data_5TYZ
# 
_entry.id   5TYZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.381 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5TYZ         pdb_00005tyz 10.2210/pdb5tyz/pdb 
WWPDB D_1000225059 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5TXX unspecified 
PDB . 5TXZ unspecified 
PDB . 5TYB unspecified 
PDB . 5TYC unspecified 
PDB . 5TYD unspecified 
PDB . 5TYE unspecified 
PDB . 5TYF unspecified 
PDB . 5TYG unspecified 
PDB . 5TYU unspecified 
PDB . 5TYV unspecified 
PDB . 5TYW unspecified 
PDB . 5TYX unspecified 
PDB . 5TYY unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TYZ 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jamsen, J.A.' 1 ? 
'Wilson, S.H.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                253 
_citation.page_last                 253 
_citation.title                     'Time-lapse crystallography snapshots of a double-strand break repair polymerase in action.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-017-00271-7 
_citation.pdbx_database_id_PubMed   28811466 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jamsen, J.A.'   1 ? 
primary 'Beard, W.A.'    2 ? 
primary 'Pedersen, L.C.' 3 ? 
primary 'Shock, D.D.'    4 ? 
primary 'Moon, A.F.'     5 ? 
primary 'Krahn, J.M.'    6 ? 
primary 'Bebenek, K.'    7 ? 
primary 'Kunkel, T.A.'   8 ? 
primary 'Wilson, S.H.'   9 ? 
# 
_cell.length_a           59.934 
_cell.length_b           68.653 
_cell.length_c           109.999 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5TYZ 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         5TYZ 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed DNA/RNA polymerase mu'                  40054.434 1   2.7.7.7 ? 'UNP residues 132-494' ? 
2  polymer     syn 
;DNA (5'-D(*CP*GP*GP*CP*AP*TP*AP*CP*G)-3')
;
2740.812  1   ?       ? ?                      ? 
3  polymer     syn 
;DNA (5'-D(*CP*GP*TP*AP*T)-3')
;
1495.023  1   ?       ? ?                      ? 
4  polymer     syn 
;DNA (5'-D(P*GP*CP*CP*G)-3')
;
1191.818  1   ?       ? ?                      ? 
5  non-polymer syn 'MANGANESE (II) ION'                                  54.938    6   ?       ? ?                      ? 
6  non-polymer syn 'SODIUM ION'                                          22.990    1   ?       ? ?                      ? 
7  non-polymer syn 2,3-DIHYDROXY-1,4-DITHIOBUTANE                        154.251   2   ?       ? ?                      ? 
8  non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   1   ?       ? ?                      ? 
9  non-polymer syn 1,2-ETHANEDIOL                                        62.068    3   ?       ? ?                      ? 
10 non-polymer syn 'GLYCOLIC ACID'                                       76.051    1   ?       ? ?                      ? 
11 water       nat water                                                 18.015    312 ?       ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Mu,Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DA)(DT)(DA)(DC)(DG)' CGGCATACG T ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)(DT)' CGTAT P ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   PRO n 
1 7   LEU n 
1 8   SER n 
1 9   PRO n 
1 10  ALA n 
1 11  TRP n 
1 12  MET n 
1 13  PRO n 
1 14  ALA n 
1 15  TYR n 
1 16  ALA n 
1 17  CYS n 
1 18  GLN n 
1 19  ARG n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  LEU n 
1 24  THR n 
1 25  HIS n 
1 26  HIS n 
1 27  ASN n 
1 28  THR n 
1 29  GLY n 
1 30  LEU n 
1 31  SER n 
1 32  GLU n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  ILE n 
1 37  LEU n 
1 38  ALA n 
1 39  GLU n 
1 40  ALA n 
1 41  ALA n 
1 42  GLY n 
1 43  PHE n 
1 44  GLU n 
1 45  GLY n 
1 46  SER n 
1 47  GLU n 
1 48  GLY n 
1 49  ARG n 
1 50  LEU n 
1 51  LEU n 
1 52  THR n 
1 53  PHE n 
1 54  CYS n 
1 55  ARG n 
1 56  ALA n 
1 57  ALA n 
1 58  SER n 
1 59  VAL n 
1 60  LEU n 
1 61  LYS n 
1 62  ALA n 
1 63  LEU n 
1 64  PRO n 
1 65  SER n 
1 66  PRO n 
1 67  VAL n 
1 68  THR n 
1 69  THR n 
1 70  LEU n 
1 71  SER n 
1 72  GLN n 
1 73  LEU n 
1 74  GLN n 
1 75  GLY n 
1 76  LEU n 
1 77  PRO n 
1 78  HIS n 
1 79  PHE n 
1 80  GLY n 
1 81  GLU n 
1 82  HIS n 
1 83  SER n 
1 84  SER n 
1 85  ARG n 
1 86  VAL n 
1 87  VAL n 
1 88  GLN n 
1 89  GLU n 
1 90  LEU n 
1 91  LEU n 
1 92  GLU n 
1 93  HIS n 
1 94  GLY n 
1 95  VAL n 
1 96  CYS n 
1 97  GLU n 
1 98  GLU n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 VAL n 
1 103 ARG n 
1 104 ARG n 
1 105 SER n 
1 106 GLU n 
1 107 ARG n 
1 108 TYR n 
1 109 GLN n 
1 110 THR n 
1 111 MET n 
1 112 LYS n 
1 113 LEU n 
1 114 PHE n 
1 115 THR n 
1 116 GLN n 
1 117 ILE n 
1 118 PHE n 
1 119 GLY n 
1 120 VAL n 
1 121 GLY n 
1 122 VAL n 
1 123 LYS n 
1 124 THR n 
1 125 ALA n 
1 126 ASP n 
1 127 ARG n 
1 128 TRP n 
1 129 TYR n 
1 130 ARG n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ARG n 
1 135 THR n 
1 136 LEU n 
1 137 ASP n 
1 138 ASP n 
1 139 LEU n 
1 140 ARG n 
1 141 GLU n 
1 142 GLN n 
1 143 PRO n 
1 144 GLN n 
1 145 LYS n 
1 146 LEU n 
1 147 THR n 
1 148 GLN n 
1 149 GLN n 
1 150 GLN n 
1 151 LYS n 
1 152 ALA n 
1 153 GLY n 
1 154 LEU n 
1 155 GLN n 
1 156 HIS n 
1 157 HIS n 
1 158 GLN n 
1 159 ASP n 
1 160 LEU n 
1 161 SER n 
1 162 THR n 
1 163 PRO n 
1 164 VAL n 
1 165 LEU n 
1 166 ARG n 
1 167 SER n 
1 168 ASP n 
1 169 VAL n 
1 170 ASP n 
1 171 ALA n 
1 172 LEU n 
1 173 GLN n 
1 174 GLN n 
1 175 VAL n 
1 176 VAL n 
1 177 GLU n 
1 178 GLU n 
1 179 ALA n 
1 180 VAL n 
1 181 GLY n 
1 182 GLN n 
1 183 ALA n 
1 184 LEU n 
1 185 PRO n 
1 186 GLY n 
1 187 ALA n 
1 188 THR n 
1 189 VAL n 
1 190 THR n 
1 191 LEU n 
1 192 THR n 
1 193 GLY n 
1 194 GLY n 
1 195 PHE n 
1 196 ARG n 
1 197 ARG n 
1 198 GLY n 
1 199 LYS n 
1 200 LEU n 
1 201 GLN n 
1 202 GLY n 
1 203 HIS n 
1 204 ASP n 
1 205 VAL n 
1 206 ASP n 
1 207 PHE n 
1 208 LEU n 
1 209 ILE n 
1 210 THR n 
1 211 HIS n 
1 212 PRO n 
1 213 LYS n 
1 214 GLU n 
1 215 GLY n 
1 216 GLN n 
1 217 GLU n 
1 218 ALA n 
1 219 GLY n 
1 220 LEU n 
1 221 LEU n 
1 222 PRO n 
1 223 ARG n 
1 224 VAL n 
1 225 MET n 
1 226 CYS n 
1 227 ARG n 
1 228 LEU n 
1 229 GLN n 
1 230 ASP n 
1 231 GLN n 
1 232 GLY n 
1 233 LEU n 
1 234 ILE n 
1 235 LEU n 
1 236 TYR n 
1 237 HIS n 
1 238 GLN n 
1 239 HIS n 
1 240 GLN n 
1 241 HIS n 
1 242 SER n 
1 243 CYS n 
1 244 CYS n 
1 245 GLU n 
1 246 SER n 
1 247 PRO n 
1 248 THR n 
1 249 ARG n 
1 250 LEU n 
1 251 ALA n 
1 252 GLN n 
1 253 GLN n 
1 254 SER n 
1 255 HIS n 
1 256 MET n 
1 257 ASP n 
1 258 ALA n 
1 259 PHE n 
1 260 GLU n 
1 261 ARG n 
1 262 SER n 
1 263 PHE n 
1 264 CYS n 
1 265 ILE n 
1 266 PHE n 
1 267 ARG n 
1 268 LEU n 
1 269 PRO n 
1 270 GLN n 
1 271 PRO n 
1 272 GLY n 
1 273 SER n 
1 274 TRP n 
1 275 LYS n 
1 276 ALA n 
1 277 VAL n 
1 278 ARG n 
1 279 VAL n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 VAL n 
1 284 ALA n 
1 285 PRO n 
1 286 VAL n 
1 287 SER n 
1 288 GLN n 
1 289 PHE n 
1 290 PRO n 
1 291 PHE n 
1 292 ALA n 
1 293 LEU n 
1 294 LEU n 
1 295 GLY n 
1 296 TRP n 
1 297 THR n 
1 298 GLY n 
1 299 SER n 
1 300 LYS n 
1 301 LEU n 
1 302 PHE n 
1 303 GLN n 
1 304 ARG n 
1 305 GLU n 
1 306 LEU n 
1 307 ARG n 
1 308 ARG n 
1 309 PHE n 
1 310 SER n 
1 311 ARG n 
1 312 LYS n 
1 313 GLU n 
1 314 LYS n 
1 315 GLY n 
1 316 LEU n 
1 317 TRP n 
1 318 LEU n 
1 319 ASN n 
1 320 SER n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 PHE n 
1 325 ASP n 
1 326 PRO n 
1 327 GLU n 
1 328 GLN n 
1 329 LYS n 
1 330 THR n 
1 331 PHE n 
1 332 PHE n 
1 333 GLN n 
1 334 ALA n 
1 335 ALA n 
1 336 SER n 
1 337 GLU n 
1 338 GLU n 
1 339 ASP n 
1 340 ILE n 
1 341 PHE n 
1 342 ARG n 
1 343 HIS n 
1 344 LEU n 
1 345 GLY n 
1 346 LEU n 
1 347 GLU n 
1 348 TYR n 
1 349 LEU n 
1 350 PRO n 
1 351 PRO n 
1 352 GLU n 
1 353 GLN n 
1 354 ARG n 
1 355 ASN n 
1 356 ALA n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
3 5   DT  n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   356 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLM, polmu' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              CodonPlus-RIL 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEXM 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 9 unidentified ? 32644 ? 
3 1 sample 1 5 unidentified ? 32644 ? 
4 1 sample 1 4 unidentified ? 32644 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPOLM_HUMAN Q9NP87 ? 1 
;PLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSR
VVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVL
RSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSCCE
SPTRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKE
KGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
132 
2 PDB 5TYZ        5TYZ   ? 2 ? 1   
3 PDB 5TYZ        5TYZ   ? 3 ? 1   
4 PDB 5TYZ        5TYZ   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5TYZ A 6 ? 356 ? Q9NP87 132 ? 494 ? 132 494 
2 2 5TYZ T 1 ? 9   ? 5TYZ   1   ? 9   ? 1   9   
3 3 5TYZ P 1 ? 5   ? 5TYZ   1   ? 5   ? 1   5   
4 4 5TYZ D 1 ? 4   ? 5TYZ   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5TYZ GLY A 1   ? UNP Q9NP87 ?   ?   'expression tag' 127 1  
1 5TYZ SER A 2   ? UNP Q9NP87 ?   ?   'expression tag' 128 2  
1 5TYZ ALA A 3   ? UNP Q9NP87 ?   ?   'expression tag' 129 3  
1 5TYZ ALA A 4   ? UNP Q9NP87 ?   ?   'expression tag' 130 4  
1 5TYZ ALA A 5   ? UNP Q9NP87 ?   ?   'expression tag' 131 5  
1 5TYZ ?   A ?   ? UNP Q9NP87 PRO 398 deletion         ?   6  
1 5TYZ ?   A ?   ? UNP Q9NP87 GLY 399 deletion         ?   7  
1 5TYZ ?   A ?   ? UNP Q9NP87 ALA 400 deletion         ?   8  
1 5TYZ ?   A ?   ? UNP Q9NP87 ALA 401 deletion         ?   9  
1 5TYZ ?   A ?   ? UNP Q9NP87 VAL 402 deletion         ?   10 
1 5TYZ ?   A ?   ? UNP Q9NP87 GLY 403 deletion         ?   11 
1 5TYZ ?   A ?   ? UNP Q9NP87 GLY 404 deletion         ?   12 
1 5TYZ ?   A ?   ? UNP Q9NP87 SER 405 deletion         ?   13 
1 5TYZ ?   A ?   ? UNP Q9NP87 THR 406 deletion         ?   14 
1 5TYZ ?   A ?   ? UNP Q9NP87 ARG 407 deletion         ?   15 
1 5TYZ ?   A ?   ? UNP Q9NP87 PRO 408 deletion         ?   16 
1 5TYZ ?   A ?   ? UNP Q9NP87 CYS 409 deletion         ?   17 
1 5TYZ GLY A 272 ? UNP Q9NP87 PRO 410 conflict         410 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ?                                          
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                              ?                                          
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?                                          
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?                                          
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                              ?                                          
'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                  ?                                          
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                   ?                                          
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                  ?                                          
'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                          ?                                          
'C10 H15 N2 O8 P' 322.208 
DTT non-polymer         . 2,3-DIHYDROXY-1,4-DITHIOBUTANE                        1,4-DITHIOTHREITOL                         
'C4 H10 O2 S2'    154.251 
EDO non-polymer         . 1,2-ETHANEDIOL                                        'ETHYLENE GLYCOL'                          
'C2 H6 O2'        62.068  
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES                                      
'C8 H18 N2 O4 S'  238.305 
GLN 'L-peptide linking' y GLUTAMINE                                             ?                                          
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?                                          
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                               ?                                          
'C2 H5 N O2'      75.067  
GOA non-polymer         . 'GLYCOLIC ACID'                                       'HYDROXYACETIC ACID; HYDROXYETHANOIC ACID' 
'C2 H4 O3'        76.051  
HIS 'L-peptide linking' y HISTIDINE                                             ?                                          
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                 ?                                          'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?                                          
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?                                          
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                ?                                          
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                            ?                                          
'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                  ?                                          'Mn 2' 
54.938  
NA  non-polymer         . 'SODIUM ION'                                          ?                                          'Na 1' 
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?                                          
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                               ?                                          
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                ?                                          
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                             ?                                          
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?                                          
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?                                          
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                ?                                          
'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TYZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.67 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.92 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.665 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '85-90mM HEPES pH 7.5, 17-18% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 944' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            23.770 
_reflns.entry_id                         5TYZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.980 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       32271 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.400 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.500 
_reflns.pdbx_Rmerge_I_obs                0.095 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         22.237 
_reflns.pdbx_netI_over_sigmaI            8.500 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.217 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         272826 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.980 2.010  ? ? ? ? ? ? ? 94.000  ? ? ? ? 0.690 ? ? ? ? ? ? ? ? 4.700 ? ? ? ? ? ? ? 1  1 ? ? 
2.010 2.050  ? ? ? ? ? ? ? 96.900  ? ? ? ? 0.522 ? ? ? ? ? ? ? ? 5.200 ? ? ? ? ? ? ? 2  1 ? ? 
2.050 2.090  ? ? ? ? ? ? ? 99.400  ? ? ? ? 0.477 ? ? ? ? ? ? ? ? 5.800 ? ? ? ? ? ? ? 3  1 ? ? 
2.090 2.130  ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.440 ? ? ? ? ? ? ? ? 6.600 ? ? ? ? ? ? ? 4  1 ? ? 
2.130 2.180  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.359 ? ? ? ? ? ? ? ? 7.500 ? ? ? ? ? ? ? 5  1 ? ? 
2.180 2.230  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.363 ? ? ? ? ? ? ? ? 8.800 ? ? ? ? ? ? ? 6  1 ? ? 
2.230 2.290  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.370 ? ? ? ? ? ? ? ? 9.300 ? ? ? ? ? ? ? 7  1 ? ? 
2.290 2.350  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.300 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 8  1 ? ? 
2.350 2.420  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.276 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 9  1 ? ? 
2.420 2.490  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.261 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 10 1 ? ? 
2.490 2.580  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.232 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 11 1 ? ? 
2.580 2.690  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.201 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 12 1 ? ? 
2.690 2.810  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.174 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 13 1 ? ? 
2.810 2.960  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 14 1 ? ? 
2.960 3.140  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 15 1 ? ? 
3.140 3.390  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? ? ? ? 16 1 ? ? 
3.390 3.730  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 9.300 ? ? ? ? ? ? ? 17 1 ? ? 
3.730 4.260  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 9.200 ? ? ? ? ? ? ? 18 1 ? ? 
4.260 5.370  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 9.100 ? ? ? ? ? ? ? 19 1 ? ? 
5.370 50.000 ? ? ? ? ? ? ? 97.500  ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 8.400 ? ? ? ? ? ? ? 20 1 ? ? 
# 
_refine.entry_id                                 5TYZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.9770 
_refine.ls_d_res_low                             21.9820 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.6100 
_refine.ls_number_reflns_obs                     31980 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1774 
_refine.ls_R_factor_R_work                       0.1755 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2149 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  1598 
_refine.ls_number_reflns_R_work                  30382 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               36.3937 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2100 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4M04 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                96.310 
_refine.B_iso_min                                18.140 
_refine.pdbx_overall_phase_error                 21.2200 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.9770 
_refine_hist.d_res_low                        21.9820 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             325 
_refine_hist.number_atoms_total               3271 
_refine_hist.pdbx_number_residues_total       344 
_refine_hist.pdbx_B_iso_mean_ligand           45.91 
_refine_hist.pdbx_B_iso_mean_solvent          43.23 
_refine_hist.pdbx_number_atoms_protein        2551 
_refine_hist.pdbx_number_atoms_nucleic_acid   364 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           3251 0.005  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          4509 0.680  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     493  0.044  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      530  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1878 13.510 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.9774 2.0412  11 93.0000  2566 . 0.2364 0.2768 . 136 0.0000 2702 . 'X-RAY DIFFRACTION' 
2.0412 2.1141  11 100.0000 2761 . 0.2032 0.2472 . 147 0.0000 2908 . 'X-RAY DIFFRACTION' 
2.1141 2.1986  11 100.0000 2759 . 0.1886 0.2340 . 143 0.0000 2902 . 'X-RAY DIFFRACTION' 
2.1986 2.2986  11 100.0000 2748 . 0.1862 0.2608 . 143 0.0000 2891 . 'X-RAY DIFFRACTION' 
2.2986 2.4196  11 100.0000 2772 . 0.1808 0.2149 . 148 0.0000 2920 . 'X-RAY DIFFRACTION' 
2.4196 2.5710  11 99.0000  2726 . 0.1946 0.2478 . 141 0.0000 2867 . 'X-RAY DIFFRACTION' 
2.5710 2.7692  11 98.0000  2759 . 0.2021 0.2470 . 148 0.0000 2907 . 'X-RAY DIFFRACTION' 
2.7692 3.0472  11 96.0000  2699 . 0.2129 0.2391 . 140 0.0000 2839 . 'X-RAY DIFFRACTION' 
3.0472 3.4866  11 100.0000 2804 . 0.1608 0.2036 . 147 0.0000 2951 . 'X-RAY DIFFRACTION' 
3.4866 4.3870  11 100.0000 2838 . 0.1433 0.1719 . 150 0.0000 2988 . 'X-RAY DIFFRACTION' 
4.3870 21.9831 11 99.0000  2950 . 0.1713 0.2105 . 155 0.0000 3105 . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                     5TYZ 
_struct.title                        'DNA Polymerase Mu Product Complex, Mn2+ (960 min)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TYZ 
_struct_keywords.text            
'Time-Lapse Crystallography, Product Metal, DNA Polymerase Mu, Double Strand Break Repair, Transferase-DNA complex' 
_struct_keywords.pdbx_keywords   Transferase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 5  ? 
H N N 5  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 7  ? 
M N N 8  ? 
N N N 9  ? 
O N N 9  ? 
P N N 9  ? 
Q N N 10 ? 
R N N 5  ? 
S N N 11 ? 
T N N 11 ? 
U N N 11 ? 
V N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR A 15  ? ARG A 19  ? TYR A 141 ARG A 145 5 ? 5  
HELX_P HELX_P2  AA2 ASN A 27  ? GLU A 44  ? ASN A 153 GLU A 170 1 ? 18 
HELX_P HELX_P3  AA3 SER A 46  ? ALA A 62  ? SER A 172 ALA A 188 1 ? 17 
HELX_P HELX_P4  AA4 THR A 69  ? GLN A 74  ? THR A 195 GLN A 200 5 ? 6  
HELX_P HELX_P5  AA5 GLY A 80  ? GLY A 94  ? GLY A 206 GLY A 220 1 ? 15 
HELX_P HELX_P6  AA6 CYS A 96  ? SER A 105 ? CYS A 222 SER A 231 1 ? 10 
HELX_P HELX_P7  AA7 SER A 105 ? GLN A 116 ? SER A 231 GLN A 242 1 ? 12 
HELX_P HELX_P8  AA8 GLY A 121 ? GLU A 131 ? GLY A 247 GLU A 257 1 ? 11 
HELX_P HELX_P9  AA9 THR A 135 ? GLN A 142 ? THR A 261 GLN A 268 1 ? 8  
HELX_P HELX_P10 AB1 PRO A 143 ? LEU A 146 ? PRO A 269 LEU A 272 5 ? 4  
HELX_P HELX_P11 AB2 THR A 147 ? HIS A 156 ? THR A 273 HIS A 282 1 ? 10 
HELX_P HELX_P12 AB3 HIS A 156 ? SER A 161 ? HIS A 282 SER A 287 1 ? 6  
HELX_P HELX_P13 AB4 ARG A 166 ? LEU A 184 ? ARG A 292 LEU A 310 1 ? 19 
HELX_P HELX_P14 AB5 THR A 192 ? ARG A 197 ? THR A 318 ARG A 323 1 ? 6  
HELX_P HELX_P15 AB6 GLY A 219 ? GLN A 231 ? GLY A 345 GLN A 357 1 ? 13 
HELX_P HELX_P16 AB7 PRO A 285 ? SER A 287 ? PRO A 423 SER A 425 5 ? 3  
HELX_P HELX_P17 AB8 GLN A 288 ? GLY A 298 ? GLN A 426 GLY A 436 1 ? 11 
HELX_P HELX_P18 AB9 SER A 299 ? GLY A 315 ? SER A 437 GLY A 453 1 ? 17 
HELX_P HELX_P19 AC1 SER A 336 ? LEU A 344 ? SER A 474 LEU A 482 1 ? 9  
HELX_P HELX_P20 AC2 PRO A 350 ? ARG A 354 ? PRO A 488 ARG A 492 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale none ? A CYS 54  SG  ? ? ? 1_555 L DTT . S1  ? ? A CYS 180 A DTT 508 1_555 ? ? ? ? ? ? ?            2.043 ? ? 
covale2  covale none ? A CYS 226 SG  A ? ? 1_555 K DTT . S1  A ? A CYS 352 A DTT 507 1_555 ? ? ? ? ? ? ?            2.040 ? ? 
metalc1  metalc ?    ? A HIS 82  ND1 ? ? ? 1_555 G MN  . MN  ? ? A HIS 208 A MN  503 1_555 ? ? ? ? ? ? ?            2.458 ? ? 
metalc2  metalc ?    ? A GLU 92  OE1 ? ? ? 1_555 H MN  . MN  ? ? A GLU 218 A MN  504 1_555 ? ? ? ? ? ? ?            2.745 ? ? 
metalc3  metalc ?    ? A HIS 93  NE2 ? ? ? 1_555 H MN  . MN  ? ? A HIS 219 A MN  504 1_555 ? ? ? ? ? ? ?            2.342 ? ? 
metalc4  metalc ?    ? A THR 115 O   ? ? ? 1_555 J NA  . NA  ? ? A THR 241 A NA  506 1_555 ? ? ? ? ? ? ?            2.386 ? ? 
metalc5  metalc ?    ? A ILE 117 O   ? ? ? 1_555 J NA  . NA  ? ? A ILE 243 A NA  506 1_555 ? ? ? ? ? ? ?            2.397 ? ? 
metalc6  metalc ?    ? A VAL 120 O   ? ? ? 1_555 J NA  . NA  ? ? A VAL 246 A NA  506 1_555 ? ? ? ? ? ? ?            2.319 ? ? 
metalc7  metalc ?    ? A ASP 204 OD1 ? ? ? 1_555 E MN  . MN  ? ? A ASP 330 A MN  501 1_555 ? ? ? ? ? ? ?            2.132 ? ? 
metalc8  metalc ?    ? A ASP 204 OD2 ? ? ? 1_555 F MN  . MN  ? ? A ASP 330 A MN  502 1_555 ? ? ? ? ? ? ?            1.763 ? ? 
metalc9  metalc ?    ? A ASP 206 OD2 ? ? ? 1_555 E MN  . MN  ? ? A ASP 332 A MN  501 1_555 ? ? ? ? ? ? ?            2.097 ? ? 
metalc10 metalc ?    ? A ASP 206 OD1 ? ? ? 1_555 F MN  . MN  ? ? A ASP 332 A MN  502 1_555 ? ? ? ? ? ? ?            2.104 ? ? 
metalc11 metalc ?    ? A GLU 260 OE1 ? ? ? 1_555 I MN  . MN  ? ? A GLU 386 A MN  505 1_555 ? ? ? ? ? ? ?            2.648 ? ? 
metalc12 metalc ?    ? A GLU 260 OE2 ? ? ? 1_555 I MN  . MN  ? ? A GLU 386 A MN  505 1_555 ? ? ? ? ? ? ?            2.293 ? ? 
metalc13 metalc ?    ? A ASP 280 OD2 ? ? ? 1_555 F MN  . MN  ? ? A ASP 418 A MN  502 1_555 ? ? ? ? ? ? ?            2.092 ? ? 
metalc14 metalc ?    ? A HIS 321 NE2 ? ? ? 1_555 I MN  . MN  ? ? A HIS 459 A MN  505 1_555 ? ? ? ? ? ? ?            2.402 ? ? 
metalc15 metalc ?    ? E MN  .   MN  ? ? ? 1_555 Q GOA . O2  ? ? A MN  501 A GOA 513 1_555 ? ? ? ? ? ? ?            2.207 ? ? 
metalc16 metalc ?    ? E MN  .   MN  ? ? ? 1_555 Q GOA . O   ? ? A MN  501 A GOA 513 1_555 ? ? ? ? ? ? ?            2.203 ? ? 
metalc17 metalc ?    ? E MN  .   MN  ? ? ? 1_555 S HOH . O   ? ? A MN  501 A HOH 628 1_555 ? ? ? ? ? ? ?            1.994 ? ? 
metalc18 metalc ?    ? E MN  .   MN  ? ? ? 1_555 C DT  5 OP1 ? ? A MN  501 P DT  5   1_555 ? ? ? ? ? ? ?            2.161 ? ? 
metalc19 metalc ?    ? F MN  .   MN  ? ? ? 1_555 C DT  5 OP1 ? ? A MN  502 P DT  5   1_555 ? ? ? ? ? ? ?            2.143 ? ? 
metalc20 metalc ?    ? F MN  .   MN  ? ? ? 1_555 U HOH . O   ? ? A MN  502 P HOH 105 1_555 ? ? ? ? ? ? ?            2.338 ? ? 
metalc21 metalc ?    ? G MN  .   MN  ? ? ? 1_555 S HOH . O   A ? A MN  503 A HOH 820 1_555 ? ? ? ? ? ? ?            2.451 ? ? 
metalc22 metalc ?    ? G MN  .   MN  ? ? ? 1_555 D DG  1 OP3 ? ? A MN  503 D DG  1   1_555 ? ? ? ? ? ? ?            2.266 ? ? 
metalc23 metalc ?    ? G MN  .   MN  ? ? ? 1_555 V HOH . O   ? ? A MN  503 D HOH 111 1_555 ? ? ? ? ? ? ?            2.701 ? ? 
metalc24 metalc ?    ? H MN  .   MN  ? ? ? 1_555 S HOH . O   ? ? A MN  504 A HOH 634 1_555 ? ? ? ? ? ? ?            1.804 ? ? 
metalc25 metalc ?    ? I MN  .   MN  ? ? ? 1_555 S HOH . O   ? ? A MN  505 A HOH 791 1_555 ? ? ? ? ? ? ?            2.302 ? ? 
metalc26 metalc ?    ? I MN  .   MN  ? ? ? 1_555 S HOH . O   ? ? A MN  505 A HOH 821 1_555 ? ? ? ? ? ? ?            2.494 ? ? 
metalc27 metalc ?    ? I MN  .   MN  ? ? ? 1_555 T HOH . O   ? ? A MN  505 T HOH 201 1_555 ? ? ? ? ? ? ?            2.477 ? ? 
metalc28 metalc ?    ? J NA  .   NA  ? ? ? 1_555 S HOH . O   ? ? A NA  506 A HOH 804 1_555 ? ? ? ? ? ? ?            2.379 ? ? 
metalc29 metalc ?    ? J NA  .   NA  ? ? ? 1_555 C DT  3 OP1 ? ? A NA  506 P DT  3   1_555 ? ? ? ? ? ? ?            2.613 ? ? 
metalc30 metalc ?    ? J NA  .   NA  ? ? ? 1_555 U HOH . O   ? ? A NA  506 P HOH 112 1_555 ? ? ? ? ? ? ?            2.442 ? ? 
metalc31 metalc ?    ? B DG  2   N7  ? ? ? 1_555 R MN  . MN  ? ? T DG  2   T MN  101 1_555 ? ? ? ? ? ? ?            2.702 ? ? 
metalc32 metalc ?    ? R MN  .   MN  ? ? ? 1_555 T HOH . O   ? ? T MN  101 T HOH 203 1_555 ? ? ? ? ? ? ?            2.465 ? ? 
metalc33 metalc ?    ? R MN  .   MN  ? ? ? 1_555 T HOH . O   ? ? T MN  101 T HOH 210 1_555 ? ? ? ? ? ? ?            2.447 ? ? 
hydrog1  hydrog ?    ? B DC  1   N3  ? ? ? 1_555 D DG  4 N1  A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ?    ? B DC  1   N3  ? ? ? 1_555 D DG  4 N1  B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? B DC  1   N4  ? ? ? 1_555 D DG  4 O6  A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? B DC  1   N4  ? ? ? 1_555 D DG  4 O6  B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ?    ? B DC  1   O2  ? ? ? 1_555 D DG  4 N2  A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? B DC  1   O2  ? ? ? 1_555 D DG  4 N2  B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ?    ? B DG  2   N1  ? ? ? 1_555 D DC  3 N3  A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? B DG  2   N1  ? ? ? 1_555 D DC  3 N3  B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ?    ? B DG  2   N2  ? ? ? 1_555 D DC  3 O2  A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ?    ? B DG  2   N2  ? ? ? 1_555 D DC  3 O2  B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ?    ? B DG  2   O6  ? ? ? 1_555 D DC  3 N4  A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? B DG  2   O6  ? ? ? 1_555 D DC  3 N4  B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? B DG  3   N1  ? ? ? 1_555 D DC  2 N3  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ?    ? B DG  3   N2  ? ? ? 1_555 D DC  2 O2  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? B DG  3   O6  ? ? ? 1_555 D DC  2 N4  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ?    ? B DC  4   N3  ? ? ? 1_555 D DG  1 N1  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? B DC  4   N4  ? ? ? 1_555 D DG  1 O6  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? B DC  4   O2  ? ? ? 1_555 D DG  1 N2  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? B DA  5   N1  ? ? ? 1_555 C DT  5 N3  ? ? T DA  5   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? B DA  5   N6  ? ? ? 1_555 C DT  5 O4  ? ? T DA  5   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? B DT  6   N3  ? ? ? 1_555 C DA  4 N1  ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? B DT  6   O4  ? ? ? 1_555 C DA  4 N6  ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? B DA  7   N1  ? ? ? 1_555 C DT  3 N3  ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? B DA  7   N6  ? ? ? 1_555 C DT  3 O4  ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? B DC  8   N3  ? ? ? 1_555 C DG  2 N1  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ?    ? B DC  8   N4  ? ? ? 1_555 C DG  2 O6  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ?    ? B DC  8   O2  ? ? ? 1_555 C DG  2 N2  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ?    ? B DG  9   N1  ? ? ? 1_555 C DC  1 N3  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ?    ? B DG  9   N2  ? ? ? 1_555 C DC  1 O2  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ?    ? B DG  9   O6  ? ? ? 1_555 C DC  1 N4  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           298 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            436 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    299 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     437 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 164 ? LEU A 165 ? VAL A 290 LEU A 291 
AA1 2 GLN A 201 ? GLY A 202 ? GLN A 327 GLY A 328 
AA2 1 THR A 188 ? LEU A 191 ? THR A 314 LEU A 317 
AA2 2 VAL A 205 ? THR A 210 ? VAL A 331 THR A 336 
AA2 3 SER A 273 ? VAL A 283 ? SER A 411 VAL A 421 
AA2 4 ARG A 261 ? GLN A 270 ? ARG A 387 GLN A 396 
AA2 5 ILE A 234 ? TYR A 236 ? ILE A 360 TYR A 362 
AA3 1 TRP A 317 ? LEU A 318 ? TRP A 455 LEU A 456 
AA3 2 LEU A 323 ? ASP A 325 ? LEU A 461 ASP A 463 
AA3 3 THR A 330 ? PHE A 331 ? THR A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 164 ? N VAL A 290 O GLY A 202 ? O GLY A 328 
AA2 1 2 N THR A 190 ? N THR A 316 O LEU A 208 ? O LEU A 334 
AA2 2 3 N ILE A 209 ? N ILE A 335 O VAL A 282 ? O VAL A 420 
AA2 3 4 O VAL A 277 ? O VAL A 415 N PHE A 266 ? N PHE A 392 
AA2 4 5 O ILE A 265 ? O ILE A 391 N LEU A 235 ? N LEU A 361 
AA3 1 2 N TRP A 317 ? N TRP A 455 O PHE A 324 ? O PHE A 462 
AA3 2 3 N ASP A 325 ? N ASP A 463 O THR A 330 ? O THR A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 6 'binding site for residue MN A 501'  
AC2 Software A MN  502 ? 7 'binding site for residue MN A 502'  
AC3 Software A MN  503 ? 4 'binding site for residue MN A 503'  
AC4 Software A MN  504 ? 3 'binding site for residue MN A 504'  
AC5 Software A MN  505 ? 5 'binding site for residue MN A 505'  
AC6 Software A NA  506 ? 6 'binding site for residue NA A 506'  
AC7 Software A DTT 507 ? 3 'binding site for residue DTT A 507' 
AC8 Software A DTT 508 ? 1 'binding site for residue DTT A 508' 
AC9 Software A EPE 509 ? 5 'binding site for residue EPE A 509' 
AD1 Software A EDO 510 ? 7 'binding site for residue EDO A 510' 
AD2 Software A EDO 511 ? 4 'binding site for residue EDO A 511' 
AD3 Software A EDO 512 ? 5 'binding site for residue EDO A 512' 
AD4 Software A GOA 513 ? 9 'binding site for residue GOA A 513' 
AD5 Software T MN  101 ? 3 'binding site for residue MN T 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 204 ? ASP A 330 . ? 1_555 ? 
2  AC1 6 ASP A 206 ? ASP A 332 . ? 1_555 ? 
3  AC1 6 MN  F .   ? MN  A 502 . ? 1_555 ? 
4  AC1 6 GOA Q .   ? GOA A 513 . ? 1_555 ? 
5  AC1 6 HOH S .   ? HOH A 628 . ? 1_555 ? 
6  AC1 6 DT  C 5   ? DT  P 5   . ? 1_555 ? 
7  AC2 7 ASP A 204 ? ASP A 330 . ? 1_555 ? 
8  AC2 7 ASP A 206 ? ASP A 332 . ? 1_555 ? 
9  AC2 7 ASP A 280 ? ASP A 418 . ? 1_555 ? 
10 AC2 7 MN  E .   ? MN  A 501 . ? 1_555 ? 
11 AC2 7 DA  C 4   ? DA  P 4   . ? 1_555 ? 
12 AC2 7 DT  C 5   ? DT  P 5   . ? 1_555 ? 
13 AC2 7 HOH U .   ? HOH P 105 . ? 1_555 ? 
14 AC3 4 HIS A 82  ? HIS A 208 . ? 1_555 ? 
15 AC3 4 HOH S .   ? HOH A 820 . ? 1_555 ? 
16 AC3 4 DG  D 1   ? DG  D 1   . ? 1_555 ? 
17 AC3 4 HOH V .   ? HOH D 111 . ? 1_555 ? 
18 AC4 3 GLU A 92  ? GLU A 218 . ? 1_555 ? 
19 AC4 3 HIS A 93  ? HIS A 219 . ? 1_555 ? 
20 AC4 3 HOH S .   ? HOH A 634 . ? 1_555 ? 
21 AC5 5 GLU A 260 ? GLU A 386 . ? 1_555 ? 
22 AC5 5 HIS A 321 ? HIS A 459 . ? 1_555 ? 
23 AC5 5 HOH S .   ? HOH A 791 . ? 1_555 ? 
24 AC5 5 HOH S .   ? HOH A 821 . ? 1_555 ? 
25 AC5 5 HOH T .   ? HOH T 201 . ? 1_555 ? 
26 AC6 6 THR A 115 ? THR A 241 . ? 1_555 ? 
27 AC6 6 ILE A 117 ? ILE A 243 . ? 1_555 ? 
28 AC6 6 VAL A 120 ? VAL A 246 . ? 1_555 ? 
29 AC6 6 HOH S .   ? HOH A 804 . ? 1_555 ? 
30 AC6 6 DT  C 3   ? DT  P 3   . ? 1_555 ? 
31 AC6 6 HOH U .   ? HOH P 112 . ? 1_555 ? 
32 AC7 3 GLN A 158 ? GLN A 284 . ? 4_455 ? 
33 AC7 3 CYS A 226 ? CYS A 352 . ? 1_555 ? 
34 AC7 3 ASP A 230 ? ASP A 356 . ? 1_555 ? 
35 AC8 1 CYS A 54  ? CYS A 180 . ? 1_555 ? 
36 AC9 5 LEU A 23  ? LEU A 149 . ? 1_555 ? 
37 AC9 5 LYS A 199 ? LYS A 325 . ? 1_555 ? 
38 AC9 5 LEU A 200 ? LEU A 326 . ? 1_555 ? 
39 AC9 5 GLN A 201 ? GLN A 327 . ? 1_555 ? 
40 AC9 5 HOH S .   ? HOH A 666 . ? 1_555 ? 
41 AD1 7 ARG A 261 ? ARG A 387 . ? 1_555 ? 
42 AD1 7 GLY A 295 ? GLY A 433 . ? 1_555 ? 
43 AD1 7 TRP A 296 ? TRP A 434 . ? 1_555 ? 
44 AD1 7 ARG A 307 ? ARG A 445 . ? 1_555 ? 
45 AD1 7 HOH S .   ? HOH A 687 . ? 1_555 ? 
46 AD1 7 DA  C 4   ? DA  P 4   . ? 1_555 ? 
47 AD1 7 DT  C 5   ? DT  P 5   . ? 1_555 ? 
48 AD2 4 THR A 68  ? THR A 194 . ? 4_445 ? 
49 AD2 4 THR A 188 ? THR A 314 . ? 1_555 ? 
50 AD2 4 THR A 210 ? THR A 336 . ? 1_555 ? 
51 AD2 4 HOH S .   ? HOH A 640 . ? 1_555 ? 
52 AD3 5 PRO A 64  ? PRO A 190 . ? 1_555 ? 
53 AD3 5 SER A 65  ? SER A 191 . ? 1_555 ? 
54 AD3 5 PRO A 66  ? PRO A 192 . ? 1_555 ? 
55 AD3 5 GLN A 72  ? GLN A 198 . ? 1_555 ? 
56 AD3 5 HOH S .   ? HOH A 657 . ? 1_555 ? 
57 AD4 9 GLY A 193 ? GLY A 319 . ? 1_555 ? 
58 AD4 9 GLY A 194 ? GLY A 320 . ? 1_555 ? 
59 AD4 9 ARG A 197 ? ARG A 323 . ? 1_555 ? 
60 AD4 9 ASP A 204 ? ASP A 330 . ? 1_555 ? 
61 AD4 9 ASP A 206 ? ASP A 332 . ? 1_555 ? 
62 AD4 9 MN  E .   ? MN  A 501 . ? 1_555 ? 
63 AD4 9 HOH S .   ? HOH A 628 . ? 1_555 ? 
64 AD4 9 HOH S .   ? HOH A 719 . ? 1_555 ? 
65 AD4 9 DT  C 5   ? DT  P 5   . ? 1_555 ? 
66 AD5 3 DG  B 2   ? DG  T 2   . ? 1_555 ? 
67 AD5 3 HOH T .   ? HOH T 203 . ? 1_555 ? 
68 AD5 3 HOH T .   ? HOH T 210 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5TYZ 
_atom_sites.fract_transf_matrix[1][1]   0.016685 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014566 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009091 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . TRP A 1  11  ? -0.860  -31.869 -11.536 1.00 83.74 ? 137 TRP A N     1 
ATOM   2    C  CA    . TRP A 1  11  ? -0.102  -30.990 -12.416 1.00 80.64 ? 137 TRP A CA    1 
ATOM   3    C  C     . TRP A 1  11  ? -0.362  -29.529 -12.061 1.00 80.51 ? 137 TRP A C     1 
ATOM   4    O  O     . TRP A 1  11  ? -1.509  -29.124 -11.871 1.00 86.39 ? 137 TRP A O     1 
ATOM   5    C  CB    . TRP A 1  11  ? -0.468  -31.252 -13.878 1.00 75.73 ? 137 TRP A CB    1 
ATOM   6    N  N     A MET A 1  12  ? 0.710   -28.747 -11.965 0.29 51.61 ? 138 MET A N     1 
ATOM   7    N  N     B MET A 1  12  ? 0.700   -28.743 -11.977 0.71 51.99 ? 138 MET A N     1 
ATOM   8    C  CA    A MET A 1  12  ? 0.586   -27.325 -11.671 0.29 45.94 ? 138 MET A CA    1 
ATOM   9    C  CA    B MET A 1  12  ? 0.540   -27.340 -11.632 0.71 46.01 ? 138 MET A CA    1 
ATOM   10   C  C     A MET A 1  12  ? -0.218  -26.638 -12.772 0.29 43.18 ? 138 MET A C     1 
ATOM   11   C  C     B MET A 1  12  ? -0.192  -26.608 -12.751 0.71 42.31 ? 138 MET A C     1 
ATOM   12   O  O     A MET A 1  12  ? 0.072   -26.843 -13.960 0.29 43.46 ? 138 MET A O     1 
ATOM   13   O  O     B MET A 1  12  ? 0.190   -26.732 -13.920 0.71 41.89 ? 138 MET A O     1 
ATOM   14   C  CB    A MET A 1  12  ? 1.972   -26.686 -11.559 0.29 43.78 ? 138 MET A CB    1 
ATOM   15   C  CB    B MET A 1  12  ? 1.879   -26.670 -11.384 0.71 42.91 ? 138 MET A CB    1 
ATOM   16   C  CG    A MET A 1  12  ? 1.979   -25.166 -11.357 0.29 42.88 ? 138 MET A CG    1 
ATOM   17   C  CG    B MET A 1  12  ? 1.716   -25.197 -11.052 0.71 43.99 ? 138 MET A CG    1 
ATOM   18   S  SD    A MET A 1  12  ? 2.183   -24.660 -9.638  0.29 42.54 ? 138 MET A SD    1 
ATOM   19   S  SD    B MET A 1  12  ? 3.263   -24.318 -10.930 0.71 40.54 ? 138 MET A SD    1 
ATOM   20   C  CE    A MET A 1  12  ? 3.882   -25.135 -9.339  0.29 40.12 ? 138 MET A CE    1 
ATOM   21   C  CE    B MET A 1  12  ? 3.956   -25.055 -9.454  0.71 39.71 ? 138 MET A CE    1 
ATOM   22   N  N     . PRO A 1  13  ? -1.211  -25.816 -12.438 1.00 43.97 ? 139 PRO A N     1 
ATOM   23   C  CA    . PRO A 1  13  ? -1.971  -25.131 -13.487 1.00 43.08 ? 139 PRO A CA    1 
ATOM   24   C  C     . PRO A 1  13  ? -1.122  -24.105 -14.225 1.00 38.10 ? 139 PRO A C     1 
ATOM   25   O  O     . PRO A 1  13  ? -0.078  -23.650 -13.752 1.00 35.27 ? 139 PRO A O     1 
ATOM   26   C  CB    . PRO A 1  13  ? -3.118  -24.465 -12.720 1.00 44.65 ? 139 PRO A CB    1 
ATOM   27   C  CG    . PRO A 1  13  ? -2.603  -24.297 -11.347 1.00 44.51 ? 139 PRO A CG    1 
ATOM   28   C  CD    . PRO A 1  13  ? -1.708  -25.476 -11.093 1.00 44.49 ? 139 PRO A CD    1 
ATOM   29   N  N     . ALA A 1  14  ? -1.597  -23.741 -15.414 1.00 33.85 ? 140 ALA A N     1 
ATOM   30   C  CA    . ALA A 1  14  ? -0.815  -22.924 -16.333 1.00 31.45 ? 140 ALA A CA    1 
ATOM   31   C  C     . ALA A 1  14  ? -0.944  -21.428 -16.078 1.00 31.35 ? 140 ALA A C     1 
ATOM   32   O  O     . ALA A 1  14  ? -0.058  -20.670 -16.493 1.00 32.37 ? 140 ALA A O     1 
ATOM   33   C  CB    . ALA A 1  14  ? -1.231  -23.224 -17.779 1.00 33.57 ? 140 ALA A CB    1 
ATOM   34   N  N     . TYR A 1  15  ? -2.013  -20.987 -15.419 1.00 32.90 ? 141 TYR A N     1 
ATOM   35   C  CA    . TYR A 1  15  ? -2.227  -19.578 -15.106 1.00 30.15 ? 141 TYR A CA    1 
ATOM   36   C  C     . TYR A 1  15  ? -1.849  -19.302 -13.657 1.00 30.87 ? 141 TYR A C     1 
ATOM   37   O  O     . TYR A 1  15  ? -2.202  -20.072 -12.759 1.00 32.00 ? 141 TYR A O     1 
ATOM   38   C  CB    . TYR A 1  15  ? -3.689  -19.179 -15.305 1.00 27.56 ? 141 TYR A CB    1 
ATOM   39   C  CG    . TYR A 1  15  ? -4.199  -19.201 -16.722 1.00 26.27 ? 141 TYR A CG    1 
ATOM   40   C  CD1   . TYR A 1  15  ? -4.656  -20.374 -17.300 1.00 28.60 ? 141 TYR A CD1   1 
ATOM   41   C  CD2   . TYR A 1  15  ? -4.270  -18.034 -17.463 1.00 31.83 ? 141 TYR A CD2   1 
ATOM   42   C  CE1   . TYR A 1  15  ? -5.150  -20.384 -18.594 1.00 31.81 ? 141 TYR A CE1   1 
ATOM   43   C  CE2   . TYR A 1  15  ? -4.762  -18.031 -18.746 1.00 32.47 ? 141 TYR A CE2   1 
ATOM   44   C  CZ    . TYR A 1  15  ? -5.205  -19.202 -19.307 1.00 30.68 ? 141 TYR A CZ    1 
ATOM   45   O  OH    . TYR A 1  15  ? -5.687  -19.184 -20.590 1.00 32.34 ? 141 TYR A OH    1 
ATOM   46   N  N     . ALA A 1  16  ? -1.175  -18.169 -13.426 1.00 27.94 ? 142 ALA A N     1 
ATOM   47   C  CA    . ALA A 1  16  ? -0.721  -17.840 -12.078 1.00 28.16 ? 142 ALA A CA    1 
ATOM   48   C  C     . ALA A 1  16  ? -1.883  -17.598 -11.125 1.00 25.30 ? 142 ALA A C     1 
ATOM   49   O  O     . ALA A 1  16  ? -1.736  -17.780 -9.912  1.00 26.07 ? 142 ALA A O     1 
ATOM   50   C  CB    . ALA A 1  16  ? 0.182   -16.609 -12.107 1.00 31.68 ? 142 ALA A CB    1 
ATOM   51   N  N     . CYS A 1  17  ? -3.038  -17.185 -11.639 1.00 27.42 ? 143 CYS A N     1 
ATOM   52   C  CA    . CYS A 1  17  ? -4.193  -16.972 -10.772 1.00 28.23 ? 143 CYS A CA    1 
ATOM   53   C  C     . CYS A 1  17  ? -4.828  -18.271 -10.300 1.00 31.46 ? 143 CYS A C     1 
ATOM   54   O  O     . CYS A 1  17  ? -5.774  -18.221 -9.505  1.00 28.53 ? 143 CYS A O     1 
ATOM   55   C  CB    . CYS A 1  17  ? -5.230  -16.124 -11.501 1.00 27.55 ? 143 CYS A CB    1 
ATOM   56   S  SG    . CYS A 1  17  ? -5.762  -16.854 -13.052 1.00 27.89 ? 143 CYS A SG    1 
ATOM   57   N  N     . GLN A 1  18  ? -4.336  -19.421 -10.763 1.00 25.54 ? 144 GLN A N     1 
ATOM   58   C  CA    . GLN A 1  18  ? -4.847  -20.727 -10.372 1.00 26.52 ? 144 GLN A CA    1 
ATOM   59   C  C     . GLN A 1  18  ? -4.015  -21.399 -9.292  1.00 30.40 ? 144 GLN A C     1 
ATOM   60   O  O     . GLN A 1  18  ? -4.314  -22.538 -8.921  1.00 30.48 ? 144 GLN A O     1 
ATOM   61   C  CB    . GLN A 1  18  ? -4.897  -21.653 -11.585 1.00 26.08 ? 144 GLN A CB    1 
ATOM   62   C  CG    . GLN A 1  18  ? -5.874  -21.239 -12.648 1.00 32.32 ? 144 GLN A CG    1 
ATOM   63   C  CD    . GLN A 1  18  ? -5.863  -22.191 -13.818 1.00 31.91 ? 144 GLN A CD    1 
ATOM   64   O  OE1   . GLN A 1  18  ? -4.898  -22.244 -14.587 1.00 29.10 ? 144 GLN A OE1   1 
ATOM   65   N  NE2   . GLN A 1  18  ? -6.927  -22.965 -13.950 1.00 34.39 ? 144 GLN A NE2   1 
ATOM   66   N  N     . ARG A 1  19  ? -2.983  -20.733 -8.785  1.00 33.82 ? 145 ARG A N     1 
ATOM   67   C  CA    . ARG A 1  19  ? -2.083  -21.338 -7.830  1.00 37.65 ? 145 ARG A CA    1 
ATOM   68   C  C     . ARG A 1  19  ? -1.671  -20.301 -6.792  1.00 29.37 ? 145 ARG A C     1 
ATOM   69   O  O     . ARG A 1  19  ? -1.450  -19.132 -7.139  1.00 25.26 ? 145 ARG A O     1 
ATOM   70   C  CB    . ARG A 1  19  ? -0.839  -21.898 -8.538  1.00 39.62 ? 145 ARG A CB    1 
ATOM   71   C  CG    . ARG A 1  19  ? -0.170  -20.894 -9.466  1.00 39.52 ? 145 ARG A CG    1 
ATOM   72   C  CD    . ARG A 1  19  ? 1.001   -21.486 -10.244 1.00 43.62 ? 145 ARG A CD    1 
ATOM   73   N  NE    . ARG A 1  19  ? 1.745   -20.444 -10.959 1.00 43.02 ? 145 ARG A NE    1 
ATOM   74   C  CZ    . ARG A 1  19  ? 1.806   -20.304 -12.282 1.00 38.38 ? 145 ARG A CZ    1 
ATOM   75   N  NH1   . ARG A 1  19  ? 1.179   -21.151 -13.093 1.00 33.22 ? 145 ARG A NH1   1 
ATOM   76   N  NH2   . ARG A 1  19  ? 2.512   -19.300 -12.795 1.00 35.08 ? 145 ARG A NH2   1 
ATOM   77   N  N     . PRO A 1  20  ? -1.580  -20.686 -5.519  1.00 27.28 ? 146 PRO A N     1 
ATOM   78   C  CA    . PRO A 1  20  ? -1.053  -19.762 -4.507  1.00 24.17 ? 146 PRO A CA    1 
ATOM   79   C  C     . PRO A 1  20  ? 0.422   -19.487 -4.751  1.00 28.09 ? 146 PRO A C     1 
ATOM   80   O  O     . PRO A 1  20  ? 1.216   -20.411 -4.956  1.00 25.34 ? 146 PRO A O     1 
ATOM   81   C  CB    . PRO A 1  20  ? -1.275  -20.511 -3.189  1.00 24.37 ? 146 PRO A CB    1 
ATOM   82   C  CG    . PRO A 1  20  ? -1.382  -21.926 -3.565  1.00 29.28 ? 146 PRO A CG    1 
ATOM   83   C  CD    . PRO A 1  20  ? -2.000  -21.964 -4.922  1.00 31.32 ? 146 PRO A CD    1 
ATOM   84   N  N     . THR A 1  21  ? 0.789   -18.210 -4.738  1.00 21.86 ? 147 THR A N     1 
ATOM   85   C  CA    . THR A 1  21  ? 2.195   -17.825 -4.860  1.00 21.96 ? 147 THR A CA    1 
ATOM   86   C  C     . THR A 1  21  ? 2.577   -16.969 -3.662  1.00 23.72 ? 147 THR A C     1 
ATOM   87   O  O     . THR A 1  21  ? 2.202   -15.782 -3.601  1.00 22.69 ? 147 THR A O     1 
ATOM   88   C  CB    . THR A 1  21  ? 2.461   -17.076 -6.162  1.00 23.38 ? 147 THR A CB    1 
ATOM   89   O  OG1   . THR A 1  21  ? 1.898   -17.798 -7.260  1.00 24.40 ? 147 THR A OG1   1 
ATOM   90   C  CG2   . THR A 1  21  ? 3.959   -16.939 -6.382  1.00 27.78 ? 147 THR A CG2   1 
ATOM   91   N  N     . PRO A 1  22  ? 3.311   -17.508 -2.692  1.00 27.69 ? 148 PRO A N     1 
ATOM   92   C  CA    . PRO A 1  22  ? 3.661   -16.730 -1.501  1.00 27.26 ? 148 PRO A CA    1 
ATOM   93   C  C     . PRO A 1  22  ? 4.791   -15.752 -1.785  1.00 25.72 ? 148 PRO A C     1 
ATOM   94   O  O     . PRO A 1  22  ? 5.475   -15.811 -2.809  1.00 23.32 ? 148 PRO A O     1 
ATOM   95   C  CB    . PRO A 1  22  ? 4.097   -17.801 -0.499  1.00 29.26 ? 148 PRO A CB    1 
ATOM   96   C  CG    . PRO A 1  22  ? 4.712   -18.855 -1.373  1.00 31.92 ? 148 PRO A CG    1 
ATOM   97   C  CD    . PRO A 1  22  ? 3.897   -18.861 -2.644  1.00 31.39 ? 148 PRO A CD    1 
ATOM   98   N  N     . LEU A 1  23  ? 4.984   -14.837 -0.837  1.00 23.95 ? 149 LEU A N     1 
ATOM   99   C  CA    . LEU A 1  23  ? 5.987   -13.796 -1.020  1.00 25.89 ? 149 LEU A CA    1 
ATOM   100  C  C     . LEU A 1  23  ? 7.392   -14.379 -0.999  1.00 28.85 ? 149 LEU A C     1 
ATOM   101  O  O     . LEU A 1  23  ? 8.231   -14.024 -1.833  1.00 30.44 ? 149 LEU A O     1 
ATOM   102  C  CB    . LEU A 1  23  ? 5.844   -12.729 0.061   1.00 27.12 ? 149 LEU A CB    1 
ATOM   103  C  CG    . LEU A 1  23  ? 6.884   -11.607 -0.008  1.00 30.71 ? 149 LEU A CG    1 
ATOM   104  C  CD1   . LEU A 1  23  ? 6.937   -10.958 -1.398  1.00 32.19 ? 149 LEU A CD1   1 
ATOM   105  C  CD2   . LEU A 1  23  ? 6.588   -10.567 1.061   1.00 30.03 ? 149 LEU A CD2   1 
ATOM   106  N  N     . THR A 1  24  ? 7.665   -15.269 -0.056  1.00 22.24 ? 150 THR A N     1 
ATOM   107  C  CA    . THR A 1  24  ? 8.949   -15.940 0.026   1.00 23.47 ? 150 THR A CA    1 
ATOM   108  C  C     . THR A 1  24  ? 8.747   -17.417 -0.282  1.00 26.16 ? 150 THR A C     1 
ATOM   109  O  O     . THR A 1  24  ? 7.690   -17.988 0.008   1.00 26.04 ? 150 THR A O     1 
ATOM   110  C  CB    . THR A 1  24  ? 9.574   -15.756 1.412   1.00 27.56 ? 150 THR A CB    1 
ATOM   111  O  OG1   . THR A 1  24  ? 8.729   -16.346 2.398   1.00 26.49 ? 150 THR A OG1   1 
ATOM   112  C  CG2   . THR A 1  24  ? 9.756   -14.278 1.730   1.00 34.49 ? 150 THR A CG2   1 
ATOM   113  N  N     . HIS A 1  25  ? 9.757   -18.030 -0.888  1.00 23.71 ? 151 HIS A N     1 
ATOM   114  C  CA    . HIS A 1  25  ? 9.572   -19.352 -1.457  1.00 24.20 ? 151 HIS A CA    1 
ATOM   115  C  C     . HIS A 1  25  ? 10.914  -20.083 -1.463  1.00 24.98 ? 151 HIS A C     1 
ATOM   116  O  O     . HIS A 1  25  ? 11.844  -19.714 -0.737  1.00 25.28 ? 151 HIS A O     1 
ATOM   117  C  CB    . HIS A 1  25  ? 8.925   -19.231 -2.848  1.00 23.83 ? 151 HIS A CB    1 
ATOM   118  C  CG    . HIS A 1  25  ? 9.712   -18.404 -3.815  1.00 24.04 ? 151 HIS A CG    1 
ATOM   119  N  ND1   . HIS A 1  25  ? 10.678  -18.940 -4.645  1.00 23.45 ? 151 HIS A ND1   1 
ATOM   120  C  CD2   . HIS A 1  25  ? 9.678   -17.077 -4.086  1.00 23.72 ? 151 HIS A CD2   1 
ATOM   121  C  CE1   . HIS A 1  25  ? 11.197  -17.979 -5.388  1.00 25.13 ? 151 HIS A CE1   1 
ATOM   122  N  NE2   . HIS A 1  25  ? 10.608  -16.839 -5.068  1.00 24.69 ? 151 HIS A NE2   1 
ATOM   123  N  N     . HIS A 1  26  ? 11.004  -21.141 -2.271  1.00 25.40 ? 152 HIS A N     1 
ATOM   124  C  CA    . HIS A 1  26  ? 12.069  -22.128 -2.153  1.00 26.40 ? 152 HIS A CA    1 
ATOM   125  C  C     . HIS A 1  26  ? 12.951  -22.200 -3.393  1.00 26.37 ? 152 HIS A C     1 
ATOM   126  O  O     . HIS A 1  26  ? 13.754  -23.137 -3.520  1.00 27.26 ? 152 HIS A O     1 
ATOM   127  C  CB    . HIS A 1  26  ? 11.443  -23.492 -1.844  1.00 27.29 ? 152 HIS A CB    1 
ATOM   128  C  CG    . HIS A 1  26  ? 10.350  -23.419 -0.826  1.00 27.31 ? 152 HIS A CG    1 
ATOM   129  N  ND1   . HIS A 1  26  ? 10.597  -23.246 0.518   1.00 27.79 ? 152 HIS A ND1   1 
ATOM   130  C  CD2   . HIS A 1  26  ? 9.003   -23.454 -0.959  1.00 26.99 ? 152 HIS A CD2   1 
ATOM   131  C  CE1   . HIS A 1  26  ? 9.448   -23.189 1.170   1.00 27.98 ? 152 HIS A CE1   1 
ATOM   132  N  NE2   . HIS A 1  26  ? 8.466   -23.310 0.296   1.00 27.28 ? 152 HIS A NE2   1 
ATOM   133  N  N     . ASN A 1  27  ? 12.843  -21.227 -4.292  1.00 25.50 ? 153 ASN A N     1 
ATOM   134  C  CA    . ASN A 1  27  ? 13.620  -21.192 -5.528  1.00 26.63 ? 153 ASN A CA    1 
ATOM   135  C  C     . ASN A 1  27  ? 14.001  -19.757 -5.874  1.00 24.76 ? 153 ASN A C     1 
ATOM   136  O  O     . ASN A 1  27  ? 13.934  -19.333 -7.033  1.00 24.40 ? 153 ASN A O     1 
ATOM   137  C  CB    . ASN A 1  27  ? 12.844  -21.840 -6.670  1.00 25.55 ? 153 ASN A CB    1 
ATOM   138  C  CG    . ASN A 1  27  ? 12.704  -23.329 -6.492  1.00 26.54 ? 153 ASN A CG    1 
ATOM   139  O  OD1   . ASN A 1  27  ? 13.650  -24.069 -6.712  1.00 27.35 ? 153 ASN A OD1   1 
ATOM   140  N  ND2   . ASN A 1  27  ? 11.523  -23.776 -6.069  1.00 26.58 ? 153 ASN A ND2   1 
ATOM   141  N  N     . THR A 1  28  ? 14.438  -19.000 -4.872  1.00 24.66 ? 154 THR A N     1 
ATOM   142  C  CA    . THR A 1  28  ? 14.672  -17.572 -5.059  1.00 27.29 ? 154 THR A CA    1 
ATOM   143  C  C     . THR A 1  28  ? 15.719  -17.313 -6.139  1.00 25.86 ? 154 THR A C     1 
ATOM   144  O  O     . THR A 1  28  ? 15.494  -16.519 -7.061  1.00 24.94 ? 154 THR A O     1 
ATOM   145  C  CB    . THR A 1  28  ? 15.090  -16.955 -3.727  1.00 31.00 ? 154 THR A CB    1 
ATOM   146  O  OG1   . THR A 1  28  ? 14.146  -17.341 -2.720  1.00 28.49 ? 154 THR A OG1   1 
ATOM   147  C  CG2   . THR A 1  28  ? 15.140  -15.429 -3.821  1.00 31.81 ? 154 THR A CG2   1 
ATOM   148  N  N     . GLY A 1  29  ? 16.874  -17.971 -6.039  1.00 29.36 ? 155 GLY A N     1 
ATOM   149  C  CA    . GLY A 1  29  ? 17.929  -17.749 -7.016  1.00 33.56 ? 155 GLY A CA    1 
ATOM   150  C  C     . GLY A 1  29  ? 17.504  -18.085 -8.434  1.00 30.91 ? 155 GLY A C     1 
ATOM   151  O  O     . GLY A 1  29  ? 17.812  -17.350 -9.376  1.00 26.03 ? 155 GLY A O     1 
ATOM   152  N  N     . LEU A 1  30  ? 16.791  -19.199 -8.610  1.00 25.44 ? 156 LEU A N     1 
ATOM   153  C  CA    . LEU A 1  30  ? 16.335  -19.566 -9.946  1.00 25.49 ? 156 LEU A CA    1 
ATOM   154  C  C     . LEU A 1  30  ? 15.371  -18.519 -10.499 1.00 27.00 ? 156 LEU A C     1 
ATOM   155  O  O     . LEU A 1  30  ? 15.517  -18.066 -11.640 1.00 24.61 ? 156 LEU A O     1 
ATOM   156  C  CB    . LEU A 1  30  ? 15.683  -20.949 -9.916  1.00 28.49 ? 156 LEU A CB    1 
ATOM   157  C  CG    . LEU A 1  30  ? 16.584  -22.116 -9.467  1.00 27.52 ? 156 LEU A CG    1 
ATOM   158  C  CD1   . LEU A 1  30  ? 15.849  -23.435 -9.507  1.00 27.62 ? 156 LEU A CD1   1 
ATOM   159  C  CD2   . LEU A 1  30  ? 17.845  -22.222 -10.321 1.00 27.72 ? 156 LEU A CD2   1 
ATOM   160  N  N     . SER A 1  31  ? 14.387  -18.101 -9.696  1.00 26.07 ? 157 SER A N     1 
ATOM   161  C  CA    . SER A 1  31  ? 13.417  -17.127 -10.189 1.00 24.68 ? 157 SER A CA    1 
ATOM   162  C  C     . SER A 1  31  ? 14.074  -15.782 -10.475 1.00 22.93 ? 157 SER A C     1 
ATOM   163  O  O     . SER A 1  31  ? 13.742  -15.127 -11.470 1.00 22.74 ? 157 SER A O     1 
ATOM   164  C  CB    . SER A 1  31  ? 12.265  -16.970 -9.192  1.00 26.87 ? 157 SER A CB    1 
ATOM   165  O  OG    . SER A 1  31  ? 12.736  -16.549 -7.928  1.00 38.41 ? 157 SER A OG    1 
ATOM   166  N  N     . GLU A 1  32  ? 15.015  -15.350 -9.628  1.00 25.48 ? 158 GLU A N     1 
ATOM   167  C  CA    A GLU A 1  32  ? 15.662  -14.070 -9.876  0.58 26.83 ? 158 GLU A CA    1 
ATOM   168  C  CA    B GLU A 1  32  ? 15.704  -14.080 -9.861  0.42 26.89 ? 158 GLU A CA    1 
ATOM   169  C  C     . GLU A 1  32  ? 16.428  -14.095 -11.197 1.00 26.51 ? 158 GLU A C     1 
ATOM   170  O  O     . GLU A 1  32  ? 16.414  -13.107 -11.938 1.00 23.32 ? 158 GLU A O     1 
ATOM   171  C  CB    A GLU A 1  32  ? 16.552  -13.694 -8.685  0.58 27.16 ? 158 GLU A CB    1 
ATOM   172  C  CB    B GLU A 1  32  ? 16.699  -13.792 -8.732  0.42 27.61 ? 158 GLU A CB    1 
ATOM   173  C  CG    A GLU A 1  32  ? 15.696  -13.218 -7.495  0.58 29.81 ? 158 GLU A CG    1 
ATOM   174  C  CG    B GLU A 1  32  ? 17.342  -12.394 -8.783  0.42 29.41 ? 158 GLU A CG    1 
ATOM   175  C  CD    A GLU A 1  32  ? 16.464  -12.917 -6.209  0.58 32.33 ? 158 GLU A CD    1 
ATOM   176  C  CD    B GLU A 1  32  ? 18.553  -12.293 -9.714  0.42 29.97 ? 158 GLU A CD    1 
ATOM   177  O  OE1   A GLU A 1  32  ? 17.681  -13.194 -6.115  0.58 30.28 ? 158 GLU A OE1   1 
ATOM   178  O  OE1   B GLU A 1  32  ? 18.994  -13.326 -10.261 0.42 30.66 ? 158 GLU A OE1   1 
ATOM   179  O  OE2   A GLU A 1  32  ? 15.819  -12.390 -5.276  0.58 28.50 ? 158 GLU A OE2   1 
ATOM   180  O  OE2   B GLU A 1  32  ? 19.073  -11.168 -9.896  0.42 28.25 ? 158 GLU A OE2   1 
ATOM   181  N  N     . ALA A 1  33  ? 17.064  -15.221 -11.531 1.00 27.73 ? 159 ALA A N     1 
ATOM   182  C  CA    . ALA A 1  33  ? 17.794  -15.309 -12.792 1.00 27.67 ? 159 ALA A CA    1 
ATOM   183  C  C     . ALA A 1  33  ? 16.854  -15.156 -13.981 1.00 26.74 ? 159 ALA A C     1 
ATOM   184  O  O     . ALA A 1  33  ? 17.144  -14.417 -14.928 1.00 27.18 ? 159 ALA A O     1 
ATOM   185  C  CB    . ALA A 1  33  ? 18.546  -16.634 -12.867 1.00 32.47 ? 159 ALA A CB    1 
ATOM   186  N  N     . LEU A 1  34  ? 15.719  -15.854 -13.951 1.00 26.95 ? 160 LEU A N     1 
ATOM   187  C  CA    . LEU A 1  34  ? 14.771  -15.768 -15.053 1.00 30.00 ? 160 LEU A CA    1 
ATOM   188  C  C     . LEU A 1  34  ? 14.170  -14.375 -15.154 1.00 26.27 ? 160 LEU A C     1 
ATOM   189  O  O     . LEU A 1  34  ? 13.850  -13.912 -16.254 1.00 25.30 ? 160 LEU A O     1 
ATOM   190  C  CB    . LEU A 1  34  ? 13.673  -16.820 -14.876 1.00 28.46 ? 160 LEU A CB    1 
ATOM   191  C  CG    . LEU A 1  34  ? 14.156  -18.271 -14.977 1.00 28.13 ? 160 LEU A CG    1 
ATOM   192  C  CD1   . LEU A 1  34  ? 13.137  -19.237 -14.395 1.00 29.52 ? 160 LEU A CD1   1 
ATOM   193  C  CD2   . LEU A 1  34  ? 14.440  -18.607 -16.427 1.00 33.13 ? 160 LEU A CD2   1 
ATOM   194  N  N     . GLU A 1  35  ? 14.023  -13.686 -14.027 1.00 22.97 ? 161 GLU A N     1 
ATOM   195  C  CA    . GLU A 1  35  ? 13.452  -12.353 -14.067 1.00 25.74 ? 161 GLU A CA    1 
ATOM   196  C  C     . GLU A 1  35  ? 14.440  -11.346 -14.639 1.00 25.21 ? 161 GLU A C     1 
ATOM   197  O  O     . GLU A 1  35  ? 14.021  -10.342 -15.222 1.00 23.07 ? 161 GLU A O     1 
ATOM   198  C  CB    . GLU A 1  35  ? 12.970  -11.965 -12.672 1.00 31.04 ? 161 GLU A CB    1 
ATOM   199  C  CG    . GLU A 1  35  ? 11.684  -12.705 -12.320 1.00 37.26 ? 161 GLU A CG    1 
ATOM   200  C  CD    . GLU A 1  35  ? 11.118  -12.358 -10.958 1.00 42.16 ? 161 GLU A CD    1 
ATOM   201  O  OE1   . GLU A 1  35  ? 11.868  -11.870 -10.091 1.00 44.45 ? 161 GLU A OE1   1 
ATOM   202  O  OE2   . GLU A 1  35  ? 9.909   -12.592 -10.756 1.00 47.11 ? 161 GLU A OE2   1 
ATOM   203  N  N     . ILE A 1  36  ? 15.746  -11.605 -14.519 1.00 27.27 ? 162 ILE A N     1 
ATOM   204  C  CA    . ILE A 1  36  ? 16.722  -10.791 -15.245 1.00 28.89 ? 162 ILE A CA    1 
ATOM   205  C  C     . ILE A 1  36  ? 16.463  -10.887 -16.744 1.00 30.30 ? 162 ILE A C     1 
ATOM   206  O  O     . ILE A 1  36  ? 16.410  -9.875  -17.457 1.00 27.25 ? 162 ILE A O     1 
ATOM   207  C  CB    . ILE A 1  36  ? 18.161  -11.223 -14.895 1.00 28.37 ? 162 ILE A CB    1 
ATOM   208  C  CG1   . ILE A 1  36  ? 18.501  -10.899 -13.432 1.00 32.81 ? 162 ILE A CG1   1 
ATOM   209  C  CG2   . ILE A 1  36  ? 19.176  -10.571 -15.828 1.00 31.12 ? 162 ILE A CG2   1 
ATOM   210  C  CD1   . ILE A 1  36  ? 18.604  -9.420  -13.106 1.00 38.07 ? 162 ILE A CD1   1 
