   23.263  33.405 1.00 18.00  ?  158 GLU C CB   1 
ATOM   4914 C CG   . GLU C 1 113 ? 3.823   23.879  32.024 1.00 19.10  ?  158 GLU C CG   1 
ATOM   4915 C CD   . GLU C 1 113 ? 3.740   25.399  32.055 1.00 22.78  ?  158 GLU C CD   1 
ATOM   4916 O OE1  . GLU C 1 113 ? 2.828   25.928  32.722 1.00 27.71  ?  158 GLU C OE1  1 
ATOM   4917 O OE2  . GLU C 1 113 ? 4.594   26.065  31.434 1.00 24.31  -1 158 GLU C OE2  1 
ATOM   4918 H H    . GLU C 1 113 ? 6.586   23.662  33.977 1.00 19.54  ?  158 GLU C H    1 
ATOM   4919 H HA   . GLU C 1 113 ? 4.769   24.680  34.334 1.00 22.03  ?  158 GLU C HA   1 
ATOM   4920 H HB2  . GLU C 1 113 ? 3.683   22.299  33.311 1.00 21.60  ?  158 GLU C HB2  1 
ATOM   4921 H HB3  . GLU C 1 113 ? 2.746   23.514  33.721 1.00 21.60  ?  158 GLU C HB3  1 
ATOM   4922 H HG2  . GLU C 1 113 ? 4.698   23.632  31.687 1.00 22.92  ?  158 GLU C HG2  1 
ATOM   4923 H HG3  . GLU C 1 113 ? 3.131   23.551  31.429 1.00 22.92  ?  158 GLU C HG3  1 
ATOM   4924 N N    . GLN C 1 114 ? 5.110   23.543  36.816 1.00 16.49  ?  159 GLN C N    1 
ATOM   4925 C CA   . GLN C 1 114 ? 4.776   23.304  38.214 1.00 19.59  ?  159 GLN C CA   1 
ATOM   4926 C C    . GLN C 1 114 ? 4.107   24.495  38.890 1.00 20.27  ?  159 GLN C C    1 
ATOM   4927 O O    . GLN C 1 114 ? 3.570   24.338  39.991 1.00 20.85  ?  159 GLN C O    1 
ATOM   4928 C CB   . GLN C 1 114 ? 6.039   22.928  38.990 1.00 17.96  ?  159 GLN C CB   1 
ATOM   4929 C CG   . GLN C 1 114 ? 6.607   21.578  38.600 1.00 18.38  ?  159 GLN C CG   1 
ATOM   4930 C CD   . GLN C 1 114 ? 5.668   20.445  38.943 1.00 18.28  ?  159 GLN C CD   1 
ATOM   4931 O OE1  . GLN C 1 114 ? 5.116   20.396  40.040 1.00 20.42  ?  159 GLN C OE1  1 
ATOM   4932 N NE2  . GLN C 1 114 ? 5.476   19.525  38.002 1.00 21.07  ?  159 GLN C NE2  1 
ATOM   4933 H H    . GLN C 1 114 ? 5.936   23.740  36.680 1.00 19.79  ?  159 GLN C H    1 
ATOM   4934 H HA   . GLN C 1 114 ? 4.163   22.554  38.264 1.00 23.50  ?  159 GLN C HA   1 
ATOM   4935 H HB2  . GLN C 1 114 ? 6.720   23.597  38.824 1.00 21.55  ?  159 GLN C HB2  1 
ATOM   4936 H HB3  . GLN C 1 114 ? 5.828   22.900  39.937 1.00 21.55  ?  159 GLN C HB3  1 
ATOM   4937 H HG2  . GLN C 1 114 ? 6.763   21.563  37.643 1.00 22.05  ?  159 GLN C HG2  1 
ATOM   4938 H HG3  . GLN C 1 114 ? 7.440   21.435  39.076 1.00 22.05  ?  159 GLN C HG3  1 
ATOM   4939 H HE21 . GLN C 1 114 ? 5.878   19.595  37.245 1.00 25.29  ?  159 GLN C HE21 1 
ATOM   4940 H HE22 . GLN C 1 114 ? 4.950   18.861  38.150 1.00 25.29  ?  159 GLN C HE22 1 
ATOM   4941 N N    . PHE C 1 115 ? 4.115   25.675  38.271 1.00 19.46  ?  160 PHE C N    1 
ATOM   4942 C CA   . PHE C 1 115 ? 3.594   26.851  38.957 1.00 19.08  ?  160 PHE C CA   1 
ATOM   4943 C C    . PHE C 1 115 ? 2.082   26.977  38.791 1.00 21.30  ?  160 PHE C C    1 
ATOM   4944 O O    . PHE C 1 115 ? 1.389   27.399  39.724 1.00 25.77  ?  160 PHE C O    1 
ATOM   4945 C CB   . PHE C 1 115 ? 4.328   28.094  38.459 1.00 19.07  ?  160 PHE C CB   1 
ATOM   4946 C CG   . PHE C 1 115 ? 5.758   28.149  38.915 1.00 15.56  ?  160 PHE C CG   1 
ATOM   4947 C CD1  . PHE C 1 115 ? 6.755   27.527  38.185 1.00 15.91  ?  160 PHE C CD1  1 
ATOM   4948 C CD2  . PHE C 1 115 ? 6.098   28.793  40.090 1.00 14.83  ?  160 PHE C CD2  1 
ATOM   4949 C CE1  . PHE C 1 115 ? 8.064   27.554  38.612 1.00 15.42  ?  160 PHE C CE1  1 
ATOM   4950 C CE2  . PHE C 1 115 ? 7.411   28.827  40.523 1.00 15.52  ?  160 PHE C CE2  1 
ATOM   4951 C CZ   . PHE C 1 115 ? 8.395   28.209  39.781 1.00 16.20  ?  160 PHE C CZ   1 
ATOM   4952 H H    . PHE C 1 115 ? 4.409   25.817  37.476 1.00 23.35  ?  160 PHE C H    1 
ATOM   4953 H HA   . PHE C 1 115 ? 3.777   26.763  39.905 1.00 22.89  ?  160 PHE C HA   1 
ATOM   4954 H HB2  . PHE C 1 115 ? 4.322   28.096  37.489 1.00 22.88  ?  160 PHE C HB2  1 
ATOM   4955 H HB3  . PHE C 1 115 ? 3.875   28.883  38.795 1.00 22.88  ?  160 PHE C HB3  1 
ATOM   4956 H HD1  . PHE C 1 115 ? 6.538   27.083  37.397 1.00 19.09  ?  160 PHE C HD1  1 
ATOM   4957 H HD2  . PHE C 1 115 ? 5.437   29.210  40.594 1.00 17.80  ?  160 PHE C HD2  1 
ATOM   4958 H HE1  . PHE C 1 115 ? 8.727   27.138  38.108 1.00 18.51  ?  160 PHE C HE1  1 
ATOM   4959 H HE2  . PHE C 1 115 ? 7.630   29.269  41.312 1.00 18.63  ?  160 PHE C HE2  1 
ATOM   4960 H HZ   . PHE C 1 115 ? 9.280   28.232  40.068 1.00 19.44  ?  160 PHE C HZ   1 
ATOM   4961 N N    . MET C 1 116 ? 1.554   26.603  37.627 1.00 22.75  ?  161 MET C N    1 
ATOM   4962 C CA   A MET C 1 116 ? 0.111   26.579  37.392 0.50 24.19  ?  161 MET C CA   1 
ATOM   4963 C CA   B MET C 1 116 ? 0.111   26.580  37.386 0.50 24.19  ?  161 MET C CA   1 
ATOM   4964 C C    . MET C 1 116 ? -0.507  27.955  37.646 1.00 24.39  ?  161 MET C C    1 
ATOM   4965 O O    . MET C 1 116 ? -1.418  28.122  38.461 1.00 29.10  ?  161 MET C O    1 
ATOM   4966 C CB   A MET C 1 116 ? -0.554  25.506  38.259 0.50 27.57  ?  161 MET C CB   1 
ATOM   4967 C CB   B MET C 1 116 ? -0.563  25.499  38.239 0.50 27.56  ?  161 MET C CB   1 
ATOM   4968 C CG   A MET C 1 116 ? 0.054   24.124  38.083 0.50 28.18  ?  161 MET C CG   1 
ATOM   4969 C CG   B MET C 1 116 ? -0.109  24.082  37.908 0.50 28.30  ?  161 MET C CG   1 
ATOM   4970 S SD   A MET C 1 116 ? -0.716  22.867  39.118 0.50 31.43  ?  161 MET C SD   1 
ATOM   4971 S SD   B MET C 1 116 ? -0.563  23.560  36.238 0.50 30.78  ?  161 MET C SD   1 
ATOM   4972 C CE   A MET C 1 116 ? 0.221   21.425  38.622 0.50 33.18  ?  161 MET C CE   1 
ATOM   4973 C CE   B MET C 1 116 ? -2.341  23.415  36.397 0.50 30.47  ?  161 MET C CE   1 
ATOM   4974 H H    A MET C 1 116 ? 2.018   26.354  36.947 0.50 27.31  ?  161 MET C H    1 
ATOM   4975 H H    B MET C 1 116 ? 2.019   26.353  36.949 0.50 27.31  ?  161 MET C H    1 
ATOM   4976 H HA   A MET C 1 116 ? -0.044  26.340  36.465 0.50 29.03  ?  161 MET C HA   1 
ATOM   4977 H HA   B MET C 1 116 ? -0.039  26.349  36.456 0.50 29.03  ?  161 MET C HA   1 
ATOM   4978 H HB2  A MET C 1 116 ? -0.463  25.755  39.192 0.50 33.08  ?  161 MET C HB2  1 
ATOM   4979 H HB2  B MET C 1 116 ? -0.359  25.666  39.172 0.50 33.07  ?  161 MET C HB2  1 
ATOM   4980 H HB3  A MET C 1 116 ? -1.494  25.450  38.024 0.50 33.08  ?  161 MET C HB3  1 
ATOM   4981 H HB3  B MET C 1 116 ? -1.522  25.544  38.099 0.50 33.07  ?  161 MET C HB3  1 
ATOM   4982 H HG2  A MET C 1 116 ? -0.048  23.852  37.158 0.50 33.82  ?  161 MET C HG2  1 
ATOM   4983 H HG2  B MET C 1 116 ? 0.858   24.037  37.982 0.50 33.96  ?  161 MET C HG2  1 
ATOM   4984 H HG3  A MET C 1 116 ? 0.995   24.164  38.314 0.50 33.82  ?  161 MET C HG3  1 
ATOM   4985 H HG3  B MET C 1 116 ? -0.518  23.466  38.535 0.50 33.96  ?  161 MET C HG3  1 
ATOM   4986 H HE1  A MET C 1 116 ? -0.100  20.655  39.117 0.50 39.82  ?  161 MET C HE1  1 
ATOM   4987 H HE1  B MET C 1 116 ? -2.711  23.133  35.545 0.50 36.57  ?  161 MET C HE1  1 
ATOM   4988 H HE2  A MET C 1 116 ? 0.100   21.281  37.671 0.50 39.82  ?  161 MET C HE2  1 
ATOM   4989 H HE2  B MET C 1 116 ? -2.544  22.756  37.080 0.50 36.57  ?  161 MET C HE2  1 
ATOM   4990 H HE3  A MET C 1 116 ? 1.159   21.576  38.817 0.50 39.82  ?  161 MET C HE3  1 
ATOM   4991 H HE3  B MET C 1 116 ? -2.707  24.277  36.649 0.50 36.57  ?  161 MET C HE3  1 
ATOM   4992 N N    . VAL C 1 117 ? 0.009   28.945  36.921 1.00 19.89  ?  162 VAL C N    1 
ATOM   4993 C CA   . VAL C 1 117 ? -0.488  30.313  36.988 1.00 23.97  ?  162 VAL C CA   1 
ATOM   4994 C C    . VAL C 1 117 ? -0.797  30.770  35.571 1.00 19.77  ?  162 VAL C C    1 
ATOM   4995 O O    . VAL C 1 117 ? -0.506  31.909  35.195 1.00 20.56  ?  162 VAL C O    1 
ATOM   4996 C CB   . VAL C 1 117 ? 0.524   31.251  37.672 1.00 21.62  ?  162 VAL C CB   1 
ATOM   4997 C CG1  . VAL C 1 117 ? 0.635   30.922  39.150 1.00 22.85  ?  162 VAL C CG1  1 
ATOM   4998 C CG2  . VAL C 1 117 ? 1.884   31.151  36.999 1.00 19.77  ?  162 VAL C CG2  1 
ATOM   4999 H H    . VAL C 1 117 ? 0.663   28.845  36.371 1.00 23.87  ?  162 VAL C H    1 
ATOM   5000 H HA   . VAL C 1 117 ? -1.312  30.330  37.500 1.00 28.77  ?  162 VAL C HA   1 
ATOM   5001 H HB   . VAL C 1 117 ? 0.214   32.166  37.590 1.00 25.95  ?  162 VAL C HB   1 
ATOM   5002 H HG11 . VAL C 1 117 ? 1.277   31.524  39.559 1.00 27.43  ?  162 VAL C HG11 1 
ATOM   5003 H HG12 . VAL C 1 117 ? -0.235  31.034  39.564 1.00 27.43  ?  162 VAL C HG12 1 
ATOM   5004 H HG13 . VAL C 1 117 ? 0.933   30.004  39.247 1.00 27.43  ?  162 VAL C HG13 1 
ATOM   5005 H HG21 . VAL C 1 117 ? 2.502   31.750  37.447 1.00 23.72  ?  162 VAL C HG21 1 
ATOM   5006 H HG22 . VAL C 1 117 ? 2.202   30.237  37.064 1.00 23.72  ?  162 VAL C HG22 1 
ATOM   5007 H HG23 . VAL C 1 117 ? 1.794   31.405  36.067 1.00 23.72  ?  162 VAL C HG23 1 
ATOM   5008 N N    . GLY C 1 118 ? -1.375  29.878  34.774 1.00 21.65  ?  163 GLY C N    1 
ATOM   5009 C CA   . GLY C 1 118 ? -1.713  30.229  33.404 1.00 21.47  ?  163 GLY C CA   1 
ATOM   5010 C C    . GLY C 1 118 ? -0.499  30.699  32.628 1.00 22.20  ?  163 GLY C C    1 
ATOM   5011 O O    . GLY C 1 118 ? 0.554   30.052  32.614 1.00 18.87  ?  163 GLY C O    1 
ATOM   5012 H H    . GLY C 1 118 ? -1.578  29.074  34.999 1.00 25.98  ?  163 GLY C H    1 
ATOM   5013 H HA2  . GLY C 1 118 ? -2.088  29.456  32.954 1.00 25.76  ?  163 GLY C HA2  1 
ATOM   5014 H HA3  . GLY C 1 118 ? -2.375  30.938  33.404 1.00 25.76  ?  163 GLY C HA3  1 
ATOM   5015 N N    . GLU C 1 119 ? -0.643  31.854  31.980 1.00 20.84  ?  164 GLU C N    1 
ATOM   5016 C CA   A GLU C 1 119 ? 0.391   32.413  31.122 0.50 21.95  ?  164 GLU C CA   1 
ATOM   5017 C CA   B GLU C 1 119 ? 0.388   32.420  31.121 0.50 21.93  ?  164 GLU C CA   1 
ATOM   5018 C C    . GLU C 1 119 ? 1.290   33.408  31.847 1.00 20.42  ?  164 GLU C C    1 
ATOM   5019 O O    . GLU C 1 119 ? 2.068   34.110  31.193 1.00 19.55  ?  164 GLU C O    1 
ATOM   5020 C CB   A GLU C 1 119 ? -0.254  33.102  29.916 0.50 23.04  ?  164 GLU C CB   1 
ATOM   5021 C CB   B GLU C 1 119 ? -0.261  33.119  29.924 0.50 22.85  ?  164 GLU C CB   1 
ATOM   5022 C CG   A GLU C 1 119 ? -1.395  32.320  29.280 0.50 24.17  ?  164 GLU C CG   1 
ATOM   5023 C CG   B GLU C 1 119 ? -0.967  32.183  28.966 0.50 24.45  ?  164 GLU C CG   1 
ATOM   5024 C CD   A GLU C 1 119 ? -0.962  30.956  28.782 0.50 23.78  ?  164 GLU C CD   1 
ATOM   5025 C CD   B GLU C 1 119 ? -0.035  31.622  27.912 0.50 24.55  ?  164 GLU C CD   1 
ATOM   5026 O OE1  A GLU C 1 119 ? -1.311  29.942  29.421 0.50 21.70  ?  164 GLU C OE1  1 
ATOM   5027 O OE1  B GLU C 1 119 ? 0.510   32.416  27.115 0.50 23.30  ?  164 GLU C OE1  1 
ATOM   5028 O OE2  A GLU C 1 119 ? -0.257  30.898  27.754 0.50 25.54  -1 164 GLU C OE2  1 
ATOM   5029 O OE2  B GLU C 1 119 ? 0.159   30.388  27.888 0.50 25.26  -1 164 GLU C OE2  1 
ATOM   5030 H H    A GLU C 1 119 ? -1.350  32.341  32.026 0.50 25.01  ?  164 GLU C H    1 
ATOM   5031 H H    B GLU C 1 119 ? -1.351  32.340  32.026 0.50 25.01  ?  164 GLU C H    1 
ATOM   5032 H HA   A GLU C 1 119 ? 0.949   31.692  30.791 0.50 26.34  ?  164 GLU C HA   1 
ATOM   5033 H HA   B GLU C 1 119 ? 0.944   31.701  30.782 0.50 26.32  ?  164 GLU C HA   1 
ATOM   5034 H HB2  A GLU C 1 119 ? -0.607  33.959  30.201 0.50 27.65  ?  164 GLU C HB2  1 
ATOM   5035 H HB2  B GLU C 1 119 ? -0.916  33.755  30.252 0.50 27.42  ?  164 GLU C HB2  1 
ATOM   5036 H HB3  A GLU C 1 119 ? 0.425   33.238  29.237 0.50 27.65  ?  164 GLU C HB3  1 
ATOM   5037 H HB3  B GLU C 1 119 ? 0.428   33.586  29.426 0.50 27.42  ?  164 GLU C HB3  1 
ATOM   5038 H HG2  A GLU C 1 119 ? -2.095  32.191  29.938 0.50 29.01  ?  164 GLU C HG2  1 
ATOM   5039 H HG2  B GLU C 1 119 ? -1.338  31.439  29.466 0.50 29.33  ?  164 GLU C HG2  1 
ATOM   5040 H HG3  A GLU C 1 119 ? -1.738  32.821  28.524 0.50 29.01  ?  164 GLU C HG3  1 
ATOM   5041 H HG3  B GLU C 1 119 ? -1.675  32.668  28.514 0.50 29.33  ?  164 GLU C HG3  1 
ATOM   5042 N N    . GLU C 1 120 ? 1.217   33.468  33.178 1.00 16.58  ?  165 GLU C N    1 
ATOM   5043 C CA   . GLU C 1 120 ? 1.827   34.571  33.914 1.00 17.66  ?  165 GLU C CA   1 
ATOM   5044 C C    . GLU C 1 120 ? 3.351   34.512  33.938 1.00 17.27  ?  165 GLU C C    1 
ATOM   5045 O O    . GLU C 1 120 ? 3.997   35.560  34.051 1.00 13.84  ?  165 GLU C O    1 
ATOM   5046 C CB   . GLU C 1 120 ? 1.283   34.599  35.339 1.00 14.91  ?  165 GLU C CB   1 
ATOM   5047 C CG   . GLU C 1 120 ? 0.055   35.483  35.494 1.00 19.37  ?  165 GLU C CG   1 
ATOM   5048 C CD   . GLU C 1 120 ? 0.388   36.961  35.379 1.00 19.81  ?  165 GLU C CD   1 
ATOM   5049 O OE1  . GLU C 1 120 ? -0.299  37.673  34.614 1.00 17.89  ?  165 GLU C OE1  1 
ATOM   5050 O OE2  . GLU C 1 120 ? 1.352   37.406  36.042 1.00 19.50  -1 165 GLU C OE2  1 
ATOM   5051 H H    . GLU C 1 120 ? 0.822   32.886  33.673 1.00 19.89  ?  165 GLU C H    1 
ATOM   5052 H HA   . GLU C 1 120 ? 1.573   35.404  33.487 1.00 21.19  ?  165 GLU C HA   1 
ATOM   5053 H HB2  . GLU C 1 120 ? 1.037   33.698  35.600 1.00 17.89  ?  165 GLU C HB2  1 
ATOM   5054 H HB3  . GLU C 1 120 ? 1.972   34.938  35.932 1.00 17.89  ?  165 GLU C HB3  1 
ATOM   5055 H HG2  . GLU C 1 120 ? -0.584  35.263  34.797 1.00 23.24  ?  165 GLU C HG2  1 
ATOM   5056 H HG3  . GLU C 1 120 ? -0.338  35.329  36.367 1.00 23.24  ?  165 GLU C HG3  1 
ATOM   5057 N N    . ILE C 1 121 ? 3.949   33.324  33.852 1.00 14.64  ?  166 ILE C N    1 
ATOM   5058 C CA   . ILE C 1 121 ? 5.399   33.231  33.972 1.00 14.39  ?  166 ILE C CA   1 
ATOM   5059 C C    . ILE C 1 121 ? 6.056   33.832  32.739 1.00 15.03  ?  166 ILE C C    1 
ATOM   5060 O O    . ILE C 1 121 ? 5.615   33.613  31.603 1.00 15.02  ?  166 ILE C O    1 
ATOM   5061 C CB   . ILE C 1 121 ? 5.850   31.773  34.171 1.00 14.74  ?  166 ILE C CB   1 
ATOM   5062 C CG1  . ILE C 1 121 ? 5.187   31.155  35.405 1.00 18.40  ?  166 ILE C CG1  1 
ATOM   5063 C CG2  . ILE C 1 121 ? 7.379   31.707  34.294 1.00 12.75  ?  166 ILE C CG2  1 
ATOM   5064 C CD1  . ILE C 1 121 ? 5.512   31.859  36.711 1.00 16.48  ?  166 ILE C CD1  1 
ATOM   5065 H H    . ILE C 1 121 ? 3.546   32.574  33.728 1.00 17.56  ?  166 ILE C H    1 
ATOM   5066 H HA   . ILE C 1 121 ? 5.686   33.743  34.745 1.00 17.26  ?  166 ILE C HA   1 
ATOM   5067 H HB   . ILE C 1 121 ? 5.584   31.261  33.391 1.00 17.69  ?  166 ILE C HB   1 
ATOM   5068 H HG12 . ILE C 1 121 ? 4.224   31.183  35.286 1.00 22.08  ?  166 ILE C HG12 1 
ATOM   5069 H HG13 . ILE C 1 121 ? 5.480   30.234  35.486 1.00 22.08  ?  166 ILE C HG13 1 
ATOM   5070 H HG21 . ILE C 1 121 ? 7.645   30.783  34.419 1.00 15.30  ?  166 ILE C HG21 1 
ATOM   5071 H HG22 . ILE C 1 121 ? 7.776   32.060  33.483 1.00 15.30  ?  166 ILE C HG22 1 
ATOM   5072 H HG23 . ILE C 1 121 ? 7.656   32.238  35.057 1.00 15.30  ?  166 ILE C HG23 1 
ATOM   5073 H HD11 . ILE C 1 121 ? 5.053   31.406  37.436 1.00 19.77  ?  166 ILE C HD11 1 
ATOM   5074 H HD12 . ILE C 1 121 ? 6.470   31.830  36.856 1.00 19.77  ?  166 ILE C HD12 1 
ATOM   5075 H HD13 . ILE C 1 121 ? 5.213   32.781  36.656 1.00 19.77  ?  166 ILE C HD13 1 
ATOM   5076 N N    . CYS C 1 122 ? 7.125   34.594  32.958 1.00 14.52  ?  167 CYS C N    1 
ATOM   5077 C CA   . CYS C 1 122 ? 7.957   35.098  31.875 1.00 13.36  ?  167 CYS C CA   1 
ATOM   5078 C C    . CYS C 1 122 ? 9.279   34.361  31.759 1.00 12.24  ?  167 CYS C C    1 
ATOM   5079 O O    . CYS C 1 122 ? 9.697   34.016  30.650 1.00 12.43  ?  167 CYS C O    1 
ATOM   5080 C CB   . CYS C 1 122 ? 8.231   36.596  32.069 1.00 13.02  ?  167 CYS C CB   1 
ATOM   5081 S SG   . CYS C 1 122 ? 6.726   37.596  32.184 1.00 15.51  ?  167 CYS C SG   1 
ATOM   5082 H H    . CYS C 1 122 ? 7.391   34.836  33.739 1.00 17.42  ?  167 CYS C H    1 
ATOM   5083 H HA   . CYS C 1 122 ? 7.481   34.988  31.037 1.00 16.04  ?  167 CYS C HA   1 
ATOM   5084 H HB2  . CYS C 1 122 ? 8.734   36.719  32.889 1.00 15.62  ?  167 CYS C HB2  1 
ATOM   5085 H HB3  . CYS C 1 122 ? 8.747   36.920  31.314 1.00 15.62  ?  167 CYS C HB3  1 
ATOM   5086 H HG   . CYS C 1 122 ? 7.032   38.747  32.333 1.00 18.61  ?  167 CYS C HG   1 
ATOM   5087 N N    . GLY C 1 123 ? 9.940   34.107  32.879 1.00 11.72  ?  168 GLY C N    1 
ATOM   5088 C CA   . GLY C 1 123 ? 11.215  33.423  32.854 1.00 12.37  ?  168 GLY C CA   1 
ATOM   5089 C C    . GLY C 1 123 ? 11.864  33.452  34.217 1.00 9.98   ?  168 GLY C C    1 
ATOM   5090 O O    . GLY C 1 123 ? 11.294  33.931  35.204 1.00 12.33  ?  168 GLY C O    1 
ATOM   5091 H H    . GLY C 1 123 ? 9.669   34.322  33.666 1.00 14.06  ?  168 GLY C H    1 
ATOM   5092 H HA2  . GLY C 1 123 ? 11.087  32.499  32.588 1.00 14.85  ?  168 GLY C HA2  1 
ATOM   5093 H HA3  . GLY C 1 123 ? 11.806  33.853  32.216 1.00 14.85  ?  168 GLY C HA3  1 
ATOM   5094 N N    . ALA C 1 124 ? 13.082  32.932  34.247 1.00 9.98   ?  169 ALA C N    1 
ATOM   5095 C CA   . ALA C 1 124 ? 13.843  32.802  35.473 1.00 9.23   ?  169 ALA C CA   1 
ATOM   5096 C C    . ALA C 1 124 ? 15.249  33.317  35.234 1.00 9.36   ?  169 ALA C C    1 
ATOM   5097 O O    . ALA C 1 124 ? 15.747  33.315  34.104 1.00 9.13   ?  169 ALA C O    1 
ATOM   5098 C CB   . ALA C 1 124 ? 13.893  31.349  35.956 1.00 10.41  ?  169 ALA C CB   1 
ATOM   5099 H H    . ALA C 1 124 ? 13.497  32.642  33.552 1.00 11.98  ?  169 ALA C H    1 
ATOM   5100 H HA   . ALA C 1 124 ? 13.432  33.342  36.166 1.00 11.07  ?  169 ALA C HA   1 
ATOM   5101 H HB1  . ALA C 1 124 ? 14.410  31.308  36.776 1.00 12.49  ?  169 ALA C HB1  1 
ATOM   5102 H HB2  . ALA C 1 124 ? 12.989  31.039  36.119 1.00 12.49  ?  169 ALA C HB2  1 
ATOM   5103 H HB3  . ALA C 1 124 ? 14.312  30.804  35.272 1.00 12.49  ?  169 ALA C HB3  1 
ATOM   5104 N N    . VAL C 1 125 ? 15.875  33.765  36.316 1.00 11.43  ?  170 VAL C N    1 
ATOM   5105 C CA   . VAL C 1 125 ? 17.207  34.348  36.272 1.00 12.13  ?  170 VAL C CA   1 
ATOM   5106 C C    . VAL C 1 125 ? 18.003  33.833  37.458 1.00 11.31  ?  170 VAL C C    1 
ATOM   5107 O O    . VAL C 1 125 ? 17.473  33.689  38.563 1.00 12.93  ?  170 VAL C O    1 
ATOM   5108 C CB   . VAL C 1 125 ? 17.153  35.888  36.299 1.00 12.33  ?  170 VAL C CB   1 
ATOM   5109 C CG1  . VAL C 1 125 ? 18.546  36.468  36.147 1.00 13.38  ?  170 VAL C CG1  1 
ATOM   5110 C CG2  . VAL C 1 125 ? 16.212  36.416  35.218 1.00 15.72  ?  170 VAL C CG2  1 
ATOM   5111 H H    . VAL C 1 125 ? 15.538  33.740  37.107 1.00 13.71  ?  170 VAL C H    1 
ATOM   5112 H HA   . VAL C 1 125 ? 17.655  34.070  35.457 1.00 14.56  ?  170 VAL C HA   1 
ATOM   5113 H HB   . VAL C 1 125 ? 16.805  36.173  37.158 1.00 14.80  ?  170 VAL C HB   1 
ATOM   5114 H HG11 . VAL C 1 125 ? 18.488  37.436  36.166 1.00 16.05  ?  170 VAL C HG11 1 
ATOM   5115 H HG12 . VAL C 1 125 ? 19.100  36.155  36.879 1.00 16.05  ?  170 VAL C HG12 1 
ATOM   5116 H HG13 . VAL C 1 125 ? 18.919  36.176  35.300 1.00 16.05  ?  170 VAL C HG13 1 
ATOM   5117 H HG21 . VAL C 1 125 ? 16.198  37.385  35.258 1.00 18.86  ?  170 VAL C HG21 1 
ATOM   5118 H HG22 . VAL C 1 125 ? 16.534  36.125  34.351 1.00 18.86  ?  170 VAL C HG22 1 
ATOM   5119 H HG23 . VAL C 1 125 ? 15.322  36.064  35.376 1.00 18.86  ?  170 VAL C HG23 1 
ATOM   5120 N N    . VAL C 1 126 ? 19.282  33.566  37.227 1.00 13.31  ?  171 VAL C N    1 
ATOM   5121 C CA   . VAL C 1 126 ? 20.239  33.322  38.295 1.00 14.78  ?  171 VAL C CA   1 
ATOM   5122 C C    . VAL C 1 126 ? 21.381  34.305  38.103 1.00 14.55  ?  171 VAL C C    1 
ATOM   5123 O O    . VAL C 1 126 ? 21.895  34.462  36.987 1.00 12.94  ?  171 VAL C O    1 
ATOM   5124 C CB   . VAL C 1 126 ? 20.747  31.868  38.305 1.00 15.94  ?  171 VAL C CB   1 
ATOM   5125 C CG1  . VAL C 1 126 ? 21.360  31.506  36.972 1.00 15.72  ?  171 VAL C CG1  1 
ATOM   5126 C CG2  . VAL C 1 126 ? 21.744  31.657  39.441 1.00 15.43  ?  171 VAL C CG2  1 
ATOM   5127 H H    . VAL C 1 126 ? 19.627  33.520  36.441 1.00 15.98  ?  171 VAL C H    1 
ATOM   5128 H HA   . VAL C 1 126 ? 19.819  33.505  39.150 1.00 17.74  ?  171 VAL C HA   1 
ATOM   5129 H HB   . VAL C 1 126 ? 19.994  31.275  38.457 1.00 19.12  ?  171 VAL C HB   1 
ATOM   5130 H HG11 . VAL C 1 126 ? 21.671  30.588  37.007 1.00 18.87  ?  171 VAL C HG11 1 
ATOM   5131 H HG12 . VAL C 1 126 ? 20.689  31.602  36.279 1.00 18.87  ?  171 VAL C HG12 1 
ATOM   5132 H HG13 . VAL C 1 126 ? 22.106  32.101  36.796 1.00 18.87  ?  171 VAL C HG13 1 
ATOM   5133 H HG21 . VAL C 1 126 ? 22.048  30.737  39.427 1.00 18.52  ?  171 VAL C HG21 1 
ATOM   5134 H HG22 . VAL C 1 126 ? 22.496  32.257  39.316 1.00 18.52  ?  171 VAL C HG22 1 
ATOM   5135 H HG23 . VAL C 1 126 ? 21.305  31.848  40.285 1.00 18.52  ?  171 VAL C HG23 1 
ATOM   5136 N N    . SER C 1 127 ? 21.753  34.981  39.182 1.00 16.76  ?  172 SER C N    1 
ATOM   5137 C CA   . SER C 1 127 ? 22.774  36.016  39.156 1.00 21.39  ?  172 SER C CA   1 
ATOM   5138 C C    . SER C 1 127 ? 23.847  35.644  40.164 1.00 22.70  ?  172 SER C C    1 
ATOM   5139 O O    . SER C 1 127 ? 23.547  35.441  41.345 1.00 21.01  ?  172 SER C O    1 
ATOM   5140 C CB   . SER C 1 127 ? 22.172  37.382  39.485 1.00 23.01  ?  172 SER C CB   1 
ATOM   5141 O OG   . SER C 1 127 ? 20.975  37.593  38.754 1.00 26.22  ?  172 SER C OG   1 
ATOM   5142 H H    . SER C 1 127 ? 21.417  34.854  39.963 1.00 20.11  ?  172 SER C H    1 
ATOM   5143 H HA   . SER C 1 127 ? 23.177  36.058  38.274 1.00 25.67  ?  172 SER C HA   1 
ATOM   5144 H HB2  . SER C 1 127 ? 21.974  37.419  40.434 1.00 27.61  ?  172 SER C HB2  1 
ATOM   5145 H HB3  . SER C 1 127 ? 22.811  38.074  39.252 1.00 27.61  ?  172 SER C HB3  1 
ATOM   5146 H HG   . SER C 1 127 ? 21.132  37.562  37.930 1.00 31.46  ?  172 SER C HG   1 
ATOM   5147 N N    . VAL C 1 128 ? 25.089  35.553  39.704 1.00 25.39  ?  173 VAL C N    1 
ATOM   5148 C CA   . VAL C 1 128 ? 26.208  35.206  40.568 1.00 26.93  ?  173 VAL C CA   1 
ATOM   5149 C C    . VAL C 1 128 ? 26.940  36.485  40.946 1.00 26.01  ?  173 VAL C C    1 
ATOM   5150 O O    . VAL C 1 128 ? 27.331  37.273  40.075 1.00 26.09  ?  173 VAL C O    1 
ATOM   5151 C CB   . VAL C 1 128 ? 27.148  34.191  39.893 1.00 25.68  ?  173 VAL C CB   1 
ATOM   5152 C CG1  . VAL C 1 128 ? 26.383  32.914  39.572 1.00 31.48  ?  173 VAL C CG1  1 
ATOM   5153 C CG2  . VAL C 1 128 ? 27.779  34.766  38.632 1.00 35.22  ?  173 VAL C CG2  1 
ATOM   5154 H H    . VAL C 1 128 ? 25.311  35.689  38.885 1.00 30.47  ?  173 VAL C H    1 
ATOM   5155 H HA   . VAL C 1 128 ? 25.867  34.804  41.381 1.00 32.32  ?  173 VAL C HA   1 
ATOM   5156 H HB   . VAL C 1 128 ? 27.863  33.966  40.509 1.00 30.82  ?  173 VAL C HB   1 
ATOM   5157 H HG11 . VAL C 1 128 ? 26.986  32.284  39.148 1.00 37.77  ?  173 VAL C HG11 1 
ATOM   5158 H HG12 . VAL C 1 128 ? 26.037  32.538  40.396 1.00 37.77  ?  173 VAL C HG12 1 
ATOM   5159 H HG13 . VAL C 1 128 ? 25.651  33.128  38.972 1.00 37.77  ?  173 VAL C HG13 1 
ATOM   5160 H HG21 . VAL C 1 128 ? 28.362  34.099  38.238 1.00 42.26  ?  173 VAL C HG21 1 
ATOM   5161 H HG22 . VAL C 1 128 ? 27.075  35.002  38.007 1.00 42.26  ?  173 VAL C HG22 1 
ATOM   5162 H HG23 . VAL C 1 128 ? 28.291  35.556  38.867 1.00 42.26  ?  173 VAL C HG23 1 
ATOM   5163 N N    . ARG C 1 129 ? 27.091  36.701  42.248 1.00 30.32  ?  174 ARG C N    1 
ATOM   5164 C CA   . ARG C 1 129 ? 27.852  37.806  42.805 1.00 28.25  ?  174 ARG C CA   1 
ATOM   5165 C C    . ARG C 1 129 ? 28.828  37.229  43.823 1.00 30.89  ?  174 ARG C C    1 
ATOM   5166 O O    . ARG C 1 129 ? 28.807  36.030  44.119 1.00 35.24  ?  174 ARG C O    1 
ATOM   5167 C CB   . ARG C 1 129 ? 26.927  38.849  43.446 1.00 31.53  ?  174 ARG C CB   1 
ATOM   5168 C CG   . ARG C 1 129 ? 25.768  39.300  42.550 1.00 28.86  ?  174 ARG C CG   1 
ATOM   5169 C CD   . ARG C 1 129 ? 26.252  40.107  41.351 1.00 34.14  ?  174 ARG C CD   1 
ATOM   5170 N NE   . ARG C 1 129 ? 25.145  40.587  40.521 1.00 36.44  ?  174 ARG C NE   1 
ATOM   5171 C CZ   . ARG C 1 129 ? 24.783  40.065  39.349 1.00 36.72  ?  174 ARG C CZ   1 
ATOM   5172 N NH1  . ARG C 1 129 ? 25.434  39.030  38.829 1.00 31.65  1  174 ARG C NH1  1 
ATOM   5173 N NH2  . ARG C 1 129 ? 23.759  40.586  38.686 1.00 33.84  ?  174 ARG C NH2  1 
ATOM   5174 H H    . ARG C 1 129 ? 26.745  36.196  42.851 1.00 36.38  ?  174 ARG C H    1 
ATOM   5175 H HA   . ARG C 1 129 ? 28.360  38.237  42.101 1.00 33.90  ?  174 ARG C HA   1 
ATOM   5176 H HB2  . ARG C 1 129 ? 26.545  38.472  44.254 1.00 37.84  ?  174 ARG C HB2  1 
ATOM   5177 H HB3  . ARG C 1 129 ? 27.451  39.635  43.667 1.00 37.84  ?  174 ARG C HB3  1 
ATOM   5178 H HG2  . ARG C 1 129 ? 25.299  38.518  42.218 1.00 34.64  ?  174 ARG C HG2  1 
ATOM   5179 H HG3  . ARG C 1 129 ? 25.165  39.857  43.066 1.00 34.64  ?  174 ARG C HG3  1 
ATOM   5180 H HD2  . ARG C 1 129 ? 26.749  40.878  41.667 1.00 40.96  ?  174 ARG C HD2  1 
ATOM   5181 H HD3  . ARG C 1 129 ? 26.822  39.547  40.800 1.00 40.96  ?  174 ARG C HD3  1 
ATOM   5182 H HE   . ARG C 1 129 ? 24.694  41.258  40.812 1.00 43.72  ?  174 ARG C HE   1 
ATOM   5183 H HH11 . ARG C 1 129 ? 26.099  38.685  39.251 1.00 37.99  ?  174 ARG C HH11 1 
ATOM   5184 H HH12 . ARG C 1 129 ? 25.189  38.704  38.072 1.00 37.99  ?  174 ARG C HH12 1 
ATOM   5185 H HH21 . ARG C 1 129 ? 23.331  41.256  39.013 1.00 40.61  ?  174 ARG C HH21 1 
ATOM   5186 H HH22 . ARG C 1 129 ? 23.522  40.253  37.929 1.00 40.61  ?  174 ARG C HH22 1 
ATOM   5187 N N    . PHE C 1 130 ? 29.693  38.084  44.367 1.00 29.43  ?  175 PHE C N    1 
ATOM   5188 C CA   . PHE C 1 130 ? 30.794  37.587  45.189 1.00 36.45  ?  175 PHE C CA   1 
ATOM   5189 C C    . PHE C 1 130 ? 30.286  36.898  46.450 1.00 37.39  ?  175 PHE C C    1 
ATOM   5190 O O    . PHE C 1 130 ? 30.519  35.701  46.657 1.00 42.22  ?  175 PHE C O    1 
ATOM   5191 C CB   . PHE C 1 130 ? 31.744  38.726  45.555 1.00 36.18  ?  175 PHE C CB   1 
ATOM   5192 C CG   . PHE C 1 130 ? 32.837  38.309  46.500 1.00 39.78  ?  175 PHE C CG   1 
ATOM   5193 C CD1  . PHE C 1 130 ? 33.654  37.229  46.199 1.00 33.04  ?  175 PHE C CD1  1 
ATOM   5194 C CD2  . PHE C 1 130 ? 33.051  38.993  47.686 1.00 46.13  ?  175 PHE C CD2  1 
