data_5TK5
# 
_entry.id   5TK5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TK5         
WWPDB D_1000224381 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TK5 
_pdbx_database_status.recvd_initial_deposition_date   2016-10-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pidugu, L.S.' 1 
'Toth, E.A.'   2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr D Struct Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2059-7983 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            73 
_citation.language                  ? 
_citation.page_first                340 
_citation.page_last                 348 
_citation.title                     
'Crystal structures of human 3-hydroxyanthranilate 3,4-dioxygenase with native and non-native metals bound in the active site.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2059798317002029 
_citation.pdbx_database_id_PubMed   28375145 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pidugu, L.S.'  1 ? 
primary 'Neu, H.'       2 ? 
primary 'Wong, T.L.'    3 ? 
primary 'Pozharski, E.' 4 ? 
primary 'Molloy, J.L.'  5 ? 
primary 'Michel, S.L.'  6 ? 
primary 'Toth, E.A.'    7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5TK5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     57.076 
_cell.length_a_esd                 ? 
_cell.length_b                     57.076 
_cell.length_b_esd                 ? 
_cell.length_c                     415.871 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5TK5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '3-hydroxyanthranilate 3,4-dioxygenase' 32892.379 1   1.13.11.6 ? ? ? 
2 non-polymer syn 'FE (III) ION'                          55.845    1   ?         ? ? ? 
3 non-polymer syn 'SULFATE ION'                           96.063    3   ?         ? ? ? 
4 water       nat water                                   18.015    173 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '3-hydroxyanthranilate oxygenase,3-HAO,3-hydroxyanthranilic acid dioxygenase,HAD' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPGSMERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVV
IRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRT
GKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGS
SVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPGSMERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVV
IRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRT
GKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGS
SVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   SER n 
1 5   MET n 
1 6   GLU n 
1 7   ARG n 
1 8   ARG n 
1 9   LEU n 
1 10  GLY n 
1 11  VAL n 
1 12  ARG n 
1 13  ALA n 
1 14  TRP n 
1 15  VAL n 
1 16  LYS n 
1 17  GLU n 
1 18  ASN n 
1 19  ARG n 
1 20  GLY n 
1 21  SER n 
1 22  PHE n 
1 23  GLN n 
1 24  PRO n 
1 25  PRO n 
1 26  VAL n 
1 27  CYS n 
1 28  ASN n 
1 29  LYS n 
1 30  LEU n 
1 31  MET n 
1 32  HIS n 
1 33  GLN n 
1 34  GLU n 
1 35  GLN n 
1 36  LEU n 
1 37  LYS n 
1 38  VAL n 
1 39  MET n 
1 40  PHE n 
1 41  ILE n 
1 42  GLY n 
1 43  GLY n 
1 44  PRO n 
1 45  ASN n 
1 46  THR n 
1 47  ARG n 
1 48  LYS n 
1 49  ASP n 
1 50  TYR n 
1 51  HIS n 
1 52  ILE n 
1 53  GLU n 
1 54  GLU n 
1 55  GLY n 
1 56  GLU n 
1 57  GLU n 
1 58  VAL n 
1 59  PHE n 
1 60  TYR n 
1 61  GLN n 
1 62  LEU n 
1 63  GLU n 
1 64  GLY n 
1 65  ASP n 
1 66  MET n 
1 67  VAL n 
1 68  LEU n 
1 69  ARG n 
1 70  VAL n 
1 71  LEU n 
1 72  GLU n 
1 73  GLN n 
1 74  GLY n 
1 75  LYS n 
1 76  HIS n 
1 77  ARG n 
1 78  ASP n 
1 79  VAL n 
1 80  VAL n 
1 81  ILE n 
1 82  ARG n 
1 83  GLN n 
1 84  GLY n 
1 85  GLU n 
1 86  ILE n 
1 87  PHE n 
1 88  LEU n 
1 89  LEU n 
1 90  PRO n 
1 91  ALA n 
1 92  ARG n 
1 93  VAL n 
1 94  PRO n 
1 95  HIS n 
1 96  SER n 
1 97  PRO n 
1 98  GLN n 
1 99  ARG n 
1 100 PHE n 
1 101 ALA n 
1 102 ASN n 
1 103 THR n 
1 104 VAL n 
1 105 GLY n 
1 106 LEU n 
1 107 VAL n 
1 108 VAL n 
1 109 GLU n 
1 110 ARG n 
1 111 ARG n 
1 112 ARG n 
1 113 LEU n 
1 114 GLU n 
1 115 THR n 
1 116 GLU n 
1 117 LEU n 
1 118 ASP n 
1 119 GLY n 
1 120 LEU n 
1 121 ARG n 
1 122 TYR n 
1 123 TYR n 
1 124 VAL n 
1 125 GLY n 
1 126 ASP n 
1 127 THR n 
1 128 MET n 
1 129 ASP n 
1 130 VAL n 
1 131 LEU n 
1 132 PHE n 
1 133 GLU n 
1 134 LYS n 
1 135 TRP n 
1 136 PHE n 
1 137 TYR n 
1 138 CYS n 
1 139 LYS n 
1 140 ASP n 
1 141 LEU n 
1 142 GLY n 
1 143 THR n 
1 144 GLN n 
1 145 LEU n 
1 146 ALA n 
1 147 PRO n 
1 148 ILE n 
1 149 ILE n 
1 150 GLN n 
1 151 GLU n 
1 152 PHE n 
1 153 PHE n 
1 154 SER n 
1 155 SER n 
1 156 GLU n 
1 157 GLN n 
1 158 TYR n 
1 159 ARG n 
1 160 THR n 
1 161 GLY n 
1 162 LYS n 
1 163 PRO n 
1 164 ILE n 
1 165 PRO n 
1 166 ASP n 
1 167 GLN n 
1 168 LEU n 
1 169 LEU n 
1 170 LYS n 
1 171 GLU n 
1 172 PRO n 
1 173 PRO n 
1 174 PHE n 
1 175 PRO n 
1 176 LEU n 
1 177 SER n 
1 178 THR n 
1 179 ARG n 
1 180 SER n 
1 181 ILE n 
1 182 MET n 
1 183 GLU n 
1 184 PRO n 
1 185 MET n 
1 186 SER n 
1 187 LEU n 
1 188 ASP n 
1 189 ALA n 
1 190 TRP n 
1 191 LEU n 
1 192 ASP n 
1 193 SER n 
1 194 HIS n 
1 195 HIS n 
1 196 ARG n 
1 197 GLU n 
1 198 LEU n 
1 199 GLN n 
1 200 ALA n 
1 201 GLY n 
1 202 THR n 
1 203 PRO n 
1 204 LEU n 
1 205 SER n 
1 206 LEU n 
1 207 PHE n 
1 208 GLY n 
1 209 ASP n 
1 210 THR n 
1 211 TYR n 
1 212 GLU n 
1 213 THR n 
1 214 GLN n 
1 215 VAL n 
1 216 ILE n 
1 217 ALA n 
1 218 TYR n 
1 219 GLY n 
1 220 GLN n 
1 221 GLY n 
1 222 SER n 
1 223 SER n 
1 224 GLU n 
1 225 GLY n 
1 226 LEU n 
1 227 ARG n 
1 228 GLN n 
1 229 ASN n 
1 230 VAL n 
1 231 ASP n 
1 232 VAL n 
1 233 TRP n 
1 234 LEU n 
1 235 TRP n 
1 236 GLN n 
1 237 LEU n 
1 238 GLU n 
1 239 GLY n 
1 240 SER n 
1 241 SER n 
1 242 VAL n 
1 243 VAL n 
1 244 THR n 
1 245 MET n 
1 246 GLY n 
1 247 GLY n 
1 248 ARG n 
1 249 ARG n 
1 250 LEU n 
1 251 SER n 
1 252 LEU n 
1 253 ALA n 
1 254 PRO n 
1 255 ASP n 
1 256 ASP n 
1 257 SER n 
1 258 LEU n 
1 259 LEU n 
1 260 VAL n 
1 261 LEU n 
1 262 ALA n 
1 263 GLY n 
1 264 THR n 
1 265 SER n 
1 266 TYR n 
1 267 ALA n 
1 268 TRP n 
1 269 GLU n 
1 270 ARG n 
1 271 THR n 
1 272 GLN n 
1 273 GLY n 
1 274 SER n 
1 275 VAL n 
1 276 ALA n 
1 277 LEU n 
1 278 SER n 
1 279 VAL n 
1 280 THR n 
1 281 GLN n 
1 282 ASP n 
1 283 PRO n 
1 284 ALA n 
1 285 CYS n 
1 286 LYS n 
1 287 LYS n 
1 288 PRO n 
1 289 LEU n 
1 290 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   290 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HAAO 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pVP16 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    3HAO_HUMAN 
_struct_ref.pdbx_db_accession          P46952 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVVIRQG
EIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRTGKPI
PDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVT
MGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5TK5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 290 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P46952 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  286 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       286 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5TK5 GLY A 1 ? UNP P46952 ? ? 'expression tag' -3 1 
1 5TK5 PRO A 2 ? UNP P46952 ? ? 'expression tag' -2 2 
1 5TK5 GLY A 3 ? UNP P46952 ? ? 'expression tag' -1 3 
1 5TK5 SER A 4 ? UNP P46952 ? ? 'expression tag' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TK5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.97 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.62 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES pH 7.5, 2% PEG 400, and 2.0 M ammonium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5498 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5498 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            19.87 
_reflns.entry_id                         5TK5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.88 
_reflns.d_resolution_low                 38.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       34383 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  32.9 
_reflns.pdbx_Rmerge_I_obs                0.478 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.88 
_reflns_shell.d_res_low                   1.92 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        87.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             15.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.7935 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.7935 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -1.5870 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               20.66 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.9120 
_refine.correlation_coeff_Fo_to_Fc_free          0.8913 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5TK5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.88 
_refine.ls_d_res_low                             38.00 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     34135 
_refine.ls_number_reflns_R_free                  1696 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.05 
_refine.ls_percent_reflns_R_free                 4.97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2034 
_refine.ls_R_factor_R_free                       0.2177 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2027 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2QNK 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.109 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.114 
_refine.pdbx_overall_SU_R_Blow_DPI               0.129 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.120 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5TK5 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.238 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        2225 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             173 
_refine_hist.number_atoms_total               2414 
_refine_hist.d_res_high                       1.88 
_refine_hist.d_res_low                        38.00 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 2294 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.09  ? 3121 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 786  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 53   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 337  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 2294 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 0    ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 3.80  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 15.85 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 285  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 2629 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.88 
_refine_ls_shell.d_res_low                        1.94 
_refine_ls_shell.number_reflns_all                2600 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             139 
_refine_ls_shell.number_reflns_R_work             2461 
_refine_ls_shell.percent_reflns_obs               88.93 
_refine_ls_shell.percent_reflns_R_free            5.35 
_refine_ls_shell.R_factor_all                     0.2045 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2420 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2026 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   17 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5TK5 
_struct.title                        'Crystal structure of human 3HAO with iron bound in the active site' 
_struct.pdbx_descriptor              '3-hydroxyanthranilate 3,4-dioxygenase (E.C.1.13.11.6)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TK5 
_struct_keywords.text            '3-hydroxyanthranilate oxygenase dioxygenase, cupin kynurenine pathway, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 VAL A 11  ? ASN A 18  ? VAL A 7   ASN A 14  1 ? 8  
HELX_P HELX_P2 AA2 ARG A 19  ? GLN A 23  ? ARG A 15  GLN A 19  5 ? 5  
HELX_P HELX_P3 AA3 ASP A 140 ? SER A 154 ? ASP A 136 SER A 150 1 ? 15 
HELX_P HELX_P4 AA4 SER A 155 ? GLY A 161 ? SER A 151 GLY A 157 1 ? 7  
HELX_P HELX_P5 AA5 ILE A 164 ? LEU A 168 ? ILE A 160 LEU A 164 5 ? 5  
HELX_P HELX_P6 AA6 LEU A 187 ? HIS A 194 ? LEU A 183 HIS A 190 1 ? 8  
HELX_P HELX_P7 AA7 HIS A 194 ? ALA A 200 ? HIS A 190 ALA A 196 1 ? 7  
HELX_P HELX_P8 AA8 ASP A 282 ? LYS A 286 ? ASP A 278 LYS A 282 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 51 ND1 ? ? ? 1_555 B FE  . FE ? ? A HIS 47  A FE  301 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc2 metalc ? ? A GLU 57 OE1 ? ? ? 1_555 B FE  . FE ? ? A GLU 53  A FE  301 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc3 metalc ? ? A GLU 57 OE2 ? ? ? 1_555 B FE  . FE ? ? A GLU 53  A FE  301 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc4 metalc ? ? A HIS 95 NE2 ? ? ? 1_555 B FE  . FE ? ? A HIS 91  A FE  301 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc5 metalc ? ? B FE  .  FE  ? ? ? 1_555 F HOH . O  ? ? A FE  301 A HOH 448 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc6 metalc ? ? B FE  .  FE  ? ? ? 1_555 F HOH . O  ? ? A FE  301 A HOH 527 1_555 ? ? ? ? ? ? ? 2.094 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 24 A . ? PRO 20 A PRO 25 A ? PRO 21 A 1 9.42  
2 GLY 43 A . ? GLY 39 A PRO 44 A ? PRO 40 A 1 -0.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 9   ? GLY A 10  ? LEU A 5   GLY A 6   
AA1 2 ASP A 256 ? VAL A 260 ? ASP A 252 VAL A 256 
AA1 3 VAL A 232 ? GLU A 238 ? VAL A 228 GLU A 234 
AA1 4 VAL A 275 ? THR A 280 ? VAL A 271 THR A 276 
AA1 5 GLN A 214 ? TYR A 218 ? GLN A 210 TYR A 214 
AA1 6 LEU A 204 ? SER A 205 ? LEU A 200 SER A 201 
AA2 1 ASN A 28  ? GLN A 33  ? ASN A 24  GLN A 29  
AA2 2 LEU A 36  ? ILE A 41  ? LEU A 32  ILE A 37  
AA2 3 VAL A 104 ? ARG A 110 ? VAL A 100 ARG A 106 
AA2 4 GLU A 57  ? GLU A 63  ? GLU A 53  GLU A 59  
AA2 5 GLU A 85  ? LEU A 89  ? GLU A 81  LEU A 85  
AA2 6 MET A 185 ? SER A 186 ? MET A 181 SER A 182 
AA3 1 TYR A 50  ? ILE A 52  ? TYR A 46  ILE A 48  
AA3 2 ASP A 118 ? TYR A 123 ? ASP A 114 TYR A 119 
AA3 3 VAL A 130 ? PHE A 136 ? VAL A 126 PHE A 132 
AA4 1 LYS A 75  ? ILE A 81  ? LYS A 71  ILE A 77  
AA4 2 MET A 66  ? GLU A 72  ? MET A 62  GLU A 68  
AA4 3 HIS A 95  ? GLN A 98  ? HIS A 91  GLN A 94  
AA5 1 GLY A 221 ? GLY A 225 ? GLY A 217 GLY A 221 
AA5 2 TYR A 266 ? ARG A 270 ? TYR A 262 ARG A 266 
AA5 3 SER A 241 ? MET A 245 ? SER A 237 MET A 241 
AA5 4 ARG A 248 ? LEU A 252 ? ARG A 244 LEU A 248 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 9   ? N LEU A 5   O SER A 257 ? O SER A 253 
AA1 2 3 O VAL A 260 ? O VAL A 256 N VAL A 232 ? N VAL A 228 
AA1 3 4 N TRP A 235 ? N TRP A 231 O LEU A 277 ? O LEU A 273 
AA1 4 5 O THR A 280 ? O THR A 276 N GLN A 214 ? N GLN A 210 
AA1 5 6 O ALA A 217 ? O ALA A 213 N LEU A 204 ? N LEU A 200 
AA2 1 2 N MET A 31  ? N MET A 27  O VAL A 38  ? O VAL A 34  
AA2 2 3 N LYS A 37  ? N LYS A 33  O GLU A 109 ? O GLU A 105 
AA2 3 4 O LEU A 106 ? O LEU A 102 N TYR A 60  ? N TYR A 56  
AA2 4 5 N PHE A 59  ? N PHE A 55  O PHE A 87  ? O PHE A 83  
AA2 5 6 N ILE A 86  ? N ILE A 82  O MET A 185 ? O MET A 181 
AA3 1 2 N TYR A 50  ? N TYR A 46  O ARG A 121 ? O ARG A 117 
AA3 2 3 N ASP A 118 ? N ASP A 114 O PHE A 136 ? O PHE A 132 
AA4 1 2 O VAL A 79  ? O VAL A 75  N LEU A 68  ? N LEU A 64  
AA4 2 3 N VAL A 67  ? N VAL A 63  O GLN A 98  ? O GLN A 94  
AA5 1 2 N GLY A 221 ? N GLY A 217 O ARG A 270 ? O ARG A 266 
AA5 2 3 O ALA A 267 ? O ALA A 263 N THR A 244 ? N THR A 240 
AA5 3 4 N VAL A 243 ? N VAL A 239 O LEU A 250 ? O LEU A 246 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FE  301 ? 5 'binding site for residue FE A 301'  
AC2 Software A SO4 302 ? 6 'binding site for residue SO4 A 302' 
AC3 Software A SO4 303 ? 2 'binding site for residue SO4 A 303' 
AC4 Software A SO4 304 ? 2 'binding site for residue SO4 A 304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 51  ? HIS A 47  . ? 1_555 ? 
2  AC1 5 GLU A 57  ? GLU A 53  . ? 1_555 ? 
3  AC1 5 HIS A 95  ? HIS A 91  . ? 1_555 ? 
4  AC1 5 HOH F .   ? HOH A 448 . ? 1_555 ? 
5  AC1 5 HOH F .   ? HOH A 527 . ? 1_555 ? 
6  AC2 6 ARG A 92  ? ARG A 88  . ? 1_555 ? 
7  AC2 6 SER A 177 ? SER A 173 . ? 1_555 ? 
8  AC2 6 THR A 178 ? THR A 174 . ? 1_555 ? 
9  AC2 6 ARG A 179 ? ARG A 175 . ? 1_555 ? 
10 AC2 6 HOH F .   ? HOH A 438 . ? 1_555 ? 
11 AC2 6 HOH F .   ? HOH A 446 . ? 1_555 ? 
12 AC3 2 ARG A 179 ? ARG A 175 . ? 1_555 ? 
13 AC3 2 SER A 180 ? SER A 176 . ? 1_555 ? 
14 AC4 2 ARG A 7   ? ARG A 3   . ? 1_555 ? 
15 AC4 2 ARG A 8   ? ARG A 4   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5TK5 
_atom_sites.fract_transf_matrix[1][1]   0.017520 
_atom_sites.fract_transf_matrix[1][2]   0.010115 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020231 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002405 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 7   ? 6.930  0.050   22.269  1.00 37.11  ? 3   ARG A N   1 
ATOM   2    C  CA  . ARG A 1 7   ? 8.278  -0.015  21.723  1.00 36.19  ? 3   ARG A CA  1 
ATOM   3    C  C   . ARG A 1 7   ? 9.251  -0.815  22.603  1.00 34.17  ? 3   ARG A C   1 
ATOM   4    O  O   . ARG A 1 7   ? 10.135 -1.447  22.048  1.00 32.35  ? 3   ARG A O   1 
ATOM   5    C  CB  . ARG A 1 7   ? 8.835  1.381   21.391  1.00 39.88  ? 3   ARG A CB  1 
ATOM   6    N  N   . ARG A 1 8   ? 9.103  -0.824  23.945  1.00 27.80  ? 4   ARG A N   1 
ATOM   7    C  CA  . ARG A 1 8   ? 10.000 -1.641  24.761  1.00 25.81  ? 4   ARG A CA  1 
ATOM   8    C  C   . ARG A 1 8   ? 9.582  -3.111  24.615  1.00 28.40  ? 4   ARG A C   1 
ATOM   9    O  O   . ARG A 1 8   ? 8.390  -3.417  24.670  1.00 30.04  ? 4   ARG A O   1 
ATOM   10   C  CB  . ARG A 1 8   ? 9.965  -1.232  26.246  1.00 23.40  ? 4   ARG A CB  1 
ATOM   11   C  CG  . ARG A 1 8   ? 10.437 0.201   26.507  1.00 27.77  ? 4   ARG A CG  1 
ATOM   12   C  CD  . ARG A 1 8   ? 10.012 0.667   27.891  1.00 34.69  ? 4   ARG A CD  1 
ATOM   13   N  NE  . ARG A 1 8   ? 8.605  1.071   27.937  1.00 37.37  ? 4   ARG A NE  1 
ATOM   14   C  CZ  . ARG A 1 8   ? 7.853  1.079   29.037  1.00 58.64  ? 4   ARG A CZ  1 
ATOM   15   N  NH1 . ARG A 1 8   ? 8.363  0.692   30.205  1.00 36.81  ? 4   ARG A NH1 1 
ATOM   16   N  NH2 . ARG A 1 8   ? 6.584  1.458   28.979  1.00 55.01  ? 4   ARG A NH2 1 
ATOM   17   N  N   . LEU A 1 9   ? 10.547 -4.009  24.391  1.00 20.10  ? 5   LEU A N   1 
ATOM   18   C  CA  . LEU A 1 9   ? 10.258 -5.438  24.308  1.00 17.60  ? 5   LEU A CA  1 
ATOM   19   C  C   . LEU A 1 9   ? 11.057 -6.194  25.354  1.00 18.20  ? 5   LEU A C   1 
ATOM   20   O  O   . LEU A 1 9   ? 12.283 -6.189  25.300  1.00 18.57  ? 5   LEU A O   1 
ATOM   21   C  CB  . LEU A 1 9   ? 10.547 -6.009  22.888  1.00 16.90  ? 5   LEU A CB  1 
ATOM   22   C  CG  . LEU A 1 9   ? 9.659  -5.481  21.732  1.00 21.33  ? 5   LEU A CG  1 
ATOM   23   C  CD1 . LEU A 1 9   ? 10.100 -6.082  20.362  1.00 20.24  ? 5   LEU A CD1 1 
ATOM   24   C  CD2 . LEU A 1 9   ? 8.170  -5.816  21.961  1.00 23.88  ? 5   LEU A CD2 1 
ATOM   25   N  N   . GLY A 1 10  ? 10.374 -6.855  26.289  1.00 15.27  ? 6   GLY A N   1 
ATOM   26   C  CA  . GLY A 1 10  ? 11.025 -7.733  27.262  1.00 14.48  ? 6   GLY A CA  1 
ATOM   27   C  C   . GLY A 1 10  ? 11.510 -8.916  26.437  1.00 18.27  ? 6   GLY A C   1 
ATOM   28   O  O   . GLY A 1 10  ? 10.707 -9.544  25.737  1.00 18.09  ? 6   GLY A O   1 
ATOM   29   N  N   . VAL A 1 11  ? 12.827 -9.161  26.408  1.00 13.64  ? 7   VAL A N   1 
ATOM   30   C  CA  . VAL A 1 11  ? 13.390 -10.180 25.492  1.00 13.49  ? 7   VAL A CA  1 
ATOM   31   C  C   . VAL A 1 11  ? 12.817 -11.582 25.743  1.00 14.70  ? 7   VAL A C   1 
ATOM   32   O  O   . VAL A 1 11  ? 12.326 -12.179 24.794  1.00 12.28  ? 7   VAL A O   1 
ATOM   33   C  CB  . VAL A 1 11  ? 14.950 -10.164 25.439  1.00 16.66  ? 7   VAL A CB  1 
ATOM   34   C  CG1 . VAL A 1 11  ? 15.502 -11.325 24.612  1.00 17.14  ? 7   VAL A CG1 1 
ATOM   35   C  CG2 . VAL A 1 11  ? 15.446 -8.848  24.868  1.00 15.88  ? 7   VAL A CG2 1 
ATOM   36   N  N   . ARG A 1 12  ? 12.868 -12.113 26.980  1.00 13.38  ? 8   ARG A N   1 
ATOM   37   C  CA  A ARG A 1 12  ? 12.324 -13.447 27.246  0.50 13.55  ? 8   ARG A CA  1 
ATOM   38   C  CA  B ARG A 1 12  ? 12.336 -13.451 27.231  0.50 13.26  ? 8   ARG A CA  1 
ATOM   39   C  C   . ARG A 1 12  ? 10.793 -13.468 27.165  1.00 16.67  ? 8   ARG A C   1 
ATOM   40   O  O   . ARG A 1 12  ? 10.208 -14.506 26.834  1.00 13.74  ? 8   ARG A O   1 
ATOM   41   C  CB  A ARG A 1 12  ? 12.851 -14.028 28.558  0.50 14.35  ? 8   ARG A CB  1 
ATOM   42   C  CB  B ARG A 1 12  ? 12.901 -14.045 28.524  0.50 12.73  ? 8   ARG A CB  1 
ATOM   43   C  CG  A ARG A 1 12  ? 14.273 -14.534 28.405  0.50 21.60  ? 8   ARG A CG  1 
ATOM   44   C  CG  B ARG A 1 12  ? 14.400 -14.331 28.416  0.50 14.16  ? 8   ARG A CG  1 
ATOM   45   C  CD  A ARG A 1 12  ? 14.772 -15.300 29.614  0.50 30.89  ? 8   ARG A CD  1 
ATOM   46   C  CD  B ARG A 1 12  ? 14.965 -14.931 29.683  0.50 18.35  ? 8   ARG A CD  1 
ATOM   47   N  NE  A ARG A 1 12  ? 16.048 -15.962 29.323  0.50 35.59  ? 8   ARG A NE  1 
ATOM   48   N  NE  B ARG A 1 12  ? 16.356 -15.365 29.518  0.50 20.13  ? 8   ARG A NE  1 
ATOM   49   C  CZ  A ARG A 1 12  ? 17.240 -15.379 29.426  0.50 41.90  ? 8   ARG A CZ  1 
ATOM   50   C  CZ  B ARG A 1 12  ? 16.707 -16.608 29.208  0.50 34.96  ? 8   ARG A CZ  1 
ATOM   51   N  NH1 A ARG A 1 12  ? 17.341 -14.119 29.831  0.50 31.31  ? 8   ARG A NH1 1 
ATOM   52   N  NH1 B ARG A 1 12  ? 15.789 -17.542 29.018  0.50 27.22  ? 8   ARG A NH1 1 
ATOM   53   N  NH2 A ARG A 1 12  ? 18.339 -16.053 29.118  0.50 23.90  ? 8   ARG A NH2 1 
ATOM   54   N  NH2 B ARG A 1 12  ? 17.989 -16.919 29.062  0.50 20.95  ? 8   ARG A NH2 1 
ATOM   55   N  N   . ALA A 1 13  ? 10.133 -12.296 27.405  1.00 14.87  ? 9   ALA A N   1 
ATOM   56   C  CA  . ALA A 1 13  ? 8.668  -12.187 27.299  1.00 16.27  ? 9   ALA A CA  1 
ATOM   57   C  C   . ALA A 1 13  ? 8.280  -12.314 25.810  1.00 18.31  ? 9   ALA A C   1 
ATOM   58   O  O   . ALA A 1 13  ? 7.314  -13.014 25.471  1.00 18.20  ? 9   ALA A O   1 
ATOM   59   C  CB  . ALA A 1 13  ? 8.179  -10.853 27.850  1.00 17.32  ? 9   ALA A CB  1 
ATOM   60   N  N   . TRP A 1 14  ? 9.070  -11.678 24.932  1.00 13.15  ? 10  TRP A N   1 
ATOM   61   C  CA  . TRP A 1 14  ? 8.829  -11.751 23.484  1.00 12.87  ? 10  TRP A CA  1 
ATOM   62   C  C   . TRP A 1 14  ? 9.038  -13.195 22.978  1.00 15.40  ? 10  TRP A C   1 
ATOM   63   O  O   . TRP A 1 14  ? 8.248  -13.680 22.177  1.00 16.76  ? 10  TRP A O   1 
ATOM   64   C  CB  . TRP A 1 14  ? 9.698  -10.725 22.745  1.00 11.11  ? 10  TRP A CB  1 
ATOM   65   C  CG  . TRP A 1 14  ? 9.500  -10.688 21.260  1.00 12.25  ? 10  TRP A CG  1 
ATOM   66   C  CD1 . TRP A 1 14  ? 8.653  -9.875  20.567  1.00 15.34  ? 10  TRP A CD1 1 
ATOM   67   C  CD2 . TRP A 1 14  ? 10.188 -11.478 20.282  1.00 12.52  ? 10  TRP A CD2 1 
ATOM   68   N  NE1 . TRP A 1 14  ? 8.779  -10.102 19.214  1.00 14.63  ? 10  TRP A NE1 1 
ATOM   69   C  CE2 . TRP A 1 14  ? 9.701  -11.093 19.011  1.00 16.72  ? 10  TRP A CE2 1 
ATOM   70   C  CE3 . TRP A 1 14  ? 11.172 -12.487 20.355  1.00 14.29  ? 10  TRP A CE3 1 
ATOM   71   C  CZ2 . TRP A 1 14  ? 10.160 -11.684 17.824  1.00 16.04  ? 10  TRP A CZ2 1 
ATOM   72   C  CZ3 . TRP A 1 14  ? 11.629 -13.062 19.177  1.00 15.35  ? 10  TRP A CZ3 1 
ATOM   73   C  CH2 . TRP A 1 14  ? 11.159 -12.626 17.930  1.00 15.68  ? 10  TRP A CH2 1 
ATOM   74   N  N   . VAL A 1 15  ? 10.093 -13.865 23.449  1.00 12.09  ? 11  VAL A N   1 
ATOM   75   C  CA  . VAL A 1 15  ? 10.401 -15.253 23.121  1.00 13.42  ? 11  VAL A CA  1 
ATOM   76   C  C   . VAL A 1 15  ? 9.220  -16.188 23.540  1.00 17.78  ? 11  VAL A C   1 
ATOM   77   O  O   . VAL A 1 15  ? 8.774  -16.982 22.728  1.00 14.98  ? 11  VAL A O   1 
ATOM   78   C  CB  . VAL A 1 15  ? 11.784 -15.676 23.691  1.00 16.83  ? 11  VAL A CB  1 
ATOM   79   C  CG1 . VAL A 1 15  ? 11.979 -17.211 23.641  1.00 16.84  ? 11  VAL A CG1 1 
ATOM   80   C  CG2 . VAL A 1 15  ? 12.900 -14.954 22.938  1.00 16.10  ? 11  VAL A CG2 1 
ATOM   81   N  N   . LYS A 1 16  ? 8.677  -16.019 24.767  1.00 16.01  ? 12  LYS A N   1 
ATOM   82   C  CA  . LYS A 1 16  ? 7.521  -16.780 25.246  1.00 16.12  ? 12  LYS A CA  1 
ATOM   83   C  C   . LYS A 1 16  ? 6.277  -16.559 24.333  1.00 20.67  ? 12  LYS A C   1 
ATOM   84   O  O   . LYS A 1 16  ? 5.603  -17.522 23.983  1.00 20.33  ? 12  LYS A O   1 
ATOM   85   C  CB  . LYS A 1 16  ? 7.199  -16.402 26.711  1.00 18.34  ? 12  LYS A CB  1 
ATOM   86   C  CG  . LYS A 1 16  ? 5.877  -17.014 27.192  1.00 24.92  ? 12  LYS A CG  1 
ATOM   87   C  CD  . LYS A 1 16  ? 5.430  -16.504 28.544  1.00 30.47  ? 12  LYS A CD  1 
ATOM   88   C  CE  . LYS A 1 16  ? 4.005  -16.916 28.796  1.00 45.95  ? 12  LYS A CE  1 
ATOM   89   N  NZ  . LYS A 1 16  ? 3.498  -16.354 30.069  1.00 65.51  ? 12  LYS A NZ  1 
ATOM   90   N  N   . GLU A 1 17  ? 5.962  -15.304 23.986  1.00 19.50  ? 13  GLU A N   1 
ATOM   91   C  CA  . GLU A 1 17  ? 4.828  -14.956 23.122  1.00 20.87  ? 13  GLU A CA  1 
ATOM   92   C  C   . GLU A 1 17  ? 5.004  -15.584 21.720  1.00 23.52  ? 13  GLU A C   1 
ATOM   93   O  O   . GLU A 1 17  ? 4.022  -16.004 21.121  1.00 23.68  ? 13  GLU A O   1 
ATOM   94   C  CB  . GLU A 1 17  ? 4.668  -13.426 23.001  1.00 22.67  ? 13  GLU A CB  1 
ATOM   95   C  CG  . GLU A 1 17  ? 3.475  -12.965 22.170  1.00 37.26  ? 13  GLU A CG  1 
ATOM   96   N  N   . ASN A 1 18  ? 6.245  -15.680 21.236  1.00 17.81  ? 14  ASN A N   1 
ATOM   97   C  CA  . ASN A 1 18  ? 6.567  -16.236 19.907  1.00 17.18  ? 14  ASN A CA  1 
ATOM   98   C  C   . ASN A 1 18  ? 7.149  -17.666 19.906  1.00 18.20  ? 14  ASN A C   1 
ATOM   99   O  O   . ASN A 1 18  ? 7.624  -18.146 18.868  1.00 17.52  ? 14  ASN A O   1 
ATOM   100  C  CB  . ASN A 1 18  ? 7.504  -15.256 19.199  1.00 15.00  ? 14  ASN A CB  1 
ATOM   101  C  CG  . ASN A 1 18  ? 6.774  -13.972 18.881  1.00 31.47  ? 14  ASN A CG  1 
ATOM   102  O  OD1 . ASN A 1 18  ? 6.944  -12.942 19.534  1.00 26.27  ? 14  ASN A OD1 1 
ATOM   103  N  ND2 . ASN A 1 18  ? 5.811  -14.056 17.992  1.00 18.12  ? 14  ASN A ND2 1 
ATOM   104  N  N   . ARG A 1 19  ? 7.030  -18.377 21.029  1.00 14.74  ? 15  ARG A N   1 
ATOM   105  C  CA  . ARG A 1 19  ? 7.568  -19.721 21.236  1.00 15.62  ? 15  ARG A CA  1 
ATOM   106  C  C   . ARG A 1 19  ? 7.404  -20.694 20.047  1.00 19.52  ? 15  ARG A C   1 
ATOM   107  O  O   . ARG A 1 19  ? 8.360  -21.392 19.713  1.00 17.98  ? 15  ARG A O   1 
ATOM   108  C  CB  . ARG A 1 19  ? 7.001  -20.346 22.520  1.00 16.55  ? 15  ARG A CB  1 
ATOM   109  C  CG  . ARG A 1 19  ? 7.613  -21.713 22.861  1.00 28.85  ? 15  ARG A CG  1 
ATOM   110  C  CD  . ARG A 1 19  ? 9.111  -21.667 23.137  1.00 35.63  ? 15  ARG A CD  1 
ATOM   111  N  NE  . ARG A 1 19  ? 9.423  -20.905 24.350  1.00 30.73  ? 15  ARG A NE  1 
ATOM   112  C  CZ  . ARG A 1 19  ? 10.640 -20.798 24.863  1.00 38.00  ? 15  ARG A CZ  1 
ATOM   113  N  NH1 . ARG A 1 19  ? 11.670 -21.392 24.277  1.00 25.10  ? 15  ARG A NH1 1 
ATOM   114  N  NH2 . ARG A 1 19  ? 10.839 -20.080 25.965  1.00 21.74  ? 15  ARG A NH2 1 
ATOM   115  N  N   . GLY A 1 20  ? 6.222  -20.715 19.427  1.00 17.00  ? 16  GLY A N   1 
ATOM   116  C  CA  . GLY A 1 20  ? 5.923  -21.607 18.298  1.00 18.17  ? 16  GLY A CA  1 
ATOM   117  C  C   . GLY A 1 20  ? 6.793  -21.393 17.072  1.00 20.42  ? 16  GLY A C   1 
ATOM   118  O  O   . GLY A 1 20  ? 6.916  -22.290 16.238  1.00 18.93  ? 16  GLY A O   1 
ATOM   119  N  N   . SER A 1 21  ? 7.406  -20.188 16.959  1.00 16.42  ? 17  SER A N   1 
ATOM   120  C  CA  . SER A 1 21  ? 8.310  -19.878 15.849  1.00 15.82  ? 17  SER A CA  1 
ATOM   121  C  C   . SER A 1 21  ? 9.616  -20.634 15.960  1.00 17.62  ? 17  SER A C   1 
ATOM   122  O  O   . SER A 1 21  ? 10.268 -20.835 14.943  1.00 16.96  ? 17  SER A O   1 
ATOM   123  C  CB  . SER A 1 21  ? 8.631  -18.386 15.809  1.00 17.06  ? 17  SER A CB  1 
ATOM   124  O  OG  . SER A 1 21  ? 7.530  -17.611 15.376  1.00 20.57  ? 17  SER A OG  1 
ATOM   125  N  N   . PHE A 1 22  ? 10.029 -21.018 17.181  1.00 12.47  ? 18  PHE A N   1 
ATOM   126  C  CA  . PHE A 1 22  ? 11.361 -21.565 17.399  1.00 13.06  ? 18  PHE A CA  1 
ATOM   127  C  C   . PHE A 1 22  ? 11.439 -23.071 17.262  1.00 20.11  ? 18  PHE A C   1 
ATOM   128  O  O   . PHE A 1 22  ? 12.212 -23.713 17.952  1.00 20.49  ? 18  PHE A O   1 
ATOM   129  C  CB  . PHE A 1 22  ? 11.935 -21.043 18.750  1.00 13.73  ? 18  PHE A CB  1 
ATOM   130  C  CG  . PHE A 1 22  ? 11.740 -19.545 18.834  1.00 13.69  ? 18  PHE A CG  1 
ATOM   131  C  CD1 . PHE A 1 22  ? 12.172 -18.710 17.807  1.00 14.85  ? 18  PHE A CD1 1 
ATOM   132  C  CD2 . PHE A 1 22  ? 11.025 -18.982 19.875  1.00 14.40  ? 18  PHE A CD2 1 
ATOM   133  C  CE1 . PHE A 1 22  ? 11.882 -17.352 17.825  1.00 15.32  ? 18  PHE A CE1 1 
ATOM   134  C  CE2 . PHE A 1 22  ? 10.797 -17.605 19.923  1.00 16.20  ? 18  PHE A CE2 1 
ATOM   135  C  CZ  . PHE A 1 22  ? 11.191 -16.805 18.883  1.00 12.55  ? 18  PHE A CZ  1 
ATOM   136  N  N   . GLN A 1 23  ? 10.714 -23.625 16.278  1.00 18.57  ? 19  GLN A N   1 
ATOM   137  C  CA  . GLN A 1 23  ? 10.771 -25.047 15.969  1.00 18.13  ? 19  GLN A CA  1 
ATOM   138  C  C   . GLN A 1 23  ? 10.486 -25.218 14.473  1.00 20.97  ? 19  GLN A C   1 
ATOM   139  O  O   . GLN A 1 23  ? 10.064 -24.237 13.852  1.00 20.08  ? 19  GLN A O   1 
ATOM   140  C  CB  . GLN A 1 23  ? 9.843  -25.861 16.875  1.00 19.01  ? 19  GLN A CB  1 
ATOM   141  C  CG  . GLN A 1 23  ? 8.330  -25.662 16.667  1.00 23.94  ? 19  GLN A CG  1 
ATOM   142  C  CD  . GLN A 1 23  ? 7.561  -26.650 17.515  1.00 43.07  ? 19  GLN A CD  1 
ATOM   143  O  OE1 . GLN A 1 23  ? 8.130  -27.557 18.140  1.00 38.34  ? 19  GLN A OE1 1 
ATOM   144  N  NE2 . GLN A 1 23  ? 6.242  -26.525 17.529  1.00 40.43  ? 19  GLN A NE2 1 
ATOM   145  N  N   . PRO A 1 24  ? 10.802 -26.382 13.860  1.00 17.27  ? 20  PRO A N   1 
ATOM   146  C  CA  . PRO A 1 24  ? 10.574 -26.530 12.413  1.00 17.59  ? 20  PRO A CA  1 
ATOM   147  C  C   . PRO A 1 24  ? 9.105  -26.253 12.052  1.00 23.20  ? 20  PRO A C   1 
ATOM   148  O  O   . PRO A 1 24  ? 8.230  -26.383 12.911  1.00 22.01  ? 20  PRO A O   1 
ATOM   149  C  CB  . PRO A 1 24  ? 10.980 -27.991 12.145  1.00 19.57  ? 20  PRO A CB  1 
ATOM   150  C  CG  . PRO A 1 24  ? 11.909 -28.337 13.243  1.00 22.86  ? 20  PRO A CG  1 
ATOM   151  C  CD  . PRO A 1 24  ? 11.353 -27.627 14.431  1.00 17.98  ? 20  PRO A CD  1 
ATOM   152  N  N   . PRO A 1 25  ? 8.799  -25.826 10.826  1.00 22.63  ? 21  PRO A N   1 
ATOM   153  C  CA  . PRO A 1 25  ? 9.681  -25.742 9.635   1.00 22.75  ? 21  PRO A CA  1 
ATOM   154  C  C   . PRO A 1 25  ? 10.595 -24.515 9.506   1.00 28.78  ? 21  PRO A C   1 
ATOM   155  O  O   . PRO A 1 25  ? 11.680 -24.665 8.942   1.00 30.10  ? 21  PRO A O   1 
ATOM   156  C  CB  . PRO A 1 25  ? 8.687  -25.827 8.468   1.00 24.36  ? 21  PRO A CB  1 
ATOM   157  C  CG  . PRO A 1 25  ? 7.420  -25.185 9.014   1.00 28.36  ? 21  PRO A CG  1 
ATOM   158  C  CD  . PRO A 1 25  ? 7.380  -25.563 10.479  1.00 23.80  ? 21  PRO A CD  1 
ATOM   159  N  N   . VAL A 1 26  ? 10.199 -23.345 10.015  1.00 25.08  ? 22  VAL A N   1 
ATOM   160  C  CA  . VAL A 1 26  ? 10.970 -22.096 9.869   1.00 25.52  ? 22  VAL A CA  1 
ATOM   161  C  C   . VAL A 1 26  ? 12.037 -21.818 10.940  1.00 25.84  ? 22  VAL A C   1 
ATOM   162  O  O   . VAL A 1 26  ? 13.011 -21.126 10.634  1.00 24.48  ? 22  VAL A O   1 
ATOM   163  N  N   . CYS A 1 27  ? 11.833 -22.283 12.189  1.00 21.80  ? 23  CYS A N   1 
ATOM   164  C  CA  . CYS A 1 27  ? 12.787 -22.163 13.320  1.00 22.10  ? 23  CYS A CA  1 
ATOM   165  C  C   . CYS A 1 27  ? 13.141 -20.740 13.750  1.00 22.66  ? 23  CYS A C   1 
ATOM   166  O  O   . CYS A 1 27  ? 13.778 -20.584 14.782  1.00 22.61  ? 23  CYS A O   1 
ATOM   167  C  CB  . CYS A 1 27  ? 14.065 -22.954 13.051  1.00 23.49  ? 23  CYS A CB  1 
ATOM   168  S  SG  . CYS A 1 27  ? 13.823 -24.743 12.949  1.00 28.20  ? 23  CYS A SG  1 
ATOM   169  N  N   . ASN A 1 28  ? 12.814 -19.722 12.990  1.00 17.71  ? 24  ASN A N   1 
ATOM   170  C  CA  . ASN A 1 28  ? 13.207 -18.384 13.402  1.00 17.70  ? 24  ASN A CA  1 
ATOM   171  C  C   . ASN A 1 28  ? 12.106 -17.341 13.337  1.00 20.40  ? 24  ASN A C   1 
ATOM   172  O  O   . ASN A 1 28  ? 11.106 -17.507 12.633  1.00 19.26  ? 24  ASN A O   1 
ATOM   173  C  CB  . ASN A 1 28  ? 14.418 -17.914 12.585  1.00 20.45  ? 24  ASN A CB  1 
ATOM   174  C  CG  . ASN A 1 28  ? 14.031 -17.408 11.220  1.00 45.55  ? 24  ASN A CG  1 
ATOM   175  O  OD1 . ASN A 1 28  ? 13.851 -16.202 11.003  1.00 43.53  ? 24  ASN A OD1 1 
ATOM   176  N  ND2 . ASN A 1 28  ? 13.779 -18.325 10.310  1.00 36.29  ? 24  ASN A ND2 1 
ATOM   177  N  N   . LYS A 1 29  ? 12.325 -16.238 14.035  1.00 16.53  ? 25  LYS A N   1 
ATOM   178  C  CA  . LYS A 1 29  ? 11.459 -15.069 13.948  1.00 15.23  ? 25  LYS A CA  1 
ATOM   179  C  C   . LYS A 1 29  ? 12.348 -13.873 14.140  1.00 17.04  ? 25  LYS A C   1 
ATOM   180  O  O   . LYS A 1 29  ? 13.173 -13.863 15.067  1.00 13.41  ? 25  LYS A O   1 
ATOM   181  C  CB  . LYS A 1 29  ? 10.315 -15.059 14.967  1.00 17.42  ? 25  LYS A CB  1 
ATOM   182  C  CG  . LYS A 1 29  ? 9.320  -13.944 14.649  1.00 22.28  ? 25  LYS A CG  1 
ATOM   183  C  CD  . LYS A 1 29  ? 8.127  -13.923 15.587  1.00 29.18  ? 25  LYS A CD  1 
ATOM   184  C  CE  . LYS A 1 29  ? 7.188  -12.783 15.278  1.00 27.32  ? 25  LYS A CE  1 
ATOM   185  N  NZ  . LYS A 1 29  ? 6.491  -12.988 13.989  1.00 21.81  ? 25  LYS A NZ  1 
ATOM   186  N  N   . LEU A 1 30  ? 12.199 -12.872 13.245  1.00 15.05  ? 26  LEU A N   1 
ATOM   187  C  CA  . LEU A 1 30  ? 12.936 -11.607 13.359  1.00 15.04  ? 26  LEU A CA  1 
ATOM   188  C  C   . LEU A 1 30  ? 12.216 -10.730 14.359  1.00 16.82  ? 26  LEU A C   1 
ATOM   189  O  O   . LEU A 1 30  ? 11.021 -10.472 14.213  1.00 15.76  ? 26  LEU A O   1 
ATOM   190  C  CB  . LEU A 1 30  ? 12.971 -10.893 11.996  1.00 15.91  ? 26  LEU A CB  1 
ATOM   191  C  CG  . LEU A 1 30  ? 14.053 -11.367 11.025  1.00 21.59  ? 26  LEU A CG  1 
ATOM   192  C  CD1 . LEU A 1 30  ? 13.627 -11.102 9.580   1.00 23.36  ? 26  LEU A CD1 1 
ATOM   193  C  CD2 . LEU A 1 30  ? 15.354 -10.662 11.298  1.00 24.22  ? 26  LEU A CD2 1 
ATOM   194  N  N   . MET A 1 31  ? 12.917 -10.263 15.379  1.00 13.07  ? 27  MET A N   1 
ATOM   195  C  CA  . MET A 1 31  ? 12.322 -9.296  16.312  1.00 12.34  ? 27  MET A CA  1 
ATOM   196  C  C   . MET A 1 31  ? 12.368 -7.917  15.615  1.00 15.36  ? 27  MET A C   1 
ATOM   197  O  O   . MET A 1 31  ? 11.422 -7.128  15.710  1.00 14.64  ? 27  MET A O   1 
ATOM   198  C  CB  . MET A 1 31  ? 13.131 -9.243  17.632  1.00 12.82  ? 27  MET A CB  1 
ATOM   199  C  CG  . MET A 1 31  ? 12.612 -8.199  18.588  1.00 15.23  ? 27  MET A CG  1 
ATOM   200  S  SD  . MET A 1 31  ? 13.671 -8.032  20.050  1.00 16.88  ? 27  MET A SD  1 
ATOM   201  C  CE  . MET A 1 31  ? 12.839 -9.203  21.182  1.00 15.63  ? 27  MET A CE  1 
ATOM   202  N  N   . HIS A 1 32  ? 13.483 -7.624  14.954  1.00 11.91  ? 28  HIS A N   1 
ATOM   203  C  CA  . HIS A 1 32  ? 13.728 -6.356  14.233  1.00 11.51  ? 28  HIS A CA  1 
ATOM   204  C  C   . HIS A 1 32  ? 14.298 -6.669  12.862  1.00 15.76  ? 28  HIS A C   1 
ATOM   205  O  O   . HIS A 1 32  ? 15.195 -7.518  12.755  1.00 13.97  ? 28  HIS A O   1 
ATOM   206  C  CB  . HIS A 1 32  ? 14.633 -5.414  15.021  1.00 9.94   ? 28  HIS A CB  1 
ATOM   207  C  CG  . HIS A 1 32  ? 14.062 -5.062  16.370  1.00 11.96  ? 28  HIS A CG  1 
ATOM   208  N  ND1 . HIS A 1 32  ? 12.867 -4.407  16.491  1.00 13.83  ? 28  HIS A ND1 1 
ATOM   209  C  CD2 . HIS A 1 32  ? 14.536 -5.329  17.605  1.00 11.96  ? 28  HIS A CD2 1 
ATOM   210  C  CE1 . HIS A 1 32  ? 12.630 -4.310  17.794  1.00 12.40  ? 28  HIS A CE1 1 
ATOM   211  N  NE2 . HIS A 1 32  ? 13.633 -4.817  18.501  1.00 11.46  ? 28  HIS A NE2 1 
ATOM   212  N  N   . GLN A 1 33  ? 13.795 -6.004  11.818  1.00 13.29  ? 29  GLN A N   1 
ATOM   213  C  CA  . GLN A 1 33  ? 14.223 -6.381  10.467  1.00 13.63  ? 29  GLN A CA  1 
ATOM   214  C  C   . GLN A 1 33  ? 14.500 -5.241  9.496   1.00 18.56  ? 29  GLN A C   1 
ATOM   215  O  O   . GLN A 1 33  ? 14.386 -5.466  8.289   1.00 17.54  ? 29  GLN A O   1 
ATOM   216  C  CB  . GLN A 1 33  ? 13.200 -7.358  9.845   1.00 14.76  ? 29  GLN A CB  1 
ATOM   217  C  CG  . GLN A 1 33  ? 11.756 -6.845  9.793   1.00 26.28  ? 29  GLN A CG  1 
ATOM   218  C  CD  . GLN A 1 33  ? 10.829 -7.957  9.359   1.00 40.08  ? 29  GLN A CD  1 
ATOM   219  O  OE1 . GLN A 1 33  ? 10.276 -8.686  10.170  1.00 31.07  ? 29  GLN A OE1 1 
ATOM   220  N  NE2 . GLN A 1 33  ? 10.674 -8.143  8.066   1.00 41.67  ? 29  GLN A NE2 1 
ATOM   221  N  N   . GLU A 1 34  ? 14.942 -4.082  9.987   1.00 16.60  ? 30  GLU A N   1 
ATOM   222  C  CA  . GLU A 1 34  ? 15.296 -2.934  9.143   1.00 16.53  ? 30  GLU A CA  1 
ATOM   223  C  C   . GLU A 1 34  ? 16.820 -2.927  8.920   1.00 19.12  ? 30  GLU A C   1 
ATOM   224  O  O   . GLU A 1 34  ? 17.310 -3.899  8.350   1.00 17.14  ? 30  GLU A O   1 
ATOM   225  C  CB  . GLU A 1 34  ? 14.721 -1.623  9.689   1.00 17.64  ? 30  GLU A CB  1 
ATOM   226  C  CG  . GLU A 1 34  ? 13.205 -1.596  9.616   1.00 30.88  ? 30  GLU A CG  1 
ATOM   227  C  CD  . GLU A 1 34  ? 12.490 -0.278  9.850   1.00 54.01  ? 30  GLU A CD  1 
ATOM   228  O  OE1 . GLU A 1 34  ? 13.110 0.798   9.689   1.00 48.44  ? 30  GLU A OE1 1 
ATOM   229  O  OE2 . GLU A 1 34  ? 11.270 -0.329  10.128  1.00 54.00  ? 30  GLU A OE2 1 
ATOM   230  N  N   . GLN A 1 35  ? 17.579 -1.886  9.341   1.00 14.54  ? 31  GLN A N   1 
ATOM   231  C  CA  . GLN A 1 35  ? 19.028 -1.910  9.096   1.00 12.88  ? 31  GLN A CA  1 
ATOM   232  C  C   . GLN A 1 35  ? 19.712 -3.027  9.908   1.00 14.14  ? 31  GLN A C   1 
ATOM   233  O  O   . GLN A 1 35  ? 20.622 -3.656  9.421   1.00 12.37  ? 31  GLN A O   1 
ATOM   234  C  CB  . GLN A 1 35  ? 19.685 -0.542  9.347   1.00 13.53  ? 31  GLN A CB  1 
ATOM   235  C  CG  . GLN A 1 35  ? 21.133 -0.472  8.828   1.00 12.70  ? 31  GLN A CG  1 
ATOM   236  C  CD  . GLN A 1 35  ? 22.118 -0.945  9.871   1.00 14.22  ? 31  GLN A CD  1 
ATOM   237  O  OE1 . GLN A 1 35  ? 21.873 -0.802  11.095  1.00 12.20  ? 31  GLN A OE1 1 
ATOM   238  N  NE2 . GLN A 1 35  ? 23.256 -1.525  9.436   1.00 12.82  ? 31  GLN A NE2 1 
ATOM   239  N  N   . LEU A 1 36  ? 19.262 -3.228  11.149  1.00 11.99  ? 32  LEU A N   1 
ATOM   240  C  CA  . LEU A 1 36  ? 19.774 -4.237  12.037  1.00 12.08  ? 32  LEU A CA  1 
ATOM   241  C  C   . LEU A 1 36  ? 18.767 -5.401  12.137  1.00 13.84  ? 32  LEU A C   1 
ATOM   242  O  O   . LEU A 1 36  ? 17.603 -5.220  12.505  1.00 13.68  ? 32  LEU A O   1 
ATOM   243  C  CB  . LEU A 1 36  ? 20.037 -3.582  13.410  1.00 12.09  ? 32  LEU A CB  1 
ATOM   244  C  CG  . LEU A 1 36  ? 20.991 -4.299  14.342  1.00 17.35  ? 32  LEU A CG  1 
ATOM   245  C  CD1 . LEU A 1 36  ? 22.382 -4.453  13.722  1.00 15.95  ? 32  LEU A CD1 1 
ATOM   246  C  CD2 . LEU A 1 36  ? 21.026 -3.598  15.699  1.00 18.19  ? 32  LEU A CD2 1 
ATOM   247  N  N   . LYS A 1 37  ? 19.223 -6.601  11.788  1.00 10.54  ? 33  LYS A N   1 
ATOM   248  C  CA  . LYS A 1 37  ? 18.408 -7.816  11.818  1.00 9.46   ? 33  LYS A CA  1 
ATOM   249  C  C   . LYS A 1 37  ? 18.619 -8.498  13.162  1.00 12.81  ? 33  LYS A C   1 
ATOM   250  O  O   . LYS A 1 37  ? 19.696 -9.053  13.425  1.00 13.81  ? 33  LYS A O   1 
ATOM   251  C  CB  . LYS A 1 37  ? 18.805 -8.758  10.659  1.00 13.78  ? 33  LYS A CB  1 
ATOM   252  C  CG  . LYS A 1 37  ? 18.952 -8.053  9.297   1.00 14.48  ? 33  LYS A CG  1 
ATOM   253  C  CD  . LYS A 1 37  ? 17.663 -7.429  8.745   1.00 15.62  ? 33  LYS A CD  1 
ATOM   254  C  CE  . LYS A 1 37  ? 17.881 -6.953  7.296   1.00 13.17  ? 33  LYS A CE  1 
ATOM   255  N  NZ  . LYS A 1 37  ? 16.625 -6.360  6.766   1.00 15.67  ? 33  LYS A NZ  1 
ATOM   256  N  N   . VAL A 1 38  ? 17.617 -8.409  14.028  1.00 9.37   ? 34  VAL A N   1 
ATOM   257  C  CA  . VAL A 1 38  ? 17.682 -8.995  15.366  1.00 8.56   ? 34  VAL A CA  1 
ATOM   258  C  C   . VAL A 1 38  ? 16.798 -10.246 15.314  1.00 14.50  ? 34  VAL A C   1 
ATOM   259  O  O   . VAL A 1 38  ? 15.576 -10.134 15.199  1.00 14.93  ? 34  VAL A O   1 
ATOM   260  C  CB  . VAL A 1 38  ? 17.271 -7.990  16.458  1.00 10.44  ? 34  VAL A CB  1 
ATOM   261  C  CG1 . VAL A 1 38  ? 17.381 -8.631  17.845  1.00 9.83   ? 34  VAL A CG1 1 
ATOM   262  C  CG2 . VAL A 1 38  ? 18.130 -6.741  16.392  1.00 11.42  ? 34  VAL A CG2 1 
ATOM   263  N  N   . MET A 1 39  ? 17.410 -11.424 15.289  1.00 13.53  ? 35  MET A N   1 
ATOM   264  C  CA  . MET A 1 39  ? 16.617 -12.630 15.108  1.00 15.87  ? 35  MET A CA  1 
ATOM   265  C  C   . MET A 1 39  ? 16.801 -13.659 16.186  1.00 16.64  ? 35  MET A C   1 
ATOM   266  O  O   . MET A 1 39  ? 17.888 -13.807 16.741  1.00 13.56  ? 35  MET A O   1 
ATOM   267  C  CB  . MET A 1 39  ? 16.875 -13.241 13.726  1.00 20.72  ? 35  MET A CB  1 
ATOM   268  C  CG  . MET A 1 39  ? 18.162 -13.987 13.589  1.00 27.45  ? 35  MET A CG  1 
ATOM   269  S  SD  . MET A 1 39  ? 18.395 -14.435 11.850  1.00 36.57  ? 35  MET A SD  1 
ATOM   270  C  CE  . MET A 1 39  ? 18.994 -12.879 11.204  1.00 33.51  ? 35  MET A CE  1 
ATOM   271  N  N   . PHE A 1 40  ? 15.736 -14.427 16.419  1.00 13.45  ? 36  PHE A N   1 
ATOM   272  C  CA  . PHE A 1 40  ? 15.747 -15.492 17.405  1.00 12.39  ? 36  PHE A CA  1 
ATOM   273  C  C   . PHE A 1 40  ? 15.497 -16.792 16.701  1.00 16.39  ? 36  PHE A C   1 
ATOM   274  O  O   . PHE A 1 40  ? 14.607 -16.865 15.838  1.00 14.44  ? 36  PHE A O   1 
ATOM   275  C  CB  . PHE A 1 40  ? 14.749 -15.200 18.524  1.00 13.34  ? 36  PHE A CB  1 
ATOM   276  C  CG  . PHE A 1 40  ? 15.193 -14.026 19.376  1.00 12.77  ? 36  PHE A CG  1 
ATOM   277  C  CD1 . PHE A 1 40  ? 14.993 -12.715 18.948  1.00 14.26  ? 36  PHE A CD1 1 
ATOM   278  C  CD2 . PHE A 1 40  ? 15.837 -14.232 20.591  1.00 15.73  ? 36  PHE A CD2 1 
ATOM   279  C  CE1 . PHE A 1 40  ? 15.408 -11.628 19.734  1.00 13.85  ? 36  PHE A CE1 1 
ATOM   280  C  CE2 . PHE A 1 40  ? 16.245 -13.144 21.377  1.00 16.58  ? 36  PHE A CE2 1 
ATOM   281  C  CZ  . PHE A 1 40  ? 16.032 -11.853 20.938  1.00 13.98  ? 36  PHE A CZ  1 
ATOM   282  N  N   . ILE A 1 41  ? 16.375 -17.787 16.960  1.00 12.24  ? 37  ILE A N   1 
ATOM   283  C  CA  . ILE A 1 41  ? 16.334 -19.055 16.233  1.00 12.94  ? 37  ILE A CA  1 
ATOM   284  C  C   . ILE A 1 41  ? 16.321 -20.250 17.155  1.00 16.15  ? 37  ILE A C   1 
ATOM   285  O  O   . ILE A 1 41  ? 17.088 -20.291 18.105  1.00 13.74  ? 37  ILE A O   1 
ATOM   286  C  CB  . ILE A 1 41  ? 17.537 -19.146 15.242  1.00 15.79  ? 37  ILE A CB  1 
ATOM   287  C  CG1 . ILE A 1 41  ? 17.826 -17.785 14.552  1.00 17.32  ? 37  ILE A CG1 1 
ATOM   288  C  CG2 . ILE A 1 41  ? 17.367 -20.281 14.227  1.00 14.14  ? 37  ILE A CG2 1 
ATOM   289  C  CD1 . ILE A 1 41  ? 19.064 -17.762 13.571  1.00 20.90  ? 37  ILE A CD1 1 
ATOM   290  N  N   . GLY A 1 42  ? 15.468 -21.216 16.831  1.00 14.60  ? 38  GLY A N   1 
ATOM   291  C  CA  . GLY A 1 42  ? 15.367 -22.478 17.548  1.00 14.27  ? 38  GLY A CA  1 
ATOM   292  C  C   . GLY A 1 42  ? 15.913 -23.621 16.718  1.00 18.48  ? 38  GLY A C   1 
ATOM   293  O  O   . GLY A 1 42  ? 16.625 -23.425 15.733  1.00 17.68  ? 38  GLY A O   1 
ATOM   294  N  N   . GLY A 1 43  ? 15.523 -24.811 17.096  1.00 15.42  ? 39  GLY A N   1 
ATOM   295  C  CA  . GLY A 1 43  ? 15.878 -26.034 16.412  1.00 15.57  ? 39  GLY A CA  1 
ATOM   296  C  C   . GLY A 1 43  ? 14.758 -27.049 16.612  1.00 20.52  ? 39  GLY A C   1 
ATOM   297  O  O   . GLY A 1 43  ? 13.658 -26.678 17.045  1.00 17.38  ? 39  GLY A O   1 
ATOM   298  N  N   . PRO A 1 44  ? 15.000 -28.340 16.319  1.00 18.57  ? 40  PRO A N   1 
ATOM   299  C  CA  . PRO A 1 44  ? 16.246 -28.923 15.794  1.00 18.65  ? 40  PRO A CA  1 
ATOM   300  C  C   . PRO A 1 44  ? 16.491 -28.530 14.347  1.00 22.08  ? 40  PRO A C   1 
ATOM   301  O  O   . PRO A 1 44  ? 15.548 -28.403 13.567  1.00 21.44  ? 40  PRO A O   1 
ATOM   302  C  CB  . PRO A 1 44  ? 16.007 -30.434 15.935  1.00 21.10  ? 40  PRO A CB  1 
ATOM   303  C  CG  . PRO A 1 44  ? 14.514 -30.582 15.788  1.00 24.44  ? 40  PRO A CG  1 
ATOM   304  C  CD  . PRO A 1 44  ? 13.951 -29.372 16.491  1.00 20.04  ? 40  PRO A CD  1 
ATOM   305  N  N   . ASN A 1 45  ? 17.761 -28.262 14.016  1.00 18.02  ? 41  ASN A N   1 
ATOM   306  C  CA  . ASN A 1 45  ? 18.146 -27.899 12.657  1.00 16.97  ? 41  ASN A CA  1 
ATOM   307  C  C   . ASN A 1 45  ? 19.618 -28.231 12.449  1.00 21.15  ? 41  ASN A C   1 
ATOM   308  O  O   . ASN A 1 45  ? 20.502 -27.469 12.848  1.00 22.71  ? 41  ASN A O   1 
ATOM   309  C  CB  . ASN A 1 45  ? 17.836 -26.437 12.355  1.00 12.68  ? 41  ASN A CB  1 
ATOM   310  C  CG  . ASN A 1 45  ? 18.122 -26.006 10.923  1.00 27.56  ? 41  ASN A CG  1 
ATOM   311  O  OD1 . ASN A 1 45  ? 18.635 -24.911 10.681  1.00 30.47  ? 41  ASN A OD1 1 
ATOM   312  N  ND2 . ASN A 1 45  ? 17.805 -26.832 9.942   1.00 22.19  ? 41  ASN A ND2 1 
ATOM   313  N  N   . THR A 1 46  ? 19.856 -29.374 11.841  1.00 17.22  ? 42  THR A N   1 
ATOM   314  C  CA  . THR A 1 46  ? 21.180 -29.891 11.492  1.00 18.37  ? 42  THR A CA  1 
ATOM   315  C  C   . THR A 1 46  ? 21.292 -29.834 9.997   1.00 22.32  ? 42  THR A C   1 
ATOM   316  O  O   . THR A 1 46  ? 20.315 -30.075 9.286   1.00 22.78  ? 42  THR A O   1 
ATOM   317  C  CB  . THR A 1 46  ? 21.445 -31.262 12.105  1.00 29.84  ? 42  THR A CB  1 
ATOM   318  O  OG1 . THR A 1 46  ? 20.436 -32.142 11.651  1.00 35.80  ? 42  THR A OG1 1 
ATOM   319  C  CG2 . THR A 1 46  ? 21.472 -31.225 13.634  1.00 28.45  ? 42  THR A CG2 1 
ATOM   320  N  N   . ARG A 1 47  ? 22.452 -29.414 9.512   1.00 17.69  ? 43  ARG A N   1 
ATOM   321  C  CA  . ARG A 1 47  ? 22.635 -29.134 8.095   1.00 16.57  ? 43  ARG A CA  1 
ATOM   322  C  C   . ARG A 1 47  ? 24.098 -29.139 7.721   1.00 17.30  ? 43  ARG A C   1 
ATOM   323  O  O   . ARG A 1 47  ? 24.940 -29.018 8.594   1.00 17.38  ? 43  ARG A O   1 
ATOM   324  C  CB  . ARG A 1 47  ? 22.053 -27.737 7.817   1.00 17.74  ? 43  ARG A CB  1 
ATOM   325  C  CG  . ARG A 1 47  ? 22.638 -26.605 8.713   1.00 18.50  ? 43  ARG A CG  1 
ATOM   326  C  CD  . ARG A 1 47  ? 21.637 -25.460 8.875   1.00 18.73  ? 43  ARG A CD  1 
ATOM   327  N  NE  . ARG A 1 47  ? 21.400 -24.737 7.617   1.00 19.11  ? 43  ARG A NE  1 
ATOM   328  C  CZ  . ARG A 1 47  ? 20.423 -23.852 7.436   1.00 38.66  ? 43  ARG A CZ  1 
ATOM   329  N  NH1 . ARG A 1 47  ? 20.294 -23.225 6.272   1.00 30.10  ? 43  ARG A NH1 1 
ATOM   330  N  NH2 . ARG A 1 47  ? 19.566 -23.586 8.416   1.00 27.21  ? 43  ARG A NH2 1 
ATOM   331  N  N   . LYS A 1 48  ? 24.393 -29.237 6.424   1.00 13.66  ? 44  LYS A N   1 
ATOM   332  C  CA  . LYS A 1 48  ? 25.758 -29.234 5.887   1.00 12.73  ? 44  LYS A CA  1 
ATOM   333  C  C   . LYS A 1 48  ? 26.027 -27.980 5.034   1.00 15.23  ? 44  LYS A C   1 
ATOM   334  O  O   . LYS A 1 48  ? 27.123 -27.832 4.514   1.00 14.97  ? 44  LYS A O   1 
ATOM   335  C  CB  . LYS A 1 48  ? 26.015 -30.518 5.045   1.00 16.54  ? 44  LYS A CB  1 
ATOM   336  C  CG  . LYS A 1 48  ? 25.645 -31.821 5.779   1.00 34.41  ? 44  LYS A CG  1 
ATOM   337  C  CD  . LYS A 1 48  ? 26.517 -32.999 5.397   1.00 46.59  ? 44  LYS A CD  1 
ATOM   338  C  CE  . LYS A 1 48  ? 26.137 -34.220 6.197   1.00 57.78  ? 44  LYS A CE  1 
ATOM   339  N  NZ  . LYS A 1 48  ? 27.248 -35.197 6.283   1.00 70.45  ? 44  LYS A NZ  1 
ATOM   340  N  N   . ASP A 1 49  ? 25.039 -27.096 4.852   1.00 13.50  ? 45  ASP A N   1 
ATOM   341  C  CA  . ASP A 1 49  ? 25.260 -25.879 4.049   1.00 13.72  ? 45  ASP A CA  1 
ATOM   342  C  C   . ASP A 1 49  ? 26.016 -24.857 4.850   1.00 16.59  ? 45  ASP A C   1 
ATOM   343  O  O   . ASP A 1 49  ? 25.729 -24.659 6.036   1.00 14.88  ? 45  ASP A O   1 
ATOM   344  C  CB  . ASP A 1 49  ? 23.958 -25.262 3.526   1.00 15.06  ? 45  ASP A CB  1 
ATOM   345  C  CG  . ASP A 1 49  ? 22.938 -24.985 4.614   1.00 18.08  ? 45  ASP A CG  1 
ATOM   346  O  OD1 . ASP A 1 49  ? 22.485 -25.946 5.252   1.00 17.79  ? 45  ASP A OD1 1 
ATOM   347  O  OD2 . ASP A 1 49  ? 22.554 -23.801 4.788   1.00 21.09  ? 45  ASP A OD2 1 
ATOM   348  N  N   . TYR A 1 50  ? 26.960 -24.191 4.192   1.00 12.85  ? 46  TYR A N   1 
ATOM   349  C  CA  . TYR A 1 50  ? 27.764 -23.106 4.786   1.00 11.67  ? 46  TYR A CA  1 
ATOM   350  C  C   . TYR A 1 50  ? 27.378 -21.793 4.193   1.00 12.34  ? 46  TYR A C   1 
ATOM   351  O  O   . TYR A 1 50  ? 27.432 -21.619 2.974   1.00 12.00  ? 46  TYR A O   1 
ATOM   352  C  CB  . TYR A 1 50  ? 29.279 -23.338 4.583   1.00 11.19  ? 46  TYR A CB  1 
ATOM   353  C  CG  . TYR A 1 50  ? 29.827 -24.415 5.487   1.00 12.41  ? 46  TYR A CG  1 
ATOM   354  C  CD1 . TYR A 1 50  ? 29.602 -25.765 5.217   1.00 14.07  ? 46  TYR A CD1 1 
ATOM   355  C  CD2 . TYR A 1 50  ? 30.554 -24.091 6.625   1.00 12.74  ? 46  TYR A CD2 1 
ATOM   356  C  CE1 . TYR A 1 50  ? 30.088 -26.764 6.058   1.00 15.39  ? 46  TYR A CE1 1 
ATOM   357  C  CE2 . TYR A 1 50  ? 31.063 -25.085 7.463   1.00 13.92  ? 46  TYR A CE2 1 
ATOM   358  C  CZ  . TYR A 1 50  ? 30.827 -26.422 7.178   1.00 18.96  ? 46  TYR A CZ  1 
ATOM   359  O  OH  . TYR A 1 50  ? 31.349 -27.406 7.991   1.00 15.87  ? 46  TYR A OH  1 
ATOM   360  N  N   . HIS A 1 51  ? 26.969 -20.870 5.045   1.00 9.71   ? 47  HIS A N   1 
ATOM   361  C  CA  . HIS A 1 51  ? 26.596 -19.499 4.676   1.00 9.35   ? 47  HIS A CA  1 
ATOM   362  C  C   . HIS A 1 51  ? 27.857 -18.646 4.613   1.00 12.85  ? 47  HIS A C   1 
ATOM   363  O  O   . HIS A 1 51  ? 28.756 -18.820 5.428   1.00 13.23  ? 47  HIS A O   1 
ATOM   364  C  CB  . HIS A 1 51  ? 25.618 -18.919 5.726   1.00 9.75   ? 47  HIS A CB  1 
ATOM   365  C  CG  . HIS A 1 51  ? 25.148 -17.529 5.406   1.00 12.52  ? 47  HIS A CG  1 
ATOM   366  N  ND1 . HIS A 1 51  ? 24.966 -16.577 6.409   1.00 12.66  ? 47  HIS A ND1 1 
ATOM   367  C  CD2 . HIS A 1 51  ? 24.828 -16.978 4.208   1.00 12.41  ? 47  HIS A CD2 1 
ATOM   368  C  CE1 . HIS A 1 51  ? 24.568 -15.487 5.775   1.00 12.71  ? 47  HIS A CE1 1 
ATOM   369  N  NE2 . HIS A 1 51  ? 24.494 -15.679 4.450   1.00 12.58  ? 47  HIS A NE2 1 
ATOM   370  N  N   . ILE A 1 52  ? 27.955 -17.760 3.644   1.00 10.46  ? 48  ILE A N   1 
ATOM   371  C  CA  . ILE A 1 52  ? 29.113 -16.833 3.555   1.00 9.67   ? 48  ILE A CA  1 
ATOM   372  C  C   . ILE A 1 52  ? 28.527 -15.454 3.291   1.00 13.74  ? 48  ILE A C   1 
ATOM   373  O  O   . ILE A 1 52  ? 27.699 -15.314 2.395   1.00 13.54  ? 48  ILE A O   1 
ATOM   374  C  CB  . ILE A 1 52  ? 30.130 -17.229 2.447   1.00 12.14  ? 48  ILE A CB  1 
ATOM   375  C  CG1 . ILE A 1 52  ? 30.512 -18.734 2.531   1.00 12.31  ? 48  ILE A CG1 1 
ATOM   376  C  CG2 . ILE A 1 52  ? 31.388 -16.343 2.492   1.00 12.53  ? 48  ILE A CG2 1 
ATOM   377  C  CD1 . ILE A 1 52  ? 31.342 -19.268 1.305   1.00 18.29  ? 48  ILE A CD1 1 
ATOM   378  N  N   . GLU A 1 53  ? 28.958 -14.433 4.057   1.00 10.98  ? 49  GLU A N   1 
ATOM   379  C  CA  . GLU A 1 53  ? 28.477 -13.071 3.841   1.00 10.20  ? 49  GLU A CA  1 
ATOM   380  C  C   . GLU A 1 53  ? 29.556 -12.016 4.103   1.00 12.30  ? 49  GLU A C   1 
ATOM   381  O  O   . GLU A 1 53  ? 30.554 -12.311 4.757   1.00 12.24  ? 49  GLU A O   1 
ATOM   382  C  CB  . GLU A 1 53  ? 27.181 -12.786 4.630   1.00 10.95  ? 49  GLU A CB  1 
ATOM   383  C  CG  . GLU A 1 53  ? 27.347 -12.793 6.147   1.00 15.07  ? 49  GLU A CG  1 
ATOM   384  C  CD  . GLU A 1 53  ? 26.492 -11.785 6.893   1.00 14.16  ? 49  GLU A CD  1 
ATOM   385  O  OE1 . GLU A 1 53  ? 26.485 -10.598 6.497   1.00 16.93  ? 49  GLU A OE1 1 
ATOM   386  O  OE2 . GLU A 1 53  ? 25.899 -12.158 7.929   1.00 15.57  ? 49  GLU A OE2 1 
ATOM   387  N  N   . GLU A 1 54  ? 29.303 -10.764 3.665   1.00 10.09  ? 50  GLU A N   1 
ATOM   388  C  CA  . GLU A 1 54  ? 30.257 -9.664  3.822   1.00 9.80   ? 50  GLU A CA  1 
ATOM   389  C  C   . GLU A 1 54  ? 30.121 -8.929  5.148   1.00 14.49  ? 50  GLU A C   1 
ATOM   390  O  O   . GLU A 1 54  ? 30.992 -8.149  5.511   1.00 13.32  ? 50  GLU A O   1 
ATOM   391  C  CB  . GLU A 1 54  ? 30.212 -8.698  2.642   1.00 10.84  ? 50  GLU A CB  1 
ATOM   392  C  CG  . GLU A 1 54  ? 30.580 -9.424  1.359   1.00 12.34  ? 50  GLU A CG  1 
ATOM   393  C  CD  . GLU A 1 54  ? 30.685 -8.560  0.116   1.00 32.13  ? 50  GLU A CD  1 
ATOM   394  O  OE1 . GLU A 1 54  ? 31.424 -7.551  0.155   1.00 25.32  ? 50  GLU A OE1 1 
ATOM   395  O  OE2 . GLU A 1 54  ? 30.086 -8.933  -0.920  1.00 28.62  ? 50  GLU A OE2 1 
ATOM   396  N  N   . GLY A 1 55  ? 29.054 -9.212  5.872   1.00 13.25  ? 51  GLY A N   1 
ATOM   397  C  CA  . GLY A 1 55  ? 28.849 -8.652  7.199   1.00 11.26  ? 51  GLY A CA  1 
ATOM   398  C  C   . GLY A 1 55  ? 29.235 -9.649  8.270   1.00 14.37  ? 51  GLY A C   1 
ATOM   399  O  O   . GLY A 1 55  ? 29.600 -10.795 7.982   1.00 13.69  ? 51  GLY A O   1 
ATOM   400  N  N   . GLU A 1 56  ? 29.163 -9.222  9.520   1.00 10.82  ? 52  GLU A N   1 
ATOM   401  C  CA  . GLU A 1 56  ? 29.520 -10.101 10.643  1.00 10.33  ? 52  GLU A CA  1 
ATOM   402  C  C   . GLU A 1 56  ? 28.244 -10.633 11.301  1.00 13.82  ? 52  GLU A C   1 
ATOM   403  O  O   . GLU A 1 56  ? 27.152 -10.121 11.039  1.00 13.77  ? 52  GLU A O   1 
ATOM   404  C  CB  . GLU A 1 56  ? 30.295 -9.289  11.682  1.00 10.85  ? 52  GLU A CB  1 
ATOM   405  C  CG  . GLU A 1 56  ? 31.588 -8.729  11.117  1.00 12.83  ? 52  GLU A CG  1 
ATOM   406  C  CD  . GLU A 1 56  ? 32.356 -7.892  12.107  1.00 23.46  ? 52  GLU A CD  1 
ATOM   407  O  OE1 . GLU A 1 56  ? 31.739 -7.423  13.090  1.00 19.11  ? 52  GLU A OE1 1 
ATOM   408  O  OE2 . GLU A 1 56  ? 33.566 -7.665  11.889  1.00 18.48  ? 52  GLU A OE2 1 
ATOM   409  N  N   . GLU A 1 57  ? 28.360 -11.677 12.140  1.00 10.49  ? 53  GLU A N   1 
ATOM   410  C  CA  . GLU A 1 57  ? 27.153 -12.205 12.805  1.00 8.96   ? 53  GLU A CA  1 
ATOM   411  C  C   . GLU A 1 57  ? 27.484 -12.394 14.274  1.00 11.52  ? 53  GLU A C   1 
ATOM   412  O  O   . GLU A 1 57  ? 28.520 -12.996 14.601  1.00 11.70  ? 53  GLU A O   1 
ATOM   413  C  CB  . GLU A 1 57  ? 26.696 -13.537 12.185  1.00 10.51  ? 53  GLU A CB  1 
ATOM   414  C  CG  . GLU A 1 57  ? 26.396 -13.472 10.683  1.00 12.04  ? 53  GLU A CG  1 
ATOM   415  C  CD  . GLU A 1 57  ? 25.875 -14.714 9.970   1.00 14.69  ? 53  GLU A CD  1 
ATOM   416  O  OE1 . GLU A 1 57  ? 25.552 -15.729 10.630  1.00 11.54  ? 53  GLU A OE1 1 
ATOM   417  O  OE2 . GLU A 1 57  ? 25.775 -14.655 8.723   1.00 17.06  ? 53  GLU A OE2 1 
ATOM   418  N  N   . VAL A 1 58  ? 26.625 -11.866 15.141  1.00 9.66   ? 54  VAL A N   1 
ATOM   419  C  CA  . VAL A 1 58  ? 26.811 -11.983 16.608  1.00 11.08  ? 54  VAL A CA  1 
ATOM   420  C  C   . VAL A 1 58  ? 25.886 -13.108 17.011  1.00 13.12  ? 54  VAL A C   1 
ATOM   421  O  O   . VAL A 1 58  ? 24.710 -13.081 16.637  1.00 13.13  ? 54  VAL A O   1 
ATOM   422  C  CB  . VAL A 1 58  ? 26.390 -10.694 17.379  1.00 17.49  ? 54  VAL A CB  1 
ATOM   423  C  CG1 . VAL A 1 58  ? 26.729 -10.793 18.876  1.00 18.67  ? 54  VAL A CG1 1 
ATOM   424  C  CG2 . VAL A 1 58  ? 26.966 -9.433  16.761  1.00 17.47  ? 54  VAL A CG2 1 
ATOM   425  N  N   . PHE A 1 59  ? 26.382 -14.061 17.831  1.00 9.96   ? 55  PHE A N   1 
ATOM   426  C  CA  . PHE A 1 59  ? 25.578 -15.172 18.312  1.00 8.99   ? 55  PHE A CA  1 
ATOM   427  C  C   . PHE A 1 59  ? 25.501 -15.087 19.823  1.00 13.09  ? 55  PHE A C   1 
ATOM   428  O  O   . PHE A 1 59  ? 26.492 -14.814 20.470  1.00 11.44  ? 55  PHE A O   1 
ATOM   429  C  CB  . PHE A 1 59  ? 26.245 -16.506 17.946  1.00 11.47  ? 55  PHE A CB  1 
ATOM   430  C  CG  . PHE A 1 59  ? 26.222 -16.806 16.470  1.00 12.85  ? 55  PHE A CG  1 
ATOM   431  C  CD1 . PHE A 1 59  ? 27.137 -16.210 15.610  1.00 12.80  ? 55  PHE A CD1 1 
ATOM   432  C  CD2 . PHE A 1 59  ? 25.299 -17.700 15.940  1.00 15.39  ? 55  PHE A CD2 1 
ATOM   433  C  CE1 . PHE A 1 59  ? 27.100 -16.465 14.238  1.00 13.45  ? 55  PHE A CE1 1 
ATOM   434  C  CE2 . PHE A 1 59  ? 25.272 -17.973 14.565  1.00 17.88  ? 55  PHE A CE2 1 
ATOM   435  C  CZ  . PHE A 1 59  ? 26.174 -17.349 13.724  1.00 16.19  ? 55  PHE A CZ  1 
ATOM   436  N  N   . TYR A 1 60  ? 24.327 -15.340 20.392  1.00 11.54  ? 56  TYR A N   1 
ATOM   437  C  CA  . TYR A 1 60  ? 24.247 -15.386 21.847  1.00 11.34  ? 56  TYR A CA  1 
ATOM   438  C  C   . TYR A 1 60  ? 23.230 -16.456 22.172  1.00 14.88  ? 56  TYR A C   1 
ATOM   439  O  O   . TYR A 1 60  ? 22.117 -16.415 21.649  1.00 15.27  ? 56  TYR A O   1 