ATOM   211  N  N     . LEU A 1  37  ? 16.295  -12.109 -17.248 1.00 24.78 ? 163 LEU A N     1 
ATOM   212  C  CA    . LEU A 1  37  ? 16.068  -12.283 -18.677 1.00 26.57 ? 163 LEU A CA    1 
ATOM   213  C  C     . LEU A 1  37  ? 14.733  -11.694 -19.104 1.00 25.73 ? 163 LEU A C     1 
ATOM   214  O  O     . LEU A 1  37  ? 14.612  -11.198 -20.229 1.00 29.77 ? 163 LEU A O     1 
ATOM   215  C  CB    . LEU A 1  37  ? 16.138  -13.760 -19.046 1.00 28.41 ? 163 LEU A CB    1 
ATOM   216  C  CG    . LEU A 1  37  ? 17.434  -14.467 -18.634 1.00 33.81 ? 163 LEU A CG    1 
ATOM   217  C  CD1   . LEU A 1  37  ? 17.420  -15.918 -19.111 1.00 33.56 ? 163 LEU A CD1   1 
ATOM   218  C  CD2   . LEU A 1  37  ? 18.662  -13.736 -19.178 1.00 33.05 ? 163 LEU A CD2   1 
ATOM   219  N  N     . ALA A 1  38  ? 13.730  -11.734 -18.227 1.00 24.94 ? 164 ALA A N     1 
ATOM   220  C  CA    . ALA A 1  38  ? 12.448  -11.108 -18.535 1.00 23.71 ? 164 ALA A CA    1 
ATOM   221  C  C     . ALA A 1  38  ? 12.617  -9.606  -18.679 1.00 23.81 ? 164 ALA A C     1 
ATOM   222  O  O     . ALA A 1  38  ? 12.166  -9.005  -19.660 1.00 25.74 ? 164 ALA A O     1 
ATOM   223  C  CB    . ALA A 1  38  ? 11.432  -11.424 -17.436 1.00 23.40 ? 164 ALA A CB    1 
ATOM   224  N  N     . GLU A 1  39  ? 13.289  -8.994  -17.702 1.00 25.42 ? 165 GLU A N     1 
ATOM   225  C  CA    . GLU A 1  39  ? 13.563  -7.562  -17.733 1.00 26.50 ? 165 GLU A CA    1 
ATOM   226  C  C     . GLU A 1  39  ? 14.320  -7.181  -18.997 1.00 27.90 ? 165 GLU A C     1 
ATOM   227  O  O     . GLU A 1  39  ? 13.953  -6.224  -19.691 1.00 29.18 ? 165 GLU A O     1 
ATOM   228  C  CB    . GLU A 1  39  ? 14.351  -7.185  -16.477 1.00 30.92 ? 165 GLU A CB    1 
ATOM   229  C  CG    . GLU A 1  39  ? 14.442  -5.718  -16.184 1.00 34.73 ? 165 GLU A CG    1 
ATOM   230  C  CD    . GLU A 1  39  ? 15.297  -5.440  -14.956 1.00 38.78 ? 165 GLU A CD    1 
ATOM   231  O  OE1   . GLU A 1  39  ? 16.049  -6.345  -14.520 1.00 36.24 ? 165 GLU A OE1   1 
ATOM   232  O  OE2   . GLU A 1  39  ? 15.210  -4.317  -14.423 1.00 41.14 ? 165 GLU A OE2   1 
ATOM   233  N  N     . ALA A 1  40  ? 15.372  -7.934  -19.328 1.00 26.72 ? 166 ALA A N     1 
ATOM   234  C  CA    . ALA A 1  40  ? 16.143  -7.631  -20.527 1.00 29.37 ? 166 ALA A CA    1 
ATOM   235  C  C     . ALA A 1  40  ? 15.273  -7.723  -21.772 1.00 32.47 ? 166 ALA A C     1 
ATOM   236  O  O     . ALA A 1  40  ? 15.390  -6.897  -22.687 1.00 35.33 ? 166 ALA A O     1 
ATOM   237  C  CB    . ALA A 1  40  ? 17.338  -8.579  -20.643 1.00 30.21 ? 166 ALA A CB    1 
ATOM   238  N  N     . ALA A 1  41  ? 14.394  -8.723  -21.829 1.00 26.95 ? 167 ALA A N     1 
ATOM   239  C  CA    . ALA A 1  41  ? 13.469  -8.818  -22.954 1.00 28.42 ? 167 ALA A CA    1 
ATOM   240  C  C     . ALA A 1  41  ? 12.635  -7.552  -23.079 1.00 29.35 ? 167 ALA A C     1 
ATOM   241  O  O     . ALA A 1  41  ? 12.453  -7.021  -24.184 1.00 32.68 ? 167 ALA A O     1 
ATOM   242  C  CB    . ALA A 1  41  ? 12.566  -10.039 -22.788 1.00 30.08 ? 167 ALA A CB    1 
ATOM   243  N  N     . GLY A 1  42  ? 12.135  -7.042  -21.955 1.00 32.30 ? 168 GLY A N     1 
ATOM   244  C  CA    . GLY A 1  42  ? 11.373  -5.803  -21.987 1.00 35.22 ? 168 GLY A CA    1 
ATOM   245  C  C     . GLY A 1  42  ? 12.185  -4.641  -22.523 1.00 36.82 ? 168 GLY A C     1 
ATOM   246  O  O     . GLY A 1  42  ? 11.702  -3.860  -23.344 1.00 38.84 ? 168 GLY A O     1 
ATOM   247  N  N     . PHE A 1  43  ? 13.436  -4.516  -22.075 1.00 32.42 ? 169 PHE A N     1 
ATOM   248  C  CA    . PHE A 1  43  ? 14.300  -3.454  -22.574 1.00 36.49 ? 169 PHE A CA    1 
ATOM   249  C  C     . PHE A 1  43  ? 14.498  -3.535  -24.079 1.00 43.10 ? 169 PHE A C     1 
ATOM   250  O  O     . PHE A 1  43  ? 14.809  -2.517  -24.706 1.00 47.60 ? 169 PHE A O     1 
ATOM   251  C  CB    . PHE A 1  43  ? 15.665  -3.503  -21.881 1.00 34.14 ? 169 PHE A CB    1 
ATOM   252  C  CG    . PHE A 1  43  ? 15.619  -3.210  -20.405 1.00 33.64 ? 169 PHE A CG    1 
ATOM   253  C  CD1   . PHE A 1  43  ? 14.515  -2.608  -19.826 1.00 34.01 ? 169 PHE A CD1   1 
ATOM   254  C  CD2   . PHE A 1  43  ? 16.697  -3.537  -19.598 1.00 34.30 ? 169 PHE A CD2   1 
ATOM   255  C  CE1   . PHE A 1  43  ? 14.484  -2.348  -18.471 1.00 33.71 ? 169 PHE A CE1   1 
ATOM   256  C  CE2   . PHE A 1  43  ? 16.673  -3.281  -18.245 1.00 32.86 ? 169 PHE A CE2   1 
ATOM   257  C  CZ    . PHE A 1  43  ? 15.568  -2.685  -17.678 1.00 33.25 ? 169 PHE A CZ    1 
ATOM   258  N  N     . GLU A 1  44  ? 14.331  -4.713  -24.673 1.00 33.35 ? 170 GLU A N     1 
ATOM   259  C  CA    . GLU A 1  44  ? 14.449  -4.867  -26.115 1.00 37.35 ? 170 GLU A CA    1 
ATOM   260  C  C     . GLU A 1  44  ? 13.099  -4.872  -26.821 1.00 37.42 ? 170 GLU A C     1 
ATOM   261  O  O     . GLU A 1  44  ? 13.053  -5.051  -28.040 1.00 39.32 ? 170 GLU A O     1 
ATOM   262  C  CB    . GLU A 1  44  ? 15.222  -6.148  -26.442 1.00 37.81 ? 170 GLU A CB    1 
ATOM   263  C  CG    . GLU A 1  44  ? 16.582  -6.210  -25.760 1.00 48.78 ? 170 GLU A CG    1 
ATOM   264  C  CD    . GLU A 1  44  ? 17.362  -4.903  -25.887 1.00 56.27 ? 170 GLU A CD    1 
ATOM   265  O  OE1   . GLU A 1  44  ? 17.551  -4.432  -27.029 1.00 58.88 ? 170 GLU A OE1   1 
ATOM   266  O  OE2   . GLU A 1  44  ? 17.770  -4.339  -24.846 1.00 55.16 ? 170 GLU A OE2   1 
ATOM   267  N  N     . GLY A 1  45  ? 12.007  -4.666  -26.098 1.00 46.79 ? 171 GLY A N     1 
ATOM   268  C  CA    . GLY A 1  45  ? 10.702  -4.596  -26.720 1.00 48.58 ? 171 GLY A CA    1 
ATOM   269  C  C     . GLY A 1  45  ? 10.024  -5.926  -26.962 1.00 45.15 ? 171 GLY A C     1 
ATOM   270  O  O     . GLY A 1  45  ? 8.966   -5.954  -27.601 1.00 48.28 ? 171 GLY A O     1 
ATOM   271  N  N     A SER A 1  46  ? 10.593  -7.032  -26.489 0.52 41.40 ? 172 SER A N     1 
ATOM   272  N  N     B SER A 1  46  ? 10.586  -7.025  -26.459 0.48 41.42 ? 172 SER A N     1 
ATOM   273  C  CA    A SER A 1  46  ? 9.986   -8.346  -26.704 0.52 39.71 ? 172 SER A CA    1 
ATOM   274  C  CA    B SER A 1  46  ? 10.015  -8.356  -26.662 0.48 39.64 ? 172 SER A CA    1 
ATOM   275  C  C     A SER A 1  46  ? 9.103   -8.663  -25.507 0.52 35.60 ? 172 SER A C     1 
ATOM   276  C  C     B SER A 1  46  ? 9.101   -8.676  -25.483 0.48 35.69 ? 172 SER A C     1 
ATOM   277  O  O     A SER A 1  46  ? 9.522   -9.305  -24.543 0.52 34.02 ? 172 SER A O     1 
ATOM   278  O  O     B SER A 1  46  ? 9.486   -9.328  -24.510 0.48 34.11 ? 172 SER A O     1 
ATOM   279  C  CB    A SER A 1  46  ? 11.044  -9.418  -26.920 0.52 41.67 ? 172 SER A CB    1 
ATOM   280  C  CB    B SER A 1  46  ? 11.121  -9.392  -26.817 0.48 41.51 ? 172 SER A CB    1 
ATOM   281  O  OG    A SER A 1  46  ? 10.418  -10.655 -27.216 0.52 40.03 ? 172 SER A OG    1 
ATOM   282  O  OG    B SER A 1  46  ? 12.001  -9.045  -27.872 0.48 43.38 ? 172 SER A OG    1 
ATOM   283  N  N     . GLU A 1  47  ? 7.855   -8.201  -25.581 1.00 35.23 ? 173 GLU A N     1 
ATOM   284  C  CA    . GLU A 1  47  ? 6.897   -8.442  -24.509 1.00 36.04 ? 173 GLU A CA    1 
ATOM   285  C  C     . GLU A 1  47  ? 6.538   -9.920  -24.389 1.00 30.64 ? 173 GLU A C     1 
ATOM   286  O  O     . GLU A 1  47  ? 6.210   -10.385 -23.293 1.00 26.24 ? 173 GLU A O     1 
ATOM   287  C  CB    . GLU A 1  47  ? 5.635   -7.610  -24.744 1.00 42.97 ? 173 GLU A CB    1 
ATOM   288  C  CG    . GLU A 1  47  ? 4.682   -7.562  -23.553 1.00 51.91 ? 173 GLU A CG    1 
ATOM   289  C  CD    . GLU A 1  47  ? 5.167   -6.650  -22.436 1.00 58.47 ? 173 GLU A CD    1 
ATOM   290  O  OE1   . GLU A 1  47  ? 6.305   -6.142  -22.522 1.00 60.85 ? 173 GLU A OE1   1 
ATOM   291  O  OE2   . GLU A 1  47  ? 4.403   -6.441  -21.469 1.00 61.64 ? 173 GLU A OE2   1 
ATOM   292  N  N     . GLY A 1  48  ? 6.567   -10.668 -25.493 1.00 33.90 ? 174 GLY A N     1 
ATOM   293  C  CA    . GLY A 1  48  ? 6.259   -12.090 -25.416 1.00 31.68 ? 174 GLY A CA    1 
ATOM   294  C  C     . GLY A 1  48  ? 7.295   -12.872 -24.630 1.00 28.67 ? 174 GLY A C     1 
ATOM   295  O  O     . GLY A 1  48  ? 6.952   -13.713 -23.792 1.00 29.58 ? 174 GLY A O     1 
ATOM   296  N  N     A ARG A 1  49  ? 8.580   -12.619 -24.898 0.62 29.48 ? 175 ARG A N     1 
ATOM   297  N  N     B ARG A 1  49  ? 8.579   -12.610 -24.887 0.38 29.98 ? 175 ARG A N     1 
ATOM   298  C  CA    A ARG A 1  49  ? 9.632   -13.285 -24.136 0.62 31.35 ? 175 ARG A CA    1 
ATOM   299  C  CA    B ARG A 1  49  ? 9.632   -13.286 -24.137 0.38 31.12 ? 175 ARG A CA    1 
ATOM   300  C  C     A ARG A 1  49  ? 9.617   -12.842 -22.677 0.62 27.92 ? 175 ARG A C     1 
ATOM   301  C  C     B ARG A 1  49  ? 9.644   -12.837 -22.679 0.38 28.38 ? 175 ARG A C     1 
ATOM   302  O  O     A ARG A 1  49  ? 9.809   -13.662 -21.771 0.62 29.18 ? 175 ARG A O     1 
ATOM   303  O  O     B ARG A 1  49  ? 9.876   -13.650 -21.776 0.38 28.90 ? 175 ARG A O     1 
ATOM   304  C  CB    A ARG A 1  49  ? 10.996  -13.009 -24.769 0.62 32.75 ? 175 ARG A CB    1 
ATOM   305  C  CB    B ARG A 1  49  ? 10.985  -13.032 -24.800 0.38 32.51 ? 175 ARG A CB    1 
ATOM   306  C  CG    A ARG A 1  49  ? 11.134  -13.534 -26.185 0.62 34.20 ? 175 ARG A CG    1 
ATOM   307  C  CG    B ARG A 1  49  ? 11.109  -13.651 -26.187 0.38 33.86 ? 175 ARG A CG    1 
ATOM   308  C  CD    A ARG A 1  49  ? 12.450  -13.106 -26.829 0.62 33.21 ? 175 ARG A CD    1 
ATOM   309  C  CD    B ARG A 1  49  ? 12.411  -13.254 -26.869 0.38 33.65 ? 175 ARG A CD    1 
ATOM   310  N  NE    A ARG A 1  49  ? 13.576  -13.949 -26.432 0.62 35.28 ? 175 ARG A NE    1 
ATOM   311  N  NE    B ARG A 1  49  ? 12.673  -14.059 -28.060 0.38 34.32 ? 175 ARG A NE    1 
ATOM   312  C  CZ    A ARG A 1  49  ? 14.557  -13.591 -25.604 0.62 36.02 ? 175 ARG A CZ    1 
ATOM   313  C  CZ    B ARG A 1  49  ? 12.102  -13.866 -29.246 0.38 38.37 ? 175 ARG A CZ    1 
ATOM   314  N  NH1   A ARG A 1  49  ? 14.579  -12.382 -25.047 0.62 32.10 ? 175 ARG A NH1   1 
ATOM   315  N  NH1   B ARG A 1  49  ? 11.217  -12.891 -29.417 0.38 38.15 ? 175 ARG A NH1   1 
ATOM   316  N  NH2   A ARG A 1  49  ? 15.530  -14.458 -25.332 0.62 31.99 ? 175 ARG A NH2   1 
ATOM   317  N  NH2   B ARG A 1  49  ? 12.411  -14.658 -30.266 0.38 39.35 ? 175 ARG A NH2   1 
ATOM   318  N  N     . LEU A 1  50  ? 9.394   -11.550 -22.429 1.00 27.63 ? 176 LEU A N     1 
ATOM   319  C  CA    . LEU A 1  50  ? 9.249   -11.069 -21.058 1.00 25.00 ? 176 LEU A CA    1 
ATOM   320  C  C     . LEU A 1  50  ? 8.183   -11.860 -20.318 1.00 24.14 ? 176 LEU A C     1 
ATOM   321  O  O     . LEU A 1  50  ? 8.390   -12.301 -19.183 1.00 23.19 ? 176 LEU A O     1 
ATOM   322  C  CB    . LEU A 1  50  ? 8.888   -9.578  -21.042 1.00 26.88 ? 176 LEU A CB    1 
ATOM   323  C  CG    . LEU A 1  50  ? 8.572   -9.000  -19.651 1.00 29.89 ? 176 LEU A CG    1 
ATOM   324  C  CD1   . LEU A 1  50  ? 9.048   -7.551  -19.552 1.00 29.57 ? 176 LEU A CD1   1 
ATOM   325  C  CD2   . LEU A 1  50  ? 7.081   -9.082  -19.293 1.00 28.83 ? 176 LEU A CD2   1 
ATOM   326  N  N     . LEU A 1  51  ? 7.013   -12.026 -20.941 1.00 25.09 ? 177 LEU A N     1 
ATOM   327  C  CA    . LEU A 1  51  ? 5.931   -12.740 -20.272 1.00 26.22 ? 177 LEU A CA    1 
ATOM   328  C  C     . LEU A 1  51  ? 6.317   -14.184 -19.976 1.00 23.82 ? 177 LEU A C     1 
ATOM   329  O  O     . LEU A 1  51  ? 6.049   -14.689 -18.882 1.00 23.98 ? 177 LEU A O     1 
ATOM   330  C  CB    . LEU A 1  51  ? 4.658   -12.697 -21.117 1.00 27.91 ? 177 LEU A CB    1 
ATOM   331  C  CG    . LEU A 1  51  ? 3.715   -11.529 -20.890 1.00 34.38 ? 177 LEU A CG    1 
ATOM   332  C  CD1   . LEU A 1  51  ? 2.587   -11.605 -21.916 1.00 35.32 ? 177 LEU A CD1   1 
ATOM   333  C  CD2   . LEU A 1  51  ? 3.154   -11.544 -19.461 1.00 30.50 ? 177 LEU A CD2   1 
ATOM   334  N  N     . THR A 1  52  ? 6.926   -14.872 -20.940 1.00 24.74 ? 178 THR A N     1 
ATOM   335  C  CA    . THR A 1  52  ? 7.293   -16.268 -20.713 1.00 25.77 ? 178 THR A CA    1 
ATOM   336  C  C     . THR A 1  52  ? 8.283   -16.396 -19.560 1.00 28.29 ? 178 THR A C     1 
ATOM   337  O  O     . THR A 1  52  ? 8.096   -17.220 -18.658 1.00 26.85 ? 178 THR A O     1 
ATOM   338  C  CB    . THR A 1  52  ? 7.857   -16.882 -21.997 1.00 29.63 ? 178 THR A CB    1 
ATOM   339  O  OG1   . THR A 1  52  ? 6.786   -17.143 -22.916 1.00 30.82 ? 178 THR A OG1   1 
ATOM   340  C  CG2   . THR A 1  52  ? 8.578   -18.199 -21.711 1.00 29.34 ? 178 THR A CG2   1 
ATOM   341  N  N     . PHE A 1  53  ? 9.351   -15.592 -19.572 1.00 26.51 ? 179 PHE A N     1 
ATOM   342  C  CA    . PHE A 1  53  ? 10.321  -15.648 -18.479 1.00 24.34 ? 179 PHE A CA    1 
ATOM   343  C  C     . PHE A 1  53  ? 9.673   -15.281 -17.149 1.00 23.97 ? 179 PHE A C     1 
ATOM   344  O  O     . PHE A 1  53  ? 9.955   -15.910 -16.120 1.00 24.44 ? 179 PHE A O     1 
ATOM   345  C  CB    . PHE A 1  53  ? 11.509  -14.728 -18.775 1.00 24.40 ? 179 PHE A CB    1 
ATOM   346  C  CG    . PHE A 1  53  ? 12.447  -15.258 -19.822 1.00 26.30 ? 179 PHE A CG    1 
ATOM   347  C  CD1   . PHE A 1  53  ? 12.960  -16.547 -19.737 1.00 33.80 ? 179 PHE A CD1   1 
ATOM   348  C  CD2   . PHE A 1  53  ? 12.815  -14.468 -20.897 1.00 29.08 ? 179 PHE A CD2   1 
ATOM   349  C  CE1   . PHE A 1  53  ? 13.828  -17.032 -20.701 1.00 35.35 ? 179 PHE A CE1   1 
ATOM   350  C  CE2   . PHE A 1  53  ? 13.685  -14.944 -21.865 1.00 30.73 ? 179 PHE A CE2   1 
ATOM   351  C  CZ    . PHE A 1  53  ? 14.191  -16.232 -21.768 1.00 32.36 ? 179 PHE A CZ    1 
ATOM   352  N  N     . CYS A 1  54  ? 8.801   -14.270 -17.146 1.00 22.77 ? 180 CYS A N     1 
ATOM   353  C  CA    . CYS A 1  54  ? 8.077   -13.909 -15.927 1.00 24.42 ? 180 CYS A CA    1 
ATOM   354  C  C     . CYS A 1  54  ? 7.225   -15.068 -15.426 1.00 25.12 ? 180 CYS A C     1 
ATOM   355  O  O     . CYS A 1  54  ? 7.198   -15.362 -14.224 1.00 21.72 ? 180 CYS A O     1 
ATOM   356  C  CB    . CYS A 1  54  ? 7.192   -12.686 -16.177 1.00 31.76 ? 180 CYS A CB    1 
ATOM   357  S  SG    . CYS A 1  54  ? 8.027   -11.083 -16.104 1.00 41.56 ? 180 CYS A SG    1 
ATOM   358  N  N     . ARG A 1  55  ? 6.483   -15.714 -16.332 1.00 22.52 ? 181 ARG A N     1 
ATOM   359  C  CA    . ARG A 1  55  ? 5.639   -16.833 -15.927 1.00 22.73 ? 181 ARG A CA    1 
ATOM   360  C  C     . ARG A 1  55  ? 6.481   -17.998 -15.429 1.00 24.55 ? 181 ARG A C     1 
ATOM   361  O  O     . ARG A 1  55  ? 6.150   -18.623 -14.415 1.00 24.79 ? 181 ARG A O     1 
ATOM   362  C  CB    . ARG A 1  55  ? 4.759   -17.285 -17.098 1.00 23.36 ? 181 ARG A CB    1 
ATOM   363  C  CG    . ARG A 1  55  ? 3.678   -16.304 -17.501 1.00 23.05 ? 181 ARG A CG    1 
ATOM   364  C  CD    . ARG A 1  55  ? 3.128   -16.666 -18.874 1.00 27.97 ? 181 ARG A CD    1 
ATOM   365  N  NE    . ARG A 1  55  ? 2.138   -15.720 -19.360 1.00 25.19 ? 181 ARG A NE    1 
ATOM   366  C  CZ    . ARG A 1  55  ? 1.720   -15.665 -20.621 1.00 26.88 ? 181 ARG A CZ    1 
ATOM   367  N  NH1   . ARG A 1  55  ? 2.211   -16.495 -21.530 1.00 28.80 ? 181 ARG A NH1   1 
ATOM   368  N  NH2   . ARG A 1  55  ? 0.821   -14.768 -20.979 1.00 29.43 ? 181 ARG A NH2   1 
ATOM   369  N  N     . ALA A 1  56  ? 7.571   -18.314 -16.136 1.00 23.76 ? 182 ALA A N     1 
ATOM   370  C  CA    . ALA A 1  56  ? 8.443   -19.395 -15.686 1.00 25.72 ? 182 ALA A CA    1 
ATOM   371  C  C     . ALA A 1  56  ? 8.982   -19.105 -14.290 1.00 24.74 ? 182 ALA A C     1 
ATOM   372  O  O     . ALA A 1  56  ? 8.985   -19.984 -13.420 1.00 27.50 ? 182 ALA A O     1 
ATOM   373  C  CB    . ALA A 1  56  ? 9.586   -19.601 -16.677 1.00 25.02 ? 182 ALA A CB    1 
ATOM   374  N  N     . ALA A 1  57  ? 9.425   -17.869 -14.052 1.00 23.35 ? 183 ALA A N     1 
ATOM   375  C  CA    . ALA A 1  57  ? 9.865   -17.491 -12.713 1.00 22.74 ? 183 ALA A CA    1 
ATOM   376  C  C     . ALA A 1  57  ? 8.756   -17.703 -11.692 1.00 23.64 ? 183 ALA A C     1 
ATOM   377  O  O     . ALA A 1  57  ? 8.999   -18.237 -10.606 1.00 22.71 ? 183 ALA A O     1 
ATOM   378  C  CB    . ALA A 1  57  ? 10.317  -16.032 -12.694 1.00 26.22 ? 183 ALA A CB    1 
ATOM   379  N  N     . SER A 1  58  ? 7.526   -17.292 -12.022 1.00 27.61 ? 184 SER A N     1 
ATOM   380  C  CA    A SER A 1  58  ? 6.427   -17.404 -11.068 0.32 25.48 ? 184 SER A CA    1 
ATOM   381  C  CA    B SER A 1  58  ? 6.432   -17.404 -11.061 0.68 25.41 ? 184 SER A CA    1 
ATOM   382  C  C     . SER A 1  58  ? 6.084   -18.860 -10.777 1.00 22.41 ? 184 SER A C     1 
ATOM   383  O  O     . SER A 1  58  ? 5.684   -19.188 -9.657  1.00 22.43 ? 184 SER A O     1 
ATOM   384  C  CB    A SER A 1  58  ? 5.199   -16.659 -11.592 0.32 25.66 ? 184 SER A CB    1 
ATOM   385  C  CB    B SER A 1  58  ? 5.199   -16.646 -11.563 0.68 24.31 ? 184 SER A CB    1 
ATOM   386  O  OG    A SER A 1  58  ? 4.186   -16.585 -10.605 0.32 23.57 ? 184 SER A OG    1 
ATOM   387  O  OG    B SER A 1  58  ? 4.608   -17.297 -12.673 0.68 31.77 ? 184 SER A OG    1 
ATOM   388  N  N     . VAL A 1  59  ? 6.236   -19.743 -11.766 1.00 23.08 ? 185 VAL A N     1 
ATOM   389  C  CA    . VAL A 1  59  ? 6.009   -21.170 -11.535 1.00 23.90 ? 185 VAL A CA    1 
ATOM   390  C  C     . VAL A 1  59  ? 6.926   -21.671 -10.426 1.00 26.11 ? 185 VAL A C     1 
ATOM   391  O  O     . VAL A 1  59  ? 6.502   -22.395 -9.518  1.00 25.57 ? 185 VAL A O     1 
ATOM   392  C  CB    . VAL A 1  59  ? 6.215   -21.966 -12.841 1.00 25.31 ? 185 VAL A CB    1 
ATOM   393  C  CG1   . VAL A 1  59  ? 6.375   -23.461 -12.567 1.00 26.82 ? 185 VAL A CG1   1 
ATOM   394  C  CG2   . VAL A 1  59  ? 5.054   -21.743 -13.794 1.00 29.50 ? 185 VAL A CG2   1 
ATOM   395  N  N     . LEU A 1  60  ? 8.201   -21.286 -10.484 1.00 24.12 ? 186 LEU A N     1 
ATOM   396  C  CA    . LEU A 1  60  ? 9.150   -21.709 -9.461  1.00 27.58 ? 186 LEU A CA    1 
ATOM   397  C  C     . LEU A 1  60  ? 8.789   -21.141 -8.095  1.00 26.79 ? 186 LEU A C     1 
ATOM   398  O  O     . LEU A 1  60  ? 8.994   -21.801 -7.066  1.00 25.75 ? 186 LEU A O     1 
ATOM   399  C  CB    . LEU A 1  60  ? 10.559  -21.279 -9.855  1.00 29.50 ? 186 LEU A CB    1 
ATOM   400  C  CG    . LEU A 1  60  ? 11.073  -21.836 -11.186 1.00 33.05 ? 186 LEU A CG    1 
ATOM   401  C  CD1   . LEU A 1  60  ? 12.517  -21.412 -11.414 1.00 33.54 ? 186 LEU A CD1   1 
ATOM   402  C  CD2   . LEU A 1  60  ? 10.955  -23.352 -11.223 1.00 36.35 ? 186 LEU A CD2   1 
ATOM   403  N  N     . LYS A 1  61  ? 8.292   -19.903 -8.058  1.00 23.15 ? 187 LYS A N     1 
ATOM   404  C  CA    . LYS A 1  61  ? 7.861   -19.325 -6.788  1.00 26.50 ? 187 LYS A CA    1 
ATOM   405  C  C     . LYS A 1  61  ? 6.719   -20.119 -6.165  1.00 24.47 ? 187 LYS A C     1 
ATOM   406  O  O     . LYS A 1  61  ? 6.546   -20.095 -4.941  1.00 23.24 ? 187 LYS A O     1 
ATOM   407  C  CB    . LYS A 1  61  ? 7.416   -17.873 -6.975  1.00 24.21 ? 187 LYS A CB    1 
ATOM   408  C  CG    . LYS A 1  61  ? 8.412   -16.955 -7.661  1.00 28.68 ? 187 LYS A CG    1 
ATOM   409  C  CD    . LYS A 1  61  ? 7.881   -15.519 -7.707  1.00 27.15 ? 187 LYS A CD    1 
ATOM   410  C  CE    . LYS A 1  61  ? 8.703   -14.652 -8.644  1.00 34.15 ? 187 LYS A CE    1 
ATOM   411  N  NZ    . LYS A 1  61  ? 8.069   -13.324 -8.903  1.00 35.14 ? 187 LYS A NZ    1 
ATOM   412  N  N     . ALA A 1  62  ? 5.931   -20.821 -6.982  1.00 24.14 ? 188 ALA A N     1 
ATOM   413  C  CA    . ALA A 1  62  ? 4.765   -21.560 -6.506  1.00 32.05 ? 188 ALA A CA    1 
ATOM   414  C  C     . ALA A 1  62  ? 5.073   -23.000 -6.113  1.00 26.67 ? 188 ALA A C     1 
ATOM   415  O  O     . ALA A 1  62  ? 4.181   -23.695 -5.600  1.00 25.45 ? 188 ALA A O     1 
ATOM   416  C  CB    . ALA A 1  62  ? 3.665   -21.559 -7.579  1.00 29.78 ? 188 ALA A CB    1 
ATOM   417  N  N     . LEU A 1  63  ? 6.296   -23.468 -6.333  1.00 28.23 ? 189 LEU A N     1 
ATOM   418  C  CA    . LEU A 1  63  ? 6.634   -24.838 -5.985  1.00 28.83 ? 189 LEU A CA    1 
ATOM   419  C  C     . LEU A 1  63  ? 6.783   -24.985 -4.470  1.00 26.87 ? 189 LEU A C     1 
ATOM   420  O  O     . LEU A 1  63  ? 7.140   -24.034 -3.777  1.00 26.30 ? 189 LEU A O     1 
ATOM   421  C  CB    . LEU A 1  63  ? 7.929   -25.259 -6.679  1.00 28.83 ? 189 LEU A CB    1 
ATOM   422  C  CG    . LEU A 1  63  ? 7.851   -25.431 -8.197  1.00 26.99 ? 189 LEU A CG    1 
ATOM   423  C  CD1   . LEU A 1  63  ? 9.227   -25.709 -8.767  1.00 27.98 ? 189 LEU A CD1   1 
ATOM   424  C  CD2   . LEU A 1  63  ? 6.896   -26.552 -8.576  1.00 27.83 ? 189 LEU A CD2   1 
ATOM   425  N  N     . PRO A 1  64  ? 6.517   -26.171 -3.927  1.00 27.97 ? 190 PRO A N     1 
ATOM   426  C  CA    . PRO A 1  64  ? 6.586   -26.360 -2.473  1.00 28.65 ? 190 PRO A CA    1 
ATOM   427  C  C     . PRO A 1  64  ? 7.964   -26.709 -1.929  1.00 29.18 ? 190 PRO A C     1 
ATOM   428  O  O     . PRO A 1  64  ? 8.088   -26.907 -0.716  1.00 29.81 ? 190 PRO A O     1 
ATOM   429  C  CB    . PRO A 1  64  ? 5.613   -27.524 -2.256  1.00 29.69 ? 190 PRO A CB    1 
ATOM   430  C  CG    . PRO A 1  64  ? 5.804   -28.367 -3.489  1.00 34.27 ? 190 PRO A CG    1 
ATOM   431  C  CD    . PRO A 1  64  ? 5.976   -27.364 -4.608  1.00 32.99 ? 190 PRO A CD    1 
ATOM   432  N  N     . SER A 1  65  ? 8.989   -26.794 -2.772  1.00 30.33 ? 191 SER A N     1 
ATOM   433  C  CA    . SER A 1  65  ? 10.328  -27.147 -2.315  1.00 29.88 ? 191 SER A CA    1 
ATOM   434  C  C     . SER A 1  65  ? 11.320  -26.756 -3.400  1.00 29.45 ? 191 SER A C     1 
ATOM   435  O  O     . SER A 1  65  ? 10.923  -26.407 -4.523  1.00 28.79 ? 191 SER A O     1 
ATOM   436  C  CB    . SER A 1  65  ? 10.430  -28.647 -1.991  1.00 31.41 ? 191 SER A CB    1 
ATOM   437  O  OG    . SER A 1  65  ? 10.357  -29.391 -3.181  1.00 31.76 ? 191 SER A OG    1 
ATOM   438  N  N     . PRO A 1  66  ? 12.617  -26.791 -3.100  1.00 29.91 ? 192 PRO A N     1 
ATOM   439  C  CA    . PRO A 1  66  ? 13.607  -26.353 -4.090  1.00 29.58 ? 192 PRO A CA    1 
ATOM   440  C  C     . PRO A 1  66  ? 13.728  -27.328 -5.248  1.00 30.22 ? 192 PRO A C     1 
ATOM   441  O  O     . PRO A 1  66  ? 13.693  -28.550 -5.069  1.00 31.36 ? 192 PRO A O     1 
ATOM   442  C  CB    . PRO A 1  66  ? 14.914  -26.290 -3.286  1.00 30.17 ? 192 PRO A CB    1 
ATOM   443  C  CG    . PRO A 1  66  ? 14.502  -26.238 -1.869  1.00 30.41 ? 192 PRO A CG    1 
ATOM   444  C  CD    . PRO A 1  66  ? 13.250  -27.066 -1.800  1.00 30.74 ? 192 PRO A CD    1 
ATOM   445  N  N     . VAL A 1  67  ? 13.878  -26.770 -6.447  1.00 29.61 ? 193 VAL A N     1 
ATOM   446  C  CA    . VAL A 1  67  ? 14.286  -27.565 -7.599  1.00 30.33 ? 193 VAL A CA    1 
ATOM   447  C  C     . VAL A 1  67  ? 15.754  -27.932 -7.433  1.00 31.18 ? 193 VAL A C     1 
ATOM   448  O  O     . VAL A 1  67  ? 16.620  -27.056 -7.344  1.00 30.76 ? 193 VAL A O     1 
ATOM   449  C  CB    . VAL A 1  67  ? 14.045  -26.795 -8.904  1.00 29.55 ? 193 VAL A CB    1 
ATOM   450  C  CG1   . VAL A 1  67  ? 14.644  -27.539 -10.103 1.00 30.43 ? 193 VAL A CG1   1 
ATOM   451  C  CG2   . VAL A 1  67  ? 12.557  -26.581 -9.104  1.00 28.93 ? 193 VAL A CG2   1 
ATOM   452  N  N     . THR A 1  68  ? 16.040  -29.235 -7.384  1.00 35.10 ? 194 THR A N     1 
ATOM   453  C  CA    . THR A 1  68  ? 17.409  -29.714 -7.281  1.00 39.60 ? 194 THR A CA    1 
ATOM   454  C  C     . THR A 1  68  ? 17.907  -30.402 -8.540  1.00 43.01 ? 194 THR A C     1 
ATOM   455  O  O     . THR A 1  68  ? 19.123  -30.503 -8.729  1.00 43.24 ? 194 THR A O     1 
ATOM   456  C  CB    . THR A 1  68  ? 17.550  -30.692 -6.105  1.00 41.91 ? 194 THR A CB    1 
ATOM   457  O  OG1   . THR A 1  68  ? 16.524  -31.690 -6.181  1.00 41.11 ? 194 THR A OG1   1 
ATOM   458  C  CG2   . THR A 1  68  ? 17.443  -29.944 -4.782  1.00 48.43 ? 194 THR A CG2   1 
ATOM   459  N  N     . THR A 1  69  ? 17.011  -30.873 -9.400  1.00 43.25 ? 195 THR A N     1 
ATOM   460  C  CA    . THR A 1  69  ? 17.417  -31.616 -10.579 1.00 46.87 ? 195 THR A CA    1 
ATOM   461  C  C     . THR A 1  69  ? 16.558  -31.192 -11.757 1.00 40.68 ? 195 THR A C     1 
ATOM   462  O  O     . THR A 1  69  ? 15.397  -30.799 -11.598 1.00 37.34 ? 195 THR A O     1 
ATOM   463  C  CB    . THR A 1  69  ? 17.318  -33.135 -10.357 1.00 47.39 ? 195 THR A CB    1 
ATOM   464  O  OG1   . THR A 1  69  ? 15.945  -33.521 -10.217 1.00 49.28 ? 195 THR A OG1   1 
ATOM   465  C  CG2   . THR A 1  69  ? 18.080  -33.532 -9.106  1.00 50.13 ? 195 THR A CG2   1 
ATOM   466  N  N     . LEU A 1  70  ? 17.153  -31.269 -12.946 1.00 41.99 ? 196 LEU A N     1 
ATOM   467  C  CA    . LEU A 1  70  ? 16.479  -30.797 -14.147 1.00 46.23 ? 196 LEU A CA    1 
ATOM   468  C  C     . LEU A 1  70  ? 15.195  -31.569 -14.407 1.00 43.01 ? 196 LEU A C     1 
ATOM   469  O  O     . LEU A 1  70  ? 14.217  -30.999 -14.904 1.00 41.20 ? 196 LEU A O     1 
ATOM   470  C  CB    . LEU A 1  70  ? 17.425  -30.909 -15.343 1.00 56.39 ? 196 LEU A CB    1 
ATOM   471  C  CG    . LEU A 1  70  ? 17.067  -30.067 -16.569 1.00 63.36 ? 196 LEU A CG    1 
ATOM   472  C  CD1   . LEU A 1  70  ? 17.162  -28.584 -16.243 1.00 61.94 ? 196 LEU A CD1   1 
ATOM   473  C  CD2   . LEU A 1  70  ? 17.976  -30.416 -17.739 1.00 66.81 ? 196 LEU A CD2   1 
ATOM   474  N  N     . SER A 1  71  ? 15.169  -32.857 -14.064 1.00 45.90 ? 197 SER A N     1 
ATOM   475  C  CA    . SER A 1  71  ? 13.979  -33.663 -14.313 1.00 50.28 ? 197 SER A CA    1 
ATOM   476  C  C     . SER A 1  71  ? 12.773  -33.126 -13.560 1.00 43.93 ? 197 SER A C     1 
ATOM   477  O  O     . SER A 1  71  ? 11.631  -33.348 -13.978 1.00 44.04 ? 197 SER A O     1 
ATOM   478  C  CB    . SER A 1  71  ? 14.240  -35.119 -13.922 1.00 56.69 ? 197 SER A CB    1 
ATOM   479  O  OG    . SER A 1  71  ? 14.366  -35.248 -12.517 1.00 57.46 ? 197 SER A OG    1 
ATOM   480  N  N     . GLN A 1  72  ? 12.999  -32.413 -12.455 1.00 44.03 ? 198 GLN A N     1 
ATOM   481  C  CA    . GLN A 1  72  ? 11.892  -31.824 -11.711 1.00 42.43 ? 198 GLN A CA    1 
ATOM   482  C  C     . GLN A 1  72  ? 11.161  -30.746 -12.503 1.00 40.16 ? 198 GLN A C     1 
ATOM   483  O  O     . GLN A 1  72  ? 10.066  -30.342 -12.098 1.00 39.22 ? 198 GLN A O     1 
ATOM   484  C  CB    . GLN A 1  72  ? 12.403  -31.256 -10.383 1.00 41.84 ? 198 GLN A CB    1 
ATOM   485  C  CG    . GLN A 1  72  ? 12.791  -32.341 -9.381  1.00 44.52 ? 198 GLN A CG    1 
ATOM   486  C  CD    . GLN A 1  72  ? 13.700  -31.844 -8.272  1.00 42.04 ? 198 GLN A CD    1 
ATOM   487  O  OE1   . GLN A 1  72  ? 14.309  -30.787 -8.381  1.00 36.44 ? 198 GLN A OE1   1 
ATOM   488  N  NE2   . GLN A 1  72  ? 13.811  -32.626 -7.203  1.00 45.91 ? 198 GLN A NE2   1 
ATOM   489  N  N     . LEU A 1  73  ? 11.725  -30.282 -13.622 1.00 39.17 ? 199 LEU A N     1 
ATOM   490  C  CA    . LEU A 1  73  ? 11.021  -29.333 -14.475 1.00 39.70 ? 199 LEU A CA    1 
ATOM   491  C  C     . LEU A 1  73  ? 10.059  -30.014 -15.435 1.00 43.60 ? 199 LEU A C     1 
ATOM   492  O  O     . LEU A 1  73  ? 9.187   -29.342 -15.994 1.00 38.55 ? 199 LEU A O     1 
ATOM   493  C  CB    . LEU A 1  73  ? 12.016  -28.493 -15.278 1.00 38.60 ? 199 LEU A CB    1 
ATOM   494  C  CG    . LEU A 1  73  ? 12.970  -27.600 -14.476 1.00 35.45 ? 199 LEU A CG    1 
ATOM   495  C  CD1   . LEU A 1  73  ? 13.874  -26.822 -15.415 1.00 39.04 ? 199 LEU A CD1   1 
ATOM   496  C  CD2   . LEU A 1  73  ? 12.226  -26.646 -13.555 1.00 32.49 ? 199 LEU A CD2   1 
ATOM   497  N  N     . GLN A 1  74  ? 10.197  -31.325 -15.634 1.00 41.64 ? 200 GLN A N     1 
ATOM   498  C  CA    . GLN A 1  74  ? 9.351   -32.030 -16.587 1.00 44.64 ? 200 GLN A CA    1 
ATOM   499  C  C     . GLN A 1  74  ? 7.884   -31.796 -16.261 1.00 45.53 ? 200 GLN A C     1 
ATOM   500  O  O     . GLN A 1  74  ? 7.438   -32.023 -15.133 1.00 44.05 ? 200 GLN A O     1 
ATOM   501  C  CB    . GLN A 1  74  ? 9.673   -33.527 -16.570 1.00 44.13 ? 200 GLN A CB    1 
ATOM   502  N  N     . GLY A 1  75  ? 7.134   -31.321 -17.247 1.00 54.70 ? 201 GLY A N     1 
ATOM   503  C  CA    . GLY A 1  75  ? 5.719   -31.094 -17.073 1.00 57.51 ? 201 GLY A CA    1 
ATOM   504  C  C     . GLY A 1  75  ? 5.339   -29.756 -16.471 1.00 55.50 ? 201 GLY A C     1 
ATOM   505  O  O     . GLY A 1  75  ? 4.143   -29.445 -16.412 1.00 56.70 ? 201 GLY A O     1 
ATOM   506  N  N     . LEU A 1  76  ? 6.297   -28.955 -16.011 1.00 45.34 ? 202 LEU A N     1 
ATOM   507  C  CA    . LEU A 1  76  ? 5.943   -27.639 -15.482 1.00 42.07 ? 202 LEU A CA    1 
ATOM   508  C  C     . LEU A 1  76  ? 5.563   -26.714 -16.633 1.00 31.00 ? 202 LEU A C     1 
ATOM   509  O  O     . LEU A 1  76  ? 6.298   -26.632 -17.623 1.00 32.36 ? 202 LEU A O     1 
ATOM   510  C  CB    . LEU A 1  76  ? 7.096   -27.021 -14.684 1.00 39.19 ? 202 LEU A CB    1 
ATOM   511  C  CG    . LEU A 1  76  ? 7.506   -27.721 -13.389 1.00 39.27 ? 202 LEU A CG    1 
ATOM   512  C  CD1   . LEU A 1  76  ? 8.574   -26.910 -12.665 1.00 35.28 ? 202 LEU A CD1   1 
ATOM   513  C  CD2   . LEU A 1  76  ? 6.303   -27.957 -12.483 1.00 40.50 ? 202 LEU A CD2   1 
ATOM   514  N  N     . PRO A 1  77  ? 4.459   -25.987 -16.542 1.00 34.45 ? 203 PRO A N     1 
ATOM   515  C  CA    . PRO A 1  77  ? 4.123   -25.058 -17.622 1.00 36.95 ? 203 PRO A CA    1 
ATOM   516  C  C     . PRO A 1  77  ? 5.160   -23.955 -17.727 1.00 33.84 ? 203 PRO A C     1 
ATOM   517  O  O     . PRO A 1  77  ? 5.748   -23.525 -16.733 1.00 28.62 ? 203 PRO A O     1 
ATOM   518  C  CB    . PRO A 1  77  ? 2.758   -24.503 -17.206 1.00 35.59 ? 203 PRO A CB    1 
ATOM   519  C  CG    . PRO A 1  77  ? 2.757   -24.610 -15.733 1.00 39.45 ? 203 PRO A CG    1 
ATOM   520  C  CD    . PRO A 1  77  ? 3.527   -25.864 -15.409 1.00 37.04 ? 203 PRO A CD    1 
ATOM   521  N  N     . HIS A 1  78  ? 5.400   -23.526 -18.964 1.00 28.99 ? 204 HIS A N     1 
ATOM   522  C  CA    . HIS A 1  78  ? 6.233   -22.384 -19.305 1.00 30.19 ? 204 HIS A CA    1 
ATOM   523  C  C     . HIS A 1  78  ? 7.722   -22.681 -19.187 1.00 33.21 ? 204 HIS A C     1 
ATOM   524  O  O     . HIS A 1  78  ? 8.534   -21.736 -19.214 1.00 35.37 ? 204 HIS A O     1 
ATOM   525  C  CB    . HIS A 1  78  ? 5.872   -21.164 -18.450 1.00 30.66 ? 204 HIS A CB    1 
ATOM   526  C  CG    . HIS A 1  78  ? 4.416   -20.827 -18.505 1.00 31.41 ? 204 HIS A CG    1 
ATOM   527  N  ND1   . HIS A 1  78  ? 3.791   -20.443 -19.672 1.00 31.23 ? 204 HIS A ND1   1 
ATOM   528  C  CD2   . HIS A 1  78  ? 3.455   -20.854 -17.553 1.00 31.80 ? 204 HIS A CD2   1 
ATOM   529  C  CE1   . HIS A 1  78  ? 2.509   -20.234 -19.433 1.00 32.53 ? 204 HIS A CE1   1 
ATOM   530  N  NE2   . HIS A 1  78  ? 2.280   -20.474 -18.154 1.00 34.36 ? 204 HIS A NE2   1 
ATOM   531  N  N     . PHE A 1  79  ? 8.120   -23.947 -19.062 1.00 32.24 ? 205 PHE A N     1 
ATOM   532  C  CA    . PHE A 1  79  ? 9.529   -24.326 -19.097 1.00 31.54 ? 205 PHE A CA    1 
ATOM   533  C  C     . PHE A 1  79  ? 9.789   -25.118 -20.370 1.00 40.30 ? 205 PHE A C     1 
ATOM   534  O  O     . PHE A 1  79  ? 9.498   -26.314 -20.445 1.00 51.38 ? 205 PHE A O     1 
ATOM   535  C  CB    . PHE A 1  79  ? 9.930   -25.112 -17.853 1.00 29.23 ? 205 PHE A CB    1 
ATOM   536  C  CG    . PHE A 1  79  ? 10.319  -24.235 -16.706 1.00 28.15 ? 205 PHE A CG    1 
ATOM   537  C  CD1   . PHE A 1  79  ? 11.626  -23.810 -16.560 1.00 28.85 ? 205 PHE A CD1   1 
ATOM   538  C  CD2   . PHE A 1  79  ? 9.369   -23.792 -15.802 1.00 27.83 ? 205 PHE A CD2   1 
ATOM   539  C  CE1   . PHE A 1  79  ? 11.987  -22.978 -15.518 1.00 30.07 ? 205 PHE A CE1   1 
ATOM   540  C  CE2   . PHE A 1  79  ? 9.724   -22.958 -14.759 1.00 28.09 ? 205 PHE A CE2   1 
ATOM   541  C  CZ    . PHE A 1  79  ? 11.032  -22.549 -14.617 1.00 27.41 ? 205 PHE A CZ    1 
ATOM   542  N  N     . GLY A 1  80  ? 10.349  -24.435 -21.368 1.00 38.96 ? 206 GLY A N     1 
ATOM   543  C  CA    . GLY A 1  80  ? 10.826  -25.053 -22.571 1.00 41.79 ? 206 GLY A CA    1 
ATOM   544  C  C     . GLY A 1  80  ? 12.338  -25.094 -22.625 1.00 40.59 ? 206 GLY A C     1 
ATOM   545  O  O     . GLY A 1  80  ? 13.031  -25.032 -21.602 1.00 35.67 ? 206 GLY A O     1 
ATOM   546  N  N     . GLU A 1  81  ? 12.858  -25.185 -23.848 1.00 33.57 ? 207 GLU A N     1 
ATOM   547  C  CA    . GLU A 1  81  ? 14.297  -25.318 -24.043 1.00 40.42 ? 207 GLU A CA    1 
ATOM   548  C  C     . GLU A 1  81  ? 15.065  -24.223 -23.311 1.00 34.24 ? 207 GLU A C     1 
ATOM   549  O  O     . GLU A 1  81  ? 16.050  -24.500 -22.616 1.00 35.43 ? 207 GLU A O     1 
ATOM   550  C  CB    . GLU A 1  81  ? 14.618  -25.292 -25.539 1.00 52.65 ? 207 GLU A CB    1 
ATOM   551  C  CG    . GLU A 1  81  ? 16.096  -25.386 -25.866 1.00 66.26 ? 207 GLU A CG    1 
ATOM   552  C  CD    . GLU A 1  81  ? 16.348  -25.597 -27.349 1.00 78.47 ? 207 GLU A CD    1 
ATOM   553  O  OE1   . GLU A 1  81  ? 15.369  -25.608 -28.126 1.00 82.23 ? 207 GLU A OE1   1 
ATOM   554  O  OE2   . GLU A 1  81  ? 17.525  -25.757 -27.737 1.00 84.29 ? 207 GLU A OE2   1 
ATOM   555  N  N     . HIS A 1  82  ? 14.618  -22.974 -23.443 1.00 41.62 ? 208 HIS A N     1 
ATOM   556  C  CA    . HIS A 1  82  ? 15.432  -21.844 -23.006 1.00 39.76 ? 208 HIS A CA    1 
ATOM   557  C  C     . HIS A 1  82  ? 15.432  -21.717 -21.486 1.00 36.48 ? 208 HIS A C     1 
ATOM   558  O  O     . HIS A 1  82  ? 16.492  -21.706 -20.850 1.00 31.40 ? 208 HIS A O     1 
ATOM   559  C  CB    . HIS A 1  82  ? 14.934  -20.556 -23.669 1.00 37.66 ? 208 HIS A CB    1 
ATOM   560  C  CG    . HIS A 1  82  ? 15.945  -19.451 -23.679 1.00 37.54 ? 208 HIS A CG    1 
ATOM   561  N  ND1   . HIS A 1  82  ? 16.168  -18.657 -24.784 1.00 38.65 ? 208 HIS A ND1   1 
ATOM   562  C  CD2   . HIS A 1  82  ? 16.792  -19.006 -22.720 1.00 35.25 ? 208 HIS A CD2   1 
ATOM   563  C  CE1   . HIS A 1  82  ? 17.109  -17.773 -24.507 1.00 36.53 ? 208 HIS A CE1   1 
ATOM   564  N  NE2   . HIS A 1  82  ? 17.504  -17.962 -23.262 1.00 36.10 ? 208 HIS A NE2   1 
ATOM   565  N  N     . SER A 1  83  ? 14.251  -21.614 -20.876 1.00 31.92 ? 209 SER A N     1 
ATOM   566  C  CA    A SER A 1  83  ? 14.202  -21.481 -19.424 0.62 31.62 ? 209 SER A CA    1 
ATOM   567  C  CA    B SER A 1  83  ? 14.188  -21.487 -19.424 0.38 31.55 ? 209 SER A CA    1 
ATOM   568  C  C     . SER A 1  83  ? 14.766  -22.715 -18.735 1.00 31.08 ? 209 SER A C     1 
ATOM   569  O  O     . SER A 1  83  ? 15.345  -22.602 -17.649 1.00 29.38 ? 209 SER A O     1 
ATOM   570  C  CB    A SER A 1  83  ? 12.770  -21.216 -18.961 0.62 29.52 ? 209 SER A CB    1 
ATOM   571  C  CB    B SER A 1  83  ? 12.744  -21.254 -18.982 0.38 29.89 ? 209 SER A CB    1 
ATOM   572  O  OG    A SER A 1  83  ? 12.263  -20.044 -19.567 0.62 29.45 ? 209 SER A OG    1 
ATOM   573  O  OG    B SER A 1  83  ? 11.881  -22.219 -19.561 0.38 30.36 ? 209 SER A OG    1 
ATOM   574  N  N     . SER A 1  84  ? 14.625  -23.895 -19.353 1.00 34.47 ? 210 SER A N     1 
ATOM   575  C  CA    . SER A 1  84  ? 15.188  -25.108 -18.766 1.00 37.66 ? 210 SER A CA    1 
ATOM   576  C  C     . SER A 1  84  ? 16.712  -25.062 -18.765 1.00 39.07 ? 210 SER A C     1 
ATOM   577  O  O     . SER A 1  84  ? 17.350  -25.479 -17.790 1.00 34.77 ? 210 SER A O     1 
ATOM   578  C  CB    . SER A 1  84  ? 14.700  -26.350 -19.519 1.00 37.57 ? 210 SER A CB    1 
ATOM   579  O  OG    . SER A 1  84  ? 13.293  -26.519 -19.391 1.00 38.83 ? 210 SER A OG    1 
ATOM   580  N  N     . ARG A 1  85  ? 17.310  -24.575 -19.855 1.00 42.19 ? 211 ARG A N     1 
ATOM   581  C  CA    . ARG A 1  85  ? 18.764  -24.466 -19.917 1.00 41.23 ? 211 ARG A CA    1 
ATOM   582  C  C     . ARG A 1  85  ? 19.286  -23.492 -18.867 1.00 37.04 ? 211 ARG A C     1 
ATOM   583  O  O     . ARG A 1  85  ? 20.312  -23.750 -18.229 1.00 34.88 ? 211 ARG A O     1 
ATOM   584  C  CB    . ARG A 1  85  ? 19.193  -24.034 -21.321 1.00 44.59 ? 211 ARG A CB    1 
ATOM   585  C  CG    . ARG A 1  85  ? 20.689  -23.925 -21.517 1.00 49.00 ? 211 ARG A CG    1 
ATOM   586  C  CD    . ARG A 1  85  ? 21.025  -23.450 -22.920 1.00 52.59 ? 211 ARG A CD    1 
ATOM   587  N  N     . VAL A 1  86  ? 18.600  -22.360 -18.680 1.00 34.14 ? 212 VAL A N     1 
ATOM   588  C  CA    . VAL A 1  86  ? 18.986  -21.416 -17.631 1.00 36.58 ? 212 VAL A CA    1 
ATOM   589  C  C     . VAL A 1  86  ? 19.046  -22.124 -16.282 1.00 36.59 ? 212 VAL A C     1 
ATOM   590  O  O     . VAL A 1  86  ? 20.029  -22.007 -15.539 1.00 34.49 ? 212 VAL A O     1 
ATOM   591  C  CB    . VAL A 1  86  ? 18.015  -20.223 -17.599 1.00 39.03 ? 212 VAL A CB    1 
ATOM   592  C  CG1   . VAL A 1  86  ? 18.326  -19.306 -16.425 1.00 36.79 ? 212 VAL A CG1   1 
ATOM   593  C  CG2   . VAL A 1  86  ? 18.093  -19.444 -18.912 1.00 43.61 ? 212 VAL A CG2   1 
ATOM   594  N  N     . VAL A 1  87  ? 17.989  -22.866 -15.944 1.00 29.43 ? 213 VAL A N     1 
ATOM   595  C  CA    . VAL A 1  87  ? 17.958  -23.579 -14.669 1.00 31.35 ? 213 VAL A CA    1 
ATOM   596  C  C     . VAL A 1  87  ? 19.057  -24.627 -14.627 1.00 34.16 ? 213 VAL A C     1 
ATOM   597  O  O     . VAL A 1  87  ? 19.727  -24.803 -13.603 1.00 30.94 ? 213 VAL A O     1 
ATOM   598  C  CB    . VAL A 1  87  ? 16.578  -24.223 -14.440 1.00 32.87 ? 213 VAL A CB    1 
ATOM   599  C  CG1   . VAL A 1  87  ? 16.617  -25.195 -13.261 1.00 33.46 ? 213 VAL A CG1   1 
ATOM   600  C  CG2   . VAL A 1  87  ? 15.532  -23.160 -14.205 1.00 32.19 ? 213 VAL A CG2   1 
ATOM   601  N  N     . GLN A 1  88  ? 19.236  -25.357 -15.729 1.00 31.64 ? 214 GLN A N     1 
ATOM   602  C  CA    . GLN A 1  88  ? 20.246  -26.407 -15.784 1.00 36.07 ? 214 GLN A CA    1 
ATOM   603  C  C     . GLN A 1  88  ? 21.620  -25.858 -15.429 1.00 33.86 ? 214 GLN A C     1 
ATOM   604  O  O     . GLN A 1  88  ? 22.364  -26.462 -14.645 1.00 34.63 ? 214 GLN A O     1 
ATOM   605  C  CB    . GLN A 1  88  ? 20.262  -27.032 -17.182 1.00 46.76 ? 214 GLN A CB    1 
ATOM   606  C  CG    . GLN A 1  88  ? 21.325  -28.104 -17.390 1.00 59.22 ? 214 GLN A CG    1 
ATOM   607  C  CD    . GLN A 1  88  ? 21.345  -28.627 -18.815 1.00 70.58 ? 214 GLN A CD    1 
ATOM   608  O  OE1   . GLN A 1  88  ? 20.452  -28.328 -19.611 1.00 70.56 ? 214 GLN A OE1   1 
ATOM   609  N  NE2   . GLN A 1  88  ? 22.370  -29.408 -19.148 1.00 76.79 ? 214 GLN A NE2   1 
ATOM   610  N  N     . GLU A 1  89  ? 21.984  -24.715 -16.011 1.00 37.80 ? 215 GLU A N     1 
ATOM   611  C  CA    . GLU A 1  89  ? 23.306  -24.157 -15.760 1.00 36.84 ? 215 GLU A CA    1 
ATOM   612  C  C     . GLU A 1  89  ? 23.435  -23.692 -14.316 1.00 32.35 ? 215 GLU A C     1 
ATOM   613  O  O     . GLU A 1  89  ? 24.482  -23.886 -13.687 1.00 36.90 ? 215 GLU A O     1 
ATOM   614  C  CB    . GLU A 1  89  ? 23.590  -23.012 -16.731 1.00 45.75 ? 215 GLU A CB    1 
ATOM   615  C  CG    . GLU A 1  89  ? 23.605  -23.436 -18.187 1.00 53.93 ? 215 GLU A CG    1 
ATOM   616  C  CD    . GLU A 1  89  ? 24.068  -22.331 -19.120 1.00 65.54 ? 215 GLU A CD    1 
ATOM   617  O  OE1   . GLU A 1  89  ? 24.491  -21.259 -18.628 1.00 65.30 ? 215 GLU A OE1   1 
ATOM   618  O  OE2   . GLU A 1  89  ? 24.012  -22.539 -20.351 1.00 70.45 ? 215 GLU A OE2   1 
ATOM   619  N  N     . LEU A 1  90  ? 22.380  -23.099 -13.766 1.00 31.20 ? 216 LEU A N     1 
ATOM   620  C  CA    . LEU A 1  90  ? 22.424  -22.682 -12.370 1.00 32.48 ? 216 LEU A CA    1 
ATOM   621  C  C     . LEU A 1  90  ? 22.569  -23.882 -11.444 1.00 32.78 ? 216 LEU A C     1 
ATOM   622  O  O     . LEU A 1  90  ? 23.287  -23.815 -10.441 1.00 33.00 ? 216 LEU A O     1 
ATOM   623  C  CB    . LEU A 1  90  ? 21.169  -21.878 -12.027 1.00 32.26 ? 216 LEU A CB    1 
ATOM   624  C  CG    . LEU A 1  90  ? 21.140  -20.478 -12.641 1.00 37.12 ? 216 LEU A CG    1 
ATOM   625  C  CD1   . LEU A 1  90  ? 19.722  -19.938 -12.746 1.00 35.50 ? 216 LEU A CD1   1 
ATOM   626  C  CD2   . LEU A 1  90  ? 22.013  -19.535 -11.826 1.00 41.79 ? 216 LEU A CD2   1 
ATOM   627  N  N     . LEU A 1  91  ? 21.902  -24.995 -11.767 1.00 31.91 ? 217 LEU A N     1 
ATOM   628  C  CA    . LEU A 1  91  ? 22.033  -26.189 -10.939 1.00 36.19 ? 217 LEU A CA    1 
ATOM   629  C  C     . LEU A 1  91  ? 23.422  -26.802 -11.052 1.00 41.89 ? 217 LEU A C     1 
ATOM   630  O  O     . LEU A 1  91  ? 23.943  -27.333 -10.065 1.00 42.37 ? 217 LEU A O     1 
ATOM   631  C  CB    . LEU A 1  91  ? 20.973  -27.226 -11.325 1.00 34.30 ? 217 LEU A CB    1 
ATOM   632  C  CG    . LEU A 1  91  ? 19.511  -26.874 -11.028 1.00 38.39 ? 217 LEU A CG    1 
ATOM   633  C  CD1   . LEU A 1  91  ? 18.585  -28.005 -11.479 1.00 41.00 ? 217 LEU A CD1   1 
ATOM   634  C  CD2   . LEU A 1  91  ? 19.295  -26.577 -9.557  1.00 42.05 ? 217 LEU A CD2   1 
ATOM   635  N  N     . GLU A 1  92  ? 24.037  -26.735 -12.234 1.00 40.51 ? 218 GLU A N     1 
ATOM   636  C  CA    . GLU A 1  92  ? 25.334  -27.371 -12.451 1.00 50.84 ? 218 GLU A CA    1 
ATOM   637  C  C     . GLU A 1  92  ? 26.485  -26.483 -11.996 1.00 48.10 ? 218 GLU A C     1 
ATOM   638  O  O     . GLU A 1  92  ? 27.412  -26.953 -11.325 1.00 50.03 ? 218 GLU A O     1 
ATOM   639  C  CB    . GLU A 1  92  ? 25.510  -27.724 -13.929 1.00 65.39 ? 218 GLU A CB    1 
ATOM   640  C  CG    . GLU A 1  92  ? 24.548  -28.776 -14.448 1.00 77.06 ? 218 GLU A CG    1 
ATOM   641  C  CD    . GLU A 1  92  ? 24.698  -29.014 -15.939 1.00 84.14 ? 218 GLU A CD    1 
ATOM   642  O  OE1   . GLU A 1  92  ? 25.637  -28.452 -16.545 1.00 86.13 ? 218 GLU A OE1   1 
ATOM   643  O  OE2   . GLU A 1  92  ? 23.874  -29.762 -16.506 1.00 86.79 ? 218 GLU A OE2   1 
ATOM   644  N  N     . HIS A 1  93  ? 26.457  -25.204 -12.370 1.00 45.87 ? 219 HIS A N     1 
ATOM   645  C  CA    . HIS A 1  93  ? 27.586  -24.312 -12.155 1.00 44.98 ? 219 HIS A CA    1 
ATOM   646  C  C     . HIS A 1  93  ? 27.291  -23.176 -11.189 1.00 41.81 ? 219 HIS A C     1 
ATOM   647  O  O     . HIS A 1  93  ? 28.191  -22.377 -10.909 1.00 42.23 ? 219 HIS A O     1 
ATOM   648  C  CB    . HIS A 1  93  ? 28.050  -23.719 -13.492 1.00 48.37 ? 219 HIS A CB    1 
ATOM   649  C  CG    . HIS A 1  93  ? 28.224  -24.738 -14.575 1.00 52.65 ? 219 HIS A CG    1 
ATOM   650  N  ND1   . HIS A 1  93  ? 29.220  -25.690 -14.547 1.00 55.46 ? 219 HIS A ND1   1 
ATOM   651  C  CD2   . HIS A 1  93  ? 27.530  -24.952 -15.718 1.00 52.26 ? 219 HIS A CD2   1 
ATOM   652  C  CE1   . HIS A 1  93  ? 29.129  -26.450 -15.623 1.00 56.27 ? 219 HIS A CE1   1 
ATOM   653  N  NE2   . HIS A 1  93  ? 28.111  -26.024 -16.350 1.00 55.68 ? 219 HIS A NE2   1 
ATOM   654  N  N     . GLY A 1  94  ? 26.068  -23.073 -10.674 1.00 43.41 ? 220 GLY A N     1 
ATOM   655  C  CA    . GLY A 1  94  ? 25.702  -21.962 -9.822  1.00 41.34 ? 220 GLY A CA    1 
ATOM   656  C  C     . GLY A 1  94  ? 25.578  -20.632 -10.529 1.00 39.84 ? 220 GLY A C     1 
ATOM   657  O  O     . GLY A 1  94  ? 25.258  -19.632 -9.877  1.00 35.07 ? 220 GLY A O     1 
ATOM   658  N  N     A VAL A 1  95  ? 25.799  -20.596 -11.843 0.37 41.82 ? 221 VAL A N     1 
ATOM   659  N  N     B VAL A 1  95  ? 25.831  -20.574 -11.833 0.63 41.75 ? 221 VAL A N     1 
ATOM   660  C  CA    A VAL A 1  95  ? 25.784  -19.367 -12.626 0.37 42.03 ? 221 VAL A CA    1 
ATOM   661  C  CA    B VAL A 1  95  ? 25.694  -19.338 -12.590 0.63 41.90 ? 221 VAL A CA    1 
ATOM   662  C  C     A VAL A 1  95  ? 25.293  -19.713 -14.025 0.37 40.91 ? 221 VAL A C     1 
ATOM   663  C  C     B VAL A 1  95  ? 25.290  -19.696 -14.010 0.63 40.62 ? 221 VAL A C     1 
ATOM   664  O  O     A VAL A 1  95  ? 25.512  -20.823 -14.518 0.37 41.15 ? 221 VAL A O     1 
ATOM   665  O  O     B VAL A 1  95  ? 25.573  -20.794 -14.498 0.63 40.62 ? 221 VAL A O     1 
ATOM   666  C  CB    A VAL A 1  95  ? 27.190  -18.717 -12.674 0.37 43.89 ? 221 VAL A CB    1 
ATOM   667  C  CB    B VAL A 1  95  ? 26.996  -18.500 -12.581 0.63 44.13 ? 221 VAL A CB    1 
ATOM   668  C  CG1   A VAL A 1  95  ? 27.171  -17.450 -13.500 0.37 42.30 ? 221 VAL A CG1   1 
ATOM   669  C  CG1   B VAL A 1  95  ? 27.246  -17.910 -11.201 0.63 45.50 ? 221 VAL A CG1   1 
ATOM   670  C  CG2   A VAL A 1  95  ? 27.705  -18.424 -11.268 0.37 44.81 ? 221 VAL A CG2   1 
ATOM   671  C  CG2   B VAL A 1  95  ? 28.182  -19.347 -13.030 0.63 42.75 ? 221 VAL A CG2   1 
ATOM   672  N  N     . CYS A 1  96  ? 24.625  -18.755 -14.670 1.00 41.40 ? 222 CYS A N     1 
ATOM   673  C  CA    . CYS A 1  96  ? 24.171  -18.908 -16.049 1.00 39.00 ? 222 CYS A CA    1 
ATOM   674  C  C     . CYS A 1  96  ? 24.848  -17.845 -16.903 1.00 36.15 ? 222 CYS A C     1 
ATOM   675  O  O     . CYS A 1  96  ? 24.664  -16.643 -16.671 1.00 33.00 ? 222 CYS A O     1 
ATOM   676  C  CB    . CYS A 1  96  ? 22.650  -18.792 -16.149 1.00 40.94 ? 222 CYS A CB    1 
ATOM   677  S  SG    . CYS A 1  96  ? 22.031  -18.784 -17.859 1.00 42.46 ? 222 CYS A SG    1 
ATOM   678  N  N     . GLU A 1  97  ? 25.615  -18.289 -17.899 1.00 36.99 ? 223 GLU A N     1 
ATOM   679  C  CA    . GLU A 1  97  ? 26.445  -17.364 -18.662 1.00 36.40 ? 223 GLU A CA    1 
ATOM   680  C  C     . GLU A 1  97  ? 25.608  -16.265 -19.297 1.00 33.45 ? 223 GLU A C     1 
ATOM   681  O  O     . GLU A 1  97  ? 26.002  -15.093 -19.287 1.00 35.02 ? 223 GLU A O     1 
ATOM   682  C  CB    . GLU A 1  97  ? 27.233  -18.121 -19.731 1.00 40.94 ? 223 GLU A CB    1 
ATOM   683  C  CG    . GLU A 1  97  ? 28.124  -17.230 -20.574 1.00 40.97 ? 223 GLU A CG    1 
ATOM   684  N  N     . GLU A 1  98  ? 24.450  -16.620 -19.853 1.00 32.85 ? 224 GLU A N     1 
ATOM   685  C  CA    . GLU A 1  98  ? 23.595  -15.616 -20.479 1.00 36.27 ? 224 GLU A CA    1 
ATOM   686  C  C     . GLU A 1  98  ? 23.157  -14.566 -19.468 1.00 32.35 ? 224 GLU A C     1 
ATOM   687  O  O     . GLU A 1  98  ? 23.196  -13.362 -19.748 1.00 31.97 ? 224 GLU A O     1 
ATOM   688  C  CB    . GLU A 1  98  ? 22.372  -16.279 -21.120 1.00 36.89 ? 224 GLU A CB    1 
ATOM   689  C  CG    . GLU A 1  98  ? 21.558  -15.306 -21.970 1.00 39.48 ? 224 GLU A CG    1 
ATOM   690  C  CD    . GLU A 1  98  ? 20.239  -15.875 -22.460 1.00 42.17 ? 224 GLU A CD    1 
ATOM   691  O  OE1   . GLU A 1  98  ? 19.930  -17.043 -22.152 1.00 41.72 ? 224 GLU A OE1   1 
ATOM   692  O  OE2   . GLU A 1  98  ? 19.509  -15.137 -23.156 1.00 42.75 ? 224 GLU A OE2   1 
ATOM   693  N  N     . VAL A 1  99  ? 22.720  -15.007 -18.287 1.00 30.21 ? 225 VAL A N     1 
ATOM   694  C  CA    . VAL A 1  99  ? 22.269  -14.074 -17.260 1.00 28.66 ? 225 VAL A CA    1 
ATOM   695  C  C     . VAL A 1  99  ? 23.395  -13.129 -16.869 1.00 30.60 ? 225 VAL A C     1 
ATOM   696  O  O     . VAL A 1  99  ? 23.187  -11.918 -16.713 1.00 28.39 ? 225 VAL A O     1 
ATOM   697  C  CB    . VAL A 1  99  ? 21.732  -14.850 -16.042 1.00 32.92 ? 225 VAL A CB    1 
ATOM   698  C  CG1   . VAL A 1  99  ? 21.382  -13.902 -14.911 1.00 32.61 ? 225 VAL A CG1   1 
ATOM   699  C  CG2   . VAL A 1  99  ? 20.513  -15.688 -16.443 1.00 33.36 ? 225 VAL A CG2   1 
ATOM   700  N  N     . GLU A 1  100 ? 24.602  -13.666 -16.682 1.00 34.32 ? 226 GLU A N     1 
ATOM   701  C  CA    . GLU A 1  100 ? 25.715  -12.824 -16.258 1.00 37.04 ? 226 GLU A CA    1 
ATOM   702  C  C     . GLU A 1  100 ? 26.118  -11.857 -17.356 1.00 33.05 ? 226 GLU A C     1 
ATOM   703  O  O     . GLU A 1  100 ? 26.421  -10.691 -17.084 1.00 32.35 ? 226 GLU A O     1 
ATOM   704  C  CB    . GLU A 1  100 ? 26.896  -13.691 -15.839 1.00 35.58 ? 226 GLU A CB    1 
ATOM   705  C  CG    . GLU A 1  100 ? 26.577  -14.610 -14.679 1.00 39.79 ? 226 GLU A CG    1 
ATOM   706  C  CD    . GLU A 1  100 ? 26.010  -13.862 -13.488 1.00 45.28 ? 226 GLU A CD    1 
ATOM   707  O  OE1   . GLU A 1  100 ? 26.637  -12.867 -13.066 1.00 45.85 ? 226 GLU A OE1   1 
ATOM   708  O  OE2   . GLU A 1  100 ? 24.929  -14.249 -12.992 1.00 46.91 ? 226 GLU A OE2   1 
ATOM   709  N  N     . ARG A 1  101 ? 26.092  -12.311 -18.607 1.00 31.38 ? 227 ARG A N     1 
ATOM   710  C  CA    . ARG A 1  101 ? 26.371  -11.414 -19.718 1.00 38.19 ? 227 ARG A CA    1 
ATOM   711  C  C     . ARG A 1  101 ? 25.369  -10.261 -19.755 1.00 32.62 ? 227 ARG A C     1 
ATOM   712  O  O     . ARG A 1  101 ? 25.748  -9.110  -19.995 1.00 33.60 ? 227 ARG A O     1 
ATOM   713  C  CB    . ARG A 1  101 ? 26.364  -12.208 -21.022 1.00 52.56 ? 227 ARG A CB    1 
ATOM   714  C  CG    . ARG A 1  101 ? 26.504  -11.374 -22.282 1.00 67.96 ? 227 ARG A CG    1 
ATOM   715  C  CD    . ARG A 1  101 ? 27.086  -12.189 -23.437 1.00 79.50 ? 227 ARG A CD    1 
ATOM   716  N  NE    . ARG A 1  101 ? 26.870  -13.629 -23.290 1.00 88.24 ? 227 ARG A NE    1 
ATOM   717  C  CZ    . ARG A 1  101 ? 25.763  -14.273 -23.653 1.00 91.93 ? 227 ARG A CZ    1 
ATOM   718  N  NH1   . ARG A 1  101 ? 24.741  -13.615 -24.187 1.00 93.33 ? 227 ARG A NH1   1 
ATOM   719  N  NH2   . ARG A 1  101 ? 25.676  -15.585 -23.475 1.00 91.01 ? 227 ARG A NH2   1 
ATOM   720  N  N     . VAL A 1  102 ? 24.090  -10.538 -19.489 1.00 30.22 ? 228 VAL A N     1 
ATOM   721  C  CA    . VAL A 1  102 ? 23.108  -9.456  -19.416 1.00 29.45 ? 228 VAL A CA    1 
ATOM   722  C  C     . VAL A 1  102 ? 23.440  -8.521  -18.262 1.00 32.61 ? 228 VAL A C     1 
ATOM   723  O  O     . VAL A 1  102 ? 23.506  -7.298  -18.432 1.00 32.59 ? 228 VAL A O     1 
ATOM   724  C  CB    . VAL A 1  102 ? 21.678  -10.017 -19.288 1.00 34.75 ? 228 VAL A CB    1 
ATOM   725  C  CG1   . VAL A 1  102 ? 20.666  -8.877  -19.024 1.00 32.80 ? 228 VAL A CG1   1 
ATOM   726  C  CG2   . VAL A 1  102 ? 21.285  -10.782 -20.544 1.00 37.15 ? 228 VAL A CG2   1 
ATOM   727  N  N     . ARG A 1  103 ? 23.649  -9.082  -17.065 1.00 32.55 ? 229 ARG A N     1 
ATOM   728  C  CA    . ARG A 1  103 ? 23.948  -8.256  -15.898 1.00 38.26 ? 229 ARG A CA    1 
ATOM   729  C  C     . ARG A 1  103 ? 25.046  -7.246  -16.196 1.00 41.22 ? 229 ARG A C     1 
ATOM   730  O  O     . ARG A 1  103 ? 24.947  -6.076  -15.805 1.00 44.30 ? 229 ARG A O     1 
ATOM   731  C  CB    . ARG A 1  103 ? 24.385  -9.122  -14.717 1.00 42.48 ? 229 ARG A CB    1 
ATOM   732  C  CG    . ARG A 1  103 ? 23.306  -9.923  -14.040 1.00 49.90 ? 229 ARG A CG    1 
ATOM   733  C  CD    . ARG A 1  103 ? 23.888  -10.587 -12.800 1.00 55.82 ? 229 ARG A CD    1 
ATOM   734  N  NE    . ARG A 1  103 ? 23.166  -11.792 -12.407 1.00 62.16 ? 229 ARG A NE    1 
ATOM   735  C  CZ    . ARG A 1  103 ? 22.106  -11.810 -11.605 1.00 66.90 ? 229 ARG A CZ    1 
ATOM   736  N  NH1   . ARG A 1  103 ? 21.622  -10.683 -11.098 1.00 66.68 ? 229 ARG A NH1   1 
ATOM   737  N  NH2   . ARG A 1  103 ? 21.527  -12.965 -11.310 1.00 69.66 ? 229 ARG A NH2   1 
ATOM   738  N  N     . ARG A 1  104 ? 26.108  -7.687  -16.875 1.00 43.98 ? 230 ARG A N     1 
ATOM   739  C  CA    . ARG A 1  104 ? 27.286  -6.862  -17.111 1.00 45.01 ? 230 ARG A CA    1 
ATOM   740  C  C     . ARG A 1  104 ? 27.136  -5.913  -18.293 1.00 41.56 ? 230 ARG A C     1 
ATOM   741  O  O     . ARG A 1  104 ? 27.948  -4.994  -18.428 1.00 41.90 ? 230 ARG A O     1 
ATOM   742  C  CB    . ARG A 1  104 ? 28.517  -7.746  -17.360 1.00 49.13 ? 230 ARG A CB    1 
ATOM   743  C  CG    . ARG A 1  104 ? 28.838  -8.739  -16.258 1.00 53.87 ? 230 ARG A CG    1 
ATOM   744  C  CD    . ARG A 1  104 ? 30.204  -9.390  -16.486 1.00 55.51 ? 230 ARG A CD    1 
ATOM   745  N  NE    . ARG A 1  104 ? 30.328  -10.003 -17.811 1.00 51.83 ? 230 ARG A NE    1 
ATOM   746  C  CZ    . ARG A 1  104 ? 30.115  -11.289 -18.080 1.00 49.78 ? 230 ARG A CZ    1 
ATOM   747  N  NH1   . ARG A 1  104 ? 29.764  -12.135 -17.118 1.00 50.04 ? 230 ARG A NH1   1 
ATOM   748  N  NH2   . ARG A 1  104 ? 30.260  -11.734 -19.320 1.00 46.60 ? 230 ARG A NH2   1 
ATOM   749  N  N     . SER A 1  105 ? 26.149  -6.115  -19.160 1.00 35.00 ? 231 SER A N     1 
ATOM   750  C  CA    . SER A 1  105 ? 26.099  -5.352  -20.397 1.00 37.06 ? 231 SER A CA    1 
ATOM   751  C  C     . SER A 1  105 ? 25.783  -3.889  -20.119 1.00 36.79 ? 231 SER A C     1 
ATOM   752  O  O     . SER A 1  105 ? 24.940  -3.562  -19.278 1.00 35.28 ? 231 SER A O     1 
ATOM   753  C  CB    . SER A 1  105 ? 25.052  -5.932  -21.345 1.00 35.34 ? 231 SER A CB    1 
ATOM   754  O  OG    . SER A 1  105 ? 23.761  -5.791  -20.799 1.00 35.97 ? 231 SER A OG    1 
ATOM   755  N  N     A GLU A 1  106 ? 26.469  -3.003  -20.842 0.56 38.68 ? 232 GLU A N     1 
ATOM   756  N  N     B GLU A 1  106 ? 26.476  -3.004  -20.839 0.44 38.79 ? 232 GLU A N     1 
ATOM   757  C  CA    A GLU A 1  106 ? 26.195  -1.576  -20.722 0.56 39.03 ? 232 GLU A CA    1 
ATOM   758  C  CA    B GLU A 1  106 ? 26.207  -1.574  -20.737 0.44 39.20 ? 232 GLU A CA    1 
ATOM   759  C  C     A GLU A 1  106 ? 24.746  -1.268  -21.079 0.56 38.29 ? 232 GLU A C     1 
ATOM   760  C  C     B GLU A 1  106 ? 24.762  -1.255  -21.098 0.44 38.31 ? 232 GLU A C     1 
ATOM   761  O  O     A GLU A 1  106 ? 24.123  -0.388  -20.475 0.56 37.63 ? 232 GLU A O     1 
ATOM   762  O  O     B GLU A 1  106 ? 24.159  -0.350  -20.511 0.44 37.82 ? 232 GLU A O     1 
ATOM   763  C  CB    A GLU A 1  106 ? 27.153  -0.787  -21.619 0.56 42.26 ? 232 GLU A CB    1 
ATOM   764  C  CB    B GLU A 1  106 ? 27.175  -0.810  -21.645 0.44 42.26 ? 232 GLU A CB    1 
ATOM   765  C  CG    A GLU A 1  106 ? 27.099  0.717   -21.415 0.56 43.66 ? 232 GLU A CG    1 
ATOM   766  C  CG    B GLU A 1  106 ? 27.037  0.702   -21.611 0.44 43.63 ? 232 GLU A CG    1 
ATOM   767  C  CD    A GLU A 1  106 ? 28.135  1.455   -22.243 0.56 46.27 ? 232 GLU A CD    1 
ATOM   768  C  CD    B GLU A 1  106 ? 28.123  1.395   -22.418 0.44 46.23 ? 232 GLU A CD    1 
ATOM   769  O  OE1   A GLU A 1  106 ? 28.479  0.972   -23.344 0.56 46.53 ? 232 GLU A OE1   1 
ATOM   770  O  OE1   B GLU A 1  106 ? 29.091  0.714   -22.820 0.44 46.41 ? 232 GLU A OE1   1 
ATOM   771  O  OE2   A GLU A 1  106 ? 28.609  2.517   -21.787 0.56 46.77 ? 232 GLU A OE2   1 
ATOM   772  O  OE2   B GLU A 1  106 ? 28.011  2.618   -22.652 0.44 47.15 ? 232 GLU A OE2   1 
ATOM   773  N  N     . ARG A 1  107 ? 24.190  -1.993  -22.051 1.00 37.90 ? 233 ARG A N     1 
ATOM   774  C  CA    . ARG A 1  107 ? 22.798  -1.779  -22.437 1.00 37.51 ? 233 ARG A CA    1 
ATOM   775  C  C     . ARG A 1  107 ? 21.854  -2.056  -21.270 1.00 33.29 ? 233 ARG A C     1 
ATOM   776  O  O     . ARG A 1  107 ? 20.991  -1.231  -20.943 1.00 33.75 ? 233 ARG A O     1 
ATOM   777  C  CB    . ARG A 1  107 ? 22.464  -2.669  -23.640 1.00 39.47 ? 233 ARG A CB    1 
ATOM   778  C  CG    . ARG A 1  107 ? 20.990  -2.772  -24.020 1.00 42.24 ? 233 ARG A CG    1 
ATOM   779  C  CD    . ARG A 1  107 ? 20.464  -1.512  -24.684 1.00 38.27 ? 233 ARG A CD    1 
ATOM   780  N  NE    . ARG A 1  107 ? 19.048  -1.654  -25.017 1.00 36.13 ? 233 ARG A NE    1 
ATOM   781  C  CZ    . ARG A 1  107 ? 18.342  -0.762  -25.701 1.00 41.69 ? 233 ARG A CZ    1 
ATOM   782  N  NH1   . ARG A 1  107 ? 18.913  0.352   -26.137 1.00 44.81 ? 233 ARG A NH1   1 
ATOM   783  N  NH2   . ARG A 1  107 ? 17.057  -0.987  -25.951 1.00 41.88 ? 233 ARG A NH2   1 
ATOM   784  N  N     . TYR A 1  108 ? 22.000  -3.218  -20.632 1.00 30.10 ? 234 TYR A N     1 
ATOM   785  C  CA    . TYR A 1  108 ? 21.100  -3.585  -19.542 1.00 29.23 ? 234 TYR A CA    1 
ATOM   786  C  C     . TYR A 1  108 ? 21.218  -2.605  -18.382 1.00 28.41 ? 234 TYR A C     1 
ATOM   787  O  O     . TYR A 1  108 ? 20.209  -2.110  -17.865 1.00 27.61 ? 234 TYR A O     1 
ATOM   788  C  CB    . TYR A 1  108 ? 21.393  -5.016  -19.077 1.00 31.69 ? 234 TYR A CB    1 
ATOM   789  C  CG    . TYR A 1  108 ? 20.649  -5.409  -17.818 1.00 32.83 ? 234 TYR A CG    1 
ATOM   790  C  CD1   . TYR A 1  108 ? 19.332  -5.855  -17.873 1.00 35.40 ? 234 TYR A CD1   1 
ATOM   791  C  CD2   . TYR A 1  108 ? 21.256  -5.316  -16.575 1.00 35.50 ? 234 TYR A CD2   1 