ATOM   5195 C CE1  . PHE C 1 130 ? 34.663  36.841  47.061 1.00 33.61  ?  175 PHE C CE1  1 
ATOM   5196 C CE2  . PHE C 1 130 ? 34.060  38.607  48.554 1.00 41.64  ?  175 PHE C CE2  1 
ATOM   5197 C CZ   . PHE C 1 130 ? 34.865  37.531  48.240 1.00 38.37  ?  175 PHE C CZ   1 
ATOM   5198 H H    . PHE C 1 130 ? 29.667  38.939  44.277 1.00 35.32  ?  175 PHE C H    1 
ATOM   5199 H HA   . PHE C 1 130 ? 31.297  36.935  44.676 1.00 43.73  ?  175 PHE C HA   1 
ATOM   5200 H HB2  . PHE C 1 130 ? 32.161  39.059  44.745 1.00 43.41  ?  175 PHE C HB2  1 
ATOM   5201 H HB3  . PHE C 1 130 ? 31.236  39.434  45.981 1.00 43.41  ?  175 PHE C HB3  1 
ATOM   5202 H HD1  . PHE C 1 130 ? 33.522  36.761  45.406 1.00 39.65  ?  175 PHE C HD1  1 
ATOM   5203 H HD2  . PHE C 1 130 ? 32.512  39.719  47.901 1.00 55.35  ?  175 PHE C HD2  1 
ATOM   5204 H HE1  . PHE C 1 130 ? 35.204  36.115  46.848 1.00 40.34  ?  175 PHE C HE1  1 
ATOM   5205 H HE2  . PHE C 1 130 ? 34.194  39.074  49.347 1.00 49.97  ?  175 PHE C HE2  1 
ATOM   5206 H HZ   . PHE C 1 130 ? 35.543  37.271  48.822 1.00 46.04  ?  175 PHE C HZ   1 
ATOM   5207 N N    . GLN C 1 131 ? 29.608  37.642  47.321 1.00 35.21  ?  176 GLN C N    1 
ATOM   5208 C CA   . GLN C 1 131 ? 29.217  37.113  48.621 1.00 39.93  ?  176 GLN C CA   1 
ATOM   5209 C C    . GLN C 1 131 ? 27.886  36.377  48.596 1.00 36.19  ?  176 GLN C C    1 
ATOM   5210 O O    . GLN C 1 131 ? 27.563  35.687  49.569 1.00 34.23  ?  176 GLN C O    1 
ATOM   5211 C CB   . GLN C 1 131 ? 29.147  38.242  49.655 1.00 46.98  ?  176 GLN C CB   1 
ATOM   5212 C CG   . GLN C 1 131 ? 30.505  38.807  50.044 1.00 55.13  ?  176 GLN C CG   1 
ATOM   5213 C CD   . GLN C 1 131 ? 30.436  39.699  51.268 1.00 56.81  ?  176 GLN C CD   1 
ATOM   5214 O OE1  . GLN C 1 131 ? 29.390  40.272  51.575 1.00 63.49  ?  176 GLN C OE1  1 
ATOM   5215 N NE2  . GLN C 1 131 ? 31.552  39.815  51.980 1.00 56.48  ?  176 GLN C NE2  1 
ATOM   5216 H H    . GLN C 1 131 ? 29.364  38.455  47.182 1.00 42.25  ?  176 GLN C H    1 
ATOM   5217 H HA   . GLN C 1 131 ? 29.895  36.485  48.916 1.00 47.92  ?  176 GLN C HA   1 
ATOM   5218 H HB2  . GLN C 1 131 ? 28.618  38.967  49.289 1.00 56.37  ?  176 GLN C HB2  1 
ATOM   5219 H HB3  . GLN C 1 131 ? 28.727  37.901  50.460 1.00 56.37  ?  176 GLN C HB3  1 
ATOM   5220 H HG2  . GLN C 1 131 ? 31.109  38.074  50.240 1.00 66.16  ?  176 GLN C HG2  1 
ATOM   5221 H HG3  . GLN C 1 131 ? 30.851  39.335  49.307 1.00 66.16  ?  176 GLN C HG3  1 
ATOM   5222 H HE21 . GLN C 1 131 ? 32.262  39.396  51.737 1.00 67.77  ?  176 GLN C HE21 1 
ATOM   5223 H HE22 . GLN C 1 131 ? 31.564  40.310  52.683 1.00 67.77  ?  176 GLN C HE22 1 
ATOM   5224 N N    . GLU C 1 132 ? 27.110  36.499  47.524 1.00 34.39  ?  177 GLU C N    1 
ATOM   5225 C CA   . GLU C 1 132 ? 25.825  35.821  47.455 1.00 33.52  ?  177 GLU C CA   1 
ATOM   5226 C C    . GLU C 1 132 ? 25.450  35.611  45.997 1.00 31.31  ?  177 GLU C C    1 
ATOM   5227 O O    . GLU C 1 132 ? 26.008  36.234  45.092 1.00 31.67  ?  177 GLU C O    1 
ATOM   5228 C CB   . GLU C 1 132 ? 24.730  36.612  48.180 1.00 31.05  ?  177 GLU C CB   1 
ATOM   5229 C CG   . GLU C 1 132 ? 24.513  38.015  47.632 1.00 37.19  ?  177 GLU C CG   1 
ATOM   5230 C CD   . GLU C 1 132 ? 23.349  38.732  48.292 1.00 37.44  ?  177 GLU C CD   1 
ATOM   5231 O OE1  . GLU C 1 132 ? 22.804  38.209  49.288 1.00 36.43  ?  177 GLU C OE1  1 
ATOM   5232 O OE2  . GLU C 1 132 ? 22.979  39.823  47.810 1.00 44.61  -1 177 GLU C OE2  1 
ATOM   5233 H H    . GLU C 1 132 ? 27.304  36.967  46.829 1.00 41.27  ?  177 GLU C H    1 
ATOM   5234 H HA   . GLU C 1 132 ? 25.900  34.951  47.877 1.00 40.22  ?  177 GLU C HA   1 
ATOM   5235 H HB2  . GLU C 1 132 ? 23.892  36.130  48.100 1.00 37.26  ?  177 GLU C HB2  1 
ATOM   5236 H HB3  . GLU C 1 132 ? 24.973  36.694  49.116 1.00 37.26  ?  177 GLU C HB3  1 
ATOM   5237 H HG2  . GLU C 1 132 ? 25.314  38.540  47.784 1.00 44.63  ?  177 GLU C HG2  1 
ATOM   5238 H HG3  . GLU C 1 132 ? 24.329  37.957  46.682 1.00 44.63  ?  177 GLU C HG3  1 
ATOM   5239 N N    . ASP C 1 133 ? 24.501  34.708  45.789 1.00 24.82  ?  178 ASP C N    1 
ATOM   5240 C CA   . ASP C 1 133 ? 23.864  34.516  44.500 1.00 21.49  ?  178 ASP C CA   1 
ATOM   5241 C C    . ASP C 1 133 ? 22.390  34.866  44.649 1.00 19.52  ?  178 ASP C C    1 
ATOM   5242 O O    . ASP C 1 133 ? 21.838  34.848  45.752 1.00 21.67  ?  178 ASP C O    1 
ATOM   5243 C CB   . ASP C 1 133 ? 24.039  33.075  43.997 1.00 25.04  ?  178 ASP C CB   1 
ATOM   5244 C CG   . ASP C 1 133 ? 25.502  32.687  43.828 1.00 28.87  ?  178 ASP C CG   1 
ATOM   5245 O OD1  . ASP C 1 133 ? 26.293  33.517  43.329 1.00 28.59  ?  178 ASP C OD1  1 
ATOM   5246 O OD2  . ASP C 1 133 ? 25.863  31.552  44.207 1.00 29.56  -1 178 ASP C OD2  1 
ATOM   5247 H H    . ASP C 1 133 ? 24.202  34.180  46.399 1.00 29.79  ?  178 ASP C H    1 
ATOM   5248 H HA   . ASP C 1 133 ? 24.260  35.119  43.851 1.00 25.79  ?  178 ASP C HA   1 
ATOM   5249 H HB2  . ASP C 1 133 ? 23.638  32.466  44.637 1.00 30.05  ?  178 ASP C HB2  1 
ATOM   5250 H HB3  . ASP C 1 133 ? 23.603  32.986  43.135 1.00 30.05  ?  178 ASP C HB3  1 
ATOM   5251 N N    . ILE C 1 134 ? 21.757  35.209  43.532 1.00 18.08  ?  179 ILE C N    1 
ATOM   5252 C CA   . ILE C 1 134 ? 20.353  35.599  43.527 1.00 16.54  ?  179 ILE C CA   1 
ATOM   5253 C C    . ILE C 1 134 ? 19.640  34.833  42.429 1.00 17.41  ?  179 ILE C C    1 
ATOM   5254 O O    . ILE C 1 134 ? 20.120  34.776  41.291 1.00 19.06  ?  179 ILE C O    1 
ATOM   5255 C CB   . ILE C 1 134 ? 20.172  37.115  43.317 1.00 19.59  ?  179 ILE C CB   1 
ATOM   5256 C CG1  . ILE C 1 134 ? 21.024  37.897  44.321 1.00 23.41  ?  179 ILE C CG1  1 
ATOM   5257 C CG2  . ILE C 1 134 ? 18.691  37.480  43.442 1.00 21.06  ?  179 ILE C CG2  1 
ATOM   5258 C CD1  . ILE C 1 134 ? 20.991  39.403  44.128 1.00 27.76  ?  179 ILE C CD1  1 
ATOM   5259 H H    . ILE C 1 134 ? 22.124  35.224  42.754 1.00 21.69  ?  179 ILE C H    1 
ATOM   5260 H HA   . ILE C 1 134 ? 19.951  35.360  44.377 1.00 19.85  ?  179 ILE C HA   1 
ATOM   5261 H HB   . ILE C 1 134 ? 20.469  37.339  42.421 1.00 23.51  ?  179 ILE C HB   1 
ATOM   5262 H HG12 . ILE C 1 134 ? 20.702  37.707  45.216 1.00 28.10  ?  179 ILE C HG12 1 
ATOM   5263 H HG13 . ILE C 1 134 ? 21.946  37.608  44.237 1.00 28.10  ?  179 ILE C HG13 1 
ATOM   5264 H HG21 . ILE C 1 134 ? 18.589  38.435  43.308 1.00 25.28  ?  179 ILE C HG21 1 
ATOM   5265 H HG22 . ILE C 1 134 ? 18.188  36.995  42.769 1.00 25.28  ?  179 ILE C HG22 1 
ATOM   5266 H HG23 . ILE C 1 134 ? 18.380  37.235  44.328 1.00 25.28  ?  179 ILE C HG23 1 
ATOM   5267 H HD11 . ILE C 1 134 ? 21.553  39.820  44.800 1.00 33.31  ?  179 ILE C HD11 1 
ATOM   5268 H HD12 . ILE C 1 134 ? 21.323  39.614  43.241 1.00 33.31  ?  179 ILE C HD12 1 
ATOM   5269 H HD13 . ILE C 1 134 ? 20.077  39.713  44.221 1.00 33.31  ?  179 ILE C HD13 1 
ATOM   5270 N N    . ILE C 1 135 ? 18.491  34.260  42.765 1.00 17.13  ?  180 ILE C N    1 
ATOM   5271 C CA   A ILE C 1 135 ? 17.652  33.554  41.808 0.50 17.65  ?  180 ILE C CA   1 
ATOM   5272 C CA   B ILE C 1 135 ? 17.651  33.554  41.809 0.50 17.66  ?  180 ILE C CA   1 
ATOM   5273 C C    . ILE C 1 135 ? 16.254  34.150  41.880 1.00 16.36  ?  180 ILE C C    1 
ATOM   5274 O O    . ILE C 1 135 ? 15.734  34.410  42.971 1.00 15.83  ?  180 ILE C O    1 
ATOM   5275 C CB   A ILE C 1 135 ? 17.634  32.033  42.076 0.50 19.16  ?  180 ILE C CB   1 
ATOM   5276 C CB   B ILE C 1 135 ? 17.627  32.036  42.087 0.50 19.22  ?  180 ILE C CB   1 
ATOM   5277 C CG1  A ILE C 1 135 ? 16.941  31.297  40.928 0.50 20.37  ?  180 ILE C CG1  1 
ATOM   5278 C CG1  B ILE C 1 135 ? 19.026  31.456  41.879 0.50 20.17  ?  180 ILE C CG1  1 
ATOM   5279 C CG2  A ILE C 1 135 ? 16.960  31.723  43.407 0.50 19.98  ?  180 ILE C CG2  1 
ATOM   5280 C CG2  B ILE C 1 135 ? 16.626  31.331  41.173 0.50 20.54  ?  180 ILE C CG2  1 
ATOM   5281 C CD1  A ILE C 1 135 ? 17.194  29.802  40.922 0.50 20.34  ?  180 ILE C CD1  1 
ATOM   5282 C CD1  B ILE C 1 135 ? 19.181  30.028  42.329 0.50 23.48  ?  180 ILE C CD1  1 
ATOM   5283 H H    . ILE C 1 135 ? 18.171  34.270  43.563 1.00 20.56  ?  180 ILE C H    1 
ATOM   5284 H HA   . ILE C 1 135 ? 17.997  33.696  40.913 1.00 21.20  ?  180 ILE C HA   1 
ATOM   5285 H HB   A ILE C 1 135 ? 18.552  31.724  42.123 0.50 23.00  ?  180 ILE C HB   1 
ATOM   5286 H HB   B ILE C 1 135 ? 17.362  31.892  43.010 0.50 23.07  ?  180 ILE C HB   1 
ATOM   5287 H HG12 A ILE C 1 135 ? 15.983  31.435  40.999 0.50 24.44  ?  180 ILE C HG12 1 
ATOM   5288 H HG12 B ILE C 1 135 ? 19.239  31.491  40.933 0.50 24.20  ?  180 ILE C HG12 1 
ATOM   5289 H HG13 A ILE C 1 135 ? 17.263  31.656  40.086 0.50 24.44  ?  180 ILE C HG13 1 
ATOM   5290 H HG13 B ILE C 1 135 ? 19.662  31.992  42.377 0.50 24.20  ?  180 ILE C HG13 1 
ATOM   5291 H HG21 A ILE C 1 135 ? 16.964  30.763  43.546 0.50 23.97  ?  180 ILE C HG21 1 
ATOM   5292 H HG21 B ILE C 1 135 ? 16.633  30.382  41.370 0.50 24.64  ?  180 ILE C HG21 1 
ATOM   5293 H HG22 A ILE C 1 135 ? 17.450  32.163  44.119 0.50 23.97  ?  180 ILE C HG22 1 
ATOM   5294 H HG22 B ILE C 1 135 ? 15.742  31.696  41.332 0.50 24.64  ?  180 ILE C HG22 1 
ATOM   5295 H HG23 A ILE C 1 135 ? 16.047  32.050  43.382 0.50 23.97  ?  180 ILE C HG23 1 
ATOM   5296 H HG23 B ILE C 1 135 ? 16.885  31.479  40.249 0.50 24.64  ?  180 ILE C HG23 1 
ATOM   5297 H HD11 A ILE C 1 135 ? 16.725  29.406  40.170 0.50 24.40  ?  180 ILE C HD11 1 
ATOM   5298 H HD11 B ILE C 1 135 ? 20.093  29.742  42.162 0.50 28.17  ?  180 ILE C HD11 1 
ATOM   5299 H HD12 A ILE C 1 135 ? 18.147  29.644  40.839 0.50 24.40  ?  180 ILE C HD12 1 
ATOM   5300 H HD12 B ILE C 1 135 ? 18.986  29.973  43.278 0.50 28.17  ?  180 ILE C HD12 1 
ATOM   5301 H HD13 A ILE C 1 135 ? 16.866  29.423  41.753 0.50 24.40  ?  180 ILE C HD13 1 
ATOM   5302 H HD13 B ILE C 1 135 ? 18.563  29.471  41.832 0.50 28.17  ?  180 ILE C HD13 1 
ATOM   5303 N N    . SER C 1 136 ? 15.655  34.380  40.716 1.00 15.16  ?  181 SER C N    1 
ATOM   5304 C CA   . SER C 1 136 ? 14.363  35.035  40.649 1.00 14.53  ?  181 SER C CA   1 
ATOM   5305 C C    . SER C 1 136 ? 13.529  34.413  39.543 1.00 11.58  ?  181 SER C C    1 
ATOM   5306 O O    . SER C 1 136 ? 14.048  33.800  38.610 1.00 13.83  ?  181 SER C O    1 
ATOM   5307 C CB   . SER C 1 136 ? 14.513  36.544  40.398 1.00 15.64  ?  181 SER C CB   1 
ATOM   5308 O OG   . SER C 1 136 ? 15.116  36.791  39.145 1.00 21.79  ?  181 SER C OG   1 
ATOM   5309 H H    . SER C 1 136 ? 15.980  34.164  39.950 1.00 18.19  ?  181 SER C H    1 
ATOM   5310 H HA   . SER C 1 136 ? 13.896  34.911  41.490 1.00 17.44  ?  181 SER C HA   1 
ATOM   5311 H HB2  . SER C 1 136 ? 13.634  36.955  40.412 1.00 18.77  ?  181 SER C HB2  1 
ATOM   5312 H HB3  . SER C 1 136 ? 15.068  36.926  41.096 1.00 18.77  ?  181 SER C HB3  1 
ATOM   5313 H HG   . SER C 1 136 ? 14.646  36.465  38.530 1.00 26.14  ?  181 SER C HG   1 
ATOM   5314 N N    . ILE C 1 137 ? 12.220  34.594  39.656 1.00 11.66  ?  182 ILE C N    1 
ATOM   5315 C CA   . ILE C 1 137 ? 11.284  34.196  38.618 1.00 11.25  ?  182 ILE C CA   1 
ATOM   5316 C C    . ILE C 1 137 ? 10.358  35.373  38.356 1.00 11.74  ?  182 ILE C C    1 
ATOM   5317 O O    . ILE C 1 137 ? 9.782   35.936  39.294 1.00 11.56  ?  182 ILE C O    1 
ATOM   5318 C CB   . ILE C 1 137 ? 10.493  32.931  39.005 1.00 12.83  ?  182 ILE C CB   1 
ATOM   5319 C CG1  . ILE C 1 137 ? 9.575   32.518  37.856 1.00 13.69  ?  182 ILE C CG1  1 
ATOM   5320 C CG2  . ILE C 1 137 ? 9.704   33.143  40.300 1.00 14.17  ?  182 ILE C CG2  1 
ATOM   5321 C CD1  . ILE C 1 137 ? 9.020   31.130  38.004 1.00 14.43  ?  182 ILE C CD1  1 
ATOM   5322 H H    . ILE C 1 137 ? 11.843  34.953  40.340 1.00 14.00  ?  182 ILE C H    1 
ATOM   5323 H HA   . ILE C 1 137 ? 11.774  34.008  37.802 1.00 13.50  ?  182 ILE C HA   1 
ATOM   5324 H HB   . ILE C 1 137 ? 11.128  32.213  39.155 1.00 15.40  ?  182 ILE C HB   1 
ATOM   5325 H HG12 . ILE C 1 137 ? 8.827   33.134  37.815 1.00 16.43  ?  182 ILE C HG12 1 
ATOM   5326 H HG13 . ILE C 1 137 ? 10.076  32.551  37.027 1.00 16.43  ?  182 ILE C HG13 1 
ATOM   5327 H HG21 . ILE C 1 137 ? 9.221   32.329  40.512 1.00 17.00  ?  182 ILE C HG21 1 
ATOM   5328 H HG22 . ILE C 1 137 ? 10.324  33.356  41.015 1.00 17.00  ?  182 ILE C HG22 1 
ATOM   5329 H HG23 . ILE C 1 137 ? 9.081   33.875  40.173 1.00 17.00  ?  182 ILE C HG23 1 
ATOM   5330 H HD11 . ILE C 1 137 ? 8.450   30.936  37.244 1.00 17.31  ?  182 ILE C HD11 1 
ATOM   5331 H HD12 . ILE C 1 137 ? 9.755   30.498  38.037 1.00 17.31  ?  182 ILE C HD12 1 
ATOM   5332 H HD13 . ILE C 1 137 ? 8.506   31.082  38.825 1.00 17.31  ?  182 ILE C HD13 1 
ATOM   5333 N N    . TRP C 1 138 ? 10.238  35.750  37.086 1.00 10.52  ?  183 TRP C N    1 
ATOM   5334 C CA   . TRP C 1 138 ? 9.468   36.905  36.652 1.00 11.83  ?  183 TRP C CA   1 
ATOM   5335 C C    . TRP C 1 138 ? 8.080   36.466  36.213 1.00 12.04  ?  183 TRP C C    1 
ATOM   5336 O O    . TRP C 1 138 ? 7.930   35.443  35.540 1.00 13.35  ?  183 TRP C O    1 
ATOM   5337 C CB   . TRP C 1 138 ? 10.142  37.610  35.474 1.00 11.93  ?  183 TRP C CB   1 
ATOM   5338 C CG   . TRP C 1 138 ? 11.496  38.174  35.734 1.00 11.93  ?  183 TRP C CG   1 
ATOM   5339 C CD1  . TRP C 1 138 ? 12.389  37.789  36.689 1.00 15.16  ?  183 TRP C CD1  1 
ATOM   5340 C CD2  . TRP C 1 138 ? 12.113  39.241  35.009 1.00 12.11  ?  183 TRP C CD2  1 
ATOM   5341 N NE1  . TRP C 1 138 ? 13.533  38.558  36.603 1.00 15.34  ?  183 TRP C NE1  1 
ATOM   5342 C CE2  . TRP C 1 138 ? 13.383  39.458  35.580 1.00 14.82  ?  183 TRP C CE2  1 
ATOM   5343 C CE3  . TRP C 1 138 ? 11.711  40.036  33.934 1.00 14.83  ?  183 TRP C CE3  1 
ATOM   5344 C CZ2  . TRP C 1 138 ? 14.254  40.442  35.110 1.00 14.17  ?  183 TRP C CZ2  1 
ATOM   5345 C CZ3  . TRP C 1 138 ? 12.577  41.015  33.468 1.00 14.17  ?  183 TRP C CZ3  1 
ATOM   5346 C CH2  . TRP C 1 138 ? 13.834  41.207  34.056 1.00 15.97  ?  183 TRP C CH2  1 
ATOM   5347 H H    . TRP C 1 138 ? 10.611  35.332  36.433 1.00 12.62  ?  183 TRP C H    1 
ATOM   5348 H HA   . TRP C 1 138 ? 9.380   37.535  37.384 1.00 14.20  ?  183 TRP C HA   1 
ATOM   5349 H HB2  . TRP C 1 138 ? 10.230  36.973  34.747 1.00 14.31  ?  183 TRP C HB2  1 
ATOM   5350 H HB3  . TRP C 1 138 ? 9.574   38.343  35.191 1.00 14.31  ?  183 TRP C HB3  1 
ATOM   5351 H HD1  . TRP C 1 138 ? 12.250  37.108  37.306 1.00 18.19  ?  183 TRP C HD1  1 
ATOM   5352 H HE1  . TRP C 1 138 ? 14.223  38.487  37.110 1.00 18.41  ?  183 TRP C HE1  1 
ATOM   5353 H HE3  . TRP C 1 138 ? 10.876  39.916  33.542 1.00 17.79  ?  183 TRP C HE3  1 
ATOM   5354 H HZ2  . TRP C 1 138 ? 15.090  40.571  35.497 1.00 17.00  ?  183 TRP C HZ2  1 
ATOM   5355 H HZ3  . TRP C 1 138 ? 12.319  41.551  32.752 1.00 17.01  ?  183 TRP C HZ3  1 
ATOM   5356 H HH2  . TRP C 1 138 ? 14.396  41.868  33.721 1.00 19.16  ?  183 TRP C HH2  1 
ATOM   5357 N N    . ASN C 1 139 ? 7.072   37.258  36.567 1.00 14.08  ?  184 ASN C N    1 
ATOM   5358 C CA   . ASN C 1 139 ? 5.720   37.038  36.080 1.00 13.52  ?  184 ASN C CA   1 
ATOM   5359 C C    . ASN C 1 139 ? 5.191   38.336  35.478 1.00 14.88  ?  184 ASN C C    1 
ATOM   5360 O O    . ASN C 1 139 ? 5.752   39.418  35.675 1.00 15.64  ?  184 ASN C O    1 
ATOM   5361 C CB   . ASN C 1 139 ? 4.797   36.505  37.190 1.00 12.98  ?  184 ASN C CB   1 
ATOM   5362 C CG   . ASN C 1 139 ? 4.501   37.533  38.262 1.00 16.42  ?  184 ASN C CG   1 
ATOM   5363 O OD1  . ASN C 1 139 ? 5.382   37.927  39.023 1.00 15.39  ?  184 ASN C OD1  1 
ATOM   5364 N ND2  . ASN C 1 139 ? 3.241   37.945  38.350 1.00 12.94  ?  184 ASN C ND2  1 
ATOM   5365 H H    . ASN C 1 139 ? 7.149   37.934  37.093 1.00 16.89  ?  184 ASN C H    1 
ATOM   5366 H HA   . ASN C 1 139 ? 5.746   36.374  35.374 1.00 16.23  ?  184 ASN C HA   1 
ATOM   5367 H HB2  . ASN C 1 139 ? 3.954   36.233  36.796 1.00 15.57  ?  184 ASN C HB2  1 
ATOM   5368 H HB3  . ASN C 1 139 ? 5.224   35.745  37.616 1.00 15.57  ?  184 ASN C HB3  1 
ATOM   5369 H HD21 . ASN C 1 139 ? 3.020   38.529  38.943 1.00 15.52  ?  184 ASN C HD21 1 
ATOM   5370 H HD22 . ASN C 1 139 ? 2.646   37.629  37.816 1.00 15.52  ?  184 ASN C HD22 1 
ATOM   5371 N N    . LYS C 1 140 ? 4.097   38.213  34.725 1.00 16.54  ?  185 LYS C N    1 
ATOM   5372 C CA   . LYS C 1 140 ? 3.662   39.296  33.848 1.00 14.78  ?  185 LYS C CA   1 
ATOM   5373 C C    . LYS C 1 140 ? 2.958   40.415  34.609 1.00 17.87  ?  185 LYS C C    1 
ATOM   5374 O O    . LYS C 1 140 ? 3.112   41.592  34.259 1.00 20.82  ?  185 LYS C O    1 
ATOM   5375 C CB   . LYS C 1 140 ? 2.747   38.738  32.754 1.00 18.75  ?  185 LYS C CB   1 
ATOM   5376 C CG   . LYS C 1 140 ? 3.481   37.861  31.742 1.00 22.07  ?  185 LYS C CG   1 
ATOM   5377 C CD   . LYS C 1 140 ? 2.549   37.221  30.724 1.00 24.00  ?  185 LYS C CD   1 
ATOM   5378 C CE   . LYS C 1 140 ? 3.336   36.435  29.681 1.00 23.60  ?  185 LYS C CE   1 
ATOM   5379 N NZ   . LYS C 1 140 ? 2.456   35.755  28.687 1.00 26.94  1  185 LYS C NZ   1 
ATOM   5380 H H    . LYS C 1 140 ? 3.593   37.516  34.705 1.00 19.85  ?  185 LYS C H    1 
ATOM   5381 H HA   . LYS C 1 140 ? 4.442   39.678  33.416 1.00 17.74  ?  185 LYS C HA   1 
ATOM   5382 H HB2  . LYS C 1 140 ? 2.054   38.199  33.168 1.00 22.50  ?  185 LYS C HB2  1 
ATOM   5383 H HB3  . LYS C 1 140 ? 2.346   39.478  32.272 1.00 22.50  ?  185 LYS C HB3  1 
ATOM   5384 H HG2  . LYS C 1 140 ? 4.122   38.406  31.259 1.00 26.48  ?  185 LYS C HG2  1 
ATOM   5385 H HG3  . LYS C 1 140 ? 3.941   37.150  32.215 1.00 26.48  ?  185 LYS C HG3  1 
ATOM   5386 H HD2  . LYS C 1 140 ? 1.948   36.610  31.178 1.00 28.80  ?  185 LYS C HD2  1 
ATOM   5387 H HD3  . LYS C 1 140 ? 2.045   37.914  30.269 1.00 28.80  ?  185 LYS C HD3  1 
ATOM   5388 H HE2  . LYS C 1 140 ? 3.918   37.043  29.199 1.00 28.32  ?  185 LYS C HE2  1 
ATOM   5389 H HE3  . LYS C 1 140 ? 3.864   35.755  30.129 1.00 28.32  ?  185 LYS C HE3  1 
ATOM   5390 H HZ1  . LYS C 1 140 ? 2.952   35.308  28.098 1.00 32.33  ?  185 LYS C HZ1  1 
ATOM   5391 H HZ2  . LYS C 1 140 ? 1.915   35.183  29.102 1.00 32.33  ?  185 LYS C HZ2  1 
ATOM   5392 H HZ3  . LYS C 1 140 ? 1.964   36.357  28.255 1.00 32.33  ?  185 LYS C HZ3  1 
ATOM   5393 N N    . THR C 1 141 ? 2.187   40.077  35.642 1.00 18.54  ?  186 THR C N    1 
ATOM   5394 C CA   . THR C 1 141 ? 1.330   41.035  36.337 1.00 17.70  ?  186 THR C CA   1 
ATOM   5395 C C    . THR C 1 141 ? 1.722   41.086  37.809 1.00 16.17  ?  186 THR C C    1 
ATOM   5396 O O    . THR C 1 141 ? 1.422   40.161  38.574 1.00 17.59  ?  186 THR C O    1 
ATOM   5397 C CB   . THR C 1 141 ? -0.142  40.659  36.179 1.00 19.75  ?  186 THR C CB   1 
ATOM   5398 O OG1  . THR C 1 141 ? -0.425  40.414  34.797 1.00 20.36  ?  186 THR C OG1  1 
ATOM   5399 C CG2  . THR C 1 141 ? -1.041  41.786  36.682 1.00 22.47  ?  186 THR C CG2  1 
ATOM   5400 H H    . THR C 1 141 ? 2.143   39.281  35.965 1.00 22.25  ?  186 THR C H    1 
ATOM   5401 H HA   . THR C 1 141 ? 1.461   41.917  35.956 1.00 21.24  ?  186 THR C HA   1 
ATOM   5402 H HB   . THR C 1 141 ? -0.331  39.860  36.696 1.00 23.70  ?  186 THR C HB   1 
ATOM   5403 H HG1  . THR C 1 141 ? 0.053   39.784  34.513 1.00 24.43  ?  186 THR C HG1  1 
ATOM   5404 H HG21 . THR C 1 141 ? -1.973  41.538  36.578 1.00 26.97  ?  186 THR C HG21 1 
ATOM   5405 H HG22 . THR C 1 141 ? -0.864  41.958  37.620 1.00 26.97  ?  186 THR C HG22 1 
ATOM   5406 H HG23 . THR C 1 141 ? -0.872  42.596  36.176 1.00 26.97  ?  186 THR C HG23 1 
ATOM   5407 N N    . ALA C 1 142 ? 2.376   42.177  38.208 1.00 16.30  ?  187 ALA C N    1 
ATOM   5408 C CA   . ALA C 1 142 ? 2.795   42.319  39.596 1.00 16.03  ?  187 ALA C CA   1 
ATOM   5409 C C    . ALA C 1 142 ? 1.605   42.488  40.531 1.00 17.53  ?  187 ALA C C    1 
ATOM   5410 O O    . ALA C 1 142 ? 1.679   42.089  41.698 1.00 16.29  ?  187 ALA C O    1 
ATOM   5411 C CB   . ALA C 1 142 ? 3.753   43.503  39.735 1.00 22.35  ?  187 ALA C CB   1 
ATOM   5412 H H    . ALA C 1 142 ? 2.585   42.839  37.701 1.00 19.56  ?  187 ALA C H    1 
ATOM   5413 H HA   . ALA C 1 142 ? 3.272   41.517  39.863 1.00 19.23  ?  187 ALA C HA   1 
ATOM   5414 H HB1  . ALA C 1 142 ? 4.022   43.584  40.664 1.00 26.82  ?  187 ALA C HB1  1 
ATOM   5415 H HB2  . ALA C 1 142 ? 4.530   43.347  39.177 1.00 26.82  ?  187 ALA C HB2  1 
ATOM   5416 H HB3  . ALA C 1 142 ? 3.298   44.311  39.451 1.00 26.82  ?  187 ALA C HB3  1 
ATOM   5417 N N    . SER C 1 143 ? 0.506   43.065  40.043 1.00 21.08  ?  188 SER C N    1 
ATOM   5418 C CA   . SER C 1 143 ? -0.675  43.303  40.864 1.00 22.32  ?  188 SER C CA   1 
ATOM   5419 C C    . SER C 1 143 ? -1.574  42.079  40.993 1.00 21.68  ?  188 SER C C    1 
ATOM   5420 O O    . SER C 1 143 ? -2.573  42.141  41.719 1.00 19.57  ?  188 SER C O    1 
ATOM   5421 C CB   . SER C 1 143 ? -1.488  44.462  40.284 1.00 27.77  ?  188 SER C CB   1 
ATOM   5422 O OG   . SER C 1 143 ? -2.071  44.091  39.048 1.00 31.15  ?  188 SER C OG   1 
ATOM   5423 H H    . SER C 1 143 ? 0.422   43.330  39.229 1.00 25.30  ?  188 SER C H    1 
ATOM   5424 H HA   . SER C 1 143 ? -0.390  43.557  41.755 1.00 26.78  ?  188 SER C HA   1 
ATOM   5425 H HB2  . SER C 1 143 ? -2.191  44.699  40.907 1.00 33.32  ?  188 SER C HB2  1 
ATOM   5426 H HB3  . SER C 1 143 ? -0.900  45.221  40.141 1.00 33.32  ?  188 SER C HB3  1 
ATOM   5427 H HG   . SER C 1 143 ? -1.471  43.882  38.498 1.00 37.38  ?  188 SER C HG   1 
ATOM   5428 N N    . ASP C 1 144 ? -1.262  40.984  40.305 1.00 19.96  ?  189 ASP C N    1 
ATOM   5429 C CA   . ASP C 1 144 ? -2.043  39.749  40.403 1.00 20.14  ?  189 ASP C CA   1 
ATOM   5430 C C    . ASP C 1 144 ? -1.595  39.014  41.659 1.00 21.03  ?  189 ASP C C    1 
ATOM   5431 O O    . ASP C 1 144 ? -0.675  38.196  41.636 1.00 22.95  ?  189 ASP C O    1 
ATOM   5432 C CB   . ASP C 1 144 ? -1.858  38.898  39.153 1.00 21.14  ?  189 ASP C CB   1 
ATOM   5433 C CG   . ASP C 1 144 ? -2.757  37.677  39.138 1.00 21.43  ?  189 ASP C CG   1 
ATOM   5434 O OD1  . ASP C 1 144 ? -3.356  37.358  40.186 1.00 20.04  ?  189 ASP C OD1  1 
ATOM   5435 O OD2  . ASP C 1 144 ? -2.853  37.030  38.074 1.00 22.09  -1 189 ASP C OD2  1 
ATOM   5436 H H    . ASP C 1 144 ? -0.593  40.928  39.767 1.00 23.95  ?  189 ASP C H    1 
ATOM   5437 H HA   . ASP C 1 144 ? -2.984  39.967  40.492 1.00 24.17  ?  189 ASP C HA   1 
ATOM   5438 H HB2  . ASP C 1 144 ? -2.066  39.434  38.372 1.00 25.37  ?  189 ASP C HB2  1 
ATOM   5439 H HB3  . ASP C 1 144 ? -0.938  38.593  39.112 1.00 25.37  ?  189 ASP C HB3  1 
ATOM   5440 N N    . GLN C 1 145 ? -2.268  39.307  42.775 1.00 20.27  ?  190 GLN C N    1 
ATOM   5441 C CA   . GLN C 1 145 ? -1.841  38.778  44.065 1.00 22.36  ?  190 GLN C CA   1 
ATOM   5442 C C    . GLN C 1 145 ? -2.070  37.276  44.166 1.00 20.29  ?  190 GLN C C    1 
ATOM   5443 O O    . GLN C 1 145 ? -1.287  36.575  44.816 1.00 18.54  ?  190 GLN C O    1 
ATOM   5444 C CB   . GLN C 1 145 ? -2.580  39.495  45.193 1.00 26.77  ?  190 GLN C CB   1 
ATOM   5445 C CG   . GLN C 1 145 ? -2.411  40.999  45.200 1.00 34.13  ?  190 GLN C CG   1 
ATOM   5446 C CD   . GLN C 1 145 ? -3.178  41.650  46.332 1.00 41.65  ?  190 GLN C CD   1 
ATOM   5447 O OE1  . GLN C 1 145 ? -3.307  41.080  47.415 1.00 40.82  ?  190 GLN C OE1  1 
ATOM   5448 N NE2  . GLN C 1 145 ? -3.702  42.844  46.083 1.00 46.36  ?  190 GLN C NE2  1 
ATOM   5449 H H    . GLN C 1 145 ? -2.968  39.805  42.808 1.00 24.32  ?  190 GLN C H    1 
ATOM   5450 H HA   . GLN C 1 145 ? -0.892  38.944  44.175 1.00 26.83  ?  190 GLN C HA   1 
ATOM   5451 H HB2  . GLN C 1 145 ? -3.528  39.306  45.112 1.00 32.12  ?  190 GLN C HB2  1 
ATOM   5452 H HB3  . GLN C 1 145 ? -2.251  39.158  46.041 1.00 32.12  ?  190 GLN C HB3  1 
ATOM   5453 H HG2  . GLN C 1 145 ? -1.471  41.214  45.310 1.00 40.95  ?  190 GLN C HG2  1 
ATOM   5454 H HG3  . GLN C 1 145 ? -2.741  41.361  44.363 1.00 40.95  ?  190 GLN C HG3  1 
ATOM   5455 H HE21 . GLN C 1 145 ? -3.597  43.208  45.311 1.00 55.63  ?  190 GLN C HE21 1 
ATOM   5456 H HE22 . GLN C 1 145 ? -4.147  43.254  46.695 1.00 55.63  ?  190 GLN C HE22 1 
ATOM   5457 N N    . ALA C 1 146 ? -3.139  36.767  43.551 1.00 17.58  ?  191 ALA C N    1 
ATOM   5458 C CA   . ALA C 1 146 ? -3.344  35.325  43.526 1.00 22.21  ?  191 ALA C CA   1 
ATOM   5459 C C    . ALA C 1 146 ? -2.176  34.632  42.839 1.00 17.98  ?  191 ALA C C    1 
ATOM   5460 O O    . ALA C 1 146 ? -1.664  33.622  43.335 1.00 21.64  ?  191 ALA C O    1 
ATOM   5461 C CB   . ALA C 1 146 ? -4.661  34.991  42.826 1.00 24.16  ?  191 ALA C CB   1 
ATOM   5462 H H    . ALA C 1 146 ? -3.747  37.226  43.151 1.00 21.10  ?  191 ALA C H    1 
ATOM   5463 H HA   . ALA C 1 146 ? -3.395  34.996  44.437 1.00 26.66  ?  191 ALA C HA   1 
ATOM   5464 H HB1  . ALA C 1 146 ? -4.779  34.028  42.819 1.00 28.99  ?  191 ALA C HB1  1 
ATOM   5465 H HB2  . ALA C 1 146 ? -5.390  35.411  43.308 1.00 28.99  ?  191 ALA C HB2  1 
ATOM   5466 H HB3  . ALA C 1 146 ? -4.629  35.327  41.916 1.00 28.99  ?  191 ALA C HB3  1 
ATOM   5467 N N    . THR C 1 147 ? -1.724  35.179  41.710 1.00 18.79  ?  192 THR C N    1 
ATOM   5468 C CA   . THR C 1 147 ? -0.615  34.576  40.976 1.00 20.14  ?  192 THR C CA   1 
ATOM   5469 C C    . THR C 1 147 ? 0.681   34.638  41.777 1.00 17.47  ?  192 THR C C    1 
ATOM   5470 O O    . THR C 1 147 ? 1.398   33.638  41.890 1.00 18.69  ?  192 THR C O    1 
ATOM   5471 C CB   . THR C 1 147 ? -0.452  35.271  39.621 1.00 18.68  ?  192 THR C CB   1 
ATOM   5472 O OG1  . THR C 1 147 ? -1.519  34.872  38.753 1.00 22.24  ?  192 THR C OG1  1 
ATOM   5473 C CG2  . THR C 1 147 ? 0.891   34.927  38.967 1.00 16.66  ?  192 THR C CG2  1 
ATOM   5474 H H    . THR C 1 147 ? -2.040  35.894  41.352 1.00 22.54  ?  192 THR C H    1 
ATOM   5475 H HA   . THR C 1 147 ? -0.819  33.643  40.810 1.00 24.16  ?  192 THR C HA   1 