ATOM   440  C  CB  . TYR A 1 60  ? 23.885 -14.018 22.439  1.00 10.34  ? 56  TYR A CB  1 
ATOM   441  C  CG  . TYR A 1 60  ? 23.489 -14.111 23.891  1.00 10.37  ? 56  TYR A CG  1 
ATOM   442  C  CD1 . TYR A 1 60  ? 24.452 -14.217 24.891  1.00 11.77  ? 56  TYR A CD1 1 
ATOM   443  C  CD2 . TYR A 1 60  ? 22.151 -14.208 24.260  1.00 11.22  ? 56  TYR A CD2 1 
ATOM   444  C  CE1 . TYR A 1 60  ? 24.087 -14.357 26.236  1.00 11.70  ? 56  TYR A CE1 1 
ATOM   445  C  CE2 . TYR A 1 60  ? 21.777 -14.369 25.590  1.00 11.86  ? 56  TYR A CE2 1 
ATOM   446  C  CZ  . TYR A 1 60  ? 22.743 -14.424 26.573  1.00 17.19  ? 56  TYR A CZ  1 
ATOM   447  O  OH  . TYR A 1 60  ? 22.330 -14.610 27.868  1.00 17.27  ? 56  TYR A OH  1 
ATOM   448  N  N   . GLN A 1 61  ? 23.592 -17.410 23.031  1.00 12.73  ? 57  GLN A N   1 
ATOM   449  C  CA  . GLN A 1 61  ? 22.629 -18.462 23.372  1.00 11.02  ? 57  GLN A CA  1 
ATOM   450  C  C   . GLN A 1 61  ? 21.774 -18.118 24.585  1.00 15.41  ? 57  GLN A C   1 
ATOM   451  O  O   . GLN A 1 61  ? 22.268 -18.097 25.717  1.00 13.94  ? 57  GLN A O   1 
ATOM   452  C  CB  . GLN A 1 61  ? 23.325 -19.820 23.528  1.00 12.08  ? 57  GLN A CB  1 
ATOM   453  C  CG  . GLN A 1 61  ? 23.671 -20.474 22.199  1.00 13.48  ? 57  GLN A CG  1 
ATOM   454  C  CD  . GLN A 1 61  ? 22.464 -20.642 21.301  1.00 20.97  ? 57  GLN A CD  1 
ATOM   455  O  OE1 . GLN A 1 61  ? 22.396 -20.061 20.216  1.00 16.88  ? 57  GLN A OE1 1 
ATOM   456  N  NE2 . GLN A 1 61  ? 21.513 -21.473 21.704  1.00 11.84  ? 57  GLN A NE2 1 
ATOM   457  N  N   . LEU A 1 62  ? 20.489 -17.839 24.347  1.00 12.47  ? 58  LEU A N   1 
ATOM   458  C  CA  A LEU A 1 62  ? 19.535 -17.530 25.420  0.50 13.91  ? 58  LEU A CA  1 
ATOM   459  C  CA  B LEU A 1 62  ? 19.545 -17.514 25.411  0.50 13.00  ? 58  LEU A CA  1 
ATOM   460  C  C   . LEU A 1 62  ? 19.149 -18.806 26.147  1.00 16.51  ? 58  LEU A C   1 
ATOM   461  O  O   . LEU A 1 62  ? 19.171 -18.846 27.390  1.00 14.17  ? 58  LEU A O   1 
ATOM   462  C  CB  A LEU A 1 62  ? 18.242 -16.903 24.855  0.50 14.63  ? 58  LEU A CB  1 
ATOM   463  C  CB  B LEU A 1 62  ? 18.295 -16.838 24.785  0.50 12.87  ? 58  LEU A CB  1 
ATOM   464  C  CG  A LEU A 1 62  ? 18.260 -15.418 24.578  0.50 19.65  ? 58  LEU A CG  1 
ATOM   465  C  CG  B LEU A 1 62  ? 17.277 -16.192 25.722  0.50 15.80  ? 58  LEU A CG  1 
ATOM   466  C  CD1 A LEU A 1 62  ? 18.680 -15.155 23.173  0.50 19.94  ? 58  LEU A CD1 1 
ATOM   467  C  CD1 B LEU A 1 62  ? 17.757 -14.821 26.205  0.50 15.50  ? 58  LEU A CD1 1 
ATOM   468  C  CD2 A LEU A 1 62  ? 16.889 -14.834 24.794  0.50 21.48  ? 58  LEU A CD2 1 
ATOM   469  C  CD2 B LEU A 1 62  ? 15.941 -16.008 25.002  0.50 16.24  ? 58  LEU A CD2 1 
ATOM   470  N  N   . GLU A 1 63  ? 18.783 -19.852 25.384  1.00 13.71  ? 59  GLU A N   1 
ATOM   471  C  CA  . GLU A 1 63  ? 18.363 -21.118 25.985  1.00 14.19  ? 59  GLU A CA  1 
ATOM   472  C  C   . GLU A 1 63  ? 19.056 -22.279 25.304  1.00 16.83  ? 59  GLU A C   1 
ATOM   473  O  O   . GLU A 1 63  ? 18.920 -22.453 24.098  1.00 15.64  ? 59  GLU A O   1 
ATOM   474  C  CB  . GLU A 1 63  ? 16.831 -21.316 25.841  1.00 15.78  ? 59  GLU A CB  1 
ATOM   475  C  CG  . GLU A 1 63  ? 15.956 -20.273 26.508  1.00 22.52  ? 59  GLU A CG  1 
ATOM   476  C  CD  . GLU A 1 63  ? 14.468 -20.471 26.247  1.00 40.63  ? 59  GLU A CD  1 
ATOM   477  O  OE1 . GLU A 1 63  ? 14.076 -21.546 25.741  1.00 35.04  ? 59  GLU A OE1 1 
ATOM   478  O  OE2 . GLU A 1 63  ? 13.690 -19.543 26.557  1.00 33.20  ? 59  GLU A OE2 1 
ATOM   479  N  N   . GLY A 1 64  ? 19.797 -23.058 26.069  1.00 13.62  ? 60  GLY A N   1 
ATOM   480  C  CA  . GLY A 1 64  ? 20.502 -24.202 25.511  1.00 13.08  ? 60  GLY A CA  1 
ATOM   481  C  C   . GLY A 1 64  ? 21.725 -23.853 24.678  1.00 16.37  ? 60  GLY A C   1 
ATOM   482  O  O   . GLY A 1 64  ? 22.072 -22.684 24.517  1.00 17.23  ? 60  GLY A O   1 
ATOM   483  N  N   . ASP A 1 65  ? 22.390 -24.887 24.147  1.00 12.59  ? 61  ASP A N   1 
ATOM   484  C  CA  . ASP A 1 65  ? 23.654 -24.735 23.435  1.00 12.10  ? 61  ASP A CA  1 
ATOM   485  C  C   . ASP A 1 65  ? 23.422 -24.912 21.940  1.00 15.48  ? 61  ASP A C   1 
ATOM   486  O  O   . ASP A 1 65  ? 22.393 -25.458 21.536  1.00 14.55  ? 61  ASP A O   1 
ATOM   487  C  CB  . ASP A 1 65  ? 24.628 -25.840 23.906  1.00 13.56  ? 61  ASP A CB  1 
ATOM   488  C  CG  . ASP A 1 65  ? 24.863 -25.943 25.408  1.00 20.59  ? 61  ASP A CG  1 
ATOM   489  O  OD1 . ASP A 1 65  ? 24.586 -24.964 26.123  1.00 17.58  ? 61  ASP A OD1 1 
ATOM   490  O  OD2 . ASP A 1 65  ? 25.331 -27.006 25.859  1.00 21.48  ? 61  ASP A OD2 1 
ATOM   491  N  N   . MET A 1 66  ? 24.377 -24.450 21.129  1.00 12.88  ? 62  MET A N   1 
ATOM   492  C  CA  . MET A 1 66  ? 24.364 -24.674 19.673  1.00 12.71  ? 62  MET A CA  1 
ATOM   493  C  C   . MET A 1 66  ? 25.809 -24.937 19.260  1.00 15.00  ? 62  MET A C   1 
ATOM   494  O  O   . MET A 1 66  ? 26.732 -24.774 20.074  1.00 13.44  ? 62  MET A O   1 
ATOM   495  C  CB  . MET A 1 66  ? 23.763 -23.471 18.916  1.00 14.61  ? 62  MET A CB  1 
ATOM   496  C  CG  . MET A 1 66  ? 24.634 -22.232 19.016  1.00 19.39  ? 62  MET A CG  1 
ATOM   497  S  SD  . MET A 1 66  ? 24.441 -20.997 17.723  1.00 24.49  ? 62  MET A SD  1 
ATOM   498  C  CE  . MET A 1 66  ? 24.689 -21.968 16.171  1.00 19.74  ? 62  MET A CE  1 
ATOM   499  N  N   . VAL A 1 67  ? 26.007 -25.420 18.026  1.00 11.54  ? 63  VAL A N   1 
ATOM   500  C  CA  . VAL A 1 67  ? 27.351 -25.659 17.510  1.00 12.92  ? 63  VAL A CA  1 
ATOM   501  C  C   . VAL A 1 67  ? 27.439 -24.914 16.190  1.00 15.63  ? 63  VAL A C   1 
ATOM   502  O  O   . VAL A 1 67  ? 26.613 -25.146 15.323  1.00 14.09  ? 63  VAL A O   1 
ATOM   503  C  CB  . VAL A 1 67  ? 27.717 -27.176 17.362  1.00 16.17  ? 63  VAL A CB  1 
ATOM   504  C  CG1 . VAL A 1 67  ? 29.059 -27.360 16.645  1.00 16.12  ? 63  VAL A CG1 1 
ATOM   505  C  CG2 . VAL A 1 67  ? 27.748 -27.869 18.728  1.00 17.20  ? 63  VAL A CG2 1 
ATOM   506  N  N   . LEU A 1 68  ? 28.369 -23.974 16.075  1.00 13.52  ? 64  LEU A N   1 
ATOM   507  C  CA  . LEU A 1 68  ? 28.593 -23.265 14.812  1.00 13.99  ? 64  LEU A CA  1 
ATOM   508  C  C   . LEU A 1 68  ? 29.798 -23.895 14.119  1.00 17.57  ? 64  LEU A C   1 
ATOM   509  O  O   . LEU A 1 68  ? 30.922 -23.759 14.598  1.00 17.90  ? 64  LEU A O   1 
ATOM   510  C  CB  . LEU A 1 68  ? 28.823 -21.747 15.047  1.00 14.14  ? 64  LEU A CB  1 
ATOM   511  C  CG  . LEU A 1 68  ? 28.906 -20.908 13.766  1.00 16.73  ? 64  LEU A CG  1 
ATOM   512  C  CD1 . LEU A 1 68  ? 27.549 -20.805 13.079  1.00 15.98  ? 64  LEU A CD1 1 
ATOM   513  C  CD2 . LEU A 1 68  ? 29.432 -19.550 14.058  1.00 18.03  ? 64  LEU A CD2 1 
ATOM   514  N  N   . ARG A 1 69  ? 29.566 -24.640 13.031  1.00 13.95  ? 65  ARG A N   1 
ATOM   515  C  CA  . ARG A 1 69  ? 30.664 -25.251 12.277  1.00 13.26  ? 65  ARG A CA  1 
ATOM   516  C  C   . ARG A 1 69  ? 31.249 -24.133 11.403  1.00 18.25  ? 65  ARG A C   1 
ATOM   517  O  O   . ARG A 1 69  ? 30.493 -23.407 10.785  1.00 18.19  ? 65  ARG A O   1 
ATOM   518  C  CB  . ARG A 1 69  ? 30.162 -26.399 11.385  1.00 13.34  ? 65  ARG A CB  1 
ATOM   519  C  CG  . ARG A 1 69  ? 29.444 -27.535 12.134  1.00 19.54  ? 65  ARG A CG  1 
ATOM   520  C  CD  . ARG A 1 69  ? 29.642 -28.871 11.413  1.00 19.04  ? 65  ARG A CD  1 
ATOM   521  N  NE  . ARG A 1 69  ? 28.682 -29.882 11.864  1.00 30.76  ? 65  ARG A NE  1 
ATOM   522  C  CZ  . ARG A 1 69  ? 28.776 -30.571 12.998  1.00 47.42  ? 65  ARG A CZ  1 
ATOM   523  N  NH1 . ARG A 1 69  ? 27.852 -31.473 13.308  1.00 37.29  ? 65  ARG A NH1 1 
ATOM   524  N  NH2 . ARG A 1 69  ? 29.780 -30.353 13.839  1.00 29.59  ? 65  ARG A NH2 1 
ATOM   525  N  N   . VAL A 1 70  ? 32.580 -23.967 11.380  1.00 14.42  ? 66  VAL A N   1 
ATOM   526  C  CA  . VAL A 1 70  ? 33.216 -22.922 10.602  1.00 13.16  ? 66  VAL A CA  1 
ATOM   527  C  C   . VAL A 1 70  ? 34.325 -23.510 9.770   1.00 17.01  ? 66  VAL A C   1 
ATOM   528  O  O   . VAL A 1 70  ? 34.847 -24.595 10.095  1.00 17.01  ? 66  VAL A O   1 
ATOM   529  C  CB  . VAL A 1 70  ? 33.743 -21.722 11.454  1.00 17.31  ? 66  VAL A CB  1 
ATOM   530  C  CG1 . VAL A 1 70  ? 32.607 -20.910 12.114  1.00 16.18  ? 66  VAL A CG1 1 
ATOM   531  C  CG2 . VAL A 1 70  ? 34.797 -22.173 12.481  1.00 17.29  ? 66  VAL A CG2 1 
ATOM   532  N  N   . LEU A 1 71  ? 34.716 -22.777 8.723   1.00 13.25  ? 67  LEU A N   1 
ATOM   533  C  CA  . LEU A 1 71  ? 35.884 -23.116 7.925   1.00 15.32  ? 67  LEU A CA  1 
ATOM   534  C  C   . LEU A 1 71  ? 36.867 -22.015 8.264   1.00 20.05  ? 67  LEU A C   1 
ATOM   535  O  O   . LEU A 1 71  ? 36.596 -20.847 8.005   1.00 18.91  ? 67  LEU A O   1 
ATOM   536  C  CB  . LEU A 1 71  ? 35.577 -23.168 6.432   1.00 15.78  ? 67  LEU A CB  1 
ATOM   537  C  CG  . LEU A 1 71  ? 34.533 -24.215 5.999   1.00 21.59  ? 67  LEU A CG  1 
ATOM   538  C  CD1 . LEU A 1 71  ? 34.617 -24.401 4.529   1.00 22.95  ? 67  LEU A CD1 1 
ATOM   539  C  CD2 . LEU A 1 71  ? 34.765 -25.587 6.668   1.00 23.29  ? 67  LEU A CD2 1 
ATOM   540  N  N   . GLU A 1 72  ? 37.970 -22.384 8.923   1.00 15.11  ? 68  GLU A N   1 
ATOM   541  C  CA  . GLU A 1 72  ? 38.915 -21.392 9.435   1.00 14.88  ? 68  GLU A CA  1 
ATOM   542  C  C   . GLU A 1 72  ? 40.305 -21.778 9.044   1.00 20.11  ? 68  GLU A C   1 
ATOM   543  O  O   . GLU A 1 72  ? 40.769 -22.863 9.425   1.00 18.20  ? 68  GLU A O   1 
ATOM   544  C  CB  . GLU A 1 72  ? 38.807 -21.356 10.985  1.00 16.30  ? 68  GLU A CB  1 
ATOM   545  C  CG  . GLU A 1 72  ? 39.841 -20.506 11.730  1.00 25.94  ? 68  GLU A CG  1 
ATOM   546  C  CD  . GLU A 1 72  ? 39.857 -20.704 13.240  1.00 42.70  ? 68  GLU A CD  1 
ATOM   547  O  OE1 . GLU A 1 72  ? 39.219 -21.669 13.721  1.00 49.40  ? 68  GLU A OE1 1 
ATOM   548  O  OE2 . GLU A 1 72  ? 40.501 -19.896 13.946  1.00 27.66  ? 68  GLU A OE2 1 
ATOM   549  N  N   . GLN A 1 73  ? 40.972 -20.880 8.303   1.00 20.20  ? 69  GLN A N   1 
ATOM   550  C  CA  . GLN A 1 73  ? 42.368 -21.007 7.858   1.00 20.04  ? 69  GLN A CA  1 
ATOM   551  C  C   . GLN A 1 73  ? 42.676 -22.408 7.322   1.00 24.56  ? 69  GLN A C   1 
ATOM   552  O  O   . GLN A 1 73  ? 43.664 -23.013 7.702   1.00 24.77  ? 69  GLN A O   1 
ATOM   553  C  CB  . GLN A 1 73  ? 43.321 -20.595 9.008   1.00 21.27  ? 69  GLN A CB  1 
ATOM   554  C  CG  . GLN A 1 73  ? 42.918 -19.285 9.681   1.00 29.45  ? 69  GLN A CG  1 
ATOM   555  C  CD  . GLN A 1 73  ? 43.832 -18.858 10.800  1.00 38.36  ? 69  GLN A CD  1 
ATOM   556  O  OE1 . GLN A 1 73  ? 44.176 -19.633 11.700  1.00 30.60  ? 69  GLN A OE1 1 
ATOM   557  N  NE2 . GLN A 1 73  ? 44.128 -17.573 10.829  1.00 26.96  ? 69  GLN A NE2 1 
ATOM   558  N  N   . GLY A 1 74  ? 41.789 -22.927 6.477   1.00 20.15  ? 70  GLY A N   1 
ATOM   559  C  CA  . GLY A 1 74  ? 41.952 -24.232 5.849   1.00 19.96  ? 70  GLY A CA  1 
ATOM   560  C  C   . GLY A 1 74  ? 41.497 -25.431 6.657   1.00 24.94  ? 70  GLY A C   1 
ATOM   561  O  O   . GLY A 1 74  ? 41.641 -26.562 6.202   1.00 26.55  ? 70  GLY A O   1 
ATOM   562  N  N   . LYS A 1 75  ? 40.927 -25.213 7.840   1.00 20.00  ? 71  LYS A N   1 
ATOM   563  C  CA  . LYS A 1 75  ? 40.487 -26.307 8.708   1.00 19.20  ? 71  LYS A CA  1 
ATOM   564  C  C   . LYS A 1 75  ? 38.988 -26.250 9.029   1.00 22.48  ? 71  LYS A C   1 
ATOM   565  O  O   . LYS A 1 75  ? 38.385 -25.176 8.989   1.00 20.25  ? 71  LYS A O   1 
ATOM   566  C  CB  . LYS A 1 75  ? 41.285 -26.281 10.024  1.00 20.70  ? 71  LYS A CB  1 
ATOM   567  C  CG  . LYS A 1 75  ? 42.778 -26.563 9.824   1.00 37.63  ? 71  LYS A CG  1 
ATOM   568  C  CD  . LYS A 1 75  ? 43.496 -26.821 11.130  1.00 53.14  ? 71  LYS A CD  1 
ATOM   569  N  N   . HIS A 1 76  ? 38.401 -27.406 9.355   1.00 20.37  ? 72  HIS A N   1 
ATOM   570  C  CA  . HIS A 1 76  ? 37.024 -27.518 9.833   1.00 21.87  ? 72  HIS A CA  1 
ATOM   571  C  C   . HIS A 1 76  ? 37.128 -27.320 11.331  1.00 24.34  ? 72  HIS A C   1 
ATOM   572  O  O   . HIS A 1 76  ? 38.038 -27.873 11.971  1.00 23.71  ? 72  HIS A O   1 
ATOM   573  C  CB  . HIS A 1 76  ? 36.424 -28.926 9.569   1.00 23.72  ? 72  HIS A CB  1 
ATOM   574  C  CG  . HIS A 1 76  ? 36.156 -29.199 8.125   1.00 28.22  ? 72  HIS A CG  1 
ATOM   575  N  ND1 . HIS A 1 76  ? 34.933 -28.904 7.551   1.00 30.64  ? 72  HIS A ND1 1 
ATOM   576  C  CD2 . HIS A 1 76  ? 36.965 -29.738 7.184   1.00 31.22  ? 72  HIS A CD2 1 
ATOM   577  C  CE1 . HIS A 1 76  ? 35.051 -29.223 6.269   1.00 31.02  ? 72  HIS A CE1 1 
ATOM   578  N  NE2 . HIS A 1 76  ? 36.252 -29.742 6.005   1.00 31.69  ? 72  HIS A NE2 1 
ATOM   579  N  N   . ARG A 1 77  ? 36.255 -26.490 11.894  1.00 17.49  ? 73  ARG A N   1 
ATOM   580  C  CA  . ARG A 1 77  ? 36.241 -26.301 13.331  1.00 17.29  ? 73  ARG A CA  1 
ATOM   581  C  C   . ARG A 1 77  ? 34.808 -26.200 13.808  1.00 22.02  ? 73  ARG A C   1 
ATOM   582  O  O   . ARG A 1 77  ? 33.978 -25.594 13.130  1.00 22.10  ? 73  ARG A O   1 
ATOM   583  C  CB  . ARG A 1 77  ? 37.055 -25.063 13.744  1.00 20.35  ? 73  ARG A CB  1 
ATOM   584  N  N   . ASP A 1 78  ? 34.509 -26.795 14.968  1.00 17.44  ? 74  ASP A N   1 
ATOM   585  C  CA  . ASP A 1 78  ? 33.195 -26.708 15.586  1.00 17.03  ? 74  ASP A CA  1 
ATOM   586  C  C   . ASP A 1 78  ? 33.327 -25.757 16.733  1.00 22.67  ? 74  ASP A C   1 
ATOM   587  O  O   . ASP A 1 78  ? 34.095 -26.013 17.663  1.00 23.22  ? 74  ASP A O   1 
ATOM   588  C  CB  . ASP A 1 78  ? 32.713 -28.070 16.125  1.00 18.93  ? 74  ASP A CB  1 
ATOM   589  C  CG  . ASP A 1 78  ? 32.510 -29.146 15.089  1.00 27.57  ? 74  ASP A CG  1 
ATOM   590  O  OD1 . ASP A 1 78  ? 32.193 -28.803 13.931  1.00 27.31  ? 74  ASP A OD1 1 
ATOM   591  O  OD2 . ASP A 1 78  ? 32.505 -30.333 15.468  1.00 32.63  ? 74  ASP A OD2 1 
ATOM   592  N  N   . VAL A 1 79  ? 32.568 -24.659 16.681  1.00 18.05  ? 75  VAL A N   1 
ATOM   593  C  CA  . VAL A 1 79  ? 32.565 -23.642 17.715  1.00 16.54  ? 75  VAL A CA  1 
ATOM   594  C  C   . VAL A 1 79  ? 31.326 -23.948 18.562  1.00 17.23  ? 75  VAL A C   1 
ATOM   595  O  O   . VAL A 1 79  ? 30.203 -23.730 18.129  1.00 16.98  ? 75  VAL A O   1 
ATOM   596  C  CB  . VAL A 1 79  ? 32.549 -22.194 17.124  1.00 20.08  ? 75  VAL A CB  1 
ATOM   597  C  CG1 . VAL A 1 79  ? 32.610 -21.144 18.228  1.00 20.24  ? 75  VAL A CG1 1 
ATOM   598  C  CG2 . VAL A 1 79  ? 33.692 -21.974 16.123  1.00 19.31  ? 75  VAL A CG2 1 
ATOM   599  N  N   . VAL A 1 80  ? 31.531 -24.474 19.756  1.00 13.23  ? 76  VAL A N   1 
ATOM   600  C  CA  . VAL A 1 80  ? 30.435 -24.776 20.649  1.00 13.55  ? 76  VAL A CA  1 
ATOM   601  C  C   . VAL A 1 80  ? 30.011 -23.489 21.345  1.00 14.96  ? 76  VAL A C   1 
ATOM   602  O  O   . VAL A 1 80  ? 30.841 -22.824 21.952  1.00 16.02  ? 76  VAL A O   1 
ATOM   603  C  CB  . VAL A 1 80  ? 30.740 -25.933 21.645  1.00 18.41  ? 76  VAL A CB  1 
ATOM   604  C  CG1 . VAL A 1 80  ? 29.540 -26.181 22.566  1.00 17.66  ? 76  VAL A CG1 1 
ATOM   605  C  CG2 . VAL A 1 80  ? 31.092 -27.220 20.887  1.00 18.98  ? 76  VAL A CG2 1 
ATOM   606  N  N   . ILE A 1 81  ? 28.738 -23.100 21.214  1.00 12.00  ? 77  ILE A N   1 
ATOM   607  C  CA  . ILE A 1 81  ? 28.266 -21.871 21.882  1.00 11.91  ? 77  ILE A CA  1 
ATOM   608  C  C   . ILE A 1 81  ? 27.293 -22.338 22.932  1.00 15.08  ? 77  ILE A C   1 
ATOM   609  O  O   . ILE A 1 81  ? 26.163 -22.680 22.597  1.00 15.17  ? 77  ILE A O   1 
ATOM   610  C  CB  . ILE A 1 81  ? 27.659 -20.796 20.918  1.00 14.09  ? 77  ILE A CB  1 
ATOM   611  C  CG1 . ILE A 1 81  ? 28.653 -20.435 19.776  1.00 15.00  ? 77  ILE A CG1 1 
ATOM   612  C  CG2 . ILE A 1 81  ? 27.275 -19.522 21.729  1.00 13.29  ? 77  ILE A CG2 1 
ATOM   613  C  CD1 . ILE A 1 81  ? 28.013 -19.685 18.608  1.00 12.33  ? 77  ILE A CD1 1 
ATOM   614  N  N   . ARG A 1 82  ? 27.729 -22.359 24.210  1.00 11.85  ? 78  ARG A N   1 
ATOM   615  C  CA  A ARG A 1 82  ? 26.904 -22.814 25.330  0.50 10.81  ? 78  ARG A CA  1 
ATOM   616  C  CA  B ARG A 1 82  ? 26.882 -22.829 25.297  0.50 10.90  ? 78  ARG A CA  1 
ATOM   617  C  C   . ARG A 1 82  ? 25.885 -21.769 25.770  1.00 14.33  ? 78  ARG A C   1 
ATOM   618  O  O   . ARG A 1 82  ? 26.064 -20.575 25.504  1.00 12.19  ? 78  ARG A O   1 
ATOM   619  C  CB  A ARG A 1 82  ? 27.794 -23.209 26.531  0.50 11.73  ? 78  ARG A CB  1 
ATOM   620  C  CB  B ARG A 1 82  ? 27.749 -23.378 26.453  0.50 12.68  ? 78  ARG A CB  1 
ATOM   621  C  CG  A ARG A 1 82  ? 28.880 -24.214 26.154  0.50 19.94  ? 78  ARG A CG  1 
ATOM   622  C  CG  B ARG A 1 82  ? 28.370 -24.740 26.104  0.50 17.46  ? 78  ARG A CG  1 
ATOM   623  C  CD  A ARG A 1 82  ? 29.262 -25.154 27.277  0.50 37.71  ? 78  ARG A CD  1 
ATOM   624  C  CD  B ARG A 1 82  ? 29.656 -25.025 26.857  0.50 33.51  ? 78  ARG A CD  1 
ATOM   625  N  NE  A ARG A 1 82  ? 29.099 -26.561 26.886  0.50 44.31  ? 78  ARG A NE  1 
ATOM   626  N  NE  B ARG A 1 82  ? 30.437 -26.090 26.208  0.50 39.17  ? 78  ARG A NE  1 
ATOM   627  C  CZ  A ARG A 1 82  ? 29.992 -27.259 26.186  0.50 51.06  ? 78  ARG A CZ  1 
ATOM   628  C  CZ  B ARG A 1 82  ? 31.706 -25.955 25.825  0.50 49.75  ? 78  ARG A CZ  1 
ATOM   629  N  NH1 A ARG A 1 82  ? 31.121 -26.697 25.778  0.50 48.50  ? 78  ARG A NH1 1 
ATOM   630  N  NH1 B ARG A 1 82  ? 32.357 -24.825 26.020  0.50 34.31  ? 78  ARG A NH1 1 
ATOM   631  N  NH2 A ARG A 1 82  ? 29.755 -28.531 25.891  0.50 23.77  ? 78  ARG A NH2 1 
ATOM   632  N  NH2 B ARG A 1 82  ? 32.334 -26.975 25.241  0.50 34.82  ? 78  ARG A NH2 1 
ATOM   633  N  N   . GLN A 1 83  ? 24.818 -22.186 26.491  1.00 10.76  ? 79  GLN A N   1 
ATOM   634  C  CA  . GLN A 1 83  ? 23.860 -21.194 26.999  1.00 11.65  ? 79  GLN A CA  1 
ATOM   635  C  C   . GLN A 1 83  ? 24.631 -20.078 27.765  1.00 16.02  ? 79  GLN A C   1 
ATOM   636  O  O   . GLN A 1 83  ? 25.578 -20.381 28.515  1.00 16.45  ? 79  GLN A O   1 
ATOM   637  C  CB  . GLN A 1 83  ? 22.882 -21.872 27.961  1.00 11.87  ? 79  GLN A CB  1 
ATOM   638  C  CG  . GLN A 1 83  ? 21.835 -20.911 28.509  1.00 9.13   ? 79  GLN A CG  1 
ATOM   639  C  CD  . GLN A 1 83  ? 20.844 -21.667 29.320  1.00 17.58  ? 79  GLN A CD  1 
ATOM   640  O  OE1 . GLN A 1 83  ? 20.069 -22.464 28.799  1.00 15.81  ? 79  GLN A OE1 1 
ATOM   641  N  NE2 . GLN A 1 83  ? 20.888 -21.469 30.619  1.00 15.16  ? 79  GLN A NE2 1 
ATOM   642  N  N   . GLY A 1 84  ? 24.256 -18.828 27.538  1.00 12.07  ? 80  GLY A N   1 
ATOM   643  C  CA  . GLY A 1 84  ? 24.873 -17.674 28.187  1.00 12.44  ? 80  GLY A CA  1 
ATOM   644  C  C   . GLY A 1 84  ? 26.156 -17.176 27.544  1.00 14.00  ? 80  GLY A C   1 
ATOM   645  O  O   . GLY A 1 84  ? 26.726 -16.188 28.002  1.00 11.85  ? 80  GLY A O   1 
ATOM   646  N  N   . GLU A 1 85  ? 26.601 -17.845 26.464  1.00 11.30  ? 81  GLU A N   1 
ATOM   647  C  CA  . GLU A 1 85  ? 27.833 -17.496 25.762  1.00 10.65  ? 81  GLU A CA  1 
ATOM   648  C  C   . GLU A 1 85  ? 27.514 -16.628 24.583  1.00 14.43  ? 81  GLU A C   1 
ATOM   649  O  O   . GLU A 1 85  ? 26.489 -16.828 23.947  1.00 12.53  ? 81  GLU A O   1 
ATOM   650  C  CB  . GLU A 1 85  ? 28.628 -18.741 25.305  1.00 11.82  ? 81  GLU A CB  1 
ATOM   651  C  CG  . GLU A 1 85  ? 29.313 -19.458 26.469  1.00 15.47  ? 81  GLU A CG  1 
ATOM   652  C  CD  . GLU A 1 85  ? 30.237 -20.618 26.139  1.00 27.32  ? 81  GLU A CD  1 
ATOM   653  O  OE1 . GLU A 1 85  ? 30.188 -21.147 25.006  1.00 15.29  ? 81  GLU A OE1 1 
ATOM   654  O  OE2 . GLU A 1 85  ? 30.990 -21.028 27.046  1.00 23.76  ? 81  GLU A OE2 1 
ATOM   655  N  N   . ILE A 1 86  ? 28.381 -15.636 24.342  1.00 11.04  ? 82  ILE A N   1 
ATOM   656  C  CA  . ILE A 1 86  ? 28.312 -14.699 23.237  1.00 10.12  ? 82  ILE A CA  1 
ATOM   657  C  C   . ILE A 1 86  ? 29.528 -14.913 22.363  1.00 13.88  ? 82  ILE A C   1 
ATOM   658  O  O   . ILE A 1 86  ? 30.623 -15.223 22.852  1.00 11.09  ? 82  ILE A O   1 
ATOM   659  C  CB  . ILE A 1 86  ? 28.161 -13.224 23.745  1.00 11.79  ? 82  ILE A CB  1 
ATOM   660  C  CG1 . ILE A 1 86  ? 27.748 -12.297 22.566  1.00 13.55  ? 82  ILE A CG1 1 
ATOM   661  C  CG2 . ILE A 1 86  ? 29.438 -12.698 24.514  1.00 9.68   ? 82  ILE A CG2 1 
ATOM   662  C  CD1 . ILE A 1 86  ? 27.090 -10.902 22.981  1.00 14.83  ? 82  ILE A CD1 1 
ATOM   663  N  N   . PHE A 1 87  ? 29.347 -14.721 21.051  1.00 11.32  ? 83  PHE A N   1 
ATOM   664  C  CA  . PHE A 1 87  ? 30.403 -15.020 20.113  1.00 9.69   ? 83  PHE A CA  1 
ATOM   665  C  C   . PHE A 1 87  ? 30.195 -14.126 18.887  1.00 13.17  ? 83  PHE A C   1 
ATOM   666  O  O   . PHE A 1 87  ? 29.061 -13.918 18.487  1.00 12.20  ? 83  PHE A O   1 
ATOM   667  C  CB  . PHE A 1 87  ? 30.302 -16.527 19.725  1.00 10.25  ? 83  PHE A CB  1 
ATOM   668  C  CG  . PHE A 1 87  ? 31.102 -16.912 18.500  1.00 10.16  ? 83  PHE A CG  1 
ATOM   669  C  CD1 . PHE A 1 87  ? 32.479 -17.074 18.574  1.00 12.91  ? 83  PHE A CD1 1 
ATOM   670  C  CD2 . PHE A 1 87  ? 30.488 -17.015 17.249  1.00 11.38  ? 83  PHE A CD2 1 
ATOM   671  C  CE1 . PHE A 1 87  ? 33.223 -17.393 17.430  1.00 14.62  ? 83  PHE A CE1 1 
ATOM   672  C  CE2 . PHE A 1 87  ? 31.233 -17.321 16.108  1.00 14.44  ? 83  PHE A CE2 1 
ATOM   673  C  CZ  . PHE A 1 87  ? 32.599 -17.492 16.200  1.00 12.60  ? 83  PHE A CZ  1 
ATOM   674  N  N   . LEU A 1 88  ? 31.283 -13.570 18.340  1.00 9.69   ? 84  LEU A N   1 
ATOM   675  C  CA  . LEU A 1 88  ? 31.241 -12.741 17.143  1.00 9.69   ? 84  LEU A CA  1 
ATOM   676  C  C   . LEU A 1 88  ? 31.961 -13.399 15.988  1.00 15.30  ? 84  LEU A C   1 
ATOM   677  O  O   . LEU A 1 88  ? 33.143 -13.758 16.098  1.00 14.92  ? 84  LEU A O   1 
ATOM   678  C  CB  . LEU A 1 88  ? 31.799 -11.317 17.406  1.00 10.38  ? 84  LEU A CB  1 
ATOM   679  C  CG  . LEU A 1 88  ? 31.778 -10.341 16.201  1.00 14.55  ? 84  LEU A CG  1 
ATOM   680  C  CD1 . LEU A 1 88  ? 30.331 -10.082 15.723  1.00 15.30  ? 84  LEU A CD1 1 
ATOM   681  C  CD2 . LEU A 1 88  ? 32.405 -9.003  16.584  1.00 15.57  ? 84  LEU A CD2 1 
ATOM   682  N  N   . LEU A 1 89  ? 31.250 -13.552 14.858  1.00 12.59  ? 85  LEU A N   1 
ATOM   683  C  CA  . LEU A 1 89  ? 31.840 -14.142 13.667  1.00 11.28  ? 85  LEU A CA  1 
ATOM   684  C  C   . LEU A 1 89  ? 32.301 -13.053 12.718  1.00 14.83  ? 85  LEU A C   1 
ATOM   685  O  O   . LEU A 1 89  ? 31.498 -12.209 12.324  1.00 15.08  ? 85  LEU A O   1 
ATOM   686  C  CB  . LEU A 1 89  ? 30.846 -15.085 12.958  1.00 10.74  ? 85  LEU A CB  1 
ATOM   687  C  CG  . LEU A 1 89  ? 31.446 -15.833 11.790  1.00 13.08  ? 85  LEU A CG  1 
ATOM   688  C  CD1 . LEU A 1 89  ? 32.291 -17.031 12.280  1.00 13.83  ? 85  LEU A CD1 1 
ATOM   689  C  CD2 . LEU A 1 89  ? 30.364 -16.262 10.861  1.00 14.63  ? 85  LEU A CD2 1 
ATOM   690  N  N   . PRO A 1 90  ? 33.590 -13.017 12.335  1.00 13.64  ? 86  PRO A N   1 
ATOM   691  C  CA  . PRO A 1 90  ? 34.008 -11.984 11.379  1.00 13.73  ? 86  PRO A CA  1 
ATOM   692  C  C   . PRO A 1 90  ? 33.416 -12.228 9.985   1.00 15.79  ? 86  PRO A C   1 
ATOM   693  O  O   . PRO A 1 90  ? 32.828 -13.274 9.693   1.00 13.30  ? 86  PRO A O   1 
ATOM   694  C  CB  . PRO A 1 90  ? 35.550 -12.048 11.387  1.00 16.36  ? 86  PRO A CB  1 
ATOM   695  C  CG  . PRO A 1 90  ? 35.914 -13.346 11.987  1.00 21.21  ? 86  PRO A CG  1 
ATOM   696  C  CD  . PRO A 1 90  ? 34.695 -13.957 12.667  1.00 17.15  ? 86  PRO A CD  1 
ATOM   697  N  N   . ALA A 1 91  ? 33.515 -11.205 9.155   1.00 13.48  ? 87  ALA A N   1 
ATOM   698  C  CA  . ALA A 1 91  ? 33.000 -11.210 7.796   1.00 12.31  ? 87  ALA A CA  1 
ATOM   699  C  C   . ALA A 1 91  ? 33.697 -12.275 6.981   1.00 13.58  ? 87  ALA A C   1 
ATOM   700  O  O   . ALA A 1 91  ? 34.878 -12.535 7.162   1.00 12.93  ? 87  ALA A O   1 
ATOM   701  C  CB  . ALA A 1 91  ? 33.258 -9.844  7.166   1.00 13.00  ? 87  ALA A CB  1 
ATOM   702  N  N   . ARG A 1 92  ? 32.933 -12.919 6.097   1.00 11.54  ? 88  ARG A N   1 
ATOM   703  C  CA  . ARG A 1 92  ? 33.378 -13.796 5.023   1.00 10.23  ? 88  ARG A CA  1 
ATOM   704  C  C   . ARG A 1 92  ? 33.962 -15.161 5.482   1.00 14.19  ? 88  ARG A C   1 
ATOM   705  O  O   . ARG A 1 92  ? 34.652 -15.842 4.726   1.00 14.15  ? 88  ARG A O   1 
ATOM   706  C  CB  . ARG A 1 92  ? 34.338 -13.017 4.089   1.00 9.75   ? 88  ARG A CB  1 
ATOM   707  C  CG  . ARG A 1 92  ? 33.681 -11.760 3.468   1.00 17.55  ? 88  ARG A CG  1 
ATOM   708  C  CD  . ARG A 1 92  ? 34.707 -10.864 2.761   1.00 16.71  ? 88  ARG A CD  1 
ATOM   709  N  NE  . ARG A 1 92  ? 35.387 -10.000 3.721   1.00 20.81  ? 88  ARG A NE  1 
ATOM   710  C  CZ  . ARG A 1 92  ? 36.658 -10.119 4.095   1.00 25.87  ? 88  ARG A CZ  1 
ATOM   711  N  NH1 . ARG A 1 92  ? 37.413 -11.083 3.586   1.00 16.29  ? 88  ARG A NH1 1 
ATOM   712  N  NH2 . ARG A 1 92  ? 37.182 -9.279  4.971   1.00 17.62  ? 88  ARG A NH2 1 
ATOM   713  N  N   . VAL A 1 93  ? 33.596 -15.581 6.693   1.00 10.98  ? 89  VAL A N   1 
ATOM   714  C  CA  . VAL A 1 93  ? 33.938 -16.873 7.228   1.00 10.81  ? 89  VAL A CA  1 
ATOM   715  C  C   . VAL A 1 93  ? 32.757 -17.803 6.858   1.00 13.73  ? 89  VAL A C   1 
ATOM   716  O  O   . VAL A 1 93  ? 31.611 -17.527 7.264   1.00 14.46  ? 89  VAL A O   1 
ATOM   717  C  CB  . VAL A 1 93  ? 34.100 -16.888 8.774   1.00 13.63  ? 89  VAL A CB  1 
ATOM   718  C  CG1 . VAL A 1 93  ? 34.394 -18.306 9.273   1.00 14.42  ? 89  VAL A CG1 1 
ATOM   719  C  CG2 . VAL A 1 93  ? 35.178 -15.923 9.224   1.00 13.50  ? 89  VAL A CG2 1 
ATOM   720  N  N   . PRO A 1 94  ? 33.027 -18.905 6.129   1.00 11.19  ? 90  PRO A N   1 
ATOM   721  C  CA  . PRO A 1 94  ? 31.954 -19.882 5.847   1.00 10.89  ? 90  PRO A CA  1 
ATOM   722  C  C   . PRO A 1 94  ? 31.497 -20.499 7.172   1.00 13.00  ? 90  PRO A C   1 
ATOM   723  O  O   . PRO A 1 94  ? 32.342 -20.843 7.992   1.00 12.84  ? 90  PRO A O   1 
ATOM   724  C  CB  . PRO A 1 94  ? 32.646 -20.907 4.946   1.00 11.87  ? 90  PRO A CB  1 
ATOM   725  C  CG  . PRO A 1 94  ? 33.892 -20.187 4.392   1.00 15.38  ? 90  PRO A CG  1 
ATOM   726  C  CD  . PRO A 1 94  ? 34.325 -19.344 5.559   1.00 11.86  ? 90  PRO A CD  1 
ATOM   727  N  N   . HIS A 1 95  ? 30.184 -20.575 7.425   1.00 8.99   ? 91  HIS A N   1 
ATOM   728  C  CA  . HIS A 1 95  ? 29.659 -21.085 8.707   1.00 9.04   ? 91  HIS A CA  1 
ATOM   729  C  C   . HIS A 1 95  ? 28.375 -21.873 8.508   1.00 12.36  ? 91  HIS A C   1 
ATOM   730  O  O   . HIS A 1 95  ? 27.571 -21.517 7.664   1.00 11.23  ? 91  HIS A O   1 
ATOM   731  C  CB  . HIS A 1 95  ? 29.447 -19.921 9.705   1.00 9.76   ? 91  HIS A CB  1 
ATOM   732  C  CG  . HIS A 1 95  ? 28.559 -18.817 9.181   1.00 11.02  ? 91  HIS A CG  1 
ATOM   733  N  ND1 . HIS A 1 95  ? 29.031 -17.885 8.273   1.00 12.83  ? 91  HIS A ND1 1 
ATOM   734  C  CD2 . HIS A 1 95  ? 27.256 -18.563 9.431   1.00 11.81  ? 91  HIS A CD2 1 
ATOM   735  C  CE1 . HIS A 1 95  ? 28.002 -17.095 7.993   1.00 12.51  ? 91  HIS A CE1 1 
ATOM   736  N  NE2 . HIS A 1 95  ? 26.910 -17.473 8.652   1.00 12.18  ? 91  HIS A NE2 1 
ATOM   737  N  N   . SER A 1 96  ? 28.165 -22.916 9.318   1.00 10.81  ? 92  SER A N   1 
ATOM   738  C  CA  . SER A 1 96  ? 27.021 -23.829 9.209   1.00 10.30  ? 92  SER A CA  1 
ATOM   739  C  C   . SER A 1 96  ? 26.483 -24.053 10.630  1.00 14.50  ? 92  SER A C   1 
ATOM   740  O  O   . SER A 1 96  ? 27.062 -24.824 11.404  1.00 13.86  ? 92  SER A O   1 
ATOM   741  C  CB  . SER A 1 96  ? 27.491 -25.151 8.606   1.00 12.88  ? 92  SER A CB  1 
ATOM   742  O  OG  . SER A 1 96  ? 26.387 -26.010 8.343   1.00 15.36  ? 92  SER A OG  1 
ATOM   743  N  N   . PRO A 1 97  ? 25.401 -23.357 11.002  1.00 13.72  ? 93  PRO A N   1 
ATOM   744  C  CA  . PRO A 1 97  ? 24.903 -23.481 12.366  1.00 14.23  ? 93  PRO A CA  1 
ATOM   745  C  C   . PRO A 1 97  ? 24.079 -24.752 12.607  1.00 17.88  ? 93  PRO A C   1 
ATOM   746  O  O   . PRO A 1 97  ? 23.249 -25.149 11.790  1.00 17.48  ? 93  PRO A O   1 
ATOM   747  C  CB  . PRO A 1 97  ? 24.123 -22.176 12.572  1.00 16.24  ? 93  PRO A CB  1 
ATOM   748  C  CG  . PRO A 1 97  ? 23.607 -21.830 11.188  1.00 21.05  ? 93  PRO A CG  1 
ATOM   749  C  CD  . PRO A 1 97  ? 24.600 -22.387 10.208  1.00 16.20  ? 93  PRO A CD  1 
ATOM   750  N  N   . GLN A 1 98  ? 24.359 -25.405 13.737  1.00 14.46  ? 94  GLN A N   1 
ATOM   751  C  CA  . GLN A 1 98  ? 23.698 -26.632 14.147  1.00 13.33  ? 94  GLN A CA  1 
ATOM   752  C  C   . GLN A 1 98  ? 22.892 -26.295 15.372  1.00 16.48  ? 94  GLN A C   1 
ATOM   753  O  O   . GLN A 1 98  ? 23.463 -25.856 16.372  1.00 14.52  ? 94  GLN A O   1 
ATOM   754  C  CB  . GLN A 1 98  ? 24.730 -27.739 14.464  1.00 14.13  ? 94  GLN A CB  1 
ATOM   755  C  CG  . GLN A 1 98  ? 25.821 -27.969 13.401  1.00 14.47  ? 94  GLN A CG  1 
ATOM   756  C  CD  . GLN A 1 98  ? 25.251 -28.238 12.029  1.00 19.90  ? 94  GLN A CD  1 
ATOM   757  O  OE1 . GLN A 1 98  ? 24.407 -29.103 11.854  1.00 16.07  ? 94  GLN A OE1 1 
ATOM   758  N  NE2 . GLN A 1 98  ? 25.652 -27.464 11.030  1.00 14.81  ? 94  GLN A NE2 1 
ATOM   759  N  N   . ARG A 1 99  ? 21.552 -26.490 15.304  1.00 13.51  ? 95  ARG A N   1 
ATOM   760  C  CA  . ARG A 1 99  ? 20.688 -26.176 16.439  1.00 13.37  ? 95  ARG A CA  1 
ATOM   761  C  C   . ARG A 1 99  ? 19.923 -27.396 16.918  1.00 17.18  ? 95  ARG A C   1 
ATOM   762  O  O   . ARG A 1 99  ? 19.644 -28.312 16.140  1.00 14.40  ? 95  ARG A O   1 
ATOM   763  C  CB  . ARG A 1 99  ? 19.772 -24.979 16.157  1.00 13.56  ? 95  ARG A CB  1 
ATOM   764  C  CG  . ARG A 1 99  ? 20.594 -23.697 15.922  1.00 18.47  ? 95  ARG A CG  1 
ATOM   765  C  CD  . ARG A 1 99  ? 19.756 -22.442 15.760  1.00 16.48  ? 95  ARG A CD  1 
ATOM   766  N  NE  . ARG A 1 99  ? 20.596 -21.256 15.497  1.00 14.36  ? 95  ARG A NE  1 
ATOM   767  C  CZ  . ARG A 1 99  ? 21.145 -20.517 16.453  1.00 20.99  ? 95  ARG A CZ  1 
ATOM   768  N  NH1 . ARG A 1 99  ? 20.967 -20.828 17.734  1.00 11.85  ? 95  ARG A NH1 1 
ATOM   769  N  NH2 . ARG A 1 99  ? 21.919 -19.483 16.135  1.00 14.67  ? 95  ARG A NH2 1 
ATOM   770  N  N   . PHE A 1 100 ? 19.608 -27.393 18.203  1.00 15.90  ? 96  PHE A N   1 
ATOM   771  C  CA  . PHE A 1 100 ? 18.958 -28.497 18.886  1.00 16.20  ? 96  PHE A CA  1 
ATOM   772  C  C   . PHE A 1 100 ? 17.534 -28.155 19.337  1.00 18.07  ? 96  PHE A C   1 
ATOM   773  O  O   . PHE A 1 100 ? 17.174 -26.983 19.423  1.00 15.09  ? 96  PHE A O   1 
ATOM   774  C  CB  . PHE A 1 100 ? 19.871 -28.966 20.043  1.00 20.00  ? 96  PHE A CB  1 
ATOM   775  C  CG  . PHE A 1 100 ? 21.240 -29.350 19.505  1.00 23.96  ? 96  PHE A CG  1 
ATOM   776  C  CD1 . PHE A 1 100 ? 21.481 -30.632 19.024  1.00 29.73  ? 96  PHE A CD1 1 
ATOM   777  C  CD2 . PHE A 1 100 ? 22.263 -28.412 19.417  1.00 28.89  ? 96  PHE A CD2 1 
ATOM   778  C  CE1 . PHE A 1 100 ? 22.709 -30.962 18.448  1.00 32.43  ? 96  PHE A CE1 1 
ATOM   779  C  CE2 . PHE A 1 100 ? 23.485 -28.734 18.822  1.00 32.83  ? 96  PHE A CE2 1 
ATOM   780  C  CZ  . PHE A 1 100 ? 23.704 -30.008 18.348  1.00 31.84  ? 96  PHE A CZ  1 
ATOM   781  N  N   . ALA A 1 101 ? 16.718 -29.189 19.620  1.00 15.69  ? 97  ALA A N   1 
ATOM   782  C  CA  . ALA A 1 101 ? 15.328 -29.000 20.060  1.00 14.94  ? 97  ALA A CA  1 
ATOM   783  C  C   . ALA A 1 101 ? 15.282 -28.183 21.335  1.00 17.58  ? 97  ALA A C   1 
ATOM   784  O  O   . ALA A 1 101 ? 16.193 -28.300 22.165  1.00 16.25  ? 97  ALA A O   1 
ATOM   785  C  CB  . ALA A 1 101 ? 14.659 -30.362 20.303  1.00 15.99  ? 97  ALA A CB  1 
ATOM   786  N  N   . ASN A 1 102 ? 14.215 -27.363 21.498  1.00 12.81  ? 98  ASN A N   1 
ATOM   787  C  CA  . ASN A 1 102 ? 13.930 -26.577 22.702  1.00 14.25  ? 98  ASN A CA  1 
ATOM   788  C  C   . ASN A 1 102 ? 15.025 -25.578 23.057  1.00 18.47  ? 98  ASN A C   1 
ATOM   789  O  O   . ASN A 1 102 ? 15.234 -25.300 24.230  1.00 19.08  ? 98  ASN A O   1 
ATOM   790  C  CB  . ASN A 1 102 ? 13.659 -27.525 23.907  1.00 14.17  ? 98  ASN A CB  1 
ATOM   791  C  CG  . ASN A 1 102 ? 12.790 -28.714 23.542  1.00 36.51  ? 98  ASN A CG  1 
ATOM   792  O  OD1 . ASN A 1 102 ? 13.209 -29.883 23.637  1.00 32.20  ? 98  ASN A OD1 1 
ATOM   793  N  ND2 . ASN A 1 102 ? 11.588 -28.440 23.059  1.00 26.27  ? 98  ASN A ND2 1 
ATOM   794  N  N   . THR A 1 103 ? 15.728 -25.052 22.055  1.00 12.18  ? 99  THR A N   1 
ATOM   795  C  CA  . THR A 1 103 ? 16.782 -24.060 22.301  1.00 12.53  ? 99  THR A CA  1 
ATOM   796  C  C   . THR A 1 103 ? 16.337 -22.727 21.705  1.00 16.01  ? 99  THR A C   1 
ATOM   797  O  O   . THR A 1 103 ? 15.489 -22.724 20.827  1.00 15.36  ? 99  THR A O   1 
ATOM   798  C  CB  . THR A 1 103 ? 18.137 -24.502 21.702  1.00 18.93  ? 99  THR A CB  1 
ATOM   799  O  OG1 . THR A 1 103 ? 18.064 -24.591 20.266  1.00 18.71  ? 99  THR A OG1 1 
ATOM   800  C  CG2 . THR A 1 103 ? 18.656 -25.807 22.301  1.00 15.72  ? 99  THR A CG2 1 
ATOM   801  N  N   . VAL A 1 104 ? 16.908 -21.605 22.163  1.00 12.39  ? 100 VAL A N   1 
ATOM   802  C  CA  . VAL A 1 104 ? 16.641 -20.275 21.594  1.00 12.62  ? 100 VAL A CA  1 
ATOM   803  C  C   . VAL A 1 104 ? 17.973 -19.546 21.546  1.00 15.49  ? 100 VAL A C   1 
ATOM   804  O  O   . VAL A 1 104 ? 18.675 -19.417 22.560  1.00 14.24  ? 100 VAL A O   1 
ATOM   805  C  CB  . VAL A 1 104 ? 15.555 -19.426 22.330  1.00 16.75  ? 100 VAL A CB  1 
ATOM   806  C  CG1 . VAL A 1 104 ? 15.341 -18.071 21.638  1.00 15.96  ? 100 VAL A CG1 1 
ATOM   807  C  CG2 . VAL A 1 104 ? 14.220 -20.184 22.447  1.00 16.11  ? 100 VAL A CG2 1 
ATOM   808  N  N   . GLY A 1 105 ? 18.313 -19.076 20.368  1.00 12.39  ? 101 GLY A N   1 
ATOM   809  C  CA  . GLY A 1 105 ? 19.530 -18.306 20.182  1.00 13.04  ? 101 GLY A CA  1 
ATOM   810  C  C   . GLY A 1 105 ? 19.245 -16.966 19.531  1.00 17.19  ? 101 GLY A C   1 
ATOM   811  O  O   . GLY A 1 105 ? 18.316 -16.846 18.742  1.00 16.31  ? 101 GLY A O   1 
ATOM   812  N  N   . LEU A 1 106 ? 20.016 -15.966 19.892  1.00 12.16  ? 102 LEU A N   1 
ATOM   813  C  CA  . LEU A 1 106 ? 19.968 -14.641 19.302  1.00 11.37  ? 102 LEU A CA  1 
ATOM   814  C  C   . LEU A 1 106 ? 21.045 -14.612 18.236  1.00 12.73  ? 102 LEU A C   1 
ATOM   815  O  O   . LEU A 1 106 ? 22.183 -15.006 18.493  1.00 11.29  ? 102 LEU A O   1 
ATOM   816  C  CB  . LEU A 1 106 ? 20.299 -13.567 20.370  1.00 11.17  ? 102 LEU A CB  1 
ATOM   817  C  CG  . LEU A 1 106 ? 20.631 -12.139 19.864  1.00 15.71  ? 102 LEU A CG  1 
ATOM   818  C  CD1 . LEU A 1 106 ? 19.435 -11.508 19.135  1.00 15.36  ? 102 LEU A CD1 1 
ATOM   819  C  CD2 . LEU A 1 106 ? 21.105 -11.232 21.012  1.00 15.68  ? 102 LEU A CD2 1 
ATOM   820  N  N   . VAL A 1 107 ? 20.708 -14.087 17.067  1.00 11.47  ? 103 VAL A N   1 
ATOM   821  C  CA  . VAL A 1 107 ? 21.684 -13.829 15.998  1.00 11.96  ? 103 VAL A CA  1 
ATOM   822  C  C   . VAL A 1 107 ? 21.449 -12.388 15.540  1.00 14.64  ? 103 VAL A C   1 
ATOM   823  O  O   . VAL A 1 107 ? 20.319 -12.014 15.309  1.00 12.85  ? 103 VAL A O   1 
ATOM   824  C  CB  . VAL A 1 107 ? 21.666 -14.833 14.810  1.00 16.67  ? 103 VAL A CB  1 
ATOM   825  C  CG1 . VAL A 1 107 ? 22.687 -14.432 13.729  1.00 16.30  ? 103 VAL A CG1 1 
ATOM   826  C  CG2 . VAL A 1 107 ? 21.944 -16.253 15.297  1.00 16.62  ? 103 VAL A CG2 1 
ATOM   827  N  N   . VAL A 1 108 ? 22.502 -11.580 15.470  1.00 11.62  ? 104 VAL A N   1 
ATOM   828  C  CA  . VAL A 1 108 ? 22.376 -10.212 14.995  1.00 10.11  ? 104 VAL A CA  1 
ATOM   829  C  C   . VAL A 1 108 ? 23.225 -10.077 13.769  1.00 13.54  ? 104 VAL A C   1 
ATOM   830  O  O   . VAL A 1 108 ? 24.407 -10.419 13.776  1.00 14.84  ? 104 VAL A O   1 
ATOM   831  C  CB  . VAL A 1 108 ? 22.731 -9.100  16.010  1.00 13.47  ? 104 VAL A CB  1 
ATOM   832  C  CG1 . VAL A 1 108 ? 22.535 -7.708  15.377  1.00 12.77  ? 104 VAL A CG1 1 
ATOM   833  C  CG2 . VAL A 1 108 ? 21.920 -9.231  17.295  1.00 12.90  ? 104 VAL A CG2 1 
ATOM   834  N  N   . GLU A 1 109 ? 22.613 -9.602  12.714  1.00 10.07  ? 105 GLU A N   1 
ATOM   835  C  CA  . GLU A 1 109 ? 23.311 -9.309  11.473  1.00 11.23  ? 105 GLU A CA  1 
ATOM   836  C  C   . GLU A 1 109 ? 22.711 -8.052  10.870  1.00 14.76  ? 105 GLU A C   1 
ATOM   837  O  O   . GLU A 1 109 ? 21.816 -7.465  11.473  1.00 15.21  ? 105 GLU A O   1 
ATOM   838  C  CB  . GLU A 1 109 ? 23.372 -10.524 10.519  1.00 13.33  ? 105 GLU A CB  1 
ATOM   839  C  CG  . GLU A 1 109 ? 22.077 -11.179 10.127  1.00 24.70  ? 105 GLU A CG  1 
ATOM   840  C  CD  . GLU A 1 109 ? 22.348 -12.408 9.273   1.00 34.29  ? 105 GLU A CD  1 
ATOM   841  O  OE1 . GLU A 1 109 ? 22.628 -13.488 9.842   1.00 28.05  ? 105 GLU A OE1 1 
ATOM   842  O  OE2 . GLU A 1 109 ? 22.376 -12.267 8.031   1.00 23.34  ? 105 GLU A OE2 1 
ATOM   843  N  N   . ARG A 1 110 ? 23.239 -7.569  9.748   1.00 12.00  ? 106 ARG A N   1 
ATOM   844  C  CA  . ARG A 1 110 ? 22.732 -6.324  9.199   1.00 11.92  ? 106 ARG A CA  1 
ATOM   845  C  C   . ARG A 1 110 ? 22.242 -6.451  7.786   1.00 14.94  ? 106 ARG A C   1 
ATOM   846  O  O   . ARG A 1 110 ? 22.576 -7.396  7.079   1.00 14.17  ? 106 ARG A O   1 
ATOM   847  C  CB  . ARG A 1 110 ? 23.810 -5.208  9.277   1.00 14.50  ? 106 ARG A CB  1 
ATOM   848  C  CG  . ARG A 1 110 ? 25.104 -5.468  8.465   1.00 14.69  ? 106 ARG A CG  1 
ATOM   849  C  CD  . ARG A 1 110 ? 25.841 -4.162  8.202   1.00 11.42  ? 106 ARG A CD  1 
ATOM   850  N  NE  . ARG A 1 110 ? 27.185 -4.373  7.657   1.00 14.41  ? 106 ARG A NE  1 
ATOM   851  C  CZ  . ARG A 1 110 ? 27.459 -4.673  6.388   1.00 24.35  ? 106 ARG A CZ  1 
ATOM   852  N  NH1 . ARG A 1 110 ? 26.480 -4.818  5.503   1.00 14.72  ? 106 ARG A NH1 1 
ATOM   853  N  NH2 . ARG A 1 110 ? 28.714 -4.859  6.002   1.00 16.41  ? 106 ARG A NH2 1 
ATOM   854  N  N   . ARG A 1 111 ? 21.488 -5.446  7.370   1.00 12.53  ? 107 ARG A N   1 
ATOM   855  C  CA  . ARG A 1 111 ? 21.043 -5.275  5.994   1.00 11.53  ? 107 ARG A CA  1 
ATOM   856  C  C   . ARG A 1 111 ? 22.305 -5.202  5.138   1.00 13.93  ? 107 ARG A C   1 
ATOM   857  O  O   . ARG A 1 111 ? 23.270 -4.528  5.513   1.00 13.17  ? 107 ARG A O   1 
ATOM   858  C  CB  . ARG A 1 111 ? 20.279 -3.963  5.886   1.00 12.38  ? 107 ARG A CB  1 
ATOM   859  C  CG  . ARG A 1 111 ? 19.849 -3.634  4.448   1.00 18.16  ? 107 ARG A CG  1 
ATOM   860  C  CD  . ARG A 1 111 ? 19.243 -2.252  4.440   1.00 21.46  ? 107 ARG A CD  1 
ATOM   861  N  NE  . ARG A 1 111 ? 17.870 -2.300  4.901   1.00 25.81  ? 107 ARG A NE  1 
ATOM   862  C  CZ  . ARG A 1 111 ? 17.279 -1.336  5.604   1.00 36.42  ? 107 ARG A CZ  1 
ATOM   863  N  NH1 . ARG A 1 111 ? 17.941 -0.239  5.941   1.00 17.03  ? 107 ARG A NH1 1 
ATOM   864  N  NH2 . ARG A 1 111 ? 16.012 -1.473  5.979   1.00 24.89  ? 107 ARG A NH2 1 
ATOM   865  N  N   . ARG A 1 112 ? 22.283 -5.854  3.981   1.00 12.07  ? 108 ARG A N   1 
ATOM   866  C  CA  . ARG A 1 112 ? 23.450 -5.841  3.117   1.00 13.23  ? 108 ARG A CA  1 
ATOM   867  C  C   . ARG A 1 112 ? 23.514 -4.565  2.317   1.00 16.63  ? 108 ARG A C   1 
ATOM   868  O  O   . ARG A 1 112 ? 22.483 -4.003  1.955   1.00 15.22  ? 108 ARG A O   1 
ATOM   869  C  CB  . ARG A 1 112 ? 23.455 -7.035  2.135   1.00 13.48  ? 108 ARG A CB  1 
ATOM   870  C  CG  . ARG A 1 112 ? 23.273 -8.463  2.684   1.00 15.07  ? 108 ARG A CG  1 
ATOM   871  C  CD  . ARG A 1 112 ? 23.962 -8.827  3.978   1.00 14.98  ? 108 ARG A CD  1 
ATOM   872  N  NE  . ARG A 1 112 ? 23.874 -10.282 4.211   1.00 17.81  ? 108 ARG A NE  1 
ATOM   873  C  CZ  . ARG A 1 112 ? 23.509 -10.847 5.355   1.00 26.66  ? 108 ARG A CZ  1 
ATOM   874  N  NH1 . ARG A 1 112 ? 23.207 -10.101 6.414   1.00 18.68  ? 108 ARG A NH1 1 
ATOM   875  N  NH2 . ARG A 1 112 ? 23.458 -12.169 5.454   1.00 15.91  ? 108 ARG A NH2 1 
ATOM   876  N  N   . LEU A 1 113 ? 24.714 -4.178  1.934   1.00 13.41  ? 109 LEU A N   1 
ATOM   877  C  CA  . LEU A 1 113 ? 24.871 -3.052  1.009   1.00 13.05  ? 109 LEU A CA  1 
ATOM   878  C  C   . LEU A 1 113 ? 24.479 -3.608  -0.375  1.00 16.18  ? 109 LEU A C   1 
ATOM   879  O  O   . LEU A 1 113 ? 24.531 -4.812  -0.566  1.00 13.81  ? 109 LEU A O   1 
ATOM   880  C  CB  . LEU A 1 113 ? 26.338 -2.583  0.997   1.00 13.01  ? 109 LEU A CB  1 
ATOM   881  C  CG  . LEU A 1 113 ? 26.826 -1.899  2.280   1.00 17.94  ? 109 LEU A CG  1 
ATOM   882  C  CD1 . LEU A 1 113 ? 28.259 -1.417  2.121   1.00 17.05  ? 109 LEU A CD1 1 
ATOM   883  C  CD2 . LEU A 1 113 ? 25.909 -0.714  2.664   1.00 21.30  ? 109 LEU A CD2 1 
ATOM   884  N  N   . GLU A 1 114 ? 24.024 -2.760  -1.309  1.00 15.71  ? 110 GLU A N   1 
ATOM   885  C  CA  . GLU A 1 114 ? 23.613 -3.274  -2.621  1.00 16.35  ? 110 GLU A CA  1 
ATOM   886  C  C   . GLU A 1 114 ? 24.752 -3.956  -3.392  1.00 18.01  ? 110 GLU A C   1 
ATOM   887  O  O   . GLU A 1 114 ? 24.470 -4.673  -4.351  1.00 17.57  ? 110 GLU A O   1 
ATOM   888  C  CB  . GLU A 1 114 ? 23.009 -2.142  -3.472  1.00 18.60  ? 110 GLU A CB  1 
ATOM   889  N  N   . THR A 1 115 ? 26.022 -3.731  -2.992  1.00 13.48  ? 111 THR A N   1 
ATOM   890  C  CA  . THR A 1 115 ? 27.210 -4.300  -3.628  1.00 14.90  ? 111 THR A CA  1 
ATOM   891  C  C   . THR A 1 115 ? 27.520 -5.702  -3.125  1.00 18.49  ? 111 THR A C   1 
ATOM   892  O  O   . THR A 1 115 ? 28.203 -6.470  -3.790  1.00 19.14  ? 111 THR A O   1 
ATOM   893  C  CB  . THR A 1 115 ? 28.450 -3.407  -3.348  1.00 17.65  ? 111 THR A CB  1 
ATOM   894  O  OG1 . THR A 1 115 ? 28.506 -3.118  -1.944  1.00 17.07  ? 111 THR A OG1 1 
ATOM   895  C  CG2 . THR A 1 115 ? 28.426 -2.112  -4.132  1.00 18.96  ? 111 THR A CG2 1 
ATOM   896  N  N   . GLU A 1 116 ? 27.041 -6.013  -1.926  1.00 12.89  ? 112 GLU A N   1 
ATOM   897  C  CA  . GLU A 1 116 ? 27.357 -7.236  -1.185  1.00 11.15  ? 112 GLU A CA  1 
ATOM   898  C  C   . GLU A 1 116 ? 26.650 -8.496  -1.630  1.00 14.99  ? 112 GLU A C   1 
ATOM   899  O  O   . GLU A 1 116 ? 25.431 -8.520  -1.757  1.00 16.86  ? 112 GLU A O   1 
ATOM   900  C  CB  . GLU A 1 116 ? 27.098 -6.991  0.334   1.00 10.78  ? 112 GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 116 ? 28.151 -6.058  0.927   1.00 15.07  ? 112 GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 116 ? 27.961 -5.651  2.382   1.00 26.91  ? 112 GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 116 ? 26.822 -5.732  2.884   1.00 14.79  ? 112 GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 116 ? 28.950 -5.227  3.014   1.00 20.86  ? 112 GLU A OE2 1 
ATOM   905  N  N   . LEU A 1 117 ? 27.428 -9.571  -1.807  1.00 14.34  ? 113 LEU A N   1 
ATOM   906  C  CA  . LEU A 1 117 ? 26.899 -10.884 -2.194  1.00 14.59  ? 113 LEU A CA  1 
ATOM   907  C  C   . LEU A 1 117 ? 26.953 -11.851 -1.033  1.00 16.91  ? 113 LEU A C   1 
ATOM   908  O  O   . LEU A 1 117 ? 27.934 -11.884 -0.284  1.00 17.05  ? 113 LEU A O   1 
ATOM   909  C  CB  . LEU A 1 117 ? 27.708 -11.485 -3.369  1.00 15.56  ? 113 LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 117 ? 27.322 -10.955 -4.754  1.00 21.81  ? 113 LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 117 ? 28.331 -11.372 -5.792  1.00 24.34  ? 113 LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 117 ? 26.006 -11.514 -5.196  1.00 22.50  ? 113 LEU A CD2 1 
ATOM   913  N  N   . ASP A 1 118 ? 25.923 -12.680 -0.924  1.00 13.62  ? 114 ASP A N   1 
ATOM   914  C  CA  . ASP A 1 118 ? 25.894 -13.772 0.046   1.00 12.34  ? 114 ASP A CA  1 
ATOM   915  C  C   . ASP A 1 118 ? 26.091 -15.039 -0.734  1.00 15.60  ? 114 ASP A C   1 
ATOM   916  O  O   . ASP A 1 118 ? 25.746 -15.100 -1.915  1.00 14.22  ? 114 ASP A O   1 
ATOM   917  C  CB  . ASP A 1 118 ? 24.547 -13.836 0.775   1.00 13.10  ? 114 ASP A CB  1 
ATOM   918  C  CG  . ASP A 1 118 ? 24.482 -12.957 2.000   1.00 13.66  ? 114 ASP A CG  1 
ATOM   919  O  OD1 . ASP A 1 118 ? 24.814 -11.757 1.891   1.00 14.38  ? 114 ASP A OD1 1 
ATOM   920  O  OD2 . ASP A 1 118 ? 23.987 -13.428 3.032   1.00 18.76  ? 114 ASP A OD2 1 
ATOM   921  N  N   . GLY A 1 119 ? 26.637 -16.048 -0.080  1.00 12.07  ? 115 GLY A N   1 
ATOM   922  C  CA  . GLY A 1 119 ? 26.793 -17.336 -0.714  1.00 12.62  ? 115 GLY A CA  1 
ATOM   923  C  C   . GLY A 1 119 ? 26.382 -18.458 0.190   1.00 16.58  ? 115 GLY A C   1 
ATOM   924  O  O   . GLY A 1 119 ? 26.352 -18.304 1.420   1.00 14.95  ? 115 GLY A O   1 
ATOM   925  N  N   . LEU A 1 120 ? 26.021 -19.571 -0.445  1.00 11.72  ? 116 LEU A N   1 
ATOM   926  C  CA  . LEU A 1 120 ? 25.695 -20.819 0.212   1.00 12.05  ? 116 LEU A CA  1 
ATOM   927  C  C   . LEU A 1 120 ? 26.484 -21.914 -0.481  1.00 15.92  ? 116 LEU A C   1 
ATOM   928  O  O   . LEU A 1 120 ? 26.403 -22.059 -1.715  1.00 14.11  ? 116 LEU A O   1 
ATOM   929  C  CB  . LEU A 1 120 ? 24.191 -21.123 0.180   1.00 12.43  ? 116 LEU A CB  1 
ATOM   930  C  CG  . LEU A 1 120 ? 23.749 -22.109 1.250   1.00 17.06  ? 116 LEU A CG  1 
ATOM   931  C  CD1 . LEU A 1 120 ? 23.760 -21.458 2.681   1.00 14.97  ? 116 LEU A CD1 1 
ATOM   932  C  CD2 . LEU A 1 120 ? 22.398 -22.726 0.913   1.00 20.10  ? 116 LEU A CD2 1 
ATOM   933  N  N   . ARG A 1 121 ? 27.284 -22.651 0.310   1.00 13.37  ? 117 ARG A N   1 
ATOM   934  C  CA  . ARG A 1 121 ? 28.100 -23.736 -0.196  1.00 12.55  ? 117 ARG A CA  1 
ATOM   935  C  C   . ARG A 1 121 ? 27.886 -25.051 0.491   1.00 13.58  ? 117 ARG A C   1 
ATOM   936  O  O   . ARG A 1 121 ? 27.738 -25.110 1.717   1.00 11.84  ? 117 ARG A O   1 
ATOM   937  C  CB  . ARG A 1 121 ? 29.604 -23.394 -0.069  1.00 13.66  ? 117 ARG A CB  1 
ATOM   938  C  CG  . ARG A 1 121 ? 30.073 -22.286 -1.009  1.00 18.51  ? 117 ARG A CG  1 
ATOM   939  C  CD  . ARG A 1 121 ? 31.586 -22.069 -0.969  1.00 12.47  ? 117 ARG A CD  1 
ATOM   940  N  NE  . ARG A 1 121 ? 32.044 -21.465 -2.217  1.00 12.14  ? 117 ARG A NE  1 
ATOM   941  C  CZ  . ARG A 1 121 ? 33.278 -21.036 -2.448  1.00 22.69  ? 117 ARG A CZ  1 
ATOM   942  N  NH1 . ARG A 1 121 ? 34.211 -21.146 -1.497  1.00 16.44  ? 117 ARG A NH1 1 
ATOM   943  N  NH2 . ARG A 1 121 ? 33.607 -20.529 -3.620  1.00 22.93  ? 117 ARG A NH2 1 
ATOM   944  N  N   . TYR A 1 122 ? 27.986 -26.122 -0.291  1.00 11.14  ? 118 TYR A N   1 
ATOM   945  C  CA  . TYR A 1 122 ? 28.042 -27.480 0.215   1.00 10.65  ? 118 TYR A CA  1 
ATOM   946  C  C   . TYR A 1 122 ? 29.411 -27.989 -0.216  1.00 15.26  ? 118 TYR A C   1 
ATOM   947  O  O   . TYR A 1 122 ? 29.865 -27.678 -1.313  1.00 15.66  ? 118 TYR A O   1 
ATOM   948  C  CB  . TYR A 1 122 ? 26.963 -28.397 -0.366  1.00 11.62  ? 118 TYR A CB  1 
ATOM   949  C  CG  . TYR A 1 122 ? 25.570 -28.072 0.125   1.00 12.50  ? 118 TYR A CG  1 
ATOM   950  C  CD1 . TYR A 1 122 ? 24.774 -27.142 -0.542  1.00 14.94  ? 118 TYR A CD1 1 
ATOM   951  C  CD2 . TYR A 1 122 ? 25.032 -28.723 1.227   1.00 13.01  ? 118 TYR A CD2 1 
ATOM   952  C  CE1 . TYR A 1 122 ? 23.486 -26.846 -0.104  1.00 13.18  ? 118 TYR A CE1 1 
ATOM   953  C  CE2 . TYR A 1 122 ? 23.745 -28.426 1.684   1.00 13.84  ? 118 TYR A CE2 1 
ATOM   954  C  CZ  . TYR A 1 122 ? 22.957 -27.528 0.977   1.00 15.43  ? 118 TYR A CZ  1 
ATOM   955  O  OH  . TYR A 1 122 ? 21.662 -27.297 1.362   1.00 15.08  ? 118 TYR A OH  1 
ATOM   956  N  N   . TYR A 1 123 ? 30.049 -28.755 0.632   1.00 13.78  ? 119 TYR A N   1 
ATOM   957  C  CA  . TYR A 1 123 ? 31.380 -29.282 0.315   1.00 14.74  ? 119 TYR A CA  1 
ATOM   958  C  C   . TYR A 1 123 ? 31.318 -30.781 0.068   1.00 18.04  ? 119 TYR A C   1 
ATOM   959  O  O   . TYR A 1 123 ? 30.363 -31.437 0.493   1.00 17.20  ? 119 TYR A O   1 
ATOM   960  C  CB  . TYR A 1 123 ? 32.399 -28.911 1.431   1.00 15.18  ? 119 TYR A CB  1 
ATOM   961  C  CG  . TYR A 1 123 ? 32.609 -27.423 1.565   1.00 15.82  ? 119 TYR A CG  1 
ATOM   962  C  CD1 . TYR A 1 123 ? 31.768 -26.649 2.358   1.00 18.57  ? 119 TYR A CD1 1 
ATOM   963  C  CD2 . TYR A 1 123 ? 33.631 -26.776 0.872   1.00 15.61  ? 119 TYR A CD2 1 
ATOM   964  C  CE1 . TYR A 1 123 ? 31.896 -25.262 2.410   1.00 18.66  ? 119 TYR A CE1 1 
ATOM   965  C  CE2 . TYR A 1 123 ? 33.791 -25.394 0.944   1.00 16.30  ? 119 TYR A CE2 1 
ATOM   966  C  CZ  . TYR A 1 123 ? 32.912 -24.640 1.707   1.00 21.46  ? 119 TYR A CZ  1 
ATOM   967  O  OH  . TYR A 1 123 ? 33.045 -23.284 1.817   1.00 24.05  ? 119 TYR A OH  1 
ATOM   968  N  N   . VAL A 1 124 ? 32.328 -31.310 -0.637  1.00 15.95  ? 120 VAL A N   1 
ATOM   969  C  CA  . VAL A 1 124 ? 32.471 -32.740 -0.925  1.00 17.84  ? 120 VAL A CA  1 
ATOM   970  C  C   . VAL A 1 124 ? 32.938 -33.384 0.383   1.00 25.69  ? 120 VAL A C   1 
ATOM   971  O  O   . VAL A 1 124 ? 34.043 -33.105 0.854   1.00 25.02  ? 120 VAL A O   1 
ATOM   972  C  CB  . VAL A 1 124 ? 33.449 -33.013 -2.107  1.00 21.12  ? 120 VAL A CB  1 
ATOM   973  C  CG1 . VAL A 1 124 ? 33.669 -34.517 -2.308  1.00 22.53  ? 120 VAL A CG1 1 
ATOM   974  C  CG2 . VAL A 1 124 ? 32.969 -32.355 -3.397  1.00 20.30  ? 120 VAL A CG2 1 
ATOM   975  N  N   . GLY A 1 125 ? 32.067 -34.169 1.003   1.00 26.32  ? 121 GLY A N   1 
ATOM   976  C  CA  . GLY A 1 125 ? 32.367 -34.826 2.272   1.00 27.55  ? 121 GLY A CA  1 
ATOM   977  C  C   . GLY A 1 125 ? 32.977 -33.901 3.313   1.00 32.96  ? 121 GLY A C   1 
ATOM   978  O  O   . GLY A 1 125 ? 32.449 -32.818 3.564   1.00 32.64  ? 121 GLY A O   1 
ATOM   979  N  N   . ASP A 1 126 ? 34.122 -34.312 3.888   1.00 31.07  ? 122 ASP A N   1 
ATOM   980  C  CA  . ASP A 1 126 ? 34.865 -33.585 4.931   1.00 30.71  ? 122 ASP A CA  1 
ATOM   981  C  C   . ASP A 1 126 ? 36.013 -32.729 4.385   1.00 31.04  ? 122 ASP A C   1 
ATOM   982  O  O   . ASP A 1 126 ? 36.877 -32.310 5.151   1.00 31.17  ? 122 ASP A O   1 
ATOM   983  C  CB  . ASP A 1 126 ? 35.416 -34.594 5.965   1.00 32.97  ? 122 ASP A CB  1 
ATOM   984  N  N   . THR A 1 127 ? 36.014 -32.454 3.080   1.00 25.16  ? 123 THR A N   1 
ATOM   985  C  CA  . THR A 1 127 ? 37.067 -31.700 2.393   1.00 23.60  ? 123 THR A CA  1 
ATOM   986  C  C   . THR A 1 127 ? 36.703 -30.232 2.191   1.00 25.11  ? 123 THR A C   1 
ATOM   987  O  O   . THR A 1 127 ? 35.596 -29.818 2.535   1.00 25.04  ? 123 THR A O   1 
ATOM   988  C  CB  . THR A 1 127 ? 37.361 -32.382 1.048   1.00 27.93  ? 123 THR A CB  1 
ATOM   989  O  OG1 . THR A 1 127 ? 36.370 -31.989 0.079   1.00 19.06  ? 123 THR A OG1 1 
ATOM   990  C  CG2 . THR A 1 127 ? 37.435 -33.906 1.169   1.00 29.48  ? 123 THR A CG2 1 
ATOM   991  N  N   . MET A 1 128 ? 37.631 -29.450 1.620   1.00 19.38  ? 124 MET A N   1 
ATOM   992  C  CA  . MET A 1 128 ? 37.408 -28.044 1.273   1.00 18.62  ? 124 MET A CA  1 
ATOM   993  C  C   . MET A 1 128 ? 37.023 -27.916 -0.219  1.00 19.25  ? 124 MET A C   1 
ATOM   994  O  O   . MET A 1 128 ? 36.949 -26.802 -0.728  1.00 19.34  ? 124 MET A O   1 
ATOM   995  C  CB  . MET A 1 128 ? 38.648 -27.179 1.579   1.00 21.96  ? 124 MET A CB  1 
ATOM   996  C  CG  . MET A 1 128 ? 39.095 -27.232 3.026   1.00 26.59  ? 124 MET A CG  1 
ATOM   997  S  SD  . MET A 1 128 ? 37.729 -26.880 4.157   1.00 31.44  ? 124 MET A SD  1 
ATOM   998  C  CE  . MET A 1 128 ? 38.507 -27.169 5.640   1.00 28.73  ? 124 MET A CE  1 
ATOM   999  N  N   . ASP A 1 129 ? 36.803 -29.042 -0.925  1.00 14.06  ? 125 ASP A N   1 
ATOM   1000 C  CA  . ASP A 1 129 ? 36.395 -28.990 -2.342  1.00 14.58  ? 125 ASP A CA  1 
ATOM   1001 C  C   . ASP A 1 129 ? 34.919 -28.640 -2.375  1.00 15.99  ? 125 ASP A C   1 
ATOM   1002 O  O   . ASP A 1 129 ? 34.160 -29.191 -1.607  1.00 15.07  ? 125 ASP A O   1 
ATOM   1003 C  CB  . ASP A 1 129 ? 36.618 -30.347 -3.022  1.00 17.57  ? 125 ASP A CB  1 
ATOM   1004 C  CG  . ASP A 1 129 ? 38.088 -30.696 -3.213  1.00 33.19  ? 125 ASP A CG  1 
ATOM   1005 O  OD1 . ASP A 1 129 ? 38.967 -29.876 -2.794  1.00 30.06  ? 125 ASP A OD1 1 
ATOM   1006 O  OD2 . ASP A 1 129 ? 38.367 -31.797 -3.729  1.00 38.85  ? 125 ASP A OD2 1 
ATOM   1007 N  N   . VAL A 1 130 ? 34.539 -27.682 -3.203  1.00 14.76  ? 126 VAL A N   1 
ATOM   1008 C  CA  . VAL A 1 130 ? 33.146 -27.226 -3.275  1.00 14.51  ? 126 VAL A CA  1 
ATOM   1009 C  C   . VAL A 1 130 ? 32.350 -28.206 -4.120  1.00 16.48  ? 126 VAL A C   1 
ATOM   1010 O  O   . VAL A 1 130 ? 32.759 -28.524 -5.234  1.00 15.12  ? 126 VAL A O   1 
ATOM   1011 C  CB  . VAL A 1 130 ? 33.017 -25.768 -3.815  1.00 17.65  ? 126 VAL A CB  1 
ATOM   1012 C  CG1 . VAL A 1 130 ? 31.558 -25.320 -3.839  1.00 16.81  ? 126 VAL A CG1 1 
ATOM   1013 C  CG2 . VAL A 1 130 ? 33.871 -24.783 -2.997  1.00 17.27  ? 126 VAL A CG2 1 
ATOM   1014 N  N   . LEU A 1 131 ? 31.200 -28.655 -3.601  1.00 13.06  ? 127 LEU A N   1 
ATOM   1015 C  CA  . LEU A 1 131 ? 30.298 -29.573 -4.305  1.00 12.54  ? 127 LEU A CA  1 
ATOM   1016 C  C   . LEU A 1 131 ? 29.187 -28.801 -5.057  1.00 15.34  ? 127 LEU A C   1 
ATOM   1017 O  O   . LEU A 1 131 ? 28.867 -29.094 -6.205  1.00 14.54  ? 127 LEU A O   1 
ATOM   1018 C  CB  . LEU A 1 131 ? 29.675 -30.527 -3.280  1.00 12.97  ? 127 LEU A CB  1 
ATOM   1019 C  CG  . LEU A 1 131 ? 28.603 -31.538 -3.749  1.00 15.30  ? 127 LEU A CG  1 
ATOM   1020 C  CD1 . LEU A 1 131 ? 29.131 -32.486 -4.811  1.00 15.71  ? 127 LEU A CD1 1 
ATOM   1021 C  CD2 . LEU A 1 131 ? 28.067 -32.330 -2.566  1.00 16.71  ? 127 LEU A CD2 1 
ATOM   1022 N  N   . PHE A 1 132 ? 28.604 -27.826 -4.402  1.00 12.15  ? 128 PHE A N   1 
ATOM   1023 C  CA  . PHE A 1 132 ? 27.515 -27.024 -4.952  1.00 12.01  ? 128 PHE A CA  1 
ATOM   1024 C  C   . PHE A 1 132 ? 27.583 -25.634 -4.325  1.00 14.00  ? 128 PHE A C   1 
ATOM   1025 O  O   . PHE A 1 132 ? 27.873 -25.509 -3.123  1.00 13.24  ? 128 PHE A O   1 
ATOM   1026 C  CB  . PHE A 1 132 ? 26.169 -27.694 -4.640  1.00 13.65  ? 128 PHE A CB  1 
ATOM   1027 C  CG  . PHE A 1 132 ? 24.914 -26.970 -5.108  1.00 14.56  ? 128 PHE A CG  1 
ATOM   1028 C  CD1 . PHE A 1 132 ? 24.315 -25.993 -4.312  1.00 15.75  ? 128 PHE A CD1 1 
ATOM   1029 C  CD2 . PHE A 1 132 ? 24.279 -27.333 -6.293  1.00 16.32  ? 128 PHE A CD2 1 
ATOM   1030 C  CE1 . PHE A 1 132 ? 23.165 -25.320 -4.745  1.00 16.14  ? 128 PHE A CE1 1 
ATOM   1031 C  CE2 . PHE A 1 132 ? 23.105 -26.685 -6.704  1.00 19.22  ? 128 PHE A CE2 1 
ATOM   1032 C  CZ  . PHE A 1 132 ? 22.539 -25.711 -5.907  1.00 17.04  ? 128 PHE A CZ  1 
ATOM   1033 N  N   . GLU A 1 133 ? 27.296 -24.605 -5.109  1.00 9.54   ? 129 GLU A N   1 
ATOM   1034 C  CA  . GLU A 1 133 ? 27.324 -23.239 -4.570  1.00 10.53  ? 129 GLU A CA  1 
ATOM   1035 C  C   . GLU A 1 133 ? 26.379 -22.305 -5.283  1.00 15.62  ? 129 GLU A C   1 
ATOM   1036 O  O   . GLU A 1 133 ? 26.193 -22.418 -6.500  1.00 14.20  ? 129 GLU A O   1 
ATOM   1037 C  CB  . GLU A 1 133 ? 28.757 -22.648 -4.544  1.00 11.43  ? 129 GLU A CB  1 
ATOM   1038 C  CG  . GLU A 1 133 ? 29.330 -22.318 -5.907  1.00 17.72  ? 129 GLU A CG  1 
ATOM   1039 C  CD  . GLU A 1 133 ? 30.727 -21.739 -5.834  1.00 25.12  ? 129 GLU A CD  1 
ATOM   1040 O  OE1 . GLU A 1 133 ? 31.078 -21.121 -4.805  1.00 22.00  ? 129 GLU A OE1 1 
ATOM   1041 O  OE2 . GLU A 1 133 ? 31.498 -21.958 -6.790  1.00 20.94  ? 129 GLU A OE2 1 
ATOM   1042 N  N   . LYS A 1 134 ? 25.789 -21.373 -4.541  1.00 11.82  ? 130 LYS A N   1 
ATOM   1043 C  CA  . LYS A 1 134 ? 24.927 -20.368 -5.170  1.00 11.42  ? 130 LYS A CA  1 
ATOM   1044 C  C   . LYS A 1 134 ? 25.232 -19.027 -4.526  1.00 15.59  ? 130 LYS A C   1 
ATOM   1045 O  O   . LYS A 1 134 ? 25.410 -18.974 -3.307  1.00 14.64  ? 130 LYS A O   1 
ATOM   1046 C  CB  . LYS A 1 134 ? 23.455 -20.737 -5.009  1.00 14.47  ? 130 LYS A CB  1 
ATOM   1047 C  CG  . LYS A 1 134 ? 22.600 -20.318 -6.201  1.00 41.66  ? 130 LYS A CG  1 
ATOM   1048 C  CD  . LYS A 1 134 ? 21.623 -21.422 -6.599  1.00 50.66  ? 130 LYS A CD  1 
ATOM   1049 C  CE  . LYS A 1 134 ? 21.676 -21.734 -8.076  1.00 58.77  ? 130 LYS A CE  1 
ATOM   1050 N  NZ  . LYS A 1 134 ? 22.811 -22.632 -8.426  1.00 65.15  ? 130 LYS A NZ  1 
ATOM   1051 N  N   . TRP A 1 135 ? 25.373 -17.974 -5.326  1.00 12.99  ? 131 TRP A N   1 
ATOM   1052 C  CA  . TRP A 1 135 ? 25.630 -16.617 -4.804  1.00 14.52  ? 131 TRP A CA  1 
ATOM   1053 C  C   . TRP A 1 135 ? 24.448 -15.723 -5.143  1.00 18.08  ? 131 TRP A C   1 
ATOM   1054 O  O   . TRP A 1 135 ? 23.852 -15.866 -6.211  1.00 16.36  ? 131 TRP A O   1 
ATOM   1055 C  CB  . TRP A 1 135 ? 26.953 -16.043 -5.325  1.00 15.08  ? 131 TRP A CB  1 
ATOM   1056 C  CG  . TRP A 1 135 ? 28.133 -16.856 -4.861  1.00 16.24  ? 131 TRP A CG  1 
ATOM   1057 C  CD1 . TRP A 1 135 ? 28.520 -18.074 -5.336  1.00 19.38  ? 131 TRP A CD1 1 
ATOM   1058 C  CD2 . TRP A 1 135 ? 28.912 -16.619 -3.688  1.00 15.59  ? 131 TRP A CD2 1 
ATOM   1059 N  NE1 . TRP A 1 135 ? 29.505 -18.600 -4.545  1.00 18.89  ? 131 TRP A NE1 1 
ATOM   1060 C  CE2 . TRP A 1 135 ? 29.781 -17.720 -3.532  1.00 19.33  ? 131 TRP A CE2 1 
ATOM   1061 C  CE3 . TRP A 1 135 ? 28.952 -15.582 -2.743  1.00 16.22  ? 131 TRP A CE3 1 
ATOM   1062 C  CZ2 . TRP A 1 135 ? 30.760 -17.765 -2.534  1.00 17.95  ? 131 TRP A CZ2 1 
ATOM   1063 C  CZ3 . TRP A 1 135 ? 29.908 -15.633 -1.738  1.00 16.99  ? 131 TRP A CZ3 1 
ATOM   1064 C  CH2 . TRP A 1 135 ? 30.798 -16.715 -1.637  1.00 18.05  ? 131 TRP A CH2 1 
ATOM   1065 N  N   . PHE A 1 136 ? 24.081 -14.814 -4.238  1.00 14.20  ? 132 PHE A N   1 