ATOM   792  C  CE1   . TYR A 1  108 ? 18.643  -6.201  -16.719 1.00 35.04 ? 234 TYR A CE1   1 
ATOM   793  C  CE2   . TYR A 1  108 ? 20.582  -5.661  -15.419 1.00 38.28 ? 234 TYR A CE2   1 
ATOM   794  C  CZ    . TYR A 1  108 ? 19.274  -6.106  -15.497 1.00 38.86 ? 234 TYR A CZ    1 
ATOM   795  O  OH    . TYR A 1  108 ? 18.602  -6.444  -14.345 1.00 37.06 ? 234 TYR A OH    1 
ATOM   796  N  N     . GLN A 1  109 ? 22.447  -2.302  -17.962 1.00 29.97 ? 235 GLN A N     1 
ATOM   797  C  CA    . GLN A 1  109 ? 22.635  -1.419  -16.814 1.00 35.72 ? 235 GLN A CA    1 
ATOM   798  C  C     . GLN A 1  109 ? 22.063  -0.033  -17.075 1.00 30.55 ? 235 GLN A C     1 
ATOM   799  O  O     . GLN A 1  109 ? 21.461  0.578   -16.183 1.00 31.63 ? 235 GLN A O     1 
ATOM   800  C  CB    . GLN A 1  109 ? 24.120  -1.323  -16.469 1.00 42.46 ? 235 GLN A CB    1 
ATOM   801  C  CG    . GLN A 1  109 ? 24.724  -2.632  -16.003 1.00 54.71 ? 235 GLN A CG    1 
ATOM   802  C  CD    . GLN A 1  109 ? 26.206  -2.505  -15.687 1.00 68.62 ? 235 GLN A CD    1 
ATOM   803  O  OE1   . GLN A 1  109 ? 26.732  -1.397  -15.564 1.00 70.53 ? 235 GLN A OE1   1 
ATOM   804  N  NE2   . GLN A 1  109 ? 26.887  -3.641  -15.561 1.00 71.38 ? 235 GLN A NE2   1 
ATOM   805  N  N     . THR A 1  110 ? 22.235  0.483   -18.291 1.00 34.26 ? 236 THR A N     1 
ATOM   806  C  CA    . THR A 1  110 ? 21.769  1.834   -18.581 1.00 34.17 ? 236 THR A CA    1 
ATOM   807  C  C     . THR A 1  110 ? 20.253  1.874   -18.738 1.00 34.38 ? 236 THR A C     1 
ATOM   808  O  O     . THR A 1  110 ? 19.597  2.795   -18.238 1.00 33.82 ? 236 THR A O     1 
ATOM   809  C  CB    . THR A 1  110 ? 22.457  2.361   -19.837 1.00 41.03 ? 236 THR A CB    1 
ATOM   810  O  OG1   . THR A 1  110 ? 23.878  2.232   -19.694 1.00 43.45 ? 236 THR A OG1   1 
ATOM   811  C  CG2   . THR A 1  110 ? 22.104  3.834   -20.061 1.00 43.71 ? 236 THR A CG2   1 
ATOM   812  N  N     . MET A 1  111 ? 19.678  0.891   -19.434 1.00 31.44 ? 237 MET A N     1 
ATOM   813  C  CA    . MET A 1  111 ? 18.227  0.834   -19.568 1.00 36.14 ? 237 MET A CA    1 
ATOM   814  C  C     . MET A 1  111 ? 17.563  0.663   -18.209 1.00 34.83 ? 237 MET A C     1 
ATOM   815  O  O     . MET A 1  111 ? 16.509  1.253   -17.942 1.00 28.27 ? 237 MET A O     1 
ATOM   816  C  CB    . MET A 1  111 ? 17.829  -0.307  -20.505 1.00 34.64 ? 237 MET A CB    1 
ATOM   817  C  CG    . MET A 1  111 ? 18.196  -0.073  -21.953 1.00 35.23 ? 237 MET A CG    1 
ATOM   818  S  SD    . MET A 1  111 ? 17.274  1.289   -22.697 1.00 36.70 ? 237 MET A SD    1 
ATOM   819  C  CE    . MET A 1  111 ? 15.634  0.581   -22.782 1.00 37.97 ? 237 MET A CE    1 
ATOM   820  N  N     . LYS A 1  112 ? 18.158  -0.157  -17.342 1.00 29.59 ? 238 LYS A N     1 
ATOM   821  C  CA    . LYS A 1  112 ? 17.644  -0.297  -15.987 1.00 33.43 ? 238 LYS A CA    1 
ATOM   822  C  C     . LYS A 1  112 ? 17.714  1.031   -15.250 1.00 32.56 ? 238 LYS A C     1 
ATOM   823  O  O     . LYS A 1  112 ? 16.733  1.470   -14.637 1.00 32.83 ? 238 LYS A O     1 
ATOM   824  C  CB    . LYS A 1  112 ? 18.433  -1.372  -15.238 1.00 37.15 ? 238 LYS A CB    1 
ATOM   825  C  CG    . LYS A 1  112 ? 17.865  -1.710  -13.867 1.00 43.88 ? 238 LYS A CG    1 
ATOM   826  C  CD    . LYS A 1  112 ? 18.431  -3.023  -13.334 1.00 51.11 ? 238 LYS A CD    1 
ATOM   827  C  CE    . LYS A 1  112 ? 17.824  -3.403  -11.986 1.00 55.55 ? 238 LYS A CE    1 
ATOM   828  N  NZ    . LYS A 1  112 ? 16.352  -3.651  -12.060 1.00 56.79 ? 238 LYS A NZ    1 
ATOM   829  N  N     . LEU A 1  113 ? 18.877  1.685   -15.301 1.00 30.87 ? 239 LEU A N     1 
ATOM   830  C  CA    . LEU A 1  113 ? 19.048  2.971   -14.635 1.00 34.48 ? 239 LEU A CA    1 
ATOM   831  C  C     . LEU A 1  113 ? 18.034  3.987   -15.135 1.00 34.21 ? 239 LEU A C     1 
ATOM   832  O  O     . LEU A 1  113 ? 17.408  4.693   -14.335 1.00 35.12 ? 239 LEU A O     1 
ATOM   833  C  CB    . LEU A 1  113 ? 20.477  3.481   -14.854 1.00 36.80 ? 239 LEU A CB    1 
ATOM   834  C  CG    . LEU A 1  113 ? 20.842  4.854   -14.280 1.00 38.48 ? 239 LEU A CG    1 
ATOM   835  C  CD1   . LEU A 1  113 ? 20.821  4.829   -12.764 1.00 40.42 ? 239 LEU A CD1   1 
ATOM   836  C  CD2   . LEU A 1  113 ? 22.209  5.299   -14.797 1.00 40.23 ? 239 LEU A CD2   1 
ATOM   837  N  N     . PHE A 1  114 ? 17.835  4.059   -16.453 1.00 32.08 ? 240 PHE A N     1 
ATOM   838  C  CA    . PHE A 1  114 ? 16.967  5.089   -17.016 1.00 34.35 ? 240 PHE A CA    1 
ATOM   839  C  C     . PHE A 1  114 ? 15.492  4.774   -16.765 1.00 35.58 ? 240 PHE A C     1 
ATOM   840  O  O     . PHE A 1  114 ? 14.721  5.651   -16.353 1.00 34.29 ? 240 PHE A O     1 
ATOM   841  C  CB    . PHE A 1  114 ? 17.237  5.246   -18.518 1.00 33.02 ? 240 PHE A CB    1 
ATOM   842  C  CG    . PHE A 1  114 ? 18.507  6.007   -18.861 1.00 31.03 ? 240 PHE A CG    1 
ATOM   843  C  CD1   . PHE A 1  114 ? 19.282  6.617   -17.887 1.00 32.92 ? 240 PHE A CD1   1 
ATOM   844  C  CD2   . PHE A 1  114 ? 18.904  6.123   -20.181 1.00 31.78 ? 240 PHE A CD2   1 
ATOM   845  C  CE1   . PHE A 1  114 ? 20.432  7.309   -18.225 1.00 33.44 ? 240 PHE A CE1   1 
ATOM   846  C  CE2   . PHE A 1  114 ? 20.056  6.814   -20.527 1.00 34.76 ? 240 PHE A CE2   1 
ATOM   847  C  CZ    . PHE A 1  114 ? 20.816  7.413   -19.550 1.00 34.95 ? 240 PHE A CZ    1 
ATOM   848  N  N     . THR A 1  115 ? 15.072  3.530   -17.005 1.00 30.66 ? 241 THR A N     1 
ATOM   849  C  CA    . THR A 1  115 ? 13.659  3.203   -16.831 1.00 31.55 ? 241 THR A CA    1 
ATOM   850  C  C     . THR A 1  115 ? 13.216  3.303   -15.379 1.00 34.59 ? 241 THR A C     1 
ATOM   851  O  O     . THR A 1  115 ? 12.020  3.468   -15.128 1.00 35.05 ? 241 THR A O     1 
ATOM   852  C  CB    . THR A 1  115 ? 13.344  1.801   -17.347 1.00 31.52 ? 241 THR A CB    1 
ATOM   853  O  OG1   . THR A 1  115 ? 14.162  0.835   -16.671 1.00 29.90 ? 241 THR A OG1   1 
ATOM   854  C  CG2   . THR A 1  115 ? 13.557  1.726   -18.850 1.00 30.89 ? 241 THR A CG2   1 
ATOM   855  N  N     . GLN A 1  116 ? 14.141  3.191   -14.422 1.00 36.44 ? 242 GLN A N     1 
ATOM   856  C  CA    . GLN A 1  116 ? 13.788  3.336   -13.016 1.00 36.70 ? 242 GLN A CA    1 
ATOM   857  C  C     . GLN A 1  116 ? 13.490  4.778   -12.640 1.00 36.67 ? 242 GLN A C     1 
ATOM   858  O  O     . GLN A 1  116 ? 12.992  5.027   -11.534 1.00 36.87 ? 242 GLN A O     1 
ATOM   859  C  CB    . GLN A 1  116 ? 14.910  2.785   -12.135 1.00 42.41 ? 242 GLN A CB    1 
ATOM   860  C  CG    . GLN A 1  116 ? 14.828  1.288   -11.926 1.00 48.55 ? 242 GLN A CG    1 
ATOM   861  C  CD    . GLN A 1  116 ? 16.074  0.708   -11.277 1.00 54.33 ? 242 GLN A CD    1 
ATOM   862  O  OE1   . GLN A 1  116 ? 17.067  1.408   -11.047 1.00 53.58 ? 242 GLN A OE1   1 
ATOM   863  N  NE2   . GLN A 1  116 ? 16.028  -0.583  -10.988 1.00 55.97 ? 242 GLN A NE2   1 
ATOM   864  N  N     . ILE A 1  117 ? 13.767  5.726   -13.532 1.00 30.83 ? 243 ILE A N     1 
ATOM   865  C  CA    . ILE A 1  117 ? 13.388  7.110   -13.303 1.00 33.04 ? 243 ILE A CA    1 
ATOM   866  C  C     . ILE A 1  117 ? 11.882  7.252   -13.476 1.00 32.11 ? 243 ILE A C     1 
ATOM   867  O  O     . ILE A 1  117 ? 11.321  6.853   -14.504 1.00 30.16 ? 243 ILE A O     1 
ATOM   868  C  CB    . ILE A 1  117 ? 14.127  8.042   -14.272 1.00 36.38 ? 243 ILE A CB    1 
ATOM   869  C  CG1   . ILE A 1  117 ? 15.645  7.834   -14.189 1.00 39.61 ? 243 ILE A CG1   1 
ATOM   870  C  CG2   . ILE A 1  117 ? 13.765  9.491   -13.977 1.00 36.90 ? 243 ILE A CG2   1 
ATOM   871  C  CD1   . ILE A 1  117 ? 16.408  8.526   -15.307 1.00 38.80 ? 243 ILE A CD1   1 
ATOM   872  N  N     . PHE A 1  118 ? 11.227  7.841   -12.478 1.00 32.30 ? 244 PHE A N     1 
ATOM   873  C  CA    . PHE A 1  118 ? 9.823   8.218   -12.600 1.00 26.50 ? 244 PHE A CA    1 
ATOM   874  C  C     . PHE A 1  118 ? 9.647   9.191   -13.762 1.00 29.95 ? 244 PHE A C     1 
ATOM   875  O  O     . PHE A 1  118 ? 10.247  10.270  -13.780 1.00 30.68 ? 244 PHE A O     1 
ATOM   876  C  CB    . PHE A 1  118 ? 9.350   8.844   -11.289 1.00 30.42 ? 244 PHE A CB    1 
ATOM   877  C  CG    . PHE A 1  118 ? 7.910   9.285   -11.301 1.00 33.43 ? 244 PHE A CG    1 
ATOM   878  C  CD1   . PHE A 1  118 ? 6.889   8.359   -11.435 1.00 31.74 ? 244 PHE A CD1   1 
ATOM   879  C  CD2   . PHE A 1  118 ? 7.582   10.622  -11.153 1.00 34.01 ? 244 PHE A CD2   1 
ATOM   880  C  CE1   . PHE A 1  118 ? 5.560   8.762   -11.439 1.00 33.18 ? 244 PHE A CE1   1 
ATOM   881  C  CE2   . PHE A 1  118 ? 6.251   11.031  -11.153 1.00 34.28 ? 244 PHE A CE2   1 
ATOM   882  C  CZ    . PHE A 1  118 ? 5.244   10.097  -11.297 1.00 34.72 ? 244 PHE A CZ    1 
ATOM   883  N  N     . GLY A 1  119 ? 8.839   8.801   -14.743 1.00 27.10 ? 245 GLY A N     1 
ATOM   884  C  CA    . GLY A 1  119 ? 8.626   9.604   -15.929 1.00 26.66 ? 245 GLY A CA    1 
ATOM   885  C  C     . GLY A 1  119 ? 9.379   9.133   -17.152 1.00 35.41 ? 245 GLY A C     1 
ATOM   886  O  O     . GLY A 1  119 ? 9.241   9.746   -18.221 1.00 32.08 ? 245 GLY A O     1 
ATOM   887  N  N     . VAL A 1  120 ? 10.160  8.064   -17.033 1.00 33.22 ? 246 VAL A N     1 
ATOM   888  C  CA    . VAL A 1  120 ? 10.955  7.530   -18.128 1.00 30.86 ? 246 VAL A CA    1 
ATOM   889  C  C     . VAL A 1  120 ? 10.542  6.084   -18.348 1.00 30.01 ? 246 VAL A C     1 
ATOM   890  O  O     . VAL A 1  120 ? 10.647  5.259   -17.432 1.00 31.05 ? 246 VAL A O     1 
ATOM   891  C  CB    . VAL A 1  120 ? 12.459  7.629   -17.835 1.00 32.68 ? 246 VAL A CB    1 
ATOM   892  C  CG1   . VAL A 1  120 ? 13.267  7.079   -19.004 1.00 33.34 ? 246 VAL A CG1   1 
ATOM   893  C  CG2   . VAL A 1  120 ? 12.843  9.080   -17.543 1.00 32.94 ? 246 VAL A CG2   1 
ATOM   894  N  N     . GLY A 1  121 ? 10.076  5.777   -19.559 1.00 29.49 ? 247 GLY A N     1 
ATOM   895  C  CA    . GLY A 1  121 ? 9.747   4.423   -19.937 1.00 29.33 ? 247 GLY A CA    1 
ATOM   896  C  C     . GLY A 1  121 ? 10.800  3.820   -20.855 1.00 31.69 ? 247 GLY A C     1 
ATOM   897  O  O     . GLY A 1  121 ? 11.832  4.415   -21.147 1.00 38.70 ? 247 GLY A O     1 
ATOM   898  N  N     . VAL A 1  122 ? 10.516  2.595   -21.304 1.00 32.27 ? 248 VAL A N     1 
ATOM   899  C  CA    . VAL A 1  122 ? 11.452  1.894   -22.179 1.00 30.31 ? 248 VAL A CA    1 
ATOM   900  C  C     . VAL A 1  122 ? 11.735  2.718   -23.426 1.00 34.78 ? 248 VAL A C     1 
ATOM   901  O  O     . VAL A 1  122 ? 12.887  2.832   -23.866 1.00 36.09 ? 248 VAL A O     1 
ATOM   902  C  CB    . VAL A 1  122 ? 10.910  0.499   -22.545 1.00 32.20 ? 248 VAL A CB    1 
ATOM   903  C  CG1   . VAL A 1  122 ? 11.848  -0.199  -23.517 1.00 35.80 ? 248 VAL A CG1   1 
ATOM   904  C  CG2   . VAL A 1  122 ? 10.726  -0.348  -21.303 1.00 37.12 ? 248 VAL A CG2   1 
ATOM   905  N  N     . LYS A 1  123 ? 10.691  3.290   -24.029 1.00 35.23 ? 249 LYS A N     1 
ATOM   906  C  CA    . LYS A 1  123 ? 10.881  4.027   -25.275 1.00 38.13 ? 249 LYS A CA    1 
ATOM   907  C  C     . LYS A 1  123 ? 11.795  5.229   -25.072 1.00 38.43 ? 249 LYS A C     1 
ATOM   908  O  O     . LYS A 1  123 ? 12.666  5.503   -25.905 1.00 39.39 ? 249 LYS A O     1 
ATOM   909  C  CB    . LYS A 1  123 ? 9.531   4.467   -25.838 1.00 39.77 ? 249 LYS A CB    1 
ATOM   910  C  CG    . LYS A 1  123 ? 8.709   3.321   -26.404 1.00 44.54 ? 249 LYS A CG    1 
ATOM   911  C  CD    . LYS A 1  123 ? 7.372   3.801   -26.945 1.00 45.50 ? 249 LYS A CD    1 
ATOM   912  N  N     . THR A 1  124 ? 11.610  5.964   -23.975 1.00 38.90 ? 250 THR A N     1 
ATOM   913  C  CA    . THR A 1  124 ? 12.465  7.119   -23.718 1.00 38.03 ? 250 THR A CA    1 
ATOM   914  C  C     . THR A 1  124 ? 13.887  6.678   -23.394 1.00 33.69 ? 250 THR A C     1 
ATOM   915  O  O     . THR A 1  124 ? 14.856  7.198   -23.959 1.00 37.48 ? 250 THR A O     1 
ATOM   916  C  CB    . THR A 1  124 ? 11.879  7.948   -22.576 1.00 38.27 ? 250 THR A CB    1 
ATOM   917  O  OG1   . THR A 1  124 ? 10.541  8.335   -22.910 1.00 36.94 ? 250 THR A OG1   1 
ATOM   918  C  CG2   . THR A 1  124 ? 12.715  9.186   -22.327 1.00 40.46 ? 250 THR A CG2   1 
ATOM   919  N  N     . ALA A 1  125 ? 14.028  5.721   -22.476 1.00 30.48 ? 251 ALA A N     1 
ATOM   920  C  CA    . ALA A 1  125 ? 15.342  5.190   -22.140 1.00 30.78 ? 251 ALA A CA    1 
ATOM   921  C  C     . ALA A 1  125 ? 16.086  4.726   -23.384 1.00 34.84 ? 251 ALA A C     1 
ATOM   922  O  O     . ALA A 1  125 ? 17.274  5.023   -23.562 1.00 35.49 ? 251 ALA A O     1 
ATOM   923  C  CB    . ALA A 1  125 ? 15.191  4.034   -21.151 1.00 32.72 ? 251 ALA A CB    1 
ATOM   924  N  N     . ASP A 1  126 ? 15.401  3.989   -24.260 1.00 37.75 ? 252 ASP A N     1 
ATOM   925  C  CA    . ASP A 1  126 ? 16.064  3.466   -25.448 1.00 41.08 ? 252 ASP A CA    1 
ATOM   926  C  C     . ASP A 1  126 ? 16.582  4.595   -26.331 1.00 41.29 ? 252 ASP A C     1 
ATOM   927  O  O     . ASP A 1  126 ? 17.717  4.541   -26.816 1.00 44.48 ? 252 ASP A O     1 
ATOM   928  C  CB    . ASP A 1  126 ? 15.119  2.568   -26.241 1.00 39.99 ? 252 ASP A CB    1 
ATOM   929  C  CG    . ASP A 1  126 ? 15.731  2.103   -27.552 1.00 44.01 ? 252 ASP A CG    1 
ATOM   930  O  OD1   . ASP A 1  126 ? 16.766  1.402   -27.513 1.00 44.33 ? 252 ASP A OD1   1 
ATOM   931  O  OD2   . ASP A 1  126 ? 15.194  2.459   -28.621 1.00 44.52 ? 252 ASP A OD2   1 
ATOM   932  N  N     A ARG A 1  127 ? 15.757  5.622   -26.560 0.60 37.54 ? 253 ARG A N     1 
ATOM   933  N  N     B ARG A 1  127 ? 15.769  5.634   -26.548 0.40 37.88 ? 253 ARG A N     1 
ATOM   934  C  CA    A ARG A 1  127 ? 16.186  6.745   -27.388 0.60 39.56 ? 253 ARG A CA    1 
ATOM   935  C  CA    B ARG A 1  127 ? 16.205  6.732   -27.406 0.40 39.65 ? 253 ARG A CA    1 
ATOM   936  C  C     A ARG A 1  127 ? 17.418  7.413   -26.795 0.60 40.11 ? 253 ARG A C     1 
ATOM   937  C  C     B ARG A 1  127 ? 17.404  7.455   -26.805 0.40 40.06 ? 253 ARG A C     1 
ATOM   938  O  O     A ARG A 1  127 ? 18.395  7.688   -27.501 0.60 39.99 ? 253 ARG A O     1 
ATOM   939  O  O     B ARG A 1  127 ? 18.351  7.804   -27.520 0.40 40.45 ? 253 ARG A O     1 
ATOM   940  C  CB    A ARG A 1  127 ? 15.047  7.755   -27.539 0.60 41.63 ? 253 ARG A CB    1 
ATOM   941  C  CB    B ARG A 1  127 ? 15.052  7.708   -27.648 0.40 41.55 ? 253 ARG A CB    1 
ATOM   942  C  CG    A ARG A 1  127 ? 15.472  9.075   -28.185 0.60 44.45 ? 253 ARG A CG    1 
ATOM   943  C  CG    B ARG A 1  127 ? 15.390  8.819   -28.638 0.40 44.46 ? 253 ARG A CG    1 
ATOM   944  C  CD    A ARG A 1  127 ? 14.274  9.964   -28.498 0.60 45.48 ? 253 ARG A CD    1 
ATOM   945  C  CD    B ARG A 1  127 ? 14.152  9.584   -29.101 0.40 45.04 ? 253 ARG A CD    1 
ATOM   946  N  NE    A ARG A 1  127 ? 13.554  10.388  -27.297 0.60 43.60 ? 253 ARG A NE    1 
ATOM   947  N  NE    B ARG A 1  127 ? 13.464  10.257  -27.998 0.40 44.67 ? 253 ARG A NE    1 
ATOM   948  C  CZ    A ARG A 1  127 ? 13.913  11.413  -26.527 0.60 44.64 ? 253 ARG A CZ    1 
ATOM   949  C  CZ    B ARG A 1  127 ? 12.344  9.833   -27.416 0.40 41.92 ? 253 ARG A CZ    1 
ATOM   950  N  NH1   A ARG A 1  127 ? 14.997  12.122  -26.816 0.60 45.94 ? 253 ARG A NH1   1 
ATOM   951  N  NH1   B ARG A 1  127 ? 11.742  8.721   -27.819 0.40 39.94 ? 253 ARG A NH1   1 
ATOM   952  N  NH2   A ARG A 1  127 ? 13.189  11.729  -25.460 0.60 42.00 ? 253 ARG A NH2   1 
ATOM   953  N  NH2   B ARG A 1  127 ? 11.816  10.534  -26.420 0.40 40.34 ? 253 ARG A NH2   1 
ATOM   954  N  N     . TRP A 1  128 ? 17.384  7.686   -25.491 1.00 43.59 ? 254 TRP A N     1 
ATOM   955  C  CA    . TRP A 1  128 ? 18.540  8.276   -24.825 1.00 42.68 ? 254 TRP A CA    1 
ATOM   956  C  C     . TRP A 1  128 ? 19.778  7.400   -24.986 1.00 41.47 ? 254 TRP A C     1 
ATOM   957  O  O     . TRP A 1  128 ? 20.875  7.907   -25.258 1.00 39.02 ? 254 TRP A O     1 
ATOM   958  C  CB    . TRP A 1  128 ? 18.219  8.497   -23.349 1.00 39.66 ? 254 TRP A CB    1 
ATOM   959  C  CG    . TRP A 1  128 ? 17.210  9.585   -23.114 1.00 41.55 ? 254 TRP A CG    1 
ATOM   960  C  CD1   . TRP A 1  128 ? 16.766  10.503  -24.022 1.00 42.72 ? 254 TRP A CD1   1 
ATOM   961  C  CD2   . TRP A 1  128 ? 16.523  9.869   -21.891 1.00 39.15 ? 254 TRP A CD2   1 
ATOM   962  N  NE1   . TRP A 1  128 ? 15.847  11.340  -23.439 1.00 41.60 ? 254 TRP A NE1   1 
ATOM   963  C  CE2   . TRP A 1  128 ? 15.679  10.971  -22.131 1.00 36.36 ? 254 TRP A CE2   1 
ATOM   964  C  CE3   . TRP A 1  128 ? 16.536  9.294   -20.617 1.00 37.18 ? 254 TRP A CE3   1 
ATOM   965  C  CZ2   . TRP A 1  128 ? 14.864  11.513  -21.146 1.00 34.17 ? 254 TRP A CZ2   1 
ATOM   966  C  CZ3   . TRP A 1  128 ? 15.724  9.833   -19.641 1.00 34.53 ? 254 TRP A CZ3   1 
ATOM   967  C  CH2   . TRP A 1  128 ? 14.900  10.931  -19.912 1.00 35.49 ? 254 TRP A CH2   1 
ATOM   968  N  N     . TYR A 1  129 ? 19.622  6.082   -24.828 1.00 37.17 ? 255 TYR A N     1 
ATOM   969  C  CA    . TYR A 1  129 ? 20.758  5.178   -25.001 1.00 38.19 ? 255 TYR A CA    1 
ATOM   970  C  C     . TYR A 1  129 ? 21.330  5.288   -26.403 1.00 44.96 ? 255 TYR A C     1 
ATOM   971  O  O     . TYR A 1  129 ? 22.554  5.303   -26.584 1.00 43.07 ? 255 TYR A O     1 
ATOM   972  C  CB    . TYR A 1  129 ? 20.343  3.733   -24.714 1.00 39.18 ? 255 TYR A CB    1 
ATOM   973  C  CG    . TYR A 1  129 ? 21.519  2.784   -24.624 1.00 40.73 ? 255 TYR A CG    1 
ATOM   974  C  CD1   . TYR A 1  129 ? 22.182  2.587   -23.420 1.00 39.78 ? 255 TYR A CD1   1 
ATOM   975  C  CD2   . TYR A 1  129 ? 21.978  2.100   -25.744 1.00 41.55 ? 255 TYR A CD2   1 
ATOM   976  C  CE1   . TYR A 1  129 ? 23.267  1.732   -23.330 1.00 39.42 ? 255 TYR A CE1   1 
ATOM   977  C  CE2   . TYR A 1  129 ? 23.060  1.237   -25.663 1.00 40.66 ? 255 TYR A CE2   1 
ATOM   978  C  CZ    . TYR A 1  129 ? 23.700  1.058   -24.452 1.00 40.19 ? 255 TYR A CZ    1 
ATOM   979  O  OH    . TYR A 1  129 ? 24.782  0.208   -24.357 1.00 44.10 ? 255 TYR A OH    1 
ATOM   980  N  N     . ARG A 1  130 ? 20.458  5.361   -27.412 1.00 48.35 ? 256 ARG A N     1 
ATOM   981  C  CA    . ARG A 1  130 ? 20.927  5.506   -28.785 1.00 52.02 ? 256 ARG A CA    1 
ATOM   982  C  C     . ARG A 1  130 ? 21.594  6.856   -29.005 1.00 49.60 ? 256 ARG A C     1 
ATOM   983  O  O     . ARG A 1  130 ? 22.452  6.985   -29.885 1.00 51.73 ? 256 ARG A O     1 
ATOM   984  C  CB    . ARG A 1  130 ? 19.762  5.313   -29.761 1.00 54.84 ? 256 ARG A CB    1 
ATOM   985  C  CG    . ARG A 1  130 ? 19.214  3.891   -29.781 1.00 58.74 ? 256 ARG A CG    1 
ATOM   986  C  CD    . ARG A 1  130 ? 18.175  3.681   -30.874 1.00 67.51 ? 256 ARG A CD    1 
ATOM   987  N  NE    . ARG A 1  130 ? 16.833  4.119   -30.483 1.00 73.56 ? 256 ARG A NE    1 
ATOM   988  C  CZ    . ARG A 1  130 ? 16.281  5.288   -30.806 1.00 78.32 ? 256 ARG A CZ    1 
ATOM   989  N  NH1   . ARG A 1  130 ? 16.942  6.176   -31.536 1.00 82.67 ? 256 ARG A NH1   1 
ATOM   990  N  NH2   . ARG A 1  130 ? 15.052  5.573   -30.392 1.00 76.88 ? 256 ARG A NH2   1 
ATOM   991  N  N     . GLU A 1  131 ? 21.230  7.865   -28.217 1.00 53.30 ? 257 GLU A N     1 
ATOM   992  C  CA    . GLU A 1  131 ? 21.858  9.176   -28.319 1.00 54.14 ? 257 GLU A CA    1 
ATOM   993  C  C     . GLU A 1  131 ? 23.206  9.240   -27.610 1.00 51.32 ? 257 GLU A C     1 
ATOM   994  O  O     . GLU A 1  131 ? 23.846  10.296  -27.625 1.00 46.69 ? 257 GLU A O     1 
ATOM   995  C  CB    . GLU A 1  131 ? 20.918  10.250  -27.758 1.00 53.48 ? 257 GLU A CB    1 
ATOM   996  C  CG    . GLU A 1  131 ? 19.711  10.520  -28.644 1.00 54.91 ? 257 GLU A CG    1 
ATOM   997  C  CD    . GLU A 1  131 ? 18.684  11.431  -27.992 1.00 58.75 ? 257 GLU A CD    1 
ATOM   998  O  OE1   . GLU A 1  131 ? 18.931  11.909  -26.865 1.00 59.48 ? 257 GLU A OE1   1 
ATOM   999  O  OE2   . GLU A 1  131 ? 17.624  11.667  -28.608 1.00 59.88 ? 257 GLU A OE2   1 
ATOM   1000 N  N     . GLY A 1  132 ? 23.658  8.144   -27.007 1.00 46.26 ? 258 GLY A N     1 
ATOM   1001 C  CA    . GLY A 1  132 ? 24.928  8.121   -26.319 1.00 44.67 ? 258 GLY A CA    1 
ATOM   1002 C  C     . GLY A 1  132 ? 24.842  8.426   -24.845 1.00 44.92 ? 258 GLY A C     1 
ATOM   1003 O  O     . GLY A 1  132 ? 25.871  8.386   -24.162 1.00 48.35 ? 258 GLY A O     1 
ATOM   1004 N  N     . LEU A 1  133 ? 23.655  8.725   -24.329 1.00 42.09 ? 259 LEU A N     1 
ATOM   1005 C  CA    . LEU A 1  133 ? 23.524  9.043   -22.918 1.00 44.31 ? 259 LEU A CA    1 
ATOM   1006 C  C     . LEU A 1  133 ? 23.645  7.773   -22.089 1.00 45.18 ? 259 LEU A C     1 
ATOM   1007 O  O     . LEU A 1  133 ? 23.168  6.704   -22.487 1.00 42.90 ? 259 LEU A O     1 
ATOM   1008 C  CB    . LEU A 1  133 ? 22.189  9.741   -22.654 1.00 47.98 ? 259 LEU A CB    1 
ATOM   1009 C  CG    . LEU A 1  133 ? 21.989  11.030  -23.462 1.00 46.83 ? 259 LEU A CG    1 
ATOM   1010 C  CD1   . LEU A 1  133 ? 20.564  11.521  -23.388 1.00 45.97 ? 259 LEU A CD1   1 
ATOM   1011 C  CD2   . LEU A 1  133 ? 22.939  12.109  -22.973 1.00 51.37 ? 259 LEU A CD2   1 
ATOM   1012 N  N     . ARG A 1  134 ? 24.310  7.889   -20.934 1.00 46.75 ? 260 ARG A N     1 
ATOM   1013 C  CA    . ARG A 1  134 ? 24.578  6.727   -20.091 1.00 46.90 ? 260 ARG A CA    1 
ATOM   1014 C  C     . ARG A 1  134 ? 24.306  6.934   -18.605 1.00 43.73 ? 260 ARG A C     1 
ATOM   1015 O  O     . ARG A 1  134 ? 23.967  5.960   -17.929 1.00 39.51 ? 260 ARG A O     1 
ATOM   1016 C  CB    . ARG A 1  134 ? 26.039  6.282   -20.263 1.00 49.15 ? 260 ARG A CB    1 
ATOM   1017 C  CG    . ARG A 1  134 ? 26.384  5.783   -21.660 1.00 46.30 ? 260 ARG A CG    1 
ATOM   1018 C  CD    . ARG A 1  134 ? 25.677  4.471   -21.985 1.00 43.13 ? 260 ARG A CD    1 
ATOM   1019 N  NE    . ARG A 1  134 ? 26.056  3.970   -23.303 1.00 43.91 ? 260 ARG A NE    1 
ATOM   1020 C  CZ    . ARG A 1  134 ? 25.446  4.288   -24.441 1.00 42.08 ? 260 ARG A CZ    1 
ATOM   1021 N  NH1   . ARG A 1  134 ? 24.406  5.113   -24.447 1.00 39.92 ? 260 ARG A NH1   1 
ATOM   1022 N  NH2   . ARG A 1  134 ? 25.883  3.777   -25.584 1.00 43.84 ? 260 ARG A NH2   1 
ATOM   1023 N  N     . THR A 1  135 ? 24.434  8.145   -18.068 1.00 41.70 ? 261 THR A N     1 
ATOM   1024 C  CA    . THR A 1  135 ? 24.372  8.376   -16.631 1.00 42.66 ? 261 THR A CA    1 
ATOM   1025 C  C     . THR A 1  135 ? 23.273  9.382   -16.310 1.00 42.75 ? 261 THR A C     1 
ATOM   1026 O  O     . THR A 1  135 ? 22.734  10.051  -17.194 1.00 45.67 ? 261 THR A O     1 
ATOM   1027 C  CB    . THR A 1  135 ? 25.721  8.888   -16.111 1.00 47.87 ? 261 THR A CB    1 
ATOM   1028 O  OG1   . THR A 1  135 ? 25.918  10.230  -16.565 1.00 47.56 ? 261 THR A OG1   1 
ATOM   1029 C  CG2   . THR A 1  135 ? 26.858  8.012   -16.622 1.00 45.89 ? 261 THR A CG2   1 
ATOM   1030 N  N     . LEU A 1  136 ? 22.945  9.489   -15.020 1.00 39.89 ? 262 LEU A N     1 
ATOM   1031 C  CA    . LEU A 1  136 ? 21.937  10.456  -14.597 1.00 41.20 ? 262 LEU A CA    1 
ATOM   1032 C  C     . LEU A 1  136 ? 22.435  11.883  -14.778 1.00 46.58 ? 262 LEU A C     1 
ATOM   1033 O  O     . LEU A 1  136 ? 21.648  12.779  -15.106 1.00 45.04 ? 262 LEU A O     1 
ATOM   1034 C  CB    . LEU A 1  136 ? 21.551  10.212  -13.138 1.00 42.80 ? 262 LEU A CB    1 
ATOM   1035 C  CG    . LEU A 1  136 ? 20.949  8.843   -12.791 1.00 42.76 ? 262 LEU A CG    1 
ATOM   1036 C  CD1   . LEU A 1  136 ? 20.615  8.768   -11.307 1.00 41.31 ? 262 LEU A CD1   1 
ATOM   1037 C  CD2   . LEU A 1  136 ? 19.713  8.536   -13.623 1.00 38.98 ? 262 LEU A CD2   1 
ATOM   1038 N  N     . ASP A 1  137 ? 23.735  12.113  -14.582 1.00 48.63 ? 263 ASP A N     1 
ATOM   1039 C  CA    . ASP A 1  137 ? 24.284  13.447  -14.799 1.00 57.31 ? 263 ASP A CA    1 
ATOM   1040 C  C     . ASP A 1  137 ? 24.268  13.824  -16.274 1.00 55.63 ? 263 ASP A C     1 
ATOM   1041 O  O     . ASP A 1  137 ? 24.154  15.009  -16.608 1.00 54.43 ? 263 ASP A O     1 
ATOM   1042 C  CB    . ASP A 1  137 ? 25.700  13.534  -14.228 1.00 60.89 ? 263 ASP A CB    1 
ATOM   1043 C  CG    . ASP A 1  137 ? 25.709  13.557  -12.709 1.00 63.16 ? 263 ASP A CG    1 
ATOM   1044 O  OD1   . ASP A 1  137 ? 24.652  13.876  -12.114 1.00 60.67 ? 263 ASP A OD1   1 
ATOM   1045 O  OD2   . ASP A 1  137 ? 26.763  13.260  -12.110 1.00 63.88 ? 263 ASP A OD2   1 
ATOM   1046 N  N     . ASP A 1  138 ? 24.363  12.840  -17.170 1.00 51.62 ? 264 ASP A N     1 
ATOM   1047 C  CA    . ASP A 1  138 ? 24.159  13.122  -18.586 1.00 49.25 ? 264 ASP A CA    1 
ATOM   1048 C  C     . ASP A 1  138 ? 22.778  13.721  -18.817 1.00 43.08 ? 264 ASP A C     1 
ATOM   1049 O  O     . ASP A 1  138 ? 22.617  14.649  -19.617 1.00 42.53 ? 264 ASP A O     1 
ATOM   1050 C  CB    . ASP A 1  138 ? 24.340  11.846  -19.407 1.00 51.95 ? 264 ASP A CB    1 
ATOM   1051 C  CG    . ASP A 1  138 ? 25.749  11.279  -19.312 1.00 56.81 ? 264 ASP A CG    1 
ATOM   1052 O  OD1   . ASP A 1  138 ? 26.692  12.050  -19.025 1.00 57.49 ? 264 ASP A OD1   1 
ATOM   1053 O  OD2   . ASP A 1  138 ? 25.910  10.060  -19.533 1.00 56.19 ? 264 ASP A OD2   1 
ATOM   1054 N  N     . LEU A 1  139 ? 21.775  13.222  -18.099 1.00 45.62 ? 265 LEU A N     1 
ATOM   1055 C  CA    . LEU A 1  139 ? 20.426  13.754  -18.241 1.00 49.36 ? 265 LEU A CA    1 
ATOM   1056 C  C     . LEU A 1  139 ? 20.301  15.120  -17.575 1.00 52.42 ? 265 LEU A C     1 
ATOM   1057 O  O     . LEU A 1  139 ? 19.594  16.000  -18.078 1.00 52.77 ? 265 LEU A O     1 
ATOM   1058 C  CB    . LEU A 1  139 ? 19.419  12.771  -17.646 1.00 45.30 ? 265 LEU A CB    1 
ATOM   1059 C  CG    . LEU A 1  139 ? 19.469  11.335  -18.177 1.00 39.60 ? 265 LEU A CG    1 
ATOM   1060 C  CD1   . LEU A 1  139 ? 18.549  10.434  -17.365 1.00 39.90 ? 265 LEU A CD1   1 
ATOM   1061 C  CD2   . LEU A 1  139 ? 19.085  11.286  -19.643 1.00 41.35 ? 265 LEU A CD2   1 
ATOM   1062 N  N     . ARG A 1  140 ? 20.989  15.319  -16.449 1.00 48.03 ? 266 ARG A N     1 
ATOM   1063 C  CA    . ARG A 1  140 ? 20.917  16.594  -15.747 1.00 52.93 ? 266 ARG A CA    1 
ATOM   1064 C  C     . ARG A 1  140 ? 21.562  17.719  -16.547 1.00 59.60 ? 266 ARG A C     1 
ATOM   1065 O  O     . ARG A 1  140 ? 21.139  18.874  -16.431 1.00 60.42 ? 266 ARG A O     1 
ATOM   1066 C  CB    . ARG A 1  140 ? 21.574  16.464  -14.371 1.00 51.94 ? 266 ARG A CB    1 
ATOM   1067 C  CG    . ARG A 1  140 ? 20.629  15.928  -13.297 1.00 50.23 ? 266 ARG A CG    1 
ATOM   1068 C  CD    . ARG A 1  140 ? 21.335  15.054  -12.271 1.00 47.84 ? 266 ARG A CD    1 
ATOM   1069 N  NE    . ARG A 1  140 ? 20.398  14.532  -11.276 1.00 48.54 ? 266 ARG A NE    1 
ATOM   1070 C  CZ    . ARG A 1  140 ? 20.683  13.563  -10.412 1.00 48.20 ? 266 ARG A CZ    1 
ATOM   1071 N  NH1   . ARG A 1  140 ? 21.881  12.995  -10.417 1.00 48.71 ? 266 ARG A NH1   1 
ATOM   1072 N  NH2   . ARG A 1  140 ? 19.767  13.158  -9.542  1.00 47.17 ? 266 ARG A NH2   1 
ATOM   1073 N  N     . GLU A 1  141 ? 22.565  17.404  -17.373 1.00 64.77 ? 267 GLU A N     1 
ATOM   1074 C  CA    . GLU A 1  141 ? 23.283  18.439  -18.114 1.00 68.99 ? 267 GLU A CA    1 
ATOM   1075 C  C     . GLU A 1  141 ? 22.394  19.136  -19.138 1.00 73.88 ? 267 GLU A C     1 
ATOM   1076 O  O     . GLU A 1  141 ? 22.618  20.311  -19.450 1.00 76.85 ? 267 GLU A O     1 
ATOM   1077 C  CB    . GLU A 1  141 ? 24.504  17.833  -18.809 1.00 71.25 ? 267 GLU A CB    1 
ATOM   1078 C  CG    . GLU A 1  141 ? 25.621  17.402  -17.859 1.00 72.63 ? 267 GLU A CG    1 
ATOM   1079 C  CD    . GLU A 1  141 ? 26.611  16.440  -18.503 1.00 72.35 ? 267 GLU A CD    1 
ATOM   1080 O  OE1   . GLU A 1  141 ? 26.497  16.196  -19.723 1.00 73.15 ? 267 GLU A OE1   1 
ATOM   1081 O  OE2   . GLU A 1  141 ? 27.502  15.925  -17.789 1.00 70.70 ? 267 GLU A OE2   1 
ATOM   1082 N  N     . GLN A 1  142 ? 21.390  18.442  -19.671 1.00 81.34 ? 268 GLN A N     1 
ATOM   1083 C  CA    . GLN A 1  142 ? 20.513  18.984  -20.710 1.00 84.94 ? 268 GLN A CA    1 
ATOM   1084 C  C     . GLN A 1  142 ? 19.062  18.850  -20.264 1.00 85.35 ? 268 GLN A C     1 
ATOM   1085 O  O     . GLN A 1  142 ? 18.289  18.072  -20.837 1.00 83.63 ? 268 GLN A O     1 
ATOM   1086 C  CB    . GLN A 1  142 ? 20.747  18.273  -22.043 1.00 84.60 ? 268 GLN A CB    1 
ATOM   1087 N  N     . PRO A 1  143 ? 18.653  19.614  -19.246 1.00 70.36 ? 269 PRO A N     1 
ATOM   1088 C  CA    . PRO A 1  143 ? 17.283  19.487  -18.729 1.00 70.06 ? 269 PRO A CA    1 
ATOM   1089 C  C     . PRO A 1  143 ? 16.225  20.084  -19.638 1.00 74.01 ? 269 PRO A C     1 
ATOM   1090 O  O     . PRO A 1  143 ? 15.032  19.947  -19.340 1.00 73.71 ? 269 PRO A O     1 
ATOM   1091 C  CB    . PRO A 1  143 ? 17.350  20.241  -17.395 1.00 67.59 ? 269 PRO A CB    1 
ATOM   1092 C  CG    . PRO A 1  143 ? 18.383  21.274  -17.613 1.00 71.22 ? 269 PRO A CG    1 
ATOM   1093 C  CD    . PRO A 1  143 ? 19.407  20.668  -18.546 1.00 72.55 ? 269 PRO A CD    1 
ATOM   1094 N  N     . GLN A 1  144 ? 16.619  20.738  -20.731 1.00 69.57 ? 270 GLN A N     1 
ATOM   1095 C  CA    . GLN A 1  144 ? 15.637  21.336  -21.628 1.00 71.38 ? 270 GLN A CA    1 
ATOM   1096 C  C     . GLN A 1  144 ? 14.779  20.275  -22.303 1.00 70.14 ? 270 GLN A C     1 
ATOM   1097 O  O     . GLN A 1  144 ? 13.631  20.550  -22.669 1.00 72.35 ? 270 GLN A O     1 
ATOM   1098 C  CB    . GLN A 1  144 ? 16.344  22.197  -22.677 1.00 74.30 ? 270 GLN A CB    1 
ATOM   1099 N  N     . LYS A 1  145 ? 15.309  19.063  -22.470 1.00 84.49 ? 271 LYS A N     1 
ATOM   1100 C  CA    . LYS A 1  145 ? 14.599  17.984  -23.140 1.00 79.52 ? 271 LYS A CA    1 
ATOM   1101 C  C     . LYS A 1  145 ? 13.816  17.099  -22.174 1.00 70.34 ? 271 LYS A C     1 
ATOM   1102 O  O     . LYS A 1  145 ? 13.402  16.000  -22.558 1.00 72.26 ? 271 LYS A O     1 
ATOM   1103 C  CB    . LYS A 1  145 ? 15.584  17.131  -23.941 1.00 81.52 ? 271 LYS A CB    1 
ATOM   1104 N  N     . LEU A 1  146 ? 13.599  17.549  -20.941 1.00 61.34 ? 272 LEU A N     1 
ATOM   1105 C  CA    . LEU A 1  146 ? 12.925  16.750  -19.927 1.00 51.82 ? 272 LEU A CA    1 
ATOM   1106 C  C     . LEU A 1  146 ? 11.521  17.275  -19.685 1.00 50.01 ? 272 LEU A C     1 
ATOM   1107 O  O     . LEU A 1  146 ? 11.285  18.488  -19.704 1.00 50.90 ? 272 LEU A O     1 
ATOM   1108 C  CB    . LEU A 1  146 ? 13.693  16.759  -18.604 1.00 42.94 ? 272 LEU A CB    1 
ATOM   1109 C  CG    . LEU A 1  146 ? 15.114  16.207  -18.645 1.00 43.76 ? 272 LEU A CG    1 
ATOM   1110 C  CD1   . LEU A 1  146 ? 15.748  16.340  -17.270 1.00 42.69 ? 272 LEU A CD1   1 
ATOM   1111 C  CD2   . LEU A 1  146 ? 15.120  14.761  -19.107 1.00 36.62 ? 272 LEU A CD2   1 
ATOM   1112 N  N     . THR A 1  147 ? 10.597  16.353  -19.446 1.00 52.57 ? 273 THR A N     1 
ATOM   1113 C  CA    . THR A 1  147 ? 9.281   16.734  -18.975 1.00 50.23 ? 273 THR A CA    1 
ATOM   1114 C  C     . THR A 1  147 ? 9.361   17.156  -17.512 1.00 47.18 ? 273 THR A C     1 
ATOM   1115 O  O     . THR A 1  147 ? 10.335  16.874  -16.811 1.00 45.66 ? 273 THR A O     1 
ATOM   1116 C  CB    . THR A 1  147 ? 8.304   15.575  -19.138 1.00 48.43 ? 273 THR A CB    1 
ATOM   1117 O  OG1   . THR A 1  147 ? 8.759   14.463  -18.358 1.00 49.48 ? 273 THR A OG1   1 
ATOM   1118 C  CG2   . THR A 1  147 ? 8.214   15.159  -20.595 1.00 48.16 ? 273 THR A CG2   1 
ATOM   1119 N  N     . GLN A 1  148 ? 8.323   17.858  -17.055 1.00 50.23 ? 274 GLN A N     1 
ATOM   1120 C  CA    . GLN A 1  148 ? 8.243   18.202  -15.640 1.00 49.76 ? 274 GLN A CA    1 
ATOM   1121 C  C     . GLN A 1  148 ? 8.235   16.944  -14.785 1.00 43.17 ? 274 GLN A C     1 
ATOM   1122 O  O     . GLN A 1  148 ? 8.812   16.916  -13.692 1.00 40.24 ? 274 GLN A O     1 
ATOM   1123 C  CB    . GLN A 1  148 ? 6.991   19.041  -15.369 1.00 48.05 ? 274 GLN A CB    1 
ATOM   1124 N  N     . GLN A 1  149 ? 7.587   15.888  -15.275 1.00 36.26 ? 275 GLN A N     1 
ATOM   1125 C  CA    . GLN A 1  149 ? 7.539   14.634  -14.536 1.00 37.22 ? 275 GLN A CA    1 
ATOM   1126 C  C     . GLN A 1  149 ? 8.927   14.023  -14.422 1.00 35.83 ? 275 GLN A C     1 
ATOM   1127 O  O     . GLN A 1  149 ? 9.293   13.491  -13.368 1.00 37.57 ? 275 GLN A O     1 
ATOM   1128 C  CB    . GLN A 1  149 ? 6.574   13.673  -15.226 1.00 38.15 ? 275 GLN A CB    1 
ATOM   1129 C  CG    . GLN A 1  149 ? 6.271   12.410  -14.463 1.00 42.35 ? 275 GLN A CG    1 
ATOM   1130 C  CD    . GLN A 1  149 ? 5.306   11.513  -15.218 1.00 42.95 ? 275 GLN A CD    1 
ATOM   1131 O  OE1   . GLN A 1  149 ? 5.544   11.163  -16.372 1.00 43.83 ? 275 GLN A OE1   1 
ATOM   1132 N  NE2   . GLN A 1  149 ? 4.199   11.157  -14.576 1.00 42.03 ? 275 GLN A NE2   1 
ATOM   1133 N  N     . GLN A 1  150 ? 9.721   14.117  -15.491 1.00 36.89 ? 276 GLN A N     1 
ATOM   1134 C  CA    . GLN A 1  150 ? 11.059  13.537  -15.487 1.00 34.47 ? 276 GLN A CA    1 
ATOM   1135 C  C     . GLN A 1  150 ? 12.015  14.365  -14.641 1.00 36.75 ? 276 GLN A C     1 
ATOM   1136 O  O     . GLN A 1  150 ? 12.902  13.813  -13.980 1.00 36.86 ? 276 GLN A O     1 
ATOM   1137 C  CB    . GLN A 1  150 ? 11.565  13.415  -16.923 1.00 36.28 ? 276 GLN A CB    1 
ATOM   1138 C  CG    . GLN A 1  150 ? 10.831  12.349  -17.723 1.00 35.64 ? 276 GLN A CG    1 
ATOM   1139 C  CD    . GLN A 1  150 ? 10.995  12.509  -19.218 1.00 36.87 ? 276 GLN A CD    1 
ATOM   1140 O  OE1   . GLN A 1  150 ? 11.555  13.497  -19.696 1.00 34.67 ? 276 GLN A OE1   1 
ATOM   1141 N  NE2   . GLN A 1  150 ? 10.499  11.537  -19.969 1.00 36.94 ? 276 GLN A NE2   1 
ATOM   1142 N  N     . LYS A 1  151 ? 11.854  15.691  -14.648 1.00 38.14 ? 277 LYS A N     1 
ATOM   1143 C  CA    . LYS A 1  151 ? 12.657  16.535  -13.768 1.00 38.73 ? 277 LYS A CA    1 
ATOM   1144 C  C     . LYS A 1  151 ? 12.400  16.191  -12.307 1.00 35.33 ? 277 LYS A C     1 
ATOM   1145 O  O     . LYS A 1  151 ? 13.325  16.184  -11.487 1.00 35.47 ? 277 LYS A O     1 
ATOM   1146 C  CB    . LYS A 1  151 ? 12.349  18.012  -14.029 1.00 44.68 ? 277 LYS A CB    1 
ATOM   1147 C  CG    . LYS A 1  151 ? 12.839  18.519  -15.374 1.00 54.72 ? 277 LYS A CG    1 
ATOM   1148 C  CD    . LYS A 1  151 ? 12.325  19.921  -15.668 1.00 63.50 ? 277 LYS A CD    1 
ATOM   1149 C  CE    . LYS A 1  151 ? 12.777  20.402  -17.039 1.00 68.37 ? 277 LYS A CE    1 
ATOM   1150 N  NZ    . LYS A 1  151 ? 12.172  21.709  -17.409 1.00 72.20 ? 277 LYS A NZ    1 
ATOM   1151 N  N     . ALA A 1  152 ? 11.143  15.923  -11.957 1.00 37.73 ? 278 ALA A N     1 
ATOM   1152 C  CA    . ALA A 1  152 ? 10.830  15.499  -10.599 1.00 40.41 ? 278 ALA A CA    1 
ATOM   1153 C  C     . ALA A 1  152 ? 11.446  14.139  -10.300 1.00 39.05 ? 278 ALA A C     1 
ATOM   1154 O  O     . ALA A 1  152 ? 12.055  13.937  -9.242  1.00 40.32 ? 278 ALA A O     1 
ATOM   1155 C  CB    . ALA A 1  152 ? 9.316   15.461  -10.405 1.00 45.33 ? 278 ALA A CB    1 
ATOM   1156 N  N     . GLY A 1  153 ? 11.299  13.190  -11.225 1.00 31.49 ? 279 GLY A N     1 
ATOM   1157 C  CA    . GLY A 1  153 ? 11.873  11.871  -11.008 1.00 32.08 ? 279 GLY A CA    1 
ATOM   1158 C  C     . GLY A 1  153 ? 13.380  11.923  -10.840 1.00 30.27 ? 279 GLY A C     1 
ATOM   1159 O  O     . GLY A 1  153 ? 13.952  11.199  -10.021 1.00 32.03 ? 279 GLY A O     1 
ATOM   1160 N  N     A LEU A 1  154 ? 14.038  12.797  -11.597 0.45 29.92 ? 280 LEU A N     1 
ATOM   1161 N  N     B LEU A 1  154 ? 14.047  12.773  -11.618 0.55 29.91 ? 280 LEU A N     1 
ATOM   1162 C  CA    A LEU A 1  154 ? 15.490  12.896  -11.540 0.45 31.00 ? 280 LEU A CA    1 
ATOM   1163 C  CA    B LEU A 1  154 ? 15.498  12.874  -11.508 0.55 30.85 ? 280 LEU A CA    1 
ATOM   1164 C  C     A LEU A 1  154 ? 15.950  13.620  -10.279 0.45 35.14 ? 280 LEU A C     1 
ATOM   1165 C  C     B LEU A 1  154 ? 15.900  13.569  -10.215 0.55 35.27 ? 280 LEU A C     1 
ATOM   1166 O  O     A LEU A 1  154 ? 16.921  13.199  -9.639  0.45 34.75 ? 280 LEU A O     1 
ATOM   1167 O  O     B LEU A 1  154 ? 16.780  13.088  -9.490  0.55 34.08 ? 280 LEU A O     1 
ATOM   1168 C  CB    A LEU A 1  154 ? 15.992  13.601  -12.798 0.45 32.08 ? 280 LEU A CB    1 
ATOM   1169 C  CB    B LEU A 1  154 ? 16.069  13.607  -12.719 0.55 32.10 ? 280 LEU A CB    1 
ATOM   1170 C  CG    A LEU A 1  154 ? 17.486  13.618  -13.109 0.45 33.18 ? 280 LEU A CG    1 
ATOM   1171 C  CG    B LEU A 1  154 ? 16.214  12.760  -13.981 0.55 31.88 ? 280 LEU A CG    1 
ATOM   1172 C  CD1   A LEU A 1  154 ? 18.118  12.243  -12.946 0.45 34.55 ? 280 LEU A CD1   1 
ATOM   1173 C  CD1   B LEU A 1  154 ? 16.510  13.643  -15.175 0.55 35.48 ? 280 LEU A CD1   1 
ATOM   1174 C  CD2   A LEU A 1  154 ? 17.668  14.120  -14.534 0.45 36.01 ? 280 LEU A CD2   1 
ATOM   1175 C  CD2   B LEU A 1  154 ? 17.308  11.721  -13.813 0.55 33.36 ? 280 LEU A CD2   1 
ATOM   1176 N  N     . GLN A 1  155 ? 15.256  14.698  -9.900  1.00 31.93 ? 281 GLN A N     1 
ATOM   1177 C  CA    . GLN A 1  155 ? 15.592  15.415  -8.670  1.00 37.84 ? 281 GLN A CA    1 
ATOM   1178 C  C     . GLN A 1  155 ? 15.464  14.506  -7.455  1.00 31.58 ? 281 GLN A C     1 
ATOM   1179 O  O     . GLN A 1  155 ? 16.331  14.502  -6.573  1.00 32.08 ? 281 GLN A O     1 
ATOM   1180 C  CB    . GLN A 1  155 ? 14.687  16.642  -8.501  1.00 42.62 ? 281 GLN A CB    1 
ATOM   1181 C  CG    . GLN A 1  155 ? 15.125  17.885  -9.284  1.00 49.96 ? 281 GLN A CG    1 
ATOM   1182 C  CD    . GLN A 1  155 ? 14.009  18.914  -9.421  1.00 59.29 ? 281 GLN A CD    1 
ATOM   1183 O  OE1   . GLN A 1  155 ? 12.824  18.591  -9.285  1.00 60.11 ? 281 GLN A OE1   1 
ATOM   1184 N  NE2   . GLN A 1  155 ? 14.385  20.160  -9.692  1.00 62.82 ? 281 GLN A NE2   1 
ATOM   1185 N  N     . HIS A 1  156 ? 14.400  13.717  -7.400  1.00 30.25 ? 282 HIS A N     1 
ATOM   1186 C  CA    . HIS A 1  156 ? 14.112  12.882  -6.244  1.00 33.61 ? 282 HIS A CA    1 
ATOM   1187 C  C     . HIS A 1  156 ? 14.618  11.459  -6.404  1.00 32.85 ? 282 HIS A C     1 
ATOM   1188 O  O     . HIS A 1  156 ? 14.283  10.600  -5.582  1.00 31.38 ? 282 HIS A O     1 
ATOM   1189 C  CB    . HIS A 1  156 ? 12.607  12.887  -5.978  1.00 29.29 ? 282 HIS A CB    1 
ATOM   1190 C  CG    . HIS A 1  156 ? 12.075  14.246  -5.637  1.00 29.47 ? 282 HIS A CG    1 
ATOM   1191 N  ND1   . HIS A 1  156 ? 12.434  14.914  -4.488  1.00 30.60 ? 282 HIS A ND1   1 
ATOM   1192 C  CD2   . HIS A 1  156 ? 11.225  15.067  -6.298  1.00 29.79 ? 282 HIS A CD2   1 
ATOM   1193 C  CE1   . HIS A 1  156 ? 11.828  16.089  -4.453  1.00 31.66 ? 282 HIS A CE1   1 
ATOM   1194 N  NE2   . HIS A 1  156 ? 11.089  16.207  -5.541  1.00 30.80 ? 282 HIS A NE2   1 
ATOM   1195 N  N     . HIS A 1  157 ? 15.443  11.196  -7.420  1.00 32.00 ? 283 HIS A N     1 
ATOM   1196 C  CA    . HIS A 1  157 ? 15.767  9.812   -7.763  1.00 33.72 ? 283 HIS A CA    1 
ATOM   1197 C  C     . HIS A 1  157 ? 16.404  9.078   -6.589  1.00 28.55 ? 283 HIS A C     1 
ATOM   1198 O  O     . HIS A 1  157 ? 16.091  7.909   -6.334  1.00 26.81 ? 283 HIS A O     1 
ATOM   1199 C  CB    . HIS A 1  157 ? 16.692  9.775   -8.976  1.00 40.35 ? 283 HIS A CB    1 
ATOM   1200 C  CG    . HIS A 1  157 ? 17.047  8.389   -9.416  1.00 42.08 ? 283 HIS A CG    1 
ATOM   1201 N  ND1   . HIS A 1  157 ? 18.220  7.768   -9.044  1.00 41.69 ? 283 HIS A ND1   1 
ATOM   1202 C  CD2   . HIS A 1  157 ? 16.384  7.505   -10.198 1.00 41.09 ? 283 HIS A CD2   1 
ATOM   1203 C  CE1   . HIS A 1  157 ? 18.262  6.559   -9.574  1.00 43.30 ? 283 HIS A CE1   1 
ATOM   1204 N  NE2   . HIS A 1  157 ? 17.161  6.376   -10.282 1.00 42.11 ? 283 HIS A NE2   1 
ATOM   1205 N  N     . GLN A 1  158 ? 17.306  9.742   -5.864  1.00 28.88 ? 284 GLN A N     1 
ATOM   1206 C  CA    . GLN A 1  158 ? 18.016  9.063   -4.785  1.00 31.91 ? 284 GLN A CA    1 
ATOM   1207 C  C     . GLN A 1  158 ? 17.046  8.595   -3.705  1.00 29.14 ? 284 GLN A C     1 
ATOM   1208 O  O     . GLN A 1  158 ? 17.075  7.429   -3.293  1.00 29.73 ? 284 GLN A O     1 
ATOM   1209 C  CB    . GLN A 1  158 ? 19.086  9.985   -4.203  1.00 35.91 ? 284 GLN A CB    1 
ATOM   1210 C  CG    . GLN A 1  158 ? 19.974  9.335   -3.161  1.00 44.62 ? 284 GLN A CG    1 
ATOM   1211 C  CD    . GLN A 1  158 ? 21.106  10.249  -2.715  1.00 59.39 ? 284 GLN A CD    1 
ATOM   1212 O  OE1   . GLN A 1  158 ? 21.202  11.399  -3.152  1.00 60.86 ? 284 GLN A OE1   1 
ATOM   1213 N  NE2   . GLN A 1  158 ? 21.970  9.739   -1.844  1.00 65.84 ? 284 GLN A NE2   1 
ATOM   1214 N  N     . ASP A 1  159 ? 16.171  9.488   -3.239  1.00 28.19 ? 285 ASP A N     1 
ATOM   1215 C  CA    . ASP A 1  159 ? 15.162  9.091   -2.259  1.00 27.52 ? 285 ASP A CA    1 
ATOM   1216 C  C     . ASP A 1  159 ? 14.256  7.994   -2.807  1.00 27.05 ? 285 ASP A C     1 
ATOM   1217 O  O     . ASP A 1  159 ? 13.911  7.044   -2.096  1.00 27.96 ? 285 ASP A O     1 
ATOM   1218 C  CB    . ASP A 1  159 ? 14.310  10.292  -1.848  1.00 27.96 ? 285 ASP A CB    1 
ATOM   1219 C  CG    . ASP A 1  159 ? 15.005  11.213  -0.857  1.00 33.36 ? 285 ASP A CG    1 
ATOM   1220 O  OD1   . ASP A 1  159 ? 16.134  10.911  -0.421  1.00 36.72 ? 285 ASP A OD1   1 
ATOM   1221 O  OD2   . ASP A 1  159 ? 14.401  12.251  -0.510  1.00 35.76 ? 285 ASP A OD2   1 
ATOM   1222 N  N     . LEU A 1  160 ? 13.830  8.125   -4.060  1.00 25.86 ? 286 LEU A N     1 
ATOM   1223 C  CA    . LEU A 1  160 ? 12.908  7.154   -4.619  1.00 26.55 ? 286 LEU A CA    1 
ATOM   1224 C  C     . LEU A 1  160 ? 13.551  5.785   -4.804  1.00 28.03 ? 286 LEU A C     1 
ATOM   1225 O  O     . LEU A 1  160 ? 12.827  4.806   -4.995  1.00 28.79 ? 286 LEU A O     1 
ATOM   1226 C  CB    . LEU A 1  160 ? 12.344  7.688   -5.938  1.00 25.63 ? 286 LEU A CB    1 
ATOM   1227 C  CG    . LEU A 1  160 ? 11.535  8.992   -5.808  1.00 32.24 ? 286 LEU A CG    1 
ATOM   1228 C  CD1   . LEU A 1  160 ? 10.784  9.305   -7.094  1.00 32.00 ? 286 LEU A CD1   1 
ATOM   1229 C  CD2   . LEU A 1  160 ? 10.567  8.959   -4.637  1.00 28.33 ? 286 LEU A CD2   1 
ATOM   1230 N  N     . SER A 1  161 ? 14.880  5.692   -4.741  1.00 29.71 ? 287 SER A N     1 
ATOM   1231 C  CA    A SER A 1  161 ? 15.560  4.408   -4.790  0.40 30.43 ? 287 SER A CA    1 
ATOM   1232 C  CA    B SER A 1  161 ? 15.569  4.410   -4.789  0.60 30.00 ? 287 SER A CA    1 
ATOM   1233 C  C     . SER A 1  161 ? 15.730  3.781   -3.413  1.00 29.77 ? 287 SER A C     1 
ATOM   1234 O  O     . SER A 1  161 ? 16.129  2.618   -3.325  1.00 28.54 ? 287 SER A O     1 
ATOM   1235 C  CB    A SER A 1  161 ? 16.931  4.570   -5.458  0.40 33.72 ? 287 SER A CB    1 
ATOM   1236 C  CB    B SER A 1  161 ? 16.953  4.575   -5.431  0.60 34.07 ? 287 SER A CB    1 
ATOM   1237 O  OG    A SER A 1  161 ? 16.789  5.068   -6.778  0.40 33.20 ? 287 SER A OG    1 
ATOM   1238 O  OG    B SER A 1  161 ? 17.873  5.153   -4.521  0.60 33.43 ? 287 SER A OG    1 
ATOM   1239 N  N     . THR A 1  162 ? 15.440  4.520   -2.347  1.00 33.04 ? 288 THR A N     1 
ATOM   1240 C  CA    A THR A 1  162 ? 15.530  3.986   -0.992  0.75 35.08 ? 288 THR A CA    1 
ATOM   1241 C  CA    B THR A 1  162 ? 15.536  3.971   -1.001  0.25 35.71 ? 288 THR A CA    1 
ATOM   1242 C  C     . THR A 1  162 ? 14.262  3.200   -0.667  1.00 36.05 ? 288 THR A C     1 
ATOM   1243 O  O     . THR A 1  162 ? 13.160  3.706   -0.897  1.00 35.09 ? 288 THR A O     1 
ATOM   1244 C  CB    A THR A 1  162 ? 15.705  5.126   0.008   0.75 37.28 ? 288 THR A CB    1 
ATOM   1245 C  CB    B THR A 1  162 ? 15.755  5.079   0.026   0.25 37.75 ? 288 THR A CB    1 
ATOM   1246 O  OG1   A THR A 1  162 ? 16.804  5.950   -0.398  0.75 41.46 ? 288 THR A OG1   1 
ATOM   1247 O  OG1   B THR A 1  162 ? 14.648  5.987   0.003   0.25 39.01 ? 288 THR A OG1   1 
ATOM   1248 C  CG2   A THR A 1  162 ? 15.956  4.600   1.415   0.75 37.02 ? 288 THR A CG2   1 
ATOM   1249 C  CG2   B THR A 1  162 ? 17.038  5.838   -0.270  0.25 40.25 ? 288 THR A CG2   1 
ATOM   1250 N  N     . PRO A 1  163 ? 14.367  1.982   -0.128  1.00 37.70 ? 289 PRO A N     1 
ATOM   1251 C  CA    . PRO A 1  163 ? 13.150  1.219   0.179   1.00 35.59 ? 289 PRO A CA    1 
ATOM   1252 C  C     . PRO A 1  163 ? 12.235  1.954   1.147   1.00 30.57 ? 289 PRO A C     1 
ATOM   1253 O  O     . PRO A 1  163 ? 12.675  2.540   2.139   1.00 27.43 ? 289 PRO A O     1 
ATOM   1254 C  CB    . PRO A 1  163 ? 13.683  -0.080  0.795   1.00 37.16 ? 289 PRO A CB    1 
ATOM   1255 C  CG    . PRO A 1  163 ? 15.074  -0.202  0.293   1.00 41.15 ? 289 PRO A CG    1 
ATOM   1256 C  CD    . PRO A 1  163 ? 15.584  1.195   0.158   1.00 42.89 ? 289 PRO A CD    1 
ATOM   1257 N  N     . VAL A 1  164 ? 10.948  1.925   0.834   1.00 31.69 ? 290 VAL A N     1 
ATOM   1258 C  CA    . VAL A 1  164 ? 9.914   2.373   1.758   1.00 30.60 ? 290 VAL A CA    1 
ATOM   1259 C  C     . VAL A 1  164 ? 9.664   1.268   2.772   1.00 27.71 ? 290 VAL A C     1 
ATOM   1260 O  O     . VAL A 1  164 ? 9.545   0.096   2.404   1.00 24.86 ? 290 VAL A O     1 
ATOM   1261 C  CB    . VAL A 1  164 ? 8.625   2.720   1.000   1.00 31.77 ? 290 VAL A CB    1 
ATOM   1262 C  CG1   . VAL A 1  164 ? 7.603   3.279   1.947   1.00 31.52 ? 290 VAL A CG1   1 
ATOM   1263 C  CG2   . VAL A 1  164 ? 8.911   3.698   -0.139  1.00 37.13 ? 290 VAL A CG2   1 
ATOM   1264 N  N     . LEU A 1  165 ? 9.572   1.636   4.043   1.00 30.73 ? 291 LEU A N     1 
ATOM   1265 C  CA    . LEU A 1  165 ? 9.381   0.676   5.118   1.00 34.24 ? 291 LEU A CA    1 
ATOM   1266 C  C     . LEU A 1  165 ? 7.932   0.691   5.584   1.00 37.91 ? 291 LEU A C     1 
ATOM   1267 O  O     . LEU A 1  165 ? 7.204   1.670   5.405   1.00 31.08 ? 291 LEU A O     1 
ATOM   1268 C  CB    . LEU A 1  165 ? 10.316  0.986   6.294   1.00 32.10 ? 291 LEU A CB    1 
ATOM   1269 C  CG    . LEU A 1  165 ? 11.804  1.086   5.937   1.00 34.26 ? 291 LEU A CG    1 
ATOM   1270 C  CD1   . LEU A 1  165 ? 12.641  1.440   7.170   1.00 40.05 ? 291 LEU A CD1   1 
ATOM   1271 C  CD2   . LEU A 1  165 ? 12.295  -0.204  5.310   1.00 32.55 ? 291 LEU A CD2   1 
ATOM   1272 N  N     . ARG A 1  166 ? 7.513   -0.418  6.195   1.00 44.19 ? 292 ARG A N     1 
ATOM   1273 C  CA    . ARG A 1  166 ? 6.135   -0.490  6.661   1.00 47.51 ? 292 ARG A CA    1 
ATOM   1274 C  C     . ARG A 1  166 ? 5.840   0.608   7.676   1.00 40.64 ? 292 ARG A C     1 
ATOM   1275 O  O     . ARG A 1  166 ? 4.724   1.141   7.707   1.00 41.36 ? 292 ARG A O     1 
ATOM   1276 C  CB    . ARG A 1  166 ? 5.841   -1.876  7.245   1.00 57.54 ? 292 ARG A CB    1 
ATOM   1277 C  CG    . ARG A 1  166 ? 4.388   -2.072  7.700   1.00 69.05 ? 292 ARG A CG    1 
ATOM   1278 C  CD    . ARG A 1  166 ? 3.385   -1.844  6.570   1.00 75.47 ? 292 ARG A CD    1 
ATOM   1279 N  NE    . ARG A 1  166 ? 2.020   -1.675  7.065   1.00 79.06 ? 292 ARG A NE    1 
ATOM   1280 C  CZ    . ARG A 1  166 ? 1.023   -2.536  6.883   1.00 85.51 ? 292 ARG A CZ    1 
ATOM   1281 N  NH1   . ARG A 1  166 ? 1.202   -3.662  6.204   1.00 86.58 ? 292 ARG A NH1   1 
ATOM   1282 N  NH2   . ARG A 1  166 ? -0.174  -2.263  7.385   1.00 89.41 ? 292 ARG A NH2   1 
ATOM   1283 N  N     . SER A 1  167 ? 6.827   0.986   8.493   1.00 43.24 ? 293 SER A N     1 
ATOM   1284 C  CA    . SER A 1  167 ? 6.620   2.091   9.423   1.00 47.86 ? 293 SER A CA    1 
ATOM   1285 C  C     . SER A 1  167 ? 6.334   3.383   8.672   1.00 46.40 ? 293 SER A C     1 
ATOM   1286 O  O     . SER A 1  167 ? 5.514   4.201   9.107   1.00 47.75 ? 293 SER A O     1 
ATOM   1287 C  CB    . SER A 1  167 ? 7.842   2.262   10.325  1.00 59.02 ? 293 SER A CB    1 
ATOM   1288 O  OG    . SER A 1  167 ? 8.923   2.851   9.618   1.00 62.43 ? 293 SER A OG    1 
ATOM   1289 N  N     . ASP A 1  168 ? 7.014   3.594   7.547   1.00 41.66 ? 294 ASP A N     1 
ATOM   1290 C  CA    . ASP A 1  168 ? 6.687   4.733   6.701   1.00 37.91 ? 294 ASP A CA    1 
ATOM   1291 C  C     . ASP A 1  168 ? 5.239   4.661   6.236   1.00 35.12 ? 294 ASP A C     1 
ATOM   1292 O  O     . ASP A 1  168 ? 4.555   5.685   6.146   1.00 32.44 ? 294 ASP A O     1 
ATOM   1293 C  CB    . ASP A 1  168 ? 7.625   4.775   5.496   1.00 40.51 ? 294 ASP A CB    1 
ATOM   1294 C  CG    . ASP A 1  168 ? 9.091   4.832   5.895   1.00 40.99 ? 294 ASP A CG    1 
ATOM   1295 O  OD1   . ASP A 1  168 ? 9.400   5.399   6.967   1.00 42.62 ? 294 ASP A OD1   1 
ATOM   1296 O  OD2   . ASP A 1  168 ? 9.928   4.302   5.137   1.00 35.75 ? 294 ASP A OD2   1 
ATOM   1297 N  N     . VAL A 1  169 ? 4.753   3.456   5.941   1.00 37.23 ? 295 VAL A N     1 
ATOM   1298 C  CA    . VAL A 1  169 ? 3.417   3.314   5.368   1.00 34.14 ? 295 VAL A CA    1 
ATOM   1299 C  C     . VAL A 1  169 ? 2.357   3.765   6.364   1.00 30.58 ? 295 VAL A C     1 
ATOM   1300 O  O     . VAL A 1  169 ? 1.413   4.481   6.009   1.00 27.68 ? 295 VAL A O     1 
ATOM   1301 C  CB    . VAL A 1  169 ? 3.184   1.862   4.918   1.00 30.47 ? 295 VAL A CB    1 
ATOM   1302 C  CG1   . VAL A 1  169 ? 1.747   1.665   4.455   1.00 32.17 ? 295 VAL A CG1   1 
ATOM   1303 C  CG2   . VAL A 1  169 ? 4.155   1.492   3.812   1.00 31.35 ? 295 VAL A CG2   1 
ATOM   1304 N  N     . ASP A 1  170 ? 2.487   3.343   7.622   1.00 38.19 ? 296 ASP A N     1 
ATOM   1305 C  CA    . ASP A 1  170 ? 1.481   3.693   8.619   1.00 43.18 ? 296 ASP A CA    1 
ATOM   1306 C  C     . ASP A 1  170 ? 1.395   5.201   8.799   1.00 42.39 ? 296 ASP A C     1 
ATOM   1307 O  O     . ASP A 1  170 ? 0.303   5.754   8.985   1.00 43.62 ? 296 ASP A O     1 
ATOM   1308 C  CB    . ASP A 1  170 ? 1.801   3.005   9.944   1.00 50.74 ? 296 ASP A CB    1 
ATOM   1309 C  CG    . ASP A 1  170 ? 1.880   1.492   9.810   1.00 59.23 ? 296 ASP A CG    1 
ATOM   1310 O  OD1   . ASP A 1  170 ? 1.018   0.908   9.114   1.00 61.24 ? 296 ASP A OD1   1 
ATOM   1311 O  OD2   . ASP A 1  170 ? 2.811   0.886   10.385  1.00 60.85 ? 296 ASP A OD2   1 
ATOM   1312 N  N     . ALA A 1  171 ? 2.534   5.889   8.719   1.00 41.05 ? 297 ALA A N     1 
ATOM   1313 C  CA    . ALA A 1  171 ? 2.534   7.341   8.858   1.00 44.66 ? 297 ALA A CA    1 
ATOM   1314 C  C     . ALA A 1  171 ? 1.857   7.998   7.664   1.00 38.03 ? 297 ALA A C     1 
ATOM   1315 O  O     . ALA A 1  171 ? 1.020   8.892   7.827   1.00 37.79 ? 297 ALA A O     1 
ATOM   1316 C  CB    . ALA A 1  171 ? 3.966   7.856   9.012   1.00 51.93 ? 297 ALA A CB    1 
ATOM   1317 N  N     . LEU A 1  172 ? 2.211   7.565   6.453   1.00 33.34 ? 298 LEU A N     1 
ATOM   1318 C  CA    . LEU A 1  172 ? 1.547   8.080   5.263   1.00 34.94 ? 298 LEU A CA    1 
ATOM   1319 C  C     . LEU A 1  172 ? 0.043   7.851   5.327   1.00 32.16 ? 298 LEU A C     1 
ATOM   1320 O  O     . LEU A 1  172 ? -0.739  8.732   4.951   1.00 33.13 ? 298 LEU A O     1 
ATOM   1321 C  CB    . LEU A 1  172 ? 2.117   7.423   4.010   1.00 36.07 ? 298 LEU A CB    1 
ATOM   1322 C  CG    . LEU A 1  172 ? 3.469   7.957   3.559   1.00 48.47 ? 298 LEU A CG    1 
ATOM   1323 C  CD1   . LEU A 1  172 ? 4.096   7.003   2.556   1.00 52.13 ? 298 LEU A CD1   1 
ATOM   1324 C  CD2   . LEU A 1  172 ? 3.314   9.353   2.963   1.00 49.11 ? 298 LEU A CD2   1 
ATOM   1325 N  N     . GLN A 1  173 ? -0.387  6.672   5.778   1.00 31.90 ? 299 GLN A N     1 
ATOM   1326 C  CA    . GLN A 1  173 ? -1.819  6.395   5.786   1.00 30.81 ? 299 GLN A CA    1 
ATOM   1327 C  C     . GLN A 1  173 ? -2.546  7.339   6.729   1.00 31.54 ? 299 GLN A C     1 
ATOM   1328 O  O     . GLN A 1  173 ? -3.641  7.825   6.416   1.00 31.28 ? 299 GLN A O     1 
ATOM   1329 C  CB    . GLN A 1  173 ? -2.097  4.943   6.166   1.00 32.07 ? 299 GLN A CB    1 
ATOM   1330 C  CG    . GLN A 1  173 ? -3.584  4.630   6.082   1.00 34.61 ? 299 GLN A CG    1 
ATOM   1331 C  CD    . GLN A 1  173 ? -3.895  3.154   5.975   1.00 41.25 ? 299 GLN A CD    1 
ATOM   1332 O  OE1   . GLN A 1  173 ? -3.009  2.323   5.773   1.00 34.56 ? 299 GLN A OE1   1 
ATOM   1333 N  NE2   . GLN A 1  173 ? -5.177  2.820   6.107   1.00 46.17 ? 299 GLN A NE2   1 
ATOM   1334 N  N     . GLN A 1  174 ? -1.944  7.630   7.883   1.00 39.05 ? 300 GLN A N     1 
ATOM   1335 C  CA    . GLN A 1  174 ? -2.551  8.582   8.805   1.00 42.12 ? 300 GLN A CA    1 
ATOM   1336 C  C     . GLN A 1  174 ? -2.800  9.921   8.121   1.00 38.35 ? 300 GLN A C     1 
ATOM   1337 O  O     . GLN A 1  174 ? -3.910  10.461  8.175   1.00 37.37 ? 300 GLN A O     1 
ATOM   1338 C  CB    . GLN A 1  174 ? -1.664  8.754   10.037  1.00 45.01 ? 300 GLN A CB    1 
ATOM   1339 C  CG    . GLN A 1  174 ? -1.644  7.540   10.949  1.00 45.79 ? 300 GLN A CG    1 
ATOM   1340 N  N     . VAL A 1  175 ? -1.785  10.469  7.448   1.00 34.39 ? 301 VAL A N     1 
ATOM   1341 C  CA    . VAL A 1  175 ? -1.953  11.802  6.882   1.00 40.68 ? 301 VAL A CA    1 
ATOM   1342 C  C     . VAL A 1  175 ? -2.925  11.771  5.709   1.00 39.54 ? 301 VAL A C     1 
ATOM   1343 O  O     . VAL A 1  175 ? -3.660  12.740  5.481   1.00 39.95 ? 301 VAL A O     1 
ATOM   1344 C  CB    . VAL A 1  175 ? -0.595  12.412  6.481   1.00 43.03 ? 301 VAL A CB    1 
ATOM   1345 C  CG1   . VAL A 1  175 ? 0.372   12.384  7.667   1.00 45.29 ? 301 VAL A CG1   1 
ATOM   1346 C  CG2   . VAL A 1  175 ? 0.006   11.703  5.275   1.00 42.83 ? 301 VAL A CG2   1 
ATOM   1347 N  N     . VAL A 1  176 ? -2.959  10.676  4.950   1.00 32.88 ? 302 VAL A N     1 
ATOM   1348 C  CA    . VAL A 1  176 ? -3.903  10.588  3.839   1.00 31.34 ? 302 VAL A CA    1 
ATOM   1349 C  C     . VAL A 1  176 ? -5.334  10.537  4.363   1.00 31.21 ? 302 VAL A C     1 
ATOM   1350 O  O     . VAL A 1  176 ? -6.227  11.215  3.838   1.00 29.96 ? 302 VAL A O     1 
ATOM   1351 C  CB    . VAL A 1  176 ? -3.568  9.377   2.950   1.00 28.45 ? 302 VAL A CB    1 
ATOM   1352 C  CG1   . VAL A 1  176 ? -4.615  9.179   1.868   1.00 31.80 ? 302 VAL A CG1   1 
ATOM   1353 C  CG2   . VAL A 1  176 ? -2.206  9.568   2.305   1.00 33.03 ? 302 VAL A CG2   1 
ATOM   1354 N  N     . GLU A 1  177 ? -5.571  9.759   5.417   1.00 33.00 ? 303 GLU A N     1 
ATOM   1355 C  CA    . GLU A 1  177 ? -6.905  9.687   6.006   1.00 35.53 ? 303 GLU A CA    1 
ATOM   1356 C  C     . GLU A 1  177 ? -7.363  11.044  6.519   1.00 38.61 ? 303 GLU A C     1 
ATOM   1357 O  O     . GLU A 1  177 ? -8.537  11.405  6.370   1.00 38.36 ? 303 GLU A O     1 
ATOM   1358 C  CB    . GLU A 1  177 ? -6.919  8.647   7.125   1.00 34.35 ? 303 GLU A CB    1 
ATOM   1359 C  CG    . GLU A 1  177 ? -6.726  7.240   6.592   1.00 37.72 ? 303 GLU A CG    1 
ATOM   1360 C  CD    . GLU A 1  177 ? -6.513  6.204   7.671   1.00 39.79 ? 303 GLU A CD    1 
ATOM   1361 O  OE1   . GLU A 1  177 ? -6.145  6.580   8.798   1.00 42.58 ? 303 GLU A OE1   1 
ATOM   1362 O  OE2   . GLU A 1  177 ? -6.709  5.004   7.385   1.00 42.93 ? 303 GLU A OE2   1 
ATOM   1363 N  N     . GLU A 1  178 ? -6.452  11.819  7.115   1.00 30.79 ? 304 GLU A N     1 
ATOM   1364 C  CA    . GLU A 1  178 ? -6.817  13.148  7.593   1.00 41.23 ? 304 GLU A CA    1 
ATOM   1365 C  C     . GLU A 1  178 ? -7.311  14.020  6.444   1.00 36.76 ? 304 GLU A C     1 
ATOM   1366 O  O     . GLU A 1  178 ? -8.341  14.691  6.557   1.00 39.25 ? 304 GLU A O     1 
ATOM   1367 C  CB    . GLU A 1  178 ? -5.624  13.801  8.298   1.00 53.74 ? 304 GLU A CB    1 
ATOM   1368 C  CG    . GLU A 1  178 ? -5.939  15.152  8.944   1.00 67.27 ? 304 GLU A CG    1 
ATOM   1369 C  CD    . GLU A 1  178 ? -6.959  15.042  10.071  1.00 78.15 ? 304 GLU A CD    1 
ATOM   1370 O  OE1   . GLU A 1  178 ? -6.847  14.101  10.887  1.00 80.71 ? 304 GLU A OE1   1 
ATOM   1371 O  OE2   . GLU A 1  178 ? -7.879  15.887  10.137  1.00 81.31 ? 304 GLU A OE2   1 
ATOM   1372 N  N     . ALA A 1  179 ? -6.585  14.018  5.324   1.00 36.53 ? 305 ALA A N     1 