ATOM   5476 H HB   . THR C 1 147 ? -0.488  36.232  39.750 1.00 22.42  ?  192 THR C HB   1 
ATOM   5477 H HG1  . THR C 1 147 ? -1.438  35.248  38.006 1.00 26.69  ?  192 THR C HG1  1 
ATOM   5478 H HG21 . THR C 1 147 ? 0.968   35.380  38.113 1.00 19.99  ?  192 THR C HG21 1 
ATOM   5479 H HG22 . THR C 1 147 ? 1.620   35.209  39.541 1.00 19.99  ?  192 THR C HG22 1 
ATOM   5480 H HG23 . THR C 1 147 ? 0.954   33.970  38.824 1.00 19.99  ?  192 THR C HG23 1 
ATOM   5481 N N    . THR C 1 148 ? 1.017   35.811  42.324 1.00 16.99  ?  193 THR C N    1 
ATOM   5482 C CA   . THR C 1 148 ? 2.278   35.934  43.047 1.00 17.37  ?  193 THR C CA   1 
ATOM   5483 C C    . THR C 1 148 ? 2.301   35.042  44.285 1.00 17.82  ?  193 THR C C    1 
ATOM   5484 O O    . THR C 1 148 ? 3.356   34.505  44.642 1.00 17.68  ?  193 THR C O    1 
ATOM   5485 C CB   . THR C 1 148 ? 2.542   37.399  43.423 1.00 18.69  ?  193 THR C CB   1 
ATOM   5486 O OG1  . THR C 1 148 ? 1.496   37.886  44.270 1.00 17.79  ?  193 THR C OG1  1 
ATOM   5487 C CG2  . THR C 1 148 ? 2.620   38.268  42.172 1.00 17.46  ?  193 THR C CG2  1 
ATOM   5488 H H    . THR C 1 148 ? 0.544   36.529  42.290 1.00 20.39  ?  193 THR C H    1 
ATOM   5489 H HA   . THR C 1 148 ? 2.999   35.646  42.464 1.00 20.84  ?  193 THR C HA   1 
ATOM   5490 H HB   . THR C 1 148 ? 3.389   37.462  43.891 1.00 22.42  ?  193 THR C HB   1 
ATOM   5491 H HG1  . THR C 1 148 ? 0.758   37.836  43.872 1.00 21.34  ?  193 THR C HG1  1 
ATOM   5492 H HG21 . THR C 1 148 ? 2.787   39.190  42.420 1.00 20.95  ?  193 THR C HG21 1 
ATOM   5493 H HG22 . THR C 1 148 ? 3.340   37.960  41.600 1.00 20.95  ?  193 THR C HG22 1 
ATOM   5494 H HG23 . THR C 1 148 ? 1.785   38.218  41.682 1.00 20.95  ?  193 THR C HG23 1 
ATOM   5495 N N    . ALA C 1 149 ? 1.152   34.843  44.936 1.00 19.13  ?  194 ALA C N    1 
ATOM   5496 C CA   . ALA C 1 149 ? 1.106   33.922  46.070 1.00 18.74  ?  194 ALA C CA   1 
ATOM   5497 C C    . ALA C 1 149 ? 1.322   32.482  45.620 1.00 17.35  ?  194 ALA C C    1 
ATOM   5498 O O    . ALA C 1 149 ? 2.048   31.725  46.273 1.00 17.08  ?  194 ALA C O    1 
ATOM   5499 C CB   . ALA C 1 149 ? -0.227  34.053  46.808 1.00 17.60  ?  194 ALA C CB   1 
ATOM   5500 H H    . ALA C 1 149 ? 0.403   35.221  44.746 1.00 22.96  ?  194 ALA C H    1 
ATOM   5501 H HA   . ALA C 1 149 ? 1.815   34.151  46.691 1.00 22.48  ?  194 ALA C HA   1 
ATOM   5502 H HB1  . ALA C 1 149 ? -0.235  33.434  47.554 1.00 21.12  ?  194 ALA C HB1  1 
ATOM   5503 H HB2  . ALA C 1 149 ? -0.321  34.962  47.130 1.00 21.12  ?  194 ALA C HB2  1 
ATOM   5504 H HB3  . ALA C 1 149 ? -0.948  33.842  46.194 1.00 21.12  ?  194 ALA C HB3  1 
ATOM   5505 N N    . ARG C 1 150 ? 0.694   32.084  44.512 1.00 18.05  ?  195 ARG C N    1 
ATOM   5506 C CA   . ARG C 1 150 ? 0.877   30.728  44.004 1.00 21.41  ?  195 ARG C CA   1 
ATOM   5507 C C    . ARG C 1 150 ? 2.313   30.500  43.553 1.00 19.17  ?  195 ARG C C    1 
ATOM   5508 O O    . ARG C 1 150 ? 2.886   29.432  43.801 1.00 16.15  ?  195 ARG C O    1 
ATOM   5509 C CB   . ARG C 1 150 ? -0.104  30.470  42.861 1.00 26.04  ?  195 ARG C CB   1 
ATOM   5510 C CG   . ARG C 1 150 ? -1.551  30.312  43.334 1.00 26.34  ?  195 ARG C CG   1 
ATOM   5511 C CD   . ARG C 1 150 ? -2.556  30.531  42.207 1.00 33.52  ?  195 ARG C CD   1 
ATOM   5512 N NE   . ARG C 1 150 ? -2.696  29.364  41.339 1.00 36.84  ?  195 ARG C NE   1 
ATOM   5513 C CZ   . ARG C 1 150 ? -3.659  28.451  41.440 1.00 42.36  ?  195 ARG C CZ   1 
ATOM   5514 N NH1  . ARG C 1 150 ? -4.594  28.549  42.379 1.00 45.97  1  195 ARG C NH1  1 
ATOM   5515 N NH2  . ARG C 1 150 ? -3.692  27.431  40.593 1.00 38.21  ?  195 ARG C NH2  1 
ATOM   5516 H H    . ARG C 1 150 ? 0.165   32.574  44.043 1.00 21.66  ?  195 ARG C H    1 
ATOM   5517 H HA   . ARG C 1 150 ? 0.682   30.097  44.714 1.00 25.69  ?  195 ARG C HA   1 
ATOM   5518 H HB2  . ARG C 1 150 ? -0.072  31.217  42.244 1.00 31.25  ?  195 ARG C HB2  1 
ATOM   5519 H HB3  . ARG C 1 150 ? 0.152   29.652  42.406 1.00 31.25  ?  195 ARG C HB3  1 
ATOM   5520 H HG2  . ARG C 1 150 ? -1.676  29.414  43.679 1.00 31.61  ?  195 ARG C HG2  1 
ATOM   5521 H HG3  . ARG C 1 150 ? -1.730  30.964  44.029 1.00 31.61  ?  195 ARG C HG3  1 
ATOM   5522 H HD2  . ARG C 1 150 ? -3.425  30.724  42.592 1.00 40.22  ?  195 ARG C HD2  1 
ATOM   5523 H HD3  . ARG C 1 150 ? -2.261  31.277  41.662 1.00 40.22  ?  195 ARG C HD3  1 
ATOM   5524 H HE   . ARG C 1 150 ? -2.113  29.259  40.716 1.00 44.20  ?  195 ARG C HE   1 
ATOM   5525 H HH11 . ARG C 1 150 ? -4.581  29.208  42.931 1.00 55.16  ?  195 ARG C HH11 1 
ATOM   5526 H HH12 . ARG C 1 150 ? -5.212  27.953  42.434 1.00 55.16  ?  195 ARG C HH12 1 
ATOM   5527 H HH21 . ARG C 1 150 ? -3.091  27.360  39.982 1.00 45.85  ?  195 ARG C HH21 1 
ATOM   5528 H HH22 . ARG C 1 150 ? -4.313  26.839  40.656 1.00 45.85  ?  195 ARG C HH22 1 
ATOM   5529 N N    . ILE C 1 151 ? 2.912   31.490  42.887 1.00 14.80  ?  196 ILE C N    1 
ATOM   5530 C CA   . ILE C 1 151 ? 4.330   31.402  42.542 1.00 14.40  ?  196 ILE C CA   1 
ATOM   5531 C C    . ILE C 1 151 ? 5.165   31.236  43.804 1.00 15.95  ?  196 ILE C C    1 
ATOM   5532 O O    . ILE C 1 151 ? 6.110   30.439  43.843 1.00 16.51  ?  196 ILE C O    1 
ATOM   5533 C CB   . ILE C 1 151 ? 4.761   32.640  41.731 1.00 16.46  ?  196 ILE C CB   1 
ATOM   5534 C CG1  . ILE C 1 151 ? 4.060   32.640  40.368 1.00 18.11  ?  196 ILE C CG1  1 
ATOM   5535 C CG2  . ILE C 1 151 ? 6.287   32.675  41.563 1.00 11.79  ?  196 ILE C CG2  1 
ATOM   5536 C CD1  . ILE C 1 151 ? 4.281   33.893  39.538 1.00 17.13  ?  196 ILE C CD1  1 
ATOM   5537 H H    . ILE C 1 151 ? 2.525   32.213  42.626 1.00 17.76  ?  196 ILE C H    1 
ATOM   5538 H HA   . ILE C 1 151 ? 4.470   30.619  41.987 1.00 17.28  ?  196 ILE C HA   1 
ATOM   5539 H HB   . ILE C 1 151 ? 4.488   33.434  42.216 1.00 19.76  ?  196 ILE C HB   1 
ATOM   5540 H HG12 . ILE C 1 151 ? 4.386   31.885  39.853 1.00 21.73  ?  196 ILE C HG12 1 
ATOM   5541 H HG13 . ILE C 1 151 ? 3.105   32.548  40.511 1.00 21.73  ?  196 ILE C HG13 1 
ATOM   5542 H HG21 . ILE C 1 151 ? 6.530   33.462  41.050 1.00 14.15  ?  196 ILE C HG21 1 
ATOM   5543 H HG22 . ILE C 1 151 ? 6.701   32.710  42.439 1.00 14.15  ?  196 ILE C HG22 1 
ATOM   5544 H HG23 . ILE C 1 151 ? 6.571   31.874  41.094 1.00 14.15  ?  196 ILE C HG23 1 
ATOM   5545 H HD11 . ILE C 1 151 ? 3.804   33.803  38.698 1.00 20.55  ?  196 ILE C HD11 1 
ATOM   5546 H HD12 . ILE C 1 151 ? 3.947   34.659  40.029 1.00 20.55  ?  196 ILE C HD12 1 
ATOM   5547 H HD13 . ILE C 1 151 ? 5.231   33.995  39.369 1.00 20.55  ?  196 ILE C HD13 1 
ATOM   5548 N N    . ARG C 1 152 ? 4.829   31.988  44.854 1.00 16.52  ?  197 ARG C N    1 
ATOM   5549 C CA   . ARG C 1 152 ? 5.540   31.886  46.123 1.00 15.96  ?  197 ARG C CA   1 
ATOM   5550 C C    . ARG C 1 152 ? 5.440   30.477  46.699 1.00 17.55  ?  197 ARG C C    1 
ATOM   5551 O O    . ARG C 1 152 ? 6.444   29.897  47.128 1.00 14.09  ?  197 ARG C O    1 
ATOM   5552 C CB   . ARG C 1 152 ? 4.965   32.912  47.097 1.00 19.45  ?  197 ARG C CB   1 
ATOM   5553 C CG   . ARG C 1 152 ? 5.586   32.926  48.481 1.00 19.06  ?  197 ARG C CG   1 
ATOM   5554 C CD   . ARG C 1 152 ? 4.707   33.719  49.417 1.00 21.10  ?  197 ARG C CD   1 
ATOM   5555 N NE   . ARG C 1 152 ? 3.405   33.078  49.589 1.00 29.64  ?  197 ARG C NE   1 
ATOM   5556 C CZ   . ARG C 1 152 ? 2.257   33.726  49.765 1.00 26.91  ?  197 ARG C CZ   1 
ATOM   5557 N NH1  . ARG C 1 152 ? 2.224   35.051  49.790 1.00 29.89  1  197 ARG C NH1  1 
ATOM   5558 N NH2  . ARG C 1 152 ? 1.131   33.042  49.909 1.00 29.33  ?  197 ARG C NH2  1 
ATOM   5559 H H    . ARG C 1 152 ? 4.191   32.565  44.853 1.00 19.82  ?  197 ARG C H    1 
ATOM   5560 H HA   . ARG C 1 152 ? 6.477   32.091  45.983 1.00 19.15  ?  197 ARG C HA   1 
ATOM   5561 H HB2  . ARG C 1 152 ? 5.086   33.796  46.716 1.00 23.34  ?  197 ARG C HB2  1 
ATOM   5562 H HB3  . ARG C 1 152 ? 4.018   32.734  47.206 1.00 23.34  ?  197 ARG C HB3  1 
ATOM   5563 H HG2  . ARG C 1 152 ? 5.658   32.019  48.816 1.00 22.87  ?  197 ARG C HG2  1 
ATOM   5564 H HG3  . ARG C 1 152 ? 6.459   33.348  48.443 1.00 22.87  ?  197 ARG C HG3  1 
ATOM   5565 H HD2  . ARG C 1 152 ? 5.135   33.779  50.286 1.00 25.31  ?  197 ARG C HD2  1 
ATOM   5566 H HD3  . ARG C 1 152 ? 4.565   34.606  49.051 1.00 25.31  ?  197 ARG C HD3  1 
ATOM   5567 H HE   . ARG C 1 152 ? 3.379   32.219  49.576 1.00 35.56  ?  197 ARG C HE   1 
ATOM   5568 H HH11 . ARG C 1 152 ? 2.951   35.501  49.696 1.00 35.87  ?  197 ARG C HH11 1 
ATOM   5569 H HH12 . ARG C 1 152 ? 1.476   35.460  49.903 1.00 35.87  ?  197 ARG C HH12 1 
ATOM   5570 H HH21 . ARG C 1 152 ? 1.146   32.182  49.893 1.00 35.19  ?  197 ARG C HH21 1 
ATOM   5571 H HH22 . ARG C 1 152 ? 0.387   33.457  50.022 1.00 35.19  ?  197 ARG C HH22 1 
ATOM   5572 N N    . ASP C 1 153 ? 4.225   29.919  46.732 1.00 15.79  ?  198 ASP C N    1 
ATOM   5573 C CA   . ASP C 1 153 ? 4.037   28.551  47.213 1.00 19.47  ?  198 ASP C CA   1 
ATOM   5574 C C    . ASP C 1 153 ? 4.900   27.568  46.436 1.00 18.30  ?  198 ASP C C    1 
ATOM   5575 O O    . ASP C 1 153 ? 5.582   26.720  47.023 1.00 20.78  ?  198 ASP C O    1 
ATOM   5576 C CB   . ASP C 1 153 ? 2.568   28.143  47.091 1.00 22.64  ?  198 ASP C CB   1 
ATOM   5577 C CG   . ASP C 1 153 ? 1.674   28.860  48.070 1.00 28.14  ?  198 ASP C CG   1 
ATOM   5578 O OD1  . ASP C 1 153 ? 2.186   29.386  49.080 1.00 24.65  ?  198 ASP C OD1  1 
ATOM   5579 O OD2  . ASP C 1 153 ? 0.445   28.878  47.834 1.00 30.95  -1 198 ASP C OD2  1 
ATOM   5580 H H    . ASP C 1 153 ? 3.501   30.310  46.483 1.00 18.95  ?  198 ASP C H    1 
ATOM   5581 H HA   . ASP C 1 153 ? 4.289   28.503  48.149 1.00 23.37  ?  198 ASP C HA   1 
ATOM   5582 H HB2  . ASP C 1 153 ? 2.257   28.350  46.195 1.00 27.17  ?  198 ASP C HB2  1 
ATOM   5583 H HB3  . ASP C 1 153 ? 2.491   27.191  47.257 1.00 27.17  ?  198 ASP C HB3  1 
ATOM   5584 N N    . THR C 1 154 ? 4.851   27.644  45.104 1.00 19.94  ?  199 THR C N    1 
ATOM   5585 C CA   . THR C 1 154 ? 5.611   26.712  44.280 1.00 18.87  ?  199 THR C CA   1 
ATOM   5586 C C    . THR C 1 154 ? 7.101   26.823  44.570 1.00 18.40  ?  199 THR C C    1 
ATOM   5587 O O    . THR C 1 154 ? 7.788   25.806  44.718 1.00 17.69  ?  199 THR C O    1 
ATOM   5588 C CB   . THR C 1 154 ? 5.324   26.975  42.799 1.00 19.72  ?  199 THR C CB   1 
ATOM   5589 O OG1  . THR C 1 154 ? 3.920   26.824  42.549 1.00 21.17  ?  199 THR C OG1  1 
ATOM   5590 C CG2  . THR C 1 154 ? 6.095   26.005  41.906 1.00 18.32  ?  199 THR C CG2  1 
ATOM   5591 H H    . THR C 1 154 ? 4.391   28.221  44.662 1.00 23.93  ?  199 THR C H    1 
ATOM   5592 H HA   . THR C 1 154 ? 5.331   25.807  44.485 1.00 22.65  ?  199 THR C HA   1 
ATOM   5593 H HB   . THR C 1 154 ? 5.595   27.878  42.574 1.00 23.66  ?  199 THR C HB   1 
ATOM   5594 H HG1  . THR C 1 154 ? 3.676   26.044  42.743 1.00 25.41  ?  199 THR C HG1  1 
ATOM   5595 H HG21 . THR C 1 154 ? 5.900   26.187  40.974 1.00 21.99  ?  199 THR C HG21 1 
ATOM   5596 H HG22 . THR C 1 154 ? 7.048   26.105  42.054 1.00 21.99  ?  199 THR C HG22 1 
ATOM   5597 H HG23 . THR C 1 154 ? 5.837   25.092  42.110 1.00 21.99  ?  199 THR C HG23 1 
ATOM   5598 N N    . LEU C 1 155 ? 7.614   28.051  44.675 1.00 17.64  ?  200 LEU C N    1 
ATOM   5599 C CA   . LEU C 1 155 ? 9.034   28.247  44.952 1.00 15.33  ?  200 LEU C CA   1 
ATOM   5600 C C    . LEU C 1 155 ? 9.447   27.538  46.234 1.00 19.19  ?  200 LEU C C    1 
ATOM   5601 O O    . LEU C 1 155 ? 10.476  26.852  46.273 1.00 22.06  ?  200 LEU C O    1 
ATOM   5602 C CB   . LEU C 1 155 ? 9.348   29.743  45.042 1.00 18.33  ?  200 LEU C CB   1 
ATOM   5603 C CG   . LEU C 1 155 ? 9.490   30.542  43.743 1.00 16.66  ?  200 LEU C CG   1 
ATOM   5604 C CD1  . LEU C 1 155 ? 9.701   32.025  44.049 1.00 14.94  ?  200 LEU C CD1  1 
ATOM   5605 C CD2  . LEU C 1 155 ? 10.640  30.017  42.894 1.00 17.36  ?  200 LEU C CD2  1 
ATOM   5606 H H    . LEU C 1 155 ? 7.164   28.779  44.590 1.00 21.16  ?  200 LEU C H    1 
ATOM   5607 H HA   . LEU C 1 155 ? 9.553   27.875  44.222 1.00 18.40  ?  200 LEU C HA   1 
ATOM   5608 H HB2  . LEU C 1 155 ? 8.639   30.164  45.553 1.00 22.00  ?  200 LEU C HB2  1 
ATOM   5609 H HB3  . LEU C 1 155 ? 10.184  29.841  45.524 1.00 22.00  ?  200 LEU C HB3  1 
ATOM   5610 H HG   . LEU C 1 155 ? 8.673   30.456  43.228 1.00 19.99  ?  200 LEU C HG   1 
ATOM   5611 H HD11 . LEU C 1 155 ? 9.788   32.511  43.214 1.00 17.93  ?  200 LEU C HD11 1 
ATOM   5612 H HD12 . LEU C 1 155 ? 8.936   32.356  44.546 1.00 17.93  ?  200 LEU C HD12 1 
ATOM   5613 H HD13 . LEU C 1 155 ? 10.508  32.127  44.577 1.00 17.93  ?  200 LEU C HD13 1 
ATOM   5614 H HD21 . LEU C 1 155 ? 10.699  30.545  42.082 1.00 20.84  ?  200 LEU C HD21 1 
ATOM   5615 H HD22 . LEU C 1 155 ? 11.464  30.091  43.399 1.00 20.84  ?  200 LEU C HD22 1 
ATOM   5616 H HD23 . LEU C 1 155 ? 10.469  29.088  42.673 1.00 20.84  ?  200 LEU C HD23 1 
ATOM   5617 N N    . ARG C 1 156 ? 8.659   27.691  47.301 1.00 16.60  ?  201 ARG C N    1 
ATOM   5618 C CA   . ARG C 1 156 ? 9.035   27.080  48.569 1.00 19.75  ?  201 ARG C CA   1 
ATOM   5619 C C    . ARG C 1 156 ? 9.088   25.564  48.445 1.00 23.23  ?  201 ARG C C    1 
ATOM   5620 O O    . ARG C 1 156 ? 10.007  24.922  48.966 1.00 22.18  ?  201 ARG C O    1 
ATOM   5621 C CB   . ARG C 1 156 ? 8.064   27.504  49.670 1.00 20.09  ?  201 ARG C CB   1 
ATOM   5622 C CG   . ARG C 1 156 ? 8.274   28.940  50.133 1.00 17.99  ?  201 ARG C CG   1 
ATOM   5623 C CD   . ARG C 1 156 ? 7.721   29.189  51.529 1.00 18.22  ?  201 ARG C CD   1 
ATOM   5624 N NE   . ARG C 1 156 ? 7.954   30.566  51.952 1.00 19.24  ?  201 ARG C NE   1 
ATOM   5625 C CZ   . ARG C 1 156 ? 9.112   31.025  52.419 1.00 20.42  ?  201 ARG C CZ   1 
ATOM   5626 N NH1  . ARG C 1 156 ? 10.155  30.215  52.537 1.00 20.37  1  201 ARG C NH1  1 
ATOM   5627 N NH2  . ARG C 1 156 ? 9.228   32.300  52.771 1.00 17.51  ?  201 ARG C NH2  1 
ATOM   5628 H H    . ARG C 1 156 ? 7.921   28.133  47.314 1.00 19.92  ?  201 ARG C H    1 
ATOM   5629 H HA   . ARG C 1 156 ? 9.920   27.389  48.817 1.00 23.70  ?  201 ARG C HA   1 
ATOM   5630 H HB2  . ARG C 1 156 ? 7.157   27.427  49.337 1.00 24.10  ?  201 ARG C HB2  1 
ATOM   5631 H HB3  . ARG C 1 156 ? 8.185   26.922  50.437 1.00 24.10  ?  201 ARG C HB3  1 
ATOM   5632 H HG2  . ARG C 1 156 ? 9.224   29.133  50.147 1.00 21.59  ?  201 ARG C HG2  1 
ATOM   5633 H HG3  . ARG C 1 156 ? 7.822   29.539  49.519 1.00 21.59  ?  201 ARG C HG3  1 
ATOM   5634 H HD2  . ARG C 1 156 ? 6.764   29.029  51.529 1.00 21.87  ?  201 ARG C HD2  1 
ATOM   5635 H HD3  . ARG C 1 156 ? 8.161   28.598  52.160 1.00 21.87  ?  201 ARG C HD3  1 
ATOM   5636 H HE   . ARG C 1 156 ? 7.298   31.119  51.894 1.00 23.09  ?  201 ARG C HE   1 
ATOM   5637 H HH11 . ARG C 1 156 ? 10.086  29.389  52.308 1.00 24.44  ?  201 ARG C HH11 1 
ATOM   5638 H HH12 . ARG C 1 156 ? 10.901  30.516  52.840 1.00 24.44  ?  201 ARG C HH12 1 
ATOM   5639 H HH21 . ARG C 1 156 ? 8.554   32.829  52.698 1.00 21.02  ?  201 ARG C HH21 1 
ATOM   5640 H HH22 . ARG C 1 156 ? 9.975   32.596  53.076 1.00 21.02  ?  201 ARG C HH22 1 
ATOM   5641 N N    . ARG C 1 157 ? 8.123   24.977  47.737 1.00 21.68  ?  202 ARG C N    1 
ATOM   5642 C CA   . ARG C 1 157 ? 8.135   23.536  47.508 1.00 24.04  ?  202 ARG C CA   1 
ATOM   5643 C C    . ARG C 1 157 ? 9.331   23.122  46.657 1.00 24.74  ?  202 ARG C C    1 
ATOM   5644 O O    . ARG C 1 157 ? 10.193  22.356  47.104 1.00 24.52  ?  202 ARG C O    1 
ATOM   5645 C CB   . ARG C 1 157 ? 6.826   23.104  46.843 1.00 21.95  ?  202 ARG C CB   1 
ATOM   5646 C CG   . ARG C 1 157 ? 6.724   21.598  46.597 1.00 28.12  ?  202 ARG C CG   1 
ATOM   5647 C CD   . ARG C 1 157 ? 5.336   21.187  46.124 1.00 24.75  ?  202 ARG C CD   1 
ATOM   5648 N NE   . ARG C 1 157 ? 4.987   21.767  44.829 1.00 22.79  ?  202 ARG C NE   1 
ATOM   5649 C CZ   . ARG C 1 157 ? 5.326   21.250  43.650 1.00 23.15  ?  202 ARG C CZ   1 
ATOM   5650 N NH1  . ARG C 1 157 ? 6.036   20.131  43.581 1.00 26.21  1  202 ARG C NH1  1 
ATOM   5651 N NH2  . ARG C 1 157 ? 4.956   21.857  42.530 1.00 25.72  ?  202 ARG C NH2  1 
ATOM   5652 H H    . ARG C 1 157 ? 7.456   25.388  47.382 1.00 26.02  ?  202 ARG C H    1 
ATOM   5653 H HA   . ARG C 1 157 ? 8.203   23.081  48.362 1.00 28.84  ?  202 ARG C HA   1 
ATOM   5654 H HB2  . ARG C 1 157 ? 6.085   23.361  47.413 1.00 26.34  ?  202 ARG C HB2  1 
ATOM   5655 H HB3  . ARG C 1 157 ? 6.750   23.549  45.984 1.00 26.34  ?  202 ARG C HB3  1 
ATOM   5656 H HG2  . ARG C 1 157 ? 7.364   21.343  45.915 1.00 33.74  ?  202 ARG C HG2  1 
ATOM   5657 H HG3  . ARG C 1 157 ? 6.913   21.128  47.424 1.00 33.74  ?  202 ARG C HG3  1 
ATOM   5658 H HD2  . ARG C 1 157 ? 5.305   20.222  46.039 1.00 29.70  ?  202 ARG C HD2  1 
ATOM   5659 H HD3  . ARG C 1 157 ? 4.680   21.485  46.773 1.00 29.70  ?  202 ARG C HD3  1 
ATOM   5660 H HE   . ARG C 1 157 ? 4.530   22.495  44.828 1.00 27.35  ?  202 ARG C HE   1 
ATOM   5661 H HH11 . ARG C 1 157 ? 6.280   19.731  44.302 1.00 31.45  ?  202 ARG C HH11 1 
ATOM   5662 H HH12 . ARG C 1 157 ? 6.251   19.805  42.815 1.00 31.45  ?  202 ARG C HH12 1 
ATOM   5663 H HH21 . ARG C 1 157 ? 4.497   22.583  42.566 1.00 30.87  ?  202 ARG C HH21 1 
ATOM   5664 H HH22 . ARG C 1 157 ? 5.176   21.525  41.768 1.00 30.87  ?  202 ARG C HH22 1 
ATOM   5665 N N    . VAL C 1 158 ? 9.409   23.630  45.423 1.00 19.70  ?  203 VAL C N    1 
ATOM   5666 C CA   . VAL C 1 158 ? 10.327  23.042  44.450 1.00 19.90  ?  203 VAL C CA   1 
ATOM   5667 C C    . VAL C 1 158 ? 11.779  23.379  44.745 1.00 22.70  ?  203 VAL C C    1 
ATOM   5668 O O    . VAL C 1 158 ? 12.675  22.638  44.323 1.00 20.77  ?  203 VAL C O    1 
ATOM   5669 C CB   . VAL C 1 158 ? 9.963   23.470  43.018 1.00 18.62  ?  203 VAL C CB   1 
ATOM   5670 C CG1  . VAL C 1 158 ? 8.501   23.144  42.725 1.00 20.93  ?  203 VAL C CG1  1 
ATOM   5671 C CG2  . VAL C 1 158 ? 10.259  24.954  42.782 1.00 21.41  ?  203 VAL C CG2  1 
ATOM   5672 H H    . VAL C 1 158 ? 8.953   24.298  45.132 1.00 23.64  ?  203 VAL C H    1 
ATOM   5673 H HA   . VAL C 1 158 ? 10.240  22.077  44.495 1.00 23.88  ?  203 VAL C HA   1 
ATOM   5674 H HB   . VAL C 1 158 ? 10.506  22.961  42.396 1.00 22.35  ?  203 VAL C HB   1 
ATOM   5675 H HG11 . VAL C 1 158 ? 8.291   23.421  41.820 1.00 25.12  ?  203 VAL C HG11 1 
ATOM   5676 H HG12 . VAL C 1 158 ? 8.367   22.187  42.819 1.00 25.12  ?  203 VAL C HG12 1 
ATOM   5677 H HG13 . VAL C 1 158 ? 7.939   23.620  43.356 1.00 25.12  ?  203 VAL C HG13 1 
ATOM   5678 H HG21 . VAL C 1 158 ? 10.017  25.183  41.871 1.00 25.69  ?  203 VAL C HG21 1 
ATOM   5679 H HG22 . VAL C 1 158 ? 9.739   25.483  43.406 1.00 25.69  ?  203 VAL C HG22 1 
ATOM   5680 H HG23 . VAL C 1 158 ? 11.206  25.112  42.922 1.00 25.69  ?  203 VAL C HG23 1 
ATOM   5681 N N    . LEU C 1 159 ? 12.046  24.474  45.450 1.00 21.43  ?  204 LEU C N    1 
ATOM   5682 C CA   . LEU C 1 159 ? 13.411  24.831  45.808 1.00 21.36  ?  204 LEU C CA   1 
ATOM   5683 C C    . LEU C 1 159 ? 13.820  24.302  47.173 1.00 24.46  ?  204 LEU C C    1 
ATOM   5684 O O    . LEU C 1 159 ? 14.955  24.543  47.595 1.00 25.40  ?  204 LEU C O    1 
ATOM   5685 C CB   . LEU C 1 159 ? 13.591  26.353  45.774 1.00 21.85  ?  204 LEU C CB   1 
ATOM   5686 C CG   . LEU C 1 159 ? 13.344  27.032  44.428 1.00 18.96  ?  204 LEU C CG   1 
ATOM   5687 C CD1  . LEU C 1 159 ? 13.715  28.507  44.504 1.00 21.18  ?  204 LEU C CD1  1 
ATOM   5688 C CD2  . LEU C 1 159 ? 14.112  26.346  43.307 1.00 19.23  ?  204 LEU C CD2  1 
ATOM   5689 H H    . LEU C 1 159 ? 11.451  25.027  45.733 1.00 25.72  ?  204 LEU C H    1 
ATOM   5690 H HA   . LEU C 1 159 ? 14.014  24.448  45.152 1.00 25.64  ?  204 LEU C HA   1 
ATOM   5691 H HB2  . LEU C 1 159 ? 12.975  26.746  46.413 1.00 26.22  ?  204 LEU C HB2  1 
ATOM   5692 H HB3  . LEU C 1 159 ? 14.501  26.558  46.038 1.00 26.22  ?  204 LEU C HB3  1 
ATOM   5693 H HG   . LEU C 1 159 ? 12.399  26.975  44.218 1.00 22.75  ?  204 LEU C HG   1 
ATOM   5694 H HD11 . LEU C 1 159 ? 13.551  28.918  43.641 1.00 25.42  ?  204 LEU C HD11 1 
ATOM   5695 H HD12 . LEU C 1 159 ? 13.170  28.935  45.183 1.00 25.42  ?  204 LEU C HD12 1 
ATOM   5696 H HD13 . LEU C 1 159 ? 14.654  28.585  44.735 1.00 25.42  ?  204 LEU C HD13 1 
ATOM   5697 H HD21 . LEU C 1 159 ? 13.930  26.806  42.472 1.00 23.07  ?  204 LEU C HD21 1 
ATOM   5698 H HD22 . LEU C 1 159 ? 15.061  26.385  43.505 1.00 23.07  ?  204 LEU C HD22 1 
ATOM   5699 H HD23 . LEU C 1 159 ? 13.824  25.422  43.246 1.00 23.07  ?  204 LEU C HD23 1 
ATOM   5700 N N    . ASN C 1 160 ? 12.933  23.593  47.869 1.00 23.10  ?  205 ASN C N    1 
ATOM   5701 C CA   . ASN C 1 160 ? 13.250  23.025  49.176 1.00 24.47  ?  205 ASN C CA   1 
ATOM   5702 C C    . ASN C 1 160 ? 13.775  24.100  50.125 1.00 24.80  ?  205 ASN C C    1 
ATOM   5703 O O    . ASN C 1 160 ? 14.756  23.905  50.845 1.00 22.67  ?  205 ASN C O    1 
ATOM   5704 C CB   . ASN C 1 160 ? 14.254  21.878  49.035 1.00 26.22  ?  205 ASN C CB   1 
ATOM   5705 C CG   . ASN C 1 160 ? 13.816  20.844  48.009 1.00 28.44  ?  205 ASN C CG   1 
ATOM   5706 O OD1  . ASN C 1 160 ? 14.526  20.574  47.037 1.00 30.16  ?  205 ASN C OD1  1 
ATOM   5707 N ND2  . ASN C 1 160 ? 12.632  20.273  48.211 1.00 28.94  ?  205 ASN C ND2  1 
ATOM   5708 H H    . ASN C 1 160 ? 12.132  23.426  47.602 1.00 27.73  ?  205 ASN C H    1 
ATOM   5709 H HA   . ASN C 1 160 ? 12.439  22.661  49.563 1.00 29.36  ?  205 ASN C HA   1 
ATOM   5710 H HB2  . ASN C 1 160 ? 15.109  22.238  48.752 1.00 31.46  ?  205 ASN C HB2  1 
ATOM   5711 H HB3  . ASN C 1 160 ? 14.347  21.431  49.891 1.00 31.46  ?  205 ASN C HB3  1 
ATOM   5712 H HD21 . ASN C 1 160 ? 12.340  19.682  47.659 1.00 34.73  ?  205 ASN C HD21 1 
ATOM   5713 H HD22 . ASN C 1 160 ? 12.159  20.495  48.894 1.00 34.73  ?  205 ASN C HD22 1 
ATOM   5714 N N    . LEU C 1 161 ? 13.110  25.253  50.126 1.00 23.17  ?  206 LEU C N    1 
ATOM   5715 C CA   . LEU C 1 161 ? 13.531  26.349  50.987 1.00 25.54  ?  206 LEU C CA   1 
ATOM   5716 C C    . LEU C 1 161 ? 13.095  26.088  52.429 1.00 22.06  ?  206 LEU C C    1 
ATOM   5717 O O    . LEU C 1 161 ? 11.974  25.631  52.661 1.00 22.27  ?  206 LEU C O    1 
ATOM   5718 C CB   . LEU C 1 161 ? 12.924  27.671  50.516 1.00 23.01  ?  206 LEU C CB   1 
ATOM   5719 C CG   . LEU C 1 161 ? 13.145  28.082  49.062 1.00 23.88  ?  206 LEU C CG   1 
ATOM   5720 C CD1  . LEU C 1 161 ? 12.357  29.349  48.750 1.00 18.62  ?  206 LEU C CD1  1 
ATOM   5721 C CD2  . LEU C 1 161 ? 14.624  28.286  48.780 1.00 19.48  ?  206 LEU C CD2  1 
ATOM   5722 H H    . LEU C 1 161 ? 12.420  25.423  49.642 1.00 27.80  ?  206 LEU C H    1 
ATOM   5723 H HA   . LEU C 1 161 ? 14.498  26.427  50.965 1.00 30.65  ?  206 LEU C HA   1 
ATOM   5724 H HB2  . LEU C 1 161 ? 11.965  27.625  50.654 1.00 27.61  ?  206 LEU C HB2  1 
ATOM   5725 H HB3  . LEU C 1 161 ? 13.289  28.380  51.068 1.00 27.61  ?  206 LEU C HB3  1 
ATOM   5726 H HG   . LEU C 1 161 ? 12.822  27.376  48.480 1.00 28.66  ?  206 LEU C HG   1 
ATOM   5727 H HD11 . LEU C 1 161 ? 12.509  29.595  47.824 1.00 22.35  ?  206 LEU C HD11 1 
ATOM   5728 H HD12 . LEU C 1 161 ? 11.414  29.178  48.897 1.00 22.35  ?  206 LEU C HD12 1 
ATOM   5729 H HD13 . LEU C 1 161 ? 12.660  30.061  49.336 1.00 22.35  ?  206 LEU C HD13 1 
ATOM   5730 H HD21 . LEU C 1 161 ? 14.735  28.546  47.852 1.00 23.37  ?  206 LEU C HD21 1 
ATOM   5731 H HD22 . LEU C 1 161 ? 14.962  28.985  49.362 1.00 23.37  ?  206 LEU C HD22 1 
ATOM   5732 H HD23 . LEU C 1 161 ? 15.095  27.456  48.951 1.00 23.37  ?  206 LEU C HD23 1 
ATOM   5733 N N    . PRO C 1 162 ? 13.944  26.376  53.413 1.00 22.44  ?  207 PRO C N    1 
ATOM   5734 C CA   . PRO C 1 162 ? 13.469  26.432  54.799 1.00 22.32  ?  207 PRO C CA   1 
ATOM   5735 C C    . PRO C 1 162 ? 12.301  27.394  54.912 1.00 22.86  ?  207 PRO C C    1 
ATOM   5736 O O    . PRO C 1 162 ? 12.226  28.371  54.152 1.00 23.19  ?  207 PRO C O    1 
ATOM   5737 C CB   . PRO C 1 162 ? 14.690  26.944  55.578 1.00 22.14  ?  207 PRO C CB   1 
ATOM   5738 C CG   . PRO C 1 162 ? 15.855  26.576  54.742 1.00 23.29  ?  207 PRO C CG   1 
ATOM   5739 C CD   . PRO C 1 162 ? 15.395  26.617  53.317 1.00 25.08  ?  207 PRO C CD   1 
ATOM   5740 H HA   . PRO C 1 162 ? 13.213  25.553  55.118 1.00 26.79  ?  207 PRO C HA   1 
ATOM   5741 H HB2  . PRO C 1 162 ? 14.632  27.907  55.682 1.00 26.56  ?  207 PRO C HB2  1 
ATOM   5742 H HB3  . PRO C 1 162 ? 14.735  26.506  56.442 1.00 26.56  ?  207 PRO C HB3  1 
ATOM   5743 H HG2  . PRO C 1 162 ? 16.569  27.217  54.885 1.00 27.95  ?  207 PRO C HG2  1 
ATOM   5744 H HG3  . PRO C 1 162 ? 16.150  25.682  54.976 1.00 27.95  ?  207 PRO C HG3  1 
ATOM   5745 H HD2  . PRO C 1 162 ? 15.567  27.490  52.931 1.00 30.10  ?  207 PRO C HD2  1 
ATOM   5746 H HD3  . PRO C 1 162 ? 15.821  25.912  52.804 1.00 30.10  ?  207 PRO C HD3  1 
ATOM   5747 N N    . PRO C 1 163 ? 11.360  27.152  55.828 1.00 19.85  ?  208 PRO C N    1 
ATOM   5748 C CA   . PRO C 1 163 ? 10.229  28.084  55.964 1.00 21.64  ?  208 PRO C CA   1 
ATOM   5749 C C    . PRO C 1 163 ? 10.645  29.520  56.222 1.00 23.11  ?  208 PRO C C    1 
ATOM   5750 O O    . PRO C 1 163 ? 9.968   30.445  55.755 1.00 19.37  ?  208 PRO C O    1 
ATOM   5751 C CB   . PRO C 1 163 ? 9.450   27.505  57.150 1.00 22.11  ?  208 PRO C CB   1 
ATOM   5752 C CG   . PRO C 1 163 ? 9.735   26.047  57.093 1.00 21.63  ?  208 PRO C CG   1 
ATOM   5753 C CD   . PRO C 1 163 ? 11.167  25.936  56.638 1.00 23.94  ?  208 PRO C CD   1 
ATOM   5754 H HA   . PRO C 1 163 ? 9.671   28.051  55.170 1.00 25.97  ?  208 PRO C HA   1 
ATOM   5755 H HB2  . PRO C 1 163 ? 9.776   27.889  57.978 1.00 26.54  ?  208 PRO C HB2  1 
ATOM   5756 H HB3  . PRO C 1 163 ? 8.502   27.677  57.037 1.00 26.54  ?  208 PRO C HB3  1 
ATOM   5757 H HG2  . PRO C 1 163 ? 9.625   25.659  57.976 1.00 25.95  ?  208 PRO C HG2  1 