ATOM   1066 C  CA  . PHE A 1 136 ? 22.890 -13.997 -4.467  1.00 13.68  ? 132 PHE A CA  1 
ATOM   1067 C  C   . PHE A 1 136 ? 22.945 -12.707 -3.691  1.00 15.10  ? 132 PHE A C   1 
ATOM   1068 O  O   . PHE A 1 136 ? 23.742 -12.578 -2.765  1.00 14.20  ? 132 PHE A O   1 
ATOM   1069 C  CB  . PHE A 1 136 ? 21.627 -14.828 -4.044  1.00 15.50  ? 132 PHE A CB  1 
ATOM   1070 C  CG  . PHE A 1 136 ? 21.695 -15.322 -2.608  1.00 16.82  ? 132 PHE A CG  1 
ATOM   1071 C  CD1 . PHE A 1 136 ? 22.427 -16.465 -2.277  1.00 18.65  ? 132 PHE A CD1 1 
ATOM   1072 C  CD2 . PHE A 1 136 ? 21.061 -14.624 -1.585  1.00 19.00  ? 132 PHE A CD2 1 
ATOM   1073 C  CE1 . PHE A 1 136 ? 22.514 -16.903 -0.948  1.00 19.60  ? 132 PHE A CE1 1 
ATOM   1074 C  CE2 . PHE A 1 136 ? 21.150 -15.061 -0.256  1.00 21.91  ? 132 PHE A CE2 1 
ATOM   1075 C  CZ  . PHE A 1 136 ? 21.895 -16.179 0.056   1.00 19.88  ? 132 PHE A CZ  1 
ATOM   1076 N  N   . TYR A 1 137 ? 22.044 -11.764 -4.022  1.00 13.36  ? 133 TYR A N   1 
ATOM   1077 C  CA  . TYR A 1 137 ? 21.932 -10.514 -3.300  1.00 14.28  ? 133 TYR A CA  1 
ATOM   1078 C  C   . TYR A 1 137 ? 20.869 -10.712 -2.229  1.00 19.12  ? 133 TYR A C   1 
ATOM   1079 O  O   . TYR A 1 137 ? 19.718 -11.016 -2.541  1.00 18.58  ? 133 TYR A O   1 
ATOM   1080 C  CB  . TYR A 1 137 ? 21.642 -9.338  -4.267  1.00 15.72  ? 133 TYR A CB  1 
ATOM   1081 C  CG  . TYR A 1 137 ? 22.822 -9.063  -5.184  1.00 16.66  ? 133 TYR A CG  1 
ATOM   1082 C  CD1 . TYR A 1 137 ? 23.873 -8.249  -4.773  1.00 17.87  ? 133 TYR A CD1 1 
ATOM   1083 C  CD2 . TYR A 1 137 ? 22.897 -9.638  -6.452  1.00 16.87  ? 133 TYR A CD2 1 
ATOM   1084 C  CE1 . TYR A 1 137 ? 24.953 -7.982  -5.613  1.00 16.50  ? 133 TYR A CE1 1 
ATOM   1085 C  CE2 . TYR A 1 137 ? 23.964 -9.368  -7.307  1.00 17.39  ? 133 TYR A CE2 1 
ATOM   1086 C  CZ  . TYR A 1 137 ? 24.984 -8.532  -6.884  1.00 22.18  ? 133 TYR A CZ  1 
ATOM   1087 O  OH  . TYR A 1 137 ? 26.066 -8.306  -7.688  1.00 21.08  ? 133 TYR A OH  1 
ATOM   1088 N  N   . CYS A 1 138 ? 21.301 -10.676 -0.964  1.00 17.43  ? 134 CYS A N   1 
ATOM   1089 C  CA  . CYS A 1 138 ? 20.444 -10.970 0.182   1.00 18.35  ? 134 CYS A CA  1 
ATOM   1090 C  C   . CYS A 1 138 ? 19.563 -9.811  0.626   1.00 24.41  ? 134 CYS A C   1 
ATOM   1091 O  O   . CYS A 1 138 ? 20.056 -8.716  0.937   1.00 23.65  ? 134 CYS A O   1 
ATOM   1092 C  CB  . CYS A 1 138 ? 21.293 -11.497 1.338   1.00 19.54  ? 134 CYS A CB  1 
ATOM   1093 S  SG  . CYS A 1 138 ? 20.345 -11.921 2.823   1.00 24.75  ? 134 CYS A SG  1 
ATOM   1094 N  N   . LYS A 1 139 ? 18.245 -10.081 0.689   1.00 23.39  ? 135 LYS A N   1 
ATOM   1095 C  CA  . LYS A 1 139 ? 17.218 -9.166  1.181   1.00 23.69  ? 135 LYS A CA  1 
ATOM   1096 C  C   . LYS A 1 139 ? 16.496 -9.840  2.348   1.00 28.82  ? 135 LYS A C   1 
ATOM   1097 O  O   . LYS A 1 139 ? 16.356 -9.229  3.409   1.00 28.06  ? 135 LYS A O   1 
ATOM   1098 C  CB  . LYS A 1 139 ? 16.247 -8.769  0.066   1.00 25.84  ? 135 LYS A CB  1 
ATOM   1099 C  CG  . LYS A 1 139 ? 16.888 -7.849  -0.968  1.00 38.69  ? 135 LYS A CG  1 
ATOM   1100 N  N   . ASP A 1 140 ? 16.043 -11.105 2.152   1.00 24.76  ? 136 ASP A N   1 
ATOM   1101 C  CA  . ASP A 1 140 ? 15.387 -11.891 3.197   1.00 23.63  ? 136 ASP A CA  1 
ATOM   1102 C  C   . ASP A 1 140 ? 16.038 -13.276 3.168   1.00 24.99  ? 136 ASP A C   1 
ATOM   1103 O  O   . ASP A 1 140 ? 15.628 -14.145 2.390   1.00 22.62  ? 136 ASP A O   1 
ATOM   1104 C  CB  . ASP A 1 140 ? 13.858 -11.960 2.974   1.00 25.82  ? 136 ASP A CB  1 
ATOM   1105 C  CG  . ASP A 1 140 ? 13.101 -12.534 4.164   1.00 37.98  ? 136 ASP A CG  1 
ATOM   1106 O  OD1 . ASP A 1 140 ? 13.621 -12.453 5.295   1.00 39.98  ? 136 ASP A OD1 1 
ATOM   1107 O  OD2 . ASP A 1 140 ? 11.972 -13.019 3.969   1.00 45.06  ? 136 ASP A OD2 1 
ATOM   1108 N  N   . LEU A 1 141 ? 17.119 -13.439 3.960   1.00 20.99  ? 137 LEU A N   1 
ATOM   1109 C  CA  . LEU A 1 141 ? 17.976 -14.622 3.970   1.00 19.56  ? 137 LEU A CA  1 
ATOM   1110 C  C   . LEU A 1 141 ? 17.247 -15.981 3.988   1.00 22.67  ? 137 LEU A C   1 
ATOM   1111 O  O   . LEU A 1 141 ? 17.465 -16.764 3.065   1.00 22.37  ? 137 LEU A O   1 
ATOM   1112 C  CB  . LEU A 1 141 ? 19.017 -14.551 5.100   1.00 19.49  ? 137 LEU A CB  1 
ATOM   1113 C  CG  . LEU A 1 141 ? 20.093 -15.649 5.071   1.00 24.14  ? 137 LEU A CG  1 
ATOM   1114 C  CD1 . LEU A 1 141 ? 20.862 -15.660 3.740   1.00 22.77  ? 137 LEU A CD1 1 
ATOM   1115 C  CD2 . LEU A 1 141 ? 21.046 -15.498 6.251   1.00 26.32  ? 137 LEU A CD2 1 
ATOM   1116 N  N   . GLY A 1 142 ? 16.464 -16.273 5.030   1.00 20.46  ? 138 GLY A N   1 
ATOM   1117 C  CA  . GLY A 1 142 ? 15.724 -17.536 5.155   1.00 20.46  ? 138 GLY A CA  1 
ATOM   1118 C  C   . GLY A 1 142 ? 14.900 -17.895 3.931   1.00 23.74  ? 138 GLY A C   1 
ATOM   1119 O  O   . GLY A 1 142 ? 14.992 -19.007 3.415   1.00 24.73  ? 138 GLY A O   1 
ATOM   1120 N  N   . THR A 1 143 ? 14.166 -16.919 3.416   1.00 18.44  ? 139 THR A N   1 
ATOM   1121 C  CA  . THR A 1 143 ? 13.317 -17.032 2.246   1.00 18.18  ? 139 THR A CA  1 
ATOM   1122 C  C   . THR A 1 143 ? 14.120 -17.299 0.979   1.00 22.15  ? 139 THR A C   1 
ATOM   1123 O  O   . THR A 1 143 ? 13.657 -18.015 0.102   1.00 22.72  ? 139 THR A O   1 
ATOM   1124 C  CB  . THR A 1 143 ? 12.452 -15.773 2.151   1.00 29.08  ? 139 THR A CB  1 
ATOM   1125 O  OG1 . THR A 1 143 ? 11.643 -15.663 3.337   1.00 26.38  ? 139 THR A OG1 1 
ATOM   1126 C  CG2 . THR A 1 143 ? 11.589 -15.760 0.951   1.00 27.17  ? 139 THR A CG2 1 
ATOM   1127 N  N   . GLN A 1 144 ? 15.306 -16.705 0.863   1.00 19.33  ? 140 GLN A N   1 
ATOM   1128 C  CA  . GLN A 1 144 ? 16.147 -16.930 -0.314  1.00 17.75  ? 140 GLN A CA  1 
ATOM   1129 C  C   . GLN A 1 144 ? 16.938 -18.230 -0.231  1.00 19.07  ? 140 GLN A C   1 
ATOM   1130 O  O   . GLN A 1 144 ? 17.284 -18.804 -1.270  1.00 17.79  ? 140 GLN A O   1 
ATOM   1131 C  CB  . GLN A 1 144 ? 17.053 -15.730 -0.566  1.00 19.34  ? 140 GLN A CB  1 
ATOM   1132 C  CG  . GLN A 1 144 ? 16.255 -14.519 -1.068  1.00 23.15  ? 140 GLN A CG  1 
ATOM   1133 C  CD  . GLN A 1 144 ? 17.120 -13.307 -1.119  1.00 23.97  ? 140 GLN A CD  1 
ATOM   1134 O  OE1 . GLN A 1 144 ? 17.432 -12.706 -0.091  1.00 24.89  ? 140 GLN A OE1 1 
ATOM   1135 N  NE2 . GLN A 1 144 ? 17.598 -12.976 -2.300  1.00 19.67  ? 140 GLN A NE2 1 
ATOM   1136 N  N   . LEU A 1 145 ? 17.254 -18.685 0.989   1.00 15.24  ? 141 LEU A N   1 
ATOM   1137 C  CA  . LEU A 1 145 ? 17.974 -19.955 1.133   1.00 15.89  ? 141 LEU A CA  1 
ATOM   1138 C  C   . LEU A 1 145 ? 17.131 -21.167 0.805   1.00 20.38  ? 141 LEU A C   1 
ATOM   1139 O  O   . LEU A 1 145 ? 17.658 -22.123 0.228   1.00 19.31  ? 141 LEU A O   1 
ATOM   1140 C  CB  . LEU A 1 145 ? 18.545 -20.116 2.542   1.00 15.95  ? 141 LEU A CB  1 
ATOM   1141 C  CG  . LEU A 1 145 ? 19.735 -19.196 2.881   1.00 19.36  ? 141 LEU A CG  1 
ATOM   1142 C  CD1 . LEU A 1 145 ? 20.317 -19.592 4.235   1.00 20.40  ? 141 LEU A CD1 1 
ATOM   1143 C  CD2 . LEU A 1 145 ? 20.808 -19.211 1.781   1.00 17.24  ? 141 LEU A CD2 1 
ATOM   1144 N  N   . ALA A 1 146 ? 15.833 -21.160 1.193   1.00 17.56  ? 142 ALA A N   1 
ATOM   1145 C  CA  . ALA A 1 146 ? 14.928 -22.307 0.989   1.00 17.29  ? 142 ALA A CA  1 
ATOM   1146 C  C   . ALA A 1 146 ? 14.973 -22.892 -0.449  1.00 18.58  ? 142 ALA A C   1 
ATOM   1147 O  O   . ALA A 1 146 ? 15.234 -24.092 -0.569  1.00 17.95  ? 142 ALA A O   1 
ATOM   1148 C  CB  . ALA A 1 146 ? 13.500 -21.956 1.408   1.00 18.71  ? 142 ALA A CB  1 
ATOM   1149 N  N   . PRO A 1 147 ? 14.819 -22.104 -1.531  1.00 16.60  ? 143 PRO A N   1 
ATOM   1150 C  CA  . PRO A 1 147 ? 14.904 -22.704 -2.874  1.00 17.11  ? 143 PRO A CA  1 
ATOM   1151 C  C   . PRO A 1 147 ? 16.304 -23.183 -3.241  1.00 19.70  ? 143 PRO A C   1 
ATOM   1152 O  O   . PRO A 1 147 ? 16.413 -24.054 -4.091  1.00 17.06  ? 143 PRO A O   1 
ATOM   1153 C  CB  . PRO A 1 147 ? 14.487 -21.578 -3.816  1.00 19.04  ? 143 PRO A CB  1 
ATOM   1154 C  CG  . PRO A 1 147 ? 14.617 -20.354 -3.072  1.00 23.38  ? 143 PRO A CG  1 
ATOM   1155 C  CD  . PRO A 1 147 ? 14.492 -20.667 -1.619  1.00 18.93  ? 143 PRO A CD  1 
ATOM   1156 N  N   . ILE A 1 148 ? 17.355 -22.543 -2.692  1.00 16.42  ? 144 ILE A N   1 
ATOM   1157 C  CA  . ILE A 1 148 ? 18.737 -22.957 -2.967  1.00 15.72  ? 144 ILE A CA  1 
ATOM   1158 C  C   . ILE A 1 148 ? 18.956 -24.354 -2.383  1.00 17.31  ? 144 ILE A C   1 
ATOM   1159 O  O   . ILE A 1 148 ? 19.466 -25.233 -3.071  1.00 16.15  ? 144 ILE A O   1 
ATOM   1160 C  CB  . ILE A 1 148 ? 19.767 -21.925 -2.432  1.00 19.02  ? 144 ILE A CB  1 
ATOM   1161 C  CG1 . ILE A 1 148 ? 19.592 -20.558 -3.156  1.00 18.83  ? 144 ILE A CG1 1 
ATOM   1162 C  CG2 . ILE A 1 148 ? 21.209 -22.477 -2.596  1.00 20.28  ? 144 ILE A CG2 1 
ATOM   1163 C  CD1 . ILE A 1 148 ? 20.441 -19.366 -2.545  1.00 17.19  ? 144 ILE A CD1 1 
ATOM   1164 N  N   . ILE A 1 149 ? 18.534 -24.560 -1.125  1.00 12.51  ? 145 ILE A N   1 
ATOM   1165 C  CA  . ILE A 1 149 ? 18.645 -25.846 -0.438  1.00 12.84  ? 145 ILE A CA  1 
ATOM   1166 C  C   . ILE A 1 149 ? 17.841 -26.918 -1.169  1.00 18.26  ? 145 ILE A C   1 
ATOM   1167 O  O   . ILE A 1 149 ? 18.342 -28.034 -1.369  1.00 16.95  ? 145 ILE A O   1 
ATOM   1168 C  CB  . ILE A 1 149 ? 18.211 -25.655 1.037   1.00 14.98  ? 145 ILE A CB  1 
ATOM   1169 C  CG1 . ILE A 1 149 ? 19.278 -24.788 1.760   1.00 15.49  ? 145 ILE A CG1 1 
ATOM   1170 C  CG2 . ILE A 1 149 ? 17.978 -27.016 1.743   1.00 14.95  ? 145 ILE A CG2 1 
ATOM   1171 C  CD1 . ILE A 1 149 ? 18.900 -24.277 3.198   1.00 20.66  ? 145 ILE A CD1 1 
ATOM   1172 N  N   . GLN A 1 150 ? 16.587 -26.576 -1.571  1.00 15.61  ? 146 GLN A N   1 
ATOM   1173 C  CA  . GLN A 1 150 ? 15.716 -27.510 -2.322  1.00 14.69  ? 146 GLN A CA  1 
ATOM   1174 C  C   . GLN A 1 150 ? 16.377 -27.840 -3.649  1.00 17.71  ? 146 GLN A C   1 
ATOM   1175 O  O   . GLN A 1 150 ? 16.330 -28.991 -4.073  1.00 16.17  ? 146 GLN A O   1 
ATOM   1176 C  CB  . GLN A 1 150 ? 14.308 -26.917 -2.556  1.00 15.73  ? 146 GLN A CB  1 
ATOM   1177 C  CG  . GLN A 1 150 ? 13.474 -26.874 -1.256  1.00 20.70  ? 146 GLN A CG  1 
ATOM   1178 C  CD  . GLN A 1 150 ? 12.207 -26.038 -1.374  1.00 35.66  ? 146 GLN A CD  1 
ATOM   1179 O  OE1 . GLN A 1 150 ? 11.864 -25.536 -2.435  1.00 27.51  ? 146 GLN A OE1 1 
ATOM   1180 N  NE2 . GLN A 1 150 ? 11.525 -25.806 -0.267  1.00 26.37  ? 146 GLN A NE2 1 
ATOM   1181 N  N   . GLU A 1 151 ? 17.035 -26.846 -4.286  1.00 15.98  ? 147 GLU A N   1 
ATOM   1182 C  CA  . GLU A 1 151 ? 17.724 -27.103 -5.550  1.00 15.89  ? 147 GLU A CA  1 
ATOM   1183 C  C   . GLU A 1 151 ? 18.863 -28.104 -5.313  1.00 19.05  ? 147 GLU A C   1 
ATOM   1184 O  O   . GLU A 1 151 ? 19.032 -29.064 -6.089  1.00 18.90  ? 147 GLU A O   1 
ATOM   1185 C  CB  . GLU A 1 151 ? 18.307 -25.800 -6.135  1.00 17.15  ? 147 GLU A CB  1 
ATOM   1186 C  CG  . GLU A 1 151 ? 19.003 -26.048 -7.462  1.00 25.23  ? 147 GLU A CG  1 
ATOM   1187 C  CD  . GLU A 1 151 ? 19.499 -24.837 -8.216  1.00 40.21  ? 147 GLU A CD  1 
ATOM   1188 O  OE1 . GLU A 1 151 ? 19.062 -23.708 -7.898  1.00 27.78  ? 147 GLU A OE1 1 
ATOM   1189 O  OE2 . GLU A 1 151 ? 20.277 -25.028 -9.179  1.00 35.73  ? 147 GLU A OE2 1 
ATOM   1190 N  N   . PHE A 1 152 ? 19.616 -27.889 -4.221  1.00 14.82  ? 148 PHE A N   1 
ATOM   1191 C  CA  . PHE A 1 152 ? 20.724 -28.782 -3.913  1.00 13.88  ? 148 PHE A CA  1 
ATOM   1192 C  C   . PHE A 1 152 ? 20.226 -30.202 -3.716  1.00 18.72  ? 148 PHE A C   1 
ATOM   1193 O  O   . PHE A 1 152 ? 20.805 -31.117 -4.284  1.00 19.32  ? 148 PHE A O   1 
ATOM   1194 C  CB  . PHE A 1 152 ? 21.497 -28.347 -2.659  1.00 14.13  ? 148 PHE A CB  1 
ATOM   1195 C  CG  . PHE A 1 152 ? 22.563 -29.372 -2.294  1.00 14.80  ? 148 PHE A CG  1 
ATOM   1196 C  CD1 . PHE A 1 152 ? 23.637 -29.621 -3.155  1.00 15.53  ? 148 PHE A CD1 1 
ATOM   1197 C  CD2 . PHE A 1 152 ? 22.480 -30.096 -1.110  1.00 15.80  ? 148 PHE A CD2 1 
ATOM   1198 C  CE1 . PHE A 1 152 ? 24.613 -30.561 -2.824  1.00 15.81  ? 148 PHE A CE1 1 
ATOM   1199 C  CE2 . PHE A 1 152 ? 23.468 -31.031 -0.772  1.00 18.80  ? 148 PHE A CE2 1 
ATOM   1200 C  CZ  . PHE A 1 152 ? 24.535 -31.243 -1.628  1.00 16.26  ? 148 PHE A CZ  1 
ATOM   1201 N  N   . PHE A 1 153 ? 19.141 -30.388 -2.935  1.00 14.81  ? 149 PHE A N   1 
ATOM   1202 C  CA  . PHE A 1 153 ? 18.673 -31.731 -2.626  1.00 15.51  ? 149 PHE A CA  1 
ATOM   1203 C  C   . PHE A 1 153 ? 18.058 -32.458 -3.823  1.00 18.80  ? 149 PHE A C   1 
ATOM   1204 O  O   . PHE A 1 153 ? 18.008 -33.693 -3.824  1.00 18.09  ? 149 PHE A O   1 
ATOM   1205 C  CB  . PHE A 1 153 ? 17.759 -31.720 -1.408  1.00 17.93  ? 149 PHE A CB  1 
ATOM   1206 C  CG  . PHE A 1 153 ? 18.570 -31.600 -0.136  1.00 20.98  ? 149 PHE A CG  1 
ATOM   1207 C  CD1 . PHE A 1 153 ? 19.580 -32.520 0.157   1.00 25.76  ? 149 PHE A CD1 1 
ATOM   1208 C  CD2 . PHE A 1 153 ? 18.291 -30.610 0.794   1.00 23.01  ? 149 PHE A CD2 1 
ATOM   1209 C  CE1 . PHE A 1 153 ? 20.315 -32.421 1.346   1.00 26.77  ? 149 PHE A CE1 1 
ATOM   1210 C  CE2 . PHE A 1 153 ? 19.019 -30.524 1.989   1.00 25.57  ? 149 PHE A CE2 1 
ATOM   1211 C  CZ  . PHE A 1 153 ? 20.040 -31.411 2.242   1.00 24.39  ? 149 PHE A CZ  1 
ATOM   1212 N  N   . SER A 1 154 ? 17.763 -31.717 -4.886  1.00 14.97  ? 150 SER A N   1 
ATOM   1213 C  CA  . SER A 1 154 ? 17.256 -32.291 -6.129  1.00 16.30  ? 150 SER A CA  1 
ATOM   1214 C  C   . SER A 1 154 ? 18.342 -32.411 -7.197  1.00 21.38  ? 150 SER A C   1 
ATOM   1215 O  O   . SER A 1 154 ? 18.041 -32.854 -8.302  1.00 20.04  ? 150 SER A O   1 
ATOM   1216 C  CB  . SER A 1 154 ? 16.133 -31.417 -6.687  1.00 22.31  ? 150 SER A CB  1 
ATOM   1217 O  OG  . SER A 1 154 ? 15.102 -31.205 -5.737  1.00 34.12  ? 150 SER A OG  1 
ATOM   1218 N  N   . SER A 1 155 ? 19.606 -32.044 -6.874  1.00 17.48  ? 151 SER A N   1 
ATOM   1219 C  CA  . SER A 1 155 ? 20.708 -31.984 -7.851  1.00 16.72  ? 151 SER A CA  1 
ATOM   1220 C  C   . SER A 1 155 ? 21.445 -33.293 -8.096  1.00 22.25  ? 151 SER A C   1 
ATOM   1221 O  O   . SER A 1 155 ? 21.424 -34.182 -7.245  1.00 19.87  ? 151 SER A O   1 
ATOM   1222 C  CB  . SER A 1 155 ? 21.720 -30.908 -7.434  1.00 16.55  ? 151 SER A CB  1 
ATOM   1223 O  OG  . SER A 1 155 ? 22.509 -31.354 -6.336  1.00 15.43  ? 151 SER A OG  1 
ATOM   1224 N  N   . GLU A 1 156 ? 22.173 -33.362 -9.236  1.00 20.80  ? 152 GLU A N   1 
ATOM   1225 C  CA  . GLU A 1 156 ? 23.046 -34.497 -9.575  1.00 21.75  ? 152 GLU A CA  1 
ATOM   1226 C  C   . GLU A 1 156 ? 24.223 -34.521 -8.558  1.00 23.87  ? 152 GLU A C   1 
ATOM   1227 O  O   . GLU A 1 156 ? 24.697 -35.593 -8.172  1.00 21.92  ? 152 GLU A O   1 
ATOM   1228 C  CB  . GLU A 1 156 ? 23.589 -34.332 -11.005 1.00 23.61  ? 152 GLU A CB  1 
ATOM   1229 N  N   . GLN A 1 157 ? 24.651 -33.318 -8.105  1.00 19.01  ? 153 GLN A N   1 
ATOM   1230 C  CA  . GLN A 1 157 ? 25.737 -33.126 -7.128  1.00 17.76  ? 153 GLN A CA  1 
ATOM   1231 C  C   . GLN A 1 157 ? 25.403 -33.780 -5.823  1.00 20.52  ? 153 GLN A C   1 
ATOM   1232 O  O   . GLN A 1 157 ? 26.281 -34.384 -5.225  1.00 21.13  ? 153 GLN A O   1 
ATOM   1233 C  CB  . GLN A 1 157 ? 26.030 -31.627 -6.882  1.00 18.09  ? 153 GLN A CB  1 
ATOM   1234 C  CG  . GLN A 1 157 ? 26.646 -30.888 -8.070  1.00 14.48  ? 153 GLN A CG  1 
ATOM   1235 C  CD  . GLN A 1 157 ? 25.610 -30.159 -8.901  1.00 26.82  ? 153 GLN A CD  1 
ATOM   1236 O  OE1 . GLN A 1 157 ? 24.536 -30.676 -9.148  1.00 17.60  ? 153 GLN A OE1 1 
ATOM   1237 N  NE2 . GLN A 1 157 ? 25.943 -28.975 -9.408  1.00 18.92  ? 153 GLN A NE2 1 
ATOM   1238 N  N   . TYR A 1 158 ? 24.137 -33.675 -5.353  1.00 16.24  ? 154 TYR A N   1 
ATOM   1239 C  CA  . TYR A 1 158 ? 23.727 -34.324 -4.092  1.00 16.07  ? 154 TYR A CA  1 
ATOM   1240 C  C   . TYR A 1 158 ? 23.669 -35.830 -4.293  1.00 22.95  ? 154 TYR A C   1 
ATOM   1241 O  O   . TYR A 1 158 ? 24.084 -36.582 -3.420  1.00 21.43  ? 154 TYR A O   1 
ATOM   1242 C  CB  . TYR A 1 158 ? 22.341 -33.843 -3.607  1.00 16.87  ? 154 TYR A CB  1 
ATOM   1243 C  CG  . TYR A 1 158 ? 21.861 -34.546 -2.353  1.00 21.39  ? 154 TYR A CG  1 
ATOM   1244 C  CD1 . TYR A 1 158 ? 22.539 -34.405 -1.147  1.00 23.08  ? 154 TYR A CD1 1 
ATOM   1245 C  CD2 . TYR A 1 158 ? 20.713 -35.335 -2.365  1.00 24.40  ? 154 TYR A CD2 1 
ATOM   1246 C  CE1 . TYR A 1 158 ? 22.117 -35.062 0.003   1.00 24.38  ? 154 TYR A CE1 1 
ATOM   1247 C  CE2 . TYR A 1 158 ? 20.263 -35.976 -1.210  1.00 25.57  ? 154 TYR A CE2 1 
ATOM   1248 C  CZ  . TYR A 1 158 ? 20.973 -35.837 -0.026  1.00 33.24  ? 154 TYR A CZ  1 
ATOM   1249 O  OH  . TYR A 1 158 ? 20.553 -36.449 1.127   1.00 35.83  ? 154 TYR A OH  1 
ATOM   1250 N  N   . ARG A 1 159 ? 23.068 -36.247 -5.406  1.00 22.64  ? 155 ARG A N   1 
ATOM   1251 C  CA  . ARG A 1 159 ? 22.878 -37.650 -5.759  1.00 24.50  ? 155 ARG A CA  1 
ATOM   1252 C  C   . ARG A 1 159 ? 24.201 -38.416 -5.865  1.00 29.01  ? 155 ARG A C   1 
ATOM   1253 O  O   . ARG A 1 159 ? 24.339 -39.460 -5.238  1.00 28.97  ? 155 ARG A O   1 
ATOM   1254 C  CB  . ARG A 1 159 ? 22.082 -37.753 -7.075  1.00 26.31  ? 155 ARG A CB  1 
ATOM   1255 C  CG  . ARG A 1 159 ? 21.613 -39.175 -7.353  1.00 35.95  ? 155 ARG A CG  1 
ATOM   1256 C  CD  . ARG A 1 159 ? 20.954 -39.308 -8.713  1.00 40.39  ? 155 ARG A CD  1 
ATOM   1257 N  NE  . ARG A 1 159 ? 21.911 -39.214 -9.814  1.00 49.25  ? 155 ARG A NE  1 
ATOM   1258 C  CZ  . ARG A 1 159 ? 22.663 -40.219 -10.254 1.00 67.42  ? 155 ARG A CZ  1 
ATOM   1259 N  NH1 . ARG A 1 159 ? 22.590 -41.412 -9.666  1.00 58.39  ? 155 ARG A NH1 1 
ATOM   1260 N  NH2 . ARG A 1 159 ? 23.496 -40.045 -11.265 1.00 56.79  ? 155 ARG A NH2 1 
ATOM   1261 N  N   . THR A 1 160 ? 25.171 -37.870 -6.619  1.00 25.55  ? 156 THR A N   1 
ATOM   1262 C  CA  . THR A 1 160 ? 26.476 -38.511 -6.839  1.00 26.22  ? 156 THR A CA  1 
ATOM   1263 C  C   . THR A 1 160 ? 27.584 -38.127 -5.836  1.00 30.91  ? 156 THR A C   1 
ATOM   1264 O  O   . THR A 1 160 ? 28.556 -38.877 -5.698  1.00 30.84  ? 156 THR A O   1 
ATOM   1265 C  CB  . THR A 1 160 ? 26.982 -38.196 -8.261  1.00 32.78  ? 156 THR A CB  1 
ATOM   1266 O  OG1 . THR A 1 160 ? 27.349 -36.821 -8.304  1.00 25.33  ? 156 THR A OG1 1 
ATOM   1267 C  CG2 . THR A 1 160 ? 25.954 -38.507 -9.363  1.00 29.35  ? 156 THR A CG2 1 
ATOM   1268 N  N   . GLY A 1 161 ? 27.496 -36.929 -5.247  1.00 25.40  ? 157 GLY A N   1 
ATOM   1269 C  CA  . GLY A 1 161 ? 28.539 -36.419 -4.362  1.00 24.41  ? 157 GLY A CA  1 
ATOM   1270 C  C   . GLY A 1 161 ? 29.690 -35.831 -5.166  1.00 27.21  ? 157 GLY A C   1 
ATOM   1271 O  O   . GLY A 1 161 ? 30.750 -35.537 -4.616  1.00 26.59  ? 157 GLY A O   1 
ATOM   1272 N  N   . LYS A 1 162 ? 29.461 -35.596 -6.470  1.00 22.90  ? 158 LYS A N   1 
ATOM   1273 C  CA  . LYS A 1 162 ? 30.432 -35.072 -7.424  1.00 23.08  ? 158 LYS A CA  1 
ATOM   1274 C  C   . LYS A 1 162 ? 30.044 -33.665 -7.894  1.00 25.36  ? 158 LYS A C   1 
ATOM   1275 O  O   . LYS A 1 162 ? 28.905 -33.462 -8.312  1.00 23.34  ? 158 LYS A O   1 
ATOM   1276 C  CB  . LYS A 1 162 ? 30.511 -35.993 -8.670  1.00 27.09  ? 158 LYS A CB  1 
ATOM   1277 C  CG  . LYS A 1 162 ? 30.819 -37.473 -8.405  1.00 42.14  ? 158 LYS A CG  1 
ATOM   1278 C  CD  . LYS A 1 162 ? 32.298 -37.777 -8.239  1.00 47.92  ? 158 LYS A CD  1 
ATOM   1279 C  CE  . LYS A 1 162 ? 32.533 -39.242 -7.984  1.00 56.23  ? 158 LYS A CE  1 
ATOM   1280 N  N   . PRO A 1 163 ? 30.974 -32.687 -7.912  1.00 22.15  ? 159 PRO A N   1 
ATOM   1281 C  CA  . PRO A 1 163 ? 30.610 -31.351 -8.422  1.00 21.03  ? 159 PRO A CA  1 
ATOM   1282 C  C   . PRO A 1 163 ? 30.458 -31.338 -9.943  1.00 24.29  ? 159 PRO A C   1 
ATOM   1283 O  O   . PRO A 1 163 ? 30.989 -32.224 -10.613 1.00 23.33  ? 159 PRO A O   1 
ATOM   1284 C  CB  . PRO A 1 163 ? 31.778 -30.468 -7.999  1.00 23.63  ? 159 PRO A CB  1 
ATOM   1285 C  CG  . PRO A 1 163 ? 32.684 -31.357 -7.130  1.00 29.29  ? 159 PRO A CG  1 
ATOM   1286 C  CD  . PRO A 1 163 ? 32.387 -32.754 -7.494  1.00 24.52  ? 159 PRO A CD  1 
ATOM   1287 N  N   . ILE A 1 164 ? 29.674 -30.403 -10.472 1.00 20.43  ? 160 ILE A N   1 
ATOM   1288 C  CA  . ILE A 1 164 ? 29.538 -30.163 -11.910 1.00 21.36  ? 160 ILE A CA  1 
ATOM   1289 C  C   . ILE A 1 164 ? 30.430 -28.918 -12.110 1.00 22.97  ? 160 ILE A C   1 
ATOM   1290 O  O   . ILE A 1 164 ? 30.063 -27.829 -11.659 1.00 19.99  ? 160 ILE A O   1 
ATOM   1291 C  CB  . ILE A 1 164 ? 28.079 -29.975 -12.425 1.00 25.06  ? 160 ILE A CB  1 
ATOM   1292 C  CG1 . ILE A 1 164 ? 27.238 -31.262 -12.170 1.00 26.74  ? 160 ILE A CG1 1 
ATOM   1293 C  CG2 . ILE A 1 164 ? 28.107 -29.597 -13.925 1.00 25.03  ? 160 ILE A CG2 1 
ATOM   1294 C  CD1 . ILE A 1 164 ? 25.677 -31.204 -12.525 1.00 31.78  ? 160 ILE A CD1 1 
ATOM   1295 N  N   . PRO A 1 165 ? 31.662 -29.102 -12.659 1.00 20.61  ? 161 PRO A N   1 
ATOM   1296 C  CA  . PRO A 1 165 ? 32.602 -27.961 -12.786 1.00 20.33  ? 161 PRO A CA  1 
ATOM   1297 C  C   . PRO A 1 165 ? 32.024 -26.675 -13.366 1.00 22.34  ? 161 PRO A C   1 
ATOM   1298 O  O   . PRO A 1 165 ? 32.281 -25.604 -12.796 1.00 20.16  ? 161 PRO A O   1 
ATOM   1299 C  CB  . PRO A 1 165 ? 33.736 -28.522 -13.658 1.00 22.79  ? 161 PRO A CB  1 
ATOM   1300 C  CG  . PRO A 1 165 ? 33.686 -29.974 -13.449 1.00 28.18  ? 161 PRO A CG  1 
ATOM   1301 C  CD  . PRO A 1 165 ? 32.249 -30.348 -13.190 1.00 23.68  ? 161 PRO A CD  1 
ATOM   1302 N  N   . ASP A 1 166 ? 31.222 -26.757 -14.466 1.00 18.70  ? 162 ASP A N   1 
ATOM   1303 C  CA  . ASP A 1 166 ? 30.610 -25.579 -15.094 1.00 21.44  ? 162 ASP A CA  1 
ATOM   1304 C  C   . ASP A 1 166 ? 29.660 -24.814 -14.172 1.00 24.75  ? 162 ASP A C   1 
ATOM   1305 O  O   . ASP A 1 166 ? 29.364 -23.637 -14.421 1.00 24.64  ? 162 ASP A O   1 
ATOM   1306 C  CB  . ASP A 1 166 ? 29.857 -25.974 -16.381 1.00 25.89  ? 162 ASP A CB  1 
ATOM   1307 C  CG  . ASP A 1 166 ? 30.761 -26.287 -17.555 1.00 46.27  ? 162 ASP A CG  1 
ATOM   1308 O  OD1 . ASP A 1 166 ? 31.747 -25.545 -17.764 1.00 46.27  ? 162 ASP A OD1 1 
ATOM   1309 O  OD2 . ASP A 1 166 ? 30.437 -27.231 -18.314 1.00 59.74  ? 162 ASP A OD2 1 
ATOM   1310 N  N   . GLN A 1 167 ? 29.198 -25.483 -13.104 1.00 19.65  ? 163 GLN A N   1 
ATOM   1311 C  CA  . GLN A 1 167 ? 28.270 -24.884 -12.150 1.00 18.35  ? 163 GLN A CA  1 
ATOM   1312 C  C   . GLN A 1 167 ? 28.963 -24.274 -10.924 1.00 23.22  ? 163 GLN A C   1 
ATOM   1313 O  O   . GLN A 1 167 ? 28.291 -23.783 -10.013 1.00 23.45  ? 163 GLN A O   1 
ATOM   1314 C  CB  . GLN A 1 167 ? 27.192 -25.898 -11.757 1.00 18.91  ? 163 GLN A CB  1 
ATOM   1315 C  CG  . GLN A 1 167 ? 26.250 -26.186 -12.938 1.00 28.29  ? 163 GLN A CG  1 
ATOM   1316 C  CD  . GLN A 1 167 ? 25.150 -27.171 -12.636 1.00 37.50  ? 163 GLN A CD  1 
ATOM   1317 O  OE1 . GLN A 1 167 ? 24.746 -27.359 -11.489 1.00 29.97  ? 163 GLN A OE1 1 
ATOM   1318 N  NE2 . GLN A 1 167 ? 24.574 -27.762 -13.679 1.00 29.24  ? 163 GLN A NE2 1 
ATOM   1319 N  N   . LEU A 1 168 ? 30.297 -24.268 -10.914 1.00 18.55  ? 164 LEU A N   1 
ATOM   1320 C  CA  . LEU A 1 168 ? 31.052 -23.663 -9.829  1.00 17.23  ? 164 LEU A CA  1 
ATOM   1321 C  C   . LEU A 1 168 ? 31.651 -22.380 -10.359 1.00 20.80  ? 164 LEU A C   1 
ATOM   1322 O  O   . LEU A 1 168 ? 31.977 -22.278 -11.554 1.00 18.60  ? 164 LEU A O   1 
ATOM   1323 C  CB  . LEU A 1 168 ? 32.160 -24.609 -9.338  1.00 17.41  ? 164 LEU A CB  1 
ATOM   1324 C  CG  . LEU A 1 168 ? 31.728 -25.930 -8.699  1.00 21.72  ? 164 LEU A CG  1 
ATOM   1325 C  CD1 . LEU A 1 168 ? 32.921 -26.769 -8.335  1.00 22.90  ? 164 LEU A CD1 1 
ATOM   1326 C  CD2 . LEU A 1 168 ? 30.860 -25.707 -7.479  1.00 23.48  ? 164 LEU A CD2 1 
ATOM   1327 N  N   . LEU A 1 169 ? 31.844 -21.411 -9.478  1.00 17.12  ? 165 LEU A N   1 
ATOM   1328 C  CA  . LEU A 1 169 ? 32.476 -20.159 -9.881  1.00 19.22  ? 165 LEU A CA  1 
ATOM   1329 C  C   . LEU A 1 169 ? 33.958 -20.404 -10.029 1.00 20.72  ? 165 LEU A C   1 
ATOM   1330 O  O   . LEU A 1 169 ? 34.499 -21.243 -9.315  1.00 19.51  ? 165 LEU A O   1 
ATOM   1331 C  CB  . LEU A 1 169 ? 32.302 -19.086 -8.786  1.00 20.43  ? 165 LEU A CB  1 
ATOM   1332 C  CG  . LEU A 1 169 ? 30.918 -18.500 -8.530  1.00 26.34  ? 165 LEU A CG  1 
ATOM   1333 C  CD1 . LEU A 1 169 ? 31.026 -17.368 -7.513  1.00 26.69  ? 165 LEU A CD1 1 
ATOM   1334 C  CD2 . LEU A 1 169 ? 30.294 -17.938 -9.804  1.00 31.39  ? 165 LEU A CD2 1 
ATOM   1335 N  N   . LYS A 1 170 ? 34.628 -19.626 -10.879 1.00 20.21  ? 166 LYS A N   1 
ATOM   1336 C  CA  . LYS A 1 170 ? 36.092 -19.706 -11.035 1.00 21.18  ? 166 LYS A CA  1 
ATOM   1337 C  C   . LYS A 1 170 ? 36.778 -19.296 -9.733  1.00 27.05  ? 166 LYS A C   1 
ATOM   1338 O  O   . LYS A 1 170 ? 37.804 -19.866 -9.361  1.00 27.00  ? 166 LYS A O   1 
ATOM   1339 C  CB  . LYS A 1 170 ? 36.547 -18.868 -12.231 1.00 23.22  ? 166 LYS A CB  1 
ATOM   1340 C  CG  . LYS A 1 170 ? 35.889 -19.394 -13.507 1.00 27.32  ? 166 LYS A CG  1 
ATOM   1341 C  CD  . LYS A 1 170 ? 36.392 -18.786 -14.817 1.00 34.99  ? 166 LYS A CD  1 
ATOM   1342 C  CE  . LYS A 1 170 ? 35.488 -19.273 -15.933 1.00 39.85  ? 166 LYS A CE  1 
ATOM   1343 N  NZ  . LYS A 1 170 ? 35.961 -18.848 -17.272 1.00 61.80  ? 166 LYS A NZ  1 
ATOM   1344 N  N   . GLU A 1 171 ? 36.154 -18.367 -8.998  1.00 23.89  ? 167 GLU A N   1 
ATOM   1345 C  CA  . GLU A 1 171 ? 36.661 -17.919 -7.700  1.00 23.97  ? 167 GLU A CA  1 
ATOM   1346 C  C   . GLU A 1 171 ? 35.508 -17.265 -6.932  1.00 25.09  ? 167 GLU A C   1 
ATOM   1347 O  O   . GLU A 1 171 ? 34.569 -16.813 -7.584  1.00 23.93  ? 167 GLU A O   1 
ATOM   1348 C  CB  . GLU A 1 171 ? 37.842 -16.928 -7.879  1.00 25.05  ? 167 GLU A CB  1 
ATOM   1349 C  CG  . GLU A 1 171 ? 37.532 -15.695 -8.715  1.00 36.80  ? 167 GLU A CG  1 
ATOM   1350 N  N   . PRO A 1 172 ? 35.572 -17.121 -5.589  1.00 21.34  ? 168 PRO A N   1 
ATOM   1351 C  CA  . PRO A 1 172 ? 34.482 -16.423 -4.900  1.00 20.28  ? 168 PRO A CA  1 
ATOM   1352 C  C   . PRO A 1 172 ? 34.422 -14.943 -5.305  1.00 24.30  ? 168 PRO A C   1 
ATOM   1353 O  O   . PRO A 1 172 ? 35.444 -14.411 -5.768  1.00 24.27  ? 168 PRO A O   1 
ATOM   1354 C  CB  . PRO A 1 172 ? 34.796 -16.628 -3.405  1.00 21.94  ? 168 PRO A CB  1 
ATOM   1355 C  CG  . PRO A 1 172 ? 36.223 -16.941 -3.336  1.00 27.77  ? 168 PRO A CG  1 
ATOM   1356 C  CD  . PRO A 1 172 ? 36.617 -17.577 -4.643  1.00 23.63  ? 168 PRO A CD  1 
ATOM   1357 N  N   . PRO A 1 173 ? 33.249 -14.262 -5.208  1.00 20.72  ? 169 PRO A N   1 
ATOM   1358 C  CA  . PRO A 1 173 ? 33.192 -12.836 -5.591  1.00 20.72  ? 169 PRO A CA  1 
ATOM   1359 C  C   . PRO A 1 173 ? 34.023 -11.910 -4.693  1.00 23.92  ? 169 PRO A C   1 
ATOM   1360 O  O   . PRO A 1 173 ? 34.185 -10.746 -5.016  1.00 24.11  ? 169 PRO A O   1 
ATOM   1361 C  CB  . PRO A 1 173 ? 31.700 -12.493 -5.523  1.00 22.52  ? 169 PRO A CB  1 
ATOM   1362 C  CG  . PRO A 1 173 ? 31.112 -13.511 -4.573  1.00 25.91  ? 169 PRO A CG  1 
ATOM   1363 C  CD  . PRO A 1 173 ? 31.932 -14.758 -4.727  1.00 20.91  ? 169 PRO A CD  1 
ATOM   1364 N  N   . PHE A 1 174 ? 34.555 -12.427 -3.578  1.00 18.72  ? 170 PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 174 ? 35.410 -11.672 -2.660  1.00 18.17  ? 170 PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 174 ? 36.365 -12.664 -1.956  1.00 21.38  ? 170 PHE A C   1 
ATOM   1367 O  O   . PHE A 1 174 ? 36.052 -13.853 -1.928  1.00 19.97  ? 170 PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 174 ? 34.565 -10.906 -1.609  1.00 19.05  ? 170 PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 174 ? 33.475 -11.720 -0.949  1.00 18.35  ? 170 PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 174 ? 33.785 -12.717 -0.028  1.00 19.83  ? 170 PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 174 ? 32.138 -11.485 -1.242  1.00 19.72  ? 170 PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 174 ? 32.775 -13.503 0.551   1.00 20.42  ? 170 PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 174 ? 31.132 -12.244 -0.645  1.00 21.87  ? 170 PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 174 ? 31.455 -13.247 0.251   1.00 19.38  ? 170 PHE A CZ  1 
ATOM   1375 N  N   . PRO A 1 175 ? 37.500 -12.216 -1.357  1.00 19.63  ? 171 PRO A N   1 
ATOM   1376 C  CA  . PRO A 1 175 ? 38.371 -13.166 -0.653  1.00 19.60  ? 171 PRO A CA  1 
ATOM   1377 C  C   . PRO A 1 175 ? 37.681 -13.678 0.609   1.00 21.31  ? 171 PRO A C   1 
ATOM   1378 O  O   . PRO A 1 175 ? 37.081 -12.881 1.344   1.00 18.99  ? 171 PRO A O   1 
ATOM   1379 C  CB  . PRO A 1 175 ? 39.594 -12.309 -0.256  1.00 21.80  ? 171 PRO A CB  1 
ATOM   1380 C  CG  . PRO A 1 175 ? 39.504 -11.053 -1.076  1.00 26.95  ? 171 PRO A CG  1 
ATOM   1381 C  CD  . PRO A 1 175 ? 38.031 -10.836 -1.271  1.00 22.63  ? 171 PRO A CD  1 
ATOM   1382 N  N   . LEU A 1 176 ? 37.803 -14.980 0.889   1.00 17.32  ? 172 LEU A N   1 
ATOM   1383 C  CA  . LEU A 1 176 ? 37.223 -15.482 2.128   1.00 17.74  ? 172 LEU A CA  1 
ATOM   1384 C  C   . LEU A 1 176 ? 38.138 -15.042 3.277   1.00 19.70  ? 172 LEU A C   1 
ATOM   1385 O  O   . LEU A 1 176 ? 39.318 -14.720 3.055   1.00 17.48  ? 172 LEU A O   1 
ATOM   1386 C  CB  . LEU A 1 176 ? 37.022 -16.992 2.102   1.00 18.65  ? 172 LEU A CB  1 
ATOM   1387 C  CG  . LEU A 1 176 ? 36.235 -17.568 0.898   1.00 25.35  ? 172 LEU A CG  1 
ATOM   1388 C  CD1 . LEU A 1 176 ? 36.170 -19.067 0.977   1.00 27.20  ? 172 LEU A CD1 1 
ATOM   1389 C  CD2 . LEU A 1 176 ? 34.810 -16.994 0.804   1.00 27.97  ? 172 LEU A CD2 1 
ATOM   1390 N  N   . SER A 1 177 ? 37.574 -14.952 4.479   1.00 13.95  ? 173 SER A N   1 
ATOM   1391 C  CA  . SER A 1 177 ? 38.296 -14.542 5.675   1.00 13.37  ? 173 SER A CA  1 
ATOM   1392 C  C   . SER A 1 177 ? 39.605 -15.328 5.928   1.00 18.03  ? 173 SER A C   1 
ATOM   1393 O  O   . SER A 1 177 ? 39.649 -16.544 5.764   1.00 16.92  ? 173 SER A O   1 
ATOM   1394 C  CB  . SER A 1 177 ? 37.396 -14.713 6.886   1.00 13.26  ? 173 SER A CB  1 
ATOM   1395 O  OG  . SER A 1 177 ? 38.078 -14.292 8.060   1.00 17.04  ? 173 SER A OG  1 
ATOM   1396 N  N   . THR A 1 178 ? 40.641 -14.624 6.390   1.00 16.41  ? 174 THR A N   1 
ATOM   1397 C  CA  . THR A 1 178 ? 41.911 -15.266 6.759   1.00 16.29  ? 174 THR A CA  1 
ATOM   1398 C  C   . THR A 1 178 ? 42.034 -15.220 8.284   1.00 20.89  ? 174 THR A C   1 
ATOM   1399 O  O   . THR A 1 178 ? 43.072 -15.555 8.835   1.00 21.55  ? 174 THR A O   1 
ATOM   1400 C  CB  . THR A 1 178 ? 43.129 -14.554 6.094   1.00 23.03  ? 174 THR A CB  1 
ATOM   1401 O  OG1 . THR A 1 178 ? 43.330 -13.255 6.635   1.00 27.22  ? 174 THR A OG1 1 
ATOM   1402 C  CG2 . THR A 1 178 ? 43.064 -14.509 4.595   1.00 23.54  ? 174 THR A CG2 1 
ATOM   1403 N  N   . ARG A 1 179 ? 40.987 -14.775 8.974   1.00 17.06  ? 175 ARG A N   1 
ATOM   1404 C  CA  . ARG A 1 179 ? 41.085 -14.563 10.409  1.00 17.05  ? 175 ARG A CA  1 
ATOM   1405 C  C   . ARG A 1 179 ? 40.970 -15.772 11.295  1.00 21.95  ? 175 ARG A C   1 
ATOM   1406 O  O   . ARG A 1 179 ? 40.329 -16.770 10.943  1.00 21.46  ? 175 ARG A O   1 
ATOM   1407 C  CB  . ARG A 1 179 ? 40.053 -13.523 10.823  1.00 20.81  ? 175 ARG A CB  1 
ATOM   1408 C  CG  . ARG A 1 179 ? 40.468 -12.201 10.233  1.00 29.85  ? 175 ARG A CG  1 
ATOM   1409 C  CD  . ARG A 1 179 ? 39.694 -11.093 10.778  1.00 30.30  ? 175 ARG A CD  1 
ATOM   1410 N  NE  . ARG A 1 179 ? 40.006 -10.821 12.175  1.00 30.72  ? 175 ARG A NE  1 
ATOM   1411 C  CZ  . ARG A 1 179 ? 39.427 -9.835  12.838  1.00 39.05  ? 175 ARG A CZ  1 
ATOM   1412 N  NH1 . ARG A 1 179 ? 38.523 -9.069  12.236  1.00 23.19  ? 175 ARG A NH1 1 
ATOM   1413 N  NH2 . ARG A 1 179 ? 39.739 -9.605  14.107  1.00 30.41  ? 175 ARG A NH2 1 
ATOM   1414 N  N   . SER A 1 180 ? 41.592 -15.667 12.491  1.00 18.91  ? 176 SER A N   1 
ATOM   1415 C  CA  . SER A 1 180 ? 41.467 -16.700 13.512  1.00 19.51  ? 176 SER A CA  1 
ATOM   1416 C  C   . SER A 1 180 ? 40.158 -16.378 14.219  1.00 22.68  ? 176 SER A C   1 
ATOM   1417 O  O   . SER A 1 180 ? 39.861 -15.205 14.463  1.00 22.78  ? 176 SER A O   1 
ATOM   1418 C  CB  . SER A 1 180 ? 42.630 -16.656 14.498  1.00 23.12  ? 176 SER A CB  1 
ATOM   1419 O  OG  . SER A 1 180 ? 42.732 -15.371 15.082  1.00 33.73  ? 176 SER A OG  1 
ATOM   1420 N  N   . ILE A 1 181 ? 39.399 -17.405 14.556  1.00 17.53  ? 177 ILE A N   1 
ATOM   1421 C  CA  . ILE A 1 181 ? 38.071 -17.290 15.155  1.00 17.45  ? 177 ILE A CA  1 
ATOM   1422 C  C   . ILE A 1 181 ? 38.242 -17.223 16.676  1.00 21.45  ? 177 ILE A C   1 
ATOM   1423 O  O   . ILE A 1 181 ? 39.043 -17.987 17.215  1.00 18.97  ? 177 ILE A O   1 
ATOM   1424 C  CB  . ILE A 1 181 ? 37.225 -18.517 14.670  1.00 21.51  ? 177 ILE A CB  1 
ATOM   1425 C  CG1 . ILE A 1 181 ? 37.048 -18.552 13.111  1.00 22.60  ? 177 ILE A CG1 1 
ATOM   1426 C  CG2 . ILE A 1 181 ? 35.886 -18.652 15.375  1.00 22.01  ? 177 ILE A CG2 1 
ATOM   1427 C  CD1 . ILE A 1 181 ? 36.496 -17.334 12.432  1.00 31.97  ? 177 ILE A CD1 1 
ATOM   1428 N  N   . MET A 1 182 ? 37.507 -16.306 17.369  1.00 16.04  ? 178 MET A N   1 
ATOM   1429 C  CA  . MET A 1 182 ? 37.612 -16.191 18.842  1.00 14.90  ? 178 MET A CA  1 
ATOM   1430 C  C   . MET A 1 182 ? 36.930 -17.376 19.532  1.00 18.67  ? 178 MET A C   1 
ATOM   1431 O  O   . MET A 1 182 ? 36.176 -18.132 18.921  1.00 17.66  ? 178 MET A O   1 
ATOM   1432 C  CB  . MET A 1 182 ? 36.955 -14.887 19.356  1.00 16.33  ? 178 MET A CB  1 
ATOM   1433 C  CG  . MET A 1 182 ? 35.404 -14.896 19.213  1.00 17.10  ? 178 MET A CG  1 
ATOM   1434 S  SD  . MET A 1 182 ? 34.543 -13.406 19.774  1.00 18.91  ? 178 MET A SD  1 
ATOM   1435 C  CE  . MET A 1 182 ? 35.244 -12.192 18.611  1.00 15.83  ? 178 MET A CE  1 
ATOM   1436 N  N   . GLU A 1 183 ? 37.136 -17.476 20.837  1.00 16.70  ? 179 GLU A N   1 
ATOM   1437 C  CA  . GLU A 1 183 ? 36.446 -18.436 21.650  1.00 16.13  ? 179 GLU A CA  1 
ATOM   1438 C  C   . GLU A 1 183 ? 35.165 -17.778 22.143  1.00 16.96  ? 179 GLU A C   1 
ATOM   1439 O  O   . GLU A 1 183 ? 35.220 -16.628 22.577  1.00 16.95  ? 179 GLU A O   1 
ATOM   1440 C  CB  . GLU A 1 183 ? 37.303 -18.822 22.872  1.00 18.60  ? 179 GLU A CB  1 
ATOM   1441 C  CG  . GLU A 1 183 ? 38.319 -19.906 22.546  1.00 31.60  ? 179 GLU A CG  1 
ATOM   1442 C  CD  . GLU A 1 183 ? 37.734 -21.305 22.525  1.00 54.28  ? 179 GLU A CD  1 
ATOM   1443 O  OE1 . GLU A 1 183 ? 37.462 -21.820 21.417  1.00 51.38  ? 179 GLU A OE1 1 
ATOM   1444 O  OE2 . GLU A 1 183 ? 37.518 -21.874 23.620  1.00 56.56  ? 179 GLU A OE2 1 
ATOM   1445 N  N   . PRO A 1 184 ? 34.002 -18.478 22.122  1.00 12.90  ? 180 PRO A N   1 
ATOM   1446 C  CA  . PRO A 1 184 ? 32.789 -17.897 22.723  1.00 13.46  ? 180 PRO A CA  1 
ATOM   1447 C  C   . PRO A 1 184 ? 33.044 -17.666 24.216  1.00 18.07  ? 180 PRO A C   1 
ATOM   1448 O  O   . PRO A 1 184 ? 33.865 -18.369 24.820  1.00 17.58  ? 180 PRO A O   1 
ATOM   1449 C  CB  . PRO A 1 184 ? 31.748 -19.009 22.559  1.00 15.99  ? 180 PRO A CB  1 
ATOM   1450 C  CG  . PRO A 1 184 ? 32.266 -19.817 21.354  1.00 20.53  ? 180 PRO A CG  1 
ATOM   1451 C  CD  . PRO A 1 184 ? 33.751 -19.842 21.611  1.00 16.06  ? 180 PRO A CD  1 
ATOM   1452 N  N   . MET A 1 185 ? 32.395 -16.674 24.794  1.00 14.75  ? 181 MET A N   1 
ATOM   1453 C  CA  . MET A 1 185 ? 32.654 -16.392 26.215  1.00 15.68  ? 181 MET A CA  1 
ATOM   1454 C  C   . MET A 1 185 ? 31.372 -16.181 26.935  1.00 15.54  ? 181 MET A C   1 
ATOM   1455 O  O   . MET A 1 185 ? 30.386 -15.758 26.335  1.00 12.44  ? 181 MET A O   1 
ATOM   1456 C  CB  . MET A 1 185 ? 33.553 -15.146 26.366  1.00 18.34  ? 181 MET A CB  1 
ATOM   1457 C  CG  . MET A 1 185 ? 32.919 -13.854 25.840  1.00 22.54  ? 181 MET A CG  1 
ATOM   1458 S  SD  . MET A 1 185 ? 34.085 -12.507 26.021  1.00 27.31  ? 181 MET A SD  1 
ATOM   1459 C  CE  . MET A 1 185 ? 33.029 -11.093 25.518  1.00 24.46  ? 181 MET A CE  1 
ATOM   1460 N  N   . SER A 1 186 ? 31.393 -16.428 28.248  1.00 12.82  ? 182 SER A N   1 
ATOM   1461 C  CA  . SER A 1 186 ? 30.213 -16.221 29.047  1.00 11.56  ? 182 SER A CA  1 
ATOM   1462 C  C   . SER A 1 186 ? 29.990 -14.718 29.157  1.00 14.62  ? 182 SER A C   1 
ATOM   1463 O  O   . SER A 1 186 ? 30.890 -13.976 29.598  1.00 15.94  ? 182 SER A O   1 
ATOM   1464 C  CB  . SER A 1 186 ? 30.405 -16.823 30.439  1.00 15.05  ? 182 SER A CB  1 
ATOM   1465 O  OG  . SER A 1 186 ? 29.395 -16.266 31.263  1.00 16.73  ? 182 SER A OG  1 
ATOM   1466 N  N   . LEU A 1 187 ? 28.794 -14.264 28.754  1.00 11.19  ? 183 LEU A N   1 
ATOM   1467 C  CA  . LEU A 1 187 ? 28.454 -12.844 28.795  1.00 11.04  ? 183 LEU A CA  1 
ATOM   1468 C  C   . LEU A 1 187 ? 28.415 -12.376 30.255  1.00 15.04  ? 183 LEU A C   1 
ATOM   1469 O  O   . LEU A 1 187 ? 29.039 -11.368 30.598  1.00 12.06  ? 183 LEU A O   1 
ATOM   1470 C  CB  . LEU A 1 187 ? 27.106 -12.579 28.092  1.00 10.91  ? 183 LEU A CB  1 
ATOM   1471 C  CG  . LEU A 1 187 ? 26.550 -11.127 28.177  1.00 14.99  ? 183 LEU A CG  1 
ATOM   1472 C  CD1 . LEU A 1 187 ? 27.477 -10.137 27.544  1.00 15.14  ? 183 LEU A CD1 1 
ATOM   1473 C  CD2 . LEU A 1 187 ? 25.148 -11.029 27.517  1.00 14.68  ? 183 LEU A CD2 1 
ATOM   1474 N  N   . ASP A 1 188 ? 27.709 -13.123 31.112  1.00 13.25  ? 184 ASP A N   1 
ATOM   1475 C  CA  . ASP A 1 188 ? 27.645 -12.731 32.528  1.00 13.95  ? 184 ASP A CA  1 
ATOM   1476 C  C   . ASP A 1 188 ? 29.017 -12.707 33.198  1.00 17.93  ? 184 ASP A C   1 
ATOM   1477 O  O   . ASP A 1 188 ? 29.284 -11.800 33.996  1.00 19.87  ? 184 ASP A O   1 
ATOM   1478 C  CB  . ASP A 1 188 ? 26.669 -13.607 33.304  1.00 16.66  ? 184 ASP A CB  1 
ATOM   1479 C  CG  . ASP A 1 188 ? 25.195 -13.314 33.051  1.00 34.15  ? 184 ASP A CG  1 
ATOM   1480 O  OD1 . ASP A 1 188 ? 24.856 -12.128 32.782  1.00 36.25  ? 184 ASP A OD1 1 
ATOM   1481 O  OD2 . ASP A 1 188 ? 24.374 -14.258 33.155  1.00 37.14  ? 184 ASP A OD2 1 
ATOM   1482 N  N   . ALA A 1 189 ? 29.884 -13.665 32.874  1.00 15.08  ? 185 ALA A N   1 
ATOM   1483 C  CA  . ALA A 1 189 ? 31.223 -13.719 33.479  1.00 15.23  ? 185 ALA A CA  1 
ATOM   1484 C  C   . ALA A 1 189 ? 32.077 -12.527 33.064  1.00 17.90  ? 185 ALA A C   1 
ATOM   1485 O  O   . ALA A 1 189 ? 32.722 -11.935 33.909  1.00 16.47  ? 185 ALA A O   1 
ATOM   1486 C  CB  . ALA A 1 189 ? 31.926 -15.027 33.158  1.00 15.35  ? 185 ALA A CB  1 
ATOM   1487 N  N   . TRP A 1 190 ? 32.012 -12.117 31.788  1.00 13.70  ? 186 TRP A N   1 
ATOM   1488 C  CA  . TRP A 1 190 ? 32.761 -10.966 31.281  1.00 14.16  ? 186 TRP A CA  1 
ATOM   1489 C  C   . TRP A 1 190 ? 32.232 -9.668  31.925  1.00 17.27  ? 186 TRP A C   1 
ATOM   1490 O  O   . TRP A 1 190 ? 33.025 -8.832  32.347  1.00 18.13  ? 186 TRP A O   1 
ATOM   1491 C  CB  . TRP A 1 190 ? 32.668 -10.905 29.729  1.00 12.95  ? 186 TRP A CB  1 
ATOM   1492 C  CG  . TRP A 1 190 ? 33.502 -9.824  29.094  1.00 14.62  ? 186 TRP A CG  1 
ATOM   1493 C  CD1 . TRP A 1 190 ? 34.744 -9.957  28.557  1.00 17.95  ? 186 TRP A CD1 1 
ATOM   1494 C  CD2 . TRP A 1 190 ? 33.122 -8.448  28.893  1.00 14.89  ? 186 TRP A CD2 1 
ATOM   1495 N  NE1 . TRP A 1 190 ? 35.183 -8.737  28.060  1.00 16.97  ? 186 TRP A NE1 1 
ATOM   1496 C  CE2 . TRP A 1 190 ? 34.205 -7.799  28.253  1.00 18.30  ? 186 TRP A CE2 1 
ATOM   1497 C  CE3 . TRP A 1 190 ? 31.958 -7.702  29.175  1.00 16.06  ? 186 TRP A CE3 1 
ATOM   1498 C  CZ2 . TRP A 1 190 ? 34.170 -6.439  27.914  1.00 17.78  ? 186 TRP A CZ2 1 
ATOM   1499 C  CZ3 . TRP A 1 190 ? 31.924 -6.358  28.837  1.00 17.49  ? 186 TRP A CZ3 1 
ATOM   1500 C  CH2 . TRP A 1 190 ? 33.014 -5.739  28.201  1.00 17.78  ? 186 TRP A CH2 1 
ATOM   1501 N  N   . LEU A 1 191 ? 30.908 -9.530  32.060  1.00 13.17  ? 187 LEU A N   1 
ATOM   1502 C  CA  . LEU A 1 191 ? 30.299 -8.332  32.651  1.00 13.59  ? 187 LEU A CA  1 
ATOM   1503 C  C   . LEU A 1 191 ? 30.687 -8.207  34.114  1.00 17.89  ? 187 LEU A C   1 
ATOM   1504 O  O   . LEU A 1 191 ? 31.081 -7.114  34.561  1.00 18.76  ? 187 LEU A O   1 
ATOM   1505 C  CB  . LEU A 1 191 ? 28.769 -8.367  32.509  1.00 13.49  ? 187 LEU A CB  1 
ATOM   1506 C  CG  . LEU A 1 191 ? 28.240 -8.180  31.072  1.00 18.50  ? 187 LEU A CG  1 
ATOM   1507 C  CD1 . LEU A 1 191 ? 26.734 -8.380  31.037  1.00 18.62  ? 187 LEU A CD1 1 
ATOM   1508 C  CD2 . LEU A 1 191 ? 28.595 -6.766  30.530  1.00 19.67  ? 187 LEU A CD2 1 
ATOM   1509 N  N   . ASP A 1 192 ? 30.611 -9.325  34.848  1.00 13.94  ? 188 ASP A N   1 
ATOM   1510 C  CA  . ASP A 1 192 ? 30.996 -9.310  36.272  1.00 13.86  ? 188 ASP A CA  1 
ATOM   1511 C  C   . ASP A 1 192 ? 32.481 -8.975  36.453  1.00 20.83  ? 188 ASP A C   1 
ATOM   1512 O  O   . ASP A 1 192 ? 32.802 -8.142  37.305  1.00 21.22  ? 188 ASP A O   1 
ATOM   1513 C  CB  . ASP A 1 192 ? 30.665 -10.632 36.950  1.00 14.16  ? 188 ASP A CB  1 
ATOM   1514 C  CG  . ASP A 1 192 ? 29.196 -10.847 37.206  1.00 22.25  ? 188 ASP A CG  1 
ATOM   1515 O  OD1 . ASP A 1 192 ? 28.486 -9.847  37.436  1.00 20.85  ? 188 ASP A OD1 1 
ATOM   1516 O  OD2 . ASP A 1 192 ? 28.774 -12.031 37.291  1.00 26.63  ? 188 ASP A OD2 1 
ATOM   1517 N  N   . SER A 1 193 ? 33.377 -9.596  35.646  1.00 18.67  ? 189 SER A N   1 
ATOM   1518 C  CA  . SER A 1 193 ? 34.822 -9.360  35.725  1.00 19.30  ? 189 SER A CA  1 
ATOM   1519 C  C   . SER A 1 193 ? 35.216 -7.902  35.385  1.00 23.97  ? 189 SER A C   1 
ATOM   1520 O  O   . SER A 1 193 ? 36.248 -7.413  35.869  1.00 24.12  ? 189 SER A O   1 
ATOM   1521 C  CB  . SER A 1 193 ? 35.579 -10.347 34.838  1.00 25.03  ? 189 SER A CB  1 
ATOM   1522 O  OG  . SER A 1 193 ? 35.330 -10.075 33.467  1.00 43.94  ? 189 SER A OG  1 
ATOM   1523 N  N   . HIS A 1 194 ? 34.386 -7.191  34.597  1.00 18.63  ? 190 HIS A N   1 
ATOM   1524 C  CA  . HIS A 1 194 ? 34.673 -5.795  34.231  1.00 19.63  ? 190 HIS A CA  1 
ATOM   1525 C  C   . HIS A 1 194 ? 33.789 -4.789  34.998  1.00 21.60  ? 190 HIS A C   1 
ATOM   1526 O  O   . HIS A 1 194 ? 33.661 -3.640  34.572  1.00 19.19  ? 190 HIS A O   1 
ATOM   1527 C  CB  . HIS A 1 194 ? 34.513 -5.632  32.696  1.00 21.19  ? 190 HIS A CB  1 
ATOM   1528 C  CG  . HIS A 1 194 ? 35.586 -6.333  31.915  1.00 24.96  ? 190 HIS A CG  1 
ATOM   1529 N  ND1 . HIS A 1 194 ? 36.788 -5.708  31.618  1.00 26.58  ? 190 HIS A ND1 1 
ATOM   1530 C  CD2 . HIS A 1 194 ? 35.616 -7.589  31.406  1.00 27.40  ? 190 HIS A CD2 1 
ATOM   1531 C  CE1 . HIS A 1 194 ? 37.498 -6.587  30.926  1.00 26.17  ? 190 HIS A CE1 1 
ATOM   1532 N  NE2 . HIS A 1 194 ? 36.842 -7.729  30.769  1.00 26.84  ? 190 HIS A NE2 1 
ATOM   1533 N  N   . HIS A 1 195 ? 33.197 -5.199  36.152  1.00 17.13  ? 191 HIS A N   1 
ATOM   1534 C  CA  . HIS A 1 195 ? 32.265 -4.323  36.871  1.00 17.19  ? 191 HIS A CA  1 
ATOM   1535 C  C   . HIS A 1 195 ? 32.848 -2.979  37.288  1.00 21.60  ? 191 HIS A C   1 
ATOM   1536 O  O   . HIS A 1 195 ? 32.111 -1.995  37.257  1.00 21.56  ? 191 HIS A O   1 
ATOM   1537 C  CB  . HIS A 1 195 ? 31.601 -5.016  38.092  1.00 18.03  ? 191 HIS A CB  1 
ATOM   1538 C  CG  . HIS A 1 195 ? 32.501 -5.242  39.272  1.00 21.71  ? 191 HIS A CG  1 
ATOM   1539 N  ND1 . HIS A 1 195 ? 33.190 -6.428  39.437  1.00 23.03  ? 191 HIS A ND1 1 
ATOM   1540 C  CD2 . HIS A 1 195 ? 32.744 -4.446  40.347  1.00 23.37  ? 191 HIS A CD2 1 
ATOM   1541 C  CE1 . HIS A 1 195 ? 33.848 -6.315  40.584  1.00 22.27  ? 191 HIS A CE1 1 
ATOM   1542 N  NE2 . HIS A 1 195 ? 33.636 -5.135  41.154  1.00 22.68  ? 191 HIS A NE2 1 
ATOM   1543 N  N   . ARG A 1 196 ? 34.131 -2.939  37.717  1.00 20.41  ? 192 ARG A N   1 
ATOM   1544 C  CA  . ARG A 1 196 ? 34.742 -1.690  38.221  1.00 21.08  ? 192 ARG A CA  1 
ATOM   1545 C  C   . ARG A 1 196 ? 34.822 -0.618  37.138  1.00 23.73  ? 192 ARG A C   1 
ATOM   1546 O  O   . ARG A 1 196 ? 34.315 0.475   37.354  1.00 22.00  ? 192 ARG A O   1 
ATOM   1547 C  CB  . ARG A 1 196 ? 36.081 -1.928  38.925  1.00 22.49  ? 192 ARG A CB  1 
ATOM   1548 C  CG  . ARG A 1 196 ? 35.911 -2.687  40.244  1.00 34.29  ? 192 ARG A CG  1 
ATOM   1549 C  CD  . ARG A 1 196 ? 37.197 -2.771  41.050  1.00 45.62  ? 192 ARG A CD  1 
ATOM   1550 N  N   . GLU A 1 197 ? 35.293 -0.978  35.943  1.00 22.07  ? 193 GLU A N   1 
ATOM   1551 C  CA  . GLU A 1 197 ? 35.339 -0.071  34.791  1.00 22.95  ? 193 GLU A CA  1 
ATOM   1552 C  C   . GLU A 1 197 ? 33.939 0.366   34.366  1.00 23.65  ? 193 GLU A C   1 
ATOM   1553 O  O   . GLU A 1 197 ? 33.722 1.548   34.178  1.00 23.10  ? 193 GLU A O   1 
ATOM   1554 C  CB  . GLU A 1 197 ? 36.053 -0.723  33.599  1.00 25.03  ? 193 GLU A CB  1 
ATOM   1555 C  CG  . GLU A 1 197 ? 37.545 -0.469  33.565  1.00 39.86  ? 193 GLU A CG  1 
ATOM   1556 C  CD  . GLU A 1 197 ? 38.149 -0.823  32.222  1.00 63.40  ? 193 GLU A CD  1 
ATOM   1557 O  OE1 . GLU A 1 197 ? 38.423 -2.026  31.999  1.00 56.93  ? 193 GLU A OE1 1 
ATOM   1558 O  OE2 . GLU A 1 197 ? 38.289 0.088   31.372  1.00 52.76  ? 193 GLU A OE2 1 
ATOM   1559 N  N   . LEU A 1 198 ? 32.984 -0.582  34.230  1.00 19.90  ? 194 LEU A N   1 
ATOM   1560 C  CA  . LEU A 1 198 ? 31.608 -0.273  33.816  1.00 19.22  ? 194 LEU A CA  1 
ATOM   1561 C  C   . LEU A 1 198 ? 30.917 0.719   34.763  1.00 26.05  ? 194 LEU A C   1 
ATOM   1562 O  O   . LEU A 1 198 ? 30.295 1.685   34.318  1.00 25.89  ? 194 LEU A O   1 
ATOM   1563 C  CB  . LEU A 1 198 ? 30.785 -1.565  33.755  1.00 18.58  ? 194 LEU A CB  1 
ATOM   1564 C  CG  . LEU A 1 198 ? 31.083 -2.476  32.566  1.00 21.81  ? 194 LEU A CG  1 
ATOM   1565 C  CD1 . LEU A 1 198 ? 30.265 -3.771  32.665  1.00 21.71  ? 194 LEU A CD1 1 
ATOM   1566 C  CD2 . LEU A 1 198 ? 30.832 -1.730  31.233  1.00 18.45  ? 194 LEU A CD2 1 
ATOM   1567 N  N   . GLN A 1 199 ? 31.054 0.490   36.072  1.00 24.17  ? 195 GLN A N   1 
ATOM   1568 C  CA  . GLN A 1 199 ? 30.397 1.352   37.047  1.00 25.21  ? 195 GLN A CA  1 
ATOM   1569 C  C   . GLN A 1 199 ? 31.157 2.669   37.303  1.00 30.90  ? 195 GLN A C   1 
ATOM   1570 O  O   . GLN A 1 199 ? 30.584 3.584   37.903  1.00 31.09  ? 195 GLN A O   1 
ATOM   1571 C  CB  . GLN A 1 199 ? 30.057 0.589   38.340  1.00 26.15  ? 195 GLN A CB  1 
ATOM   1572 C  CG  . GLN A 1 199 ? 28.984 -0.514  38.140  1.00 31.85  ? 195 GLN A CG  1 
ATOM   1573 C  CD  . GLN A 1 199 ? 27.774 -0.176  37.254  1.00 32.67  ? 195 GLN A CD  1 
ATOM   1574 O  OE1 . GLN A 1 199 ? 27.216 0.931   37.274  1.00 21.24  ? 195 GLN A OE1 1 
ATOM   1575 N  NE2 . GLN A 1 199 ? 27.283 -1.160  36.509  1.00 16.29  ? 195 GLN A NE2 1 
ATOM   1576 N  N   . ALA A 1 200 ? 32.382 2.809   36.753  1.00 28.57  ? 196 ALA A N   1 
ATOM   1577 C  CA  . ALA A 1 200 ? 33.177 4.044   36.826  1.00 29.12  ? 196 ALA A CA  1 
ATOM   1578 C  C   . ALA A 1 200 ? 32.855 4.983   35.627  1.00 34.34  ? 196 ALA A C   1 
ATOM   1579 O  O   . ALA A 1 200 ? 33.540 5.992   35.429  1.00 33.90  ? 196 ALA A O   1 
ATOM   1580 C  CB  . ALA A 1 200 ? 34.662 3.716   36.855  1.00 29.83  ? 196 ALA A CB  1 
ATOM   1581 N  N   . GLY A 1 201 ? 31.812 4.641   34.853  1.00 29.13  ? 197 GLY A N   1 
ATOM   1582 C  CA  . GLY A 1 201 ? 31.345 5.439   33.725  1.00 27.82  ? 197 GLY A CA  1 
ATOM   1583 C  C   . GLY A 1 201 ? 32.025 5.229   32.388  1.00 32.35  ? 197 GLY A C   1 
ATOM   1584 O  O   . GLY A 1 201 ? 31.798 6.026   31.469  1.00 32.20  ? 197 GLY A O   1 
ATOM   1585 N  N   . THR A 1 202 ? 32.850 4.169   32.257  1.00 27.27  ? 198 THR A N   1 
ATOM   1586 C  CA  . THR A 1 202 ? 33.532 3.875   31.002  1.00 27.75  ? 198 THR A CA  1 
ATOM   1587 C  C   . THR A 1 202 ? 32.767 2.745   30.257  1.00 29.36  ? 198 THR A C   1 
ATOM   1588 O  O   . THR A 1 202 ? 32.824 1.597   30.692  1.00 28.38  ? 198 THR A O   1 
ATOM   1589 C  CB  . THR A 1 202 ? 35.020 3.470   31.232  1.00 40.03  ? 198 THR A CB  1 
ATOM   1590 O  OG1 . THR A 1 202 ? 35.718 4.498   31.937  1.00 43.44  ? 198 THR A OG1 1 
ATOM   1591 C  CG2 . THR A 1 202 ? 35.764 3.176   29.913  1.00 37.55  ? 198 THR A CG2 1 
ATOM   1592 N  N   . PRO A 1 203 ? 32.082 3.045   29.137  1.00 23.87  ? 199 PRO A N   1 
ATOM   1593 C  CA  . PRO A 1 203 ? 31.455 1.964   28.358  1.00 23.66  ? 199 PRO A CA  1 
ATOM   1594 C  C   . PRO A 1 203 ? 32.542 1.107   27.701  1.00 25.28  ? 199 PRO A C   1 
ATOM   1595 O  O   . PRO A 1 203 ? 33.591 1.633   27.330  1.00 25.80  ? 199 PRO A O   1 
ATOM   1596 C  CB  . PRO A 1 203 ? 30.594 2.713   27.330  1.00 25.83  ? 199 PRO A CB  1 
ATOM   1597 C  CG  . PRO A 1 203 ? 30.633 4.163   27.733  1.00 30.63  ? 199 PRO A CG  1 
ATOM   1598 C  CD  . PRO A 1 203 ? 31.919 4.342   28.461  1.00 25.83  ? 199 PRO A CD  1 
ATOM   1599 N  N   . LEU A 1 204 ? 32.336 -0.219  27.609  1.00 18.37  ? 200 LEU A N   1 
ATOM   1600 C  CA  . LEU A 1 204 ? 33.359 -1.130  27.093  1.00 16.85  ? 200 LEU A CA  1 
ATOM   1601 C  C   . LEU A 1 204 ? 32.911 -1.950  25.919  1.00 16.93  ? 200 LEU A C   1 
ATOM   1602 O  O   . LEU A 1 204 ? 31.864 -2.581  26.000  1.00 13.78  ? 200 LEU A O   1 
ATOM   1603 C  CB  . LEU A 1 204 ? 33.763 -2.116  28.197  1.00 17.45  ? 200 LEU A CB  1 
ATOM   1604 C  CG  . LEU A 1 204 ? 34.517 -1.534  29.375  1.00 22.47  ? 200 LEU A CG  1 
ATOM   1605 C  CD1 . LEU A 1 204 ? 34.631 -2.559  30.471  1.00 21.99  ? 200 LEU A CD1 1 
ATOM   1606 C  CD2 . LEU A 1 204 ? 35.886 -1.011  28.932  1.00 25.58  ? 200 LEU A CD2 1 
ATOM   1607 N  N   . SER A 1 205 ? 33.755 -2.032  24.896  1.00 13.32  ? 201 SER A N   1 
ATOM   1608 C  CA  . SER A 1 205 ? 33.501 -2.854  23.723  1.00 12.84  ? 201 SER A CA  1 
ATOM   1609 C  C   . SER A 1 205 ? 33.853 -4.283  24.083  1.00 17.62  ? 201 SER A C   1 
ATOM   1610 O  O   . SER A 1 205 ? 34.946 -4.550  24.596  1.00 17.41  ? 201 SER A O   1 
ATOM   1611 C  CB  . SER A 1 205 ? 34.330 -2.377  22.530  1.00 13.96  ? 201 SER A CB  1 
ATOM   1612 O  OG  . SER A 1 205 ? 34.087 -3.219  21.417  1.00 17.99  ? 201 SER A OG  1 
ATOM   1613 N  N   . LEU A 1 206 ? 32.903 -5.214  23.867  1.00 14.63  ? 202 LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 206 ? 33.145 -6.621  24.180  1.00 13.90  ? 202 LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 206 ? 34.188 -7.234  23.272  1.00 16.73  ? 202 LEU A C   1 
ATOM   1616 O  O   . LEU A 1 206 ? 34.956 -8.064  23.730  1.00 16.74  ? 202 LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 206 ? 31.850 -7.436  24.041  1.00 13.94  ? 202 LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 206 ? 30.990 -7.552  25.321  1.00 18.36  ? 202 LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 206 ? 30.223 -6.264  25.585  1.00 18.37  ? 202 LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 206 ? 29.954 -8.685  25.175  1.00 21.02  ? 202 LEU A CD2 1 
ATOM   1621 N  N   . PHE A 1 207 ? 34.168 -6.876  21.975  1.00 12.01  ? 203 PHE A N   1 
ATOM   1622 C  CA  . PHE A 1 207 ? 35.039 -7.507  20.998  1.00 13.45  ? 203 PHE A CA  1 
ATOM   1623 C  C   . PHE A 1 207 ? 36.190 -6.650  20.440  1.00 17.60  ? 203 PHE A C   1 
ATOM   1624 O  O   . PHE A 1 207 ? 37.064 -7.209  19.772  1.00 15.59  ? 203 PHE A O   1 
ATOM   1625 C  CB  . PHE A 1 207 ? 34.200 -8.097  19.864  1.00 14.87  ? 203 PHE A CB  1 
ATOM   1626 C  CG  . PHE A 1 207 ? 33.179 -9.057  20.431  1.00 16.19  ? 203 PHE A CG  1 
ATOM   1627 C  CD1 . PHE A 1 207 ? 33.578 -10.213 21.102  1.00 18.77  ? 203 PHE A CD1 1 
ATOM   1628 C  CD2 . PHE A 1 207 ? 31.823 -8.794  20.319  1.00 16.87  ? 203 PHE A CD2 1 
ATOM   1629 C  CE1 . PHE A 1 207 ? 32.624 -11.099 21.636  1.00 19.31  ? 203 PHE A CE1 1 
ATOM   1630 C  CE2 . PHE A 1 207 ? 30.876 -9.695  20.826  1.00 19.45  ? 203 PHE A CE2 1 
ATOM   1631 C  CZ  . PHE A 1 207 ? 31.283 -10.833 21.492  1.00 17.82  ? 203 PHE A CZ  1 
ATOM   1632 N  N   . GLY A 1 208 ? 36.179 -5.345  20.695  1.00 17.17  ? 204 GLY A N   1 
ATOM   1633 C  CA  . GLY A 1 208 ? 37.264 -4.459  20.284  1.00 17.11  ? 204 GLY A CA  1 
ATOM   1634 C  C   . GLY A 1 208 ? 37.207 -3.896  18.875  1.00 22.42  ? 204 GLY A C   1 
ATOM   1635 O  O   . GLY A 1 208 ? 36.274 -4.158  18.103  1.00 20.35  ? 204 GLY A O   1 
ATOM   1636 N  N   . ASP A 1 209 ? 38.253 -3.132  18.516  1.00 20.58  ? 205 ASP A N   1 
ATOM   1637 C  CA  . ASP A 1 209 ? 38.256 -2.394  17.260  1.00 21.01  ? 205 ASP A CA  1 
ATOM   1638 C  C   . ASP A 1 209 ? 38.641 -3.178  16.015  1.00 21.87  ? 205 ASP A C   1 
ATOM   1639 O  O   . ASP A 1 209 ? 38.620 -2.583  14.934  1.00 21.66  ? 205 ASP A O   1 
ATOM   1640 C  CB  . ASP A 1 209 ? 39.131 -1.129  17.373  1.00 24.77  ? 205 ASP A CB  1 
ATOM   1641 C  CG  . ASP A 1 209 ? 40.584 -1.360  17.724  1.00 42.92  ? 205 ASP A CG  1 
ATOM   1642 O  OD1 . ASP A 1 209 ? 41.040 -2.534  17.666  1.00 44.44  ? 205 ASP A OD1 1 
ATOM   1643 O  OD2 . ASP A 1 209 ? 41.273 -0.369  18.058  1.00 54.33  ? 205 ASP A OD2 1 
ATOM   1644 N  N   . THR A 1 210 ? 38.942 -4.486  16.113  1.00 18.33  ? 206 THR A N   1 
ATOM   1645 C  CA  . THR A 1 210 ? 39.289 -5.239  14.894  1.00 17.18  ? 206 THR A CA  1 
ATOM   1646 C  C   . THR A 1 210 ? 38.058 -5.789  14.162  1.00 19.24  ? 206 THR A C   1 
ATOM   1647 O  O   . THR A 1 210 ? 38.218 -6.531  13.180  1.00 17.12  ? 206 THR A O   1 
ATOM   1648 C  CB  . THR A 1 210 ? 40.333 -6.349  15.151  1.00 24.22  ? 206 THR A CB  1 
ATOM   1649 O  OG1 . THR A 1 210 ? 39.710 -7.413  15.864  1.00 20.56  ? 206 THR A OG1 1 
ATOM   1650 C  CG2 . THR A 1 210 ? 41.579 -5.854  15.874  1.00 22.52  ? 206 THR A CG2 1 
ATOM   1651 N  N   . TYR A 1 211 ? 36.838 -5.465  14.644  1.00 14.96  ? 207 TYR A N   1 
ATOM   1652 C  CA  . TYR A 1 211 ? 35.595 -5.917  13.996  1.00 13.51  ? 207 TYR A CA  1 
ATOM   1653 C  C   . TYR A 1 211 ? 34.725 -4.746  13.620  1.00 17.47  ? 207 TYR A C   1 
ATOM   1654 O  O   . TYR A 1 211 ? 34.833 -3.699  14.253  1.00 16.56  ? 207 TYR A O   1 
ATOM   1655 C  CB  . TYR A 1 211 ? 34.791 -6.833  14.945  1.00 15.94  ? 207 TYR A CB  1 
ATOM   1656 C  CG  . TYR A 1 211 ? 35.549 -8.069  15.348  1.00 16.28  ? 207 TYR A CG  1 
ATOM   1657 C  CD1 . TYR A 1 211 ? 35.652 -9.157  14.486  1.00 18.66  ? 207 TYR A CD1 1 
ATOM   1658 C  CD2 . TYR A 1 211 ? 36.197 -8.144  16.574  1.00 16.64  ? 207 TYR A CD2 1 
ATOM   1659 C  CE1 . TYR A 1 211 ? 36.375 -10.292 14.838  1.00 19.79  ? 207 TYR A CE1 1 
ATOM   1660 C  CE2 . TYR A 1 211 ? 36.921 -9.277  16.939  1.00 17.50  ? 207 TYR A CE2 1 
ATOM   1661 C  CZ  . TYR A 1 211 ? 37.022 -10.343 16.061  1.00 24.14  ? 207 TYR A CZ  1 
ATOM   1662 O  OH  . TYR A 1 211 ? 37.749 -11.452 16.395  1.00 21.24  ? 207 TYR A OH  1 
ATOM   1663 N  N   . GLU A 1 212 ? 33.823 -4.934  12.636  1.00 14.88  ? 208 GLU A N   1 
ATOM   1664 C  CA  . GLU A 1 212 ? 32.858 -3.908  12.218  1.00 14.64  ? 208 GLU A CA  1 
ATOM   1665 C  C   . GLU A 1 212 ? 31.829 -3.646  13.349  1.00 17.52  ? 208 GLU A C   1 
ATOM   1666 O  O   . GLU A 1 212 ? 31.546 -2.497  13.712  1.00 16.86  ? 208 GLU A O   1 
ATOM   1667 C  CB  . GLU A 1 212 ? 32.105 -4.393  10.970  1.00 15.24  ? 208 GLU A CB  1 
ATOM   1668 C  CG  . GLU A 1 212 ? 31.037 -3.416  10.524  1.00 20.66  ? 208 GLU A CG  1 
ATOM   1669 C  CD  . GLU A 1 212 ? 30.085 -3.955  9.481   1.00 35.17  ? 208 GLU A CD  1 
ATOM   1670 O  OE1 . GLU A 1 212 ? 30.542 -4.282  8.365   1.00 25.42  ? 208 GLU A OE1 1 
ATOM   1671 O  OE2 . GLU A 1 212 ? 28.875 -4.043  9.785   1.00 29.03  ? 208 GLU A OE2 1 
ATOM   1672 N  N   . THR A 1 213 ? 31.244 -4.742  13.850  1.00 13.92  ? 209 THR A N   1 
ATOM   1673 C  CA  . THR A 1 213 ? 30.211 -4.772  14.880  1.00 13.42  ? 209 THR A CA  1 
ATOM   1674 C  C   . THR A 1 213 ? 30.757 -4.170  16.133  1.00 14.67  ? 209 THR A C   1 
ATOM   1675 O  O   . THR A 1 213 ? 31.922 -4.393  16.454  1.00 13.01  ? 209 THR A O   1 
ATOM   1676 C  CB  . THR A 1 213 ? 29.829 -6.243  15.211  1.00 17.23  ? 209 THR A CB  1 
ATOM   1677 O  OG1 . THR A 1 213 ? 29.300 -6.840  14.045  1.00 18.65  ? 209 THR A OG1 1 
ATOM   1678 C  CG2 . THR A 1 213 ? 28.793 -6.371  16.350  1.00 13.96  ? 209 THR A CG2 1 
ATOM   1679 N  N   . GLN A 1 214 ? 29.887 -3.457  16.860  1.00 12.44  ? 210 GLN A N   1 
ATOM   1680 C  CA  . GLN A 1 214 ? 30.221 -2.942  18.174  1.00 12.91  ? 210 GLN A CA  1 
ATOM   1681 C  C   . GLN A 1 214 ? 29.158 -3.358  19.146  1.00 15.82  ? 210 GLN A C   1 
ATOM   1682 O  O   . GLN A 1 214 ? 28.013 -2.903  19.059  1.00 17.57  ? 210 GLN A O   1 
ATOM   1683 C  CB  . GLN A 1 214 ? 30.445 -1.412  18.180  1.00 14.14  ? 210 GLN A CB  1 
ATOM   1684 C  CG  . GLN A 1 214 ? 31.760 -0.947  17.497  1.00 14.52  ? 210 GLN A CG  1 
ATOM   1685 C  CD  . GLN A 1 214 ? 33.017 -1.578  18.069  1.00 29.03  ? 210 GLN A CD  1 
ATOM   1686 O  OE1 . GLN A 1 214 ? 33.197 -1.703  19.286  1.00 26.89  ? 210 GLN A OE1 1 
ATOM   1687 N  NE2 . GLN A 1 214 ? 33.925 -1.996  17.203  1.00 21.62  ? 210 GLN A NE2 1 
ATOM   1688 N  N   . VAL A 1 215 ? 29.525 -4.277  20.052  1.00 12.32  ? 211 VAL A N   1 
ATOM   1689 C  CA  . VAL A 1 215 ? 28.631 -4.685  21.134  1.00 11.60  ? 211 VAL A CA  1 