ATOM   1373 C  CA    . ALA A 1  179 ? -6.988  14.833  4.184   1.00 36.30 ? 305 ALA A CA    1 
ATOM   1374 C  C     . ALA A 1  179 ? -8.271  14.303  3.551   1.00 34.82 ? 305 ALA A C     1 
ATOM   1375 O  O     . ALA A 1  179 ? -9.139  15.084  3.143   1.00 37.16 ? 305 ALA A O     1 
ATOM   1376 C  CB    . ALA A 1  179 ? -5.862  14.878  3.152   1.00 36.41 ? 305 ALA A CB    1 
ATOM   1377 N  N     . VAL A 1  180 ? -8.401  12.981  3.451   1.00 33.00 ? 306 VAL A N     1 
ATOM   1378 C  CA    . VAL A 1  180 ? -9.622  12.380  2.913   1.00 30.73 ? 306 VAL A CA    1 
ATOM   1379 C  C     . VAL A 1  180 ? -10.810 12.705  3.809   1.00 29.77 ? 306 VAL A C     1 
ATOM   1380 O  O     . VAL A 1  180 ? -11.904 13.026  3.327   1.00 29.83 ? 306 VAL A O     1 
ATOM   1381 C  CB    . VAL A 1  180 ? -9.422  10.860  2.745   1.00 30.47 ? 306 VAL A CB    1 
ATOM   1382 C  CG1   . VAL A 1  180 ? -10.734 10.149  2.413   1.00 32.90 ? 306 VAL A CG1   1 
ATOM   1383 C  CG2   . VAL A 1  180 ? -8.407  10.586  1.649   1.00 29.36 ? 306 VAL A CG2   1 
ATOM   1384 N  N     . GLY A 1  181 ? -10.613 12.644  5.127   1.00 33.57 ? 307 GLY A N     1 
ATOM   1385 C  CA    . GLY A 1  181 ? -11.704 12.913  6.050   1.00 31.96 ? 307 GLY A CA    1 
ATOM   1386 C  C     . GLY A 1  181 ? -12.238 14.325  5.946   1.00 40.03 ? 307 GLY A C     1 
ATOM   1387 O  O     . GLY A 1  181 ? -13.437 14.553  6.128   1.00 42.21 ? 307 GLY A O     1 
ATOM   1388 N  N     . GLN A 1  182 ? -11.364 15.293  5.662   1.00 38.35 ? 308 GLN A N     1 
ATOM   1389 C  CA    . GLN A 1  182 ? -11.823 16.665  5.473   1.00 39.33 ? 308 GLN A CA    1 
ATOM   1390 C  C     . GLN A 1  182 ? -12.460 16.851  4.104   1.00 33.36 ? 308 GLN A C     1 
ATOM   1391 O  O     . GLN A 1  182 ? -13.438 17.597  3.964   1.00 35.52 ? 308 GLN A O     1 
ATOM   1392 C  CB    . GLN A 1  182 ? -10.655 17.635  5.653   1.00 42.98 ? 308 GLN A CB    1 
ATOM   1393 C  CG    . GLN A 1  182 ? -10.073 17.597  7.048   1.00 48.17 ? 308 GLN A CG    1 
ATOM   1394 C  CD    . GLN A 1  182 ? -8.857  18.478  7.200   1.00 51.65 ? 308 GLN A CD    1 
ATOM   1395 O  OE1   . GLN A 1  182 ? -8.560  19.304  6.337   1.00 51.26 ? 308 GLN A OE1   1 
ATOM   1396 N  NE2   . GLN A 1  182 ? -8.141  18.305  8.302   1.00 58.00 ? 308 GLN A NE2   1 
ATOM   1397 N  N     . ALA A 1  183 ? -11.924 16.173  3.090   1.00 32.49 ? 309 ALA A N     1 
ATOM   1398 C  CA    . ALA A 1  183 ? -12.449 16.312  1.739   1.00 33.69 ? 309 ALA A CA    1 
ATOM   1399 C  C     . ALA A 1  183 ? -13.841 15.709  1.624   1.00 32.36 ? 309 ALA A C     1 
ATOM   1400 O  O     . ALA A 1  183 ? -14.697 16.245  0.908   1.00 35.18 ? 309 ALA A O     1 
ATOM   1401 C  CB    . ALA A 1  183 ? -11.500 15.653  0.741   1.00 34.90 ? 309 ALA A CB    1 
ATOM   1402 N  N     . LEU A 1  184 ? -14.082 14.595  2.304   1.00 35.06 ? 310 LEU A N     1 
ATOM   1403 C  CA    . LEU A 1  184 ? -15.388 13.946  2.255   1.00 36.59 ? 310 LEU A CA    1 
ATOM   1404 C  C     . LEU A 1  184 ? -15.580 13.096  3.502   1.00 32.21 ? 310 LEU A C     1 
ATOM   1405 O  O     . LEU A 1  184 ? -15.086 11.963  3.557   1.00 28.88 ? 310 LEU A O     1 
ATOM   1406 C  CB    . LEU A 1  184 ? -15.524 13.081  1.001   1.00 32.59 ? 310 LEU A CB    1 
ATOM   1407 C  CG    . LEU A 1  184 ? -16.845 12.315  0.836   1.00 27.63 ? 310 LEU A CG    1 
ATOM   1408 C  CD1   . LEU A 1  184 ? -18.010 13.252  0.653   1.00 30.80 ? 310 LEU A CD1   1 
ATOM   1409 C  CD2   . LEU A 1  184 ? -16.738 11.353  -0.345  1.00 31.04 ? 310 LEU A CD2   1 
ATOM   1410 N  N     . PRO A 1  185 ? -16.265 13.606  4.523   1.00 33.18 ? 311 PRO A N     1 
ATOM   1411 C  CA    . PRO A 1  185 ? -16.548 12.781  5.701   1.00 34.08 ? 311 PRO A CA    1 
ATOM   1412 C  C     . PRO A 1  185 ? -17.158 11.444  5.310   1.00 33.15 ? 311 PRO A C     1 
ATOM   1413 O  O     . PRO A 1  185 ? -18.030 11.364  4.442   1.00 34.51 ? 311 PRO A O     1 
ATOM   1414 C  CB    . PRO A 1  185 ? -17.531 13.643  6.499   1.00 39.17 ? 311 PRO A CB    1 
ATOM   1415 C  CG    . PRO A 1  185 ? -17.110 15.047  6.159   1.00 42.73 ? 311 PRO A CG    1 
ATOM   1416 C  CD    . PRO A 1  185 ? -16.711 15.000  4.712   1.00 36.73 ? 311 PRO A CD    1 
ATOM   1417 N  N     . GLY A 1  186 ? -16.693 10.386  5.973   1.00 28.62 ? 312 GLY A N     1 
ATOM   1418 C  CA    . GLY A 1  186 ? -17.137 9.045   5.693   1.00 29.63 ? 312 GLY A CA    1 
ATOM   1419 C  C     . GLY A 1  186 ? -16.291 8.301   4.684   1.00 32.05 ? 312 GLY A C     1 
ATOM   1420 O  O     . GLY A 1  186 ? -16.402 7.074   4.583   1.00 31.60 ? 312 GLY A O     1 
ATOM   1421 N  N     . ALA A 1  187 ? -15.451 8.997   3.929   1.00 26.42 ? 313 ALA A N     1 
ATOM   1422 C  CA    . ALA A 1  187 ? -14.637 8.308   2.944   1.00 27.27 ? 313 ALA A CA    1 
ATOM   1423 C  C     . ALA A 1  187 ? -13.578 7.469   3.650   1.00 29.59 ? 313 ALA A C     1 
ATOM   1424 O  O     . ALA A 1  187 ? -13.114 7.811   4.739   1.00 32.32 ? 313 ALA A O     1 
ATOM   1425 C  CB    . ALA A 1  187 ? -13.982 9.305   1.994   1.00 29.67 ? 313 ALA A CB    1 
ATOM   1426 N  N     . THR A 1  188 ? -13.201 6.358   3.017   1.00 27.65 ? 314 THR A N     1 
ATOM   1427 C  CA    . THR A 1  188 ? -12.271 5.402   3.601   1.00 29.01 ? 314 THR A CA    1 
ATOM   1428 C  C     . THR A 1  188 ? -11.025 5.281   2.735   1.00 26.32 ? 314 THR A C     1 
ATOM   1429 O  O     . THR A 1  188 ? -11.058 5.538   1.530   1.00 24.58 ? 314 THR A O     1 
ATOM   1430 C  CB    . THR A 1  188 ? -12.916 4.025   3.751   1.00 30.50 ? 314 THR A CB    1 
ATOM   1431 O  OG1   . THR A 1  188 ? -13.197 3.487   2.450   1.00 28.44 ? 314 THR A OG1   1 
ATOM   1432 C  CG2   . THR A 1  188 ? -14.216 4.133   4.556   1.00 33.10 ? 314 THR A CG2   1 
ATOM   1433 N  N     . VAL A 1  189 ? -9.928  4.870   3.371   1.00 26.82 ? 315 VAL A N     1 
ATOM   1434 C  CA    . VAL A 1  189 ? -8.633  4.690   2.721   1.00 24.12 ? 315 VAL A CA    1 
ATOM   1435 C  C     . VAL A 1  189 ? -8.190  3.257   2.970   1.00 23.78 ? 315 VAL A C     1 
ATOM   1436 O  O     . VAL A 1  189 ? -8.181  2.799   4.118   1.00 26.61 ? 315 VAL A O     1 
ATOM   1437 C  CB    . VAL A 1  189 ? -7.579  5.676   3.259   1.00 25.37 ? 315 VAL A CB    1 
ATOM   1438 C  CG1   . VAL A 1  189 ? -6.215  5.424   2.619   1.00 24.48 ? 315 VAL A CG1   1 
ATOM   1439 C  CG2   . VAL A 1  189 ? -8.026  7.115   3.037   1.00 25.72 ? 315 VAL A CG2   1 
ATOM   1440 N  N     . THR A 1  190 ? -7.828  2.555   1.903   1.00 24.01 ? 316 THR A N     1 
ATOM   1441 C  CA    . THR A 1  190 ? -7.392  1.168   1.981   1.00 23.42 ? 316 THR A CA    1 
ATOM   1442 C  C     . THR A 1  190 ? -5.988  1.040   1.405   1.00 23.92 ? 316 THR A C     1 
ATOM   1443 O  O     . THR A 1  190 ? -5.735  1.460   0.273   1.00 20.75 ? 316 THR A O     1 
ATOM   1444 C  CB    . THR A 1  190 ? -8.359  0.253   1.220   1.00 26.06 ? 316 THR A CB    1 
ATOM   1445 O  OG1   . THR A 1  190 ? -9.649  0.305   1.839   1.00 25.74 ? 316 THR A OG1   1 
ATOM   1446 C  CG2   . THR A 1  190 ? -7.857  -1.195  1.216   1.00 27.03 ? 316 THR A CG2   1 
ATOM   1447 N  N     . LEU A 1  191 ? -5.084  0.449   2.179   1.00 21.14 ? 317 LEU A N     1 
ATOM   1448 C  CA    . LEU A 1  191 ? -3.745  0.161   1.683   1.00 21.48 ? 317 LEU A CA    1 
ATOM   1449 C  C     . LEU A 1  191 ? -3.828  -0.969  0.668   1.00 22.99 ? 317 LEU A C     1 
ATOM   1450 O  O     . LEU A 1  191 ? -4.451  -2.001  0.924   1.00 25.36 ? 317 LEU A O     1 
ATOM   1451 C  CB    . LEU A 1  191 ? -2.825  -0.212  2.846   1.00 21.53 ? 317 LEU A CB    1 
ATOM   1452 C  CG    . LEU A 1  191 ? -1.379  -0.612  2.551   1.00 24.08 ? 317 LEU A CG    1 
ATOM   1453 C  CD1   . LEU A 1  191 ? -0.597  0.545   1.919   1.00 21.54 ? 317 LEU A CD1   1 
ATOM   1454 C  CD2   . LEU A 1  191 ? -0.710  -1.094  3.845   1.00 24.91 ? 317 LEU A CD2   1 
ATOM   1455 N  N     A THR A 1  192 ? -3.226  -0.759  -0.499  0.74 19.22 ? 318 THR A N     1 
ATOM   1456 N  N     B THR A 1  192 ? -3.216  -0.771  -0.493  0.26 20.21 ? 318 THR A N     1 
ATOM   1457 C  CA    A THR A 1  192 ? -3.214  -1.788  -1.530  0.74 19.82 ? 318 THR A CA    1 
ATOM   1458 C  CA    B THR A 1  192 ? -3.201  -1.794  -1.530  0.26 20.09 ? 318 THR A CA    1 
ATOM   1459 C  C     A THR A 1  192 ? -1.781  -2.101  -1.948  0.74 18.78 ? 318 THR A C     1 
ATOM   1460 C  C     B THR A 1  192 ? -1.758  -1.949  -2.010  0.26 19.54 ? 318 THR A C     1 
ATOM   1461 O  O     A THR A 1  192 ? -0.860  -2.004  -1.129  0.74 19.78 ? 318 THR A O     1 
ATOM   1462 O  O     B THR A 1  192 ? -0.796  -1.591  -1.320  0.26 20.83 ? 318 THR A O     1 
ATOM   1463 C  CB    A THR A 1  192 ? -4.072  -1.351  -2.723  0.74 18.88 ? 318 THR A CB    1 
ATOM   1464 C  CB    B THR A 1  192 ? -4.205  -1.435  -2.638  0.26 19.88 ? 318 THR A CB    1 
ATOM   1465 O  OG1   A THR A 1  192 ? -3.463  -0.240  -3.394  0.74 23.54 ? 318 THR A OG1   1 
ATOM   1466 O  OG1   B THR A 1  192 ? -4.253  -2.484  -3.613  0.26 18.93 ? 318 THR A OG1   1 
ATOM   1467 C  CG2   A THR A 1  192 ? -5.450  -0.946  -2.250  0.74 20.44 ? 318 THR A CG2   1 
ATOM   1468 C  CG2   B THR A 1  192 ? -3.839  -0.121  -3.313  0.26 20.56 ? 318 THR A CG2   1 
ATOM   1469 N  N     . GLY A 1  193 ? -1.587  -2.515  -3.199  1.00 18.34 ? 319 GLY A N     1 
ATOM   1470 C  CA    . GLY A 1  193 ? -0.262  -2.761  -3.722  1.00 21.38 ? 319 GLY A CA    1 
ATOM   1471 C  C     . GLY A 1  193 ? 0.517   -3.821  -2.950  1.00 22.48 ? 319 GLY A C     1 
ATOM   1472 O  O     . GLY A 1  193 ? -0.034  -4.680  -2.261  1.00 19.30 ? 319 GLY A O     1 
ATOM   1473 N  N     . GLY A 1  194 ? 1.844   -3.737  -3.082  1.00 21.49 ? 320 GLY A N     1 
ATOM   1474 C  CA    . GLY A 1  194 ? 2.708   -4.757  -2.512  1.00 23.40 ? 320 GLY A CA    1 
ATOM   1475 C  C     . GLY A 1  194 ? 2.599   -4.883  -1.005  1.00 29.30 ? 320 GLY A C     1 
ATOM   1476 O  O     . GLY A 1  194 ? 2.716   -5.988  -0.459  1.00 22.77 ? 320 GLY A O     1 
ATOM   1477 N  N     . PHE A 1  195 ? 2.359   -3.770  -0.304  1.00 20.79 ? 321 PHE A N     1 
ATOM   1478 C  CA    . PHE A 1  195 ? 2.234   -3.874  1.142   1.00 19.67 ? 321 PHE A CA    1 
ATOM   1479 C  C     . PHE A 1  195 ? 1.008   -4.679  1.544   1.00 19.74 ? 321 PHE A C     1 
ATOM   1480 O  O     . PHE A 1  195 ? 1.058   -5.408  2.539   1.00 22.27 ? 321 PHE A O     1 
ATOM   1481 C  CB    . PHE A 1  195 ? 2.224   -2.482  1.777   1.00 22.60 ? 321 PHE A CB    1 
ATOM   1482 C  CG    . PHE A 1  195 ? 3.570   -1.815  1.733   1.00 23.31 ? 321 PHE A CG    1 
ATOM   1483 C  CD1   . PHE A 1  195 ? 4.579   -2.240  2.575   1.00 21.71 ? 321 PHE A CD1   1 
ATOM   1484 C  CD2   . PHE A 1  195 ? 3.846   -0.819  0.813   1.00 23.09 ? 321 PHE A CD2   1 
ATOM   1485 C  CE1   . PHE A 1  195 ? 5.827   -1.658  2.541   1.00 25.49 ? 321 PHE A CE1   1 
ATOM   1486 C  CE2   . PHE A 1  195 ? 5.111   -0.234  0.764   1.00 21.87 ? 321 PHE A CE2   1 
ATOM   1487 C  CZ    . PHE A 1  195 ? 6.093   -0.652  1.623   1.00 22.88 ? 321 PHE A CZ    1 
ATOM   1488 N  N     . ARG A 1  196 ? -0.090  -4.599  0.786   1.00 19.37 ? 322 ARG A N     1 
ATOM   1489 C  CA    . ARG A 1  196 ? -1.241  -5.433  1.141   1.00 20.77 ? 322 ARG A CA    1 
ATOM   1490 C  C     . ARG A 1  196 ? -0.947  -6.911  0.897   1.00 19.55 ? 322 ARG A C     1 
ATOM   1491 O  O     . ARG A 1  196 ? -1.535  -7.777  1.556   1.00 19.94 ? 322 ARG A O     1 
ATOM   1492 C  CB    . ARG A 1  196 ? -2.491  -5.008  0.365   1.00 21.98 ? 322 ARG A CB    1 
ATOM   1493 C  CG    . ARG A 1  196 ? -3.756  -5.816  0.738   1.00 22.10 ? 322 ARG A CG    1 
ATOM   1494 C  CD    . ARG A 1  196 ? -5.073  -5.208  0.180   1.00 22.99 ? 322 ARG A CD    1 
ATOM   1495 N  NE    . ARG A 1  196 ? -6.213  -6.064  0.548   1.00 21.51 ? 322 ARG A NE    1 
ATOM   1496 C  CZ    . ARG A 1  196 ? -6.938  -6.796  -0.297  1.00 22.63 ? 322 ARG A CZ    1 
ATOM   1497 N  NH1   . ARG A 1  196 ? -6.716  -6.774  -1.609  1.00 19.32 ? 322 ARG A NH1   1 
ATOM   1498 N  NH2   . ARG A 1  196 ? -7.913  -7.551  0.180   1.00 26.46 ? 322 ARG A NH2   1 
ATOM   1499 N  N     . ARG A 1  197 ? -0.053  -7.220  -0.040  1.00 19.24 ? 323 ARG A N     1 
ATOM   1500 C  CA    . ARG A 1  197 ? 0.373   -8.599  -0.263  1.00 23.06 ? 323 ARG A CA    1 
ATOM   1501 C  C     . ARG A 1  197 ? 1.352   -9.095  0.797   1.00 25.11 ? 323 ARG A C     1 
ATOM   1502 O  O     . ARG A 1  197 ? 1.811   -10.241 0.706   1.00 24.67 ? 323 ARG A O     1 
ATOM   1503 C  CB    . ARG A 1  197 ? 0.999   -8.732  -1.654  1.00 22.62 ? 323 ARG A CB    1 
ATOM   1504 C  CG    . ARG A 1  197 ? 0.050   -8.369  -2.801  1.00 19.26 ? 323 ARG A CG    1 
ATOM   1505 C  CD    . ARG A 1  197 ? 0.510   -8.990  -4.108  1.00 18.94 ? 323 ARG A CD    1 
ATOM   1506 N  NE    . ARG A 1  197 ? 1.902   -8.656  -4.391  1.00 21.67 ? 323 ARG A NE    1 
ATOM   1507 C  CZ    . ARG A 1  197 ? 2.302   -7.513  -4.929  1.00 23.73 ? 323 ARG A CZ    1 
ATOM   1508 N  NH1   . ARG A 1  197 ? 1.412   -6.580  -5.267  1.00 18.84 ? 323 ARG A NH1   1 
ATOM   1509 N  NH2   . ARG A 1  197 ? 3.596   -7.305  -5.125  1.00 19.96 ? 323 ARG A NH2   1 
ATOM   1510 N  N     . GLY A 1  198 ? 1.682   -8.271  1.792   1.00 22.07 ? 324 GLY A N     1 
ATOM   1511 C  CA    . GLY A 1  198 ? 2.531   -8.684  2.893   1.00 24.18 ? 324 GLY A CA    1 
ATOM   1512 C  C     . GLY A 1  198 ? 3.984   -8.263  2.791   1.00 27.01 ? 324 GLY A C     1 
ATOM   1513 O  O     . GLY A 1  198 ? 4.770   -8.581  3.694   1.00 21.57 ? 324 GLY A O     1 
ATOM   1514 N  N     . LYS A 1  199 ? 4.370   -7.568  1.729   1.00 23.73 ? 325 LYS A N     1 
ATOM   1515 C  CA    . LYS A 1  199 ? 5.741   -7.101  1.617   1.00 23.77 ? 325 LYS A CA    1 
ATOM   1516 C  C     . LYS A 1  199 ? 6.091   -6.217  2.805   1.00 22.17 ? 325 LYS A C     1 
ATOM   1517 O  O     . LYS A 1  199 ? 5.257   -5.459  3.306   1.00 27.53 ? 325 LYS A O     1 
ATOM   1518 C  CB    . LYS A 1  199 ? 5.936   -6.337  0.306   1.00 24.64 ? 325 LYS A CB    1 
ATOM   1519 C  CG    . LYS A 1  199 ? 5.935   -7.227  -0.925  1.00 22.94 ? 325 LYS A CG    1 
ATOM   1520 C  CD    . LYS A 1  199 ? 6.222   -6.457  -2.213  1.00 26.31 ? 325 LYS A CD    1 
ATOM   1521 C  CE    . LYS A 1  199 ? 7.623   -5.867  -2.274  1.00 33.31 ? 325 LYS A CE    1 
ATOM   1522 N  NZ    . LYS A 1  199 ? 8.701   -6.885  -2.161  1.00 44.42 ? 325 LYS A NZ    1 
ATOM   1523 N  N     . LEU A 1  200 ? 7.331   -6.340  3.274   1.00 24.31 ? 326 LEU A N     1 
ATOM   1524 C  CA    . LEU A 1  200 ? 7.815   -5.511  4.368   1.00 30.10 ? 326 LEU A CA    1 
ATOM   1525 C  C     . LEU A 1  200 ? 8.455   -4.224  3.880   1.00 30.46 ? 326 LEU A C     1 
ATOM   1526 O  O     . LEU A 1  200 ? 8.556   -3.265  4.652   1.00 32.81 ? 326 LEU A O     1 
ATOM   1527 C  CB    . LEU A 1  200 ? 8.828   -6.285  5.214   1.00 34.11 ? 326 LEU A CB    1 
ATOM   1528 C  CG    . LEU A 1  200 ? 8.303   -7.583  5.827   1.00 39.98 ? 326 LEU A CG    1 
ATOM   1529 C  CD1   . LEU A 1  200 ? 9.329   -8.135  6.794   1.00 43.75 ? 326 LEU A CD1   1 
ATOM   1530 C  CD2   . LEU A 1  200 ? 6.961   -7.381  6.521   1.00 39.94 ? 326 LEU A CD2   1 
ATOM   1531 N  N     . GLN A 1  201 ? 8.888   -4.193  2.625   1.00 31.65 ? 327 GLN A N     1 
ATOM   1532 C  CA    . GLN A 1  201 ? 9.433   -3.002  2.002   1.00 35.09 ? 327 GLN A CA    1 
ATOM   1533 C  C     . GLN A 1  201 ? 8.793   -2.832  0.637   1.00 33.31 ? 327 GLN A C     1 
ATOM   1534 O  O     . GLN A 1  201 ? 8.183   -3.755  0.092   1.00 31.60 ? 327 GLN A O     1 
ATOM   1535 C  CB    . GLN A 1  201 ? 10.960  -3.082  1.856   1.00 37.15 ? 327 GLN A CB    1 
ATOM   1536 C  CG    . GLN A 1  201 ? 11.700  -3.201  3.174   1.00 44.16 ? 327 GLN A CG    1 
ATOM   1537 C  CD    . GLN A 1  201 ? 13.208  -3.284  2.993   1.00 43.70 ? 327 GLN A CD    1 
ATOM   1538 O  OE1   . GLN A 1  201 ? 13.708  -3.368  1.870   1.00 38.67 ? 327 GLN A OE1   1 
ATOM   1539 N  NE2   . GLN A 1  201 ? 13.937  -3.267  4.101   1.00 50.09 ? 327 GLN A NE2   1 
ATOM   1540 N  N     . GLY A 1  202 ? 8.931   -1.632  0.089   1.00 28.23 ? 328 GLY A N     1 
ATOM   1541 C  CA    . GLY A 1  202 ? 8.453   -1.375  -1.254  1.00 31.27 ? 328 GLY A CA    1 
ATOM   1542 C  C     . GLY A 1  202 ? 9.110   -0.128  -1.794  1.00 30.20 ? 328 GLY A C     1 
ATOM   1543 O  O     . GLY A 1  202 ? 9.847   0.567   -1.092  1.00 31.69 ? 328 GLY A O     1 
ATOM   1544 N  N     A HIS A 1  203 ? 8.826   0.149   -3.062  0.59 31.45 ? 329 HIS A N     1 
ATOM   1545 N  N     B HIS A 1  203 ? 8.843   0.137   -3.072  0.41 31.67 ? 329 HIS A N     1 
ATOM   1546 C  CA    A HIS A 1  203 ? 9.324   1.344   -3.724  0.59 32.65 ? 329 HIS A CA    1 
ATOM   1547 C  CA    B HIS A 1  203 ? 9.325   1.343   -3.727  0.41 32.47 ? 329 HIS A CA    1 
ATOM   1548 C  C     A HIS A 1  203 ? 8.260   2.420   -3.878  0.59 30.05 ? 329 HIS A C     1 
ATOM   1549 C  C     B HIS A 1  203 ? 8.304   2.470   -3.713  0.41 30.09 ? 329 HIS A C     1 
ATOM   1550 O  O     A HIS A 1  203 ? 8.547   3.481   -4.440  0.59 26.50 ? 329 HIS A O     1 
ATOM   1551 O  O     B HIS A 1  203 ? 8.668   3.616   -3.996  0.41 27.78 ? 329 HIS A O     1 
ATOM   1552 C  CB    A HIS A 1  203 ? 9.900   0.974   -5.093  0.59 34.51 ? 329 HIS A CB    1 
ATOM   1553 C  CB    B HIS A 1  203 ? 9.715   1.042   -5.179  0.41 33.68 ? 329 HIS A CB    1 
ATOM   1554 C  CG    A HIS A 1  203 ? 11.158  0.166   -5.010  0.59 36.71 ? 329 HIS A CG    1 
ATOM   1555 C  CG    B HIS A 1  203 ? 8.545   0.797   -6.080  0.41 29.00 ? 329 HIS A CG    1 
ATOM   1556 N  ND1   A HIS A 1  203 ? 11.357  -0.985  -5.743  0.59 37.32 ? 329 HIS A ND1   1 
ATOM   1557 C  CD2   A HIS A 1  203 ? 12.281  0.343   -4.274  0.59 37.28 ? 329 HIS A CD2   1 
ATOM   1558 C  CE1   A HIS A 1  203 ? 12.549  -1.480  -5.465  0.59 37.70 ? 329 HIS A CE1   1 
ATOM   1559 N  NE2   A HIS A 1  203 ? 13.131  -0.692  -4.578  0.59 38.50 ? 329 HIS A NE2   1 
ATOM   1560 N  N     . ASP A 1  204 ? 7.045   2.172   -3.396  1.00 26.17 ? 330 ASP A N     1 
ATOM   1561 C  CA    . ASP A 1  204 ? 5.987   3.172   -3.394  1.00 28.86 ? 330 ASP A CA    1 
ATOM   1562 C  C     . ASP A 1  204 ? 4.875   2.650   -2.494  1.00 25.76 ? 330 ASP A C     1 
ATOM   1563 O  O     . ASP A 1  204 ? 4.919   1.517   -2.006  1.00 22.87 ? 330 ASP A O     1 
ATOM   1564 C  CB    . ASP A 1  204 ? 5.485   3.490   -4.816  1.00 30.04 ? 330 ASP A CB    1 
ATOM   1565 C  CG    . ASP A 1  204 ? 4.256   2.663   -5.232  1.00 32.50 ? 330 ASP A CG    1 
ATOM   1566 O  OD1   . ASP A 1  204 ? 4.217   1.457   -4.960  1.00 27.09 ? 330 ASP A OD1   1 
ATOM   1567 O  OD2   . ASP A 1  204 ? 3.323   3.237   -5.847  1.00 35.87 ? 330 ASP A OD2   1 
ATOM   1568 N  N     . VAL A 1  205 ? 3.909   3.511   -2.233  1.00 22.38 ? 331 VAL A N     1 
ATOM   1569 C  CA    . VAL A 1  205 ? 2.754   3.162   -1.417  1.00 23.54 ? 331 VAL A CA    1 
ATOM   1570 C  C     . VAL A 1  205 ? 1.505   3.437   -2.235  1.00 20.02 ? 331 VAL A C     1 
ATOM   1571 O  O     . VAL A 1  205 ? 1.397   4.479   -2.896  1.00 21.51 ? 331 VAL A O     1 
ATOM   1572 C  CB    . VAL A 1  205 ? 2.732   3.945   -0.087  1.00 27.58 ? 331 VAL A CB    1 
ATOM   1573 C  CG1   . VAL A 1  205 ? 1.646   3.401   0.827   1.00 28.37 ? 331 VAL A CG1   1 
ATOM   1574 C  CG2   . VAL A 1  205 ? 4.087   3.861   0.604   1.00 27.68 ? 331 VAL A CG2   1 
ATOM   1575 N  N     . ASP A 1  206 ? 0.560   2.505   -2.179  1.00 19.58 ? 332 ASP A N     1 
ATOM   1576 C  CA    . ASP A 1  206 ? -0.655  2.556   -2.981  1.00 19.37 ? 332 ASP A CA    1 
ATOM   1577 C  C     . ASP A 1  206 ? -1.863  2.600   -2.058  1.00 20.84 ? 332 ASP A C     1 
ATOM   1578 O  O     . ASP A 1  206 ? -1.979  1.766   -1.156  1.00 21.80 ? 332 ASP A O     1 
ATOM   1579 C  CB    . ASP A 1  206 ? -0.740  1.336   -3.898  1.00 18.89 ? 332 ASP A CB    1 
ATOM   1580 C  CG    . ASP A 1  206 ? 0.469   1.206   -4.798  1.00 21.56 ? 332 ASP A CG    1 
ATOM   1581 O  OD1   . ASP A 1  206 ? 0.690   2.107   -5.629  1.00 23.14 ? 332 ASP A OD1   1 
ATOM   1582 O  OD2   . ASP A 1  206 ? 1.199   0.210   -4.658  1.00 22.19 ? 332 ASP A OD2   1 
ATOM   1583 N  N     . PHE A 1  207 ? -2.767  3.552   -2.291  1.00 19.78 ? 333 PHE A N     1 
ATOM   1584 C  CA    . PHE A 1  207 ? -3.990  3.660   -1.508  1.00 20.45 ? 333 PHE A CA    1 
ATOM   1585 C  C     . PHE A 1  207 ? -5.203  3.689   -2.424  1.00 20.68 ? 333 PHE A C     1 
ATOM   1586 O  O     . PHE A 1  207 ? -5.161  4.282   -3.508  1.00 22.84 ? 333 PHE A O     1 
ATOM   1587 C  CB    . PHE A 1  207 ? -4.009  4.915   -0.645  1.00 22.36 ? 333 PHE A CB    1 
ATOM   1588 C  CG    . PHE A 1  207 ? -2.980  4.922   0.448   1.00 25.53 ? 333 PHE A CG    1 
ATOM   1589 C  CD1   . PHE A 1  207 ? -3.111  4.087   1.552   1.00 23.74 ? 333 PHE A CD1   1 
ATOM   1590 C  CD2   . PHE A 1  207 ? -1.898  5.784   0.389   1.00 29.64 ? 333 PHE A CD2   1 
ATOM   1591 C  CE1   . PHE A 1  207 ? -2.181  4.100   2.558   1.00 27.41 ? 333 PHE A CE1   1 
ATOM   1592 C  CE2   . PHE A 1  207 ? -0.955  5.801   1.400   1.00 32.45 ? 333 PHE A CE2   1 
ATOM   1593 C  CZ    . PHE A 1  207 ? -1.092  4.955   2.482   1.00 30.21 ? 333 PHE A CZ    1 
ATOM   1594 N  N     . LEU A 1  208 ? -6.283  3.063   -1.966  1.00 19.94 ? 334 LEU A N     1 
ATOM   1595 C  CA    . LEU A 1  208 ? -7.566  3.062   -2.657  1.00 20.00 ? 334 LEU A CA    1 
ATOM   1596 C  C     . LEU A 1  208 ? -8.599  3.730   -1.761  1.00 22.76 ? 334 LEU A C     1 
ATOM   1597 O  O     . LEU A 1  208 ? -8.745  3.362   -0.590  1.00 25.96 ? 334 LEU A O     1 
ATOM   1598 C  CB    . LEU A 1  208 ? -7.985  1.633   -3.007  1.00 19.66 ? 334 LEU A CB    1 
ATOM   1599 C  CG    . LEU A 1  208 ? -9.302  1.414   -3.746  1.00 20.85 ? 334 LEU A CG    1 
ATOM   1600 C  CD1   . LEU A 1  208 ? -9.324  2.186   -5.071  1.00 21.64 ? 334 LEU A CD1   1 
ATOM   1601 C  CD2   . LEU A 1  208 ? -9.513  -0.071  -3.980  1.00 22.28 ? 334 LEU A CD2   1 
ATOM   1602 N  N     . ILE A 1  209 ? -9.318  4.700   -2.317  1.00 20.91 ? 335 ILE A N     1 
ATOM   1603 C  CA    . ILE A 1  209 ? -10.224 5.564   -1.572  1.00 21.56 ? 335 ILE A CA    1 
ATOM   1604 C  C     . ILE A 1  209 ? -11.622 5.361   -2.142  1.00 24.28 ? 335 ILE A C     1 
ATOM   1605 O  O     . ILE A 1  209 ? -11.797 5.343   -3.363  1.00 27.71 ? 335 ILE A O     1 
ATOM   1606 C  CB    . ILE A 1  209 ? -9.804  7.046   -1.677  1.00 22.05 ? 335 ILE A CB    1 
ATOM   1607 C  CG1   . ILE A 1  209 ? -8.402  7.261   -1.091  1.00 22.06 ? 335 ILE A CG1   1 
ATOM   1608 C  CG2   . ILE A 1  209 ? -10.805 7.951   -0.982  1.00 25.65 ? 335 ILE A CG2   1 
ATOM   1609 C  CD1   . ILE A 1  209 ? -7.753  8.575   -1.521  1.00 22.45 ? 335 ILE A CD1   1 
ATOM   1610 N  N     . THR A 1  210 ? -12.614 5.219   -1.267  1.00 23.74 ? 336 THR A N     1 
ATOM   1611 C  CA    . THR A 1  210 ? -13.997 5.119   -1.710  1.00 25.77 ? 336 THR A CA    1 
ATOM   1612 C  C     . THR A 1  210 ? -14.889 5.722   -0.634  1.00 25.48 ? 336 THR A C     1 
ATOM   1613 O  O     . THR A 1  210 ? -14.409 6.277   0.359   1.00 23.54 ? 336 THR A O     1 
ATOM   1614 C  CB    . THR A 1  210 ? -14.369 3.663   -2.016  1.00 24.75 ? 336 THR A CB    1 
ATOM   1615 O  OG1   . THR A 1  210 ? -15.658 3.602   -2.645  1.00 28.83 ? 336 THR A OG1   1 
ATOM   1616 C  CG2   . THR A 1  210 ? -14.385 2.827   -0.735  1.00 31.46 ? 336 THR A CG2   1 
ATOM   1617 N  N     . HIS A 1  211 ? -16.202 5.614   -0.846  1.00 23.68 ? 337 HIS A N     1 
ATOM   1618 C  CA    . HIS A 1  211 ? -17.197 6.094   0.097   1.00 28.48 ? 337 HIS A CA    1 
ATOM   1619 C  C     . HIS A 1  211 ? -18.401 5.159   0.037   1.00 28.74 ? 337 HIS A C     1 
ATOM   1620 O  O     . HIS A 1  211 ? -18.815 4.772   -1.065  1.00 26.90 ? 337 HIS A O     1 
ATOM   1621 C  CB    . HIS A 1  211 ? -17.617 7.536   -0.223  1.00 28.69 ? 337 HIS A CB    1 
ATOM   1622 C  CG    . HIS A 1  211 ? -18.466 8.169   0.835   1.00 33.62 ? 337 HIS A CG    1 
ATOM   1623 N  ND1   . HIS A 1  211 ? -19.817 7.922   0.953   1.00 32.14 ? 337 HIS A ND1   1 
ATOM   1624 C  CD2   . HIS A 1  211 ? -18.156 9.049   1.818   1.00 35.38 ? 337 HIS A CD2   1 
ATOM   1625 C  CE1   . HIS A 1  211 ? -20.301 8.616   1.970   1.00 35.51 ? 337 HIS A CE1   1 
ATOM   1626 N  NE2   . HIS A 1  211 ? -19.313 9.310   2.510   1.00 32.97 ? 337 HIS A NE2   1 
ATOM   1627 N  N     . PRO A 1  212 ? -18.982 4.778   1.182   1.00 29.35 ? 338 PRO A N     1 
ATOM   1628 C  CA    . PRO A 1  212 ? -20.068 3.780   1.158   1.00 31.91 ? 338 PRO A CA    1 
ATOM   1629 C  C     . PRO A 1  212 ? -21.329 4.230   0.432   1.00 32.56 ? 338 PRO A C     1 
ATOM   1630 O  O     . PRO A 1  212 ? -22.168 3.379   0.123   1.00 34.19 ? 338 PRO A O     1 
ATOM   1631 C  CB    . PRO A 1  212 ? -20.351 3.528   2.646   1.00 31.70 ? 338 PRO A CB    1 
ATOM   1632 C  CG    . PRO A 1  212 ? -19.892 4.752   3.335   1.00 36.59 ? 338 PRO A CG    1 
ATOM   1633 C  CD    . PRO A 1  212 ? -18.692 5.234   2.552   1.00 33.42 ? 338 PRO A CD    1 
ATOM   1634 N  N     . LYS A 1  213 ? -21.493 5.517   0.146   1.00 32.09 ? 339 LYS A N     1 
ATOM   1635 C  CA    . LYS A 1  213 ? -22.664 6.026   -0.566  1.00 32.11 ? 339 LYS A CA    1 
ATOM   1636 C  C     . LYS A 1  213 ? -22.273 6.244   -2.024  1.00 33.94 ? 339 LYS A C     1 
ATOM   1637 O  O     . LYS A 1  213 ? -21.549 7.195   -2.345  1.00 29.03 ? 339 LYS A O     1 
ATOM   1638 C  CB    . LYS A 1  213 ? -23.174 7.316   0.072   1.00 31.05 ? 339 LYS A CB    1 
ATOM   1639 C  CG    . LYS A 1  213 ? -24.595 7.701   -0.333  1.00 34.86 ? 339 LYS A CG    1 
ATOM   1640 N  N     . GLU A 1  214 ? -22.747 5.354   -2.900  1.00 30.71 ? 340 GLU A N     1 
ATOM   1641 C  CA    . GLU A 1  214 ? -22.439 5.429   -4.322  1.00 34.18 ? 340 GLU A CA    1 
ATOM   1642 C  C     . GLU A 1  214 ? -22.669 6.836   -4.850  1.00 35.68 ? 340 GLU A C     1 
ATOM   1643 O  O     . GLU A 1  214 ? -23.728 7.428   -4.632  1.00 29.26 ? 340 GLU A O     1 
ATOM   1644 C  CB    . GLU A 1  214 ? -23.311 4.439   -5.099  1.00 36.07 ? 340 GLU A CB    1 
ATOM   1645 C  CG    . GLU A 1  214 ? -22.987 4.341   -6.592  1.00 35.62 ? 340 GLU A CG    1 
ATOM   1646 C  CD    . GLU A 1  214 ? -21.848 3.375   -6.890  1.00 33.36 ? 340 GLU A CD    1 
ATOM   1647 O  OE1   . GLU A 1  214 ? -21.399 2.678   -5.959  1.00 30.27 ? 340 GLU A OE1   1 
ATOM   1648 O  OE2   . GLU A 1  214 ? -21.408 3.309   -8.058  1.00 33.62 ? 340 GLU A OE2   1 
ATOM   1649 N  N     . GLY A 1  215 ? -21.667 7.367   -5.552  1.00 37.68 ? 341 GLY A N     1 
ATOM   1650 C  CA    . GLY A 1  215 ? -21.741 8.671   -6.162  1.00 37.97 ? 341 GLY A CA    1 
ATOM   1651 C  C     . GLY A 1  215 ? -21.106 9.780   -5.346  1.00 34.41 ? 341 GLY A C     1 
ATOM   1652 O  O     . GLY A 1  215 ? -20.699 10.796  -5.918  1.00 34.30 ? 341 GLY A O     1 
ATOM   1653 N  N     . GLN A 1  216 ? -21.018 9.616   -4.024  1.00 32.59 ? 342 GLN A N     1 
ATOM   1654 C  CA    . GLN A 1  216 ? -20.419 10.654  -3.190  1.00 32.97 ? 342 GLN A CA    1 
ATOM   1655 C  C     . GLN A 1  216 ? -18.925 10.803  -3.447  1.00 31.31 ? 342 GLN A C     1 
ATOM   1656 O  O     . GLN A 1  216 ? -18.356 11.857  -3.144  1.00 29.39 ? 342 GLN A O     1 
ATOM   1657 C  CB    . GLN A 1  216 ? -20.665 10.356  -1.709  1.00 32.41 ? 342 GLN A CB    1 
ATOM   1658 C  CG    . GLN A 1  216 ? -22.085 10.622  -1.232  1.00 33.16 ? 342 GLN A CG    1 
ATOM   1659 C  CD    . GLN A 1  216 ? -22.440 12.095  -1.282  1.00 44.35 ? 342 GLN A CD    1 
ATOM   1660 O  OE1   . GLN A 1  216 ? -21.911 12.900  -0.512  1.00 47.90 ? 342 GLN A OE1   1 
ATOM   1661 N  NE2   . GLN A 1  216 ? -23.325 12.458  -2.202  1.00 47.83 ? 342 GLN A NE2   1 
ATOM   1662 N  N     . GLU A 1  217 ? -18.280 9.782   -4.005  1.00 29.74 ? 343 GLU A N     1 
ATOM   1663 C  CA    . GLU A 1  217 ? -16.847 9.849   -4.257  1.00 28.83 ? 343 GLU A CA    1 
ATOM   1664 C  C     . GLU A 1  217 ? -16.507 10.723  -5.454  1.00 25.61 ? 343 GLU A C     1 
ATOM   1665 O  O     . GLU A 1  217 ? -15.333 11.055  -5.641  1.00 27.64 ? 343 GLU A O     1 
ATOM   1666 C  CB    . GLU A 1  217 ? -16.279 8.435   -4.472  1.00 31.62 ? 343 GLU A CB    1 
ATOM   1667 C  CG    . GLU A 1  217 ? -16.527 7.839   -5.860  1.00 33.78 ? 343 GLU A CG    1 
ATOM   1668 C  CD    . GLU A 1  217 ? -17.995 7.654   -6.193  1.00 35.75 ? 343 GLU A CD    1 
ATOM   1669 O  OE1   . GLU A 1  217 ? -18.809 7.447   -5.270  1.00 34.25 ? 343 GLU A OE1   1 
ATOM   1670 O  OE2   . GLU A 1  217 ? -18.336 7.709   -7.389  1.00 39.45 ? 343 GLU A OE2   1 
ATOM   1671 N  N     . ALA A 1  218 ? -17.496 11.087  -6.265  1.00 27.11 ? 344 ALA A N     1 
ATOM   1672 C  CA    . ALA A 1  218 ? -17.253 11.939  -7.419  1.00 35.27 ? 344 ALA A CA    1 
ATOM   1673 C  C     . ALA A 1  218 ? -16.599 13.250  -6.991  1.00 35.80 ? 344 ALA A C     1 
ATOM   1674 O  O     . ALA A 1  218 ? -17.018 13.880  -6.019  1.00 35.34 ? 344 ALA A O     1 
ATOM   1675 C  CB    . ALA A 1  218 ? -18.572 12.221  -8.140  1.00 40.07 ? 344 ALA A CB    1 
ATOM   1676 N  N     . GLY A 1  219 ? -15.568 13.660  -7.733  1.00 34.26 ? 345 GLY A N     1 
ATOM   1677 C  CA    . GLY A 1  219 ? -14.855 14.895  -7.451  1.00 36.53 ? 345 GLY A CA    1 
ATOM   1678 C  C     . GLY A 1  219 ? -13.932 14.841  -6.258  1.00 32.50 ? 345 GLY A C     1 
ATOM   1679 O  O     . GLY A 1  219 ? -13.409 15.879  -5.843  1.00 32.27 ? 345 GLY A O     1 
ATOM   1680 N  N     . LEU A 1  220 ? -13.692 13.658  -5.702  1.00 26.53 ? 346 LEU A N     1 
ATOM   1681 C  CA    . LEU A 1  220 ? -12.994 13.569  -4.427  1.00 28.91 ? 346 LEU A CA    1 
ATOM   1682 C  C     . LEU A 1  220 ? -11.492 13.806  -4.572  1.00 30.28 ? 346 LEU A C     1 
ATOM   1683 O  O     . LEU A 1  220 ? -10.884 14.484  -3.735  1.00 27.32 ? 346 LEU A O     1 
ATOM   1684 C  CB    . LEU A 1  220 ? -13.262 12.203  -3.795  1.00 29.96 ? 346 LEU A CB    1 
ATOM   1685 C  CG    . LEU A 1  220 ? -12.558 11.915  -2.472  1.00 35.93 ? 346 LEU A CG    1 
ATOM   1686 C  CD1   . LEU A 1  220 ? -12.915 12.958  -1.428  1.00 40.65 ? 346 LEU A CD1   1 
ATOM   1687 C  CD2   . LEU A 1  220 ? -12.932 10.534  -1.984  1.00 34.66 ? 346 LEU A CD2   1 
ATOM   1688 N  N     . LEU A 1  221 ? -10.875 13.278  -5.615  1.00 31.30 ? 347 LEU A N     1 
ATOM   1689 C  CA    . LEU A 1  221 ? -9.417  13.288  -5.644  1.00 33.61 ? 347 LEU A CA    1 
ATOM   1690 C  C     . LEU A 1  221 ? -8.862  14.708  -5.715  1.00 30.01 ? 347 LEU A C     1 
ATOM   1691 O  O     . LEU A 1  221 ? -7.873  15.010  -5.032  1.00 28.04 ? 347 LEU A O     1 
ATOM   1692 C  CB    . LEU A 1  221 ? -8.900  12.438  -6.809  1.00 31.69 ? 347 LEU A CB    1 
ATOM   1693 C  CG    . LEU A 1  221 ? -7.457  11.932  -6.713  1.00 34.93 ? 347 LEU A CG    1 
ATOM   1694 C  CD1   . LEU A 1  221 ? -7.112  11.368  -5.331  1.00 33.52 ? 347 LEU A CD1   1 
ATOM   1695 C  CD2   . LEU A 1  221 ? -7.213  10.859  -7.774  1.00 34.34 ? 347 LEU A CD2   1 
ATOM   1696 N  N     . PRO A 1  222 ? -9.447  15.613  -6.509  1.00 30.32 ? 348 PRO A N     1 
ATOM   1697 C  CA    . PRO A 1  222 ? -8.945  16.999  -6.481  1.00 30.09 ? 348 PRO A CA    1 
ATOM   1698 C  C     . PRO A 1  222 ? -9.017  17.622  -5.101  1.00 35.83 ? 348 PRO A C     1 
ATOM   1699 O  O     . PRO A 1  222 ? -8.132  18.405  -4.730  1.00 32.36 ? 348 PRO A O     1 
ATOM   1700 C  CB    . PRO A 1  222 ? -9.855  17.734  -7.478  1.00 31.98 ? 348 PRO A CB    1 
ATOM   1701 C  CG    . PRO A 1  222 ? -10.423 16.674  -8.349  1.00 35.83 ? 348 PRO A CG    1 
ATOM   1702 C  CD    . PRO A 1  222 ? -10.495 15.420  -7.526  1.00 33.25 ? 348 PRO A CD    1 
ATOM   1703 N  N     . ARG A 1  223 ? -10.061 17.303  -4.329  1.00 33.37 ? 349 ARG A N     1 
ATOM   1704 C  CA    . ARG A 1  223 ? -10.204 17.882  -2.999  1.00 32.98 ? 349 ARG A CA    1 
ATOM   1705 C  C     . ARG A 1  223 ? -9.170  17.307  -2.045  1.00 31.82 ? 349 ARG A C     1 
ATOM   1706 O  O     . ARG A 1  223 ? -8.634  18.020  -1.186  1.00 29.38 ? 349 ARG A O     1 
ATOM   1707 C  CB    . ARG A 1  223 ? -11.617 17.637  -2.472  1.00 36.20 ? 349 ARG A CB    1 
ATOM   1708 C  CG    . ARG A 1  223 ? -12.698 18.386  -3.241  1.00 37.36 ? 349 ARG A CG    1 
ATOM   1709 C  CD    . ARG A 1  223 ? -14.104 17.941  -2.842  1.00 33.83 ? 349 ARG A CD    1 
ATOM   1710 N  NE    . ARG A 1  223 ? -14.307 17.986  -1.398  1.00 30.45 ? 349 ARG A NE    1 
ATOM   1711 C  CZ    . ARG A 1  223 ? -14.541 19.099  -0.707  1.00 31.66 ? 349 ARG A CZ    1 
ATOM   1712 N  NH1   . ARG A 1  223 ? -14.595 20.276  -1.322  1.00 33.17 ? 349 ARG A NH1   1 
ATOM   1713 N  NH2   . ARG A 1  223 ? -14.713 19.035  0.606   1.00 31.96 ? 349 ARG A NH2   1 
ATOM   1714 N  N     . VAL A 1  224 ? -8.886  16.015  -2.179  1.00 30.89 ? 350 VAL A N     1 
ATOM   1715 C  CA    . VAL A 1  224 ? -7.842  15.396  -1.374  1.00 29.86 ? 350 VAL A CA    1 
ATOM   1716 C  C     . VAL A 1  224 ? -6.494  16.022  -1.705  1.00 28.60 ? 350 VAL A C     1 
ATOM   1717 O  O     . VAL A 1  224 ? -5.732  16.410  -0.814  1.00 31.15 ? 350 VAL A O     1 
ATOM   1718 C  CB    . VAL A 1  224 ? -7.831  13.872  -1.597  1.00 26.45 ? 350 VAL A CB    1 
ATOM   1719 C  CG1   . VAL A 1  224 ? -6.620  13.238  -0.921  1.00 28.06 ? 350 VAL A CG1   1 
ATOM   1720 C  CG2   . VAL A 1  224 ? -9.123  13.242  -1.081  1.00 28.75 ? 350 VAL A CG2   1 
ATOM   1721 N  N     . MET A 1  225 ? -6.188  16.145  -2.999  1.00 30.49 ? 351 MET A N     1 
ATOM   1722 C  CA    . MET A 1  225 ? -4.882  16.667  -3.398  1.00 32.79 ? 351 MET A CA    1 
ATOM   1723 C  C     . MET A 1  225 ? -4.699  18.111  -2.941  1.00 34.80 ? 351 MET A C     1 
ATOM   1724 O  O     . MET A 1  225 ? -3.630  18.480  -2.438  1.00 34.26 ? 351 MET A O     1 
ATOM   1725 C  CB    . MET A 1  225 ? -4.718  16.553  -4.914  1.00 33.83 ? 351 MET A CB    1 
ATOM   1726 C  CG    . MET A 1  225 ? -4.641  15.109  -5.429  1.00 39.13 ? 351 MET A CG    1 
ATOM   1727 S  SD    . MET A 1  225 ? -3.383  14.121  -4.597  1.00 39.48 ? 351 MET A SD    1 
ATOM   1728 C  CE    . MET A 1  225 ? -1.935  15.120  -4.936  1.00 41.97 ? 351 MET A CE    1 
ATOM   1729 N  N     A CYS A 1  226 ? -5.733  18.940  -3.111  0.51 39.33 ? 352 CYS A N     1 
ATOM   1730 N  N     B CYS A 1  226 ? -5.727  18.946  -3.099  0.49 39.34 ? 352 CYS A N     1 
ATOM   1731 C  CA    A CYS A 1  226 ? -5.653  20.333  -2.681  0.51 43.00 ? 352 CYS A CA    1 
ATOM   1732 C  CA    B CYS A 1  226 ? -5.599  20.337  -2.676  0.49 42.93 ? 352 CYS A CA    1 
ATOM   1733 C  C     A CYS A 1  226 ? -5.309  20.425  -1.201  0.51 42.58 ? 352 CYS A C     1 
ATOM   1734 C  C     B CYS A 1  226 ? -5.294  20.428  -1.187  0.49 42.60 ? 352 CYS A C     1 
ATOM   1735 O  O     A CYS A 1  226 ? -4.529  21.291  -0.787  0.51 44.65 ? 352 CYS A O     1 
ATOM   1736 O  O     B CYS A 1  226 ? -4.529  21.297  -0.754  0.49 44.73 ? 352 CYS A O     1 
ATOM   1737 C  CB    A CYS A 1  226 ? -6.977  21.045  -2.976  0.51 44.08 ? 352 CYS A CB    1 
ATOM   1738 C  CB    B CYS A 1  226 ? -6.871  21.114  -3.017  0.49 44.13 ? 352 CYS A CB    1 
ATOM   1739 S  SG    A CYS A 1  226 ? -7.054  22.774  -2.461  0.51 50.14 ? 352 CYS A SG    1 
ATOM   1740 S  SG    B CYS A 1  226 ? -7.020  21.500  -4.771  0.49 45.36 ? 352 CYS A SG    1 
ATOM   1741 N  N     . ARG A 1  227 ? -5.871  19.529  -0.389  1.00 32.99 ? 353 ARG A N     1 
ATOM   1742 C  CA    . ARG A 1  227 ? -5.628  19.557  1.047   1.00 32.46 ? 353 ARG A CA    1 
ATOM   1743 C  C     . ARG A 1  227 ? -4.236  19.038  1.389   1.00 34.70 ? 353 ARG A C     1 
ATOM   1744 O  O     . ARG A 1  227 ? -3.550  19.602  2.249   1.00 37.12 ? 353 ARG A O     1 
ATOM   1745 C  CB    . ARG A 1  227 ? -6.710  18.755  1.760   1.00 30.70 ? 353 ARG A CB    1 
ATOM   1746 C  CG    . ARG A 1  227 ? -7.971  19.589  1.975   1.00 37.67 ? 353 ARG A CG    1 
ATOM   1747 C  CD    . ARG A 1  227 ? -9.266  18.786  2.020   1.00 40.66 ? 353 ARG A CD    1 
ATOM   1748 N  NE    . ARG A 1  227 ? -10.389 19.716  2.167   1.00 44.17 ? 353 ARG A NE    1 
ATOM   1749 C  CZ    . ARG A 1  227 ? -11.024 20.313  1.159   1.00 42.45 ? 353 ARG A CZ    1 
ATOM   1750 N  NH1   . ARG A 1  227 ? -10.690 20.063  -0.103  1.00 40.10 ? 353 ARG A NH1   1 
ATOM   1751 N  NH2   . ARG A 1  227 ? -12.005 21.170  1.417   1.00 43.38 ? 353 ARG A NH2   1 
ATOM   1752 N  N     . LEU A 1  228 ? -3.792  17.978  0.719   1.00 32.31 ? 354 LEU A N     1 
ATOM   1753 C  CA    . LEU A 1  228 ? -2.423  17.516  0.917   1.00 33.62 ? 354 LEU A CA    1 
ATOM   1754 C  C     . LEU A 1  228 ? -1.419  18.596  0.540   1.00 31.85 ? 354 LEU A C     1 
ATOM   1755 O  O     . LEU A 1  228 ? -0.432  18.815  1.256   1.00 31.46 ? 354 LEU A O     1 
ATOM   1756 C  CB    . LEU A 1  228 ? -2.183  16.251  0.102   1.00 29.52 ? 354 LEU A CB    1 
ATOM   1757 C  CG    . LEU A 1  228 ? -3.033  15.065  0.552   1.00 31.17 ? 354 LEU A CG    1 
ATOM   1758 C  CD1   . LEU A 1  228 ? -2.970  13.957  -0.480  1.00 32.26 ? 354 LEU A CD1   1 
ATOM   1759 C  CD2   . LEU A 1  228 ? -2.575  14.569  1.909   1.00 30.89 ? 354 LEU A CD2   1 
ATOM   1760 N  N     . GLN A 1  229 ? -1.652  19.287  -0.580  1.00 37.78 ? 355 GLN A N     1 
ATOM   1761 C  CA    . GLN A 1  229 ? -0.735  20.346  -0.999  1.00 39.77 ? 355 GLN A CA    1 
ATOM   1762 C  C     . GLN A 1  229 ? -0.682  21.466  0.031   1.00 41.42 ? 355 GLN A C     1 
ATOM   1763 O  O     . GLN A 1  229 ? 0.393   22.005  0.320   1.00 38.28 ? 355 GLN A O     1 
ATOM   1764 C  CB    . GLN A 1  229 ? -1.149  20.903  -2.363  1.00 40.14 ? 355 GLN A CB    1 
ATOM   1765 C  CG    . GLN A 1  229 ? -1.016  19.923  -3.512  1.00 44.67 ? 355 GLN A CG    1 
ATOM   1766 N  N     . ASP A 1  230 ? -1.834  21.831  0.598   1.00 44.08 ? 356 ASP A N     1 
ATOM   1767 C  CA    . ASP A 1  230 ? -1.865  22.898  1.594   1.00 52.12 ? 356 ASP A CA    1 
ATOM   1768 C  C     . ASP A 1  230 ? -1.153  22.490  2.878   1.00 45.97 ? 356 ASP A C     1 
ATOM   1769 O  O     . ASP A 1  230 ? -0.651  23.354  3.606   1.00 48.98 ? 356 ASP A O     1 
ATOM   1770 C  CB    . ASP A 1  230 ? -3.312  23.299  1.895   1.00 63.01 ? 356 ASP A CB    1 
ATOM   1771 C  CG    . ASP A 1  230 ? -3.975  24.020  0.731   1.00 69.49 ? 356 ASP A CG    1 
ATOM   1772 O  OD1   . ASP A 1  230 ? -3.244  24.570  -0.121  1.00 72.19 ? 356 ASP A OD1   1 
ATOM   1773 O  OD2   . ASP A 1  230 ? -5.225  24.044  0.670   1.00 71.13 ? 356 ASP A OD2   1 
ATOM   1774 N  N     . GLN A 1  231 ? -1.105  21.195  3.179   1.00 38.38 ? 357 GLN A N     1 
ATOM   1775 C  CA    . GLN A 1  231 ? -0.306  20.709  4.297   1.00 41.16 ? 357 GLN A CA    1 
ATOM   1776 C  C     . GLN A 1  231 ? 1.192   20.748  4.018   1.00 39.76 ? 357 GLN A C     1 
ATOM   1777 O  O     . GLN A 1  231 ? 1.966   20.412  4.919   1.00 39.12 ? 357 GLN A O     1 
ATOM   1778 C  CB    . GLN A 1  231 ? -0.704  19.274  4.650   1.00 49.20 ? 357 GLN A CB    1 
ATOM   1779 C  CG    . GLN A 1  231 ? -2.121  19.105  5.181   1.00 58.94 ? 357 GLN A CG    1 
ATOM   1780 C  CD    . GLN A 1  231 ? -2.272  19.543  6.627   1.00 68.85 ? 357 GLN A CD    1 
ATOM   1781 O  OE1   . GLN A 1  231 ? -1.645  20.507  7.073   1.00 70.03 ? 357 GLN A OE1   1 
ATOM   1782 N  NE2   . GLN A 1  231 ? -3.114  18.832  7.370   1.00 73.02 ? 357 GLN A NE2   1 
ATOM   1783 N  N     . GLY A 1  232 ? 1.614   21.124  2.809   1.00 41.13 ? 358 GLY A N     1 
ATOM   1784 C  CA    . GLY A 1  232 ? 3.021   21.112  2.453   1.00 39.66 ? 358 GLY A CA    1 
ATOM   1785 C  C     . GLY A 1  232 ? 3.606   19.737  2.203   1.00 38.24 ? 358 GLY A C     1 
ATOM   1786 O  O     . GLY A 1  232 ? 4.831   19.588  2.197   1.00 36.36 ? 358 GLY A O     1 
ATOM   1787 N  N     . LEU A 1  233 ? 2.769   18.726  1.974   1.00 32.42 ? 359 LEU A N     1 
ATOM   1788 C  CA    . LEU A 1  233 ? 3.226   17.342  1.904   1.00 34.37 ? 359 LEU A CA    1 
ATOM   1789 C  C     . LEU A 1  233 ? 3.494   16.848  0.489   1.00 31.83 ? 359 LEU A C     1 
ATOM   1790 O  O     . LEU A 1  233 ? 4.015   15.736  0.329   1.00 33.65 ? 359 LEU A O     1 
ATOM   1791 C  CB    . LEU A 1  233 ? 2.186   16.412  2.550   1.00 40.26 ? 359 LEU A CB    1 
ATOM   1792 C  CG    . LEU A 1  233 ? 1.953   16.556  4.054   1.00 46.47 ? 359 LEU A CG    1 
ATOM   1793 C  CD1   . LEU A 1  233 ? 0.787   15.682  4.482   1.00 47.17 ? 359 LEU A CD1   1 
ATOM   1794 C  CD2   . LEU A 1  233 ? 3.205   16.199  4.839   1.00 47.74 ? 359 LEU A CD2   1 
ATOM   1795 N  N     . ILE A 1  234 ? 3.132   17.614  -0.532  1.00 33.93 ? 360 ILE A N     1 
ATOM   1796 C  CA    . ILE A 1  234 ? 3.190   17.156  -1.914  1.00 32.84 ? 360 ILE A CA    1 
ATOM   1797 C  C     . ILE A 1  234 ? 4.399   17.806  -2.568  1.00 33.61 ? 360 ILE A C     1 
ATOM   1798 O  O     . ILE A 1  234 ? 4.422   19.022  -2.783  1.00 37.12 ? 360 ILE A O     1 
ATOM   1799 C  CB    . ILE A 1  234 ? 1.896   17.485  -2.671  1.00 31.57 ? 360 ILE A CB    1 
ATOM   1800 C  CG1   . ILE A 1  234 ? 0.698   16.795  -2.006  1.00 30.46 ? 360 ILE A CG1   1 
ATOM   1801 C  CG2   . ILE A 1  234 ? 2.008   17.080  -4.147  1.00 31.72 ? 360 ILE A CG2   1 
ATOM   1802 C  CD1   . ILE A 1  234 ? 0.763   15.274  -2.005  1.00 31.75 ? 360 ILE A CD1   1 
ATOM   1803 N  N     . LEU A 1  235 ? 5.412   16.993  -2.878  1.00 30.28 ? 361 LEU A N     1 
ATOM   1804 C  CA    . LEU A 1  235 ? 6.569   17.482  -3.616  1.00 34.14 ? 361 LEU A CA    1 
ATOM   1805 C  C     . LEU A 1  235 ? 6.301   17.516  -5.113  1.00 38.69 ? 361 LEU A C     1 
ATOM   1806 O  O     . LEU A 1  235 ? 6.910   18.323  -5.827  1.00 39.82 ? 361 LEU A O     1 
ATOM   1807 C  CB    . LEU A 1  235 ? 7.794   16.605  -3.327  1.00 32.20 ? 361 LEU A CB    1 
ATOM   1808 C  CG    . LEU A 1  235 ? 8.354   16.704  -1.904  1.00 34.73 ? 361 LEU A CG    1 
ATOM   1809 C  CD1   . LEU A 1  235 ? 9.185   15.477  -1.568  1.00 35.27 ? 361 LEU A CD1   1 
ATOM   1810 C  CD2   . LEU A 1  235 ? 9.183   17.980  -1.734  1.00 36.21 ? 361 LEU A CD2   1 
ATOM   1811 N  N     . TYR A 1  236 ? 5.395   16.665  -5.594  1.00 38.51 ? 362 TYR A N     1 
ATOM   1812 C  CA    . TYR A 1  236 ? 5.048   16.602  -7.005  1.00 39.34 ? 362 TYR A CA    1 
ATOM   1813 C  C     . TYR A 1  236 ? 3.726   15.869  -7.177  1.00 42.22 ? 362 TYR A C     1 
ATOM   1814 O  O     . TYR A 1  236 ? 3.461   14.879  -6.491  1.00 33.30 ? 362 TYR A O     1 
ATOM   1815 C  CB    . TYR A 1  236 ? 6.121   15.884  -7.836  1.00 38.94 ? 362 TYR A CB    1 
ATOM   1816 C  CG    . TYR A 1  236 ? 5.625   15.538  -9.223  1.00 38.55 ? 362 TYR A CG    1 
ATOM   1817 C  CD1   . TYR A 1  236 ? 4.928   14.362  -9.460  1.00 40.37 ? 362 TYR A CD1   1 
ATOM   1818 C  CD2   . TYR A 1  236 ? 5.827   16.404  -10.290 1.00 40.71 ? 362 TYR A CD2   1 
ATOM   1819 C  CE1   . TYR A 1  236 ? 4.451   14.054  -10.715 1.00 42.07 ? 362 TYR A CE1   1 
ATOM   1820 C  CE2   . TYR A 1  236 ? 5.356   16.103  -11.551 1.00 38.31 ? 362 TYR A CE2   1 
ATOM   1821 C  CZ    . TYR A 1  236 ? 4.676   14.928  -11.759 1.00 42.87 ? 362 TYR A CZ    1 
ATOM   1822 O  OH    . TYR A 1  236 ? 4.209   14.626  -13.017 1.00 49.68 ? 362 TYR A OH    1 
ATOM   1823 N  N     . HIS A 1  237 ? 2.921   16.349  -8.121  1.00 38.34 ? 363 HIS A N     1 
ATOM   1824 C  CA    . HIS A 1  237 ? 1.774   15.607  -8.629  1.00 44.23 ? 363 HIS A CA    1 
ATOM   1825 C  C     . HIS A 1  237 ? 1.358   16.244  -9.947  1.00 41.69 ? 363 HIS A C     1 
ATOM   1826 O  O     . HIS A 1  237 ? 1.809   17.334  -10.300 1.00 43.38 ? 363 HIS A O     1 
ATOM   1827 C  CB    . HIS A 1  237 ? 0.615   15.586  -7.626  1.00 57.02 ? 363 HIS A CB    1 
ATOM   1828 C  CG    . HIS A 1  237 ? -0.202  16.838  -7.615  1.00 72.69 ? 363 HIS A CG    1 
ATOM   1829 N  ND1   . HIS A 1  237 ? 0.296   18.049  -7.185  1.00 79.17 ? 363 HIS A ND1   1 
ATOM   1830 C  CD2   . HIS A 1  237 ? -1.487  17.066  -7.975  1.00 77.50 ? 363 HIS A CD2   1 
ATOM   1831 C  CE1   . HIS A 1  237 ? -0.646  18.970  -7.283  1.00 81.86 ? 363 HIS A CE1   1 
ATOM   1832 N  NE2   . HIS A 1  237 ? -1.739  18.399  -7.759  1.00 79.88 ? 363 HIS A NE2   1 
ATOM   1833 N  N     . GLN A 1  238 ? 0.500   15.546  -10.677 1.00 55.51 ? 364 GLN A N     1 
ATOM   1834 C  CA    . GLN A 1  238 ? 0.049   16.021  -11.979 1.00 56.14 ? 364 GLN A CA    1 
ATOM   1835 C  C     . GLN A 1  238 ? -0.886  17.216  -11.834 1.00 57.95 ? 364 GLN A C     1 
ATOM   1836 O  O     . GLN A 1  238 ? -0.454  18.367  -11.904 1.00 60.11 ? 364 GLN A O     1 
ATOM   1837 C  CB    . GLN A 1  238 ? -0.650  14.895  -12.739 1.00 57.07 ? 364 GLN A CB    1 
ATOM   1838 N  N     . PHE A 1  259 ? -10.244 13.763  -11.912 1.00 44.35 ? 385 PHE A N     1 
ATOM   1839 C  CA    . PHE A 1  259 ? -9.414  12.588  -12.163 1.00 44.85 ? 385 PHE A CA    1 
ATOM   1840 C  C     . PHE A 1  259 ? -9.622  11.551  -11.063 1.00 41.32 ? 385 PHE A C     1 
ATOM   1841 O  O     . PHE A 1  259 ? -10.208 11.855  -10.027 1.00 41.99 ? 385 PHE A O     1 
ATOM   1842 C  CB    . PHE A 1  259 ? -7.932  12.979  -12.278 1.00 56.04 ? 385 PHE A CB    1 
ATOM   1843 C  CG    . PHE A 1  259 ? -7.427  13.846  -11.151 1.00 68.94 ? 385 PHE A CG    1 
ATOM   1844 C  CD1   . PHE A 1  259 ? -7.753  15.192  -11.086 1.00 75.87 ? 385 PHE A CD1   1 
ATOM   1845 C  CD2   . PHE A 1  259 ? -6.593  13.322  -10.178 1.00 73.81 ? 385 PHE A CD2   1 
ATOM   1846 C  CE1   . PHE A 1  259 ? -7.277  15.990  -10.056 1.00 77.37 ? 385 PHE A CE1   1 
ATOM   1847 C  CE2   . PHE A 1  259 ? -6.113  14.117  -9.146  1.00 75.96 ? 385 PHE A CE2   1 
ATOM   1848 C  CZ    . PHE A 1  259 ? -6.456  15.450  -9.086  1.00 76.00 ? 385 PHE A CZ    1 
ATOM   1849 N  N     . GLU A 1  260 ? -9.156  10.318  -11.293 1.00 39.01 ? 386 GLU A N     1 
ATOM   1850 C  CA    . GLU A 1  260 ? -9.329  9.246   -10.321 1.00 38.72 ? 386 GLU A CA    1 
ATOM   1851 C  C     . GLU A 1  260 ? -8.041  8.524   -9.938  1.00 33.08 ? 386 GLU A C     1 
ATOM   1852 O  O     . GLU A 1  260 ? -8.081  7.683   -9.031  1.00 27.87 ? 386 GLU A O     1 
ATOM   1853 C  CB    . GLU A 1  260 ? -10.347 8.219   -10.838 1.00 39.55 ? 386 GLU A CB    1 
ATOM   1854 C  CG    . GLU A 1  260 ? -9.951  7.527   -12.120 1.00 42.84 ? 386 GLU A CG    1 
ATOM   1855 C  CD    . GLU A 1  260 ? -11.135 6.862   -12.804 1.00 44.13 ? 386 GLU A CD    1 
ATOM   1856 O  OE1   . GLU A 1  260 ? -12.203 7.498   -12.892 1.00 46.53 ? 386 GLU A OE1   1 
ATOM   1857 O  OE2   . GLU A 1  260 ? -11.003 5.703   -13.246 1.00 44.34 ? 386 GLU A OE2   1 
ATOM   1858 N  N     . ARG A 1  261 ? -6.910  8.825   -10.577 1.00 29.80 ? 387 ARG A N     1 
ATOM   1859 C  CA    . ARG A 1  261 ? -5.611  8.292   -10.186 1.00 27.46 ? 387 ARG A CA    1 
ATOM   1860 C  C     . ARG A 1  261 ? -4.640  9.453   -10.072 1.00 30.82 ? 387 ARG A C     1 
ATOM   1861 O  O     . ARG A 1  261 ? -4.590  10.305  -10.962 1.00 27.95 ? 387 ARG A O     1 
ATOM   1862 C  CB    . ARG A 1  261 ? -5.087  7.271   -11.201 1.00 28.32 ? 387 ARG A CB    1 
ATOM   1863 C  CG    . ARG A 1  261 ? -6.021  6.087   -11.428 1.00 32.67 ? 387 ARG A CG    1 
ATOM   1864 C  CD    . ARG A 1  261 ? -5.499  5.163   -12.523 1.00 32.37 ? 387 ARG A CD    1 
ATOM   1865 N  NE    . ARG A 1  261 ? -6.394  4.030   -12.745 1.00 30.28 ? 387 ARG A NE    1 
ATOM   1866 C  CZ    . ARG A 1  261 ? -6.111  2.997   -13.529 1.00 31.89 ? 387 ARG A CZ    1 
ATOM   1867 N  NH1   . ARG A 1  261 ? -4.950  2.945   -14.172 1.00 30.99 ? 387 ARG A NH1   1 
ATOM   1868 N  NH2   . ARG A 1  261 ? -6.992  2.014   -13.669 1.00 34.71 ? 387 ARG A NH2   1 
ATOM   1869 N  N     . SER A 1  262 ? -3.874  9.484   -8.985  1.00 23.54 ? 388 SER A N     1 
ATOM   1870 C  CA    . SER A 1  262 ? -2.907  10.545  -8.737  1.00 26.47 ? 388 SER A CA    1 
ATOM   1871 C  C     . SER A 1  262 ? -1.577  9.898   -8.389  1.00 25.15 ? 388 SER A C     1 
ATOM   1872 O  O     . SER A 1  262 ? -1.494  9.155   -7.410  1.00 29.90 ? 388 SER A O     1 
ATOM   1873 C  CB    . SER A 1  262 ? -3.382  11.457  -7.601  1.00 27.30 ? 388 SER A CB    1 
ATOM   1874 O  OG    . SER A 1  262 ? -2.410  12.435  -7.285  1.00 36.35 ? 388 SER A OG    1 
ATOM   1875 N  N     . PHE A 1  263 ? -0.545  10.169  -9.192  1.00 25.41 ? 389 PHE A N     1 
ATOM   1876 C  CA    . PHE A 1  263 ? 0.802   9.645   -8.953  1.00 27.95 ? 389 PHE A CA    1 
ATOM   1877 C  C     . PHE A 1  263 ? 1.629   10.788  -8.380  1.00 28.77 ? 389 PHE A C     1 
ATOM   1878 O  O     . PHE A 1  263 ? 2.071   11.676  -9.111  1.00 30.11 ? 389 PHE A O     1 
ATOM   1879 C  CB    . PHE A 1  263 ? 1.418   9.096   -10.236 1.00 26.08 ? 389 PHE A CB    1 
ATOM   1880 C  CG    . PHE A 1  263 ? 0.460   8.303   -11.076 1.00 22.30 ? 389 PHE A CG    1 
ATOM   1881 C  CD1   . PHE A 1  263 ? -0.132  7.160   -10.583 1.00 26.15 ? 389 PHE A CD1   1 
ATOM   1882 C  CD2   . PHE A 1  263 ? 0.154   8.709   -12.363 1.00 26.23 ? 389 PHE A CD2   1 
ATOM   1883 C  CE1   . PHE A 1  263 ? -1.013  6.432   -11.357 1.00 27.26 ? 389 PHE A CE1   1 
ATOM   1884 C  CE2   . PHE A 1  263 ? -0.719  7.986   -13.139 1.00 29.28 ? 389 PHE A CE2   1 
ATOM   1885 C  CZ    . PHE A 1  263 ? -1.307  6.851   -12.636 1.00 27.29 ? 389 PHE A CZ    1 
ATOM   1886 N  N     A CYS A 1  264 ? 1.831   10.789  -7.069  0.27 25.00 ? 390 CYS A N     1 
ATOM   1887 N  N     B CYS A 1  264 ? 1.851   10.741  -7.071  0.73 23.41 ? 390 CYS A N     1 
ATOM   1888 C  CA    A CYS A 1  264 ? 2.481   11.918  -6.429  0.27 28.04 ? 390 CYS A CA    1 
ATOM   1889 C  CA    B CYS A 1  264 ? 2.462   11.827  -6.330  0.73 27.39 ? 390 CYS A CA    1 
ATOM   1890 C  C     A CYS A 1  264 ? 3.719   11.474  -5.664  0.27 29.35 ? 390 CYS A C     1 
ATOM   1891 C  C     B CYS A 1  264 ? 3.839   11.431  -5.823  0.73 30.70 ? 390 CYS A C     1 
ATOM   1892 O  O     A CYS A 1  264 ? 3.898   10.296  -5.336  0.27 26.67 ? 390 CYS A O     1 
ATOM   1893 O  O     B CYS A 1  264 ? 4.214   10.253  -5.790  0.73 23.66 ? 390 CYS A O     1 
ATOM   1894 C  CB    A CYS A 1  264 ? 1.523   12.650  -5.484  0.27 30.33 ? 390 CYS A CB    1 
ATOM   1895 C  CB    B CYS A 1  264 ? 1.591   12.228  -5.136  0.73 29.80 ? 390 CYS A CB    1 
ATOM   1896 S  SG    A CYS A 1  264 ? 1.051   11.704  -4.038  0.27 29.46 ? 390 CYS A SG    1 
ATOM   1897 S  SG    B CYS A 1  264 ? -0.170  12.181  -5.467  0.73 31.21 ? 390 CYS A SG    1 
ATOM   1898 N  N     . ILE A 1  265 ? 4.578   12.453  -5.404  1.00 30.11 ? 391 ILE A N     1 
ATOM   1899 C  CA    . ILE A 1  265 ? 5.756   12.290  -4.571  1.00 28.41 ? 391 ILE A CA    1 
ATOM   1900 C  C     . ILE A 1  265 ? 5.450   13.021  -3.275  1.00 29.55 ? 391 ILE A C     1 
ATOM   1901 O  O     . ILE A 1  265 ? 5.235   14.242  -3.275  1.00 32.53 ? 391 ILE A O     1 
ATOM   1902 C  CB    . ILE A 1  265 ? 7.018   12.832  -5.254  1.00 31.94 ? 391 ILE A CB    1 
ATOM   1903 C  CG1   . ILE A 1  265 ? 7.242   12.090  -6.576  1.00 29.63 ? 391 ILE A CG1   1 
ATOM   1904 C  CG2   . ILE A 1  265 ? 8.240   12.707  -4.326  1.00 30.64 ? 391 ILE A CG2   1 
ATOM   1905 C  CD1   . ILE A 1  265 ? 8.403   12.638  -7.400  1.00 33.04 ? 391 ILE A CD1   1 
ATOM   1906 N  N     A PHE A 1  266 ? 5.406   12.266  -2.182  0.27 29.40 ? 392 PHE A N     1 
ATOM   1907 N  N     B PHE A 1  266 ? 5.402   12.279  -2.179  0.73 29.84 ? 392 PHE A N     1 
ATOM   1908 C  CA    A PHE A 1  266 ? 5.106   12.790  -0.861  0.27 30.60 ? 392 PHE A CA    1 
ATOM   1909 C  CA    B PHE A 1  266 ? 5.087   12.843  -0.878  0.73 29.57 ? 392 PHE A CA    1 
ATOM   1910 C  C     A PHE A 1  266 ? 6.383   13.222  -0.158  0.27 30.30 ? 392 PHE A C     1 
ATOM   1911 C  C     B PHE A 1  266 ? 6.356   13.191  -0.124  0.73 30.65 ? 392 PHE A C     1 
ATOM   1912 O  O     A PHE A 1  266 ? 7.464   12.675  -0.393  0.27 28.42 ? 392 PHE A O     1 
ATOM   1913 O  O     B PHE A 1  266 ? 7.394   12.536  -0.269  0.73 26.92 ? 392 PHE A O     1 
ATOM   1914 C  CB    A PHE A 1  266 ? 4.409   11.731  -0.003  0.27 33.92 ? 392 PHE A CB    1 
ATOM   1915 C  CB    B PHE A 1  266 ? 4.291   11.863  -0.019  0.73 33.72 ? 392 PHE A CB    1 
ATOM   1916 C  CG    A PHE A 1  266 ? 2.927   11.929  0.146   0.27 36.43 ? 392 PHE A CG    1 
ATOM   1917 C  CG    B PHE A 1  266 ? 2.813   11.905  -0.227  0.73 34.97 ? 392 PHE A CG    1 
ATOM   1918 C  CD1   A PHE A 1  266 ? 2.066   11.623  -0.890  0.27 38.23 ? 392 PHE A CD1   1 
ATOM   1919 C  CD1   B PHE A 1  266 ? 2.266   11.837  -1.492  0.73 38.21 ? 392 PHE A CD1   1 
ATOM   1920 C  CD2   A PHE A 1  266 ? 2.394   12.385  1.341   0.27 38.39 ? 392 PHE A CD2   1 
ATOM   1921 C  CD2   B PHE A 1  266 ? 1.965   11.953  0.865   0.73 37.90 ? 392 PHE A CD2   1 
ATOM   1922 C  CE1   A PHE A 1  266 ? 0.700   11.785  -0.746  0.27 39.09 ? 392 PHE A CE1   1 
ATOM   1923 C  CE1   B PHE A 1  266 ? 0.890   11.843  -1.664  0.73 41.00 ? 392 PHE A CE1   1 
ATOM   1924 C  CE2   A PHE A 1  266 ? 1.031   12.551  1.489   0.27 39.73 ? 392 PHE A CE2   1 
ATOM   1925 C  CE2   B PHE A 1  266 ? 0.598   11.956  0.701   0.73 39.18 ? 392 PHE A CE2   1 
ATOM   1926 C  CZ    A PHE A 1  266 ? 0.184   12.251  0.443   0.27 39.62 ? 392 PHE A CZ    1 
ATOM   1927 C  CZ    B PHE A 1  266 ? 0.060   11.900  -0.564  0.73 38.84 ? 392 PHE A CZ    1 
ATOM   1928 N  N     . ARG A 1  267 ? 6.240   14.206  0.723   1.00 34.02 ? 393 ARG A N     1 
ATOM   1929 C  CA    . ARG A 1  267 ? 7.287   14.583  1.652   1.00 37.48 ? 393 ARG A CA    1 
ATOM   1930 C  C     . ARG A 1  267 ? 7.030   13.830  2.955   1.00 40.43 ? 393 ARG A C     1 
ATOM   1931 O  O     . ARG A 1  267 ? 6.088   14.144  3.688   1.00 44.16 ? 393 ARG A O     1 
ATOM   1932 C  CB    . ARG A 1  267 ? 7.263   16.093  1.847   1.00 39.67 ? 393 ARG A CB    1 
ATOM   1933 C  CG    . ARG A 1  267 ? 8.307   16.638  2.759   1.00 44.32 ? 393 ARG A CG    1 
ATOM   1934 C  CD    . ARG A 1  267 ? 8.053   18.115  2.937   1.00 41.96 ? 393 ARG A CD    1 
ATOM   1935 N  NE    . ARG A 1  267 ? 8.906   18.675  3.961   1.00 37.43 ? 393 ARG A NE    1 
ATOM   1936 C  CZ    . ARG A 1  267 ? 9.809   19.629  3.768   1.00 36.65 ? 393 ARG A CZ    1 
ATOM   1937 N  NH1   . ARG A 1  267 ? 9.995   20.175  2.573   1.00 36.67 ? 393 ARG A NH1   1 
ATOM   1938 N  NH2   . ARG A 1  267 ? 10.521  20.049  4.795   1.00 43.91 ? 393 ARG A NH2   1 
ATOM   1939 N  N     . LEU A 1  268 ? 7.854   12.826  3.235   1.00 31.20 ? 394 LEU A N     1 
ATOM   1940 C  CA    . LEU A 1  268 ? 7.656   11.981  4.399   1.00 38.57 ? 394 LEU A CA    1 
ATOM   1941 C  C     . LEU A 1  268 ? 8.627   12.370  5.501   1.00 44.60 ? 394 LEU A C     1 
ATOM   1942 O  O     . LEU A 1  268 ? 9.847   12.296  5.284   1.00 42.54 ? 394 LEU A O     1 
ATOM   1943 C  CB    . LEU A 1  268 ? 7.858   10.521  4.026   1.00 40.69 ? 394 LEU A CB    1 
ATOM   1944 C  CG    . LEU A 1  268 ? 7.714   9.553   5.199   1.00 46.60 ? 394 LEU A CG    1 
ATOM   1945 C  CD1   . LEU A 1  268 ? 6.281   9.555   5.719   1.00 44.68 ? 394 LEU A CD1   1 
ATOM   1946 C  CD2   . LEU A 1  268 ? 8.145   8.161   4.785   1.00 44.18 ? 394 LEU A CD2   1 
ATOM   1947 N  N     . PRO A 1  269 ? 8.155   12.748  6.690   1.00 52.57 ? 395 PRO A N     1 
ATOM   1948 C  CA    . PRO A 1  269 ? 9.085   13.083  7.774   1.00 61.34 ? 395 PRO A CA    1 
ATOM   1949 C  C     . PRO A 1  269 ? 10.046  11.947  8.094   1.00 64.19 ? 395 PRO A C     1 
ATOM   1950 O  O     . PRO A 1  269 ? 9.708   10.764  8.002   1.00 62.61 ? 395 PRO A O     1 
ATOM   1951 C  CB    . PRO A 1  269 ? 8.156   13.379  8.955   1.00 62.18 ? 395 PRO A CB    1 
ATOM   1952 C  CG    . PRO A 1  269 ? 6.909   13.874  8.319   1.00 59.51 ? 395 PRO A CG    1 