ATOM   5758 H HG3  . PRO C 1 163 ? 9.139   25.623  56.456 1.00 25.95  ?  208 PRO C HG3  1 
ATOM   5759 H HD2  . PRO C 1 163 ? 11.766  25.939  57.401 1.00 28.73  ?  208 PRO C HD2  1 
ATOM   5760 H HD3  . PRO C 1 163 ? 11.288  25.143  56.093 1.00 28.73  ?  208 PRO C HD3  1 
ATOM   5761 N N    . ASN C 1 164 ? 11.733  29.734  56.957 1.00 23.64  ?  209 ASN C N    1 
ATOM   5762 C CA   . ASN C 1 164 ? 12.157  31.070  57.354 1.00 26.72  ?  209 ASN C CA   1 
ATOM   5763 C C    . ASN C 1 164 ? 12.988  31.770  56.287 1.00 23.31  ?  209 ASN C C    1 
ATOM   5764 O O    . ASN C 1 164 ? 13.375  32.926  56.490 1.00 20.64  ?  209 ASN C O    1 
ATOM   5765 C CB   . ASN C 1 164 ? 12.952  30.995  58.660 1.00 26.57  ?  209 ASN C CB   1 
ATOM   5766 C CG   . ASN C 1 164 ? 14.161  30.089  58.551 1.00 31.27  ?  209 ASN C CG   1 
ATOM   5767 O OD1  . ASN C 1 164 ? 14.040  28.862  58.595 1.00 32.09  ?  209 ASN C OD1  1 
ATOM   5768 N ND2  . ASN C 1 164 ? 15.338  30.687  58.401 1.00 34.16  ?  209 ASN C ND2  1 
ATOM   5769 H H    . ASN C 1 164 ? 12.250  29.109  57.243 1.00 28.37  ?  209 ASN C H    1 
ATOM   5770 H HA   . ASN C 1 164 ? 11.369  31.612  57.517 1.00 32.06  ?  209 ASN C HA   1 
ATOM   5771 H HB2  . ASN C 1 164 ? 13.262  31.884  58.894 1.00 31.88  ?  209 ASN C HB2  1 
ATOM   5772 H HB3  . ASN C 1 164 ? 12.378  30.648  59.361 1.00 31.88  ?  209 ASN C HB3  1 
ATOM   5773 H HD21 . ASN C 1 164 ? 16.054  30.216  58.334 1.00 40.99  ?  209 ASN C HD21 1 
ATOM   5774 H HD22 . ASN C 1 164 ? 15.382  31.546  58.370 1.00 40.99  ?  209 ASN C HD22 1 
ATOM   5775 N N    . THR C 1 165 ? 13.274  31.103  55.170 1.00 19.64  ?  210 THR C N    1 
ATOM   5776 C CA   . THR C 1 165 ? 13.933  31.759  54.050 1.00 22.05  ?  210 THR C CA   1 
ATOM   5777 C C    . THR C 1 165 ? 13.141  32.988  53.629 1.00 23.05  ?  210 THR C C    1 
ATOM   5778 O O    . THR C 1 165 ? 11.945  32.902  53.334 1.00 22.69  ?  210 THR C O    1 
ATOM   5779 C CB   . THR C 1 165 ? 14.069  30.796  52.871 1.00 25.10  ?  210 THR C CB   1 
ATOM   5780 O OG1  . THR C 1 165 ? 14.838  29.654  53.267 1.00 25.37  ?  210 THR C OG1  1 
ATOM   5781 C CG2  . THR C 1 165 ? 14.755  31.480  51.685 1.00 26.00  ?  210 THR C CG2  1 
ATOM   5782 H H    . THR C 1 165 ? 13.096  30.272  55.038 1.00 23.57  ?  210 THR C H    1 
ATOM   5783 H HA   . THR C 1 165 ? 14.821  32.043  54.319 1.00 26.46  ?  210 THR C HA   1 
ATOM   5784 H HB   . THR C 1 165 ? 13.187  30.507  52.589 1.00 30.12  ?  210 THR C HB   1 
ATOM   5785 H HG1  . THR C 1 165 ? 14.458  29.258  53.903 1.00 30.45  ?  210 THR C HG1  1 
ATOM   5786 H HG21 . THR C 1 165 ? 14.835  30.858  50.945 1.00 31.20  ?  210 THR C HG21 1 
ATOM   5787 H HG22 . THR C 1 165 ? 14.235  32.247  51.398 1.00 31.20  ?  210 THR C HG22 1 
ATOM   5788 H HG23 . THR C 1 165 ? 15.641  31.779  51.942 1.00 31.20  ?  210 THR C HG23 1 
ATOM   5789 N N    . ILE C 1 166 ? 13.815  34.134  53.600 1.00 20.27  ?  211 ILE C N    1 
ATOM   5790 C CA   . ILE C 1 166 ? 13.171  35.394  53.247 1.00 22.73  ?  211 ILE C CA   1 
ATOM   5791 C C    . ILE C 1 166 ? 13.060  35.479  51.730 1.00 22.38  ?  211 ILE C C    1 
ATOM   5792 O O    . ILE C 1 166 ? 14.066  35.421  51.016 1.00 24.60  ?  211 ILE C O    1 
ATOM   5793 C CB   . ILE C 1 166 ? 13.948  36.590  53.814 1.00 21.87  ?  211 ILE C CB   1 
ATOM   5794 C CG1  . ILE C 1 166 ? 14.005  36.505  55.341 1.00 22.78  ?  211 ILE C CG1  1 
ATOM   5795 C CG2  . ILE C 1 166 ? 13.295  37.899  53.386 1.00 27.44  ?  211 ILE C CG2  1 
ATOM   5796 C CD1  . ILE C 1 166 ? 15.006  37.445  55.976 1.00 34.97  ?  211 ILE C CD1  1 
ATOM   5797 H H    . ILE C 1 166 ? 14.653  34.209  53.782 1.00 24.32  ?  211 ILE C H    1 
ATOM   5798 H HA   . ILE C 1 166 ? 12.275  35.410  53.619 1.00 27.28  ?  211 ILE C HA   1 
ATOM   5799 H HB   . ILE C 1 166 ? 14.854  36.566  53.466 1.00 26.25  ?  211 ILE C HB   1 
ATOM   5800 H HG12 . ILE C 1 166 ? 13.129  36.721  55.697 1.00 27.34  ?  211 ILE C HG12 1 
ATOM   5801 H HG13 . ILE C 1 166 ? 14.248  35.600  55.593 1.00 27.34  ?  211 ILE C HG13 1 
ATOM   5802 H HG21 . ILE C 1 166 ? 13.802  38.639  53.754 1.00 32.92  ?  211 ILE C HG21 1 
ATOM   5803 H HG22 . ILE C 1 166 ? 13.293  37.948  52.417 1.00 32.92  ?  211 ILE C HG22 1 
ATOM   5804 H HG23 . ILE C 1 166 ? 12.385  37.921  53.721 1.00 32.92  ?  211 ILE C HG23 1 
ATOM   5805 H HD11 . ILE C 1 166 ? 14.980  37.330  56.939 1.00 41.96  ?  211 ILE C HD11 1 
ATOM   5806 H HD12 . ILE C 1 166 ? 15.892  37.236  55.641 1.00 41.96  ?  211 ILE C HD12 1 
ATOM   5807 H HD13 . ILE C 1 166 ? 14.772  38.358  55.745 1.00 41.96  ?  211 ILE C HD13 1 
ATOM   5808 N N    . MET C 1 167 ? 11.835  35.613  51.236 1.00 18.50  ?  212 MET C N    1 
ATOM   5809 C CA   . MET C 1 167 ? 11.567  35.818  49.823 1.00 16.83  ?  212 MET C CA   1 
ATOM   5810 C C    . MET C 1 167 ? 11.074  37.246  49.628 1.00 16.52  ?  212 MET C C    1 
ATOM   5811 O O    . MET C 1 167 ? 10.304  37.762  50.445 1.00 17.07  ?  212 MET C O    1 
ATOM   5812 C CB   . MET C 1 167 ? 10.527  34.815  49.312 1.00 18.28  ?  212 MET C CB   1 
ATOM   5813 C CG   . MET C 1 167 ? 10.890  33.353  49.585 1.00 21.19  ?  212 MET C CG   1 
ATOM   5814 S SD   . MET C 1 167 ? 9.563   32.179  49.209 1.00 20.51  ?  212 MET C SD   1 
ATOM   5815 C CE   . MET C 1 167 ? 9.531   32.253  47.434 1.00 15.84  ?  212 MET C CE   1 
ATOM   5816 H H    . MET C 1 167 ? 11.122  35.588  51.718 1.00 22.20  ?  212 MET C H    1 
ATOM   5817 H HA   . MET C 1 167 ? 12.386  35.690  49.320 1.00 20.20  ?  212 MET C HA   1 
ATOM   5818 H HB2  . MET C 1 167 ? 9.679   34.996  49.747 1.00 21.93  ?  212 MET C HB2  1 
ATOM   5819 H HB3  . MET C 1 167 ? 10.434  34.923  48.352 1.00 21.93  ?  212 MET C HB3  1 
ATOM   5820 H HG2  . MET C 1 167 ? 11.658  33.115  49.041 1.00 25.42  ?  212 MET C HG2  1 
ATOM   5821 H HG3  . MET C 1 167 ? 11.112  33.257  50.525 1.00 25.42  ?  212 MET C HG3  1 
ATOM   5822 H HE1  . MET C 1 167 ? 8.843   31.653  47.106 1.00 19.01  ?  212 MET C HE1  1 
ATOM   5823 H HE2  . MET C 1 167 ? 9.335   33.162  47.160 1.00 19.01  ?  212 MET C HE2  1 
ATOM   5824 H HE3  . MET C 1 167 ? 10.397  31.983  47.092 1.00 19.01  ?  212 MET C HE3  1 
ATOM   5825 N N    . GLU C 1 168 ? 11.536  37.892  48.562 1.00 14.40  ?  213 GLU C N    1 
ATOM   5826 C CA   . GLU C 1 168 ? 11.169  39.273  48.276 1.00 14.87  ?  213 GLU C CA   1 
ATOM   5827 C C    . GLU C 1 168 ? 10.523  39.353  46.902 1.00 15.58  ?  213 GLU C C    1 
ATOM   5828 O O    . GLU C 1 168 ? 11.098  38.895  45.908 1.00 14.03  ?  213 GLU C O    1 
ATOM   5829 C CB   . GLU C 1 168 ? 12.388  40.196  48.348 1.00 13.94  ?  213 GLU C CB   1 
ATOM   5830 C CG   . GLU C 1 168 ? 12.059  41.665  48.083 1.00 14.79  ?  213 GLU C CG   1 
ATOM   5831 C CD   . GLU C 1 168 ? 13.244  42.595  48.285 1.00 21.66  ?  213 GLU C CD   1 
ATOM   5832 O OE1  . GLU C 1 168 ? 14.371  42.106  48.514 1.00 19.46  ?  213 GLU C OE1  1 
ATOM   5833 O OE2  . GLU C 1 168 ? 13.043  43.826  48.219 1.00 20.12  -1 213 GLU C OE2  1 
ATOM   5834 H H    . GLU C 1 168 ? 12.069  37.547  47.983 1.00 17.28  ?  213 GLU C H    1 
ATOM   5835 H HA   . GLU C 1 168 ? 10.523  39.574  48.933 1.00 17.84  ?  213 GLU C HA   1 
ATOM   5836 H HB2  . GLU C 1 168 ? 12.776  40.134  49.235 1.00 16.72  ?  213 GLU C HB2  1 
ATOM   5837 H HB3  . GLU C 1 168 ? 13.036  39.913  47.685 1.00 16.72  ?  213 GLU C HB3  1 
ATOM   5838 H HG2  . GLU C 1 168 ? 11.759  41.759  47.165 1.00 17.75  ?  213 GLU C HG2  1 
ATOM   5839 H HG3  . GLU C 1 168 ? 11.355  41.944  48.690 1.00 17.75  ?  213 GLU C HG3  1 
ATOM   5840 N N    . TYR C 1 169 ? 9.325   39.925  46.851 1.00 11.94  ?  214 TYR C N    1 
ATOM   5841 C CA   . TYR C 1 169 ? 8.670   40.231  45.591 1.00 12.77  ?  214 TYR C CA   1 
ATOM   5842 C C    . TYR C 1 169 ? 8.747   41.729  45.360 1.00 14.72  ?  214 TYR C C    1 
ATOM   5843 O O    . TYR C 1 169 ? 8.415   42.512  46.254 1.00 14.09  ?  214 TYR C O    1 
ATOM   5844 C CB   . TYR C 1 169 ? 7.208   39.790  45.569 1.00 13.39  ?  214 TYR C CB   1 
ATOM   5845 C CG   . TYR C 1 169 ? 6.631   39.914  44.182 1.00 14.69  ?  214 TYR C CG   1 
ATOM   5846 C CD1  . TYR C 1 169 ? 6.078   41.109  43.739 1.00 13.66  ?  214 TYR C CD1  1 
ATOM   5847 C CD2  . TYR C 1 169 ? 6.681   38.848  43.297 1.00 14.11  ?  214 TYR C CD2  1 
ATOM   5848 C CE1  . TYR C 1 169 ? 5.573   41.227  42.462 1.00 15.47  ?  214 TYR C CE1  1 
ATOM   5849 C CE2  . TYR C 1 169 ? 6.176   38.957  42.023 1.00 13.91  ?  214 TYR C CE2  1 
ATOM   5850 C CZ   . TYR C 1 169 ? 5.625   40.149  41.608 1.00 14.23  ?  214 TYR C CZ   1 
ATOM   5851 O OH   . TYR C 1 169 ? 5.124   40.250  40.334 1.00 16.51  ?  214 TYR C OH   1 
ATOM   5852 H H    . TYR C 1 169 ? 8.866   40.148  47.543 1.00 14.33  ?  214 TYR C H    1 
ATOM   5853 H HA   . TYR C 1 169 ? 9.137   39.784  44.868 1.00 15.33  ?  214 TYR C HA   1 
ATOM   5854 H HB2  . TYR C 1 169 ? 7.148   38.861  45.844 1.00 16.07  ?  214 TYR C HB2  1 
ATOM   5855 H HB3  . TYR C 1 169 ? 6.692   40.353  46.167 1.00 16.07  ?  214 TYR C HB3  1 
ATOM   5856 H HD1  . TYR C 1 169 ? 6.043   41.838  44.314 1.00 16.39  ?  214 TYR C HD1  1 
ATOM   5857 H HD2  . TYR C 1 169 ? 7.054   38.042  43.573 1.00 16.93  ?  214 TYR C HD2  1 
ATOM   5858 H HE1  . TYR C 1 169 ? 5.198   42.030  42.180 1.00 18.56  ?  214 TYR C HE1  1 
ATOM   5859 H HE2  . TYR C 1 169 ? 6.211   38.231  41.443 1.00 16.69  ?  214 TYR C HE2  1 
ATOM   5860 H HH   . TYR C 1 169 ? 5.222   39.521  39.928 1.00 19.81  ?  214 TYR C HH   1 
ATOM   5861 N N    . LYS C 1 170 ? 9.171   42.123  44.165 1.00 15.90  ?  215 LYS C N    1 
ATOM   5862 C CA   . LYS C 1 170 ? 9.212   43.535  43.826 1.00 17.09  ?  215 LYS C CA   1 
ATOM   5863 C C    . LYS C 1 170 ? 8.904   43.706  42.348 1.00 16.32  ?  215 LYS C C    1 
ATOM   5864 O O    . LYS C 1 170 ? 9.203   42.833  41.528 1.00 15.91  ?  215 LYS C O    1 
ATOM   5865 C CB   . LYS C 1 170 ? 10.575  44.142  44.176 1.00 18.80  ?  215 LYS C CB   1 
ATOM   5866 C CG   . LYS C 1 170 ? 11.735  43.522  43.437 1.00 19.28  ?  215 LYS C CG   1 
ATOM   5867 C CD   . LYS C 1 170 ? 13.046  43.684  44.206 1.00 21.02  ?  215 LYS C CD   1 
ATOM   5868 C CE   . LYS C 1 170 ? 13.359  45.132  44.526 1.00 23.54  ?  215 LYS C CE   1 
ATOM   5869 N NZ   . LYS C 1 170 ? 14.677  45.256  45.206 1.00 33.13  1  215 LYS C NZ   1 
ATOM   5870 H H    . LYS C 1 170 ? 9.437   41.596  43.540 1.00 19.08  ?  215 LYS C H    1 
ATOM   5871 H HA   . LYS C 1 170 ? 8.532   44.005  44.333 1.00 20.51  ?  215 LYS C HA   1 
ATOM   5872 H HB2  . LYS C 1 170 ? 10.560  45.087  43.961 1.00 22.56  ?  215 LYS C HB2  1 
ATOM   5873 H HB3  . LYS C 1 170 ? 10.733  44.024  45.126 1.00 22.56  ?  215 LYS C HB3  1 
ATOM   5874 H HG2  . LYS C 1 170 ? 11.568  42.574  43.318 1.00 23.14  ?  215 LYS C HG2  1 
ATOM   5875 H HG3  . LYS C 1 170 ? 11.833  43.956  42.575 1.00 23.14  ?  215 LYS C HG3  1 
ATOM   5876 H HD2  . LYS C 1 170 ? 12.983  43.198  45.044 1.00 25.22  ?  215 LYS C HD2  1 
ATOM   5877 H HD3  . LYS C 1 170 ? 13.773  43.330  43.670 1.00 25.22  ?  215 LYS C HD3  1 
ATOM   5878 H HE2  . LYS C 1 170 ? 13.391  45.643  43.702 1.00 28.24  ?  215 LYS C HE2  1 
ATOM   5879 H HE3  . LYS C 1 170 ? 12.676  45.486  45.116 1.00 28.24  ?  215 LYS C HE3  1 
ATOM   5880 H HZ1  . LYS C 1 170 ? 14.846  46.111  45.387 1.00 39.75  ?  215 LYS C HZ1  1 
ATOM   5881 H HZ2  . LYS C 1 170 ? 14.670  44.795  45.968 1.00 39.75  ?  215 LYS C HZ2  1 
ATOM   5882 H HZ3  . LYS C 1 170 ? 15.321  44.938  44.681 1.00 39.75  ?  215 LYS C HZ3  1 
ATOM   5883 N N    . THR C 1 171 ? 8.287   44.835  42.018 1.00 19.79  ?  216 THR C N    1 
ATOM   5884 C CA   . THR C 1 171 ? 8.122   45.193  40.621 1.00 18.56  ?  216 THR C CA   1 
ATOM   5885 C C    . THR C 1 171 ? 9.483   45.502  40.015 1.00 19.42  ?  216 THR C C    1 
ATOM   5886 O O    . THR C 1 171 ? 10.477  45.701  40.720 1.00 20.92  ?  216 THR C O    1 
ATOM   5887 C CB   . THR C 1 171 ? 7.206   46.406  40.461 1.00 25.86  ?  216 THR C CB   1 
ATOM   5888 O OG1  . THR C 1 171 ? 7.896   47.582  40.901 1.00 26.03  ?  216 THR C OG1  1 
ATOM   5889 C CG2  . THR C 1 171 ? 5.921   46.232  41.264 1.00 27.93  ?  216 THR C CG2  1 
ATOM   5890 H H    . THR C 1 171 ? 7.960   45.402  42.577 1.00 23.75  ?  216 THR C H    1 
ATOM   5891 H HA   . THR C 1 171 ? 7.732   44.447  40.139 1.00 22.28  ?  216 THR C HA   1 
ATOM   5892 H HB   . THR C 1 171 ? 6.968   46.506  39.526 1.00 31.03  ?  216 THR C HB   1 
ATOM   5893 H HG1  . THR C 1 171 ? 7.400   48.255  40.817 1.00 31.24  ?  216 THR C HG1  1 
ATOM   5894 H HG21 . THR C 1 171 ? 5.352   47.009  41.152 1.00 33.51  ?  216 THR C HG21 1 
ATOM   5895 H HG22 . THR C 1 171 ? 5.443   45.445  40.958 1.00 33.51  ?  216 THR C HG22 1 
ATOM   5896 H HG23 . THR C 1 171 ? 6.130   46.127  42.206 1.00 33.51  ?  216 THR C HG23 1 
ATOM   5897 N N    . HIS C 1 172 ? 9.527   45.535  38.687 1.00 17.73  ?  217 HIS C N    1 
ATOM   5898 C CA   . HIS C 1 172 ? 10.779  45.870  38.024 1.00 20.18  ?  217 HIS C CA   1 
ATOM   5899 C C    . HIS C 1 172 ? 11.186  47.308  38.303 1.00 18.45  ?  217 HIS C C    1 
ATOM   5900 O O    . HIS C 1 172 ? 12.381  47.599  38.411 1.00 19.27  ?  217 HIS C O    1 
ATOM   5901 C CB   . HIS C 1 172 ? 10.658  45.616  36.526 1.00 21.90  ?  217 HIS C CB   1 
ATOM   5902 C CG   . HIS C 1 172 ? 10.289  44.205  36.200 1.00 19.44  ?  217 HIS C CG   1 
ATOM   5903 N ND1  . HIS C 1 172 ? 11.085  43.134  36.543 1.00 17.71  ?  217 HIS C ND1  1 
ATOM   5904 C CD2  . HIS C 1 172 ? 9.198   43.686  35.591 1.00 19.01  ?  217 HIS C CD2  1 
ATOM   5905 C CE1  . HIS C 1 172 ? 10.504  42.016  36.150 1.00 17.65  ?  217 HIS C CE1  1 
ATOM   5906 N NE2  . HIS C 1 172 ? 9.360   42.323  35.567 1.00 16.71  ?  217 HIS C NE2  1 
ATOM   5907 H H    . HIS C 1 172 ? 8.867   45.372  38.161 1.00 21.28  ?  217 HIS C H    1 
ATOM   5908 H HA   . HIS C 1 172 ? 11.479  45.293  38.368 1.00 24.22  ?  217 HIS C HA   1 
ATOM   5909 H HB2  . HIS C 1 172 ? 9.971   46.196  36.162 1.00 26.28  ?  217 HIS C HB2  1 
ATOM   5910 H HB3  . HIS C 1 172 ? 11.511  45.807  36.104 1.00 26.28  ?  217 HIS C HB3  1 
ATOM   5911 H HD2  . HIS C 1 172 ? 8.478   44.163  35.247 1.00 22.81  ?  217 HIS C HD2  1 
ATOM   5912 H HE1  . HIS C 1 172 ? 10.846  41.158  36.260 1.00 21.18  ?  217 HIS C HE1  1 
ATOM   5913 H HE2  . HIS C 1 172 ? 8.805   41.760  35.228 1.00 20.05  ?  217 HIS C HE2  1 
ATOM   5914 N N    . THR C 1 173 ? 10.216  48.216  38.441 1.00 21.37  ?  218 THR C N    1 
ATOM   5915 C CA   . THR C 1 173 ? 10.553  49.592  38.798 1.00 22.83  ?  218 THR C CA   1 
ATOM   5916 C C    . THR C 1 173 ? 11.171  49.656  40.188 1.00 23.55  ?  218 THR C C    1 
ATOM   5917 O O    . THR C 1 173 ? 12.073  50.465  40.437 1.00 23.23  ?  218 THR C O    1 
ATOM   5918 C CB   . THR C 1 173 ? 9.312   50.486  38.728 1.00 22.13  ?  218 THR C CB   1 
ATOM   5919 O OG1  . THR C 1 173 ? 8.342   50.043  39.684 1.00 28.20  ?  218 THR C OG1  1 
ATOM   5920 C CG2  . THR C 1 173 ? 8.702   50.458  37.335 1.00 23.85  ?  218 THR C CG2  1 
ATOM   5921 H H    . THR C 1 173 ? 9.376   48.064  38.336 1.00 25.64  ?  218 THR C H    1 
ATOM   5922 H HA   . THR C 1 173 ? 11.203  49.932  38.164 1.00 27.40  ?  218 THR C HA   1 
ATOM   5923 H HB   . THR C 1 173 ? 9.566   51.400  38.931 1.00 26.55  ?  218 THR C HB   1 
ATOM   5924 H HG1  . THR C 1 173 ? 7.660   50.532  39.649 1.00 33.83  ?  218 THR C HG1  1 
ATOM   5925 H HG21 . THR C 1 173 ? 7.918   51.028  37.305 1.00 28.62  ?  218 THR C HG21 1 
ATOM   5926 H HG22 . THR C 1 173 ? 9.348   50.775  36.684 1.00 28.62  ?  218 THR C HG22 1 
ATOM   5927 H HG23 . THR C 1 173 ? 8.442   49.552  37.105 1.00 28.62  ?  218 THR C HG23 1 
ATOM   5928 N N    . ASP C 1 174 ? 10.704  48.807  41.111 1.00 19.68  ?  219 ASP C N    1 
ATOM   5929 C CA   . ASP C 1 174 ? 11.295  48.766  42.443 1.00 20.89  ?  219 ASP C CA   1 
ATOM   5930 C C    . ASP C 1 174 ? 12.756  48.345  42.404 1.00 20.91  ?  219 ASP C C    1 
ATOM   5931 O O    . ASP C 1 174 ? 13.497  48.626  43.351 1.00 20.37  ?  219 ASP C O    1 
ATOM   5932 C CB   . ASP C 1 174 ? 10.530  47.800  43.345 1.00 21.98  ?  219 ASP C CB   1 
ATOM   5933 C CG   . ASP C 1 174 ? 9.096   48.223  43.592 1.00 24.42  ?  219 ASP C CG   1 
ATOM   5934 O OD1  . ASP C 1 174 ? 8.795   49.431  43.499 1.00 26.35  ?  219 ASP C OD1  1 
ATOM   5935 O OD2  . ASP C 1 174 ? 8.270   47.333  43.892 1.00 23.96  -1 219 ASP C OD2  1 
ATOM   5936 H H    . ASP C 1 174 ? 10.057  48.254  40.988 1.00 23.61  ?  219 ASP C H    1 
ATOM   5937 H HA   . ASP C 1 174 ? 11.247  49.651  42.838 1.00 25.07  ?  219 ASP C HA   1 
ATOM   5938 H HB2  . ASP C 1 174 ? 10.515  46.924  42.928 1.00 26.38  ?  219 ASP C HB2  1 
ATOM   5939 H HB3  . ASP C 1 174 ? 10.978  47.749  44.204 1.00 26.38  ?  219 ASP C HB3  1 
ATOM   5940 N N    . SER C 1 175 ? 13.180  47.665  41.342 1.00 24.30  ?  220 SER C N    1 
ATOM   5941 C CA   . SER C 1 175 ? 14.529  47.126  41.241 1.00 25.72  ?  220 SER C CA   1 
ATOM   5942 C C    . SER C 1 175 ? 15.474  48.028  40.463 1.00 26.33  ?  220 SER C C    1 
ATOM   5943 O O    . SER C 1 175 ? 16.644  47.671  40.290 1.00 26.46  ?  220 SER C O    1 
ATOM   5944 C CB   . SER C 1 175 ? 14.491  45.746  40.576 1.00 24.76  ?  220 SER C CB   1 
ATOM   5945 O OG   . SER C 1 175 ? 13.582  44.888  41.237 1.00 28.05  ?  220 SER C OG   1 
ATOM   5946 H H    . SER C 1 175 ? 12.692  47.500  40.653 1.00 29.16  ?  220 SER C H    1 
ATOM   5947 H HA   . SER C 1 175 ? 14.890  47.016  42.135 1.00 30.86  ?  220 SER C HA   1 
ATOM   5948 H HB2  . SER C 1 175 ? 14.213  45.849  39.653 1.00 29.71  ?  220 SER C HB2  1 
ATOM   5949 H HB3  . SER C 1 175 ? 15.378  45.354  40.613 1.00 29.71  ?  220 SER C HB3  1 
ATOM   5950 H HG   . SER C 1 175 ? 13.572  44.136  40.862 1.00 33.66  ?  220 SER C HG   1 
ATOM   5951 N N    . ILE C 1 176 ? 15.004  49.180  39.994 1.00 28.26  ?  221 ILE C N    1 
ATOM   5952 C CA   . ILE C 1 176 ? 15.751  50.022  39.070 1.00 26.76  ?  221 ILE C CA   1 
ATOM   5953 C C    . ILE C 1 176 ? 15.919  51.400  39.690 1.00 27.77  ?  221 ILE C C    1 
ATOM   5954 O O    . ILE C 1 176 ? 14.968  51.961  40.245 1.00 24.70  ?  221 ILE C O    1 
ATOM   5955 C CB   . ILE C 1 176 ? 15.034  50.118  37.707 1.00 27.74  ?  221 ILE C CB   1 
ATOM   5956 C CG1  . ILE C 1 176 ? 14.935  48.740  37.062 1.00 30.70  ?  221 ILE C CG1  1 
ATOM   5957 C CG2  . ILE C 1 176 ? 15.759  51.078  36.771 1.00 29.35  ?  221 ILE C CG2  1 
ATOM   5958 C CD1  . ILE C 1 176 ? 13.873  48.654  36.001 1.00 33.12  ?  221 ILE C CD1  1 
ATOM   5959 H H    . ILE C 1 176 ? 14.234  49.502  40.204 1.00 33.91  ?  221 ILE C H    1 
ATOM   5960 H HA   . ILE C 1 176 ? 16.631  49.641  38.927 1.00 32.11  ?  221 ILE C HA   1 
ATOM   5961 H HB   . ILE C 1 176 ? 14.136  50.453  37.856 1.00 33.28  ?  221 ILE C HB   1 
ATOM   5962 H HG12 . ILE C 1 176 ? 15.786  48.525  36.649 1.00 36.84  ?  221 ILE C HG12 1 
ATOM   5963 H HG13 . ILE C 1 176 ? 14.726  48.086  37.747 1.00 36.84  ?  221 ILE C HG13 1 
ATOM   5964 H HG21 . ILE C 1 176 ? 15.283  51.115  35.926 1.00 35.22  ?  221 ILE C HG21 1 
ATOM   5965 H HG22 . ILE C 1 176 ? 15.781  51.959  37.177 1.00 35.22  ?  221 ILE C HG22 1 
ATOM   5966 H HG23 . ILE C 1 176 ? 16.663  50.757  36.628 1.00 35.22  ?  221 ILE C HG23 1 
ATOM   5967 H HD11 . ILE C 1 176 ? 13.865  47.756  35.635 1.00 39.74  ?  221 ILE C HD11 1 
ATOM   5968 H HD12 . ILE C 1 176 ? 13.012  48.857  36.400 1.00 39.74  ?  221 ILE C HD12 1 
ATOM   5969 H HD13 . ILE C 1 176 ? 14.073  49.295  35.302 1.00 39.74  ?  221 ILE C HD13 1 
ATOM   5970 N N    . LYS C 1 177 ? 17.134  51.943  39.590 1.00 27.16  ?  222 LYS C N    1 
ATOM   5971 C CA   . LYS C 1 177 ? 17.431  53.296  40.062 1.00 30.83  ?  222 LYS C CA   1 
ATOM   5972 C C    . LYS C 1 177 ? 17.056  53.450  41.535 1.00 29.64  ?  222 LYS C C    1 
ATOM   5973 O O    . LYS C 1 177 ? 16.379  54.400  41.935 1.00 29.34  ?  222 LYS C O    1 
ATOM   5974 C CB   . LYS C 1 177 ? 16.714  54.337  39.199 1.00 28.71  ?  222 LYS C CB   1 
ATOM   5975 C CG   . LYS C 1 177 ? 17.078  54.282  37.721 1.00 30.26  ?  222 LYS C CG   1 
ATOM   5976 C CD   . LYS C 1 177 ? 18.208  55.235  37.376 1.00 31.33  ?  222 LYS C CD   1 
ATOM   5977 C CE   . LYS C 1 177 ? 18.563  55.156  35.897 1.00 36.35  ?  222 LYS C CE   1 
ATOM   5978 N NZ   . LYS C 1 177 ? 17.377  55.373  35.022 1.00 34.30  1  222 LYS C NZ   1 
ATOM   5979 H H    . LYS C 1 177 ? 17.813  51.541  39.248 1.00 32.60  ?  222 LYS C H    1 
ATOM   5980 H HA   . LYS C 1 177 ? 18.385  53.451  39.981 1.00 36.99  ?  222 LYS C HA   1 
ATOM   5981 H HB2  . LYS C 1 177 ? 15.757  54.197  39.273 1.00 34.45  ?  222 LYS C HB2  1 
ATOM   5982 H HB3  . LYS C 1 177 ? 16.941  55.222  39.526 1.00 34.45  ?  222 LYS C HB3  1 
ATOM   5983 H HG2  . LYS C 1 177 ? 17.362  53.382  37.496 1.00 36.31  ?  222 LYS C HG2  1 
ATOM   5984 H HG3  . LYS C 1 177 ? 16.303  54.529  37.192 1.00 36.31  ?  222 LYS C HG3  1 
ATOM   5985 H HD2  . LYS C 1 177 ? 17.934  56.144  37.575 1.00 37.60  ?  222 LYS C HD2  1 
ATOM   5986 H HD3  . LYS C 1 177 ? 18.995  54.999  37.891 1.00 37.60  ?  222 LYS C HD3  1 
ATOM   5987 H HE2  . LYS C 1 177 ? 19.220  55.839  35.690 1.00 43.62  ?  222 LYS C HE2  1 
ATOM   5988 H HE3  . LYS C 1 177 ? 18.924  54.277  35.703 1.00 43.62  ?  222 LYS C HE3  1 
ATOM   5989 H HZ1  . LYS C 1 177 ? 17.616  55.321  34.166 1.00 41.16  ?  222 LYS C HZ1  1 
ATOM   5990 H HZ2  . LYS C 1 177 ? 16.759  54.754  35.187 1.00 41.16  ?  222 LYS C HZ2  1 
ATOM   5991 H HZ3  . LYS C 1 177 ? 17.029  56.178  35.176 1.00 41.16  ?  222 LYS C HZ3  1 
ATOM   5992 N N    . MET C 1 178 ? 17.506  52.492  42.346 1.00 33.73  ?  223 MET C N    1 
ATOM   5993 C CA   . MET C 1 178 ? 17.223  52.443  43.771 1.00 39.17  ?  223 MET C CA   1 
ATOM   5994 C C    . MET C 1 178 ? 18.449  51.898  44.492 1.00 47.70  ?  223 MET C C    1 
ATOM   5995 O O    . MET C 1 178 ? 19.143  51.022  43.953 1.00 51.60  ?  223 MET C O    1 
ATOM   5996 C CB   . MET C 1 178 ? 16.013  51.549  44.074 1.00 39.51  ?  223 MET C CB   1 
ATOM   5997 C CG   . MET C 1 178 ? 14.666  52.195  43.801 1.00 32.38  ?  223 MET C CG   1 
ATOM   5998 S SD   . MET C 1 178 ? 14.320  53.586  44.894 1.00 39.46  ?  223 MET C SD   1 
ATOM   5999 C CE   . MET C 1 178 ? 14.320  52.789  46.493 1.00 29.48  ?  223 MET C CE   1 
ATOM   6000 H H    . MET C 1 178 ? 17.995  51.837  42.077 1.00 40.48  ?  223 MET C H    1 
ATOM   6001 H HA   . MET C 1 178 ? 17.031  53.338  44.092 1.00 47.00  ?  223 MET C HA   1 
ATOM   6002 H HB2  . MET C 1 178 ? 16.072  50.751  43.526 1.00 47.41  ?  223 MET C HB2  1 
ATOM   6003 H HB3  . MET C 1 178 ? 16.036  51.303  45.012 1.00 47.41  ?  223 MET C HB3  1 
ATOM   6004 H HG2  . MET C 1 178 ? 14.653  52.522  42.887 1.00 38.86  ?  223 MET C HG2  1 
ATOM   6005 H HG3  . MET C 1 178 ? 13.968  51.534  43.927 1.00 38.86  ?  223 MET C HG3  1 
ATOM   6006 H HE1  . MET C 1 178 ? 14.140  53.453  47.176 1.00 35.38  ?  223 MET C HE1  1 
ATOM   6007 H HE2  . MET C 1 178 ? 13.630  52.106  46.505 1.00 35.38  ?  223 MET C HE2  1 
ATOM   6008 H HE3  . MET C 1 178 ? 15.188  52.385  46.644 1.00 35.38  ?  223 MET C HE3  1 
ATOM   6009 N N    . PRO C 1 179 ? 18.739  52.378  45.714 1.00 54.43  ?  224 PRO C N    1 
ATOM   6010 C CA   . PRO C 1 179 ? 19.889  51.852  46.461 1.00 56.32  ?  224 PRO C CA   1 
ATOM   6011 C C    . PRO C 1 179 ? 19.793  50.350  46.716 1.00 55.49  ?  224 PRO C C    1 
ATOM   6012 O O    . PRO C 1 179 ? 20.447  49.582  46.009 1.00 58.14  ?  224 PRO C O    1 
ATOM   6013 C CB   . PRO C 1 179 ? 19.838  52.634  47.780 1.00 45.43  ?  224 PRO C CB   1 
ATOM   6014 C CG   . PRO C 1 179 ? 18.425  53.100  47.892 1.00 40.88  ?  224 PRO C CG   1 
ATOM   6015 C CD   . PRO C 1 179 ? 18.011  53.396  46.489 1.00 41.65  ?  224 PRO C CD   1 
ATOM   6016 H HA   . PRO C 1 179 ? 20.717  52.052  45.998 1.00 67.59  ?  224 PRO C HA   1 
ATOM   6017 H HB2  . PRO C 1 179 ? 20.067  52.047  48.517 1.00 54.51  ?  224 PRO C HB2  1 
ATOM   6018 H HB3  . PRO C 1 179 ? 20.447  53.388  47.737 1.00 54.51  ?  224 PRO C HB3  1 
ATOM   6019 H HG2  . PRO C 1 179 ? 17.876  52.396  48.272 1.00 49.06  ?  224 PRO C HG2  1 
ATOM   6020 H HG3  . PRO C 1 179 ? 18.386  53.900  48.439 1.00 49.06  ?  224 PRO C HG3  1 
ATOM   6021 H HD2  . PRO C 1 179 ? 17.054  53.282  46.386 1.00 49.98  ?  224 PRO C HD2  1 
ATOM   6022 H HD3  . PRO C 1 179 ? 18.296  54.287  46.232 1.00 49.98  ?  224 PRO C HD3  1 
ATOM   6023 N N    . MET D 2 4   ? -8.690  21.532  30.768 1.00 53.81  ?  49  MET D N    1 
ATOM   6024 C CA   . MET D 2 4   ? -7.514  21.348  31.612 1.00 61.82  ?  49  MET D CA   1 
ATOM   6025 C C    . MET D 2 4   ? -6.453  20.507  30.910 1.00 57.62  ?  49  MET D C    1 
ATOM   6026 O O    . MET D 2 4   ? -6.187  19.374  31.311 1.00 61.36  ?  49  MET D O    1 
ATOM   6027 C CB   . MET D 2 4   ? -7.905  20.685  32.935 1.00 70.79  ?  49  MET D CB   1 
ATOM   6028 C CG   . MET D 2 4   ? -8.773  21.551  33.838 1.00 63.93  ?  49  MET D CG   1 
ATOM   6029 S SD   . MET D 2 4   ? -7.890  22.954  34.552 1.00 71.46  ?  49  MET D SD   1 
ATOM   6030 C CE   . MET D 2 4   ? -6.715  22.123  35.622 1.00 69.56  ?  49  MET D CE   1 
ATOM   6031 H HA   . MET D 2 4   ? -7.138  22.219  31.816 1.00 74.19  ?  49  MET D HA   1 
ATOM   6032 H HB2  . MET D 2 4   ? -8.400  19.873  32.742 1.00 84.95  ?  49  MET D HB2  1 
ATOM   6033 H HB3  . MET D 2 4   ? -7.097  20.467  33.424 1.00 84.95  ?  49  MET D HB3  1 
ATOM   6034 H HG2  . MET D 2 4   ? -9.515  21.899  33.319 1.00 76.71  ?  49  MET D HG2  1 
ATOM   6035 H HG3  . MET D 2 4   ? -9.107  21.007  34.568 1.00 76.71  ?  49  MET D HG3  1 
ATOM   6036 H HE1  . MET D 2 4   ? -6.171  22.790  36.071 1.00 83.47  ?  49  MET D HE1  1 
ATOM   6037 H HE2  . MET D 2 4   ? -7.201  21.597  36.276 1.00 83.47  ?  49  MET D HE2  1 
ATOM   6038 H HE3  . MET D 2 4   ? -6.153  21.545  35.083 1.00 83.47  ?  49  MET D HE3  1 