ATOM   1690 C  C   . VAL A 1 215 ? 29.248 -3.975  22.343  1.00 14.76  ? 211 VAL A C   1 
ATOM   1691 O  O   . VAL A 1 215 ? 30.375 -4.281  22.712  1.00 14.83  ? 211 VAL A O   1 
ATOM   1692 C  CB  . VAL A 1 215 ? 28.521 -6.226  21.320  1.00 14.93  ? 211 VAL A CB  1 
ATOM   1693 C  CG1 . VAL A 1 215 ? 27.611 -6.574  22.511  1.00 14.05  ? 211 VAL A CG1 1 
ATOM   1694 C  CG2 . VAL A 1 215 ? 28.002 -6.890  20.040  1.00 14.96  ? 211 VAL A CG2 1 
ATOM   1695 N  N   . ILE A 1 216 ? 28.562 -2.966  22.879  1.00 11.32  ? 212 ILE A N   1 
ATOM   1696 C  CA  . ILE A 1 216 ? 29.138 -2.191  23.979  1.00 10.93  ? 212 ILE A CA  1 
ATOM   1697 C  C   . ILE A 1 216 ? 28.375 -2.466  25.280  1.00 14.33  ? 212 ILE A C   1 
ATOM   1698 O  O   . ILE A 1 216 ? 27.157 -2.444  25.259  1.00 14.69  ? 212 ILE A O   1 
ATOM   1699 C  CB  . ILE A 1 216 ? 29.099 -0.663  23.622  1.00 13.67  ? 212 ILE A CB  1 
ATOM   1700 C  CG1 . ILE A 1 216 ? 29.704 -0.340  22.200  1.00 14.35  ? 212 ILE A CG1 1 
ATOM   1701 C  CG2 . ILE A 1 216 ? 29.736 0.192   24.724  1.00 13.59  ? 212 ILE A CG2 1 
ATOM   1702 C  CD1 . ILE A 1 216 ? 31.199 -0.504  22.024  1.00 25.11  ? 212 ILE A CD1 1 
ATOM   1703 N  N   . ALA A 1 217 ? 29.084 -2.658  26.397  1.00 11.92  ? 213 ALA A N   1 
ATOM   1704 C  CA  . ALA A 1 217 ? 28.475 -2.767  27.727  1.00 11.06  ? 213 ALA A CA  1 
ATOM   1705 C  C   . ALA A 1 217 ? 28.537 -1.387  28.405  1.00 15.00  ? 213 ALA A C   1 
ATOM   1706 O  O   . ALA A 1 217 ? 29.567 -0.687  28.348  1.00 12.97  ? 213 ALA A O   1 
ATOM   1707 C  CB  . ALA A 1 217 ? 29.224 -3.784  28.575  1.00 12.66  ? 213 ALA A CB  1 
ATOM   1708 N  N   . TYR A 1 218 ? 27.449 -1.033  29.088  1.00 11.37  ? 214 TYR A N   1 
ATOM   1709 C  CA  . TYR A 1 218 ? 27.310 0.229   29.786  1.00 12.17  ? 214 TYR A CA  1 
ATOM   1710 C  C   . TYR A 1 218 ? 26.890 -0.019  31.203  1.00 17.62  ? 214 TYR A C   1 
ATOM   1711 O  O   . TYR A 1 218 ? 25.954 -0.783  31.429  1.00 17.74  ? 214 TYR A O   1 
ATOM   1712 C  CB  . TYR A 1 218 ? 26.183 1.055   29.175  1.00 13.56  ? 214 TYR A CB  1 
ATOM   1713 C  CG  . TYR A 1 218 ? 26.367 1.415   27.725  1.00 16.74  ? 214 TYR A CG  1 
ATOM   1714 C  CD1 . TYR A 1 218 ? 26.050 0.507   26.721  1.00 19.20  ? 214 TYR A CD1 1 
ATOM   1715 C  CD2 . TYR A 1 218 ? 26.835 2.670   27.352  1.00 18.91  ? 214 TYR A CD2 1 
ATOM   1716 C  CE1 . TYR A 1 218 ? 26.207 0.831   25.379  1.00 19.01  ? 214 TYR A CE1 1 
ATOM   1717 C  CE2 . TYR A 1 218 ? 26.953 3.021   26.003  1.00 20.61  ? 214 TYR A CE2 1 
ATOM   1718 C  CZ  . TYR A 1 218 ? 26.656 2.080   25.024  1.00 24.51  ? 214 TYR A CZ  1 
ATOM   1719 O  OH  . TYR A 1 218 ? 26.766 2.341   23.689  1.00 26.20  ? 214 TYR A OH  1 
ATOM   1720 N  N   . GLY A 1 219 ? 27.503 0.709   32.118  1.00 14.41  ? 215 GLY A N   1 
ATOM   1721 C  CA  . GLY A 1 219 ? 27.115 0.730   33.521  1.00 13.69  ? 215 GLY A CA  1 
ATOM   1722 C  C   . GLY A 1 219 ? 26.474 2.085   33.742  1.00 18.87  ? 215 GLY A C   1 
ATOM   1723 O  O   . GLY A 1 219 ? 26.032 2.725   32.785  1.00 17.56  ? 215 GLY A O   1 
ATOM   1724 N  N   . GLN A 1 220 ? 26.452 2.558   34.982  1.00 14.93  ? 216 GLN A N   1 
ATOM   1725 C  CA  . GLN A 1 220 ? 25.906 3.866   35.336  1.00 15.58  ? 216 GLN A CA  1 
ATOM   1726 C  C   . GLN A 1 220 ? 26.421 5.032   34.440  1.00 18.89  ? 216 GLN A C   1 
ATOM   1727 O  O   . GLN A 1 220 ? 27.587 5.065   34.072  1.00 18.86  ? 216 GLN A O   1 
ATOM   1728 C  CB  . GLN A 1 220 ? 26.293 4.162   36.808  1.00 16.39  ? 216 GLN A CB  1 
ATOM   1729 C  CG  . GLN A 1 220 ? 25.813 5.499   37.295  1.00 25.76  ? 216 GLN A CG  1 
ATOM   1730 C  CD  . GLN A 1 220 ? 26.100 5.691   38.755  1.00 30.93  ? 216 GLN A CD  1 
ATOM   1731 O  OE1 . GLN A 1 220 ? 27.047 5.129   39.310  1.00 26.75  ? 216 GLN A OE1 1 
ATOM   1732 N  NE2 . GLN A 1 220 ? 25.319 6.541   39.377  1.00 31.96  ? 216 GLN A NE2 1 
ATOM   1733 N  N   . GLY A 1 221 ? 25.562 5.997   34.166  1.00 20.15  ? 217 GLY A N   1 
ATOM   1734 C  CA  . GLY A 1 221 ? 25.967 7.161   33.386  1.00 21.83  ? 217 GLY A CA  1 
ATOM   1735 C  C   . GLY A 1 221 ? 24.903 7.664   32.443  1.00 26.47  ? 217 GLY A C   1 
ATOM   1736 O  O   . GLY A 1 221 ? 23.767 7.202   32.478  1.00 24.04  ? 217 GLY A O   1 
ATOM   1737 N  N   . SER A 1 222 ? 25.282 8.652   31.631  1.00 24.76  ? 218 SER A N   1 
ATOM   1738 C  CA  . SER A 1 222 ? 24.434 9.327   30.658  1.00 26.10  ? 218 SER A CA  1 
ATOM   1739 C  C   . SER A 1 222 ? 25.068 9.300   29.290  1.00 30.78  ? 218 SER A C   1 
ATOM   1740 O  O   . SER A 1 222 ? 26.262 9.560   29.162  1.00 31.22  ? 218 SER A O   1 
ATOM   1741 C  CB  . SER A 1 222 ? 24.186 10.781  31.048  1.00 33.45  ? 218 SER A CB  1 
ATOM   1742 O  OG  . SER A 1 222 ? 24.928 11.190  32.185  1.00 48.65  ? 218 SER A OG  1 
ATOM   1743 N  N   . SER A 1 223 ? 24.257 8.975   28.283  1.00 26.63  ? 219 SER A N   1 
ATOM   1744 C  CA  . SER A 1 223 ? 24.606 8.909   26.863  1.00 26.65  ? 219 SER A CA  1 
ATOM   1745 C  C   . SER A 1 223 ? 23.609 9.760   26.070  1.00 30.49  ? 219 SER A C   1 
ATOM   1746 O  O   . SER A 1 223 ? 22.509 10.066  26.529  1.00 27.71  ? 219 SER A O   1 
ATOM   1747 C  CB  . SER A 1 223 ? 24.495 7.473   26.357  1.00 28.93  ? 219 SER A CB  1 
ATOM   1748 O  OG  . SER A 1 223 ? 25.619 6.682   26.707  1.00 39.80  ? 219 SER A OG  1 
ATOM   1749 N  N   . GLU A 1 224 ? 23.993 10.090  24.858  1.00 30.72  ? 220 GLU A N   1 
ATOM   1750 C  CA  . GLU A 1 224 ? 23.171 10.827  23.923  1.00 31.56  ? 220 GLU A CA  1 
ATOM   1751 C  C   . GLU A 1 224 ? 23.526 10.246  22.591  1.00 36.75  ? 220 GLU A C   1 
ATOM   1752 O  O   . GLU A 1 224 ? 24.708 10.134  22.255  1.00 37.12  ? 220 GLU A O   1 
ATOM   1753 C  CB  . GLU A 1 224 ? 23.477 12.334  23.962  1.00 33.50  ? 220 GLU A CB  1 
ATOM   1754 N  N   . GLY A 1 225 ? 22.515 9.774   21.897  1.00 33.30  ? 221 GLY A N   1 
ATOM   1755 C  CA  . GLY A 1 225 ? 22.685 9.192   20.578  1.00 32.70  ? 221 GLY A CA  1 
ATOM   1756 C  C   . GLY A 1 225 ? 22.237 10.193  19.547  1.00 34.88  ? 221 GLY A C   1 
ATOM   1757 O  O   . GLY A 1 225 ? 21.157 10.775  19.678  1.00 32.80  ? 221 GLY A O   1 
ATOM   1758 N  N   . LEU A 1 226 ? 23.086 10.442  18.557  1.00 32.60  ? 222 LEU A N   1 
ATOM   1759 C  CA  . LEU A 1 226 ? 22.771 11.390  17.486  1.00 32.42  ? 222 LEU A CA  1 
ATOM   1760 C  C   . LEU A 1 226 ? 22.073 10.616  16.372  1.00 34.21  ? 222 LEU A C   1 
ATOM   1761 O  O   . LEU A 1 226 ? 22.226 9.400   16.303  1.00 33.49  ? 222 LEU A O   1 
ATOM   1762 C  CB  . LEU A 1 226 ? 24.067 12.041  16.958  1.00 32.86  ? 222 LEU A CB  1 
ATOM   1763 C  CG  . LEU A 1 226 ? 24.942 12.751  18.005  1.00 38.73  ? 222 LEU A CG  1 
ATOM   1764 N  N   . ARG A 1 227 ? 21.327 11.304  15.496  1.00 30.29  ? 223 ARG A N   1 
ATOM   1765 C  CA  . ARG A 1 227 ? 20.657 10.659  14.361  1.00 29.73  ? 223 ARG A CA  1 
ATOM   1766 C  C   . ARG A 1 227 ? 21.721 9.987   13.480  1.00 31.56  ? 223 ARG A C   1 
ATOM   1767 O  O   . ARG A 1 227 ? 22.694 10.641  13.123  1.00 31.81  ? 223 ARG A O   1 
ATOM   1768 C  CB  . ARG A 1 227 ? 19.866 11.694  13.549  1.00 30.33  ? 223 ARG A CB  1 
ATOM   1769 C  CG  . ARG A 1 227 ? 18.578 12.154  14.210  1.00 36.38  ? 223 ARG A CG  1 
ATOM   1770 C  CD  . ARG A 1 227 ? 17.893 13.225  13.382  1.00 44.48  ? 223 ARG A CD  1 
ATOM   1771 N  N   . GLN A 1 228 ? 21.579 8.673   13.199  1.00 25.73  ? 224 GLN A N   1 
ATOM   1772 C  CA  . GLN A 1 228 ? 22.546 7.890   12.394  1.00 24.58  ? 224 GLN A CA  1 
ATOM   1773 C  C   . GLN A 1 228 ? 21.776 7.166   11.296  1.00 25.53  ? 224 GLN A C   1 
ATOM   1774 O  O   . GLN A 1 228 ? 20.589 6.901   11.485  1.00 25.16  ? 224 GLN A O   1 
ATOM   1775 C  CB  . GLN A 1 228 ? 23.189 6.765   13.247  1.00 25.99  ? 224 GLN A CB  1 
ATOM   1776 C  CG  . GLN A 1 228 ? 23.956 7.165   14.485  1.00 33.45  ? 224 GLN A CG  1 
ATOM   1777 C  CD  . GLN A 1 228 ? 24.763 5.996   14.997  1.00 36.75  ? 224 GLN A CD  1 
ATOM   1778 O  OE1 . GLN A 1 228 ? 24.371 5.303   15.945  1.00 29.78  ? 224 GLN A OE1 1 
ATOM   1779 N  NE2 . GLN A 1 228 ? 25.915 5.750   14.378  1.00 20.96  ? 224 GLN A NE2 1 
ATOM   1780 N  N   . ASN A 1 229 ? 22.470 6.706   10.231  1.00 18.19  ? 225 ASN A N   1 
ATOM   1781 C  CA  . ASN A 1 229 ? 21.803 5.926   9.194   1.00 17.13  ? 225 ASN A CA  1 
ATOM   1782 C  C   . ASN A 1 229 ? 21.816 4.422   9.535   1.00 20.21  ? 225 ASN A C   1 
ATOM   1783 O  O   . ASN A 1 229 ? 21.600 3.595   8.655   1.00 19.64  ? 225 ASN A O   1 
ATOM   1784 C  CB  . ASN A 1 229 ? 22.426 6.181   7.807   1.00 17.68  ? 225 ASN A CB  1 
ATOM   1785 C  CG  . ASN A 1 229 ? 21.427 6.018   6.695   1.00 25.35  ? 225 ASN A CG  1 
ATOM   1786 O  OD1 . ASN A 1 229 ? 20.233 6.304   6.859   1.00 29.50  ? 225 ASN A OD1 1 
ATOM   1787 N  ND2 . ASN A 1 229 ? 21.889 5.649   5.512   1.00 23.05  ? 225 ASN A ND2 1 
ATOM   1788 N  N   . VAL A 1 230 ? 22.109 4.080   10.802  1.00 14.96  ? 226 VAL A N   1 
ATOM   1789 C  CA  . VAL A 1 230 ? 22.155 2.703   11.278  1.00 14.14  ? 226 VAL A CA  1 
ATOM   1790 C  C   . VAL A 1 230 ? 21.238 2.573   12.475  1.00 17.12  ? 226 VAL A C   1 
ATOM   1791 O  O   . VAL A 1 230 ? 21.037 3.557   13.189  1.00 16.36  ? 226 VAL A O   1 
ATOM   1792 C  CB  . VAL A 1 230 ? 23.593 2.133   11.537  1.00 17.48  ? 226 VAL A CB  1 
ATOM   1793 C  CG1 . VAL A 1 230 ? 24.474 2.231   10.294  1.00 16.91  ? 226 VAL A CG1 1 
ATOM   1794 C  CG2 . VAL A 1 230 ? 24.268 2.777   12.739  1.00 17.76  ? 226 VAL A CG2 1 
ATOM   1795 N  N   . ASP A 1 231 ? 20.683 1.366   12.688  1.00 12.41  ? 227 ASP A N   1 
ATOM   1796 C  CA  . ASP A 1 231 ? 19.826 1.120   13.845  1.00 11.77  ? 227 ASP A CA  1 
ATOM   1797 C  C   . ASP A 1 231 ? 20.721 0.795   15.000  1.00 15.49  ? 227 ASP A C   1 
ATOM   1798 O  O   . ASP A 1 231 ? 21.832 0.303   14.789  1.00 17.43  ? 227 ASP A O   1 
ATOM   1799 C  CB  . ASP A 1 231 ? 18.893 -0.087  13.602  1.00 12.93  ? 227 ASP A CB  1 
ATOM   1800 C  CG  . ASP A 1 231 ? 17.874 0.083   12.495  1.00 17.61  ? 227 ASP A CG  1 
ATOM   1801 O  OD1 . ASP A 1 231 ? 17.524 1.254   12.170  1.00 17.88  ? 227 ASP A OD1 1 
ATOM   1802 O  OD2 . ASP A 1 231 ? 17.400 -0.941  11.973  1.00 18.10  ? 227 ASP A OD2 1 
ATOM   1803 N  N   . VAL A 1 232 ? 20.232 0.992   16.226  1.00 12.05  ? 228 VAL A N   1 
ATOM   1804 C  CA  . VAL A 1 232 ? 21.006 0.611   17.417  1.00 12.72  ? 228 VAL A CA  1 
ATOM   1805 C  C   . VAL A 1 232 ? 20.054 -0.197  18.284  1.00 15.31  ? 228 VAL A C   1 
ATOM   1806 O  O   . VAL A 1 232 ? 18.950 0.252   18.532  1.00 14.83  ? 228 VAL A O   1 
ATOM   1807 C  CB  . VAL A 1 232 ? 21.594 1.855   18.175  1.00 17.15  ? 228 VAL A CB  1 
ATOM   1808 C  CG1 . VAL A 1 232 ? 22.275 1.449   19.495  1.00 17.51  ? 228 VAL A CG1 1 
ATOM   1809 C  CG2 . VAL A 1 232 ? 22.571 2.627   17.289  1.00 16.91  ? 228 VAL A CG2 1 
ATOM   1810 N  N   . TRP A 1 233 ? 20.478 -1.371  18.762  1.00 13.96  ? 229 TRP A N   1 
ATOM   1811 C  CA  . TRP A 1 233 ? 19.602 -2.157  19.634  1.00 13.13  ? 229 TRP A CA  1 
ATOM   1812 C  C   . TRP A 1 233 ? 20.163 -2.098  21.064  1.00 14.70  ? 229 TRP A C   1 
ATOM   1813 O  O   . TRP A 1 233 ? 21.342 -2.356  21.268  1.00 14.09  ? 229 TRP A O   1 
ATOM   1814 C  CB  . TRP A 1 233 ? 19.476 -3.604  19.131  1.00 11.68  ? 229 TRP A CB  1 
ATOM   1815 C  CG  . TRP A 1 233 ? 18.452 -4.425  19.851  1.00 12.36  ? 229 TRP A CG  1 
ATOM   1816 C  CD1 . TRP A 1 233 ? 17.113 -4.169  19.958  1.00 14.75  ? 229 TRP A CD1 1 
ATOM   1817 C  CD2 . TRP A 1 233 ? 18.673 -5.685  20.496  1.00 12.38  ? 229 TRP A CD2 1 
ATOM   1818 N  NE1 . TRP A 1 233 ? 16.488 -5.194  20.615  1.00 14.10  ? 229 TRP A NE1 1 
ATOM   1819 C  CE2 . TRP A 1 233 ? 17.427 -6.114  21.004  1.00 15.57  ? 229 TRP A CE2 1 
ATOM   1820 C  CE3 . TRP A 1 233 ? 19.811 -6.488  20.709  1.00 14.22  ? 229 TRP A CE3 1 
ATOM   1821 C  CZ2 . TRP A 1 233 ? 17.285 -7.305  21.726  1.00 14.74  ? 229 TRP A CZ2 1 
ATOM   1822 C  CZ3 . TRP A 1 233 ? 19.670 -7.665  21.433  1.00 15.57  ? 229 TRP A CZ3 1 
ATOM   1823 C  CH2 . TRP A 1 233 ? 18.413 -8.068  21.918  1.00 16.00  ? 229 TRP A CH2 1 
ATOM   1824 N  N   . LEU A 1 234 ? 19.314 -1.730  22.015  1.00 12.61  ? 230 LEU A N   1 
ATOM   1825 C  CA  . LEU A 1 234 ? 19.661 -1.626  23.437  1.00 12.56  ? 230 LEU A CA  1 
ATOM   1826 C  C   . LEU A 1 234 ? 19.001 -2.753  24.199  1.00 14.85  ? 230 LEU A C   1 
ATOM   1827 O  O   . LEU A 1 234 ? 17.826 -3.051  23.966  1.00 12.76  ? 230 LEU A O   1 
ATOM   1828 C  CB  . LEU A 1 234 ? 19.178 -0.275  24.028  1.00 12.37  ? 230 LEU A CB  1 
ATOM   1829 C  CG  . LEU A 1 234 ? 19.599 0.986   23.264  1.00 16.30  ? 230 LEU A CG  1 
ATOM   1830 C  CD1 . LEU A 1 234 ? 19.012 2.261   23.921  1.00 17.45  ? 230 LEU A CD1 1 
ATOM   1831 C  CD2 . LEU A 1 234 ? 21.119 1.097   23.129  1.00 14.84  ? 230 LEU A CD2 1 
ATOM   1832 N  N   . TRP A 1 235 ? 19.738 -3.355  25.121  1.00 13.14  ? 231 TRP A N   1 
ATOM   1833 C  CA  . TRP A 1 235 ? 19.196 -4.428  25.936  1.00 13.67  ? 231 TRP A CA  1 
ATOM   1834 C  C   . TRP A 1 235 ? 19.664 -4.229  27.369  1.00 15.95  ? 231 TRP A C   1 
ATOM   1835 O  O   . TRP A 1 235 ? 20.858 -4.339  27.656  1.00 13.88  ? 231 TRP A O   1 
ATOM   1836 C  CB  . TRP A 1 235 ? 19.660 -5.791  25.392  1.00 12.62  ? 231 TRP A CB  1 
ATOM   1837 C  CG  . TRP A 1 235 ? 19.026 -7.011  26.000  1.00 14.32  ? 231 TRP A CG  1 
ATOM   1838 C  CD1 . TRP A 1 235 ? 17.986 -7.067  26.890  1.00 17.17  ? 231 TRP A CD1 1 
ATOM   1839 C  CD2 . TRP A 1 235 ? 19.420 -8.361  25.757  1.00 15.22  ? 231 TRP A CD2 1 
ATOM   1840 N  NE1 . TRP A 1 235 ? 17.726 -8.377  27.226  1.00 16.62  ? 231 TRP A NE1 1 
ATOM   1841 C  CE2 . TRP A 1 235 ? 18.567 -9.192  26.519  1.00 18.86  ? 231 TRP A CE2 1 
ATOM   1842 C  CE3 . TRP A 1 235 ? 20.374 -8.958  24.908  1.00 17.24  ? 231 TRP A CE3 1 
ATOM   1843 C  CZ2 . TRP A 1 235 ? 18.636 -10.588 26.458  1.00 18.77  ? 231 TRP A CZ2 1 
ATOM   1844 C  CZ3 . TRP A 1 235 ? 20.472 -10.340 24.878  1.00 19.16  ? 231 TRP A CZ3 1 
ATOM   1845 C  CH2 . TRP A 1 235 ? 19.588 -11.143 25.617  1.00 20.32  ? 231 TRP A CH2 1 
ATOM   1846 N  N   . GLN A 1 236 ? 18.716 -3.881  28.239  1.00 12.47  ? 232 GLN A N   1 
ATOM   1847 C  CA  . GLN A 1 236 ? 18.950 -3.683  29.677  1.00 11.18  ? 232 GLN A CA  1 
ATOM   1848 C  C   . GLN A 1 236 ? 19.025 -5.062  30.322  1.00 15.66  ? 232 GLN A C   1 
ATOM   1849 O  O   . GLN A 1 236 ? 18.038 -5.804  30.307  1.00 17.01  ? 232 GLN A O   1 
ATOM   1850 C  CB  . GLN A 1 236 ? 17.787 -2.871  30.291  1.00 12.88  ? 232 GLN A CB  1 
ATOM   1851 C  CG  . GLN A 1 236 ? 18.079 -2.422  31.736  1.00 13.15  ? 232 GLN A CG  1 
ATOM   1852 C  CD  . GLN A 1 236 ? 19.126 -1.333  31.703  1.00 19.88  ? 232 GLN A CD  1 
ATOM   1853 O  OE1 . GLN A 1 236 ? 19.119 -0.476  30.828  1.00 14.72  ? 232 GLN A OE1 1 
ATOM   1854 N  NE2 . GLN A 1 236 ? 20.164 -1.471  32.505  1.00 16.26  ? 232 GLN A NE2 1 
ATOM   1855 N  N   . LEU A 1 237 ? 20.209 -5.436  30.840  1.00 13.09  ? 233 LEU A N   1 
ATOM   1856 C  CA  . LEU A 1 237 ? 20.398 -6.753  31.452  1.00 13.97  ? 233 LEU A CA  1 
ATOM   1857 C  C   . LEU A 1 237 ? 20.119 -6.760  32.942  1.00 18.91  ? 233 LEU A C   1 
ATOM   1858 O  O   . LEU A 1 237 ? 19.401 -7.628  33.419  1.00 19.61  ? 233 LEU A O   1 
ATOM   1859 C  CB  . LEU A 1 237 ? 21.783 -7.345  31.148  1.00 13.79  ? 233 LEU A CB  1 
ATOM   1860 C  CG  . LEU A 1 237 ? 22.123 -7.459  29.634  1.00 17.16  ? 233 LEU A CG  1 
ATOM   1861 C  CD1 . LEU A 1 237 ? 23.486 -8.046  29.443  1.00 17.93  ? 233 LEU A CD1 1 
ATOM   1862 C  CD2 . LEU A 1 237 ? 21.109 -8.277  28.903  1.00 17.45  ? 233 LEU A CD2 1 
ATOM   1863 N  N   . GLU A 1 238 ? 20.698 -5.816  33.665  1.00 15.60  ? 234 GLU A N   1 
ATOM   1864 C  CA  . GLU A 1 238 ? 20.523 -5.725  35.123  1.00 14.80  ? 234 GLU A CA  1 
ATOM   1865 C  C   . GLU A 1 238 ? 20.127 -4.304  35.480  1.00 16.59  ? 234 GLU A C   1 
ATOM   1866 O  O   . GLU A 1 238 ? 20.601 -3.342  34.871  1.00 12.35  ? 234 GLU A O   1 
ATOM   1867 C  CB  . GLU A 1 238 ? 21.825 -6.091  35.872  1.00 16.50  ? 234 GLU A CB  1 
ATOM   1868 C  CG  . GLU A 1 238 ? 22.536 -7.326  35.343  1.00 32.79  ? 234 GLU A CG  1 
ATOM   1869 C  CD  . GLU A 1 238 ? 22.727 -8.482  36.308  1.00 59.38  ? 234 GLU A CD  1 
ATOM   1870 O  OE1 . GLU A 1 238 ? 23.863 -9.002  36.371  1.00 36.14  ? 234 GLU A OE1 1 
ATOM   1871 O  OE2 . GLU A 1 238 ? 21.746 -8.889  36.970  1.00 68.63  ? 234 GLU A OE2 1 
ATOM   1872 N  N   . GLY A 1 239 ? 19.292 -4.166  36.502  1.00 14.01  ? 235 GLY A N   1 
ATOM   1873 C  CA  . GLY A 1 239 ? 18.864 -2.843  36.933  1.00 13.05  ? 235 GLY A CA  1 
ATOM   1874 C  C   . GLY A 1 239 ? 18.049 -2.134  35.872  1.00 16.23  ? 235 GLY A C   1 
ATOM   1875 O  O   . GLY A 1 239 ? 17.519 -2.781  34.957  1.00 16.31  ? 235 GLY A O   1 
ATOM   1876 N  N   . SER A 1 240 ? 17.949 -0.817  35.965  1.00 13.00  ? 236 SER A N   1 
ATOM   1877 C  CA  . SER A 1 240 ? 17.105 -0.067  35.050  1.00 13.56  ? 236 SER A CA  1 
ATOM   1878 C  C   . SER A 1 240 ? 17.762 1.185   34.475  1.00 17.24  ? 236 SER A C   1 
ATOM   1879 O  O   . SER A 1 240 ? 18.772 1.683   34.967  1.00 15.28  ? 236 SER A O   1 
ATOM   1880 C  CB  . SER A 1 240 ? 15.798 0.319   35.739  1.00 18.68  ? 236 SER A CB  1 
ATOM   1881 O  OG  . SER A 1 240 ? 16.053 1.210   36.820  1.00 22.36  ? 236 SER A OG  1 
ATOM   1882 N  N   . SER A 1 241 ? 17.138 1.708   33.435  1.00 13.93  ? 237 SER A N   1 
ATOM   1883 C  CA  . SER A 1 241 ? 17.581 2.923   32.804  1.00 14.27  ? 237 SER A CA  1 
ATOM   1884 C  C   . SER A 1 241 ? 16.373 3.611   32.187  1.00 18.78  ? 237 SER A C   1 
ATOM   1885 O  O   . SER A 1 241 ? 15.275 3.044   32.180  1.00 17.33  ? 237 SER A O   1 
ATOM   1886 C  CB  . SER A 1 241 ? 18.646 2.608   31.752  1.00 17.01  ? 237 SER A CB  1 
ATOM   1887 O  OG  . SER A 1 241 ? 18.069 1.923   30.655  1.00 20.59  ? 237 SER A OG  1 
ATOM   1888 N  N   . VAL A 1 242 ? 16.563 4.847   31.705  1.00 17.04  ? 238 VAL A N   1 
ATOM   1889 C  CA  . VAL A 1 242 ? 15.489 5.608   31.060  1.00 17.10  ? 238 VAL A CA  1 
ATOM   1890 C  C   . VAL A 1 242 ? 16.004 6.109   29.714  1.00 17.36  ? 238 VAL A C   1 
ATOM   1891 O  O   . VAL A 1 242 ? 17.029 6.779   29.673  1.00 15.45  ? 238 VAL A O   1 
ATOM   1892 C  CB  . VAL A 1 242 ? 14.982 6.783   31.947  1.00 22.47  ? 238 VAL A CB  1 
ATOM   1893 C  CG1 . VAL A 1 242 ? 13.872 7.569   31.247  1.00 23.11  ? 238 VAL A CG1 1 
ATOM   1894 C  CG2 . VAL A 1 242 ? 14.497 6.285   33.309  1.00 22.24  ? 238 VAL A CG2 1 
ATOM   1895 N  N   . VAL A 1 243 ? 15.299 5.775   28.636  1.00 13.25  ? 239 VAL A N   1 
ATOM   1896 C  CA  . VAL A 1 243 ? 15.643 6.290   27.297  1.00 14.82  ? 239 VAL A CA  1 
ATOM   1897 C  C   . VAL A 1 243 ? 14.610 7.388   26.969  1.00 20.57  ? 239 VAL A C   1 
ATOM   1898 O  O   . VAL A 1 243 ? 13.418 7.134   27.100  1.00 20.19  ? 239 VAL A O   1 
ATOM   1899 C  CB  . VAL A 1 243 ? 15.644 5.173   26.222  1.00 17.97  ? 239 VAL A CB  1 
ATOM   1900 C  CG1 . VAL A 1 243 ? 15.930 5.747   24.826  1.00 17.10  ? 239 VAL A CG1 1 
ATOM   1901 C  CG2 . VAL A 1 243 ? 16.661 4.092   26.579  1.00 18.33  ? 239 VAL A CG2 1 
ATOM   1902 N  N   . THR A 1 244 ? 15.072 8.604   26.599  1.00 19.12  ? 240 THR A N   1 
ATOM   1903 C  CA  . THR A 1 244 ? 14.185 9.700   26.174  1.00 19.95  ? 240 THR A CA  1 
ATOM   1904 C  C   . THR A 1 244 ? 14.308 9.725   24.672  1.00 25.26  ? 240 THR A C   1 
ATOM   1905 O  O   . THR A 1 244 ? 15.395 9.975   24.164  1.00 23.42  ? 240 THR A O   1 
ATOM   1906 C  CB  . THR A 1 244 ? 14.522 11.040  26.853  1.00 26.29  ? 240 THR A CB  1 
ATOM   1907 O  OG1 . THR A 1 244 ? 14.486 10.822  28.264  1.00 22.30  ? 240 THR A OG1 1 
ATOM   1908 C  CG2 . THR A 1 244 ? 13.503 12.153  26.495  1.00 26.98  ? 240 THR A CG2 1 
ATOM   1909 N  N   . MET A 1 245 ? 13.216 9.403   23.976  1.00 23.65  ? 241 MET A N   1 
ATOM   1910 C  CA  . MET A 1 245 ? 13.226 9.273   22.515  1.00 25.63  ? 241 MET A CA  1 
ATOM   1911 C  C   . MET A 1 245 ? 11.850 9.627   21.958  1.00 31.74  ? 241 MET A C   1 
ATOM   1912 O  O   . MET A 1 245 ? 10.849 9.175   22.503  1.00 29.03  ? 241 MET A O   1 
ATOM   1913 C  CB  . MET A 1 245 ? 13.591 7.808   22.200  1.00 27.83  ? 241 MET A CB  1 
ATOM   1914 C  CG  . MET A 1 245 ? 13.550 7.418   20.761  1.00 31.69  ? 241 MET A CG  1 
ATOM   1915 S  SD  . MET A 1 245 ? 13.931 5.647   20.677  1.00 35.37  ? 241 MET A SD  1 
ATOM   1916 C  CE  . MET A 1 245 ? 12.289 4.952   20.607  1.00 32.57  ? 241 MET A CE  1 
ATOM   1917 N  N   . GLY A 1 246 ? 11.826 10.443  20.897  1.00 32.26  ? 242 GLY A N   1 
ATOM   1918 C  CA  . GLY A 1 246 ? 10.605 10.898  20.229  1.00 32.51  ? 242 GLY A CA  1 
ATOM   1919 C  C   . GLY A 1 246 ? 9.560  11.502  21.156  1.00 38.17  ? 242 GLY A C   1 
ATOM   1920 O  O   . GLY A 1 246 ? 8.370  11.206  21.022  1.00 37.42  ? 242 GLY A O   1 
ATOM   1921 N  N   . GLY A 1 247 ? 10.015 12.307  22.116  1.00 36.25  ? 243 GLY A N   1 
ATOM   1922 C  CA  . GLY A 1 247 ? 9.162  12.981  23.093  1.00 36.57  ? 243 GLY A CA  1 
ATOM   1923 C  C   . GLY A 1 247 ? 8.711  12.149  24.280  1.00 42.34  ? 243 GLY A C   1 
ATOM   1924 O  O   . GLY A 1 247 ? 8.081  12.691  25.195  1.00 43.31  ? 243 GLY A O   1 
ATOM   1925 N  N   . ARG A 1 248 ? 9.031  10.832  24.289  1.00 36.83  ? 244 ARG A N   1 
ATOM   1926 C  CA  . ARG A 1 248 ? 8.636  9.890   25.347  1.00 35.59  ? 244 ARG A CA  1 
ATOM   1927 C  C   . ARG A 1 248 ? 9.801  9.439   26.244  1.00 37.02  ? 244 ARG A C   1 
ATOM   1928 O  O   . ARG A 1 248 ? 10.919 9.255   25.773  1.00 35.63  ? 244 ARG A O   1 
ATOM   1929 C  CB  . ARG A 1 248 ? 7.990  8.630   24.733  1.00 34.97  ? 244 ARG A CB  1 
ATOM   1930 C  CG  . ARG A 1 248 ? 6.815  8.890   23.791  1.00 48.94  ? 244 ARG A CG  1 
ATOM   1931 C  CD  . ARG A 1 248 ? 5.898  7.686   23.689  1.00 58.32  ? 244 ARG A CD  1 
ATOM   1932 N  N   . ARG A 1 249 ? 9.527  9.229   27.531  1.00 32.40  ? 245 ARG A N   1 
ATOM   1933 C  CA  . ARG A 1 249 ? 10.509 8.696   28.478  1.00 31.14  ? 245 ARG A CA  1 
ATOM   1934 C  C   . ARG A 1 249 ? 10.158 7.218   28.611  1.00 31.71  ? 245 ARG A C   1 
ATOM   1935 O  O   . ARG A 1 249 ? 9.037  6.888   29.010  1.00 32.44  ? 245 ARG A O   1 
ATOM   1936 C  CB  . ARG A 1 249 ? 10.419 9.417   29.837  1.00 32.83  ? 245 ARG A CB  1 
ATOM   1937 C  CG  . ARG A 1 249 ? 11.330 10.625  29.921  1.00 48.59  ? 245 ARG A CG  1 
ATOM   1938 N  N   . LEU A 1 250 ? 11.071 6.328   28.186  1.00 24.05  ? 246 LEU A N   1 
ATOM   1939 C  CA  . LEU A 1 250 ? 10.831 4.895   28.206  1.00 22.42  ? 246 LEU A CA  1 
ATOM   1940 C  C   . LEU A 1 250 ? 11.724 4.258   29.252  1.00 22.96  ? 246 LEU A C   1 
ATOM   1941 O  O   . LEU A 1 250 ? 12.937 4.272   29.099  1.00 19.82  ? 246 LEU A O   1 
ATOM   1942 C  CB  . LEU A 1 250 ? 11.089 4.256   26.815  1.00 22.89  ? 246 LEU A CB  1 
ATOM   1943 C  CG  . LEU A 1 250 ? 10.337 4.825   25.594  1.00 29.00  ? 246 LEU A CG  1 
ATOM   1944 C  CD1 . LEU A 1 250 ? 10.838 4.164   24.326  1.00 30.11  ? 246 LEU A CD1 1 
ATOM   1945 C  CD2 . LEU A 1 250 ? 8.819  4.605   25.701  1.00 32.88  ? 246 LEU A CD2 1 
ATOM   1946 N  N   . SER A 1 251 ? 11.117 3.748   30.328  1.00 20.57  ? 247 SER A N   1 
ATOM   1947 C  CA  . SER A 1 251 ? 11.804 3.082   31.434  1.00 21.08  ? 247 SER A CA  1 
ATOM   1948 C  C   . SER A 1 251 ? 12.149 1.645   31.037  1.00 26.21  ? 247 SER A C   1 
ATOM   1949 O  O   . SER A 1 251 ? 11.250 0.841   30.781  1.00 27.51  ? 247 SER A O   1 
ATOM   1950 C  CB  . SER A 1 251 ? 10.913 3.080   32.672  1.00 24.55  ? 247 SER A CB  1 
ATOM   1951 O  OG  . SER A 1 251 ? 10.590 4.422   32.997  1.00 39.28  ? 247 SER A OG  1 
ATOM   1952 N  N   . LEU A 1 252 ? 13.447 1.331   30.961  1.00 19.56  ? 248 LEU A N   1 
ATOM   1953 C  CA  . LEU A 1 252 ? 13.893 -0.021  30.613  1.00 17.20  ? 248 LEU A CA  1 
ATOM   1954 C  C   . LEU A 1 252 ? 14.133 -0.762  31.901  1.00 20.24  ? 248 LEU A C   1 
ATOM   1955 O  O   . LEU A 1 252 ? 15.000 -0.367  32.667  1.00 19.41  ? 248 LEU A O   1 
ATOM   1956 C  CB  . LEU A 1 252 ? 15.181 -0.005  29.797  1.00 17.15  ? 248 LEU A CB  1 
ATOM   1957 C  CG  . LEU A 1 252 ? 15.136 0.557   28.375  1.00 21.91  ? 248 LEU A CG  1 
ATOM   1958 C  CD1 . LEU A 1 252 ? 16.475 0.277   27.670  1.00 22.12  ? 248 LEU A CD1 1 
ATOM   1959 C  CD2 . LEU A 1 252 ? 14.002 -0.080  27.553  1.00 24.10  ? 248 LEU A CD2 1 
ATOM   1960 N  N   . ALA A 1 253 ? 13.346 -1.809  32.153  1.00 15.42  ? 249 ALA A N   1 
ATOM   1961 C  CA  . ALA A 1 253 ? 13.479 -2.610  33.356  1.00 16.43  ? 249 ALA A CA  1 
ATOM   1962 C  C   . ALA A 1 253 ? 14.362 -3.808  33.010  1.00 18.04  ? 249 ALA A C   1 
ATOM   1963 O  O   . ALA A 1 253 ? 14.653 -3.988  31.824  1.00 16.79  ? 249 ALA A O   1 
ATOM   1964 C  CB  . ALA A 1 253 ? 12.090 -3.072  33.815  1.00 18.07  ? 249 ALA A CB  1 
ATOM   1965 N  N   . PRO A 1 254 ? 14.803 -4.645  33.981  1.00 12.90  ? 250 PRO A N   1 
ATOM   1966 C  CA  . PRO A 1 254 ? 15.629 -5.818  33.645  1.00 11.94  ? 250 PRO A CA  1 
ATOM   1967 C  C   . PRO A 1 254 ? 15.031 -6.690  32.533  1.00 15.32  ? 250 PRO A C   1 
ATOM   1968 O  O   . PRO A 1 254 ? 13.859 -7.048  32.576  1.00 13.79  ? 250 PRO A O   1 
ATOM   1969 C  CB  . PRO A 1 254 ? 15.676 -6.589  34.973  1.00 14.17  ? 250 PRO A CB  1 
ATOM   1970 C  CG  . PRO A 1 254 ? 15.650 -5.504  35.979  1.00 17.45  ? 250 PRO A CG  1 
ATOM   1971 C  CD  . PRO A 1 254 ? 14.643 -4.518  35.452  1.00 14.34  ? 250 PRO A CD  1 
ATOM   1972 N  N   . ASP A 1 255 ? 15.841 -6.963  31.504  1.00 12.76  ? 251 ASP A N   1 
ATOM   1973 C  CA  . ASP A 1 255 ? 15.540 -7.756  30.290  1.00 13.44  ? 251 ASP A CA  1 
ATOM   1974 C  C   . ASP A 1 255 ? 14.766 -6.959  29.206  1.00 15.72  ? 251 ASP A C   1 
ATOM   1975 O  O   . ASP A 1 255 ? 14.501 -7.521  28.129  1.00 15.73  ? 251 ASP A O   1 
ATOM   1976 C  CB  . ASP A 1 255 ? 14.850 -9.098  30.601  1.00 14.69  ? 251 ASP A CB  1 
ATOM   1977 C  CG  . ASP A 1 255 ? 14.999 -10.137 29.499  1.00 17.29  ? 251 ASP A CG  1 
ATOM   1978 O  OD1 . ASP A 1 255 ? 16.081 -10.195 28.880  1.00 17.35  ? 251 ASP A OD1 1 
ATOM   1979 O  OD2 . ASP A 1 255 ? 14.033 -10.902 29.267  1.00 14.80  ? 251 ASP A OD2 1 
ATOM   1980 N  N   . ASP A 1 256 ? 14.439 -5.673  29.446  1.00 14.04  ? 252 ASP A N   1 
ATOM   1981 C  CA  . ASP A 1 256 ? 13.777 -4.871  28.401  1.00 12.54  ? 252 ASP A CA  1 
ATOM   1982 C  C   . ASP A 1 256 ? 14.791 -4.495  27.317  1.00 15.24  ? 252 ASP A C   1 
ATOM   1983 O  O   . ASP A 1 256 ? 15.951 -4.247  27.611  1.00 13.37  ? 252 ASP A O   1 
ATOM   1984 C  CB  . ASP A 1 256 ? 13.115 -3.579  28.929  1.00 13.80  ? 252 ASP A CB  1 
ATOM   1985 C  CG  . ASP A 1 256 ? 11.777 -3.780  29.631  1.00 22.65  ? 252 ASP A CG  1 
ATOM   1986 O  OD1 . ASP A 1 256 ? 11.162 -4.844  29.449  1.00 20.32  ? 252 ASP A OD1 1 
ATOM   1987 O  OD2 . ASP A 1 256 ? 11.358 -2.868  30.368  1.00 24.49  ? 252 ASP A OD2 1 
ATOM   1988 N  N   . SER A 1 257 ? 14.330 -4.468  26.070  1.00 12.55  ? 253 SER A N   1 
ATOM   1989 C  CA  . SER A 1 257 ? 15.172 -4.087  24.952  1.00 11.10  ? 253 SER A CA  1 
ATOM   1990 C  C   . SER A 1 257 ? 14.430 -3.008  24.167  1.00 15.46  ? 253 SER A C   1 
ATOM   1991 O  O   . SER A 1 257 ? 13.180 -2.895  24.244  1.00 14.55  ? 253 SER A O   1 
ATOM   1992 C  CB  . SER A 1 257 ? 15.487 -5.281  24.062  1.00 12.42  ? 253 SER A CB  1 
ATOM   1993 O  OG  . SER A 1 257 ? 14.312 -5.775  23.446  1.00 15.23  ? 253 SER A OG  1 
ATOM   1994 N  N   . LEU A 1 258 ? 15.203 -2.208  23.431  1.00 12.19  ? 254 LEU A N   1 
ATOM   1995 C  CA  . LEU A 1 258 ? 14.646 -1.134  22.638  1.00 13.36  ? 254 LEU A CA  1 
ATOM   1996 C  C   . LEU A 1 258 ? 15.458 -0.930  21.385  1.00 14.07  ? 254 LEU A C   1 
ATOM   1997 O  O   . LEU A 1 258 ? 16.673 -0.824  21.448  1.00 13.31  ? 254 LEU A O   1 
ATOM   1998 C  CB  . LEU A 1 258 ? 14.578 0.166   23.479  1.00 14.86  ? 254 LEU A CB  1 
ATOM   1999 C  CG  . LEU A 1 258 ? 14.005 1.421   22.783  1.00 21.90  ? 254 LEU A CG  1 
ATOM   2000 C  CD1 . LEU A 1 258 ? 12.521 1.269   22.470  1.00 21.74  ? 254 LEU A CD1 1 
ATOM   2001 C  CD2 . LEU A 1 258 ? 14.246 2.670   23.618  1.00 26.67  ? 254 LEU A CD2 1 
ATOM   2002 N  N   . LEU A 1 259 ? 14.774 -0.878  20.247  1.00 11.81  ? 255 LEU A N   1 
ATOM   2003 C  CA  . LEU A 1 259 ? 15.445 -0.588  18.989  1.00 11.78  ? 255 LEU A CA  1 
ATOM   2004 C  C   . LEU A 1 259 ? 15.363 0.914   18.722  1.00 18.22  ? 255 LEU A C   1 
ATOM   2005 O  O   . LEU A 1 259 ? 14.271 1.479   18.653  1.00 18.42  ? 255 LEU A O   1 
ATOM   2006 C  CB  . LEU A 1 259 ? 14.819 -1.339  17.822  1.00 11.23  ? 255 LEU A CB  1 
ATOM   2007 C  CG  . LEU A 1 259 ? 15.599 -1.225  16.510  1.00 15.89  ? 255 LEU A CG  1 
ATOM   2008 C  CD1 . LEU A 1 259 ? 16.897 -2.053  16.563  1.00 14.89  ? 255 LEU A CD1 1 
ATOM   2009 C  CD2 . LEU A 1 259 ? 14.718 -1.594  15.359  1.00 21.27  ? 255 LEU A CD2 1 
ATOM   2010 N  N   . VAL A 1 260 ? 16.517 1.532   18.490  1.00 15.33  ? 256 VAL A N   1 
ATOM   2011 C  CA  . VAL A 1 260 ? 16.547 2.943   18.141  1.00 14.96  ? 256 VAL A CA  1 
ATOM   2012 C  C   . VAL A 1 260 ? 16.705 2.944   16.619  1.00 17.76  ? 256 VAL A C   1 
ATOM   2013 O  O   . VAL A 1 260 ? 17.746 2.559   16.125  1.00 15.53  ? 256 VAL A O   1 
ATOM   2014 C  CB  . VAL A 1 260 ? 17.692 3.680   18.843  1.00 17.83  ? 256 VAL A CB  1 
ATOM   2015 C  CG1 . VAL A 1 260 ? 17.744 5.147   18.388  1.00 17.89  ? 256 VAL A CG1 1 
ATOM   2016 C  CG2 . VAL A 1 260 ? 17.542 3.567   20.368  1.00 17.56  ? 256 VAL A CG2 1 
ATOM   2017 N  N   . LEU A 1 261 ? 15.646 3.296   15.903  1.00 16.66  ? 257 LEU A N   1 
ATOM   2018 C  CA  . LEU A 1 261 ? 15.659 3.284   14.431  1.00 16.65  ? 257 LEU A CA  1 
ATOM   2019 C  C   . LEU A 1 261 ? 16.567 4.337   13.861  1.00 18.83  ? 257 LEU A C   1 
ATOM   2020 O  O   . LEU A 1 261 ? 16.639 5.427   14.394  1.00 16.00  ? 257 LEU A O   1 
ATOM   2021 C  CB  . LEU A 1 261 ? 14.239 3.501   13.890  1.00 17.33  ? 257 LEU A CB  1 
ATOM   2022 C  CG  . LEU A 1 261 ? 13.302 2.314   14.014  1.00 23.45  ? 257 LEU A CG  1 
ATOM   2023 C  CD1 . LEU A 1 261 ? 11.860 2.769   13.962  1.00 25.81  ? 257 LEU A CD1 1 
ATOM   2024 C  CD2 . LEU A 1 261 ? 13.625 1.258   12.959  1.00 21.79  ? 257 LEU A CD2 1 
ATOM   2025 N  N   . ALA A 1 262 ? 17.230 4.028   12.739  1.00 17.05  ? 258 ALA A N   1 
ATOM   2026 C  CA  . ALA A 1 262 ? 18.063 4.972   12.019  1.00 18.15  ? 258 ALA A CA  1 
ATOM   2027 C  C   . ALA A 1 262 ? 17.277 6.274   11.818  1.00 21.28  ? 258 ALA A C   1 
ATOM   2028 O  O   . ALA A 1 262 ? 16.102 6.236   11.437  1.00 17.91  ? 258 ALA A O   1 
ATOM   2029 C  CB  . ALA A 1 262 ? 18.431 4.390   10.654  1.00 18.80  ? 258 ALA A CB  1 
ATOM   2030 N  N   . GLY A 1 263 ? 17.919 7.391   12.131  1.00 20.17  ? 259 GLY A N   1 
ATOM   2031 C  CA  . GLY A 1 263 ? 17.323 8.709   11.954  1.00 20.44  ? 259 GLY A CA  1 
ATOM   2032 C  C   . GLY A 1 263 ? 16.647 9.284   13.184  1.00 24.96  ? 259 GLY A C   1 
ATOM   2033 O  O   . GLY A 1 263 ? 15.993 10.325  13.091  1.00 24.45  ? 259 GLY A O   1 
ATOM   2034 N  N   . THR A 1 264 ? 16.782 8.606   14.327  1.00 19.70  ? 260 THR A N   1 
ATOM   2035 C  CA  . THR A 1 264 ? 16.189 8.993   15.617  1.00 19.83  ? 260 THR A CA  1 
ATOM   2036 C  C   . THR A 1 264 ? 17.296 9.336   16.600  1.00 25.80  ? 260 THR A C   1 
ATOM   2037 O  O   . THR A 1 264 ? 18.321 8.648   16.654  1.00 24.70  ? 260 THR A O   1 
ATOM   2038 C  CB  . THR A 1 264 ? 15.323 7.830   16.167  1.00 32.21  ? 260 THR A CB  1 
ATOM   2039 O  OG1 . THR A 1 264 ? 14.311 7.503   15.217  1.00 37.50  ? 260 THR A OG1 1 
ATOM   2040 C  CG2 . THR A 1 264 ? 14.678 8.143   17.505  1.00 32.17  ? 260 THR A CG2 1 
ATOM   2041 N  N   . SER A 1 265 ? 17.087 10.395  17.383  1.00 22.74  ? 261 SER A N   1 
ATOM   2042 C  CA  . SER A 1 265 ? 18.019 10.775  18.428  1.00 23.45  ? 261 SER A CA  1 
ATOM   2043 C  C   . SER A 1 265 ? 17.453 10.282  19.771  1.00 25.74  ? 261 SER A C   1 
ATOM   2044 O  O   . SER A 1 265 ? 16.253 10.042  19.895  1.00 23.39  ? 261 SER A O   1 
ATOM   2045 C  CB  . SER A 1 265 ? 18.201 12.285  18.461  1.00 28.13  ? 261 SER A CB  1 
ATOM   2046 O  OG  . SER A 1 265 ? 16.987 12.933  18.802  1.00 35.62  ? 261 SER A OG  1 
ATOM   2047 N  N   . TYR A 1 266 ? 18.318 10.107  20.758  1.00 23.23  ? 262 TYR A N   1 
ATOM   2048 C  CA  . TYR A 1 266 ? 17.844 9.673   22.065  1.00 23.09  ? 262 TYR A CA  1 
ATOM   2049 C  C   . TYR A 1 266 ? 18.785 10.127  23.138  1.00 25.71  ? 262 TYR A C   1 
ATOM   2050 O  O   . TYR A 1 266 ? 19.941 10.448  22.857  1.00 24.51  ? 262 TYR A O   1 
ATOM   2051 C  CB  . TYR A 1 266 ? 17.619 8.131   22.119  1.00 24.50  ? 262 TYR A CB  1 
ATOM   2052 C  CG  . TYR A 1 266 ? 18.883 7.310   22.069  1.00 24.47  ? 262 TYR A CG  1 
ATOM   2053 C  CD1 . TYR A 1 266 ? 19.498 7.012   20.857  1.00 25.49  ? 262 TYR A CD1 1 
ATOM   2054 C  CD2 . TYR A 1 266 ? 19.483 6.846   23.237  1.00 25.40  ? 262 TYR A CD2 1 
ATOM   2055 C  CE1 . TYR A 1 266 ? 20.669 6.260   20.806  1.00 25.37  ? 262 TYR A CE1 1 
ATOM   2056 C  CE2 . TYR A 1 266 ? 20.666 6.113   23.200  1.00 25.72  ? 262 TYR A CE2 1 
ATOM   2057 C  CZ  . TYR A 1 266 ? 21.253 5.811   21.981  1.00 31.78  ? 262 TYR A CZ  1 
ATOM   2058 O  OH  . TYR A 1 266 ? 22.409 5.066   21.938  1.00 32.44  ? 262 TYR A OH  1 
ATOM   2059 N  N   . ALA A 1 267 ? 18.274 10.169  24.369  1.00 22.93  ? 263 ALA A N   1 
ATOM   2060 C  CA  . ALA A 1 267 ? 19.064 10.477  25.561  1.00 22.46  ? 263 ALA A CA  1 
ATOM   2061 C  C   . ALA A 1 267 ? 18.919 9.199   26.444  1.00 24.21  ? 263 ALA A C   1 
ATOM   2062 O  O   . ALA A 1 267 ? 17.843 8.605   26.481  1.00 23.49  ? 263 ALA A O   1 
ATOM   2063 C  CB  . ALA A 1 267 ? 18.500 11.702  26.274  1.00 22.72  ? 263 ALA A CB  1 
ATOM   2064 N  N   . TRP A 1 268 ? 20.008 8.754   27.075  1.00 17.48  ? 264 TRP A N   1 
ATOM   2065 C  CA  . TRP A 1 268 ? 19.994 7.545   27.895  1.00 15.96  ? 264 TRP A CA  1 
ATOM   2066 C  C   . TRP A 1 268 ? 20.631 7.801   29.257  1.00 18.33  ? 264 TRP A C   1 
ATOM   2067 O  O   . TRP A 1 268 ? 21.793 8.215   29.322  1.00 19.10  ? 264 TRP A O   1 
ATOM   2068 C  CB  . TRP A 1 268 ? 20.733 6.439   27.135  1.00 14.58  ? 264 TRP A CB  1 
ATOM   2069 C  CG  . TRP A 1 268 ? 20.534 5.034   27.632  1.00 14.83  ? 264 TRP A CG  1 
ATOM   2070 C  CD1 . TRP A 1 268 ? 19.608 4.590   28.530  1.00 17.45  ? 264 TRP A CD1 1 
ATOM   2071 C  CD2 . TRP A 1 268 ? 21.277 3.883   27.218  1.00 14.53  ? 264 TRP A CD2 1 
ATOM   2072 N  NE1 . TRP A 1 268 ? 19.691 3.225   28.660  1.00 16.92  ? 264 TRP A NE1 1 
ATOM   2073 C  CE2 . TRP A 1 268 ? 20.737 2.769   27.897  1.00 18.05  ? 264 TRP A CE2 1 
ATOM   2074 C  CE3 . TRP A 1 268 ? 22.360 3.684   26.331  1.00 15.31  ? 264 TRP A CE3 1 
ATOM   2075 C  CZ2 . TRP A 1 268 ? 21.223 1.472   27.708  1.00 16.67  ? 264 TRP A CZ2 1 
ATOM   2076 C  CZ3 . TRP A 1 268 ? 22.892 2.406   26.207  1.00 16.99  ? 264 TRP A CZ3 1 
ATOM   2077 C  CH2 . TRP A 1 268 ? 22.338 1.322   26.899  1.00 17.54  ? 264 TRP A CH2 1 
ATOM   2078 N  N   . GLU A 1 269 ? 19.868 7.563   30.316  1.00 14.28  ? 265 GLU A N   1 
ATOM   2079 C  CA  . GLU A 1 269 ? 20.237 7.752   31.729  1.00 14.64  ? 265 GLU A CA  1 
ATOM   2080 C  C   . GLU A 1 269 ? 20.192 6.372   32.397  1.00 17.35  ? 265 GLU A C   1 
ATOM   2081 O  O   . GLU A 1 269 ? 19.108 5.795   32.538  1.00 14.70  ? 265 GLU A O   1 
ATOM   2082 C  CB  . GLU A 1 269 ? 19.205 8.682   32.396  1.00 17.22  ? 265 GLU A CB  1 
ATOM   2083 C  CG  . GLU A 1 269 ? 19.106 10.063  31.755  1.00 30.19  ? 265 GLU A CG  1 
ATOM   2084 N  N   . ARG A 1 270 ? 21.367 5.831   32.788  1.00 14.69  ? 266 ARG A N   1 
ATOM   2085 C  CA  . ARG A 1 270 ? 21.502 4.485   33.380  1.00 13.66  ? 266 ARG A CA  1 
ATOM   2086 C  C   . ARG A 1 270 ? 21.822 4.621   34.854  1.00 18.65  ? 266 ARG A C   1 
ATOM   2087 O  O   . ARG A 1 270 ? 22.700 5.395   35.227  1.00 16.98  ? 266 ARG A O   1 
ATOM   2088 C  CB  . ARG A 1 270 ? 22.623 3.694   32.667  1.00 13.35  ? 266 ARG A CB  1 
ATOM   2089 C  CG  . ARG A 1 270 ? 22.373 3.605   31.156  1.00 14.45  ? 266 ARG A CG  1 
ATOM   2090 C  CD  . ARG A 1 270 ? 23.560 3.073   30.410  1.00 18.14  ? 266 ARG A CD  1 
ATOM   2091 N  NE  . ARG A 1 270 ? 24.749 3.926   30.495  1.00 15.10  ? 266 ARG A NE  1 
ATOM   2092 C  CZ  . ARG A 1 270 ? 25.029 4.910   29.648  1.00 19.05  ? 266 ARG A CZ  1 
ATOM   2093 N  NH1 . ARG A 1 270 ? 26.150 5.604   29.787  1.00 19.18  ? 266 ARG A NH1 1 
ATOM   2094 N  NH2 . ARG A 1 270 ? 24.206 5.200   28.657  1.00 14.20  ? 266 ARG A NH2 1 
ATOM   2095 N  N   . THR A 1 271 ? 21.117 3.854   35.671  1.00 16.36  ? 267 THR A N   1 
ATOM   2096 C  CA  . THR A 1 271 ? 21.228 3.922   37.140  1.00 16.04  ? 267 THR A CA  1 
ATOM   2097 C  C   . THR A 1 271 ? 22.490 3.244   37.696  1.00 19.57  ? 267 THR A C   1 
ATOM   2098 O  O   . THR A 1 271 ? 23.125 2.419   37.029  1.00 17.16  ? 267 THR A O   1 
ATOM   2099 C  CB  . THR A 1 271 ? 19.950 3.345   37.780  1.00 24.76  ? 267 THR A CB  1 
ATOM   2100 O  OG1 . THR A 1 271 ? 19.828 1.942   37.458  1.00 19.16  ? 267 THR A OG1 1 
ATOM   2101 C  CG2 . THR A 1 271 ? 18.691 4.105   37.373  1.00 26.83  ? 267 THR A CG2 1 
ATOM   2102 N  N   . GLN A 1 272 ? 22.793 3.508   38.992  1.00 16.49  ? 268 GLN A N   1 
ATOM   2103 C  CA  . GLN A 1 272 ? 23.938 2.880   39.626  1.00 16.54  ? 268 GLN A CA  1 
ATOM   2104 C  C   . GLN A 1 272 ? 23.698 1.357   39.686  1.00 19.59  ? 268 GLN A C   1 
ATOM   2105 O  O   . GLN A 1 272 ? 22.584 0.923   39.976  1.00 18.96  ? 268 GLN A O   1 
ATOM   2106 C  CB  . GLN A 1 272 ? 24.113 3.428   41.051  1.00 17.60  ? 268 GLN A CB  1 
ATOM   2107 C  CG  . GLN A 1 272 ? 25.379 2.933   41.749  1.00 24.83  ? 268 GLN A CG  1 
ATOM   2108 C  CD  . GLN A 1 272 ? 25.613 3.645   43.060  1.00 35.02  ? 268 GLN A CD  1 
ATOM   2109 O  OE1 . GLN A 1 272 ? 25.009 4.673   43.340  1.00 25.18  ? 268 GLN A OE1 1 
ATOM   2110 N  NE2 . GLN A 1 272 ? 26.528 3.133   43.871  1.00 28.33  ? 268 GLN A NE2 1 
ATOM   2111 N  N   . GLY A 1 273 ? 24.733 0.585   39.391  1.00 16.97  ? 269 GLY A N   1 
ATOM   2112 C  CA  . GLY A 1 273 ? 24.668 -0.873  39.418  1.00 17.42  ? 269 GLY A CA  1 
ATOM   2113 C  C   . GLY A 1 273 ? 23.981 -1.501  38.214  1.00 22.94  ? 269 GLY A C   1 
ATOM   2114 O  O   . GLY A 1 273 ? 23.905 -2.724  38.119  1.00 23.05  ? 269 GLY A O   1 
ATOM   2115 N  N   . SER A 1 274 ? 23.445 -0.685  37.303  1.00 17.75  ? 270 SER A N   1 
ATOM   2116 C  CA  . SER A 1 274 ? 22.739 -1.247  36.148  1.00 15.67  ? 270 SER A CA  1 
ATOM   2117 C  C   . SER A 1 274 ? 23.736 -1.665  35.065  1.00 16.46  ? 270 SER A C   1 
ATOM   2118 O  O   . SER A 1 274 ? 24.838 -1.118  35.004  1.00 15.08  ? 270 SER A O   1 
ATOM   2119 C  CB  . SER A 1 274 ? 21.715 -0.257  35.604  1.00 17.36  ? 270 SER A CB  1 
ATOM   2120 O  OG  . SER A 1 274 ? 22.325 0.819   34.905  1.00 15.98  ? 270 SER A OG  1 
ATOM   2121 N  N   . VAL A 1 275 ? 23.352 -2.646  34.221  1.00 12.51  ? 271 VAL A N   1 
ATOM   2122 C  CA  . VAL A 1 275 ? 24.197 -3.139  33.136  1.00 11.52  ? 271 VAL A CA  1 
ATOM   2123 C  C   . VAL A 1 275 ? 23.333 -3.275  31.917  1.00 14.25  ? 271 VAL A C   1 
ATOM   2124 O  O   . VAL A 1 275 ? 22.303 -3.947  31.968  1.00 15.76  ? 271 VAL A O   1 
ATOM   2125 C  CB  . VAL A 1 275 ? 24.936 -4.479  33.470  1.00 16.32  ? 271 VAL A CB  1 
ATOM   2126 C  CG1 . VAL A 1 275 ? 25.841 -4.917  32.327  1.00 16.39  ? 271 VAL A CG1 1 
ATOM   2127 C  CG2 . VAL A 1 275 ? 25.743 -4.374  34.765  1.00 17.23  ? 271 VAL A CG2 1 
ATOM   2128 N  N   . ALA A 1 276 ? 23.780 -2.693  30.812  1.00 10.82  ? 272 ALA A N   1 
ATOM   2129 C  CA  . ALA A 1 276 ? 23.066 -2.774  29.539  1.00 10.18  ? 272 ALA A CA  1 
ATOM   2130 C  C   . ALA A 1 276 ? 24.041 -2.945  28.385  1.00 13.70  ? 272 ALA A C   1 
ATOM   2131 O  O   . ALA A 1 276 ? 25.242 -2.698  28.512  1.00 11.61  ? 272 ALA A O   1 
ATOM   2132 C  CB  . ALA A 1 276 ? 22.250 -1.491  29.311  1.00 10.92  ? 272 ALA A CB  1 
ATOM   2133 N  N   . LEU A 1 277 ? 23.500 -3.385  27.257  1.00 12.11  ? 273 LEU A N   1 
ATOM   2134 C  CA  . LEU A 1 277 ? 24.271 -3.531  26.022  1.00 12.33  ? 273 LEU A CA  1 
ATOM   2135 C  C   . LEU A 1 277 ? 23.662 -2.687  24.954  1.00 14.78  ? 273 LEU A C   1 
ATOM   2136 O  O   . LEU A 1 277 ? 22.439 -2.518  24.944  1.00 13.24  ? 273 LEU A O   1 
ATOM   2137 C  CB  . LEU A 1 277 ? 24.211 -4.980  25.482  1.00 12.47  ? 273 LEU A CB  1 
ATOM   2138 C  CG  . LEU A 1 277 ? 24.781 -6.129  26.325  1.00 17.78  ? 273 LEU A CG  1 
ATOM   2139 C  CD1 . LEU A 1 277 ? 24.647 -7.451  25.556  1.00 17.88  ? 273 LEU A CD1 1 
ATOM   2140 C  CD2 . LEU A 1 277 ? 26.271 -5.883  26.717  1.00 18.58  ? 273 LEU A CD2 1 
ATOM   2141 N  N   . SER A 1 278 ? 24.497 -2.277  23.979  1.00 11.20  ? 274 SER A N   1 
ATOM   2142 C  CA  . SER A 1 278 ? 24.027 -1.691  22.726  1.00 11.51  ? 274 SER A CA  1 
ATOM   2143 C  C   . SER A 1 278 ? 24.683 -2.524  21.660  1.00 14.51  ? 274 SER A C   1 
ATOM   2144 O  O   . SER A 1 278 ? 25.810 -2.977  21.859  1.00 15.21  ? 274 SER A O   1 
ATOM   2145 C  CB  . SER A 1 278 ? 24.428 -0.232  22.551  1.00 14.16  ? 274 SER A CB  1 
ATOM   2146 O  OG  . SER A 1 278 ? 25.811 -0.069  22.283  1.00 19.04  ? 274 SER A OG  1 
ATOM   2147 N  N   . VAL A 1 279 ? 23.989 -2.743  20.543  1.00 11.61  ? 275 VAL A N   1 
ATOM   2148 C  CA  . VAL A 1 279 ? 24.543 -3.507  19.418  1.00 12.44  ? 275 VAL A CA  1 
ATOM   2149 C  C   . VAL A 1 279 ? 24.388 -2.622  18.188  1.00 14.23  ? 275 VAL A C   1 
ATOM   2150 O  O   . VAL A 1 279 ? 23.295 -2.131  17.934  1.00 12.61  ? 275 VAL A O   1 
ATOM   2151 C  CB  . VAL A 1 279 ? 23.861 -4.890  19.205  1.00 18.17  ? 275 VAL A CB  1 
ATOM   2152 C  CG1 . VAL A 1 279 ? 24.469 -5.627  18.003  1.00 17.52  ? 275 VAL A CG1 1 
ATOM   2153 C  CG2 . VAL A 1 279 ? 23.963 -5.758  20.464  1.00 18.47  ? 275 VAL A CG2 1 
ATOM   2154 N  N   . THR A 1 280 ? 25.492 -2.381  17.484  1.00 14.74  ? 276 THR A N   1 
ATOM   2155 C  CA  . THR A 1 280 ? 25.537 -1.592  16.248  1.00 14.57  ? 276 THR A CA  1 
ATOM   2156 C  C   . THR A 1 280 ? 26.370 -2.397  15.249  1.00 16.11  ? 276 THR A C   1 
ATOM   2157 O  O   . THR A 1 280 ? 27.390 -3.001  15.615  1.00 17.33  ? 276 THR A O   1 
ATOM   2158 C  CB  . THR A 1 280 ? 26.165 -0.163  16.465  1.00 17.11  ? 276 THR A CB  1 
ATOM   2159 O  OG1 . THR A 1 280 ? 25.564 0.488   17.581  1.00 14.93  ? 276 THR A OG1 1 
ATOM   2160 C  CG2 . THR A 1 280 ? 25.954 0.761   15.252  1.00 13.10  ? 276 THR A CG2 1 
ATOM   2161 N  N   . GLN A 1 281 ? 25.922 -2.402  13.993  1.00 10.93  ? 277 GLN A N   1 
ATOM   2162 C  CA  . GLN A 1 281 ? 26.626 -3.003  12.861  1.00 9.16   ? 277 GLN A CA  1 
ATOM   2163 C  C   . GLN A 1 281 ? 26.560 -1.989  11.756  1.00 14.21  ? 277 GLN A C   1 
ATOM   2164 O  O   . GLN A 1 281 ? 25.646 -2.007  10.936  1.00 13.92  ? 277 GLN A O   1 
ATOM   2165 C  CB  . GLN A 1 281 ? 25.987 -4.333  12.455  1.00 11.17  ? 277 GLN A CB  1 
ATOM   2166 C  CG  . GLN A 1 281 ? 26.262 -5.414  13.520  1.00 15.70  ? 277 GLN A CG  1 
ATOM   2167 C  CD  . GLN A 1 281 ? 25.929 -6.760  12.991  1.00 27.65  ? 277 GLN A CD  1 
ATOM   2168 O  OE1 . GLN A 1 281 ? 25.114 -6.877  12.105  1.00 30.46  ? 277 GLN A OE1 1 
ATOM   2169 N  NE2 . GLN A 1 281 ? 26.665 -7.777  13.407  1.00 22.33  ? 277 GLN A NE2 1 
ATOM   2170 N  N   . ASP A 1 282 ? 27.476 -1.016  11.823  1.00 12.92  ? 278 ASP A N   1 
ATOM   2171 C  CA  . ASP A 1 282 ? 27.516 0.068   10.865  1.00 11.77  ? 278 ASP A CA  1 
ATOM   2172 C  C   . ASP A 1 282 ? 28.358 -0.368  9.653   1.00 14.02  ? 278 ASP A C   1 
ATOM   2173 O  O   . ASP A 1 282 ? 29.558 -0.598  9.788   1.00 12.18  ? 278 ASP A O   1 
ATOM   2174 C  CB  . ASP A 1 282 ? 28.100 1.327   11.556  1.00 13.58  ? 278 ASP A CB  1 
ATOM   2175 C  CG  . ASP A 1 282 ? 28.117 2.598   10.727  1.00 18.60  ? 278 ASP A CG  1 
ATOM   2176 O  OD1 . ASP A 1 282 ? 27.963 2.504   9.478   1.00 16.56  ? 278 ASP A OD1 1 
ATOM   2177 O  OD2 . ASP A 1 282 ? 28.390 3.672   11.303  1.00 20.13  ? 278 ASP A OD2 1 
ATOM   2178 N  N   . PRO A 1 283 ? 27.759 -0.432  8.442   1.00 13.06  ? 279 PRO A N   1 
ATOM   2179 C  CA  . PRO A 1 283 ? 28.539 -0.849  7.261   1.00 13.04  ? 279 PRO A CA  1 
ATOM   2180 C  C   . PRO A 1 283 ? 29.695 0.082   6.899   1.00 17.67  ? 279 PRO A C   1 
ATOM   2181 O  O   . PRO A 1 283 ? 30.597 -0.346  6.177   1.00 16.57  ? 279 PRO A O   1 
ATOM   2182 C  CB  . PRO A 1 283 ? 27.478 -0.941  6.154   1.00 14.35  ? 279 PRO A CB  1 
ATOM   2183 C  CG  . PRO A 1 283 ? 26.416 0.053   6.589   1.00 18.53  ? 279 PRO A CG  1 
ATOM   2184 C  CD  . PRO A 1 283 ? 26.355 -0.162  8.084   1.00 15.38  ? 279 PRO A CD  1 
ATOM   2185 N  N   . ALA A 1 284 ? 29.687 1.345   7.398   1.00 16.26  ? 280 ALA A N   1 
ATOM   2186 C  CA  . ALA A 1 284 ? 30.804 2.284   7.147   1.00 17.54  ? 280 ALA A CA  1 
ATOM   2187 C  C   . ALA A 1 284 ? 32.069 1.798   7.900   1.00 24.14  ? 280 ALA A C   1 
ATOM   2188 O  O   . ALA A 1 284 ? 33.173 2.223   7.583   1.00 23.18  ? 280 ALA A O   1 
ATOM   2189 C  CB  . ALA A 1 284 ? 30.433 3.681   7.606   1.00 18.28  ? 280 ALA A CB  1 
ATOM   2190 N  N   . CYS A 1 285 ? 31.893 0.879   8.883   1.00 20.44  ? 281 CYS A N   1 
ATOM   2191 C  CA  . CYS A 1 285 ? 32.962 0.333   9.720   1.00 20.80  ? 281 CYS A CA  1 
ATOM   2192 C  C   . CYS A 1 285 ? 33.498 -1.024  9.230   1.00 22.82  ? 281 CYS A C   1 
ATOM   2193 O  O   . CYS A 1 285 ? 34.344 -1.640  9.901   1.00 20.78  ? 281 CYS A O   1 
ATOM   2194 C  CB  . CYS A 1 285 ? 32.516 0.276   11.179  1.00 21.58  ? 281 CYS A CB  1 
ATOM   2195 S  SG  . CYS A 1 285 ? 32.092 1.896   11.871  1.00 26.91  ? 281 CYS A SG  1 
ATOM   2196 N  N   . LYS A 1 286 ? 33.031 -1.462  8.044   1.00 19.62  ? 282 LYS A N   1 
ATOM   2197 C  CA  . LYS A 1 286 ? 33.448 -2.726  7.425   1.00 20.14  ? 282 LYS A CA  1 
ATOM   2198 C  C   . LYS A 1 286 ? 34.965 -2.736  7.257   1.00 23.22  ? 282 LYS A C   1 
ATOM   2199 O  O   . LYS A 1 286 ? 35.530 -1.761  6.773   1.00 21.49  ? 282 LYS A O   1 
ATOM   2200 C  CB  . LYS A 1 286 ? 32.747 -2.891  6.061   1.00 22.47  ? 282 LYS A CB  1 
ATOM   2201 C  CG  . LYS A 1 286 ? 33.081 -4.187  5.323   1.00 29.59  ? 282 LYS A CG  1 
ATOM   2202 C  CD  . LYS A 1 286 ? 32.014 -4.598  4.317   1.00 30.59  ? 282 LYS A CD  1 
ATOM   2203 C  CE  . LYS A 1 286 ? 31.999 -3.770  3.069   1.00 28.23  ? 282 LYS A CE  1 
ATOM   2204 N  NZ  . LYS A 1 286 ? 31.337 -4.498  1.955   1.00 26.69  ? 282 LYS A NZ  1 
ATOM   2205 N  N   . LYS A 1 287 ? 35.617 -3.823  7.677   1.00 20.99  ? 283 LYS A N   1 
ATOM   2206 C  CA  . LYS A 1 287 ? 37.069 -3.971  7.598   1.00 21.35  ? 283 LYS A CA  1 
ATOM   2207 C  C   . LYS A 1 287 ? 37.556 -4.119  6.157   1.00 27.53  ? 283 LYS A C   1 
ATOM   2208 O  O   . LYS A 1 287 ? 36.936 -4.851  5.385   1.00 25.87  ? 283 LYS A O   1 
ATOM   2209 C  CB  . LYS A 1 287 ? 37.547 -5.148  8.456   1.00 23.76  ? 283 LYS A CB  1 
ATOM   2210 C  CG  . LYS A 1 287 ? 37.108 -5.043  9.914   1.00 24.24  ? 283 LYS A CG  1 
ATOM   2211 C  CD  . LYS A 1 287 ? 38.098 -4.254  10.739  1.00 37.48  ? 283 LYS A CD  1 
ATOM   2212 C  CE  . LYS A 1 287 ? 37.468 -3.065  11.387  1.00 37.39  ? 283 LYS A CE  1 
ATOM   2213 N  NZ  . LYS A 1 287 ? 38.455 -2.319  12.203  1.00 30.80  ? 283 LYS A NZ  1 
ATOM   2214 N  N   . PRO A 1 288 ? 38.639 -3.412  5.756   1.00 27.94  ? 284 PRO A N   1 
ATOM   2215 C  CA  . PRO A 1 288 ? 39.128 -3.554  4.364   1.00 28.08  ? 284 PRO A CA  1 
ATOM   2216 C  C   . PRO A 1 288 ? 39.536 -4.997  4.028   1.00 33.68  ? 284 PRO A C   1 
ATOM   2217 O  O   . PRO A 1 288 ? 39.964 -5.730  4.916   1.00 33.05  ? 284 PRO A O   1 
ATOM   2218 C  CB  . PRO A 1 288 ? 40.298 -2.562  4.277   1.00 29.86  ? 284 PRO A CB  1 
ATOM   2219 C  CG  . PRO A 1 288 ? 40.692 -2.289  5.677   1.00 34.50  ? 284 PRO A CG  1 
ATOM   2220 C  CD  . PRO A 1 288 ? 39.483 -2.484  6.543   1.00 30.19  ? 284 PRO A CD  1 
ATOM   2221 N  N   . LEU A 1 289 ? 39.329 -5.415  2.762   1.00 31.67  ? 285 LEU A N   1 
ATOM   2222 C  CA  . LEU A 1 289 ? 39.632 -6.769  2.281   1.00 61.56  ? 285 LEU A CA  1 
ATOM   2223 C  C   . LEU A 1 289 ? 41.059 -6.872  1.756   1.00 107.00 ? 285 LEU A C   1 
ATOM   2224 O  O   . LEU A 1 289 ? 41.598 -7.971  1.644   1.00 75.75  ? 285 LEU A O   1 
ATOM   2225 C  CB  . LEU A 1 289 ? 38.632 -7.199  1.197   1.00 61.46  ? 285 LEU A CB  1 
HETATM 2226 FE FE  . FE  B 2 .   ? 25.139 -16.556 8.539   1.00 14.30  ? 301 FE  A FE  1 
HETATM 2227 S  S   . SO4 C 3 .   ? 40.587 -10.892 6.364   1.00 49.28  ? 302 SO4 A S   1 
HETATM 2228 O  O1  . SO4 C 3 .   ? 41.626 -11.458 5.507   1.00 51.53  ? 302 SO4 A O1  1 
HETATM 2229 O  O2  . SO4 C 3 .   ? 39.787 -9.964  5.587   1.00 51.45  ? 302 SO4 A O2  1 
HETATM 2230 O  O3  . SO4 C 3 .   ? 39.735 -11.950 6.876   1.00 47.23  ? 302 SO4 A O3  1 
HETATM 2231 O  O4  . SO4 C 3 .   ? 41.228 -10.189 7.490   1.00 48.93  ? 302 SO4 A O4  1 
HETATM 2232 S  S   . SO4 D 3 .   ? 43.857 -12.791 12.981  1.00 55.76  ? 303 SO4 A S   1 
HETATM 2233 O  O1  . SO4 D 3 .   ? 44.041 -12.169 11.661  1.00 55.66  ? 303 SO4 A O1  1 
HETATM 2234 O  O2  . SO4 D 3 .   ? 44.624 -14.031 13.047  1.00 57.14  ? 303 SO4 A O2  1 
HETATM 2235 O  O3  . SO4 D 3 .   ? 42.447 -13.077 13.205  1.00 55.99  ? 303 SO4 A O3  1 
HETATM 2236 O  O4  . SO4 D 3 .   ? 44.314 -11.872 14.022  1.00 57.63  ? 303 SO4 A O4  1 
HETATM 2237 S  S   . SO4 E 3 .   ? 5.899  1.004   25.275  1.00 45.39  ? 304 SO4 A S   1 
HETATM 2238 O  O1  . SO4 E 3 .   ? 5.199  -0.265  25.123  1.00 46.06  ? 304 SO4 A O1  1 
HETATM 2239 O  O2  . SO4 E 3 .   ? 5.705  1.810   24.074  1.00 45.24  ? 304 SO4 A O2  1 
HETATM 2240 O  O3  . SO4 E 3 .   ? 7.340  0.765   25.440  1.00 44.61  ? 304 SO4 A O3  1 
HETATM 2241 O  O4  . SO4 E 3 .   ? 5.416  1.689   26.468  1.00 44.54  ? 304 SO4 A O4  1 
HETATM 2242 O  O   . HOH F 4 .   ? 33.299 -28.985 11.640  1.00 23.57  ? 401 HOH A O   1 
HETATM 2243 O  O   . HOH F 4 .   ? 28.942 -17.419 33.498  1.00 19.94  ? 402 HOH A O   1 
HETATM 2244 O  O   . HOH F 4 .   ? 34.949 -8.668  9.956   1.00 18.54  ? 403 HOH A O   1 
HETATM 2245 O  O   . HOH F 4 .   ? 13.564 -24.411 20.065  1.00 24.99  ? 404 HOH A O   1 
HETATM 2246 O  O   . HOH F 4 .   ? 12.093 -1.930  20.398  1.00 12.99  ? 405 HOH A O   1 
HETATM 2247 O  O   . HOH F 4 .   ? 21.171 -27.844 3.875   1.00 15.42  ? 406 HOH A O   1 
HETATM 2248 O  O   . HOH F 4 .   ? 33.293 -8.115  4.241   1.00 12.97  ? 407 HOH A O   1 
HETATM 2249 O  O   . HOH F 4 .   ? 30.193 -20.791 29.547  1.00 25.71  ? 408 HOH A O   1 
HETATM 2250 O  O   . HOH F 4 .   ? 23.342 -6.911  -1.723  1.00 27.99  ? 409 HOH A O   1 
HETATM 2251 O  O   . HOH F 4 .   ? 37.035 -24.192 -0.344  1.00 23.39  ? 410 HOH A O   1 
HETATM 2252 O  O   . HOH F 4 .   ? 12.051 -6.938  34.500  0.50 110.56 ? 411 HOH A O   1 
HETATM 2253 O  O   . HOH F 4 .   ? 33.752 1.436   39.751  1.00 24.75  ? 412 HOH A O   1 
HETATM 2254 O  O   . HOH F 4 .   ? 38.901 -11.260 18.767  1.00 28.27  ? 413 HOH A O   1 
HETATM 2255 O  O   . HOH F 4 .   ? 23.806 -14.150 30.013  1.00 34.31  ? 414 HOH A O   1 
HETATM 2256 O  O   . HOH F 4 .   ? 15.884 -3.210  12.593  1.00 16.91  ? 415 HOH A O   1 
HETATM 2257 O  O   . HOH F 4 .   ? 32.308 -22.606 24.389  1.00 23.79  ? 416 HOH A O   1 
HETATM 2258 O  O   . HOH F 4 .   ? 20.796 -25.002 19.472  1.00 15.24  ? 417 HOH A O   1 
HETATM 2259 O  O   . HOH F 4 .   ? 33.752 -25.078 -16.095 1.00 20.80  ? 418 HOH A O   1 
HETATM 2260 O  O   . HOH F 4 .   ? 5.485  -16.409 16.564  1.00 23.39  ? 419 HOH A O   1 
HETATM 2261 O  O   . HOH F 4 .   ? 17.161 -17.945 -3.779  1.00 23.27  ? 420 HOH A O   1 
HETATM 2262 O  O   . HOH F 4 .   ? 28.632 -28.283 -8.727  1.00 18.77  ? 421 HOH A O   1 
HETATM 2263 O  O   . HOH F 4 .   ? 26.266 -15.471 30.522  1.00 20.17  ? 422 HOH A O   1 
HETATM 2264 O  O   . HOH F 4 .   ? 20.157 -11.128 7.084   1.00 32.15  ? 423 HOH A O   1 
HETATM 2265 O  O   . HOH F 4 .   ? 26.801 -0.444  19.834  1.00 14.54  ? 424 HOH A O   1 
HETATM 2266 O  O   . HOH F 4 .   ? 27.112 -10.401 1.966   1.00 13.02  ? 425 HOH A O   1 
HETATM 2267 O  O   . HOH F 4 .   ? 34.157 -22.216 -6.767  1.00 26.94  ? 426 HOH A O   1 
HETATM 2268 O  O   . HOH F 4 .   ? 12.469 -27.164 19.388  1.00 20.36  ? 427 HOH A O   1 
HETATM 2269 O  O   . HOH F 4 .   ? 29.284 3.619   13.823  1.00 31.89  ? 428 HOH A O   1 
HETATM 2270 O  O   . HOH F 4 .   ? 39.152 -6.414  18.292  1.00 18.92  ? 429 HOH A O   1 
HETATM 2271 O  O   . HOH F 4 .   ? 14.079 11.604  19.707  1.00 29.00  ? 430 HOH A O   1 
HETATM 2272 O  O   . HOH F 4 .   ? 26.713 -30.617 9.820   1.00 28.73  ? 431 HOH A O   1 
HETATM 2273 O  O   . HOH F 4 .   ? 28.950 -29.317 3.221   1.00 16.71  ? 432 HOH A O   1 
HETATM 2274 O  O   . HOH F 4 .   ? 7.528  -23.360 13.727  1.00 25.89  ? 433 HOH A O   1 
HETATM 2275 O  O   . HOH F 4 .   ? 1.760  -16.105 32.104  1.00 50.83  ? 434 HOH A O   1 
HETATM 2276 O  O   . HOH F 4 .   ? 44.930 -23.802 9.939   1.00 29.90  ? 435 HOH A O   1 
HETATM 2277 O  O   . HOH F 4 .   ? 25.532 -4.804  38.632  1.00 37.73  ? 436 HOH A O   1 
HETATM 2278 O  O   . HOH F 4 .   ? 20.809 -6.999  -0.993  1.00 22.78  ? 437 HOH A O   1 
HETATM 2279 O  O   . HOH F 4 .   ? 40.566 -12.211 3.151   1.00 32.58  ? 438 HOH A O   1 
HETATM 2280 O  O   . HOH F 4 .   ? 35.534 -7.107  5.818   1.00 18.51  ? 439 HOH A O   1 
HETATM 2281 O  O   . HOH F 4 .   ? 35.397 -22.408 0.844   1.00 26.71  ? 440 HOH A O   1 
HETATM 2282 O  O   . HOH F 4 .   ? 8.492  -5.168  29.277  1.00 33.88  ? 441 HOH A O   1 
HETATM 2283 O  O   . HOH F 4 .   ? 19.906 4.532   15.433  1.00 12.52  ? 442 HOH A O   1 
HETATM 2284 O  O   . HOH F 4 .   ? 34.530 -27.990 19.444  1.00 33.02  ? 443 HOH A O   1 
HETATM 2285 O  O   . HOH F 4 .   ? 15.925 1.712   10.044  1.00 24.55  ? 444 HOH A O   1 
HETATM 2286 O  O   . HOH F 4 .   ? 33.761 -5.292  18.222  1.00 15.79  ? 445 HOH A O   1 
HETATM 2287 O  O   . HOH F 4 .   ? 37.238 -11.591 8.097   1.00 15.77  ? 446 HOH A O   1 
HETATM 2288 O  O   . HOH F 4 .   ? 23.941 -10.153 -0.188  1.00 16.12  ? 447 HOH A O   1 
HETATM 2289 O  O   . HOH F 4 .   ? 23.277 -15.785 8.556   1.00 19.20  ? 448 HOH A O   1 
HETATM 2290 O  O   . HOH F 4 .   ? 20.682 -23.988 12.202  1.00 23.70  ? 449 HOH A O   1 
HETATM 2291 O  O   . HOH F 4 .   ? 39.797 -29.884 -0.212  1.00 21.13  ? 450 HOH A O   1 
HETATM 2292 O  O   . HOH F 4 .   ? 28.032 -31.473 1.879   1.00 26.45  ? 451 HOH A O   1 
HETATM 2293 O  O   . HOH F 4 .   ? 23.728 5.102   19.566  1.00 34.42  ? 452 HOH A O   1 
HETATM 2294 O  O   . HOH F 4 .   ? 31.727 -6.635  7.709   1.00 21.62  ? 453 HOH A O   1 
HETATM 2295 O  O   . HOH F 4 .   ? 23.345 -2.048  6.617   1.00 16.78  ? 454 HOH A O   1 
HETATM 2296 O  O   . HOH F 4 .   ? 25.247 -25.235 28.744  1.00 22.55  ? 455 HOH A O   1 
HETATM 2297 O  O   . HOH F 4 .   ? 7.854  -16.980 12.751  1.00 36.14  ? 456 HOH A O   1 
HETATM 2298 O  O   . HOH F 4 .   ? 12.555 -17.297 -2.280  1.00 34.81  ? 457 HOH A O   1 
HETATM 2299 O  O   . HOH F 4 .   ? 31.402 0.212   3.637   1.00 29.17  ? 458 HOH A O   1 
HETATM 2300 O  O   . HOH F 4 .   ? 19.361 7.083   14.684  1.00 23.06  ? 459 HOH A O   1 
HETATM 2301 O  O   . HOH F 4 .   ? 30.397 -14.200 37.010  1.00 32.52  ? 460 HOH A O   1 
HETATM 2302 O  O   . HOH F 4 .   ? 35.107 -28.755 -6.598  1.00 18.94  ? 461 HOH A O   1 
HETATM 2303 O  O   . HOH F 4 .   ? 18.778 -22.197 19.173  1.00 14.21  ? 462 HOH A O   1 
HETATM 2304 O  O   . HOH F 4 .   ? 33.353 -13.350 36.153  1.00 25.40  ? 463 HOH A O   1 
HETATM 2305 O  O   . HOH F 4 .   ? 23.030 0.157   32.353  1.00 18.08  ? 464 HOH A O   1 
HETATM 2306 O  O   . HOH F 4 .   ? 33.382 -27.007 9.768   1.00 17.84  ? 465 HOH A O   1 
HETATM 2307 O  O   . HOH F 4 .   ? 15.535 3.797   36.119  1.00 33.54  ? 466 HOH A O   1 
HETATM 2308 O  O   . HOH F 4 .   ? 30.119 -13.396 8.629   1.00 12.60  ? 467 HOH A O   1 
HETATM 2309 O  O   . HOH F 4 .   ? 36.160 -5.374  37.683  1.00 25.04  ? 468 HOH A O   1 
HETATM 2310 O  O   . HOH F 4 .   ? 17.497 -22.871 29.622  1.00 17.24  ? 469 HOH A O   1 
HETATM 2311 O  O   . HOH F 4 .   ? 23.577 -1.145  13.265  1.00 12.73  ? 470 HOH A O   1 
HETATM 2312 O  O   . HOH F 4 .   ? 29.275 -1.024  14.114  1.00 16.23  ? 471 HOH A O   1 
HETATM 2313 O  O   . HOH F 4 .   ? 8.808  -24.094 19.681  1.00 27.13  ? 472 HOH A O   1 
HETATM 2314 O  O   . HOH F 4 .   ? 18.693 -29.344 -8.793  1.00 19.15  ? 473 HOH A O   1 
HETATM 2315 O  O   . HOH F 4 .   ? 16.614 9.587   29.474  1.00 21.67  ? 474 HOH A O   1 
HETATM 2316 O  O   . HOH F 4 .   ? 30.340 -15.218 6.501   1.00 11.57  ? 475 HOH A O   1 