ATOM   1953 C  CD    . PRO A 1  269 ? 6.763   13.073  7.049   1.00 54.96 ? 395 PRO A CD    1 
ATOM   1954 N  N     . GLN A 1  270 ? 11.263  12.334  8.472   1.00 62.23 ? 396 GLN A N     1 
ATOM   1955 C  CA    . GLN A 1  270 ? 12.338  11.426  8.848   1.00 64.13 ? 396 GLN A CA    1 
ATOM   1956 C  C     . GLN A 1  270 ? 13.019  11.965  10.101  1.00 70.53 ? 396 GLN A C     1 
ATOM   1957 O  O     . GLN A 1  270 ? 12.809  13.128  10.466  1.00 69.45 ? 396 GLN A O     1 
ATOM   1958 C  CB    . GLN A 1  270 ? 13.355  11.284  7.712   1.00 62.60 ? 396 GLN A CB    1 
ATOM   1959 C  CG    . GLN A 1  270 ? 12.871  10.488  6.519   1.00 59.09 ? 396 GLN A CG    1 
ATOM   1960 C  CD    . GLN A 1  270 ? 12.949  8.993   6.748   1.00 59.66 ? 396 GLN A CD    1 
ATOM   1961 O  OE1   . GLN A 1  270 ? 14.022  8.389   6.635   1.00 57.48 ? 396 GLN A OE1   1 
ATOM   1962 N  NE2   . GLN A 1  270 ? 11.813  8.385   7.072   1.00 58.41 ? 396 GLN A NE2   1 
ATOM   1963 N  N     . PRO A 1  271 ? 13.832  11.158  10.787  1.00 66.35 ? 397 PRO A N     1 
ATOM   1964 C  CA    . PRO A 1  271 ? 14.568  11.667  11.955  1.00 66.97 ? 397 PRO A CA    1 
ATOM   1965 C  C     . PRO A 1  271 ? 15.299  12.970  11.665  1.00 58.32 ? 397 PRO A C     1 
ATOM   1966 O  O     . PRO A 1  271 ? 16.317  12.973  10.965  1.00 55.76 ? 397 PRO A O     1 
ATOM   1967 C  CB    . PRO A 1  271 ? 15.548  10.528  12.269  1.00 69.89 ? 397 PRO A CB    1 
ATOM   1968 C  CG    . PRO A 1  271 ? 14.856  9.303   11.788  1.00 69.23 ? 397 PRO A CG    1 
ATOM   1969 C  CD    . PRO A 1  271 ? 14.054  9.716   10.580  1.00 67.64 ? 397 PRO A CD    1 
ATOM   1970 N  N     . GLY A 1  272 ? 14.785  14.082  12.189  1.00 65.45 ? 410 GLY A N     1 
ATOM   1971 C  CA    . GLY A 1  272 ? 15.392  15.379  11.949  1.00 61.36 ? 410 GLY A CA    1 
ATOM   1972 C  C     . GLY A 1  272 ? 15.404  15.837  10.503  1.00 56.05 ? 410 GLY A C     1 
ATOM   1973 O  O     . GLY A 1  272 ? 16.127  16.785  10.174  1.00 50.83 ? 410 GLY A O     1 
ATOM   1974 N  N     . SER A 1  273 ? 14.633  15.198  9.624   1.00 52.53 ? 411 SER A N     1 
ATOM   1975 C  CA    . SER A 1  273 ? 14.599  15.584  8.217   1.00 46.38 ? 411 SER A CA    1 
ATOM   1976 C  C     . SER A 1  273 ? 13.374  14.964  7.552   1.00 44.06 ? 411 SER A C     1 
ATOM   1977 O  O     . SER A 1  273 ? 12.313  14.879  8.176   1.00 47.60 ? 411 SER A O     1 
ATOM   1978 C  CB    . SER A 1  273 ? 15.890  15.161  7.516   1.00 44.20 ? 411 SER A CB    1 
ATOM   1979 O  OG    . SER A 1  273 ? 15.954  15.655  6.191   1.00 44.94 ? 411 SER A OG    1 
ATOM   1980 N  N     . TRP A 1  274 ? 13.499  14.533  6.299   1.00 41.71 ? 412 TRP A N     1 
ATOM   1981 C  CA    . TRP A 1  274 ? 12.378  13.949  5.571   1.00 37.39 ? 412 TRP A CA    1 
ATOM   1982 C  C     . TRP A 1  274 ? 12.938  13.279  4.328   1.00 35.23 ? 412 TRP A C     1 
ATOM   1983 O  O     . TRP A 1  274 ? 14.117  13.433  4.000   1.00 34.27 ? 412 TRP A O     1 
ATOM   1984 C  CB    . TRP A 1  274 ? 11.336  15.006  5.195   1.00 39.16 ? 412 TRP A CB    1 
ATOM   1985 C  CG    . TRP A 1  274 ? 11.915  16.169  4.432   1.00 42.65 ? 412 TRP A CG    1 
ATOM   1986 C  CD1   . TRP A 1  274 ? 12.424  17.325  4.958   1.00 41.96 ? 412 TRP A CD1   1 
ATOM   1987 C  CD2   . TRP A 1  274 ? 12.045  16.288  3.009   1.00 39.07 ? 412 TRP A CD2   1 
ATOM   1988 N  NE1   . TRP A 1  274 ? 12.859  18.153  3.949   1.00 38.43 ? 412 TRP A NE1   1 
ATOM   1989 C  CE2   . TRP A 1  274 ? 12.640  17.538  2.745   1.00 37.24 ? 412 TRP A CE2   1 
ATOM   1990 C  CE3   . TRP A 1  274 ? 11.718  15.458  1.934   1.00 38.75 ? 412 TRP A CE3   1 
ATOM   1991 C  CZ2   . TRP A 1  274 ? 12.910  17.976  1.454   1.00 38.43 ? 412 TRP A CZ2   1 
ATOM   1992 C  CZ3   . TRP A 1  274 ? 11.994  15.895  0.651   1.00 32.05 ? 412 TRP A CZ3   1 
ATOM   1993 C  CH2   . TRP A 1  274 ? 12.576  17.143  0.422   1.00 33.48 ? 412 TRP A CH2   1 
ATOM   1994 N  N     . LYS A 1  275 ? 12.077  12.543  3.628   1.00 31.32 ? 413 LYS A N     1 
ATOM   1995 C  CA    . LYS A 1  275 ? 12.481  11.946  2.365   1.00 31.28 ? 413 LYS A CA    1 
ATOM   1996 C  C     . LYS A 1  275 ? 11.291  11.898  1.424   1.00 28.61 ? 413 LYS A C     1 
ATOM   1997 O  O     . LYS A 1  275 ? 10.134  11.816  1.853   1.00 29.48 ? 413 LYS A O     1 
ATOM   1998 C  CB    . LYS A 1  275 ? 13.059  10.534  2.550   1.00 32.94 ? 413 LYS A CB    1 
ATOM   1999 C  CG    . LYS A 1  275 ? 12.059  9.501   3.064   1.00 38.15 ? 413 LYS A CG    1 
ATOM   2000 C  CD    . LYS A 1  275 ? 12.621  8.078   2.982   1.00 39.31 ? 413 LYS A CD    1 
ATOM   2001 C  CE    . LYS A 1  275 ? 11.667  7.070   3.621   1.00 44.84 ? 413 LYS A CE    1 
ATOM   2002 N  NZ    . LYS A 1  275 ? 12.111  5.654   3.430   1.00 46.60 ? 413 LYS A NZ    1 
ATOM   2003 N  N     . ALA A 1  276 ? 11.594  11.938  0.133   1.00 28.32 ? 414 ALA A N     1 
ATOM   2004 C  CA    . ALA A 1  276 ? 10.568  11.820  -0.886  1.00 27.46 ? 414 ALA A CA    1 
ATOM   2005 C  C     . ALA A 1  276 ? 10.130  10.366  -1.027  1.00 26.19 ? 414 ALA A C     1 
ATOM   2006 O  O     . ALA A 1  276 ? 10.953  9.445   -0.995  1.00 25.93 ? 414 ALA A O     1 
ATOM   2007 C  CB    . ALA A 1  276 ? 11.084  12.342  -2.221  1.00 27.79 ? 414 ALA A CB    1 
ATOM   2008 N  N     . VAL A 1  277 ? 8.824   10.160  -1.175  1.00 25.48 ? 415 VAL A N     1 
ATOM   2009 C  CA    A VAL A 1  277 ? 8.247   8.825   -1.317  0.68 25.57 ? 415 VAL A CA    1 
ATOM   2010 C  CA    B VAL A 1  277 ? 8.262   8.825   -1.333  0.32 25.50 ? 415 VAL A CA    1 
ATOM   2011 C  C     . VAL A 1  277 ? 7.154   8.887   -2.372  1.00 23.81 ? 415 VAL A C     1 
ATOM   2012 O  O     . VAL A 1  277 ? 6.316   9.795   -2.348  1.00 24.13 ? 415 VAL A O     1 
ATOM   2013 C  CB    A VAL A 1  277 ? 7.673   8.296   0.014   0.68 26.19 ? 415 VAL A CB    1 
ATOM   2014 C  CB    B VAL A 1  277 ? 7.733   8.254   -0.002  0.32 26.55 ? 415 VAL A CB    1 
ATOM   2015 C  CG1   A VAL A 1  277 ? 7.078   6.900   -0.168  0.68 25.27 ? 415 VAL A CG1   1 
ATOM   2016 C  CG1   B VAL A 1  277 ? 8.892   7.876   0.910   0.32 28.02 ? 415 VAL A CG1   1 
ATOM   2017 C  CG2   A VAL A 1  277 ? 8.751   8.268   1.085   0.68 28.87 ? 415 VAL A CG2   1 
ATOM   2018 C  CG2   B VAL A 1  277 ? 6.814   9.246   0.688   0.32 27.07 ? 415 VAL A CG2   1 
ATOM   2019 N  N     . ARG A 1  278 ? 7.161   7.928   -3.291  1.00 23.08 ? 416 ARG A N     1 
ATOM   2020 C  CA    . ARG A 1  278 ? 6.111   7.821   -4.289  1.00 22.58 ? 416 ARG A CA    1 
ATOM   2021 C  C     . ARG A 1  278 ? 4.850   7.233   -3.657  1.00 24.77 ? 416 ARG A C     1 
ATOM   2022 O  O     . ARG A 1  278 ? 4.896   6.182   -3.008  1.00 21.65 ? 416 ARG A O     1 
ATOM   2023 C  CB    . ARG A 1  278 ? 6.574   6.952   -5.450  1.00 22.14 ? 416 ARG A CB    1 
ATOM   2024 C  CG    . ARG A 1  278 ? 7.397   7.688   -6.489  1.00 23.99 ? 416 ARG A CG    1 
ATOM   2025 C  CD    . ARG A 1  278 ? 6.526   8.400   -7.527  1.00 24.49 ? 416 ARG A CD    1 
ATOM   2026 N  NE    . ARG A 1  278 ? 5.748   7.436   -8.300  1.00 25.46 ? 416 ARG A NE    1 
ATOM   2027 C  CZ    . ARG A 1  278 ? 4.441   7.212   -8.156  1.00 24.83 ? 416 ARG A CZ    1 
ATOM   2028 N  NH1   . ARG A 1  278 ? 3.721   7.902   -7.285  1.00 27.41 ? 416 ARG A NH1   1 
ATOM   2029 N  NH2   . ARG A 1  278 ? 3.850   6.296   -8.903  1.00 24.66 ? 416 ARG A NH2   1 
ATOM   2030 N  N     . VAL A 1  279 ? 3.727   7.916   -3.845  1.00 23.79 ? 417 VAL A N     1 
ATOM   2031 C  CA    . VAL A 1  279 ? 2.434   7.473   -3.337  1.00 21.69 ? 417 VAL A CA    1 
ATOM   2032 C  C     . VAL A 1  279 ? 1.441   7.551   -4.479  1.00 21.46 ? 417 VAL A C     1 
ATOM   2033 O  O     . VAL A 1  279 ? 1.390   8.559   -5.195  1.00 23.03 ? 417 VAL A O     1 
ATOM   2034 C  CB    . VAL A 1  279 ? 1.944   8.320   -2.147  1.00 23.12 ? 417 VAL A CB    1 
ATOM   2035 C  CG1   . VAL A 1  279 ? 0.640   7.749   -1.587  1.00 25.50 ? 417 VAL A CG1   1 
ATOM   2036 C  CG2   . VAL A 1  279 ? 2.996   8.381   -1.065  1.00 27.11 ? 417 VAL A CG2   1 
ATOM   2037 N  N     . ASP A 1  280 ? 0.659   6.492   -4.649  1.00 22.14 ? 418 ASP A N     1 
ATOM   2038 C  CA    . ASP A 1  280 ? -0.422  6.455   -5.622  1.00 24.01 ? 418 ASP A CA    1 
ATOM   2039 C  C     . ASP A 1  280 ? -1.750  6.517   -4.883  1.00 24.04 ? 418 ASP A C     1 
ATOM   2040 O  O     . ASP A 1  280 ? -2.004  5.703   -3.989  1.00 24.15 ? 418 ASP A O     1 
ATOM   2041 C  CB    . ASP A 1  280 ? -0.345  5.187   -6.481  1.00 25.00 ? 418 ASP A CB    1 
ATOM   2042 C  CG    . ASP A 1  280 ? 0.828   5.207   -7.453  1.00 25.33 ? 418 ASP A CG    1 
ATOM   2043 O  OD1   . ASP A 1  280 ? 1.309   6.311   -7.771  1.00 25.77 ? 418 ASP A OD1   1 
ATOM   2044 O  OD2   . ASP A 1  280 ? 1.256   4.127   -7.909  1.00 23.41 ? 418 ASP A OD2   1 
ATOM   2045 N  N     . LEU A 1  281 ? -2.594  7.473   -5.262  1.00 24.02 ? 419 LEU A N     1 
ATOM   2046 C  CA    . LEU A 1  281 ? -3.930  7.618   -4.699  1.00 21.88 ? 419 LEU A CA    1 
ATOM   2047 C  C     . LEU A 1  281 ? -4.948  7.352   -5.791  1.00 21.09 ? 419 LEU A C     1 
ATOM   2048 O  O     . LEU A 1  281 ? -4.865  7.934   -6.877  1.00 25.73 ? 419 LEU A O     1 
ATOM   2049 C  CB    . LEU A 1  281 ? -4.151  9.020   -4.124  1.00 22.01 ? 419 LEU A CB    1 
ATOM   2050 C  CG    . LEU A 1  281 ? -3.161  9.503   -3.067  1.00 27.74 ? 419 LEU A CG    1 
ATOM   2051 C  CD1   . LEU A 1  281 ? -3.529  10.913  -2.641  1.00 35.68 ? 419 LEU A CD1   1 
ATOM   2052 C  CD2   . LEU A 1  281 ? -3.115  8.588   -1.859  1.00 28.92 ? 419 LEU A CD2   1 
ATOM   2053 N  N     . VAL A 1  282 ? -5.921  6.504   -5.491  1.00 20.78 ? 420 VAL A N     1 
ATOM   2054 C  CA    . VAL A 1  282 ? -6.890  6.054   -6.478  1.00 20.70 ? 420 VAL A CA    1 
ATOM   2055 C  C     . VAL A 1  282 ? -8.266  6.113   -5.837  1.00 20.93 ? 420 VAL A C     1 
ATOM   2056 O  O     . VAL A 1  282 ? -8.430  5.754   -4.667  1.00 23.69 ? 420 VAL A O     1 
ATOM   2057 C  CB    . VAL A 1  282 ? -6.578  4.630   -6.971  1.00 20.98 ? 420 VAL A CB    1 
ATOM   2058 C  CG1   . VAL A 1  282 ? -7.533  4.236   -8.112  1.00 23.84 ? 420 VAL A CG1   1 
ATOM   2059 C  CG2   . VAL A 1  282 ? -5.104  4.512   -7.390  1.00 26.89 ? 420 VAL A CG2   1 
ATOM   2060 N  N     . VAL A 1  283 ? -9.252  6.568   -6.598  1.00 22.81 ? 421 VAL A N     1 
ATOM   2061 C  CA    . VAL A 1  283 ? -10.629 6.646   -6.128  1.00 23.30 ? 421 VAL A CA    1 
ATOM   2062 C  C     . VAL A 1  283 ? -11.480 5.717   -6.981  1.00 22.89 ? 421 VAL A C     1 
ATOM   2063 O  O     . VAL A 1  283 ? -11.298 5.632   -8.200  1.00 25.19 ? 421 VAL A O     1 
ATOM   2064 C  CB    . VAL A 1  283 ? -11.165 8.089   -6.186  1.00 26.69 ? 421 VAL A CB    1 
ATOM   2065 C  CG1   . VAL A 1  283 ? -12.641 8.139   -5.786  1.00 31.56 ? 421 VAL A CG1   1 
ATOM   2066 C  CG2   . VAL A 1  283 ? -10.332 8.996   -5.280  1.00 25.64 ? 421 VAL A CG2   1 
ATOM   2067 N  N     . ALA A 1  284 ? -12.410 5.022   -6.338  1.00 21.53 ? 422 ALA A N     1 
ATOM   2068 C  CA    . ALA A 1  284 ? -13.366 4.196   -7.048  1.00 21.60 ? 422 ALA A CA    1 
ATOM   2069 C  C     . ALA A 1  284 ? -14.702 4.297   -6.331  1.00 23.13 ? 422 ALA A C     1 
ATOM   2070 O  O     . ALA A 1  284 ? -14.732 4.387   -5.096  1.00 26.46 ? 422 ALA A O     1 
ATOM   2071 C  CB    . ALA A 1  284 ? -12.927 2.727   -7.105  1.00 21.66 ? 422 ALA A CB    1 
ATOM   2072 N  N     . PRO A 1  285 ? -15.815 4.295   -7.061  1.00 24.01 ? 423 PRO A N     1 
ATOM   2073 C  CA    . PRO A 1  285 ? -17.112 4.173   -6.391  1.00 28.56 ? 423 PRO A CA    1 
ATOM   2074 C  C     . PRO A 1  285 ? -17.215 2.809   -5.728  1.00 25.82 ? 423 PRO A C     1 
ATOM   2075 O  O     . PRO A 1  285 ? -16.553 1.849   -6.132  1.00 23.11 ? 423 PRO A O     1 
ATOM   2076 C  CB    . PRO A 1  285 ? -18.127 4.334   -7.528  1.00 31.06 ? 423 PRO A CB    1 
ATOM   2077 C  CG    . PRO A 1  285 ? -17.395 3.926   -8.757  1.00 30.56 ? 423 PRO A CG    1 
ATOM   2078 C  CD    . PRO A 1  285 ? -15.946 4.309   -8.528  1.00 26.52 ? 423 PRO A CD    1 
ATOM   2079 N  N     . VAL A 1  286 ? -18.047 2.729   -4.689  1.00 23.17 ? 424 VAL A N     1 
ATOM   2080 C  CA    . VAL A 1  286 ? -18.085 1.509   -3.894  1.00 27.14 ? 424 VAL A CA    1 
ATOM   2081 C  C     . VAL A 1  286 ? -18.544 0.322   -4.735  1.00 29.59 ? 424 VAL A C     1 
ATOM   2082 O  O     . VAL A 1  286 ? -18.118 -0.815  -4.496  1.00 26.64 ? 424 VAL A O     1 
ATOM   2083 C  CB    . VAL A 1  286 ? -18.967 1.708   -2.648  1.00 31.26 ? 424 VAL A CB    1 
ATOM   2084 C  CG1   . VAL A 1  286 ? -20.444 1.876   -3.030  1.00 33.96 ? 424 VAL A CG1   1 
ATOM   2085 C  CG2   . VAL A 1  286 ? -18.774 0.552   -1.686  1.00 36.12 ? 424 VAL A CG2   1 
ATOM   2086 N  N     . SER A 1  287 ? -19.397 0.557   -5.736  1.00 30.30 ? 425 SER A N     1 
ATOM   2087 C  CA    . SER A 1  287 ? -19.811 -0.529  -6.620  1.00 31.72 ? 425 SER A CA    1 
ATOM   2088 C  C     . SER A 1  287 ? -18.623 -1.162  -7.334  1.00 35.73 ? 425 SER A C     1 
ATOM   2089 O  O     . SER A 1  287 ? -18.649 -2.361  -7.638  1.00 31.65 ? 425 SER A O     1 
ATOM   2090 C  CB    . SER A 1  287 ? -20.812 -0.021  -7.653  1.00 32.48 ? 425 SER A CB    1 
ATOM   2091 O  OG    . SER A 1  287 ? -20.203 0.928   -8.510  1.00 29.32 ? 425 SER A OG    1 
ATOM   2092 N  N     . GLN A 1  288 ? -17.581 -0.380  -7.619  1.00 26.17 ? 426 GLN A N     1 
ATOM   2093 C  CA    . GLN A 1  288 ? -16.399 -0.881  -8.304  1.00 25.60 ? 426 GLN A CA    1 
ATOM   2094 C  C     . GLN A 1  288 ? -15.276 -1.250  -7.352  1.00 22.78 ? 426 GLN A C     1 
ATOM   2095 O  O     . GLN A 1  288 ? -14.268 -1.807  -7.800  1.00 21.09 ? 426 GLN A O     1 
ATOM   2096 C  CB    . GLN A 1  288 ? -15.877 0.161   -9.300  1.00 29.40 ? 426 GLN A CB    1 
ATOM   2097 C  CG    . GLN A 1  288 ? -16.855 0.492   -10.414 1.00 28.17 ? 426 GLN A CG    1 
ATOM   2098 C  CD    . GLN A 1  288 ? -16.374 1.639   -11.278 1.00 32.31 ? 426 GLN A CD    1 
ATOM   2099 O  OE1   . GLN A 1  288 ? -15.242 2.099   -11.145 1.00 35.06 ? 426 GLN A OE1   1 
ATOM   2100 N  NE2   . GLN A 1  288 ? -17.238 2.112   -12.165 1.00 35.49 ? 426 GLN A NE2   1 
ATOM   2101 N  N     . PHE A 1  289 ? -15.430 -0.962  -6.061  1.00 21.36 ? 427 PHE A N     1 
ATOM   2102 C  CA    . PHE A 1  289 ? -14.336 -1.131  -5.108  1.00 20.91 ? 427 PHE A CA    1 
ATOM   2103 C  C     . PHE A 1  289 ? -13.736 -2.531  -5.134  1.00 20.60 ? 427 PHE A C     1 
ATOM   2104 O  O     . PHE A 1  289 ? -12.499 -2.644  -5.158  1.00 20.54 ? 427 PHE A O     1 
ATOM   2105 C  CB    . PHE A 1  289 ? -14.841 -0.766  -3.706  1.00 24.35 ? 427 PHE A CB    1 
ATOM   2106 C  CG    . PHE A 1  289 ? -13.813 -0.919  -2.634  1.00 24.79 ? 427 PHE A CG    1 
ATOM   2107 C  CD1   . PHE A 1  289 ? -12.890 0.083   -2.399  1.00 29.01 ? 427 PHE A CD1   1 
ATOM   2108 C  CD2   . PHE A 1  289 ? -13.761 -2.067  -1.866  1.00 21.56 ? 427 PHE A CD2   1 
ATOM   2109 C  CE1   . PHE A 1  289 ? -11.942 -0.054  -1.407  1.00 33.20 ? 427 PHE A CE1   1 
ATOM   2110 C  CE2   . PHE A 1  289 ? -12.820 -2.212  -0.879  1.00 27.19 ? 427 PHE A CE2   1 
ATOM   2111 C  CZ    . PHE A 1  289 ? -11.901 -1.210  -0.648  1.00 29.74 ? 427 PHE A CZ    1 
ATOM   2112 N  N     . PRO A 1  290 ? -14.520 -3.615  -5.150  1.00 23.69 ? 428 PRO A N     1 
ATOM   2113 C  CA    . PRO A 1  290 ? -13.896 -4.951  -5.180  1.00 25.91 ? 428 PRO A CA    1 
ATOM   2114 C  C     . PRO A 1  290 ? -12.981 -5.146  -6.372  1.00 21.04 ? 428 PRO A C     1 
ATOM   2115 O  O     . PRO A 1  290 ? -11.909 -5.739  -6.232  1.00 20.11 ? 428 PRO A O     1 
ATOM   2116 C  CB    . PRO A 1  290 ? -15.097 -5.905  -5.227  1.00 26.57 ? 428 PRO A CB    1 
ATOM   2117 C  CG    . PRO A 1  290 ? -16.239 -5.127  -4.635  1.00 27.11 ? 428 PRO A CG    1 
ATOM   2118 C  CD    . PRO A 1  290 ? -15.986 -3.687  -5.040  1.00 26.40 ? 428 PRO A CD    1 
ATOM   2119 N  N     . PHE A 1  291 ? -13.375 -4.654  -7.545  1.00 24.39 ? 429 PHE A N     1 
ATOM   2120 C  CA    . PHE A 1  291 ? -12.541 -4.797  -8.735  1.00 25.38 ? 429 PHE A CA    1 
ATOM   2121 C  C     . PHE A 1  291 ? -11.300 -3.916  -8.660  1.00 23.52 ? 429 PHE A C     1 
ATOM   2122 O  O     . PHE A 1  291 ? -10.233 -4.293  -9.157  1.00 23.04 ? 429 PHE A O     1 
ATOM   2123 C  CB    . PHE A 1  291 ? -13.356 -4.452  -9.977  1.00 21.98 ? 429 PHE A CB    1 
ATOM   2124 C  CG    . PHE A 1  291 ? -14.576 -5.305  -10.153 1.00 21.39 ? 429 PHE A CG    1 
ATOM   2125 C  CD1   . PHE A 1  291 ? -14.487 -6.525  -10.784 1.00 22.96 ? 429 PHE A CD1   1 
ATOM   2126 C  CD2   . PHE A 1  291 ? -15.812 -4.886  -9.686  1.00 26.80 ? 429 PHE A CD2   1 
ATOM   2127 C  CE1   . PHE A 1  291 ? -15.603 -7.322  -10.950 1.00 26.54 ? 429 PHE A CE1   1 
ATOM   2128 C  CE2   . PHE A 1  291 ? -16.933 -5.681  -9.845  1.00 28.65 ? 429 PHE A CE2   1 
ATOM   2129 C  CZ    . PHE A 1  291 ? -16.827 -6.901  -10.479 1.00 25.44 ? 429 PHE A CZ    1 
ATOM   2130 N  N     . ALA A 1  292 ? -11.421 -2.733  -8.069  1.00 23.30 ? 430 ALA A N     1 
ATOM   2131 C  CA    . ALA A 1  292 ? -10.269 -1.842  -7.990  1.00 22.72 ? 430 ALA A CA    1 
ATOM   2132 C  C     . ALA A 1  292 ? -9.300  -2.325  -6.923  1.00 21.61 ? 430 ALA A C     1 
ATOM   2133 O  O     . ALA A 1  292 ? -8.077  -2.276  -7.109  1.00 22.51 ? 430 ALA A O     1 
ATOM   2134 C  CB    . ALA A 1  292 ? -10.730 -0.413  -7.701  1.00 24.19 ? 430 ALA A CB    1 
ATOM   2135 N  N     . LEU A 1  293 ? -9.837  -2.799  -5.802  1.00 19.26 ? 431 LEU A N     1 
ATOM   2136 C  CA    . LEU A 1  293 ? -9.008  -3.449  -4.795  1.00 19.09 ? 431 LEU A CA    1 
ATOM   2137 C  C     . LEU A 1  293 ? -8.234  -4.616  -5.400  1.00 20.60 ? 431 LEU A C     1 
ATOM   2138 O  O     . LEU A 1  293 ? -7.015  -4.735  -5.220  1.00 18.63 ? 431 LEU A O     1 
ATOM   2139 C  CB    . LEU A 1  293 ? -9.879  -3.934  -3.641  1.00 19.45 ? 431 LEU A CB    1 
ATOM   2140 C  CG    . LEU A 1  293 ? -9.111  -4.568  -2.473  1.00 23.03 ? 431 LEU A CG    1 
ATOM   2141 C  CD1   . LEU A 1  293 ? -8.081  -3.598  -1.900  1.00 25.16 ? 431 LEU A CD1   1 
ATOM   2142 C  CD2   . LEU A 1  293 ? -10.082 -5.010  -1.390  1.00 23.78 ? 431 LEU A CD2   1 
ATOM   2143 N  N     . LEU A 1  294 ? -8.933  -5.486  -6.126  1.00 22.51 ? 432 LEU A N     1 
ATOM   2144 C  CA    . LEU A 1  294 ? -8.281  -6.645  -6.733  1.00 23.61 ? 432 LEU A CA    1 
ATOM   2145 C  C     . LEU A 1  294 ? -7.178  -6.204  -7.683  1.00 21.06 ? 432 LEU A C     1 
ATOM   2146 O  O     . LEU A 1  294 ? -6.041  -6.695  -7.617  1.00 18.55 ? 432 LEU A O     1 
ATOM   2147 C  CB    . LEU A 1  294 ? -9.326  -7.486  -7.468  1.00 26.52 ? 432 LEU A CB    1 
ATOM   2148 C  CG    . LEU A 1  294 ? -8.883  -8.779  -8.143  1.00 25.67 ? 432 LEU A CG    1 
ATOM   2149 C  CD1   . LEU A 1  294 ? -8.312  -9.727  -7.106  1.00 25.71 ? 432 LEU A CD1   1 
ATOM   2150 C  CD2   . LEU A 1  294 ? -10.068 -9.403  -8.876  1.00 21.45 ? 432 LEU A CD2   1 
ATOM   2151 N  N     . GLY A 1  295 ? -7.496  -5.258  -8.568  1.00 18.93 ? 433 GLY A N     1 
ATOM   2152 C  CA    . GLY A 1  295 ? -6.517  -4.793  -9.535  1.00 20.71 ? 433 GLY A CA    1 
ATOM   2153 C  C     . GLY A 1  295 ? -5.318  -4.120  -8.892  1.00 23.60 ? 433 GLY A C     1 
ATOM   2154 O  O     . GLY A 1  295 ? -4.170  -4.379  -9.267  1.00 22.24 ? 433 GLY A O     1 
ATOM   2155 N  N     . TRP A 1  296 ? -5.564  -3.233  -7.928  1.00 20.76 ? 434 TRP A N     1 
ATOM   2156 C  CA    . TRP A 1  296 ? -4.461  -2.492  -7.321  1.00 20.94 ? 434 TRP A CA    1 
ATOM   2157 C  C     . TRP A 1  296 ? -3.689  -3.290  -6.276  1.00 19.64 ? 434 TRP A C     1 
ATOM   2158 O  O     . TRP A 1  296 ? -2.652  -2.811  -5.799  1.00 22.26 ? 434 TRP A O     1 
ATOM   2159 C  CB    . TRP A 1  296 ? -4.986  -1.191  -6.710  1.00 18.43 ? 434 TRP A CB    1 
ATOM   2160 C  CG    . TRP A 1  296 ? -5.211  -0.188  -7.778  1.00 18.66 ? 434 TRP A CG    1 
ATOM   2161 C  CD1   . TRP A 1  296 ? -6.326  -0.036  -8.539  1.00 22.06 ? 434 TRP A CD1   1 
ATOM   2162 C  CD2   . TRP A 1  296 ? -4.269  0.786   -8.239  1.00 22.53 ? 434 TRP A CD2   1 
ATOM   2163 N  NE1   . TRP A 1  296 ? -6.142  0.983   -9.450  1.00 27.17 ? 434 TRP A NE1   1 
ATOM   2164 C  CE2   . TRP A 1  296 ? -4.886  1.505   -9.279  1.00 26.66 ? 434 TRP A CE2   1 
ATOM   2165 C  CE3   . TRP A 1  296 ? -2.961  1.121   -7.867  1.00 22.02 ? 434 TRP A CE3   1 
ATOM   2166 C  CZ2   . TRP A 1  296 ? -4.241  2.545   -9.953  1.00 27.22 ? 434 TRP A CZ2   1 
ATOM   2167 C  CZ3   . TRP A 1  296 ? -2.328  2.163   -8.531  1.00 23.27 ? 434 TRP A CZ3   1 
ATOM   2168 C  CH2   . TRP A 1  296 ? -2.965  2.854   -9.563  1.00 25.80 ? 434 TRP A CH2   1 
ATOM   2169 N  N     . THR A 1  297 ? -4.155  -4.475  -5.904  1.00 18.14 ? 435 THR A N     1 
ATOM   2170 C  CA    . THR A 1  297 ? -3.390  -5.320  -4.995  1.00 19.68 ? 435 THR A CA    1 
ATOM   2171 C  C     . THR A 1  297 ? -2.402  -6.211  -5.743  1.00 19.02 ? 435 THR A C     1 
ATOM   2172 O  O     . THR A 1  297 ? -1.401  -6.642  -5.155  1.00 19.41 ? 435 THR A O     1 
ATOM   2173 C  CB    . THR A 1  297 ? -4.349  -6.142  -4.122  1.00 20.43 ? 435 THR A CB    1 
ATOM   2174 O  OG1   . THR A 1  297 ? -5.130  -5.250  -3.318  1.00 21.71 ? 435 THR A OG1   1 
ATOM   2175 C  CG2   . THR A 1  297 ? -3.604  -7.066  -3.164  1.00 22.15 ? 435 THR A CG2   1 
ATOM   2176 N  N     . GLY A 1  298 ? -2.624  -6.458  -7.029  1.00 22.26 ? 436 GLY A N     1 
ATOM   2177 C  CA    . GLY A 1  298 ? -1.599  -7.134  -7.809  1.00 23.30 ? 436 GLY A CA    1 
ATOM   2178 C  C     . GLY A 1  298 ? -1.456  -8.593  -7.397  1.00 25.12 ? 436 GLY A C     1 
ATOM   2179 O  O     . GLY A 1  298 ? -2.382  -9.195  -6.846  1.00 18.43 ? 436 GLY A O     1 
ATOM   2180 N  N     . SER A 1  299 ? -0.281  -9.175  -7.669  1.00 23.99 ? 437 SER A N     1 
ATOM   2181 C  CA    . SER A 1  299 ? 0.834   -8.540  -8.357  1.00 19.54 ? 437 SER A CA    1 
ATOM   2182 C  C     . SER A 1  299 ? 0.506   -8.180  -9.793  1.00 19.20 ? 437 SER A C     1 
ATOM   2183 O  O     . SER A 1  299 ? -0.523  -8.588  -10.328 1.00 18.76 ? 437 SER A O     1 
ATOM   2184 C  CB    . SER A 1  299 ? 2.050   -9.472  -8.350  1.00 24.09 ? 437 SER A CB    1 
ATOM   2185 O  OG    . SER A 1  299 ? 1.813   -10.596 -9.188  1.00 18.73 ? 437 SER A OG    1 
ATOM   2186 N  N     . LYS A 1  300 ? 1.415   -7.444  -10.436 1.00 19.98 ? 438 LYS A N     1 
ATOM   2187 C  CA    . LYS A 1  300 ? 1.235   -7.123  -11.846 1.00 21.54 ? 438 LYS A CA    1 
ATOM   2188 C  C     . LYS A 1  300 ? 1.011   -8.386  -12.668 1.00 22.86 ? 438 LYS A C     1 
ATOM   2189 O  O     . LYS A 1  300 ? 0.061   -8.471  -13.457 1.00 19.94 ? 438 LYS A O     1 
ATOM   2190 C  CB    . LYS A 1  300 ? 2.445   -6.360  -12.379 1.00 26.12 ? 438 LYS A CB    1 
ATOM   2191 C  CG    . LYS A 1  300 ? 2.428   -6.166  -13.892 1.00 32.40 ? 438 LYS A CG    1 
ATOM   2192 C  CD    . LYS A 1  300 ? 3.622   -5.338  -14.382 1.00 34.48 ? 438 LYS A CD    1 
ATOM   2193 C  CE    . LYS A 1  300 ? 3.563   -5.141  -15.885 1.00 41.70 ? 438 LYS A CE    1 
ATOM   2194 N  NZ    . LYS A 1  300 ? 4.700   -4.341  -16.417 1.00 46.42 ? 438 LYS A NZ    1 
ATOM   2195 N  N     . LEU A 1  301 ? 1.904   -9.370  -12.528 1.00 19.07 ? 439 LEU A N     1 
ATOM   2196 C  CA    . LEU A 1  301 ? 1.736   -10.609 -13.285 1.00 22.23 ? 439 LEU A CA    1 
ATOM   2197 C  C     . LEU A 1  301 ? 0.442   -11.314 -12.905 1.00 20.58 ? 439 LEU A C     1 
ATOM   2198 O  O     . LEU A 1  301 ? -0.263  -11.851 -13.768 1.00 19.98 ? 439 LEU A O     1 
ATOM   2199 C  CB    . LEU A 1  301 ? 2.927   -11.539 -13.055 1.00 25.51 ? 439 LEU A CB    1 
ATOM   2200 C  CG    . LEU A 1  301 ? 2.863   -12.878 -13.798 1.00 26.23 ? 439 LEU A CG    1 
ATOM   2201 C  CD1   . LEU A 1  301 ? 2.823   -12.659 -15.306 1.00 27.22 ? 439 LEU A CD1   1 
ATOM   2202 C  CD2   . LEU A 1  301 ? 4.038   -13.751 -13.409 1.00 24.11 ? 439 LEU A CD2   1 
ATOM   2203 N  N     . PHE A 1  302 ? 0.116   -11.339 -11.613 1.00 19.26 ? 440 PHE A N     1 
ATOM   2204 C  CA    . PHE A 1  302 ? -1.126  -11.979 -11.192 1.00 20.88 ? 440 PHE A CA    1 
ATOM   2205 C  C     . PHE A 1  302 ? -2.329  -11.353 -11.888 1.00 21.87 ? 440 PHE A C     1 
ATOM   2206 O  O     . PHE A 1  302 ? -3.218  -12.068 -12.360 1.00 19.91 ? 440 PHE A O     1 
ATOM   2207 C  CB    . PHE A 1  302 ? -1.277  -11.894 -9.672  1.00 21.47 ? 440 PHE A CB    1 
ATOM   2208 C  CG    . PHE A 1  302 ? -2.427  -12.697 -9.132  1.00 22.82 ? 440 PHE A CG    1 
ATOM   2209 C  CD1   . PHE A 1  302 ? -3.710  -12.193 -9.156  1.00 22.40 ? 440 PHE A CD1   1 
ATOM   2210 C  CD2   . PHE A 1  302 ? -2.216  -13.949 -8.579  1.00 19.99 ? 440 PHE A CD2   1 
ATOM   2211 C  CE1   . PHE A 1  302 ? -4.774  -12.933 -8.666  1.00 22.72 ? 440 PHE A CE1   1 
ATOM   2212 C  CE2   . PHE A 1  302 ? -3.262  -14.690 -8.084  1.00 23.77 ? 440 PHE A CE2   1 
ATOM   2213 C  CZ    . PHE A 1  302 ? -4.548  -14.182 -8.123  1.00 20.26 ? 440 PHE A CZ    1 
ATOM   2214 N  N     . GLN A 1  303 ? -2.375  -10.017 -11.974 1.00 19.48 ? 441 GLN A N     1 
ATOM   2215 C  CA    . GLN A 1  303 ? -3.523  -9.371  -12.613 1.00 19.35 ? 441 GLN A CA    1 
ATOM   2216 C  C     . GLN A 1  303 ? -3.567  -9.647  -14.115 1.00 19.88 ? 441 GLN A C     1 
ATOM   2217 O  O     . GLN A 1  303 ? -4.643  -9.904  -14.672 1.00 20.94 ? 441 GLN A O     1 
ATOM   2218 C  CB    . GLN A 1  303 ? -3.498  -7.875  -12.337 1.00 24.05 ? 441 GLN A CB    1 
ATOM   2219 C  CG    . GLN A 1  303 ? -3.703  -7.535  -10.870 1.00 26.14 ? 441 GLN A CG    1 
ATOM   2220 C  CD    . GLN A 1  303 ? -4.947  -8.177  -10.294 1.00 30.11 ? 441 GLN A CD    1 
ATOM   2221 O  OE1   . GLN A 1  303 ? -6.034  -8.074  -10.865 1.00 29.03 ? 441 GLN A OE1   1 
ATOM   2222 N  NE2   . GLN A 1  303 ? -4.790  -8.866  -9.165  1.00 31.46 ? 441 GLN A NE2   1 
ATOM   2223 N  N     . ARG A 1  304 ? -2.420  -9.579  -14.791 1.00 24.14 ? 442 ARG A N     1 
ATOM   2224 C  CA    . ARG A 1  304 ? -2.365  -9.942  -16.206 1.00 28.12 ? 442 ARG A CA    1 
ATOM   2225 C  C     . ARG A 1  304 ? -2.853  -11.366 -16.417 1.00 25.23 ? 442 ARG A C     1 
ATOM   2226 O  O     . ARG A 1  304 ? -3.616  -11.646 -17.347 1.00 25.09 ? 442 ARG A O     1 
ATOM   2227 C  CB    . ARG A 1  304 ? -0.936  -9.802  -16.738 1.00 27.60 ? 442 ARG A CB    1 
ATOM   2228 C  CG    . ARG A 1  304 ? -0.351  -8.417  -16.638 1.00 30.62 ? 442 ARG A CG    1 
ATOM   2229 C  CD    . ARG A 1  304 ? 1.106   -8.404  -17.100 1.00 28.96 ? 442 ARG A CD    1 
ATOM   2230 N  NE    . ARG A 1  304 ? 1.195   -8.499  -18.555 1.00 28.09 ? 442 ARG A NE    1 
ATOM   2231 C  CZ    . ARG A 1  304 ? 2.253   -8.123  -19.266 1.00 31.86 ? 442 ARG A CZ    1 
ATOM   2232 N  NH1   . ARG A 1  304 ? 3.331   -7.638  -18.659 1.00 33.58 ? 442 ARG A NH1   1 
ATOM   2233 N  NH2   . ARG A 1  304 ? 2.224   -8.224  -20.587 1.00 31.73 ? 442 ARG A NH2   1 
ATOM   2234 N  N     . GLU A 1  305 ? -2.397  -12.289 -15.573 1.00 23.34 ? 443 GLU A N     1 
ATOM   2235 C  CA    . GLU A 1  305 ? -2.805  -13.680 -15.711 1.00 28.47 ? 443 GLU A CA    1 
ATOM   2236 C  C     . GLU A 1  305 ? -4.287  -13.838 -15.408 1.00 25.73 ? 443 GLU A C     1 
ATOM   2237 O  O     . GLU A 1  305 ? -5.000  -14.573 -16.104 1.00 24.46 ? 443 GLU A O     1 
ATOM   2238 C  CB    . GLU A 1  305 ? -1.955  -14.553 -14.785 1.00 31.40 ? 443 GLU A CB    1 
ATOM   2239 C  CG    . GLU A 1  305 ? -0.505  -14.634 -15.215 1.00 32.20 ? 443 GLU A CG    1 
ATOM   2240 C  CD    . GLU A 1  305 ? -0.306  -15.645 -16.322 1.00 33.21 ? 443 GLU A CD    1 
ATOM   2241 O  OE1   . GLU A 1  305 ? -0.396  -16.853 -16.024 1.00 30.01 ? 443 GLU A OE1   1 
ATOM   2242 O  OE2   . GLU A 1  305 ? -0.101  -15.231 -17.483 1.00 31.68 ? 443 GLU A OE2   1 
ATOM   2243 N  N     . LEU A 1  306 ? -4.772  -13.128 -14.392 1.00 23.87 ? 444 LEU A N     1 
ATOM   2244 C  CA    . LEU A 1  306 ? -6.188  -13.200 -14.047 1.00 24.81 ? 444 LEU A CA    1 
ATOM   2245 C  C     . LEU A 1  306 ? -7.058  -12.683 -15.184 1.00 22.82 ? 444 LEU A C     1 
ATOM   2246 O  O     . LEU A 1  306 ? -8.073  -13.297 -15.529 1.00 22.45 ? 444 LEU A O     1 
ATOM   2247 C  CB    . LEU A 1  306 ? -6.441  -12.410 -12.764 1.00 26.20 ? 444 LEU A CB    1 
ATOM   2248 C  CG    . LEU A 1  306 ? -7.851  -12.486 -12.185 1.00 25.98 ? 444 LEU A CG    1 
ATOM   2249 C  CD1   . LEU A 1  306 ? -8.147  -13.903 -11.725 1.00 26.56 ? 444 LEU A CD1   1 
ATOM   2250 C  CD2   . LEU A 1  306 ? -7.975  -11.518 -11.033 1.00 27.47 ? 444 LEU A CD2   1 
ATOM   2251 N  N     . ARG A 1  307 ? -6.670  -11.561 -15.793 1.00 23.08 ? 445 ARG A N     1 
ATOM   2252 C  CA    . ARG A 1  307 ? -7.441  -11.029 -16.912 1.00 22.86 ? 445 ARG A CA    1 
ATOM   2253 C  C     . ARG A 1  307 ? -7.352  -11.941 -18.129 1.00 25.10 ? 445 ARG A C     1 
ATOM   2254 O  O     . ARG A 1  307 ? -8.347  -12.139 -18.840 1.00 23.79 ? 445 ARG A O     1 
ATOM   2255 C  CB    . ARG A 1  307 ? -6.953  -9.622  -17.247 1.00 22.23 ? 445 ARG A CB    1 
ATOM   2256 C  CG    . ARG A 1  307 ? -7.217  -8.652  -16.114 1.00 23.55 ? 445 ARG A CG    1 
ATOM   2257 C  CD    . ARG A 1  307 ? -6.543  -7.317  -16.294 1.00 22.55 ? 445 ARG A CD    1 
ATOM   2258 N  NE    . ARG A 1  307 ? -6.815  -6.490  -15.117 1.00 23.13 ? 445 ARG A NE    1 
ATOM   2259 C  CZ    . ARG A 1  307 ? -6.624  -5.182  -15.048 1.00 26.19 ? 445 ARG A CZ    1 
ATOM   2260 N  NH1   . ARG A 1  307 ? -6.154  -4.523  -16.099 1.00 31.44 ? 445 ARG A NH1   1 
ATOM   2261 N  NH2   . ARG A 1  307 ? -6.909  -4.534  -13.922 1.00 24.60 ? 445 ARG A NH2   1 
ATOM   2262 N  N     . ARG A 1  308 ? -6.167  -12.502 -18.390 1.00 24.70 ? 446 ARG A N     1 
ATOM   2263 C  CA    . ARG A 1  308 ? -6.027  -13.450 -19.492 1.00 23.98 ? 446 ARG A CA    1 
ATOM   2264 C  C     . ARG A 1  308 ? -6.911  -14.668 -19.264 1.00 24.55 ? 446 ARG A C     1 
ATOM   2265 O  O     . ARG A 1  308 ? -7.630  -15.114 -20.169 1.00 29.34 ? 446 ARG A O     1 
ATOM   2266 C  CB    . ARG A 1  308 ? -4.558  -13.859 -19.643 1.00 24.62 ? 446 ARG A CB    1 
ATOM   2267 C  CG    . ARG A 1  308 ? -4.300  -14.733 -20.860 1.00 28.85 ? 446 ARG A CG    1 
ATOM   2268 C  CD    . ARG A 1  308 ? -2.812  -14.846 -21.175 1.00 29.37 ? 446 ARG A CD    1 
ATOM   2269 N  NE    . ARG A 1  308 ? -2.041  -15.519 -20.129 1.00 29.62 ? 446 ARG A NE    1 
ATOM   2270 C  CZ    . ARG A 1  308 ? -1.776  -16.826 -20.101 1.00 36.90 ? 446 ARG A CZ    1 
ATOM   2271 N  NH1   . ARG A 1  308 ? -2.235  -17.631 -21.055 1.00 35.61 ? 446 ARG A NH1   1 
ATOM   2272 N  NH2   . ARG A 1  308 ? -1.049  -17.333 -19.111 1.00 29.24 ? 446 ARG A NH2   1 
ATOM   2273 N  N     . PHE A 1  309 ? -6.881  -15.210 -18.047 1.00 27.13 ? 447 PHE A N     1 
ATOM   2274 C  CA    . PHE A 1  309 ? -7.727  -16.346 -17.708 1.00 26.99 ? 447 PHE A CA    1 
ATOM   2275 C  C     . PHE A 1  309 ? -9.192  -16.006 -17.924 1.00 26.83 ? 447 PHE A C     1 
ATOM   2276 O  O     . PHE A 1  309 ? -9.932  -16.753 -18.578 1.00 28.31 ? 447 PHE A O     1 
ATOM   2277 C  CB    . PHE A 1  309 ? -7.479  -16.754 -16.255 1.00 27.80 ? 447 PHE A CB    1 
ATOM   2278 C  CG    . PHE A 1  309 ? -8.346  -17.879 -15.782 1.00 26.10 ? 447 PHE A CG    1 
ATOM   2279 C  CD1   . PHE A 1  309 ? -9.576  -17.630 -15.199 1.00 27.14 ? 447 PHE A CD1   1 
ATOM   2280 C  CD2   . PHE A 1  309 ? -7.928  -19.195 -15.912 1.00 30.18 ? 447 PHE A CD2   1 
ATOM   2281 C  CE1   . PHE A 1  309 ? -10.375 -18.672 -14.764 1.00 31.24 ? 447 PHE A CE1   1 
ATOM   2282 C  CE2   . PHE A 1  309 ? -8.721  -20.233 -15.479 1.00 32.89 ? 447 PHE A CE2   1 
ATOM   2283 C  CZ    . PHE A 1  309 ? -9.947  -19.971 -14.905 1.00 34.94 ? 447 PHE A CZ    1 
ATOM   2284 N  N     . SER A 1  310 ? -9.624  -14.869 -17.381 1.00 24.46 ? 448 SER A N     1 
ATOM   2285 C  CA    . SER A 1  310 ? -11.010 -14.449 -17.509 1.00 26.62 ? 448 SER A CA    1 
ATOM   2286 C  C     . SER A 1  310 ? -11.462 -14.460 -18.965 1.00 29.58 ? 448 SER A C     1 
ATOM   2287 O  O     . SER A 1  310 ? -12.496 -15.047 -19.305 1.00 28.78 ? 448 SER A O     1 
ATOM   2288 C  CB    . SER A 1  310 ? -11.170 -13.054 -16.902 1.00 24.70 ? 448 SER A CB    1 
ATOM   2289 O  OG    . SER A 1  310 ? -12.524 -12.653 -16.916 1.00 32.22 ? 448 SER A OG    1 
ATOM   2290 N  N     . ARG A 1  311 ? -10.695 -13.810 -19.842 1.00 29.60 ? 449 ARG A N     1 
ATOM   2291 C  CA    . ARG A 1  311 ? -11.098 -13.695 -21.240 1.00 32.40 ? 449 ARG A CA    1 
ATOM   2292 C  C     . ARG A 1  311 ? -10.997 -15.033 -21.961 1.00 36.44 ? 449 ARG A C     1 
ATOM   2293 O  O     . ARG A 1  311 ? -11.962 -15.490 -22.585 1.00 36.65 ? 449 ARG A O     1 
ATOM   2294 C  CB    . ARG A 1  311 ? -10.238 -12.647 -21.947 1.00 32.57 ? 449 ARG A CB    1 
ATOM   2295 C  CG    . ARG A 1  311 ? -10.572 -12.464 -23.426 1.00 34.15 ? 449 ARG A CG    1 
ATOM   2296 C  CD    . ARG A 1  311 ? -9.738  -11.347 -24.050 1.00 35.66 ? 449 ARG A CD    1 
ATOM   2297 N  NE    . ARG A 1  311 ? -10.249 -10.027 -23.700 1.00 34.45 ? 449 ARG A NE    1 
ATOM   2298 C  CZ    . ARG A 1  311 ? -11.103 -9.325  -24.442 1.00 43.33 ? 449 ARG A CZ    1 
ATOM   2299 N  NH1   . ARG A 1  311 ? -11.559 -9.805  -25.592 1.00 47.07 ? 449 ARG A NH1   1 
ATOM   2300 N  NH2   . ARG A 1  311 ? -11.505 -8.131  -24.028 1.00 46.45 ? 449 ARG A NH2   1 
ATOM   2301 N  N     . LYS A 1  312 ? -9.834  -15.678 -21.888 1.00 32.18 ? 450 LYS A N     1 
ATOM   2302 C  CA    . LYS A 1  312 ? -9.570  -16.836 -22.733 1.00 35.60 ? 450 LYS A CA    1 
ATOM   2303 C  C     . LYS A 1  312 ? -10.268 -18.098 -22.241 1.00 34.85 ? 450 LYS A C     1 
ATOM   2304 O  O     . LYS A 1  312 ? -10.665 -18.934 -23.060 1.00 33.29 ? 450 LYS A O     1 
ATOM   2305 C  CB    . LYS A 1  312 ? -8.062  -17.076 -22.827 1.00 38.72 ? 450 LYS A CB    1 
ATOM   2306 C  CG    . LYS A 1  312 ? -7.267  -15.858 -23.296 1.00 44.27 ? 450 LYS A CG    1 
ATOM   2307 C  CD    . LYS A 1  312 ? -7.652  -15.433 -24.712 1.00 48.39 ? 450 LYS A CD    1 
ATOM   2308 C  CE    . LYS A 1  312 ? -6.855  -14.220 -25.171 1.00 49.98 ? 450 LYS A CE    1 
ATOM   2309 N  NZ    . LYS A 1  312 ? -7.191  -13.831 -26.573 1.00 52.41 ? 450 LYS A NZ    1 
ATOM   2310 N  N     . GLU A 1  313 ? -10.427 -18.268 -20.930 1.00 36.68 ? 451 GLU A N     1 
ATOM   2311 C  CA    . GLU A 1  313 ? -11.012 -19.493 -20.400 1.00 35.91 ? 451 GLU A CA    1 
ATOM   2312 C  C     . GLU A 1  313 ? -12.490 -19.355 -20.068 1.00 33.96 ? 451 GLU A C     1 
ATOM   2313 O  O     . GLU A 1  313 ? -13.238 -20.324 -20.220 1.00 33.78 ? 451 GLU A O     1 
ATOM   2314 C  CB    . GLU A 1  313 ? -10.257 -19.946 -19.144 1.00 34.46 ? 451 GLU A CB    1 
ATOM   2315 C  CG    . GLU A 1  313 ? -8.759  -20.156 -19.350 1.00 33.66 ? 451 GLU A CG    1 
ATOM   2316 C  CD    . GLU A 1  313 ? -8.446  -21.218 -20.385 1.00 37.80 ? 451 GLU A CD    1 
ATOM   2317 O  OE1   . GLU A 1  313 ? -9.196  -22.211 -20.471 1.00 38.69 ? 451 GLU A OE1   1 
ATOM   2318 O  OE2   . GLU A 1  313 ? -7.450  -21.050 -21.118 1.00 36.62 ? 451 GLU A OE2   1 
ATOM   2319 N  N     . LYS A 1  314 ? -12.929 -18.173 -19.633 1.00 31.83 ? 452 LYS A N     1 
ATOM   2320 C  CA    . LYS A 1  314 ? -14.308 -17.952 -19.225 1.00 33.34 ? 452 LYS A CA    1 
ATOM   2321 C  C     . LYS A 1  314 ? -15.075 -17.014 -20.145 1.00 33.27 ? 452 LYS A C     1 
ATOM   2322 O  O     . LYS A 1  314 ? -16.286 -16.856 -19.964 1.00 35.52 ? 452 LYS A O     1 
ATOM   2323 C  CB    . LYS A 1  314 ? -14.348 -17.390 -17.798 1.00 38.84 ? 452 LYS A CB    1 
ATOM   2324 C  CG    . LYS A 1  314 ? -13.623 -18.250 -16.777 1.00 38.33 ? 452 LYS A CG    1 
ATOM   2325 C  CD    . LYS A 1  314 ? -14.284 -19.615 -16.623 1.00 39.98 ? 452 LYS A CD    1 
ATOM   2326 C  CE    . LYS A 1  314 ? -13.495 -20.505 -15.681 1.00 43.20 ? 452 LYS A CE    1 
ATOM   2327 N  NZ    . LYS A 1  314 ? -14.203 -21.777 -15.398 1.00 49.48 ? 452 LYS A NZ    1 
ATOM   2328 N  N     . GLY A 1  315 ? -14.419 -16.395 -21.124 1.00 32.70 ? 453 GLY A N     1 
ATOM   2329 C  CA    . GLY A 1  315 ? -15.123 -15.497 -22.019 1.00 32.41 ? 453 GLY A CA    1 
ATOM   2330 C  C     . GLY A 1  315 ? -15.641 -14.236 -21.362 1.00 33.49 ? 453 GLY A C     1 
ATOM   2331 O  O     . GLY A 1  315 ? -16.591 -13.631 -21.867 1.00 31.95 ? 453 GLY A O     1 
ATOM   2332 N  N     . LEU A 1  316 ? -15.045 -13.825 -20.245 1.00 30.41 ? 454 LEU A N     1 
ATOM   2333 C  CA    . LEU A 1  316 ? -15.419 -12.608 -19.539 1.00 27.33 ? 454 LEU A CA    1 
ATOM   2334 C  C     . LEU A 1  316 ? -14.283 -11.593 -19.580 1.00 28.79 ? 454 LEU A C     1 
ATOM   2335 O  O     . LEU A 1  316 ? -13.101 -11.954 -19.563 1.00 28.91 ? 454 LEU A O     1 
ATOM   2336 C  CB    . LEU A 1  316 ? -15.778 -12.918 -18.086 1.00 28.75 ? 454 LEU A CB    1 
ATOM   2337 C  CG    . LEU A 1  316 ? -16.819 -14.023 -17.909 1.00 37.62 ? 454 LEU A CG    1 
ATOM   2338 C  CD1   . LEU A 1  316 ? -16.988 -14.345 -16.433 1.00 37.50 ? 454 LEU A CD1   1 
ATOM   2339 C  CD2   . LEU A 1  316 ? -18.163 -13.637 -18.545 1.00 35.71 ? 454 LEU A CD2   1 
ATOM   2340 N  N     . TRP A 1  317 ? -14.648 -10.310 -19.614 1.00 26.66 ? 455 TRP A N     1 
ATOM   2341 C  CA    . TRP A 1  317 ? -13.678 -9.228  -19.734 1.00 26.08 ? 455 TRP A CA    1 
ATOM   2342 C  C     . TRP A 1  317 ? -13.520 -8.545  -18.383 1.00 28.14 ? 455 TRP A C     1 
ATOM   2343 O  O     . TRP A 1  317 ? -14.479 -7.958  -17.861 1.00 27.21 ? 455 TRP A O     1 
ATOM   2344 C  CB    . TRP A 1  317 ? -14.118 -8.226  -20.799 1.00 28.51 ? 455 TRP A CB    1 
ATOM   2345 C  CG    . TRP A 1  317 ? -14.305 -8.845  -22.132 1.00 33.75 ? 455 TRP A CG    1 
ATOM   2346 C  CD1   . TRP A 1  317 ? -13.904 -10.093 -22.522 1.00 35.85 ? 455 TRP A CD1   1 
ATOM   2347 C  CD2   . TRP A 1  317 ? -14.954 -8.259  -23.264 1.00 38.91 ? 455 TRP A CD2   1 
ATOM   2348 N  NE1   . TRP A 1  317 ? -14.259 -10.316 -23.830 1.00 38.72 ? 455 TRP A NE1   1 
ATOM   2349 C  CE2   . TRP A 1  317 ? -14.906 -9.205  -24.309 1.00 40.01 ? 455 TRP A CE2   1 
ATOM   2350 C  CE3   . TRP A 1  317 ? -15.565 -7.024  -23.499 1.00 41.23 ? 455 TRP A CE3   1 
ATOM   2351 C  CZ2   . TRP A 1  317 ? -15.445 -8.954  -25.569 1.00 40.05 ? 455 TRP A CZ2   1 
ATOM   2352 C  CZ3   . TRP A 1  317 ? -16.102 -6.778  -24.754 1.00 43.83 ? 455 TRP A CZ3   1 
ATOM   2353 C  CH2   . TRP A 1  317 ? -16.036 -7.736  -25.770 1.00 41.48 ? 455 TRP A CH2   1 
ATOM   2354 N  N     . LEU A 1  318 ? -12.309 -8.612  -17.834 1.00 26.40 ? 456 LEU A N     1 
ATOM   2355 C  CA    . LEU A 1  318 ? -12.002 -8.128  -16.498 1.00 23.20 ? 456 LEU A CA    1 
ATOM   2356 C  C     . LEU A 1  318 ? -11.092 -6.907  -16.558 1.00 24.93 ? 456 LEU A C     1 
ATOM   2357 O  O     . LEU A 1  318 ? -10.096 -6.896  -17.287 1.00 25.64 ? 456 LEU A O     1 
ATOM   2358 C  CB    . LEU A 1  318 ? -11.311 -9.223  -15.677 1.00 22.97 ? 456 LEU A CB    1 
ATOM   2359 C  CG    . LEU A 1  318 ? -10.844 -8.817  -14.272 1.00 21.56 ? 456 LEU A CG    1 
ATOM   2360 C  CD1   . LEU A 1  318 ? -12.038 -8.499  -13.372 1.00 24.89 ? 456 LEU A CD1   1 
ATOM   2361 C  CD2   . LEU A 1  318 ? -9.998  -9.909  -13.657 1.00 24.90 ? 456 LEU A CD2   1 
ATOM   2362 N  N     . ASN A 1  319 ? -11.415 -5.900  -15.753 1.00 23.08 ? 457 ASN A N     1 
ATOM   2363 C  CA    . ASN A 1  319 ? -10.503 -4.790  -15.507 1.00 24.46 ? 457 ASN A CA    1 
ATOM   2364 C  C     . ASN A 1  319 ? -10.748 -4.303  -14.085 1.00 26.06 ? 457 ASN A C     1 
ATOM   2365 O  O     . ASN A 1  319 ? -11.471 -4.941  -13.315 1.00 25.43 ? 457 ASN A O     1 
ATOM   2366 C  CB    . ASN A 1  319 ? -10.671 -3.689  -16.561 1.00 28.98 ? 457 ASN A CB    1 
ATOM   2367 C  CG    . ASN A 1  319 ? -12.042 -3.041  -16.529 1.00 31.78 ? 457 ASN A CG    1 
ATOM   2368 O  OD1   . ASN A 1  319 ? -12.743 -3.082  -15.520 1.00 31.86 ? 457 ASN A OD1   1 
ATOM   2369 N  ND2   . ASN A 1  319 ? -12.423 -2.421  -17.643 1.00 36.38 ? 457 ASN A ND2   1 
ATOM   2370 N  N     . SER A 1  320 ? -10.123 -3.179  -13.723 1.00 25.91 ? 458 SER A N     1 
ATOM   2371 C  CA    . SER A 1  320 ? -10.228 -2.674  -12.358 1.00 24.97 ? 458 SER A CA    1 
ATOM   2372 C  C     . SER A 1  320 ? -11.533 -1.934  -12.099 1.00 24.08 ? 458 SER A C     1 
ATOM   2373 O  O     . SER A 1  320 ? -11.733 -1.442  -10.981 1.00 24.83 ? 458 SER A O     1 
ATOM   2374 C  CB    . SER A 1  320 ? -9.040  -1.759  -12.034 1.00 29.06 ? 458 SER A CB    1 
ATOM   2375 O  OG    . SER A 1  320 ? -9.112  -0.541  -12.750 1.00 33.66 ? 458 SER A OG    1 
ATOM   2376 N  N     . HIS A 1  321 ? -12.421 -1.859  -13.094 1.00 24.83 ? 459 HIS A N     1 
ATOM   2377 C  CA    . HIS A 1  321 ? -13.758 -1.295  -12.937 1.00 26.70 ? 459 HIS A CA    1 
ATOM   2378 C  C     . HIS A 1  321 ? -14.859 -2.345  -12.836 1.00 30.02 ? 459 HIS A C     1 
ATOM   2379 O  O     . HIS A 1  321 ? -15.921 -2.057  -12.273 1.00 30.90 ? 459 HIS A O     1 
ATOM   2380 C  CB    . HIS A 1  321 ? -14.100 -0.378  -14.121 1.00 33.16 ? 459 HIS A CB    1 
ATOM   2381 C  CG    . HIS A 1  321 ? -13.296 0.882   -14.170 1.00 38.79 ? 459 HIS A CG    1 
ATOM   2382 N  ND1   . HIS A 1  321 ? -11.952 0.896   -14.466 1.00 44.65 ? 459 HIS A ND1   1 
ATOM   2383 C  CD2   . HIS A 1  321 ? -13.649 2.174   -13.971 1.00 43.94 ? 459 HIS A CD2   1 
ATOM   2384 C  CE1   . HIS A 1  321 ? -11.508 2.140   -14.439 1.00 43.40 ? 459 HIS A CE1   1 
ATOM   2385 N  NE2   . HIS A 1  321 ? -12.520 2.935   -14.143 1.00 42.55 ? 459 HIS A NE2   1 
ATOM   2386 N  N     . GLY A 1  322 ? -14.666 -3.537  -13.389 1.00 26.41 ? 460 GLY A N     1 
ATOM   2387 C  CA    . GLY A 1  322 ? -15.733 -4.516  -13.369 1.00 31.23 ? 460 GLY A CA    1 
ATOM   2388 C  C     . GLY A 1  322 ? -15.383 -5.742  -14.185 1.00 33.40 ? 460 GLY A C     1 
ATOM   2389 O  O     . GLY A 1  322 ? -14.250 -5.909  -14.649 1.00 29.69 ? 460 GLY A O     1 
ATOM   2390 N  N     . LEU A 1  323 ? -16.390 -6.603  -14.335 1.00 30.96 ? 461 LEU A N     1 
ATOM   2391 C  CA    . LEU A 1  323 ? -16.275 -7.853  -15.076 1.00 31.16 ? 461 LEU A CA    1 
ATOM   2392 C  C     . LEU A 1  323 ? -17.487 -7.965  -15.985 1.00 30.90 ? 461 LEU A C     1 
ATOM   2393 O  O     . LEU A 1  323 ? -18.624 -7.994  -15.502 1.00 30.57 ? 461 LEU A O     1 
ATOM   2394 C  CB    . LEU A 1  323 ? -16.196 -9.053  -14.129 1.00 29.71 ? 461 LEU A CB    1 
ATOM   2395 C  CG    . LEU A 1  323 ? -16.170 -10.438 -14.778 1.00 26.26 ? 461 LEU A CG    1 
ATOM   2396 C  CD1   . LEU A 1  323 ? -14.884 -10.624 -15.565 1.00 24.26 ? 461 LEU A CD1   1 
ATOM   2397 C  CD2   . LEU A 1  323 ? -16.312 -11.508 -13.707 1.00 25.45 ? 461 LEU A CD2   1 
ATOM   2398 N  N     . PHE A 1  324 ? -17.240 -8.052  -17.287 1.00 30.97 ? 462 PHE A N     1 
ATOM   2399 C  CA    . PHE A 1  324 ? -18.257 -7.884  -18.315 1.00 32.69 ? 462 PHE A CA    1 
ATOM   2400 C  C     . PHE A 1  324 ? -18.479 -9.203  -19.040 1.00 32.39 ? 462 PHE A C     1 
ATOM   2401 O  O     . PHE A 1  324 ? -17.518 -9.858  -19.459 1.00 29.09 ? 462 PHE A O     1 
ATOM   2402 C  CB    . PHE A 1  324 ? -17.823 -6.786  -19.296 1.00 36.45 ? 462 PHE A CB    1 
ATOM   2403 C  CG    . PHE A 1  324 ? -18.844 -6.454  -20.360 1.00 37.09 ? 462 PHE A CG    1 
ATOM   2404 C  CD1   . PHE A 1  324 ? -19.999 -5.764  -20.045 1.00 36.97 ? 462 PHE A CD1   1 
ATOM   2405 C  CD2   . PHE A 1  324 ? -18.614 -6.796  -21.686 1.00 39.84 ? 462 PHE A CD2   1 
ATOM   2406 C  CE1   . PHE A 1  324 ? -20.925 -5.445  -21.027 1.00 36.25 ? 462 PHE A CE1   1 
ATOM   2407 C  CE2   . PHE A 1  324 ? -19.530 -6.477  -22.673 1.00 40.12 ? 462 PHE A CE2   1 
ATOM   2408 C  CZ    . PHE A 1  324 ? -20.688 -5.806  -22.343 1.00 38.63 ? 462 PHE A CZ    1 
ATOM   2409 N  N     . ASP A 1  325 ? -19.746 -9.602  -19.156 1.00 32.72 ? 463 ASP A N     1 
ATOM   2410 C  CA    . ASP A 1  325 ? -20.126 -10.727 -19.993 1.00 40.26 ? 463 ASP A CA    1 
ATOM   2411 C  C     . ASP A 1  325 ? -20.474 -10.169 -21.365 1.00 43.89 ? 463 ASP A C     1 
ATOM   2412 O  O     . ASP A 1  325 ? -21.490 -9.467  -21.495 1.00 40.94 ? 463 ASP A O     1 
ATOM   2413 C  CB    . ASP A 1  325 ? -21.310 -11.474 -19.398 1.00 42.92 ? 463 ASP A CB    1 
ATOM   2414 C  CG    . ASP A 1  325 ? -21.705 -12.700 -20.213 1.00 44.62 ? 463 ASP A CG    1 
ATOM   2415 O  OD1   . ASP A 1  325 ? -21.344 -12.781 -21.405 1.00 45.10 ? 463 ASP A OD1   1 
ATOM   2416 O  OD2   . ASP A 1  325 ? -22.381 -13.588 -19.656 1.00 46.14 ? 463 ASP A OD2   1 
ATOM   2417 N  N     . PRO A 1  326 ? -19.666 -10.417 -22.400 1.00 43.76 ? 464 PRO A N     1 
ATOM   2418 C  CA    . PRO A 1  326 ? -19.932 -9.800  -23.705 1.00 42.32 ? 464 PRO A CA    1 
ATOM   2419 C  C     . PRO A 1  326 ? -21.045 -10.468 -24.483 1.00 43.89 ? 464 PRO A C     1 
ATOM   2420 O  O     . PRO A 1  326 ? -21.492 -9.903  -25.491 1.00 43.46 ? 464 PRO A O     1 
ATOM   2421 C  CB    . PRO A 1  326 ? -18.590 -9.942  -24.431 1.00 45.78 ? 464 PRO A CB    1 
ATOM   2422 C  CG    . PRO A 1  326 ? -17.988 -11.175 -23.847 1.00 46.41 ? 464 PRO A CG    1 
ATOM   2423 C  CD    . PRO A 1  326 ? -18.430 -11.222 -22.410 1.00 42.98 ? 464 PRO A CD    1 
ATOM   2424 N  N     . GLU A 1  327 ? -21.497 -11.647 -24.059 1.00 49.56 ? 465 GLU A N     1 
ATOM   2425 C  CA    . GLU A 1  327 ? -22.640 -12.284 -24.700 1.00 54.81 ? 465 GLU A CA    1 
ATOM   2426 C  C     . GLU A 1  327 ? -23.946 -11.651 -24.233 1.00 60.82 ? 465 GLU A C     1 
ATOM   2427 O  O     . GLU A 1  327 ? -24.774 -11.237 -25.052 1.00 63.09 ? 465 GLU A O     1 
ATOM   2428 C  CB    . GLU A 1  327 ? -22.633 -13.786 -24.410 1.00 53.73 ? 465 GLU A CB    1 
ATOM   2429 C  CG    . GLU A 1  327 ? -21.421 -14.516 -24.968 1.00 54.69 ? 465 GLU A CG    1 
ATOM   2430 N  N     . GLN A 1  328 ? -24.138 -11.557 -22.918 1.00 54.64 ? 466 GLN A N     1 
ATOM   2431 C  CA    . GLN A 1  328 ? -25.341 -10.970 -22.349 1.00 56.56 ? 466 GLN A CA    1 
ATOM   2432 C  C     . GLN A 1  328 ? -25.266 -9.456  -22.213 1.00 52.65 ? 466 GLN A C     1 
ATOM   2433 O  O     . GLN A 1  328 ? -26.285 -8.830  -21.900 1.00 50.98 ? 466 GLN A O     1 
ATOM   2434 C  CB    . GLN A 1  328 ? -25.621 -11.580 -20.974 1.00 65.71 ? 466 GLN A CB    1 
ATOM   2435 C  CG    . GLN A 1  328 ? -25.710 -13.091 -20.987 1.00 76.14 ? 466 GLN A CG    1 
ATOM   2436 C  CD    . GLN A 1  328 ? -26.235 -13.654 -19.682 1.00 83.45 ? 466 GLN A CD    1 
ATOM   2437 O  OE1   . GLN A 1  328 ? -26.311 -12.950 -18.672 1.00 81.28 ? 466 GLN A OE1   1 
ATOM   2438 N  NE2   . GLN A 1  328 ? -26.610 -14.930 -19.700 1.00 86.62 ? 466 GLN A NE2   1 
ATOM   2439 N  N     . LYS A 1  329 ? -24.099 -8.851  -22.438 1.00 47.72 ? 467 LYS A N     1 
ATOM   2440 C  CA    . LYS A 1  329 ? -23.934 -7.406  -22.293 1.00 50.21 ? 467 LYS A CA    1 
ATOM   2441 C  C     . LYS A 1  329 ? -24.315 -6.958  -20.883 1.00 46.81 ? 467 LYS A C     1 
ATOM   2442 O  O     . LYS A 1  329 ? -25.087 -6.018  -20.693 1.00 48.12 ? 467 LYS A O     1 
ATOM   2443 C  CB    . LYS A 1  329 ? -24.751 -6.643  -23.343 1.00 56.45 ? 467 LYS A CB    1 
ATOM   2444 C  CG    . LYS A 1  329 ? -24.107 -6.549  -24.726 1.00 60.04 ? 467 LYS A CG    1 
ATOM   2445 C  CD    . LYS A 1  329 ? -24.351 -7.794  -25.557 1.00 61.87 ? 467 LYS A CD    1 
ATOM   2446 C  CE    . LYS A 1  329 ? -23.919 -7.591  -27.004 1.00 60.84 ? 467 LYS A CE    1 
ATOM   2447 N  N     . THR A 1  330 ? -23.759 -7.642  -19.884 1.00 47.17 ? 468 THR A N     1 
ATOM   2448 C  CA    . THR A 1  330 ? -24.050 -7.346  -18.488 1.00 41.66 ? 468 THR A CA    1 
ATOM   2449 C  C     . THR A 1  330 ? -22.764 -7.351  -17.679 1.00 33.73 ? 468 THR A C     1 
ATOM   2450 O  O     . THR A 1  330 ? -21.821 -8.083  -17.988 1.00 37.41 ? 468 THR A O     1 
ATOM   2451 C  CB    . THR A 1  330 ? -25.012 -8.365  -17.879 1.00 39.92 ? 468 THR A CB    1 
ATOM   2452 O  OG1   . THR A 1  330 ? -24.395 -9.654  -17.887 1.00 43.17 ? 468 THR A OG1   1 
ATOM   2453 C  CG2   . THR A 1  330 ? -26.310 -8.423  -18.661 1.00 43.23 ? 468 THR A CG2   1 
ATOM   2454 N  N     . PHE A 1  331 ? -22.742 -6.526  -16.637 1.00 33.58 ? 469 PHE A N     1 
ATOM   2455 C  CA    . PHE A 1  331 ? -21.631 -6.472  -15.697 1.00 33.80 ? 469 PHE A CA    1 
ATOM   2456 C  C     . PHE A 1  331 ? -21.992 -7.267  -14.452 1.00 33.13 ? 469 PHE A C     1 
ATOM   2457 O  O     . PHE A 1  331 ? -23.133 -7.220  -13.978 1.00 33.64 ? 469 PHE A O     1 
ATOM   2458 C  CB    . PHE A 1  331 ? -21.292 -5.030  -15.302 1.00 34.00 ? 469 PHE A CB    1 
ATOM   2459 C  CG    . PHE A 1  331 ? -20.665 -4.228  -16.403 1.00 40.77 ? 469 PHE A CG    1 
ATOM   2460 C  CD1   . PHE A 1  331 ? -21.452 -3.549  -17.319 1.00 44.11 ? 469 PHE A CD1   1 
ATOM   2461 C  CD2   . PHE A 1  331 ? -19.286 -4.146  -16.517 1.00 45.25 ? 469 PHE A CD2   1 
ATOM   2462 C  CE1   . PHE A 1  331 ? -20.873 -2.810  -18.335 1.00 45.02 ? 469 PHE A CE1   1 
ATOM   2463 C  CE2   . PHE A 1  331 ? -18.700 -3.405  -17.531 1.00 44.55 ? 469 PHE A CE2   1 
ATOM   2464 C  CZ    . PHE A 1  331 ? -19.496 -2.740  -18.441 1.00 45.24 ? 469 PHE A CZ    1 
ATOM   2465 N  N     A PHE A 1  332 ? -21.025 -8.017  -13.945 0.52 31.12 ? 470 PHE A N     1 
ATOM   2466 N  N     B PHE A 1  332 ? -21.015 -7.996  -13.927 0.48 31.17 ? 470 PHE A N     1 
ATOM   2467 C  CA    A PHE A 1  332 ? -21.207 -8.740  -12.700 0.52 31.15 ? 470 PHE A CA    1 
ATOM   2468 C  CA    B PHE A 1  332 ? -21.198 -8.761  -12.702 0.48 31.24 ? 470 PHE A CA    1 
ATOM   2469 C  C     A PHE A 1  332 ? -21.132 -7.770  -11.531 0.52 32.48 ? 470 PHE A C     1 
ATOM   2470 C  C     B PHE A 1  332 ? -21.080 -7.840  -11.494 0.48 32.60 ? 470 PHE A C     1 
ATOM   2471 O  O     A PHE A 1  332 ? -20.277 -6.882  -11.491 0.52 32.71 ? 470 PHE A O     1 
ATOM   2472 O  O     B PHE A 1  332 ? -20.133 -7.056  -11.388 0.48 33.13 ? 470 PHE A O     1 
ATOM   2473 C  CB    A PHE A 1  332 ? -20.145 -9.830  -12.556 0.52 32.07 ? 470 PHE A CB    1 
ATOM   2474 C  CB    B PHE A 1  332 ? -20.161 -9.883  -12.624 0.48 32.18 ? 470 PHE A CB    1 
ATOM   2475 C  CG    A PHE A 1  332 ? -20.260 -10.927 -13.580 0.52 33.07 ? 470 PHE A CG    1 
ATOM   2476 C  CG    B PHE A 1  332 ? -20.105 -10.572 -11.290 0.48 31.26 ? 470 PHE A CG    1 
ATOM   2477 C  CD1   A PHE A 1  332 ? -19.878 -10.712 -14.893 0.52 31.21 ? 470 PHE A CD1   1 
ATOM   2478 C  CD1   B PHE A 1  332 ? -21.185 -11.298 -10.825 0.48 32.76 ? 470 PHE A CD1   1 
ATOM   2479 C  CD2   A PHE A 1  332 ? -20.750 -12.172 -13.227 0.52 34.59 ? 470 PHE A CD2   1 
ATOM   2480 C  CD2   B PHE A 1  332 ? -18.964 -10.500 -10.507 0.48 29.80 ? 470 PHE A CD2   1 
ATOM   2481 C  CE1   A PHE A 1  332 ? -19.981 -11.710 -15.836 0.52 33.09 ? 470 PHE A CE1   1 
ATOM   2482 C  CE1   B PHE A 1  332 ? -21.135 -11.933 -9.598  0.48 34.11 ? 470 PHE A CE1   1 
ATOM   2483 C  CE2   A PHE A 1  332 ? -20.858 -13.183 -14.170 0.52 37.15 ? 470 PHE A CE2   1 
ATOM   2484 C  CE2   B PHE A 1  332 ? -18.905 -11.134 -9.281  0.48 29.80 ? 470 PHE A CE2   1 
ATOM   2485 C  CZ    A PHE A 1  332 ? -20.471 -12.949 -15.478 0.52 36.46 ? 470 PHE A CZ    1 
ATOM   2486 C  CZ    B PHE A 1  332 ? -19.993 -11.852 -8.825  0.48 33.19 ? 470 PHE A CZ    1 
ATOM   2487 N  N     . GLN A 1  333 ? -22.046 -7.930  -10.586 1.00 32.76 ? 471 GLN A N     1 
ATOM   2488 C  CA    . GLN A 1  333 ? -22.007 -7.157  -9.357  1.00 35.82 ? 471 GLN A CA    1 
ATOM   2489 C  C     . GLN A 1  333 ? -21.190 -7.941  -8.344  1.00 34.42 ? 471 GLN A C     1 
ATOM   2490 O  O     . GLN A 1  333 ? -21.396 -9.146  -8.165  1.00 41.93 ? 471 GLN A O     1 
ATOM   2491 C  CB    . GLN A 1  333 ? -23.416 -6.881  -8.830  1.00 42.13 ? 471 GLN A CB    1 
ATOM   2492 C  CG    . GLN A 1  333 ? -24.237 -5.962  -9.729  1.00 47.50 ? 471 GLN A CG    1 
ATOM   2493 C  CD    . GLN A 1  333 ? -23.613 -4.588  -9.888  1.00 45.27 ? 471 GLN A CD    1 
ATOM   2494 N  N     . ALA A 1  334 ? -20.234 -7.273  -7.723  1.00 28.18 ? 472 ALA A N     1 
ATOM   2495 C  CA    . ALA A 1  334 ? -19.391 -7.901  -6.720  1.00 25.98 ? 472 ALA A CA    1 
ATOM   2496 C  C     . ALA A 1  334 ? -19.424 -7.048  -5.467  1.00 26.73 ? 472 ALA A C     1 
ATOM   2497 O  O     . ALA A 1  334 ? -19.303 -5.822  -5.543  1.00 30.97 ? 472 ALA A O     1 
ATOM   2498 C  CB    . ALA A 1  334 ? -17.955 -8.067  -7.217  1.00 31.28 ? 472 ALA A CB    1 
ATOM   2499 N  N     . ALA A 1  335 ? -19.627 -7.698  -4.325  1.00 24.15 ? 473 ALA A N     1 
ATOM   2500 C  CA    . ALA A 1  335 ? -19.498 -7.050  -3.033  1.00 28.55 ? 473 ALA A CA    1 
ATOM   2501 C  C     . ALA A 1  335 ? -18.152 -7.308  -2.376  1.00 27.40 ? 473 ALA A C     1 
ATOM   2502 O  O     . ALA A 1  335 ? -17.880 -6.721  -1.322  1.00 23.46 ? 473 ALA A O     1 
ATOM   2503 C  CB    . ALA A 1  335 ? -20.614 -7.520  -2.093  1.00 29.76 ? 473 ALA A CB    1 
ATOM   2504 N  N     . SER A 1  336 ? -17.314 -8.161  -2.971  1.00 29.46 ? 474 SER A N     1 
ATOM   2505 C  CA    . SER A 1  336 ? -16.043 -8.547  -2.373  1.00 26.10 ? 474 SER A CA    1 
ATOM   2506 C  C     . SER A 1  336 ? -15.142 -9.163  -3.435  1.00 24.95 ? 474 SER A C     1 
ATOM   2507 O  O     . SER A 1  336 ? -15.593 -9.573  -4.509  1.00 22.43 ? 474 SER A O     1 
ATOM   2508 C  CB    . SER A 1  336 ? -16.244 -9.552  -1.234  1.00 23.34 ? 474 SER A CB    1 
ATOM   2509 O  OG    . SER A 1  336 ? -16.811 -10.755 -1.747  1.00 23.90 ? 474 SER A OG    1 
ATOM   2510 N  N     . GLU A 1  337 ? -13.853 -9.241  -3.104  1.00 21.73 ? 475 GLU A N     1 
ATOM   2511 C  CA    . GLU A 1  337 ? -12.929 -10.008 -3.928  1.00 22.13 ? 475 GLU A CA    1 
ATOM   2512 C  C     . GLU A 1  337 ? -13.370 -11.456 -4.022  1.00 25.76 ? 475 GLU A C     1 
ATOM   2513 O  O     . GLU A 1  337 ? -13.265 -12.079 -5.088  1.00 22.15 ? 475 GLU A O     1 
ATOM   2514 C  CB    . GLU A 1  337 ? -11.513 -9.926  -3.353  1.00 23.46 ? 475 GLU A CB    1 
ATOM   2515 C  CG    . GLU A 1  337 ? -10.880 -8.557  -3.455  1.00 21.15 ? 475 GLU A CG    1 
ATOM   2516 C  CD    . GLU A 1  337 ? -9.436  -8.533  -2.958  1.00 21.55 ? 475 GLU A CD    1 
ATOM   2517 O  OE1   . GLU A 1  337 ? -9.124  -9.133  -1.903  1.00 20.40 ? 475 GLU A OE1   1 
ATOM   2518 O  OE2   . GLU A 1  337 ? -8.605  -7.919  -3.637  1.00 19.95 ? 475 GLU A OE2   1 
ATOM   2519 N  N     . GLU A 1  338 ? -13.853 -12.016 -2.909  1.00 23.53 ? 476 GLU A N     1 
ATOM   2520 C  CA    . GLU A 1  338 ? -14.325 -13.392 -2.924  1.00 23.48 ? 476 GLU A CA    1 
ATOM   2521 C  C     . GLU A 1  338 ? -15.375 -13.589 -4.009  1.00 24.99 ? 476 GLU A C     1 
ATOM   2522 O  O     . GLU A 1  338 ? -15.374 -14.608 -4.707  1.00 27.52 ? 476 GLU A O     1 
ATOM   2523 C  CB    . GLU A 1  338 ? -14.885 -13.780 -1.548  1.00 27.42 ? 476 GLU A CB    1 
ATOM   2524 C  CG    . GLU A 1  338 ? -13.826 -14.043 -0.474  1.00 25.61 ? 476 GLU A CG    1 
ATOM   2525 C  CD    . GLU A 1  338 ? -14.403 -14.724 0.764   1.00 32.16 ? 476 GLU A CD    1 
ATOM   2526 O  OE1   . GLU A 1  338 ? -14.334 -14.127 1.861   1.00 31.56 ? 476 GLU A OE1   1 
ATOM   2527 O  OE2   . GLU A 1  338 ? -14.929 -15.859 0.643   1.00 26.84 ? 476 GLU A OE2   1 
ATOM   2528 N  N     . ASP A 1  339 ? -16.287 -12.623 -4.157  1.00 23.92 ? 477 ASP A N     1 
ATOM   2529 C  CA    . ASP A 1  339 ? -17.298 -12.698 -5.213  1.00 24.40 ? 477 ASP A CA    1 
ATOM   2530 C  C     . ASP A 1  339 ? -16.652 -12.845 -6.583  1.00 24.05 ? 477 ASP A C     1 
ATOM   2531 O  O     . ASP A 1  339 ? -17.136 -13.606 -7.433  1.00 24.67 ? 477 ASP A O     1 
ATOM   2532 C  CB    . ASP A 1  339 ? -18.159 -11.439 -5.212  1.00 26.33 ? 477 ASP A CB    1 
ATOM   2533 C  CG    . ASP A 1  339 ? -19.468 -11.598 -4.474  1.00 29.00 ? 477 ASP A CG    1 