ATOM   6039 N N    . THR D 2 5   ? -5.847  21.062  29.863 1.00 52.08  ?  50  THR D N    1 
ATOM   6040 C CA   . THR D 2 5   ? -4.777  20.393  29.125 1.00 51.43  ?  50  THR D CA   1 
ATOM   6041 C C    . THR D 2 5   ? -3.562  21.320  29.130 1.00 48.15  ?  50  THR D C    1 
ATOM   6042 O O    . THR D 2 5   ? -3.430  22.203  28.279 1.00 45.57  ?  50  THR D O    1 
ATOM   6043 C CB   . THR D 2 5   ? -5.207  20.034  27.692 1.00 54.02  ?  50  THR D CB   1 
ATOM   6044 O OG1  . THR D 2 5   ? -5.266  21.216  26.885 1.00 58.63  ?  50  THR D OG1  1 
ATOM   6045 C CG2  . THR D 2 5   ? -6.571  19.356  27.690 1.00 55.60  ?  50  THR D CG2  1 
ATOM   6046 H H    . THR D 2 5   ? -6.042  21.840  29.554 1.00 62.49  ?  50  THR D H    1 
ATOM   6047 H HA   . THR D 2 5   ? -4.536  19.574  29.584 1.00 61.71  ?  50  THR D HA   1 
ATOM   6048 H HB   . THR D 2 5   ? -4.562  19.418  27.310 1.00 64.82  ?  50  THR D HB   1 
ATOM   6049 H HG1  . THR D 2 5   ? -4.511  21.584  26.858 1.00 70.35  ?  50  THR D HG1  1 
ATOM   6050 H HG21 . THR D 2 5   ? -6.830  19.135  26.781 1.00 66.72  ?  50  THR D HG21 1 
ATOM   6051 H HG22 . THR D 2 5   ? -6.537  18.541  28.215 1.00 66.72  ?  50  THR D HG22 1 
ATOM   6052 H HG23 . THR D 2 5   ? -7.237  19.950  28.071 1.00 66.72  ?  50  THR D HG23 1 
ATOM   6053 N N    . ARG D 2 6   ? -2.684  21.120  30.107 1.00 37.45  ?  51  ARG D N    1 
ATOM   6054 C CA   . ARG D 2 6   ? -1.381  21.765  30.153 1.00 30.12  ?  51  ARG D CA   1 
ATOM   6055 C C    . ARG D 2 6   ? -0.323  20.680  30.275 1.00 25.14  ?  51  ARG D C    1 
ATOM   6056 O O    . ARG D 2 6   ? -0.520  19.690  30.986 1.00 22.83  ?  51  ARG D O    1 
ATOM   6057 C CB   . ARG D 2 6   ? -1.285  22.749  31.328 1.00 29.87  ?  51  ARG D CB   1 
ATOM   6058 C CG   . ARG D 2 6   ? 0.017   23.530  31.396 1.00 29.68  ?  51  ARG D CG   1 
ATOM   6059 C CD   . ARG D 2 6   ? -0.136  24.779  32.257 1.00 28.43  ?  51  ARG D CD   1 
ATOM   6060 N NE   . ARG D 2 6   ? -0.992  25.776  31.623 1.00 29.40  ?  51  ARG D NE   1 
ATOM   6061 C CZ   . ARG D 2 6   ? -0.562  26.875  31.005 1.00 26.87  ?  51  ARG D CZ   1 
ATOM   6062 N NH1  . ARG D 2 6   ? 0.734   27.162  30.927 1.00 22.72  1  51  ARG D NH1  1 
ATOM   6063 N NH2  . ARG D 2 6   ? -1.441  27.701  30.461 1.00 24.11  ?  51  ARG D NH2  1 
ATOM   6064 H H    . ARG D 2 6   ? -2.827  20.598  30.775 1.00 44.94  ?  51  ARG D H    1 
ATOM   6065 H HA   . ARG D 2 6   ? -1.230  22.253  29.328 1.00 36.15  ?  51  ARG D HA   1 
ATOM   6066 H HB2  . ARG D 2 6   ? -2.009  23.390  31.254 1.00 35.84  ?  51  ARG D HB2  1 
ATOM   6067 H HB3  . ARG D 2 6   ? -1.373  22.252  32.156 1.00 35.84  ?  51  ARG D HB3  1 
ATOM   6068 H HG2  . ARG D 2 6   ? 0.707   22.972  31.787 1.00 35.62  ?  51  ARG D HG2  1 
ATOM   6069 H HG3  . ARG D 2 6   ? 0.273   23.806  30.502 1.00 35.62  ?  51  ARG D HG3  1 
ATOM   6070 H HD2  . ARG D 2 6   ? -0.535  24.533  33.107 1.00 34.12  ?  51  ARG D HD2  1 
ATOM   6071 H HD3  . ARG D 2 6   ? 0.737   25.176  32.400 1.00 34.12  ?  51  ARG D HD3  1 
ATOM   6072 H HE   . ARG D 2 6   ? -1.842  25.644  31.650 1.00 35.28  ?  51  ARG D HE   1 
ATOM   6073 H HH11 . ARG D 2 6   ? 1.313   26.631  31.276 1.00 27.26  ?  51  ARG D HH11 1 
ATOM   6074 H HH12 . ARG D 2 6   ? 0.993   27.877  30.525 1.00 27.26  ?  51  ARG D HH12 1 
ATOM   6075 H HH21 . ARG D 2 6   ? -2.282  27.526  30.508 1.00 28.93  ?  51  ARG D HH21 1 
ATOM   6076 H HH22 . ARG D 2 6   ? -1.172  28.415  30.064 1.00 28.93  ?  51  ARG D HH22 1 
ATOM   6077 N N    . ILE D 2 7   ? 0.788   20.850  29.564 1.00 19.07  ?  52  ILE D N    1 
ATOM   6078 C CA   . ILE D 2 7   ? 1.838   19.838  29.554 1.00 20.81  ?  52  ILE D CA   1 
ATOM   6079 C C    . ILE D 2 7   ? 2.648   19.997  30.836 1.00 21.68  ?  52  ILE D C    1 
ATOM   6080 O O    . ILE D 2 7   ? 3.386   20.972  30.999 1.00 19.74  ?  52  ILE D O    1 
ATOM   6081 C CB   . ILE D 2 7   ? 2.726   19.949  28.309 1.00 16.94  ?  52  ILE D CB   1 
ATOM   6082 C CG1  . ILE D 2 7   ? 1.879   19.761  27.047 1.00 18.92  ?  52  ILE D CG1  1 
ATOM   6083 C CG2  . ILE D 2 7   ? 3.838   18.910  28.366 1.00 19.43  ?  52  ILE D CG2  1 
ATOM   6084 C CD1  . ILE D 2 7   ? 2.650   19.895  25.743 1.00 20.51  ?  52  ILE D CD1  1 
ATOM   6085 H H    . ILE D 2 7   ? 0.957   21.540  29.081 1.00 22.89  ?  52  ILE D H    1 
ATOM   6086 H HA   . ILE D 2 7   ? 1.433   18.956  29.559 1.00 24.97  ?  52  ILE D HA   1 
ATOM   6087 H HB   . ILE D 2 7   ? 3.125   20.833  28.288 1.00 20.33  ?  52  ILE D HB   1 
ATOM   6088 H HG12 . ILE D 2 7   ? 1.487   18.873  27.066 1.00 22.71  ?  52  ILE D HG12 1 
ATOM   6089 H HG13 . ILE D 2 7   ? 1.176   20.428  27.043 1.00 22.71  ?  52  ILE D HG13 1 
ATOM   6090 H HG21 . ILE D 2 7   ? 4.389   18.995  27.572 1.00 23.32  ?  52  ILE D HG21 1 
ATOM   6091 H HG22 . ILE D 2 7   ? 4.374   19.066  29.159 1.00 23.32  ?  52  ILE D HG22 1 
ATOM   6092 H HG23 . ILE D 2 7   ? 3.442   18.026  28.402 1.00 23.32  ?  52  ILE D HG23 1 
ATOM   6093 H HD11 . ILE D 2 7   ? 2.039   19.762  25.001 1.00 24.61  ?  52  ILE D HD11 1 
ATOM   6094 H HD12 . ILE D 2 7   ? 3.038   20.783  25.697 1.00 24.61  ?  52  ILE D HD12 1 
ATOM   6095 H HD13 . ILE D 2 7   ? 3.351   19.225  25.720 1.00 24.61  ?  52  ILE D HD13 1 
ATOM   6096 N N    . ILE D 2 8   ? 2.507   19.034  31.745 1.00 19.69  ?  53  ILE D N    1 
ATOM   6097 C CA   . ILE D 2 8   ? 3.115   19.074  33.068 1.00 18.25  ?  53  ILE D CA   1 
ATOM   6098 C C    . ILE D 2 8   ? 4.098   17.918  33.185 1.00 20.22  ?  53  ILE D C    1 
ATOM   6099 O O    . ILE D 2 8   ? 3.828   16.812  32.705 1.00 20.12  ?  53  ILE D O    1 
ATOM   6100 C CB   . ILE D 2 8   ? 2.044   18.993  34.177 1.00 22.99  ?  53  ILE D CB   1 
ATOM   6101 C CG1  . ILE D 2 8   ? 1.090   20.188  34.078 1.00 24.01  ?  53  ILE D CG1  1 
ATOM   6102 C CG2  . ILE D 2 8   ? 2.695   18.929  35.561 1.00 19.96  ?  53  ILE D CG2  1 
ATOM   6103 C CD1  . ILE D 2 8   ? -0.146  20.065  34.946 1.00 29.96  ?  53  ILE D CD1  1 
ATOM   6104 H H    . ILE D 2 8   ? 2.045   18.321  31.610 1.00 23.63  ?  53  ILE D H    1 
ATOM   6105 H HA   . ILE D 2 8   ? 3.604   19.905  33.173 1.00 21.89  ?  53  ILE D HA   1 
ATOM   6106 H HB   . ILE D 2 8   ? 1.530   18.181  34.045 1.00 27.59  ?  53  ILE D HB   1 
ATOM   6107 H HG12 . ILE D 2 8   ? 1.565   20.989  34.351 1.00 28.81  ?  53  ILE D HG12 1 
ATOM   6108 H HG13 . ILE D 2 8   ? 0.798   20.278  33.158 1.00 28.81  ?  53  ILE D HG13 1 
ATOM   6109 H HG21 . ILE D 2 8   ? 1.998   18.879  36.235 1.00 23.96  ?  53  ILE D HG21 1 
ATOM   6110 H HG22 . ILE D 2 8   ? 3.259   18.142  35.609 1.00 23.96  ?  53  ILE D HG22 1 
ATOM   6111 H HG23 . ILE D 2 8   ? 3.229   19.728  35.696 1.00 23.96  ?  53  ILE D HG23 1 
ATOM   6112 H HD11 . ILE D 2 8   ? -0.694  20.857  34.827 1.00 35.95  ?  53  ILE D HD11 1 
ATOM   6113 H HD12 . ILE D 2 8   ? -0.641  19.276  34.678 1.00 35.95  ?  53  ILE D HD12 1 
ATOM   6114 H HD13 . ILE D 2 8   ? 0.127   19.987  35.873 1.00 35.95  ?  53  ILE D HD13 1 
ATOM   6115 N N    . TYR D 2 9   ? 5.237   18.175  33.826 1.00 18.51  ?  54  TYR D N    1 
ATOM   6116 C CA   . TYR D 2 9   ? 6.248   17.154  34.063 1.00 18.76  ?  54  TYR D CA   1 
ATOM   6117 C C    . TYR D 2 9   ? 6.767   17.292  35.485 1.00 21.34  ?  54  TYR D C    1 
ATOM   6118 O O    . TYR D 2 9   ? 7.171   18.385  35.893 1.00 17.09  ?  54  TYR D O    1 
ATOM   6119 C CB   . TYR D 2 9   ? 7.422   17.275  33.088 1.00 18.33  ?  54  TYR D CB   1 
ATOM   6120 C CG   . TYR D 2 9   ? 7.076   17.118  31.627 1.00 18.80  ?  54  TYR D CG   1 
ATOM   6121 C CD1  . TYR D 2 9   ? 6.692   15.888  31.111 1.00 18.96  ?  54  TYR D CD1  1 
ATOM   6122 C CD2  . TYR D 2 9   ? 7.170   18.193  30.756 1.00 14.30  ?  54  TYR D CD2  1 
ATOM   6123 C CE1  . TYR D 2 9   ? 6.390   15.740  29.776 1.00 17.16  ?  54  TYR D CE1  1 
ATOM   6124 C CE2  . TYR D 2 9   ? 6.873   18.055  29.418 1.00 16.76  ?  54  TYR D CE2  1 
ATOM   6125 C CZ   . TYR D 2 9   ? 6.485   16.825  28.931 1.00 18.88  ?  54  TYR D CZ   1 
ATOM   6126 O OH   . TYR D 2 9   ? 6.187   16.681  27.598 1.00 18.33  ?  54  TYR D OH   1 
ATOM   6127 H H    . TYR D 2 9   ? 5.448   18.949  34.138 1.00 22.21  ?  54  TYR D H    1 
ATOM   6128 H HA   . TYR D 2 9   ? 5.852   16.274  33.963 1.00 22.51  ?  54  TYR D HA   1 
ATOM   6129 H HB2  . TYR D 2 9   ? 7.823   18.152  33.199 1.00 21.99  ?  54  TYR D HB2  1 
ATOM   6130 H HB3  . TYR D 2 9   ? 8.074   16.592  33.308 1.00 21.99  ?  54  TYR D HB3  1 
ATOM   6131 H HD1  . TYR D 2 9   ? 6.628   15.154  31.678 1.00 22.75  ?  54  TYR D HD1  1 
ATOM   6132 H HD2  . TYR D 2 9   ? 7.433   19.023  31.082 1.00 17.16  ?  54  TYR D HD2  1 
ATOM   6133 H HE1  . TYR D 2 9   ? 6.129   14.911  29.445 1.00 20.59  ?  54  TYR D HE1  1 
ATOM   6134 H HE2  . TYR D 2 9   ? 6.935   18.786  28.847 1.00 20.11  ?  54  TYR D HE2  1 
ATOM   6135 H HH   . TYR D 2 9   ? 6.286   17.415  27.201 1.00 22.00  ?  54  TYR D HH   1 
ATOM   6136 N N    . ASP D 2 10  ? 6.770   16.189  36.228 1.00 19.65  ?  55  ASP D N    1 
ATOM   6137 C CA   . ASP D 2 10  ? 7.386   16.189  37.544 1.00 22.55  ?  55  ASP D CA   1 
ATOM   6138 C C    . ASP D 2 10  ? 8.907   16.209  37.405 1.00 20.87  ?  55  ASP D C    1 
ATOM   6139 O O    . ASP D 2 10  ? 9.468   15.828  36.376 1.00 16.28  ?  55  ASP D O    1 
ATOM   6140 C CB   . ASP D 2 10  ? 6.940   14.966  38.349 1.00 25.67  ?  55  ASP D CB   1 
ATOM   6141 C CG   . ASP D 2 10  ? 6.803   15.261  39.833 1.00 32.00  ?  55  ASP D CG   1 
ATOM   6142 O OD1  . ASP D 2 10  ? 7.602   16.064  40.363 1.00 37.79  ?  55  ASP D OD1  1 
ATOM   6143 O OD2  . ASP D 2 10  ? 5.887   14.693  40.468 1.00 33.29  ?  55  ASP D OD2  1 
ATOM   6144 H H    . ASP D 2 10  ? 6.425   15.437  35.994 1.00 23.58  ?  55  ASP D H    1 
ATOM   6145 H HA   . ASP D 2 10  ? 7.113   16.986  38.026 1.00 27.06  ?  55  ASP D HA   1 
ATOM   6146 H HB2  . ASP D 2 10  ? 6.078   14.669  38.020 1.00 30.81  ?  55  ASP D HB2  1 
ATOM   6147 H HB3  . ASP D 2 10  ? 7.598   14.261  38.242 1.00 30.81  ?  55  ASP D HB3  1 
ATOM   6148 N N    . ARG D 2 11  ? 9.576   16.669  38.464 1.00 21.92  ?  56  ARG D N    1 
ATOM   6149 C CA   . ARG D 2 11  ? 11.029  16.805  38.421 1.00 19.23  ?  56  ARG D CA   1 
ATOM   6150 C C    . ARG D 2 11  ? 11.698  15.467  38.133 1.00 22.17  ?  56  ARG D C    1 
ATOM   6151 O O    . ARG D 2 11  ? 12.620  15.381  37.314 1.00 21.45  ?  56  ARG D O    1 
ATOM   6152 C CB   . ARG D 2 11  ? 11.538  17.381  39.741 1.00 22.67  ?  56  ARG D CB   1 
ATOM   6153 C CG   . ARG D 2 11  ? 13.045  17.580  39.788 1.00 24.03  ?  56  ARG D CG   1 
ATOM   6154 C CD   . ARG D 2 11  ? 13.507  17.991  41.172 1.00 21.72  ?  56  ARG D CD   1 
ATOM   6155 N NE   . ARG D 2 11  ? 14.909  18.400  41.165 1.00 26.38  ?  56  ARG D NE   1 
ATOM   6156 C CZ   . ARG D 2 11  ? 15.942  17.601  41.423 1.00 31.22  ?  56  ARG D CZ   1 
ATOM   6157 N NH1  . ARG D 2 11  ? 17.176  18.089  41.380 1.00 35.25  1  56  ARG D NH1  1 
ATOM   6158 N NH2  . ARG D 2 11  ? 15.754  16.322  41.724 1.00 34.26  ?  56  ARG D NH2  1 
ATOM   6159 H H    . ARG D 2 11  ? 9.217   16.905  39.209 1.00 26.30  ?  56  ARG D H    1 
ATOM   6160 H HA   . ARG D 2 11  ? 11.269  17.421  37.711 1.00 23.07  ?  56  ARG D HA   1 
ATOM   6161 H HB2  . ARG D 2 11  ? 11.121  18.245  39.886 1.00 27.20  ?  56  ARG D HB2  1 
ATOM   6162 H HB3  . ARG D 2 11  ? 11.297  16.776  40.460 1.00 27.20  ?  56  ARG D HB3  1 
ATOM   6163 H HG2  . ARG D 2 11  ? 13.484  16.747  39.555 1.00 28.84  ?  56  ARG D HG2  1 
ATOM   6164 H HG3  . ARG D 2 11  ? 13.295  18.278  39.164 1.00 28.84  ?  56  ARG D HG3  1 
ATOM   6165 H HD2  . ARG D 2 11  ? 12.972  18.740  41.480 1.00 26.06  ?  56  ARG D HD2  1 
ATOM   6166 H HD3  . ARG D 2 11  ? 13.412  17.239  41.778 1.00 26.06  ?  56  ARG D HD3  1 
ATOM   6167 H HE   . ARG D 2 11  ? 15.081  19.222  40.979 1.00 31.66  ?  56  ARG D HE   1 
ATOM   6168 H HH11 . ARG D 2 11  ? 17.305  18.917  41.188 1.00 42.31  ?  56  ARG D HH11 1 
ATOM   6169 H HH12 . ARG D 2 11  ? 17.846  17.577  41.549 1.00 42.31  ?  56  ARG D HH12 1 
ATOM   6170 H HH21 . ARG D 2 11  ? 14.957  16.000  41.752 1.00 41.11  ?  56  ARG D HH21 1 
ATOM   6171 H HH22 . ARG D 2 11  ? 16.429  15.816  41.890 1.00 41.11  ?  56  ARG D HH22 1 
ATOM   6172 N N    . LYS D 2 12  ? 11.254  14.412  38.815 1.00 20.41  ?  57  LYS D N    1 
ATOM   6173 C CA   . LYS D 2 12  ? 11.856  13.099  38.621 1.00 22.15  ?  57  LYS D CA   1 
ATOM   6174 C C    . LYS D 2 12  ? 11.814  12.691  37.155 1.00 21.25  ?  57  LYS D C    1 
ATOM   6175 O O    . LYS D 2 12  ? 12.804  12.185  36.613 1.00 23.24  ?  57  LYS D O    1 
ATOM   6176 C CB   . LYS D 2 12  ? 11.134  12.070  39.491 1.00 24.66  ?  57  LYS D CB   1 
ATOM   6177 C CG   . LYS D 2 12  ? 11.779  10.702  39.500 1.00 33.99  ?  57  LYS D CG   1 
ATOM   6178 C CD   . LYS D 2 12  ? 11.108  9.787   40.511 1.00 39.04  ?  57  LYS D CD   1 
ATOM   6179 C CE   . LYS D 2 12  ? 11.823  8.450   40.609 1.00 40.17  ?  57  LYS D CE   1 
ATOM   6180 N NZ   . LYS D 2 12  ? 13.243  8.609   41.028 1.00 40.25  1  57  LYS D NZ   1 
ATOM   6181 H H    . LYS D 2 12  ? 10.614  14.431  39.389 1.00 24.50  ?  57  LYS D H    1 
ATOM   6182 H HA   . LYS D 2 12  ? 12.784  13.131  38.898 1.00 26.58  ?  57  LYS D HA   1 
ATOM   6183 H HB2  . LYS D 2 12  ? 11.116  12.394  40.406 1.00 29.60  ?  57  LYS D HB2  1 
ATOM   6184 H HB3  . LYS D 2 12  ? 10.227  11.966  39.163 1.00 29.60  ?  57  LYS D HB3  1 
ATOM   6185 H HG2  . LYS D 2 12  ? 11.693  10.300  38.621 1.00 40.78  ?  57  LYS D HG2  1 
ATOM   6186 H HG3  . LYS D 2 12  ? 12.714  10.789  39.741 1.00 40.78  ?  57  LYS D HG3  1 
ATOM   6187 H HD2  . LYS D 2 12  ? 11.127  10.208  41.385 1.00 46.84  ?  57  LYS D HD2  1 
ATOM   6188 H HD3  . LYS D 2 12  ? 10.192  9.624   40.236 1.00 46.84  ?  57  LYS D HD3  1 
ATOM   6189 H HE2  . LYS D 2 12  ? 11.373  7.896   41.266 1.00 48.21  ?  57  LYS D HE2  1 
ATOM   6190 H HE3  . LYS D 2 12  ? 11.810  8.017   39.741 1.00 48.21  ?  57  LYS D HE3  1 
ATOM   6191 H HZ1  . LYS D 2 12  ? 13.636  7.812   41.078 1.00 48.30  ?  57  LYS D HZ1  1 
ATOM   6192 H HZ2  . LYS D 2 12  ? 13.680  9.111   40.438 1.00 48.30  ?  57  LYS D HZ2  1 
ATOM   6193 H HZ3  . LYS D 2 12  ? 13.282  9.001   41.827 1.00 48.30  ?  57  LYS D HZ3  1 
ATOM   6194 N N    . PHE D 2 13  ? 10.678  12.914  36.492 1.00 21.42  ?  58  PHE D N    1 
ATOM   6195 C CA   . PHE D 2 13  ? 10.553  12.535  35.091 1.00 22.16  ?  58  PHE D CA   1 
ATOM   6196 C C    . PHE D 2 13  ? 11.553  13.290  34.225 1.00 21.57  ?  58  PHE D C    1 
ATOM   6197 O O    . PHE D 2 13  ? 12.268  12.688  33.415 1.00 20.36  ?  58  PHE D O    1 
ATOM   6198 C CB   . PHE D 2 13  ? 9.125   12.785  34.607 1.00 22.74  ?  58  PHE D CB   1 
ATOM   6199 C CG   . PHE D 2 13  ? 8.905   12.400  33.176 1.00 25.48  ?  58  PHE D CG   1 
ATOM   6200 C CD1  . PHE D 2 13  ? 8.756   11.066  32.821 1.00 29.57  ?  58  PHE D CD1  1 
ATOM   6201 C CD2  . PHE D 2 13  ? 8.862   13.364  32.182 1.00 22.90  ?  58  PHE D CD2  1 
ATOM   6202 C CE1  . PHE D 2 13  ? 8.563   10.705  31.502 1.00 27.43  ?  58  PHE D CE1  1 
ATOM   6203 C CE2  . PHE D 2 13  ? 8.670   13.010  30.862 1.00 25.75  ?  58  PHE D CE2  1 
ATOM   6204 C CZ   . PHE D 2 13  ? 8.518   11.679  30.520 1.00 26.60  ?  58  PHE D CZ   1 
ATOM   6205 H H    . PHE D 2 13  ? 9.976   13.280  36.828 1.00 25.70  ?  58  PHE D H    1 
ATOM   6206 H HA   . PHE D 2 13  ? 10.736  11.587  35.003 1.00 26.59  ?  58  PHE D HA   1 
ATOM   6207 H HB2  . PHE D 2 13  ? 8.513   12.267  35.153 1.00 27.29  ?  58  PHE D HB2  1 
ATOM   6208 H HB3  . PHE D 2 13  ? 8.925   13.730  34.695 1.00 27.29  ?  58  PHE D HB3  1 
ATOM   6209 H HD1  . PHE D 2 13  ? 8.786   10.409  33.478 1.00 35.49  ?  58  PHE D HD1  1 
ATOM   6210 H HD2  . PHE D 2 13  ? 8.964   14.261  32.408 1.00 27.47  ?  58  PHE D HD2  1 
ATOM   6211 H HE1  . PHE D 2 13  ? 8.461   9.809   31.274 1.00 32.91  ?  58  PHE D HE1  1 
ATOM   6212 H HE2  . PHE D 2 13  ? 8.639   13.666  30.203 1.00 30.90  ?  58  PHE D HE2  1 
ATOM   6213 H HZ   . PHE D 2 13  ? 8.387   11.439  29.631 1.00 31.92  ?  58  PHE D HZ   1 
ATOM   6214 N N    . LEU D 2 14  ? 11.618  14.614  34.381 1.00 18.93  ?  59  LEU D N    1 
ATOM   6215 C CA   . LEU D 2 14  ? 12.531  15.407  33.563 1.00 20.64  ?  59  LEU D CA   1 
ATOM   6216 C C    . LEU D 2 14  ? 13.972  14.960  33.756 1.00 19.92  ?  59  LEU D C    1 
ATOM   6217 O O    . LEU D 2 14  ? 14.762  14.963  32.805 1.00 20.22  ?  59  LEU D O    1 
ATOM   6218 C CB   . LEU D 2 14  ? 12.382  16.892  33.900 1.00 16.75  ?  59  LEU D CB   1 
ATOM   6219 C CG   . LEU D 2 14  ? 11.023  17.516  33.570 1.00 14.38  ?  59  LEU D CG   1 
ATOM   6220 C CD1  . LEU D 2 14  ? 10.963  18.953  34.074 1.00 14.67  ?  59  LEU D CD1  1 
ATOM   6221 C CD2  . LEU D 2 14  ? 10.762  17.464  32.077 1.00 13.82  ?  59  LEU D CD2  1 
ATOM   6222 H H    . LEU D 2 14  ? 11.152  15.069  34.943 1.00 22.72  ?  59  LEU D H    1 
ATOM   6223 H HA   . LEU D 2 14  ? 12.302  15.287  32.628 1.00 24.77  ?  59  LEU D HA   1 
ATOM   6224 H HB2  . LEU D 2 14  ? 12.530  17.007  34.852 1.00 20.10  ?  59  LEU D HB2  1 
ATOM   6225 H HB3  . LEU D 2 14  ? 13.055  17.387  33.407 1.00 20.10  ?  59  LEU D HB3  1 
ATOM   6226 H HG   . LEU D 2 14  ? 10.326  17.011  34.016 1.00 17.26  ?  59  LEU D HG   1 
ATOM   6227 H HD11 . LEU D 2 14  ? 10.096  19.328  33.855 1.00 17.60  ?  59  LEU D HD11 1 
ATOM   6228 H HD12 . LEU D 2 14  ? 11.091  18.955  35.035 1.00 17.60  ?  59  LEU D HD12 1 
ATOM   6229 H HD13 . LEU D 2 14  ? 11.664  19.467  33.645 1.00 17.60  ?  59  LEU D HD13 1 
ATOM   6230 H HD21 . LEU D 2 14  ? 9.898   17.864  31.894 1.00 16.59  ?  59  LEU D HD21 1 
ATOM   6231 H HD22 . LEU D 2 14  ? 11.459  17.957  31.617 1.00 16.59  ?  59  LEU D HD22 1 
ATOM   6232 H HD23 . LEU D 2 14  ? 10.766  16.538  31.788 1.00 16.59  ?  59  LEU D HD23 1 
ATOM   6233 N N    . MET D 2 15  ? 14.331  14.570  34.979 1.00 20.27  ?  60  MET D N    1 
ATOM   6234 C CA   . MET D 2 15  ? 15.704  14.160  35.250 1.00 23.59  ?  60  MET D CA   1 
ATOM   6235 C C    . MET D 2 15  ? 16.064  12.896  34.484 1.00 29.50  ?  60  MET D C    1 
ATOM   6236 O O    . MET D 2 15  ? 17.193  12.756  34.001 1.00 28.63  ?  60  MET D O    1 
ATOM   6237 C CB   . MET D 2 15  ? 15.900  13.935  36.745 1.00 27.83  ?  60  MET D CB   1 
ATOM   6238 C CG   . MET D 2 15  ? 17.241  14.428  37.256 1.00 38.32  ?  60  MET D CG   1 
ATOM   6239 S SD   . MET D 2 15  ? 17.348  16.225  37.219 1.00 40.03  ?  60  MET D SD   1 
ATOM   6240 C CE   . MET D 2 15  ? 16.132  16.628  38.460 1.00 40.09  ?  60  MET D CE   1 
ATOM   6241 H H    . MET D 2 15  ? 13.805  14.534  35.659 1.00 24.33  ?  60  MET D H    1 
ATOM   6242 H HA   . MET D 2 15  ? 16.302  14.873  34.976 1.00 28.30  ?  60  MET D HA   1 
ATOM   6243 H HB2  . MET D 2 15  ? 15.205  14.408  37.228 1.00 33.39  ?  60  MET D HB2  1 
ATOM   6244 H HB3  . MET D 2 15  ? 15.842  12.984  36.930 1.00 33.39  ?  60  MET D HB3  1 
ATOM   6245 H HG2  . MET D 2 15  ? 17.360  14.137  38.174 1.00 45.98  ?  60  MET D HG2  1 
ATOM   6246 H HG3  . MET D 2 15  ? 17.948  14.071  36.696 1.00 45.98  ?  60  MET D HG3  1 
ATOM   6247 H HE1  . MET D 2 15  ? 16.080  17.592  38.550 1.00 48.11  ?  60  MET D HE1  1 
ATOM   6248 H HE2  . MET D 2 15  ? 15.272  16.274  38.185 1.00 48.11  ?  60  MET D HE2  1 
ATOM   6249 H HE3  . MET D 2 15  ? 16.399  16.230  39.304 1.00 48.11  ?  60  MET D HE3  1 
ATOM   6250 N N    . GLU D 2 16  ? 15.125  11.960  34.371 1.00 26.46  ?  61  GLU D N    1 
ATOM   6251 C CA   . GLU D 2 16  ? 15.418  10.713  33.681 1.00 30.93  ?  61  GLU D CA   1 
ATOM   6252 C C    . GLU D 2 16  ? 15.449  10.877  32.167 1.00 33.39  ?  61  GLU D C    1 
ATOM   6253 O O    . GLU D 2 16  ? 16.099  10.076  31.487 1.00 32.25  ?  61  GLU D O    1 
ATOM   6254 C CB   . GLU D 2 16  ? 14.397  9.641   34.072 1.00 32.64  ?  61  GLU D CB   1 
ATOM   6255 C CG   . GLU D 2 16  ? 14.794  8.236   33.639 1.00 42.28  ?  61  GLU D CG   1 
ATOM   6256 C CD   . GLU D 2 16  ? 16.203  7.871   34.072 1.00 42.54  ?  61  GLU D CD   1 
ATOM   6257 O OE1  . GLU D 2 16  ? 16.545  8.097   35.254 1.00 44.53  ?  61  GLU D OE1  1 
ATOM   6258 O OE2  . GLU D 2 16  ? 16.976  7.377   33.224 1.00 41.18  ?  61  GLU D OE2  1 
ATOM   6259 H H    . GLU D 2 16  ? 14.325  12.022  34.680 1.00 31.75  ?  61  GLU D H    1 
ATOM   6260 H HA   . GLU D 2 16  ? 16.293  10.403  33.961 1.00 37.12  ?  61  GLU D HA   1 
ATOM   6261 H HB2  . GLU D 2 16  ? 14.299  9.639   35.037 1.00 39.17  ?  61  GLU D HB2  1 
ATOM   6262 H HB3  . GLU D 2 16  ? 13.547  9.851   33.655 1.00 39.17  ?  61  GLU D HB3  1 
ATOM   6263 H HG2  . GLU D 2 16  ? 14.182  7.597   34.038 1.00 50.73  ?  61  GLU D HG2  1 
ATOM   6264 H HG3  . GLU D 2 16  ? 14.752  8.178   32.672 1.00 50.73  ?  61  GLU D HG3  1 
ATOM   6265 N N    . CYS D 2 17  ? 14.777  11.896  31.624 1.00 30.13  ?  62  CYS D N    1 
ATOM   6266 C CA   . CYS D 2 17  ? 14.847  12.155  30.191 1.00 25.38  ?  62  CYS D CA   1 
ATOM   6267 C C    . CYS D 2 17  ? 16.233  12.605  29.755 1.00 29.12  ?  62  CYS D C    1 
ATOM   6268 O O    . CYS D 2 17  ? 16.531  12.584  28.556 1.00 31.60  ?  62  CYS D O    1 
ATOM   6269 C CB   . CYS D 2 17  ? 13.817  13.212  29.795 1.00 25.06  ?  62  CYS D CB   1 
ATOM   6270 S SG   . CYS D 2 17  ? 12.101  12.674  29.953 1.00 26.34  ?  62  CYS D SG   1 
ATOM   6271 H H    . CYS D 2 17  ? 14.280  12.445  32.062 1.00 36.16  ?  62  CYS D H    1 
ATOM   6272 H HA   . CYS D 2 17  ? 14.635  11.337  29.714 1.00 30.46  ?  62  CYS D HA   1 
ATOM   6273 H HB2  . CYS D 2 17  ? 13.936  13.989  30.362 1.00 30.08  ?  62  CYS D HB2  1 
ATOM   6274 H HB3  . CYS D 2 17  ? 13.965  13.457  28.868 1.00 30.08  ?  62  CYS D HB3  1 
ATOM   6275 H HG   . CYS D 2 17  ? 11.887  12.380  31.097 1.00 31.61  ?  62  CYS D HG   1 
ATOM   6276 N N    . ARG D 2 18  ? 17.082  13.013  30.698 1.00 30.90  ?  63  ARG D N    1 
ATOM   6277 C CA   . ARG D 2 18  ? 18.427  13.456  30.362 1.00 35.44  ?  63  ARG D CA   1 
ATOM   6278 C C    . ARG D 2 18  ? 19.290  12.326  29.812 1.00 41.44  ?  63  ARG D C    1 
ATOM   6279 O O    . ARG D 2 18  ? 20.269  12.597  29.110 1.00 43.28  ?  63  ARG D O    1 
ATOM   6280 C CB   . ARG D 2 18  ? 19.084  14.059  31.604 1.00 35.73  ?  63  ARG D CB   1 
ATOM   6281 C CG   . ARG D 2 18  ? 20.526  14.513  31.414 1.00 41.18  ?  63  ARG D CG   1 
ATOM   6282 C CD   . ARG D 2 18  ? 21.130  15.013  32.721 1.00 42.88  ?  63  ARG D CD   1 
ATOM   6283 N NE   . ARG D 2 18  ? 20.900  14.078  33.820 1.00 53.61  ?  63  ARG D NE   1 
ATOM   6284 C CZ   . ARG D 2 18  ? 21.572  12.944  33.999 1.00 56.94  ?  63  ARG D CZ   1 
ATOM   6285 N NH1  . ARG D 2 18  ? 22.529  12.588  33.150 1.00 56.67  ?  63  ARG D NH1  1 
ATOM   6286 N NH2  . ARG D 2 18  ? 21.284  12.161  35.030 1.00 56.80  ?  63  ARG D NH2  1 
ATOM   6287 H H    . ARG D 2 18  ? 16.900  13.042  31.538 1.00 37.09  ?  63  ARG D H    1 
ATOM   6288 H HA   . ARG D 2 18  ? 18.373  14.148  29.684 1.00 42.53  ?  63  ARG D HA   1 
ATOM   6289 H HB2  . ARG D 2 18  ? 18.568  14.833  31.881 1.00 42.87  ?  63  ARG D HB2  1 
ATOM   6290 H HB3  . ARG D 2 18  ? 19.077  13.394  32.310 1.00 42.87  ?  63  ARG D HB3  1 
ATOM   6291 H HG2  . ARG D 2 18  ? 21.058  13.766  31.100 1.00 49.41  ?  63  ARG D HG2  1 
ATOM   6292 H HG3  . ARG D 2 18  ? 20.551  15.238  30.771 1.00 49.41  ?  63  ARG D HG3  1 
ATOM   6293 H HD2  . ARG D 2 18  ? 22.087  15.120  32.609 1.00 51.46  ?  63  ARG D HD2  1 
ATOM   6294 H HD3  . ARG D 2 18  ? 20.723  15.862  32.956 1.00 51.46  ?  63  ARG D HD3  1 
ATOM   6295 H HE   . ARG D 2 18  ? 20.287  14.274  34.390 1.00 64.33  ?  63  ARG D HE   1 
ATOM   6296 H HH11 . ARG D 2 18  ? 22.719  13.092  32.480 1.00 68.00  ?  63  ARG D HH11 1 
ATOM   6297 H HH12 . ARG D 2 18  ? 22.960  11.854  33.272 1.00 68.00  ?  63  ARG D HH12 1 
ATOM   6298 H HH21 . ARG D 2 18  ? 20.665  12.387  35.582 1.00 68.15  ?  63  ARG D HH21 1 
ATOM   6299 H HH22 . ARG D 2 18  ? 21.718  11.428  35.148 1.00 68.15  ?  63  ARG D HH22 1 
ATOM   6300 N N    . ASN D 2 19  ? 18.945  11.072  30.105 1.00 38.44  ?  64  ASN D N    1 
ATOM   6301 C CA   . ASN D 2 19  ? 19.808  9.944   29.777 1.00 43.49  ?  64  ASN D CA   1 
ATOM   6302 C C    . ASN D 2 19  ? 19.690  9.488   28.329 1.00 42.75  ?  64  ASN D C    1 
ATOM   6303 O O    . ASN D 2 19  ? 20.521  8.689   27.885 1.00 44.20  ?  64  ASN D O    1 
ATOM   6304 C CB   . ASN D 2 19  ? 19.497  8.770   30.706 1.00 40.11  ?  64  ASN D CB   1 
ATOM   6305 C CG   . ASN D 2 19  ? 19.950  9.023   32.129 1.00 43.00  ?  64  ASN D CG   1 
ATOM   6306 O OD1  . ASN D 2 19  ? 21.018  9.590   32.359 1.00 54.38  ?  64  ASN D OD1  1 
ATOM   6307 N ND2  . ASN D 2 19  ? 19.139  8.609   33.091 1.00 41.58  ?  64  ASN D ND2  1 
ATOM   6308 H H    . ASN D 2 19  ? 18.213  10.850  30.497 1.00 46.12  ?  64  ASN D H    1 
ATOM   6309 H HA   . ASN D 2 19  ? 20.730  10.204  29.929 1.00 52.18  ?  64  ASN D HA   1 
ATOM   6310 H HB2  . ASN D 2 19  ? 18.538  8.620   30.718 1.00 48.13  ?  64  ASN D HB2  1 
ATOM   6311 H HB3  . ASN D 2 19  ? 19.953  7.978   30.381 1.00 48.13  ?  64  ASN D HB3  1 
ATOM   6312 H HD21 . ASN D 2 19  ? 19.352  8.730   33.916 1.00 49.89  ?  64  ASN D HD21 1 
ATOM   6313 H HD22 . ASN D 2 19  ? 18.398  8.220   32.892 1.00 49.89  ?  64  ASN D HD22 1 
ATOM   6314 N N    . SER D 2 20  ? 18.695  9.958   27.587 1.00 44.92  ?  65  SER D N    1 
ATOM   6315 C CA   . SER D 2 20  ? 18.585  9.568   26.191 1.00 44.78  ?  65  SER D CA   1 
ATOM   6316 C C    . SER D 2 20  ? 19.845  10.001  25.441 1.00 48.92  ?  65  SER D C    1 
ATOM   6317 O O    . SER D 2 20  ? 20.333  11.119  25.647 1.00 46.85  ?  65  SER D O    1 
ATOM   6318 C CB   . SER D 2 20  ? 17.348  10.198  25.549 1.00 44.81  ?  65  SER D CB   1 
ATOM   6319 O OG   . SER D 2 20  ? 17.436  11.613  25.541 1.00 47.21  ?  65  SER D OG   1 
ATOM   6320 H H    . SER D 2 20  ? 18.081  10.493  27.863 1.00 53.90  ?  65  SER D H    1 