HETATM 2317 O  O   . HOH F 4 .   ? 28.334 -3.633  37.066  1.00 24.19  ? 476 HOH A O   1 
HETATM 2318 O  O   . HOH F 4 .   ? 25.836 -10.164 38.111  1.00 27.84  ? 477 HOH A O   1 
HETATM 2319 O  O   . HOH F 4 .   ? 11.346 -10.321 29.453  1.00 16.62  ? 478 HOH A O   1 
HETATM 2320 O  O   . HOH F 4 .   ? 19.937 -7.361  3.334   1.00 13.15  ? 479 HOH A O   1 
HETATM 2321 O  O   . HOH F 4 .   ? 19.211 -0.278  38.976  1.00 22.36  ? 480 HOH A O   1 
HETATM 2322 O  O   . HOH F 4 .   ? 35.652 -14.884 15.866  1.00 21.03  ? 481 HOH A O   1 
HETATM 2323 O  O   . HOH F 4 .   ? 29.827 2.432   31.701  1.00 21.91  ? 482 HOH A O   1 
HETATM 2324 O  O   . HOH F 4 .   ? 27.761 -19.234 29.758  1.00 16.21  ? 483 HOH A O   1 
HETATM 2325 O  O   . HOH F 4 .   ? 13.541 -4.211  21.199  1.00 14.06  ? 484 HOH A O   1 
HETATM 2326 O  O   . HOH F 4 .   ? 10.818 -3.789  14.736  1.00 28.82  ? 485 HOH A O   1 
HETATM 2327 O  O   . HOH F 4 .   ? 25.954 -22.861 29.696  1.00 18.73  ? 486 HOH A O   1 
HETATM 2328 O  O   . HOH F 4 .   ? 28.149 -6.679  10.247  1.00 21.37  ? 487 HOH A O   1 
HETATM 2329 O  O   . HOH F 4 .   ? 28.960 -5.985  35.948  1.00 19.33  ? 488 HOH A O   1 
HETATM 2330 O  O   . HOH F 4 .   ? 27.048 -25.321 -8.049  1.00 19.24  ? 489 HOH A O   1 
HETATM 2331 O  O   . HOH F 4 .   ? 28.458 4.716   31.444  1.00 22.75  ? 490 HOH A O   1 
HETATM 2332 O  O   . HOH F 4 .   ? 33.990 -24.631 21.080  1.00 28.79  ? 491 HOH A O   1 
HETATM 2333 O  O   . HOH F 4 .   ? 21.817 -1.283  1.909   1.00 16.00  ? 492 HOH A O   1 
HETATM 2334 O  O   . HOH F 4 .   ? 10.128 -26.041 23.030  1.00 21.61  ? 493 HOH A O   1 
HETATM 2335 O  O   . HOH F 4 .   ? 7.277  -20.239 26.036  1.00 23.73  ? 494 HOH A O   1 
HETATM 2336 O  O   . HOH F 4 .   ? 5.525  -26.144 13.631  1.00 22.20  ? 495 HOH A O   1 
HETATM 2337 O  O   . HOH F 4 .   ? 40.247 -2.979  20.496  1.00 35.62  ? 496 HOH A O   1 
HETATM 2338 O  O   . HOH F 4 .   ? 8.079  -22.096 11.383  1.00 28.22  ? 497 HOH A O   1 
HETATM 2339 O  O   . HOH F 4 .   ? 10.573 -30.392 21.301  1.00 41.00  ? 498 HOH A O   1 
HETATM 2340 O  O   . HOH F 4 .   ? 14.739 4.167   10.091  1.00 25.60  ? 499 HOH A O   1 
HETATM 2341 O  O   . HOH F 4 .   ? 24.188 -22.360 6.585   1.00 20.59  ? 500 HOH A O   1 
HETATM 2342 O  O   . HOH F 4 .   ? 22.690 -17.884 18.329  1.00 10.55  ? 501 HOH A O   1 
HETATM 2343 O  O   . HOH F 4 .   ? 17.385 -6.661  3.980   1.00 24.69  ? 502 HOH A O   1 
HETATM 2344 O  O   . HOH F 4 .   ? 11.644 -7.352  30.847  1.00 20.28  ? 503 HOH A O   1 
HETATM 2345 O  O   . HOH F 4 .   ? 37.970 -9.729  20.705  1.00 32.08  ? 504 HOH A O   1 
HETATM 2346 O  O   . HOH F 4 .   ? 32.283 -5.184  20.449  1.00 17.02  ? 505 HOH A O   1 
HETATM 2347 O  O   . HOH F 4 .   ? 13.632 2.644   34.461  1.00 37.90  ? 506 HOH A O   1 
HETATM 2348 O  O   . HOH F 4 .   ? 4.928  -12.737 26.986  1.00 26.38  ? 507 HOH A O   1 
HETATM 2349 O  O   . HOH F 4 .   ? 36.241 -0.659  24.953  1.00 34.39  ? 508 HOH A O   1 
HETATM 2350 O  O   . HOH F 4 .   ? 22.347 -30.316 4.764   1.00 16.18  ? 509 HOH A O   1 
HETATM 2351 O  O   . HOH F 4 .   ? 39.468 -16.563 -0.795  1.00 21.76  ? 510 HOH A O   1 
HETATM 2352 O  O   . HOH F 4 .   ? 15.642 -21.484 4.673   1.00 28.95  ? 511 HOH A O   1 
HETATM 2353 O  O   . HOH F 4 .   ? 16.514 -0.223  39.251  1.00 21.90  ? 512 HOH A O   1 
HETATM 2354 O  O   . HOH F 4 .   ? 25.452 -18.522 -8.137  1.00 24.00  ? 513 HOH A O   1 
HETATM 2355 O  O   . HOH F 4 .   ? 18.288 -6.572  37.691  1.00 15.58  ? 514 HOH A O   1 
HETATM 2356 O  O   . HOH F 4 .   ? 36.398 -26.748 -5.175  1.00 20.62  ? 515 HOH A O   1 
HETATM 2357 O  O   . HOH F 4 .   ? 11.837 -3.943  12.229  1.00 25.31  ? 516 HOH A O   1 
HETATM 2358 O  O   . HOH F 4 .   ? 17.859 -31.749 18.982  1.00 21.45  ? 517 HOH A O   1 
HETATM 2359 O  O   . HOH F 4 .   ? 41.186 -29.396 6.400   1.00 26.37  ? 518 HOH A O   1 
HETATM 2360 O  O   . HOH F 4 .   ? 39.728 -18.077 8.449   1.00 24.53  ? 519 HOH A O   1 
HETATM 2361 O  O   . HOH F 4 .   ? 30.774 -29.123 -16.170 1.00 25.52  ? 520 HOH A O   1 
HETATM 2362 O  O   . HOH F 4 .   ? 34.376 -6.371  8.245   1.00 19.12  ? 521 HOH A O   1 
HETATM 2363 O  O   . HOH F 4 .   ? 17.933 -21.580 6.551   1.00 29.06  ? 522 HOH A O   1 
HETATM 2364 O  O   . HOH F 4 .   ? 5.269  -10.610 19.170  1.00 32.66  ? 523 HOH A O   1 
HETATM 2365 O  O   . HOH F 4 .   ? 12.142 -23.117 21.993  1.00 30.14  ? 524 HOH A O   1 
HETATM 2366 O  O   . HOH F 4 .   ? 22.388 -19.504 13.268  1.00 18.85  ? 525 HOH A O   1 
HETATM 2367 O  O   . HOH F 4 .   ? 10.352 -13.162 11.004  1.00 20.52  ? 526 HOH A O   1 
HETATM 2368 O  O   . HOH F 4 .   ? 24.150 -18.313 9.106   1.00 19.26  ? 527 HOH A O   1 
HETATM 2369 O  O   . HOH F 4 .   ? 21.371 -17.276 28.577  1.00 22.47  ? 528 HOH A O   1 
HETATM 2370 O  O   . HOH F 4 .   ? 25.675 -8.967  8.799   1.00 13.05  ? 529 HOH A O   1 
HETATM 2371 O  O   . HOH F 4 .   ? 35.948 -20.738 -5.358  1.00 32.90  ? 530 HOH A O   1 
HETATM 2372 O  O   . HOH F 4 .   ? 20.301 -12.337 -6.299  1.00 25.97  ? 531 HOH A O   1 
HETATM 2373 O  O   . HOH F 4 .   ? 20.025 -5.037  0.718   1.00 28.86  ? 532 HOH A O   1 
HETATM 2374 O  O   . HOH F 4 .   ? 33.758 -14.515 29.977  1.00 25.80  ? 533 HOH A O   1 
HETATM 2375 O  O   . HOH F 4 .   ? 13.093 -26.375 2.165   1.00 45.76  ? 534 HOH A O   1 
HETATM 2376 O  O   . HOH F 4 .   ? 20.481 -21.286 12.525  1.00 17.59  ? 535 HOH A O   1 
HETATM 2377 O  O   . HOH F 4 .   ? 28.093 9.512   32.100  1.00 32.99  ? 536 HOH A O   1 
HETATM 2378 O  O   . HOH F 4 .   ? 28.028 -28.498 8.456   1.00 24.75  ? 537 HOH A O   1 
HETATM 2379 O  O   . HOH F 4 .   ? 33.758 -17.887 29.363  1.00 31.63  ? 538 HOH A O   1 
HETATM 2380 O  O   . HOH F 4 .   ? 15.334 -9.068  6.493   1.00 31.43  ? 539 HOH A O   1 
HETATM 2381 O  O   . HOH F 4 .   ? 16.436 -15.439 7.927   1.00 39.37  ? 540 HOH A O   1 
HETATM 2382 O  O   . HOH F 4 .   ? 39.247 -21.700 5.361   1.00 28.27  ? 541 HOH A O   1 
HETATM 2383 O  O   . HOH F 4 .   ? 37.527 -9.183  9.368   1.00 18.97  ? 542 HOH A O   1 
HETATM 2384 O  O   . HOH F 4 .   ? 37.105 -3.406  35.674  1.00 24.72  ? 543 HOH A O   1 
HETATM 2385 O  O   . HOH F 4 .   ? 33.044 -17.658 -12.631 1.00 39.49  ? 544 HOH A O   1 
HETATM 2386 O  O   . HOH F 4 .   ? 3.742  -18.981 20.036  1.00 29.10  ? 545 HOH A O   1 
HETATM 2387 O  O   . HOH F 4 .   ? 31.062 -30.361 4.840   1.00 22.66  ? 546 HOH A O   1 
HETATM 2388 O  O   . HOH F 4 .   ? 23.425 0.000   0.000   0.50 36.42  ? 547 HOH A O   1 
HETATM 2389 O  O   . HOH F 4 .   ? 23.018 -17.363 11.455  1.00 26.61  ? 548 HOH A O   1 
HETATM 2390 O  O   . HOH F 4 .   ? 21.316 -27.704 24.980  1.00 27.07  ? 549 HOH A O   1 
HETATM 2391 O  O   . HOH F 4 .   ? 36.884 -28.332 16.304  1.00 35.30  ? 550 HOH A O   1 
HETATM 2392 O  O   . HOH F 4 .   ? 27.460 -20.303 -8.482  1.00 39.91  ? 551 HOH A O   1 
HETATM 2393 O  O   . HOH F 4 .   ? 40.041 -30.063 8.767   1.00 32.04  ? 552 HOH A O   1 
HETATM 2394 O  O   . HOH F 4 .   ? 10.811 -29.208 18.726  1.00 25.25  ? 553 HOH A O   1 
HETATM 2395 O  O   . HOH F 4 .   ? 21.508 6.230   40.113  1.00 28.20  ? 554 HOH A O   1 
HETATM 2396 O  O   . HOH F 4 .   ? 26.902 -7.764  35.546  1.00 15.36  ? 555 HOH A O   1 
HETATM 2397 O  O   . HOH F 4 .   ? 14.672 12.531  16.573  1.00 31.69  ? 556 HOH A O   1 
HETATM 2398 O  O   . HOH F 4 .   ? 17.817 -26.440 6.693   1.00 37.96  ? 557 HOH A O   1 
HETATM 2399 O  O   . HOH F 4 .   ? 21.818 10.335  32.848  1.00 47.55  ? 558 HOH A O   1 
HETATM 2400 O  O   . HOH F 4 .   ? 20.081 -8.959  5.525   1.00 37.24  ? 559 HOH A O   1 
HETATM 2401 O  O   . HOH F 4 .   ? 20.618 -31.700 6.374   1.00 38.63  ? 560 HOH A O   1 
HETATM 2402 O  O   . HOH F 4 .   ? 15.572 -4.500  3.101   1.00 42.36  ? 561 HOH A O   1 
HETATM 2403 O  O   . HOH F 4 .   ? 9.920  -12.137 31.113  1.00 16.21  ? 562 HOH A O   1 
HETATM 2404 O  O   . HOH F 4 .   ? 6.164  -24.889 21.005  1.00 30.11  ? 563 HOH A O   1 
HETATM 2405 O  O   . HOH F 4 .   ? 22.786 -35.426 4.161   1.00 43.13  ? 564 HOH A O   1 
HETATM 2406 O  O   . HOH F 4 .   ? 12.137 0.203   35.272  1.00 27.77  ? 565 HOH A O   1 
HETATM 2407 O  O   . HOH F 4 .   ? 22.092 -0.535  4.646   1.00 22.41  ? 566 HOH A O   1 
HETATM 2408 O  O   . HOH F 4 .   ? 23.056 -20.193 7.753   1.00 19.28  ? 567 HOH A O   1 
HETATM 2409 O  O   . HOH F 4 .   ? 13.000 -1.816  37.152  1.00 22.56  ? 568 HOH A O   1 
HETATM 2410 O  O   . HOH F 4 .   ? 35.984 -23.749 -5.445  1.00 32.61  ? 569 HOH A O   1 
HETATM 2411 O  O   . HOH F 4 .   ? 35.076 -28.911 -9.624  1.00 29.31  ? 570 HOH A O   1 
HETATM 2412 O  O   . HOH F 4 .   ? 29.960 1.475   15.359  1.00 25.77  ? 571 HOH A O   1 
HETATM 2413 O  O   . HOH F 4 .   ? 23.446 -32.213 3.045   1.00 22.74  ? 572 HOH A O   1 
HETATM 2414 O  O   . HOH F 4 .   ? 25.737 -32.862 1.515   1.00 26.80  ? 573 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 7   ? 0.4874 0.4736 0.4493 0.0180  0.0155  0.0144  3   ARG A N   
2    C CA  . ARG A 7   ? 0.4764 0.4604 0.4383 0.0161  0.0147  0.0129  3   ARG A CA  
3    C C   . ARG A 7   ? 0.4509 0.4334 0.4140 0.0142  0.0139  0.0120  3   ARG A C   
4    O O   . ARG A 7   ? 0.4270 0.4100 0.3921 0.0124  0.0129  0.0109  3   ARG A O   
5    C CB  . ARG A 7   ? 0.5261 0.5056 0.4836 0.0169  0.0154  0.0127  3   ARG A CB  
6    N N   . ARG A 8   ? 0.3712 0.3519 0.3330 0.0147  0.0142  0.0125  4   ARG A N   
7    C CA  . ARG A 8   ? 0.3460 0.3257 0.3090 0.0131  0.0134  0.0117  4   ARG A CA  
8    C C   . ARG A 8   ? 0.3759 0.3599 0.3434 0.0121  0.0128  0.0117  4   ARG A C   
9    O O   . ARG A 8   ? 0.3951 0.3821 0.3641 0.0130  0.0132  0.0127  4   ARG A O   
10   C CB  . ARG A 8   ? 0.3175 0.2939 0.2776 0.0140  0.0140  0.0123  4   ARG A CB  
11   C CG  . ARG A 8   ? 0.3762 0.3476 0.3313 0.0147  0.0147  0.0122  4   ARG A CG  
12   C CD  . ARG A 8   ? 0.4659 0.4344 0.4179 0.0162  0.0155  0.0131  4   ARG A CD  
13   N NE  . ARG A 8   ? 0.4996 0.4694 0.4507 0.0186  0.0167  0.0147  4   ARG A NE  
14   C CZ  . ARG A 8   ? 0.7696 0.7389 0.7195 0.0201  0.0175  0.0158  4   ARG A CZ  
15   N NH1 . ARG A 8   ? 0.4940 0.4612 0.4434 0.0195  0.0172  0.0155  4   ARG A NH1 
16   N NH2 . ARG A 8   ? 0.7233 0.6942 0.6726 0.0224  0.0186  0.0173  4   ARG A NH2 
17   N N   . LEU A 9   ? 0.2699 0.2542 0.2395 0.0102  0.0118  0.0106  5   LEU A N   
18   C CA  . LEU A 9   ? 0.2359 0.2235 0.2093 0.0091  0.0112  0.0104  5   LEU A CA  
19   C C   . LEU A 9   ? 0.2440 0.2300 0.2177 0.0082  0.0108  0.0100  5   LEU A C   
20   O O   . LEU A 9   ? 0.2494 0.2336 0.2226 0.0071  0.0103  0.0090  5   LEU A O   
21   C CB  . LEU A 9   ? 0.2255 0.2154 0.2013 0.0078  0.0105  0.0096  5   LEU A CB  
22   C CG  . LEU A 9   ? 0.2808 0.2731 0.2567 0.0087  0.0108  0.0101  5   LEU A CG  
23   C CD1 . LEU A 9   ? 0.2656 0.2597 0.2436 0.0073  0.0099  0.0092  5   LEU A CD1 
24   C CD2 . LEU A 9   ? 0.3113 0.3071 0.2888 0.0096  0.0112  0.0113  5   LEU A CD2 
25   N N   . GLY A 10  ? 0.2062 0.1932 0.1809 0.0085  0.0112  0.0107  6   GLY A N   
26   C CA  . GLY A 10  ? 0.1964 0.1822 0.1716 0.0078  0.0109  0.0103  6   GLY A CA  
27   C C   . GLY A 10  ? 0.2428 0.2305 0.2208 0.0061  0.0101  0.0094  6   GLY A C   
28   O O   . GLY A 10  ? 0.2388 0.2295 0.2191 0.0057  0.0101  0.0096  6   GLY A O   
29   N N   . VAL A 11  ? 0.1847 0.1708 0.1625 0.0051  0.0095  0.0085  7   VAL A N   
30   C CA  . VAL A 11  ? 0.1817 0.1693 0.1617 0.0037  0.0088  0.0077  7   VAL A CA  
31   C C   . VAL A 11  ? 0.1956 0.1849 0.1779 0.0032  0.0090  0.0078  7   VAL A C   
32   O O   . VAL A 11  ? 0.1637 0.1551 0.1477 0.0024  0.0088  0.0077  7   VAL A O   
33   C CB  . VAL A 11  ? 0.2226 0.2084 0.2019 0.0030  0.0082  0.0067  7   VAL A CB  
34   C CG1 . VAL A 11  ? 0.2276 0.2146 0.2090 0.0018  0.0077  0.0061  7   VAL A CG1 
35   C CG2 . VAL A 11  ? 0.2137 0.1982 0.1912 0.0031  0.0081  0.0065  7   VAL A CG2 
36   N N   . ARG A 12  ? 0.1794 0.1676 0.1614 0.0035  0.0093  0.0081  8   ARG A N   
37   C CA  A ARG A 12  ? 0.1806 0.1700 0.1644 0.0029  0.0096  0.0083  8   ARG A CA  
38   C CA  B ARG A 12  ? 0.1768 0.1663 0.1606 0.0029  0.0096  0.0083  8   ARG A CA  
39   C C   . ARG A 12  ? 0.2189 0.2107 0.2038 0.0032  0.0101  0.0092  8   ARG A C   
40   O O   . ARG A 12  ? 0.1805 0.1742 0.1674 0.0022  0.0102  0.0093  8   ARG A O   
41   C CB  A ARG A 12  ? 0.1915 0.1791 0.1746 0.0032  0.0098  0.0084  8   ARG A CB  
42   C CB  B ARG A 12  ? 0.1710 0.1585 0.1541 0.0031  0.0098  0.0083  8   ARG A CB  
43   C CG  A ARG A 12  ? 0.2838 0.2701 0.2667 0.0025  0.0092  0.0075  8   ARG A CG  
44   C CG  B ARG A 12  ? 0.1897 0.1758 0.1723 0.0026  0.0091  0.0074  8   ARG A CG  
45   C CD  A ARG A 12  ? 0.4021 0.3870 0.3844 0.0029  0.0094  0.0075  8   ARG A CD  
46   C CD  B ARG A 12  ? 0.2436 0.2281 0.2254 0.0030  0.0093  0.0075  8   ARG A CD  
47   N NE  A ARG A 12  ? 0.4618 0.4461 0.4442 0.0023  0.0090  0.0068  8   ARG A NE  
48   N NE  B ARG A 12  ? 0.2665 0.2503 0.2481 0.0025  0.0088  0.0067  8   ARG A NE  
49   C CZ  A ARG A 12  ? 0.5425 0.5258 0.5237 0.0024  0.0084  0.0063  8   ARG A CZ  
50   C CZ  B ARG A 12  ? 0.4539 0.4379 0.4366 0.0019  0.0088  0.0064  8   ARG A CZ  
51   N NH1 A ARG A 12  ? 0.4091 0.3915 0.3888 0.0029  0.0082  0.0064  8   ARG A NH1 
52   N NH1 B ARG A 12  ? 0.3552 0.3399 0.3390 0.0015  0.0094  0.0067  8   ARG A NH1 
53   N NH2 A ARG A 12  ? 0.3144 0.2977 0.2960 0.0019  0.0080  0.0058  8   ARG A NH2 
54   N NH2 B ARG A 12  ? 0.2767 0.2603 0.2591 0.0018  0.0084  0.0059  8   ARG A NH2 
55   N N   . ALA A 13  ? 0.1964 0.1884 0.1801 0.0045  0.0105  0.0100  9   ALA A N   
56   C CA  . ALA A 13  ? 0.2129 0.2077 0.1977 0.0051  0.0111  0.0111  9   ALA A CA  
57   C C   . ALA A 13  ? 0.2372 0.2349 0.2237 0.0042  0.0106  0.0107  9   ALA A C   
58   O O   . ALA A 13  ? 0.2341 0.2348 0.2227 0.0034  0.0108  0.0111  9   ALA A O   
59   C CB  . ALA A 13  ? 0.2272 0.2211 0.2097 0.0070  0.0118  0.0120  9   ALA A CB  
60   N N   . TRP A 14  ? 0.1725 0.1691 0.1580 0.0040  0.0101  0.0100  10  TRP A N   
61   C CA  . TRP A 14  ? 0.1677 0.1667 0.1545 0.0033  0.0096  0.0096  10  TRP A CA  
62   C C   . TRP A 14  ? 0.1988 0.1987 0.1877 0.0014  0.0091  0.0089  10  TRP A C   
63   O O   . TRP A 14  ? 0.2146 0.2173 0.2050 0.0006  0.0089  0.0089  10  TRP A O   
64   C CB  . TRP A 14  ? 0.1465 0.1439 0.1317 0.0037  0.0092  0.0090  10  TRP A CB  
65   C CG  . TRP A 14  ? 0.1600 0.1594 0.1461 0.0031  0.0088  0.0086  10  TRP A CG  
66   C CD1 . TRP A 14  ? 0.1985 0.1999 0.1844 0.0041  0.0090  0.0092  10  TRP A CD1 
67   C CD2 . TRP A 14  ? 0.1631 0.1626 0.1503 0.0017  0.0080  0.0076  10  TRP A CD2 
68   N NE1 . TRP A 14  ? 0.1887 0.1915 0.1755 0.0033  0.0084  0.0085  10  TRP A NE1 
69   C CE2 . TRP A 14  ? 0.2154 0.2170 0.2030 0.0017  0.0078  0.0076  10  TRP A CE2 
70   C CE3 . TRP A 14  ? 0.1858 0.1838 0.1735 0.0004  0.0077  0.0068  10  TRP A CE3 
71   C CZ2 . TRP A 14  ? 0.2063 0.2083 0.1947 0.0006  0.0071  0.0067  10  TRP A CZ2 
72   C CZ3 . TRP A 14  ? 0.1988 0.1972 0.1873 -0.0006 0.0071  0.0060  10  TRP A CZ3 
73   C CH2 . TRP A 14  ? 0.2023 0.2025 0.1911 -0.0006 0.0068  0.0059  10  TRP A CH2 
74   N N   . VAL A 15  ? 0.1578 0.1553 0.1463 0.0008  0.0089  0.0082  11  VAL A N   
75   C CA  . VAL A 15  ? 0.1743 0.1718 0.1640 -0.0007 0.0087  0.0076  11  VAL A CA  
76   C C   . VAL A 15  ? 0.2283 0.2277 0.2195 -0.0014 0.0091  0.0082  11  VAL A C   
77   O O   . VAL A 15  ? 0.1919 0.1930 0.1845 -0.0028 0.0089  0.0079  11  VAL A O   
78   C CB  . VAL A 15  ? 0.2188 0.2133 0.2075 -0.0008 0.0085  0.0069  11  VAL A CB  
79   C CG1 . VAL A 15  ? 0.2187 0.2128 0.2082 -0.0021 0.0086  0.0065  11  VAL A CG1 
80   C CG2 . VAL A 15  ? 0.2103 0.2037 0.1980 -0.0007 0.0080  0.0063  11  VAL A CG2 
81   N N   . LYS A 16  ? 0.2061 0.2053 0.1971 -0.0005 0.0099  0.0091  12  LYS A N   
82   C CA  . LYS A 16  ? 0.2062 0.2074 0.1987 -0.0010 0.0104  0.0098  12  LYS A CA  
83   C C   . LYS A 16  ? 0.2620 0.2672 0.2561 -0.0015 0.0103  0.0103  12  LYS A C   
84   O O   . LYS A 16  ? 0.2565 0.2637 0.2522 -0.0030 0.0103  0.0103  12  LYS A O   
85   C CB  . LYS A 16  ? 0.2350 0.2352 0.2265 0.0005  0.0113  0.0108  12  LYS A CB  
86   C CG  . LYS A 16  ? 0.3170 0.3196 0.3102 0.0001  0.0120  0.0117  12  LYS A CG  
87   C CD  . LYS A 16  ? 0.3878 0.3898 0.3801 0.0018  0.0129  0.0129  12  LYS A CD  
88   C CE  . LYS A 16  ? 0.5821 0.5874 0.5763 0.0015  0.0136  0.0140  12  LYS A CE  
89   N NZ  . LYS A 16  ? 0.8305 0.8352 0.8236 0.0034  0.0146  0.0153  12  LYS A NZ  
90   N N   . GLU A 17  ? 0.2470 0.2535 0.2405 -0.0001 0.0102  0.0108  13  GLU A N   
91   C CA  . GLU A 17  ? 0.2626 0.2732 0.2574 -0.0001 0.0101  0.0113  13  GLU A CA  
92   C C   . GLU A 17  ? 0.2954 0.3071 0.2912 -0.0019 0.0092  0.0103  13  GLU A C   
93   O O   . GLU A 17  ? 0.2956 0.3109 0.2932 -0.0030 0.0090  0.0106  13  GLU A O   
94   C CB  . GLU A 17  ? 0.2858 0.2966 0.2790 0.0020  0.0103  0.0120  13  GLU A CB  
95   C CG  . GLU A 17  ? 0.4687 0.4840 0.4632 0.0024  0.0103  0.0128  13  GLU A CG  
96   N N   . ASN A 18  ? 0.2244 0.2333 0.2192 -0.0023 0.0087  0.0092  14  ASN A N   
97   C CA  . ASN A 18  ? 0.2160 0.2254 0.2113 -0.0038 0.0079  0.0082  14  ASN A CA  
98   C C   . ASN A 18  ? 0.2295 0.2368 0.2250 -0.0056 0.0078  0.0074  14  ASN A C   
99   O O   . ASN A 18  ? 0.2211 0.2280 0.2165 -0.0066 0.0072  0.0065  14  ASN A O   
100  C CB  . ASN A 18  ? 0.1895 0.1972 0.1833 -0.0028 0.0075  0.0077  14  ASN A CB  
101  C CG  . ASN A 18  ? 0.3975 0.4074 0.3910 -0.0013 0.0076  0.0084  14  ASN A CG  
102  O OD1 . ASN A 18  ? 0.3325 0.3410 0.3245 0.0004  0.0081  0.0090  14  ASN A OD1 
103  N ND2 . ASN A 18  ? 0.2267 0.2402 0.2215 -0.0018 0.0073  0.0087  14  ASN A ND2 
104  N N   . ARG A 19  ? 0.1861 0.1923 0.1817 -0.0058 0.0084  0.0077  15  ARG A N   
105  C CA  . ARG A 19  ? 0.1981 0.2020 0.1935 -0.0072 0.0086  0.0071  15  ARG A CA  
106  C C   . ARG A 19  ? 0.2471 0.2515 0.2429 -0.0093 0.0080  0.0063  15  ARG A C   
107  O O   . ARG A 19  ? 0.2289 0.2306 0.2237 -0.0098 0.0079  0.0054  15  ARG A O   
108  C CB  . ARG A 19  ? 0.2098 0.2134 0.2055 -0.0073 0.0094  0.0078  15  ARG A CB  
109  C CG  . ARG A 19  ? 0.3668 0.3674 0.3618 -0.0084 0.0098  0.0072  15  ARG A CG  
110  C CD  . ARG A 19  ? 0.4545 0.4515 0.4478 -0.0074 0.0098  0.0066  15  ARG A CD  
111  N NE  . ARG A 19  ? 0.3929 0.3890 0.3855 -0.0056 0.0102  0.0072  15  ARG A NE  
112  C CZ  . ARG A 19  ? 0.4864 0.4799 0.4776 -0.0047 0.0101  0.0068  15  ARG A CZ  
113  N NH1 . ARG A 19  ? 0.3238 0.3155 0.3142 -0.0052 0.0098  0.0060  15  ARG A NH1 
114  N NH2 . ARG A 19  ? 0.2811 0.2737 0.2715 -0.0032 0.0104  0.0074  15  ARG A NH2 
115  N N   . GLY A 20  ? 0.2135 0.2216 0.2108 -0.0102 0.0077  0.0066  16  GLY A N   
116  C CA  . GLY A 20  ? 0.2279 0.2369 0.2257 -0.0124 0.0072  0.0058  16  GLY A CA  
117  C C   . GLY A 20  ? 0.2571 0.2648 0.2538 -0.0123 0.0064  0.0049  16  GLY A C   
118  O O   . GLY A 20  ? 0.2387 0.2454 0.2349 -0.0140 0.0060  0.0041  16  GLY A O   
119  N N   . SER A 21  ? 0.2068 0.2142 0.2029 -0.0104 0.0062  0.0050  17  SER A N   
120  C CA  . SER A 21  ? 0.2000 0.2060 0.1951 -0.0102 0.0056  0.0042  17  SER A CA  
121  C C   . SER A 21  ? 0.2246 0.2265 0.2182 -0.0104 0.0058  0.0035  17  SER A C   
122  O O   . SER A 21  ? 0.2170 0.2177 0.2098 -0.0107 0.0053  0.0027  17  SER A O   
123  C CB  . SER A 21  ? 0.2157 0.2221 0.2104 -0.0082 0.0056  0.0045  17  SER A CB  
124  O OG  . SER A 21  ? 0.2587 0.2688 0.2543 -0.0077 0.0053  0.0052  17  SER A OG  
125  N N   . PHE A 22  ? 0.1602 0.1601 0.1534 -0.0100 0.0065  0.0037  18  PHE A N   
126  C CA  . PHE A 22  ? 0.1694 0.1658 0.1612 -0.0097 0.0067  0.0032  18  PHE A CA  
127  C C   . PHE A 22  ? 0.2596 0.2539 0.2506 -0.0112 0.0070  0.0028  18  PHE A C   
128  O O   . PHE A 22  ? 0.2656 0.2572 0.2555 -0.0109 0.0076  0.0027  18  PHE A O   
129  C CB  . PHE A 22  ? 0.1784 0.1735 0.1698 -0.0082 0.0072  0.0037  18  PHE A CB  
130  C CG  . PHE A 22  ? 0.1772 0.1740 0.1689 -0.0068 0.0070  0.0042  18  PHE A CG  
131  C CD1 . PHE A 22  ? 0.1919 0.1891 0.1833 -0.0064 0.0064  0.0039  18  PHE A CD1 
132  C CD2 . PHE A 22  ? 0.1857 0.1837 0.1779 -0.0060 0.0074  0.0050  18  PHE A CD2 
133  C CE1 . PHE A 22  ? 0.1974 0.1959 0.1887 -0.0052 0.0063  0.0043  18  PHE A CE1 
134  C CE2 . PHE A 22  ? 0.2081 0.2072 0.2001 -0.0047 0.0073  0.0055  18  PHE A CE2 
135  C CZ  . PHE A 22  ? 0.1619 0.1613 0.1535 -0.0043 0.0068  0.0051  18  PHE A CZ  
136  N N   . GLN A 23  ? 0.2397 0.2351 0.2309 -0.0129 0.0066  0.0024  19  GLN A N   
137  C CA  . GLN A 23  ? 0.2352 0.2282 0.2252 -0.0145 0.0069  0.0018  19  GLN A CA  
138  C C   . GLN A 23  ? 0.2711 0.2649 0.2608 -0.0158 0.0061  0.0011  19  GLN A C   
139  O O   . GLN A 23  ? 0.2584 0.2552 0.2493 -0.0153 0.0054  0.0012  19  GLN A O   
140  C CB  . GLN A 23  ? 0.2462 0.2395 0.2367 -0.0157 0.0076  0.0022  19  GLN A CB  
141  C CG  . GLN A 23  ? 0.3067 0.3040 0.2991 -0.0171 0.0072  0.0026  19  GLN A CG  
142  C CD  . GLN A 23  ? 0.5489 0.5459 0.5416 -0.0185 0.0081  0.0029  19  GLN A CD  
143  O OE1 . GLN A 23  ? 0.4908 0.4841 0.4819 -0.0186 0.0089  0.0027  19  GLN A OE1 
144  N NE2 . GLN A 23  ? 0.5135 0.5143 0.5081 -0.0196 0.0079  0.0034  19  GLN A NE2 
145  N N   . PRO A 24  ? 0.2258 0.2168 0.2138 -0.0171 0.0062  0.0004  20  PRO A N   
146  C CA  . PRO A 24  ? 0.2299 0.2213 0.2173 -0.0183 0.0054  -0.0003 20  PRO A CA  
147  C C   . PRO A 24  ? 0.2989 0.2946 0.2882 -0.0197 0.0048  -0.0001 20  PRO A C   
148  O O   . PRO A 24  ? 0.2827 0.2802 0.2732 -0.0203 0.0051  0.0005  20  PRO A O   
149  C CB  . PRO A 24  ? 0.2572 0.2443 0.2420 -0.0196 0.0059  -0.0009 20  PRO A CB  
150  C CG  . PRO A 24  ? 0.3002 0.2844 0.2840 -0.0183 0.0070  -0.0006 20  PRO A CG  
151  C CD  . PRO A 24  ? 0.2367 0.2236 0.2227 -0.0176 0.0072  0.0002  20  PRO A CD  
152  N N   . PRO A 25  ? 0.2909 0.2886 0.2804 -0.0200 0.0038  -0.0005 21  PRO A N   
153  C CA  . PRO A 25  ? 0.2936 0.2893 0.2814 -0.0195 0.0033  -0.0012 21  PRO A CA  
154  C C   . PRO A 25  ? 0.3698 0.3658 0.3580 -0.0171 0.0032  -0.0009 21  PRO A C   
155  O O   . PRO A 25  ? 0.3881 0.3811 0.3746 -0.0164 0.0033  -0.0014 21  PRO A O   
156  C CB  . PRO A 25  ? 0.3130 0.3114 0.3012 -0.0212 0.0024  -0.0016 21  PRO A CB  
157  C CG  . PRO A 25  ? 0.3611 0.3645 0.3519 -0.0214 0.0021  -0.0008 21  PRO A CG  
158  C CD  . PRO A 25  ? 0.3035 0.3059 0.2949 -0.0213 0.0031  -0.0002 21  PRO A CD  
159  N N   . VAL A 26  ? 0.3213 0.3203 0.3112 -0.0158 0.0032  -0.0002 22  VAL A N   
160  C CA  . VAL A 26  ? 0.3269 0.3260 0.3168 -0.0137 0.0031  0.0000  22  VAL A CA  
161  C C   . VAL A 26  ? 0.3318 0.3286 0.3214 -0.0122 0.0038  0.0003  22  VAL A C   
162  O O   . VAL A 26  ? 0.3151 0.3109 0.3041 -0.0109 0.0038  0.0002  22  VAL A O   
163  N N   . CYS A 27  ? 0.2807 0.2771 0.2707 -0.0125 0.0044  0.0007  23  CYS A N   
164  C CA  . CYS A 27  ? 0.2852 0.2796 0.2748 -0.0112 0.0051  0.0011  23  CYS A CA  
165  C C   . CYS A 27  ? 0.2918 0.2872 0.2819 -0.0095 0.0050  0.0015  23  CYS A C   
166  O O   . CYS A 27  ? 0.2918 0.2858 0.2815 -0.0086 0.0055  0.0018  23  CYS A O   
167  C CB  . CYS A 27  ? 0.3046 0.2955 0.2924 -0.0111 0.0053  0.0006  23  CYS A CB  
168  S SG  . CYS A 27  ? 0.3657 0.3539 0.3520 -0.0129 0.0058  0.0001  23  CYS A SG  
169  N N   . ASN A 28  ? 0.2284 0.2258 0.2189 -0.0089 0.0046  0.0016  24  ASN A N   
170  C CA  . ASN A 28  ? 0.2281 0.2258 0.2186 -0.0073 0.0047  0.0020  24  ASN A CA  
171  C C   . ASN A 28  ? 0.2611 0.2617 0.2524 -0.0067 0.0046  0.0025  24  ASN A C   
172  O O   . ASN A 28  ? 0.2457 0.2486 0.2376 -0.0074 0.0042  0.0026  24  ASN A O   
173  C CB  . ASN A 28  ? 0.2638 0.2599 0.2533 -0.0067 0.0045  0.0015  24  ASN A CB  
174  C CG  . ASN A 28  ? 0.5813 0.5788 0.5708 -0.0067 0.0040  0.0013  24  ASN A CG  
175  O OD1 . ASN A 28  ? 0.5553 0.5540 0.5447 -0.0057 0.0039  0.0015  24  ASN A OD1 
176  N ND2 . ASN A 28  ? 0.4640 0.4615 0.4533 -0.0078 0.0036  0.0007  24  ASN A ND2 
177  N N   . LYS A 29  ? 0.2123 0.2127 0.2032 -0.0054 0.0049  0.0030  25  LYS A N   
178  C CA  . LYS A 29  ? 0.1951 0.1976 0.1861 -0.0043 0.0050  0.0037  25  LYS A CA  
179  C C   . LYS A 29  ? 0.2189 0.2197 0.2086 -0.0030 0.0052  0.0037  25  LYS A C   
180  O O   . LYS A 29  ? 0.1740 0.1726 0.1631 -0.0028 0.0054  0.0037  25  LYS A O   
181  C CB  . LYS A 29  ? 0.2219 0.2263 0.2138 -0.0041 0.0054  0.0045  25  LYS A CB  
182  C CG  . LYS A 29  ? 0.2824 0.2896 0.2744 -0.0030 0.0055  0.0052  25  LYS A CG  
183  C CD  . LYS A 29  ? 0.3688 0.3782 0.3617 -0.0026 0.0059  0.0063  25  LYS A CD  
184  C CE  . LYS A 29  ? 0.3444 0.3564 0.3371 -0.0011 0.0061  0.0071  25  LYS A CE  
185  N NZ  . LYS A 29  ? 0.2732 0.2885 0.2670 -0.0018 0.0055  0.0069  25  LYS A NZ  
186  N N   . LEU A 30  ? 0.1937 0.1953 0.1828 -0.0022 0.0051  0.0037  26  LEU A N   
187  C CA  . LEU A 30  ? 0.1947 0.1945 0.1823 -0.0010 0.0054  0.0038  26  LEU A CA  
188  C C   . LEU A 30  ? 0.2174 0.2175 0.2043 0.0002  0.0060  0.0047  26  LEU A C   
189  O O   . LEU A 30  ? 0.2030 0.2056 0.1904 0.0007  0.0061  0.0053  26  LEU A O   
190  C CB  . LEU A 30  ? 0.2058 0.2061 0.1927 -0.0005 0.0052  0.0035  26  LEU A CB  
191  C CG  . LEU A 30  ? 0.2782 0.2771 0.2650 -0.0012 0.0048  0.0027  26  LEU A CG  
192  C CD1 . LEU A 30  ? 0.3002 0.3005 0.2869 -0.0009 0.0045  0.0025  26  LEU A CD1 
193  C CD2 . LEU A 30  ? 0.3128 0.3090 0.2983 -0.0008 0.0051  0.0025  26  LEU A CD2 
194  N N   . MET A 31  ? 0.1711 0.1688 0.1568 0.0006  0.0063  0.0048  27  MET A N   
195  C CA  . MET A 31  ? 0.1623 0.1598 0.1468 0.0019  0.0070  0.0056  27  MET A CA  
196  C C   . MET A 31  ? 0.2015 0.1982 0.1841 0.0031  0.0073  0.0057  27  MET A C   
197  O O   . MET A 31  ? 0.1923 0.1899 0.1740 0.0044  0.0078  0.0065  27  MET A O   
198  C CB  . MET A 31  ? 0.1695 0.1644 0.1531 0.0019  0.0072  0.0056  27  MET A CB  
199  C CG  . MET A 31  ? 0.2010 0.1949 0.1827 0.0032  0.0079  0.0064  27  MET A CG  
200  S SD  . MET A 31  ? 0.2235 0.2141 0.2036 0.0031  0.0080  0.0063  27  MET A SD  
201  C CE  . MET A 31  ? 0.2067 0.1987 0.1885 0.0030  0.0082  0.0069  27  MET A CE  
202  N N   . HIS A 32  ? 0.1586 0.1535 0.1404 0.0027  0.0071  0.0050  28  HIS A N   
203  C CA  . HIS A 32  ? 0.1546 0.1482 0.1344 0.0036  0.0075  0.0050  28  HIS A CA  
204  C C   . HIS A 32  ? 0.2081 0.2021 0.1886 0.0030  0.0070  0.0043  28  HIS A C   
205  O O   . HIS A 32  ? 0.1852 0.1787 0.1668 0.0018  0.0065  0.0037  28  HIS A O   
206  C CB  . HIS A 32  ? 0.1367 0.1269 0.1142 0.0038  0.0079  0.0049  28  HIS A CB  
207  C CG  . HIS A 32  ? 0.1629 0.1523 0.1393 0.0046  0.0084  0.0057  28  HIS A CG  
208  N ND1 . HIS A 32  ? 0.1865 0.1769 0.1619 0.0061  0.0091  0.0066  28  HIS A ND1 
209  C CD2 . HIS A 32  ? 0.1634 0.1514 0.1395 0.0041  0.0083  0.0057  28  HIS A CD2 
210  C CE1 . HIS A 32  ? 0.1692 0.1584 0.1437 0.0065  0.0094  0.0071  28  HIS A CE1 
211  N NE2 . HIS A 32  ? 0.1576 0.1453 0.1325 0.0053  0.0090  0.0065  28  HIS A NE2 
212  N N   . GLN A 33  ? 0.1767 0.1716 0.1565 0.0039  0.0072  0.0044  29  GLN A N   
213  C CA  . GLN A 33  ? 0.1807 0.1761 0.1612 0.0033  0.0067  0.0038  29  GLN A CA  
214  C C   . GLN A 33  ? 0.2441 0.2383 0.2227 0.0043  0.0072  0.0037  29  GLN A C   
215  O O   . GLN A 33  ? 0.2307 0.2260 0.2097 0.0044  0.0069  0.0034  29  GLN A O   
216  C CB  . GLN A 33  ? 0.1931 0.1919 0.1756 0.0029  0.0061  0.0038  29  GLN A CB  
217  C CG  . GLN A 33  ? 0.3383 0.3397 0.3206 0.0042  0.0064  0.0046  29  GLN A CG  
218  C CD  . GLN A 33  ? 0.5111 0.5160 0.4957 0.0033  0.0057  0.0046  29  GLN A CD  
219  O OE1 . GLN A 33  ? 0.3962 0.4024 0.3820 0.0026  0.0056  0.0049  29  GLN A OE1 
220  N NE2 . GLN A 33  ? 0.5308 0.5370 0.5156 0.0032  0.0052  0.0042  29  GLN A NE2 
221  N N   . GLU A 34  ? 0.2210 0.2125 0.1973 0.0050  0.0079  0.0039  30  GLU A N   
222  C CA  . GLU A 34  ? 0.2215 0.2112 0.1955 0.0059  0.0085  0.0038  30  GLU A CA  
223  C C   . GLU A 34  ? 0.2551 0.2425 0.2290 0.0047  0.0084  0.0031  30  GLU A C   
224  O O   . GLU A 34  ? 0.2290 0.2175 0.2047 0.0038  0.0077  0.0026  30  GLU A O   
225  C CB  . GLU A 34  ? 0.2370 0.2250 0.2082 0.0074  0.0096  0.0045  30  GLU A CB  
226  C CG  . GLU A 34  ? 0.4035 0.3945 0.3751 0.0088  0.0097  0.0053  30  GLU A CG  
227  C CD  . GLU A 34  ? 0.6980 0.6877 0.6665 0.0109  0.0109  0.0062  30  GLU A CD  
228  O OE1 . GLU A 34  ? 0.6296 0.6158 0.5951 0.0114  0.0117  0.0061  30  GLU A OE1 
229  O OE2 . GLU A 34  ? 0.6969 0.6892 0.6657 0.0120  0.0111  0.0071  30  GLU A OE2 
230  N N   . GLN A 35  ? 0.1989 0.1832 0.1705 0.0047  0.0090  0.0031  31  GLN A N   
231  C CA  . GLN A 35  ? 0.1784 0.1611 0.1501 0.0034  0.0089  0.0024  31  GLN A CA  
232  C C   . GLN A 35  ? 0.1933 0.1769 0.1672 0.0021  0.0081  0.0022  31  GLN A C   
233  O O   . GLN A 35  ? 0.1703 0.1542 0.1455 0.0012  0.0077  0.0018  31  GLN A O   
234  C CB  . GLN A 35  ? 0.1887 0.1680 0.1574 0.0034  0.0097  0.0024  31  GLN A CB  
235  C CG  . GLN A 35  ? 0.1785 0.1567 0.1474 0.0022  0.0097  0.0019  31  GLN A CG  
236  C CD  . GLN A 35  ? 0.1974 0.1754 0.1673 0.0007  0.0091  0.0017  31  GLN A CD  
237  O OE1 . GLN A 35  ? 0.1724 0.1497 0.1416 0.0006  0.0091  0.0019  31  GLN A OE1 
238  N NE2 . GLN A 35  ? 0.1790 0.1577 0.1505 -0.0004 0.0087  0.0013  31  GLN A NE2 
239  N N   . LEU A 36  ? 0.1660 0.1497 0.1399 0.0020  0.0080  0.0025  32  LEU A N   
240  C CA  . LEU A 36  ? 0.1663 0.1507 0.1419 0.0010  0.0074  0.0023  32  LEU A CA  
241  C C   . LEU A 36  ? 0.1872 0.1740 0.1648 0.0012  0.0070  0.0025  32  LEU A C   
242  O O   . LEU A 36  ? 0.1849 0.1726 0.1623 0.0020  0.0072  0.0031  32  LEU A O   
243  C CB  . LEU A 36  ? 0.1676 0.1500 0.1416 0.0008  0.0077  0.0026  32  LEU A CB  
244  C CG  . LEU A 36  ? 0.2340 0.2164 0.2090 -0.0003 0.0071  0.0023  32  LEU A CG  
245  C CD1 . LEU A 36  ? 0.2160 0.1983 0.1917 -0.0013 0.0068  0.0018  32  LEU A CD1 
246  C CD2 . LEU A 36  ? 0.2459 0.2263 0.2189 -0.0003 0.0074  0.0025  32  LEU A CD2 
247  N N   . LYS A 37  ? 0.1443 0.1323 0.1238 0.0003  0.0064  0.0022  33  LYS A N   
248  C CA  . LYS A 37  ? 0.1294 0.1194 0.1107 0.0001  0.0060  0.0022  33  LYS A CA  
249  C C   . LYS A 37  ? 0.1716 0.1614 0.1536 -0.0004 0.0059  0.0024  33  LYS A C   
250  O O   . LYS A 37  ? 0.1844 0.1736 0.1668 -0.0011 0.0056  0.0021  33  LYS A O   
251  C CB  . LYS A 37  ? 0.1834 0.1742 0.1659 -0.0004 0.0056  0.0018  33  LYS A CB  
252  C CG  . LYS A 37  ? 0.1926 0.1832 0.1744 0.0001  0.0057  0.0015  33  LYS A CG  
253  C CD  . LYS A 37  ? 0.2068 0.1986 0.1880 0.0010  0.0059  0.0019  33  LYS A CD  
254  C CE  . LYS A 37  ? 0.1761 0.1677 0.1565 0.0015  0.0060  0.0016  33  LYS A CE  
255  N NZ  . LYS A 37  ? 0.2075 0.2006 0.1874 0.0027  0.0062  0.0019  33  LYS A NZ  
256  N N   . VAL A 38  ? 0.1280 0.1183 0.1099 0.0001  0.0061  0.0029  34  VAL A N   
257  C CA  . VAL A 38  ? 0.1177 0.1077 0.1000 -0.0002 0.0061  0.0031  34  VAL A CA  
258  C C   . VAL A 38  ? 0.1916 0.1836 0.1757 -0.0006 0.0059  0.0032  34  VAL A C   
259  O O   . VAL A 38  ? 0.1964 0.1900 0.1808 -0.0001 0.0060  0.0036  34  VAL A O   
260  C CB  . VAL A 38  ? 0.1424 0.1313 0.1231 0.0006  0.0065  0.0036  34  VAL A CB  
261  C CG1 . VAL A 38  ? 0.1347 0.1232 0.1157 0.0004  0.0065  0.0038  34  VAL A CG1 
262  C CG2 . VAL A 38  ? 0.1562 0.1428 0.1347 0.0007  0.0068  0.0034  34  VAL A CG2 
263  N N   . MET A 39  ? 0.1790 0.1709 0.1641 -0.0014 0.0055  0.0028  35  MET A N   
264  C CA  . MET A 39  ? 0.2077 0.2010 0.1941 -0.0020 0.0054  0.0028  35  MET A CA  
265  C C   . MET A 39  ? 0.2175 0.2102 0.2044 -0.0024 0.0055  0.0029  35  MET A C   
266  O O   . MET A 39  ? 0.1792 0.1705 0.1657 -0.0024 0.0055  0.0027  35  MET A O   
267  C CB  . MET A 39  ? 0.2689 0.2626 0.2558 -0.0026 0.0050  0.0023  35  MET A CB  
268  C CG  . MET A 39  ? 0.3546 0.3469 0.3415 -0.0031 0.0049  0.0018  35  MET A CG  
269  S SD  . MET A 39  ? 0.4701 0.4625 0.4570 -0.0035 0.0046  0.0013  35  MET A SD  
270  C CE  . MET A 39  ? 0.4317 0.4237 0.4177 -0.0026 0.0047  0.0012  35  MET A CE  
271  N N   . PHE A 40  ? 0.1764 0.1704 0.1643 -0.0028 0.0056  0.0031  36  PHE A N   
272  C CA  . PHE A 40  ? 0.1631 0.1564 0.1513 -0.0033 0.0058  0.0033  36  PHE A CA  
273  C C   . PHE A 40  ? 0.2134 0.2070 0.2022 -0.0044 0.0057  0.0029  36  PHE A C   
274  O O   . PHE A 40  ? 0.1880 0.1832 0.1774 -0.0049 0.0055  0.0028  36  PHE A O   
275  C CB  . PHE A 40  ? 0.1749 0.1689 0.1632 -0.0028 0.0063  0.0040  36  PHE A CB  
276  C CG  . PHE A 40  ? 0.1684 0.1613 0.1555 -0.0017 0.0064  0.0043  36  PHE A CG  
277  C CD1 . PHE A 40  ? 0.1875 0.1806 0.1737 -0.0010 0.0064  0.0045  36  PHE A CD1 
278  C CD2 . PHE A 40  ? 0.2066 0.1980 0.1931 -0.0014 0.0066  0.0044  36  PHE A CD2 
279  C CE1 . PHE A 40  ? 0.1833 0.1749 0.1680 -0.0001 0.0067  0.0047  36  PHE A CE1 
280  C CE2 . PHE A 40  ? 0.2183 0.2083 0.2033 -0.0006 0.0067  0.0046  36  PHE A CE2 
281  C CZ  . PHE A 40  ? 0.1857 0.1757 0.1697 -0.0001 0.0068  0.0047  36  PHE A CZ  
282  N N   . ILE A 41  ? 0.1615 0.1534 0.1500 -0.0047 0.0058  0.0026  37  ILE A N   
283  C CA  . ILE A 41  ? 0.1707 0.1620 0.1591 -0.0057 0.0058  0.0022  37  ILE A CA  
284  C C   . ILE A 41  ? 0.2118 0.2018 0.2000 -0.0061 0.0064  0.0023  37  ILE A C   
285  O O   . ILE A 41  ? 0.1818 0.1706 0.1696 -0.0054 0.0066  0.0025  37  ILE A O   
286  C CB  . ILE A 41  ? 0.2074 0.1975 0.1951 -0.0056 0.0056  0.0017  37  ILE A CB  
287  C CG1 . ILE A 41  ? 0.2264 0.2174 0.2142 -0.0049 0.0052  0.0016  37  ILE A CG1 
288  C CG2 . ILE A 41  ? 0.1868 0.1762 0.1742 -0.0066 0.0055  0.0012  37  ILE A CG2 
289  C CD1 . ILE A 41  ? 0.2724 0.2624 0.2595 -0.0047 0.0050  0.0012  37  ILE A CD1 
290  N N   . GLY A 42  ? 0.1920 0.1822 0.1805 -0.0073 0.0065  0.0021  38  GLY A N   
291  C CA  . GLY A 42  ? 0.1886 0.1771 0.1765 -0.0079 0.0071  0.0022  38  GLY A CA  
292  C C   . GLY A 42  ? 0.2430 0.2294 0.2296 -0.0086 0.0072  0.0016  38  GLY A C   
293  O O   . GLY A 42  ? 0.2332 0.2192 0.2193 -0.0084 0.0068  0.0012  38  GLY A O   
294  N N   . GLY A 43  ? 0.2051 0.1899 0.1910 -0.0095 0.0078  0.0016  39  GLY A N   
295  C CA  . GLY A 43  ? 0.2084 0.1907 0.1926 -0.0103 0.0081  0.0011  39  GLY A CA  
296  C C   . GLY A 43  ? 0.2713 0.2530 0.2553 -0.0121 0.0086  0.0010  39  GLY A C   
297  O O   . GLY A 43  ? 0.2302 0.2144 0.2158 -0.0127 0.0085  0.0014  39  GLY A O   
298  N N   . PRO A 44  ? 0.2483 0.2269 0.2302 -0.0129 0.0092  0.0007  40  PRO A N   
299  C CA  . PRO A 44  ? 0.2512 0.2267 0.2309 -0.0121 0.0095  0.0004  40  PRO A CA  
300  C C   . PRO A 44  ? 0.2945 0.2705 0.2740 -0.0123 0.0087  -0.0001 40  PRO A C   
301  O O   . PRO A 44  ? 0.2857 0.2632 0.2658 -0.0138 0.0080  -0.0005 40  PRO A O   
302  C CB  . PRO A 44  ? 0.2841 0.2561 0.2614 -0.0133 0.0105  0.0002  40  PRO A CB  
303  C CG  . PRO A 44  ? 0.3255 0.2992 0.3040 -0.0155 0.0102  0.0000  40  PRO A CG  
304  C CD  . PRO A 44  ? 0.2675 0.2451 0.2489 -0.0149 0.0097  0.0005  40  PRO A CD  
305  N N   . ASN A 45  ? 0.2436 0.2188 0.2224 -0.0108 0.0087  -0.0001 41  ASN A N   
306  C CA  . ASN A 45  ? 0.2304 0.2057 0.2088 -0.0107 0.0080  -0.0005 41  ASN A CA  
307  C C   . ASN A 45  ? 0.2846 0.2576 0.2612 -0.0092 0.0085  -0.0004 41  ASN A C   
308  O O   . ASN A 45  ? 0.3036 0.2779 0.2812 -0.0077 0.0084  0.0000  41  ASN A O   
309  C CB  . ASN A 45  ? 0.1740 0.1530 0.1548 -0.0104 0.0071  -0.0004 41  ASN A CB  
310  C CG  . ASN A 45  ? 0.3625 0.3418 0.3429 -0.0103 0.0065  -0.0008 41  ASN A CG  
311  O OD1 . ASN A 45  ? 0.3985 0.3793 0.3799 -0.0092 0.0061  -0.0007 41  ASN A OD1 
312  N ND2 . ASN A 45  ? 0.2956 0.2731 0.2744 -0.0115 0.0064  -0.0014 41  ASN A ND2 
313  N N   . THR A 46  ? 0.2368 0.2065 0.2108 -0.0096 0.0091  -0.0007 42  THR A N   
314  C CA  . THR A 46  ? 0.2530 0.2202 0.2249 -0.0081 0.0097  -0.0005 42  THR A CA  
315  C C   . THR A 46  ? 0.3035 0.2700 0.2744 -0.0085 0.0092  -0.0009 42  THR A C   
316  O O   . THR A 46  ? 0.3096 0.2759 0.2801 -0.0102 0.0088  -0.0015 42  THR A O   
317  C CB  . THR A 46  ? 0.4004 0.3638 0.3695 -0.0079 0.0110  -0.0003 42  THR A CB  
318  O OG1 . THR A 46  ? 0.4772 0.4384 0.4447 -0.0100 0.0111  -0.0009 42  THR A OG1 
319  C CG2 . THR A 46  ? 0.3822 0.3464 0.3523 -0.0072 0.0115  0.0003  42  THR A CG2 
320  N N   . ARG A 47  ? 0.2449 0.2116 0.2157 -0.0069 0.0093  -0.0006 43  ARG A N   
321  C CA  . ARG A 47  ? 0.2310 0.1975 0.2011 -0.0069 0.0088  -0.0010 43  ARG A CA  
322  C C   . ARG A 47  ? 0.2408 0.2064 0.2099 -0.0050 0.0093  -0.0005 43  ARG A C   
323  O O   . ARG A 47  ? 0.2414 0.2078 0.2111 -0.0036 0.0097  0.0001  43  ARG A O   
324  C CB  . ARG A 47  ? 0.2436 0.2140 0.2166 -0.0073 0.0076  -0.0012 43  ARG A CB  
325  C CG  . ARG A 47  ? 0.2514 0.2247 0.2268 -0.0061 0.0075  -0.0006 43  ARG A CG  
326  C CD  . ARG A 47  ? 0.2525 0.2290 0.2304 -0.0068 0.0066  -0.0007 43  ARG A CD  
327  N NE  . ARG A 47  ? 0.2568 0.2344 0.2350 -0.0070 0.0060  -0.0011 43  ARG A NE  
328  C CZ  . ARG A 47  ? 0.5030 0.4831 0.4828 -0.0076 0.0053  -0.0013 43  ARG A CZ  
329  N NH1 . ARG A 47  ? 0.3943 0.3753 0.3742 -0.0075 0.0047  -0.0016 43  ARG A NH1 
330  N NH2 . ARG A 47  ? 0.3569 0.3387 0.3382 -0.0081 0.0052  -0.0011 43  ARG A NH2 
331  N N   . LYS A 48  ? 0.1957 0.1600 0.1633 -0.0048 0.0092  -0.0007 44  LYS A N   
332  C CA  . LYS A 48  ? 0.1846 0.1481 0.1511 -0.0029 0.0097  -0.0002 44  LYS A CA  
333  C C   . LYS A 48  ? 0.2147 0.1809 0.1832 -0.0026 0.0089  -0.0002 44  LYS A C   
334  O O   . LYS A 48  ? 0.2116 0.1776 0.1796 -0.0011 0.0092  0.0002  44  LYS A O   
335  C CB  . LYS A 48  ? 0.2357 0.1946 0.1982 -0.0027 0.0105  -0.0003 44  LYS A CB  
336  C CG  . LYS A 48  ? 0.4639 0.4194 0.4239 -0.0033 0.0114  -0.0004 44  LYS A CG  
337  C CD  . LYS A 48  ? 0.6211 0.5722 0.5771 -0.0020 0.0127  0.0000  44  LYS A CD  
338  C CE  . LYS A 48  ? 0.7648 0.7124 0.7181 -0.0025 0.0137  0.0000  44  LYS A CE  
339  N NZ  . LYS A 48  ? 0.9276 0.8717 0.8775 -0.0004 0.0152  0.0008  44  LYS A NZ  
340  N N   . ASP A 49  ? 0.1913 0.1598 0.1617 -0.0038 0.0079  -0.0007 45  ASP A N   
341  C CA  . ASP A 49  ? 0.1929 0.1636 0.1648 -0.0033 0.0073  -0.0008 45  ASP A CA  
342  C C   . ASP A 49  ? 0.2276 0.2011 0.2019 -0.0024 0.0073  -0.0002 45  ASP A C   
343  O O   . ASP A 49  ? 0.2049 0.1798 0.1806 -0.0027 0.0072  0.0000  45  ASP A O   
344  C CB  . ASP A 49  ? 0.2090 0.1813 0.1820 -0.0047 0.0063  -0.0014 45  ASP A CB  
345  C CG  . ASP A 49  ? 0.2459 0.2202 0.2208 -0.0057 0.0060  -0.0015 45  ASP A CG  
346  O OD1 . ASP A 49  ? 0.2430 0.2159 0.2170 -0.0065 0.0063  -0.0016 45  ASP A OD1 
347  O OD2 . ASP A 49  ? 0.2825 0.2596 0.2594 -0.0057 0.0054  -0.0015 45  ASP A OD2 
348  N N   . TYR A 50  ? 0.1797 0.1540 0.1544 -0.0013 0.0073  0.0001  46  TYR A N   
349  C CA  . TYR A 50  ? 0.1632 0.1402 0.1399 -0.0006 0.0073  0.0006  46  TYR A CA  
350  C C   . TYR A 50  ? 0.1707 0.1495 0.1488 -0.0009 0.0066  0.0003  46  TYR A C   
351  O O   . TYR A 50  ? 0.1668 0.1449 0.1441 -0.0007 0.0066  0.0001  46  TYR A O   
352  C CB  . TYR A 50  ? 0.1574 0.1342 0.1336 0.0009  0.0079  0.0014  46  TYR A CB  
353  C CG  . TYR A 50  ? 0.1736 0.1493 0.1487 0.0016  0.0087  0.0019  46  TYR A CG  
354  C CD1 . TYR A 50  ? 0.1966 0.1690 0.1691 0.0017  0.0093  0.0018  46  TYR A CD1 
355  C CD2 . TYR A 50  ? 0.1766 0.1544 0.1531 0.0021  0.0088  0.0025  46  TYR A CD2 
356  C CE1 . TYR A 50  ? 0.2142 0.1853 0.1853 0.0025  0.0101  0.0023  46  TYR A CE1 
357  C CE2 . TYR A 50  ? 0.1922 0.1691 0.1676 0.0030  0.0095  0.0030  46  TYR A CE2 
358  C CZ  . TYR A 50  ? 0.2581 0.2316 0.2307 0.0032  0.0102  0.0029  46  TYR A CZ  
359  O OH  . TYR A 50  ? 0.2198 0.1921 0.1910 0.0043  0.0110  0.0035  46  TYR A OH  
360  N N   . HIS A 51  ? 0.1361 0.1170 0.1160 -0.0014 0.0062  0.0003  47  HIS A N   
361  C CA  . HIS A 51  ? 0.1306 0.1131 0.1116 -0.0016 0.0058  0.0001  47  HIS A CA  
362  C C   . HIS A 51  ? 0.1743 0.1579 0.1561 -0.0008 0.0060  0.0006  47  HIS A C   
363  O O   . HIS A 51  ? 0.1788 0.1629 0.1609 -0.0005 0.0063  0.0011  47  HIS A O   
364  C CB  . HIS A 51  ? 0.1348 0.1187 0.1171 -0.0023 0.0054  0.0000  47  HIS A CB  
365  C CG  . HIS A 51  ? 0.1692 0.1545 0.1522 -0.0023 0.0051  -0.0001 47  HIS A CG  
366  N ND1 . HIS A 51  ? 0.1702 0.1568 0.1542 -0.0024 0.0050  0.0001  47  HIS A ND1 
367  C CD2 . HIS A 51  ? 0.1679 0.1532 0.1505 -0.0022 0.0049  -0.0004 47  HIS A CD2 
368  C CE1 . HIS A 51  ? 0.1705 0.1577 0.1545 -0.0023 0.0048  -0.0001 47  HIS A CE1 
369  N NE2 . HIS A 51  ? 0.1694 0.1559 0.1527 -0.0021 0.0048  -0.0003 47  HIS A NE2 
370  N N   . ILE A 52  ? 0.1439 0.1278 0.1257 -0.0006 0.0059  0.0005  48  ILE A N   
371  C CA  . ILE A 52  ? 0.1334 0.1183 0.1159 -0.0001 0.0062  0.0009  48  ILE A CA  
372  C C   . ILE A 52  ? 0.1844 0.1701 0.1674 -0.0005 0.0060  0.0006  48  ILE A C   
373  O O   . ILE A 52  ? 0.1823 0.1675 0.1647 -0.0004 0.0058  0.0002  48  ILE A O   
374  C CB  . ILE A 52  ? 0.1651 0.1493 0.1468 0.0008  0.0067  0.0013  48  ILE A CB  
375  C CG1 . ILE A 52  ? 0.1682 0.1509 0.1487 0.0013  0.0071  0.0015  48  ILE A CG1 
376  C CG2 . ILE A 52  ? 0.1693 0.1550 0.1520 0.0011  0.0070  0.0018  48  ILE A CG2 
377  C CD1 . ILE A 52  ? 0.2448 0.2262 0.2240 0.0024  0.0077  0.0019  48  ILE A CD1 
378  N N   . GLU A 53  ? 0.1489 0.1357 0.1327 -0.0007 0.0060  0.0009  49  GLU A N   
379  C CA  . GLU A 53  ? 0.1389 0.1260 0.1227 -0.0009 0.0059  0.0007  49  GLU A CA  
380  C C   . GLU A 53  ? 0.1652 0.1529 0.1493 -0.0011 0.0062  0.0010  49  GLU A C   
381  O O   . GLU A 53  ? 0.1638 0.1524 0.1487 -0.0012 0.0063  0.0014  49  GLU A O   
382  C CB  . GLU A 53  ? 0.1483 0.1357 0.1322 -0.0013 0.0056  0.0004  49  GLU A CB  
383  C CG  . GLU A 53  ? 0.2000 0.1880 0.1845 -0.0018 0.0055  0.0006  49  GLU A CG  
384  C CD  . GLU A 53  ? 0.1885 0.1767 0.1729 -0.0020 0.0053  0.0006  49  GLU A CD  
385  O OE1 . GLU A 53  ? 0.2239 0.2117 0.2077 -0.0019 0.0056  0.0005  49  GLU A OE1 
386  O OE2 . GLU A 53  ? 0.2062 0.1946 0.1909 -0.0023 0.0052  0.0006  49  GLU A OE2 
387  N N   . GLU A 54  ? 0.1374 0.1248 0.1211 -0.0011 0.0064  0.0008  50  GLU A N   
388  C CA  . GLU A 54  ? 0.1337 0.1213 0.1174 -0.0016 0.0067  0.0010  50  GLU A CA  
389  C C   . GLU A 54  ? 0.1930 0.1808 0.1767 -0.0023 0.0066  0.0010  50  GLU A C   
390  O O   . GLU A 54  ? 0.1780 0.1661 0.1618 -0.0030 0.0068  0.0012  50  GLU A O   
391  C CB  . GLU A 54  ? 0.1475 0.1341 0.1302 -0.0012 0.0072  0.0009  50  GLU A CB  
392  C CG  . GLU A 54  ? 0.1666 0.1529 0.1492 -0.0004 0.0074  0.0010  50  GLU A CG  
393  C CD  . GLU A 54  ? 0.4179 0.4033 0.3997 0.0001  0.0080  0.0009  50  GLU A CD  
394  O OE1 . GLU A 54  ? 0.3317 0.3170 0.3134 -0.0003 0.0085  0.0011  50  GLU A OE1 
395  O OE2 . GLU A 54  ? 0.3740 0.3586 0.3550 0.0009  0.0079  0.0007  50  GLU A OE2 
396  N N   . GLY A 55  ? 0.1774 0.1651 0.1610 -0.0023 0.0062  0.0009  51  GLY A N   
397  C CA  . GLY A 55  ? 0.1523 0.1400 0.1357 -0.0029 0.0061  0.0009  51  GLY A CA  
398  C C   . GLY A 55  ? 0.1910 0.1797 0.1754 -0.0031 0.0057  0.0011  51  GLY A C   
399  O O   . GLY A 55  ? 0.1819 0.1712 0.1670 -0.0028 0.0057  0.0012  51  GLY A O   
400  N N   . GLU A 56  ? 0.1461 0.1348 0.1303 -0.0036 0.0055  0.0011  52  GLU A N   
401  C CA  . GLU A 56  ? 0.1394 0.1290 0.1243 -0.0037 0.0052  0.0013  52  GLU A CA  
402  C C   . GLU A 56  ? 0.1837 0.1729 0.1685 -0.0034 0.0051  0.0012  52  GLU A C   
403  O O   . GLU A 56  ? 0.1836 0.1720 0.1677 -0.0032 0.0051  0.0011  52  GLU A O   
404  C CB  . GLU A 56  ? 0.1458 0.1358 0.1305 -0.0045 0.0050  0.0014  52  GLU A CB  
405  C CG  . GLU A 56  ? 0.1707 0.1614 0.1556 -0.0051 0.0052  0.0016  52  GLU A CG  
406  C CD  . GLU A 56  ? 0.3052 0.2964 0.2898 -0.0062 0.0050  0.0016  52  GLU A CD  
407  O OE1 . GLU A 56  ? 0.2508 0.2408 0.2343 -0.0065 0.0048  0.0014  52  GLU A OE1 
408  O OE2 . GLU A 56  ? 0.2415 0.2340 0.2267 -0.0068 0.0050  0.0018  52  GLU A OE2 
409  N N   . GLU A 57  ? 0.1412 0.1309 0.1265 -0.0033 0.0049  0.0014  53  GLU A N   
410  C CA  . GLU A 57  ? 0.1220 0.1113 0.1073 -0.0031 0.0048  0.0014  53  GLU A CA  
411  C C   . GLU A 57  ? 0.1542 0.1438 0.1396 -0.0032 0.0047  0.0016  53  GLU A C   
412  O O   . GLU A 57  ? 0.1561 0.1464 0.1419 -0.0032 0.0046  0.0018  53  GLU A O   
413  C CB  . GLU A 57  ? 0.1415 0.1307 0.1272 -0.0028 0.0049  0.0013  53  GLU A CB  
414  C CG  . GLU A 57  ? 0.1610 0.1500 0.1466 -0.0027 0.0050  0.0011  53  GLU A CG  
415  C CD  . GLU A 57  ? 0.1947 0.1832 0.1802 -0.0026 0.0050  0.0009  53  GLU A CD  
416  O OE1 . GLU A 57  ? 0.1549 0.1432 0.1405 -0.0027 0.0050  0.0010  53  GLU A OE1 
417  O OE2 . GLU A 57  ? 0.2249 0.2131 0.2101 -0.0024 0.0050  0.0007  53  GLU A OE2 
418  N N   . VAL A 58  ? 0.1310 0.1201 0.1158 -0.0033 0.0046  0.0016  54  VAL A N   
419  C CA  . VAL A 58  ? 0.1491 0.1381 0.1337 -0.0033 0.0045  0.0018  54  VAL A CA  
420  C C   . VAL A 58  ? 0.1748 0.1637 0.1598 -0.0029 0.0046  0.0019  54  VAL A C   
421  O O   . VAL A 58  ? 0.1751 0.1637 0.1601 -0.0028 0.0048  0.0018  54  VAL A O   
422  C CB  . VAL A 58  ? 0.2311 0.2192 0.2144 -0.0035 0.0045  0.0018  54  VAL A CB  
423  C CG1 . VAL A 58  ? 0.2462 0.2342 0.2291 -0.0035 0.0042  0.0020  54  VAL A CG1 
424  C CG2 . VAL A 58  ? 0.2312 0.2188 0.2137 -0.0040 0.0045  0.0016  54  VAL A CG2 
425  N N   . PHE A 59  ? 0.1347 0.1239 0.1200 -0.0026 0.0046  0.0021  55  PHE A N   
426  C CA  . PHE A 59  ? 0.1225 0.1112 0.1079 -0.0023 0.0049  0.0022  55  PHE A CA  
427  C C   . PHE A 59  ? 0.1746 0.1631 0.1596 -0.0021 0.0049  0.0025  55  PHE A C   
428  O O   . PHE A 59  ? 0.1537 0.1426 0.1384 -0.0020 0.0046  0.0026  55  PHE A O   
429  C CB  . PHE A 59  ? 0.1538 0.1426 0.1394 -0.0020 0.0051  0.0023  55  PHE A CB  
430  C CG  . PHE A 59  ? 0.1712 0.1599 0.1570 -0.0022 0.0052  0.0021  55  PHE A CG  
431  C CD1 . PHE A 59  ? 0.1704 0.1597 0.1564 -0.0022 0.0051  0.0020  55  PHE A CD1 
432  C CD2 . PHE A 59  ? 0.2037 0.1916 0.1895 -0.0023 0.0055  0.0019  55  PHE A CD2 
433  C CE1 . PHE A 59  ? 0.1786 0.1676 0.1646 -0.0022 0.0052  0.0018  55  PHE A CE1 
434  C CE2 . PHE A 59  ? 0.2353 0.2229 0.2210 -0.0025 0.0055  0.0017  55  PHE A CE2 
435  C CZ  . PHE A 59  ? 0.2138 0.2018 0.1995 -0.0024 0.0054  0.0016  55  PHE A CZ  
436  N N   . TYR A 60  ? 0.1553 0.1432 0.1401 -0.0019 0.0051  0.0026  56  TYR A N   
437  C CA  . TYR A 60  ? 0.1530 0.1405 0.1373 -0.0015 0.0052  0.0029  56  TYR A CA  
438  C C   . TYR A 60  ? 0.1979 0.1850 0.1825 -0.0013 0.0057  0.0031  56  TYR A C   
439  O O   . TYR A 60  ? 0.2027 0.1899 0.1877 -0.0016 0.0059  0.0030  56  TYR A O   
440  C CB  . TYR A 60  ? 0.1408 0.1278 0.1242 -0.0016 0.0050  0.0029  56  TYR A CB  
441  C CG  . TYR A 60  ? 0.1417 0.1280 0.1244 -0.0011 0.0052  0.0033  56  TYR A CG  
442  C CD1 . TYR A 60  ? 0.1596 0.1459 0.1417 -0.0008 0.0049  0.0033  56  TYR A CD1 
443  C CD2 . TYR A 60  ? 0.1526 0.1385 0.1353 -0.0007 0.0056  0.0036  56  TYR A CD2 
444  C CE1 . TYR A 60  ? 0.1592 0.1447 0.1406 -0.0003 0.0051  0.0036  56  TYR A CE1 
445  C CE2 . TYR A 60  ? 0.1612 0.1463 0.1432 -0.0002 0.0059  0.0039  56  TYR A CE2 
446  C CZ  . TYR A 60  ? 0.2291 0.2139 0.2104 0.0001  0.0056  0.0039  56  TYR A CZ  
447  O OH  . TYR A 60  ? 0.2306 0.2145 0.2110 0.0008  0.0059  0.0043  56  TYR A OH  
448  N N   . GLN A 61  ? 0.1709 0.1575 0.1553 -0.0009 0.0060  0.0033  57  GLN A N   
449  C CA  . GLN A 61  ? 0.1494 0.1353 0.1339 -0.0008 0.0065  0.0034  57  GLN A CA  
450  C C   . GLN A 61  ? 0.2053 0.1908 0.1895 -0.0005 0.0068  0.0038  57  GLN A C   
451  O O   . GLN A 61  ? 0.1870 0.1721 0.1704 0.0002  0.0068  0.0040  57  GLN A O   
452  C CB  . GLN A 61  ? 0.1632 0.1485 0.1473 -0.0004 0.0070  0.0035  57  GLN A CB  
453  C CG  . GLN A 61  ? 0.1810 0.1661 0.1652 -0.0008 0.0070  0.0032  57  GLN A CG  
454  C CD  . GLN A 61  ? 0.2757 0.2607 0.2605 -0.0017 0.0071  0.0030  57  GLN A CD  
455  O OE1 . GLN A 61  ? 0.2235 0.2091 0.2087 -0.0021 0.0067  0.0027  57  GLN A OE1 
456  N NE2 . GLN A 61  ? 0.1603 0.1445 0.1450 -0.0020 0.0077  0.0031  57  GLN A NE2 
457  N N   . LEU A 62  ? 0.1677 0.1536 0.1524 -0.0008 0.0069  0.0039  58  LEU A N   
458  C CA  A LEU A 62  ? 0.1862 0.1718 0.1706 -0.0004 0.0073  0.0044  58  LEU A CA  
459  C CA  B LEU A 62  ? 0.1747 0.1602 0.1590 -0.0004 0.0073  0.0044  58  LEU A CA  
460  C C   . LEU A 62  ? 0.2194 0.2042 0.2038 -0.0002 0.0080  0.0047  58  LEU A C   
461  O O   . LEU A 62  ? 0.1903 0.1743 0.1739 0.0005  0.0082  0.0050  58  LEU A O   
462  C CB  A LEU A 62  ? 0.1948 0.1813 0.1797 -0.0006 0.0074  0.0046  58  LEU A CB  
463  C CB  B LEU A 62  ? 0.1725 0.1590 0.1574 -0.0007 0.0073  0.0046  58  LEU A CB  
464  C CG  A LEU A 62  ? 0.2585 0.2453 0.2428 -0.0004 0.0070  0.0046  58  LEU A CG  
465  C CG  B LEU A 62  ? 0.2097 0.1963 0.1943 0.0000  0.0077  0.0052  58  LEU A CG  
466  C CD1 A LEU A 62  ? 0.2618 0.2493 0.2466 -0.0010 0.0066  0.0041  58  LEU A CD1 
467  C CD1 B LEU A 62  ? 0.2068 0.1925 0.1898 0.0006  0.0074  0.0052  58  LEU A CD1 
468  C CD2 A LEU A 62  ? 0.2815 0.2689 0.2658 0.0000  0.0074  0.0052  58  LEU A CD2 
469  C CD2 B LEU A 62  ? 0.2145 0.2026 0.2000 -0.0003 0.0079  0.0055  58  LEU A CD2 
470  N N   . GLU A 63  ? 0.1836 0.1685 0.1687 -0.0009 0.0083  0.0045  59  GLU A N   
471  C CA  . GLU A 63  ? 0.1901 0.1739 0.1750 -0.0010 0.0090  0.0047  59  GLU A CA  
472  C C   . GLU A 63  ? 0.2241 0.2069 0.2085 -0.0013 0.0092  0.0043  59  GLU A C   
473  O O   . GLU A 63  ? 0.2087 0.1919 0.1936 -0.0022 0.0090  0.0040  59  GLU A O   
474  C CB  . GLU A 63  ? 0.2097 0.1943 0.1955 -0.0018 0.0094  0.0050  59  GLU A CB  
475  C CG  . GLU A 63  ? 0.2947 0.2803 0.2808 -0.0013 0.0094  0.0055  59  GLU A CG  
476  C CD  . GLU A 63  ? 0.5232 0.5103 0.5105 -0.0020 0.0098  0.0059  59  GLU A CD  
477  O OE1 . GLU A 63  ? 0.4521 0.4392 0.4399 -0.0031 0.0101  0.0057  59  GLU A OE1 
478  O OE2 . GLU A 63  ? 0.4285 0.4168 0.4161 -0.0015 0.0098  0.0064  59  GLU A OE2 
479  N N   . GLY A 64  ? 0.1843 0.1657 0.1676 -0.0006 0.0097  0.0045  60  GLY A N   
480  C CA  . GLY A 64  ? 0.1782 0.1583 0.1607 -0.0006 0.0101  0.0042  60  GLY A CA  
481  C C   . GLY A 64  ? 0.2196 0.2004 0.2021 -0.0003 0.0095  0.0039  60  GLY A C   
482  O O   . GLY A 64  ? 0.2298 0.2120 0.2128 -0.0002 0.0087  0.0039  60  GLY A O   
483  N N   . ASP A 65  ? 0.1725 0.1519 0.1539 -0.0001 0.0100  0.0038  61  ASP A N   
484  C CA  . ASP A 65  ? 0.1662 0.1462 0.1474 0.0004  0.0096  0.0037  61  ASP A CA  
485  C C   . ASP A 65  ? 0.2090 0.1888 0.1904 -0.0006 0.0094  0.0033  61  ASP A C   
486  O O   . ASP A 65  ? 0.1976 0.1764 0.1788 -0.0016 0.0097  0.0031  61  ASP A O   
487  C CB  . ASP A 65  ? 0.1857 0.1644 0.1653 0.0016  0.0103  0.0041  61  ASP A CB  
488  C CG  . ASP A 65  ? 0.2749 0.2534 0.2539 0.0028  0.0106  0.0045  61  ASP A CG  
489  O OD1 . ASP A 65  ? 0.2360 0.2158 0.2160 0.0027  0.0101  0.0046  61  ASP A OD1 
490  O OD2 . ASP A 65  ? 0.2872 0.2643 0.2648 0.0038  0.0115  0.0048  61  ASP A OD2 
491  N N   . MET A 66  ? 0.1757 0.1565 0.1573 -0.0003 0.0090  0.0032  62  MET A N   
492  C CA  . MET A 66  ? 0.1737 0.1540 0.1551 -0.0009 0.0089  0.0029  62  MET A CA  
493  C C   . MET A 66  ? 0.2030 0.1833 0.1836 0.0001  0.0090  0.0031  62  MET A C   
494  O O   . MET A 66  ? 0.1829 0.1642 0.1635 0.0012  0.0090  0.0035  62  MET A O   
495  C CB  . MET A 66  ? 0.1968 0.1787 0.1795 -0.0018 0.0081  0.0025  62  MET A CB  
496  C CG  . MET A 66  ? 0.2565 0.2403 0.2401 -0.0013 0.0074  0.0026  62  MET A CG  
497  S SD  . MET A 66  ? 0.3203 0.3054 0.3048 -0.0020 0.0067  0.0023  62  MET A SD  
498  C CE  . MET A 66  ? 0.2608 0.2446 0.2445 -0.0022 0.0070  0.0020  62  MET A CE  
499  N N   . VAL A 67  ? 0.1597 0.1390 0.1396 0.0000  0.0092  0.0029  63  VAL A N   
500  C CA  . VAL A 67  ? 0.1774 0.1568 0.1566 0.0011  0.0094  0.0032  63  VAL A CA  
501  C C   . VAL A 67  ? 0.2112 0.1915 0.1911 0.0005  0.0088  0.0029  63  VAL A C   
502  O O   . VAL A 67  ? 0.1922 0.1714 0.1718 -0.0004 0.0087  0.0024  63  VAL A O   
503  C CB  . VAL A 67  ? 0.2203 0.1970 0.1971 0.0019  0.0105  0.0035  63  VAL A CB  
504  C CG1 . VAL A 67  ? 0.2199 0.1969 0.1959 0.0031  0.0107  0.0039  63  VAL A CG1 
505  C CG2 . VAL A 67  ? 0.2339 0.2097 0.2098 0.0027  0.0112  0.0039  63  VAL A CG2 
506  N N   . LEU A 68  ? 0.1834 0.1659 0.1644 0.0009  0.0083  0.0031  64  LEU A N   
507  C CA  . LEU A 68  ? 0.1889 0.1722 0.1705 0.0006  0.0079  0.0029  64  LEU A CA  
508  C C   . LEU A 68  ? 0.2347 0.2176 0.2152 0.0017  0.0084  0.0033  64  LEU A C   
509  O O   . LEU A 68  ? 0.2382 0.2227 0.2191 0.0026  0.0085  0.0039  64  LEU A O   
510  C CB  . LEU A 68  ? 0.1894 0.1751 0.1726 0.0002  0.0071  0.0028  64  LEU A CB  
511  C CG  . LEU A 68  ? 0.2219 0.2082 0.2057 -0.0002 0.0067  0.0026  64  LEU A CG  
512  C CD1 . LEU A 68  ? 0.2127 0.1980 0.1964 -0.0011 0.0065  0.0020  64  LEU A CD1 
513  C CD2 . LEU A 68  ? 0.2373 0.2255 0.2221 -0.0004 0.0062  0.0026  64  LEU A CD2 
514  N N   . ARG A 69  ? 0.1901 0.1708 0.1692 0.0016  0.0088  0.0031  65  ARG A N   
515  C CA  . ARG A 69  ? 0.1820 0.1621 0.1598 0.0029  0.0094  0.0036  65  ARG A CA  
516  C C   . ARG A 69  ? 0.2440 0.2262 0.2233 0.0028  0.0089  0.0036  65  ARG A C   
517  O O   . ARG A 69  ? 0.2430 0.2253 0.2230 0.0017  0.0083  0.0030  65  ARG A O   
518  C CB  . ARG A 69  ? 0.1849 0.1615 0.1604 0.0027  0.0100  0.0033  65  ARG A CB  
519  C CG  . ARG A 69  ? 0.2649 0.2389 0.2387 0.0025  0.0106  0.0032  65  ARG A CG  
520  C CD  . ARG A 69  ? 0.2609 0.2312 0.2315 0.0031  0.0116  0.0033  65  ARG A CD  
521  N NE  . ARG A 69  ? 0.4108 0.3781 0.3796 0.0023  0.0122  0.0029  65  ARG A NE  
522  C CZ  . ARG A 69  ? 0.6225 0.5889 0.5904 0.0029  0.0129  0.0033  65  ARG A CZ  
523  N NH1 . ARG A 69  ? 0.4957 0.4592 0.4619 0.0020  0.0135  0.0029  65  ARG A NH1 
524  N NH2 . ARG A 69  ? 0.3958 0.3642 0.3645 0.0045  0.0131  0.0040  65  ARG A NH2 
525  N N   . VAL A 70  ? 0.1947 0.1787 0.1744 0.0039  0.0091  0.0043  66  VAL A N   
526  C CA  . VAL A 70  ? 0.1777 0.1636 0.1587 0.0037  0.0087  0.0044  66  VAL A CA  
527  C C   . VAL A 70  ? 0.2269 0.2126 0.2068 0.0051  0.0094  0.0051  66  VAL A C   
528  O O   . VAL A 70  ? 0.2277 0.2125 0.2061 0.0064  0.0101  0.0057  66  VAL A O   
529  C CB  . VAL A 70  ? 0.2285 0.2177 0.2115 0.0033  0.0080  0.0046  66  VAL A CB  
530  C CG1 . VAL A 70  ? 0.2140 0.2031 0.1978 0.0020  0.0073  0.0039  66  VAL A CG1 
531  C CG2 . VAL A 70  ? 0.2277 0.2185 0.2108 0.0044  0.0083  0.0054  66  VAL A CG2 
532  N N   . LEU A 71  ? 0.1788 0.1654 0.1594 0.0050  0.0092  0.0051  67  LEU A N   
533  C CA  . LEU A 71  ? 0.2051 0.1921 0.1851 0.0064  0.0099  0.0059  67  LEU A CA  
534  C C   . LEU A 71  ? 0.2629 0.2537 0.2451 0.0062  0.0095  0.0064  67  LEU A C   
535  O O   . LEU A 71  ? 0.2477 0.2396 0.2314 0.0050  0.0089  0.0059  67  LEU A O   
536  C CB  . LEU A 71  ? 0.2119 0.1968 0.1908 0.0064  0.0101  0.0056  67  LEU A CB  
537  C CG  . LEU A 71  ? 0.2876 0.2686 0.2640 0.0062  0.0103  0.0050  67  LEU A CG  
538  C CD1 . LEU A 71  ? 0.3060 0.2850 0.2809 0.0067  0.0107  0.0049  67  LEU A CD1 
539  C CD2 . LEU A 71  ? 0.3104 0.2895 0.2848 0.0073  0.0112  0.0055  67  LEU A CD2 
540  N N   . GLU A 72  ? 0.1994 0.1925 0.1820 0.0073  0.0098  0.0073  68  GLU A N   
541  C CA  . GLU A 72  ? 0.1945 0.1916 0.1793 0.0069  0.0093  0.0078  68  GLU A CA  
542  C C   . GLU A 72  ? 0.2599 0.2592 0.2448 0.0084  0.0100  0.0090  68  GLU A C   
543  O O   . GLU A 72  ? 0.2362 0.2354 0.2199 0.0101  0.0107  0.0098  68  GLU A O   
544  C CB  . GLU A 72  ? 0.2119 0.2104 0.1973 0.0065  0.0089  0.0077  68  GLU A CB  
545  C CG  . GLU A 72  ? 0.3318 0.3345 0.3192 0.0061  0.0083  0.0082  68  GLU A CG  
546  C CD  . GLU A 72  ? 0.5436 0.5476 0.5312 0.0061  0.0079  0.0083  68  GLU A CD  
547  O OE1 . GLU A 72  ? 0.6297 0.6313 0.6158 0.0069  0.0083  0.0082  68  GLU A OE1 
548  O OE2 . GLU A 72  ? 0.3515 0.3587 0.3406 0.0053  0.0073  0.0085  68  GLU A OE2 
549  N N   . GLN A 73  ? 0.2600 0.2614 0.2463 0.0080  0.0099  0.0093  69  GLN A N   
550  C CA  . GLN A 73  ? 0.2567 0.2610 0.2436 0.0093  0.0105  0.0106  69  GLN A CA  
551  C C   . GLN A 73  ? 0.3155 0.3177 0.3001 0.0116  0.0117  0.0114  69  GLN A C   
552  O O   . GLN A 73  ? 0.3174 0.3218 0.3019 0.0131  0.0123  0.0125  69  GLN A O   
553  C CB  . GLN A 73  ? 0.2701 0.2791 0.2590 0.0090  0.0101  0.0112  69  GLN A CB  