ATOM   2534 O  OD1   . ASP A 1  339 ? -19.821 -12.721 -4.052  1.00 27.88 ? 477 ASP A OD1   1 
ATOM   2535 O  OD2   . ASP A 1  339 ? -20.152 -10.560 -4.327  1.00 28.86 ? 477 ASP A OD2   1 
ATOM   2536 N  N     . ILE A 1  340 ? -15.572 -12.102 -6.824  1.00 23.18 ? 478 ILE A N     1 
ATOM   2537 C  CA    . ILE A 1  340 ? -14.958 -12.077 -8.146  1.00 23.35 ? 478 ILE A CA    1 
ATOM   2538 C  C     . ILE A 1  340 ? -14.306 -13.416 -8.450  1.00 24.28 ? 478 ILE A C     1 
ATOM   2539 O  O     . ILE A 1  340 ? -14.495 -13.985 -9.530  1.00 26.73 ? 478 ILE A O     1 
ATOM   2540 C  CB    . ILE A 1  340 ? -13.943 -10.926 -8.247  1.00 22.63 ? 478 ILE A CB    1 
ATOM   2541 C  CG1   . ILE A 1  340 ? -14.632 -9.580  -7.978  1.00 23.71 ? 478 ILE A CG1   1 
ATOM   2542 C  CG2   . ILE A 1  340 ? -13.273 -10.939 -9.625  1.00 22.47 ? 478 ILE A CG2   1 
ATOM   2543 C  CD1   . ILE A 1  340 ? -13.672 -8.409  -7.754  1.00 21.18 ? 478 ILE A CD1   1 
ATOM   2544 N  N     . PHE A 1  341 ? -13.521 -13.939 -7.506  1.00 22.98 ? 479 PHE A N     1 
ATOM   2545 C  CA    . PHE A 1  341 ? -12.957 -15.272 -7.686  1.00 24.55 ? 479 PHE A CA    1 
ATOM   2546 C  C     . PHE A 1  341 ? -14.056 -16.292 -7.975  1.00 28.94 ? 479 PHE A C     1 
ATOM   2547 O  O     . PHE A 1  341 ? -13.923 -17.130 -8.877  1.00 24.93 ? 479 PHE A O     1 
ATOM   2548 C  CB    . PHE A 1  341 ? -12.148 -15.670 -6.448  1.00 23.24 ? 479 PHE A CB    1 
ATOM   2549 C  CG    . PHE A 1  341 ? -10.762 -15.082 -6.416  1.00 22.39 ? 479 PHE A CG    1 
ATOM   2550 C  CD1   . PHE A 1  341 ? -10.530 -13.841 -5.850  1.00 21.75 ? 479 PHE A CD1   1 
ATOM   2551 C  CD2   . PHE A 1  341 ? -9.690  -15.781 -6.955  1.00 22.34 ? 479 PHE A CD2   1 
ATOM   2552 C  CE1   . PHE A 1  341 ? -9.245  -13.297 -5.822  1.00 22.43 ? 479 PHE A CE1   1 
ATOM   2553 C  CE2   . PHE A 1  341 ? -8.405  -15.246 -6.937  1.00 21.66 ? 479 PHE A CE2   1 
ATOM   2554 C  CZ    . PHE A 1  341 ? -8.183  -13.998 -6.373  1.00 21.03 ? 479 PHE A CZ    1 
ATOM   2555 N  N     . ARG A 1  342 ? -15.161 -16.226 -7.232  1.00 24.95 ? 480 ARG A N     1 
ATOM   2556 C  CA    . ARG A 1  342 ? -16.255 -17.168 -7.461  1.00 29.05 ? 480 ARG A CA    1 
ATOM   2557 C  C     . ARG A 1  342 ? -16.825 -17.022 -8.870  1.00 28.13 ? 480 ARG A C     1 
ATOM   2558 O  O     . ARG A 1  342 ? -17.051 -18.018 -9.566  1.00 27.92 ? 480 ARG A O     1 
ATOM   2559 C  CB    . ARG A 1  342 ? -17.348 -16.967 -6.413  1.00 29.75 ? 480 ARG A CB    1 
ATOM   2560 C  CG    . ARG A 1  342 ? -17.005 -17.568 -5.045  1.00 30.15 ? 480 ARG A CG    1 
ATOM   2561 C  CD    . ARG A 1  342 ? -18.236 -17.603 -4.134  1.00 34.82 ? 480 ARG A CD    1 
ATOM   2562 N  NE    . ARG A 1  342 ? -18.633 -16.268 -3.685  1.00 30.44 ? 480 ARG A NE    1 
ATOM   2563 C  CZ    . ARG A 1  342 ? -18.246 -15.705 -2.544  1.00 29.04 ? 480 ARG A CZ    1 
ATOM   2564 N  NH1   . ARG A 1  342 ? -17.437 -16.344 -1.713  1.00 28.59 ? 480 ARG A NH1   1 
ATOM   2565 N  NH2   . ARG A 1  342 ? -18.667 -14.486 -2.232  1.00 31.13 ? 480 ARG A NH2   1 
ATOM   2566 N  N     A HIS A 1  343 ? -17.073 -15.781 -9.297  0.52 29.81 ? 481 HIS A N     1 
ATOM   2567 N  N     B HIS A 1  343 ? -17.049 -15.791 -9.323  0.48 29.87 ? 481 HIS A N     1 
ATOM   2568 C  CA    A HIS A 1  343 ? -17.585 -15.535 -10.640 0.52 32.15 ? 481 HIS A CA    1 
ATOM   2569 C  CA    B HIS A 1  343 ? -17.638 -15.623 -10.643 0.48 32.19 ? 481 HIS A CA    1 
ATOM   2570 C  C     A HIS A 1  343 ? -16.709 -16.200 -11.692 0.52 34.27 ? 481 HIS A C     1 
ATOM   2571 C  C     B HIS A 1  343 ? -16.694 -16.068 -11.756 0.48 34.09 ? 481 HIS A C     1 
ATOM   2572 O  O     A HIS A 1  343 ? -17.210 -16.707 -12.702 0.52 32.37 ? 481 HIS A O     1 
ATOM   2573 O  O     B HIS A 1  343 ? -17.150 -16.294 -12.882 0.48 32.36 ? 481 HIS A O     1 
ATOM   2574 C  CB    A HIS A 1  343 ? -17.663 -14.029 -10.901 0.52 33.28 ? 481 HIS A CB    1 
ATOM   2575 C  CB    B HIS A 1  343 ? -18.056 -14.172 -10.859 0.48 33.90 ? 481 HIS A CB    1 
ATOM   2576 C  CG    A HIS A 1  343 ? -18.745 -13.331 -10.135 0.52 33.83 ? 481 HIS A CG    1 
ATOM   2577 C  CG    B HIS A 1  343 ? -19.094 -14.005 -11.923 0.48 35.17 ? 481 HIS A CG    1 
ATOM   2578 N  ND1   A HIS A 1  343 ? -19.894 -13.968 -9.718  0.52 35.04 ? 481 HIS A ND1   1 
ATOM   2579 N  ND1   B HIS A 1  343 ? -18.825 -13.417 -13.140 0.48 37.03 ? 481 HIS A ND1   1 
ATOM   2580 C  CD2   A HIS A 1  343 ? -18.855 -12.047 -9.717  0.52 31.39 ? 481 HIS A CD2   1 
ATOM   2581 C  CD2   B HIS A 1  343 ? -20.397 -14.370 -11.962 0.48 35.63 ? 481 HIS A CD2   1 
ATOM   2582 C  CE1   A HIS A 1  343 ? -20.663 -13.109 -9.075  0.52 35.32 ? 481 HIS A CE1   1 
ATOM   2583 C  CE1   B HIS A 1  343 ? -19.918 -13.420 -13.880 0.48 35.46 ? 481 HIS A CE1   1 
ATOM   2584 N  NE2   A HIS A 1  343 ? -20.056 -11.936 -9.059  0.52 34.36 ? 481 HIS A NE2   1 
ATOM   2585 N  NE2   B HIS A 1  343 ? -20.887 -13.991 -13.188 0.48 36.98 ? 481 HIS A NE2   1 
ATOM   2586 N  N     . LEU A 1  344 ? -15.398 -16.206 -11.469 1.00 32.15 ? 482 LEU A N     1 
ATOM   2587 C  CA    . LEU A 1  344 ? -14.434 -16.720 -12.433 1.00 29.74 ? 482 LEU A CA    1 
ATOM   2588 C  C     . LEU A 1  344 ? -14.146 -18.209 -12.262 1.00 32.10 ? 482 LEU A C     1 
ATOM   2589 O  O     . LEU A 1  344 ? -13.292 -18.741 -12.976 1.00 34.03 ? 482 LEU A O     1 
ATOM   2590 C  CB    . LEU A 1  344 ? -13.119 -15.933 -12.331 1.00 26.00 ? 482 LEU A CB    1 
ATOM   2591 C  CG    . LEU A 1  344 ? -13.182 -14.436 -12.666 1.00 23.86 ? 482 LEU A CG    1 
ATOM   2592 C  CD1   . LEU A 1  344 ? -11.866 -13.754 -12.394 1.00 26.53 ? 482 LEU A CD1   1 
ATOM   2593 C  CD2   . LEU A 1  344 ? -13.566 -14.231 -14.108 1.00 25.69 ? 482 LEU A CD2   1 
ATOM   2594 N  N     . GLY A 1  345 ? -14.821 -18.895 -11.340 1.00 28.60 ? 483 GLY A N     1 
ATOM   2595 C  CA    . GLY A 1  345 ? -14.534 -20.306 -11.123 1.00 28.92 ? 483 GLY A CA    1 
ATOM   2596 C  C     . GLY A 1  345 ? -13.161 -20.603 -10.553 1.00 29.46 ? 483 GLY A C     1 
ATOM   2597 O  O     . GLY A 1  345 ? -12.649 -21.708 -10.740 1.00 30.57 ? 483 GLY A O     1 
ATOM   2598 N  N     . LEU A 1  346 ? -12.550 -19.647 -9.859  1.00 26.00 ? 484 LEU A N     1 
ATOM   2599 C  CA    . LEU A 1  346 ? -11.240 -19.813 -9.247  1.00 27.00 ? 484 LEU A CA    1 
ATOM   2600 C  C     . LEU A 1  346 ? -11.381 -19.946 -7.737  1.00 29.13 ? 484 LEU A C     1 
ATOM   2601 O  O     . LEU A 1  346 ? -12.213 -19.270 -7.124  1.00 29.32 ? 484 LEU A O     1 
ATOM   2602 C  CB    . LEU A 1  346 ? -10.335 -18.613 -9.561  1.00 25.96 ? 484 LEU A CB    1 
ATOM   2603 C  CG    . LEU A 1  346 ? -9.928  -18.408 -11.020 1.00 25.27 ? 484 LEU A CG    1 
ATOM   2604 C  CD1   . LEU A 1  346 ? -9.344  -17.021 -11.248 1.00 23.53 ? 484 LEU A CD1   1 
ATOM   2605 C  CD2   . LEU A 1  346 ? -8.927  -19.484 -11.410 1.00 28.94 ? 484 LEU A CD2   1 
ATOM   2606 N  N     . GLU A 1  347 ? -10.552 -20.799 -7.136  1.00 25.98 ? 485 GLU A N     1 
ATOM   2607 C  CA    . GLU A 1  347 ? -10.447 -20.824 -5.683  1.00 33.53 ? 485 GLU A CA    1 
ATOM   2608 C  C     . GLU A 1  347 ? -9.891  -19.495 -5.188  1.00 26.08 ? 485 GLU A C     1 
ATOM   2609 O  O     . GLU A 1  347 ? -8.980  -18.922 -5.790  1.00 23.99 ? 485 GLU A O     1 
ATOM   2610 C  CB    . GLU A 1  347 ? -9.543  -21.968 -5.219  1.00 44.53 ? 485 GLU A CB    1 
ATOM   2611 C  CG    . GLU A 1  347 ? -10.090 -23.360 -5.487  1.00 59.79 ? 485 GLU A CG    1 
ATOM   2612 C  CD    . GLU A 1  347 ? -9.189  -24.453 -4.925  1.00 73.63 ? 485 GLU A CD    1 
ATOM   2613 O  OE1   . GLU A 1  347 ? -8.614  -24.251 -3.833  1.00 76.71 ? 485 GLU A OE1   1 
ATOM   2614 O  OE2   . GLU A 1  347 ? -9.049  -25.509 -5.579  1.00 77.94 ? 485 GLU A OE2   1 
ATOM   2615 N  N     . TYR A 1  348 ? -10.454 -19.001 -4.091  1.00 30.25 ? 486 TYR A N     1 
ATOM   2616 C  CA    . TYR A 1  348 ? -10.034 -17.718 -3.552  1.00 28.79 ? 486 TYR A CA    1 
ATOM   2617 C  C     . TYR A 1  348 ? -8.573  -17.762 -3.132  1.00 28.30 ? 486 TYR A C     1 
ATOM   2618 O  O     . TYR A 1  348 ? -8.101  -18.746 -2.556  1.00 25.26 ? 486 TYR A O     1 
ATOM   2619 C  CB    . TYR A 1  348 ? -10.895 -17.332 -2.353  1.00 29.66 ? 486 TYR A CB    1 
ATOM   2620 C  CG    . TYR A 1  348 ? -10.459 -16.028 -1.724  1.00 27.15 ? 486 TYR A CG    1 
ATOM   2621 C  CD1   . TYR A 1  348 ? -10.732 -14.819 -2.340  1.00 26.34 ? 486 TYR A CD1   1 
ATOM   2622 C  CD2   . TYR A 1  348 ? -9.756  -16.010 -0.528  1.00 27.04 ? 486 TYR A CD2   1 
ATOM   2623 C  CE1   . TYR A 1  348 ? -10.328 -13.630 -1.783  1.00 31.30 ? 486 TYR A CE1   1 
ATOM   2624 C  CE2   . TYR A 1  348 ? -9.350  -14.822 0.045   1.00 27.75 ? 486 TYR A CE2   1 
ATOM   2625 C  CZ    . TYR A 1  348 ? -9.642  -13.633 -0.587  1.00 32.10 ? 486 TYR A CZ    1 
ATOM   2626 O  OH    . TYR A 1  348 ? -9.240  -12.439 -0.031  1.00 32.75 ? 486 TYR A OH    1 
ATOM   2627 N  N     . LEU A 1  349 ? -7.861  -16.679 -3.418  1.00 23.31 ? 487 LEU A N     1 
ATOM   2628 C  CA    . LEU A 1  349 ? -6.483  -16.503 -2.985  1.00 23.34 ? 487 LEU A CA    1 
ATOM   2629 C  C     . LEU A 1  349 ? -6.400  -15.215 -2.183  1.00 25.41 ? 487 LEU A C     1 
ATOM   2630 O  O     . LEU A 1  349 ? -6.780  -14.150 -2.698  1.00 21.20 ? 487 LEU A O     1 
ATOM   2631 C  CB    . LEU A 1  349 ? -5.530  -16.446 -4.182  1.00 23.11 ? 487 LEU A CB    1 
ATOM   2632 C  CG    . LEU A 1  349 ? -5.344  -17.768 -4.928  1.00 24.67 ? 487 LEU A CG    1 
ATOM   2633 C  CD1   . LEU A 1  349 ? -4.522  -17.568 -6.180  1.00 25.81 ? 487 LEU A CD1   1 
ATOM   2634 C  CD2   . LEU A 1  349 ? -4.686  -18.808 -4.021  1.00 26.39 ? 487 LEU A CD2   1 
ATOM   2635 N  N     . PRO A 1  350 ? -5.938  -15.238 -0.941  1.00 25.40 ? 488 PRO A N     1 
ATOM   2636 C  CA    . PRO A 1  350 ? -5.740  -13.994 -0.229  1.00 24.41 ? 488 PRO A CA    1 
ATOM   2637 C  C     . PRO A 1  350 ? -4.600  -13.207 -0.850  1.00 23.03 ? 488 PRO A C     1 
ATOM   2638 O  O     . PRO A 1  350 ? -3.777  -13.769 -1.588  1.00 20.75 ? 488 PRO A O     1 
ATOM   2639 C  CB    . PRO A 1  350 ? -5.404  -14.450 1.197   1.00 27.22 ? 488 PRO A CB    1 
ATOM   2640 C  CG    . PRO A 1  350 ? -4.791  -15.793 1.015   1.00 30.81 ? 488 PRO A CG    1 
ATOM   2641 C  CD    . PRO A 1  350 ? -5.514  -16.405 -0.147  1.00 26.90 ? 488 PRO A CD    1 
ATOM   2642 N  N     . PRO A 1  351 ? -4.517  -11.908 -0.573  1.00 21.58 ? 489 PRO A N     1 
ATOM   2643 C  CA    . PRO A 1  351 ? -3.458  -11.082 -1.187  1.00 23.14 ? 489 PRO A CA    1 
ATOM   2644 C  C     . PRO A 1  351 ? -2.057  -11.636 -1.004  1.00 19.95 ? 489 PRO A C     1 
ATOM   2645 O  O     . PRO A 1  351 ? -1.218  -11.509 -1.909  1.00 21.45 ? 489 PRO A O     1 
ATOM   2646 C  CB    . PRO A 1  351 ? -3.628  -9.737  -0.474  1.00 24.06 ? 489 PRO A CB    1 
ATOM   2647 C  CG    . PRO A 1  351 ? -5.051  -9.697  -0.070  1.00 29.10 ? 489 PRO A CG    1 
ATOM   2648 C  CD    . PRO A 1  351 ? -5.396  -11.118 0.303   1.00 26.43 ? 489 PRO A CD    1 
ATOM   2649 N  N     . GLU A 1  352 ? -1.786  -12.274 0.134   1.00 21.22 ? 490 GLU A N     1 
ATOM   2650 C  CA    A GLU A 1  352 ? -0.444  -12.776 0.396   0.49 25.03 ? 490 GLU A CA    1 
ATOM   2651 C  CA    B GLU A 1  352 ? -0.469  -12.818 0.441   0.51 25.20 ? 490 GLU A CA    1 
ATOM   2652 C  C     . GLU A 1  352 ? -0.091  -13.991 -0.456  1.00 22.10 ? 490 GLU A C     1 
ATOM   2653 O  O     . GLU A 1  352 ? 1.078   -14.381 -0.483  1.00 24.20 ? 490 GLU A O     1 
ATOM   2654 C  CB    A GLU A 1  352 ? -0.286  -13.106 1.887   0.49 26.87 ? 490 GLU A CB    1 
ATOM   2655 C  CB    B GLU A 1  352 ? -0.422  -13.258 1.910   0.51 26.94 ? 490 GLU A CB    1 
ATOM   2656 C  CG    A GLU A 1  352 ? -1.084  -14.307 2.386   0.49 29.76 ? 490 GLU A CG    1 
ATOM   2657 C  CG    B GLU A 1  352 ? -0.635  -12.141 2.926   0.51 28.28 ? 490 GLU A CG    1 
ATOM   2658 C  CD    A GLU A 1  352 ? -2.425  -13.935 2.983   0.49 29.51 ? 490 GLU A CD    1 
ATOM   2659 C  CD    B GLU A 1  352 ? -2.091  -11.736 3.089   0.51 29.66 ? 490 GLU A CD    1 
ATOM   2660 O  OE1   A GLU A 1  352 ? -2.895  -12.799 2.750   0.49 26.72 ? 490 GLU A OE1   1 
ATOM   2661 O  OE1   B GLU A 1  352 ? -2.963  -12.309 2.400   0.51 26.33 ? 490 GLU A OE1   1 
ATOM   2662 O  OE2   A GLU A 1  352 ? -3.011  -14.795 3.685   0.49 26.33 ? 490 GLU A OE2   1 
ATOM   2663 O  OE2   B GLU A 1  352 ? -2.360  -10.838 3.914   0.51 31.72 ? 490 GLU A OE2   1 
ATOM   2664 N  N     . GLN A 1  353 ? -1.050  -14.574 -1.171  1.00 20.95 ? 491 GLN A N     1 
ATOM   2665 C  CA    . GLN A 1  353 ? -0.786  -15.656 -2.109  1.00 24.87 ? 491 GLN A CA    1 
ATOM   2666 C  C     . GLN A 1  353 ? -0.924  -15.210 -3.555  1.00 23.31 ? 491 GLN A C     1 
ATOM   2667 O  O     . GLN A 1  353 ? -1.034  -16.057 -4.450  1.00 22.33 ? 491 GLN A O     1 
ATOM   2668 C  CB    . GLN A 1  353 ? -1.728  -16.827 -1.836  1.00 25.22 ? 491 GLN A CB    1 
ATOM   2669 C  CG    . GLN A 1  353 ? -1.607  -17.365 -0.425  1.00 28.51 ? 491 GLN A CG    1 
ATOM   2670 C  CD    . GLN A 1  353 ? -0.216  -17.904 -0.136  1.00 28.27 ? 491 GLN A CD    1 
ATOM   2671 O  OE1   . GLN A 1  353 ? 0.496   -18.338 -1.043  1.00 28.35 ? 491 GLN A OE1   1 
ATOM   2672 N  NE2   . GLN A 1  353 ? 0.176   -17.878 1.128   1.00 29.81 ? 491 GLN A NE2   1 
ATOM   2673 N  N     . ARG A 1  354 ? -0.945  -13.902 -3.802  1.00 22.82 ? 492 ARG A N     1 
ATOM   2674 C  CA    . ARG A 1  354 ? -1.014  -13.354 -5.149  1.00 21.48 ? 492 ARG A CA    1 
ATOM   2675 C  C     . ARG A 1  354 ? 0.327   -12.770 -5.584  1.00 20.41 ? 492 ARG A C     1 
ATOM   2676 O  O     . ARG A 1  354 ? 0.374   -11.892 -6.455  1.00 21.22 ? 492 ARG A O     1 
ATOM   2677 C  CB    . ARG A 1  354 ? -2.114  -12.293 -5.232  1.00 22.52 ? 492 ARG A CB    1 
ATOM   2678 C  CG    . ARG A 1  354 ? -3.489  -12.768 -4.794  1.00 22.63 ? 492 ARG A CG    1 
ATOM   2679 C  CD    . ARG A 1  354 ? -4.514  -11.626 -4.892  1.00 21.41 ? 492 ARG A CD    1 
ATOM   2680 N  NE    . ARG A 1  354 ? -5.690  -11.901 -4.069  1.00 23.12 ? 492 ARG A NE    1 
ATOM   2681 C  CZ    . ARG A 1  354 ? -6.569  -10.987 -3.668  1.00 24.06 ? 492 ARG A CZ    1 
ATOM   2682 N  NH1   . ARG A 1  354 ? -6.422  -9.718  -4.007  1.00 20.44 ? 492 ARG A NH1   1 
ATOM   2683 N  NH2   . ARG A 1  354 ? -7.598  -11.345 -2.913  1.00 23.19 ? 492 ARG A NH2   1 
ATOM   2684 N  N     . ASN A 1  355 ? 1.418   -13.230 -4.983  1.00 20.27 ? 493 ASN A N     1 
ATOM   2685 C  CA    . ASN A 1  355 ? 2.750   -12.706 -5.284  1.00 25.04 ? 493 ASN A CA    1 
ATOM   2686 C  C     . ASN A 1  355 ? 3.374   -13.402 -6.488  1.00 29.56 ? 493 ASN A C     1 
ATOM   2687 O  O     . ASN A 1  355 ? 4.519   -13.852 -6.455  1.00 28.64 ? 493 ASN A O     1 
ATOM   2688 C  CB    . ASN A 1  355 ? 3.640   -12.832 -4.053  1.00 21.44 ? 493 ASN A CB    1 
ATOM   2689 C  CG    . ASN A 1  355 ? 3.276   -11.830 -2.982  1.00 25.87 ? 493 ASN A CG    1 
ATOM   2690 O  OD1   . ASN A 1  355 ? 3.463   -10.623 -3.155  1.00 24.77 ? 493 ASN A OD1   1 
ATOM   2691 N  ND2   . ASN A 1  355 ? 2.751   -12.321 -1.868  1.00 24.37 ? 493 ASN A ND2   1 
ATOM   2692 N  N     . ALA A 1  356 ? 2.613   -13.491 -7.571  1.00 23.86 ? 494 ALA A N     1 
ATOM   2693 C  CA    . ALA A 1  356 ? 3.116   -14.099 -8.796  1.00 27.92 ? 494 ALA A CA    1 
ATOM   2694 C  C     . ALA A 1  356 ? 4.223   -13.238 -9.381  1.00 31.83 ? 494 ALA A C     1 
ATOM   2695 O  O     . ALA A 1  356 ? 4.124   -12.003 -9.364  1.00 26.48 ? 494 ALA A O     1 
ATOM   2696 C  CB    . ALA A 1  356 ? 1.998   -14.282 -9.795  1.00 27.43 ? 494 ALA A CB    1 
ATOM   2697 O  OXT   . ALA A 1  356 ? 5.232   -13.766 -9.869  1.00 31.40 ? 494 ALA A OXT   1 
ATOM   2698 O  "O5'" . DC  B 2  1   ? 3.380   -18.817 -38.916 1.00 84.54 ? 1   DC  T "O5'" 1 
ATOM   2699 C  "C5'" . DC  B 2  1   ? 2.084   -18.955 -39.489 1.00 83.25 ? 1   DC  T "C5'" 1 
ATOM   2700 C  "C4'" . DC  B 2  1   ? 1.020   -19.011 -38.412 1.00 76.59 ? 1   DC  T "C4'" 1 
ATOM   2701 O  "O4'" . DC  B 2  1   ? 1.262   -20.135 -37.546 1.00 75.22 ? 1   DC  T "O4'" 1 
ATOM   2702 C  "C3'" . DC  B 2  1   ? 0.996   -17.802 -37.494 1.00 67.09 ? 1   DC  T "C3'" 1 
ATOM   2703 O  "O3'" . DC  B 2  1   ? 0.036   -16.881 -37.936 1.00 57.90 ? 1   DC  T "O3'" 1 
ATOM   2704 C  "C2'" . DC  B 2  1   ? 0.670   -18.366 -36.105 1.00 64.56 ? 1   DC  T "C2'" 1 
ATOM   2705 C  "C1'" . DC  B 2  1   ? 0.678   -19.878 -36.290 1.00 65.39 ? 1   DC  T "C1'" 1 
ATOM   2706 N  N1    . DC  B 2  1   ? 1.455   -20.612 -35.253 1.00 57.10 ? 1   DC  T N1    1 
ATOM   2707 C  C2    . DC  B 2  1   ? 0.847   -20.941 -34.040 1.00 49.39 ? 1   DC  T C2    1 
ATOM   2708 O  O2    . DC  B 2  1   ? -0.324  -20.605 -33.847 1.00 47.33 ? 1   DC  T O2    1 
ATOM   2709 N  N3    . DC  B 2  1   ? 1.558   -21.624 -33.114 1.00 39.33 ? 1   DC  T N3    1 
ATOM   2710 C  C4    . DC  B 2  1   ? 2.819   -21.975 -33.368 1.00 39.79 ? 1   DC  T C4    1 
ATOM   2711 N  N4    . DC  B 2  1   ? 3.481   -22.651 -32.424 1.00 39.04 ? 1   DC  T N4    1 
ATOM   2712 C  C5    . DC  B 2  1   ? 3.458   -21.647 -34.596 1.00 52.43 ? 1   DC  T C5    1 
ATOM   2713 C  C6    . DC  B 2  1   ? 2.745   -20.974 -35.502 1.00 56.36 ? 1   DC  T C6    1 
ATOM   2714 P  P     . DG  B 2  2   ? 0.147   -15.348 -37.493 1.00 74.07 ? 2   DG  T P     1 
ATOM   2715 O  OP1   . DG  B 2  2   ? -0.381  -14.521 -38.603 1.00 81.27 ? 2   DG  T OP1   1 
ATOM   2716 O  OP2   . DG  B 2  2   ? 1.509   -15.104 -36.962 1.00 68.89 ? 2   DG  T OP2   1 
ATOM   2717 O  "O5'" . DG  B 2  2   ? -0.861  -15.271 -36.270 1.00 69.57 ? 2   DG  T "O5'" 1 
ATOM   2718 C  "C5'" . DG  B 2  2   ? -2.098  -15.943 -36.344 1.00 59.37 ? 2   DG  T "C5'" 1 
ATOM   2719 C  "C4'" . DG  B 2  2   ? -2.870  -15.752 -35.067 1.00 47.82 ? 2   DG  T "C4'" 1 
ATOM   2720 O  "O4'" . DG  B 2  2   ? -2.292  -16.572 -34.019 1.00 41.04 ? 2   DG  T "O4'" 1 
ATOM   2721 C  "C3'" . DG  B 2  2   ? -2.840  -14.338 -34.525 1.00 47.03 ? 2   DG  T "C3'" 1 
ATOM   2722 O  "O3'" . DG  B 2  2   ? -4.025  -14.072 -33.821 1.00 48.89 ? 2   DG  T "O3'" 1 
ATOM   2723 C  "C2'" . DG  B 2  2   ? -1.598  -14.342 -33.633 1.00 44.27 ? 2   DG  T "C2'" 1 
ATOM   2724 C  "C1'" . DG  B 2  2   ? -1.587  -15.765 -33.084 1.00 40.33 ? 2   DG  T "C1'" 1 
ATOM   2725 N  N9    . DG  B 2  2   ? -0.261  -16.359 -32.911 1.00 38.20 ? 2   DG  T N9    1 
ATOM   2726 C  C8    . DG  B 2  2   ? 0.846   -16.184 -33.707 1.00 39.38 ? 2   DG  T C8    1 
ATOM   2727 N  N7    . DG  B 2  2   ? 1.878   -16.882 -33.321 1.00 37.10 ? 2   DG  T N7    1 
ATOM   2728 C  C5    . DG  B 2  2   ? 1.424   -17.573 -32.205 1.00 36.20 ? 2   DG  T C5    1 
ATOM   2729 C  C6    . DG  B 2  2   ? 2.096   -18.498 -31.369 1.00 35.46 ? 2   DG  T C6    1 
ATOM   2730 O  O6    . DG  B 2  2   ? 3.268   -18.900 -31.455 1.00 35.73 ? 2   DG  T O6    1 
ATOM   2731 N  N1    . DG  B 2  2   ? 1.266   -18.966 -30.351 1.00 35.95 ? 2   DG  T N1    1 
ATOM   2732 C  C2    . DG  B 2  2   ? -0.044  -18.589 -30.172 1.00 34.31 ? 2   DG  T C2    1 
ATOM   2733 N  N2    . DG  B 2  2   ? -0.691  -19.145 -29.141 1.00 34.87 ? 2   DG  T N2    1 
ATOM   2734 N  N3    . DG  B 2  2   ? -0.682  -17.734 -30.954 1.00 34.85 ? 2   DG  T N3    1 
ATOM   2735 C  C4    . DG  B 2  2   ? 0.109   -17.269 -31.946 1.00 36.34 ? 2   DG  T C4    1 
ATOM   2736 P  P     . DG  B 2  3   ? -4.192  -12.701 -33.012 1.00 49.50 ? 3   DG  T P     1 
ATOM   2737 O  OP1   . DG  B 2  3   ? -5.644  -12.428 -32.978 1.00 56.75 ? 3   DG  T OP1   1 
ATOM   2738 O  OP2   . DG  B 2  3   ? -3.213  -11.713 -33.525 1.00 49.38 ? 3   DG  T OP2   1 
ATOM   2739 O  "O5'" . DG  B 2  3   ? -3.714  -13.081 -31.549 1.00 41.82 ? 3   DG  T "O5'" 1 
ATOM   2740 C  "C5'" . DG  B 2  3   ? -4.458  -13.999 -30.795 1.00 37.89 ? 3   DG  T "C5'" 1 
ATOM   2741 C  "C4'" . DG  B 2  3   ? -3.842  -14.159 -29.435 1.00 34.34 ? 3   DG  T "C4'" 1 
ATOM   2742 O  "O4'" . DG  B 2  3   ? -2.583  -14.842 -29.568 1.00 33.32 ? 3   DG  T "O4'" 1 
ATOM   2743 C  "C3'" . DG  B 2  3   ? -3.548  -12.837 -28.730 1.00 34.09 ? 3   DG  T "C3'" 1 
ATOM   2744 O  "O3'" . DG  B 2  3   ? -4.322  -12.744 -27.550 1.00 36.70 ? 3   DG  T "O3'" 1 
ATOM   2745 C  "C2'" . DG  B 2  3   ? -2.035  -12.861 -28.457 1.00 33.77 ? 3   DG  T "C2'" 1 
ATOM   2746 C  "C1'" . DG  B 2  3   ? -1.663  -14.326 -28.644 1.00 34.27 ? 3   DG  T "C1'" 1 
ATOM   2747 N  N9    . DG  B 2  3   ? -0.322  -14.562 -29.177 1.00 34.67 ? 3   DG  T N9    1 
ATOM   2748 C  C8    . DG  B 2  3   ? 0.219   -14.048 -30.335 1.00 32.59 ? 3   DG  T C8    1 
ATOM   2749 N  N7    . DG  B 2  3   ? 1.432   -14.468 -30.569 1.00 32.92 ? 3   DG  T N7    1 
ATOM   2750 C  C5    . DG  B 2  3   ? 1.704   -15.325 -29.510 1.00 32.09 ? 3   DG  T C5    1 
ATOM   2751 C  C6    . DG  B 2  3   ? 2.862   -16.080 -29.225 1.00 31.99 ? 3   DG  T C6    1 
ATOM   2752 O  O6    . DG  B 2  3   ? 3.918   -16.144 -29.876 1.00 32.73 ? 3   DG  T O6    1 
ATOM   2753 N  N1    . DG  B 2  3   ? 2.717   -16.822 -28.054 1.00 31.08 ? 3   DG  T N1    1 
ATOM   2754 C  C2    . DG  B 2  3   ? 1.601   -16.831 -27.266 1.00 30.34 ? 3   DG  T C2    1 
ATOM   2755 N  N2    . DG  B 2  3   ? 1.655   -17.602 -26.174 1.00 29.67 ? 3   DG  T N2    1 
ATOM   2756 N  N3    . DG  B 2  3   ? 0.510   -16.131 -27.519 1.00 30.36 ? 3   DG  T N3    1 
ATOM   2757 C  C4    . DG  B 2  3   ? 0.632   -15.404 -28.655 1.00 31.38 ? 3   DG  T C4    1 
ATOM   2758 P  P     . DC  B 2  4   ? -4.413  -11.365 -26.732 1.00 38.02 ? 4   DC  T P     1 
ATOM   2759 O  OP1   . DC  B 2  4   ? -5.672  -11.448 -25.963 1.00 40.00 ? 4   DC  T OP1   1 
ATOM   2760 O  OP2   . DC  B 2  4   ? -4.131  -10.221 -27.621 1.00 33.40 ? 4   DC  T OP2   1 
ATOM   2761 O  "O5'" . DC  B 2  4   ? -3.182  -11.455 -25.722 1.00 36.52 ? 4   DC  T "O5'" 1 
ATOM   2762 C  "C5'" . DC  B 2  4   ? -3.058  -12.571 -24.860 1.00 35.89 ? 4   DC  T "C5'" 1 
ATOM   2763 C  "C4'" . DC  B 2  4   ? -1.672  -12.616 -24.252 1.00 30.93 ? 4   DC  T "C4'" 1 
ATOM   2764 O  "O4'" . DC  B 2  4   ? -0.701  -13.002 -25.270 1.00 29.58 ? 4   DC  T "O4'" 1 
ATOM   2765 C  "C3'" . DC  B 2  4   ? -1.178  -11.270 -23.691 1.00 27.33 ? 4   DC  T "C3'" 1 
ATOM   2766 O  "O3'" . DC  B 2  4   ? -0.878  -11.378 -22.301 1.00 25.87 ? 4   DC  T "O3'" 1 
ATOM   2767 C  "C2'" . DC  B 2  4   ? 0.064   -10.951 -24.528 1.00 30.37 ? 4   DC  T "C2'" 1 
ATOM   2768 C  "C1'" . DC  B 2  4   ? 0.499   -12.337 -24.968 1.00 33.74 ? 4   DC  T "C1'" 1 
ATOM   2769 N  N1    . DC  B 2  4   ? 1.410   -12.382 -26.143 1.00 29.02 ? 4   DC  T N1    1 
ATOM   2770 C  C2    . DC  B 2  4   ? 2.454   -13.306 -26.144 1.00 28.00 ? 4   DC  T C2    1 
ATOM   2771 O  O2    . DC  B 2  4   ? 2.589   -14.052 -25.172 1.00 29.10 ? 4   DC  T O2    1 
ATOM   2772 N  N3    . DC  B 2  4   ? 3.289   -13.355 -27.205 1.00 29.03 ? 4   DC  T N3    1 
ATOM   2773 C  C4    . DC  B 2  4   ? 3.106   -12.534 -28.234 1.00 29.83 ? 4   DC  T C4    1 
ATOM   2774 N  N4    . DC  B 2  4   ? 3.954   -12.629 -29.261 1.00 34.55 ? 4   DC  T N4    1 
ATOM   2775 C  C5    . DC  B 2  4   ? 2.038   -11.587 -28.263 1.00 29.64 ? 4   DC  T C5    1 
ATOM   2776 C  C6    . DC  B 2  4   ? 1.221   -11.544 -27.206 1.00 28.58 ? 4   DC  T C6    1 
ATOM   2777 P  P     . DA  B 2  5   ? -0.824  -10.059 -21.384 1.00 25.70 ? 5   DA  T P     1 
ATOM   2778 O  OP1   . DA  B 2  5   ? -0.097  -8.980  -22.081 1.00 26.27 ? 5   DA  T OP1   1 
ATOM   2779 O  OP2   . DA  B 2  5   ? -0.360  -10.494 -20.051 1.00 23.45 ? 5   DA  T OP2   1 
ATOM   2780 O  "O5'" . DA  B 2  5   ? -2.358  -9.609  -21.268 1.00 27.26 ? 5   DA  T "O5'" 1 
ATOM   2781 C  "C5'" . DA  B 2  5   ? -3.286  -10.456 -20.623 1.00 26.42 ? 5   DA  T "C5'" 1 
ATOM   2782 C  "C4'" . DA  B 2  5   ? -4.475  -9.675  -20.116 1.00 26.22 ? 5   DA  T "C4'" 1 
ATOM   2783 O  "O4'" . DA  B 2  5   ? -4.034  -8.693  -19.140 1.00 22.17 ? 5   DA  T "O4'" 1 
ATOM   2784 C  "C3'" . DA  B 2  5   ? -5.228  -8.895  -21.178 1.00 29.73 ? 5   DA  T "C3'" 1 
ATOM   2785 O  "O3'" . DA  B 2  5   ? -6.623  -8.884  -20.870 1.00 28.09 ? 5   DA  T "O3'" 1 
ATOM   2786 C  "C2'" . DA  B 2  5   ? -4.583  -7.510  -21.121 1.00 25.87 ? 5   DA  T "C2'" 1 
ATOM   2787 C  "C1'" . DA  B 2  5   ? -4.185  -7.378  -19.655 1.00 29.73 ? 5   DA  T "C1'" 1 
ATOM   2788 N  N9    . DA  B 2  5   ? -2.929  -6.667  -19.419 1.00 28.03 ? 5   DA  T N9    1 
ATOM   2789 C  C8    . DA  B 2  5   ? -1.816  -6.635  -20.223 1.00 27.66 ? 5   DA  T C8    1 
ATOM   2790 N  N7    . DA  B 2  5   ? -0.825  -5.933  -19.723 1.00 28.14 ? 5   DA  T N7    1 
ATOM   2791 C  C5    . DA  B 2  5   ? -1.323  -5.481  -18.507 1.00 25.98 ? 5   DA  T C5    1 
ATOM   2792 C  C6    . DA  B 2  5   ? -0.764  -4.693  -17.485 1.00 24.05 ? 5   DA  T C6    1 
ATOM   2793 N  N6    . DA  B 2  5   ? 0.473   -4.183  -17.539 1.00 30.04 ? 5   DA  T N6    1 
ATOM   2794 N  N1    . DA  B 2  5   ? -1.529  -4.439  -16.403 1.00 27.72 ? 5   DA  T N1    1 
ATOM   2795 C  C2    . DA  B 2  5   ? -2.766  -4.946  -16.350 1.00 25.73 ? 5   DA  T C2    1 
ATOM   2796 N  N3    . DA  B 2  5   ? -3.397  -5.706  -17.242 1.00 21.49 ? 5   DA  T N3    1 
ATOM   2797 C  C4    . DA  B 2  5   ? -2.613  -5.936  -18.307 1.00 24.16 ? 5   DA  T C4    1 
ATOM   2798 P  P     . DT  B 2  6   ? -7.659  -8.074  -21.785 1.00 26.53 ? 6   DT  T P     1 
ATOM   2799 O  OP1   . DT  B 2  6   ? -8.981  -8.673  -21.481 1.00 24.88 ? 6   DT  T OP1   1 
ATOM   2800 O  OP2   . DT  B 2  6   ? -7.145  -7.971  -23.166 1.00 28.39 ? 6   DT  T OP2   1 
ATOM   2801 O  "O5'" . DT  B 2  6   ? -7.632  -6.613  -21.157 1.00 27.10 ? 6   DT  T "O5'" 1 
ATOM   2802 C  "C5'" . DT  B 2  6   ? -8.124  -6.416  -19.848 1.00 24.68 ? 6   DT  T "C5'" 1 
ATOM   2803 C  "C4'" . DT  B 2  6   ? -7.907  -4.991  -19.413 1.00 23.90 ? 6   DT  T "C4'" 1 
ATOM   2804 O  "O4'" . DT  B 2  6   ? -6.490  -4.769  -19.192 1.00 23.95 ? 6   DT  T "O4'" 1 
ATOM   2805 C  "C3'" . DT  B 2  6   ? -8.339  -3.928  -20.445 1.00 28.43 ? 6   DT  T "C3'" 1 
ATOM   2806 O  "O3'" . DT  B 2  6   ? -9.319  -3.065  -19.890 1.00 30.17 ? 6   DT  T "O3'" 1 
ATOM   2807 C  "C2'" . DT  B 2  6   ? -7.043  -3.191  -20.764 1.00 28.91 ? 6   DT  T "C2'" 1 
ATOM   2808 C  "C1'" . DT  B 2  6   ? -6.243  -3.431  -19.500 1.00 29.00 ? 6   DT  T "C1'" 1 
ATOM   2809 N  N1    . DT  B 2  6   ? -4.776  -3.168  -19.615 1.00 28.54 ? 6   DT  T N1    1 
ATOM   2810 C  C2    . DT  B 2  6   ? -4.136  -2.572  -18.554 1.00 30.21 ? 6   DT  T C2    1 
ATOM   2811 O  O2    . DT  B 2  6   ? -4.699  -2.291  -17.513 1.00 26.18 ? 6   DT  T O2    1 
ATOM   2812 N  N3    . DT  B 2  6   ? -2.805  -2.323  -18.748 1.00 31.32 ? 6   DT  T N3    1 
ATOM   2813 C  C4    . DT  B 2  6   ? -2.062  -2.603  -19.879 1.00 33.91 ? 6   DT  T C4    1 
ATOM   2814 O  O4    . DT  B 2  6   ? -0.864  -2.344  -19.955 1.00 35.23 ? 6   DT  T O4    1 
ATOM   2815 C  C5    . DT  B 2  6   ? -2.790  -3.225  -20.957 1.00 30.23 ? 6   DT  T C5    1 
ATOM   2816 C  C7    . DT  B 2  6   ? -2.090  -3.574  -22.233 1.00 31.54 ? 6   DT  T C7    1 
ATOM   2817 C  C6    . DT  B 2  6   ? -4.104  -3.468  -20.780 1.00 28.45 ? 6   DT  T C6    1 
ATOM   2818 P  P     . DA  B 2  7   ? -10.328 -2.241  -20.832 1.00 33.14 ? 7   DA  T P     1 
ATOM   2819 O  OP1   . DA  B 2  7   ? -11.596 -2.995  -20.890 1.00 37.74 ? 7   DA  T OP1   1 
ATOM   2820 O  OP2   . DA  B 2  7   ? -9.639  -1.881  -22.082 1.00 29.99 ? 7   DA  T OP2   1 
ATOM   2821 O  "O5'" . DA  B 2  7   ? -10.586 -0.901  -20.021 1.00 35.95 ? 7   DA  T "O5'" 1 
ATOM   2822 C  "C5'" . DA  B 2  7   ? -9.661  0.165   -20.097 1.00 36.58 ? 7   DA  T "C5'" 1 
ATOM   2823 C  "C4'" . DA  B 2  7   ? -9.057  0.456   -18.738 1.00 34.61 ? 7   DA  T "C4'" 1 
ATOM   2824 O  "O4'" . DA  B 2  7   ? -7.794  -0.237  -18.623 1.00 35.55 ? 7   DA  T "O4'" 1 
ATOM   2825 C  "C3'" . DA  B 2  7   ? -8.745  1.921   -18.491 1.00 35.59 ? 7   DA  T "C3'" 1 
ATOM   2826 O  "O3'" . DA  B 2  7   ? -9.848  2.562   -17.895 1.00 34.68 ? 7   DA  T "O3'" 1 
ATOM   2827 C  "C2'" . DA  B 2  7   ? -7.529  1.879   -17.570 1.00 35.73 ? 7   DA  T "C2'" 1 
ATOM   2828 C  "C1'" . DA  B 2  7   ? -6.872  0.535   -17.880 1.00 32.93 ? 7   DA  T "C1'" 1 
ATOM   2829 N  N9    . DA  B 2  7   ? -5.635  0.643   -18.653 1.00 32.15 ? 7   DA  T N9    1 
ATOM   2830 C  C8    . DA  B 2  7   ? -5.415  0.198   -19.926 1.00 33.14 ? 7   DA  T C8    1 
ATOM   2831 N  N7    . DA  B 2  7   ? -4.195  0.428   -20.364 1.00 33.15 ? 7   DA  T N7    1 
ATOM   2832 C  C5    . DA  B 2  7   ? -3.575  1.061   -19.300 1.00 31.10 ? 7   DA  T C5    1 
ATOM   2833 C  C6    . DA  B 2  7   ? -2.270  1.562   -19.123 1.00 33.14 ? 7   DA  T C6    1 
ATOM   2834 N  N6    . DA  B 2  7   ? -1.325  1.495   -20.057 1.00 34.27 ? 7   DA  T N6    1 
ATOM   2835 N  N1    . DA  B 2  7   ? -1.979  2.143   -17.945 1.00 34.14 ? 7   DA  T N1    1 
ATOM   2836 C  C2    . DA  B 2  7   ? -2.930  2.213   -17.009 1.00 35.35 ? 7   DA  T C2    1 
ATOM   2837 N  N3    . DA  B 2  7   ? -4.188  1.774   -17.056 1.00 31.26 ? 7   DA  T N3    1 
ATOM   2838 C  C4    . DA  B 2  7   ? -4.448  1.205   -18.240 1.00 31.41 ? 7   DA  T C4    1 
ATOM   2839 P  P     . DC  B 2  8   ? -10.182 4.101   -18.228 1.00 34.71 ? 8   DC  T P     1 
ATOM   2840 O  OP1   . DC  B 2  8   ? -11.492 4.375   -17.603 1.00 34.49 ? 8   DC  T OP1   1 
ATOM   2841 O  OP2   . DC  B 2  8   ? -9.958  4.330   -19.668 1.00 32.06 ? 8   DC  T OP2   1 
ATOM   2842 O  "O5'" . DC  B 2  8   ? -9.082  4.917   -17.408 1.00 31.35 ? 8   DC  T "O5'" 1 
ATOM   2843 C  "C5'" . DC  B 2  8   ? -8.995  4.763   -16.000 1.00 30.01 ? 8   DC  T "C5'" 1 
ATOM   2844 C  "C4'" . DC  B 2  8   ? -7.867  5.603   -15.434 1.00 29.29 ? 8   DC  T "C4'" 1 
ATOM   2845 O  "O4'" . DC  B 2  8   ? -6.611  5.139   -15.992 1.00 28.19 ? 8   DC  T "O4'" 1 
ATOM   2846 C  "C3'" . DC  B 2  8   ? -7.933  7.101   -15.760 1.00 27.86 ? 8   DC  T "C3'" 1 
ATOM   2847 O  "O3'" . DC  B 2  8   ? -7.415  7.862   -14.675 1.00 30.40 ? 8   DC  T "O3'" 1 
ATOM   2848 C  "C2'" . DC  B 2  8   ? -7.072  7.196   -17.001 1.00 29.49 ? 8   DC  T "C2'" 1 
ATOM   2849 C  "C1'" . DC  B 2  8   ? -5.970  6.200   -16.660 1.00 31.59 ? 8   DC  T "C1'" 1 
ATOM   2850 N  N1    . DC  B 2  8   ? -5.239  5.656   -17.836 1.00 33.79 ? 8   DC  T N1    1 
ATOM   2851 C  C2    . DC  B 2  8   ? -3.856  5.864   -17.945 1.00 33.31 ? 8   DC  T C2    1 
ATOM   2852 O  O2    . DC  B 2  8   ? -3.269  6.501   -17.057 1.00 29.50 ? 8   DC  T O2    1 
ATOM   2853 N  N3    . DC  B 2  8   ? -3.201  5.359   -19.018 1.00 29.94 ? 8   DC  T N3    1 
ATOM   2854 C  C4    . DC  B 2  8   ? -3.870  4.674   -19.951 1.00 28.53 ? 8   DC  T C4    1 
ATOM   2855 N  N4    . DC  B 2  8   ? -3.180  4.195   -20.993 1.00 30.15 ? 8   DC  T N4    1 
ATOM   2856 C  C5    . DC  B 2  8   ? -5.275  4.445   -19.851 1.00 31.48 ? 8   DC  T C5    1 
ATOM   2857 C  C6    . DC  B 2  8   ? -5.912  4.952   -18.789 1.00 34.43 ? 8   DC  T C6    1 
ATOM   2858 P  P     . DG  B 2  9   ? -7.178  9.450   -14.789 1.00 31.62 ? 9   DG  T P     1 
ATOM   2859 O  OP1   . DG  B 2  9   ? -7.255  9.952   -13.398 1.00 33.82 ? 9   DG  T OP1   1 
ATOM   2860 O  OP2   . DG  B 2  9   ? -8.063  10.028  -15.817 1.00 30.82 ? 9   DG  T OP2   1 
ATOM   2861 O  "O5'" . DG  B 2  9   ? -5.676  9.578   -15.349 1.00 32.62 ? 9   DG  T "O5'" 1 
ATOM   2862 C  "C5'" . DG  B 2  9   ? -4.570  9.292   -14.505 1.00 36.62 ? 9   DG  T "C5'" 1 
ATOM   2863 C  "C4'" . DG  B 2  9   ? -3.497  10.359  -14.633 1.00 35.11 ? 9   DG  T "C4'" 1 
ATOM   2864 O  "O4'" . DG  B 2  9   ? -2.641  10.070  -15.770 1.00 35.42 ? 9   DG  T "O4'" 1 
ATOM   2865 C  "C3'" . DG  B 2  9   ? -4.021  11.754  -14.884 1.00 39.10 ? 9   DG  T "C3'" 1 
ATOM   2866 O  "O3'" . DG  B 2  9   ? -3.132  12.711  -14.339 1.00 43.29 ? 9   DG  T "O3'" 1 
ATOM   2867 C  "C2'" . DG  B 2  9   ? -4.099  11.812  -16.410 1.00 39.16 ? 9   DG  T "C2'" 1 
ATOM   2868 C  "C1'" . DG  B 2  9   ? -2.889  10.990  -16.827 1.00 34.60 ? 9   DG  T "C1'" 1 
ATOM   2869 N  N9    . DG  B 2  9   ? -3.052  10.204  -18.042 1.00 34.98 ? 9   DG  T N9    1 
ATOM   2870 C  C8    . DG  B 2  9   ? -4.131  9.429   -18.396 1.00 34.79 ? 9   DG  T C8    1 
ATOM   2871 N  N7    . DG  B 2  9   ? -3.958  8.781   -19.516 1.00 34.01 ? 9   DG  T N7    1 
ATOM   2872 C  C5    . DG  B 2  9   ? -2.673  9.134   -19.918 1.00 32.80 ? 9   DG  T C5    1 
ATOM   2873 C  C6    . DG  B 2  9   ? -1.932  8.736   -21.054 1.00 32.58 ? 9   DG  T C6    1 
ATOM   2874 O  O6    . DG  B 2  9   ? -2.278  7.976   -21.967 1.00 32.98 ? 9   DG  T O6    1 
ATOM   2875 N  N1    . DG  B 2  9   ? -0.669  9.323   -21.078 1.00 32.29 ? 9   DG  T N1    1 
ATOM   2876 C  C2    . DG  B 2  9   ? -0.180  10.180  -20.120 1.00 32.21 ? 9   DG  T C2    1 
ATOM   2877 N  N2    . DG  B 2  9   ? 1.062   10.650  -20.321 1.00 31.34 ? 9   DG  T N2    1 
ATOM   2878 N  N3    . DG  B 2  9   ? -0.862  10.556  -19.046 1.00 31.34 ? 9   DG  T N3    1 
ATOM   2879 C  C4    . DG  B 2  9   ? -2.100  9.999   -19.015 1.00 33.39 ? 9   DG  T C4    1 
ATOM   2880 O  "O5'" . DC  C 3  1   ? 5.767   6.328   -26.546 1.00 48.75 ? 1   DC  P "O5'" 1 
ATOM   2881 C  "C5'" . DC  C 3  1   ? 6.599   7.463   -26.676 1.00 43.64 ? 1   DC  P "C5'" 1 
ATOM   2882 C  "C4'" . DC  C 3  1   ? 6.370   8.439   -25.536 1.00 42.24 ? 1   DC  P "C4'" 1 
ATOM   2883 O  "O4'" . DC  C 3  1   ? 5.089   9.119   -25.707 1.00 40.84 ? 1   DC  P "O4'" 1 
ATOM   2884 C  "C3'" . DC  C 3  1   ? 6.273   7.814   -24.156 1.00 41.85 ? 1   DC  P "C3'" 1 
ATOM   2885 O  "O3'" . DC  C 3  1   ? 7.550   7.523   -23.606 1.00 36.64 ? 1   DC  P "O3'" 1 
ATOM   2886 C  "C2'" . DC  C 3  1   ? 5.536   8.896   -23.388 1.00 40.99 ? 1   DC  P "C2'" 1 
ATOM   2887 C  "C1'" . DC  C 3  1   ? 4.526   9.380   -24.418 1.00 40.00 ? 1   DC  P "C1'" 1 
ATOM   2888 N  N1    . DC  C 3  1   ? 3.207   8.693   -24.290 1.00 36.28 ? 1   DC  P N1    1 
ATOM   2889 C  C2    . DC  C 3  1   ? 2.330   9.106   -23.288 1.00 36.59 ? 1   DC  P C2    1 
ATOM   2890 O  O2    . DC  C 3  1   ? 2.665   10.027  -22.545 1.00 38.11 ? 1   DC  P O2    1 
ATOM   2891 N  N3    . DC  C 3  1   ? 1.135   8.488   -23.159 1.00 39.10 ? 1   DC  P N3    1 
ATOM   2892 C  C4    . DC  C 3  1   ? 0.805   7.497   -23.982 1.00 37.05 ? 1   DC  P C4    1 
ATOM   2893 N  N4    . DC  C 3  1   ? -0.393  6.926   -23.813 1.00 32.39 ? 1   DC  P N4    1 
ATOM   2894 C  C5    . DC  C 3  1   ? 1.688   7.050   -25.012 1.00 36.25 ? 1   DC  P C5    1 
ATOM   2895 C  C6    . DC  C 3  1   ? 2.872   7.671   -25.128 1.00 35.74 ? 1   DC  P C6    1 
ATOM   2896 P  P     . DG  C 3  2   ? 7.694   6.376   -22.493 1.00 35.17 ? 2   DG  P P     1 
ATOM   2897 O  OP1   . DG  C 3  2   ? 9.136   6.288   -22.153 1.00 32.65 ? 2   DG  P OP1   1 
ATOM   2898 O  OP2   . DG  C 3  2   ? 6.983   5.171   -22.969 1.00 32.88 ? 2   DG  P OP2   1 
ATOM   2899 O  "O5'" . DG  C 3  2   ? 6.868   6.926   -21.235 1.00 30.62 ? 2   DG  P "O5'" 1 
ATOM   2900 C  "C5'" . DG  C 3  2   ? 7.371   8.017   -20.475 1.00 30.29 ? 2   DG  P "C5'" 1 
ATOM   2901 C  "C4'" . DG  C 3  2   ? 6.350   8.491   -19.469 1.00 28.43 ? 2   DG  P "C4'" 1 
ATOM   2902 O  "O4'" . DG  C 3  2   ? 5.107   8.831   -20.139 1.00 30.89 ? 2   DG  P "O4'" 1 
ATOM   2903 C  "C3'" . DG  C 3  2   ? 5.938   7.463   -18.434 1.00 29.63 ? 2   DG  P "C3'" 1 
ATOM   2904 O  "O3'" . DG  C 3  2   ? 6.902   7.343   -17.401 1.00 27.93 ? 2   DG  P "O3'" 1 
ATOM   2905 C  "C2'" . DG  C 3  2   ? 4.619   8.044   -17.959 1.00 34.28 ? 2   DG  P "C2'" 1 
ATOM   2906 C  "C1'" . DG  C 3  2   ? 4.013   8.537   -19.266 1.00 33.35 ? 2   DG  P "C1'" 1 
ATOM   2907 N  N9    . DG  C 3  2   ? 3.148   7.549   -19.902 1.00 29.29 ? 2   DG  P N9    1 
ATOM   2908 C  C8    . DG  C 3  2   ? 3.437   6.778   -21.000 1.00 32.17 ? 2   DG  P C8    1 
ATOM   2909 N  N7    . DG  C 3  2   ? 2.467   5.975   -21.338 1.00 30.78 ? 2   DG  P N7    1 
ATOM   2910 C  C5    . DG  C 3  2   ? 1.470   6.236   -20.404 1.00 29.39 ? 2   DG  P C5    1 
ATOM   2911 C  C6    . DG  C 3  2   ? 0.183   5.671   -20.263 1.00 31.88 ? 2   DG  P C6    1 
ATOM   2912 O  O6    . DG  C 3  2   ? -0.360  4.803   -20.970 1.00 30.20 ? 2   DG  P O6    1 
ATOM   2913 N  N1    . DG  C 3  2   ? -0.504  6.219   -19.178 1.00 29.77 ? 2   DG  P N1    1 
ATOM   2914 C  C2    . DG  C 3  2   ? -0.005  7.180   -18.341 1.00 30.99 ? 2   DG  P C2    1 
ATOM   2915 N  N2    . DG  C 3  2   ? -0.816  7.588   -17.358 1.00 29.10 ? 2   DG  P N2    1 
ATOM   2916 N  N3    . DG  C 3  2   ? 1.204   7.715   -18.459 1.00 28.75 ? 2   DG  P N3    1 
ATOM   2917 C  C4    . DG  C 3  2   ? 1.880   7.197   -19.510 1.00 28.26 ? 2   DG  P C4    1 
ATOM   2918 P  P     . DT  C 3  3   ? 6.889   6.054   -16.445 1.00 31.29 ? 3   DT  P P     1 
ATOM   2919 O  OP1   . DT  C 3  3   ? 7.913   6.295   -15.408 1.00 30.66 ? 3   DT  P OP1   1 
ATOM   2920 O  OP2   . DT  C 3  3   ? 6.940   4.845   -17.293 1.00 28.69 ? 3   DT  P OP2   1 
ATOM   2921 O  "O5'" . DT  C 3  3   ? 5.428   6.076   -15.790 1.00 25.76 ? 3   DT  P "O5'" 1 
ATOM   2922 C  "C5'" . DT  C 3  3   ? 5.071   7.102   -14.893 1.00 25.92 ? 3   DT  P "C5'" 1 
ATOM   2923 C  "C4'" . DT  C 3  3   ? 3.681   6.874   -14.352 1.00 24.58 ? 3   DT  P "C4'" 1 
ATOM   2924 O  "O4'" . DT  C 3  3   ? 2.703   6.947   -15.421 1.00 25.93 ? 3   DT  P "O4'" 1 
ATOM   2925 C  "C3'" . DT  C 3  3   ? 3.451   5.509   -13.751 1.00 22.02 ? 3   DT  P "C3'" 1 
ATOM   2926 O  "O3'" . DT  C 3  3   ? 3.976   5.415   -12.466 1.00 23.50 ? 3   DT  P "O3'" 1 
ATOM   2927 C  "C2'" . DT  C 3  3   ? 1.939   5.420   -13.783 1.00 23.46 ? 3   DT  P "C2'" 1 
ATOM   2928 C  "C1'" . DT  C 3  3   ? 1.638   6.029   -15.144 1.00 28.10 ? 3   DT  P "C1'" 1 
ATOM   2929 N  N1    . DT  C 3  3   ? 1.570   5.017   -16.232 1.00 30.80 ? 3   DT  P N1    1 
ATOM   2930 C  C2    . DT  C 3  3   ? 0.413   4.291   -16.398 1.00 30.45 ? 3   DT  P C2    1 
ATOM   2931 O  O2    . DT  C 3  3   ? -0.566  4.429   -15.694 1.00 30.28 ? 3   DT  P O2    1 
ATOM   2932 N  N3    . DT  C 3  3   ? 0.443   3.392   -17.424 1.00 25.94 ? 3   DT  P N3    1 
ATOM   2933 C  C4    . DT  C 3  3   ? 1.503   3.131   -18.272 1.00 30.25 ? 3   DT  P C4    1 
ATOM   2934 O  O4    . DT  C 3  3   ? 1.433   2.298   -19.167 1.00 32.29 ? 3   DT  P O4    1 
ATOM   2935 C  C5    . DT  C 3  3   ? 2.689   3.918   -18.039 1.00 29.03 ? 3   DT  P C5    1 
ATOM   2936 C  C7    . DT  C 3  3   ? 3.898   3.729   -18.900 1.00 31.17 ? 3   DT  P C7    1 
ATOM   2937 C  C6    . DT  C 3  3   ? 2.669   4.811   -17.039 1.00 30.77 ? 3   DT  P C6    1 
ATOM   2938 P  P     . DA  C 3  4   ? 4.292   3.956   -11.879 1.00 25.66 ? 4   DA  P P     1 
ATOM   2939 O  OP1   . DA  C 3  4   ? 4.830   4.160   -10.519 1.00 24.21 ? 4   DA  P OP1   1 
ATOM   2940 O  OP2   . DA  C 3  4   ? 5.091   3.226   -12.895 1.00 28.39 ? 4   DA  P OP2   1 
ATOM   2941 O  "O5'" . DA  C 3  4   ? 2.857   3.277   -11.811 1.00 23.90 ? 4   DA  P "O5'" 1 
ATOM   2942 C  "C5'" . DA  C 3  4   ? 1.914   3.784   -10.882 1.00 28.89 ? 4   DA  P "C5'" 1 
ATOM   2943 C  "C4'" . DA  C 3  4   ? 0.681   2.923   -10.832 1.00 25.39 ? 4   DA  P "C4'" 1 
ATOM   2944 O  "O4'" . DA  C 3  4   ? -0.023  3.003   -12.088 1.00 25.05 ? 4   DA  P "O4'" 1 
ATOM   2945 C  "C3'" . DA  C 3  4   ? 0.946   1.444   -10.622 1.00 23.86 ? 4   DA  P "C3'" 1 
ATOM   2946 O  "O3'" . DA  C 3  4   ? 1.119   1.168   -9.252  1.00 26.33 ? 4   DA  P "O3'" 1 
ATOM   2947 C  "C2'" . DA  C 3  4   ? -0.305  0.814   -11.211 1.00 26.03 ? 4   DA  P "C2'" 1 
ATOM   2948 C  "C1'" . DA  C 3  4   ? -0.625  1.749   -12.380 1.00 27.75 ? 4   DA  P "C1'" 1 
ATOM   2949 N  N9    . DA  C 3  4   ? -0.103  1.283   -13.658 1.00 28.45 ? 4   DA  P N9    1 
ATOM   2950 C  C8    . DA  C 3  4   ? 1.138   1.532   -14.175 1.00 25.64 ? 4   DA  P C8    1 
ATOM   2951 N  N7    . DA  C 3  4   ? 1.333   0.993   -15.350 1.00 26.48 ? 4   DA  P N7    1 
ATOM   2952 C  C5    . DA  C 3  4   ? 0.148   0.337   -15.621 1.00 26.24 ? 4   DA  P C5    1 
ATOM   2953 C  C6    . DA  C 3  4   ? -0.279  -0.427  -16.721 1.00 25.31 ? 4   DA  P C6    1 
ATOM   2954 N  N6    . DA  C 3  4   ? 0.486   -0.667  -17.796 1.00 27.82 ? 4   DA  P N6    1 
ATOM   2955 N  N1    . DA  C 3  4   ? -1.528  -0.923  -16.686 1.00 23.42 ? 4   DA  P N1    1 
ATOM   2956 C  C2    . DA  C 3  4   ? -2.292  -0.674  -15.616 1.00 25.14 ? 4   DA  P C2    1 
ATOM   2957 N  N3    . DA  C 3  4   ? -1.999  0.029   -14.522 1.00 25.20 ? 4   DA  P N3    1 
ATOM   2958 C  C4    . DA  C 3  4   ? -0.753  0.512   -14.591 1.00 25.92 ? 4   DA  P C4    1 
ATOM   2959 P  P     . DT  C 3  5   ? 2.176   0.058   -8.760  1.00 30.27 ? 5   DT  P P     1 
ATOM   2960 O  OP1   . DT  C 3  5   ? 2.498   0.406   -7.361  1.00 20.59 ? 5   DT  P OP1   1 
ATOM   2961 O  OP2   . DT  C 3  5   ? 3.248   -0.163  -9.756  1.00 30.52 ? 5   DT  P OP2   1 
ATOM   2962 O  "O5'" . DT  C 3  5   ? 1.321   -1.280  -8.781  1.00 27.96 ? 5   DT  P "O5'" 1 
ATOM   2963 C  "C5'" . DT  C 3  5   ? 0.159   -1.377  -7.982  1.00 29.90 ? 5   DT  P "C5'" 1 
ATOM   2964 C  "C4'" . DT  C 3  5   ? -0.731  -2.492  -8.477  1.00 28.43 ? 5   DT  P "C4'" 1 
ATOM   2965 O  "O4'" . DT  C 3  5   ? -1.282  -2.141  -9.771  1.00 26.95 ? 5   DT  P "O4'" 1 
ATOM   2966 C  "C3'" . DT  C 3  5   ? -0.028  -3.817  -8.705  1.00 25.43 ? 5   DT  P "C3'" 1 
ATOM   2967 O  "O3'" . DT  C 3  5   ? 0.094   -4.533  -7.486  1.00 23.76 ? 5   DT  P "O3'" 1 
ATOM   2968 C  "C2'" . DT  C 3  5   ? -0.947  -4.497  -9.713  1.00 27.87 ? 5   DT  P "C2'" 1 
ATOM   2969 C  "C1'" . DT  C 3  5   ? -1.463  -3.321  -10.549 1.00 30.66 ? 5   DT  P "C1'" 1 
ATOM   2970 N  N1    . DT  C 3  5   ? -0.741  -3.158  -11.830 1.00 27.53 ? 5   DT  P N1    1 
ATOM   2971 C  C2    . DT  C 3  5   ? -1.323  -3.610  -12.979 1.00 28.66 ? 5   DT  P C2    1 
ATOM   2972 O  O2    . DT  C 3  5   ? -2.423  -4.145  -13.004 1.00 28.83 ? 5   DT  P O2    1 
ATOM   2973 N  N3    . DT  C 3  5   ? -0.577  -3.422  -14.107 1.00 27.11 ? 5   DT  P N3    1 
ATOM   2974 C  C4    . DT  C 3  5   ? 0.670   -2.837  -14.196 1.00 26.44 ? 5   DT  P C4    1 
ATOM   2975 O  O4    . DT  C 3  5   ? 1.262   -2.714  -15.263 1.00 30.02 ? 5   DT  P O4    1 
ATOM   2976 C  C5    . DT  C 3  5   ? 1.225   -2.381  -12.948 1.00 26.52 ? 5   DT  P C5    1 
ATOM   2977 C  C7    . DT  C 3  5   ? 2.571   -1.722  -12.913 1.00 30.14 ? 5   DT  P C7    1 
ATOM   2978 C  C6    . DT  C 3  5   ? 0.505   -2.573  -11.834 1.00 25.74 ? 5   DT  P C6    1 
ATOM   2979 O  OP3   . DG  D 4  1   ? 14.436  -18.563 -26.788 1.00 37.84 ? 1   DG  D OP3   1 
ATOM   2980 P  P     . DG  D 4  1   ? 13.776  -17.351 -27.320 1.00 37.70 ? 1   DG  D P     1 
ATOM   2981 O  OP1   . DG  D 4  1   ? 14.695  -16.214 -27.122 1.00 40.89 ? 1   DG  D OP1   1 
ATOM   2982 O  OP2   . DG  D 4  1   ? 13.288  -17.650 -28.680 1.00 35.62 ? 1   DG  D OP2   1 
ATOM   2983 O  "O5'" . DG  D 4  1   ? 12.477  -17.105 -26.429 1.00 33.34 ? 1   DG  D "O5'" 1 
ATOM   2984 C  "C5'" . DG  D 4  1   ? 12.617  -16.833 -25.060 1.00 29.77 ? 1   DG  D "C5'" 1 
ATOM   2985 C  "C4'" . DG  D 4  1   ? 11.642  -17.657 -24.246 1.00 31.03 ? 1   DG  D "C4'" 1 
ATOM   2986 O  "O4'" . DG  D 4  1   ? 10.302  -17.122 -24.398 1.00 33.32 ? 1   DG  D "O4'" 1 
ATOM   2987 C  "C3'" . DG  D 4  1   ? 11.530  -19.114 -24.646 1.00 31.74 ? 1   DG  D "C3'" 1 
ATOM   2988 O  "O3'" . DG  D 4  1   ? 11.175  -19.886 -23.521 1.00 29.76 ? 1   DG  D "O3'" 1 
ATOM   2989 C  "C2'" . DG  D 4  1   ? 10.440  -19.093 -25.716 1.00 30.75 ? 1   DG  D "C2'" 1 
ATOM   2990 C  "C1'" . DG  D 4  1   ? 9.528   -17.952 -25.245 1.00 30.69 ? 1   DG  D "C1'" 1 
ATOM   2991 N  N9    . DG  D 4  1   ? 8.991   -17.109 -26.310 1.00 33.05 ? 1   DG  D N9    1 
ATOM   2992 C  C8    . DG  D 4  1   ? 9.608   -16.751 -27.486 1.00 36.18 ? 1   DG  D C8    1 
ATOM   2993 N  N7    . DG  D 4  1   ? 8.884   -15.961 -28.233 1.00 36.47 ? 1   DG  D N7    1 
ATOM   2994 C  C5    . DG  D 4  1   ? 7.717   -15.776 -27.502 1.00 34.05 ? 1   DG  D C5    1 
ATOM   2995 C  C6    . DG  D 4  1   ? 6.562   -15.014 -27.802 1.00 30.56 ? 1   DG  D C6    1 
ATOM   2996 O  O6    . DG  D 4  1   ? 6.331   -14.331 -28.805 1.00 33.22 ? 1   DG  D O6    1 
ATOM   2997 N  N1    . DG  D 4  1   ? 5.613   -15.099 -26.797 1.00 29.32 ? 1   DG  D N1    1 
ATOM   2998 C  C2    . DG  D 4  1   ? 5.754   -15.824 -25.642 1.00 31.16 ? 1   DG  D C2    1 
ATOM   2999 N  N2    . DG  D 4  1   ? 4.719   -15.779 -24.787 1.00 32.10 ? 1   DG  D N2    1 
ATOM   3000 N  N3    . DG  D 4  1   ? 6.831   -16.541 -25.341 1.00 31.80 ? 1   DG  D N3    1 
ATOM   3001 C  C4    . DG  D 4  1   ? 7.768   -16.472 -26.315 1.00 33.35 ? 1   DG  D C4    1 
ATOM   3002 P  P     . DC  D 4  2   ? 11.277  -21.480 -23.552 1.00 32.88 ? 2   DC  D P     1 
ATOM   3003 O  OP1   . DC  D 4  2   ? 11.757  -21.849 -22.200 1.00 33.12 ? 2   DC  D OP1   1 
ATOM   3004 O  OP2   . DC  D 4  2   ? 12.008  -21.905 -24.761 1.00 31.85 ? 2   DC  D OP2   1 
ATOM   3005 O  "O5'" . DC  D 4  2   ? 9.755   -21.944 -23.663 1.00 30.53 ? 2   DC  D "O5'" 1 
ATOM   3006 C  "C5'" . DC  D 4  2   ? 8.889   -21.668 -22.584 1.00 33.76 ? 2   DC  D "C5'" 1 
ATOM   3007 C  "C4'" . DC  D 4  2   ? 7.467   -21.434 -23.047 1.00 35.64 ? 2   DC  D "C4'" 1 
ATOM   3008 O  "O4'" . DC  D 4  2   ? 7.427   -20.528 -24.155 1.00 35.35 ? 2   DC  D "O4'" 1 
ATOM   3009 C  "C3'" . DC  D 4  2   ? 6.729   -22.673 -23.537 1.00 33.18 ? 2   DC  D "C3'" 1 
ATOM   3010 O  "O3'" . DC  D 4  2   ? 6.010   -23.227 -22.448 1.00 35.41 ? 2   DC  D "O3'" 1 
ATOM   3011 C  "C2'" . DC  D 4  2   ? 5.829   -22.136 -24.677 1.00 35.68 ? 2   DC  D "C2'" 1 
ATOM   3012 C  "C1'" . DC  D 4  2   ? 6.142   -20.638 -24.696 1.00 35.23 ? 2   DC  D "C1'" 1 
ATOM   3013 N  N1    . DC  D 4  2   ? 6.116   -19.982 -26.052 1.00 35.59 ? 2   DC  D N1    1 
ATOM   3014 C  C2    . DC  D 4  2   ? 5.024   -19.179 -26.400 1.00 33.75 ? 2   DC  D C2    1 
ATOM   3015 O  O2    . DC  D 4  2   ? 4.107   -19.045 -25.595 1.00 29.85 ? 2   DC  D O2    1 
ATOM   3016 N  N3    . DC  D 4  2   ? 5.005   -18.571 -27.610 1.00 31.50 ? 2   DC  D N3    1 
ATOM   3017 C  C4    . DC  D 4  2   ? 6.024   -18.735 -28.450 1.00 33.35 ? 2   DC  D C4    1 
ATOM   3018 N  N4    . DC  D 4  2   ? 5.960   -18.116 -29.631 1.00 36.86 ? 2   DC  D N4    1 
ATOM   3019 C  C5    . DC  D 4  2   ? 7.150   -19.551 -28.120 1.00 35.36 ? 2   DC  D C5    1 
ATOM   3020 C  C6    . DC  D 4  2   ? 7.155   -20.146 -26.916 1.00 36.65 ? 2   DC  D C6    1 
ATOM   3021 P  P     A DC  D 4  3   ? 5.030   -24.483 -22.648 0.60 37.22 ? 3   DC  D P     1 
ATOM   3022 P  P     B DC  D 4  3   ? 5.105   -24.536 -22.643 0.40 36.53 ? 3   DC  D P     1 
ATOM   3023 O  OP1   A DC  D 4  3   ? 4.755   -25.009 -21.294 0.60 33.22 ? 3   DC  D OP1   1 
ATOM   3024 O  OP1   B DC  D 4  3   ? 4.881   -25.103 -21.295 0.40 33.30 ? 3   DC  D OP1   1 
ATOM   3025 O  OP2   A DC  D 4  3   ? 5.575   -25.367 -23.704 0.60 36.28 ? 3   DC  D OP2   1 
ATOM   3026 O  OP2   B DC  D 4  3   ? 5.691   -25.370 -23.718 0.40 36.31 ? 3   DC  D OP2   1 
ATOM   3027 O  "O5'" A DC  D 4  3   ? 3.688   -23.828 -23.190 0.60 35.51 ? 3   DC  D "O5'" 1 
ATOM   3028 O  "O5'" B DC  D 4  3   ? 3.726   -23.944 -23.159 0.40 36.15 ? 3   DC  D "O5'" 1 
ATOM   3029 C  "C5'" A DC  D 4  3   ? 3.057   -22.826 -22.430 0.60 38.41 ? 3   DC  D "C5'" 1 
ATOM   3030 C  "C5'" B DC  D 4  3   ? 3.059   -22.978 -22.377 0.40 38.78 ? 3   DC  D "C5'" 1 
ATOM   3031 C  "C4'" A DC  D 4  3   ? 1.611   -22.700 -22.829 0.60 43.99 ? 3   DC  D "C4'" 1 
ATOM   3032 C  "C4'" B DC  D 4  3   ? 1.633   -22.818 -22.835 0.40 43.75 ? 3   DC  D "C4'" 1 
ATOM   3033 O  "O4'" A DC  D 4  3   ? 1.523   -21.915 -24.045 0.60 43.79 ? 3   DC  D "O4'" 1 
ATOM   3034 O  "O4'" B DC  D 4  3   ? 1.601   -21.891 -23.942 0.40 43.53 ? 3   DC  D "O4'" 1 
ATOM   3035 C  "C3'" A DC  D 4  3   ? 0.921   -24.025 -23.125 0.60 47.12 ? 3   DC  D "C3'" 1 
ATOM   3036 C  "C3'" B DC  D 4  3   ? 0.980   -24.117 -23.302 0.40 47.13 ? 3   DC  D "C3'" 1 
ATOM   3037 O  "O3'" A DC  D 4  3   ? -0.423  -23.994 -22.668 0.60 49.60 ? 3   DC  D "O3'" 1 
ATOM   3038 O  "O3'" B DC  D 4  3   ? -0.082  -24.509 -22.403 0.40 49.76 ? 3   DC  D "O3'" 1 
ATOM   3039 C  "C2'" A DC  D 4  3   ? 1.034   -24.148 -24.642 0.60 45.71 ? 3   DC  D "C2'" 1 
ATOM   3040 C  "C2'" B DC  D 4  3   ? 0.502   -23.853 -24.736 0.40 46.17 ? 3   DC  D "C2'" 1 
ATOM   3041 C  "C1'" A DC  D 4  3   ? 1.003   -22.690 -25.106 0.60 44.52 ? 3   DC  D "C1'" 1 
ATOM   3042 C  "C1'" B DC  D 4  3   ? 0.853   -22.392 -25.025 0.40 44.29 ? 3   DC  D "C1'" 1 
ATOM   3043 N  N1    A DC  D 4  3   ? 1.821   -22.377 -26.334 0.60 42.51 ? 3   DC  D N1    1 
ATOM   3044 N  N1    B DC  D 4  3   ? 1.677   -22.184 -26.264 0.40 42.03 ? 3   DC  D N1    1 
ATOM   3045 C  C2    A DC  D 4  3   ? 1.363   -21.405 -27.230 0.60 39.92 ? 3   DC  D C2    1 
ATOM   3046 C  C2    B DC  D 4  3   ? 1.279   -21.234 -27.213 0.40 40.17 ? 3   DC  D C2    1 
ATOM   3047 O  O2    A DC  D 4  3   ? 0.281   -20.848 -27.014 0.60 39.73 ? 3   DC  D O2    1 
ATOM   3048 O  O2    B DC  D 4  3   ? 0.234   -20.597 -27.031 0.40 39.54 ? 3   DC  D O2    1 
ATOM   3049 N  N3    A DC  D 4  3   ? 2.113   -21.107 -28.317 0.60 39.19 ? 3   DC  D N3    1 
ATOM   3050 N  N3    B DC  D 4  3   ? 2.048   -21.044 -28.313 0.40 39.82 ? 3   DC  D N3    1 
ATOM   3051 C  C4    A DC  D 4  3   ? 3.276   -21.721 -28.515 0.60 40.22 ? 3   DC  D C4    1 
ATOM   3052 C  C4    B DC  D 4  3   ? 3.169   -21.744 -28.474 0.40 40.44 ? 3   DC  D C4    1 
ATOM   3053 N  N4    A DC  D 4  3   ? 3.979   -21.389 -29.602 0.60 41.68 ? 3   DC  D N4    1 
ATOM   3054 N  N4    B DC  D 4  3   ? 3.893   -21.518 -29.575 0.40 41.98 ? 3   DC  D N4    1 
ATOM   3055 C  C5    A DC  D 4  3   ? 3.771   -22.705 -27.610 0.60 39.39 ? 3   DC  D C5    1 
ATOM   3056 C  C5    B DC  D 4  3   ? 3.599   -22.708 -27.516 0.40 39.97 ? 3   DC  D C5    1 
ATOM   3057 C  C6    A DC  D 4  3   ? 3.024   -22.993 -26.539 0.60 40.51 ? 3   DC  D C6    1 
ATOM   3058 C  C6    B DC  D 4  3   ? 2.836   -22.888 -26.434 0.40 40.88 ? 3   DC  D C6    1 
ATOM   3059 P  P     A DG  D 4  4   ? -1.304  -25.339 -22.607 0.60 48.06 ? 4   DG  D P     1 
ATOM   3060 P  P     B DG  D 4  4   ? -1.400  -23.608 -22.183 0.40 41.82 ? 4   DG  D P     1 
ATOM   3061 O  OP1   A DG  D 4  4   ? -1.975  -25.334 -21.285 0.60 43.33 ? 4   DG  D OP1   1 
ATOM   3062 O  OP1   B DG  D 4  4   ? -1.048  -22.175 -22.167 0.40 36.06 ? 4   DG  D OP1   1 
ATOM   3063 O  OP2   A DG  D 4  4   ? -0.472  -26.487 -23.031 0.60 39.46 ? 4   DG  D OP2   1 
ATOM   3064 O  OP2   B DG  D 4  4   ? -2.101  -24.205 -21.028 0.40 41.18 ? 4   DG  D OP2   1 
ATOM   3065 O  "O5'" A DG  D 4  4   ? -2.411  -25.096 -23.729 0.60 47.19 ? 4   DG  D "O5'" 1 
ATOM   3066 O  "O5'" B DG  D 4  4   ? -2.281  -23.905 -23.482 0.40 46.41 ? 4   DG  D "O5'" 1 
ATOM   3067 C  "C5'" A DG  D 4  4   ? -3.094  -23.848 -23.775 0.60 47.16 ? 4   DG  D "C5'" 1 
ATOM   3068 C  "C5'" B DG  D 4  4   ? -3.309  -23.012 -23.877 0.40 45.79 ? 4   DG  D "C5'" 1 
ATOM   3069 C  "C4'" A DG  D 4  4   ? -3.782  -23.664 -25.109 0.60 47.53 ? 4   DG  D "C4'" 1 
ATOM   3070 C  "C4'" B DG  D 4  4   ? -3.848  -23.396 -25.244 0.40 47.44 ? 4   DG  D "C4'" 1 
ATOM   3071 O  "O4'" A DG  D 4  4   ? -2.784  -23.347 -26.125 0.60 46.83 ? 4   DG  D "O4'" 1 
ATOM   3072 O  "O4'" B DG  D 4  4   ? -2.797  -23.240 -26.240 0.40 47.05 ? 4   DG  D "O4'" 1 
ATOM   3073 C  "C3'" A DG  D 4  4   ? -4.520  -24.901 -25.615 0.60 49.53 ? 4   DG  D "C3'" 1 
ATOM   3074 C  "C3'" B DG  D 4  4   ? -4.330  -24.850 -25.356 0.40 49.19 ? 4   DG  D "C3'" 1 
ATOM   3075 O  "O3'" A DG  D 4  4   ? -5.753  -24.536 -26.222 0.60 50.18 ? 4   DG  D "O3'" 1 
ATOM   3076 O  "O3'" B DG  D 4  4   ? -5.663  -24.901 -25.846 0.40 50.31 ? 4   DG  D "O3'" 1 
ATOM   3077 C  "C2'" A DG  D 4  4   ? -3.535  -25.502 -26.608 0.60 50.54 ? 4   DG  D "C2'" 1 
ATOM   3078 C  "C2'" B DG  D 4  4   ? -3.333  -25.501 -26.316 0.40 49.89 ? 4   DG  D "C2'" 1 
ATOM   3079 C  "C1'" A DG  D 4  4   ? -2.894  -24.255 -27.196 0.60 49.21 ? 4   DG  D "C1'" 1 
ATOM   3080 C  "C1'" B DG  D 4  4   ? -2.850  -24.319 -27.139 0.40 49.02 ? 4   DG  D "C1'" 1 
ATOM   3081 N  N9    A DG  D 4  4   ? -1.570  -24.469 -27.780 0.60 47.34 ? 4   DG  D N9    1 
ATOM   3082 N  N9    B DG  D 4  4   ? -1.532  -24.503 -27.754 0.40 47.38 ? 4   DG  D N9    1 
ATOM   3083 C  C8    A DG  D 4  4   ? -0.607  -25.356 -27.361 0.60 47.05 ? 4   DG  D C8    1 
ATOM   3084 C  C8    B DG  D 4  4   ? -0.549  -25.385 -27.369 0.40 47.12 ? 4   DG  D C8    1 
ATOM   3085 N  N7    A DG  D 4  4   ? 0.480   -25.324 -28.083 0.60 46.58 ? 4   DG  D N7    1 
ATOM   3086 N  N7    B DG  D 4  4   ? 0.522   -25.327 -28.113 0.40 46.86 ? 4   DG  D N7    1 
ATOM   3087 C  C5    A DG  D 4  4   ? 0.219   -24.357 -29.047 0.60 47.37 ? 4   DG  D C5    1 
ATOM   3088 C  C5    B DG  D 4  4   ? 0.230   -24.349 -29.055 0.40 47.31 ? 4   DG  D C5    1 
ATOM   3089 C  C6    A DG  D 4  4   ? 1.028   -23.886 -30.110 0.60 47.40 ? 4   DG  D C6    1 
ATOM   3090 C  C6    B DG  D 4  4   ? 1.013   -23.853 -30.126 0.40 47.49 ? 4   DG  D C6    1 
ATOM   3091 O  O6    A DG  D 4  4   ? 2.172   -24.241 -30.418 0.60 47.03 ? 4   DG  D O6    1 
ATOM   3092 O  O6    B DG  D 4  4   ? 2.156   -24.189 -30.461 0.40 47.46 ? 4   DG  D O6    1 
ATOM   3093 N  N1    A DG  D 4  4   ? 0.382   -22.901 -30.854 0.60 45.67 ? 4   DG  D N1    1 
ATOM   3094 N  N1    B DG  D 4  4   ? 0.341   -22.864 -30.841 0.40 46.24 ? 4   DG  D N1    1 
ATOM   3095 C  C2    A DG  D 4  4   ? -0.881  -22.430 -30.601 0.60 46.26 ? 4   DG  D C2    1 
ATOM   3096 C  C2    B DG  D 4  4   ? -0.923  -22.413 -30.558 0.40 46.51 ? 4   DG  D C2    1 
ATOM   3097 N  N2    A DG  D 4  4   ? -1.332  -21.479 -31.429 0.60 48.42 ? 4   DG  D N2    1 
ATOM   3098 N  N2    B DG  D 4  4   ? -1.402  -21.454 -31.362 0.40 48.10 ? 4   DG  D N2    1 
ATOM   3099 N  N3    A DG  D 4  4   ? -1.650  -22.859 -29.606 0.60 45.25 ? 4   DG  D N3    1 
ATOM   3100 N  N3    B DG  D 4  4   ? -1.669  -22.868 -29.556 0.40 45.80 ? 4   DG  D N3    1 
ATOM   3101 C  C4    A DG  D 4  4   ? -1.038  -23.821 -28.874 0.60 46.75 ? 4   DG  D C4    1 
ATOM   3102 C  C4    B DG  D 4  4   ? -1.030  -23.833 -28.850 0.40 46.95 ? 4   DG  D C4    1 
HETATM 3103 MN MN    . MN  E 5  .   ? 3.091   -0.298  -5.406  1.00 23.34 2 501 MN  A MN    1 
HETATM 3104 MN MN    . MN  F 5  .   ? 2.224   2.503   -7.014  1.00 28.77 2 502 MN  A MN    1 
HETATM 3105 MN MN    . MN  G 5  .   ? 16.312  -19.825 -26.942 0.44 51.26 2 503 MN  A MN    1 
HETATM 3106 MN MN    . MN  H 5  .   ? 27.665  -27.487 -18.124 1.00 88.77 2 504 MN  A MN    1 
HETATM 3107 MN MN    . MN  I 5  .   ? -13.152 5.239   -13.896 0.48 40.31 2 505 MN  A MN    1 
HETATM 3108 NA NA    . NA  J 6  .   ? 10.115  4.903   -15.203 1.00 32.85 1 506 NA  A NA    1 
HETATM 3109 S  S1    A DTT K 7  .   ? -8.345  23.434  -1.026  0.51 76.23 ? 507 DTT A S1    1 
HETATM 3110 S  S1    . DTT L 7  .   ? 7.785   -10.669 -14.118 1.00 96.31 ? 508 DTT A S1    1 
HETATM 3111 C  C10   . EPE M 8  .   ? 11.696  -7.872  1.326   1.00 41.53 ? 509 EPE A C10   1 
HETATM 3112 S  S     . EPE M 8  .   ? 9.904   -7.689  1.070   1.00 39.82 ? 509 EPE A S     1 
HETATM 3113 O  O1S   . EPE M 8  .   ? 9.217   -8.260  2.226   1.00 35.58 ? 509 EPE A O1S   1 
HETATM 3114 O  O2S   . EPE M 8  .   ? 9.578   -6.272  0.936   1.00 46.65 ? 509 EPE A O2S   1 