ATOM   6321 H HA   . SER D 2 20  ? 18.507  8.603   26.129 1.00 53.73  ?  65  SER D HA   1 
ATOM   6322 H HB2  . SER D 2 20  ? 17.274  9.882   24.635 1.00 53.77  ?  65  SER D HB2  1 
ATOM   6323 H HB3  . SER D 2 20  ? 16.564  9.934   26.055 1.00 53.77  ?  65  SER D HB3  1 
ATOM   6324 H HG   . SER D 2 20  ? 16.749  11.941  25.186 1.00 56.65  ?  65  SER D HG   1 
ATOM   6325 N N    . PRO D 2 21  ? 20.398  9.154   24.565 1.00 47.79  ?  66  PRO D N    1 
ATOM   6326 C CA   . PRO D 2 21  ? 21.615  9.550   23.832 1.00 49.93  ?  66  PRO D CA   1 
ATOM   6327 C C    . PRO D 2 21  ? 21.459  10.836  23.040 1.00 46.82  ?  66  PRO D C    1 
ATOM   6328 O O    . PRO D 2 21  ? 22.468  11.383  22.578 1.00 48.27  ?  66  PRO D O    1 
ATOM   6329 C CB   . PRO D 2 21  ? 21.876  8.356   22.903 1.00 49.10  ?  66  PRO D CB   1 
ATOM   6330 C CG   . PRO D 2 21  ? 21.167  7.214   23.534 1.00 47.36  ?  66  PRO D CG   1 
ATOM   6331 C CD   . PRO D 2 21  ? 19.961  7.795   24.203 1.00 46.76  ?  66  PRO D CD   1 
ATOM   6332 H HA   . PRO D 2 21  ? 22.360  9.643   24.446 1.00 59.92  ?  66  PRO D HA   1 
ATOM   6333 H HB2  . PRO D 2 21  ? 21.513  8.541   22.022 1.00 58.92  ?  66  PRO D HB2  1 
ATOM   6334 H HB3  . PRO D 2 21  ? 22.829  8.182   22.852 1.00 58.92  ?  66  PRO D HB3  1 
ATOM   6335 H HG2  . PRO D 2 21  ? 20.903  6.578   22.851 1.00 56.83  ?  66  PRO D HG2  1 
ATOM   6336 H HG3  . PRO D 2 21  ? 21.748  6.792   24.186 1.00 56.83  ?  66  PRO D HG3  1 
ATOM   6337 H HD2  . PRO D 2 21  ? 19.215  7.832   23.584 1.00 56.12  ?  66  PRO D HD2  1 
ATOM   6338 H HD3  . PRO D 2 21  ? 19.738  7.288   24.999 1.00 56.12  ?  66  PRO D HD3  1 
ATOM   6339 N N    . VAL D 2 22  ? 20.232  11.330  22.861 1.00 43.02  ?  67  VAL D N    1 
ATOM   6340 C CA   . VAL D 2 22  ? 20.022  12.607  22.188 1.00 45.41  ?  67  VAL D CA   1 
ATOM   6341 C C    . VAL D 2 22  ? 20.690  13.737  22.959 1.00 41.29  ?  67  VAL D C    1 
ATOM   6342 O O    . VAL D 2 22  ? 21.086  14.752  22.372 1.00 45.73  ?  67  VAL D O    1 
ATOM   6343 C CB   . VAL D 2 22  ? 18.510  12.859  22.011 1.00 45.97  ?  67  VAL D CB   1 
ATOM   6344 C CG1  . VAL D 2 22  ? 18.259  14.168  21.274 1.00 41.78  ?  67  VAL D CG1  1 
ATOM   6345 C CG2  . VAL D 2 22  ? 17.853  11.697  21.275 1.00 39.75  ?  67  VAL D CG2  1 
ATOM   6346 H H    . VAL D 2 22  ? 19.508  10.945  23.122 1.00 51.62  ?  67  VAL D H    1 
ATOM   6347 H HA   . VAL D 2 22  ? 20.424  12.568  21.306 1.00 54.49  ?  67  VAL D HA   1 
ATOM   6348 H HB   . VAL D 2 22  ? 18.099  12.928  22.887 1.00 55.16  ?  67  VAL D HB   1 
ATOM   6349 H HG11 . VAL D 2 22  ? 17.303  14.298  21.179 1.00 50.13  ?  67  VAL D HG11 1 
ATOM   6350 H HG12 . VAL D 2 22  ? 18.643  14.896  21.786 1.00 50.13  ?  67  VAL D HG12 1 
ATOM   6351 H HG13 . VAL D 2 22  ? 18.676  14.122  20.399 1.00 50.13  ?  67  VAL D HG13 1 
ATOM   6352 H HG21 . VAL D 2 22  ? 16.906  11.880  21.178 1.00 47.70  ?  67  VAL D HG21 1 
ATOM   6353 H HG22 . VAL D 2 22  ? 18.264  11.603  20.402 1.00 47.70  ?  67  VAL D HG22 1 
ATOM   6354 H HG23 . VAL D 2 22  ? 17.982  10.885  21.790 1.00 47.70  ?  67  VAL D HG23 1 
ATOM   6355 N N    . THR D 2 23  ? 20.835  13.582  24.278 1.00 42.48  ?  68  THR D N    1 
ATOM   6356 C CA   . THR D 2 23  ? 21.374  14.654  25.110 1.00 43.51  ?  68  THR D CA   1 
ATOM   6357 C C    . THR D 2 23  ? 22.855  14.891  24.849 1.00 47.23  ?  68  THR D C    1 
ATOM   6358 O O    . THR D 2 23  ? 23.326  16.030  24.953 1.00 45.49  ?  68  THR D O    1 
ATOM   6359 C CB   . THR D 2 23  ? 21.157  14.329  26.588 1.00 40.88  ?  68  THR D CB   1 
ATOM   6360 O OG1  . THR D 2 23  ? 19.754  14.227  26.855 1.00 45.17  ?  68  THR D OG1  1 
ATOM   6361 C CG2  . THR D 2 23  ? 21.759  15.413  27.483 1.00 42.95  ?  68  THR D CG2  1 
ATOM   6362 H H    . THR D 2 23  ? 20.630  12.868  24.711 1.00 50.97  ?  68  THR D H    1 
ATOM   6363 H HA   . THR D 2 23  ? 20.899  15.476  24.911 1.00 52.22  ?  68  THR D HA   1 
ATOM   6364 H HB   . THR D 2 23  ? 21.587  13.485  26.799 1.00 49.06  ?  68  THR D HB   1 
ATOM   6365 H HG1  . THR D 2 23  ? 19.628  14.048  27.666 1.00 54.21  ?  68  THR D HG1  1 
ATOM   6366 H HG21 . THR D 2 23  ? 21.613  15.192  28.416 1.00 51.54  ?  68  THR D HG21 1 
ATOM   6367 H HG22 . THR D 2 23  ? 22.713  15.485  27.322 1.00 51.54  ?  68  THR D HG22 1 
ATOM   6368 H HG23 . THR D 2 23  ? 21.342  16.269  27.294 1.00 51.54  ?  68  THR D HG23 1 
ATOM   6369 N N    . LYS D 2 24  ? 23.603  13.838  24.519 1.00 46.83  ?  69  LYS D N    1 
ATOM   6370 C CA   . LYS D 2 24  ? 25.057  13.949  24.468 1.00 52.28  ?  69  LYS D CA   1 
ATOM   6371 C C    . LYS D 2 24  ? 25.517  14.932  23.398 1.00 46.81  ?  69  LYS D C    1 
ATOM   6372 O O    . LYS D 2 24  ? 26.604  15.507  23.515 1.00 52.70  ?  69  LYS D O    1 
ATOM   6373 C CB   . LYS D 2 24  ? 25.670  12.570  24.228 1.00 57.53  ?  69  LYS D CB   1 
ATOM   6374 C CG   . LYS D 2 24  ? 25.324  11.560  25.312 1.00 58.85  ?  69  LYS D CG   1 
ATOM   6375 C CD   . LYS D 2 24  ? 25.866  10.176  24.993 1.00 68.03  ?  69  LYS D CD   1 
ATOM   6376 C CE   . LYS D 2 24  ? 25.430  9.160   26.039 1.00 75.34  ?  69  LYS D CE   1 
ATOM   6377 N NZ   . LYS D 2 24  ? 25.885  7.780   25.714 1.00 72.83  ?  69  LYS D NZ   1 
ATOM   6378 H H    . LYS D 2 24  ? 23.297  13.059  24.323 1.00 56.19  ?  69  LYS D H    1 
ATOM   6379 H HA   . LYS D 2 24  ? 25.377  14.272  25.325 1.00 62.73  ?  69  LYS D HA   1 
ATOM   6380 H HB2  . LYS D 2 24  ? 25.344  12.223  23.382 1.00 69.03  ?  69  LYS D HB2  1 
ATOM   6381 H HB3  . LYS D 2 24  ? 26.636  12.656  24.198 1.00 69.03  ?  69  LYS D HB3  1 
ATOM   6382 H HG2  . LYS D 2 24  ? 25.710  11.849  26.153 1.00 70.62  ?  69  LYS D HG2  1 
ATOM   6383 H HG3  . LYS D 2 24  ? 24.359  11.496  25.391 1.00 70.62  ?  69  LYS D HG3  1 
ATOM   6384 H HD2  . LYS D 2 24  ? 25.527  9.890   24.130 1.00 81.64  ?  69  LYS D HD2  1 
ATOM   6385 H HD3  . LYS D 2 24  ? 26.835  10.206  24.981 1.00 81.64  ?  69  LYS D HD3  1 
ATOM   6386 H HE2  . LYS D 2 24  ? 25.807  9.407   26.898 1.00 90.40  ?  69  LYS D HE2  1 
ATOM   6387 H HE3  . LYS D 2 24  ? 24.461  9.153   26.091 1.00 90.40  ?  69  LYS D HE3  1 
ATOM   6388 H HZ1  . LYS D 2 24  ? 25.614  7.213   26.345 1.00 87.40  ?  69  LYS D HZ1  1 
ATOM   6389 H HZ2  . LYS D 2 24  ? 25.547  7.524   24.931 1.00 87.40  ?  69  LYS D HZ2  1 
ATOM   6390 H HZ3  . LYS D 2 24  ? 26.774  7.756   25.667 1.00 87.40  ?  69  LYS D HZ3  1 
ATOM   6391 N N    . THR D 2 25  ? 24.716  15.141  22.361 1.00 45.77  ?  70  THR D N    1 
ATOM   6392 C CA   . THR D 2 25  ? 25.119  16.059  21.306 1.00 48.96  ?  70  THR D CA   1 
ATOM   6393 C C    . THR D 2 25  ? 24.752  17.494  21.689 1.00 46.84  ?  70  THR D C    1 
ATOM   6394 O O    . THR D 2 25  ? 23.675  17.731  22.241 1.00 43.81  ?  70  THR D O    1 
ATOM   6395 C CB   . THR D 2 25  ? 24.446  15.690  19.984 1.00 47.76  ?  70  THR D CB   1 
ATOM   6396 O OG1  . THR D 2 25  ? 24.784  14.342  19.637 1.00 55.97  ?  70  THR D OG1  1 
ATOM   6397 C CG2  . THR D 2 25  ? 24.898  16.621  18.864 1.00 44.92  ?  70  THR D CG2  1 
ATOM   6398 H H    . THR D 2 25  ? 23.948  14.771  22.246 1.00 54.93  ?  70  THR D H    1 
ATOM   6399 H HA   . THR D 2 25  ? 26.080  16.010  21.185 1.00 58.75  ?  70  THR D HA   1 
ATOM   6400 H HB   . THR D 2 25  ? 23.483  15.768  20.079 1.00 57.31  ?  70  THR D HB   1 
ATOM   6401 H HG1  . THR D 2 25  ? 24.418  14.132  18.911 1.00 67.17  ?  70  THR D HG1  1 
ATOM   6402 H HG21 . THR D 2 25  ? 24.463  16.375  18.033 1.00 53.90  ?  70  THR D HG21 1 
ATOM   6403 H HG22 . THR D 2 25  ? 24.667  17.538  19.082 1.00 53.90  ?  70  THR D HG22 1 
ATOM   6404 H HG23 . THR D 2 25  ? 25.859  16.558  18.748 1.00 53.90  ?  70  THR D HG23 1 
ATOM   6405 N N    . PRO D 2 26  ? 25.623  18.465  21.422 1.00 45.98  ?  71  PRO D N    1 
ATOM   6406 C CA   . PRO D 2 26  ? 25.256  19.867  21.641 1.00 41.40  ?  71  PRO D CA   1 
ATOM   6407 C C    . PRO D 2 26  ? 24.473  20.412  20.461 1.00 44.65  ?  71  PRO D C    1 
ATOM   6408 O O    . PRO D 2 26  ? 24.649  19.947  19.325 1.00 47.35  ?  71  PRO D O    1 
ATOM   6409 C CB   . PRO D 2 26  ? 26.614  20.568  21.779 1.00 44.38  ?  71  PRO D CB   1 
ATOM   6410 C CG   . PRO D 2 26  ? 27.538  19.737  20.965 1.00 44.01  ?  71  PRO D CG   1 
ATOM   6411 C CD   . PRO D 2 26  ? 27.051  18.317  21.087 1.00 46.04  ?  71  PRO D CD   1 
ATOM   6412 H HA   . PRO D 2 26  ? 24.744  19.969  22.458 1.00 49.68  ?  71  PRO D HA   1 
ATOM   6413 H HB2  . PRO D 2 26  ? 26.557  21.469  21.425 1.00 53.26  ?  71  PRO D HB2  1 
ATOM   6414 H HB3  . PRO D 2 26  ? 26.887  20.577  22.710 1.00 53.26  ?  71  PRO D HB3  1 
ATOM   6415 H HG2  . PRO D 2 26  ? 27.505  20.029  20.041 1.00 52.82  ?  71  PRO D HG2  1 
ATOM   6416 H HG3  . PRO D 2 26  ? 28.439  19.818  21.316 1.00 52.82  ?  71  PRO D HG3  1 
ATOM   6417 H HD2  . PRO D 2 26  ? 27.153  17.852  20.242 1.00 55.25  ?  71  PRO D HD2  1 
ATOM   6418 H HD3  . PRO D 2 26  ? 27.520  17.860  21.802 1.00 55.25  ?  71  PRO D HD3  1 
ATOM   6419 N N    . PRO D 2 27  ? 23.605  21.400  20.677 1.00 41.64  ?  72  PRO D N    1 
ATOM   6420 C CA   . PRO D 2 27  ? 22.901  22.006  19.542 1.00 43.53  ?  72  PRO D CA   1 
ATOM   6421 C C    . PRO D 2 27  ? 23.877  22.685  18.593 1.00 47.81  ?  72  PRO D C    1 
ATOM   6422 O O    . PRO D 2 27  ? 24.909  23.219  19.003 1.00 47.99  ?  72  PRO D O    1 
ATOM   6423 C CB   . PRO D 2 27  ? 21.958  23.023  20.201 1.00 36.93  ?  72  PRO D CB   1 
ATOM   6424 C CG   . PRO D 2 27  ? 21.883  22.628  21.636 1.00 31.44  ?  72  PRO D CG   1 
ATOM   6425 C CD   . PRO D 2 27  ? 23.199  22.001  21.959 1.00 36.63  ?  72  PRO D CD   1 
ATOM   6426 H HA   . PRO D 2 27  ? 22.383  21.341  19.062 1.00 52.24  ?  72  PRO D HA   1 
ATOM   6427 H HB2  . PRO D 2 27  ? 22.328  23.915  20.110 1.00 44.32  ?  72  PRO D HB2  1 
ATOM   6428 H HB3  . PRO D 2 27  ? 21.083  22.971  19.786 1.00 44.32  ?  72  PRO D HB3  1 
ATOM   6429 H HG2  . PRO D 2 27  ? 21.739  23.417  22.182 1.00 37.73  ?  72  PRO D HG2  1 
ATOM   6430 H HG3  . PRO D 2 27  ? 21.163  21.991  21.760 1.00 37.73  ?  72  PRO D HG3  1 
ATOM   6431 H HD2  . PRO D 2 27  ? 23.838  22.677  22.234 1.00 43.95  ?  72  PRO D HD2  1 
ATOM   6432 H HD3  . PRO D 2 27  ? 23.091  21.315  22.636 1.00 43.95  ?  72  PRO D HD3  1 
ATOM   6433 N N    . ARG D 2 28  ? 23.538  22.659  17.304 1.00 47.65  ?  73  ARG D N    1 
ATOM   6434 C CA   . ARG D 2 28  ? 24.391  23.304  16.312 1.00 46.56  ?  73  ARG D CA   1 
ATOM   6435 C C    . ARG D 2 28  ? 24.401  24.816  16.493 1.00 48.80  ?  73  ARG D C    1 
ATOM   6436 O O    . ARG D 2 28  ? 25.465  25.445  16.453 1.00 48.96  ?  73  ARG D O    1 
ATOM   6437 C CB   . ARG D 2 28  ? 23.928  22.944  14.903 1.00 47.94  ?  73  ARG D CB   1 
ATOM   6438 C CG   . ARG D 2 28  ? 24.731  23.627  13.803 1.00 48.03  ?  73  ARG D CG   1 
ATOM   6439 C CD   . ARG D 2 28  ? 24.195  23.267  12.438 1.00 46.01  ?  73  ARG D CD   1 
ATOM   6440 N NE   . ARG D 2 28  ? 24.432  21.866  12.109 1.00 44.75  ?  73  ARG D NE   1 
ATOM   6441 C CZ   . ARG D 2 28  ? 23.794  21.210  11.147 1.00 40.50  ?  73  ARG D CZ   1 
ATOM   6442 N NH1  . ARG D 2 28  ? 22.870  21.828  10.423 1.00 39.50  1  73  ARG D NH1  1 
ATOM   6443 N NH2  . ARG D 2 28  ? 24.074  19.935  10.911 1.00 37.64  ?  73  ARG D NH2  1 
ATOM   6444 H H    . ARG D 2 28  ? 22.833  22.282  16.984 1.00 57.18  ?  73  ARG D H    1 
ATOM   6445 H HA   . ARG D 2 28  ? 25.300  22.983  16.421 1.00 55.87  ?  73  ARG D HA   1 
ATOM   6446 H HB2  . ARG D 2 28  ? 24.013  21.986  14.781 1.00 57.53  ?  73  ARG D HB2  1 
ATOM   6447 H HB3  . ARG D 2 28  ? 23.001  23.208  14.801 1.00 57.53  ?  73  ARG D HB3  1 
ATOM   6448 H HG2  . ARG D 2 28  ? 24.671  24.589  13.911 1.00 57.63  ?  73  ARG D HG2  1 
ATOM   6449 H HG3  . ARG D 2 28  ? 25.656  23.338  13.854 1.00 57.63  ?  73  ARG D HG3  1 
ATOM   6450 H HD2  . ARG D 2 28  ? 23.238  23.424  12.420 1.00 55.22  ?  73  ARG D HD2  1 
ATOM   6451 H HD3  . ARG D 2 28  ? 24.637  23.813  11.769 1.00 55.22  ?  73  ARG D HD3  1 
ATOM   6452 H HE   . ARG D 2 28  ? 24.976  21.422  12.606 1.00 53.70  ?  73  ARG D HE   1 
ATOM   6453 H HH11 . ARG D 2 28  ? 22.687  22.654  10.574 1.00 47.40  ?  73  ARG D HH11 1 
ATOM   6454 H HH12 . ARG D 2 28  ? 22.456  21.402  9.801  1.00 47.40  ?  73  ARG D HH12 1 
ATOM   6455 H HH21 . ARG D 2 28  ? 24.671  19.532  11.381 1.00 45.17  ?  73  ARG D HH21 1 
ATOM   6456 H HH22 . ARG D 2 28  ? 23.657  19.511  10.290 1.00 45.17  ?  73  ARG D HH22 1 
ATOM   6457 N N    . ASP D 2 29  ? 23.230  25.419  16.683 1.00 45.30  ?  74  ASP D N    1 
ATOM   6458 C CA   . ASP D 2 29  ? 23.159  26.859  16.888 1.00 50.69  ?  74  ASP D CA   1 
ATOM   6459 C C    . ASP D 2 29  ? 23.846  27.315  18.167 1.00 46.32  ?  74  ASP D C    1 
ATOM   6460 O O    . ASP D 2 29  ? 23.920  28.529  18.397 1.00 45.24  ?  74  ASP D O    1 
ATOM   6461 C CB   . ASP D 2 29  ? 21.701  27.312  16.909 1.00 53.37  ?  74  ASP D CB   1 
ATOM   6462 C CG   . ASP D 2 29  ? 21.098  27.401  15.520 1.00 56.96  ?  74  ASP D CG   1 
ATOM   6463 O OD1  . ASP D 2 29  ? 21.841  27.726  14.567 1.00 63.39  ?  74  ASP D OD1  1 
ATOM   6464 O OD2  . ASP D 2 29  ? 19.879  27.150  15.378 1.00 48.86  ?  74  ASP D OD2  1 
ATOM   6465 H H    . ASP D 2 29  ? 22.469  25.019  16.698 1.00 54.36  ?  74  ASP D H    1 
ATOM   6466 H HA   . ASP D 2 29  ? 23.597  27.302  16.144 1.00 60.82  ?  74  ASP D HA   1 
ATOM   6467 H HB2  . ASP D 2 29  ? 21.179  26.676  17.423 1.00 64.04  ?  74  ASP D HB2  1 
ATOM   6468 H HB3  . ASP D 2 29  ? 21.648  28.191  17.316 1.00 64.04  ?  74  ASP D HB3  1 
ATOM   6469 N N    . LEU D 2 30  ? 24.341  26.389  18.991 1.00 42.51  ?  75  LEU D N    1 
ATOM   6470 C CA   . LEU D 2 30  ? 25.004  26.735  20.237 1.00 40.43  ?  75  LEU D CA   1 
ATOM   6471 C C    . LEU D 2 30  ? 26.206  27.623  19.944 1.00 39.33  ?  75  LEU D C    1 
ATOM   6472 O O    . LEU D 2 30  ? 27.170  27.165  19.319 1.00 39.43  ?  75  LEU D O    1 
ATOM   6473 C CB   . LEU D 2 30  ? 25.445  25.475  20.981 1.00 36.71  ?  75  LEU D CB   1 
ATOM   6474 C CG   . LEU D 2 30  ? 25.889  25.709  22.425 1.00 40.06  ?  75  LEU D CG   1 
ATOM   6475 C CD1  . LEU D 2 30  ? 24.691  26.011  23.316 1.00 31.70  ?  75  LEU D CD1  1 
ATOM   6476 C CD2  . LEU D 2 30  ? 26.666  24.521  22.960 1.00 33.45  ?  75  LEU D CD2  1 
ATOM   6477 H H    . LEU D 2 30  ? 24.303  25.543  18.842 1.00 51.01  ?  75  LEU D H    1 
ATOM   6478 H HA   . LEU D 2 30  ? 24.389  27.227  20.804 1.00 48.51  ?  75  LEU D HA   1 
ATOM   6479 H HB2  . LEU D 2 30  ? 24.702  24.851  21.000 1.00 44.06  ?  75  LEU D HB2  1 
ATOM   6480 H HB3  . LEU D 2 30  ? 26.191  25.079  20.504 1.00 44.06  ?  75  LEU D HB3  1 
ATOM   6481 H HG   . LEU D 2 30  ? 26.476  26.481  22.448 1.00 48.07  ?  75  LEU D HG   1 
ATOM   6482 H HD11 . LEU D 2 30  ? 25.002  26.155  24.223 1.00 38.04  ?  75  LEU D HD11 1 
ATOM   6483 H HD12 . LEU D 2 30  ? 24.246  26.808  22.987 1.00 38.04  ?  75  LEU D HD12 1 
ATOM   6484 H HD13 . LEU D 2 30  ? 24.081  25.257  23.290 1.00 38.04  ?  75  LEU D HD13 1 
ATOM   6485 H HD21 . LEU D 2 30  ? 26.931  24.704  23.875 1.00 40.14  ?  75  LEU D HD21 1 
ATOM   6486 H HD22 . LEU D 2 30  ? 26.100  23.735  22.930 1.00 40.14  ?  75  LEU D HD22 1 
ATOM   6487 H HD23 . LEU D 2 30  ? 27.452  24.385  22.408 1.00 40.14  ?  75  LEU D HD23 1 
ATOM   6488 N N    . PRO D 2 31  ? 26.198  28.883  20.367 1.00 36.71  ?  76  PRO D N    1 
ATOM   6489 C CA   . PRO D 2 31  ? 27.377  29.725  20.163 1.00 36.42  ?  76  PRO D CA   1 
ATOM   6490 C C    . PRO D 2 31  ? 28.531  29.272  21.041 1.00 36.10  ?  76  PRO D C    1 
ATOM   6491 O O    . PRO D 2 31  ? 28.350  28.616  22.070 1.00 34.58  ?  76  PRO D O    1 
ATOM   6492 C CB   . PRO D 2 31  ? 26.891  31.123  20.558 1.00 34.53  ?  76  PRO D CB   1 
ATOM   6493 C CG   . PRO D 2 31  ? 25.788  30.872  21.516 1.00 31.95  ?  76  PRO D CG   1 
ATOM   6494 C CD   . PRO D 2 31  ? 25.118  29.611  21.056 1.00 35.21  ?  76  PRO D CD   1 
ATOM   6495 H HA   . PRO D 2 31  ? 27.648  29.721  19.232 1.00 43.71  ?  76  PRO D HA   1 
ATOM   6496 H HB2  . PRO D 2 31  ? 27.612  31.615  20.982 1.00 41.44  ?  76  PRO D HB2  1 
ATOM   6497 H HB3  . PRO D 2 31  ? 26.567  31.592  19.773 1.00 41.44  ?  76  PRO D HB3  1 
ATOM   6498 H HG2  . PRO D 2 31  ? 26.153  30.757  22.408 1.00 38.34  ?  76  PRO D HG2  1 
ATOM   6499 H HG3  . PRO D 2 31  ? 25.166  31.615  21.496 1.00 38.34  ?  76  PRO D HG3  1 
ATOM   6500 H HD2  . PRO D 2 31  ? 24.798  29.101  21.817 1.00 42.25  ?  76  PRO D HD2  1 
ATOM   6501 H HD3  . PRO D 2 31  ? 24.400  29.817  20.438 1.00 42.25  ?  76  PRO D HD3  1 
ATOM   6502 N N    . THR D 2 32  ? 29.737  29.626  20.610 1.00 32.12  ?  77  THR D N    1 
ATOM   6503 C CA   . THR D 2 32  ? 30.942  29.364  21.388 1.00 33.83  ?  77  THR D CA   1 
ATOM   6504 C C    . THR D 2 32  ? 31.211  30.585  22.259 1.00 32.57  ?  77  THR D C    1 
ATOM   6505 O O    . THR D 2 32  ? 31.616  31.638  21.757 1.00 33.34  ?  77  THR D O    1 
ATOM   6506 C CB   . THR D 2 32  ? 32.130  29.061  20.479 1.00 34.96  ?  77  THR D CB   1 
ATOM   6507 O OG1  . THR D 2 32  ? 31.742  28.111  19.479 1.00 34.45  ?  77  THR D OG1  1 
ATOM   6508 C CG2  . THR D 2 32  ? 33.281  28.486  21.290 1.00 31.96  ?  77  THR D CG2  1 
ATOM   6509 H H    . THR D 2 32  ? 29.885  30.023  19.862 1.00 38.55  ?  77  THR D H    1 
ATOM   6510 H HA   . THR D 2 32  ? 30.794  28.599  21.967 1.00 40.60  ?  77  THR D HA   1 
ATOM   6511 H HB   . THR D 2 32  ? 32.430  29.879  20.052 1.00 41.95  ?  77  THR D HB   1 
ATOM   6512 H HG1  . THR D 2 32  ? 32.394  27.941  18.976 1.00 41.33  ?  77  THR D HG1  1 
ATOM   6513 H HG21 . THR D 2 32  ? 34.033  28.295  20.709 1.00 38.36  ?  77  THR D HG21 1 
ATOM   6514 H HG22 . THR D 2 32  ? 33.559  29.123  21.967 1.00 38.36  ?  77  THR D HG22 1 
ATOM   6515 H HG23 . THR D 2 32  ? 33.002  27.665  21.725 1.00 38.36  ?  77  THR D HG23 1 
ATOM   6516 N N    . ILE D 2 33  ? 30.961  30.451  23.554 1.00 31.14  ?  78  ILE D N    1 
ATOM   6517 C CA   . ILE D 2 33  ? 31.193  31.510  24.525 1.00 28.68  ?  78  ILE D CA   1 
ATOM   6518 C C    . ILE D 2 33  ? 32.165  30.977  25.570 1.00 28.61  ?  78  ILE D C    1 
ATOM   6519 O O    . ILE D 2 33  ? 31.773  30.245  26.480 1.00 26.42  ?  78  ILE D O    1 
ATOM   6520 C CB   . ILE D 2 33  ? 29.880  31.977  25.179 1.00 30.86  ?  78  ILE D CB   1 
ATOM   6521 C CG1  . ILE D 2 33  ? 28.866  32.393  24.111 1.00 33.74  ?  78  ILE D CG1  1 
ATOM   6522 C CG2  . ILE D 2 33  ? 30.147  33.147  26.127 1.00 30.03  ?  78  ILE D CG2  1 
ATOM   6523 C CD1  . ILE D 2 33  ? 27.469  32.618  24.659 1.00 33.64  ?  78  ILE D CD1  1 
ATOM   6524 H H    . ILE D 2 33  ? 30.647  29.732  23.905 1.00 37.36  ?  78  ILE D H    1 
ATOM   6525 H HA   . ILE D 2 33  ? 31.603  32.270  24.083 1.00 34.42  ?  78  ILE D HA   1 
ATOM   6526 H HB   . ILE D 2 33  ? 29.509  31.241  25.690 1.00 37.03  ?  78  ILE D HB   1 
ATOM   6527 H HG12 . ILE D 2 33  ? 29.163  33.221  23.702 1.00 40.49  ?  78  ILE D HG12 1 
ATOM   6528 H HG13 . ILE D 2 33  ? 28.813  31.694  23.440 1.00 40.49  ?  78  ILE D HG13 1 
ATOM   6529 H HG21 . ILE D 2 33  ? 29.308  33.425  26.527 1.00 36.03  ?  78  ILE D HG21 1 
ATOM   6530 H HG22 . ILE D 2 33  ? 30.764  32.859  26.817 1.00 36.03  ?  78  ILE D HG22 1 
ATOM   6531 H HG23 . ILE D 2 33  ? 30.533  33.880  25.622 1.00 36.03  ?  78  ILE D HG23 1 
ATOM   6532 H HD11 . ILE D 2 33  ? 26.883  32.877  23.931 1.00 40.36  ?  78  ILE D HD11 1 
ATOM   6533 H HD12 . ILE D 2 33  ? 27.152  31.795  25.062 1.00 40.36  ?  78  ILE D HD12 1 
ATOM   6534 H HD13 . ILE D 2 33  ? 27.502  33.322  25.325 1.00 40.36  ?  78  ILE D HD13 1 
ATOM   6535 N N    . PRO D 2 34  ? 33.451  31.310  25.462 1.00 26.74  ?  79  PRO D N    1 
ATOM   6536 C CA   . PRO D 2 34  ? 34.428  30.789  26.427 1.00 27.79  ?  79  PRO D CA   1 
ATOM   6537 C C    . PRO D 2 34  ? 34.026  31.121  27.857 1.00 25.01  ?  79  PRO D C    1 
ATOM   6538 O O    . PRO D 2 34  ? 33.783  32.280  28.200 1.00 28.24  ?  79  PRO D O    1 
ATOM   6539 C CB   . PRO D 2 34  ? 35.732  31.487  26.022 1.00 24.26  ?  79  PRO D CB   1 
ATOM   6540 C CG   . PRO D 2 34  ? 35.547  31.836  24.590 1.00 32.11  ?  79  PRO D CG   1 
ATOM   6541 C CD   . PRO D 2 34  ? 34.092  32.153  24.437 1.00 28.29  ?  79  PRO D CD   1 
ATOM   6542 H HA   . PRO D 2 34  ? 34.527  29.829  26.330 1.00 33.35  ?  79  PRO D HA   1 
ATOM   6543 H HB2  . PRO D 2 34  ? 35.856  32.286  26.557 1.00 29.11  ?  79  PRO D HB2  1 
ATOM   6544 H HB3  . PRO D 2 34  ? 36.478  30.877  26.134 1.00 29.11  ?  79  PRO D HB3  1 
ATOM   6545 H HG2  . PRO D 2 34  ? 36.090  32.609  24.370 1.00 38.53  ?  79  PRO D HG2  1 
ATOM   6546 H HG3  . PRO D 2 34  ? 35.792  31.078  24.036 1.00 38.53  ?  79  PRO D HG3  1 
ATOM   6547 H HD2  . PRO D 2 34  ? 33.930  33.092  24.620 1.00 33.95  ?  79  PRO D HD2  1 
ATOM   6548 H HD3  . PRO D 2 34  ? 33.783  31.904  23.552 1.00 33.95  ?  79  PRO D HD3  1 
ATOM   6549 N N    . GLY D 2 35  ? 33.958  30.088  28.691 1.00 25.93  ?  80  GLY D N    1 
ATOM   6550 C CA   . GLY D 2 35  ? 33.551  30.242  30.070 1.00 28.21  ?  80  GLY D CA   1 
ATOM   6551 C C    . GLY D 2 35  ? 32.058  30.185  30.303 1.00 28.24  ?  80  GLY D C    1 
ATOM   6552 O O    . GLY D 2 35  ? 31.622  30.341  31.451 1.00 28.29  ?  80  GLY D O    1 
ATOM   6553 H H    . GLY D 2 35  ? 34.146  29.278  28.473 1.00 31.12  ?  80  GLY D H    1 
ATOM   6554 H HA2  . GLY D 2 35  ? 33.963  29.542  30.600 1.00 33.85  ?  80  GLY D HA2  1 
ATOM   6555 H HA3  . GLY D 2 35  ? 33.872  31.096  30.399 1.00 33.85  ?  80  GLY D HA3  1 
ATOM   6556 N N    . VAL D 2 36  ? 31.261  29.966  29.260 1.00 24.97  ?  81  VAL D N    1 
ATOM   6557 C CA   . VAL D 2 36  ? 29.810  29.911  29.397 1.00 29.45  ?  81  VAL D CA   1 
ATOM   6558 C C    . VAL D 2 36  ? 29.296  28.639  28.737 1.00 32.22  ?  81  VAL D C    1 
ATOM   6559 O O    . VAL D 2 36  ? 28.761  27.749  29.408 1.00 30.84  ?  81  VAL D O    1 
ATOM   6560 C CB   . VAL D 2 36  ? 29.149  31.158  28.785 1.00 31.43  ?  81  VAL D CB   1 
ATOM   6561 C CG1  . VAL D 2 36  ? 27.633  31.098  28.939 1.00 34.35  ?  81  VAL D CG1  1 
ATOM   6562 C CG2  . VAL D 2 36  ? 29.704  32.420  29.428 1.00 31.77  ?  81  VAL D CG2  1 
ATOM   6563 H H    . VAL D 2 36  ? 31.540  29.846  28.455 1.00 29.96  ?  81  VAL D H    1 
ATOM   6564 H HA   . VAL D 2 36  ? 29.580  29.878  30.339 1.00 35.34  ?  81  VAL D HA   1 
ATOM   6565 H HB   . VAL D 2 36  ? 29.353  31.191  27.837 1.00 37.71  ?  81  VAL D HB   1 
ATOM   6566 H HG11 . VAL D 2 36  ? 27.244  31.895  28.545 1.00 41.22  ?  81  VAL D HG11 1 
ATOM   6567 H HG12 . VAL D 2 36  ? 27.301  30.308  28.484 1.00 41.22  ?  81  VAL D HG12 1 
ATOM   6568 H HG13 . VAL D 2 36  ? 27.413  31.053  29.882 1.00 41.22  ?  81  VAL D HG13 1 
ATOM   6569 H HG21 . VAL D 2 36  ? 29.275  33.193  29.028 1.00 38.13  ?  81  VAL D HG21 1 
ATOM   6570 H HG22 . VAL D 2 36  ? 29.522  32.396  30.380 1.00 38.13  ?  81  VAL D HG22 1 
ATOM   6571 H HG23 . VAL D 2 36  ? 30.662  32.457  29.275 1.00 38.13  ?  81  VAL D HG23 1 
ATOM   6572 N N    . THR D 2 37  ? 29.452  28.547  27.421 1.00 33.83  ?  82  THR D N    1 
ATOM   6573 C CA   . THR D 2 37  ? 28.980  27.402  26.657 1.00 35.84  ?  82  THR D CA   1 
ATOM   6574 C C    . THR D 2 37  ? 30.135  26.446  26.396 1.00 41.64  ?  82  THR D C    1 
ATOM   6575 O O    . THR D 2 37  ? 31.256  26.872  26.102 1.00 39.76  ?  82  THR D O    1 
ATOM   6576 C CB   . THR D 2 37  ? 28.360  27.844  25.331 1.00 36.02  ?  82  THR D CB   1 
ATOM   6577 O OG1  . THR D 2 37  ? 29.302  28.637  24.599 1.00 36.91  ?  82  THR D OG1  1 
ATOM   6578 C CG2  . THR D 2 37  ? 27.100  28.656  25.578 1.00 33.41  ?  82  THR D CG2  1 
ATOM   6579 H H    . THR D 2 37  ? 29.835  29.148  26.940 1.00 40.60  ?  82  THR D H    1 
ATOM   6580 H HA   . THR D 2 37  ? 28.304  26.931  27.168 1.00 43.01  ?  82  THR D HA   1 
ATOM   6581 H HB   . THR D 2 37  ? 28.123  27.062  24.809 1.00 43.22  ?  82  THR D HB   1 
ATOM   6582 H HG1  . THR D 2 37  ? 28.965  28.883  23.870 1.00 44.29  ?  82  THR D HG1  1 
ATOM   6583 H HG21 . THR D 2 37  ? 26.713  28.932  24.733 1.00 40.09  ?  82  THR D HG21 1 
ATOM   6584 H HG22 . THR D 2 37  ? 26.451  28.121  26.062 1.00 40.09  ?  82  THR D HG22 1 
ATOM   6585 H HG23 . THR D 2 37  ? 27.311  29.445  26.101 1.00 40.09  ?  82  THR D HG23 1 
ATOM   6586 N N    . SER D 2 38  ? 29.854  25.153  26.507 1.00 43.70  ?  83  SER D N    1 
ATOM   6587 C CA   . SER D 2 38  ? 30.885  24.136  26.372 1.00 48.79  ?  83  SER D CA   1 
ATOM   6588 C C    . SER D 2 38  ? 30.330  22.896  25.681 1.00 47.81  ?  83  SER D C    1 
ATOM   6589 O O    . SER D 2 38  ? 30.552  21.767  26.122 1.00 48.93  ?  83  SER D O    1 
ATOM   6590 C CB   . SER D 2 38  ? 31.451  23.773  27.746 1.00 53.54  ?  83  SER D CB   1 
ATOM   6591 O OG   . SER D 2 38  ? 30.471  23.144  28.552 1.00 49.54  ?  83  SER D OG   1 
ATOM   6592 O OXT  . SER D 2 38  ? 29.644  23.000  24.664 1.00 46.87  ?  83  SER D OXT  1 
ATOM   6593 H H    . SER D 2 38  ? 29.069  24.839  26.662 1.00 52.44  ?  83  SER D H    1 
ATOM   6594 H HA   . SER D 2 38  ? 31.609  24.486  25.829 1.00 58.55  ?  83  SER D HA   1 
ATOM   6595 H HB2  . SER D 2 38  ? 32.198  23.166  27.628 1.00 64.25  ?  83  SER D HB2  1 
ATOM   6596 H HB3  . SER D 2 38  ? 31.749  24.583  28.187 1.00 64.25  ?  83  SER D HB3  1 
ATOM   6597 H HG   . SER D 2 38  ? 30.797  22.951  29.302 1.00 59.45  ?  83  SER D HG   1 
HETATM 6598 C C    . FMT E 3 .   ? 0.659   25.173  49.041 1.00 37.80  ?  301 FMT A C    1 
HETATM 6599 O O1   . FMT E 3 .   ? 0.480   24.055  49.525 1.00 38.05  ?  301 FMT A O1   1 
HETATM 6600 O O2   . FMT E 3 .   ? 0.629   26.189  49.734 1.00 33.07  ?  301 FMT A O2   1 
HETATM 6601 H H    . FMT E 3 .   ? 0.852   25.293  47.975 1.00 45.36  ?  301 FMT A H    1 