554  C CG  . GLN A 73  ? 0.3728 0.3829 0.3632 0.0067  0.0089  0.0103  69  GLN A CG  
555  C CD  . GLN A 73  ? 0.4836 0.4981 0.4757 0.0062  0.0084  0.0108  69  GLN A CD  
556  O OE1 . GLN A 73  ? 0.3849 0.4008 0.3768 0.0073  0.0084  0.0114  69  GLN A OE1 
557  N NE2 . GLN A 73  ? 0.3380 0.3546 0.3318 0.0043  0.0077  0.0106  69  GLN A NE2 
558  N N   . GLY A 74  ? 0.2617 0.2596 0.2442 0.0117  0.0120  0.0107  70  GLY A N   
559  C CA  . GLY A 74  ? 0.2613 0.2562 0.2409 0.0137  0.0132  0.0113  70  GLY A CA  
560  C C   . GLY A 74  ? 0.3259 0.3183 0.3033 0.0145  0.0136  0.0113  70  GLY A C   
561  O O   . GLY A 74  ? 0.3482 0.3378 0.3228 0.0162  0.0147  0.0118  70  GLY A O   
562  N N   . LYS A 75  ? 0.2627 0.2559 0.2412 0.0134  0.0129  0.0107  71  LYS A N   
563  C CA  . LYS A 75  ? 0.2541 0.2449 0.2305 0.0141  0.0134  0.0106  71  LYS A CA  
564  C C   . LYS A 75  ? 0.2968 0.2847 0.2729 0.0123  0.0128  0.0093  71  LYS A C   
565  O O   . LYS A 75  ? 0.2675 0.2564 0.2455 0.0105  0.0118  0.0084  71  LYS A O   
566  C CB  . LYS A 75  ? 0.2714 0.2660 0.2491 0.0148  0.0133  0.0114  71  LYS A CB  
567  C CG  . LYS A 75  ? 0.4847 0.4825 0.4626 0.0169  0.0140  0.0130  71  LYS A CG  
568  C CD  . LYS A 75  ? 0.6798 0.6809 0.6584 0.0179  0.0140  0.0138  71  LYS A CD  
569  N N   . HIS A 76  ? 0.2720 0.2564 0.2455 0.0129  0.0134  0.0091  72  HIS A N   
570  C CA  . HIS A 76  ? 0.2919 0.2738 0.2650 0.0113  0.0130  0.0080  72  HIS A CA  
571  C C   . HIS A 76  ? 0.3220 0.3063 0.2965 0.0112  0.0126  0.0082  72  HIS A C   
572  O O   . HIS A 76  ? 0.3138 0.2994 0.2878 0.0129  0.0132  0.0091  72  HIS A O   
573  C CB  . HIS A 76  ? 0.3182 0.2952 0.2877 0.0118  0.0140  0.0078  72  HIS A CB  
574  C CG  . HIS A 76  ? 0.3769 0.3508 0.3445 0.0117  0.0143  0.0075  72  HIS A CG  
575  N ND1 . HIS A 76  ? 0.4081 0.3802 0.3758 0.0098  0.0136  0.0063  72  HIS A ND1 
576  C CD2 . HIS A 76  ? 0.4159 0.3886 0.3816 0.0133  0.0152  0.0082  72  HIS A CD2 
577  C CE1 . HIS A 76  ? 0.4143 0.3841 0.3801 0.0102  0.0140  0.0063  72  HIS A CE1 
578  N NE2 . HIS A 76  ? 0.4233 0.3931 0.3877 0.0123  0.0150  0.0074  72  HIS A NE2 
579  N N   . ARG A 77  ? 0.2344 0.2195 0.2107 0.0095  0.0116  0.0073  73  ARG A N   
580  C CA  . ARG A 77  ? 0.2310 0.2178 0.2083 0.0094  0.0113  0.0074  73  ARG A CA  
581  C C   . ARG A 77  ? 0.2914 0.2763 0.2687 0.0078  0.0108  0.0064  73  ARG A C   
582  O O   . ARG A 77  ? 0.2925 0.2767 0.2705 0.0064  0.0103  0.0057  73  ARG A O   
583  C CB  . ARG A 77  ? 0.2674 0.2587 0.2473 0.0090  0.0104  0.0077  73  ARG A CB  
584  N N   . ASP A 78  ? 0.2340 0.2181 0.2106 0.0082  0.0111  0.0065  74  ASP A N   
585  C CA  . ASP A 78  ? 0.2292 0.2118 0.2059 0.0068  0.0108  0.0058  74  ASP A CA  
586  C C   . ASP A 78  ? 0.2990 0.2845 0.2777 0.0065  0.0100  0.0058  74  ASP A C   
587  O O   . ASP A 78  ? 0.3055 0.2925 0.2842 0.0076  0.0102  0.0064  74  ASP A O   
588  C CB  . ASP A 78  ? 0.2552 0.2345 0.2295 0.0075  0.0118  0.0058  74  ASP A CB  
589  C CG  . ASP A 78  ? 0.3668 0.3425 0.3385 0.0077  0.0128  0.0057  74  ASP A CG  
590  O OD1 . ASP A 78  ? 0.3635 0.3386 0.3354 0.0068  0.0124  0.0053  74  ASP A OD1 
591  O OD2 . ASP A 78  ? 0.4326 0.4055 0.4018 0.0086  0.0139  0.0060  74  ASP A OD2 
592  N N   . VAL A 79  ? 0.2397 0.2260 0.2200 0.0049  0.0091  0.0051  75  VAL A N   
593  C CA  . VAL A 79  ? 0.2194 0.2079 0.2012 0.0044  0.0083  0.0051  75  VAL A CA  
594  C C   . VAL A 79  ? 0.2289 0.2156 0.2102 0.0039  0.0085  0.0047  75  VAL A C   
595  O O   . VAL A 79  ? 0.2261 0.2116 0.2076 0.0028  0.0083  0.0041  75  VAL A O   
596  C CB  . VAL A 79  ? 0.2630 0.2533 0.2465 0.0032  0.0075  0.0047  75  VAL A CB  
597  C CG1 . VAL A 79  ? 0.2641 0.2562 0.2486 0.0026  0.0067  0.0046  75  VAL A CG1 
598  C CG2 . VAL A 79  ? 0.2527 0.2445 0.2366 0.0036  0.0075  0.0051  75  VAL A CG2 
599  N N   . VAL A 80  ? 0.1784 0.1651 0.1592 0.0047  0.0088  0.0050  76  VAL A N   
600  C CA  . VAL A 80  ? 0.1832 0.1682 0.1635 0.0044  0.0090  0.0048  76  VAL A CA  
601  C C   . VAL A 80  ? 0.2000 0.1866 0.1817 0.0035  0.0081  0.0045  76  VAL A C   
602  O O   . VAL A 80  ? 0.2125 0.2013 0.1948 0.0038  0.0076  0.0048  76  VAL A O   
603  C CB  . VAL A 80  ? 0.2456 0.2295 0.2243 0.0058  0.0099  0.0053  76  VAL A CB  
604  C CG1 . VAL A 80  ? 0.2368 0.2190 0.2151 0.0053  0.0101  0.0051  76  VAL A CG1 
605  C CG2 . VAL A 80  ? 0.2543 0.2360 0.2310 0.0067  0.0109  0.0056  76  VAL A CG2 
606  N N   . ILE A 81  ? 0.1627 0.1484 0.1448 0.0024  0.0079  0.0041  77  ILE A N   
607  C CA  . ILE A 81  ? 0.1609 0.1476 0.1440 0.0017  0.0072  0.0039  77  ILE A CA  
608  C C   . ILE A 81  ? 0.2018 0.1871 0.1843 0.0018  0.0076  0.0039  77  ILE A C   
609  O O   . ILE A 81  ? 0.2033 0.1873 0.1857 0.0011  0.0079  0.0037  77  ILE A O   
610  C CB  . ILE A 81  ? 0.1881 0.1752 0.1720 0.0006  0.0067  0.0034  77  ILE A CB  
611  C CG1 . ILE A 81  ? 0.1991 0.1873 0.1834 0.0005  0.0064  0.0034  77  ILE A CG1 
612  C CG2 . ILE A 81  ? 0.1777 0.1655 0.1620 0.0001  0.0061  0.0033  77  ILE A CG2 
613  C CD1 . ILE A 81  ? 0.1652 0.1534 0.1500 -0.0004 0.0061  0.0030  77  ILE A CD1 
614  N N   . ARG A 82  ? 0.1608 0.1465 0.1429 0.0026  0.0076  0.0043  78  ARG A N   
615  C CA  A ARG A 82  ? 0.1483 0.1327 0.1297 0.0029  0.0081  0.0044  78  ARG A CA  
616  C CA  B ARG A 82  ? 0.1495 0.1338 0.1310 0.0029  0.0081  0.0044  78  ARG A CA  
617  C C   . ARG A 82  ? 0.1926 0.1771 0.1747 0.0022  0.0077  0.0042  78  ARG A C   
618  O O   . ARG A 82  ? 0.1649 0.1506 0.1476 0.0016  0.0070  0.0040  78  ARG A O   
619  C CB  A ARG A 82  ? 0.1601 0.1449 0.1408 0.0042  0.0083  0.0048  78  ARG A CB  
620  C CB  B ARG A 82  ? 0.1722 0.1567 0.1527 0.0043  0.0084  0.0049  78  ARG A CB  
621  C CG  A ARG A 82  ? 0.2643 0.2491 0.2441 0.0053  0.0088  0.0052  78  ARG A CG  
622  C CG  B ARG A 82  ? 0.2334 0.2170 0.2128 0.0053  0.0093  0.0051  78  ARG A CG  
623  C CD  A ARG A 82  ? 0.4900 0.4742 0.4685 0.0068  0.0095  0.0057  78  ARG A CD  
624  C CD  B ARG A 82  ? 0.4365 0.4214 0.4153 0.0068  0.0093  0.0057  78  ARG A CD  
625  N NE  A ARG A 82  ? 0.5750 0.5567 0.5520 0.0074  0.0107  0.0058  78  ARG A NE  
626  N NE  B ARG A 82  ? 0.5087 0.4931 0.4864 0.0078  0.0101  0.0060  78  ARG A NE  
627  C CZ  A ARG A 82  ? 0.6608 0.6425 0.6370 0.0083  0.0112  0.0061  78  ARG A CZ  
628  C CZ  B ARG A 82  ? 0.6420 0.6285 0.6199 0.0085  0.0098  0.0064  78  ARG A CZ  
629  N NH1 A ARG A 82  ? 0.6272 0.6115 0.6042 0.0086  0.0105  0.0063  78  ARG A NH1 
630  N NH1 B ARG A 82  ? 0.4449 0.4344 0.4242 0.0081  0.0087  0.0064  78  ARG A NH1 
631  N NH2 A ARG A 82  ? 0.3166 0.2955 0.2909 0.0088  0.0124  0.0063  78  ARG A NH2 
632  N NH2 B ARG A 82  ? 0.4534 0.4392 0.4302 0.0097  0.0106  0.0068  78  ARG A NH2 
633  N N   . GLN A 83  ? 0.1480 0.1312 0.1298 0.0022  0.0082  0.0044  79  GLN A N   
634  C CA  . GLN A 83  ? 0.1590 0.1424 0.1412 0.0018  0.0079  0.0044  79  GLN A CA  
635  C C   . GLN A 83  ? 0.2141 0.1985 0.1960 0.0022  0.0072  0.0044  79  GLN A C   
636  O O   . GLN A 83  ? 0.2197 0.2043 0.2009 0.0030  0.0071  0.0046  79  GLN A O   
637  C CB  . GLN A 83  ? 0.1624 0.1445 0.1441 0.0021  0.0087  0.0047  79  GLN A CB  
638  C CG  . GLN A 83  ? 0.1276 0.1098 0.1096 0.0019  0.0086  0.0049  79  GLN A CG  
639  C CD  . GLN A 83  ? 0.2351 0.2162 0.2168 0.0022  0.0094  0.0053  79  GLN A CD  
640  O OE1 . GLN A 83  ? 0.2126 0.1933 0.1948 0.0015  0.0100  0.0052  79  GLN A OE1 
641  N NE2 . GLN A 83  ? 0.2049 0.1854 0.1858 0.0031  0.0096  0.0056  79  GLN A NE2 
642  N N   . GLY A 84  ? 0.1639 0.1487 0.1460 0.0016  0.0067  0.0043  80  GLY A N   
643  C CA  . GLY A 84  ? 0.1686 0.1538 0.1500 0.0016  0.0060  0.0042  80  GLY A CA  
644  C C   . GLY A 84  ? 0.1879 0.1745 0.1696 0.0012  0.0053  0.0040  80  GLY A C   
645  O O   . GLY A 84  ? 0.1607 0.1477 0.1417 0.0009  0.0047  0.0039  80  GLY A O   
646  N N   . GLU A 85  ? 0.1532 0.1404 0.1356 0.0010  0.0055  0.0039  81  GLU A N   
647  C CA  . GLU A 85  ? 0.1443 0.1331 0.1272 0.0007  0.0050  0.0037  81  GLU A CA  
648  C C   . GLU A 85  ? 0.1920 0.1809 0.1754 -0.0002 0.0048  0.0034  81  GLU A C   
649  O O   . GLU A 85  ? 0.1680 0.1561 0.1518 -0.0004 0.0051  0.0033  81  GLU A O   
650  C CB  . GLU A 85  ? 0.1589 0.1483 0.1421 0.0014  0.0054  0.0040  81  GLU A CB  
651  C CG  . GLU A 85  ? 0.2052 0.1950 0.1877 0.0025  0.0055  0.0044  81  GLU A CG  
652  C CD  . GLU A 85  ? 0.3550 0.3455 0.3374 0.0035  0.0060  0.0047  81  GLU A CD  
653  O OE1 . GLU A 85  ? 0.2028 0.1927 0.1854 0.0034  0.0064  0.0047  81  GLU A OE1 
654  O OE2 . GLU A 85  ? 0.3099 0.3012 0.2918 0.0045  0.0060  0.0051  81  GLU A OE2 
655  N N   . ILE A 86  ? 0.1487 0.1386 0.1321 -0.0008 0.0042  0.0033  82  ILE A N   
656  C CA  . ILE A 86  ? 0.1369 0.1269 0.1206 -0.0016 0.0040  0.0030  82  ILE A CA  
657  C C   . ILE A 86  ? 0.1838 0.1753 0.1682 -0.0017 0.0039  0.0030  82  ILE A C   
658  O O   . ILE A 86  ? 0.1479 0.1408 0.1325 -0.0015 0.0036  0.0032  82  ILE A O   
659  C CB  . ILE A 86  ? 0.1588 0.1480 0.1413 -0.0022 0.0036  0.0028  82  ILE A CB  
660  C CG1 . ILE A 86  ? 0.1812 0.1699 0.1638 -0.0028 0.0037  0.0025  82  ILE A CG1 
661  C CG2 . ILE A 86  ? 0.1319 0.1221 0.1139 -0.0027 0.0030  0.0028  82  ILE A CG2 
662  C CD1 . ILE A 86  ? 0.1985 0.1855 0.1794 -0.0032 0.0037  0.0024  82  ILE A CD1 
663  N N   . PHE A 87  ? 0.1513 0.1426 0.1362 -0.0021 0.0040  0.0028  83  PHE A N   
664  C CA  . PHE A 87  ? 0.1299 0.1226 0.1155 -0.0020 0.0040  0.0029  83  PHE A CA  
665  C C   . PHE A 87  ? 0.1741 0.1665 0.1599 -0.0027 0.0040  0.0026  83  PHE A C   
666  O O   . PHE A 87  ? 0.1623 0.1534 0.1478 -0.0028 0.0042  0.0024  83  PHE A O   
667  C CB  . PHE A 87  ? 0.1371 0.1295 0.1229 -0.0011 0.0046  0.0031  83  PHE A CB  
668  C CG  . PHE A 87  ? 0.1356 0.1286 0.1218 -0.0009 0.0048  0.0033  83  PHE A CG  
669  C CD1 . PHE A 87  ? 0.1696 0.1646 0.1562 -0.0005 0.0047  0.0037  83  PHE A CD1 
670  C CD2 . PHE A 87  ? 0.1514 0.1434 0.1377 -0.0011 0.0050  0.0030  83  PHE A CD2 
671  C CE1 . PHE A 87  ? 0.1909 0.1866 0.1779 -0.0002 0.0050  0.0039  83  PHE A CE1 
672  C CE2 . PHE A 87  ? 0.1900 0.1824 0.1764 -0.0008 0.0053  0.0031  83  PHE A CE2 
673  C CZ  . PHE A 87  ? 0.1659 0.1602 0.1527 -0.0003 0.0053  0.0036  83  PHE A CZ  
674  N N   . LEU A 88  ? 0.1295 0.1231 0.1156 -0.0031 0.0038  0.0027  84  LEU A N   
675  C CA  . LEU A 88  ? 0.1296 0.1228 0.1157 -0.0037 0.0039  0.0024  84  LEU A CA  
676  C C   . LEU A 88  ? 0.2001 0.1943 0.1870 -0.0033 0.0042  0.0026  84  LEU A C   
677  O O   . LEU A 88  ? 0.1945 0.1904 0.1819 -0.0031 0.0041  0.0030  84  LEU A O   
678  C CB  . LEU A 88  ? 0.1385 0.1319 0.1241 -0.0047 0.0036  0.0023  84  LEU A CB  
679  C CG  . LEU A 88  ? 0.1916 0.1844 0.1769 -0.0053 0.0038  0.0020  84  LEU A CG  
680  C CD1 . LEU A 88  ? 0.2020 0.1928 0.1865 -0.0049 0.0041  0.0018  84  LEU A CD1 
681  C CD2 . LEU A 88  ? 0.2049 0.1975 0.1893 -0.0065 0.0036  0.0019  84  LEU A CD2 
682  N N   . LEU A 89  ? 0.1662 0.1592 0.1530 -0.0030 0.0045  0.0024  85  LEU A N   
683  C CA  . LEU A 89  ? 0.1493 0.1427 0.1364 -0.0026 0.0048  0.0026  85  LEU A CA  
684  C C   . LEU A 89  ? 0.1942 0.1879 0.1815 -0.0031 0.0048  0.0025  85  LEU A C   
685  O O   . LEU A 89  ? 0.1980 0.1905 0.1847 -0.0035 0.0048  0.0021  85  LEU A O   
686  C CB  . LEU A 89  ? 0.1432 0.1351 0.1299 -0.0021 0.0051  0.0024  85  LEU A CB  
687  C CG  . LEU A 89  ? 0.1728 0.1647 0.1596 -0.0014 0.0055  0.0026  85  LEU A CG  
688  C CD1 . LEU A 89  ? 0.1821 0.1746 0.1688 -0.0006 0.0058  0.0031  85  LEU A CD1 
689  C CD2 . LEU A 89  ? 0.1932 0.1834 0.1793 -0.0014 0.0056  0.0022  85  LEU A CD2 
690  N N   . PRO A 90  ? 0.1784 0.1736 0.1662 -0.0031 0.0049  0.0029  86  PRO A N   
691  C CA  . PRO A 90  ? 0.1794 0.1748 0.1673 -0.0037 0.0051  0.0028  86  PRO A CA  
692  C C   . PRO A 90  ? 0.2062 0.2002 0.1937 -0.0031 0.0055  0.0026  86  PRO A C   
693  O O   . PRO A 90  ? 0.1750 0.1681 0.1622 -0.0023 0.0056  0.0025  86  PRO A O   
694  C CB  . PRO A 90  ? 0.2116 0.2095 0.2005 -0.0038 0.0051  0.0034  86  PRO A CB  
695  C CG  . PRO A 90  ? 0.2726 0.2715 0.2619 -0.0028 0.0051  0.0039  86  PRO A CG  
696  C CD  . PRO A 90  ? 0.2220 0.2192 0.2106 -0.0024 0.0050  0.0035  86  PRO A CD  
697  N N   . ALA A 91  ? 0.1771 0.1706 0.1643 -0.0035 0.0057  0.0024  87  ALA A N   
698  C CA  . ALA A 91  ? 0.1629 0.1551 0.1496 -0.0029 0.0060  0.0022  87  ALA A CA  
699  C C   . ALA A 91  ? 0.1788 0.1715 0.1658 -0.0020 0.0063  0.0026  87  ALA A C   
700  O O   . ALA A 91  ? 0.1697 0.1641 0.1575 -0.0019 0.0064  0.0032  87  ALA A O   
701  C CB  . ALA A 91  ? 0.1720 0.1638 0.1583 -0.0035 0.0063  0.0021  87  ALA A CB  
702  N N   . ARG A 92  ? 0.1536 0.1449 0.1400 -0.0014 0.0064  0.0024  88  ARG A N   
703  C CA  . ARG A 92  ? 0.1373 0.1281 0.1233 -0.0004 0.0068  0.0027  88  ARG A CA  
704  C C   . ARG A 92  ? 0.1873 0.1785 0.1733 0.0003  0.0070  0.0032  88  ARG A C   
705  O O   . ARG A 92  ? 0.1869 0.1780 0.1726 0.0012  0.0075  0.0036  88  ARG A O   
706  C CB  . ARG A 92  ? 0.1309 0.1223 0.1172 -0.0003 0.0073  0.0030  88  ARG A CB  
707  C CG  . ARG A 92  ? 0.2302 0.2206 0.2159 -0.0008 0.0073  0.0025  88  ARG A CG  
708  C CD  . ARG A 92  ? 0.2194 0.2103 0.2054 -0.0009 0.0078  0.0028  88  ARG A CD  
709  N NE  . ARG A 92  ? 0.2704 0.2629 0.2572 -0.0021 0.0077  0.0030  88  ARG A NE  
710  C CZ  . ARG A 92  ? 0.3335 0.3281 0.3214 -0.0024 0.0078  0.0036  88  ARG A CZ  
711  N NH1 . ARG A 92  ? 0.2117 0.2073 0.2001 -0.0014 0.0081  0.0042  88  ARG A NH1 
712  N NH2 . ARG A 92  ? 0.2285 0.2243 0.2168 -0.0036 0.0076  0.0037  88  ARG A NH2 
713  N N   . VAL A 93  ? 0.1465 0.1380 0.1328 0.0000  0.0067  0.0031  89  VAL A N   
714  C CA  . VAL A 93  ? 0.1445 0.1359 0.1304 0.0008  0.0069  0.0035  89  VAL A CA  
715  C C   . VAL A 93  ? 0.1827 0.1717 0.1673 0.0009  0.0070  0.0030  89  VAL A C   
716  O O   . VAL A 93  ? 0.1921 0.1805 0.1767 0.0002  0.0066  0.0025  89  VAL A O   
717  C CB  . VAL A 93  ? 0.1795 0.1722 0.1660 0.0005  0.0066  0.0037  89  VAL A CB  
718  C CG1 . VAL A 93  ? 0.1899 0.1823 0.1758 0.0015  0.0070  0.0041  89  VAL A CG1 
719  C CG2 . VAL A 93  ? 0.1767 0.1719 0.1644 0.0000  0.0064  0.0040  89  VAL A CG2 
720  N N   . PRO A 94  ? 0.1514 0.1389 0.1347 0.0018  0.0075  0.0032  90  PRO A N   
721  C CA  . PRO A 94  ? 0.1489 0.1340 0.1308 0.0017  0.0075  0.0027  90  PRO A CA  
722  C C   . PRO A 94  ? 0.1757 0.1606 0.1576 0.0015  0.0075  0.0027  90  PRO A C   
723  O O   . PRO A 94  ? 0.1733 0.1592 0.1555 0.0021  0.0077  0.0033  90  PRO A O   
724  C CB  . PRO A 94  ? 0.1624 0.1459 0.1427 0.0029  0.0082  0.0032  90  PRO A CB  
725  C CG  . PRO A 94  ? 0.2059 0.1912 0.1871 0.0035  0.0085  0.0038  90  PRO A CG  
726  C CD  . PRO A 94  ? 0.1599 0.1479 0.1429 0.0030  0.0081  0.0040  90  PRO A CD  
727  N N   . HIS A 95  ? 0.1252 0.1093 0.1070 0.0006  0.0071  0.0021  91  HIS A N   
728  C CA  . HIS A 95  ? 0.1259 0.1097 0.1077 0.0002  0.0071  0.0021  91  HIS A CA  
729  C C   . HIS A 95  ? 0.1689 0.1508 0.1497 -0.0005 0.0071  0.0016  91  HIS A C   
730  O O   . HIS A 95  ? 0.1547 0.1364 0.1355 -0.0011 0.0067  0.0011  91  HIS A O   
731  C CB  . HIS A 95  ? 0.1339 0.1197 0.1173 -0.0003 0.0066  0.0021  91  HIS A CB  
732  C CG  . HIS A 95  ? 0.1495 0.1357 0.1335 -0.0011 0.0061  0.0016  91  HIS A CG  
733  N ND1 . HIS A 95  ? 0.1721 0.1590 0.1564 -0.0010 0.0060  0.0016  91  HIS A ND1 
734  C CD2 . HIS A 95  ? 0.1595 0.1456 0.1437 -0.0018 0.0058  0.0012  91  HIS A CD2 
735  C CE1 . HIS A 95  ? 0.1680 0.1549 0.1525 -0.0015 0.0057  0.0011  91  HIS A CE1 
736  N NE2 . HIS A 95  ? 0.1638 0.1505 0.1483 -0.0020 0.0055  0.0009  91  HIS A NE2 
737  N N   . SER A 96  ? 0.1501 0.1308 0.1300 -0.0004 0.0075  0.0017  92  SER A N   
738  C CA  . SER A 96  ? 0.1447 0.1233 0.1234 -0.0013 0.0076  0.0012  92  SER A CA  
739  C C   . SER A 96  ? 0.1976 0.1765 0.1769 -0.0016 0.0077  0.0013  92  SER A C   
740  O O   . SER A 96  ? 0.1900 0.1681 0.1685 -0.0009 0.0083  0.0017  92  SER A O   
741  C CB  . SER A 96  ? 0.1791 0.1549 0.1554 -0.0007 0.0083  0.0013  92  SER A CB  
742  O OG  . SER A 96  ? 0.2117 0.1852 0.1865 -0.0018 0.0084  0.0008  92  SER A OG  
743  N N   . PRO A 97  ? 0.1868 0.1670 0.1674 -0.0026 0.0071  0.0010  93  PRO A N   
744  C CA  . PRO A 97  ? 0.1930 0.1736 0.1742 -0.0028 0.0072  0.0012  93  PRO A CA  
745  C C   . PRO A 97  ? 0.2404 0.2188 0.2202 -0.0035 0.0077  0.0010  93  PRO A C   
746  O O   . PRO A 97  ? 0.2357 0.2133 0.2150 -0.0045 0.0076  0.0005  93  PRO A O   
747  C CB  . PRO A 97  ? 0.2171 0.1998 0.1999 -0.0033 0.0066  0.0010  93  PRO A CB  
748  C CG  . PRO A 97  ? 0.2780 0.2609 0.2608 -0.0039 0.0062  0.0006  93  PRO A CG  
749  C CD  . PRO A 97  ? 0.2175 0.1990 0.1990 -0.0033 0.0064  0.0006  93  PRO A CD  
750  N N   . GLN A 98  ? 0.1975 0.1751 0.1767 -0.0030 0.0083  0.0014  94  GLN A N   
751  C CA  . GLN A 98  ? 0.1845 0.1598 0.1623 -0.0035 0.0090  0.0013  94  GLN A CA  
752  C C   . GLN A 98  ? 0.2235 0.2000 0.2026 -0.0039 0.0089  0.0014  94  GLN A C   
753  O O   . GLN A 98  ? 0.1981 0.1756 0.1779 -0.0030 0.0089  0.0018  94  GLN A O   
754  C CB  . GLN A 98  ? 0.1960 0.1690 0.1717 -0.0023 0.0100  0.0017  94  GLN A CB  
755  C CG  . GLN A 98  ? 0.2011 0.1732 0.1755 -0.0014 0.0102  0.0018  94  GLN A CG  
756  C CD  . GLN A 98  ? 0.2707 0.2413 0.2441 -0.0024 0.0100  0.0012  94  GLN A CD  
757  O OE1 . GLN A 98  ? 0.2234 0.1918 0.1954 -0.0036 0.0103  0.0008  94  GLN A OE1 
758  N NE2 . GLN A 98  ? 0.2055 0.1774 0.1797 -0.0022 0.0094  0.0011  94  GLN A NE2 
759  N N   . ARG A 99  ? 0.1858 0.1623 0.1653 -0.0054 0.0088  0.0011  95  ARG A N   
760  C CA  . ARG A 99  ? 0.1832 0.1609 0.1640 -0.0057 0.0088  0.0013  95  ARG A CA  
761  C C   . ARG A 99  ? 0.2326 0.2082 0.2122 -0.0066 0.0096  0.0013  95  ARG A C   
762  O O   . ARG A 99  ? 0.1985 0.1722 0.1766 -0.0076 0.0099  0.0009  95  ARG A O   
763  C CB  . ARG A 99  ? 0.1841 0.1645 0.1667 -0.0063 0.0080  0.0012  95  ARG A CB  
764  C CG  . ARG A 99  ? 0.2454 0.2275 0.2289 -0.0053 0.0074  0.0013  95  ARG A CG  
765  C CD  . ARG A 99  ? 0.2188 0.2033 0.2038 -0.0056 0.0068  0.0013  95  ARG A CD  
766  N NE  . ARG A 99  ? 0.1916 0.1771 0.1770 -0.0048 0.0063  0.0014  95  ARG A NE  
767  C CZ  . ARG A 99  ? 0.2753 0.2612 0.2609 -0.0040 0.0063  0.0017  95  ARG A CZ  
768  N NH1 . ARG A 99  ? 0.1597 0.1453 0.1453 -0.0038 0.0067  0.0020  95  ARG A NH1 
769  N NH2 . ARG A 99  ? 0.1949 0.1816 0.1808 -0.0036 0.0060  0.0017  95  ARG A NH2 
770  N N   . PHE A 100 ? 0.2161 0.1920 0.1961 -0.0063 0.0100  0.0017  96  PHE A N   
771  C CA  . PHE A 100 ? 0.2209 0.1948 0.1999 -0.0070 0.0109  0.0018  96  PHE A CA  
772  C C   . PHE A 100 ? 0.2433 0.2191 0.2240 -0.0081 0.0107  0.0019  96  PHE A C   
773  O O   . PHE A 100 ? 0.2041 0.1827 0.1866 -0.0079 0.0100  0.0021  96  PHE A O   
774  C CB  . PHE A 100 ? 0.2699 0.2423 0.2477 -0.0053 0.0117  0.0023  96  PHE A CB  
775  C CG  . PHE A 100 ? 0.3210 0.2920 0.2972 -0.0041 0.0119  0.0023  96  PHE A CG  
776  C CD1 . PHE A 100 ? 0.3961 0.3638 0.3698 -0.0043 0.0128  0.0021  96  PHE A CD1 
777  C CD2 . PHE A 100 ? 0.3825 0.3555 0.3597 -0.0029 0.0113  0.0025  96  PHE A CD2 
778  C CE1 . PHE A 100 ? 0.4312 0.3976 0.4033 -0.0030 0.0131  0.0023  96  PHE A CE1 
779  C CE2 . PHE A 100 ? 0.4332 0.4052 0.4090 -0.0018 0.0115  0.0026  96  PHE A CE2 
780  C CZ  . PHE A 100 ? 0.4225 0.3913 0.3958 -0.0018 0.0124  0.0025  96  PHE A CZ  
781  N N   . ALA A 101 ? 0.2140 0.1882 0.1939 -0.0094 0.0114  0.0019  97  ALA A N   
782  C CA  . ALA A 101 ? 0.2033 0.1795 0.1848 -0.0106 0.0114  0.0021  97  ALA A CA  
783  C C   . ALA A 101 ? 0.2358 0.2136 0.2186 -0.0093 0.0114  0.0028  97  ALA A C   
784  O O   . ALA A 101 ? 0.2198 0.1961 0.2016 -0.0078 0.0119  0.0030  97  ALA A O   
785  C CB  . ALA A 101 ? 0.2179 0.1916 0.1979 -0.0121 0.0124  0.0020  97  ALA A CB  
786  N N   . ASN A 102 ? 0.1737 0.1544 0.1585 -0.0097 0.0110  0.0031  98  ASN A N   
787  C CA  . ASN A 102 ? 0.1911 0.1733 0.1770 -0.0086 0.0111  0.0037  98  ASN A CA  
788  C C   . ASN A 102 ? 0.2445 0.2269 0.2303 -0.0068 0.0107  0.0039  98  ASN A C   
789  O O   . ASN A 102 ? 0.2524 0.2345 0.2380 -0.0056 0.0110  0.0043  98  ASN A O   
790  C CB  . ASN A 102 ? 0.1911 0.1713 0.1761 -0.0085 0.0123  0.0041  98  ASN A CB  
791  C CG  . ASN A 102 ? 0.4745 0.4537 0.4591 -0.0106 0.0129  0.0039  98  ASN A CG  
792  O OD1 . ASN A 102 ? 0.4216 0.3975 0.4042 -0.0109 0.0137  0.0037  98  ASN A OD1 
793  N ND2 . ASN A 102 ? 0.3433 0.3252 0.3296 -0.0120 0.0125  0.0040  98  ASN A ND2 
794  N N   . THR A 103 ? 0.1647 0.1476 0.1504 -0.0066 0.0099  0.0034  99  THR A N   
795  C CA  . THR A 103 ? 0.1690 0.1523 0.1547 -0.0052 0.0095  0.0035  99  THR A CA  
796  C C   . THR A 103 ? 0.2120 0.1976 0.1989 -0.0052 0.0087  0.0035  99  THR A C   
797  O O   . THR A 103 ? 0.2030 0.1899 0.1906 -0.0062 0.0084  0.0033  99  THR A O   
798  C CB  . THR A 103 ? 0.2510 0.2327 0.2354 -0.0047 0.0094  0.0031  99  THR A CB  
799  O OG1 . THR A 103 ? 0.2481 0.2300 0.2326 -0.0056 0.0090  0.0026  99  THR A OG1 
800  C CG2 . THR A 103 ? 0.2117 0.1909 0.1946 -0.0043 0.0103  0.0032  99  THR A CG2 
801  N N   . VAL A 104 ? 0.1659 0.1521 0.1528 -0.0041 0.0083  0.0037  100 VAL A N   
802  C CA  . VAL A 104 ? 0.1681 0.1560 0.1556 -0.0039 0.0077  0.0037  100 VAL A CA  
803  C C   . VAL A 104 ? 0.2048 0.1921 0.1916 -0.0032 0.0073  0.0035  100 VAL A C   
804  O O   . VAL A 104 ? 0.1895 0.1760 0.1757 -0.0024 0.0074  0.0037  100 VAL A O   
805  C CB  . VAL A 104 ? 0.2197 0.2089 0.2077 -0.0035 0.0079  0.0043  100 VAL A CB  
806  C CG1 . VAL A 104 ? 0.2092 0.1999 0.1975 -0.0032 0.0074  0.0043  100 VAL A CG1 
807  C CG2 . VAL A 104 ? 0.2110 0.2012 0.2000 -0.0044 0.0083  0.0046  100 VAL A CG2 
808  N N   . GLY A 105 ? 0.1653 0.1532 0.1523 -0.0034 0.0069  0.0031  101 GLY A N   
809  C CA  . GLY A 105 ? 0.1737 0.1615 0.1602 -0.0029 0.0065  0.0029  101 GLY A CA  
810  C C   . GLY A 105 ? 0.2259 0.2147 0.2126 -0.0028 0.0061  0.0029  101 GLY A C   
811  O O   . GLY A 105 ? 0.2143 0.2040 0.2014 -0.0032 0.0060  0.0029  101 GLY A O   
812  N N   . LEU A 106 ? 0.1626 0.1510 0.1486 -0.0023 0.0059  0.0029  102 LEU A N   
813  C CA  . LEU A 106 ? 0.1526 0.1414 0.1382 -0.0022 0.0057  0.0029  102 LEU A CA  
814  C C   . LEU A 106 ? 0.1698 0.1585 0.1554 -0.0025 0.0054  0.0024  102 LEU A C   
815  O O   . LEU A 106 ? 0.1517 0.1401 0.1373 -0.0024 0.0053  0.0024  102 LEU A O   
816  C CB  . LEU A 106 ? 0.1506 0.1386 0.1351 -0.0017 0.0057  0.0031  102 LEU A CB  
817  C CG  . LEU A 106 ? 0.2086 0.1963 0.1922 -0.0016 0.0055  0.0030  102 LEU A CG  
818  C CD1 . LEU A 106 ? 0.2039 0.1922 0.1874 -0.0013 0.0057  0.0031  102 LEU A CD1 
819  C CD2 . LEU A 106 ? 0.2091 0.1955 0.1912 -0.0014 0.0055  0.0031  102 LEU A CD2 
820  N N   . VAL A 107 ? 0.1536 0.1428 0.1393 -0.0026 0.0053  0.0022  103 VAL A N   
821  C CA  . VAL A 107 ? 0.1599 0.1490 0.1455 -0.0027 0.0051  0.0019  103 VAL A CA  
822  C C   . VAL A 107 ? 0.1941 0.1832 0.1790 -0.0025 0.0051  0.0019  103 VAL A C   
823  O O   . VAL A 107 ? 0.1712 0.1609 0.1561 -0.0022 0.0052  0.0021  103 VAL A O   
824  C CB  . VAL A 107 ? 0.2193 0.2087 0.2055 -0.0030 0.0050  0.0016  103 VAL A CB  
825  C CG1 . VAL A 107 ? 0.2147 0.2038 0.2006 -0.0030 0.0049  0.0014  103 VAL A CG1 
826  C CG2 . VAL A 107 ? 0.2187 0.2075 0.2051 -0.0032 0.0052  0.0016  103 VAL A CG2 
827  N N   . VAL A 108 ? 0.1562 0.1447 0.1405 -0.0025 0.0050  0.0018  104 VAL A N   
828  C CA  . VAL A 108 ? 0.1377 0.1256 0.1209 -0.0023 0.0052  0.0018  104 VAL A CA  
829  C C   . VAL A 108 ? 0.1810 0.1691 0.1644 -0.0025 0.0051  0.0015  104 VAL A C   
830  O O   . VAL A 108 ? 0.1973 0.1854 0.1810 -0.0029 0.0050  0.0014  104 VAL A O   
831  C CB  . VAL A 108 ? 0.1810 0.1678 0.1628 -0.0023 0.0053  0.0019  104 VAL A CB  
832  C CG1 . VAL A 108 ? 0.1730 0.1588 0.1533 -0.0021 0.0056  0.0019  104 VAL A CG1 
833  C CG2 . VAL A 108 ? 0.1741 0.1606 0.1555 -0.0019 0.0054  0.0023  104 VAL A CG2 
834  N N   . GLU A 109 ? 0.1371 0.1252 0.1201 -0.0022 0.0053  0.0014  105 GLU A N   
835  C CA  . GLU A 109 ? 0.1519 0.1399 0.1348 -0.0022 0.0053  0.0011  105 GLU A CA  
836  C C   . GLU A 109 ? 0.1974 0.1847 0.1789 -0.0017 0.0057  0.0012  105 GLU A C   
837  O O   . GLU A 109 ? 0.2033 0.1904 0.1841 -0.0013 0.0059  0.0014  105 GLU A O   
838  C CB  . GLU A 109 ? 0.1780 0.1667 0.1619 -0.0023 0.0051  0.0009  105 GLU A CB  
839  C CG  . GLU A 109 ? 0.3215 0.3110 0.3059 -0.0022 0.0050  0.0009  105 GLU A CG  
840  C CD  . GLU A 109 ? 0.4428 0.4324 0.4277 -0.0024 0.0048  0.0006  105 GLU A CD  
841  O OE1 . GLU A 109 ? 0.3637 0.3531 0.3491 -0.0028 0.0047  0.0006  105 GLU A OE1 
842  O OE2 . GLU A 109 ? 0.3042 0.2937 0.2888 -0.0022 0.0047  0.0004  105 GLU A OE2 
843  N N   . ARG A 110 ? 0.1626 0.1495 0.1438 -0.0016 0.0059  0.0010  106 ARG A N   
844  C CA  . ARG A 110 ? 0.1625 0.1485 0.1421 -0.0010 0.0063  0.0010  106 ARG A CA  
845  C C   . ARG A 110 ? 0.2004 0.1871 0.1801 -0.0004 0.0064  0.0009  106 ARG A C   
846  O O   . ARG A 110 ? 0.1901 0.1774 0.1708 -0.0006 0.0060  0.0007  106 ARG A O   
847  C CB  . ARG A 110 ? 0.1962 0.1805 0.1743 -0.0014 0.0068  0.0010  106 ARG A CB  
848  C CG  . ARG A 110 ? 0.1983 0.1828 0.1772 -0.0019 0.0067  0.0008  106 ARG A CG  
849  C CD  . ARG A 110 ? 0.1580 0.1407 0.1353 -0.0023 0.0073  0.0007  106 ARG A CD  
850  N NE  . ARG A 110 ? 0.1954 0.1785 0.1735 -0.0029 0.0073  0.0006  106 ARG A NE  
851  C CZ  . ARG A 110 ? 0.3210 0.3046 0.2997 -0.0025 0.0074  0.0006  106 ARG A CZ  
852  N NH1 . ARG A 110 ? 0.1991 0.1827 0.1775 -0.0015 0.0075  0.0005  106 ARG A NH1 
853  N NH2 . ARG A 110 ? 0.2201 0.2041 0.1995 -0.0031 0.0075  0.0006  106 ARG A NH2 
854  N N   . ARG A 111 ? 0.1706 0.1568 0.1488 0.0005  0.0068  0.0010  107 ARG A N   
855  C CA  . ARG A 111 ? 0.1579 0.1445 0.1358 0.0013  0.0069  0.0009  107 ARG A CA  
856  C C   . ARG A 111 ? 0.1886 0.1742 0.1664 0.0009  0.0071  0.0006  107 ARG A C   
857  O O   . ARG A 111 ? 0.1797 0.1639 0.1567 0.0004  0.0075  0.0006  107 ARG A O   
858  C CB  . ARG A 111 ? 0.1696 0.1554 0.1454 0.0024  0.0076  0.0013  107 ARG A CB  
859  C CG  . ARG A 111 ? 0.2429 0.2291 0.2180 0.0035  0.0079  0.0012  107 ARG A CG  
860  C CD  . ARG A 111 ? 0.2860 0.2709 0.2586 0.0047  0.0088  0.0016  107 ARG A CD  
861  N NE  . ARG A 111 ? 0.3404 0.3271 0.3131 0.0056  0.0087  0.0021  107 ARG A NE  
862  C CZ  . ARG A 111 ? 0.4757 0.4615 0.4466 0.0065  0.0094  0.0026  107 ARG A CZ  
863  N NH1 . ARG A 111 ? 0.2320 0.2146 0.2004 0.0066  0.0102  0.0026  107 ARG A NH1 
864  N NH2 . ARG A 111 ? 0.3288 0.3167 0.3000 0.0074  0.0093  0.0032  107 ARG A NH2 
865  N N   . ARG A 112 ? 0.1646 0.1509 0.1430 0.0012  0.0068  0.0004  108 ARG A N   
866  C CA  . ARG A 112 ? 0.1797 0.1652 0.1580 0.0010  0.0071  0.0002  108 ARG A CA  
867  C C   . ARG A 112 ? 0.2237 0.2078 0.2002 0.0018  0.0078  0.0003  108 ARG A C   
868  O O   . ARG A 112 ? 0.2062 0.1904 0.1816 0.0028  0.0080  0.0004  108 ARG A O   
869  C CB  . ARG A 112 ? 0.1822 0.1686 0.1615 0.0010  0.0066  0.0000  108 ARG A CB  
870  C CG  . ARG A 112 ? 0.2015 0.1889 0.1822 0.0004  0.0059  -0.0001 108 ARG A CG  
871  C CD  . ARG A 112 ? 0.2001 0.1874 0.1816 -0.0004 0.0058  0.0001  108 ARG A CD  
872  N NE  . ARG A 112 ? 0.2355 0.2234 0.2180 -0.0009 0.0054  0.0000  108 ARG A NE  
873  C CZ  . ARG A 112 ? 0.3471 0.3356 0.3303 -0.0013 0.0051  0.0001  108 ARG A CZ  
874  N NH1 . ARG A 112 ? 0.2461 0.2346 0.2292 -0.0014 0.0053  0.0003  108 ARG A NH1 
875  N NH2 . ARG A 112 ? 0.2107 0.1993 0.1945 -0.0017 0.0049  0.0000  108 ARG A NH2 
876  N N   . LEU A 113 ? 0.1835 0.1664 0.1597 0.0014  0.0082  0.0002  109 LEU A N   
877  C CA  . LEU A 113 ? 0.1800 0.1614 0.1544 0.0021  0.0091  0.0002  109 LEU A CA  
878  C C   . LEU A 113 ? 0.2193 0.2014 0.1939 0.0031  0.0089  0.0001  109 LEU A C   
879  O O   . LEU A 113 ? 0.1884 0.1717 0.1645 0.0028  0.0082  -0.0001 109 LEU A O   
880  C CB  . LEU A 113 ? 0.1799 0.1601 0.1542 0.0012  0.0096  0.0003  109 LEU A CB  
881  C CG  . LEU A 113 ? 0.2429 0.2221 0.2166 0.0001  0.0098  0.0004  109 LEU A CG  
882  C CD1 . LEU A 113 ? 0.2319 0.2104 0.2055 -0.0009 0.0102  0.0004  109 LEU A CD1 
883  C CD2 . LEU A 113 ? 0.2868 0.2643 0.2581 0.0008  0.0104  0.0005  109 LEU A CD2 
884  N N   . GLU A 114 ? 0.2143 0.1955 0.1872 0.0042  0.0095  0.0001  110 GLU A N   
885  C CA  . GLU A 114 ? 0.2221 0.2040 0.1950 0.0052  0.0092  -0.0001 110 GLU A CA  
886  C C   . GLU A 114 ? 0.2430 0.2245 0.2167 0.0048  0.0092  -0.0002 110 GLU A C   
887  O O   . GLU A 114 ? 0.2373 0.2193 0.2111 0.0054  0.0088  -0.0005 110 GLU A O   
888  C CB  . GLU A 114 ? 0.2518 0.2326 0.2225 0.0067  0.0100  0.0000  110 GLU A CB  
889  N N   . THR A 115 ? 0.1859 0.1665 0.1599 0.0039  0.0096  -0.0001 111 THR A N   
890  C CA  . THR A 115 ? 0.2036 0.1840 0.1784 0.0037  0.0097  0.0000  111 THR A CA  
891  C C   . THR A 115 ? 0.2481 0.2299 0.2247 0.0030  0.0089  0.0000  111 THR A C   
892  O O   . THR A 115 ? 0.2562 0.2380 0.2332 0.0032  0.0089  0.0000  111 THR A O   
893  C CB  . THR A 115 ? 0.2389 0.2183 0.2135 0.0030  0.0105  0.0003  111 THR A CB  
894  O OG1 . THR A 115 ? 0.2313 0.2110 0.2062 0.0019  0.0104  0.0003  111 THR A OG1 
895  C CG2 . THR A 115 ? 0.2568 0.2343 0.2293 0.0037  0.0116  0.0003  111 THR A CG2 
896  N N   . GLU A 116 ? 0.1766 0.1593 0.1540 0.0023  0.0084  0.0000  112 GLU A N   
897  C CA  . GLU A 116 ? 0.1537 0.1374 0.1326 0.0016  0.0078  0.0000  112 GLU A CA  
898  C C   . GLU A 116 ? 0.2020 0.1863 0.1812 0.0019  0.0072  -0.0002 112 GLU A C   
899  O O   . GLU A 116 ? 0.2257 0.2104 0.2045 0.0021  0.0068  -0.0005 112 GLU A O   
900  C CB  . GLU A 116 ? 0.1486 0.1329 0.1280 0.0008  0.0076  0.0001  112 GLU A CB  
901  C CG  . GLU A 116 ? 0.2031 0.1869 0.1824 0.0001  0.0081  0.0003  112 GLU A CG  
902  C CD  . GLU A 116 ? 0.3532 0.3370 0.3324 -0.0007 0.0079  0.0004  112 GLU A CD  
903  O OE1 . GLU A 116 ? 0.1996 0.1837 0.1787 -0.0004 0.0076  0.0003  112 GLU A OE1 
904  O OE2 . GLU A 116 ? 0.2764 0.2603 0.2559 -0.0016 0.0081  0.0006  112 GLU A OE2 
905  N N   . LEU A 117 ? 0.1937 0.1778 0.1734 0.0017  0.0071  -0.0001 113 LEU A N   
906  C CA  . LEU A 117 ? 0.1969 0.1810 0.1765 0.0018  0.0065  -0.0004 113 LEU A CA  
907  C C   . LEU A 117 ? 0.2257 0.2104 0.2063 0.0010  0.0062  -0.0003 113 LEU A C   
908  O O   . LEU A 117 ? 0.2272 0.2121 0.2084 0.0007  0.0064  0.0001  113 LEU A O   
909  C CB  . LEU A 117 ? 0.2098 0.1928 0.1887 0.0024  0.0068  -0.0003 113 LEU A CB  
910  C CG  . LEU A 117 ? 0.2896 0.2718 0.2672 0.0033  0.0070  -0.0006 113 LEU A CG  
911  C CD1 . LEU A 117 ? 0.3223 0.3033 0.2992 0.0041  0.0074  -0.0003 113 LEU A CD1 
912  C CD2 . LEU A 117 ? 0.2986 0.2810 0.2755 0.0033  0.0062  -0.0011 113 LEU A CD2 
913  N N   . ASP A 118 ? 0.1841 0.1689 0.1645 0.0007  0.0056  -0.0006 114 ASP A N   
914  C CA  . ASP A 118 ? 0.1676 0.1526 0.1486 0.0000  0.0054  -0.0006 114 ASP A CA  
915  C C   . ASP A 118 ? 0.2097 0.1933 0.1897 0.0002  0.0053  -0.0007 114 ASP A C   
916  O O   . ASP A 118 ? 0.1928 0.1757 0.1718 0.0005  0.0052  -0.0010 114 ASP A O   
917  C CB  . ASP A 118 ? 0.1768 0.1628 0.1583 -0.0006 0.0049  -0.0008 114 ASP A CB  
918  C CG  . ASP A 118 ? 0.1833 0.1702 0.1656 -0.0008 0.0050  -0.0005 114 ASP A CG  
919  O OD1 . ASP A 118 ? 0.1924 0.1793 0.1745 -0.0004 0.0053  -0.0004 114 ASP A OD1 
920  O OD2 . ASP A 118 ? 0.2475 0.2348 0.2303 -0.0013 0.0048  -0.0005 114 ASP A OD2 
921  N N   . GLY A 119 ? 0.1652 0.1482 0.1453 0.0000  0.0055  -0.0005 115 GLY A N   
922  C CA  . GLY A 119 ? 0.1731 0.1544 0.1518 0.0001  0.0056  -0.0006 115 GLY A CA  
923  C C   . GLY A 119 ? 0.2235 0.2043 0.2021 -0.0006 0.0055  -0.0007 115 GLY A C   
924  O O   . GLY A 119 ? 0.2021 0.1840 0.1818 -0.0009 0.0054  -0.0005 115 GLY A O   
925  N N   . LEU A 120 ? 0.1631 0.1420 0.1400 -0.0008 0.0054  -0.0010 116 LEU A N   
926  C CA  . LEU A 120 ? 0.1681 0.1457 0.1442 -0.0015 0.0055  -0.0011 116 LEU A CA  
927  C C   . LEU A 120 ? 0.2187 0.1935 0.1925 -0.0008 0.0060  -0.0010 116 LEU A C   
928  O O   . LEU A 120 ? 0.1968 0.1702 0.1691 -0.0006 0.0059  -0.0013 116 LEU A O   
929  C CB  . LEU A 120 ? 0.1728 0.1506 0.1487 -0.0028 0.0048  -0.0018 116 LEU A CB  
930  C CG  . LEU A 120 ? 0.2317 0.2089 0.2076 -0.0037 0.0049  -0.0018 116 LEU A CG  
931  C CD1 . LEU A 120 ? 0.2038 0.1831 0.1817 -0.0037 0.0050  -0.0014 116 LEU A CD1 
932  C CD2 . LEU A 120 ? 0.2706 0.2475 0.2457 -0.0052 0.0043  -0.0024 116 LEU A CD2 
933  N N   . ARG A 121 ? 0.1868 0.1608 0.1603 -0.0003 0.0067  -0.0005 117 ARG A N   
934  C CA  . ARG A 121 ? 0.1782 0.1494 0.1492 0.0006  0.0074  -0.0001 117 ARG A CA  
935  C C   . ARG A 121 ? 0.1925 0.1615 0.1619 0.0002  0.0078  -0.0002 117 ARG A C   
936  O O   . ARG A 121 ? 0.1698 0.1398 0.1404 -0.0002 0.0079  0.0000  117 ARG A O   
937  C CB  . ARG A 121 ? 0.1917 0.1639 0.1634 0.0021  0.0081  0.0008  117 ARG A CB  
938  C CG  . ARG A 121 ? 0.2524 0.2259 0.2250 0.0027  0.0080  0.0009  117 ARG A CG  
939  C CD  . ARG A 121 ? 0.1754 0.1499 0.1485 0.0041  0.0087  0.0019  117 ARG A CD  
940  N NE  . ARG A 121 ? 0.1713 0.1457 0.1442 0.0049  0.0089  0.0020  117 ARG A NE  
941  C CZ  . ARG A 121 ? 0.3043 0.2800 0.2779 0.0059  0.0095  0.0028  117 ARG A CZ  
942  N NH1 . ARG A 121 ? 0.2241 0.2016 0.1988 0.0064  0.0099  0.0036  117 ARG A NH1 
943  N NH2 . ARG A 121 ? 0.3076 0.2829 0.2807 0.0066  0.0097  0.0029  117 ARG A NH2 
944  N N   . TYR A 122 ? 0.1638 0.1293 0.1301 0.0004  0.0083  -0.0003 118 TYR A N   
945  C CA  . TYR A 122 ? 0.1594 0.1219 0.1233 0.0004  0.0090  -0.0002 118 TYR A CA  
946  C C   . TYR A 122 ? 0.2191 0.1797 0.1810 0.0024  0.0101  0.0007  118 TYR A C   
947  O O   . TYR A 122 ? 0.2244 0.1847 0.1857 0.0032  0.0102  0.0008  118 TYR A O   
948  C CB  . TYR A 122 ? 0.1737 0.1330 0.1350 -0.0011 0.0088  -0.0011 118 TYR A CB  
949  C CG  . TYR A 122 ? 0.1835 0.1448 0.1466 -0.0031 0.0079  -0.0018 118 TYR A CG  
950  C CD1 . TYR A 122 ? 0.2131 0.1767 0.1778 -0.0039 0.0068  -0.0023 118 TYR A CD1 
951  C CD2 . TYR A 122 ? 0.1902 0.1510 0.1533 -0.0041 0.0081  -0.0018 118 TYR A CD2 
952  C CE1 . TYR A 122 ? 0.1895 0.1552 0.1559 -0.0056 0.0060  -0.0028 118 TYR A CE1 
953  C CE2 . TYR A 122 ? 0.1994 0.1622 0.1643 -0.0059 0.0073  -0.0024 118 TYR A CE2 
954  C CZ  . TYR A 122 ? 0.2182 0.1834 0.1846 -0.0066 0.0062  -0.0028 118 TYR A CZ  
955  O OH  . TYR A 122 ? 0.2126 0.1800 0.1806 -0.0083 0.0055  -0.0033 118 TYR A OH  
956  N N   . TYR A 123 ? 0.2010 0.1606 0.1620 0.0033  0.0110  0.0013  119 TYR A N   
957  C CA  . TYR A 123 ? 0.2142 0.1724 0.1733 0.0054  0.0121  0.0023  119 TYR A CA  
958  C C   . TYR A 123 ? 0.2592 0.2124 0.2139 0.0058  0.0131  0.0023  119 TYR A C   
959  O O   . TYR A 123 ? 0.2496 0.2008 0.2031 0.0043  0.0130  0.0016  119 TYR A O   
960  C CB  . TYR A 123 ? 0.2180 0.1795 0.1794 0.0067  0.0125  0.0033  119 TYR A CB  
961  C CG  . TYR A 123 ? 0.2232 0.1893 0.1885 0.0064  0.0117  0.0034  119 TYR A CG  
962  C CD1 . TYR A 123 ? 0.2564 0.2248 0.2242 0.0049  0.0107  0.0028  119 TYR A CD1 
963  C CD2 . TYR A 123 ? 0.2197 0.1874 0.1858 0.0076  0.0119  0.0040  119 TYR A CD2 
964  C CE1 . TYR A 123 ? 0.2553 0.2273 0.2262 0.0045  0.0100  0.0028  119 TYR A CE1 
965  C CE2 . TYR A 123 ? 0.2262 0.1977 0.1956 0.0071  0.0112  0.0040  119 TYR A CE2 
966  C CZ  . TYR A 123 ? 0.2902 0.2635 0.2617 0.0056  0.0103  0.0034  119 TYR A CZ  
967  O OH  . TYR A 123 ? 0.3211 0.2976 0.2953 0.0051  0.0097  0.0033  119 TYR A OH  
968  N N   . VAL A 124 ? 0.2343 0.1853 0.1864 0.0077  0.0142  0.0031  120 VAL A N   
969  C CA  . VAL A 124 ? 0.2617 0.2073 0.2089 0.0085  0.0154  0.0033  120 VAL A CA  
970  C C   . VAL A 124 ? 0.3613 0.3069 0.3081 0.0094  0.0163  0.0040  120 VAL A C   
971  O O   . VAL A 124 ? 0.3513 0.2996 0.2996 0.0113  0.0168  0.0051  120 VAL A O   
972  C CB  . VAL A 124 ? 0.3049 0.2482 0.2493 0.0105  0.0163  0.0040  120 VAL A CB  
973  C CG1 . VAL A 124 ? 0.3266 0.2640 0.2655 0.0116  0.0177  0.0043  120 VAL A CG1 
974  C CG2 . VAL A 124 ? 0.2944 0.2377 0.2391 0.0097  0.0153  0.0032  120 VAL A CG2 
975  N N   . GLY A 125 ? 0.3707 0.3136 0.3158 0.0080  0.0164  0.0034  121 GLY A N   
976  C CA  . GLY A 125 ? 0.3866 0.3291 0.3311 0.0089  0.0174  0.0040  121 GLY A CA  
977  C C   . GLY A 125 ? 0.4518 0.3999 0.4007 0.0096  0.0170  0.0047  121 GLY A C   
978  O O   . GLY A 125 ? 0.4451 0.3970 0.3979 0.0082  0.0157  0.0041  121 GLY A O   
979  N N   . ASP A 126 ? 0.4280 0.3766 0.3761 0.0120  0.0181  0.0059  122 ASP A N   
980  C CA  . ASP A 126 ? 0.4204 0.3742 0.3722 0.0129  0.0178  0.0067  122 ASP A CA  
981  C C   . ASP A 126 ? 0.4226 0.3802 0.3766 0.0143  0.0177  0.0076  122 ASP A C   
982  O O   . ASP A 126 ? 0.4222 0.3837 0.3784 0.0155  0.0177  0.0085  122 ASP A O   
983  C CB  . ASP A 126 ? 0.4503 0.4027 0.3999 0.0147  0.0192  0.0076  122 ASP A CB  
984  N N   . THR A 127 ? 0.3488 0.3053 0.3021 0.0142  0.0175  0.0073  123 THR A N   
985  C CA  . THR A 127 ? 0.3274 0.2870 0.2824 0.0155  0.0175  0.0082  123 THR A CA  
986  C C   . THR A 127 ? 0.3438 0.3073 0.3029 0.0138  0.0160  0.0075  123 THR A C   
987  O O   . THR A 127 ? 0.3424 0.3061 0.3029 0.0118  0.0150  0.0064  123 THR A O   
988  C CB  . THR A 127 ? 0.3849 0.3404 0.3360 0.0168  0.0184  0.0085  123 THR A CB  
989  O OG1 . THR A 127 ? 0.2732 0.2269 0.2242 0.0149  0.0174  0.0072  123 THR A OG1 
990  C CG2 . THR A 127 ? 0.4079 0.3582 0.3541 0.0181  0.0199  0.0089  123 THR A CG2 
991  N N   . MET A 128 ? 0.2696 0.2361 0.2305 0.0148  0.0160  0.0082  124 MET A N   
992  C CA  . MET A 128 ? 0.2579 0.2275 0.2221 0.0134  0.0148  0.0077  124 MET A CA  
993  C C   . MET A 128 ? 0.2673 0.2343 0.2300 0.0132  0.0147  0.0071  124 MET A C   
994  O O   . MET A 128 ? 0.2668 0.2361 0.2317 0.0124  0.0140  0.0068  124 MET A O   
995  C CB  . MET A 128 ? 0.2975 0.2720 0.2647 0.0143  0.0148  0.0087  124 MET A CB  
996  C CG  . MET A 128 ? 0.3547 0.3322 0.3235 0.0145  0.0148  0.0093  124 MET A CG  
997  S SD  . MET A 128 ? 0.4156 0.3931 0.3859 0.0122  0.0137  0.0080  124 MET A SD  
998  C CE  . MET A 128 ? 0.3800 0.3603 0.3512 0.0132  0.0140  0.0089  124 MET A CE  
999  N N   . ASP A 129 ? 0.2044 0.1668 0.1631 0.0138  0.0155  0.0070  125 ASP A N   
1000 C CA  . ASP A 129 ? 0.2126 0.1722 0.1694 0.0136  0.0153  0.0065  125 ASP A CA  
1001 C C   . ASP A 129 ? 0.2304 0.1894 0.1879 0.0112  0.0141  0.0050  125 ASP A C   
1002 O O   . ASP A 129 ? 0.2193 0.1771 0.1762 0.0101  0.0139  0.0044  125 ASP A O   
1003 C CB  . ASP A 129 ? 0.2538 0.2082 0.2057 0.0150  0.0165  0.0068  125 ASP A CB  
1004 C CG  . ASP A 129 ? 0.4518 0.4067 0.4026 0.0178  0.0179  0.0085  125 ASP A CG  
1005 O OD1 . ASP A 129 ? 0.4094 0.3691 0.3636 0.0185  0.0178  0.0093  125 ASP A OD1 
1006 O OD2 . ASP A 129 ? 0.5264 0.4769 0.4729 0.0193  0.0191  0.0089  125 ASP A OD2 
1007 N N   . VAL A 130 ? 0.2139 0.1740 0.1728 0.0104  0.0133  0.0044  126 VAL A N   
1008 C CA  . VAL A 130 ? 0.2104 0.1707 0.1702 0.0083  0.0121  0.0031  126 VAL A CA  
1009 C C   . VAL A 130 ? 0.2382 0.1938 0.1942 0.0077  0.0121  0.0023  126 VAL A C   
1010 O O   . VAL A 130 ? 0.2226 0.1757 0.1761 0.0087  0.0126  0.0025  126 VAL A O   
1011 C CB  . VAL A 130 ? 0.2482 0.2115 0.2108 0.0078  0.0113  0.0028  126 VAL A CB  
1012 C CG1 . VAL A 130 ? 0.2372 0.2008 0.2006 0.0058  0.0101  0.0016  126 VAL A CG1 
1013 C CG2 . VAL A 130 ? 0.2409 0.2084 0.2069 0.0082  0.0113  0.0036  126 VAL A CG2 
1014 N N   . LEU A 131 ? 0.1954 0.1500 0.1510 0.0059  0.0115  0.0014  127 LEU A N   
1015 C CA  . LEU A 131 ? 0.1913 0.1417 0.1434 0.0047  0.0113  0.0005  127 LEU A CA  
1016 C C   . LEU A 131 ? 0.2260 0.1777 0.1793 0.0031  0.0100  -0.0005 127 LEU A C   
1017 O O   . LEU A 131 ? 0.2176 0.1667 0.1683 0.0029  0.0098  -0.0011 127 LEU A O   
1018 C CB  . LEU A 131 ? 0.1977 0.1464 0.1487 0.0035  0.0115  0.0002  127 LEU A CB  
1019 C CG  . LEU A 131 ? 0.2298 0.1743 0.1773 0.0018  0.0113  -0.0008 127 LEU A CG  
1020 C CD1 . LEU A 131 ? 0.2383 0.1777 0.1809 0.0029  0.0122  -0.0007 127 LEU A CD1 
1021 C CD2 . LEU A 131 ? 0.2482 0.1916 0.1952 0.0006  0.0116  -0.0010 127 LEU A CD2 
1022 N N   . PHE A 132 ? 0.1830 0.1387 0.1399 0.0021  0.0092  -0.0008 128 PHE A N   
1023 C CA  . PHE A 132 ? 0.1802 0.1377 0.1385 0.0008  0.0079  -0.0017 128 PHE A CA  
1024 C C   . PHE A 132 ? 0.2025 0.1646 0.1648 0.0009  0.0075  -0.0014 128 PHE A C   
1025 O O   . PHE A 132 ? 0.1917 0.1555 0.1559 0.0010  0.0078  -0.0009 128 PHE A O   
1026 C CB  . PHE A 132 ? 0.2015 0.1581 0.1590 -0.0014 0.0073  -0.0026 128 PHE A CB  
1027 C CG  . PHE A 132 ? 0.2118 0.1707 0.1707 -0.0029 0.0060  -0.0034 128 PHE A CG  
1028 C CD1 . PHE A 132 ? 0.2243 0.1873 0.1867 -0.0035 0.0054  -0.0034 128 PHE A CD1 
1029 C CD2 . PHE A 132 ? 0.2355 0.1924 0.1920 -0.0036 0.0054  -0.0042 128 PHE A CD2 
1030 C CE1 . PHE A 132 ? 0.2281 0.1935 0.1918 -0.0046 0.0043  -0.0041 128 PHE A CE1 
1031 C CE2 . PHE A 132 ? 0.2709 0.2305 0.2288 -0.0049 0.0042  -0.0049 128 PHE A CE2 
1032 C CZ  . PHE A 132 ? 0.2408 0.2046 0.2023 -0.0053 0.0037  -0.0048 128 PHE A CZ  
1033 N N   . GLU A 133 ? 0.1451 0.1089 0.1086 0.0010  0.0069  -0.0017 129 GLU A N   
1034 C CA  . GLU A 133 ? 0.1552 0.1229 0.1221 0.0011  0.0066  -0.0014 129 GLU A CA  
1035 C C   . GLU A 133 ? 0.2189 0.1882 0.1866 0.0005  0.0057  -0.0021 129 GLU A C   
1036 O O   . GLU A 133 ? 0.2020 0.1697 0.1678 0.0008  0.0055  -0.0024 129 GLU A O   
1037 C CB  . GLU A 133 ? 0.1659 0.1346 0.1338 0.0027  0.0074  -0.0005 129 GLU A CB  
1038 C CG  . GLU A 133 ? 0.2464 0.2140 0.2130 0.0039  0.0077  -0.0004 129 GLU A CG  
1039 C CD  . GLU A 133 ? 0.3392 0.3081 0.3070 0.0053  0.0085  0.0006  129 GLU A CD  
1040 O OE1 . GLU A 133 ? 0.2981 0.2696 0.2683 0.0050  0.0085  0.0010  129 GLU A OE1 
1041 O OE2 . GLU A 133 ? 0.2873 0.2546 0.2535 0.0065  0.0091  0.0011  129 GLU A OE2 
1042 N N   . LYS A 134 ? 0.1689 0.1411 0.1390 -0.0001 0.0053  -0.0021 130 LYS A N   
1043 C CA  . LYS A 134 ? 0.1630 0.1370 0.1339 -0.0003 0.0046  -0.0026 130 LYS A CA  
1044 C C   . LYS A 134 ? 0.2141 0.1908 0.1874 0.0002  0.0047  -0.0021 130 LYS A C   
1045 O O   . LYS A 134 ? 0.2013 0.1790 0.1760 -0.0001 0.0049  -0.0018 130 LYS A O   
1046 C CB  . LYS A 134 ? 0.2014 0.1762 0.1723 -0.0018 0.0037  -0.0032 130 LYS A CB  
1047 C CG  . LYS A 134 ? 0.5457 0.5212 0.5159 -0.0019 0.0030  -0.0038 130 LYS A CG  
1048 C CD  . LYS A 134 ? 0.6608 0.6350 0.6292 -0.0034 0.0023  -0.0045 130 LYS A CD  
1049 C CE  . LYS A 134 ? 0.7650 0.7371 0.7309 -0.0030 0.0021  -0.0050 130 LYS A CE  
1050 N NZ  . LYS A 134 ? 0.8478 0.8161 0.8114 -0.0023 0.0029  -0.0047 130 LYS A NZ  
1051 N N   . TRP A 135 ? 0.1809 0.1582 0.1544 0.0010  0.0048  -0.0021 131 TRP A N   
1052 C CA  . TRP A 135 ? 0.1991 0.1784 0.1743 0.0014  0.0050  -0.0017 131 TRP A CA  
1053 C C   . TRP A 135 ? 0.2435 0.2244 0.2191 0.0013  0.0045  -0.0021 131 TRP A C   
1054 O O   . TRP A 135 ? 0.2223 0.2027 0.1966 0.0014  0.0041  -0.0025 131 TRP A O   
1055 C CB  . TRP A 135 ? 0.2064 0.1851 0.1815 0.0025  0.0058  -0.0012 131 TRP A CB  
1056 C CG  . TRP A 135 ? 0.2214 0.1993 0.1965 0.0028  0.0064  -0.0006 131 TRP A CG  
1057 C CD1 . TRP A 135 ? 0.2625 0.2382 0.2358 0.0032  0.0066  -0.0006 131 TRP A CD1 
1058 C CD2 . TRP A 135 ? 0.2122 0.1914 0.1889 0.0027  0.0067  -0.0001 131 TRP A CD2 
1059 N NE1 . TRP A 135 ? 0.2560 0.2318 0.2298 0.0034  0.0072  0.0001  131 TRP A NE1 
1060 C CE2 . TRP A 135 ? 0.2602 0.2383 0.2361 0.0031  0.0072  0.0004  131 TRP A CE2 
1061 C CE3 . TRP A 135 ? 0.2190 0.2001 0.1974 0.0022  0.0067  0.0001  131 TRP A CE3 
1062 C CZ2 . TRP A 135 ? 0.2419 0.2212 0.2191 0.0032  0.0076  0.0010  131 TRP A CZ2 
1063 C CZ3 . TRP A 135 ? 0.2280 0.2100 0.2074 0.0021  0.0070  0.0006  131 TRP A CZ3 
1064 C CH2 . TRP A 135 ? 0.2419 0.2232 0.2208 0.0027  0.0074  0.0011  131 TRP A CH2 
1065 N N   . PHE A 136 ? 0.1933 0.1759 0.1703 0.0010  0.0045  -0.0019 132 PHE A N   
1066 C CA  . PHE A 136 ? 0.1862 0.1704 0.1633 0.0011  0.0040  -0.0022 132 PHE A CA  
1067 C C   . PHE A 136 ? 0.2034 0.1888 0.1815 0.0014  0.0044  -0.0018 132 PHE A C   
1068 O O   . PHE A 136 ? 0.1919 0.1771 0.1707 0.0012  0.0048  -0.0014 132 PHE A O   
1069 C CB  . PHE A 136 ? 0.2086 0.1940 0.1861 0.0000  0.0033  -0.0025 132 PHE A CB  
1070 C CG  . PHE A 136 ? 0.2249 0.2106 0.2035 -0.0009 0.0033  -0.0023 132 PHE A CG  
1071 C CD1 . PHE A 136 ? 0.2488 0.2328 0.2270 -0.0013 0.0035  -0.0022 132 PHE A CD1 
1072 C CD2 . PHE A 136 ? 0.2515 0.2391 0.2314 -0.0011 0.0033  -0.0020 132 PHE A CD2 
1073 C CE1 . PHE A 136 ? 0.2604 0.2447 0.2395 -0.0020 0.0037  -0.0020 132 PHE A CE1 
1074 C CE2 . PHE A 136 ? 0.2880 0.2757 0.2688 -0.0018 0.0034  -0.0018 132 PHE A CE2 
1075 C CZ  . PHE A 136 ? 0.2629 0.2491 0.2434 -0.0022 0.0036  -0.0018 132 PHE A CZ  
1076 N N   . TYR A 137 ? 0.1811 0.1677 0.1589 0.0019  0.0043  -0.0018 133 TYR A N   
1077 C CA  . TYR A 137 ? 0.1923 0.1796 0.1706 0.0023  0.0048  -0.0015 133 TYR A CA  
1078 C C   . TYR A 137 ? 0.2527 0.2417 0.2319 0.0016  0.0043  -0.0014 133 TYR A C   
1079 O O   . TYR A 137 ? 0.2454 0.2359 0.2247 0.0015  0.0038  -0.0016 133 TYR A O   
1080 C CB  . TYR A 137 ? 0.2111 0.1983 0.1881 0.0035  0.0052  -0.0015 133 TYR A CB  
1081 C CG  . TYR A 137 ? 0.2239 0.2092 0.2000 0.0042  0.0058  -0.0014 133 TYR A CG  
1082 C CD1 . TYR A 137 ? 0.2394 0.2238 0.2157 0.0043  0.0066  -0.0011 133 TYR A CD1 
1083 C CD2 . TYR A 137 ? 0.2271 0.2117 0.2023 0.0047  0.0056  -0.0017 133 TYR A CD2 
1084 C CE1 . TYR A 137 ? 0.2227 0.2057 0.1983 0.0048  0.0072  -0.0010 133 TYR A CE1 
1085 C CE2 . TYR A 137 ? 0.2344 0.2174 0.2088 0.0054  0.0062  -0.0016 133 TYR A CE2 
1086 C CZ  . TYR A 137 ? 0.2952 0.2775 0.2699 0.0055  0.0071  -0.0012 133 TYR A CZ  
1087 O OH  . TYR A 137 ? 0.2820 0.2629 0.2561 0.0061  0.0078  -0.0010 133 TYR A OH  
1088 N N   . CYS A 138 ? 0.2311 0.2200 0.2112 0.0011  0.0046  -0.0011 134 CYS A N   
1089 C CA  . CYS A 138 ? 0.2420 0.2322 0.2230 0.0004  0.0042  -0.0010 134 CYS A CA  
1090 C C   . CYS A 138 ? 0.3184 0.3098 0.2992 0.0011  0.0045  -0.0007 134 CYS A C   
1091 O O   . CYS A 138 ? 0.3093 0.2998 0.2895 0.0016  0.0051  -0.0004 134 CYS A O   
1092 C CB  . CYS A 138 ? 0.2571 0.2466 0.2389 -0.0003 0.0044  -0.0008 134 CYS A CB  
1093 S SG  . CYS A 138 ? 0.3222 0.3130 0.3051 -0.0010 0.0041  -0.0006 134 CYS A SG  
1094 N N   . LYS A 139 ? 0.3046 0.2980 0.2859 0.0010  0.0040  -0.0006 135 LYS A N   
1095 C CA  . LYS A 139 ? 0.3080 0.3030 0.2892 0.0017  0.0042  -0.0002 135 LYS A CA  
1096 C C   . LYS A 139 ? 0.3721 0.3685 0.3545 0.0008  0.0039  0.0001  135 LYS A C   
1097 O O   . LYS A 139 ? 0.3624 0.3588 0.3448 0.0011  0.0043  0.0005  135 LYS A O   
1098 C CB  . LYS A 139 ? 0.3349 0.3316 0.3154 0.0026  0.0040  -0.0002 135 LYS A CB  
1099 C CG  . LYS A 139 ? 0.4987 0.4937 0.4776 0.0038  0.0045  -0.0003 135 LYS A CG  
1100 N N   . ASP A 140 ? 0.3200 0.3174 0.3033 -0.0003 0.0032  -0.0003 136 ASP A N   
1101 C CA  . ASP A 140 ? 0.3049 0.3035 0.2894 -0.0013 0.0030  -0.0001 136 ASP A CA  
1102 C C   . ASP A 140 ? 0.3226 0.3196 0.3073 -0.0025 0.0027  -0.0006 136 ASP A C   
1103 O O   . ASP A 140 ? 0.2925 0.2900 0.2771 -0.0033 0.0022  -0.0010 136 ASP A O   
1104 C CB  . ASP A 140 ? 0.3314 0.3332 0.3166 -0.0014 0.0025  0.0001  136 ASP A CB  
1105 C CG  . ASP A 140 ? 0.4845 0.4877 0.4709 -0.0022 0.0025  0.0005  136 ASP A CG  
1106 O OD1 . ASP A 140 ? 0.5103 0.5121 0.4968 -0.0022 0.0029  0.0008  136 ASP A OD1 
1107 O OD2 . ASP A 140 ? 0.5729 0.5788 0.5602 -0.0029 0.0020  0.0006  136 ASP A OD2 
1108 N N   . LEU A 141 ? 0.2725 0.2676 0.2572 -0.0026 0.0031  -0.0005 137 LEU A N   
1109 C CA  . LEU A 141 ? 0.2551 0.2484 0.2396 -0.0034 0.0031  -0.0008 137 LEU A CA  
1110 C C   . LEU A 141 ? 0.2943 0.2880 0.2792 -0.0047 0.0027  -0.0011 137 LEU A C   
1111 O O   . LEU A 141 ? 0.2912 0.2837 0.2752 -0.0051 0.0024  -0.0016 137 LEU A O   
1112 C CB  . LEU A 141 ? 0.2546 0.2466 0.2394 -0.0032 0.0035  -0.0005 137 LEU A CB  
1113 C CG  . LEU A 141 ? 0.3142 0.3043 0.2986 -0.0036 0.0037  -0.0007 137 LEU A CG  
1114 C CD1 . LEU A 141 ? 0.2976 0.2866 0.2811 -0.0032 0.0037  -0.0010 137 LEU A CD1 
1115 C CD2 . LEU A 141 ? 0.3420 0.3315 0.3267 -0.0034 0.0041  -0.0004 137 LEU A CD2 
1116 N N   . GLY A 142 ? 0.2657 0.2605 0.2514 -0.0053 0.0027  -0.0008 138 GLY A N   
1117 C CA  . GLY A 142 ? 0.2655 0.2605 0.2515 -0.0067 0.0024  -0.0011 138 GLY A CA  
1118 C C   . GLY A 142 ? 0.3067 0.3029 0.2923 -0.0074 0.0017  -0.0015 138 GLY A C   
1119 O O   . GLY A 142 ? 0.3200 0.3147 0.3047 -0.0085 0.0015  -0.0020 138 GLY A O   
1120 N N   . THR A 143 ? 0.2386 0.2373 0.2246 -0.0068 0.0014  -0.0013 139 THR A N   
1121 C CA  . THR A 143 ? 0.2348 0.2352 0.2206 -0.0072 0.0007  -0.0017 139 THR A CA  
1122 C C   . THR A 143 ? 0.2864 0.2846 0.2706 -0.0070 0.0005  -0.0023 139 THR A C   
1123 O O   . THR A 143 ? 0.2938 0.2921 0.2773 -0.0081 -0.0001 -0.0028 139 THR A O   
1124 C CB  . THR A 143 ? 0.3716 0.3752 0.3581 -0.0061 0.0007  -0.0011 139 THR A CB  
1125 O OG1 . THR A 143 ? 0.3363 0.3419 0.3242 -0.0063 0.0009  -0.0005 139 THR A OG1 
1126 C CG2 . THR A 143 ? 0.3467 0.3526 0.3331 -0.0063 -0.0001 -0.0014 139 THR A CG2 
1127 N N   . GLN A 144 ? 0.2516 0.2478 0.2352 -0.0058 0.0011  -0.0022 140 GLN A N   
1128 C CA  . GLN A 144 ? 0.2327 0.2267 0.2148 -0.0054 0.0010  -0.0027 140 GLN A CA  
1129 C C   . GLN A 144 ? 0.2508 0.2419 0.2319 -0.0062 0.0012  -0.0030 140 GLN A C   
1130 O O   . GLN A 144 ? 0.2358 0.2250 0.2153 -0.0064 0.0011  -0.0034 140 GLN A O   
1131 C CB  . GLN A 144 ? 0.2532 0.2465 0.2350 -0.0038 0.0016  -0.0024 140 GLN A CB  
1132 C CG  . GLN A 144 ? 0.3007 0.2963 0.2826 -0.0028 0.0014  -0.0022 140 GLN A CG  
1133 C CD  . GLN A 144 ? 0.3116 0.3062 0.2931 -0.0014 0.0021  -0.0019 140 GLN A CD  
1134 O OE1 . GLN A 144 ? 0.3231 0.3176 0.3052 -0.0010 0.0026  -0.0014 140 GLN A OE1 
1135 N NE2 . GLN A 144 ? 0.2578 0.2514 0.2382 -0.0005 0.0022  -0.0021 140 GLN A NE2 
1136 N N   . LEU A 145 ? 0.2024 0.1927 0.1841 -0.0066 0.0017  -0.0027 141 LEU A N   
1137 C CA  . LEU A 145 ? 0.2120 0.1993 0.1924 -0.0072 0.0020  -0.0029 141 LEU A CA  
1138 C C   . LEU A 145 ? 0.2694 0.2562 0.2489 -0.0089 0.0016  -0.0034 141 LEU A C   
1139 O O   . LEU A 145 ? 0.2575 0.2414 0.2350 -0.0092 0.0017  -0.0038 141 LEU A O   
1140 C CB  . LEU A 145 ? 0.2127 0.1995 0.1939 -0.0071 0.0026  -0.0024 141 LEU A CB  
1141 C CG  . LEU A 145 ? 0.2558 0.2423 0.2374 -0.0056 0.0031  -0.0020 141 LEU A CG  
1142 C CD1 . LEU A 145 ? 0.2691 0.2550 0.2512 -0.0056 0.0036  -0.0016 141 LEU A CD1 
1143 C CD2 . LEU A 145 ? 0.2300 0.2147 0.2103 -0.0048 0.0033  -0.0021 141 LEU A CD2 
1144 N N   . ALA A 146 ? 0.2324 0.2218 0.2131 -0.0100 0.0011  -0.0034 142 ALA A N   
1145 C CA  . ALA A 146 ? 0.2293 0.2184 0.2092 -0.0120 0.0007  -0.0039 142 ALA A CA  
1146 C C   . ALA A 146 ? 0.2470 0.2343 0.2247 -0.0126 0.0002  -0.0046 142 ALA A C   
1147 O O   . ALA A 146 ? 0.2406 0.2248 0.2164 -0.0136 0.0004  -0.0050 142 ALA A O   
1148 C CB  . ALA A 146 ? 0.2453 0.2384 0.2272 -0.0129 0.0001  -0.0037 142 ALA A CB  
1149 N N   . PRO A 147 ? 0.2214 0.2102 0.1991 -0.0118 -0.0004 -0.0048 143 PRO A N   
1150 C CA  . PRO A 147 ? 0.2293 0.2161 0.2046 -0.0122 -0.0008 -0.0055 143 PRO A CA  
1151 C C   . PRO A 147 ? 0.2643 0.2468 0.2375 -0.0113 -0.0001 -0.0055 143 PRO A C   
1152 O O   . PRO A 147 ? 0.2326 0.2123 0.2033 -0.0119 -0.0003 -0.0061 143 PRO A O   
1153 C CB  . PRO A 147 ? 0.2526 0.2421 0.2285 -0.0112 -0.0015 -0.0055 143 PRO A CB  
1154 C CG  . PRO A 147 ? 0.3062 0.2979 0.2842 -0.0097 -0.0010 -0.0048 143 PRO A CG  
1155 C CD  . PRO A 147 ? 0.2493 0.2414 0.2287 -0.0104 -0.0006 -0.0043 143 PRO A CD  
1156 N N   . ILE A 148 ? 0.2226 0.2046 0.1966 -0.0096 0.0007  -0.0049 144 ILE A N   
1157 C CA  . ILE A 148 ? 0.2155 0.1940 0.1877 -0.0085 0.0014  -0.0048 144 ILE A CA  
1158 C C   . ILE A 148 ? 0.2371 0.2126 0.2078 -0.0095 0.0020  -0.0049 144 ILE A C   
1159 O O   . ILE A 148 ? 0.2246 0.1966 0.1925 -0.0095 0.0022  -0.0051 144 ILE A O   
1160 C CB  . ILE A 148 ? 0.2566 0.2359 0.2304 -0.0067 0.0021  -0.0041 144 ILE A CB  
1161 C CG1 . ILE A 148 ? 0.2531 0.2347 0.2278 -0.0057 0.0017  -0.0040 144 ILE A CG1 
1162 C CG2 . ILE A 148 ? 0.2741 0.2502 0.2462 -0.0057 0.0029  -0.0038 144 ILE A CG2 
1163 C CD1 . ILE A 148 ? 0.2314 0.2141 0.2077 -0.0043 0.0023  -0.0034 144 ILE A CD1 
1164 N N   . ILE A 149 ? 0.1755 0.1521 0.1476 -0.0103 0.0021  -0.0046 145 ILE A N   
1165 C CA  . ILE A 149 ? 0.1812 0.1549 0.1518 -0.0112 0.0027  -0.0047 145 ILE A CA  
1166 C C   . ILE A 149 ? 0.2513 0.2230 0.2195 -0.0131 0.0023  -0.0054 145 ILE A C   
1167 O O   . ILE A 149 ? 0.2370 0.2046 0.2023 -0.0134 0.0029  -0.0056 145 ILE A O   
1168 C CB  . ILE A 149 ? 0.2068 0.1826 0.1796 -0.0116 0.0029  -0.0042 145 ILE A CB  
1169 C CG1 . ILE A 149 ? 0.2125 0.1892 0.1869 -0.0097 0.0035  -0.0035 145 ILE A CG1 
1170 C CG2 . ILE A 149 ? 0.2078 0.1810 0.1791 -0.0130 0.0035  -0.0044 145 ILE A CG2 
1171 C CD1 . ILE A 149 ? 0.2764 0.2555 0.2531 -0.0097 0.0036  -0.0030 145 ILE A CD1 
1172 N N   . GLN A 150 ? 0.2163 0.1910 0.1857 -0.0145 0.0013  -0.0058 146 GLN A N   
1173 C CA  . GLN A 150 ? 0.2058 0.1793 0.1731 -0.0167 0.0006  -0.0067 146 GLN A CA  
1174 C C   . GLN A 150 ? 0.2462 0.2164 0.2104 -0.0160 0.0006  -0.0071 146 GLN A C   
1175 O O   . GLN A 150 ? 0.2290 0.1954 0.1901 -0.0173 0.0007  -0.0076 146 GLN A O   
1176 C CB  . GLN A 150 ? 0.2167 0.1949 0.1861 -0.0180 -0.0005 -0.0069 146 GLN A CB  
1177 C CG  . GLN A 150 ? 0.2778 0.2590 0.2499 -0.0190 -0.0005 -0.0065 146 GLN A CG  
1178 C CD  . GLN A 150 ? 0.4646 0.4511 0.4392 -0.0196 -0.0015 -0.0064 146 GLN A CD  
1179 O OE1 . GLN A 150 ? 0.3608 0.3491 0.3353 -0.0194 -0.0023 -0.0067 146 GLN A OE1 
1180 N NE2 . GLN A 150 ? 0.3452 0.3346 0.3222 -0.0200 -0.0013 -0.0058 146 GLN A NE2 
1181 N N   . GLU A 151 ? 0.2237 0.1948 0.1886 -0.0140 0.0006  -0.0068 147 GLU A N   
1182 C CA  . GLU A 151 ? 0.2246 0.1926 0.1866 -0.0132 0.0006  -0.0071 147 GLU A CA  
1183 C C   . GLU A 151 ? 0.2672 0.2302 0.2264 -0.0125 0.0018  -0.0069 147 GLU A C   
1184 O O   . GLU A 151 ? 0.2679 0.2268 0.2235 -0.0129 0.0020  -0.0073 147 GLU A O   
1185 C CB  . GLU A 151 ? 0.2394 0.2094 0.2028 -0.0110 0.0006  -0.0067 147 GLU A CB  
1186 C CG  . GLU A 151 ? 0.3438 0.3105 0.3042 -0.0100 0.0007  -0.0070 147 GLU A CG  
1187 C CD  . GLU A 151 ? 0.5327 0.5010 0.4941 -0.0080 0.0007  -0.0067 147 GLU A CD  
1188 O OE1 . GLU A 151 ? 0.3730 0.3452 0.3372 -0.0076 0.0003  -0.0065 147 GLU A OE1 
1189 O OE2 . GLU A 151 ? 0.4777 0.4431 0.4367 -0.0069 0.0010  -0.0067 147 GLU A OE2 
1190 N N   . PHE A 152 ? 0.2129 0.1764 0.1737 -0.0113 0.0027  -0.0061 148 PHE A N   
1191 C CA  . PHE A 152 ? 0.2032 0.1626 0.1617 -0.0103 0.0039  -0.0057 148 PHE A CA  
1192 C C   . PHE A 152 ? 0.2667 0.2225 0.2222 -0.0121 0.0042  -0.0062 148 PHE A C   
1193 O O   . PHE A 152 ? 0.2770 0.2282 0.2287 -0.0118 0.0049  -0.0063 148 PHE A O   
1194 C CB  . PHE A 152 ? 0.2051 0.1660 0.1659 -0.0089 0.0047  -0.0048 148 PHE A CB  
1195 C CG  . PHE A 152 ? 0.2157 0.1727 0.1739 -0.0079 0.0060  -0.0043 148 PHE A CG  
1196 C CD1 . PHE A 152 ? 0.2267 0.1810 0.1825 -0.0062 0.0066  -0.0040 148 PHE A CD1 
1197 C CD2 . PHE A 152 ? 0.2288 0.1848 0.1868 -0.0085 0.0066  -0.0041 148 PHE A CD2 
1198 C CE1 . PHE A 152 ? 0.2323 0.1830 0.1855 -0.0051 0.0079  -0.0034 148 PHE A CE1 
1199 C CE2 . PHE A 152 ? 0.2689 0.2213 0.2243 -0.0073 0.0079  -0.0036 148 PHE A CE2 
1200 C CZ  . PHE A 152 ? 0.2382 0.1882 0.1913 -0.0055 0.0086  -0.0032 148 PHE A CZ  
1201 N N   . PHE A 153 ? 0.2160 0.1736 0.1730 -0.0141 0.0038  -0.0065 149 PHE A N   
1202 C CA  . PHE A 153 ? 0.2270 0.1811 0.1812 -0.0160 0.0042  -0.0069 149 PHE A CA  
1203 C C   . PHE A 153 ? 0.2707 0.2221 0.2216 -0.0178 0.0036  -0.0079 149 PHE A C   
1204 O O   . PHE A 153 ? 0.2645 0.2112 0.2117 -0.0191 0.0042  -0.0082 149 PHE A O   
1205 C CB  . PHE A 153 ? 0.2558 0.2127 0.2126 -0.0175 0.0041  -0.0068 149 PHE A CB  
1206 C CG  . PHE A 153 ? 0.2939 0.2509 0.2521 -0.0159 0.0051  -0.0059 149 PHE A CG  
1207 C CD1 . PHE A 153 ? 0.3570 0.3096 0.3123 -0.0148 0.0065  -0.0056 149 PHE A CD1 
1208 C CD2 . PHE A 153 ? 0.3168 0.2783 0.2790 -0.0155 0.0048  -0.0055 149 PHE A CD2 
1209 C CE1 . PHE A 153 ? 0.3691 0.3222 0.3256 -0.0133 0.0074  -0.0048 149 PHE A CE1 
1210 C CE2 . PHE A 153 ? 0.3489 0.3106 0.3122 -0.0141 0.0057  -0.0047 149 PHE A CE2 