HETATM 3115 O  O3S   . EPE M 8  .   ? 9.528   -8.379  -0.154  1.00 39.54 ? 509 EPE A O3S   1 
HETATM 3116 C  C1    . EDO N 9  .   ? -4.875  -1.817  -11.469 1.00 38.96 ? 510 EDO A C1    1 
HETATM 3117 O  O1    . EDO N 9  .   ? -5.211  -2.751  -12.454 1.00 38.90 ? 510 EDO A O1    1 
HETATM 3118 C  C2    . EDO N 9  .   ? -3.993  -0.734  -12.087 1.00 36.21 ? 510 EDO A C2    1 
HETATM 3119 O  O2    . EDO N 9  .   ? -4.661  -0.168  -13.183 1.00 38.62 ? 510 EDO A O2    1 
HETATM 3120 C  C1    . EDO O 9  .   ? -14.934 -1.058  2.333   1.00 60.50 ? 511 EDO A C1    1 
HETATM 3121 O  O1    . EDO O 9  .   ? -13.675 -1.549  2.705   1.00 64.08 ? 511 EDO A O1    1 
HETATM 3122 C  C2    . EDO O 9  .   ? -14.756 0.287   1.635   1.00 56.56 ? 511 EDO A C2    1 
HETATM 3123 O  O2    . EDO O 9  .   ? -14.341 1.246   2.570   1.00 54.57 ? 511 EDO A O2    1 
HETATM 3124 C  C1    . EDO P 9  .   ? 10.207  -28.822 -6.564  1.00 41.88 ? 512 EDO A C1    1 
HETATM 3125 O  O1    . EDO P 9  .   ? 9.029   -28.964 -5.809  1.00 38.61 ? 512 EDO A O1    1 
HETATM 3126 C  C2    . EDO P 9  .   ? 10.880  -30.181 -6.762  1.00 43.24 ? 512 EDO A C2    1 
HETATM 3127 O  O2    . EDO P 9  .   ? 9.924   -31.103 -7.209  1.00 45.93 ? 512 EDO A O2    1 
HETATM 3128 C  C     . GOA Q 10 .   ? 3.233   -3.145  -6.292  1.00 24.50 ? 513 GOA A C     1 
HETATM 3129 C  CA    . GOA Q 10 .   ? 4.582   -2.654  -6.808  1.00 35.28 ? 513 GOA A CA    1 
HETATM 3130 O  O     . GOA Q 10 .   ? 2.579   -2.439  -5.477  1.00 25.85 ? 513 GOA A O     1 
HETATM 3131 O  OXT   . GOA Q 10 .   ? 2.765   -4.259  -6.664  1.00 26.46 ? 513 GOA A OXT   1 
HETATM 3132 O  O2    . GOA Q 10 .   ? 4.751   -1.296  -6.463  1.00 40.57 ? 513 GOA A O2    1 
HETATM 3133 MN MN    . MN  R 5  .   ? 4.337   -16.335 -34.297 1.00 86.62 2 101 MN  T MN    1 
HETATM 3134 O  O     . HOH S 11 .   ? -20.096 7.182   -8.692  1.00 57.15 ? 601 HOH A O     1 
HETATM 3135 O  O     . HOH S 11 .   ? 12.059  14.074  -22.412 1.00 45.23 ? 602 HOH A O     1 
HETATM 3136 O  O     . HOH S 11 .   ? 3.994   -2.117  -15.777 1.00 46.23 ? 603 HOH A O     1 
HETATM 3137 O  O     . HOH S 11 .   ? 1.295   -18.722 -15.975 1.00 37.10 ? 604 HOH A O     1 
HETATM 3138 O  O     . HOH S 11 .   ? -10.899 -7.088  -21.899 1.00 39.63 ? 605 HOH A O     1 
HETATM 3139 O  O     . HOH S 11 .   ? 13.738  -10.357 -9.518  1.00 42.05 ? 606 HOH A O     1 
HETATM 3140 O  O     . HOH S 11 .   ? 8.831   6.225   9.228   1.00 53.20 ? 607 HOH A O     1 
HETATM 3141 O  O     . HOH S 11 .   ? 1.325   -0.321  -1.460  1.00 24.01 ? 608 HOH A O     1 
HETATM 3142 O  O     . HOH S 11 .   ? 11.858  5.233   1.003   1.00 43.64 ? 609 HOH A O     1 
HETATM 3143 O  O     . HOH S 11 .   ? 9.197   5.904   -3.151  1.00 27.72 ? 610 HOH A O     1 
HETATM 3144 O  O     B HOH S 11 .   ? 2.776   -18.586 -9.643  0.68 21.91 ? 611 HOH A O     1 
HETATM 3145 O  O     . HOH S 11 .   ? -22.645 -10.418 -4.517  1.00 48.41 ? 612 HOH A O     1 
HETATM 3146 O  O     . HOH S 11 .   ? -25.903 6.861   -3.525  1.00 49.32 ? 613 HOH A O     1 
HETATM 3147 O  O     . HOH S 11 .   ? -20.974 -16.044 -8.804  1.00 53.00 ? 614 HOH A O     1 
HETATM 3148 O  O     . HOH S 11 .   ? -23.536 -15.725 -20.297 1.00 50.67 ? 615 HOH A O     1 
HETATM 3149 O  O     . HOH S 11 .   ? 4.732   -10.075 5.718   1.00 55.70 ? 616 HOH A O     1 
HETATM 3150 O  O     . HOH S 11 .   ? -5.751  18.985  8.810   1.00 52.94 ? 617 HOH A O     1 
HETATM 3151 O  O     . HOH S 11 .   ? -9.784  20.953  4.823   1.00 44.40 ? 618 HOH A O     1 
HETATM 3152 O  O     . HOH S 11 .   ? 17.473  4.255   -11.667 1.00 59.34 ? 619 HOH A O     1 
HETATM 3153 O  O     . HOH S 11 .   ? -4.995  -15.768 4.973   1.00 56.57 ? 620 HOH A O     1 
HETATM 3154 O  O     . HOH S 11 .   ? -13.820 -19.061 -5.134  1.00 29.81 ? 621 HOH A O     1 
HETATM 3155 O  O     . HOH S 11 .   ? 4.974   5.264   11.384  1.00 46.06 ? 622 HOH A O     1 
HETATM 3156 O  O     A HOH S 11 .   ? 18.378  -5.618  -22.698 0.49 28.88 ? 623 HOH A O     1 
HETATM 3157 O  O     B HOH S 11 .   ? 19.877  -7.314  -23.278 0.51 30.01 ? 623 HOH A O     1 
HETATM 3158 O  O     . HOH S 11 .   ? 13.372  -30.340 -3.249  1.00 46.77 ? 624 HOH A O     1 
HETATM 3159 O  O     . HOH S 11 .   ? 23.595  -16.435 -13.258 1.00 33.29 ? 625 HOH A O     1 
HETATM 3160 O  O     . HOH S 11 .   ? -14.185 -17.657 -1.046  1.00 27.96 ? 626 HOH A O     1 
HETATM 3161 O  O     . HOH S 11 .   ? -16.342 13.504  -3.560  1.00 38.10 ? 627 HOH A O     1 
HETATM 3162 O  O     . HOH S 11 .   ? 3.626   -0.589  -3.507  1.00 23.75 ? 628 HOH A O     1 
HETATM 3163 O  O     . HOH S 11 .   ? -9.059  -0.541  -15.334 1.00 32.56 ? 629 HOH A O     1 
HETATM 3164 O  O     . HOH S 11 .   ? -9.182  4.217   -12.165 1.00 33.08 ? 630 HOH A O     1 
HETATM 3165 O  O     . HOH S 11 .   ? 12.628  6.208   -9.257  1.00 51.15 ? 631 HOH A O     1 
HETATM 3166 O  O     . HOH S 11 .   ? 7.408   12.259  -18.591 1.00 45.70 ? 632 HOH A O     1 
HETATM 3167 O  O     . HOH S 11 .   ? 21.909  0.066   -13.675 1.00 37.27 ? 633 HOH A O     1 
HETATM 3168 O  O     . HOH S 11 .   ? 27.299  -25.863 -18.818 1.00 52.20 ? 634 HOH A O     1 
HETATM 3169 O  O     . HOH S 11 .   ? -10.500 -10.082 0.095   1.00 38.29 ? 635 HOH A O     1 
HETATM 3170 O  O     . HOH S 11 .   ? -8.273  -12.578 2.384   1.00 35.70 ? 636 HOH A O     1 
HETATM 3171 O  O     . HOH S 11 .   ? -18.739 -5.488  -13.068 1.00 25.08 ? 637 HOH A O     1 
HETATM 3172 O  O     . HOH S 11 .   ? -20.466 -4.188  -8.054  1.00 32.39 ? 638 HOH A O     1 
HETATM 3173 O  O     . HOH S 11 .   ? 5.873   -21.889 -2.984  1.00 26.56 ? 639 HOH A O     1 
HETATM 3174 O  O     . HOH S 11 .   ? -10.849 -1.698  3.032   1.00 36.63 ? 640 HOH A O     1 
HETATM 3175 O  O     . HOH S 11 .   ? -4.895  -8.830  -6.183  1.00 24.61 ? 641 HOH A O     1 
HETATM 3176 O  O     . HOH S 11 .   ? -5.138  -3.164  3.175   1.00 27.98 ? 642 HOH A O     1 
HETATM 3177 O  O     . HOH S 11 .   ? 6.171   -26.394 1.007   1.00 35.20 ? 643 HOH A O     1 
HETATM 3178 O  O     . HOH S 11 .   ? 16.222  -24.000 -6.170  1.00 38.40 ? 644 HOH A O     1 
HETATM 3179 O  O     . HOH S 11 .   ? 19.973  -15.846 -9.476  1.00 36.93 ? 645 HOH A O     1 
HETATM 3180 O  O     . HOH S 11 .   ? 9.206   -3.043  -23.573 1.00 38.61 ? 646 HOH A O     1 
HETATM 3181 O  O     . HOH S 11 .   ? 1.555   -23.010 -5.266  1.00 29.94 ? 647 HOH A O     1 
HETATM 3182 O  O     . HOH S 11 .   ? -18.966 5.350   -3.646  1.00 25.17 ? 648 HOH A O     1 
HETATM 3183 O  O     . HOH S 11 .   ? -1.781  -17.072 3.115   1.00 44.86 ? 649 HOH A O     1 
HETATM 3184 O  O     . HOH S 11 .   ? 12.718  8.860   -10.196 1.00 33.34 ? 650 HOH A O     1 
HETATM 3185 O  O     . HOH S 11 .   ? -2.475  19.697  -10.821 1.00 58.91 ? 651 HOH A O     1 
HETATM 3186 O  O     . HOH S 11 .   ? 17.927  0.368   -29.661 1.00 56.41 ? 652 HOH A O     1 
HETATM 3187 O  O     . HOH S 11 .   ? -15.162 -3.280  -16.598 1.00 34.24 ? 653 HOH A O     1 
HETATM 3188 O  O     . HOH S 11 .   ? -18.397 -2.972  -11.973 1.00 32.18 ? 654 HOH A O     1 
HETATM 3189 O  O     . HOH S 11 .   ? -17.507 5.264   6.185   1.00 36.13 ? 655 HOH A O     1 
HETATM 3190 O  O     . HOH S 11 .   ? 1.616   -20.712 -0.622  1.00 32.06 ? 656 HOH A O     1 
HETATM 3191 O  O     . HOH S 11 .   ? 7.092   -30.722 -6.315  1.00 51.66 ? 657 HOH A O     1 
HETATM 3192 O  O     . HOH S 11 .   ? -7.805  -6.911  -12.481 1.00 27.86 ? 658 HOH A O     1 
HETATM 3193 O  O     . HOH S 11 .   ? -22.116 11.822  -7.928  1.00 47.08 ? 659 HOH A O     1 
HETATM 3194 O  O     . HOH S 11 .   ? 5.251   -9.549  -4.816  1.00 24.86 ? 660 HOH A O     1 
HETATM 3195 O  O     . HOH S 11 .   ? -17.246 -20.534 -8.699  1.00 47.58 ? 661 HOH A O     1 
HETATM 3196 O  O     . HOH S 11 .   ? 3.048   -14.730 1.285   1.00 25.64 ? 662 HOH A O     1 
HETATM 3197 O  O     . HOH S 11 .   ? 27.844  -8.123  -21.327 1.00 44.56 ? 663 HOH A O     1 
HETATM 3198 O  O     . HOH S 11 .   ? -3.561  -8.483  3.510   1.00 51.89 ? 664 HOH A O     1 
HETATM 3199 O  O     . HOH S 11 .   ? 6.090   -15.906 2.471   1.00 34.91 ? 665 HOH A O     1 
HETATM 3200 O  O     . HOH S 11 .   ? 9.619   -10.687 3.290   1.00 40.59 ? 666 HOH A O     1 
HETATM 3201 O  O     . HOH S 11 .   ? 19.783  -6.184  -11.952 1.00 39.66 ? 667 HOH A O     1 
HETATM 3202 O  O     . HOH S 11 .   ? 2.871   -5.227  4.507   1.00 28.59 ? 668 HOH A O     1 
HETATM 3203 O  O     . HOH S 11 .   ? -19.823 -17.272 -12.944 1.00 54.73 ? 669 HOH A O     1 
HETATM 3204 O  O     . HOH S 11 .   ? 5.312   -5.248  -19.238 1.00 50.66 ? 670 HOH A O     1 
HETATM 3205 O  O     . HOH S 11 .   ? -22.356 -13.517 -3.635  1.00 43.39 ? 671 HOH A O     1 
HETATM 3206 O  O     . HOH S 11 .   ? -13.083 -22.934 -13.095 1.00 52.51 ? 672 HOH A O     1 
HETATM 3207 O  O     . HOH S 11 .   ? -12.257 -20.662 -2.976  1.00 45.68 ? 673 HOH A O     1 
HETATM 3208 O  O     . HOH S 11 .   ? 10.276  4.619   -6.164  1.00 32.31 ? 674 HOH A O     1 
HETATM 3209 O  O     . HOH S 11 .   ? 6.736   -14.353 -4.698  1.00 25.89 ? 675 HOH A O     1 
HETATM 3210 O  O     . HOH S 11 .   ? 16.953  -14.294 -22.921 1.00 33.86 ? 676 HOH A O     1 
HETATM 3211 O  O     . HOH S 11 .   ? -16.704 -18.194 -14.901 1.00 42.38 ? 677 HOH A O     1 
HETATM 3212 O  O     . HOH S 11 .   ? -21.796 0.766   0.723   1.00 36.61 ? 678 HOH A O     1 
HETATM 3213 O  O     . HOH S 11 .   ? 11.360  6.623   -1.283  1.00 28.47 ? 679 HOH A O     1 
HETATM 3214 O  O     . HOH S 11 .   ? -11.014 2.482   0.970   1.00 21.53 ? 680 HOH A O     1 
HETATM 3215 O  O     . HOH S 11 .   ? 17.043  -27.024 -22.693 1.00 43.00 ? 681 HOH A O     1 
HETATM 3216 O  O     . HOH S 11 .   ? 9.757   18.572  -5.536  1.00 44.96 ? 682 HOH A O     1 
HETATM 3217 O  O     . HOH S 11 .   ? -4.411  -17.929 -22.651 1.00 47.58 ? 683 HOH A O     1 
HETATM 3218 O  O     . HOH S 11 .   ? -5.753  -0.507  4.636   1.00 29.31 ? 684 HOH A O     1 
HETATM 3219 O  O     . HOH S 11 .   ? 16.249  -11.794 -22.321 1.00 31.62 ? 685 HOH A O     1 
HETATM 3220 O  O     . HOH S 11 .   ? 24.632  4.443   -28.120 1.00 53.74 ? 686 HOH A O     1 
HETATM 3221 O  O     . HOH S 11 .   ? -6.350  -1.493  -14.863 1.00 51.05 ? 687 HOH A O     1 
HETATM 3222 O  O     B HOH S 11 .   ? 16.958  13.537  -25.918 1.00 47.89 ? 688 HOH A O     1 
HETATM 3223 O  O     . HOH S 11 .   ? -24.224 3.157   -1.661  1.00 49.22 ? 689 HOH A O     1 
HETATM 3224 O  O     . HOH S 11 .   ? -0.167  -9.481  4.817   1.00 42.41 ? 690 HOH A O     1 
HETATM 3225 O  O     A HOH S 11 .   ? 8.594   -11.136 -29.199 0.52 41.64 ? 691 HOH A O     1 
HETATM 3226 O  O     B HOH S 11 .   ? 8.714   -11.375 -27.657 0.48 42.56 ? 691 HOH A O     1 
HETATM 3227 O  O     . HOH S 11 .   ? -0.540  -16.572 -7.480  1.00 29.28 ? 692 HOH A O     1 
HETATM 3228 O  O     . HOH S 11 .   ? 16.099  -22.810 -2.130  1.00 28.32 ? 693 HOH A O     1 
HETATM 3229 O  O     . HOH S 11 .   ? -4.213  -24.728 -15.539 1.00 51.18 ? 694 HOH A O     1 
HETATM 3230 O  O     . HOH S 11 .   ? -19.291 -3.250  -3.999  1.00 33.77 ? 695 HOH A O     1 
HETATM 3231 O  O     A HOH S 11 .   ? 28.568  -3.758  -22.450 0.55 36.27 ? 696 HOH A O     1 
HETATM 3232 O  O     B HOH S 11 .   ? 28.431  -5.603  -23.362 0.45 36.41 ? 696 HOH A O     1 
HETATM 3233 O  O     . HOH S 11 .   ? -23.337 0.901   -5.149  1.00 44.80 ? 697 HOH A O     1 
HETATM 3234 O  O     . HOH S 11 .   ? 11.985  -16.194 -1.454  1.00 26.07 ? 698 HOH A O     1 
HETATM 3235 O  O     . HOH S 11 .   ? 26.904  -21.656 -16.752 1.00 58.53 ? 699 HOH A O     1 
HETATM 3236 O  O     . HOH S 11 .   ? -8.490  0.602   5.759   1.00 55.14 ? 700 HOH A O     1 
HETATM 3237 O  O     . HOH S 11 .   ? 11.289  -14.225 -5.634  1.00 37.31 ? 701 HOH A O     1 
HETATM 3238 O  O     . HOH S 11 .   ? -17.840 -17.932 -17.951 1.00 48.67 ? 702 HOH A O     1 
HETATM 3239 O  O     . HOH S 11 .   ? 9.614   10.956  -22.520 1.00 45.81 ? 703 HOH A O     1 
HETATM 3240 O  O     . HOH S 11 .   ? 18.137  12.414  -6.400  1.00 35.43 ? 704 HOH A O     1 
HETATM 3241 O  O     A HOH S 11 .   ? 28.409  3.680   -19.283 1.00 54.72 ? 705 HOH A O     1 
HETATM 3242 O  O     . HOH S 11 .   ? 6.305   -11.347 -10.938 1.00 31.83 ? 706 HOH A O     1 
HETATM 3243 O  O     . HOH S 11 .   ? -6.991  -4.944  2.961   1.00 41.71 ? 707 HOH A O     1 
HETATM 3244 O  O     . HOH S 11 .   ? 15.008  -8.120  -12.652 1.00 39.41 ? 708 HOH A O     1 
HETATM 3245 O  O     . HOH S 11 .   ? 12.929  4.382   -28.435 1.00 60.90 ? 709 HOH A O     1 
HETATM 3246 O  O     . HOH S 11 .   ? -7.065  -19.877 -7.679  1.00 23.95 ? 710 HOH A O     1 
HETATM 3247 O  O     . HOH S 11 .   ? 9.373   -22.280 -4.348  1.00 25.58 ? 711 HOH A O     1 
HETATM 3248 O  O     . HOH S 11 .   ? -16.737 -18.980 -1.120  1.00 33.06 ? 712 HOH A O     1 
HETATM 3249 O  O     . HOH S 11 .   ? 14.742  14.190  -3.092  1.00 35.60 ? 713 HOH A O     1 
HETATM 3250 O  O     . HOH S 11 .   ? -3.118  15.420  6.058   1.00 41.78 ? 714 HOH A O     1 
HETATM 3251 O  O     . HOH S 11 .   ? 7.195   5.415   -9.584  1.00 27.89 ? 715 HOH A O     1 
HETATM 3252 O  O     . HOH S 11 .   ? -12.205 -14.544 3.630   1.00 33.72 ? 716 HOH A O     1 
HETATM 3253 O  O     . HOH S 11 .   ? 5.401   -10.532 -7.346  1.00 28.02 ? 717 HOH A O     1 
HETATM 3254 O  O     . HOH S 11 .   ? -14.810 12.545  -10.195 1.00 52.55 ? 718 HOH A O     1 
HETATM 3255 O  O     . HOH S 11 .   ? 3.326   -5.971  -8.817  1.00 22.17 ? 719 HOH A O     1 
HETATM 3256 O  O     . HOH S 11 .   ? -13.361 6.372   -9.966  1.00 44.20 ? 720 HOH A O     1 
HETATM 3257 O  O     . HOH S 11 .   ? -19.867 1.343   -11.506 1.00 40.42 ? 721 HOH A O     1 
HETATM 3258 O  O     . HOH S 11 .   ? -13.254 21.892  3.838   1.00 37.76 ? 722 HOH A O     1 
HETATM 3259 O  O     . HOH S 11 .   ? 10.014  18.570  7.143   1.00 44.61 ? 723 HOH A O     1 
HETATM 3260 O  O     . HOH S 11 .   ? -5.228  -11.692 3.968   1.00 42.04 ? 724 HOH A O     1 
HETATM 3261 O  O     . HOH S 11 .   ? -8.603  1.649   -11.040 1.00 26.64 ? 725 HOH A O     1 
HETATM 3262 O  O     . HOH S 11 .   ? 24.208  7.764   -13.169 1.00 40.28 ? 726 HOH A O     1 
HETATM 3263 O  O     . HOH S 11 .   ? 17.435  -34.529 -13.791 1.00 56.36 ? 727 HOH A O     1 
HETATM 3264 O  O     . HOH S 11 .   ? -22.786 -11.242 -6.867  1.00 57.99 ? 728 HOH A O     1 
HETATM 3265 O  O     . HOH S 11 .   ? 8.669   -28.660 -19.095 1.00 48.24 ? 729 HOH A O     1 
HETATM 3266 O  O     . HOH S 11 .   ? 14.940  2.356   3.828   1.00 61.68 ? 730 HOH A O     1 
HETATM 3267 O  O     . HOH S 11 .   ? 7.520   -13.396 -12.212 1.00 28.91 ? 731 HOH A O     1 
HETATM 3268 O  O     . HOH S 11 .   ? 4.340   -18.500 -21.660 1.00 28.38 ? 732 HOH A O     1 
HETATM 3269 O  O     . HOH S 11 .   ? -24.454 10.083  -3.950  1.00 39.41 ? 733 HOH A O     1 
HETATM 3270 O  O     . HOH S 11 .   ? 5.821   -22.353 -0.066  1.00 36.00 ? 734 HOH A O     1 
HETATM 3271 O  O     . HOH S 11 .   ? -13.824 -16.717 -3.605  1.00 30.70 ? 735 HOH A O     1 
HETATM 3272 O  O     . HOH S 11 .   ? -19.730 13.450  3.533   1.00 41.52 ? 736 HOH A O     1 
HETATM 3273 O  O     . HOH S 11 .   ? -12.029 11.928  -7.847  1.00 34.63 ? 737 HOH A O     1 
HETATM 3274 O  O     . HOH S 11 .   ? -25.007 -3.436  -19.491 1.00 54.60 ? 738 HOH A O     1 
HETATM 3275 O  O     . HOH S 11 .   ? 11.885  -28.968 -19.019 1.00 49.28 ? 739 HOH A O     1 
HETATM 3276 O  O     . HOH S 11 .   ? 9.176   -2.706  7.385   1.00 50.34 ? 740 HOH A O     1 
HETATM 3277 O  O     . HOH S 11 .   ? 23.646  -5.366  -13.357 1.00 55.85 ? 741 HOH A O     1 
HETATM 3278 O  O     . HOH S 11 .   ? 14.686  -26.192 -30.843 1.00 61.49 ? 742 HOH A O     1 
HETATM 3279 O  O     . HOH S 11 .   ? 12.328  -13.715 -7.951  1.00 44.78 ? 743 HOH A O     1 
HETATM 3280 O  O     . HOH S 11 .   ? -13.142 -7.428  -1.005  1.00 26.89 ? 744 HOH A O     1 
HETATM 3281 O  O     B HOH S 11 .   ? 14.814  5.740   -7.708  0.60 38.00 ? 745 HOH A O     1 
HETATM 3282 O  O     . HOH S 11 .   ? 20.826  -19.767 -21.979 1.00 55.51 ? 746 HOH A O     1 
HETATM 3283 O  O     . HOH S 11 .   ? -10.299 -6.417  -11.098 1.00 20.06 ? 747 HOH A O     1 
HETATM 3284 O  O     . HOH S 11 .   ? 2.550   20.509  -0.861  1.00 38.68 ? 748 HOH A O     1 
HETATM 3285 O  O     . HOH S 11 .   ? -25.067 -4.854  -16.314 1.00 42.88 ? 749 HOH A O     1 
HETATM 3286 O  O     . HOH S 11 .   ? 28.509  9.066   -20.311 1.00 58.99 ? 750 HOH A O     1 
HETATM 3287 O  O     A HOH S 11 .   ? -4.829  1.649   -5.105  0.74 21.69 ? 751 HOH A O     1 
HETATM 3288 O  O     . HOH S 11 .   ? -24.151 -9.856  -11.058 1.00 41.48 ? 752 HOH A O     1 
HETATM 3289 O  O     . HOH S 11 .   ? -14.699 -5.127  -18.431 1.00 36.92 ? 753 HOH A O     1 
HETATM 3290 O  O     . HOH S 11 .   ? 20.425  8.445   -7.279  1.00 50.78 ? 754 HOH A O     1 
HETATM 3291 O  O     . HOH S 11 .   ? 20.929  11.199  -7.733  1.00 48.76 ? 755 HOH A O     1 
HETATM 3292 O  O     . HOH S 11 .   ? -9.897  4.937   6.288   1.00 35.60 ? 756 HOH A O     1 
HETATM 3293 O  O     . HOH S 11 .   ? 3.057   -12.294 2.373   1.00 41.23 ? 757 HOH A O     1 
HETATM 3294 O  O     . HOH S 11 .   ? -12.989 -6.198  -25.651 1.00 61.52 ? 758 HOH A O     1 
HETATM 3295 O  O     . HOH S 11 .   ? 25.042  -18.428 -23.168 1.00 62.43 ? 759 HOH A O     1 
HETATM 3296 O  O     . HOH S 11 .   ? 11.633  -4.628  -18.882 1.00 33.95 ? 760 HOH A O     1 
HETATM 3297 O  O     . HOH S 11 .   ? -12.520 1.364   -10.343 1.00 33.95 ? 761 HOH A O     1 
HETATM 3298 O  O     . HOH S 11 .   ? 4.482   -9.010  -11.174 1.00 24.24 ? 762 HOH A O     1 
HETATM 3299 O  O     . HOH S 11 .   ? 6.094   18.518  -18.846 1.00 47.83 ? 763 HOH A O     1 
HETATM 3300 O  O     . HOH S 11 .   ? 5.806   -5.486  -5.776  1.00 40.64 ? 764 HOH A O     1 
HETATM 3301 O  O     A HOH S 11 .   ? -14.527 10.697  7.941   0.59 30.90 ? 765 HOH A O     1 
HETATM 3302 O  O     B HOH S 11 .   ? -13.711 9.444   6.664   0.41 29.70 ? 765 HOH A O     1 
HETATM 3303 O  O     . HOH S 11 .   ? -10.932 21.726  -2.524  1.00 54.47 ? 766 HOH A O     1 
HETATM 3304 O  O     . HOH S 11 .   ? 25.644  -3.693  -23.972 1.00 41.78 ? 767 HOH A O     1 
HETATM 3305 O  O     . HOH S 11 .   ? 13.931  -0.731  -26.884 1.00 43.15 ? 768 HOH A O     1 
HETATM 3306 O  O     . HOH S 11 .   ? 20.465  -12.417 -23.836 1.00 41.99 ? 769 HOH A O     1 
HETATM 3307 O  O     . HOH S 11 .   ? 7.725   -8.515  -4.441  1.00 32.46 ? 770 HOH A O     1 
HETATM 3308 O  O     . HOH S 11 .   ? 19.522  3.242   -2.951  1.00 52.72 ? 771 HOH A O     1 
HETATM 3309 O  O     . HOH S 11 .   ? 18.409  9.009   -0.117  1.00 57.45 ? 772 HOH A O     1 
HETATM 3310 O  O     . HOH S 11 .   ? -15.312 -5.262  -0.857  1.00 46.87 ? 773 HOH A O     1 
HETATM 3311 O  O     . HOH S 11 .   ? -8.188  -7.695  3.160   1.00 41.75 ? 774 HOH A O     1 
HETATM 3312 O  O     . HOH S 11 .   ? -10.463 3.337   -9.941  1.00 44.61 ? 775 HOH A O     1 
HETATM 3313 O  O     . HOH S 11 .   ? 22.002  -7.785  -11.808 1.00 49.46 ? 776 HOH A O     1 
HETATM 3314 O  O     A HOH S 11 .   ? 6.389   -9.950  -28.418 0.58 33.13 ? 777 HOH A O     1 
HETATM 3315 O  O     B HOH S 11 .   ? 6.345   -7.479  -28.529 0.42 34.18 ? 777 HOH A O     1 
HETATM 3316 O  O     . HOH S 11 .   ? -8.324  -22.045 -8.747  1.00 33.97 ? 778 HOH A O     1 
HETATM 3317 O  O     . HOH S 11 .   ? 9.883   18.918  -8.666  1.00 55.91 ? 779 HOH A O     1 
HETATM 3318 O  O     . HOH S 11 .   ? 11.054  -25.327 -26.277 1.00 43.75 ? 780 HOH A O     1 
HETATM 3319 O  O     . HOH S 11 .   ? 3.691   19.234  -8.858  1.00 48.54 ? 781 HOH A O     1 
HETATM 3320 O  O     . HOH S 11 .   ? -20.999 9.937   4.972   1.00 43.60 ? 782 HOH A O     1 
HETATM 3321 O  O     . HOH S 11 .   ? 15.815  -10.263 -11.012 1.00 41.73 ? 783 HOH A O     1 
HETATM 3322 O  O     A HOH S 11 .   ? 3.219   -3.329  -18.886 0.51 28.30 ? 784 HOH A O     1 
HETATM 3323 O  O     B HOH S 11 .   ? 1.590   -4.709  -20.698 0.49 27.09 ? 784 HOH A O     1 
HETATM 3324 O  O     . HOH S 11 .   ? -3.742  -0.541  6.543   1.00 45.04 ? 785 HOH A O     1 
HETATM 3325 O  O     . HOH S 11 .   ? 23.712  -19.463 -20.980 1.00 55.16 ? 786 HOH A O     1 
HETATM 3326 O  O     . HOH S 11 .   ? 20.208  -31.513 -12.892 1.00 47.94 ? 787 HOH A O     1 
HETATM 3327 O  O     . HOH S 11 .   ? 5.420   16.297  -17.410 1.00 52.41 ? 788 HOH A O     1 
HETATM 3328 O  O     . HOH S 11 .   ? -13.210 -10.666 -0.227  1.00 24.49 ? 789 HOH A O     1 
HETATM 3329 O  O     B HOH S 11 .   ? 14.198  13.760  -24.511 0.40 38.34 ? 790 HOH A O     1 
HETATM 3330 O  O     . HOH S 11 .   ? -14.206 4.914   -11.876 1.00 49.82 ? 791 HOH A O     1 
HETATM 3331 O  O     . HOH S 11 .   ? 18.113  16.507  -10.633 1.00 40.65 ? 792 HOH A O     1 
HETATM 3332 O  O     A HOH S 11 .   ? 10.423  9.759   -25.649 0.60 40.82 ? 793 HOH A O     1 
HETATM 3333 O  O     . HOH S 11 .   ? 7.911   1.233   -20.299 1.00 46.02 ? 794 HOH A O     1 
HETATM 3334 O  O     . HOH S 11 .   ? 16.901  -21.132 -6.178  1.00 31.84 ? 795 HOH A O     1 
HETATM 3335 O  O     . HOH S 11 .   ? -20.391 -15.217 -6.035  1.00 46.78 ? 796 HOH A O     1 
HETATM 3336 O  O     . HOH S 11 .   ? -8.494  -23.235 -11.266 1.00 41.30 ? 797 HOH A O     1 
HETATM 3337 O  O     . HOH S 11 .   ? 22.359  -15.955 -10.946 1.00 43.55 ? 798 HOH A O     1 
HETATM 3338 O  O     . HOH S 11 .   ? -10.453 8.182   6.364   1.00 60.31 ? 799 HOH A O     1 
HETATM 3339 O  O     . HOH S 11 .   ? 25.297  10.172  -12.606 1.00 51.93 ? 800 HOH A O     1 
HETATM 3340 O  O     . HOH S 11 .   ? 10.354  -10.274 -7.786  1.00 56.26 ? 801 HOH A O     1 
HETATM 3341 O  O     A HOH S 11 .   ? 22.194  -7.339  -23.106 0.92 52.93 ? 802 HOH A O     1 
HETATM 3342 O  O     . HOH S 11 .   ? 29.136  11.852  -10.480 1.00 62.21 ? 803 HOH A O     1 
HETATM 3343 O  O     . HOH S 11 .   ? 9.871   4.350   -12.902 1.00 32.46 ? 804 HOH A O     1 
HETATM 3344 O  O     A HOH S 11 .   ? 4.462   -8.717  -15.844 0.59 24.35 ? 805 HOH A O     1 
HETATM 3345 O  O     B HOH S 11 .   ? 5.689   -8.350  -14.160 0.41 25.23 ? 805 HOH A O     1 
HETATM 3346 O  O     . HOH S 11 .   ? 12.349  18.073  8.648   1.00 54.62 ? 806 HOH A O     1 
HETATM 3347 O  O     . HOH S 11 .   ? 20.199  0.566   -11.392 1.00 48.62 ? 807 HOH A O     1 
HETATM 3348 O  O     . HOH S 11 .   ? 10.524  -4.413  -3.274  1.00 59.35 ? 808 HOH A O     1 
HETATM 3349 O  O     . HOH S 11 .   ? 11.440  -13.741 -2.568  1.00 47.06 ? 809 HOH A O     1 
HETATM 3350 O  O     . HOH S 11 .   ? 8.601   -12.796 -5.645  1.00 53.07 ? 810 HOH A O     1 
HETATM 3351 O  O     . HOH S 11 .   ? -16.860 -20.513 -13.756 1.00 54.41 ? 811 HOH A O     1 
HETATM 3352 O  O     A HOH S 11 .   ? -7.172  -23.970 -17.170 0.52 37.73 ? 812 HOH A O     1 
HETATM 3353 O  O     B HOH S 11 .   ? -5.463  -23.948 -18.691 0.48 37.74 ? 812 HOH A O     1 
HETATM 3354 O  O     . HOH S 11 .   ? -5.611  -21.571 -5.889  1.00 34.51 ? 813 HOH A O     1 
HETATM 3355 O  O     . HOH S 11 .   ? -15.120 -21.113 -7.268  1.00 58.07 ? 814 HOH A O     1 
HETATM 3356 O  O     . HOH S 11 .   ? 11.365  -28.601 -22.316 1.00 57.26 ? 815 HOH A O     1 
HETATM 3357 O  O     . HOH S 11 .   ? 13.465  18.996  10.714  1.00 65.24 ? 816 HOH A O     1 
HETATM 3358 O  O     . HOH S 11 .   ? 3.052   -22.289 -2.561  1.00 33.89 ? 817 HOH A O     1 
HETATM 3359 O  O     . HOH S 11 .   ? 7.551   -31.104 -1.867  1.00 55.42 ? 818 HOH A O     1 
HETATM 3360 O  O     A HOH S 11 .   ? 5.618   -2.880  -3.404  0.55 18.96 ? 819 HOH A O     1 
HETATM 3361 O  O     B HOH S 11 .   ? 7.079   -1.987  -4.490  0.45 21.31 ? 819 HOH A O     1 
HETATM 3362 O  O     A HOH S 11 .   ? 16.926  -22.023 -26.048 0.48 40.21 ? 820 HOH A O     1 
HETATM 3363 O  O     B HOH S 11 .   ? 18.700  -22.667 -24.657 0.52 38.01 ? 820 HOH A O     1 
HETATM 3364 O  O     . HOH S 11 .   ? -15.492 5.045   -14.737 1.00 40.64 ? 821 HOH A O     1 
HETATM 3365 O  O     . HOH S 11 .   ? -15.261 5.735   7.837   1.00 57.76 ? 822 HOH A O     1 
HETATM 3366 O  O     A HOH S 11 .   ? 3.223   -16.847 3.016   0.52 33.60 ? 823 HOH A O     1 
HETATM 3367 O  O     B HOH S 11 .   ? 4.776   -18.408 3.265   0.48 34.95 ? 823 HOH A O     1 
HETATM 3368 O  O     . HOH S 11 .   ? -22.357 -3.716  -6.012  1.00 55.49 ? 824 HOH A O     1 
HETATM 3369 O  O     . HOH S 11 .   ? 9.889   -8.235  -15.999 1.00 47.76 ? 825 HOH A O     1 
HETATM 3370 O  O     . HOH S 11 .   ? -20.762 -2.632  -10.946 1.00 49.42 ? 826 HOH A O     1 
HETATM 3371 O  O     . HOH S 11 .   ? 18.866  0.531   -1.408  1.00 58.99 ? 827 HOH A O     1 
HETATM 3372 O  O     . HOH S 11 .   ? 25.892  5.533   -14.477 1.00 60.73 ? 828 HOH A O     1 
HETATM 3373 O  O     . HOH S 11 .   ? 9.299   1.476   -17.682 1.00 51.81 ? 829 HOH A O     1 
HETATM 3374 O  O     . HOH S 11 .   ? 19.827  -21.393 -7.260  1.00 47.51 ? 830 HOH A O     1 
HETATM 3375 O  O     . HOH S 11 .   ? 6.077   -13.785 3.957   1.00 57.70 ? 831 HOH A O     1 
HETATM 3376 O  O     . HOH S 11 .   ? -18.911 -0.166  -15.007 1.00 61.00 ? 832 HOH A O     1 
HETATM 3377 O  O     . HOH S 11 .   ? 23.556  -9.835  -23.469 1.00 58.00 ? 833 HOH A O     1 
HETATM 3378 O  O     . HOH S 11 .   ? 5.615   -7.812  -8.591  1.00 42.14 ? 834 HOH A O     1 
HETATM 3379 O  O     A HOH S 11 .   ? 10.079  8.307   -27.470 0.60 41.39 ? 835 HOH A O     1 
HETATM 3380 O  O     . HOH S 11 .   ? -10.361 -3.985  1.937   1.00 44.44 ? 836 HOH A O     1 
HETATM 3381 O  O     . HOH S 11 .   ? -16.359 -0.845  -17.053 1.00 54.19 ? 837 HOH A O     1 
HETATM 3382 O  O     . HOH S 11 .   ? -12.774 -19.497 -0.154  1.00 45.12 ? 838 HOH A O     1 
HETATM 3383 O  O     . HOH S 11 .   ? 17.992  -23.708 -3.999  1.00 41.67 ? 839 HOH A O     1 
HETATM 3384 O  O     . HOH S 11 .   ? 2.050   -11.666 5.130   1.00 42.20 ? 840 HOH A O     1 
HETATM 3385 O  O     . HOH S 11 .   ? -17.464 2.634   5.277   1.00 35.33 ? 841 HOH A O     1 
HETATM 3386 O  O     . HOH S 11 .   ? 20.751  -23.629 -6.814  1.00 60.01 ? 842 HOH A O     1 
HETATM 3387 O  O     . HOH S 11 .   ? 7.745   -11.804 4.452   1.00 53.41 ? 843 HOH A O     1 
HETATM 3388 O  O     . HOH S 11 .   ? 7.082   18.555  -21.293 1.00 61.06 ? 844 HOH A O     1 
HETATM 3389 O  O     . HOH S 11 .   ? -19.899 6.088   7.223   1.00 55.96 ? 845 HOH A O     1 
HETATM 3390 O  O     . HOH S 11 .   ? -11.102 -16.989 3.105   1.00 47.96 ? 846 HOH A O     1 
HETATM 3391 O  O     . HOH S 11 .   ? 22.515  -2.968  -13.416 1.00 54.56 ? 847 HOH A O     1 
HETATM 3392 O  O     . HOH S 11 .   ? -3.033  -4.571  4.490   1.00 37.57 ? 848 HOH A O     1 
HETATM 3393 O  O     . HOH S 11 .   ? -23.303 -14.262 -1.422  1.00 39.25 ? 849 HOH A O     1 
HETATM 3394 O  O     . HOH S 11 .   ? 11.321  -0.178  -27.179 1.00 60.59 ? 850 HOH A O     1 
HETATM 3395 O  O     . HOH S 11 .   ? 0.076   -24.748 -3.539  1.00 51.65 ? 851 HOH A O     1 
HETATM 3396 O  O     . HOH S 11 .   ? -12.124 -6.002  1.636   1.00 51.39 ? 852 HOH A O     1 
HETATM 3397 O  O     . HOH S 11 .   ? 8.894   -0.963  -25.876 1.00 51.19 ? 853 HOH A O     1 
HETATM 3398 O  O     . HOH S 11 .   ? -19.329 -0.077  1.975   1.00 44.47 ? 854 HOH A O     1 
HETATM 3399 O  O     . HOH S 11 .   ? -21.466 -3.374  -1.938  1.00 60.33 ? 855 HOH A O     1 
HETATM 3400 O  O     . HOH S 11 .   ? -16.806 -21.501 -2.135  1.00 40.79 ? 856 HOH A O     1 
HETATM 3401 O  O     . HOH S 11 .   ? 27.629  -27.227 -21.404 1.00 65.56 ? 857 HOH A O     1 
HETATM 3402 O  O     . HOH S 11 .   ? 16.332  1.357   7.628   1.00 57.92 ? 858 HOH A O     1 
HETATM 3403 O  O     . HOH T 11 .   ? -12.848 5.808   -16.287 1.00 43.53 ? 201 HOH T O     1 
HETATM 3404 O  O     . HOH T 11 .   ? 2.665   -13.685 -32.490 1.00 41.65 ? 202 HOH T O     1 
HETATM 3405 O  O     . HOH T 11 .   ? 4.996   -15.537 -32.060 1.00 58.86 ? 203 HOH T O     1 
HETATM 3406 O  O     . HOH T 11 .   ? -3.625  0.030   -22.832 1.00 46.15 ? 204 HOH T O     1 
HETATM 3407 O  O     . HOH T 11 .   ? -0.828  -7.306  -23.913 1.00 42.07 ? 205 HOH T O     1 
HETATM 3408 O  O     . HOH T 11 .   ? -1.240  -16.582 -25.645 1.00 43.36 ? 206 HOH T O     1 
HETATM 3409 O  O     . HOH T 11 .   ? -4.583  7.038   -22.743 1.00 38.06 ? 207 HOH T O     1 
HETATM 3410 O  O     . HOH T 11 .   ? -13.647 -1.386  -20.798 1.00 61.09 ? 208 HOH T O     1 
HETATM 3411 O  O     . HOH T 11 .   ? -11.655 -5.398  -19.826 1.00 45.60 ? 209 HOH T O     1 
HETATM 3412 O  O     . HOH T 11 .   ? 5.139   -18.435 -33.330 1.00 50.59 ? 210 HOH T O     1 
HETATM 3413 O  O     . HOH T 11 .   ? -10.126 -9.990  -19.398 1.00 28.11 ? 211 HOH T O     1 
HETATM 3414 O  O     . HOH T 11 .   ? 0.920   -1.582  -21.871 1.00 47.34 ? 212 HOH T O     1 
HETATM 3415 O  O     . HOH T 11 .   ? -6.100  7.938   -21.024 1.00 44.78 ? 213 HOH T O     1 
HETATM 3416 O  O     . HOH T 11 .   ? -0.571  -13.097 -19.170 1.00 29.67 ? 214 HOH T O     1 
HETATM 3417 O  O     . HOH T 11 .   ? 0.667   -15.469 -23.719 1.00 29.37 ? 215 HOH T O     1 
HETATM 3418 O  O     . HOH T 11 .   ? 3.823   -10.718 -31.325 1.00 44.60 ? 216 HOH T O     1 
HETATM 3419 O  O     A HOH T 11 .   ? -13.587 2.478   -18.223 0.52 32.94 ? 217 HOH T O     1 
HETATM 3420 O  O     B HOH T 11 .   ? -13.702 0.550   -18.030 0.48 31.35 ? 217 HOH T O     1 
HETATM 3421 O  O     . HOH T 11 .   ? -7.402  -0.337  -23.126 1.00 42.08 ? 218 HOH T O     1 
HETATM 3422 O  O     . HOH T 11 .   ? -0.898  0.587   -22.801 1.00 43.67 ? 219 HOH T O     1 
HETATM 3423 O  O     . HOH T 11 .   ? -3.645  -17.789 -31.002 1.00 52.66 ? 220 HOH T O     1 
HETATM 3424 O  O     . HOH T 11 .   ? -7.324  10.938  -18.589 1.00 53.16 ? 221 HOH T O     1 
HETATM 3425 O  O     . HOH T 11 .   ? -1.295  -9.178  -27.657 1.00 45.87 ? 222 HOH T O     1 
HETATM 3426 O  O     . HOH T 11 .   ? -5.328  -17.770 -32.858 1.00 47.57 ? 223 HOH T O     1 
HETATM 3427 O  O     . HOH T 11 .   ? -5.072  -4.733  -23.626 1.00 42.71 ? 224 HOH T O     1 
HETATM 3428 O  O     . HOH T 11 .   ? -3.559  -7.076  -24.615 1.00 49.64 ? 225 HOH T O     1 
HETATM 3429 O  O     A HOH T 11 .   ? -15.473 -4.180  -20.943 0.48 39.63 ? 226 HOH T O     1 
HETATM 3430 O  O     B HOH T 11 .   ? -16.905 -3.171  -21.265 0.52 39.88 ? 226 HOH T O     1 
HETATM 3431 O  O     . HOH U 11 .   ? 2.491   0.857   -20.611 1.00 42.59 ? 101 HOH P O     1 
HETATM 3432 O  O     . HOH U 11 .   ? 2.964   4.170   -22.971 1.00 43.61 ? 102 HOH P O     1 
HETATM 3433 O  O     . HOH U 11 .   ? 4.414   11.835  -21.733 1.00 44.03 ? 103 HOH P O     1 
HETATM 3434 O  O     . HOH U 11 .   ? -2.983  4.924   -14.743 1.00 25.48 ? 104 HOH P O     1 
HETATM 3435 O  O     . HOH U 11 .   ? 4.059   2.702   -8.449  1.00 29.69 ? 105 HOH P O     1 
HETATM 3436 O  O     . HOH U 11 .   ? 7.797   2.619   -23.112 1.00 35.01 ? 106 HOH P O     1 
HETATM 3437 O  O     . HOH U 11 .   ? 7.361   4.994   -13.034 1.00 46.18 ? 107 HOH P O     1 
HETATM 3438 O  O     . HOH U 11 .   ? 3.801   0.734   -16.566 1.00 31.34 ? 108 HOH P O     1 
HETATM 3439 O  O     . HOH U 11 .   ? 0.159   3.315   -23.250 1.00 53.56 ? 109 HOH P O     1 
HETATM 3440 O  O     . HOH U 11 .   ? 5.390   2.814   -15.640 1.00 31.67 ? 110 HOH P O     1 
HETATM 3441 O  O     . HOH U 11 .   ? 1.836   9.685   -16.499 1.00 41.90 ? 111 HOH P O     1 
HETATM 3442 O  O     . HOH U 11 .   ? 8.737   3.037   -15.967 1.00 29.91 ? 112 HOH P O     1 
HETATM 3443 O  O     . HOH U 11 .   ? 5.193   0.483   -11.954 1.00 46.08 ? 113 HOH P O     1 
HETATM 3444 O  O     . HOH U 11 .   ? -1.275  4.639   -25.473 1.00 62.46 ? 114 HOH P O     1 
HETATM 3445 O  O     . HOH U 11 .   ? 3.835   -3.245  -10.267 1.00 48.80 ? 115 HOH P O     1 
HETATM 3446 O  O     . HOH U 11 .   ? 7.203   11.436  -21.177 1.00 39.60 ? 116 HOH P O     1 
HETATM 3447 O  O     B HOH U 11 .   ? 3.869   -0.831  -18.919 0.73 40.75 ? 117 HOH P O     1 
HETATM 3448 O  O     . HOH V 11 .   ? 5.548   -25.368 -26.215 1.00 47.46 ? 101 HOH D O     1 
HETATM 3449 O  O     A HOH V 11 .   ? 12.208  -15.619 -29.671 0.62 49.59 ? 102 HOH D O     1 
HETATM 3450 O  O     . HOH V 11 .   ? 14.904  -18.074 -30.556 1.00 47.79 ? 103 HOH D O     1 
HETATM 3451 O  O     . HOH V 11 .   ? 13.002  -21.330 -27.076 1.00 50.81 ? 104 HOH D O     1 
HETATM 3452 O  O     A HOH V 11 .   ? 10.036  -14.724 -30.306 0.62 33.48 ? 105 HOH D O     1 
HETATM 3453 O  O     . HOH V 11 .   ? 2.565   -26.506 -20.791 1.00 48.84 ? 106 HOH D O     1 
HETATM 3454 O  O     . HOH V 11 .   ? 2.880   -26.660 -28.338 1.00 58.73 ? 107 HOH D O     1 
HETATM 3455 O  O     . HOH V 11 .   ? 2.281   -19.272 -23.430 1.00 37.44 ? 108 HOH D O     1 
HETATM 3456 O  O     . HOH V 11 .   ? -0.351  -19.521 -22.649 1.00 44.33 ? 109 HOH D O     1 
HETATM 3457 O  O     . HOH V 11 .   ? 6.430   -22.870 -30.085 1.00 45.92 ? 110 HOH D O     1 
HETATM 3458 O  O     . HOH V 11 .   ? 17.308  -17.437 -27.717 1.00 66.98 ? 111 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . TRP A 11  ? 1.0911 0.8963 1.1941 -0.0027 -0.0277 -0.0711 137 TRP A N     
2    C  CA    . TRP A 11  ? 1.0518 0.8750 1.1369 0.0040  -0.0302 -0.0798 137 TRP A CA    
3    C  C     . TRP A 11  ? 1.0519 0.8910 1.1161 0.0019  -0.0288 -0.0699 137 TRP A C     
4    O  O     . TRP A 11  ? 1.1248 0.9682 1.1895 -0.0054 -0.0280 -0.0677 137 TRP A O     
5    C  CB    . TRP A 11  ? 0.9851 0.8165 1.0757 0.0044  -0.0344 -0.1026 137 TRP A CB    
6    N  N     A MET A 12  ? 0.6884 0.5363 0.7364 0.0083  -0.0284 -0.0645 138 MET A N     
7    N  N     B MET A 12  ? 0.6931 0.5411 0.7411 0.0082  -0.0284 -0.0646 138 MET A N     
8    C  CA    A MET A 12  ? 0.6179 0.4803 0.6474 0.0069  -0.0271 -0.0562 138 MET A CA    
9    C  CA    B MET A 12  ? 0.6188 0.4808 0.6487 0.0066  -0.0270 -0.0558 138 MET A CA    
10   C  C     A MET A 12  ? 0.5796 0.4576 0.6036 0.0045  -0.0291 -0.0679 138 MET A C     
11   C  C     B MET A 12  ? 0.5687 0.4468 0.5922 0.0046  -0.0291 -0.0675 138 MET A C     
12   O  O     A MET A 12  ? 0.5809 0.4654 0.6049 0.0086  -0.0317 -0.0825 138 MET A O     
13   O  O     B MET A 12  ? 0.5613 0.4467 0.5835 0.0092  -0.0315 -0.0813 138 MET A O     
14   C  CB    A MET A 12  ? 0.5925 0.4620 0.6091 0.0144  -0.0267 -0.0513 138 MET A CB    
15   C  CB    B MET A 12  ? 0.5817 0.4503 0.5984 0.0136  -0.0264 -0.0493 138 MET A CB    
16   C  CG    A MET A 12  ? 0.5818 0.4665 0.5809 0.0135  -0.0254 -0.0443 138 MET A CG    
17   C  CG    B MET A 12  ? 0.5964 0.4786 0.5964 0.0116  -0.0249 -0.0413 138 MET A CG    
18   S  SD    A MET A 12  ? 0.5815 0.4616 0.5733 0.0118  -0.0230 -0.0247 138 MET A SD    
19   S  SD    B MET A 12  ? 0.5536 0.4458 0.5409 0.0189  -0.0245 -0.0364 138 MET A SD    
20   C  CE    A MET A 12  ? 0.5518 0.4277 0.5450 0.0207  -0.0243 -0.0215 138 MET A CE    
21   C  CE    B MET A 12  ? 0.5462 0.4238 0.5387 0.0212  -0.0243 -0.0225 138 MET A CE    
22   N  N     . PRO A 13  ? 0.5890 0.4739 0.6077 -0.0013 -0.0281 -0.0623 139 PRO A N     
23   C  CA    . PRO A 13  ? 0.5744 0.4748 0.5877 -0.0026 -0.0307 -0.0724 139 PRO A CA    
24   C  C     . PRO A 13  ? 0.5121 0.4274 0.5080 0.0039  -0.0311 -0.0743 139 PRO A C     
25   O  O     . PRO A 13  ? 0.4791 0.3946 0.4665 0.0078  -0.0287 -0.0658 139 PRO A O     
26   C  CB    . PRO A 13  ? 0.5936 0.4967 0.6064 -0.0097 -0.0287 -0.0631 139 PRO A CB    
27   C  CG    . PRO A 13  ? 0.5960 0.4907 0.6044 -0.0099 -0.0245 -0.0469 139 PRO A CG    
28   C  CD    . PRO A 13  ? 0.5979 0.4777 0.6150 -0.0064 -0.0245 -0.0465 139 PRO A CD    
29   N  N     . ALA A 14  ? 0.4554 0.3841 0.4466 0.0049  -0.0341 -0.0855 140 ALA A N     
30   C  CA    . ALA A 14  ? 0.4255 0.3684 0.4012 0.0115  -0.0339 -0.0886 140 ALA A CA    
31   C  C     . ALA A 14  ? 0.4251 0.3788 0.3872 0.0109  -0.0317 -0.0776 140 ALA A C     
32   O  O     . ALA A 14  ? 0.4390 0.4015 0.3895 0.0159  -0.0297 -0.0752 140 ALA A O     
33   C  CB    . ALA A 14  ? 0.4491 0.4025 0.4239 0.0140  -0.0383 -0.1055 140 ALA A CB    
34   N  N     . TYR A 15  ? 0.4441 0.3972 0.4088 0.0048  -0.0316 -0.0710 141 TYR A N     
35   C  CA    . TYR A 15  ? 0.4098 0.3717 0.3639 0.0041  -0.0294 -0.0611 141 TYR A CA    
36   C  C     . TYR A 15  ? 0.4220 0.3749 0.3760 0.0017  -0.0255 -0.0478 141 TYR A C     
37   O  O     . TYR A 15  ? 0.4369 0.3783 0.4004 -0.0024 -0.0247 -0.0444 141 TYR A O     
38   C  CB    . TYR A 15  ? 0.3737 0.3426 0.3310 -0.0004 -0.0318 -0.0630 141 TYR A CB    
39   C  CG    . TYR A 15  ? 0.3540 0.3354 0.3089 0.0023  -0.0367 -0.0752 141 TYR A CG    
40   C  CD1   . TYR A 15  ? 0.3806 0.3596 0.3465 0.0011  -0.0410 -0.0886 141 TYR A CD1   
41   C  CD2   . TYR A 15  ? 0.4239 0.4197 0.3660 0.0061  -0.0373 -0.0733 141 TYR A CD2   
42   C  CE1   . TYR A 15  ? 0.4179 0.4101 0.3806 0.0040  -0.0465 -0.1010 141 TYR A CE1   
43   C  CE2   . TYR A 15  ? 0.4290 0.4376 0.3669 0.0093  -0.0423 -0.0836 141 TYR A CE2   
44   C  CZ    . TYR A 15  ? 0.4035 0.4111 0.3510 0.0084  -0.0472 -0.0980 141 TYR A CZ    
45   O  OH    . TYR A 15  ? 0.4215 0.4436 0.3636 0.0121  -0.0530 -0.1094 141 TYR A OH    
46   N  N     . ALA A 16  ? 0.3863 0.3453 0.3299 0.0041  -0.0230 -0.0402 142 ALA A N     
47   C  CA    . ALA A 16  ? 0.3918 0.3442 0.3339 0.0025  -0.0201 -0.0291 142 ALA A CA    
48   C  C     . ALA A 16  ? 0.3555 0.3050 0.3008 -0.0035 -0.0187 -0.0231 142 ALA A C     
49   O  O     . ALA A 16  ? 0.3676 0.3093 0.3136 -0.0055 -0.0166 -0.0152 142 ALA A O     
50   C  CB    . ALA A 16  ? 0.4369 0.3976 0.3693 0.0058  -0.0180 -0.0240 142 ALA A CB    
51   N  N     . CYS A 17  ? 0.3794 0.3361 0.3264 -0.0061 -0.0197 -0.0266 143 CYS A N     
52   C  CA    . CYS A 17  ? 0.3886 0.3438 0.3403 -0.0117 -0.0178 -0.0216 143 CYS A CA    
53   C  C     . CYS A 17  ? 0.4286 0.3734 0.3931 -0.0164 -0.0175 -0.0228 143 CYS A C     
54   O  O     . CYS A 17  ? 0.3903 0.3336 0.3600 -0.0214 -0.0148 -0.0180 143 CYS A O     
55   C  CB    . CYS A 17  ? 0.3760 0.3432 0.3276 -0.0125 -0.0193 -0.0250 143 CYS A CB    
56   S  SG    . CYS A 17  ? 0.3762 0.3499 0.3336 -0.0111 -0.0252 -0.0387 143 CYS A SG    
57   N  N     . GLN A 18  ? 0.3541 0.2917 0.3247 -0.0148 -0.0198 -0.0289 144 GLN A N     
58   C  CA    . GLN A 18  ? 0.3656 0.2913 0.3507 -0.0191 -0.0193 -0.0300 144 GLN A CA    
59   C  C     . GLN A 18  ? 0.4192 0.3314 0.4044 -0.0181 -0.0166 -0.0207 144 GLN A C     
60   O  O     . GLN A 18  ? 0.4200 0.3203 0.4178 -0.0211 -0.0156 -0.0198 144 GLN A O     
61   C  CB    . GLN A 18  ? 0.3571 0.2824 0.3515 -0.0178 -0.0239 -0.0440 144 GLN A CB    
62   C  CG    . GLN A 18  ? 0.4310 0.3696 0.4273 -0.0189 -0.0278 -0.0541 144 GLN A CG    
63   C  CD    . GLN A 18  ? 0.4231 0.3620 0.4275 -0.0172 -0.0328 -0.0694 144 GLN A CD    
64   O  OE1   . GLN A 18  ? 0.3892 0.3309 0.3855 -0.0109 -0.0346 -0.0753 144 GLN A OE1   
65   N  NE2   . GLN A 18  ? 0.4496 0.3860 0.4710 -0.0228 -0.0349 -0.0767 144 GLN A NE2   
66   N  N     . ARG A 19  ? 0.4662 0.3800 0.4389 -0.0139 -0.0156 -0.0138 145 ARG A N     
67   C  CA    . ARG A 19  ? 0.5186 0.4216 0.4904 -0.0115 -0.0143 -0.0053 145 ARG A CA    
68   C  C     . ARG A 19  ? 0.4165 0.3241 0.3752 -0.0106 -0.0121 0.0048  145 ARG A C     
69   O  O     . ARG A 19  ? 0.3636 0.2823 0.3137 -0.0090 -0.0126 0.0029  145 ARG A O     
70   C  CB    . ARG A 19  ? 0.5441 0.4446 0.5169 -0.0050 -0.0174 -0.0114 145 ARG A CB    
71   C  CG    . ARG A 19  ? 0.5415 0.4555 0.5046 -0.0006 -0.0189 -0.0172 145 ARG A CG    
72   C  CD    . ARG A 19  ? 0.5930 0.5061 0.5583 0.0058  -0.0209 -0.0243 145 ARG A CD    
73   N  NE    . ARG A 19  ? 0.5842 0.5106 0.5396 0.0099  -0.0208 -0.0269 145 ARG A NE    
74   C  CZ    . ARG A 19  ? 0.5231 0.4584 0.4766 0.0126  -0.0218 -0.0370 145 ARG A CZ    
75   N  NH1   . ARG A 19  ? 0.4561 0.3894 0.4168 0.0120  -0.0240 -0.0475 145 ARG A NH1   
76   N  NH2   . ARG A 19  ? 0.4804 0.4274 0.4250 0.0161  -0.0204 -0.0365 145 ARG A NH2   
77   N  N     . PRO A 20  ? 0.3934 0.2928 0.3504 -0.0114 -0.0097 0.0155  146 PRO A N     
78   C  CA    . PRO A 20  ? 0.3567 0.2611 0.3006 -0.0097 -0.0086 0.0235  146 PRO A CA    
79   C  C     . PRO A 20  ? 0.4070 0.3149 0.3456 -0.0032 -0.0121 0.0218  146 PRO A C     
80   O  O     . PRO A 20  ? 0.3727 0.2736 0.3166 0.0008  -0.0144 0.0210  146 PRO A O     
81   C  CB    . PRO A 20  ? 0.3626 0.2570 0.3063 -0.0113 -0.0057 0.0351  146 PRO A CB    
82   C  CG    . PRO A 20  ? 0.4244 0.3063 0.3819 -0.0117 -0.0061 0.0338  146 PRO A CG    
83   C  CD    . PRO A 20  ? 0.4457 0.3314 0.4129 -0.0141 -0.0077 0.0210  146 PRO A CD    
84   N  N     . THR A 21  ? 0.3273 0.2460 0.2572 -0.0021 -0.0124 0.0210  147 THR A N     
85   C  CA    . THR A 21  ? 0.3282 0.2518 0.2545 0.0034  -0.0151 0.0199  147 THR A CA    
86   C  C     . THR A 21  ? 0.3520 0.2802 0.2689 0.0037  -0.0150 0.0263  147 THR A C     
87   O  O     . THR A 21  ? 0.3379 0.2740 0.2501 0.0014  -0.0135 0.0250  147 THR A O     
88   C  CB    . THR A 21  ? 0.3427 0.2759 0.2698 0.0047  -0.0155 0.0116  147 THR A CB    
89   O  OG1   . THR A 21  ? 0.3542 0.2848 0.2881 0.0041  -0.0158 0.0045  147 THR A OG1   
90   C  CG2   . THR A 21  ? 0.3970 0.3345 0.3241 0.0102  -0.0175 0.0102  147 THR A CG2   
91   N  N     . PRO A 22  ? 0.4047 0.3285 0.3188 0.0069  -0.0170 0.0328  148 PRO A N     
92   C  CA    . PRO A 22  ? 0.4008 0.3302 0.3049 0.0075  -0.0178 0.0378  148 PRO A CA    
93   C  C     . PRO A 22  ? 0.3778 0.3177 0.2816 0.0104  -0.0207 0.0329  148 PRO A C     
94   O  O     . PRO A 22  ? 0.3443 0.2866 0.2551 0.0129  -0.0218 0.0274  148 PRO A O     
95   C  CB    . PRO A 22  ? 0.4296 0.3509 0.3313 0.0110  -0.0198 0.0467  148 PRO A CB    
96   C  CG    . PRO A 22  ? 0.4618 0.3764 0.3746 0.0146  -0.0220 0.0439  148 PRO A CG    
97   C  CD    . PRO A 22  ? 0.4528 0.3667 0.3731 0.0108  -0.0192 0.0357  148 PRO A CD    
98   N  N     . LEU A 23  ? 0.3558 0.3023 0.2519 0.0101  -0.0215 0.0345  149 LEU A N     
99   C  CA    . LEU A 23  ? 0.3764 0.3330 0.2744 0.0117  -0.0238 0.0295  149 LEU A CA    
100  C  C     . LEU A 23  ? 0.4117 0.3698 0.3145 0.0174  -0.0287 0.0298  149 LEU A C     
101  O  O     . LEU A 23  ? 0.4273 0.3913 0.3380 0.0191  -0.0293 0.0246  149 LEU A O     
102  C  CB    . LEU A 23  ? 0.3924 0.3555 0.2824 0.0099  -0.0241 0.0296  149 LEU A CB    
103  C  CG    . LEU A 23  ? 0.4330 0.4064 0.3273 0.0108  -0.0267 0.0239  149 LEU A CG    
104  C  CD1   . LEU A 23  ? 0.4476 0.4240 0.3514 0.0092  -0.0236 0.0187  149 LEU A CD1   
105  C  CD2   . LEU A 23  ? 0.4250 0.4040 0.3121 0.0087  -0.0269 0.0223  149 LEU A CD2   
106  N  N     . THR A 24  ? 0.3310 0.2843 0.2297 0.0208  -0.0318 0.0364  150 THR A N     
107  C  CA    . THR A 24  ? 0.3445 0.2987 0.2486 0.0271  -0.0370 0.0376  150 THR A CA    
108  C  C     . THR A 24  ? 0.3811 0.3227 0.2901 0.0296  -0.0365 0.0418  150 THR A C     
109  O  O     . THR A 24  ? 0.3841 0.3162 0.2891 0.0267  -0.0333 0.0469  150 THR A O     
110  C  CB    . THR A 24  ? 0.3971 0.3569 0.2931 0.0304  -0.0425 0.0421  150 THR A CB    
111  O  OG1   . THR A 24  ? 0.3899 0.3421 0.2746 0.0298  -0.0413 0.0510  150 THR A OG1   
112  C  CG2   . THR A 24  ? 0.4817 0.4537 0.3750 0.0275  -0.0432 0.0360  150 THR A CG2   
113  N  N     . HIS A 25  ? 0.3468 0.2883 0.2659 0.0348  -0.0391 0.0392  151 HIS A N     
114  C  CA    . HIS A 25  ? 0.3544 0.2837 0.2814 0.0369  -0.0380 0.0401  151 HIS A CA    
115  C  C     . HIS A 25  ? 0.3610 0.2908 0.2971 0.0450  -0.0428 0.0406  151 HIS A C     
116  O  O     . HIS A 25  ? 0.3626 0.3011 0.2970 0.0488  -0.0477 0.0429  151 HIS A O     
117  C  CB    . HIS A 25  ? 0.3482 0.2767 0.2806 0.0331  -0.0333 0.0314  151 HIS A CB    
118  C  CG    . HIS A 25  ? 0.3452 0.2858 0.2824 0.0342  -0.0328 0.0230  151 HIS A CG    
119  N  ND1   . HIS A 25  ? 0.3336 0.2761 0.2811 0.0395  -0.0336 0.0178  151 HIS A ND1   
120  C  CD2   . HIS A 25  ? 0.3387 0.2900 0.2726 0.0308  -0.0309 0.0195  151 HIS A CD2   
121  C  CE1   . HIS A 25  ? 0.3502 0.3047 0.2998 0.0390  -0.0316 0.0119  151 HIS A CE1   
122  N  NE2   . HIS A 25  ? 0.3457 0.3050 0.2875 0.0337  -0.0301 0.0133  151 HIS A NE2   
123  N  N     . HIS A 26  ? 0.3658 0.2868 0.3126 0.0478  -0.0418 0.0377  152 HIS A N     
124  C  CA    . HIS A 26  ? 0.3763 0.2937 0.3329 0.0561  -0.0460 0.0398  152 HIS A CA    
125  C  C     . HIS A 26  ? 0.3697 0.2934 0.3389 0.0599  -0.0452 0.0291  152 HIS A C     
126  O  O     . HIS A 26  ? 0.3786 0.2982 0.3589 0.0670  -0.0478 0.0288  152 HIS A O     
127  C  CB    . HIS A 26  ? 0.3926 0.2916 0.3526 0.0571  -0.0453 0.0469  152 HIS A CB    
128  C  CG    . HIS A 26  ? 0.3991 0.2918 0.3468 0.0520  -0.0435 0.0570  152 HIS A CG    
129  N  ND1   . HIS A 26  ? 0.4079 0.3034 0.3447 0.0544  -0.0470 0.0678  152 HIS A ND1   
130  C  CD2   . HIS A 26  ? 0.3985 0.2840 0.3431 0.0446  -0.0383 0.0575  152 HIS A CD2   
131  C  CE1   . HIS A 26  ? 0.4155 0.3054 0.3423 0.0488  -0.0432 0.0748  152 HIS A CE1   
132  N  NE2   . HIS A 26  ? 0.4067 0.2906 0.3391 0.0426  -0.0378 0.0688  152 HIS A NE2   
133  N  N     . ASN A 27  ? 0.3556 0.2896 0.3236 0.0559  -0.0415 0.0207  153 ASN A N     
134  C  CA    . ASN A 27  ? 0.3640 0.3059 0.3419 0.0591  -0.0393 0.0108  153 ASN A CA    
135  C  C     . ASN A 27  ? 0.3358 0.2939 0.3112 0.0560  -0.0372 0.0070  153 ASN A C     
136  O  O     . ASN A 27  ? 0.3288 0.2929 0.3055 0.0544  -0.0324 -0.0001 153 ASN A O     
137  C  CB    . ASN A 27  ? 0.3520 0.2859 0.3327 0.0575  -0.0351 0.0035  153 ASN A CB    
138  C  CG    . ASN A 27  ? 0.3672 0.2851 0.3560 0.0614  -0.0369 0.0053  153 ASN A CG    
139  O  OD1   . ASN A 27  ? 0.3741 0.2910 0.3742 0.0686  -0.0387 0.0026  153 ASN A OD1   
140  N  ND2   . ASN A 27  ? 0.3733 0.2785 0.3579 0.0566  -0.0363 0.0101  153 ASN A ND2   
141  N  N     . THR A 28  ? 0.3332 0.2987 0.3052 0.0554  -0.0407 0.0119  154 THR A N     
142  C  CA    . THR A 28  ? 0.3624 0.3413 0.3330 0.0512  -0.0386 0.0089  154 THR A CA    
143  C  C     . THR A 28  ? 0.3365 0.3270 0.3191 0.0542  -0.0355 0.0019  154 THR A C     
144  O  O     . THR A 28  ? 0.3232 0.3197 0.3048 0.0506  -0.0298 -0.0021 154 THR A O     
145  C  CB    . THR A 28  ? 0.4085 0.3935 0.3758 0.0510  -0.0442 0.0136  154 THR A CB    
146  O  OG1   . THR A 28  ? 0.3842 0.3587 0.3395 0.0492  -0.0464 0.0208  154 THR A OG1   
147  C  CG2   . THR A 28  ? 0.4152 0.4116 0.3818 0.0455  -0.0419 0.0103  154 THR A CG2   
148  N  N     . GLY A 29  ? 0.3756 0.3699 0.3699 0.0611  -0.0387 0.0009  155 GLY A N     
149  C  CA    . GLY A 29  ? 0.4205 0.4272 0.4274 0.0643  -0.0350 -0.0056 155 GLY A CA    
150  C  C     . GLY A 29  ? 0.3880 0.3924 0.3941 0.0644  -0.0280 -0.0119 155 GLY A C     
151  O  O     . GLY A 29  ? 0.3218 0.3370 0.3304 0.0630  -0.0220 -0.0161 155 GLY A O     
152  N  N     . LEU A 30  ? 0.3245 0.3151 0.3272 0.0661  -0.0286 -0.0128 156 LEU A N     
153  C  CA    . LEU A 30  ? 0.3261 0.3150 0.3274 0.0665  -0.0231 -0.0205 156 LEU A CA    
154  C  C     . LEU A 30  ? 0.3481 0.3403 0.3375 0.0594  -0.0186 -0.0207 156 LEU A C     
155  O  O     . LEU A 30  ? 0.3150 0.3165 0.3037 0.0595  -0.0129 -0.0258 156 LEU A O     
156  C  CB    . LEU A 30  ? 0.3694 0.3418 0.3712 0.0688  -0.0254 -0.0220 156 LEU A CB    
157  C  CG    . LEU A 30  ? 0.3546 0.3215 0.3696 0.0769  -0.0296 -0.0215 156 LEU A CG    
158  C  CD1   . LEU A 30  ? 0.3611 0.3100 0.3783 0.0784  -0.0310 -0.0230 156 LEU A CD1   
159  C  CD2   . LEU A 30  ? 0.3488 0.3282 0.3763 0.0837  -0.0265 -0.0294 156 LEU A CD2   
160  N  N     . SER A 31  ? 0.3418 0.3272 0.3217 0.0536  -0.0209 -0.0147 157 SER A N     
161  C  CA    . SER A 31  ? 0.3265 0.3146 0.2964 0.0475  -0.0171 -0.0146 157 SER A CA    
162  C  C     . SER A 31  ? 0.2990 0.3012 0.2709 0.0457  -0.0134 -0.0137 157 SER A C     
163  O  O     . SER A 31  ? 0.2961 0.3042 0.2636 0.0439  -0.0082 -0.0157 157 SER A O     
164  C  CB    . SER A 31  ? 0.3604 0.3390 0.3215 0.0421  -0.0200 -0.0086 157 SER A CB    
165  O  OG    . SER A 31  ? 0.5059 0.4861 0.4676 0.0415  -0.0238 -0.0026 157 SER A OG    
166  N  N     . GLU A 32  ? 0.3270 0.3351 0.3061 0.0463  -0.0161 -0.0107 158 GLU A N     
167  C  CA    A GLU A 32  ? 0.3381 0.3591 0.3224 0.0439  -0.0123 -0.0102 158 GLU A CA    
168  C  CA    B GLU A 32  ? 0.3387 0.3598 0.3233 0.0441  -0.0124 -0.0102 158 GLU A CA    
169  C  C     . GLU A 32  ? 0.3284 0.3595 0.3194 0.0475  -0.0057 -0.0148 158 GLU A C     
170  O  O     . GLU A 32  ? 0.2856 0.3246 0.2757 0.0448  0.0004  -0.0140 158 GLU A O     
171  C  CB    A GLU A 32  ? 0.3378 0.3639 0.3304 0.0440  -0.0175 -0.0077 158 GLU A CB    
172  C  CB    B GLU A 32  ? 0.3426 0.3695 0.3368 0.0448  -0.0175 -0.0082 158 GLU A CB    
173  C  CG    A GLU A 32  ? 0.3768 0.3961 0.3598 0.0392  -0.0219 -0.0033 158 GLU A CG    
174  C  CG    B GLU A 32  ? 0.3586 0.3979 0.3610 0.0410  -0.0144 -0.0079 158 GLU A CG    
175  C  CD    A GLU A 32  ? 0.4051 0.4297 0.3936 0.0397  -0.0285 -0.0018 158 GLU A CD    
176  C  CD    B GLU A 32  ? 0.3566 0.4089 0.3732 0.0442  -0.0089 -0.0112 158 GLU A CD    
177  O  OE1   A GLU A 32  ? 0.3723 0.4051 0.3732 0.0442  -0.0311 -0.0036 158 GLU A OE1   
178  O  OE1   B GLU A 32  ? 0.3640 0.4167 0.3843 0.0502  -0.0081 -0.0145 158 GLU A OE1   
179  O  OE2   A GLU A 32  ? 0.3605 0.3817 0.3406 0.0359  -0.0314 0.0008  158 GLU A OE2   
180  O  OE2   B GLU A 32  ? 0.3285 0.3908 0.3539 0.0406  -0.0049 -0.0106 158 GLU A OE2   
181  N  N     . ALA A 33  ? 0.3416 0.3726 0.3393 0.0540  -0.0064 -0.0194 159 ALA A N     
182  C  CA    . ALA A 33  ? 0.3355 0.3771 0.3389 0.0581  0.0006  -0.0247 159 ALA A CA    
183  C  C     . ALA A 33  ? 0.3282 0.3692 0.3188 0.0567  0.0060  -0.0271 159 ALA A C     
184  O  O     . ALA A 33  ? 0.3302 0.3824 0.3201 0.0564  0.0134  -0.0271 159 ALA A O     
185  C  CB    . ALA A 33  ? 0.3934 0.4335 0.4066 0.0658  -0.0016 -0.0302 159 ALA A CB    
186  N  N     . LEU A 34  ? 0.3382 0.3670 0.3190 0.0559  0.0025  -0.0289 160 LEU A N     
187  C  CA    . LEU A 34  ? 0.3806 0.4097 0.3495 0.0550  0.0061  -0.0322 160 LEU A CA    
188  C  C     . LEU A 34  ? 0.3346 0.3680 0.2956 0.0492  0.0091  -0.0256 160 LEU A C     
189  O  O     . LEU A 34  ? 0.3225 0.3630 0.2758 0.0495  0.0142  -0.0265 160 LEU A O     
190  C  CB    . LEU A 34  ? 0.3677 0.3827 0.3311 0.0546  0.0009  -0.0359 160 LEU A CB    
191  C  CG    . LEU A 34  ? 0.3627 0.3718 0.3345 0.0607  -0.0013 -0.0434 160 LEU A CG    
192  C  CD1   . LEU A 34  ? 0.3861 0.3788 0.3567 0.0589  -0.0070 -0.0441 160 LEU A CD1   
193  C  CD2   . LEU A 34  ? 0.4235 0.4416 0.3936 0.0658  0.0039  -0.0531 160 LEU A CD2   
194  N  N     . GLU A 35  ? 0.2933 0.3230 0.2563 0.0444  0.0059  -0.0192 161 GLU A N     
195  C  CA    . GLU A 35  ? 0.3293 0.3618 0.2870 0.0392  0.0086  -0.0134 161 GLU A CA    
196  C  C     . GLU A 35  ? 0.3158 0.3613 0.2808 0.0393  0.0156  -0.0106 161 GLU A C     
197  O  O     . GLU A 35  ? 0.2890 0.3385 0.2491 0.0368  0.0203  -0.0063 161 GLU A O     
198  C  CB    . GLU A 35  ? 0.3990 0.4237 0.3568 0.0344  0.0033  -0.0088 161 GLU A CB    
199  C  CG    . GLU A 35  ? 0.4847 0.4975 0.4336 0.0329  -0.0012 -0.0097 161 GLU A CG    
200  C  CD    . GLU A 35  ? 0.5498 0.5554 0.4968 0.0285  -0.0054 -0.0051 161 GLU A CD    
201  O  OE1   . GLU A 35  ? 0.5757 0.5844 0.5287 0.0277  -0.0071 -0.0028 161 GLU A OE1   
202  O  OE2   . GLU A 35  ? 0.6174 0.6155 0.5572 0.0259  -0.0071 -0.0045 161 GLU A OE2   
203  N  N     . ILE A 36  ? 0.3353 0.3879 0.3130 0.0423  0.0167  -0.0126 162 ILE A N     
204  C  CA    . ILE A 36  ? 0.3484 0.4146 0.3346 0.0427  0.0248  -0.0105 162 ILE A CA    
205  C  C     . ILE A 36  ? 0.3676 0.4400 0.3438 0.0461  0.0320  -0.0120 162 ILE A C     
206  O  O     . ILE A 36  ? 0.3276 0.4070 0.3010 0.0443  0.0390  -0.0065 162 ILE A O     
207  C  CB    . ILE A 36  ? 0.3336 0.4075 0.3369 0.0462  0.0244  -0.0136 162 ILE A CB    
208  C  CG1   . ILE A 36  ? 0.3876 0.4585 0.4007 0.0428  0.0172  -0.0116 162 ILE A CG1   
209  C  CG2   . ILE A 36  ? 0.3600 0.4492 0.3731 0.0472  0.0344  -0.0123 162 ILE A CG2   
210  C  CD1   . ILE A 36  ? 0.4505 0.5259 0.4701 0.0363  0.0198  -0.0064 162 ILE A CD1   
211  N  N     . LEU A 37  ? 0.3003 0.3703 0.2707 0.0514  0.0303  -0.0196 163 LEU A N     
212  C  CA    . LEU A 37  ? 0.3242 0.4016 0.2836 0.0554  0.0364  -0.0230 163 LEU A CA    
213  C  C     . LEU A 37  ? 0.3200 0.3940 0.2638 0.0525  0.0360  -0.0192 163 LEU A C     
214  O  O     . LEU A 37  ? 0.3711 0.4543 0.3056 0.0544  0.0424  -0.0171 163 LEU A O     
215  C  CB    . LEU A 37  ? 0.3488 0.4235 0.3071 0.0616  0.0337  -0.0340 163 LEU A CB    
216  C  CG    . LEU A 37  ? 0.4107 0.4883 0.3855 0.0659  0.0335  -0.0382 163 LEU A CG    
217  C  CD1   . LEU A 37  ? 0.4091 0.4829 0.3831 0.0725  0.0314  -0.0497 163 LEU A CD1   
218  C  CD2   . LEU A 37  ? 0.3924 0.4866 0.3769 0.0673  0.0429  -0.0353 163 LEU A CD2   
219  N  N     . ALA A 38  ? 0.3152 0.3768 0.2556 0.0483  0.0286  -0.0179 164 ALA A N     
220  C  CA    . ALA A 38  ? 0.3046 0.3636 0.2327 0.0454  0.0277  -0.0140 164 ALA A CA    
221  C  C     . ALA A 38  ? 0.3033 0.3684 0.2330 0.0422  0.0337  -0.0038 164 ALA A C     
222  O  O     . ALA A 38  ? 0.3290 0.4002 0.2488 0.0434  0.0381  0.0001  164 ALA A O     
223  C  CB    . ALA A 38  ? 0.3055 0.3509 0.2327 0.0412  0.0196  -0.0143 164 ALA A CB    
224  N  N     . GLU A 39  ? 0.3198 0.3834 0.2627 0.0384  0.0337  0.0004  165 GLU A N     
225  C  CA    . GLU A 39  ? 0.3300 0.3981 0.2788 0.0347  0.0394  0.0093  165 GLU A CA    
226  C  C     . GLU A 39  ? 0.3433 0.4245 0.2921 0.0381  0.0495  0.0127  165 GLU A C     
227  O  O     . GLU A 39  ? 0.3602 0.4450 0.3035 0.0375  0.0550  0.0207  165 GLU A O     
228  C  CB    . GLU A 39  ? 0.3812 0.4472 0.3465 0.0307  0.0370  0.0101  165 GLU A CB    
229  C  CG    . GLU A 39  ? 0.4262 0.4930 0.4002 0.0255  0.0406  0.0176  165 GLU A CG    
230  C  CD    . GLU A 39  ? 0.4720 0.5385 0.4628 0.0219  0.0372  0.0158  165 GLU A CD    
231  O  OE1   . GLU A 39  ? 0.4373 0.5058 0.4339 0.0244  0.0334  0.0101  165 GLU A OE1   
232  O  OE2   . GLU A 39  ? 0.5000 0.5644 0.4987 0.0169  0.0378  0.0196  165 GLU A OE2   
233  N  N     . ALA A 40  ? 0.3239 0.4127 0.2786 0.0422  0.0524  0.0073  166 ALA A N     
234  C  CA    . ALA A 40  ? 0.3529 0.4556 0.3074 0.0458  0.0631  0.0102  166 ALA A CA    
235  C  C     . ALA A 40  ? 0.3978 0.5044 0.3316 0.0500  0.0656  0.0109  166 ALA A C     
236  O  O     . ALA A 40  ? 0.4327 0.5482 0.3615 0.0511  0.0744  0.0191  166 ALA A O     
237  C  CB    . ALA A 40  ? 0.3576 0.4681 0.3221 0.0504  0.0651  0.0024  166 ALA A CB    
238  N  N     . ALA A 41  ? 0.3339 0.4343 0.2559 0.0526  0.0581  0.0023  167 ALA A N     
239  C  CA    . ALA A 41  ? 0.3577 0.4623 0.2600 0.0565  0.0585  0.0014  167 ALA A CA    
240  C  C     . ALA A 41  ? 0.3719 0.4751 0.2681 0.0533  0.0598  0.0132  167 ALA A C     
241  O  O     . ALA A 41  ? 0.4149 0.5276 0.2991 0.0567  0.0657  0.0192  167 ALA A O     
242  C  CB    . ALA A 41  ? 0.3839 0.4802 0.2788 0.0580  0.0488  -0.0101 167 ALA A CB    
243  N  N     . GLY A 42  ? 0.4104 0.5022 0.3146 0.0472  0.0545  0.0169  168 GLY A N     
244  C  CA    . GLY A 42  ? 0.4492 0.5385 0.3504 0.0443  0.0557  0.0277  168 GLY A CA    
245  C  C     . GLY A 42  ? 0.4647 0.5621 0.3721 0.0439  0.0666  0.0393  168 GLY A C     
246  O  O     . GLY A 42  ? 0.4920 0.5937 0.3900 0.0458  0.0709  0.0486  168 GLY A O     
247  N  N     . PHE A 43  ? 0.4025 0.5024 0.3267 0.0416  0.0712  0.0395  169 PHE A N     