HETATM 6602 C C    . FMT F 3 .   ? 2.965   24.495  44.914 1.00 28.87  ?  301 FMT C C    1 
HETATM 6603 O O1   . FMT F 3 .   ? 3.468   24.349  43.801 1.00 29.28  ?  301 FMT C O1   1 
HETATM 6604 O O2   . FMT F 3 .   ? 3.173   23.692  45.823 1.00 28.68  ?  301 FMT C O2   1 
HETATM 6605 H H    . FMT F 3 .   ? 2.325   25.362  45.073 1.00 34.64  ?  301 FMT C H    1 
HETATM 6606 C C    . FMT G 3 .   ? -0.132  27.110  42.976 1.00 37.59  ?  302 FMT C C    1 
HETATM 6607 O O1   . FMT G 3 .   ? -0.754  27.457  41.972 1.00 30.94  ?  302 FMT C O1   1 
HETATM 6608 O O2   . FMT G 3 .   ? 1.066   27.363  43.115 1.00 32.24  ?  302 FMT C O2   1 
HETATM 6609 H H    . FMT G 3 .   ? -0.630  26.564  43.778 1.00 45.11  ?  302 FMT C H    1 
HETATM 6610 C C    . FMT H 3 .   ? 20.936  30.993  52.193 1.00 38.72  ?  303 FMT C C    1 
HETATM 6611 O O1   . FMT H 3 .   ? 21.574  30.448  51.293 1.00 34.36  ?  303 FMT C O1   1 
HETATM 6612 O O2   . FMT H 3 .   ? 19.780  30.663  52.455 1.00 46.63  ?  303 FMT C O2   1 
HETATM 6613 H H    . FMT H 3 .   ? 21.430  31.785  52.756 1.00 46.47  ?  303 FMT C H    1 
HETATM 6614 C C    . FMT I 3 .   ? 22.422  35.053  52.199 1.00 37.20  ?  304 FMT C C    1 
HETATM 6615 O O1   . FMT I 3 .   ? 22.344  35.987  51.401 1.00 34.68  ?  304 FMT C O1   1 
HETATM 6616 O O2   . FMT I 3 .   ? 21.429  34.414  52.549 1.00 38.45  ?  304 FMT C O2   1 
HETATM 6617 H H    . FMT I 3 .   ? 23.407  34.806  52.593 1.00 44.64  ?  304 FMT C H    1 
HETATM 6618 C C    . FMT J 3 .   ? 15.339  19.005  44.525 1.00 26.37  ?  305 FMT C C    1 
HETATM 6619 O O1   . FMT J 3 .   ? 16.228  19.131  45.367 1.00 33.49  ?  305 FMT C O1   1 
HETATM 6620 O O2   . FMT J 3 .   ? 14.184  18.710  44.824 1.00 25.64  ?  305 FMT C O2   1 
HETATM 6621 H H    . FMT J 3 .   ? 15.557  19.156  43.468 1.00 31.65  ?  305 FMT C H    1 
HETATM 6622 H HO2  . FMT J 3 .   ? 13.943  18.564  45.763 1.00 30.76  ?  305 FMT C HO2  1 
HETATM 6623 C C    . FMT K 3 .   ? 15.590  54.495  32.683 1.00 32.19  ?  306 FMT C C    1 
HETATM 6624 O O1   . FMT K 3 .   ? 15.164  55.455  33.323 1.00 25.04  ?  306 FMT C O1   1 
HETATM 6625 O O2   . FMT K 3 .   ? 16.052  53.494  33.232 1.00 34.07  ?  306 FMT C O2   1 
HETATM 6626 H H    . FMT K 3 .   ? 15.569  54.505  31.593 1.00 38.63  ?  306 FMT C H    1 
HETATM 6627 H HO2  . FMT K 3 .   ? 16.088  53.444  34.211 1.00 40.89  ?  306 FMT C HO2  1 
HETATM 6628 O O    . HOH L 4 .   ? 4.530   38.444  52.711 1.00 24.26  ?  401 HOH A O    1 
HETATM 6629 O O    . HOH L 4 .   ? 6.923   20.403  66.549 1.00 21.00  ?  402 HOH A O    1 
HETATM 6630 O O    . HOH L 4 .   ? 7.542   5.147   58.394 1.00 33.99  ?  403 HOH A O    1 
HETATM 6631 O O    . HOH L 4 .   ? 8.672   5.700   61.365 1.00 26.43  ?  404 HOH A O    1 
HETATM 6632 O O    . HOH L 4 .   ? -13.054 21.538  80.529 1.00 34.94  ?  405 HOH A O    1 
HETATM 6633 O O    . HOH L 4 .   ? -16.038 15.328  72.134 1.00 34.70  ?  406 HOH A O    1 
HETATM 6634 O O    . HOH L 4 .   ? -6.909  20.019  81.569 1.00 32.37  ?  407 HOH A O    1 
HETATM 6635 O O    . HOH L 4 .   ? -4.331  25.108  75.304 1.00 26.41  ?  408 HOH A O    1 
HETATM 6636 O O    . HOH L 4 .   ? 1.512   14.219  52.962 1.00 29.72  ?  409 HOH A O    1 
HETATM 6637 O O    . HOH L 4 .   ? 1.932   28.602  53.489 1.00 30.74  ?  410 HOH A O    1 
HETATM 6638 O O    . HOH L 4 .   ? -0.088  -5.462  75.586 1.00 31.77  ?  411 HOH A O    1 
HETATM 6639 O O    . HOH L 4 .   ? 3.878   5.449   69.759 1.00 21.71  ?  412 HOH A O    1 
HETATM 6640 O O    . HOH L 4 .   ? 9.117   14.960  70.230 1.00 23.47  ?  413 HOH A O    1 
HETATM 6641 O O    . HOH L 4 .   ? 10.665  15.459  57.307 1.00 29.20  ?  414 HOH A O    1 
HETATM 6642 O O    . HOH L 4 .   ? 5.358   26.706  53.697 1.00 29.94  ?  415 HOH A O    1 
HETATM 6643 O O    . HOH L 4 .   ? 5.944   48.821  44.082 1.00 31.66  ?  416 HOH A O    1 
HETATM 6644 O O    . HOH L 4 .   ? 12.735  23.164  61.725 1.00 23.48  ?  417 HOH A O    1 
HETATM 6645 O O    . HOH L 4 .   ? -10.542 22.356  61.080 1.00 30.38  ?  418 HOH A O    1 
HETATM 6646 O O    . HOH L 4 .   ? 2.935   10.986  59.425 1.00 17.50  ?  419 HOH A O    1 
HETATM 6647 O O    . HOH L 4 .   ? 2.416   22.026  52.347 1.00 29.01  ?  420 HOH A O    1 
HETATM 6648 O O    . HOH L 4 .   ? -17.860 15.841  68.894 1.00 38.11  ?  421 HOH A O    1 
HETATM 6649 O O    . HOH L 4 .   ? -9.686  29.402  51.432 1.00 31.87  ?  422 HOH A O    1 
HETATM 6650 O O    . HOH L 4 .   ? 5.724   2.319   58.555 1.00 35.93  ?  423 HOH A O    1 
HETATM 6651 O O    . HOH L 4 .   ? -6.060  24.712  81.498 1.00 33.51  ?  424 HOH A O    1 
HETATM 6652 O O    . HOH L 4 .   ? 4.118   8.026   83.829 1.00 33.20  ?  425 HOH A O    1 
HETATM 6653 O O    . HOH L 4 .   ? -2.685  2.153   69.526 1.00 21.87  ?  426 HOH A O    1 
HETATM 6654 O O    . HOH L 4 .   ? 4.380   10.902  57.034 1.00 27.93  ?  427 HOH A O    1 
HETATM 6655 O O    . HOH L 4 .   ? 6.057   4.819   81.259 1.00 30.09  ?  428 HOH A O    1 
HETATM 6656 O O    . HOH L 4 .   ? 11.295  12.712  65.865 1.00 28.69  ?  429 HOH A O    1 
HETATM 6657 O O    . HOH L 4 .   ? -10.687 21.210  65.935 1.00 30.70  ?  430 HOH A O    1 
HETATM 6658 O O    . HOH L 4 .   ? 5.205   13.689  53.219 1.00 32.92  ?  431 HOH A O    1 
HETATM 6659 O O    . HOH L 4 .   ? -3.295  -5.498  77.377 1.00 31.23  ?  432 HOH A O    1 
HETATM 6660 O O    . HOH L 4 .   ? -2.281  0.884   65.030 1.00 26.72  ?  433 HOH A O    1 
HETATM 6661 O O    . HOH L 4 .   ? 7.977   23.766  66.448 1.00 17.66  ?  434 HOH A O    1 
HETATM 6662 O O    . HOH L 4 .   ? -10.255 19.893  61.951 1.00 31.62  ?  435 HOH A O    1 
HETATM 6663 O O    . HOH L 4 .   ? 9.281   17.141  72.494 1.00 30.40  ?  436 HOH A O    1 
HETATM 6664 O O    . HOH L 4 .   ? 10.567  21.094  60.033 1.00 25.84  ?  437 HOH A O    1 
HETATM 6665 O O    . HOH L 4 .   ? -16.997 22.148  66.559 1.00 45.94  ?  438 HOH A O    1 
HETATM 6666 O O    . HOH L 4 .   ? 3.014   22.966  49.225 1.00 34.55  ?  439 HOH A O    1 
HETATM 6667 O O    . HOH L 4 .   ? 2.116   9.835   74.952 1.00 16.07  ?  440 HOH A O    1 
HETATM 6668 O O    . HOH L 4 .   ? 3.828   11.932  54.316 1.00 34.64  ?  441 HOH A O    1 
HETATM 6669 O O    . HOH L 4 .   ? 12.344  2.663   60.235 1.00 35.82  ?  442 HOH A O    1 
HETATM 6670 O O    . HOH L 4 .   ? -5.052  6.397   69.058 1.00 25.09  ?  443 HOH A O    1 
HETATM 6671 O O    . HOH L 4 .   ? 14.456  17.748  66.934 1.00 34.62  ?  444 HOH A O    1 
HETATM 6672 O O    . HOH L 4 .   ? -6.806  18.389  84.602 1.00 29.30  ?  445 HOH A O    1 
HETATM 6673 O O    . HOH L 4 .   ? -9.484  22.046  75.797 1.00 32.07  ?  446 HOH A O    1 
HETATM 6674 O O    . HOH L 4 .   ? 8.662   0.349   75.858 1.00 33.26  ?  447 HOH A O    1 
HETATM 6675 O O    . HOH L 4 .   ? 4.951   24.120  54.861 1.00 20.40  ?  448 HOH A O    1 
HETATM 6676 O O    . HOH L 4 .   ? -7.756  9.318   69.821 1.00 26.12  ?  449 HOH A O    1 
HETATM 6677 O O    . HOH L 4 .   ? 10.561  23.334  59.685 1.00 27.18  ?  450 HOH A O    1 
HETATM 6678 O O    . HOH L 4 .   ? 3.617   46.547  48.778 1.00 27.55  ?  451 HOH A O    1 
HETATM 6679 O O    . HOH L 4 .   ? 10.483  16.356  60.305 1.00 21.37  ?  452 HOH A O    1 
HETATM 6680 O O    . HOH L 4 .   ? -7.710  18.811  61.963 1.00 23.46  ?  453 HOH A O    1 
HETATM 6681 O O    . HOH L 4 .   ? -9.406  26.695  74.596 1.00 39.52  ?  454 HOH A O    1 
HETATM 6682 O O    . HOH L 4 .   ? -16.591 18.929  69.364 1.00 35.70  ?  455 HOH A O    1 
HETATM 6683 O O    . HOH L 4 .   ? 8.751   49.869  47.120 1.00 20.83  ?  456 HOH A O    1 
HETATM 6684 O O    . HOH L 4 .   ? 0.349   8.254   85.847 1.00 28.91  ?  457 HOH A O    1 
HETATM 6685 O O    . HOH L 4 .   ? -6.935  2.174   72.006 1.00 32.17  ?  458 HOH A O    1 
HETATM 6686 O O    . HOH L 4 .   ? 14.378  11.631  72.640 1.00 36.31  ?  459 HOH A O    1 
HETATM 6687 O O    . HOH L 4 .   ? -9.552  8.094   79.359 1.00 27.44  ?  460 HOH A O    1 
HETATM 6688 O O    . HOH L 4 .   ? -14.315 11.898  80.839 1.00 31.10  ?  461 HOH A O    1 
HETATM 6689 O O    . HOH L 4 .   ? -2.491  -7.924  65.008 1.00 33.67  ?  462 HOH A O    1 
HETATM 6690 O O    . HOH L 4 .   ? -2.442  24.675  73.410 1.00 21.76  ?  463 HOH A O    1 
HETATM 6691 O O    . HOH L 4 .   ? 5.484   18.911  71.726 1.00 26.69  ?  464 HOH A O    1 
HETATM 6692 O O    . HOH L 4 .   ? -5.480  -4.046  77.702 1.00 27.85  ?  465 HOH A O    1 
HETATM 6693 O O    . HOH L 4 .   ? 8.805   20.690  53.574 1.00 32.48  ?  466 HOH A O    1 
HETATM 6694 O O    . HOH L 4 .   ? -13.461 11.283  82.986 1.00 21.50  ?  467 HOH A O    1 
HETATM 6695 O O    . HOH L 4 .   ? 8.581   2.481   59.699 1.00 34.47  ?  468 HOH A O    1 
HETATM 6696 O O    . HOH L 4 .   ? -6.608  26.813  75.611 1.00 28.83  ?  469 HOH A O    1 
HETATM 6697 O O    . HOH L 4 .   ? 9.784   14.073  61.446 1.00 25.12  ?  470 HOH A O    1 
HETATM 6698 O O    . HOH L 4 .   ? -8.967  -10.184 74.484 1.00 33.16  ?  471 HOH A O    1 
HETATM 6699 O O    . HOH L 4 .   ? 1.222   -5.957  79.011 1.00 27.68  ?  472 HOH A O    1 
HETATM 6700 O O    . HOH L 4 .   ? -0.061  24.853  73.594 1.00 18.39  ?  473 HOH A O    1 
HETATM 6701 O O    . HOH L 4 .   ? 11.195  22.285  56.162 1.00 31.92  ?  474 HOH A O    1 
HETATM 6702 O O    . HOH L 4 .   ? 4.783   22.468  52.534 1.00 26.86  ?  475 HOH A O    1 
HETATM 6703 O O    . HOH L 4 .   ? -14.591 11.026  84.678 1.00 26.87  ?  476 HOH A O    1 
HETATM 6704 O O    . HOH L 4 .   ? -5.412  20.303  85.801 1.00 30.42  ?  477 HOH A O    1 
HETATM 6705 O O    . HOH L 4 .   ? -9.380  22.695  86.304 1.00 33.85  ?  478 HOH A O    1 
HETATM 6706 O O    . HOH L 4 .   ? 6.967   21.642  53.235 1.00 28.67  ?  479 HOH A O    1 
HETATM 6707 O O    . HOH L 4 .   ? 12.114  23.182  58.305 1.00 32.59  ?  480 HOH A O    1 
HETATM 6708 O O    . HOH L 4 .   ? -6.721  22.439  86.274 1.00 33.15  ?  481 HOH A O    1 
HETATM 6709 O O    . HOH L 4 .   ? -5.719  5.141   66.073 1.00 23.53  ?  482 HOH A O    1 
HETATM 6710 O O    . HOH L 4 .   ? 11.235  12.753  63.290 1.00 29.12  ?  483 HOH A O    1 
HETATM 6711 O O    . HOH L 4 .   ? -14.847 19.703  90.559 1.00 30.82  ?  484 HOH A O    1 
HETATM 6712 O O    . HOH L 4 .   ? 13.863  4.551   60.655 1.00 37.22  ?  485 HOH A O    1 
HETATM 6713 O O    . HOH L 4 .   ? 12.050  5.168   58.310 1.00 38.43  ?  486 HOH A O    1 
HETATM 6714 O O    . HOH M 4 .   ? 0.250   41.118  67.638 1.00 29.93  ?  101 HOH B O    1 
HETATM 6715 O O    . HOH M 4 .   ? -1.242  17.032  50.188 1.00 38.32  ?  102 HOH B O    1 
HETATM 6716 O O    . HOH M 4 .   ? -7.242  35.177  60.947 1.00 40.86  ?  103 HOH B O    1 
HETATM 6717 O O    . HOH M 4 .   ? 1.577   20.070  50.921 1.00 32.84  ?  104 HOH B O    1 
HETATM 6718 O O    . HOH M 4 .   ? -6.525  23.443  47.136 1.00 36.48  ?  105 HOH B O    1 
HETATM 6719 O O    . HOH M 4 .   ? 1.513   25.883  71.588 1.00 23.33  ?  106 HOH B O    1 
HETATM 6720 O O    . HOH M 4 .   ? 11.051  29.925  65.183 1.00 27.62  ?  107 HOH B O    1 
HETATM 6721 O O    . HOH M 4 .   ? -4.465  31.472  72.568 1.00 39.58  ?  108 HOH B O    1 
HETATM 6722 O O    . HOH M 4 .   ? 1.788   17.549  51.142 1.00 27.18  ?  109 HOH B O    1 
HETATM 6723 O O    . HOH M 4 .   ? 5.033   31.838  71.255 1.00 33.79  ?  110 HOH B O    1 
HETATM 6724 O O    . HOH M 4 .   ? 0.101   40.568  64.960 1.00 25.67  ?  111 HOH B O    1 
HETATM 6725 O O    . HOH M 4 .   ? -11.753 20.359  49.217 1.00 42.68  ?  112 HOH B O    1 
HETATM 6726 O O    . HOH M 4 .   ? -3.393  31.182  74.846 1.00 31.87  ?  113 HOH B O    1 
HETATM 6727 O O    . HOH M 4 .   ? -8.726  22.822  47.754 1.00 34.70  ?  114 HOH B O    1 
HETATM 6728 O O    . HOH N 4 .   ? 24.689  30.298  45.552 1.00 24.73  ?  401 HOH C O    1 
HETATM 6729 O O    . HOH N 4 .   ? 14.617  26.897  59.368 1.00 33.16  ?  402 HOH C O    1 
HETATM 6730 O O    . HOH N 4 .   ? 2.616   33.008  27.355 1.00 23.81  ?  403 HOH C O    1 
HETATM 6731 O O    . HOH N 4 .   ? 17.704  31.658  20.684 1.00 20.45  ?  404 HOH C O    1 
HETATM 6732 O O    . HOH N 4 .   ? 22.785  24.346  37.187 1.00 23.85  ?  405 HOH C O    1 
HETATM 6733 O O    . HOH N 4 .   ? 16.526  46.643  30.641 1.00 29.65  ?  406 HOH C O    1 
HETATM 6734 O O    . HOH N 4 .   ? 24.251  25.982  33.565 1.00 21.85  ?  407 HOH C O    1 
HETATM 6735 O O    . HOH N 4 .   ? -0.431  27.507  46.078 1.00 29.99  ?  408 HOH C O    1 
HETATM 6736 O O    . HOH N 4 .   ? 9.876   26.799  52.872 1.00 26.54  ?  409 HOH C O    1 
HETATM 6737 O O    . HOH N 4 .   ? 2.956   30.486  32.484 1.00 20.10  ?  410 HOH C O    1 
HETATM 6738 O O    . HOH N 4 .   ? 3.475   22.521  23.513 1.00 24.24  ?  411 HOH C O    1 
HETATM 6739 O O    . HOH N 4 .   ? 14.545  31.864  19.331 1.00 26.27  ?  412 HOH C O    1 
HETATM 6740 O O    . HOH N 4 .   ? 13.262  34.741  25.712 1.00 14.42  ?  413 HOH C O    1 
HETATM 6741 O O    . HOH N 4 .   ? 10.328  40.896  22.799 1.00 31.88  ?  414 HOH C O    1 
HETATM 6742 O O    . HOH N 4 .   ? 20.182  19.909  17.978 1.00 33.03  ?  415 HOH C O    1 
HETATM 6743 O O    . HOH N 4 .   ? 12.679  20.439  43.128 1.00 16.43  ?  416 HOH C O    1 
HETATM 6744 O O    . HOH N 4 .   ? 27.341  29.532  44.087 1.00 28.67  ?  417 HOH C O    1 
HETATM 6745 O O    . HOH N 4 .   ? 7.574   40.131  24.430 1.00 30.90  ?  418 HOH C O    1 
HETATM 6746 O O    . HOH N 4 .   ? -2.815  37.863  35.692 1.00 29.76  ?  419 HOH C O    1 
HETATM 6747 O O    . HOH N 4 .   ? 3.486   42.626  31.975 1.00 27.22  ?  420 HOH C O    1 
HETATM 6748 O O    . HOH N 4 .   ? 4.075   35.587  26.742 1.00 32.05  ?  421 HOH C O    1 
HETATM 6749 O O    . HOH N 4 .   ? -1.003  36.552  32.425 1.00 27.68  ?  422 HOH C O    1 
HETATM 6750 O O    . HOH N 4 .   ? 16.132  40.284  48.929 1.00 34.14  ?  423 HOH C O    1 
HETATM 6751 O O    . HOH N 4 .   ? 7.280   35.835  39.899 1.00 14.79  ?  424 HOH C O    1 
HETATM 6752 O O    . HOH N 4 .   ? 4.252   17.372  38.725 1.00 23.94  ?  425 HOH C O    1 
HETATM 6753 O O    . HOH N 4 .   ? 15.474  36.967  49.497 1.00 27.67  ?  426 HOH C O    1 
HETATM 6754 O O    . HOH N 4 .   ? 24.681  23.637  33.191 1.00 23.89  ?  427 HOH C O    1 
HETATM 6755 O O    . HOH N 4 .   ? 8.412   46.681  33.946 1.00 27.52  ?  428 HOH C O    1 
HETATM 6756 O O    . HOH N 4 .   ? -0.456  28.011  27.041 1.00 22.89  ?  429 HOH C O    1 
HETATM 6757 O O    . HOH N 4 .   ? 12.380  21.151  40.229 1.00 16.81  ?  430 HOH C O    1 
HETATM 6758 O O    . HOH N 4 .   ? 33.254  29.637  34.091 1.00 31.85  ?  431 HOH C O    1 
HETATM 6759 O O    . HOH N 4 .   ? 14.782  45.729  48.549 1.00 33.01  ?  432 HOH C O    1 
HETATM 6760 O O    . HOH N 4 .   ? 10.792  23.498  51.757 1.00 26.73  ?  433 HOH C O    1 
HETATM 6761 O O    . HOH N 4 .   ? 2.626   27.598  23.987 1.00 28.51  ?  434 HOH C O    1 
HETATM 6762 O O    . HOH N 4 .   ? 6.962   21.777  22.069 1.00 24.80  ?  435 HOH C O    1 
HETATM 6763 O O    . HOH N 4 .   ? 3.334   37.450  49.686 1.00 23.59  ?  436 HOH C O    1 
HETATM 6764 O O    . HOH N 4 .   ? 13.603  22.232  20.329 1.00 29.56  ?  437 HOH C O    1 
HETATM 6765 O O    . HOH N 4 .   ? 7.239   29.902  20.801 1.00 23.71  ?  438 HOH C O    1 
HETATM 6766 O O    . HOH N 4 .   ? 11.019  31.304  16.298 1.00 36.67  ?  439 HOH C O    1 
HETATM 6767 O O    . HOH N 4 .   ? 13.677  19.304  19.250 1.00 34.75  ?  440 HOH C O    1 
HETATM 6768 O O    . HOH N 4 .   ? 17.006  24.198  45.873 1.00 28.04  ?  441 HOH C O    1 
HETATM 6769 O O    . HOH N 4 .   ? 10.507  9.326   23.393 1.00 26.72  ?  442 HOH C O    1 
HETATM 6770 O O    . HOH N 4 .   ? 14.282  23.508  53.477 1.00 32.69  ?  443 HOH C O    1 
HETATM 6771 O O    . HOH N 4 .   ? 8.812   25.566  17.782 1.00 32.90  ?  444 HOH C O    1 
HETATM 6772 O O    . HOH N 4 .   ? -0.574  22.422  25.891 1.00 31.84  ?  445 HOH C O    1 
HETATM 6773 O O    . HOH N 4 .   ? 24.483  24.091  43.908 1.00 25.52  ?  446 HOH C O    1 
HETATM 6774 O O    . HOH N 4 .   ? 5.880   26.681  35.071 1.00 21.38  ?  447 HOH C O    1 
HETATM 6775 O O    . HOH N 4 .   ? 19.232  50.509  38.618 1.00 30.04  ?  448 HOH C O    1 
HETATM 6776 O O    . HOH N 4 .   ? 7.999   40.225  34.370 1.00 16.86  ?  449 HOH C O    1 
HETATM 6777 O O    . HOH N 4 .   ? 7.314   46.513  36.635 1.00 27.29  ?  450 HOH C O    1 
HETATM 6778 O O    . HOH N 4 .   ? 9.675   21.097  49.478 1.00 34.81  ?  451 HOH C O    1 
HETATM 6779 O O    . HOH N 4 .   ? 16.241  7.126   19.128 1.00 24.60  ?  452 HOH C O    1 
HETATM 6780 O O    . HOH N 4 .   ? 8.169   38.687  20.878 1.00 35.79  ?  453 HOH C O    1 
HETATM 6781 O O    . HOH N 4 .   ? 6.110   24.580  22.989 1.00 17.52  ?  454 HOH C O    1 
HETATM 6782 O O    . HOH N 4 .   ? 28.363  24.393  41.000 1.00 33.38  ?  455 HOH C O    1 
HETATM 6783 O O    . HOH N 4 .   ? 6.617   24.895  29.898 1.00 19.41  ?  456 HOH C O    1 
HETATM 6784 O O    . HOH N 4 .   ? 5.753   21.896  29.705 1.00 14.22  ?  457 HOH C O    1 
HETATM 6785 O O    . HOH N 4 .   ? -3.166  32.672  45.497 1.00 23.34  ?  458 HOH C O    1 
HETATM 6786 O O    . HOH N 4 .   ? 30.822  33.177  41.941 1.00 31.79  ?  459 HOH C O    1 
HETATM 6787 O O    . HOH N 4 .   ? 13.717  43.422  37.469 1.00 18.93  ?  460 HOH C O    1 
HETATM 6788 O O    . HOH N 4 .   ? 14.096  11.290  26.966 1.00 30.86  ?  461 HOH C O    1 
HETATM 6789 O O    . HOH N 4 .   ? 26.178  26.927  43.196 1.00 24.95  ?  462 HOH C O    1 
HETATM 6790 O O    . HOH N 4 .   ? 13.123  34.705  22.942 1.00 19.10  ?  463 HOH C O    1 
HETATM 6791 O O    . HOH N 4 .   ? 3.810   28.392  33.709 1.00 27.21  ?  464 HOH C O    1 
HETATM 6792 O O    . HOH N 4 .   ? 1.850   28.156  34.915 1.00 27.63  ?  465 HOH C O    1 
HETATM 6793 O O    . HOH N 4 .   ? 6.449   31.833  24.116 1.00 23.00  ?  466 HOH C O    1 
HETATM 6794 O O    . HOH N 4 .   ? 4.741   25.582  49.505 1.00 30.56  ?  467 HOH C O    1 
HETATM 6795 O O    . HOH N 4 .   ? 35.292  33.577  32.259 1.00 30.11  ?  468 HOH C O    1 
HETATM 6796 O O    . HOH N 4 .   ? 28.039  33.121  50.879 1.00 32.93  ?  469 HOH C O    1 
HETATM 6797 O O    . HOH N 4 .   ? 14.484  -4.212  12.008 1.00 24.38  ?  470 HOH C O    1 
HETATM 6798 O O    . HOH N 4 .   ? 21.699  26.873  32.628 1.00 24.94  ?  471 HOH C O    1 
HETATM 6799 O O    . HOH N 4 .   ? 0.367   31.690  24.309 1.00 32.48  ?  472 HOH C O    1 
HETATM 6800 O O    . HOH N 4 .   ? 6.543   29.420  22.942 1.00 18.73  ?  473 HOH C O    1 
HETATM 6801 O O    . HOH N 4 .   ? 21.272  37.815  21.191 1.00 31.49  ?  474 HOH C O    1 
HETATM 6802 O O    . HOH N 4 .   ? 3.905   26.626  35.501 1.00 27.09  ?  475 HOH C O    1 
HETATM 6803 O O    . HOH N 4 .   ? 0.593   44.960  37.799 1.00 26.68  ?  476 HOH C O    1 
HETATM 6804 O O    . HOH N 4 .   ? 4.426   42.922  22.048 1.00 42.26  ?  477 HOH C O    1 
HETATM 6805 O O    . HOH N 4 .   ? 10.013  19.542  46.176 1.00 28.96  ?  478 HOH C O    1 
HETATM 6806 O O    . HOH N 4 .   ? 18.225  36.602  39.911 1.00 21.94  ?  479 HOH C O    1 
HETATM 6807 O O    . HOH N 4 .   ? 16.073  39.386  37.911 1.00 21.27  ?  480 HOH C O    1 
HETATM 6808 O O    . HOH N 4 .   ? -3.659  30.290  38.675 1.00 32.20  ?  481 HOH C O    1 
HETATM 6809 O O    . HOH N 4 .   ? 15.710  44.711  32.947 1.00 18.66  ?  482 HOH C O    1 
HETATM 6810 O O    . HOH N 4 .   ? -2.064  26.972  34.603 1.00 25.82  ?  483 HOH C O    1 
HETATM 6811 O O    . HOH N 4 .   ? -3.507  32.773  39.536 1.00 27.00  ?  484 HOH C O    1 
HETATM 6812 O O    . HOH N 4 .   ? 18.241  28.196  18.827 1.00 25.64  ?  485 HOH C O    1 
HETATM 6813 O O    . HOH N 4 .   ? 18.276  -0.616  16.360 1.00 28.88  ?  486 HOH C O    1 
HETATM 6814 O O    . HOH N 4 .   ? 2.035   36.682  47.245 1.00 28.05  ?  487 HOH C O    1 
HETATM 6815 O O    . HOH N 4 .   ? 25.010  40.503  34.352 1.00 33.60  ?  488 HOH C O    1 
HETATM 6816 O O    . HOH N 4 .   ? 8.383   43.791  23.486 1.00 26.33  ?  489 HOH C O    1 
HETATM 6817 O O    . HOH N 4 .   ? 0.695   42.445  32.409 1.00 31.55  ?  490 HOH C O    1 
HETATM 6818 O O    . HOH N 4 .   ? 16.872  34.213  54.491 1.00 27.94  ?  491 HOH C O    1 
HETATM 6819 O O    . HOH N 4 .   ? 14.439  10.840  22.271 1.00 28.26  ?  492 HOH C O    1 
HETATM 6820 O O    . HOH N 4 .   ? 23.625  22.667  46.589 1.00 34.96  ?  493 HOH C O    1 
HETATM 6821 O O    . HOH N 4 .   ? 12.446  25.889  18.697 1.00 30.08  ?  494 HOH C O    1 
HETATM 6822 O O    . HOH N 4 .   ? 6.448   23.826  50.792 1.00 28.57  ?  495 HOH C O    1 
HETATM 6823 O O    . HOH N 4 .   ? 9.738   20.611  39.630 1.00 15.76  ?  496 HOH C O    1 
HETATM 6824 O O    . HOH N 4 .   ? 5.637   27.071  19.972 1.00 33.27  ?  497 HOH C O    1 
HETATM 6825 O O    . HOH N 4 .   ? 12.879  23.786  18.689 1.00 34.65  ?  498 HOH C O    1 
HETATM 6826 O O    . HOH N 4 .   ? 8.098   17.708  45.574 1.00 34.40  ?  499 HOH C O    1 
HETATM 6827 O O    . HOH N 4 .   ? 9.374   22.988  53.747 1.00 30.31  ?  500 HOH C O    1 
HETATM 6828 O O    . HOH N 4 .   ? 14.589  8.411   21.536 1.00 27.07  ?  501 HOH C O    1 
HETATM 6829 O O    . HOH N 4 .   ? 17.337  -4.261  13.183 1.00 26.05  ?  502 HOH C O    1 
HETATM 6830 O O    . HOH N 4 .   ? 13.914  27.458  17.738 1.00 33.77  ?  503 HOH C O    1 
HETATM 6831 O O    . HOH N 4 .   ? 9.704   36.292  18.929 1.00 39.42  ?  504 HOH C O    1 
HETATM 6832 O O    . HOH N 4 .   ? 7.478   21.515  50.149 1.00 27.81  ?  505 HOH C O    1 
HETATM 6833 O O    . HOH N 4 .   ? 10.209  19.053  43.424 1.00 27.83  ?  506 HOH C O    1 
HETATM 6834 O O    . HOH N 4 .   ? 7.719   25.018  53.017 1.00 27.99  ?  507 HOH C O    1 
HETATM 6835 O O    . HOH N 4 .   ? 4.488   33.300  25.566 1.00 23.30  ?  508 HOH C O    1 
HETATM 6836 O O    . HOH N 4 .   ? 6.937   41.055  20.873 1.00 38.74  ?  509 HOH C O    1 
HETATM 6837 O O    . HOH N 4 .   ? 17.579  40.181  35.759 1.00 25.01  ?  510 HOH C O    1 
HETATM 6838 O O    . HOH N 4 .   ? 8.343   34.274  18.710 1.00 40.45  ?  511 HOH C O    1 
HETATM 6839 O O    . HOH N 4 .   ? 19.195  1.880   18.081 1.00 36.01  ?  512 HOH C O    1 
HETATM 6840 O O    . HOH N 4 .   ? 7.086   36.851  19.509 1.00 39.04  ?  513 HOH C O    1 
HETATM 6841 O O    . HOH O 4 .   ? 8.204   18.072  40.930 1.00 30.85  ?  101 HOH D O    1 
HETATM 6842 O O    . HOH O 4 .   ? 3.983   15.579  26.806 1.00 22.96  ?  102 HOH D O    1 
HETATM 6843 O O    . HOH O 4 .   ? 9.091   19.784  37.031 1.00 17.65  ?  103 HOH D O    1 
HETATM 6844 O O    . HOH O 4 .   ? 16.219  6.641   30.678 1.00 33.52  ?  104 HOH D O    1 
HETATM 6845 O O    . HOH O 4 .   ? 15.662  8.503   29.173 1.00 29.96  ?  105 HOH D O    1 
HETATM 6846 O O    . HOH O 4 .   ? 32.261  32.775  32.901 1.00 28.85  ?  106 HOH D O    1 
HETATM 6847 O O    . HOH O 4 .   ? 30.014  30.853  17.719 1.00 34.84  ?  107 HOH D O    1 
HETATM 6848 O O    . HOH O 4 .   ? -4.203  26.803  33.299 1.00 28.72  ?  108 HOH D O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   46  46  GLY GLY A . n 
A 1 2   PRO 2   47  47  PRO PRO A . n 
A 1 3   HIS 3   48  48  HIS HIS A . n 
A 1 4   MET 4   49  49  MET MET A . n 
A 1 5   LEU 5   50  50  LEU LEU A . n 
A 1 6   GLU 6   51  51  GLU GLU A . n 
A 1 7   ALA 7   52  52  ALA ALA A . n 
A 1 8   GLU 8   53  53  GLU GLU A . n 
A 1 9   HIS 9   54  54  HIS HIS A . n 
A 1 10  PRO 10  55  55  PRO PRO A . n 
A 1 11  LEU 11  56  56  LEU LEU A . n 
A 1 12  GLN 12  57  57  GLN GLN A . n 
A 1 13  TYR 13  58  58  TYR TYR A . n 
A 1 14  ASN 14  59  59  ASN ASN A . n 
A 1 15  TYR 15  60  60  TYR TYR A . n 
A 1 16  THR 16  61  61  THR THR A . n 
A 1 17  PHE 17  62  62  PHE PHE A . n 
A 1 18  TRP 18  63  63  TRP TRP A . n 
A 1 19  TYR 19  64  64  TYR TYR A . n 
A 1 20  SER 20  65  65  SER SER A . n 
A 1 21  ARG 21  66  66  ARG ARG A . n 
A 1 22  ARG 22  67  ?   ?   ?   A . n 
A 1 23  THR 23  68  ?   ?   ?   A . n 
A 1 24  PRO 24  69  ?   ?   ?   A . n 
A 1 25  GLY 25  70  ?   ?   ?   A . n 
A 1 26  ARG 26  71  ?   ?   ?   A . n 
A 1 27  PRO 27  72  ?   ?   ?   A . n 
A 1 28  THR 28  73  ?   ?   ?   A . n 
A 1 29  SER 29  74  ?   ?   ?   A . n 
A 1 30  SER 30  75  ?   ?   ?   A . n 
A 1 31  GLN 31  76  ?   ?   ?   A . n 
A 1 32  SER 32  77  ?   ?   ?   A . n 
A 1 33  TYR 33  78  ?   ?   ?   A . n 
A 1 34  GLU 34  79  ?   ?   ?   A . n 
A 1 35  GLN 35  80  ?   ?   ?   A . n 
A 1 36  ASN 36  81  81  ASN ASN A . n 
A 1 37  ILE 37  82  82  ILE ILE A . n 
A 1 38  LYS 38  83  83  LYS LYS A . n 
A 1 39  GLN 39  84  84  GLN GLN A . n 
A 1 40  ILE 40  85  85  ILE ILE A . n 
A 1 41  GLY 41  86  86  GLY GLY A . n 
A 1 42  THR 42  87  87  THR THR A . n 
A 1 43  PHE 43  88  88  PHE PHE A . n 
A 1 44  ALA 44  89  89  ALA ALA A . n 
A 1 45  SER 45  90  90  SER SER A . n 
A 1 46  VAL 46  91  91  VAL VAL A . n 
A 1 47  GLU 47  92  92  GLU GLU A . n 
A 1 48  GLN 48  93  93  GLN GLN A . n 
A 1 49  PHE 49  94  94  PHE PHE A . n 
A 1 50  TRP 50  95  95  TRP TRP A . n 
A 1 51  ARG 51  96  96  ARG ARG A . n 
A 1 52  PHE 52  97  97  PHE PHE A . n 
A 1 53  TYR 53  98  98  TYR TYR A . n 
A 1 54  SER 54  99  99  SER SER A . n 
A 1 55  HIS 55  100 100 HIS HIS A . n 
A 1 56  MET 56  101 101 MET MET A . n 
A 1 57  VAL 57  102 102 VAL VAL A . n 
A 1 58  ARG 58  103 103 ARG ARG A . n 
A 1 59  PRO 59  104 104 PRO PRO A . n 
A 1 60  GLY 60  105 105 GLY GLY A . n 
A 1 61  ASP 61  106 106 ASP ASP A . n 
A 1 62  LEU 62  107 107 LEU LEU A . n 
A 1 63  THR 63  108 108 THR THR A . n 
A 1 64  GLY 64  109 109 GLY GLY A . n 
A 1 65  HIS 65  110 110 HIS HIS A . n 
A 1 66  SER 66  111 111 SER SER A . n 
A 1 67  ASP 67  112 112 ASP ASP A . n 
A 1 68  PHE 68  113 113 PHE PHE A . n 
A 1 69  HIS 69  114 114 HIS HIS A . n 
A 1 70  LEU 70  115 115 LEU LEU A . n 
A 1 71  PHE 71  116 116 PHE PHE A . n 
A 1 72  LYS 72  117 117 LYS LYS A . n 
A 1 73  GLU 73  118 118 GLU GLU A . n 
A 1 74  GLY 74  119 119 GLY GLY A . n 
A 1 75  ILE 75  120 120 ILE ILE A . n 
A 1 76  LYS 76  121 121 LYS LYS A . n 
A 1 77  PRO 77  122 122 PRO PRO A . n 
A 1 78  MET 78  123 123 MET MET A . n 
A 1 79  TRP 79  124 124 TRP TRP A . n 
A 1 80  GLU 80  125 125 GLU GLU A . n 