1211 C CZ  . PHE A 153 ? 0.3361 0.2937 0.2967 -0.0130 0.0069  -0.0044 149 PHE A CZ  
1212 N N   . SER A 154 ? 0.2212 0.1748 0.1728 -0.0177 0.0025  -0.0082 150 SER A N   
1213 C CA  . SER A 154 ? 0.2400 0.1910 0.1882 -0.0192 0.0018  -0.0091 150 SER A CA  
1214 C C   . SER A 154 ? 0.3067 0.2539 0.2518 -0.0172 0.0023  -0.0090 150 SER A C   
1215 O O   . SER A 154 ? 0.2916 0.2364 0.2336 -0.0181 0.0018  -0.0098 150 SER A O   
1216 C CB  . SER A 154 ? 0.3136 0.2698 0.2645 -0.0203 0.0002  -0.0096 150 SER A CB  
1217 O OG  . SER A 154 ? 0.4606 0.4209 0.4147 -0.0219 -0.0002 -0.0095 150 SER A OG  
1218 N N   . SER A 155 ? 0.2572 0.2039 0.2029 -0.0145 0.0034  -0.0081 151 SER A N   
1219 C CA  . SER A 155 ? 0.2493 0.1932 0.1926 -0.0122 0.0040  -0.0078 151 SER A CA  
1220 C C   . SER A 155 ? 0.3233 0.2607 0.2615 -0.0118 0.0052  -0.0077 151 SER A C   
1221 O O   . SER A 155 ? 0.2944 0.2293 0.2312 -0.0126 0.0060  -0.0076 151 SER A O   
1222 C CB  . SER A 155 ? 0.2452 0.1920 0.1917 -0.0097 0.0045  -0.0068 151 SER A CB  
1223 O OG  . SER A 155 ? 0.2313 0.1769 0.1779 -0.0087 0.0057  -0.0060 151 SER A OG  
1224 N N   . GLU A 156 ? 0.3069 0.2413 0.2422 -0.0102 0.0055  -0.0076 152 GLU A N   
1225 C CA  . GLU A 156 ? 0.3227 0.2507 0.2528 -0.0091 0.0069  -0.0074 152 GLU A CA  
1226 C C   . GLU A 156 ? 0.3492 0.2774 0.2805 -0.0068 0.0084  -0.0061 152 GLU A C   
1227 O O   . GLU A 156 ? 0.3271 0.2508 0.2549 -0.0064 0.0097  -0.0057 152 GLU A O   
1228 C CB  . GLU A 156 ? 0.3479 0.2736 0.2754 -0.0075 0.0069  -0.0074 152 GLU A CB  
1229 N N   . GLN A 157 ? 0.2843 0.2177 0.2204 -0.0054 0.0082  -0.0054 153 GLN A N   
1230 C CA  . GLN A 157 ? 0.2674 0.2021 0.2053 -0.0033 0.0093  -0.0042 153 GLN A CA  
1231 C C   . GLN A 157 ? 0.3024 0.2367 0.2406 -0.0044 0.0098  -0.0042 153 GLN A C   
1232 O O   . GLN A 157 ? 0.3113 0.2435 0.2480 -0.0029 0.0111  -0.0033 153 GLN A O   
1233 C CB  . GLN A 157 ? 0.2679 0.2085 0.2109 -0.0023 0.0087  -0.0037 153 GLN A CB  
1234 C CG  . GLN A 157 ? 0.2221 0.1631 0.1650 -0.0007 0.0086  -0.0035 153 GLN A CG  
1235 C CD  . GLN A 157 ? 0.3772 0.3204 0.3213 -0.0020 0.0072  -0.0044 153 GLN A CD  
1236 O OE1 . GLN A 157 ? 0.2614 0.2033 0.2040 -0.0041 0.0064  -0.0054 153 GLN A OE1 
1237 N NE2 . GLN A 157 ? 0.2755 0.2216 0.2220 -0.0008 0.0069  -0.0041 153 GLN A NE2 
1238 N N   . TYR A 158 ? 0.2469 0.1833 0.1869 -0.0070 0.0087  -0.0050 154 TYR A N   
1239 C CA  . TYR A 158 ? 0.2448 0.1808 0.1851 -0.0082 0.0092  -0.0049 154 TYR A CA  
1240 C C   . TYR A 158 ? 0.3359 0.2654 0.2706 -0.0090 0.0102  -0.0053 154 TYR A C   
1241 O O   . TYR A 158 ? 0.3179 0.2450 0.2511 -0.0084 0.0114  -0.0048 154 TYR A O   
1242 C CB  . TYR A 158 ? 0.2525 0.1925 0.1961 -0.0107 0.0079  -0.0057 154 TYR A CB  
1243 C CG  . TYR A 158 ? 0.3100 0.2492 0.2536 -0.0120 0.0085  -0.0056 154 TYR A CG  
1244 C CD1 . TYR A 158 ? 0.3303 0.2708 0.2757 -0.0105 0.0093  -0.0047 154 TYR A CD1 
1245 C CD2 . TYR A 158 ? 0.3493 0.2867 0.2912 -0.0148 0.0081  -0.0065 154 TYR A CD2 
1246 C CE1 . TYR A 158 ? 0.3472 0.2868 0.2925 -0.0115 0.0099  -0.0047 154 TYR A CE1 
1247 C CE2 . TYR A 158 ? 0.3643 0.3010 0.3062 -0.0160 0.0087  -0.0065 154 TYR A CE2 
1248 C CZ  . TYR A 158 ? 0.4606 0.3983 0.4042 -0.0143 0.0097  -0.0055 154 TYR A CZ  
1249 O OH  . TYR A 158 ? 0.4936 0.4306 0.4372 -0.0153 0.0103  -0.0055 154 TYR A OH  
1250 N N   . ARG A 159 ? 0.3339 0.2606 0.2656 -0.0105 0.0096  -0.0062 155 ARG A N   
1251 C CA  . ARG A 159 ? 0.3617 0.2817 0.2875 -0.0117 0.0104  -0.0067 155 ARG A CA  
1252 C C   . ARG A 159 ? 0.4219 0.3369 0.3436 -0.0090 0.0122  -0.0058 155 ARG A C   
1253 O O   . ARG A 159 ? 0.4238 0.3346 0.3423 -0.0091 0.0135  -0.0056 155 ARG A O   
1254 C CB  . ARG A 159 ? 0.3858 0.3044 0.3094 -0.0136 0.0092  -0.0079 155 ARG A CB  
1255 C CG  . ARG A 159 ? 0.5121 0.4240 0.4298 -0.0157 0.0097  -0.0087 155 ARG A CG  
1256 C CD  . ARG A 159 ? 0.5698 0.4800 0.4848 -0.0175 0.0085  -0.0098 155 ARG A CD  
1257 N NE  . ARG A 159 ? 0.6839 0.5913 0.5961 -0.0149 0.0090  -0.0094 155 ARG A NE  
1258 C CZ  . ARG A 159 ? 0.9183 0.8187 0.8246 -0.0137 0.0104  -0.0092 155 ARG A CZ  
1259 N NH1 . ARG A 159 ? 0.8070 0.7022 0.7093 -0.0147 0.0117  -0.0093 155 ARG A NH1 
1260 N NH2 . ARG A 159 ? 0.7851 0.6835 0.6892 -0.0113 0.0108  -0.0087 155 ARG A NH2 
1261 N N   . THR A 160 ? 0.3779 0.2933 0.2996 -0.0064 0.0124  -0.0051 156 THR A N   
1262 C CA  . THR A 160 ? 0.3891 0.3003 0.3070 -0.0035 0.0142  -0.0041 156 THR A CA  
1263 C C   . THR A 160 ? 0.4465 0.3607 0.3672 -0.0009 0.0152  -0.0027 156 THR A C   
1264 O O   . THR A 160 ? 0.4479 0.3585 0.3653 0.0013  0.0168  -0.0017 156 THR A O   
1265 C CB  . THR A 160 ? 0.4732 0.3830 0.3893 -0.0021 0.0140  -0.0040 156 THR A CB  
1266 O OG1 . THR A 160 ? 0.3749 0.2910 0.2963 -0.0009 0.0132  -0.0035 156 THR A OG1 
1267 C CG2 . THR A 160 ? 0.4317 0.3387 0.3448 -0.0046 0.0128  -0.0054 156 THR A CG2 
1268 N N   . GLY A 161 ? 0.3725 0.2932 0.2992 -0.0009 0.0142  -0.0025 157 GLY A N   
1269 C CA  . GLY A 161 ? 0.3578 0.2820 0.2875 0.0014  0.0149  -0.0012 157 GLY A CA  
1270 C C   . GLY A 161 ? 0.3928 0.3181 0.3229 0.0040  0.0152  -0.0003 157 GLY A C   
1271 O O   . GLY A 161 ? 0.3836 0.3113 0.3154 0.0062  0.0160  0.0009  157 GLY A O   
1272 N N   . LYS A 162 ? 0.3391 0.2632 0.2678 0.0037  0.0146  -0.0009 158 LYS A N   
1273 C CA  . LYS A 162 ? 0.3413 0.2659 0.2699 0.0060  0.0149  -0.0001 158 LYS A CA  
1274 C C   . LYS A 162 ? 0.3670 0.2966 0.3000 0.0053  0.0134  -0.0006 158 LYS A C   
1275 O O   . LYS A 162 ? 0.3412 0.2711 0.2745 0.0031  0.0122  -0.0018 158 LYS A O   
1276 C CB  . LYS A 162 ? 0.3961 0.3144 0.3188 0.0065  0.0156  -0.0004 158 LYS A CB  
1277 C CG  . LYS A 162 ? 0.5906 0.5026 0.5077 0.0071  0.0172  0.0000  158 LYS A CG  
1278 C CD  . LYS A 162 ? 0.6647 0.5759 0.5804 0.0106  0.0190  0.0017  158 LYS A CD  
1279 C CE  . LYS A 162 ? 0.7740 0.6787 0.6837 0.0114  0.0207  0.0020  158 LYS A CE  
1280 N N   . PRO A 163 ? 0.3240 0.2575 0.2602 0.0071  0.0136  0.0004  159 PRO A N   
1281 C CA  . PRO A 163 ? 0.3073 0.2449 0.2471 0.0066  0.0124  -0.0001 159 PRO A CA  
1282 C C   . PRO A 163 ? 0.3503 0.2853 0.2874 0.0069  0.0121  -0.0006 159 PRO A C   
1283 O O   . PRO A 163 ? 0.3411 0.2714 0.2738 0.0081  0.0131  -0.0002 159 PRO A O   
1284 C CB  . PRO A 163 ? 0.3376 0.2792 0.2808 0.0085  0.0129  0.0011  159 PRO A CB  
1285 C CG  . PRO A 163 ? 0.4103 0.3506 0.3521 0.0099  0.0143  0.0022  159 PRO A CG  
1286 C CD  . PRO A 163 ? 0.3536 0.2879 0.2901 0.0098  0.0150  0.0019  159 PRO A CD  
1287 N N   . ILE A 164 ? 0.2999 0.2374 0.2391 0.0057  0.0108  -0.0014 160 ILE A N   
1288 C CA  . ILE A 164 ? 0.3127 0.2487 0.2500 0.0061  0.0104  -0.0018 160 ILE A CA  
1289 C C   . ILE A 164 ? 0.3308 0.2705 0.2714 0.0079  0.0106  -0.0009 160 ILE A C   
1290 O O   . ILE A 164 ? 0.2902 0.2344 0.2349 0.0072  0.0099  -0.0011 160 ILE A O   
1291 C CB  . ILE A 164 ? 0.3595 0.2959 0.2967 0.0038  0.0088  -0.0032 160 ILE A CB  
1292 C CG1 . ILE A 164 ? 0.3832 0.3158 0.3171 0.0017  0.0086  -0.0041 160 ILE A CG1 
1293 C CG2 . ILE A 164 ? 0.3602 0.2952 0.2956 0.0046  0.0085  -0.0035 160 ILE A CG2 
1294 C CD1 . ILE A 164 ? 0.4467 0.3802 0.3807 -0.0011 0.0070  -0.0055 160 ILE A CD1 
1295 N N   . PRO A 165 ? 0.3021 0.2401 0.2410 0.0103  0.0119  0.0002  161 PRO A N   
1296 C CA  . PRO A 165 ? 0.2962 0.2378 0.2383 0.0119  0.0123  0.0011  161 PRO A CA  
1297 C C   . PRO A 165 ? 0.3198 0.2644 0.2645 0.0113  0.0112  0.0005  161 PRO A C   
1298 O O   . PRO A 165 ? 0.2895 0.2383 0.2381 0.0113  0.0111  0.0009  161 PRO A O   
1299 C CB  . PRO A 165 ? 0.3296 0.2680 0.2684 0.0144  0.0137  0.0022  161 PRO A CB  
1300 C CG  . PRO A 165 ? 0.4008 0.3344 0.3353 0.0144  0.0143  0.0022  161 PRO A CG  
1301 C CD  . PRO A 165 ? 0.3444 0.2769 0.2782 0.0117  0.0131  0.0007  161 PRO A CD  
1302 N N   . ASP A 166 ? 0.2753 0.2176 0.2175 0.0107  0.0105  -0.0004 162 ASP A N   
1303 C CA  . ASP A 166 ? 0.3084 0.2534 0.2527 0.0103  0.0096  -0.0011 162 ASP A CA  
1304 C C   . ASP A 166 ? 0.3477 0.2968 0.2957 0.0085  0.0085  -0.0017 162 ASP A C   
1305 O O   . ASP A 166 ? 0.3446 0.2966 0.2949 0.0085  0.0080  -0.0019 162 ASP A O   
1306 C CB  . ASP A 166 ? 0.3671 0.3088 0.3077 0.0100  0.0089  -0.0020 162 ASP A CB  
1307 C CG  . ASP A 166 ? 0.6276 0.5657 0.5649 0.0122  0.0099  -0.0014 162 ASP A CG  
1308 O OD1 . ASP A 166 ? 0.6265 0.5663 0.5654 0.0139  0.0107  -0.0004 162 ASP A OD1 
1309 O OD2 . ASP A 166 ? 0.8010 0.7347 0.7340 0.0120  0.0098  -0.0019 162 ASP A OD2 
1310 N N   . GLN A 167 ? 0.2831 0.2323 0.2314 0.0070  0.0082  -0.0019 163 GLN A N   
1311 C CA  . GLN A 167 ? 0.2643 0.2171 0.2159 0.0053  0.0073  -0.0024 163 GLN A CA  
1312 C C   . GLN A 167 ? 0.3237 0.2798 0.2788 0.0057  0.0078  -0.0016 163 GLN A C   
1313 O O   . GLN A 167 ? 0.3248 0.2837 0.2825 0.0045  0.0072  -0.0019 163 GLN A O   
1314 C CB  . GLN A 167 ? 0.2724 0.2236 0.2224 0.0033  0.0066  -0.0033 163 GLN A CB  
1315 C CG  . GLN A 167 ? 0.3927 0.3420 0.3401 0.0024  0.0057  -0.0043 163 GLN A CG  
1316 C CD  . GLN A 167 ? 0.5105 0.4583 0.4562 0.0001  0.0049  -0.0053 163 GLN A CD  
1317 O OE1 . GLN A 167 ? 0.4140 0.3634 0.3615 -0.0012 0.0048  -0.0053 163 GLN A OE1 
1318 N NE2 . GLN A 167 ? 0.4079 0.3529 0.3503 -0.0007 0.0044  -0.0061 163 GLN A NE2 
1319 N N   . LEU A 168 ? 0.2647 0.2204 0.2197 0.0074  0.0089  -0.0005 164 LEU A N   
1320 C CA  . LEU A 168 ? 0.2459 0.2048 0.2041 0.0078  0.0094  0.0003  164 LEU A CA  
1321 C C   . LEU A 168 ? 0.2896 0.2508 0.2497 0.0088  0.0096  0.0007  164 LEU A C   
1322 O O   . LEU A 168 ? 0.2630 0.2225 0.2214 0.0099  0.0099  0.0008  164 LEU A O   
1323 C CB  . LEU A 168 ? 0.2490 0.2064 0.2060 0.0090  0.0105  0.0013  164 LEU A CB  
1324 C CG  . LEU A 168 ? 0.3052 0.2600 0.2601 0.0082  0.0106  0.0010  164 LEU A CG  
1325 C CD1 . LEU A 168 ? 0.3211 0.2745 0.2745 0.0099  0.0119  0.0021  164 LEU A CD1 
1326 C CD2 . LEU A 168 ? 0.3259 0.2831 0.2832 0.0064  0.0098  0.0004  164 LEU A CD2 
1327 N N   . LEU A 169 ? 0.2408 0.2054 0.2042 0.0084  0.0095  0.0010  165 LEU A N   
1328 C CA  . LEU A 169 ? 0.2661 0.2328 0.2313 0.0091  0.0098  0.0015  165 LEU A CA  
1329 C C   . LEU A 169 ? 0.2852 0.2517 0.2501 0.0107  0.0110  0.0027  165 LEU A C   
1330 O O   . LEU A 169 ? 0.2701 0.2364 0.2348 0.0110  0.0114  0.0032  165 LEU A O   
1331 C CB  . LEU A 169 ? 0.2792 0.2494 0.2476 0.0081  0.0094  0.0014  165 LEU A CB  
1332 C CG  . LEU A 169 ? 0.3535 0.3247 0.3227 0.0068  0.0084  0.0005  165 LEU A CG  
1333 C CD1 . LEU A 169 ? 0.3560 0.3301 0.3279 0.0061  0.0083  0.0007  165 LEU A CD1 
1334 C CD2 . LEU A 169 ? 0.4180 0.3884 0.3861 0.0071  0.0081  -0.0001 165 LEU A CD2 
1335 N N   . LYS A 170 ? 0.2785 0.2455 0.2438 0.0117  0.0115  0.0032  166 LYS A N   
1336 C CA  . LYS A 170 ? 0.2905 0.2581 0.2560 0.0132  0.0127  0.0045  166 LYS A CA  
1337 C C   . LYS A 170 ? 0.3628 0.3339 0.3313 0.0127  0.0128  0.0051  166 LYS A C   
1338 O O   . LYS A 170 ? 0.3618 0.3337 0.3304 0.0136  0.0136  0.0061  166 LYS A O   
1339 C CB  . LYS A 170 ? 0.3165 0.2839 0.2818 0.0143  0.0132  0.0048  166 LYS A CB  
1340 C CG  . LYS A 170 ? 0.3707 0.3345 0.3327 0.0149  0.0131  0.0041  166 LYS A CG  
1341 C CD  . LYS A 170 ? 0.4684 0.4314 0.4296 0.0164  0.0138  0.0045  166 LYS A CD  
1342 C CE  . LYS A 170 ? 0.5322 0.4916 0.4901 0.0167  0.0133  0.0036  166 LYS A CE  
1343 N NZ  . LYS A 170 ? 0.8113 0.7692 0.7677 0.0183  0.0140  0.0040  166 LYS A NZ  
1344 N N   . GLU A 171 ? 0.3213 0.2946 0.2920 0.0112  0.0120  0.0045  167 GLU A N   
1345 C CA  . GLU A 171 ? 0.3203 0.2967 0.2936 0.0104  0.0120  0.0049  167 GLU A CA  
1346 C C   . GLU A 171 ? 0.3338 0.3111 0.3083 0.0087  0.0110  0.0039  167 GLU A C   
1347 O O   . GLU A 171 ? 0.3197 0.2959 0.2935 0.0084  0.0105  0.0031  167 GLU A O   
1348 C CB  . GLU A 171 ? 0.3327 0.3115 0.3078 0.0107  0.0127  0.0058  167 GLU A CB  
1349 C CG  . GLU A 171 ? 0.4814 0.4601 0.4567 0.0105  0.0127  0.0054  167 GLU A CG  
1350 N N   . PRO A 172 ? 0.2850 0.2644 0.2613 0.0078  0.0107  0.0040  168 PRO A N   
1351 C CA  . PRO A 172 ? 0.2710 0.2512 0.2483 0.0064  0.0098  0.0032  168 PRO A CA  
1352 C C   . PRO A 172 ? 0.3213 0.3024 0.2995 0.0060  0.0099  0.0030  168 PRO A C   
1353 O O   . PRO A 172 ? 0.3205 0.3023 0.2992 0.0065  0.0105  0.0036  168 PRO A O   
1354 C CB  . PRO A 172 ? 0.2909 0.2730 0.2698 0.0057  0.0097  0.0035  168 PRO A CB  
1355 C CG  . PRO A 172 ? 0.3642 0.3475 0.3435 0.0066  0.0104  0.0045  168 PRO A CG  
1356 C CD  . PRO A 172 ? 0.3131 0.2944 0.2905 0.0080  0.0111  0.0049  168 PRO A CD  
1357 N N   . PRO A 173 ? 0.2760 0.2570 0.2542 0.0052  0.0093  0.0022  169 PRO A N   
1358 C CA  . PRO A 173 ? 0.2757 0.2571 0.2544 0.0051  0.0095  0.0021  169 PRO A CA  
1359 C C   . PRO A 173 ? 0.3151 0.2984 0.2953 0.0043  0.0097  0.0025  169 PRO A C   
1360 O O   . PRO A 173 ? 0.3175 0.3009 0.2978 0.0041  0.0101  0.0025  169 PRO A O   
1361 C CB  . PRO A 173 ? 0.2988 0.2798 0.2769 0.0046  0.0088  0.0012  169 PRO A CB  
1362 C CG  . PRO A 173 ? 0.3416 0.3228 0.3199 0.0039  0.0081  0.0010  169 PRO A CG  
1363 C CD  . PRO A 173 ? 0.2788 0.2592 0.2566 0.0045  0.0085  0.0014  169 PRO A CD  
1364 N N   . PHE A 174 ? 0.2484 0.2332 0.2298 0.0038  0.0096  0.0029  170 PHE A N   
1365 C CA  . PHE A 174 ? 0.2403 0.2271 0.2232 0.0029  0.0097  0.0033  170 PHE A CA  
1366 C C   . PHE A 174 ? 0.2800 0.2684 0.2638 0.0032  0.0098  0.0040  170 PHE A C   
1367 O O   . PHE A 174 ? 0.2627 0.2502 0.2458 0.0038  0.0097  0.0040  170 PHE A O   
1368 C CB  . PHE A 174 ? 0.2511 0.2382 0.2344 0.0017  0.0092  0.0027  170 PHE A CB  
1369 C CG  . PHE A 174 ? 0.2425 0.2292 0.2256 0.0016  0.0085  0.0023  170 PHE A CG  
1370 C CD1 . PHE A 174 ? 0.2608 0.2483 0.2445 0.0015  0.0083  0.0026  170 PHE A CD1 
1371 C CD2 . PHE A 174 ? 0.2605 0.2460 0.2427 0.0016  0.0081  0.0016  170 PHE A CD2 
1372 C CE1 . PHE A 174 ? 0.2686 0.2554 0.2519 0.0014  0.0077  0.0021  170 PHE A CE1 
1373 C CE2 . PHE A 174 ? 0.2879 0.2731 0.2699 0.0013  0.0075  0.0012  170 PHE A CE2 
1374 C CZ  . PHE A 174 ? 0.2559 0.2417 0.2385 0.0012  0.0074  0.0015  170 PHE A CZ  
1375 N N   . PRO A 175 ? 0.2566 0.2473 0.2419 0.0026  0.0100  0.0047  171 PRO A N   
1376 C CA  . PRO A 175 ? 0.2553 0.2479 0.2414 0.0031  0.0101  0.0054  171 PRO A CA  
1377 C C   . PRO A 175 ? 0.2770 0.2696 0.2632 0.0025  0.0094  0.0050  171 PRO A C   
1378 O O   . PRO A 175 ? 0.2474 0.2401 0.2340 0.0014  0.0089  0.0045  171 PRO A O   
1379 C CB  . PRO A 175 ? 0.2817 0.2771 0.2694 0.0022  0.0103  0.0061  171 PRO A CB  
1380 C CG  . PRO A 175 ? 0.3473 0.3418 0.3348 0.0017  0.0107  0.0058  171 PRO A CG  
1381 C CD  . PRO A 175 ? 0.2939 0.2858 0.2801 0.0016  0.0103  0.0048  171 PRO A CD  
1382 N N   . LEU A 176 ? 0.2267 0.2190 0.2124 0.0034  0.0095  0.0054  172 LEU A N   
1383 C CA  . LEU A 176 ? 0.2319 0.2243 0.2177 0.0030  0.0089  0.0051  172 LEU A CA  
1384 C C   . LEU A 176 ? 0.2552 0.2507 0.2426 0.0023  0.0088  0.0056  172 LEU A C   
1385 O O   . LEU A 176 ? 0.2260 0.2237 0.2144 0.0025  0.0091  0.0063  172 LEU A O   
1386 C CB  . LEU A 176 ? 0.2444 0.2353 0.2288 0.0041  0.0092  0.0052  172 LEU A CB  
1387 C CG  . LEU A 176 ? 0.3310 0.3188 0.3135 0.0047  0.0094  0.0048  172 LEU A CG  
1388 C CD1 . LEU A 176 ? 0.3556 0.3415 0.3364 0.0056  0.0097  0.0050  172 LEU A CD1 
1389 C CD2 . LEU A 176 ? 0.3646 0.3511 0.3469 0.0036  0.0087  0.0037  172 LEU A CD2 
1390 N N   . SER A 177 ? 0.1821 0.1779 0.1699 0.0015  0.0082  0.0052  173 SER A N   
1391 C CA  . SER A 177 ? 0.1735 0.1720 0.1626 0.0008  0.0078  0.0055  173 SER A CA  
1392 C C   . SER A 177 ? 0.2314 0.2324 0.2212 0.0018  0.0082  0.0066  173 SER A C   
1393 O O   . SER A 177 ? 0.2180 0.2181 0.2068 0.0032  0.0086  0.0070  173 SER A O   
1394 C CB  . SER A 177 ? 0.1724 0.1702 0.1613 0.0002  0.0072  0.0050  173 SER A CB  
1395 O OG  . SER A 177 ? 0.2192 0.2193 0.2091 -0.0005 0.0069  0.0053  173 SER A OG  
1396 N N   . THR A 178 ? 0.2094 0.2135 0.2006 0.0010  0.0081  0.0071  174 THR A N   
1397 C CA  . THR A 178 ? 0.2065 0.2138 0.1986 0.0019  0.0083  0.0082  174 THR A CA  
1398 C C   . THR A 178 ? 0.2638 0.2731 0.2567 0.0012  0.0076  0.0082  174 THR A C   
1399 O O   . THR A 178 ? 0.2708 0.2833 0.2646 0.0017  0.0076  0.0091  174 THR A O   
1400 C CB  . THR A 178 ? 0.2905 0.3006 0.2840 0.0016  0.0087  0.0090  174 THR A CB  
1401 O OG1 . THR A 178 ? 0.3427 0.3543 0.3372 -0.0005 0.0081  0.0086  174 THR A OG1 
1402 C CG2 . THR A 178 ? 0.2978 0.3060 0.2905 0.0023  0.0094  0.0091  174 THR A CG2 
1403 N N   . ARG A 179 ? 0.2162 0.2236 0.2085 0.0002  0.0070  0.0072  175 ARG A N   
1404 C CA  . ARG A 179 ? 0.2154 0.2244 0.2082 -0.0006 0.0063  0.0071  175 ARG A CA  
1405 C C   . ARG A 179 ? 0.2775 0.2866 0.2698 0.0006  0.0063  0.0074  175 ARG A C   
1406 O O   . ARG A 179 ? 0.2726 0.2792 0.2637 0.0018  0.0068  0.0074  175 ARG A O   
1407 C CB  . ARG A 179 ? 0.2639 0.2708 0.2561 -0.0022 0.0058  0.0061  175 ARG A CB  
1408 C CG  . ARG A 179 ? 0.3780 0.3855 0.3707 -0.0036 0.0058  0.0059  175 ARG A CG  
1409 C CD  . ARG A 179 ? 0.3846 0.3903 0.3765 -0.0051 0.0053  0.0051  175 ARG A CD  
1410 N NE  . ARG A 179 ? 0.3893 0.3966 0.3815 -0.0060 0.0046  0.0051  175 ARG A NE  
1411 C CZ  . ARG A 179 ? 0.4956 0.5014 0.4868 -0.0073 0.0042  0.0044  175 ARG A CZ  
1412 N NH1 . ARG A 179 ? 0.2961 0.2990 0.2862 -0.0077 0.0045  0.0038  175 ARG A NH1 
1413 N NH2 . ARG A 179 ? 0.3857 0.3927 0.3769 -0.0081 0.0035  0.0044  175 ARG A NH2 
1414 N N   . SER A 180 ? 0.2379 0.2497 0.2309 0.0003  0.0058  0.0077  176 SER A N   
1415 C CA  . SER A 180 ? 0.2456 0.2575 0.2381 0.0014  0.0058  0.0080  176 SER A CA  
1416 C C   . SER A 180 ? 0.2870 0.2961 0.2786 0.0005  0.0054  0.0070  176 SER A C   
1417 O O   . SER A 180 ? 0.2883 0.2972 0.2802 -0.0011 0.0048  0.0064  176 SER A O   
1418 C CB  . SER A 180 ? 0.2896 0.3057 0.2831 0.0014  0.0054  0.0087  176 SER A CB  
1419 O OG  . SER A 180 ? 0.4233 0.4406 0.4176 -0.0006 0.0045  0.0082  176 SER A OG  
1420 N N   . ILE A 181 ? 0.2230 0.2298 0.2134 0.0016  0.0057  0.0069  177 ILE A N   
1421 C CA  . ILE A 181 ? 0.2231 0.2272 0.2128 0.0010  0.0054  0.0060  177 ILE A CA  
1422 C C   . ILE A 181 ? 0.2733 0.2788 0.2630 0.0008  0.0049  0.0061  177 ILE A C   
1423 O O   . ILE A 181 ? 0.2412 0.2486 0.2310 0.0020  0.0050  0.0068  177 ILE A O   
1424 C CB  . ILE A 181 ? 0.2759 0.2770 0.2642 0.0021  0.0061  0.0059  177 ILE A CB  
1425 C CG1 . ILE A 181 ? 0.2904 0.2900 0.2784 0.0023  0.0065  0.0058  177 ILE A CG1 
1426 C CG2 . ILE A 181 ? 0.2834 0.2820 0.2709 0.0017  0.0059  0.0053  177 ILE A CG2 
1427 C CD1 . ILE A 181 ? 0.4091 0.4080 0.3975 0.0009  0.0062  0.0052  177 ILE A CD1 
1428 N N   . MET A 182 ? 0.2051 0.2096 0.1947 -0.0004 0.0043  0.0054  178 MET A N   
1429 C CA  . MET A 182 ? 0.1904 0.1958 0.1797 -0.0006 0.0037  0.0054  178 MET A CA  
1430 C C   . MET A 182 ? 0.2391 0.2429 0.2275 0.0007  0.0042  0.0055  178 MET A C   
1431 O O   . MET A 182 ? 0.2273 0.2288 0.2151 0.0013  0.0048  0.0054  178 MET A O   
1432 C CB  . MET A 182 ? 0.2091 0.2134 0.1981 -0.0022 0.0031  0.0047  178 MET A CB  
1433 C CG  . MET A 182 ? 0.2203 0.2211 0.2083 -0.0022 0.0034  0.0041  178 MET A CG  
1434 S SD  . MET A 182 ? 0.2441 0.2432 0.2313 -0.0036 0.0029  0.0035  178 MET A SD  
1435 C CE  . MET A 182 ? 0.2047 0.2045 0.1922 -0.0049 0.0028  0.0033  178 MET A CE  
1436 N N   . GLU A 183 ? 0.2138 0.2186 0.2020 0.0009  0.0038  0.0057  179 GLU A N   
1437 C CA  . GLU A 183 ? 0.2076 0.2106 0.1947 0.0020  0.0042  0.0057  179 GLU A CA  
1438 C C   . GLU A 183 ? 0.2191 0.2196 0.2057 0.0011  0.0039  0.0050  179 GLU A C   
1439 O O   . GLU A 183 ? 0.2187 0.2198 0.2054 -0.0001 0.0032  0.0047  179 GLU A O   
1440 C CB  . GLU A 183 ? 0.2381 0.2434 0.2251 0.0029  0.0040  0.0062  179 GLU A CB  
1441 C CG  . GLU A 183 ? 0.4021 0.4092 0.3892 0.0046  0.0046  0.0071  179 GLU A CG  
1442 C CD  . GLU A 183 ? 0.6908 0.6952 0.6765 0.0062  0.0057  0.0074  179 GLU A CD  
1443 O OE1 . GLU A 183 ? 0.6548 0.6575 0.6401 0.0065  0.0063  0.0073  179 GLU A OE1 
1444 O OE2 . GLU A 183 ? 0.7202 0.7240 0.7049 0.0070  0.0058  0.0075  179 GLU A OE2 
1445 N N   . PRO A 184 ? 0.1688 0.1667 0.1546 0.0015  0.0045  0.0048  180 PRO A N   
1446 C CA  . PRO A 184 ? 0.1767 0.1727 0.1621 0.0008  0.0043  0.0043  180 PRO A CA  
1447 C C   . PRO A 184 ? 0.2350 0.2316 0.2198 0.0010  0.0039  0.0044  180 PRO A C   
1448 O O   . PRO A 184 ? 0.2284 0.2265 0.2131 0.0020  0.0040  0.0049  180 PRO A O   
1449 C CB  . PRO A 184 ? 0.2097 0.2034 0.1945 0.0015  0.0051  0.0043  180 PRO A CB  
1450 C CG  . PRO A 184 ? 0.2672 0.2609 0.2521 0.0020  0.0056  0.0045  180 PRO A CG  
1451 C CD  . PRO A 184 ? 0.2095 0.2059 0.1947 0.0026  0.0054  0.0050  180 PRO A CD  
1452 N N   . MET A 185 ? 0.1934 0.1891 0.1778 0.0002  0.0035  0.0041  181 MET A N   
1453 C CA  . MET A 185 ? 0.2053 0.2014 0.1889 0.0003  0.0030  0.0041  181 MET A CA  
1454 C C   . MET A 185 ? 0.2047 0.1984 0.1873 0.0004  0.0032  0.0039  181 MET A C   
1455 O O   . MET A 185 ? 0.1660 0.1581 0.1486 -0.0001 0.0034  0.0037  181 MET A O   
1456 C CB  . MET A 185 ? 0.2385 0.2363 0.2221 -0.0009 0.0021  0.0040  181 MET A CB  
1457 C CG  . MET A 185 ? 0.2923 0.2885 0.2755 -0.0022 0.0019  0.0034  181 MET A CG  
1458 S SD  . MET A 185 ? 0.3523 0.3501 0.3352 -0.0039 0.0010  0.0032  181 MET A SD  
1459 C CE  . MET A 185 ? 0.3177 0.3124 0.2993 -0.0050 0.0011  0.0027  181 MET A CE  
1460 N N   . SER A 186 ? 0.1707 0.1641 0.1524 0.0010  0.0031  0.0041  182 SER A N   
1461 C CA  . SER A 186 ? 0.1557 0.1469 0.1365 0.0012  0.0033  0.0040  182 SER A CA  
1462 C C   . SER A 186 ? 0.1950 0.1855 0.1750 0.0001  0.0028  0.0037  182 SER A C   
1463 O O   . SER A 186 ? 0.2116 0.2031 0.1910 -0.0006 0.0020  0.0035  182 SER A O   
1464 C CB  . SER A 186 ? 0.2003 0.1914 0.1802 0.0023  0.0034  0.0043  182 SER A CB  
1465 O OG  . SER A 186 ? 0.2226 0.2118 0.2014 0.0023  0.0035  0.0043  182 SER A OG  
1466 N N   . LEU A 187 ? 0.1522 0.1409 0.1320 -0.0002 0.0031  0.0035  183 LEU A N   
1467 C CA  . LEU A 187 ? 0.1512 0.1386 0.1297 -0.0011 0.0028  0.0033  183 LEU A CA  
1468 C C   . LEU A 187 ? 0.2028 0.1891 0.1796 -0.0008 0.0025  0.0033  183 LEU A C   
1469 O O   . LEU A 187 ? 0.1655 0.1516 0.1410 -0.0017 0.0019  0.0031  183 LEU A O   
1470 C CB  . LEU A 187 ? 0.1500 0.1360 0.1287 -0.0010 0.0034  0.0033  183 LEU A CB  
1471 C CG  . LEU A 187 ? 0.2028 0.1870 0.1798 -0.0015 0.0034  0.0031  183 LEU A CG  
1472 C CD1 . LEU A 187 ? 0.2048 0.1893 0.1813 -0.0027 0.0029  0.0027  183 LEU A CD1 
1473 C CD2 . LEU A 187 ? 0.1990 0.1823 0.1763 -0.0011 0.0041  0.0033  183 LEU A CD2 
1474 N N   . ASP A 188 ? 0.1805 0.1659 0.1570 0.0003  0.0030  0.0036  184 ASP A N   
1475 C CA  . ASP A 188 ? 0.1905 0.1746 0.1651 0.0007  0.0028  0.0037  184 ASP A CA  
1476 C C   . ASP A 188 ? 0.2405 0.2262 0.2146 0.0005  0.0019  0.0036  184 ASP A C   
1477 O O   . ASP A 188 ? 0.2660 0.2508 0.2383 0.0000  0.0013  0.0034  184 ASP A O   
1478 C CB  . ASP A 188 ? 0.2252 0.2081 0.1996 0.0020  0.0036  0.0042  184 ASP A CB  
1479 C CG  . ASP A 188 ? 0.4474 0.4286 0.4216 0.0023  0.0043  0.0044  184 ASP A CG  
1480 O OD1 . ASP A 188 ? 0.4747 0.4548 0.4479 0.0017  0.0042  0.0043  184 ASP A OD1 
1481 O OD2 . ASP A 188 ? 0.4850 0.4660 0.4600 0.0030  0.0051  0.0048  184 ASP A OD2 
1482 N N   . ALA A 189 ? 0.2031 0.1911 0.1787 0.0008  0.0018  0.0038  185 ALA A N   
1483 C CA  . ALA A 189 ? 0.2043 0.1945 0.1797 0.0007  0.0010  0.0038  185 ALA A CA  
1484 C C   . ALA A 189 ? 0.2379 0.2292 0.2131 -0.0011 0.0001  0.0033  185 ALA A C   
1485 O O   . ALA A 189 ? 0.2200 0.2118 0.1940 -0.0017 -0.0007 0.0032  185 ALA A O   
1486 C CB  . ALA A 189 ? 0.2045 0.1971 0.1815 0.0017  0.0013  0.0041  185 ALA A CB  
1487 N N   . TRP A 190 ? 0.1843 0.1758 0.1605 -0.0020 0.0003  0.0032  186 TRP A N   
1488 C CA  . TRP A 190 ? 0.1900 0.1821 0.1659 -0.0037 -0.0004 0.0028  186 TRP A CA  
1489 C C   . TRP A 190 ? 0.2312 0.2204 0.2045 -0.0046 -0.0006 0.0024  186 TRP A C   
1490 O O   . TRP A 190 ? 0.2424 0.2320 0.2145 -0.0059 -0.0014 0.0021  186 TRP A O   
1491 C CB  . TRP A 190 ? 0.1739 0.1665 0.1514 -0.0042 0.0001  0.0027  186 TRP A CB  
1492 C CG  . TRP A 190 ? 0.1949 0.1883 0.1723 -0.0059 -0.0004 0.0024  186 TRP A CG  
1493 C CD1 . TRP A 190 ? 0.2356 0.2322 0.2144 -0.0066 -0.0008 0.0025  186 TRP A CD1 
1494 C CD2 . TRP A 190 ? 0.1998 0.1907 0.1753 -0.0072 -0.0004 0.0019  186 TRP A CD2 
1495 N NE1 . TRP A 190 ? 0.2235 0.2198 0.2017 -0.0084 -0.0012 0.0021  186 TRP A NE1 
1496 C CE2 . TRP A 190 ? 0.2422 0.2348 0.2182 -0.0088 -0.0009 0.0017  186 TRP A CE2 
1497 C CE3 . TRP A 190 ? 0.2165 0.2038 0.1899 -0.0071 0.0000  0.0018  186 TRP A CE3 
1498 C CZ2 . TRP A 190 ? 0.2369 0.2275 0.2112 -0.0103 -0.0009 0.0013  186 TRP A CZ2 
1499 C CZ3 . TRP A 190 ? 0.2359 0.2212 0.2075 -0.0084 0.0000  0.0014  186 TRP A CZ3 
1500 C CH2 . TRP A 190 ? 0.2389 0.2256 0.2109 -0.0100 -0.0004 0.0011  186 TRP A CH2 
1501 N N   . LEU A 191 ? 0.1806 0.1669 0.1529 -0.0038 0.0001  0.0025  187 LEU A N   
1502 C CA  . LEU A 191 ? 0.1879 0.1710 0.1574 -0.0043 0.0001  0.0022  187 LEU A CA  
1503 C C   . LEU A 191 ? 0.2432 0.2258 0.2108 -0.0042 -0.0005 0.0022  187 LEU A C   
1504 O O   . LEU A 191 ? 0.2555 0.2366 0.2207 -0.0055 -0.0011 0.0018  187 LEU A O   
1505 C CB  . LEU A 191 ? 0.1876 0.1682 0.1566 -0.0031 0.0011  0.0025  187 LEU A CB  
1506 C CG  . LEU A 191 ? 0.2506 0.2313 0.2209 -0.0034 0.0017  0.0025  187 LEU A CG  
1507 C CD1 . LEU A 191 ? 0.2527 0.2318 0.2229 -0.0021 0.0026  0.0029  187 LEU A CD1 
1508 C CD2 . LEU A 191 ? 0.2665 0.2459 0.2351 -0.0048 0.0015  0.0021  187 LEU A CD2 
1509 N N   . ASP A 192 ? 0.1926 0.1761 0.1609 -0.0028 -0.0004 0.0026  188 ASP A N   
1510 C CA  . ASP A 192 ? 0.1923 0.1755 0.1588 -0.0024 -0.0010 0.0026  188 ASP A CA  
1511 C C   . ASP A 192 ? 0.2797 0.2655 0.2462 -0.0039 -0.0022 0.0022  188 ASP A C   
1512 O O   . ASP A 192 ? 0.2858 0.2704 0.2499 -0.0048 -0.0030 0.0019  188 ASP A O   
1513 C CB  . ASP A 192 ? 0.1956 0.1794 0.1630 -0.0005 -0.0005 0.0031  188 ASP A CB  
1514 C CG  . ASP A 192 ? 0.2992 0.2802 0.2659 0.0008  0.0005  0.0034  188 ASP A CG  
1515 O OD1 . ASP A 192 ? 0.2831 0.2613 0.2477 0.0005  0.0007  0.0033  188 ASP A OD1 
1516 O OD2 . ASP A 192 ? 0.3540 0.3356 0.3221 0.0022  0.0012  0.0039  188 ASP A OD2 
1517 N N   . SER A 193 ? 0.2503 0.2397 0.2194 -0.0041 -0.0024 0.0024  189 SER A N   
1518 C CA  . SER A 193 ? 0.2570 0.2498 0.2266 -0.0054 -0.0035 0.0022  189 SER A CA  
1519 C C   . SER A 193 ? 0.3169 0.3087 0.2851 -0.0079 -0.0041 0.0016  189 SER A C   
1520 O O   . SER A 193 ? 0.3185 0.3120 0.2859 -0.0093 -0.0052 0.0013  189 SER A O   
1521 C CB  . SER A 193 ? 0.3273 0.3240 0.2999 -0.0049 -0.0034 0.0026  189 SER A CB  
1522 O OG  . SER A 193 ? 0.5664 0.5628 0.5403 -0.0056 -0.0028 0.0025  189 SER A OG  
1523 N N   . HIS A 194 ? 0.2505 0.2393 0.2180 -0.0083 -0.0034 0.0014  190 HIS A N   
1524 C CA  . HIS A 194 ? 0.2643 0.2515 0.2299 -0.0105 -0.0037 0.0008  190 HIS A CA  
1525 C C   . HIS A 194 ? 0.2922 0.2745 0.2540 -0.0107 -0.0035 0.0005  190 HIS A C   
1526 O O   . HIS A 194 ? 0.2633 0.2429 0.2230 -0.0120 -0.0033 0.0002  190 HIS A O   
1527 C CB  . HIS A 194 ? 0.2835 0.2709 0.2508 -0.0109 -0.0030 0.0008  190 HIS A CB  
1528 C CG  . HIS A 194 ? 0.3287 0.3206 0.2992 -0.0112 -0.0033 0.0011  190 HIS A CG  
1529 N ND1 . HIS A 194 ? 0.3483 0.3426 0.3192 -0.0132 -0.0041 0.0009  190 HIS A ND1 
1530 C CD2 . HIS A 194 ? 0.3579 0.3523 0.3311 -0.0096 -0.0029 0.0016  190 HIS A CD2 
1531 C CE1 . HIS A 194 ? 0.3407 0.3389 0.3146 -0.0127 -0.0041 0.0013  190 HIS A CE1 
1532 N NE2 . HIS A 194 ? 0.3488 0.3471 0.3240 -0.0105 -0.0034 0.0017  190 HIS A NE2 
1533 N N   . HIS A 195 ? 0.2366 0.2173 0.1970 -0.0092 -0.0035 0.0008  191 HIS A N   
1534 C CA  . HIS A 195 ? 0.2403 0.2162 0.1969 -0.0089 -0.0031 0.0006  191 HIS A CA  
1535 C C   . HIS A 195 ? 0.2980 0.2716 0.2511 -0.0111 -0.0038 0.0000  191 HIS A C   
1536 O O   . HIS A 195 ? 0.2999 0.2692 0.2500 -0.0113 -0.0031 -0.0001 191 HIS A O   
1537 C CB  . HIS A 195 ? 0.2515 0.2263 0.2072 -0.0069 -0.0029 0.0010  191 HIS A CB  
1538 C CG  . HIS A 195 ? 0.2979 0.2742 0.2528 -0.0072 -0.0040 0.0009  191 HIS A CG  
1539 N ND1 . HIS A 195 ? 0.3123 0.2928 0.2699 -0.0064 -0.0044 0.0012  191 HIS A ND1 
1540 C CD2 . HIS A 195 ? 0.3209 0.2949 0.2722 -0.0080 -0.0047 0.0005  191 HIS A CD2 
1541 C CE1 . HIS A 195 ? 0.3031 0.2840 0.2590 -0.0067 -0.0054 0.0010  191 HIS A CE1 
1542 N NE2 . HIS A 195 ? 0.3108 0.2879 0.2628 -0.0078 -0.0057 0.0005  191 HIS A NE2 
1543 N N   . ARG A 196 ? 0.2819 0.2583 0.2352 -0.0127 -0.0051 -0.0004 192 ARG A N   
1544 C CA  . ARG A 196 ? 0.2924 0.2665 0.2421 -0.0151 -0.0059 -0.0010 192 ARG A CA  
1545 C C   . ARG A 196 ? 0.3268 0.2991 0.2756 -0.0170 -0.0054 -0.0014 192 ARG A C   
1546 O O   . ARG A 196 ? 0.3079 0.2753 0.2527 -0.0176 -0.0050 -0.0017 192 ARG A O   
1547 C CB  . ARG A 196 ? 0.3087 0.2868 0.2591 -0.0164 -0.0074 -0.0013 192 ARG A CB  
1548 C CG  . ARG A 196 ? 0.4583 0.4367 0.4080 -0.0146 -0.0078 -0.0010 192 ARG A CG  
1549 C CD  . ARG A 196 ? 0.6006 0.5826 0.5503 -0.0160 -0.0094 -0.0013 192 ARG A CD  
1550 N N   . GLU A 197 ? 0.3035 0.2793 0.2558 -0.0174 -0.0053 -0.0013 193 GLU A N   
1551 C CA  . GLU A 197 ? 0.3153 0.2895 0.2671 -0.0189 -0.0047 -0.0016 193 GLU A CA  
1552 C C   . GLU A 197 ? 0.3263 0.2959 0.2762 -0.0174 -0.0033 -0.0014 193 GLU A C   
1553 O O   . GLU A 197 ? 0.3218 0.2875 0.2684 -0.0186 -0.0028 -0.0017 193 GLU A O   
1554 C CB  . GLU A 197 ? 0.3386 0.3177 0.2949 -0.0191 -0.0047 -0.0013 193 GLU A CB  
1555 C CG  . GLU A 197 ? 0.5249 0.5077 0.4821 -0.0216 -0.0059 -0.0016 193 GLU A CG  
1556 C CD  . GLU A 197 ? 0.8205 0.8070 0.7814 -0.0220 -0.0056 -0.0013 193 GLU A CD  
1557 O OE1 . GLU A 197 ? 0.7360 0.7266 0.7004 -0.0205 -0.0057 -0.0008 193 GLU A OE1 
1558 O OE2 . GLU A 197 ? 0.6866 0.6714 0.6466 -0.0236 -0.0052 -0.0016 193 GLU A OE2 
1559 N N   . LEU A 198 ? 0.2779 0.2482 0.2300 -0.0149 -0.0026 -0.0008 194 LEU A N   
1560 C CA  . LEU A 198 ? 0.2709 0.2377 0.2216 -0.0133 -0.0012 -0.0004 194 LEU A CA  
1561 C C   . LEU A 198 ? 0.3609 0.3223 0.3065 -0.0131 -0.0009 -0.0005 194 LEU A C   
1562 O O   . LEU A 198 ? 0.3611 0.3187 0.3040 -0.0132 0.0000  -0.0006 194 LEU A O   
1563 C CB  . LEU A 198 ? 0.2612 0.2300 0.2149 -0.0109 -0.0007 0.0002  194 LEU A CB  
1564 C CG  . LEU A 198 ? 0.2992 0.2720 0.2573 -0.0106 -0.0006 0.0004  194 LEU A CG  
1565 C CD1 . LEU A 198 ? 0.2966 0.2709 0.2571 -0.0084 -0.0002 0.0010  194 LEU A CD1 
1566 C CD2 . LEU A 198 ? 0.2572 0.2288 0.2151 -0.0112 0.0001  0.0003  194 LEU A CD2 
1567 N N   . GLN A 199 ? 0.3378 0.2987 0.2820 -0.0128 -0.0015 -0.0006 195 GLN A N   
1568 C CA  . GLN A 199 ? 0.3544 0.3101 0.2936 -0.0124 -0.0012 -0.0006 195 GLN A CA  
1569 C C   . GLN A 199 ? 0.4288 0.3813 0.3638 -0.0151 -0.0017 -0.0014 195 GLN A C   
1570 O O   . GLN A 199 ? 0.4346 0.3818 0.3647 -0.0149 -0.0011 -0.0014 195 GLN A O   
1571 C CB  . GLN A 199 ? 0.3662 0.3221 0.3053 -0.0108 -0.0015 -0.0002 195 GLN A CB  
1572 C CG  . GLN A 199 ? 0.4369 0.3943 0.3789 -0.0081 -0.0006 0.0006  195 GLN A CG  
1573 C CD  . GLN A 199 ? 0.4480 0.4035 0.3899 -0.0069 0.0009  0.0011  195 GLN A CD  
1574 O OE1 . GLN A 199 ? 0.3059 0.2571 0.2440 -0.0068 0.0016  0.0011  195 GLN A OE1 
1575 N NE2 . GLN A 199 ? 0.2381 0.1967 0.1840 -0.0056 0.0013  0.0015  195 GLN A NE2 
1576 N N   . ALA A 200 ? 0.3978 0.3532 0.3345 -0.0175 -0.0026 -0.0019 196 ALA A N   
1577 C CA  . ALA A 200 ? 0.4069 0.3597 0.3399 -0.0204 -0.0030 -0.0027 196 ALA A CA  
1578 C C   . ALA A 200 ? 0.4744 0.4243 0.4060 -0.0210 -0.0018 -0.0028 196 ALA A C   
1579 O O   . ALA A 200 ? 0.4705 0.4183 0.3994 -0.0236 -0.0020 -0.0034 196 ALA A O   
1580 C CB  . ALA A 200 ? 0.4133 0.3712 0.3490 -0.0227 -0.0046 -0.0031 196 ALA A CB  
1581 N N   . GLY A 201 ? 0.4079 0.3577 0.3412 -0.0187 -0.0006 -0.0022 197 GLY A N   
1582 C CA  . GLY A 201 ? 0.3926 0.3397 0.3246 -0.0188 0.0007  -0.0021 197 GLY A CA  
1583 C C   . GLY A 201 ? 0.4476 0.3983 0.3833 -0.0198 0.0006  -0.0022 197 GLY A C   
1584 O O   . GLY A 201 ? 0.4470 0.3953 0.3812 -0.0202 0.0016  -0.0023 197 GLY A O   
1585 N N   . THR A 202 ? 0.3797 0.3363 0.3202 -0.0202 -0.0004 -0.0022 198 THR A N   
1586 C CA  . THR A 202 ? 0.3833 0.3436 0.3275 -0.0211 -0.0005 -0.0022 198 THR A CA  
1587 C C   . THR A 202 ? 0.4014 0.3646 0.3496 -0.0185 0.0001  -0.0015 198 THR A C   
1588 O O   . THR A 202 ? 0.3868 0.3534 0.3380 -0.0174 -0.0005 -0.0012 198 THR A O   
1589 C CB  . THR A 202 ? 0.5364 0.5015 0.4831 -0.0232 -0.0019 -0.0025 198 THR A CB  
1590 O OG1 . THR A 202 ? 0.5816 0.5443 0.5246 -0.0258 -0.0026 -0.0032 198 THR A OG1 
1591 C CG2 . THR A 202 ? 0.5024 0.4715 0.4529 -0.0239 -0.0019 -0.0024 198 THR A CG2 
1592 N N   . PRO A 203 ? 0.3323 0.2941 0.2807 -0.0176 0.0012  -0.0013 199 PRO A N   
1593 C CA  . PRO A 203 ? 0.3273 0.2920 0.2795 -0.0156 0.0016  -0.0008 199 PRO A CA  
1594 C C   . PRO A 203 ? 0.3447 0.3146 0.3013 -0.0164 0.0009  -0.0008 199 PRO A C   
1595 O O   . PRO A 203 ? 0.3510 0.3217 0.3075 -0.0184 0.0006  -0.0012 199 PRO A O   
1596 C CB  . PRO A 203 ? 0.3563 0.3182 0.3070 -0.0148 0.0029  -0.0007 199 PRO A CB  
1597 C CG  . PRO A 203 ? 0.4205 0.3773 0.3660 -0.0161 0.0034  -0.0011 199 PRO A CG  
1598 C CD  . PRO A 203 ? 0.3596 0.3173 0.3046 -0.0186 0.0022  -0.0016 199 PRO A CD  
1599 N N   . LEU A 204 ? 0.2549 0.2281 0.2149 -0.0148 0.0007  -0.0004 200 LEU A N   
1600 C CA  . LEU A 204 ? 0.2328 0.2109 0.1967 -0.0152 0.0001  -0.0003 200 LEU A CA  
1601 C C   . LEU A 204 ? 0.2322 0.2120 0.1989 -0.0138 0.0007  0.0001  200 LEU A C   
1602 O O   . LEU A 204 ? 0.1924 0.1717 0.1597 -0.0120 0.0012  0.0004  200 LEU A O   
1603 C CB  . LEU A 204 ? 0.2390 0.2197 0.2042 -0.0147 -0.0007 -0.0001 200 LEU A CB  
1604 C CG  . LEU A 204 ? 0.3035 0.2837 0.2665 -0.0163 -0.0017 -0.0004 200 LEU A CG  
1605 C CD1 . LEU A 204 ? 0.2964 0.2788 0.2604 -0.0151 -0.0023 -0.0002 200 LEU A CD1 
1606 C CD2 . LEU A 204 ? 0.3419 0.3244 0.3055 -0.0187 -0.0023 -0.0007 200 LEU A CD2 
1607 N N   . SER A 205 ? 0.1851 0.1673 0.1538 -0.0146 0.0007  0.0001  201 SER A N   
1608 C CA  . SER A 205 ? 0.1775 0.1616 0.1490 -0.0134 0.0012  0.0004  201 SER A CA  
1609 C C   . SER A 205 ? 0.2360 0.2234 0.2101 -0.0124 0.0007  0.0008  201 SER A C   
1610 O O   . SER A 205 ? 0.2321 0.2223 0.2072 -0.0132 0.0000  0.0008  201 SER A O   
1611 C CB  . SER A 205 ? 0.1911 0.1762 0.1634 -0.0146 0.0014  0.0003  201 SER A CB  
1612 O OG  . SER A 205 ? 0.2407 0.2274 0.2154 -0.0133 0.0018  0.0006  201 SER A OG  
1613 N N   . LEU A 206 ? 0.1977 0.1851 0.1730 -0.0106 0.0012  0.0010  202 LEU A N   
1614 C CA  . LEU A 206 ? 0.1868 0.1769 0.1643 -0.0095 0.0009  0.0014  202 LEU A CA  
1615 C C   . LEU A 206 ? 0.2209 0.2142 0.2007 -0.0096 0.0008  0.0017  202 LEU A C   
1616 O O   . LEU A 206 ? 0.2197 0.2156 0.2008 -0.0093 0.0004  0.0020  202 LEU A O   
1617 C CB  . LEU A 206 ? 0.1876 0.1766 0.1656 -0.0078 0.0015  0.0016  202 LEU A CB  
1618 C CG  . LEU A 206 ? 0.2446 0.2318 0.2211 -0.0070 0.0015  0.0017  202 LEU A CG  
1619 C CD1 . LEU A 206 ? 0.2468 0.2308 0.2206 -0.0074 0.0018  0.0015  202 LEU A CD1 
1620 C CD2 . LEU A 206 ? 0.2779 0.2652 0.2556 -0.0055 0.0021  0.0020  202 LEU A CD2 
1621 N N   . PHE A 207 ? 0.1610 0.1540 0.1413 -0.0099 0.0013  0.0016  203 PHE A N   
1622 C CA  . PHE A 207 ? 0.1776 0.1733 0.1600 -0.0098 0.0014  0.0019  203 PHE A CA  
1623 C C   . PHE A 207 ? 0.2297 0.2267 0.2123 -0.0114 0.0012  0.0018  203 PHE A C   
1624 O O   . PHE A 207 ? 0.2027 0.2025 0.1872 -0.0112 0.0013  0.0022  203 PHE A O   
1625 C CB  . PHE A 207 ? 0.1957 0.1904 0.1788 -0.0086 0.0021  0.0020  203 PHE A CB  
1626 C CG  . PHE A 207 ? 0.2127 0.2066 0.1959 -0.0072 0.0022  0.0021  203 PHE A CG  
1627 C CD1 . PHE A 207 ? 0.2445 0.2401 0.2286 -0.0064 0.0021  0.0024  203 PHE A CD1 
1628 C CD2 . PHE A 207 ? 0.2225 0.2140 0.2047 -0.0067 0.0026  0.0019  203 PHE A CD2 
1629 C CE1 . PHE A 207 ? 0.2517 0.2463 0.2357 -0.0052 0.0023  0.0025  203 PHE A CE1 
1630 C CE2 . PHE A 207 ? 0.2553 0.2462 0.2377 -0.0056 0.0028  0.0020  203 PHE A CE2 
1631 C CZ  . PHE A 207 ? 0.2339 0.2262 0.2171 -0.0049 0.0027  0.0023  203 PHE A CZ  
1632 N N   . GLY A 208 ? 0.2255 0.2205 0.2062 -0.0129 0.0011  0.0014  204 GLY A N   
1633 C CA  . GLY A 208 ? 0.2244 0.2205 0.2051 -0.0147 0.0010  0.0013  204 GLY A CA  
1634 C C   . GLY A 208 ? 0.2921 0.2871 0.2727 -0.0150 0.0017  0.0012  204 GLY A C   
1635 O O   . GLY A 208 ? 0.2664 0.2597 0.2470 -0.0137 0.0024  0.0012  204 GLY A O   
1636 N N   . ASP A 209 ? 0.2684 0.2645 0.2490 -0.0168 0.0017  0.0012  205 ASP A N   
1637 C CA  . ASP A 209 ? 0.2745 0.2691 0.2548 -0.0172 0.0025  0.0011  205 ASP A CA  
1638 C C   . ASP A 209 ? 0.2838 0.2807 0.2665 -0.0161 0.0029  0.0016  205 ASP A C   
1639 O O   . ASP A 209 ? 0.2817 0.2773 0.2639 -0.0164 0.0036  0.0015  205 ASP A O   
1640 C CB  . ASP A 209 ? 0.3227 0.3169 0.3015 -0.0198 0.0024  0.0008  205 ASP A CB  
1641 C CG  . ASP A 209 ? 0.5504 0.5490 0.5312 -0.0212 0.0016  0.0012  205 ASP A CG  
1642 O OD1 . ASP A 209 ? 0.5675 0.5699 0.5510 -0.0199 0.0013  0.0018  205 ASP A OD1 
1643 O OD2 . ASP A 209 ? 0.6954 0.6939 0.6749 -0.0236 0.0014  0.0009  205 ASP A OD2 
1644 N N   . THR A 210 ? 0.2372 0.2371 0.2221 -0.0148 0.0026  0.0021  206 THR A N   
1645 C CA  . THR A 210 ? 0.2214 0.2231 0.2082 -0.0137 0.0031  0.0026  206 THR A CA  
1646 C C   . THR A 210 ? 0.2485 0.2478 0.2349 -0.0119 0.0037  0.0025  206 THR A C   
1647 O O   . THR A 210 ? 0.2208 0.2210 0.2085 -0.0107 0.0041  0.0028  206 THR A O   
1648 C CB  . THR A 210 ? 0.3084 0.3143 0.2974 -0.0130 0.0027  0.0034  206 THR A CB  
1649 O OG1 . THR A 210 ? 0.2622 0.2679 0.2513 -0.0115 0.0025  0.0034  206 THR A OG1 
1650 C CG2 . THR A 210 ? 0.2857 0.2947 0.2753 -0.0148 0.0021  0.0036  206 THR A CG2 
1651 N N   . TYR A 211 ? 0.1958 0.1921 0.1805 -0.0116 0.0037  0.0020  207 TYR A N   
1652 C CA  . TYR A 211 ? 0.1782 0.1725 0.1626 -0.0101 0.0041  0.0018  207 TYR A CA  
1653 C C   . TYR A 211 ? 0.2302 0.2213 0.2125 -0.0104 0.0046  0.0014  207 TYR A C   
1654 O O   . TYR A 211 ? 0.2197 0.2094 0.2003 -0.0116 0.0045  0.0011  207 TYR A O   
1655 C CB  . TYR A 211 ? 0.2091 0.2032 0.1935 -0.0091 0.0038  0.0019  207 TYR A CB  
1656 C CG  . TYR A 211 ? 0.2118 0.2087 0.1980 -0.0085 0.0035  0.0023  207 TYR A CG  
1657 C CD1 . TYR A 211 ? 0.2413 0.2391 0.2286 -0.0072 0.0038  0.0027  207 TYR A CD1 
1658 C CD2 . TYR A 211 ? 0.2159 0.2144 0.2022 -0.0090 0.0029  0.0025  207 TYR A CD2 
1659 C CE1 . TYR A 211 ? 0.2544 0.2546 0.2430 -0.0065 0.0037  0.0032  207 TYR A CE1 
1660 C CE2 . TYR A 211 ? 0.2254 0.2265 0.2131 -0.0082 0.0026  0.0030  207 TYR A CE2 
1661 C CZ  . TYR A 211 ? 0.3088 0.3108 0.2976 -0.0069 0.0031  0.0034  207 TYR A CZ  
1662 O OH  . TYR A 211 ? 0.2710 0.2753 0.2607 -0.0059 0.0031  0.0040  207 TYR A OH  
1663 N N   . GLU A 212 ? 0.1978 0.1876 0.1799 -0.0092 0.0051  0.0013  208 GLU A N   
1664 C CA  . GLU A 212 ? 0.1965 0.1833 0.1765 -0.0091 0.0057  0.0010  208 GLU A CA  
1665 C C   . GLU A 212 ? 0.2340 0.2192 0.2125 -0.0088 0.0055  0.0008  208 GLU A C   
1666 O O   . GLU A 212 ? 0.2272 0.2100 0.2034 -0.0094 0.0058  0.0006  208 GLU A O   
1667 C CB  . GLU A 212 ? 0.2040 0.1906 0.1845 -0.0077 0.0061  0.0010  208 GLU A CB  
1668 C CG  . GLU A 212 ? 0.2742 0.2581 0.2526 -0.0072 0.0066  0.0008  208 GLU A CG  
1669 C CD  . GLU A 212 ? 0.4579 0.4418 0.4367 -0.0058 0.0069  0.0008  208 GLU A CD  
1670 O OE1 . GLU A 212 ? 0.3338 0.3185 0.3135 -0.0055 0.0071  0.0008  208 GLU A OE1 
1671 O OE2 . GLU A 212 ? 0.3805 0.3638 0.3587 -0.0050 0.0068  0.0007  208 GLU A OE2 
1672 N N   . THR A 213 ? 0.1878 0.1739 0.1674 -0.0079 0.0051  0.0010  209 THR A N   
1673 C CA  . THR A 213 ? 0.1821 0.1671 0.1607 -0.0074 0.0050  0.0010  209 THR A CA  
1674 C C   . THR A 213 ? 0.1985 0.1830 0.1759 -0.0085 0.0047  0.0009  209 THR A C   
1675 O O   . THR A 213 ? 0.1766 0.1629 0.1550 -0.0094 0.0042  0.0009  209 THR A O   
1676 C CB  . THR A 213 ? 0.2292 0.2159 0.2096 -0.0065 0.0047  0.0012  209 THR A CB  
1677 O OG1 . THR A 213 ? 0.2468 0.2338 0.2281 -0.0057 0.0049  0.0012  209 THR A OG1 
1678 C CG2 . THR A 213 ? 0.1884 0.1741 0.1680 -0.0060 0.0046  0.0012  209 THR A CG2 
1679 N N   . GLN A 214 ? 0.1717 0.1539 0.1470 -0.0083 0.0049  0.0008  210 GLN A N   
1680 C CA  . GLN A 214 ? 0.1786 0.1598 0.1523 -0.0092 0.0045  0.0007  210 GLN A CA  
1681 C C   . GLN A 214 ? 0.2158 0.1963 0.1891 -0.0081 0.0045  0.0009  210 GLN A C   
1682 O O   . GLN A 214 ? 0.2391 0.2177 0.2109 -0.0072 0.0050  0.0010  210 GLN A O   
1683 C CB  . GLN A 214 ? 0.1960 0.1743 0.1668 -0.0103 0.0049  0.0004  210 GLN A CB  
1684 C CG  . GLN A 214 ? 0.2005 0.1797 0.1717 -0.0119 0.0049  0.0003  210 GLN A CG  
1685 C CD  . GLN A 214 ? 0.3825 0.3648 0.3556 -0.0129 0.0040  0.0003  210 GLN A CD  
1686 O OE1 . GLN A 214 ? 0.3555 0.3380 0.3281 -0.0133 0.0034  0.0003  210 GLN A OE1 
1687 N NE2 . GLN A 214 ? 0.2871 0.2720 0.2624 -0.0133 0.0039  0.0005  210 GLN A NE2 
1688 N N   . VAL A 215 ? 0.1704 0.1526 0.1450 -0.0081 0.0038  0.0010  211 VAL A N   
1689 C CA  . VAL A 215 ? 0.1618 0.1433 0.1358 -0.0071 0.0038  0.0012  211 VAL A CA  
1690 C C   . VAL A 215 ? 0.2028 0.1831 0.1749 -0.0082 0.0034  0.0011  211 VAL A C   
1691 O O   . VAL A 215 ? 0.2028 0.1849 0.1757 -0.0090 0.0027  0.0010  211 VAL A O   
1692 C CB  . VAL A 215 ? 0.2023 0.1861 0.1788 -0.0063 0.0036  0.0015  211 VAL A CB  
1693 C CG1 . VAL A 215 ? 0.1917 0.1746 0.1675 -0.0054 0.0036  0.0017  211 VAL A CG1 
1694 C CG2 . VAL A 215 ? 0.2018 0.1865 0.1799 -0.0056 0.0039  0.0016  211 VAL A CG2 
1695 N N   . ILE A 216 ? 0.1613 0.1385 0.1304 -0.0081 0.0038  0.0010  212 ILE A N   
1696 C CA  . ILE A 216 ? 0.1577 0.1332 0.1244 -0.0092 0.0034  0.0008  212 ILE A CA  
1697 C C   . ILE A 216 ? 0.2015 0.1758 0.1670 -0.0082 0.0033  0.0011  212 ILE A C   
1698 O O   . ILE A 216 ? 0.2068 0.1798 0.1717 -0.0068 0.0040  0.0014  212 ILE A O   
1699 C CB  . ILE A 216 ? 0.1947 0.1668 0.1581 -0.0100 0.0039  0.0005  212 ILE A CB  
1700 C CG1 . ILE A 216 ? 0.2027 0.1756 0.1671 -0.0108 0.0042  0.0003  212 ILE A CG1 
1701 C CG2 . ILE A 216 ? 0.1953 0.1653 0.1557 -0.0115 0.0035  0.0002  212 ILE A CG2 
1702 C CD1 . ILE A 216 ? 0.3375 0.3130 0.3036 -0.0126 0.0035  0.0001  212 ILE A CD1 
1703 N N   . ALA A 217 ? 0.1709 0.1458 0.1361 -0.0088 0.0026  0.0009  213 ALA A N   
1704 C CA  . ALA A 217 ? 0.1611 0.1344 0.1246 -0.0079 0.0025  0.0012  213 ALA A CA  
1705 C C   . ALA A 217 ? 0.2137 0.1832 0.1730 -0.0089 0.0026  0.0009  213 ALA A C   
1706 O O   . ALA A 217 ? 0.1884 0.1576 0.1466 -0.0107 0.0021  0.0004  213 ALA A O   
1707 C CB  . ALA A 217 ? 0.1800 0.1559 0.1452 -0.0080 0.0017  0.0012  213 ALA A CB  
1708 N N   . TYR A 218 ? 0.1695 0.1361 0.1265 -0.0076 0.0032  0.0012  214 TYR A N   
1709 C CA  . TYR A 218 ? 0.1825 0.1449 0.1349 -0.0081 0.0035  0.0011  214 TYR A CA  
1710 C C   . TYR A 218 ? 0.2525 0.2135 0.2034 -0.0072 0.0033  0.0013  214 TYR A C   
1711 O O   . TYR A 218 ? 0.2534 0.2152 0.2056 -0.0054 0.0037  0.0019  214 TYR A O   
1712 C CB  . TYR A 218 ? 0.2019 0.1613 0.1521 -0.0070 0.0047  0.0014  214 TYR A CB  
1713 C CG  . TYR A 218 ? 0.2416 0.2016 0.1928 -0.0075 0.0051  0.0012  214 TYR A CG  
1714 C CD1 . TYR A 218 ? 0.2704 0.2338 0.2254 -0.0067 0.0052  0.0014  214 TYR A CD1 
1715 C CD2 . TYR A 218 ? 0.2711 0.2281 0.2192 -0.0089 0.0055  0.0008  214 TYR A CD2 
1716 C CE1 . TYR A 218 ? 0.2675 0.2313 0.2233 -0.0071 0.0056  0.0013  214 TYR A CE1 
1717 C CE2 . TYR A 218 ? 0.2923 0.2496 0.2411 -0.0092 0.0060  0.0007  214 TYR A CE2 
1718 C CZ  . TYR A 218 ? 0.3392 0.3001 0.2920 -0.0082 0.0060  0.0009  214 TYR A CZ  
1719 O OH  . TYR A 218 ? 0.3602 0.3216 0.3138 -0.0084 0.0064  0.0008  214 TYR A OH  
1720 N N   . GLY A 219 ? 0.2138 0.1724 0.1614 -0.0084 0.0028  0.0009  215 GLY A N   
1721 C CA  . GLY A 219 ? 0.2062 0.1627 0.1514 -0.0075 0.0027  0.0011  215 GLY A CA  
1722 C C   . GLY A 219 ? 0.2754 0.2264 0.2154 -0.0073 0.0036  0.0012  215 GLY A C   
1723 O O   . GLY A 219 ? 0.2594 0.2090 0.1987 -0.0071 0.0045  0.0013  215 GLY A O   
1724 N N   . GLN A 220 ? 0.2278 0.1755 0.1641 -0.0073 0.0034  0.0011  216 GLN A N   
1725 C CA  . GLN A 220 ? 0.2398 0.1818 0.1705 -0.0071 0.0043  0.0012  216 GLN A CA  
1726 C C   . GLN A 220 ? 0.2833 0.2229 0.2116 -0.0089 0.0046  0.0006  216 GLN A C   
1727 O O   . GLN A 220 ? 0.2819 0.2234 0.2115 -0.0112 0.0037  -0.0001 216 GLN A O   
1728 C CB  . GLN A 220 ? 0.2522 0.1914 0.1793 -0.0077 0.0036  0.0009  216 GLN A CB  
1729 C CG  . GLN A 220 ? 0.3751 0.3078 0.2957 -0.0075 0.0045  0.0009  216 GLN A CG  
1730 C CD  . GLN A 220 ? 0.4427 0.3726 0.3597 -0.0078 0.0039  0.0007  216 GLN A CD  
1731 O OE1 . GLN A 220 ? 0.3882 0.3210 0.3070 -0.0092 0.0024  0.0002  216 GLN A OE1 
1732 N NE2 . GLN A 220 ? 0.4594 0.3837 0.3711 -0.0066 0.0049  0.0011  216 GLN A NE2 
1733 N N   . GLY A 221 ? 0.3019 0.2371 0.2264 -0.0079 0.0060  0.0010  217 GLY A N   
1734 C CA  . GLY A 221 ? 0.3253 0.2574 0.2468 -0.0094 0.0066  0.0005  217 GLY A CA  
1735 C C   . GLY A 221 ? 0.3849 0.3153 0.3054 -0.0076 0.0082  0.0012  217 GLY A C   
1736 O O   . GLY A 221 ? 0.3535 0.2848 0.2751 -0.0050 0.0089  0.0021  217 GLY A O   
1737 N N   . SER A 222 ? 0.3650 0.2928 0.2831 -0.0089 0.0087  0.0008  218 SER A N   
1738 C CA  . SER A 222 ? 0.3833 0.3089 0.2995 -0.0073 0.0103  0.0013  218 SER A CA  
1739 C C   . SER A 222 ? 0.4407 0.3689 0.3598 -0.0086 0.0102  0.0009  218 SER A C   
1740 O O   . SER A 222 ? 0.4463 0.3746 0.3655 -0.0113 0.0095  0.0000  218 SER A O   
1741 C CB  . SER A 222 ? 0.4813 0.3995 0.3902 -0.0073 0.0116  0.0013  218 SER A CB  
1742 O OG  . SER A 222 ? 0.6760 0.5911 0.5813 -0.0092 0.0108  0.0006  218 SER A OG  
1743 N N   . SER A 223 ? 0.3866 0.3171 0.3083 -0.0067 0.0110  0.0015  219 SER A N   
1744 C CA  . SER A 223 ? 0.3851 0.3180 0.3096 -0.0073 0.0111  0.0012  219 SER A CA  
1745 C C   . SER A 223 ? 0.4357 0.3656 0.3571 -0.0053 0.0129  0.0019  219 SER A C   
1746 O O   . SER A 223 ? 0.4022 0.3297 0.3209 -0.0030 0.0138  0.0026  219 SER A O   
1747 C CB  . SER A 223 ? 0.4096 0.3489 0.3405 -0.0066 0.0103  0.0015  219 SER A CB  
1748 O OG  . SER A 223 ? 0.5451 0.4878 0.4793 -0.0085 0.0088  0.0009  219 SER A OG  
1749 N N   . GLU A 224 ? 0.4383 0.3685 0.3603 -0.0060 0.0132  0.0016  220 GLU A N   
1750 C CA  . GLU A 224 ? 0.4505 0.3785 0.3702 -0.0041 0.0148  0.0021  220 GLU A CA  
1751 C C   . GLU A 224 ? 0.5133 0.4456 0.4375 -0.0045 0.0145  0.0019  220 GLU A C   
1752 O O   . GLU A 224 ? 0.5169 0.4505 0.4429 -0.0069 0.0137  0.0011  220 GLU A O   
1753 C CB  . GLU A 224 ? 0.4796 0.4008 0.3926 -0.0050 0.0161  0.0018  220 GLU A CB  
1754 N N   . GLY A 225 ? 0.4679 0.4029 0.3945 -0.0021 0.0149  0.0026  221 GLY A N   
1755 C CA  . GLY A 225 ? 0.4576 0.3966 0.3883 -0.0021 0.0146  0.0024  221 GLY A CA  
1756 C C   . GLY A 225 ? 0.4871 0.4233 0.4147 -0.0009 0.0162  0.0027  221 GLY A C   
1757 O O   . GLY A 225 ? 0.4627 0.3965 0.3871 0.0014  0.0174  0.0035  221 GLY A O   
1758 N N   . LEU A 226 ? 0.4580 0.3943 0.3863 -0.0023 0.0162  0.0021  222 LEU A N   
1759 C CA  . LEU A 226 ? 0.4578 0.3913 0.3830 -0.0012 0.0177  0.0023  222 LEU A CA  
1760 C C   . LEU A 226 ? 0.4776 0.4157 0.4068 0.0007  0.0176  0.0028  222 LEU A C   
1761 O O   . LEU A 226 ? 0.4650 0.4080 0.3993 0.0002  0.0163  0.0026  222 LEU A O   
1762 C CB  . LEU A 226 ? 0.4645 0.3958 0.3884 -0.0037 0.0179  0.0015  222 LEU A CB  
1763 C CG  . LEU A 226 ? 0.5413 0.4685 0.4616 -0.0062 0.0177  0.0009  222 LEU A CG  
1764 N N   . ARG A 227 ? 0.4292 0.3657 0.3560 0.0027  0.0190  0.0033  223 ARG A N   
1765 C CA  . ARG A 227 ? 0.4195 0.3603 0.3498 0.0044  0.0189  0.0036  223 ARG A CA  
1766 C C   . ARG A 227 ? 0.4403 0.3841 0.3746 0.0026  0.0179  0.0029  223 ARG A C   
1767 O O   . ARG A 227 ? 0.4450 0.3861 0.3775 0.0010  0.0183  0.0023  223 ARG A O   
1768 C CB  . ARG A 227 ? 0.4294 0.3673 0.3557 0.0068  0.0206  0.0042  223 ARG A CB  
1769 C CG  . ARG A 227 ? 0.5076 0.4439 0.4307 0.0094  0.0216  0.0053  223 ARG A CG  
1770 C CD  . ARG A 227 ? 0.6127 0.5460 0.5314 0.0118  0.0235  0.0059  223 ARG A CD  
1771 N N   . GLN A 228 ? 0.3631 0.3121 0.3026 0.0026  0.0166  0.0029  224 GLN A N   
1772 C CA  . GLN A 228 ? 0.3462 0.2983 0.2896 0.0011  0.0157  0.0023  224 GLN A CA  
1773 C C   . GLN A 228 ? 0.3559 0.3118 0.3023 0.0028  0.0155  0.0026  224 GLN A C   
1774 O O   . GLN A 228 ? 0.3507 0.3080 0.2973 0.0046  0.0156  0.0032  224 GLN A O   
1775 C CB  . GLN A 228 ? 0.3618 0.3169 0.3089 -0.0005 0.0142  0.0019  224 GLN A CB  
1776 C CG  . GLN A 228 ? 0.4577 0.4103 0.4029 -0.0024 0.0139  0.0016  224 GLN A CG  
1777 C CD  . GLN A 228 ? 0.4970 0.4531 0.4462 -0.0039 0.0124  0.0013  224 GLN A CD  
1778 O OE1 . GLN A 228 ? 0.4077 0.3654 0.3583 -0.0036 0.0117  0.0015  224 GLN A OE1 
1779 N NE2 . GLN A 228 ? 0.2958 0.2535 0.2471 -0.0055 0.0120  0.0008  224 GLN A NE2 
1780 N N   . ASN A 229 ? 0.2614 0.2192 0.2103 0.0021  0.0151  0.0021  225 ASN A N   
1781 C CA  . ASN A 229 ? 0.2459 0.2072 0.1976 0.0034  0.0148  0.0023  225 ASN A CA  
1782 C C   . ASN A 229 ? 0.2822 0.2477 0.2383 0.0028  0.0133  0.0022  225 ASN A C   
1783 O O   . ASN A 229 ? 0.2730 0.2414 0.2318 0.0032  0.0128  0.0021  225 ASN A O   
1784 C CB  . ASN A 229 ? 0.2530 0.2140 0.2047 0.0033  0.0152  0.0020  225 ASN A CB  
1785 C CG  . ASN A 229 ? 0.3494 0.3122 0.3015 0.0054  0.0154  0.0023  225 ASN A CG  
1786 O OD1 . ASN A 229 ? 0.4023 0.3653 0.3531 0.0073  0.0159  0.0029  225 ASN A OD1 
1787 N ND2 . ASN A 229 ? 0.3193 0.2835 0.2731 0.0053  0.0152  0.0020  225 ASN A ND2 
1788 N N   . VAL A 230 ? 0.2154 0.1809 0.1721 0.0017  0.0127  0.0021  226 VAL A N   
1789 C CA  . VAL A 230 ? 0.2026 0.1715 0.1630 0.0011  0.0115  0.0021  226 VAL A CA  
1790 C C   . VAL A 230 ? 0.2406 0.2096 0.2004 0.0018  0.0114  0.0025  226 VAL A C   
1791 O O   . VAL A 230 ? 0.2330 0.1989 0.1896 0.0021  0.0121  0.0028  226 VAL A O   
1792 C CB  . VAL A 230 ? 0.2441 0.2138 0.2064 -0.0010 0.0106  0.0015  226 VAL A CB  
1793 C CG1 . VAL A 230 ? 0.2365 0.2064 0.1995 -0.0015 0.0108  0.0012  226 VAL A CG1 
1794 C CG2 . VAL A 230 ? 0.2490 0.2163 0.2093 -0.0023 0.0107  0.0014  226 VAL A CG2 
1795 N N   . ASP A 231 ? 0.1788 0.1511 0.1417 0.0021  0.0106  0.0027  227 ASP A N   
1796 C CA  . ASP A 231 ? 0.1706 0.1432 0.1333 0.0027  0.0105  0.0032  227 ASP A CA  
1797 C C   . ASP A 231 ? 0.2179 0.1898 0.1810 0.0013  0.0099  0.0029  227 ASP A C   
1798 O O   . ASP A 231 ? 0.2416 0.2144 0.2064 -0.0001 0.0093  0.0024  227 ASP A O   
1799 C CB  . ASP A 231 ? 0.1829 0.1593 0.1488 0.0034  0.0100  0.0034  227 ASP A CB  
1800 C CG  . ASP A 231 ? 0.2417 0.2196 0.2077 0.0048  0.0104  0.0038  227 ASP A CG  
1801 O OD1 . ASP A 231 ? 0.2469 0.2227 0.2099 0.0060  0.0113  0.0041  227 ASP A OD1 
1802 O OD2 . ASP A 231 ? 0.2461 0.2271 0.2147 0.0048  0.0097  0.0038  227 ASP A OD2 
1803 N N   . VAL A 232 ? 0.1752 0.1459 0.1369 0.0017  0.0101  0.0033  228 VAL A N   
1804 C CA  . VAL A 232 ? 0.1836 0.1540 0.1457 0.0004  0.0095  0.0030  228 VAL A CA  
1805 C C   . VAL A 232 ? 0.2155 0.1875 0.1789 0.0013  0.0092  0.0035  228 VAL A C   
1806 O O   . VAL A 232 ? 0.2101 0.1814 0.1719 0.0028  0.0099  0.0042  228 VAL A O   
1807 C CB  . VAL A 232 ? 0.2423 0.2086 0.2005 -0.0002 0.0099  0.0029  228 VAL A CB  
1808 C CG1 . VAL A 232 ? 0.2469 0.2130 0.2054 -0.0014 0.0092  0.0026  228 VAL A CG1 
1809 C CG2 . VAL A 232 ? 0.2403 0.2050 0.1972 -0.0013 0.0102  0.0023  228 VAL A CG2 
1810 N N   . TRP A 233 ? 0.1967 0.1708 0.1628 0.0005  0.0084  0.0033  229 TRP A N   
1811 C CA  . TRP A 233 ? 0.1854 0.1608 0.1527 0.0012  0.0083  0.0038  229 TRP A CA  
1812 C C   . TRP A 233 ? 0.2063 0.1801 0.1723 0.0007  0.0080  0.0038  229 TRP A C   
1813 O O   . TRP A 233 ? 0.1983 0.1721 0.1650 -0.0006 0.0074  0.0032  229 TRP A O   
1814 C CB  . TRP A 233 ? 0.1647 0.1435 0.1357 0.0010  0.0077  0.0037  229 TRP A CB  
1815 C CG  . TRP A 233 ? 0.1724 0.1527 0.1447 0.0016  0.0077  0.0042  229 TRP A CG  
1816 C CD1 . TRP A 233 ? 0.2026 0.1835 0.1744 0.0029  0.0083  0.0050  229 TRP A CD1 
1817 C CD2 . TRP A 233 ? 0.1714 0.1531 0.1457 0.0011  0.0072  0.0041  229 TRP A CD2 
1818 N NE1 . TRP A 233 ? 0.1932 0.1758 0.1668 0.0031  0.0082  0.0053  229 TRP A NE1 
1819 C CE2 . TRP A 233 ? 0.2113 0.1941 0.1862 0.0020  0.0075  0.0048  229 TRP A CE2 
1820 C CE3 . TRP A 233 ? 0.1942 0.1762 0.1697 0.0001  0.0066  0.0037  229 TRP A CE3 
1821 C CZ2 . TRP A 233 ? 0.1999 0.1838 0.1765 0.0017  0.0073  0.0049  229 TRP A CZ2 
1822 C CZ3 . TRP A 233 ? 0.2104 0.1936 0.1875 0.0000  0.0064  0.0038  229 TRP A CZ3 
1823 C CH2 . TRP A 233 ? 0.2155 0.1994 0.1931 0.0008  0.0068  0.0044  229 TRP A CH2 
1824 N N   . LEU A 234 ? 0.1809 0.1533 0.1451 0.0018  0.0085  0.0044  230 LEU A N   
1825 C CA  . LEU A 234 ? 0.1813 0.1519 0.1439 0.0015  0.0084  0.0044  230 LEU A CA  
1826 C C   . LEU A 234 ? 0.2090 0.1815 0.1737 0.0021  0.0082  0.0048  230 LEU A C   
1827 O O   . LEU A 234 ? 0.1818 0.1558 0.1474 0.0033  0.0087  0.0054  230 LEU A O   
1828 C CB  . LEU A 234 ? 0.1816 0.1484 0.1399 0.0024  0.0092  0.0048  230 LEU A CB  
1829 C CG  . LEU A 234 ? 0.2333 0.1974 0.1887 0.0020  0.0098  0.0045  230 LEU A CG  
1830 C CD1 . LEU A 234 ? 0.2508 0.2108 0.2015 0.0032  0.0108  0.0050  230 LEU A CD1 
1831 C CD2 . LEU A 234 ? 0.2149 0.1785 0.1705 0.0000  0.0090  0.0036  230 LEU A CD2 
1832 N N   . TRP A 235 ? 0.1871 0.1597 0.1524 0.0014  0.0076  0.0045  231 TRP A N   
1833 C CA  . TRP A 235 ? 0.1928 0.1668 0.1597 0.0020  0.0075  0.0050  231 TRP A CA  
1834 C C   . TRP A 235 ? 0.2230 0.1949 0.1879 0.0019  0.0073  0.0049  231 TRP A C   
1835 O O   . TRP A 235 ? 0.1969 0.1686 0.1618 0.0008  0.0066  0.0044  231 TRP A O   
1836 C CB  . TRP A 235 ? 0.1774 0.1543 0.1478 0.0012  0.0069  0.0046  231 TRP A CB  
1837 C CG  . TRP A 235 ? 0.1978 0.1762 0.1701 0.0017  0.0070  0.0050  231 TRP A CG  
1838 C CD1 . TRP A 235 ? 0.2342 0.2122 0.2059 0.0028  0.0075  0.0057  231 TRP A CD1 
1839 C CD2 . TRP A 235 ? 0.2076 0.1880 0.1825 0.0011  0.0066  0.0047  231 TRP A CD2 
1840 N NE1 . TRP A 235 ? 0.2260 0.2057 0.1999 0.0028  0.0075  0.0059  231 TRP A NE1 
1841 C CE2 . TRP A 235 ? 0.2532 0.2343 0.2290 0.0018  0.0069  0.0052  231 TRP A CE2 
1842 C CE3 . TRP A 235 ? 0.2323 0.2140 0.2088 0.0002  0.0061  0.0041  231 TRP A CE3 
1843 C CZ2 . TRP A 235 ? 0.2509 0.2335 0.2289 0.0014  0.0068  0.0051  231 TRP A CZ2 
1844 C CZ3 . TRP A 235 ? 0.2554 0.2386 0.2339 0.0000  0.0060  0.0041  231 TRP A CZ3 
1845 C CH2 . TRP A 235 ? 0.2699 0.2533 0.2490 0.0006  0.0063  0.0046  231 TRP A CH2 
1846 N N   . GLN A 236 ? 0.1801 0.1505 0.1433 0.0032  0.0080  0.0056  232 GLN A N   
1847 C CA  . GLN A 236 ? 0.1653 0.1334 0.1262 0.0034  0.0079  0.0058  232 GLN A CA  
1848 C C   . GLN A 236 ? 0.2205 0.1907 0.1840 0.0034  0.0075  0.0058  232 GLN A C   
1849 O O   . GLN A 236 ? 0.2364 0.2083 0.2017 0.0043  0.0080  0.0064  232 GLN A O   
1850 C CB  . GLN A 236 ? 0.1885 0.1543 0.1465 0.0050  0.0089  0.0066  232 GLN A CB  
1851 C CG  . GLN A 236 ? 0.1941 0.1566 0.1488 0.0053  0.0089  0.0067  232 GLN A CG  
1852 C CD  . GLN A 236 ? 0.2813 0.2410 0.2330 0.0040  0.0085  0.0060  232 GLN A CD  
1853 O OE1 . GLN A 236 ? 0.2168 0.1754 0.1672 0.0038  0.0089  0.0058  232 GLN A OE1 
1854 N NE2 . GLN A 236 ? 0.2359 0.1949 0.1869 0.0029  0.0076  0.0054  232 GLN A NE2 
1855 N N   . LEU A 237 ? 0.1878 0.1580 0.1514 0.0025  0.0067  0.0052  233 LEU A N   
1856 C CA  . LEU A 237 ? 0.1977 0.1697 0.1635 0.0026  0.0064  0.0053  233 LEU A CA  
1857 C C   . LEU A 237 ? 0.2615 0.2317 0.2253 0.0035  0.0066  0.0057  233 LEU A C   
1858 O O   . LEU A 237 ? 0.2696 0.2406 0.2347 0.0045  0.0071  0.0062  233 LEU A O   
1859 C CB  . LEU A 237 ? 0.1943 0.1679 0.1616 0.0014  0.0055  0.0046  233 LEU A CB  
1860 C CG  . LEU A 237 ? 0.2357 0.2112 0.2051 0.0005  0.0054  0.0042  233 LEU A CG  
1861 C CD1 . LEU A 237 ? 0.2444 0.2216 0.2152 -0.0004 0.0046  0.0037  233 LEU A CD1 
1862 C CD2 . LEU A 237 ? 0.2380 0.2153 0.2097 0.0011  0.0059  0.0046  233 LEU A CD2 
1863 N N   . GLU A 238 ? 0.2214 0.1890 0.1822 0.0032  0.0063  0.0055  234 GLU A N   
1864 C CA  . GLU A 238 ? 0.2128 0.1782 0.1712 0.0041  0.0064  0.0058  234 GLU A CA  
1865 C C   . GLU A 238 ? 0.2381 0.1998 0.1924 0.0045  0.0069  0.0060  234 GLU A C   
1866 O O   . GLU A 238 ? 0.1853 0.1458 0.1380 0.0035  0.0067  0.0055  234 GLU A O   