A 1 81  ASP 81  126 126 ASP ASP A . n 
A 1 82  ASP 82  127 127 ASP ASP A . n 
A 1 83  ALA 83  128 128 ALA ALA A . n 
A 1 84  ASN 84  129 129 ASN ASN A . n 
A 1 85  LYS 85  130 130 LYS LYS A . n 
A 1 86  ASN 86  131 131 ASN ASN A . n 
A 1 87  GLY 87  132 132 GLY GLY A . n 
A 1 88  GLY 88  133 133 GLY GLY A . n 
A 1 89  LYS 89  134 134 LYS LYS A . n 
A 1 90  TRP 90  135 135 TRP TRP A . n 
A 1 91  ILE 91  136 136 ILE ILE A . n 
A 1 92  ILE 92  137 137 ILE ILE A . n 
A 1 93  ARG 93  138 138 ARG ARG A . n 
A 1 94  LEU 94  139 139 LEU LEU A . n 
A 1 95  ARG 95  140 140 ARG ARG A . n 
A 1 96  LYS 96  141 141 LYS LYS A . n 
A 1 97  GLY 97  142 142 GLY GLY A . n 
A 1 98  LEU 98  143 143 LEU LEU A . n 
A 1 99  ALA 99  144 144 ALA ALA A . n 
A 1 100 SER 100 145 145 SER SER A . n 
A 1 101 ARG 101 146 146 ARG ARG A . n 
A 1 102 CYS 102 147 147 CYS CYS A . n 
A 1 103 TRP 103 148 148 TRP TRP A . n 
A 1 104 GLU 104 149 149 GLU GLU A . n 
A 1 105 ASN 105 150 150 ASN ASN A . n 
A 1 106 LEU 106 151 151 LEU LEU A . n 
A 1 107 ILE 107 152 152 ILE ILE A . n 
A 1 108 LEU 108 153 153 LEU LEU A . n 
A 1 109 ALA 109 154 154 ALA ALA A . n 
A 1 110 MET 110 155 155 MET MET A . n 
A 1 111 LEU 111 156 156 LEU LEU A . n 
A 1 112 GLY 112 157 157 GLY GLY A . n 
A 1 113 GLU 113 158 158 GLU GLU A . n 
A 1 114 GLN 114 159 159 GLN GLN A . n 
A 1 115 PHE 115 160 160 PHE PHE A . n 
A 1 116 MET 116 161 161 MET MET A . n 
A 1 117 VAL 117 162 162 VAL VAL A . n 
A 1 118 GLY 118 163 163 GLY GLY A . n 
A 1 119 GLU 119 164 164 GLU GLU A . n 
A 1 120 GLU 120 165 165 GLU GLU A . n 
A 1 121 ILE 121 166 166 ILE ILE A . n 
A 1 122 CYS 122 167 167 CYS CYS A . n 
A 1 123 GLY 123 168 168 GLY GLY A . n 
A 1 124 ALA 124 169 169 ALA ALA A . n 
A 1 125 VAL 125 170 170 VAL VAL A . n 
A 1 126 VAL 126 171 171 VAL VAL A . n 
A 1 127 SER 127 172 172 SER SER A . n 
A 1 128 VAL 128 173 173 VAL VAL A . n 
A 1 129 ARG 129 174 174 ARG ARG A . n 
A 1 130 PHE 130 175 175 PHE PHE A . n 
A 1 131 GLN 131 176 176 GLN GLN A . n 
A 1 132 GLU 132 177 177 GLU GLU A . n 
A 1 133 ASP 133 178 178 ASP ASP A . n 
A 1 134 ILE 134 179 179 ILE ILE A . n 
A 1 135 ILE 135 180 180 ILE ILE A . n 
A 1 136 SER 136 181 181 SER SER A . n 
A 1 137 ILE 137 182 182 ILE ILE A . n 
A 1 138 TRP 138 183 183 TRP TRP A . n 
A 1 139 ASN 139 184 184 ASN ASN A . n 
A 1 140 LYS 140 185 185 LYS LYS A . n 
A 1 141 THR 141 186 186 THR THR A . n 
A 1 142 ALA 142 187 187 ALA ALA A . n 
A 1 143 SER 143 188 188 SER SER A . n 
A 1 144 ASP 144 189 189 ASP ASP A . n 
A 1 145 GLN 145 190 190 GLN GLN A . n 
A 1 146 ALA 146 191 191 ALA ALA A . n 
A 1 147 THR 147 192 192 THR THR A . n 
A 1 148 THR 148 193 193 THR THR A . n 
A 1 149 ALA 149 194 194 ALA ALA A . n 
A 1 150 ARG 150 195 195 ARG ARG A . n 
A 1 151 ILE 151 196 196 ILE ILE A . n 
A 1 152 ARG 152 197 197 ARG ARG A . n 
A 1 153 ASP 153 198 198 ASP ASP A . n 
A 1 154 THR 154 199 199 THR THR A . n 
A 1 155 LEU 155 200 200 LEU LEU A . n 
A 1 156 ARG 156 201 201 ARG ARG A . n 
A 1 157 ARG 157 202 202 ARG ARG A . n 
A 1 158 VAL 158 203 203 VAL VAL A . n 
A 1 159 LEU 159 204 204 LEU LEU A . n 
A 1 160 ASN 160 205 205 ASN ASN A . n 
A 1 161 LEU 161 206 206 LEU LEU A . n 
A 1 162 PRO 162 207 207 PRO PRO A . n 
A 1 163 PRO 163 208 208 PRO PRO A . n 
A 1 164 ASN 164 209 209 ASN ASN A . n 
A 1 165 THR 165 210 210 THR THR A . n 
A 1 166 ILE 166 211 211 ILE ILE A . n 
A 1 167 MET 167 212 212 MET MET A . n 
A 1 168 GLU 168 213 213 GLU GLU A . n 
A 1 169 TYR 169 214 214 TYR TYR A . n 
A 1 170 LYS 170 215 215 LYS LYS A . n 
A 1 171 THR 171 216 216 THR THR A . n 
A 1 172 HIS 172 217 217 HIS HIS A . n 
A 1 173 THR 173 218 218 THR THR A . n 
A 1 174 ASP 174 219 219 ASP ASP A . n 
A 1 175 SER 175 220 220 SER SER A . n 
A 1 176 ILE 176 221 221 ILE ILE A . n 
A 1 177 LYS 177 222 222 LYS LYS A . n 
A 1 178 MET 178 223 223 MET MET A . n 
A 1 179 PRO 179 224 224 PRO PRO A . n 
A 1 180 GLY 180 225 ?   ?   ?   A . n 
A 1 181 ARG 181 226 ?   ?   ?   A . n 
A 1 182 LEU 182 227 ?   ?   ?   A . n 
A 1 183 GLY 183 228 ?   ?   ?   A . n 
A 1 184 PRO 184 229 ?   ?   ?   A . n 
A 1 185 GLN 185 230 ?   ?   ?   A . n 
A 1 186 ARG 186 231 ?   ?   ?   A . n 
A 1 187 LEU 187 232 ?   ?   ?   A . n 
A 1 188 LEU 188 233 ?   ?   ?   A . n 
A 1 189 PHE 189 234 ?   ?   ?   A . n 
B 2 1   GLY 1   46  ?   ?   ?   B . n 
B 2 2   PRO 2   47  ?   ?   ?   B . n 
B 2 3   HIS 3   48  ?   ?   ?   B . n 
B 2 4   MET 4   49  ?   ?   ?   B . n 
B 2 5   THR 5   50  50  THR THR B . n 
B 2 6   ARG 6   51  51  ARG ARG B . n 
B 2 7   ILE 7   52  52  ILE ILE B . n 
B 2 8   ILE 8   53  53  ILE ILE B . n 
B 2 9   TYR 9   54  54  TYR TYR B . n 
B 2 10  ASP 10  55  55  ASP ASP B . n 
B 2 11  ARG 11  56  56  ARG ARG B . n 
B 2 12  LYS 12  57  57  LYS LYS B . n 
B 2 13  PHE 13  58  58  PHE PHE B . n 
B 2 14  LEU 14  59  59  LEU LEU B . n 
B 2 15  MET 15  60  60  MET MET B . n 
B 2 16  GLU 16  61  61  GLU GLU B . n 
B 2 17  CYS 17  62  62  CYS CYS B . n 
B 2 18  ARG 18  63  63  ARG ARG B . n 
B 2 19  ASN 19  64  64  ASN ASN B . n 
B 2 20  SER 20  65  65  SER SER B . n 
B 2 21  PRO 21  66  66  PRO PRO B . n 
B 2 22  VAL 22  67  67  VAL VAL B . n 
B 2 23  THR 23  68  68  THR THR B . n 
B 2 24  LYS 24  69  69  LYS LYS B . n 
B 2 25  THR 25  70  70  THR THR B . n 
B 2 26  PRO 26  71  71  PRO PRO B . n 
B 2 27  PRO 27  72  72  PRO PRO B . n 
B 2 28  ARG 28  73  73  ARG ARG B . n 
B 2 29  ASP 29  74  74  ASP ASP B . n 
B 2 30  LEU 30  75  75  LEU LEU B . n 
B 2 31  PRO 31  76  76  PRO PRO B . n 
B 2 32  THR 32  77  77  THR THR B . n 
B 2 33  ILE 33  78  78  ILE ILE B . n 
B 2 34  PRO 34  79  79  PRO PRO B . n 
B 2 35  GLY 35  80  80  GLY GLY B . n 
B 2 36  VAL 36  81  81  VAL VAL B . n 
B 2 37  THR 37  82  82  THR THR B . n 
B 2 38  SER 38  83  83  SER SER B . n 
C 1 1   GLY 1   46  46  GLY GLY C . n 
C 1 2   PRO 2   47  47  PRO PRO C . n 
C 1 3   HIS 3   48  48  HIS HIS C . n 
C 1 4   MET 4   49  49  MET MET C . n 
C 1 5   LEU 5   50  50  LEU LEU C . n 
C 1 6   GLU 6   51  51  GLU GLU C . n 
C 1 7   ALA 7   52  52  ALA ALA C . n 
C 1 8   GLU 8   53  53  GLU GLU C . n 
C 1 9   HIS 9   54  54  HIS HIS C . n 
C 1 10  PRO 10  55  55  PRO PRO C . n 
C 1 11  LEU 11  56  56  LEU LEU C . n 
C 1 12  GLN 12  57  57  GLN GLN C . n 
C 1 13  TYR 13  58  58  TYR TYR C . n 
C 1 14  ASN 14  59  59  ASN ASN C . n 
C 1 15  TYR 15  60  60  TYR TYR C . n 
C 1 16  THR 16  61  61  THR THR C . n 
C 1 17  PHE 17  62  62  PHE PHE C . n 
C 1 18  TRP 18  63  63  TRP TRP C . n 
C 1 19  TYR 19  64  64  TYR TYR C . n 
C 1 20  SER 20  65  65  SER SER C . n 
C 1 21  ARG 21  66  66  ARG ARG C . n 
C 1 22  ARG 22  67  67  ARG ARG C . n 
C 1 23  THR 23  68  ?   ?   ?   C . n 
C 1 24  PRO 24  69  ?   ?   ?   C . n 
C 1 25  GLY 25  70  ?   ?   ?   C . n 
C 1 26  ARG 26  71  ?   ?   ?   C . n 
C 1 27  PRO 27  72  ?   ?   ?   C . n 
C 1 28  THR 28  73  ?   ?   ?   C . n 
C 1 29  SER 29  74  ?   ?   ?   C . n 
C 1 30  SER 30  75  ?   ?   ?   C . n 
C 1 31  GLN 31  76  ?   ?   ?   C . n 
C 1 32  SER 32  77  ?   ?   ?   C . n 
C 1 33  TYR 33  78  ?   ?   ?   C . n 
C 1 34  GLU 34  79  ?   ?   ?   C . n 
C 1 35  GLN 35  80  ?   ?   ?   C . n 
C 1 36  ASN 36  81  81  ASN ASN C . n 
C 1 37  ILE 37  82  82  ILE ILE C . n 
C 1 38  LYS 38  83  83  LYS LYS C . n 
C 1 39  GLN 39  84  84  GLN GLN C . n 
C 1 40  ILE 40  85  85  ILE ILE C . n 
C 1 41  GLY 41  86  86  GLY GLY C . n 
C 1 42  THR 42  87  87  THR THR C . n 
C 1 43  PHE 43  88  88  PHE PHE C . n 
C 1 44  ALA 44  89  89  ALA ALA C . n 
C 1 45  SER 45  90  90  SER SER C . n 
C 1 46  VAL 46  91  91  VAL VAL C . n 
C 1 47  GLU 47  92  92  GLU GLU C . n 
C 1 48  GLN 48  93  93  GLN GLN C . n 
C 1 49  PHE 49  94  94  PHE PHE C . n 
C 1 50  TRP 50  95  95  TRP TRP C . n 
C 1 51  ARG 51  96  96  ARG ARG C . n 
C 1 52  PHE 52  97  97  PHE PHE C . n 
C 1 53  TYR 53  98  98  TYR TYR C . n 
C 1 54  SER 54  99  99  SER SER C . n 
C 1 55  HIS 55  100 100 HIS HIS C . n 
C 1 56  MET 56  101 101 MET MET C . n 
C 1 57  VAL 57  102 102 VAL VAL C . n 
C 1 58  ARG 58  103 103 ARG ARG C . n 
C 1 59  PRO 59  104 104 PRO PRO C . n 
C 1 60  GLY 60  105 105 GLY GLY C . n 
C 1 61  ASP 61  106 106 ASP ASP C . n 
C 1 62  LEU 62  107 107 LEU LEU C . n 
C 1 63  THR 63  108 108 THR THR C . n 
C 1 64  GLY 64  109 109 GLY GLY C . n 
C 1 65  HIS 65  110 110 HIS HIS C . n 
C 1 66  SER 66  111 111 SER SER C . n 
C 1 67  ASP 67  112 112 ASP ASP C . n 
C 1 68  PHE 68  113 113 PHE PHE C . n 
C 1 69  HIS 69  114 114 HIS HIS C . n 
C 1 70  LEU 70  115 115 LEU LEU C . n 
C 1 71  PHE 71  116 116 PHE PHE C . n 
C 1 72  LYS 72  117 117 LYS LYS C . n 
C 1 73  GLU 73  118 118 GLU GLU C . n 
C 1 74  GLY 74  119 119 GLY GLY C . n 
C 1 75  ILE 75  120 120 ILE ILE C . n 
C 1 76  LYS 76  121 121 LYS LYS C . n 
C 1 77  PRO 77  122 122 PRO PRO C . n 
C 1 78  MET 78  123 123 MET MET C . n 
C 1 79  TRP 79  124 124 TRP TRP C . n 
C 1 80  GLU 80  125 125 GLU GLU C . n 
C 1 81  ASP 81  126 126 ASP ASP C . n 
C 1 82  ASP 82  127 127 ASP ASP C . n 
C 1 83  ALA 83  128 128 ALA ALA C . n 
C 1 84  ASN 84  129 129 ASN ASN C . n 
C 1 85  LYS 85  130 130 LYS LYS C . n 
C 1 86  ASN 86  131 131 ASN ASN C . n 
C 1 87  GLY 87  132 132 GLY GLY C . n 
C 1 88  GLY 88  133 133 GLY GLY C . n 
C 1 89  LYS 89  134 134 LYS LYS C . n 
C 1 90  TRP 90  135 135 TRP TRP C . n 
C 1 91  ILE 91  136 136 ILE ILE C . n 
C 1 92  ILE 92  137 137 ILE ILE C . n 
C 1 93  ARG 93  138 138 ARG ARG C . n 
C 1 94  LEU 94  139 139 LEU LEU C . n 
C 1 95  ARG 95  140 140 ARG ARG C . n 
C 1 96  LYS 96  141 141 LYS LYS C . n 
C 1 97  GLY 97  142 142 GLY GLY C . n 
C 1 98  LEU 98  143 143 LEU LEU C . n 
C 1 99  ALA 99  144 144 ALA ALA C . n 
C 1 100 SER 100 145 145 SER SER C . n 
C 1 101 ARG 101 146 146 ARG ARG C . n 
C 1 102 CYS 102 147 147 CYS CYS C . n 
C 1 103 TRP 103 148 148 TRP TRP C . n 
C 1 104 GLU 104 149 149 GLU GLU C . n 
C 1 105 ASN 105 150 150 ASN ASN C . n 
C 1 106 LEU 106 151 151 LEU LEU C . n 
C 1 107 ILE 107 152 152 ILE ILE C . n 
C 1 108 LEU 108 153 153 LEU LEU C . n 
C 1 109 ALA 109 154 154 ALA ALA C . n 
C 1 110 MET 110 155 155 MET MET C . n 
C 1 111 LEU 111 156 156 LEU LEU C . n 
C 1 112 GLY 112 157 157 GLY GLY C . n 
C 1 113 GLU 113 158 158 GLU GLU C . n 
C 1 114 GLN 114 159 159 GLN GLN C . n 
C 1 115 PHE 115 160 160 PHE PHE C . n 
C 1 116 MET 116 161 161 MET MET C . n 
C 1 117 VAL 117 162 162 VAL VAL C . n 
C 1 118 GLY 118 163 163 GLY GLY C . n 
C 1 119 GLU 119 164 164 GLU GLU C . n 
C 1 120 GLU 120 165 165 GLU GLU C . n 
C 1 121 ILE 121 166 166 ILE ILE C . n 
C 1 122 CYS 122 167 167 CYS CYS C . n 
C 1 123 GLY 123 168 168 GLY GLY C . n 
C 1 124 ALA 124 169 169 ALA ALA C . n 
C 1 125 VAL 125 170 170 VAL VAL C . n 
C 1 126 VAL 126 171 171 VAL VAL C . n 
C 1 127 SER 127 172 172 SER SER C . n 
C 1 128 VAL 128 173 173 VAL VAL C . n 
C 1 129 ARG 129 174 174 ARG ARG C . n 
C 1 130 PHE 130 175 175 PHE PHE C . n 
C 1 131 GLN 131 176 176 GLN GLN C . n 
C 1 132 GLU 132 177 177 GLU GLU C . n 
C 1 133 ASP 133 178 178 ASP ASP C . n 
C 1 134 ILE 134 179 179 ILE ILE C . n 
C 1 135 ILE 135 180 180 ILE ILE C . n 
C 1 136 SER 136 181 181 SER SER C . n 
C 1 137 ILE 137 182 182 ILE ILE C . n 
C 1 138 TRP 138 183 183 TRP TRP C . n 
C 1 139 ASN 139 184 184 ASN ASN C . n 
C 1 140 LYS 140 185 185 LYS LYS C . n 
C 1 141 THR 141 186 186 THR THR C . n 
C 1 142 ALA 142 187 187 ALA ALA C . n 
C 1 143 SER 143 188 188 SER SER C . n 
C 1 144 ASP 144 189 189 ASP ASP C . n 
C 1 145 GLN 145 190 190 GLN GLN C . n 
C 1 146 ALA 146 191 191 ALA ALA C . n 
C 1 147 THR 147 192 192 THR THR C . n 
C 1 148 THR 148 193 193 THR THR C . n 
C 1 149 ALA 149 194 194 ALA ALA C . n 
C 1 150 ARG 150 195 195 ARG ARG C . n 
C 1 151 ILE 151 196 196 ILE ILE C . n 
C 1 152 ARG 152 197 197 ARG ARG C . n 
C 1 153 ASP 153 198 198 ASP ASP C . n 
C 1 154 THR 154 199 199 THR THR C . n 
C 1 155 LEU 155 200 200 LEU LEU C . n 
C 1 156 ARG 156 201 201 ARG ARG C . n 
C 1 157 ARG 157 202 202 ARG ARG C . n 
C 1 158 VAL 158 203 203 VAL VAL C . n 
C 1 159 LEU 159 204 204 LEU LEU C . n 
C 1 160 ASN 160 205 205 ASN ASN C . n 
C 1 161 LEU 161 206 206 LEU LEU C . n 
C 1 162 PRO 162 207 207 PRO PRO C . n 
C 1 163 PRO 163 208 208 PRO PRO C . n 
C 1 164 ASN 164 209 209 ASN ASN C . n 
C 1 165 THR 165 210 210 THR THR C . n 
C 1 166 ILE 166 211 211 ILE ILE C . n 
C 1 167 MET 167 212 212 MET MET C . n 
C 1 168 GLU 168 213 213 GLU GLU C . n 
C 1 169 TYR 169 214 214 TYR TYR C . n 
C 1 170 LYS 170 215 215 LYS LYS C . n 
C 1 171 THR 171 216 216 THR THR C . n 
C 1 172 HIS 172 217 217 HIS HIS C . n 
C 1 173 THR 173 218 218 THR THR C . n 
C 1 174 ASP 174 219 219 ASP ASP C . n 
C 1 175 SER 175 220 220 SER SER C . n 
C 1 176 ILE 176 221 221 ILE ILE C . n 
C 1 177 LYS 177 222 222 LYS LYS C . n 
C 1 178 MET 178 223 223 MET MET C . n 
C 1 179 PRO 179 224 224 PRO PRO C . n 
C 1 180 GLY 180 225 ?   ?   ?   C . n 
C 1 181 ARG 181 226 ?   ?   ?   C . n 
C 1 182 LEU 182 227 ?   ?   ?   C . n 
C 1 183 GLY 183 228 ?   ?   ?   C . n 
C 1 184 PRO 184 229 ?   ?   ?   C . n 
C 1 185 GLN 185 230 ?   ?   ?   C . n 
C 1 186 ARG 186 231 ?   ?   ?   C . n 
C 1 187 LEU 187 232 ?   ?   ?   C . n 
C 1 188 LEU 188 233 ?   ?   ?   C . n 
C 1 189 PHE 189 234 ?   ?   ?   C . n 
D 2 1   GLY 1   46  ?   ?   ?   D . n 
D 2 2   PRO 2   47  ?   ?   ?   D . n 
D 2 3   HIS 3   48  ?   ?   ?   D . n 
D 2 4   MET 4   49  49  MET MET D . n 
D 2 5   THR 5   50  50  THR THR D . n 
D 2 6   ARG 6   51  51  ARG ARG D . n 
D 2 7   ILE 7   52  52  ILE ILE D . n 
D 2 8   ILE 8   53  53  ILE ILE D . n 
D 2 9   TYR 9   54  54  TYR TYR D . n 
D 2 10  ASP 10  55  55  ASP ASP D . n 
D 2 11  ARG 11  56  56  ARG ARG D . n 
D 2 12  LYS 12  57  57  LYS LYS D . n 
D 2 13  PHE 13  58  58  PHE PHE D . n 
D 2 14  LEU 14  59  59  LEU LEU D . n 
D 2 15  MET 15  60  60  MET MET D . n 
D 2 16  GLU 16  61  61  GLU GLU D . n 
D 2 17  CYS 17  62  62  CYS CYS D . n 
D 2 18  ARG 18  63  63  ARG ARG D . n 
D 2 19  ASN 19  64  64  ASN ASN D . n 
D 2 20  SER 20  65  65  SER SER D . n 
D 2 21  PRO 21  66  66  PRO PRO D . n 
D 2 22  VAL 22  67  67  VAL VAL D . n 
D 2 23  THR 23  68  68  THR THR D . n 
D 2 24  LYS 24  69  69  LYS LYS D . n 
D 2 25  THR 25  70  70  THR THR D . n 
D 2 26  PRO 26  71  71  PRO PRO D . n 
D 2 27  PRO 27  72  72  PRO PRO D . n 
D 2 28  ARG 28  73  73  ARG ARG D . n 
D 2 29  ASP 29  74  74  ASP ASP D . n 
D 2 30  LEU 30  75  75  LEU LEU D . n 
D 2 31  PRO 31  76  76  PRO PRO D . n 
D 2 32  THR 32  77  77  THR THR D . n 
D 2 33  ILE 33  78  78  ILE ILE D . n 
D 2 34  PRO 34  79  79  PRO PRO D . n 
D 2 35  GLY 35  80  80  GLY GLY D . n 
D 2 36  VAL 36  81  81  VAL VAL D . n 
D 2 37  THR 37  82  82  THR THR D . n 
D 2 38  SER 38  83  83  SER SER D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 FMT 1   301 5   FMT FMT A . 
F 3 FMT 1   301 1   FMT FMT C . 
G 3 FMT 1   302 2   FMT FMT C . 
H 3 FMT 1   303 3   FMT FMT C . 
I 3 FMT 1   304 4   FMT FMT C . 
J 3 FMT 1   305 6   FMT FMT C . 
K 3 FMT 1   306 7   FMT FMT C . 
L 4 HOH 1   401 61  HOH HOH A . 
L 4 HOH 2   402 12  HOH HOH A . 
L 4 HOH 3   403 35  HOH HOH A . 
L 4 HOH 4   404 122 HOH HOH A . 
L 4 HOH 5   405 178 HOH HOH A . 
L 4 HOH 6   406 100 HOH HOH A . 
L 4 HOH 7   407 145 HOH HOH A . 
L 4 HOH 8   408 30  HOH HOH A . 
L 4 HOH 9   409 45  HOH HOH A . 
L 4 HOH 10  410 152 HOH HOH A . 
L 4 HOH 11  411 78  HOH HOH A . 
L 4 HOH 12  412 202 HOH HOH A . 
L 4 HOH 13  413 18  HOH HOH A . 
L 4 HOH 14  414 83  HOH HOH A . 
L 4 HOH 15  415 87  HOH HOH A . 
L 4 HOH 16  416 201 HOH HOH A . 
L 4 HOH 17  417 48  HOH HOH A . 
L 4 HOH 18  418 58  HOH HOH A . 
L 4 HOH 19  419 4   HOH HOH A . 
L 4 HOH 20  420 76  HOH HOH A . 
L 4 HOH 21  421 194 HOH HOH A . 
L 4 HOH 22  422 162 HOH HOH A . 
L 4 HOH 23  423 157 HOH HOH A . 
L 4 HOH 24  424 197 HOH HOH A . 
L 4 HOH 25  425 153 HOH HOH A . 
L 4 HOH 26  426 203 HOH HOH A . 
L 4 HOH 27  427 46  HOH HOH A . 
L 4 HOH 28  428 68  HOH HOH A . 
L 4 HOH 29  429 29  HOH HOH A . 
L 4 HOH 30  430 108 HOH HOH A . 
L 4 HOH 31  431 113 HOH HOH A . 
L 4 HOH 32  432 183 HOH HOH A . 
L 4 HOH 33  433 120 HOH HOH A . 
L 4 HOH 34  434 6   HOH HOH A . 
L 4 HOH 35  435 97  HOH HOH A . 
L 4 HOH 36  436 140 HOH HOH A . 
L 4 HOH 37  437 107 HOH HOH A . 
L 4 HOH 38  438 103 HOH HOH A . 
L 4 HOH 39  439 213 HOH HOH A . 
L 4 HOH 40  440 9   HOH HOH A . 
L 4 HOH 41  441 195 HOH HOH A . 
L 4 HOH 42  442 168 HOH HOH A . 
L 4 HOH 43  443 110 HOH HOH A . 
L 4 HOH 44  444 114 HOH HOH A . 
L 4 HOH 45  445 31  HOH HOH A . 
L 4 HOH 46  446 47  HOH HOH A . 
L 4 HOH 47  447 150 HOH HOH A . 
L 4 HOH 48  448 8   HOH HOH A . 
L 4 HOH 49  449 179 HOH HOH A . 
L 4 HOH 50  450 88  HOH HOH A . 
L 4 HOH 51  451 105 HOH HOH A . 
L 4 HOH 52  452 51  HOH HOH A . 
L 4 HOH 53  453 28  HOH HOH A . 
L 4 HOH 54  454 86  HOH HOH A . 
L 4 HOH 55  455 123 HOH HOH A . 
L 4 HOH 56  456 11  HOH HOH A . 
L 4 HOH 57  457 147 HOH HOH A . 
L 4 HOH 58  458 109 HOH HOH A . 
L 4 HOH 59  459 189 HOH HOH A . 
L 4 HOH 60  460 92  HOH HOH A . 
L 4 HOH 61  461 111 HOH HOH A . 
L 4 HOH 62  462 220 HOH HOH A . 
L 4 HOH 63  463 22  HOH HOH A . 
L 4 HOH 64  464 128 HOH HOH A . 
L 4 HOH 65  465 216 HOH HOH A . 
L 4 HOH 66  466 215 HOH HOH A . 
L 4 HOH 67  467 55  HOH HOH A . 
L 4 HOH 68  468 118 HOH HOH A . 
L 4 HOH 69  469 34  HOH HOH A . 
L 4 HOH 70  470 138 HOH HOH A . 
L 4 HOH 71  471 164 HOH HOH A . 
L 4 HOH 72  472 187 HOH HOH A . 
L 4 HOH 73  473 204 HOH HOH A . 
L 4 HOH 74  474 106 HOH HOH A . 
L 4 HOH 75  475 130 HOH HOH A . 
L 4 HOH 76  476 129 HOH HOH A . 
L 4 HOH 77  477 161 HOH HOH A . 
L 4 HOH 78  478 219 HOH HOH A . 
L 4 HOH 79  479 212 HOH HOH A . 
L 4 HOH 80  480 80  HOH HOH A . 
L 4 HOH 81  481 184 HOH HOH A . 
L 4 HOH 82  482 104 HOH HOH A . 
L 4 HOH 83  483 119 HOH HOH A . 
L 4 HOH 84  484 182 HOH HOH A . 
L 4 HOH 85  485 149 HOH HOH A . 
L 4 HOH 86  486 176 HOH HOH A . 
M 4 HOH 1   101 74  HOH HOH B . 
M 4 HOH 2   102 171 HOH HOH B . 
M 4 HOH 3   103 144 HOH HOH B . 
M 4 HOH 4   104 148 HOH HOH B . 
M 4 HOH 5   105 77  HOH HOH B . 
M 4 HOH 6   106 36  HOH HOH B . 
M 4 HOH 7   107 117 HOH HOH B . 
M 4 HOH 8   108 169 HOH HOH B . 
M 4 HOH 9   109 37  HOH HOH B . 
M 4 HOH 10  110 143 HOH HOH B . 
M 4 HOH 11  111 56  HOH HOH B . 
M 4 HOH 12  112 198 HOH HOH B . 
M 4 HOH 13  113 190 HOH HOH B . 
M 4 HOH 14  114 126 HOH HOH B . 
N 4 HOH 1   401 209 HOH HOH C . 
N 4 HOH 2   402 44  HOH HOH C . 
N 4 HOH 3   403 81  HOH HOH C . 
N 4 HOH 4   404 71  HOH HOH C . 
N 4 HOH 5   405 40  HOH HOH C . 
N 4 HOH 6   406 156 HOH HOH C . 
N 4 HOH 7   407 50  HOH HOH C . 
N 4 HOH 8   408 27  HOH HOH C . 
N 4 HOH 9   409 112 HOH HOH C . 
N 4 HOH 10  410 24  HOH HOH C . 
N 4 HOH 11  411 25  HOH HOH C . 
N 4 HOH 12  412 84  HOH HOH C . 
N 4 HOH 13  413 1   HOH HOH C . 
N 4 HOH 14  414 54  HOH HOH C . 
N 4 HOH 15  415 23  HOH HOH C . 
N 4 HOH 16  416 3   HOH HOH C . 
N 4 HOH 17  417 82  HOH HOH C . 
N 4 HOH 18  418 211 HOH HOH C . 
N 4 HOH 19  419 69  HOH HOH C . 
N 4 HOH 20  420 32  HOH HOH C . 
N 4 HOH 21  421 146 HOH HOH C . 
N 4 HOH 22  422 167 HOH HOH C . 
N 4 HOH 23  423 67  HOH HOH C . 
N 4 HOH 24  424 5   HOH HOH C . 
N 4 HOH 25  425 41  HOH HOH C . 
N 4 HOH 26  426 62  HOH HOH C . 
N 4 HOH 27  427 163 HOH HOH C . 
N 4 HOH 28  428 98  HOH HOH C . 
N 4 HOH 29  429 15  HOH HOH C . 
N 4 HOH 30  430 13  HOH HOH C . 
N 4 HOH 31  431 141 HOH HOH C . 
N 4 HOH 32  432 79  HOH HOH C . 
N 4 HOH 33  433 93  HOH HOH C . 
N 4 HOH 34  434 75  HOH HOH C . 
N 4 HOH 35  435 38  HOH HOH C . 
N 4 HOH 36  436 60  HOH HOH C . 
N 4 HOH 37  437 39  HOH HOH C . 
N 4 HOH 38  438 66  HOH HOH C . 
N 4 HOH 39  439 90  HOH HOH C . 
N 4 HOH 40  440 205 HOH HOH C . 
N 4 HOH 41  441 70  HOH HOH C . 
N 4 HOH 42  442 158 HOH HOH C . 
N 4 HOH 43  443 172 HOH HOH C . 
N 4 HOH 44  444 218 HOH HOH C . 
N 4 HOH 45  445 160 HOH HOH C . 
N 4 HOH 46  446 102 HOH HOH C . 
N 4 HOH 47  447 19  HOH HOH C . 
N 4 HOH 48  448 142 HOH HOH C . 
N 4 HOH 49  449 200 HOH HOH C . 
N 4 HOH 50  450 136 HOH HOH C . 
N 4 HOH 51  451 191 HOH HOH C . 
N 4 HOH 52  452 42  HOH HOH C . 
N 4 HOH 53  453 177 HOH HOH C . 
N 4 HOH 54  454 7   HOH HOH C . 
N 4 HOH 55  455 133 HOH HOH C . 
N 4 HOH 56  456 206 HOH HOH C . 
N 4 HOH 57  457 2   HOH HOH C . 
N 4 HOH 58  458 65  HOH HOH C . 
N 4 HOH 59  459 116 HOH HOH C . 
N 4 HOH 60  460 17  HOH HOH C . 
N 4 HOH 61  461 155 HOH HOH C . 
N 4 HOH 62  462 49  HOH HOH C . 
N 4 HOH 63  463 16  HOH HOH C . 
N 4 HOH 64  464 134 HOH HOH C . 
N 4 HOH 65  465 217 HOH HOH C . 
N 4 HOH 66  466 53  HOH HOH C . 
N 4 HOH 67  467 186 HOH HOH C . 
N 4 HOH 68  468 175 HOH HOH C . 
N 4 HOH 69  469 214 HOH HOH C . 
N 4 HOH 70  470 26  HOH HOH C . 
N 4 HOH 71  471 85  HOH HOH C . 
N 4 HOH 72  472 139 HOH HOH C . 
N 4 HOH 73  473 99  HOH HOH C . 
N 4 HOH 74  474 115 HOH HOH C . 
N 4 HOH 75  475 132 HOH HOH C . 
N 4 HOH 76  476 91  HOH HOH C . 
N 4 HOH 77  477 185 HOH HOH C . 
N 4 HOH 78  478 159 HOH HOH C . 
N 4 HOH 79  479 52  HOH HOH C . 
N 4 HOH 80  480 33  HOH HOH C . 
N 4 HOH 81  481 170 HOH HOH C . 
N 4 HOH 82  482 21  HOH HOH C . 
N 4 HOH 83  483 96  HOH HOH C . 
N 4 HOH 84  484 165 HOH HOH C . 
N 4 HOH 85  485 59  HOH HOH C . 
N 4 HOH 86  486 73  HOH HOH C . 
N 4 HOH 87  487 173 HOH HOH C . 
N 4 HOH 88  488 207 HOH HOH C . 
N 4 HOH 89  489 43  HOH HOH C . 
N 4 HOH 90  490 135 HOH HOH C . 
N 4 HOH 91  491 72  HOH HOH C . 
N 4 HOH 92  492 196 HOH HOH C . 
N 4 HOH 93  493 124 HOH HOH C . 
N 4 HOH 94  494 151 HOH HOH C . 
N 4 HOH 95  495 166 HOH HOH C . 
N 4 HOH 96  496 10  HOH HOH C . 
N 4 HOH 97  497 95  HOH HOH C . 
N 4 HOH 98  498 174 HOH HOH C . 
N 4 HOH 99  499 221 HOH HOH C . 
N 4 HOH 100 500 57  HOH HOH C . 
N 4 HOH 101 501 121 HOH HOH C . 
N 4 HOH 102 502 181 HOH HOH C . 
N 4 HOH 103 503 208 HOH HOH C . 
N 4 HOH 104 504 193 HOH HOH C . 
N 4 HOH 105 505 137 HOH HOH C . 
N 4 HOH 106 506 125 HOH HOH C . 
N 4 HOH 107 507 63  HOH HOH C . 
N 4 HOH 108 508 89  HOH HOH C . 
N 4 HOH 109 509 188 HOH HOH C . 
N 4 HOH 110 510 131 HOH HOH C . 
N 4 HOH 111 511 199 HOH HOH C . 
N 4 HOH 112 512 180 HOH HOH C . 
N 4 HOH 113 513 210 HOH HOH C . 
O 4 HOH 1   101 20  HOH HOH D . 
O 4 HOH 2   102 101 HOH HOH D . 
O 4 HOH 3   103 14  HOH HOH D . 
O 4 HOH 4   104 154 HOH HOH D . 
O 4 HOH 5   105 94  HOH HOH D . 
O 4 HOH 6   106 64  HOH HOH D . 
O 4 HOH 7   107 127 HOH HOH D . 
O 4 HOH 8   108 192 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA dimeric 2 
2 software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,L,M           
2 1 C,D,F,G,H,I,J,K,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2740  ? 
1 MORE         -14   ? 
1 'SSA (A^2)'  10800 ? 
2 'ABSA (A^2)' 3670  ? 
2 MORE         -15   ? 
2 'SSA (A^2)'  11210 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-07-26 
2 'Structure model' 1 1 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Source and taxonomy' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            entity_src_gen 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
2 2 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
3 2 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HH22 B ARG 73  ? ? O C GLN 159 ? ? 1.58 
2  1 O    C HOH 447 ? ? O C HOH 475 ? ? 2.02 
3  1 O    A HOH 467 ? ? O A HOH 476 ? ? 2.05 
4  1 O    A HOH 450 ? ? O A HOH 480 ? ? 2.08 
5  1 O    A HOH 466 ? ? O A HOH 479 ? ? 2.10 
6  1 OE2  B GLU 61  ? ? O B HOH 101 ? ? 2.10 
7  1 O    C HOH 494 ? ? O C HOH 498 ? ? 2.15 
8  1 OD1  D ASP 55  ? ? O D HOH 101 ? ? 2.17 
9  1 OD2  C ASP 178 ? ? O C HOH 401 ? ? 2.18 
10 1 OD1  C ASN 209 ? ? O C HOH 402 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A GLN 159 ? ? 1_555 HH12 D ARG 73 ? ? 1_556 1.52 
2 1 OD1 A ASN 131 ? ? 1_555 ND2  B ASN 64 ? ? 2_647 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 174 ? ? -123.47 -169.87 
2 1 ASN A 205 ? ? -104.75 47.03   
3 1 VAL B 81  ? ? -123.14 -65.05  
4 1 VAL D 81  ? ? -129.17 -65.27  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ARG 67  ? A ARG 22  
2  1 Y 1 A THR 68  ? A THR 23  
3  1 Y 1 A PRO 69  ? A PRO 24  
4  1 Y 1 A GLY 70  ? A GLY 25  
5  1 Y 1 A ARG 71  ? A ARG 26  
6  1 Y 1 A PRO 72  ? A PRO 27  
7  1 Y 1 A THR 73  ? A THR 28  
8  1 Y 1 A SER 74  ? A SER 29  
9  1 Y 1 A SER 75  ? A SER 30  
10 1 Y 1 A GLN 76  ? A GLN 31  
11 1 Y 1 A SER 77  ? A SER 32  
12 1 Y 1 A TYR 78  ? A TYR 33  
13 1 Y 1 A GLU 79  ? A GLU 34  
14 1 Y 1 A GLN 80  ? A GLN 35  
15 1 Y 1 A GLY 225 ? A GLY 180 
16 1 Y 1 A ARG 226 ? A ARG 181 
17 1 Y 1 A LEU 227 ? A LEU 182 
18 1 Y 1 A GLY 228 ? A GLY 183 
19 1 Y 1 A PRO 229 ? A PRO 184 
20 1 Y 1 A GLN 230 ? A GLN 185 
21 1 Y 1 A ARG 231 ? A ARG 186 
22 1 Y 1 A LEU 232 ? A LEU 187 
23 1 Y 1 A LEU 233 ? A LEU 188 
24 1 Y 1 A PHE 234 ? A PHE 189 
25 1 Y 1 B GLY 46  ? B GLY 1   
26 1 Y 1 B PRO 47  ? B PRO 2   
27 1 Y 1 B HIS 48  ? B HIS 3   
28 1 Y 1 B MET 49  ? B MET 4   
29 1 Y 1 C THR 68  ? C THR 23  
30 1 Y 1 C PRO 69  ? C PRO 24  
31 1 Y 1 C GLY 70  ? C GLY 25  
32 1 Y 1 C ARG 71  ? C ARG 26  
33 1 Y 1 C PRO 72  ? C PRO 27  
34 1 Y 1 C THR 73  ? C THR 28  
35 1 Y 1 C SER 74  ? C SER 29  
36 1 Y 1 C SER 75  ? C SER 30  
37 1 Y 1 C GLN 76  ? C GLN 31  
38 1 Y 1 C SER 77  ? C SER 32  
39 1 Y 1 C TYR 78  ? C TYR 33  
40 1 Y 1 C GLU 79  ? C GLU 34  
41 1 Y 1 C GLN 80  ? C GLN 35  
42 1 Y 1 C GLY 225 ? C GLY 180 
43 1 Y 1 C ARG 226 ? C ARG 181 
44 1 Y 1 C LEU 227 ? C LEU 182 
45 1 Y 1 C GLY 228 ? C GLY 183 
46 1 Y 1 C PRO 229 ? C PRO 184 
47 1 Y 1 C GLN 230 ? C GLN 185 
48 1 Y 1 C ARG 231 ? C ARG 186 
49 1 Y 1 C LEU 232 ? C LEU 187 
50 1 Y 1 C LEU 233 ? C LEU 188 
51 1 Y 1 C PHE 234 ? C PHE 189 
52 1 Y 1 D GLY 46  ? D GLY 1   
53 1 Y 1 D PRO 47  ? D PRO 2   
54 1 Y 1 D HIS 48  ? D HIS 3   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'FORMIC ACID' FMT 
4 water         HOH 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 none ? 
2 2 none ? 
#