1867 C CB  . GLU A 238 ? 0.2343 0.2001 0.1925 0.0033  0.0054  0.0052  234 GLU A CB  
1868 C CG  . GLU A 238 ? 0.4382 0.4075 0.4000 0.0027  0.0049  0.0049  234 GLU A CG  
1869 C CD  . GLU A 238 ? 0.7744 0.7446 0.7371 0.0035  0.0048  0.0051  234 GLU A CD  
1870 O OE1 . GLU A 238 ? 0.4792 0.4510 0.4429 0.0028  0.0040  0.0047  234 GLU A OE1 
1871 O OE2 . GLU A 238 ? 0.8919 0.8613 0.8544 0.0048  0.0056  0.0057  234 GLU A OE2 
1872 N N   . GLY A 239 ? 0.2068 0.1666 0.1591 0.0060  0.0076  0.0067  235 GLY A N   
1873 C CA  . GLY A 239 ? 0.1974 0.1531 0.1452 0.0067  0.0082  0.0070  235 GLY A CA  
1874 C C   . GLY A 239 ? 0.2379 0.1935 0.1854 0.0072  0.0090  0.0075  235 GLY A C   
1875 O O   . GLY A 239 ? 0.2367 0.1954 0.1876 0.0074  0.0093  0.0077  235 GLY A O   
1876 N N   . SER A 240 ? 0.1996 0.1513 0.1429 0.0074  0.0095  0.0075  236 SER A N   
1877 C CA  . SER A 240 ? 0.2072 0.1584 0.1496 0.0083  0.0105  0.0081  236 SER A CA  
1878 C C   . SER A 240 ? 0.2559 0.2041 0.1950 0.0072  0.0105  0.0074  236 SER A C   
1879 O O   . SER A 240 ? 0.2328 0.1785 0.1694 0.0058  0.0098  0.0066  236 SER A O   
1880 C CB  . SER A 240 ? 0.2736 0.2229 0.2135 0.0107  0.0118  0.0093  236 SER A CB  
1881 O OG  . SER A 240 ? 0.3234 0.2678 0.2583 0.0110  0.0120  0.0093  236 SER A OG  
1882 N N   . SER A 241 ? 0.2139 0.1624 0.1529 0.0079  0.0113  0.0078  237 SER A N   
1883 C CA  . SER A 241 ? 0.2204 0.1658 0.1561 0.0071  0.0116  0.0073  237 SER A CA  
1884 C C   . SER A 241 ? 0.2783 0.2229 0.2124 0.0091  0.0130  0.0083  237 SER A C   
1885 O O   . SER A 241 ? 0.2584 0.2056 0.1946 0.0108  0.0136  0.0093  237 SER A O   
1886 C CB  . SER A 241 ? 0.2533 0.2012 0.1919 0.0050  0.0106  0.0063  237 SER A CB  
1887 O OG  . SER A 241 ? 0.2959 0.2479 0.2386 0.0055  0.0108  0.0066  237 SER A OG  
1888 N N   . VAL A 242 ? 0.2588 0.1997 0.1889 0.0090  0.0137  0.0081  238 VAL A N   
1889 C CA  . VAL A 242 ? 0.2606 0.2004 0.1886 0.0110  0.0151  0.0091  238 VAL A CA  
1890 C C   . VAL A 242 ? 0.2639 0.2038 0.1921 0.0099  0.0152  0.0084  238 VAL A C   
1891 O O   . VAL A 242 ? 0.2415 0.1783 0.1671 0.0082  0.0148  0.0075  238 VAL A O   
1892 C CB  . VAL A 242 ? 0.3328 0.2667 0.2543 0.0126  0.0164  0.0098  238 VAL A CB  
1893 C CG1 . VAL A 242 ? 0.3420 0.2750 0.2612 0.0151  0.0181  0.0109  238 VAL A CG1 
1894 C CG2 . VAL A 242 ? 0.3301 0.2637 0.2513 0.0138  0.0164  0.0105  238 VAL A CG2 
1895 N N   . VAL A 243 ? 0.2096 0.1531 0.1407 0.0110  0.0155  0.0089  239 VAL A N   
1896 C CA  . VAL A 243 ? 0.2294 0.1730 0.1605 0.0104  0.0157  0.0084  239 VAL A CA  
1897 C C   . VAL A 243 ? 0.3046 0.2455 0.2315 0.0128  0.0174  0.0095  239 VAL A C   
1898 O O   . VAL A 243 ? 0.2987 0.2418 0.2265 0.0150  0.0181  0.0107  239 VAL A O   
1899 C CB  . VAL A 243 ? 0.2655 0.2149 0.2025 0.0098  0.0148  0.0082  239 VAL A CB  
1900 C CG1 . VAL A 243 ? 0.2546 0.2039 0.1913 0.0094  0.0152  0.0078  239 VAL A CG1 
1901 C CG2 . VAL A 243 ? 0.2680 0.2198 0.2087 0.0076  0.0133  0.0072  239 VAL A CG2 
1902 N N   . THR A 244 ? 0.2893 0.2255 0.2116 0.0125  0.0182  0.0091  240 THR A N   
1903 C CA  . THR A 244 ? 0.3023 0.2356 0.2203 0.0149  0.0200  0.0101  240 THR A CA  
1904 C C   . THR A 244 ? 0.3680 0.3037 0.2881 0.0147  0.0200  0.0098  240 THR A C   
1905 O O   . THR A 244 ? 0.3453 0.2796 0.2651 0.0125  0.0195  0.0086  240 THR A O   
1906 C CB  . THR A 244 ? 0.3874 0.3132 0.2981 0.0149  0.0211  0.0100  240 THR A CB  
1907 O OG1 . THR A 244 ? 0.3379 0.2621 0.2473 0.0149  0.0207  0.0102  240 THR A OG1 
1908 C CG2 . THR A 244 ? 0.3990 0.3215 0.3046 0.0179  0.0231  0.0112  240 THR A CG2 
1909 N N   . MET A 245 ? 0.3455 0.2852 0.2679 0.0168  0.0205  0.0107  241 MET A N   
1910 C CA  . MET A 245 ? 0.3687 0.3114 0.2937 0.0167  0.0204  0.0105  241 MET A CA  
1911 C C   . MET A 245 ? 0.4458 0.3902 0.3699 0.0198  0.0217  0.0118  241 MET A C   
1912 O O   . MET A 245 ? 0.4102 0.3572 0.3356 0.0215  0.0218  0.0129  241 MET A O   
1913 C CB  . MET A 245 ? 0.3924 0.3409 0.3241 0.0149  0.0186  0.0098  241 MET A CB  
1914 C CG  . MET A 245 ? 0.4389 0.3912 0.3739 0.0148  0.0183  0.0095  241 MET A CG  
1915 S SD  . MET A 245 ? 0.4813 0.4394 0.4233 0.0129  0.0164  0.0088  241 MET A SD  
1916 C CE  . MET A 245 ? 0.4431 0.4063 0.3880 0.0151  0.0166  0.0101  241 MET A CE  
1917 N N   . GLY A 246 ? 0.4536 0.3965 0.3754 0.0207  0.0226  0.0119  242 GLY A N   
1918 C CA  . GLY A 246 ? 0.4567 0.4011 0.3773 0.0238  0.0239  0.0132  242 GLY A CA  
1919 C C   . GLY A 246 ? 0.5305 0.4727 0.4471 0.0266  0.0254  0.0147  242 GLY A C   
1920 O O   . GLY A 246 ? 0.5190 0.4654 0.4374 0.0289  0.0258  0.0160  242 GLY A O   
1921 N N   . GLY A 247 ? 0.5100 0.4459 0.4214 0.0263  0.0261  0.0146  243 GLY A N   
1922 C CA  . GLY A 247 ? 0.5168 0.4494 0.4234 0.0289  0.0276  0.0160  243 GLY A CA  
1923 C C   . GLY A 247 ? 0.5882 0.5232 0.4973 0.0290  0.0269  0.0165  243 GLY A C   
1924 O O   . GLY A 247 ? 0.6029 0.5347 0.5079 0.0311  0.0282  0.0177  243 GLY A O   
1925 N N   . ARG A 248 ? 0.5145 0.4547 0.4300 0.0269  0.0251  0.0158  244 ARG A N   
1926 C CA  . ARG A 248 ? 0.4969 0.4399 0.4154 0.0269  0.0244  0.0162  244 ARG A CA  
1927 C C   . ARG A 248 ? 0.5156 0.4564 0.4347 0.0241  0.0231  0.0149  244 ARG A C   
1928 O O   . ARG A 248 ? 0.4976 0.4381 0.4181 0.0215  0.0220  0.0135  244 ARG A O   
1929 C CB  . ARG A 248 ? 0.4841 0.4350 0.4095 0.0268  0.0234  0.0165  244 ARG A CB  
1930 C CG  . ARG A 248 ? 0.6597 0.6142 0.5856 0.0294  0.0243  0.0178  244 ARG A CG  
1931 C CD  . ARG A 248 ? 0.7742 0.7359 0.7059 0.0297  0.0236  0.0185  244 ARG A CD  
1932 N N   . ARG A 249 ? 0.4578 0.3974 0.3759 0.0246  0.0232  0.0155  245 ARG A N   
1933 C CA  . ARG A 249 ? 0.4420 0.3803 0.3609 0.0222  0.0219  0.0144  245 ARG A CA  
1934 C C   . ARG A 249 ? 0.4450 0.3895 0.3703 0.0217  0.0207  0.0145  245 ARG A C   
1935 O O   . ARG A 249 ? 0.4531 0.4001 0.3795 0.0238  0.0214  0.0159  245 ARG A O   
1936 C CB  . ARG A 249 ? 0.4672 0.3997 0.3805 0.0233  0.0228  0.0149  245 ARG A CB  
1937 C CG  . ARG A 249 ? 0.6712 0.5967 0.5784 0.0221  0.0232  0.0140  245 ARG A CG  
1938 N N   . LEU A 250 ? 0.3456 0.2929 0.2753 0.0192  0.0192  0.0132  246 LEU A N   
1939 C CA  . LEU A 250 ? 0.3211 0.2741 0.2567 0.0185  0.0181  0.0132  246 LEU A CA  
1940 C C   . LEU A 250 ? 0.3280 0.2800 0.2645 0.0167  0.0171  0.0124  246 LEU A C   
1941 O O   . LEU A 250 ? 0.2887 0.2393 0.2252 0.0145  0.0161  0.0111  246 LEU A O   
1942 C CB  . LEU A 250 ? 0.3241 0.2815 0.2642 0.0172  0.0173  0.0125  246 LEU A CB  
1943 C CG  . LEU A 250 ? 0.4011 0.3599 0.3408 0.0187  0.0181  0.0131  246 LEU A CG  
1944 C CD1 . LEU A 250 ? 0.4127 0.3750 0.3564 0.0171  0.0171  0.0122  246 LEU A CD1 
1945 C CD2 . LEU A 250 ? 0.4488 0.4111 0.3896 0.0211  0.0190  0.0147  246 LEU A CD2 
1946 N N   . SER A 251 ? 0.2974 0.2499 0.2343 0.0177  0.0172  0.0132  247 SER A N   
1947 C CA  . SER A 251 ? 0.3038 0.2556 0.2414 0.0165  0.0163  0.0126  247 SER A CA  
1948 C C   . SER A 251 ? 0.3652 0.3220 0.3087 0.0149  0.0151  0.0119  247 SER A C   
1949 O O   . SER A 251 ? 0.3792 0.3400 0.3261 0.0156  0.0152  0.0126  247 SER A O   
1950 C CB  . SER A 251 ? 0.3488 0.2994 0.2846 0.0185  0.0172  0.0138  247 SER A CB  
1951 O OG  . SER A 251 ? 0.5390 0.4846 0.4689 0.0201  0.0185  0.0145  247 SER A OG  
1952 N N   . LEU A 252 ? 0.2808 0.2371 0.2252 0.0126  0.0139  0.0106  248 LEU A N   
1953 C CA  . LEU A 252 ? 0.2479 0.2084 0.1974 0.0112  0.0128  0.0100  248 LEU A CA  
1954 C C   . LEU A 252 ? 0.2863 0.2465 0.2362 0.0110  0.0124  0.0100  248 LEU A C   
1955 O O   . LEU A 252 ? 0.2777 0.2348 0.2250 0.0103  0.0120  0.0094  248 LEU A O   
1956 C CB  . LEU A 252 ? 0.2469 0.2075 0.1972 0.0091  0.0119  0.0087  248 LEU A CB  
1957 C CG  . LEU A 252 ? 0.3069 0.2682 0.2574 0.0089  0.0121  0.0085  248 LEU A CG  
1958 C CD1 . LEU A 252 ? 0.3087 0.2708 0.2609 0.0068  0.0111  0.0073  248 LEU A CD1 
1959 C CD2 . LEU A 252 ? 0.3321 0.2976 0.2859 0.0100  0.0124  0.0092  248 LEU A CD2 
1960 N N   . ALA A 253 ? 0.2232 0.1865 0.1762 0.0117  0.0125  0.0106  249 ALA A N   
1961 C CA  . ALA A 253 ? 0.2358 0.1990 0.1894 0.0117  0.0123  0.0107  249 ALA A CA  
1962 C C   . ALA A 253 ? 0.2541 0.2200 0.2114 0.0100  0.0112  0.0098  249 ALA A C   
1963 O O   . ALA A 253 ? 0.2368 0.2047 0.1962 0.0090  0.0108  0.0092  249 ALA A O   
1964 C CB  . ALA A 253 ? 0.2556 0.2206 0.2104 0.0134  0.0132  0.0120  249 ALA A CB  
1965 N N   . PRO A 254 ? 0.1888 0.1546 0.1468 0.0097  0.0108  0.0096  250 PRO A N   
1966 C CA  . PRO A 254 ? 0.1747 0.1431 0.1361 0.0083  0.0099  0.0088  250 PRO A CA  
1967 C C   . PRO A 254 ? 0.2150 0.1870 0.1801 0.0079  0.0100  0.0089  250 PRO A C   
1968 O O   . PRO A 254 ? 0.1947 0.1682 0.1610 0.0089  0.0107  0.0098  250 PRO A O   
1969 C CB  . PRO A 254 ? 0.2031 0.1709 0.1644 0.0088  0.0099  0.0090  250 PRO A CB  
1970 C CG  . PRO A 254 ? 0.2472 0.2113 0.2043 0.0097  0.0102  0.0093  250 PRO A CG  
1971 C CD  . PRO A 254 ? 0.2086 0.1719 0.1642 0.0107  0.0111  0.0101  250 PRO A CD  
1972 N N   . ASP A 255 ? 0.1815 0.1549 0.1483 0.0066  0.0093  0.0081  251 ASP A N   
1973 C CA  . ASP A 255 ? 0.1880 0.1645 0.1580 0.0059  0.0091  0.0079  251 ASP A CA  
1974 C C   . ASP A 255 ? 0.2167 0.1940 0.1866 0.0063  0.0095  0.0082  251 ASP A C   
1975 O O   . ASP A 255 ? 0.2152 0.1951 0.1875 0.0058  0.0094  0.0081  251 ASP A O   
1976 C CB  . ASP A 255 ? 0.2023 0.1809 0.1749 0.0061  0.0094  0.0083  251 ASP A CB  
1977 C CG  . ASP A 255 ? 0.2334 0.2145 0.2090 0.0049  0.0090  0.0078  251 ASP A CG  
1978 O OD1 . ASP A 255 ? 0.2341 0.2152 0.2100 0.0040  0.0084  0.0070  251 ASP A OD1 
1979 O OD2 . ASP A 255 ? 0.2006 0.1837 0.1781 0.0050  0.0094  0.0083  251 ASP A OD2 
1980 N N   . ASP A 256 ? 0.1972 0.1723 0.1640 0.0073  0.0101  0.0087  252 ASP A N   
1981 C CA  . ASP A 256 ? 0.1782 0.1539 0.1445 0.0079  0.0105  0.0090  252 ASP A CA  
1982 C C   . ASP A 256 ? 0.2125 0.1878 0.1787 0.0067  0.0099  0.0080  252 ASP A C   
1983 O O   . ASP A 256 ? 0.1898 0.1632 0.1549 0.0057  0.0094  0.0073  252 ASP A O   
1984 C CB  . ASP A 256 ? 0.1963 0.1692 0.1588 0.0096  0.0115  0.0098  252 ASP A CB  
1985 C CG  . ASP A 256 ? 0.3080 0.2819 0.2706 0.0112  0.0124  0.0111  252 ASP A CG  
1986 O OD1 . ASP A 256 ? 0.2762 0.2536 0.2423 0.0110  0.0123  0.0114  252 ASP A OD1 
1987 O OD2 . ASP A 256 ? 0.3332 0.3046 0.2926 0.0126  0.0132  0.0118  252 ASP A OD2 
1988 N N   . SER A 257 ? 0.1772 0.1546 0.1449 0.0067  0.0100  0.0080  253 SER A N   
1989 C CA  . SER A 257 ? 0.1590 0.1362 0.1267 0.0058  0.0096  0.0072  253 SER A CA  
1990 C C   . SER A 257 ? 0.2149 0.1917 0.1808 0.0069  0.0103  0.0077  253 SER A C   
1991 O O   . SER A 257 ? 0.2030 0.1810 0.1688 0.0083  0.0110  0.0087  253 SER A O   
1992 C CB  . SER A 257 ? 0.1736 0.1537 0.1447 0.0046  0.0089  0.0067  253 SER A CB  
1993 O OG  . SER A 257 ? 0.2075 0.1904 0.1806 0.0051  0.0091  0.0072  253 SER A OG  
1994 N N   . LEU A 258 ? 0.1746 0.1497 0.1389 0.0063  0.0103  0.0071  254 LEU A N   
1995 C CA  . LEU A 258 ? 0.1903 0.1646 0.1526 0.0075  0.0111  0.0075  254 LEU A CA  
1996 C C   . LEU A 258 ? 0.1992 0.1735 0.1619 0.0065  0.0107  0.0067  254 LEU A C   
1997 O O   . LEU A 258 ? 0.1902 0.1629 0.1525 0.0051  0.0102  0.0059  254 LEU A O   
1998 C CB  . LEU A 258 ? 0.2124 0.1823 0.1700 0.0085  0.0119  0.0079  254 LEU A CB  
1999 C CG  . LEU A 258 ? 0.3031 0.2713 0.2576 0.0099  0.0130  0.0084  254 LEU A CG  
2000 C CD1 . LEU A 258 ? 0.2997 0.2709 0.2553 0.0119  0.0136  0.0096  254 LEU A CD1 
2001 C CD2 . LEU A 258 ? 0.3669 0.3300 0.3164 0.0105  0.0138  0.0086  254 LEU A CD2 
2002 N N   . LEU A 259 ? 0.1696 0.1460 0.1333 0.0072  0.0109  0.0069  255 LEU A N   
2003 C CA  . LEU A 259 ? 0.1692 0.1455 0.1330 0.0065  0.0108  0.0063  255 LEU A CA  
2004 C C   . LEU A 259 ? 0.2532 0.2262 0.2130 0.0076  0.0118  0.0065  255 LEU A C   
2005 O O   . LEU A 259 ? 0.2562 0.2293 0.2145 0.0094  0.0127  0.0074  255 LEU A O   
2006 C CB  . LEU A 259 ? 0.1600 0.1401 0.1267 0.0067  0.0104  0.0063  255 LEU A CB  
2007 C CG  . LEU A 259 ? 0.2188 0.1989 0.1860 0.0060  0.0102  0.0056  255 LEU A CG  
2008 C CD1 . LEU A 259 ? 0.2055 0.1856 0.1746 0.0041  0.0093  0.0047  255 LEU A CD1 
2009 C CD2 . LEU A 259 ? 0.2854 0.2686 0.2543 0.0067  0.0101  0.0058  255 LEU A CD2 
2010 N N   . VAL A 260 ? 0.2181 0.1884 0.1762 0.0065  0.0118  0.0058  256 VAL A N   
2011 C CA  . VAL A 260 ? 0.2159 0.1826 0.1698 0.0072  0.0128  0.0059  256 VAL A CA  
2012 C C   . VAL A 260 ? 0.2505 0.2187 0.2057 0.0072  0.0128  0.0056  256 VAL A C   
2013 O O   . VAL A 260 ? 0.2214 0.1901 0.1783 0.0056  0.0121  0.0048  256 VAL A O   
2014 C CB  . VAL A 260 ? 0.2546 0.2171 0.2056 0.0058  0.0129  0.0053  256 VAL A CB  
2015 C CG1 . VAL A 260 ? 0.2583 0.2168 0.2048 0.0064  0.0141  0.0054  256 VAL A CG1 
2016 C CG2 . VAL A 260 ? 0.2520 0.2132 0.2019 0.0058  0.0127  0.0056  256 VAL A CG2 
2017 N N   . LEU A 261 ? 0.2363 0.2056 0.1909 0.0090  0.0135  0.0062  257 LEU A N   
2018 C CA  . LEU A 261 ? 0.2354 0.2063 0.1911 0.0092  0.0135  0.0060  257 LEU A CA  
2019 C C   . LEU A 261 ? 0.2652 0.2324 0.2179 0.0088  0.0141  0.0055  257 LEU A C   
2020 O O   . LEU A 261 ? 0.2320 0.1953 0.1807 0.0092  0.0151  0.0057  257 LEU A O   
2021 C CB  . LEU A 261 ? 0.2433 0.2164 0.1987 0.0115  0.0141  0.0069  257 LEU A CB  
2022 C CG  . LEU A 261 ? 0.3180 0.2959 0.2771 0.0118  0.0134  0.0073  257 LEU A CG  
2023 C CD1 . LEU A 261 ? 0.3477 0.3272 0.3057 0.0141  0.0142  0.0085  257 LEU A CD1 
2024 C CD2 . LEU A 261 ? 0.2947 0.2757 0.2575 0.0105  0.0123  0.0066  257 LEU A CD2 
2025 N N   . ALA A 262 ? 0.2416 0.2100 0.1961 0.0079  0.0137  0.0048  258 ALA A N   
2026 C CA  . ALA A 262 ? 0.2574 0.2227 0.2095 0.0075  0.0144  0.0044  258 ALA A CA  
2027 C C   . ALA A 262 ? 0.2995 0.2618 0.2471 0.0096  0.0159  0.0051  258 ALA A C   
2028 O O   . ALA A 262 ? 0.2560 0.2205 0.2038 0.0116  0.0163  0.0058  258 ALA A O   
2029 C CB  . ALA A 262 ? 0.2639 0.2317 0.2186 0.0071  0.0139  0.0039  258 ALA A CB  
2030 N N   . GLY A 263 ? 0.2884 0.2460 0.2320 0.0091  0.0168  0.0049  259 GLY A N   
2031 C CA  . GLY A 263 ? 0.2947 0.2485 0.2333 0.0110  0.0185  0.0055  259 GLY A CA  
2032 C C   . GLY A 263 ? 0.3539 0.3051 0.2892 0.0121  0.0193  0.0062  259 GLY A C   
2033 O O   . GLY A 263 ? 0.3499 0.2981 0.2809 0.0141  0.0208  0.0069  259 GLY A O   
2034 N N   . THR A 264 ? 0.2863 0.2386 0.2234 0.0110  0.0183  0.0061  260 THR A N   
2035 C CA  . THR A 264 ? 0.2897 0.2397 0.2240 0.0119  0.0189  0.0068  260 THR A CA  
2036 C C   . THR A 264 ? 0.3673 0.3134 0.2996 0.0097  0.0186  0.0061  260 THR A C   
2037 O O   . THR A 264 ? 0.3519 0.2995 0.2871 0.0074  0.0173  0.0052  260 THR A O   
2038 C CB  . THR A 264 ? 0.4437 0.3984 0.3819 0.0126  0.0180  0.0073  260 THR A CB  
2039 O OG1 . THR A 264 ? 0.5086 0.4672 0.4489 0.0144  0.0181  0.0080  260 THR A OG1 
2040 C CG2 . THR A 264 ? 0.4447 0.3974 0.3804 0.0137  0.0185  0.0081  260 THR A CG2 
2041 N N   . SER A 265 ? 0.3320 0.2731 0.2589 0.0104  0.0197  0.0064  261 SER A N   
2042 C CA  . SER A 265 ? 0.3431 0.2803 0.2675 0.0084  0.0195  0.0058  261 SER A CA  
2043 C C   . SER A 265 ? 0.3718 0.3097 0.2966 0.0090  0.0191  0.0063  261 SER A C   
2044 O O   . SER A 265 ? 0.3412 0.2810 0.2665 0.0113  0.0195  0.0074  261 SER A O   
2045 C CB  . SER A 265 ? 0.4069 0.3374 0.3246 0.0086  0.0211  0.0058  261 SER A CB  
2046 O OG  . SER A 265 ? 0.5038 0.4320 0.4176 0.0115  0.0225  0.0070  261 SER A OG  
2047 N N   . TYR A 266 ? 0.3405 0.2770 0.2651 0.0069  0.0182  0.0057  262 TYR A N   
2048 C CA  . TYR A 266 ? 0.3387 0.2754 0.2634 0.0075  0.0178  0.0062  262 TYR A CA  
2049 C C   . TYR A 266 ? 0.3741 0.3068 0.2957 0.0055  0.0174  0.0055  262 TYR A C   
2050 O O   . TYR A 266 ? 0.3596 0.2909 0.2807 0.0031  0.0170  0.0045  262 TYR A O   
2051 C CB  . TYR A 266 ? 0.3523 0.2954 0.2834 0.0074  0.0164  0.0062  262 TYR A CB  
2052 C CG  . TYR A 266 ? 0.3499 0.2953 0.2846 0.0047  0.0149  0.0052  262 TYR A CG  
2053 C CD1 . TYR A 266 ? 0.3611 0.3088 0.2986 0.0037  0.0145  0.0046  262 TYR A CD1 
2054 C CD2 . TYR A 266 ? 0.3615 0.3068 0.2968 0.0033  0.0140  0.0048  262 TYR A CD2 
2055 C CE1 . TYR A 266 ? 0.3577 0.3077 0.2985 0.0014  0.0132  0.0037  262 TYR A CE1 
2056 C CE2 . TYR A 266 ? 0.3637 0.3113 0.3022 0.0011  0.0126  0.0039  262 TYR A CE2 
2057 C CZ  . TYR A 266 ? 0.4387 0.3888 0.3800 0.0002  0.0123  0.0034  262 TYR A CZ  
2058 O OH  . TYR A 266 ? 0.4452 0.3979 0.3897 -0.0019 0.0110  0.0027  262 TYR A OH  
2059 N N   . ALA A 267 ? 0.3403 0.2712 0.2598 0.0064  0.0176  0.0060  263 ALA A N   
2060 C CA  . ALA A 267 ? 0.3365 0.2638 0.2531 0.0046  0.0171  0.0054  263 ALA A CA  
2061 C C   . ALA A 267 ? 0.3558 0.2873 0.2767 0.0047  0.0159  0.0056  263 ALA A C   
2062 O O   . ALA A 267 ? 0.3450 0.2793 0.2681 0.0068  0.0161  0.0065  263 ALA A O   
2063 C CB  . ALA A 267 ? 0.3443 0.2652 0.2539 0.0061  0.0186  0.0060  263 ALA A CB  
2064 N N   . TRP A 268 ? 0.2700 0.2021 0.1923 0.0023  0.0145  0.0047  264 TRP A N   
2065 C CA  . TRP A 268 ? 0.2482 0.1840 0.1743 0.0023  0.0133  0.0048  264 TRP A CA  
2066 C C   . TRP A 268 ? 0.2803 0.2129 0.2034 0.0010  0.0128  0.0043  264 TRP A C   
2067 O O   . TRP A 268 ? 0.2910 0.2219 0.2127 -0.0014 0.0121  0.0034  264 TRP A O   
2068 C CB  . TRP A 268 ? 0.2270 0.1681 0.1590 0.0008  0.0121  0.0041  264 TRP A CB  
2069 C CG  . TRP A 268 ? 0.2271 0.1727 0.1637 0.0012  0.0111  0.0044  264 TRP A CG  
2070 C CD1 . TRP A 268 ? 0.2602 0.2061 0.1968 0.0029  0.0114  0.0051  264 TRP A CD1 
2071 C CD2 . TRP A 268 ? 0.2201 0.1702 0.1616 -0.0001 0.0099  0.0038  264 TRP A CD2 
2072 N NE1 . TRP A 268 ? 0.2504 0.2008 0.1918 0.0027  0.0105  0.0051  264 TRP A NE1 
2073 C CE2 . TRP A 268 ? 0.2629 0.2158 0.2072 0.0009  0.0096  0.0043  264 TRP A CE2 
2074 C CE3 . TRP A 268 ? 0.2285 0.1807 0.1724 -0.0019 0.0093  0.0031  264 TRP A CE3 
2075 C CZ2 . TRP A 268 ? 0.2425 0.1996 0.1914 0.0001  0.0086  0.0040  264 TRP A CZ2 
2076 C CZ3 . TRP A 268 ? 0.2469 0.2034 0.1954 -0.0026 0.0082  0.0028  264 TRP A CZ3 
2077 C CH2 . TRP A 268 ? 0.2523 0.2111 0.2031 -0.0016 0.0079  0.0032  264 TRP A CH2 
2078 N N   . GLU A 269 ? 0.2296 0.1614 0.1516 0.0027  0.0130  0.0050  265 GLU A N   
2079 C CA  . GLU A 269 ? 0.2362 0.1649 0.1551 0.0020  0.0126  0.0048  265 GLU A CA  
2080 C C   . GLU A 269 ? 0.2675 0.2007 0.1910 0.0023  0.0115  0.0050  265 GLU A C   
2081 O O   . GLU A 269 ? 0.2327 0.1679 0.1580 0.0045  0.0121  0.0059  265 GLU A O   
2082 C CB  . GLU A 269 ? 0.2725 0.1961 0.1858 0.0043  0.0141  0.0058  265 GLU A CB  
2083 C CG  . GLU A 269 ? 0.4402 0.3588 0.3482 0.0045  0.0154  0.0058  265 GLU A CG  
2084 N N   . ARG A 270 ? 0.2326 0.1676 0.1581 0.0002  0.0101  0.0041  266 ARG A N   
2085 C CA  . ARG A 270 ? 0.2167 0.1559 0.1465 0.0003  0.0090  0.0041  266 ARG A CA  
2086 C C   . ARG A 270 ? 0.2818 0.2182 0.2085 0.0000  0.0085  0.0040  266 ARG A C   
2087 O O   . ARG A 270 ? 0.2628 0.1962 0.1861 -0.0018 0.0081  0.0032  266 ARG A O   
2088 C CB  . ARG A 270 ? 0.2098 0.1534 0.1441 -0.0017 0.0078  0.0033  266 ARG A CB  
2089 C CG  . ARG A 270 ? 0.2220 0.1679 0.1590 -0.0015 0.0083  0.0034  266 ARG A CG  
2090 C CD  . ARG A 270 ? 0.2664 0.2158 0.2070 -0.0035 0.0072  0.0026  266 ARG A CD  
2091 N NE  . ARG A 270 ? 0.2295 0.1767 0.1675 -0.0058 0.0067  0.0018  266 ARG A NE  
2092 C CZ  . ARG A 270 ? 0.2810 0.2260 0.2169 -0.0068 0.0072  0.0015  266 ARG A CZ  
2093 N NH1 . ARG A 270 ? 0.2838 0.2272 0.2177 -0.0091 0.0067  0.0007  266 ARG A NH1 
2094 N NH2 . ARG A 270 ? 0.2196 0.1643 0.1556 -0.0054 0.0083  0.0019  266 ARG A NH2 
2095 N N   . THR A 271 ? 0.2521 0.1897 0.1800 0.0017  0.0086  0.0047  267 THR A N   
2096 C CA  . THR A 271 ? 0.2499 0.1848 0.1748 0.0020  0.0083  0.0047  267 THR A CA  
2097 C C   . THR A 271 ? 0.2932 0.2304 0.2201 0.0001  0.0067  0.0038  267 THR A C   
2098 O O   . THR A 271 ? 0.2596 0.2013 0.1910 -0.0010 0.0059  0.0034  267 THR A O   
2099 C CB  . THR A 271 ? 0.3600 0.2953 0.2855 0.0047  0.0092  0.0059  267 THR A CB  
2100 O OG1 . THR A 271 ? 0.2852 0.2260 0.2166 0.0050  0.0088  0.0060  267 THR A OG1 
2101 C CG2 . THR A 271 ? 0.3878 0.3208 0.3108 0.0068  0.0109  0.0069  267 THR A CG2 
2102 N N   . GLN A 272 ? 0.2563 0.1906 0.1798 -0.0001 0.0063  0.0036  268 GLN A N   
2103 C CA  . GLN A 272 ? 0.2556 0.1923 0.1806 -0.0017 0.0047  0.0029  268 GLN A CA  
2104 C C   . GLN A 272 ? 0.2908 0.2324 0.2211 -0.0004 0.0045  0.0033  268 GLN A C   
2105 O O   . GLN A 272 ? 0.2827 0.2243 0.2136 0.0018  0.0054  0.0042  268 GLN A O   
2106 C CB  . GLN A 272 ? 0.2721 0.2045 0.1921 -0.0017 0.0044  0.0027  268 GLN A CB  
2107 C CG  . GLN A 272 ? 0.3626 0.2973 0.2836 -0.0035 0.0027  0.0019  268 GLN A CG  
2108 C CD  . GLN A 272 ? 0.4950 0.4251 0.4106 -0.0038 0.0023  0.0016  268 GLN A CD  
2109 O OE1 . GLN A 272 ? 0.3739 0.2985 0.2843 -0.0033 0.0032  0.0018  268 GLN A OE1 
2110 N NE2 . GLN A 272 ? 0.4093 0.3414 0.3256 -0.0048 0.0009  0.0011  268 GLN A NE2 
2111 N N   . GLY A 273 ? 0.2550 0.2009 0.1890 -0.0018 0.0033  0.0028  269 GLY A N   
2112 C CA  . GLY A 273 ? 0.2576 0.2079 0.1962 -0.0008 0.0031  0.0031  269 GLY A CA  
2113 C C   . GLY A 273 ? 0.3253 0.2784 0.2678 0.0000  0.0038  0.0035  269 GLY A C   
2114 O O   . GLY A 273 ? 0.3243 0.2808 0.2706 0.0007  0.0037  0.0038  269 GLY A O   
2115 N N   . SER A 274 ? 0.2604 0.2120 0.2019 0.0000  0.0046  0.0037  270 SER A N   
2116 C CA  . SER A 274 ? 0.2320 0.1863 0.1770 0.0007  0.0053  0.0041  270 SER A CA  
2117 C C   . SER A 274 ? 0.2398 0.1975 0.1882 -0.0009 0.0045  0.0034  270 SER A C   
2118 O O   . SER A 274 ? 0.2228 0.1801 0.1700 -0.0027 0.0038  0.0027  270 SER A O   
2119 C CB  . SER A 274 ? 0.2552 0.2067 0.1977 0.0017  0.0065  0.0046  270 SER A CB  
2120 O OG  . SER A 274 ? 0.2390 0.1887 0.1795 0.0002  0.0064  0.0040  270 SER A OG  
2121 N N   . VAL A 275 ? 0.1873 0.1484 0.1396 -0.0003 0.0048  0.0037  271 VAL A N   
2122 C CA  . VAL A 275 ? 0.1726 0.1369 0.1281 -0.0015 0.0042  0.0032  271 VAL A CA  
2123 C C   . VAL A 275 ? 0.2062 0.1717 0.1636 -0.0009 0.0049  0.0036  271 VAL A C   
2124 O O   . VAL A 275 ? 0.2246 0.1909 0.1833 0.0005  0.0055  0.0042  271 VAL A O   
2125 C CB  . VAL A 275 ? 0.2313 0.1990 0.1899 -0.0017 0.0034  0.0031  271 VAL A CB  
2126 C CG1 . VAL A 275 ? 0.2302 0.2010 0.1917 -0.0028 0.0029  0.0027  271 VAL A CG1 
2127 C CG2 . VAL A 275 ? 0.2437 0.2105 0.2004 -0.0021 0.0026  0.0028  271 VAL A CG2 
2128 N N   . ALA A 276 ? 0.1626 0.1283 0.1201 -0.0019 0.0049  0.0032  272 ALA A N   
2129 C CA  . ALA A 276 ? 0.1536 0.1204 0.1128 -0.0014 0.0055  0.0034  272 ALA A CA  
2130 C C   . ALA A 276 ? 0.1967 0.1657 0.1581 -0.0027 0.0050  0.0028  272 ALA A C   
2131 O O   . ALA A 276 ? 0.1704 0.1395 0.1313 -0.0042 0.0043  0.0023  272 ALA A O   
2132 C CB  . ALA A 276 ? 0.1652 0.1288 0.1211 -0.0007 0.0065  0.0037  272 ALA A CB  
2133 N N   . LEU A 277 ? 0.1752 0.1460 0.1388 -0.0022 0.0054  0.0030  273 LEU A N   
2134 C CA  . LEU A 277 ? 0.1768 0.1494 0.1422 -0.0032 0.0051  0.0026  273 LEU A CA  
2135 C C   . LEU A 277 ? 0.2085 0.1800 0.1730 -0.0029 0.0058  0.0027  273 LEU A C   
2136 O O   . LEU A 277 ? 0.1896 0.1604 0.1533 -0.0015 0.0065  0.0032  273 LEU A O   
2137 C CB  . LEU A 277 ? 0.1762 0.1521 0.1454 -0.0029 0.0049  0.0027  273 LEU A CB  
2138 C CG  . LEU A 277 ? 0.2425 0.2200 0.2132 -0.0029 0.0043  0.0027  273 LEU A CG  
2139 C CD1 . LEU A 277 ? 0.2418 0.2219 0.2156 -0.0025 0.0043  0.0028  273 LEU A CD1 
2140 C CD2 . LEU A 277 ? 0.2525 0.2305 0.2228 -0.0042 0.0035  0.0022  273 LEU A CD2 
2141 N N   . SER A 278 ? 0.1630 0.1348 0.1278 -0.0039 0.0057  0.0022  274 SER A N   
2142 C CA  . SER A 278 ? 0.1673 0.1386 0.1316 -0.0036 0.0063  0.0022  274 SER A CA  
2143 C C   . SER A 278 ? 0.2032 0.1774 0.1707 -0.0041 0.0059  0.0020  274 SER A C   
2144 O O   . SER A 278 ? 0.2112 0.1868 0.1800 -0.0052 0.0052  0.0017  274 SER A O   
2145 C CB  . SER A 278 ? 0.2029 0.1710 0.1639 -0.0043 0.0067  0.0020  274 SER A CB  
2146 O OG  . SER A 278 ? 0.2645 0.2331 0.2259 -0.0061 0.0062  0.0014  274 SER A OG  
2147 N N   . VAL A 279 ? 0.1658 0.1410 0.1345 -0.0034 0.0063  0.0021  275 VAL A N   
2148 C CA  . VAL A 279 ? 0.1745 0.1522 0.1459 -0.0037 0.0060  0.0019  275 VAL A CA  
2149 C C   . VAL A 279 ? 0.1979 0.1745 0.1682 -0.0036 0.0065  0.0018  275 VAL A C   
2150 O O   . VAL A 279 ? 0.1782 0.1539 0.1472 -0.0025 0.0071  0.0021  275 VAL A O   
2151 C CB  . VAL A 279 ? 0.2455 0.2255 0.2195 -0.0030 0.0058  0.0021  275 VAL A CB  
2152 C CG1 . VAL A 279 ? 0.2359 0.2178 0.2121 -0.0034 0.0055  0.0018  275 VAL A CG1 
2153 C CG2 . VAL A 279 ? 0.2487 0.2294 0.2235 -0.0030 0.0054  0.0022  275 VAL A CG2 
2154 N N   . THR A 280 ? 0.2042 0.1810 0.1748 -0.0046 0.0064  0.0014  276 THR A N   
2155 C CA  . THR A 280 ? 0.2026 0.1785 0.1723 -0.0046 0.0070  0.0013  276 THR A CA  
2156 C C   . THR A 280 ? 0.2205 0.1987 0.1928 -0.0050 0.0066  0.0011  276 THR A C   
2157 O O   . THR A 280 ? 0.2350 0.2147 0.2087 -0.0059 0.0060  0.0010  276 THR A O   
2158 C CB  . THR A 280 ? 0.2369 0.2098 0.2035 -0.0056 0.0074  0.0011  276 THR A CB  
2159 O OG1 . THR A 280 ? 0.2110 0.1814 0.1748 -0.0052 0.0077  0.0012  276 THR A OG1 
2160 C CG2 . THR A 280 ? 0.1871 0.1584 0.1521 -0.0052 0.0083  0.0010  276 THR A CG2 
2161 N N   . GLN A 281 ? 0.1547 0.1333 0.1274 -0.0043 0.0070  0.0011  277 GLN A N   
2162 C CA  . GLN A 281 ? 0.1311 0.1113 0.1057 -0.0045 0.0068  0.0009  277 GLN A CA  
2163 C C   . GLN A 281 ? 0.1960 0.1747 0.1691 -0.0043 0.0075  0.0008  277 GLN A C   
2164 O O   . GLN A 281 ? 0.1923 0.1711 0.1653 -0.0031 0.0078  0.0009  277 GLN A O   
2165 C CB  . GLN A 281 ? 0.1551 0.1374 0.1319 -0.0037 0.0065  0.0010  277 GLN A CB  
2166 C CG  . GLN A 281 ? 0.2115 0.1952 0.1898 -0.0041 0.0059  0.0011  277 GLN A CG  
2167 C CD  . GLN A 281 ? 0.3616 0.3470 0.3419 -0.0036 0.0056  0.0011  277 GLN A CD  
2168 O OE1 . GLN A 281 ? 0.3972 0.3827 0.3775 -0.0030 0.0058  0.0011  277 GLN A OE1 
2169 N NE2 . GLN A 281 ? 0.2934 0.2799 0.2750 -0.0039 0.0052  0.0012  277 GLN A NE2 
2170 N N   . ASP A 282 ? 0.1808 0.1579 0.1523 -0.0054 0.0078  0.0007  278 ASP A N   
2171 C CA  . ASP A 282 ? 0.1675 0.1426 0.1370 -0.0052 0.0087  0.0006  278 ASP A CA  
2172 C C   . ASP A 282 ? 0.1949 0.1716 0.1663 -0.0055 0.0086  0.0005  278 ASP A C   
2173 O O   . ASP A 282 ? 0.1709 0.1486 0.1435 -0.0067 0.0083  0.0005  278 ASP A O   
2174 C CB  . ASP A 282 ? 0.1923 0.1646 0.1591 -0.0065 0.0091  0.0005  278 ASP A CB  
2175 C CG  . ASP A 282 ? 0.2577 0.2271 0.2217 -0.0064 0.0102  0.0004  278 ASP A CG  
2176 O OD1 . ASP A 282 ? 0.2316 0.2015 0.1962 -0.0055 0.0106  0.0004  278 ASP A OD1 
2177 O OD2 . ASP A 282 ? 0.2791 0.2456 0.2402 -0.0073 0.0107  0.0002  278 ASP A OD2 
2178 N N   . PRO A 283 ? 0.1827 0.1594 0.1542 -0.0042 0.0090  0.0005  279 PRO A N   
2179 C CA  . PRO A 283 ? 0.1815 0.1594 0.1544 -0.0043 0.0091  0.0005  279 PRO A CA  
2180 C C   . PRO A 283 ? 0.2410 0.2176 0.2129 -0.0055 0.0097  0.0004  279 PRO A C   
2181 O O   . PRO A 283 ? 0.2261 0.2040 0.1995 -0.0058 0.0096  0.0005  279 PRO A O   
2182 C CB  . PRO A 283 ? 0.1983 0.1761 0.1709 -0.0027 0.0094  0.0005  279 PRO A CB  
2183 C CG  . PRO A 283 ? 0.2528 0.2286 0.2228 -0.0020 0.0099  0.0006  279 PRO A CG  
2184 C CD  . PRO A 283 ? 0.2127 0.1887 0.1829 -0.0027 0.0094  0.0007  279 PRO A CD  
2185 N N   . ALA A 284 ? 0.2249 0.1988 0.1940 -0.0061 0.0103  0.0003  280 ALA A N   
2186 C CA  . ALA A 284 ? 0.2420 0.2144 0.2099 -0.0076 0.0109  0.0002  280 ALA A CA  
2187 C C   . ALA A 284 ? 0.3242 0.2989 0.2941 -0.0093 0.0101  0.0003  280 ALA A C   
2188 O O   . ALA A 284 ? 0.3120 0.2869 0.2820 -0.0107 0.0103  0.0003  280 ALA A O   
2189 C CB  . ALA A 284 ? 0.2539 0.2225 0.2180 -0.0079 0.0117  0.0001  280 ALA A CB  
2190 N N   . CYS A 285 ? 0.2762 0.2528 0.2477 -0.0093 0.0091  0.0003  281 CYS A N   
2191 C CA  . CYS A 285 ? 0.2793 0.2583 0.2526 -0.0106 0.0083  0.0004  281 CYS A CA  
2192 C C   . CYS A 285 ? 0.3027 0.2852 0.2793 -0.0101 0.0078  0.0007  281 CYS A C   
2193 O O   . CYS A 285 ? 0.2755 0.2603 0.2537 -0.0108 0.0072  0.0009  281 CYS A O   
2194 C CB  . CYS A 285 ? 0.2896 0.2681 0.2621 -0.0109 0.0078  0.0003  281 CYS A CB  
2195 S SG  . CYS A 285 ? 0.3599 0.3341 0.3282 -0.0117 0.0084  0.0000  281 CYS A SG  
2196 N N   . LYS A 286 ? 0.2619 0.2444 0.2391 -0.0087 0.0082  0.0008  282 LYS A N   
2197 C CA  . LYS A 286 ? 0.2669 0.2519 0.2464 -0.0079 0.0079  0.0011  282 LYS A CA  
2198 C C   . LYS A 286 ? 0.3048 0.2918 0.2857 -0.0090 0.0079  0.0014  282 LYS A C   
2199 O O   . LYS A 286 ? 0.2834 0.2695 0.2634 -0.0099 0.0085  0.0014  282 LYS A O   
2200 C CB  . LYS A 286 ? 0.2967 0.2809 0.2760 -0.0065 0.0084  0.0010  282 LYS A CB  
2201 C CG  . LYS A 286 ? 0.3856 0.3717 0.3669 -0.0056 0.0081  0.0013  282 LYS A CG  
2202 C CD  . LYS A 286 ? 0.3988 0.3840 0.3796 -0.0042 0.0083  0.0011  282 LYS A CD  
2203 C CE  . LYS A 286 ? 0.3697 0.3535 0.3494 -0.0037 0.0091  0.0010  282 LYS A CE  
2204 N NZ  . LYS A 286 ? 0.3502 0.3339 0.3300 -0.0023 0.0090  0.0009  282 LYS A NZ  
2205 N N   . LYS A 287 ? 0.2749 0.2647 0.2579 -0.0089 0.0073  0.0017  283 LYS A N   
2206 C CA  . LYS A 287 ? 0.2781 0.2704 0.2626 -0.0098 0.0073  0.0022  283 LYS A CA  
2207 C C   . LYS A 287 ? 0.3560 0.3488 0.3412 -0.0091 0.0080  0.0026  283 LYS A C   
2208 O O   . LYS A 287 ? 0.3351 0.3273 0.3204 -0.0075 0.0081  0.0026  283 LYS A O   
2209 C CB  . LYS A 287 ? 0.3071 0.3023 0.2934 -0.0095 0.0066  0.0026  283 LYS A CB  
2210 C CG  . LYS A 287 ? 0.3135 0.3083 0.2991 -0.0101 0.0059  0.0023  283 LYS A CG  
2211 C CD  . LYS A 287 ? 0.4809 0.4769 0.4664 -0.0120 0.0056  0.0023  283 LYS A CD  
2212 C CE  . LYS A 287 ? 0.4815 0.4746 0.4646 -0.0131 0.0056  0.0018  283 LYS A CE  
2213 N NZ  . LYS A 287 ? 0.3978 0.3919 0.3806 -0.0152 0.0052  0.0017  283 LYS A NZ  
2214 N N   . PRO A 288 ? 0.3609 0.3545 0.3463 -0.0102 0.0084  0.0028  284 PRO A N   
2215 C CA  . PRO A 288 ? 0.3623 0.3563 0.3483 -0.0094 0.0091  0.0033  284 PRO A CA  
2216 C C   . PRO A 288 ? 0.4319 0.4282 0.4197 -0.0079 0.0090  0.0039  284 PRO A C   
2217 O O   . PRO A 288 ? 0.4227 0.4213 0.4117 -0.0080 0.0084  0.0042  284 PRO A O   
2218 C CB  . PRO A 288 ? 0.3844 0.3794 0.3707 -0.0112 0.0096  0.0035  284 PRO A CB  
2219 C CG  . PRO A 288 ? 0.4426 0.4390 0.4291 -0.0129 0.0088  0.0034  284 PRO A CG  
2220 C CD  . PRO A 288 ? 0.3891 0.3836 0.3744 -0.0124 0.0083  0.0028  284 PRO A CD  
2221 N N   . LEU A 289 ? 0.4068 0.4022 0.3945 -0.0065 0.0095  0.0040  285 LEU A N   
2222 C CA  . LEU A 289 ? 0.7845 0.7812 0.7732 -0.0049 0.0095  0.0046  285 LEU A CA  
2223 C C   . LEU A 289 ? 1.3587 1.3580 1.3488 -0.0049 0.0101  0.0055  285 LEU A C   
2224 O O   . LEU A 289 ? 0.9620 0.9631 0.9531 -0.0038 0.0101  0.0062  285 LEU A O   
2225 C CB  . LEU A 289 ? 0.7845 0.7787 0.7720 -0.0034 0.0098  0.0042  285 LEU A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3  ?   ?   ?   A . n 
A 1 2   PRO 2   -2  ?   ?   ?   A . n 
A 1 3   GLY 3   -1  ?   ?   ?   A . n 
A 1 4   SER 4   0   ?   ?   ?   A . n 
A 1 5   MET 5   1   ?   ?   ?   A . n 
A 1 6   GLU 6   2   ?   ?   ?   A . n 
A 1 7   ARG 7   3   3   ARG ARG A . n 
A 1 8   ARG 8   4   4   ARG ARG A . n 
A 1 9   LEU 9   5   5   LEU LEU A . n 
A 1 10  GLY 10  6   6   GLY GLY A . n 
A 1 11  VAL 11  7   7   VAL VAL A . n 
A 1 12  ARG 12  8   8   ARG ARG A . n 
A 1 13  ALA 13  9   9   ALA ALA A . n 
A 1 14  TRP 14  10  10  TRP TRP A . n 
A 1 15  VAL 15  11  11  VAL VAL A . n 
A 1 16  LYS 16  12  12  LYS LYS A . n 
A 1 17  GLU 17  13  13  GLU GLU A . n 
A 1 18  ASN 18  14  14  ASN ASN A . n 
A 1 19  ARG 19  15  15  ARG ARG A . n 
A 1 20  GLY 20  16  16  GLY GLY A . n 
A 1 21  SER 21  17  17  SER SER A . n 
A 1 22  PHE 22  18  18  PHE PHE A . n 
A 1 23  GLN 23  19  19  GLN GLN A . n 
A 1 24  PRO 24  20  20  PRO PRO A . n 
A 1 25  PRO 25  21  21  PRO PRO A . n 
A 1 26  VAL 26  22  22  VAL VAL A . n 
A 1 27  CYS 27  23  23  CYS CYS A . n 
A 1 28  ASN 28  24  24  ASN ASN A . n 
A 1 29  LYS 29  25  25  LYS LYS A . n 
A 1 30  LEU 30  26  26  LEU LEU A . n 
A 1 31  MET 31  27  27  MET MET A . n 
A 1 32  HIS 32  28  28  HIS HIS A . n 
A 1 33  GLN 33  29  29  GLN GLN A . n 
A 1 34  GLU 34  30  30  GLU GLU A . n 
A 1 35  GLN 35  31  31  GLN GLN A . n 
A 1 36  LEU 36  32  32  LEU LEU A . n 
A 1 37  LYS 37  33  33  LYS LYS A . n 
A 1 38  VAL 38  34  34  VAL VAL A . n 
A 1 39  MET 39  35  35  MET MET A . n 
A 1 40  PHE 40  36  36  PHE PHE A . n 
A 1 41  ILE 41  37  37  ILE ILE A . n 
A 1 42  GLY 42  38  38  GLY GLY A . n 
A 1 43  GLY 43  39  39  GLY GLY A . n 
A 1 44  PRO 44  40  40  PRO PRO A . n 
A 1 45  ASN 45  41  41  ASN ASN A . n 
A 1 46  THR 46  42  42  THR THR A . n 
A 1 47  ARG 47  43  43  ARG ARG A . n 
A 1 48  LYS 48  44  44  LYS LYS A . n 
A 1 49  ASP 49  45  45  ASP ASP A . n 
A 1 50  TYR 50  46  46  TYR TYR A . n 
A 1 51  HIS 51  47  47  HIS HIS A . n 
A 1 52  ILE 52  48  48  ILE ILE A . n 
A 1 53  GLU 53  49  49  GLU GLU A . n 
A 1 54  GLU 54  50  50  GLU GLU A . n 
A 1 55  GLY 55  51  51  GLY GLY A . n 
A 1 56  GLU 56  52  52  GLU GLU A . n 
A 1 57  GLU 57  53  53  GLU GLU A . n 
A 1 58  VAL 58  54  54  VAL VAL A . n 
A 1 59  PHE 59  55  55  PHE PHE A . n 
A 1 60  TYR 60  56  56  TYR TYR A . n 
A 1 61  GLN 61  57  57  GLN GLN A . n 
A 1 62  LEU 62  58  58  LEU LEU A . n 
A 1 63  GLU 63  59  59  GLU GLU A . n 
A 1 64  GLY 64  60  60  GLY GLY A . n 
A 1 65  ASP 65  61  61  ASP ASP A . n 
A 1 66  MET 66  62  62  MET MET A . n 
A 1 67  VAL 67  63  63  VAL VAL A . n 
A 1 68  LEU 68  64  64  LEU LEU A . n 
A 1 69  ARG 69  65  65  ARG ARG A . n 
A 1 70  VAL 70  66  66  VAL VAL A . n 
A 1 71  LEU 71  67  67  LEU LEU A . n 
A 1 72  GLU 72  68  68  GLU GLU A . n 
A 1 73  GLN 73  69  69  GLN GLN A . n 
A 1 74  GLY 74  70  70  GLY GLY A . n 
A 1 75  LYS 75  71  71  LYS LYS A . n 
A 1 76  HIS 76  72  72  HIS HIS A . n 
A 1 77  ARG 77  73  73  ARG ARG A . n 
A 1 78  ASP 78  74  74  ASP ASP A . n 
A 1 79  VAL 79  75  75  VAL VAL A . n 
A 1 80  VAL 80  76  76  VAL VAL A . n 
A 1 81  ILE 81  77  77  ILE ILE A . n 
A 1 82  ARG 82  78  78  ARG ARG A . n 
A 1 83  GLN 83  79  79  GLN GLN A . n 
A 1 84  GLY 84  80  80  GLY GLY A . n 
A 1 85  GLU 85  81  81  GLU GLU A . n 
A 1 86  ILE 86  82  82  ILE ILE A . n 
A 1 87  PHE 87  83  83  PHE PHE A . n 
A 1 88  LEU 88  84  84  LEU LEU A . n 
A 1 89  LEU 89  85  85  LEU LEU A . n 
A 1 90  PRO 90  86  86  PRO PRO A . n 
A 1 91  ALA 91  87  87  ALA ALA A . n 
A 1 92  ARG 92  88  88  ARG ARG A . n 
A 1 93  VAL 93  89  89  VAL VAL A . n 
A 1 94  PRO 94  90  90  PRO PRO A . n 
A 1 95  HIS 95  91  91  HIS HIS A . n 
A 1 96  SER 96  92  92  SER SER A . n 
A 1 97  PRO 97  93  93  PRO PRO A . n 
A 1 98  GLN 98  94  94  GLN GLN A . n 
A 1 99  ARG 99  95  95  ARG ARG A . n 
A 1 100 PHE 100 96  96  PHE PHE A . n 
A 1 101 ALA 101 97  97  ALA ALA A . n 
A 1 102 ASN 102 98  98  ASN ASN A . n 
A 1 103 THR 103 99  99  THR THR A . n 
A 1 104 VAL 104 100 100 VAL VAL A . n 
A 1 105 GLY 105 101 101 GLY GLY A . n 
A 1 106 LEU 106 102 102 LEU LEU A . n 
A 1 107 VAL 107 103 103 VAL VAL A . n 
A 1 108 VAL 108 104 104 VAL VAL A . n 
A 1 109 GLU 109 105 105 GLU GLU A . n 
A 1 110 ARG 110 106 106 ARG ARG A . n 
A 1 111 ARG 111 107 107 ARG ARG A . n 
A 1 112 ARG 112 108 108 ARG ARG A . n 
A 1 113 LEU 113 109 109 LEU LEU A . n 
A 1 114 GLU 114 110 110 GLU GLU A . n 
A 1 115 THR 115 111 111 THR THR A . n 
A 1 116 GLU 116 112 112 GLU GLU A . n 
A 1 117 LEU 117 113 113 LEU LEU A . n 
A 1 118 ASP 118 114 114 ASP ASP A . n 
A 1 119 GLY 119 115 115 GLY GLY A . n 
A 1 120 LEU 120 116 116 LEU LEU A . n 
A 1 121 ARG 121 117 117 ARG ARG A . n 
A 1 122 TYR 122 118 118 TYR TYR A . n 
A 1 123 TYR 123 119 119 TYR TYR A . n 
A 1 124 VAL 124 120 120 VAL VAL A . n 
A 1 125 GLY 125 121 121 GLY GLY A . n 
A 1 126 ASP 126 122 122 ASP ASP A . n 
A 1 127 THR 127 123 123 THR THR A . n 
A 1 128 MET 128 124 124 MET MET A . n 
A 1 129 ASP 129 125 125 ASP ASP A . n 
A 1 130 VAL 130 126 126 VAL VAL A . n 
A 1 131 LEU 131 127 127 LEU LEU A . n 
A 1 132 PHE 132 128 128 PHE PHE A . n 
A 1 133 GLU 133 129 129 GLU GLU A . n 
A 1 134 LYS 134 130 130 LYS LYS A . n 
A 1 135 TRP 135 131 131 TRP TRP A . n 
A 1 136 PHE 136 132 132 PHE PHE A . n 
A 1 137 TYR 137 133 133 TYR TYR A . n 
A 1 138 CYS 138 134 134 CYS CYS A . n 
A 1 139 LYS 139 135 135 LYS LYS A . n 
A 1 140 ASP 140 136 136 ASP ASP A . n 
A 1 141 LEU 141 137 137 LEU LEU A . n 
A 1 142 GLY 142 138 138 GLY GLY A . n 
A 1 143 THR 143 139 139 THR THR A . n 
A 1 144 GLN 144 140 140 GLN GLN A . n 
A 1 145 LEU 145 141 141 LEU LEU A . n 
A 1 146 ALA 146 142 142 ALA ALA A . n 
A 1 147 PRO 147 143 143 PRO PRO A . n 
A 1 148 ILE 148 144 144 ILE ILE A . n 
A 1 149 ILE 149 145 145 ILE ILE A . n 
A 1 150 GLN 150 146 146 GLN GLN A . n 
A 1 151 GLU 151 147 147 GLU GLU A . n 
A 1 152 PHE 152 148 148 PHE PHE A . n 
A 1 153 PHE 153 149 149 PHE PHE A . n 
A 1 154 SER 154 150 150 SER SER A . n 
A 1 155 SER 155 151 151 SER SER A . n 
A 1 156 GLU 156 152 152 GLU GLU A . n 
A 1 157 GLN 157 153 153 GLN GLN A . n 
A 1 158 TYR 158 154 154 TYR TYR A . n 
A 1 159 ARG 159 155 155 ARG ARG A . n 
A 1 160 THR 160 156 156 THR THR A . n 
A 1 161 GLY 161 157 157 GLY GLY A . n 
A 1 162 LYS 162 158 158 LYS LYS A . n 
A 1 163 PRO 163 159 159 PRO PRO A . n 
A 1 164 ILE 164 160 160 ILE ILE A . n 
A 1 165 PRO 165 161 161 PRO PRO A . n 
A 1 166 ASP 166 162 162 ASP ASP A . n 
A 1 167 GLN 167 163 163 GLN GLN A . n 
A 1 168 LEU 168 164 164 LEU LEU A . n 
A 1 169 LEU 169 165 165 LEU LEU A . n 
A 1 170 LYS 170 166 166 LYS LYS A . n 
A 1 171 GLU 171 167 167 GLU GLU A . n 
A 1 172 PRO 172 168 168 PRO PRO A . n 
A 1 173 PRO 173 169 169 PRO PRO A . n 
A 1 174 PHE 174 170 170 PHE PHE A . n 
A 1 175 PRO 175 171 171 PRO PRO A . n 
A 1 176 LEU 176 172 172 LEU LEU A . n 
A 1 177 SER 177 173 173 SER SER A . n 
A 1 178 THR 178 174 174 THR THR A . n 
A 1 179 ARG 179 175 175 ARG ARG A . n 
A 1 180 SER 180 176 176 SER SER A . n 
A 1 181 ILE 181 177 177 ILE ILE A . n 
A 1 182 MET 182 178 178 MET MET A . n 
A 1 183 GLU 183 179 179 GLU GLU A . n 
A 1 184 PRO 184 180 180 PRO PRO A . n 
A 1 185 MET 185 181 181 MET MET A . n 
A 1 186 SER 186 182 182 SER SER A . n 
A 1 187 LEU 187 183 183 LEU LEU A . n 
A 1 188 ASP 188 184 184 ASP ASP A . n 
A 1 189 ALA 189 185 185 ALA ALA A . n 
A 1 190 TRP 190 186 186 TRP TRP A . n 
A 1 191 LEU 191 187 187 LEU LEU A . n 
A 1 192 ASP 192 188 188 ASP ASP A . n 
A 1 193 SER 193 189 189 SER SER A . n 
A 1 194 HIS 194 190 190 HIS HIS A . n 
A 1 195 HIS 195 191 191 HIS HIS A . n 
A 1 196 ARG 196 192 192 ARG ARG A . n 
A 1 197 GLU 197 193 193 GLU GLU A . n 
A 1 198 LEU 198 194 194 LEU LEU A . n 
A 1 199 GLN 199 195 195 GLN GLN A . n 
A 1 200 ALA 200 196 196 ALA ALA A . n 
A 1 201 GLY 201 197 197 GLY GLY A . n 
A 1 202 THR 202 198 198 THR THR A . n 
A 1 203 PRO 203 199 199 PRO PRO A . n 
A 1 204 LEU 204 200 200 LEU LEU A . n 
A 1 205 SER 205 201 201 SER SER A . n 
A 1 206 LEU 206 202 202 LEU LEU A . n 
A 1 207 PHE 207 203 203 PHE PHE A . n 
A 1 208 GLY 208 204 204 GLY GLY A . n 
A 1 209 ASP 209 205 205 ASP ASP A . n 
A 1 210 THR 210 206 206 THR THR A . n 
A 1 211 TYR 211 207 207 TYR TYR A . n 
A 1 212 GLU 212 208 208 GLU GLU A . n 
A 1 213 THR 213 209 209 THR THR A . n 
A 1 214 GLN 214 210 210 GLN GLN A . n 
A 1 215 VAL 215 211 211 VAL VAL A . n 
A 1 216 ILE 216 212 212 ILE ILE A . n 
A 1 217 ALA 217 213 213 ALA ALA A . n 
A 1 218 TYR 218 214 214 TYR TYR A . n 
A 1 219 GLY 219 215 215 GLY GLY A . n 
A 1 220 GLN 220 216 216 GLN GLN A . n 
A 1 221 GLY 221 217 217 GLY GLY A . n 
A 1 222 SER 222 218 218 SER SER A . n 
A 1 223 SER 223 219 219 SER SER A . n 
A 1 224 GLU 224 220 220 GLU GLU A . n 
A 1 225 GLY 225 221 221 GLY GLY A . n 
A 1 226 LEU 226 222 222 LEU LEU A . n 
A 1 227 ARG 227 223 223 ARG ARG A . n 
A 1 228 GLN 228 224 224 GLN GLN A . n 
A 1 229 ASN 229 225 225 ASN ASN A . n 
A 1 230 VAL 230 226 226 VAL VAL A . n 
A 1 231 ASP 231 227 227 ASP ASP A . n 
A 1 232 VAL 232 228 228 VAL VAL A . n 
A 1 233 TRP 233 229 229 TRP TRP A . n 
A 1 234 LEU 234 230 230 LEU LEU A . n 
A 1 235 TRP 235 231 231 TRP TRP A . n 
A 1 236 GLN 236 232 232 GLN GLN A . n 
A 1 237 LEU 237 233 233 LEU LEU A . n 
A 1 238 GLU 238 234 234 GLU GLU A . n 
A 1 239 GLY 239 235 235 GLY GLY A . n 
A 1 240 SER 240 236 236 SER SER A . n 
A 1 241 SER 241 237 237 SER SER A . n 
A 1 242 VAL 242 238 238 VAL VAL A . n 
A 1 243 VAL 243 239 239 VAL VAL A . n 
A 1 244 THR 244 240 240 THR THR A . n 
A 1 245 MET 245 241 241 MET MET A . n 
A 1 246 GLY 246 242 242 GLY GLY A . n 
A 1 247 GLY 247 243 243 GLY GLY A . n 
A 1 248 ARG 248 244 244 ARG ARG A . n 
A 1 249 ARG 249 245 245 ARG ARG A . n 
A 1 250 LEU 250 246 246 LEU LEU A . n 
A 1 251 SER 251 247 247 SER SER A . n 
A 1 252 LEU 252 248 248 LEU LEU A . n 
A 1 253 ALA 253 249 249 ALA ALA A . n 
A 1 254 PRO 254 250 250 PRO PRO A . n 
A 1 255 ASP 255 251 251 ASP ASP A . n 
A 1 256 ASP 256 252 252 ASP ASP A . n 
A 1 257 SER 257 253 253 SER SER A . n 
A 1 258 LEU 258 254 254 LEU LEU A . n 
A 1 259 LEU 259 255 255 LEU LEU A . n 
A 1 260 VAL 260 256 256 VAL VAL A . n 
A 1 261 LEU 261 257 257 LEU LEU A . n 
A 1 262 ALA 262 258 258 ALA ALA A . n 
A 1 263 GLY 263 259 259 GLY GLY A . n 
A 1 264 THR 264 260 260 THR THR A . n 
A 1 265 SER 265 261 261 SER SER A . n 
A 1 266 TYR 266 262 262 TYR TYR A . n 
A 1 267 ALA 267 263 263 ALA ALA A . n 
A 1 268 TRP 268 264 264 TRP TRP A . n 
A 1 269 GLU 269 265 265 GLU GLU A . n 
A 1 270 ARG 270 266 266 ARG ARG A . n 
A 1 271 THR 271 267 267 THR THR A . n 
A 1 272 GLN 272 268 268 GLN GLN A . n 
A 1 273 GLY 273 269 269 GLY GLY A . n 
A 1 274 SER 274 270 270 SER SER A . n 
A 1 275 VAL 275 271 271 VAL VAL A . n 
A 1 276 ALA 276 272 272 ALA ALA A . n 
A 1 277 LEU 277 273 273 LEU LEU A . n 
A 1 278 SER 278 274 274 SER SER A . n 
A 1 279 VAL 279 275 275 VAL VAL A . n 
A 1 280 THR 280 276 276 THR THR A . n 
A 1 281 GLN 281 277 277 GLN GLN A . n 
A 1 282 ASP 282 278 278 ASP ASP A . n 
A 1 283 PRO 283 279 279 PRO PRO A . n 
A 1 284 ALA 284 280 280 ALA ALA A . n 
A 1 285 CYS 285 281 281 CYS CYS A . n 
A 1 286 LYS 286 282 282 LYS LYS A . n 
A 1 287 LYS 287 283 283 LYS LYS A . n 
A 1 288 PRO 288 284 284 PRO PRO A . n 
A 1 289 LEU 289 285 285 LEU LEU A . n 
A 1 290 GLY 290 286 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE  1   301 1   FE  FE  A . 
C 3 SO4 1   302 1   SO4 SO4 A . 
D 3 SO4 1   303 2   SO4 SO4 A . 
E 3 SO4 1   304 3   SO4 SO4 A . 
F 4 HOH 1   401 103 HOH HOH A . 
F 4 HOH 2   402 40  HOH HOH A . 
F 4 HOH 3   403 46  HOH HOH A . 
F 4 HOH 4   404 160 HOH HOH A . 
F 4 HOH 5   405 88  HOH HOH A . 
F 4 HOH 6   406 17  HOH HOH A . 
F 4 HOH 7   407 26  HOH HOH A . 
F 4 HOH 8   408 48  HOH HOH A . 
F 4 HOH 9   409 159 HOH HOH A . 
F 4 HOH 10  410 139 HOH HOH A . 
F 4 HOH 11  411 63  HOH HOH A . 
F 4 HOH 12  412 124 HOH HOH A . 
F 4 HOH 13  413 182 HOH HOH A . 
F 4 HOH 14  414 135 HOH HOH A . 
F 4 HOH 15  415 5   HOH HOH A . 
F 4 HOH 16  416 133 HOH HOH A . 
F 4 HOH 17  417 60  HOH HOH A . 
F 4 HOH 18  418 98  HOH HOH A . 
F 4 HOH 19  419 105 HOH HOH A . 
F 4 HOH 20  420 106 HOH HOH A . 
F 4 HOH 21  421 22  HOH HOH A . 
F 4 HOH 22  422 70  HOH HOH A . 
F 4 HOH 23  423 158 HOH HOH A . 
F 4 HOH 24  424 34  HOH HOH A . 
F 4 HOH 25  425 15  HOH HOH A . 
F 4 HOH 26  426 121 HOH HOH A . 
F 4 HOH 27  427 37  HOH HOH A . 
F 4 HOH 28  428 177 HOH HOH A . 
F 4 HOH 29  429 27  HOH HOH A . 
F 4 HOH 30  430 145 HOH HOH A . 
F 4 HOH 31  431 138 HOH HOH A . 
F 4 HOH 32  432 19  HOH HOH A . 
F 4 HOH 33  433 161 HOH HOH A . 
F 4 HOH 34  434 185 HOH HOH A . 
F 4 HOH 35  435 49  HOH HOH A . 
F 4 HOH 36  436 179 HOH HOH A . 
F 4 HOH 37  437 130 HOH HOH A . 
F 4 HOH 38  438 142 HOH HOH A . 
F 4 HOH 39  439 42  HOH HOH A . 
F 4 HOH 40  440 109 HOH HOH A . 
F 4 HOH 41  441 171 HOH HOH A . 
F 4 HOH 42  442 18  HOH HOH A . 
F 4 HOH 43  443 174 HOH HOH A . 
F 4 HOH 44  444 118 HOH HOH A . 
F 4 HOH 45  445 74  HOH HOH A . 
F 4 HOH 46  446 23  HOH HOH A . 
F 4 HOH 47  447 39  HOH HOH A . 
F 4 HOH 48  448 83  HOH HOH A . 
F 4 HOH 49  449 81  HOH HOH A . 
F 4 HOH 50  450 90  HOH HOH A . 
F 4 HOH 51  451 52  HOH HOH A . 
F 4 HOH 52  452 168 HOH HOH A . 
F 4 HOH 53  453 89  HOH HOH A . 
F 4 HOH 54  454 9   HOH HOH A . 
F 4 HOH 55  455 2   HOH HOH A . 
F 4 HOH 56  456 94  HOH HOH A . 
F 4 HOH 57  457 170 HOH HOH A . 
F 4 HOH 58  458 153 HOH HOH A . 
F 4 HOH 59  459 108 HOH HOH A . 
F 4 HOH 60  460 147 HOH HOH A . 
F 4 HOH 61  461 32  HOH HOH A . 
F 4 HOH 62  462 4   HOH HOH A . 
F 4 HOH 63  463 107 HOH HOH A . 
F 4 HOH 64  464 13  HOH HOH A . 
F 4 HOH 65  465 91  HOH HOH A . 
F 4 HOH 66  466 181 HOH HOH A . 
F 4 HOH 67  467 84  HOH HOH A . 
F 4 HOH 68  468 134 HOH HOH A . 
F 4 HOH 69  469 31  HOH HOH A . 
F 4 HOH 70  470 6   HOH HOH A . 
F 4 HOH 71  471 24  HOH HOH A . 
F 4 HOH 72  472 143 HOH HOH A . 
F 4 HOH 73  473 73  HOH HOH A . 
F 4 HOH 74  474 114 HOH HOH A . 
F 4 HOH 75  475 80  HOH HOH A . 
F 4 HOH 76  476 101 HOH HOH A . 
F 4 HOH 77  477 157 HOH HOH A . 
F 4 HOH 78  478 62  HOH HOH A . 
F 4 HOH 79  479 55  HOH HOH A . 
F 4 HOH 80  480 120 HOH HOH A . 
F 4 HOH 81  481 126 HOH HOH A . 
F 4 HOH 82  482 65  HOH HOH A . 
F 4 HOH 83  483 72  HOH HOH A . 
F 4 HOH 84  484 3   HOH HOH A . 
F 4 HOH 85  485 122 HOH HOH A . 
F 4 HOH 86  486 95  HOH HOH A . 
F 4 HOH 87  487 87  HOH HOH A . 
F 4 HOH 88  488 29  HOH HOH A . 
F 4 HOH 89  489 93  HOH HOH A . 
F 4 HOH 90  490 44  HOH HOH A . 
F 4 HOH 91  491 137 HOH HOH A . 
F 4 HOH 92  492 127 HOH HOH A . 
F 4 HOH 93  493 53  HOH HOH A . 
F 4 HOH 94  494 115 HOH HOH A . 
F 4 HOH 95  495 111 HOH HOH A . 
F 4 HOH 96  496 51  HOH HOH A . 
F 4 HOH 97  497 156 HOH HOH A . 
F 4 HOH 98  498 162 HOH HOH A . 
F 4 HOH 99  499 117 HOH HOH A . 
F 4 HOH 100 500 123 HOH HOH A . 
F 4 HOH 101 501 1   HOH HOH A . 
F 4 HOH 102 502 77  HOH HOH A . 
F 4 HOH 103 503 7   HOH HOH A . 
F 4 HOH 104 504 152 HOH HOH A . 
F 4 HOH 105 505 16  HOH HOH A . 
F 4 HOH 106 506 183 HOH HOH A . 
F 4 HOH 107 507 176 HOH HOH A . 
F 4 HOH 108 508 172 HOH HOH A . 
F 4 HOH 109 509 79  HOH HOH A . 
F 4 HOH 110 510 132 HOH HOH A . 
F 4 HOH 111 511 178 HOH HOH A . 
F 4 HOH 112 512 119 HOH HOH A . 
F 4 HOH 113 513 59  HOH HOH A . 
F 4 HOH 114 514 12  HOH HOH A . 
F 4 HOH 115 515 116 HOH HOH A . 
F 4 HOH 116 516 47  HOH HOH A . 
F 4 HOH 117 517 96  HOH HOH A . 
F 4 HOH 118 518 169 HOH HOH A . 
F 4 HOH 119 519 76  HOH HOH A . 
F 4 HOH 120 520 149 HOH HOH A . 
F 4 HOH 121 521 50  HOH HOH A . 
F 4 HOH 122 522 86  HOH HOH A . 
F 4 HOH 123 523 151 HOH HOH A . 
F 4 HOH 124 524 150 HOH HOH A . 
F 4 HOH 125 525 100 HOH HOH A . 
F 4 HOH 126 526 38  HOH HOH A . 
F 4 HOH 127 527 82  HOH HOH A . 
F 4 HOH 128 528 99  HOH HOH A . 
F 4 HOH 129 529 36  HOH HOH A . 
F 4 HOH 130 530 175 HOH HOH A . 
F 4 HOH 131 531 113 HOH HOH A . 
F 4 HOH 132 532 102 HOH HOH A . 
F 4 HOH 133 533 154 HOH HOH A . 
F 4 HOH 134 534 166 HOH HOH A . 
F 4 HOH 135 535 25  HOH HOH A . 
F 4 HOH 136 536 35  HOH HOH A . 
F 4 HOH 137 537 110 HOH HOH A . 
F 4 HOH 138 538 71  HOH HOH A . 
F 4 HOH 139 539 140 HOH HOH A . 
F 4 HOH 140 540 165 HOH HOH A . 
F 4 HOH 141 541 54  HOH HOH A . 
F 4 HOH 142 542 43  HOH HOH A . 
F 4 HOH 143 543 28  HOH HOH A . 
F 4 HOH 144 544 58  HOH HOH A . 
F 4 HOH 145 545 128 HOH HOH A . 
F 4 HOH 146 546 66  HOH HOH A . 
F 4 HOH 147 547 97  HOH HOH A . 
F 4 HOH 148 548 144 HOH HOH A . 
F 4 HOH 149 549 61  HOH HOH A . 
F 4 HOH 150 550 136 HOH HOH A . 
F 4 HOH 151 551 164 HOH HOH A . 
F 4 HOH 152 552 173 HOH HOH A . 
F 4 HOH 153 553 167 HOH HOH A . 
F 4 HOH 154 554 33  HOH HOH A . 
F 4 HOH 155 555 92  HOH HOH A . 
F 4 HOH 156 556 20  HOH HOH A . 
F 4 HOH 157 557 78  HOH HOH A . 
F 4 HOH 158 558 112 HOH HOH A . 
F 4 HOH 159 559 163 HOH HOH A . 
F 4 HOH 160 560 67  HOH HOH A . 
F 4 HOH 161 561 56  HOH HOH A . 
F 4 HOH 162 562 41  HOH HOH A . 
F 4 HOH 163 563 148 HOH HOH A . 
F 4 HOH 164 564 75  HOH HOH A . 
F 4 HOH 165 565 184 HOH HOH A . 
F 4 HOH 166 566 155 HOH HOH A . 
F 4 HOH 167 567 85  HOH HOH A . 
F 4 HOH 168 568 64  HOH HOH A . 
F 4 HOH 169 569 180 HOH HOH A . 
F 4 HOH 170 570 104 HOH HOH A . 
F 4 HOH 171 571 57  HOH HOH A . 
F 4 HOH 172 572 68  HOH HOH A . 
F 4 HOH 173 573 45  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 411 ? F HOH . 
2 1 A HOH 547 ? F HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 51 ? A HIS 47  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 OE1 ? A GLU 57 ? A GLU 53  ? 1_555 158.4 ? 
2  ND1 ? A HIS 51 ? A HIS 47  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 OE2 ? A GLU 57 ? A GLU 53  ? 1_555 97.2  ? 
3  OE1 ? A GLU 57 ? A GLU 53  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 OE2 ? A GLU 57 ? A GLU 53  ? 1_555 61.2  ? 
4  ND1 ? A HIS 51 ? A HIS 47  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 NE2 ? A HIS 95 ? A HIS 91  ? 1_555 97.1  ? 
5  OE1 ? A GLU 57 ? A GLU 53  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 NE2 ? A HIS 95 ? A HIS 91  ? 1_555 87.4  ? 
6  OE2 ? A GLU 57 ? A GLU 53  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 NE2 ? A HIS 95 ? A HIS 91  ? 1_555 98.5  ? 
7  ND1 ? A HIS 51 ? A HIS 47  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 448 ? 1_555 86.4  ? 
8  OE1 ? A GLU 57 ? A GLU 53  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 448 ? 1_555 91.2  ? 
9  OE2 ? A GLU 57 ? A GLU 53  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 448 ? 1_555 86.0  ? 
10 NE2 ? A HIS 95 ? A HIS 91  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 448 ? 1_555 173.9 ? 
11 ND1 ? A HIS 51 ? A HIS 47  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 527 ? 1_555 102.9 ? 
12 OE1 ? A GLU 57 ? A GLU 53  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 527 ? 1_555 98.1  ? 
13 OE2 ? A GLU 57 ? A GLU 53  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 527 ? 1_555 156.4 ? 
14 NE2 ? A HIS 95 ? A HIS 91  ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 527 ? 1_555 91.0  ? 
15 O   ? F HOH .  ? A HOH 448 ? 1_555 FE ? B FE . ? A FE 301 ? 1_555 O   ? F HOH .  ? A HOH 527 ? 1_555 83.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-04-12 
2 'Structure model' 1 1 2017-09-27 
3 'Structure model' 1 2 2018-04-18 
4 'Structure model' 1 3 2019-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 3 'Structure model' 'Data collection'            
3 3 'Structure model' 'Database references'        
4 4 'Structure model' 'Author supporting evidence' 
5 4 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support           
2 3 'Structure model' citation                     
3 3 'Structure model' citation_author              
4 4 'Structure model' pdbx_audit_support           
5 4 'Structure model' pdbx_struct_special_symmetry 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_pdbx_audit_support.funding_organization' 
2  3 'Structure model' '_citation.country'                        
3  3 'Structure model' '_citation.journal_abbrev'                 
4  3 'Structure model' '_citation.journal_id_ASTM'                
5  3 'Structure model' '_citation.journal_id_CSD'                 
6  3 'Structure model' '_citation.journal_id_ISSN'                
7  3 'Structure model' '_citation.page_last'                      
8  3 'Structure model' '_citation.pdbx_database_id_PubMed'        
9  3 'Structure model' '_citation.title'                          
10 3 'Structure model' '_citation_author.name'                    
11 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         24.3604 
_pdbx_refine_tls.origin_y         -12.7611 
_pdbx_refine_tls.origin_z         14.3232 
_pdbx_refine_tls.T[1][1]          0.0069 
_pdbx_refine_tls.T[2][2]          -0.0042 
_pdbx_refine_tls.T[3][3]          -0.0079 
_pdbx_refine_tls.T[1][2]          -0.0029 
_pdbx_refine_tls.T[1][3]          0.0048 
_pdbx_refine_tls.T[2][3]          0.0015 
_pdbx_refine_tls.L[1][1]          0.0248 
_pdbx_refine_tls.L[2][2]          0.0904 
_pdbx_refine_tls.L[3][3]          0.2705 
_pdbx_refine_tls.L[1][2]          -0.0476 
_pdbx_refine_tls.L[1][3]          -0.0738 
_pdbx_refine_tls.L[2][3]          -0.0569 
_pdbx_refine_tls.S[1][1]          -0.0001 
_pdbx_refine_tls.S[1][2]          -0.0002 
_pdbx_refine_tls.S[1][3]          -0.0094 
_pdbx_refine_tls.S[2][1]          0.0029 
_pdbx_refine_tls.S[2][2]          0.0003 
_pdbx_refine_tls.S[2][3]          -0.0007 
_pdbx_refine_tls.S[3][1]          -0.0049 
_pdbx_refine_tls.S[3][2]          0.0003 
_pdbx_refine_tls.S[3][3]          -0.0002 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   '{ A|* }' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER  ? ? ? 2.10.2 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .      4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 18  ? ? -90.32  39.28   
2 1 CYS A 23  ? ? 61.41   -12.48  
3 1 GLU A 30  ? ? -97.28  -118.73 
4 1 LYS A 135 ? ? -121.53 -50.15  
5 1 ASP A 251 ? ? 80.79   -0.31   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 3   ? CG  ? A ARG 7   CG  
2  1 Y 1 A ARG 3   ? CD  ? A ARG 7   CD  
3  1 Y 1 A ARG 3   ? NE  ? A ARG 7   NE  
4  1 Y 1 A ARG 3   ? CZ  ? A ARG 7   CZ  
5  1 Y 1 A ARG 3   ? NH1 ? A ARG 7   NH1 
6  1 Y 1 A ARG 3   ? NH2 ? A ARG 7   NH2 
7  1 Y 1 A GLU 13  ? CD  ? A GLU 17  CD  
8  1 Y 1 A GLU 13  ? OE1 ? A GLU 17  OE1 
9  1 Y 1 A GLU 13  ? OE2 ? A GLU 17  OE2 
10 1 Y 1 A VAL 22  ? CB  ? A VAL 26  CB  
11 1 Y 1 A VAL 22  ? CG1 ? A VAL 26  CG1 
12 1 Y 1 A VAL 22  ? CG2 ? A VAL 26  CG2 
13 1 Y 1 A LYS 71  ? CE  ? A LYS 75  CE  
14 1 Y 1 A LYS 71  ? NZ  ? A LYS 75  NZ  
15 1 Y 1 A ARG 73  ? CG  ? A ARG 77  CG  
16 1 Y 1 A ARG 73  ? CD  ? A ARG 77  CD  
17 1 Y 1 A ARG 73  ? NE  ? A ARG 77  NE  
18 1 Y 1 A ARG 73  ? CZ  ? A ARG 77  CZ  
19 1 Y 1 A ARG 73  ? NH1 ? A ARG 77  NH1 
20 1 Y 1 A ARG 73  ? NH2 ? A ARG 77  NH2 
21 1 Y 1 A GLU 110 ? CG  ? A GLU 114 CG  
22 1 Y 1 A GLU 110 ? CD  ? A GLU 114 CD  
23 1 Y 1 A GLU 110 ? OE1 ? A GLU 114 OE1 
24 1 Y 1 A GLU 110 ? OE2 ? A GLU 114 OE2 
25 1 Y 1 A ASP 122 ? CG  ? A ASP 126 CG  
26 1 Y 1 A ASP 122 ? OD1 ? A ASP 126 OD1 
27 1 Y 1 A ASP 122 ? OD2 ? A ASP 126 OD2 
28 1 Y 1 A LYS 135 ? CD  ? A LYS 139 CD  
29 1 Y 1 A LYS 135 ? CE  ? A LYS 139 CE  
30 1 Y 1 A LYS 135 ? NZ  ? A LYS 139 NZ  
31 1 Y 1 A GLU 152 ? CG  ? A GLU 156 CG  
32 1 Y 1 A GLU 152 ? CD  ? A GLU 156 CD  
33 1 Y 1 A GLU 152 ? OE1 ? A GLU 156 OE1 
34 1 Y 1 A GLU 152 ? OE2 ? A GLU 156 OE2 
35 1 Y 1 A LYS 158 ? NZ  ? A LYS 162 NZ  
36 1 Y 1 A GLU 167 ? CD  ? A GLU 171 CD  
37 1 Y 1 A GLU 167 ? OE1 ? A GLU 171 OE1 
38 1 Y 1 A GLU 167 ? OE2 ? A GLU 171 OE2 
39 1 Y 1 A ARG 192 ? NE  ? A ARG 196 NE  
40 1 Y 1 A ARG 192 ? CZ  ? A ARG 196 CZ  
41 1 Y 1 A ARG 192 ? NH1 ? A ARG 196 NH1 
42 1 Y 1 A ARG 192 ? NH2 ? A ARG 196 NH2 
43 1 Y 1 A GLU 220 ? CG  ? A GLU 224 CG  
44 1 Y 1 A GLU 220 ? CD  ? A GLU 224 CD  
45 1 Y 1 A GLU 220 ? OE1 ? A GLU 224 OE1 
46 1 Y 1 A GLU 220 ? OE2 ? A GLU 224 OE2 
47 1 Y 1 A LEU 222 ? CD1 ? A LEU 226 CD1 
48 1 Y 1 A LEU 222 ? CD2 ? A LEU 226 CD2 
49 1 Y 1 A ARG 223 ? NE  ? A ARG 227 NE  
50 1 Y 1 A ARG 223 ? CZ  ? A ARG 227 CZ  
51 1 Y 1 A ARG 223 ? NH1 ? A ARG 227 NH1 
52 1 Y 1 A ARG 223 ? NH2 ? A ARG 227 NH2 
53 1 Y 1 A ARG 244 ? NE  ? A ARG 248 NE  
54 1 Y 1 A ARG 244 ? CZ  ? A ARG 248 CZ  
55 1 Y 1 A ARG 244 ? NH1 ? A ARG 248 NH1 
56 1 Y 1 A ARG 244 ? NH2 ? A ARG 248 NH2 
57 1 Y 1 A ARG 245 ? CD  ? A ARG 249 CD  
58 1 Y 1 A ARG 245 ? NE  ? A ARG 249 NE  
59 1 Y 1 A ARG 245 ? CZ  ? A ARG 249 CZ  
60 1 Y 1 A ARG 245 ? NH1 ? A ARG 249 NH1 
61 1 Y 1 A ARG 245 ? NH2 ? A ARG 249 NH2 
62 1 Y 1 A GLU 265 ? CD  ? A GLU 269 CD  
63 1 Y 1 A GLU 265 ? OE1 ? A GLU 269 OE1 
64 1 Y 1 A GLU 265 ? OE2 ? A GLU 269 OE2 
65 1 Y 1 A LEU 285 ? CG  ? A LEU 289 CG  
66 1 Y 1 A LEU 285 ? CD1 ? A LEU 289 CD1 
67 1 Y 1 A LEU 285 ? CD2 ? A LEU 289 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY -3  ? A GLY 1   
2 1 Y 1 A PRO -2  ? A PRO 2   
3 1 Y 1 A GLY -1  ? A GLY 3   
4 1 Y 1 A SER 0   ? A SER 4   
5 1 Y 1 A MET 1   ? A MET 5   
6 1 Y 1 A GLU 2   ? A GLU 6   
7 1 Y 1 A GLY 286 ? A GLY 290 
# 
_pdbx_audit_support.funding_organization   'National Science Foundation (NSF, United States)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           CHE1306208 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 'SULFATE ION'  SO4 
4 water          HOH 
#