248  C  CA    . PHE A 43  ? 0.4482 0.5562 0.3819 0.0405  0.0825  0.0504  169 PHE A CA    
249  C  C     . PHE A 43  ? 0.5324 0.6540 0.4514 0.0471  0.0914  0.0544  169 PHE A C     
250  O  O     . PHE A 43  ? 0.5866 0.7141 0.5077 0.0468  0.1013  0.0669  169 PHE A O     
251  C  CB    . PHE A 43  ? 0.4102 0.5211 0.3659 0.0373  0.0853  0.0474  169 PHE A CB    
252  C  CG    . PHE A 43  ? 0.4026 0.5025 0.3733 0.0309  0.0776  0.0448  169 PHE A CG    
253  C  CD1   . PHE A 43  ? 0.4122 0.5009 0.3791 0.0274  0.0720  0.0478  169 PHE A CD1   
254  C  CD2   . PHE A 43  ? 0.4042 0.5061 0.3927 0.0289  0.0760  0.0389  169 PHE A CD2   
255  C  CE1   . PHE A 43  ? 0.4073 0.4872 0.3865 0.0220  0.0654  0.0445  169 PHE A CE1   
256  C  CE2   . PHE A 43  ? 0.3849 0.4784 0.3853 0.0236  0.0685  0.0359  169 PHE A CE2   
257  C  CZ    . PHE A 43  ? 0.3953 0.4777 0.3902 0.0201  0.0634  0.0386  169 PHE A CZ    
258  N  N     . GLU A 44  ? 0.4119 0.5386 0.3165 0.0531  0.0884  0.0441  170 GLU A N     
259  C  CA    . GLU A 44  ? 0.4636 0.6045 0.3512 0.0602  0.0961  0.0460  170 GLU A CA    
260  C  C     . GLU A 44  ? 0.4719 0.6129 0.3368 0.0641  0.0909  0.0470  170 GLU A C     
261  O  O     . GLU A 44  ? 0.4978 0.6512 0.3450 0.0709  0.0956  0.0475  170 GLU A O     
262  C  CB    . GLU A 44  ? 0.4670 0.6158 0.3539 0.0652  0.0970  0.0325  170 GLU A CB    
263  C  CG    . GLU A 44  ? 0.5974 0.7479 0.5080 0.0622  0.1013  0.0309  170 GLU A CG    
264  C  CD    . GLU A 44  ? 0.6857 0.8423 0.6099 0.0584  0.1129  0.0454  170 GLU A CD    
265  O  OE1   . GLU A 44  ? 0.7182 0.8866 0.6323 0.0621  0.1237  0.0539  170 GLU A OE1   
266  O  OE2   . GLU A 44  ? 0.6671 0.8168 0.6121 0.0516  0.1113  0.0483  170 GLU A OE2   
267  N  N     . GLY A 45  ? 0.5948 0.7235 0.4597 0.0604  0.0814  0.0471  171 GLY A N     
268  C  CA    . GLY A 45  ? 0.6233 0.7529 0.4695 0.0639  0.0759  0.0484  171 GLY A CA    
269  C  C     . GLY A 45  ? 0.5838 0.7141 0.4176 0.0677  0.0666  0.0327  171 GLY A C     
270  O  O     . GLY A 45  ? 0.6275 0.7614 0.4456 0.0712  0.0616  0.0320  171 GLY A O     
271  N  N     A SER A 46  ? 0.5347 0.6620 0.3765 0.0672  0.0639  0.0198  172 SER A N     
272  N  N     B SER A 46  ? 0.5348 0.6619 0.3770 0.0670  0.0638  0.0199  172 SER A N     
273  C  CA    A SER A 46  ? 0.5164 0.6430 0.3495 0.0704  0.0554  0.0041  172 SER A CA    
274  C  CA    B SER A 46  ? 0.5153 0.6416 0.3492 0.0702  0.0554  0.0040  172 SER A CA    
275  C  C     A SER A 46  ? 0.4665 0.5775 0.3085 0.0645  0.0450  -0.0001 172 SER A C     
276  C  C     B SER A 46  ? 0.4676 0.5784 0.3099 0.0644  0.0448  -0.0002 172 SER A C     
277  O  O     A SER A 46  ? 0.4451 0.5469 0.3004 0.0612  0.0420  -0.0061 172 SER A O     
278  O  O     B SER A 46  ? 0.4464 0.5477 0.3019 0.0611  0.0416  -0.0063 172 SER A O     
279  C  CB    A SER A 46  ? 0.5381 0.6696 0.3753 0.0740  0.0585  -0.0075 172 SER A CB    
280  C  CB    B SER A 46  ? 0.5358 0.6665 0.3749 0.0735  0.0587  -0.0071 172 SER A CB    
281  O  OG    A SER A 46  ? 0.5204 0.6508 0.3500 0.0773  0.0506  -0.0231 172 SER A OG    
282  O  OG    B SER A 46  ? 0.5566 0.7028 0.3888 0.0787  0.0699  -0.0026 172 SER A OG    
283  N  N     . GLU A 47  ? 0.4651 0.5739 0.2995 0.0635  0.0396  0.0036  173 GLU A N     
284  C  CA    . GLU A 47  ? 0.4772 0.5728 0.3193 0.0580  0.0306  0.0003  173 GLU A CA    
285  C  C     . GLU A 47  ? 0.4102 0.5015 0.2524 0.0587  0.0231  -0.0155 173 GLU A C     
286  O  O     . GLU A 47  ? 0.3550 0.4340 0.2080 0.0537  0.0177  -0.0189 173 GLU A O     
287  C  CB    . GLU A 47  ? 0.5671 0.6637 0.4017 0.0578  0.0270  0.0075  173 GLU A CB    
288  C  CG    . GLU A 47  ? 0.6813 0.7650 0.5258 0.0516  0.0199  0.0070  173 GLU A CG    
289  C  CD    . GLU A 47  ? 0.7628 0.8376 0.6211 0.0460  0.0237  0.0163  173 GLU A CD    
290  O  OE1   . GLU A 47  ? 0.7905 0.8682 0.6534 0.0462  0.0313  0.0223  173 GLU A OE1   
291  O  OE2   . GLU A 47  ? 0.8037 0.8692 0.6689 0.0413  0.0192  0.0170  173 GLU A OE2   
292  N  N     . GLY A 48  ? 0.4519 0.5532 0.2828 0.0647  0.0227  -0.0252 174 GLY A N     
293  C  CA    . GLY A 48  ? 0.4246 0.5210 0.2581 0.0653  0.0158  -0.0412 174 GLY A CA    
294  C  C     . GLY A 48  ? 0.3845 0.4723 0.2324 0.0639  0.0175  -0.0460 174 GLY A C     
295  O  O     . GLY A 48  ? 0.3968 0.4723 0.2547 0.0604  0.0115  -0.0524 174 GLY A O     
296  N  N     A ARG A 49  ? 0.3918 0.4865 0.2417 0.0668  0.0259  -0.0426 175 ARG A N     
297  N  N     B ARG A 49  ? 0.3982 0.4928 0.2481 0.0668  0.0259  -0.0424 175 ARG A N     
298  C  CA    A ARG A 49  ? 0.4127 0.5007 0.2776 0.0662  0.0272  -0.0462 175 ARG A CA    
299  C  CA    B ARG A 49  ? 0.4099 0.4978 0.2747 0.0662  0.0272  -0.0462 175 ARG A CA    
300  C  C     A ARG A 49  ? 0.3692 0.4444 0.2472 0.0592  0.0247  -0.0377 175 ARG A C     
301  C  C     B ARG A 49  ? 0.3749 0.4503 0.2531 0.0593  0.0248  -0.0377 175 ARG A C     
302  O  O     A ARG A 49  ? 0.3850 0.4496 0.2740 0.0575  0.0205  -0.0423 175 ARG A O     
303  O  O     B ARG A 49  ? 0.3813 0.4462 0.2706 0.0576  0.0208  -0.0422 175 ARG A O     
304  C  CB    A ARG A 49  ? 0.4261 0.5264 0.2917 0.0708  0.0372  -0.0439 175 ARG A CB    
305  C  CB    B ARG A 49  ? 0.4232 0.5237 0.2884 0.0709  0.0372  -0.0443 175 ARG A CB    
306  C  CG    A ARG A 49  ? 0.4446 0.5586 0.2963 0.0785  0.0406  -0.0536 175 ARG A CG    
307  C  CG    B ARG A 49  ? 0.4403 0.5539 0.2922 0.0787  0.0400  -0.0549 175 ARG A CG    
308  C  CD    A ARG A 49  ? 0.4273 0.5553 0.2794 0.0828  0.0523  -0.0492 175 ARG A CD    
309  C  CD    B ARG A 49  ? 0.4330 0.5609 0.2847 0.0833  0.0516  -0.0510 175 ARG A CD    
310  N  NE    A ARG A 49  ? 0.4489 0.5752 0.3164 0.0848  0.0543  -0.0568 175 ARG A NE    
311  N  NE    B ARG A 49  ? 0.4411 0.5811 0.2817 0.0913  0.0545  -0.0639 175 ARG A NE    
312  C  CZ    A ARG A 49  ? 0.4534 0.5773 0.3379 0.0819  0.0579  -0.0498 175 ARG A CZ    
313  C  CZ    B ARG A 49  ? 0.4952 0.6476 0.3153 0.0961  0.0557  -0.0658 175 ARG A CZ    
314  N  NH1   A ARG A 49  ? 0.4028 0.5249 0.2920 0.0761  0.0601  -0.0356 175 ARG A NH1   
315  N  NH1   B ARG A 49  ? 0.4956 0.6494 0.3045 0.0938  0.0541  -0.0546 175 ARG A NH1   
316  N  NH2   A ARG A 49  ? 0.3979 0.5214 0.2961 0.0850  0.0587  -0.0579 175 ARG A NH2   
317  N  NH2   B ARG A 49  ? 0.5070 0.6708 0.3174 0.1037  0.0583  -0.0793 175 ARG A NH2   
318  N  N     . LEU A 50  ? 0.3655 0.4417 0.2425 0.0557  0.0272  -0.0253 176 LEU A N     
319  C  CA    . LEU A 50  ? 0.3323 0.3974 0.2202 0.0492  0.0244  -0.0186 176 LEU A CA    
320  C  C     . LEU A 50  ? 0.3250 0.3781 0.2143 0.0461  0.0157  -0.0243 176 LEU A C     
321  O  O     . LEU A 50  ? 0.3130 0.3560 0.2121 0.0431  0.0125  -0.0247 176 LEU A O     
322  C  CB    . LEU A 50  ? 0.3560 0.4235 0.2418 0.0462  0.0277  -0.0063 176 LEU A CB    
323  C  CG    . LEU A 50  ? 0.3945 0.4511 0.2900 0.0397  0.0244  -0.0007 176 LEU A CG    
324  C  CD1   . LEU A 50  ? 0.3875 0.4475 0.2885 0.0373  0.0306  0.0105  176 LEU A CD1   
325  C  CD2   . LEU A 50  ? 0.3851 0.4345 0.2758 0.0370  0.0177  -0.0018 176 LEU A CD2   
326  N  N     . LEU A 51  ? 0.3397 0.3943 0.2193 0.0467  0.0119  -0.0280 177 LEU A N     
327  C  CA    . LEU A 51  ? 0.3564 0.4005 0.2393 0.0431  0.0045  -0.0330 177 LEU A CA    
328  C  C     . LEU A 51  ? 0.3261 0.3626 0.2165 0.0442  0.0015  -0.0432 177 LEU A C     
329  O  O     . LEU A 51  ? 0.3292 0.3536 0.2281 0.0403  -0.0022 -0.0428 177 LEU A O     
330  C  CB    . LEU A 51  ? 0.3794 0.4289 0.2524 0.0440  0.0006  -0.0367 177 LEU A CB    
331  C  CG    . LEU A 51  ? 0.4619 0.5122 0.3323 0.0409  -0.0002 -0.0272 177 LEU A CG    
332  C  CD1   . LEU A 51  ? 0.4742 0.5330 0.3347 0.0435  -0.0046 -0.0322 177 LEU A CD1   
333  C  CD2   . LEU A 51  ? 0.4135 0.4511 0.2942 0.0344  -0.0033 -0.0242 177 LEU A CD2   
334  N  N     . THR A 52  ? 0.3365 0.3797 0.2238 0.0500  0.0033  -0.0521 178 THR A N     
335  C  CA    . THR A 52  ? 0.3492 0.3844 0.2454 0.0517  0.0005  -0.0623 178 THR A CA    
336  C  C     . THR A 52  ? 0.3798 0.4069 0.2881 0.0505  0.0017  -0.0568 178 THR A C     
337  O  O     . THR A 52  ? 0.3629 0.3773 0.2801 0.0483  -0.0025 -0.0582 178 THR A O     
338  C  CB    . THR A 52  ? 0.3966 0.4420 0.2874 0.0589  0.0031  -0.0737 178 THR A CB    
339  O  OG1   . THR A 52  ? 0.4132 0.4637 0.2943 0.0600  -0.0009 -0.0823 178 THR A OG1   
340  C  CG2   . THR A 52  ? 0.3915 0.4287 0.2945 0.0618  0.0019  -0.0830 178 THR A CG2   
341  N  N     . PHE A 53  ? 0.3542 0.3893 0.2636 0.0520  0.0075  -0.0500 179 PHE A N     
342  C  CA    . PHE A 53  ? 0.3245 0.3543 0.2460 0.0512  0.0077  -0.0452 179 PHE A CA    
343  C  C     . PHE A 53  ? 0.3224 0.3415 0.2467 0.0449  0.0034  -0.0374 179 PHE A C     
344  O  O     . PHE A 53  ? 0.3287 0.3385 0.2613 0.0441  0.0000  -0.0366 179 PHE A O     
345  C  CB    . PHE A 53  ? 0.3205 0.3623 0.2444 0.0530  0.0148  -0.0397 179 PHE A CB    
346  C  CG    . PHE A 53  ? 0.3408 0.3929 0.2655 0.0599  0.0198  -0.0472 179 PHE A CG    
347  C  CD1   . PHE A 53  ? 0.4347 0.4820 0.3676 0.0642  0.0175  -0.0565 179 PHE A CD1   
348  C  CD2   . PHE A 53  ? 0.3737 0.4403 0.2910 0.0623  0.0274  -0.0448 179 PHE A CD2   
349  C  CE1   . PHE A 53  ? 0.4506 0.5080 0.3847 0.0710  0.0227  -0.0645 179 PHE A CE1   
350  C  CE2   . PHE A 53  ? 0.3910 0.4684 0.3081 0.0689  0.0331  -0.0519 179 PHE A CE2   
351  C  CZ    . PHE A 53  ? 0.4102 0.4834 0.3360 0.0734  0.0307  -0.0625 179 PHE A CZ    
352  N  N     . CYS A 54  ? 0.3089 0.3299 0.2263 0.0408  0.0037  -0.0315 180 CYS A N     
353  C  CA    . CYS A 54  ? 0.3323 0.3441 0.2514 0.0351  0.0003  -0.0253 180 CYS A CA    
354  C  C     . CYS A 54  ? 0.3444 0.3445 0.2656 0.0334  -0.0051 -0.0298 180 CYS A C     
355  O  O     . CYS A 54  ? 0.3027 0.2935 0.2289 0.0308  -0.0077 -0.0259 180 CYS A O     
356  C  CB    . CYS A 54  ? 0.4261 0.4423 0.3382 0.0319  0.0017  -0.0196 180 CYS A CB    
357  S  SG    . CYS A 54  ? 0.5468 0.5712 0.4611 0.0309  0.0076  -0.0102 180 CYS A SG    
358  N  N     . ARG A 55  ? 0.3124 0.3132 0.2301 0.0347  -0.0067 -0.0378 181 ARG A N     
359  C  CA    . ARG A 55  ? 0.3172 0.3067 0.2397 0.0324  -0.0113 -0.0426 181 ARG A CA    
360  C  C     . ARG A 55  ? 0.3401 0.3206 0.2721 0.0352  -0.0125 -0.0454 181 ARG A C     
361  O  O     . ARG A 55  ? 0.3451 0.3136 0.2832 0.0324  -0.0152 -0.0424 181 ARG A O     
362  C  CB    . ARG A 55  ? 0.3252 0.3188 0.2436 0.0335  -0.0134 -0.0526 181 ARG A CB    
363  C  CG    . ARG A 55  ? 0.3214 0.3225 0.2318 0.0309  -0.0139 -0.0496 181 ARG A CG    
364  C  CD    . ARG A 55  ? 0.3828 0.3926 0.2872 0.0341  -0.0161 -0.0604 181 ARG A CD    
365  N  NE    . ARG A 55  ? 0.3473 0.3659 0.2437 0.0329  -0.0171 -0.0572 181 ARG A NE    
366  C  CZ    . ARG A 55  ? 0.3679 0.3982 0.2554 0.0367  -0.0189 -0.0640 181 ARG A CZ    
367  N  NH1   . ARG A 55  ? 0.3915 0.4263 0.2764 0.0417  -0.0193 -0.0754 181 ARG A NH1   
368  N  NH2   . ARG A 55  ? 0.3997 0.4379 0.2807 0.0361  -0.0204 -0.0596 181 ARG A NH2   
369  N  N     . ALA A 56  ? 0.3276 0.3140 0.2614 0.0411  -0.0103 -0.0509 182 ALA A N     
370  C  CA    . ALA A 56  ? 0.3515 0.3300 0.2959 0.0448  -0.0115 -0.0535 182 ALA A CA    
371  C  C     . ALA A 56  ? 0.3393 0.3125 0.2882 0.0431  -0.0125 -0.0427 182 ALA A C     
372  O  O     . ALA A 56  ? 0.3759 0.3370 0.3319 0.0431  -0.0156 -0.0406 182 ALA A O     
373  C  CB    . ALA A 56  ? 0.3388 0.3272 0.2847 0.0518  -0.0079 -0.0608 182 ALA A CB    
374  N  N     . ALA A 57  ? 0.3200 0.3021 0.2649 0.0417  -0.0100 -0.0358 183 ALA A N     
375  C  CA    . ALA A 57  ? 0.3123 0.2911 0.2604 0.0399  -0.0117 -0.0268 183 ALA A CA    
376  C  C     . ALA A 57  ? 0.3283 0.2958 0.2740 0.0348  -0.0150 -0.0218 183 ALA A C     
377  O  O     . ALA A 57  ? 0.3180 0.2774 0.2675 0.0351  -0.0179 -0.0169 183 ALA A O     
378  C  CB    . ALA A 57  ? 0.3537 0.3438 0.2989 0.0380  -0.0085 -0.0217 183 ALA A CB    
379  N  N     . SER A 58  ? 0.3807 0.3483 0.3201 0.0304  -0.0144 -0.0223 184 SER A N     
380  C  CA    A SER A 58  ? 0.3573 0.3158 0.2951 0.0252  -0.0163 -0.0173 184 SER A CA    
381  C  CA    B SER A 58  ? 0.3563 0.3149 0.2941 0.0252  -0.0163 -0.0173 184 SER A CA    
382  C  C     . SER A 58  ? 0.3204 0.2660 0.2650 0.0255  -0.0187 -0.0194 184 SER A C     
383  O  O     . SER A 58  ? 0.3233 0.2599 0.2689 0.0228  -0.0199 -0.0127 184 SER A O     
384  C  CB    A SER A 58  ? 0.3601 0.3232 0.2919 0.0210  -0.0151 -0.0183 184 SER A CB    
385  C  CB    B SER A 58  ? 0.3430 0.3060 0.2748 0.0209  -0.0151 -0.0182 184 SER A CB    
386  O  OG    A SER A 58  ? 0.3361 0.2926 0.2670 0.0159  -0.0159 -0.0130 184 SER A OG    
387  O  OG    B SER A 58  ? 0.4370 0.4005 0.3696 0.0218  -0.0158 -0.0268 184 SER A OG    
388  N  N     . VAL A 59  ? 0.3277 0.2720 0.2774 0.0289  -0.0191 -0.0287 185 VAL A N     
389  C  CA    . VAL A 59  ? 0.3393 0.2700 0.2986 0.0295  -0.0212 -0.0314 185 VAL A CA    
390  C  C     . VAL A 59  ? 0.3683 0.2913 0.3325 0.0326  -0.0226 -0.0235 185 VAL A C     
391  O  O     . VAL A 59  ? 0.3641 0.2748 0.3326 0.0307  -0.0239 -0.0174 185 VAL A O     
392  C  CB    . VAL A 59  ? 0.3550 0.2871 0.3196 0.0337  -0.0215 -0.0447 185 VAL A CB    
393  C  CG1   . VAL A 59  ? 0.3748 0.2919 0.3526 0.0360  -0.0235 -0.0476 185 VAL A CG1   
394  C  CG2   . VAL A 59  ? 0.4077 0.3452 0.3682 0.0303  -0.0218 -0.0525 185 VAL A CG2   
395  N  N     . LEU A 60  ? 0.3403 0.2714 0.3046 0.0377  -0.0224 -0.0231 186 LEU A N     
396  C  CA    . LEU A 60  ? 0.3841 0.3104 0.3533 0.0416  -0.0247 -0.0160 186 LEU A CA    
397  C  C     . LEU A 60  ? 0.3771 0.3014 0.3392 0.0377  -0.0260 -0.0045 186 LEU A C     
398  O  O     . LEU A 60  ? 0.3662 0.2816 0.3307 0.0394  -0.0285 0.0031  186 LEU A O     
399  C  CB    . LEU A 60  ? 0.4035 0.3418 0.3755 0.0473  -0.0241 -0.0187 186 LEU A CB    
400  C  CG    . LEU A 60  ? 0.4450 0.3874 0.4235 0.0525  -0.0221 -0.0303 186 LEU A CG    
401  C  CD1   . LEU A 60  ? 0.4455 0.4005 0.4286 0.0580  -0.0207 -0.0314 186 LEU A CD1   
402  C  CD2   . LEU A 60  ? 0.4881 0.4160 0.4770 0.0557  -0.0241 -0.0345 186 LEU A CD2   
403  N  N     . LYS A 61  ? 0.3312 0.2641 0.2843 0.0330  -0.0242 -0.0029 187 LYS A N     
404  C  CA    . LYS A 61  ? 0.3765 0.3082 0.3223 0.0292  -0.0249 0.0063  187 LYS A CA    
405  C  C     . LYS A 61  ? 0.3550 0.2740 0.3007 0.0255  -0.0246 0.0111  187 LYS A C     
406  O  O     . LYS A 61  ? 0.3423 0.2576 0.2830 0.0242  -0.0253 0.0200  187 LYS A O     
407  C  CB    . LYS A 61  ? 0.3465 0.2886 0.2848 0.0248  -0.0225 0.0056  187 LYS A CB    
408  C  CG    . LYS A 61  ? 0.3985 0.3533 0.3380 0.0272  -0.0213 0.0017  187 LYS A CG    
409  C  CD    . LYS A 61  ? 0.3785 0.3411 0.3119 0.0227  -0.0189 0.0027  187 LYS A CD    
410  C  CE    . LYS A 61  ? 0.4625 0.4367 0.3985 0.0244  -0.0162 -0.0008 187 LYS A CE    
411  N  NZ    . LYS A 61  ? 0.4746 0.4546 0.4061 0.0203  -0.0132 0.0004  187 LYS A NZ    
412  N  N     . ALA A 62  ? 0.3510 0.2639 0.3024 0.0235  -0.0234 0.0050  188 ALA A N     
413  C  CA    . ALA A 62  ? 0.4540 0.3553 0.4083 0.0189  -0.0223 0.0088  188 ALA A CA    
414  C  C     . ALA A 62  ? 0.3875 0.2743 0.3517 0.0220  -0.0237 0.0123  188 ALA A C     
415  O  O     . ALA A 62  ? 0.3743 0.2501 0.3427 0.0181  -0.0221 0.0173  188 ALA A O     
416  C  CB    . ALA A 62  ? 0.4237 0.3266 0.3813 0.0146  -0.0209 -0.0003 188 ALA A CB    
417  N  N     . LEU A 63  ? 0.4056 0.2919 0.3750 0.0290  -0.0261 0.0101  189 LEU A N     
418  C  CA    . LEU A 63  ? 0.4145 0.2863 0.3948 0.0329  -0.0275 0.0136  189 LEU A CA    
419  C  C     . LEU A 63  ? 0.3935 0.2593 0.3683 0.0338  -0.0285 0.0289  189 LEU A C     
420  O  O     . LEU A 63  ? 0.3867 0.2625 0.3500 0.0342  -0.0296 0.0343  189 LEU A O     
421  C  CB    . LEU A 63  ? 0.4110 0.2852 0.3992 0.0410  -0.0298 0.0064  189 LEU A CB    
422  C  CG    . LEU A 63  ? 0.3843 0.2626 0.3787 0.0416  -0.0286 -0.0092 189 LEU A CG    
423  C  CD1   . LEU A 63  ? 0.3929 0.2763 0.3939 0.0500  -0.0298 -0.0155 189 LEU A CD1   
424  C  CD2   . LEU A 63  ? 0.3959 0.2601 0.4015 0.0385  -0.0280 -0.0145 189 LEU A CD2   
425  N  N     . PRO A 64  ? 0.4100 0.2598 0.3930 0.0345  -0.0282 0.0362  190 PRO A N     
426  C  CA    . PRO A 64  ? 0.4227 0.2671 0.3987 0.0358  -0.0288 0.0524  190 PRO A CA    
427  C  C     . PRO A 64  ? 0.4291 0.2736 0.4059 0.0452  -0.0337 0.0584  190 PRO A C     
428  O  O     . PRO A 64  ? 0.4406 0.2814 0.4105 0.0475  -0.0350 0.0722  190 PRO A O     
429  C  CB    . PRO A 64  ? 0.4384 0.2647 0.4250 0.0319  -0.0253 0.0580  190 PRO A CB    
430  C  CG    . PRO A 64  ? 0.4930 0.3123 0.4970 0.0338  -0.0261 0.0449  190 PRO A CG    
431  C  CD    . PRO A 64  ? 0.4729 0.3086 0.4719 0.0331  -0.0269 0.0302  190 PRO A CD    
432  N  N     . SER A 65  ? 0.4392 0.2889 0.4244 0.0510  -0.0365 0.0486  191 SER A N     
433  C  CA    . SER A 65  ? 0.4318 0.2829 0.4206 0.0605  -0.0415 0.0533  191 SER A CA    
434  C  C     . SER A 65  ? 0.4200 0.2835 0.4154 0.0647  -0.0429 0.0398  191 SER A C     
435  O  O     . SER A 65  ? 0.4095 0.2777 0.4066 0.0608  -0.0396 0.0277  191 SER A O     
436  C  CB    . SER A 65  ? 0.4532 0.2851 0.4551 0.0654  -0.0424 0.0609  191 SER A CB    
437  O  OG    . SER A 65  ? 0.4549 0.2791 0.4728 0.0659  -0.0406 0.0483  191 SER A OG    
438  N  N     . PRO A 66  ? 0.4223 0.2925 0.4215 0.0729  -0.0475 0.0417  192 PRO A N     
439  C  CA    . PRO A 66  ? 0.4112 0.2952 0.4174 0.0767  -0.0477 0.0295  192 PRO A CA    
440  C  C     . PRO A 66  ? 0.4169 0.2931 0.4384 0.0801  -0.0455 0.0185  192 PRO A C     
441  O  O     . PRO A 66  ? 0.4330 0.2932 0.4653 0.0840  -0.0465 0.0217  192 PRO A O     
442  C  CB    . PRO A 66  ? 0.4151 0.3074 0.4238 0.0848  -0.0538 0.0358  192 PRO A CB    
443  C  CG    . PRO A 66  ? 0.4238 0.3116 0.4202 0.0836  -0.0569 0.0505  192 PRO A CG    
444  C  CD    . PRO A 66  ? 0.4344 0.3032 0.4303 0.0789  -0.0528 0.0554  192 PRO A CD    
445  N  N     . VAL A 67  ? 0.4051 0.2926 0.4274 0.0788  -0.0422 0.0054  193 VAL A N     
446  C  CA    . VAL A 67  ? 0.4105 0.2955 0.4465 0.0838  -0.0404 -0.0072 193 VAL A CA    
447  C  C     . VAL A 67  ? 0.4154 0.3058 0.4635 0.0940  -0.0436 -0.0069 193 VAL A C     
448  O  O     . VAL A 67  ? 0.4052 0.3124 0.4510 0.0958  -0.0445 -0.0067 193 VAL A O     
449  C  CB    . VAL A 67  ? 0.3980 0.2960 0.4289 0.0801  -0.0356 -0.0203 193 VAL A CB    
450  C  CG1   . VAL A 67  ? 0.4045 0.3035 0.4480 0.0866  -0.0335 -0.0344 193 VAL A CG1   
451  C  CG2   . VAL A 67  ? 0.3951 0.2873 0.4168 0.0710  -0.0334 -0.0212 193 VAL A CG2   
452  N  N     . THR A 68  ? 0.4649 0.3410 0.5276 0.1006  -0.0453 -0.0069 194 THR A N     
453  C  CA    . THR A 68  ? 0.5158 0.3961 0.5927 0.1114  -0.0485 -0.0072 194 THR A CA    
454  C  C     . THR A 68  ? 0.5539 0.4345 0.6459 0.1173  -0.0452 -0.0230 194 THR A C     
455  O  O     . THR A 68  ? 0.5496 0.4402 0.6530 0.1257  -0.0462 -0.0267 194 THR A O     
456  C  CB    . THR A 68  ? 0.5481 0.4124 0.6317 0.1169  -0.0539 0.0070  194 THR A CB    
457  O  OG1   . THR A 68  ? 0.5437 0.3861 0.6320 0.1138  -0.0518 0.0077  194 THR A OG1   
458  C  CG2   . THR A 68  ? 0.6342 0.5035 0.7024 0.1139  -0.0580 0.0223  194 THR A CG2   
459  N  N     . THR A 69  ? 0.5597 0.4309 0.6528 0.1133  -0.0414 -0.0333 195 THR A N     
460  C  CA    . THR A 69  ? 0.6011 0.4716 0.7079 0.1192  -0.0385 -0.0497 195 THR A CA    
461  C  C     . THR A 69  ? 0.5240 0.4004 0.6212 0.1125  -0.0336 -0.0632 195 THR A C     
462  O  O     . THR A 69  ? 0.4871 0.3594 0.5723 0.1034  -0.0333 -0.0596 195 THR A O     
463  C  CB    . THR A 69  ? 0.6093 0.4568 0.7344 0.1245  -0.0406 -0.0497 195 THR A CB    
464  O  OG1   . THR A 69  ? 0.6400 0.4707 0.7617 0.1161  -0.0401 -0.0476 195 THR A OG1   
465  C  CG2   . THR A 69  ? 0.6435 0.4849 0.7762 0.1315  -0.0461 -0.0336 195 THR A CG2   
466  N  N     . LEU A 70  ? 0.5352 0.4226 0.6375 0.1176  -0.0298 -0.0788 196 LEU A N     
467  C  CA    . LEU A 70  ? 0.5895 0.4862 0.6807 0.1127  -0.0253 -0.0918 196 LEU A CA    
468  C  C     . LEU A 70  ? 0.5538 0.4335 0.6468 0.1075  -0.0264 -0.0982 196 LEU A C     
469  O  O     . LEU A 70  ? 0.5337 0.4182 0.6136 0.1001  -0.0250 -0.1021 196 LEU A O     
470  C  CB    . LEU A 70  ? 0.7115 0.6225 0.8086 0.1207  -0.0207 -0.1074 196 LEU A CB    
471  C  CG    . LEU A 70  ? 0.7991 0.7275 0.8806 0.1172  -0.0153 -0.1180 196 LEU A CG    
472  C  CD1   . LEU A 70  ? 0.7810 0.7250 0.8474 0.1118  -0.0136 -0.1062 196 LEU A CD1   
473  C  CD2   . LEU A 70  ? 0.8365 0.7772 0.9249 0.1261  -0.0101 -0.1341 196 LEU A CD2   
474  N  N     . SER A 71  ? 0.5912 0.4510 0.7017 0.1112  -0.0289 -0.0991 197 SER A N     
475  C  CA    . SER A 71  ? 0.6504 0.4933 0.7668 0.1058  -0.0298 -0.1060 197 SER A CA    
476  C  C     . SER A 71  ? 0.5756 0.4133 0.6801 0.0949  -0.0311 -0.0933 197 SER A C     
477  O  O     . SER A 71  ? 0.5791 0.4108 0.6833 0.0881  -0.0310 -0.1005 197 SER A O     
478  C  CB    . SER A 71  ? 0.7311 0.5518 0.8710 0.1117  -0.0320 -0.1063 197 SER A CB    
479  O  OG    . SER A 71  ? 0.7439 0.5530 0.8862 0.1117  -0.0350 -0.0854 197 SER A OG    
480  N  N     . GLN A 72  ? 0.5789 0.4198 0.6742 0.0932  -0.0323 -0.0753 198 GLN A N     
481  C  CA    . GLN A 72  ? 0.5637 0.4015 0.6468 0.0834  -0.0328 -0.0634 198 GLN A CA    
482  C  C     . GLN A 72  ? 0.5352 0.3887 0.6021 0.0766  -0.0305 -0.0706 198 GLN A C     
483  O  O     . GLN A 72  ? 0.5268 0.3776 0.5857 0.0682  -0.0306 -0.0643 198 GLN A O     
484  C  CB    . GLN A 72  ? 0.5580 0.3981 0.6337 0.0843  -0.0348 -0.0443 198 GLN A CB    
485  C  CG    . GLN A 72  ? 0.5934 0.4153 0.6828 0.0896  -0.0377 -0.0328 198 GLN A CG    
486  C  CD    . GLN A 72  ? 0.5617 0.3906 0.6451 0.0941  -0.0408 -0.0176 198 GLN A CD    
487  O  OE1   . GLN A 72  ? 0.4878 0.3356 0.5612 0.0948  -0.0408 -0.0184 198 GLN A OE1   
488  N  NE2   . GLN A 72  ? 0.6135 0.4272 0.7037 0.0975  -0.0437 -0.0035 198 GLN A NE2   
489  N  N     . LEU A 73  ? 0.5187 0.3887 0.5808 0.0805  -0.0283 -0.0831 199 LEU A N     
490  C  CA    . LEU A 73  ? 0.5256 0.4101 0.5727 0.0751  -0.0262 -0.0899 199 LEU A CA    
491  C  C     . LEU A 73  ? 0.5752 0.4546 0.6268 0.0725  -0.0268 -0.1055 199 LEU A C     
492  O  O     . LEU A 73  ? 0.5121 0.4006 0.5519 0.0670  -0.0264 -0.1096 199 LEU A O     
493  C  CB    . LEU A 73  ? 0.5075 0.4128 0.5463 0.0803  -0.0228 -0.0951 199 LEU A CB    
494  C  CG    . LEU A 73  ? 0.4659 0.3805 0.5004 0.0819  -0.0222 -0.0817 199 LEU A CG    
495  C  CD1   . LEU A 73  ? 0.5064 0.4416 0.5353 0.0862  -0.0176 -0.0880 199 LEU A CD1   
496  C  CD2   . LEU A 73  ? 0.4324 0.3471 0.4549 0.0738  -0.0234 -0.0678 199 LEU A CD2   
497  N  N     . GLN A 74  ? 0.5493 0.4145 0.6185 0.0765  -0.0280 -0.1148 200 GLN A N     
498  C  CA    . GLN A 74  ? 0.5865 0.4474 0.6623 0.0744  -0.0292 -0.1324 200 GLN A CA    
499  C  C     . GLN A 74  ? 0.6006 0.4565 0.6728 0.0638  -0.0309 -0.1279 200 GLN A C     
500  O  O     . GLN A 74  ? 0.5846 0.4265 0.6626 0.0590  -0.0316 -0.1137 200 GLN A O     
501  C  CB    . GLN A 74  ? 0.5785 0.4205 0.6777 0.0794  -0.0305 -0.1405 200 GLN A CB    
502  N  N     . GLY A 75  ? 0.7157 0.5844 0.7780 0.0605  -0.0315 -0.1395 201 GLY A N     
503  C  CA    . GLY A 75  ? 0.7527 0.6191 0.8131 0.0509  -0.0335 -0.1375 201 GLY A CA    
504  C  C     . GLY A 75  ? 0.7296 0.6062 0.7729 0.0458  -0.0322 -0.1218 201 GLY A C     
505  O  O     . GLY A 75  ? 0.7452 0.6229 0.7862 0.0383  -0.0336 -0.1208 201 GLY A O     
506  N  N     . LEU A 76  ? 0.6019 0.4861 0.6348 0.0495  -0.0298 -0.1103 202 LEU A N     
507  C  CA    . LEU A 76  ? 0.5624 0.4563 0.5799 0.0447  -0.0285 -0.0971 202 LEU A CA    
508  C  C     . LEU A 76  ? 0.4207 0.3334 0.4237 0.0444  -0.0281 -0.1055 202 LEU A C     
509  O  O     . LEU A 76  ? 0.4358 0.3596 0.4340 0.0507  -0.0267 -0.1152 202 LEU A O     
510  C  CB    . LEU A 76  ? 0.5266 0.4240 0.5386 0.0486  -0.0266 -0.0838 202 LEU A CB    
511  C  CG    . LEU A 76  ? 0.5295 0.4109 0.5519 0.0496  -0.0275 -0.0718 202 LEU A CG    
512  C  CD1   . LEU A 76  ? 0.4787 0.3680 0.4937 0.0530  -0.0267 -0.0600 202 LEU A CD1   
513  C  CD2   . LEU A 76  ? 0.5482 0.4171 0.5736 0.0416  -0.0283 -0.0628 202 LEU A CD2   
514  N  N     . PRO A 77  ? 0.4653 0.3827 0.4608 0.0378  -0.0290 -0.1015 203 PRO A N     
515  C  CA    . PRO A 77  ? 0.4958 0.4314 0.4769 0.0384  -0.0288 -0.1076 203 PRO A CA    
516  C  C     . PRO A 77  ? 0.4564 0.4049 0.4246 0.0427  -0.0248 -0.1000 203 PRO A C     
517  O  O     . PRO A 77  ? 0.3913 0.3365 0.3595 0.0422  -0.0230 -0.0872 203 PRO A O     
518  C  CB    . PRO A 77  ? 0.4793 0.4151 0.4580 0.0304  -0.0305 -0.1016 203 PRO A CB    
519  C  CG    . PRO A 77  ? 0.5305 0.4529 0.5156 0.0264  -0.0293 -0.0871 203 PRO A CG    
520  C  CD    . PRO A 77  ? 0.5002 0.4082 0.4989 0.0301  -0.0294 -0.0895 203 PRO A CD    
521  N  N     . HIS A 78  ? 0.3933 0.3572 0.3511 0.0471  -0.0235 -0.1085 204 HIS A N     
522  C  CA    . HIS A 78  ? 0.4077 0.3862 0.3532 0.0506  -0.0188 -0.1021 204 HIS A CA    
523  C  C     . HIS A 78  ? 0.4441 0.4228 0.3951 0.0568  -0.0152 -0.1017 204 HIS A C     
524  O  O     . HIS A 78  ? 0.4700 0.4592 0.4148 0.0587  -0.0109 -0.0942 204 HIS A O     
525  C  CB    . HIS A 78  ? 0.4152 0.3951 0.3546 0.0451  -0.0178 -0.0866 204 HIS A CB    
526  C  CG    . HIS A 78  ? 0.4258 0.4062 0.3613 0.0394  -0.0210 -0.0863 204 HIS A CG    
527  N  ND1   . HIS A 78  ? 0.4227 0.4158 0.3483 0.0408  -0.0221 -0.0935 204 HIS A ND1   
528  C  CD2   . HIS A 78  ? 0.4322 0.4031 0.3731 0.0328  -0.0233 -0.0801 204 HIS A CD2   
529  C  CE1   . HIS A 78  ? 0.4394 0.4309 0.3658 0.0352  -0.0256 -0.0919 204 HIS A CE1   
530  N  NE2   . HIS A 78  ? 0.4639 0.4419 0.3998 0.0301  -0.0259 -0.0839 204 HIS A NE2   
531  N  N     . PHE A 79  ? 0.4310 0.3987 0.3954 0.0600  -0.0168 -0.1095 205 PHE A N     
532  C  CA    . PHE A 79  ? 0.4192 0.3886 0.3906 0.0671  -0.0137 -0.1112 205 PHE A CA    
533  C  C     . PHE A 79  ? 0.5279 0.5029 0.5005 0.0736  -0.0128 -0.1293 205 PHE A C     
534  O  O     . PHE A 79  ? 0.6683 0.6314 0.6526 0.0746  -0.0161 -0.1400 205 PHE A O     
535  C  CB    . PHE A 79  ? 0.3906 0.3431 0.3770 0.0671  -0.0162 -0.1044 205 PHE A CB    
536  C  CG    . PHE A 79  ? 0.3775 0.3305 0.3615 0.0644  -0.0156 -0.0877 205 PHE A CG    
537  C  CD1   . PHE A 79  ? 0.3829 0.3446 0.3688 0.0691  -0.0127 -0.0834 205 PHE A CD1   
538  C  CD2   . PHE A 79  ? 0.3770 0.3233 0.3570 0.0570  -0.0179 -0.0774 205 PHE A CD2   
539  C  CE1   . PHE A 79  ? 0.3983 0.3617 0.3827 0.0665  -0.0130 -0.0699 205 PHE A CE1   
540  C  CE2   . PHE A 79  ? 0.3809 0.3286 0.3577 0.0547  -0.0176 -0.0638 205 PHE A CE2   
541  C  CZ    . PHE A 79  ? 0.3687 0.3250 0.3478 0.0594  -0.0156 -0.0604 205 PHE A CZ    
542  N  N     . GLY A 80  ? 0.5087 0.5020 0.4696 0.0781  -0.0078 -0.1327 206 GLY A N     
543  C  CA    . GLY A 80  ? 0.5420 0.5441 0.5020 0.0856  -0.0053 -0.1492 206 GLY A CA    
544  C  C     . GLY A 80  ? 0.5224 0.5313 0.4887 0.0928  0.0006  -0.1486 206 GLY A C     
545  O  O     . GLY A 80  ? 0.4587 0.4611 0.4356 0.0924  0.0008  -0.1377 206 GLY A O     
546  N  N     . GLU A 81  ? 0.4306 0.4544 0.3904 0.0997  0.0055  -0.1607 207 GLU A N     
547  C  CA    . GLU A 81  ? 0.5120 0.5443 0.4795 0.1072  0.0120  -0.1625 207 GLU A CA    
548  C  C     . GLU A 81  ? 0.4314 0.4699 0.3999 0.1049  0.0160  -0.1446 207 GLU A C     
549  O  O     . GLU A 81  ? 0.4426 0.4775 0.4263 0.1077  0.0168  -0.1405 207 GLU A O     
550  C  CB    . GLU A 81  ? 0.6646 0.7160 0.6198 0.1142  0.0183  -0.1761 207 GLU A CB    
551  C  CG    . GLU A 81  ? 0.8305 0.8937 0.7936 0.1224  0.0265  -0.1789 207 GLU A CG    
552  C  CD    . GLU A 81  ? 0.9831 1.0639 0.9344 0.1301  0.0327  -0.1950 207 GLU A CD    
553  O  OE1   . GLU A 81  ? 1.0348 1.1195 0.9703 0.1292  0.0298  -0.2036 207 GLU A OE1   
554  O  OE2   . GLU A 81  ? 1.0509 1.1428 1.0088 0.1375  0.0403  -0.1994 207 GLU A OE2   
555  N  N     . HIS A 82  ? 0.5268 0.5744 0.4803 0.0998  0.0181  -0.1341 208 HIS A N     
556  C  CA    . HIS A 82  ? 0.4998 0.5566 0.4544 0.0981  0.0234  -0.1196 208 HIS A CA    
557  C  C     . HIS A 82  ? 0.4592 0.5020 0.4249 0.0927  0.0179  -0.1073 208 HIS A C     
558  O  O     . HIS A 82  ? 0.3901 0.4340 0.3689 0.0948  0.0192  -0.1024 208 HIS A O     
559  C  CB    . HIS A 82  ? 0.4749 0.5448 0.4111 0.0949  0.0276  -0.1122 208 HIS A CB    
560  C  CG    . HIS A 82  ? 0.4684 0.5518 0.4060 0.0949  0.0359  -0.1011 208 HIS A CG    
561  N  ND1   . HIS A 82  ? 0.4809 0.5821 0.4057 0.0973  0.0444  -0.0993 208 HIS A ND1   
562  C  CD2   . HIS A 82  ? 0.4352 0.5175 0.3866 0.0927  0.0368  -0.0912 208 HIS A CD2   
563  C  CE1   . HIS A 82  ? 0.4487 0.5581 0.3810 0.0960  0.0510  -0.0885 208 HIS A CE1   
564  N  NE2   . HIS A 82  ? 0.4413 0.5401 0.3902 0.0931  0.0461  -0.0842 208 HIS A NE2   
565  N  N     . SER A 83  ? 0.4071 0.4379 0.3679 0.0859  0.0117  -0.1024 209 SER A N     
566  C  CA    A SER A 83  ? 0.4045 0.4232 0.3735 0.0811  0.0069  -0.0908 209 SER A CA    
567  C  CA    B SER A 83  ? 0.4038 0.4223 0.3727 0.0811  0.0069  -0.0908 209 SER A CA    
568  C  C     . SER A 83  ? 0.3963 0.4025 0.3819 0.0852  0.0031  -0.0942 209 SER A C     
569  O  O     . SER A 83  ? 0.3734 0.3754 0.3676 0.0847  0.0008  -0.0849 209 SER A O     
570  C  CB    A SER A 83  ? 0.3840 0.3930 0.3448 0.0735  0.0019  -0.0859 209 SER A CB    
571  C  CB    B SER A 83  ? 0.3887 0.3974 0.3495 0.0736  0.0018  -0.0864 209 SER A CB    
572  O  OG    A SER A 83  ? 0.3840 0.4043 0.3306 0.0704  0.0051  -0.0819 209 SER A OG    
573  O  OG    B SER A 83  ? 0.3974 0.3991 0.3571 0.0742  -0.0014 -0.0982 209 SER A OG    
574  N  N     . SER A 84  ? 0.4396 0.4400 0.4301 0.0898  0.0019  -0.1076 210 SER A N     
575  C  CA    . SER A 84  ? 0.4785 0.4661 0.4865 0.0947  -0.0014 -0.1108 210 SER A CA    
576  C  C     . SER A 84  ? 0.4892 0.4873 0.5079 0.1018  0.0026  -0.1103 210 SER A C     
577  O  O     . SER A 84  ? 0.4328 0.4234 0.4649 0.1042  -0.0008 -0.1041 210 SER A O     
578  C  CB    . SER A 84  ? 0.4785 0.4576 0.4912 0.0980  -0.0030 -0.1270 210 SER A CB    
579  O  OG    . SER A 84  ? 0.5001 0.4682 0.5072 0.0911  -0.0076 -0.1275 210 SER A OG    
580  N  N     . ARG A 85  ? 0.5244 0.5408 0.5378 0.1056  0.0099  -0.1165 211 ARG A N     
581  C  CA    . ARG A 85  ? 0.5041 0.5331 0.5293 0.1120  0.0148  -0.1163 211 ARG A CA    
582  C  C     . ARG A 85  ? 0.4484 0.4814 0.4774 0.1078  0.0137  -0.1010 211 ARG A C     
583  O  O     . ARG A 85  ? 0.4154 0.4497 0.4601 0.1121  0.0123  -0.0980 211 ARG A O     
584  C  CB    . ARG A 85  ? 0.5428 0.5918 0.5597 0.1159  0.0242  -0.1248 211 ARG A CB    
585  C  CG    . ARG A 85  ? 0.5891 0.6533 0.6194 0.1225  0.0308  -0.1257 211 ARG A CG    
586  C  CD    . ARG A 85  ? 0.6313 0.7159 0.6510 0.1260  0.0414  -0.1326 211 ARG A CD    
587  N  N     . VAL A 86  ? 0.4154 0.4510 0.4310 0.0999  0.0140  -0.0917 212 VAL A N     
588  C  CA    . VAL A 86  ? 0.4442 0.4825 0.4634 0.0953  0.0122  -0.0785 212 VAL A CA    
589  C  C     . VAL A 86  ? 0.4458 0.4692 0.4753 0.0958  0.0036  -0.0732 212 VAL A C     
590  O  O     . VAL A 86  ? 0.4137 0.4415 0.4554 0.0982  0.0017  -0.0681 212 VAL A O     
591  C  CB    . VAL A 86  ? 0.4800 0.5196 0.4834 0.0868  0.0129  -0.0706 212 VAL A CB    
592  C  CG1   . VAL A 86  ? 0.4498 0.4903 0.4575 0.0819  0.0101  -0.0586 212 VAL A CG1   
593  C  CG2   . VAL A 86  ? 0.5359 0.5916 0.5295 0.0872  0.0218  -0.0733 212 VAL A CG2   
594  N  N     . VAL A 87  ? 0.3623 0.3685 0.3872 0.0936  -0.0017 -0.0739 213 VAL A N     
595  C  CA    . VAL A 87  ? 0.3891 0.3800 0.4221 0.0942  -0.0091 -0.0672 213 VAL A CA    
596  C  C     . VAL A 87  ? 0.4192 0.4088 0.4701 0.1037  -0.0103 -0.0721 213 VAL A C     
597  O  O     . VAL A 87  ? 0.3759 0.3632 0.4366 0.1065  -0.0151 -0.0646 213 VAL A O     
598  C  CB    . VAL A 87  ? 0.4165 0.3894 0.4429 0.0898  -0.0130 -0.0673 213 VAL A CB    
599  C  CG1   . VAL A 87  ? 0.4263 0.3825 0.4626 0.0919  -0.0194 -0.0607 213 VAL A CG1   
600  C  CG2   . VAL A 87  ? 0.4127 0.3867 0.4238 0.0807  -0.0129 -0.0604 213 VAL A CG2   
601  N  N     . GLN A 88  ? 0.3852 0.3764 0.4406 0.1093  -0.0063 -0.0853 214 GLN A N     
602  C  CA    . GLN A 88  ? 0.4357 0.4253 0.5095 0.1191  -0.0069 -0.0917 214 GLN A CA    
603  C  C     . GLN A 88  ? 0.3987 0.4042 0.4837 0.1232  -0.0057 -0.0868 214 GLN A C     
604  O  O     . GLN A 88  ? 0.4048 0.4061 0.5049 0.1290  -0.0106 -0.0830 214 GLN A O     
605  C  CB    . GLN A 88  ? 0.5694 0.5629 0.6443 0.1242  -0.0012 -0.1085 214 GLN A CB    
606  C  CG    . GLN A 88  ? 0.7206 0.7136 0.8157 0.1351  -0.0006 -0.1174 214 GLN A CG    
607  C  CD    . GLN A 88  ? 0.8627 0.8618 0.9571 0.1403  0.0057  -0.1357 214 GLN A CD    
608  O  OE1   . GLN A 88  ? 0.8671 0.8685 0.9454 0.1357  0.0082  -0.1418 214 GLN A OE1   
609  N  NE2   . GLN A 88  ? 0.9343 0.9372 1.0463 0.1504  0.0081  -0.1450 214 GLN A NE2   
610  N  N     . GLU A 89  ? 0.4443 0.4686 0.5233 0.1203  0.0008  -0.0867 215 GLU A N     
611  C  CA    . GLU A 89  ? 0.4221 0.4633 0.5144 0.1235  0.0027  -0.0832 215 GLU A CA    
612  C  C     . GLU A 89  ? 0.3655 0.4034 0.4604 0.1199  -0.0053 -0.0702 215 GLU A C     
613  O  O     . GLU A 89  ? 0.4158 0.4595 0.5269 0.1253  -0.0089 -0.0676 215 GLU A O     
614  C  CB    . GLU A 89  ? 0.5305 0.5916 0.6164 0.1204  0.0125  -0.0850 215 GLU A CB    
615  C  CG    . GLU A 89  ? 0.6330 0.7009 0.7151 0.1252  0.0210  -0.0981 215 GLU A CG    
616  C  CD    . GLU A 89  ? 0.7745 0.8638 0.8518 0.1234  0.0317  -0.0980 215 GLU A CD    
617  O  OE1   . GLU A 89  ? 0.7672 0.8658 0.8480 0.1184  0.0327  -0.0882 215 GLU A OE1   
618  O  OE2   . GLU A 89  ? 0.8366 0.9336 0.9067 0.1270  0.0393  -0.1078 215 GLU A OE2   
619  N  N     . LEU A 90  ? 0.3589 0.3884 0.4382 0.1114  -0.0084 -0.0625 216 LEU A N     
620  C  CA    . LEU A 90  ? 0.3761 0.4026 0.4556 0.1082  -0.0160 -0.0511 216 LEU A CA    
621  C  C     . LEU A 90  ? 0.3818 0.3939 0.4699 0.1144  -0.0243 -0.0475 216 LEU A C     
622  O  O     . LEU A 90  ? 0.3805 0.3964 0.4769 0.1172  -0.0306 -0.0408 216 LEU A O     
623  C  CB    . LEU A 90  ? 0.3817 0.4015 0.4424 0.0983  -0.0168 -0.0447 216 LEU A CB    
624  C  CG    . LEU A 90  ? 0.4407 0.4750 0.4945 0.0921  -0.0101 -0.0445 216 LEU A CG    
625  C  CD1   . LEU A 90  ? 0.4292 0.4553 0.4644 0.0840  -0.0092 -0.0417 216 LEU A CD1   
626  C  CD2   . LEU A 90  ? 0.4930 0.5396 0.5554 0.0902  -0.0125 -0.0385 216 LEU A CD2   
627  N  N     . LEU A 91  ? 0.3765 0.3723 0.4635 0.1169  -0.0246 -0.0519 217 LEU A N     
628  C  CA    . LEU A 91  ? 0.4327 0.4130 0.5294 0.1231  -0.0316 -0.0475 217 LEU A CA    
629  C  C     . LEU A 91  ? 0.4952 0.4836 0.6130 0.1341  -0.0324 -0.0519 217 LEU A C     
630  O  O     . LEU A 91  ? 0.4997 0.4833 0.6271 0.1398  -0.0397 -0.0443 217 LEU A O     
631  C  CB    . LEU A 91  ? 0.4165 0.3767 0.5100 0.1225  -0.0310 -0.0521 217 LEU A CB    
632  C  CG    . LEU A 91  ? 0.4779 0.4272 0.5537 0.1124  -0.0315 -0.0467 217 LEU A CG    
633  C  CD1   . LEU A 91  ? 0.5165 0.4471 0.5943 0.1122  -0.0309 -0.0530 217 LEU A CD1   
634  C  CD2   . LEU A 91  ? 0.5281 0.4719 0.5978 0.1094  -0.0379 -0.0315 217 LEU A CD2   
635  N  N     . GLU A 92  ? 0.4707 0.4724 0.5959 0.1376  -0.0249 -0.0637 218 GLU A N     
636  C  CA    . GLU A 92  ? 0.5915 0.6017 0.7385 0.1485  -0.0246 -0.0695 218 GLU A CA    
637  C  C     . GLU A 92  ? 0.5464 0.5777 0.7033 0.1495  -0.0258 -0.0649 218 GLU A C     
638  O  O     . GLU A 92  ? 0.5643 0.5986 0.7380 0.1574  -0.0319 -0.0617 218 GLU A O     
639  C  CB    . GLU A 92  ? 0.7723 0.7889 0.9233 0.1524  -0.0153 -0.0851 218 GLU A CB    
640  C  CG    . GLU A 92  ? 0.9281 0.9250 1.0748 0.1532  -0.0148 -0.0930 218 GLU A CG    
641  C  CD    . GLU A 92  ? 1.0145 1.0203 1.1621 0.1569  -0.0057 -0.1099 218 GLU A CD    
642  O  OE1   . GLU A 92  ? 1.0308 1.0579 1.1839 0.1599  0.0009  -0.1144 218 GLU A OE1   
643  O  OE2   . GLU A 92  ? 1.0541 1.0464 1.1973 0.1567  -0.0050 -0.1190 218 GLU A OE2   
644  N  N     . HIS A 93  ? 0.5161 0.5625 0.6643 0.1419  -0.0203 -0.0647 219 HIS A N     
645  C  CA    . HIS A 93  ? 0.4933 0.5616 0.6540 0.1420  -0.0196 -0.0628 219 HIS A CA    
646  C  C     . HIS A 93  ? 0.4553 0.5268 0.6063 0.1332  -0.0246 -0.0526 219 HIS A C     
647  O  O     . HIS A 93  ? 0.4509 0.5402 0.6134 0.1323  -0.0251 -0.0512 219 HIS A O     
648  C  CB    . HIS A 93  ? 0.5292 0.6156 0.6931 0.1412  -0.0072 -0.0717 219 HIS A CB    
649  C  CG    . HIS A 93  ? 0.5819 0.6666 0.7519 0.1493  -0.0009 -0.0837 219 HIS A CG    
650  N  ND1   . HIS A 93  ? 0.6092 0.6969 0.8010 0.1604  -0.0026 -0.0891 219 HIS A ND1   
651  C  CD2   . HIS A 93  ? 0.5825 0.6633 0.7397 0.1483  0.0067  -0.0924 219 HIS A CD2   
652  C  CE1   . HIS A 93  ? 0.6202 0.7052 0.8127 0.1658  0.0042  -0.1011 219 HIS A CE1   
653  N  NE2   . HIS A 93  ? 0.6211 0.7024 0.7922 0.1586  0.0097  -0.1036 219 HIS A NE2   
654  N  N     . GLY A 94  ? 0.4875 0.5430 0.6191 0.1267  -0.0282 -0.0464 220 GLY A N     
655  C  CA    . GLY A 94  ? 0.4638 0.5222 0.5849 0.1182  -0.0320 -0.0383 220 GLY A CA    
656  C  C     . GLY A 94  ? 0.4423 0.5135 0.5579 0.1100  -0.0236 -0.0403 220 GLY A C     
657  O  O     . GLY A 94  ? 0.3836 0.4571 0.4917 0.1027  -0.0262 -0.0346 220 GLY A O     
658  N  N     A VAL A 95  ? 0.4637 0.5429 0.5823 0.1112  -0.0135 -0.0479 221 VAL A N     
659  N  N     B VAL A 95  ? 0.4625 0.5422 0.5815 0.1112  -0.0135 -0.0479 221 VAL A N     
660  C  CA    A VAL A 95  ? 0.4634 0.5555 0.5780 0.1045  -0.0043 -0.0487 221 VAL A CA    
661  C  CA    B VAL A 95  ? 0.4625 0.5537 0.5757 0.1040  -0.0046 -0.0483 221 VAL A CA    
662  C  C     A VAL A 95  ? 0.4529 0.5434 0.5581 0.1059  0.0050  -0.0559 221 VAL A C     
663  C  C     B VAL A 95  ? 0.4492 0.5397 0.5544 0.1058  0.0049  -0.0557 221 VAL A C     
664  O  O     A VAL A 95  ? 0.4553 0.5422 0.5659 0.1136  0.0059  -0.0632 221 VAL A O     
665  O  O     B VAL A 95  ? 0.4480 0.5357 0.5595 0.1137  0.0059  -0.0630 221 VAL A O     
666  C  CB    A VAL A 95  ? 0.4725 0.5865 0.6086 0.1059  -0.0011 -0.0498 221 VAL A CB    
667  C  CB    B VAL A 95  ? 0.4770 0.5898 0.6098 0.1038  -0.0014 -0.0484 221 VAL A CB    
668  C  CG1   A VAL A 95  ? 0.4493 0.5755 0.5825 0.0988  0.0095  -0.0491 221 VAL A CG1   
669  C  CG1   B VAL A 95  ? 0.4921 0.6069 0.6299 0.1003  -0.0113 -0.0420 221 VAL A CG1   
670  C  CG2   A VAL A 95  ? 0.4799 0.5970 0.6258 0.1052  -0.0120 -0.0444 221 VAL A CG2   
671  C  CG2   B VAL A 95  ? 0.4492 0.5725 0.6025 0.1138  0.0009  -0.0554 221 VAL A CG2   
672  N  N     . CYS A 96  ? 0.4628 0.5563 0.5541 0.0989  0.0117  -0.0541 222 CYS A N     
673  C  CA    . CYS A 96  ? 0.4354 0.5307 0.5157 0.1001  0.0206  -0.0605 222 CYS A CA    
674  C  C     . CYS A 96  ? 0.3913 0.5063 0.4759 0.0980  0.0316  -0.0597 222 CYS A C     
675  O  O     . CYS A 96  ? 0.3511 0.4701 0.4325 0.0905  0.0333  -0.0522 222 CYS A O     
676  C  CB    . CYS A 96  ? 0.4720 0.5531 0.5304 0.0943  0.0186  -0.0585 222 CYS A CB    
677  S  SG    . CYS A 96  ? 0.4949 0.5812 0.5372 0.0954  0.0286  -0.0661 222 CYS A SG    
678  N  N     . GLU A 97  ? 0.3953 0.5223 0.4876 0.1048  0.0398  -0.0674 223 GLU A N     
679  C  CA    . GLU A 97  ? 0.3786 0.5260 0.4786 0.1037  0.0514  -0.0659 223 GLU A CA    
680  C  C     . GLU A 97  ? 0.3469 0.4956 0.4283 0.0965  0.0578  -0.0596 223 GLU A C     
681  O  O     . GLU A 97  ? 0.3613 0.5203 0.4490 0.0909  0.0633  -0.0522 223 GLU A O     
682  C  CB    . GLU A 97  ? 0.4295 0.5890 0.5369 0.1128  0.0600  -0.0760 223 GLU A CB    
683  C  CG    . GLU A 97  ? 0.4197 0.6015 0.5356 0.1121  0.0737  -0.0739 223 GLU A CG    
684  N  N     . GLU A 98  ? 0.3500 0.4882 0.4099 0.0966  0.0570  -0.0624 224 GLU A N     
685  C  CA    . GLU A 98  ? 0.3989 0.5384 0.4406 0.0908  0.0623  -0.0562 224 GLU A CA    
686  C  C     . GLU A 98  ? 0.3515 0.4841 0.3935 0.0818  0.0571  -0.0455 224 GLU A C     
687  O  O     . GLU A 98  ? 0.3444 0.4847 0.3856 0.0766  0.0637  -0.0376 224 GLU A O     
688  C  CB    . GLU A 98  ? 0.4174 0.5466 0.4375 0.0927  0.0598  -0.0623 224 GLU A CB    
689  C  CG    . GLU A 98  ? 0.4553 0.5888 0.4561 0.0887  0.0659  -0.0564 224 GLU A CG    
690  C  CD    . GLU A 98  ? 0.4995 0.6230 0.4799 0.0896  0.0612  -0.0622 224 GLU A CD    
691  O  OE1   . GLU A 98  ? 0.4969 0.6092 0.4789 0.0927  0.0538  -0.0712 224 GLU A OE1   
692  O  OE2   . GLU A 98  ? 0.5110 0.6383 0.4750 0.0872  0.0649  -0.0576 224 GLU A OE2   
693  N  N     . VAL A 99  ? 0.3289 0.4469 0.3721 0.0801  0.0456  -0.0450 225 VAL A N     
694  C  CA    . VAL A 99  ? 0.3116 0.4232 0.3542 0.0722  0.0402  -0.0365 225 VAL A CA    
695  C  C     . VAL A 99  ? 0.3254 0.4500 0.3874 0.0692  0.0435  -0.0320 225 VAL A C     
696  O  O     . VAL A 99  ? 0.2967 0.4232 0.3586 0.0622  0.0459  -0.0250 225 VAL A O     
697  C  CB    . VAL A 99  ? 0.3715 0.4669 0.4125 0.0721  0.0279  -0.0371 225 VAL A CB    
698  C  CG1   . VAL A 99  ? 0.3691 0.4598 0.4101 0.0647  0.0224  -0.0295 225 VAL A CG1   
699  C  CG2   . VAL A 99  ? 0.3873 0.4693 0.4110 0.0735  0.0252  -0.0412 225 VAL A CG2   
700  N  N     . GLU A 100 ? 0.3630 0.4969 0.4440 0.0743  0.0432  -0.0364 226 GLU A N     
701  C  CA    . GLU A 100 ? 0.3856 0.5332 0.4884 0.0713  0.0453  -0.0333 226 GLU A CA    
702  C  C     . GLU A 100 ? 0.3291 0.4911 0.4355 0.0686  0.0593  -0.0297 226 GLU A C     
703  O  O     . GLU A 100 ? 0.3147 0.4827 0.4318 0.0619  0.0622  -0.0237 226 GLU A O     
704  C  CB    . GLU A 100 ? 0.3578 0.5131 0.4811 0.0782  0.0414  -0.0392 226 GLU A CB    
705  C  CG    . GLU A 100 ? 0.4165 0.5579 0.5374 0.0812  0.0276  -0.0406 226 GLU A CG    
706  C  CD    . GLU A 100 ? 0.4904 0.6236 0.6064 0.0739  0.0190  -0.0346 226 GLU A CD    
707  O  OE1   . GLU A 100 ? 0.4894 0.6331 0.6194 0.0691  0.0194  -0.0322 226 GLU A OE1   
708  O  OE2   . GLU A 100 ? 0.5222 0.6390 0.6210 0.0728  0.0124  -0.0328 226 GLU A OE2   
709  N  N     . ARG A 101 ? 0.3092 0.4767 0.4065 0.0738  0.0684  -0.0330 227 ARG A N     
710  C  CA    . ARG A 101 ? 0.3911 0.5720 0.4879 0.0719  0.0826  -0.0279 227 ARG A CA    
711  C  C     . ARG A 101 ? 0.3278 0.5011 0.4105 0.0641  0.0838  -0.0183 227 ARG A C     
712  O  O     . ARG A 101 ? 0.3342 0.5160 0.4263 0.0588  0.0922  -0.0105 227 ARG A O     
713  C  CB    . ARG A 101 ? 0.5751 0.7624 0.6596 0.0798  0.0908  -0.0343 227 ARG A CB    
714  C  CG    . ARG A 101 ? 0.7677 0.9687 0.8458 0.0790  0.1060  -0.0281 227 ARG A CG    
715  C  CD    . ARG A 101 ? 0.9102 1.1247 0.9858 0.0881  0.1155  -0.0363 227 ARG A CD    
716  N  NE    . ARG A 101 ? 1.0253 1.2312 1.0963 0.0955  0.1069  -0.0490 227 ARG A NE    
717  C  CZ    . ARG A 101 ? 1.0836 1.2778 1.1317 0.0981  0.1019  -0.0544 227 ARG A CZ    
718  N  NH1   . ARG A 101 ? 1.1097 1.3004 1.1359 0.0945  0.1039  -0.0482 227 ARG A NH1   
719  N  NH2   . ARG A 101 ? 1.0745 1.2605 1.1231 0.1044  0.0945  -0.0661 227 ARG A NH2   
720  N  N     . VAL A 102 ? 0.3095 0.4667 0.3719 0.0631  0.0758  -0.0186 228 VAL A N     
721  C  CA    . VAL A 102 ? 0.3062 0.4557 0.3571 0.0562  0.0759  -0.0099 228 VAL A CA    
722  C  C     . VAL A 102 ? 0.3411 0.4887 0.4091 0.0489  0.0715  -0.0052 228 VAL A C     
723  O  O     . VAL A 102 ? 0.3377 0.4891 0.4116 0.0432  0.0780  0.0027  228 VAL A O     
724  C  CB    . VAL A 102 ? 0.3862 0.5197 0.4144 0.0568  0.0675  -0.0121 228 VAL A CB    
725  C  CG1   . VAL A 102 ? 0.3672 0.4925 0.3865 0.0498  0.0663  -0.0034 228 VAL A CG1   
726  C  CG2   . VAL A 102 ? 0.4213 0.5580 0.4324 0.0634  0.0721  -0.0174 228 VAL A CG2   
727  N  N     . ARG A 103 ? 0.3394 0.4813 0.4158 0.0492  0.0603  -0.0101 229 ARG A N     
728  C  CA    . ARG A 103 ? 0.4071 0.5481 0.4985 0.0428  0.0546  -0.0077 229 ARG A CA    
729  C  C     . ARG A 103 ? 0.4319 0.5881 0.5461 0.0389  0.0639  -0.0042 229 ARG A C     
730  O  O     . ARG A 103 ? 0.4688 0.6238 0.5907 0.0316  0.0647  0.0007  229 ARG A O     
731  C  CB    . ARG A 103 ? 0.4586 0.5969 0.5585 0.0458  0.0426  -0.0139 229 ARG A CB    
732  C  CG    . ARG A 103 ? 0.5643 0.6859 0.6457 0.0474  0.0323  -0.0155 229 ARG A CG    
733  C  CD    . ARG A 103 ? 0.6361 0.7569 0.7280 0.0502  0.0211  -0.0192 229 ARG A CD    
734  N  NE    . ARG A 103 ? 0.7258 0.8328 0.8033 0.0547  0.0134  -0.0213 229 ARG A NE    
735  C  CZ    . ARG A 103 ? 0.7952 0.8885 0.8583 0.0517  0.0064  -0.0187 229 ARG A CZ    
736  N  NH1   . ARG A 103 ? 0.7939 0.8853 0.8541 0.0446  0.0056  -0.0149 229 ARG A NH1   
737  N  NH2   . ARG A 103 ? 0.8375 0.9188 0.8903 0.0558  0.0006  -0.0200 229 ARG A NH2   
738  N  N     . ARG A 104 ? 0.4578 0.6285 0.5847 0.0437  0.0712  -0.0071 230 ARG A N     
739  C  CA    . ARG A 104 ? 0.4568 0.6438 0.6095 0.0403  0.0802  -0.0045 230 ARG A CA    
740  C  C     . ARG A 104 ? 0.4128 0.6050 0.5614 0.0372  0.0952  0.0047  230 ARG A C     
741  O  O     . ARG A 104 ? 0.4060 0.6092 0.5766 0.0322  0.1035  0.0092  230 ARG A O     
742  C  CB    . ARG A 104 ? 0.4984 0.7003 0.6682 0.0472  0.0827  -0.0114 230 ARG A CB    
743  C  CG    . ARG A 104 ? 0.5572 0.7559 0.7337 0.0517  0.0685  -0.0194 230 ARG A CG    
744  C  CD    . ARG A 104 ? 0.5645 0.7805 0.7640 0.0581  0.0718  -0.0254 230 ARG A CD    
745  N  NE    . ARG A 104 ? 0.5185 0.7411 0.7098 0.0647  0.0834  -0.0273 230 ARG A NE    
746  C  CZ    . ARG A 104 ? 0.4981 0.7155 0.6776 0.0735  0.0802  -0.0341 230 ARG A CZ    
747  N  NH1   . ARG A 104 ? 0.5073 0.7118 0.6822 0.0766  0.0661  -0.0382 230 ARG A NH1   
748  N  NH2   . ARG A 104 ? 0.4577 0.6828 0.6303 0.0792  0.0914  -0.0370 230 ARG A NH2   
749  N  N     . SER A 105 ? 0.3408 0.5261 0.4629 0.0401  0.0990  0.0079  231 SER A N     
750  C  CA    . SER A 105 ? 0.3663 0.5589 0.4827 0.0392  0.1137  0.0172  231 SER A CA    
751  C  C     . SER A 105 ? 0.3622 0.5496 0.4861 0.0303  0.1165  0.0274  231 SER A C     
752  O  O     . SER A 105 ? 0.3499 0.5231 0.4677 0.0262  0.1067  0.0276  231 SER A O     
753  C  CB    . SER A 105 ? 0.3568 0.5440 0.4419 0.0451  0.1151  0.0173  231 SER A CB    
754  O  OG    . SER A 105 ? 0.3762 0.5463 0.4444 0.0423  0.1052  0.0186  231 SER A OG    
755  N  N     A GLU A 106 ? 0.3776 0.5765 0.5156 0.0272  0.1306  0.0361  232 GLU A N     
756  N  N     B GLU A 106 ? 0.3789 0.5778 0.5170 0.0272  0.1306  0.0360  232 GLU A N     
757  C  CA    A GLU A 106 ? 0.3809 0.5743 0.5277 0.0190  0.1351  0.0468  232 GLU A CA    
758  C  CA    B GLU A 106 ? 0.3830 0.5766 0.5299 0.0190  0.1353  0.0469  232 GLU A CA    
759  C  C     A GLU A 106 ? 0.3856 0.5649 0.5043 0.0196  0.1332  0.0536  232 GLU A C     
760  C  C     B GLU A 106 ? 0.3857 0.5653 0.5046 0.0196  0.1335  0.0537  232 GLU A C     
761  O  O     A GLU A 106 ? 0.3802 0.5478 0.5016 0.0136  0.1289  0.0578  232 GLU A O     
762  O  O     B GLU A 106 ? 0.3823 0.5504 0.5044 0.0135  0.1296  0.0582  232 GLU A O     
763  C  CB    A GLU A 106 ? 0.4107 0.6192 0.5760 0.0165  0.1526  0.0565  232 GLU A CB    
764  C  CB    B GLU A 106 ? 0.4105 0.6194 0.5758 0.0167  0.1528  0.0564  232 GLU A CB    
765  C  CG    A GLU A 106 ? 0.4244 0.6276 0.6070 0.0072  0.1579  0.0673  232 GLU A CG    
766  C  CG    B GLU A 106 ? 0.4250 0.6286 0.6041 0.0080  0.1595  0.0687  232 GLU A CG    
767  C  CD    A GLU A 106 ? 0.4451 0.6634 0.6496 0.0041  0.1759  0.0774  232 GLU A CD    
768  C  CD    B GLU A 106 ? 0.4452 0.6646 0.6469 0.0051  0.1774  0.0782  232 GLU A CD    
769  O  OE1   A GLU A 106 ? 0.4476 0.6786 0.6418 0.0104  0.1872  0.0807  232 GLU A OE1   
770  O  OE1   B GLU A 106 ? 0.4390 0.6748 0.6495 0.0092  0.1834  0.0734  232 GLU A OE1   
771  O  OE2   A GLU A 106 ? 0.4421 0.6600 0.6751 -0.0047 0.1791  0.0816  232 GLU A OE2   
772  O  OE2   B GLU A 106 ? 0.4548 0.6702 0.6666 -0.0012 0.1860  0.0907  232 GLU A OE2   
773  N  N     . ARG A 107 ? 0.3889 0.5699 0.4812 0.0271  0.1359  0.0537  233 ARG A N     
774  C  CA    . ARG A 107 ? 0.3966 0.5662 0.4623 0.0284  0.1332  0.0592  233 ARG A CA    
775  C  C     . ARG A 107 ? 0.3508 0.5040 0.4099 0.0263  0.1174  0.0523  233 ARG A C     
776  O  O     . ARG A 107 ? 0.3617 0.5037 0.4170 0.0221  0.1144  0.0582  233 ARG A O     
777  C  CB    . ARG A 107 ? 0.4278 0.6043 0.4676 0.0374  0.1373  0.0573  233 ARG A CB    
778  C  CG    . ARG A 107 ? 0.4759 0.6424 0.4867 0.0404  0.1315  0.0593  233 ARG A CG    
779  C  CD    . ARG A 107 ? 0.4281 0.5934 0.4326 0.0383  0.1398  0.0752  233 ARG A CD    
780  N  NE    . ARG A 107 ? 0.4126 0.5696 0.3906 0.0417  0.1330  0.0762  233 ARG A NE    
781  C  CZ    . ARG A 107 ? 0.4874 0.6430 0.4536 0.0422  0.1379  0.0893  233 ARG A CZ    
782  N  NH1   . ARG A 107 ? 0.5213 0.6819 0.4994 0.0394  0.1505  0.1037  233 ARG A NH1   
783  N  NH2   . ARG A 107 ? 0.4995 0.6489 0.4430 0.0457  0.1302  0.0885  233 ARG A NH2   
784  N  N     . TYR A 108 ? 0.3113 0.4628 0.3694 0.0294  0.1075  0.0401  234 TYR A N     
785  C  CA    . TYR A 108 ? 0.3078 0.4446 0.3582 0.0279  0.0934  0.0341  234 TYR A CA    
786  C  C     . TYR A 108 ? 0.2933 0.4239 0.3621 0.0200  0.0889  0.0357  234 TYR A C     
787  O  O     . TYR A 108 ? 0.2899 0.4084 0.3509 0.0167  0.0833  0.0379  234 TYR A O     
788  C  CB    . TYR A 108 ? 0.3395 0.4762 0.3883 0.0330  0.0848  0.0222  234 TYR A CB    
789  C  CG    . TYR A 108 ? 0.3602 0.4828 0.4043 0.0311  0.0710  0.0169  234 TYR A CG    
790  C  CD1   . TYR A 108 ? 0.4038 0.5151 0.4261 0.0327  0.0653  0.0159  234 TYR A CD1   
791  C  CD2   . TYR A 108 ? 0.3885 0.5102 0.4501 0.0277  0.0639  0.0131  234 TYR A CD2   
792  C  CE1   . TYR A 108 ? 0.4047 0.5037 0.4230 0.0307  0.0540  0.0121  234 TYR A CE1   
793  C  CE2   . TYR A 108 ? 0.4297 0.5396 0.4853 0.0264  0.0521  0.0093  234 TYR A CE2   
794  C  CZ    . TYR A 108 ? 0.4481 0.5464 0.4820 0.0278  0.0478  0.0092  234 TYR A CZ    
795  O  OH    . TYR A 108 ? 0.4309 0.5180 0.4591 0.0263  0.0373  0.0062  234 TYR A OH    
796  N  N     . GLN A 109 ? 0.3014 0.4412 0.3959 0.0169  0.0912  0.0339  235 GLN A N     
797  C  CA    . GLN A 109 ? 0.3694 0.5047 0.4829 0.0095  0.0859  0.0329  235 GLN A CA    
798  C  C     . GLN A 109 ? 0.3054 0.4343 0.4211 0.0038  0.0922  0.0430  235 GLN A C     
799  O  O     . GLN A 109 ? 0.3219 0.4402 0.4397 -0.0008 0.0854  0.0419  235 GLN A O     
800  C  CB    . GLN A 109 ? 0.4404 0.5894 0.5833 0.0073  0.0880  0.0288  235 GLN A CB    
801  C  CG    . GLN A 109 ? 0.5933 0.7478 0.7375 0.0131  0.0800  0.0186  235 GLN A CG    
802  C  CD    . GLN A 109 ? 0.7540 0.9239 0.9292 0.0114  0.0817  0.0144  235 GLN A CD    
803  O  OE1   . GLN A 109 ? 0.7692 0.9440 0.9666 0.0044  0.0867  0.0176  235 GLN A OE1   
804  N  NE2   . GLN A 109 ? 0.7853 0.9630 0.9640 0.0178  0.0775  0.0070  235 GLN A NE2   
805  N  N     . THR A 110 ? 0.3505 0.4857 0.4657 0.0045  0.1056  0.0534  236 THR A N     
806  C  CA    . THR A 110 ? 0.3499 0.4788 0.4695 -0.0004 0.1124  0.0647  236 THR A CA    
807  C  C     . THR A 110 ? 0.3656 0.4815 0.4591 0.0020  0.1077  0.0684  236 THR A C     
808  O  O     . THR A 110 ? 0.3608 0.4659 0.4583 -0.0025 0.1053  0.0717  236 THR A O     
809  C  CB    . THR A 110 ? 0.4306 0.5709 0.5576 0.0000  0.1289  0.0763  236 THR A CB    
810  O  OG1   . THR A 110 ? 0.4480 0.6020 0.6007 -0.0021 0.1333  0.0720  236 THR A OG1   
811  C  CG2   . THR A 110 ? 0.4637 0.5967 0.6003 -0.0056 0.1365  0.0894  236 THR A CG2   
812  N  N     . MET A 111 ? 0.3363 0.4537 0.4045 0.0092  0.1064  0.0670  237 MET A N     
813  C  CA    . MET A 111 ? 0.4073 0.5139 0.4520 0.0117  0.1008  0.0690  237 MET A CA    
814  C  C     . MET A 111 ? 0.3947 0.4893 0.4394 0.0086  0.0877  0.0604  237 MET A C     
815  O  O     . MET A 111 ? 0.3172 0.4014 0.3553 0.0069  0.0844  0.0637  237 MET A O     
816  C  CB    . MET A 111 ? 0.3947 0.5066 0.4148 0.0197  0.1006  0.0663  237 MET A CB    
817  C  CG    . MET A 111 ? 0.4005 0.5242 0.4137 0.0238  0.1137  0.0759  237 MET A CG    
818  S  SD    . MET A 111 ? 0.4237 0.5423 0.4285 0.0231  0.1205  0.0929  237 MET A SD    
819  C  CE    . MET A 111 ? 0.4521 0.5625 0.4279 0.0282  0.1087  0.0878  237 MET A CE    
820  N  N     . LYS A 112 ? 0.3254 0.4218 0.3771 0.0085  0.0803  0.0497  238 LYS A N     
821  C  CA    . LYS A 112 ? 0.3773 0.4638 0.4293 0.0057  0.0686  0.0421  238 LYS A CA    
822  C  C     . LYS A 112 ? 0.3618 0.4434 0.4320 -0.0014 0.0689  0.0443  238 LYS A C     
823  O  O     . LYS A 112 ? 0.3706 0.4416 0.4351 -0.0035 0.0638  0.0439  238 LYS A O     
824  C  CB    . LYS A 112 ? 0.4211 0.5119 0.4786 0.0076  0.0614  0.0319  238 LYS A CB    
825  C  CG    . LYS A 112 ? 0.5109 0.5922 0.5641 0.0060  0.0492  0.0248  238 LYS A CG    
826  C  CD    . LYS A 112 ? 0.6017 0.6862 0.6541 0.0102  0.0420  0.0168  238 LYS A CD    
827  C  CE    . LYS A 112 ? 0.6632 0.7385 0.7089 0.0092  0.0306  0.0115  238 LYS A CE    
828  N  NZ    . LYS A 112 ? 0.6896 0.7537 0.7146 0.0100  0.0282  0.0133  238 LYS A NZ    
829  N  N     . LEU A 113 ? 0.3298 0.4194 0.4236 -0.0051 0.0753  0.0460  239 LEU A N     
830  C  CA    . LEU A 113 ? 0.3699 0.4553 0.4849 -0.0124 0.0759  0.0468  239 LEU A CA    
831  C  C     . LEU A 113 ? 0.3717 0.4474 0.4809 -0.0137 0.0811  0.0569  239 LEU A C     
832  O  O     . LEU A 113 ? 0.3852 0.4509 0.4985 -0.0174 0.0764  0.0545  239 LEU A O     
833  C  CB    . LEU A 113 ? 0.3861 0.4831 0.5291 -0.0162 0.0838  0.0480  239 LEU A CB    
834  C  CG    . LEU A 113 ? 0.3992 0.4932 0.5697 -0.0245 0.0859  0.0483  239 LEU A CG    
835  C  CD1   . LEU A 113 ? 0.4228 0.5131 0.5999 -0.0275 0.0727  0.0351  239 LEU A CD1   
836  C  CD2   . LEU A 113 ? 0.4079 0.5148 0.6060 -0.0280 0.0963  0.0519  239 LEU A CD2   
837  N  N     . PHE A 114 ? 0.3471 0.4259 0.4458 -0.0100 0.0907  0.0680  240 PHE A N     
838  C  CA    . PHE A 114 ? 0.3799 0.4504 0.4748 -0.0105 0.0963  0.0796  240 PHE A CA    
839  C  C     . PHE A 114 ? 0.4064 0.4669 0.4786 -0.0072 0.0878  0.0775  240 PHE A C     
840  O  O     . PHE A 114 ? 0.3923 0.4425 0.4682 -0.0097 0.0861  0.0799  240 PHE A O     
841  C  CB    . PHE A 114 ? 0.3623 0.4409 0.4513 -0.0067 0.1090  0.0930  240 PHE A CB    
842  C  CG    . PHE A 114 ? 0.3258 0.4122 0.4412 -0.0113 0.1206  0.0995  240 PHE A CG    
843  C  CD1   . PHE A 114 ? 0.3403 0.4256 0.4848 -0.0189 0.1190  0.0932  240 PHE A CD1   
844  C  CD2   . PHE A 114 ? 0.3336 0.4293 0.4447 -0.0080 0.1336  0.1120  240 PHE A CD2   
845  C  CE1   . PHE A 114 ? 0.3354 0.4284 0.5068 -0.0237 0.1300  0.0990  240 PHE A CE1   
846  C  CE2   . PHE A 114 ? 0.3604 0.4638 0.4967 -0.0125 0.1456  0.1190  240 PHE A CE2   
847  C  CZ    . PHE A 114 ? 0.3528 0.4546 0.5207 -0.0207 0.1439  0.1125  240 PHE A CZ    
848  N  N     . THR A 115 ? 0.3505 0.4139 0.4008 -0.0016 0.0826  0.0727  241 THR A N     
849  C  CA    . THR A 115 ? 0.3711 0.4262 0.4017 0.0012  0.0751  0.0709  241 THR A CA    
850  C  C     . THR A 115 ? 0.4108 0.4568 0.4467 -0.0029 0.0657  0.0617  241 THR A C     
851  O  O     . THR A 115 ? 0.4225 0.4606 0.4486 -0.0022 0.0614  0.0619  241 THR A O     
852  C  CB    . THR A 115 ? 0.3762 0.4361 0.3852 0.0073  0.0713  0.0662  241 THR A CB    
853  O  OG1   . THR A 115 ? 0.3528 0.4165 0.3667 0.0070  0.0664  0.0559  241 THR A OG1   
854  C  CG2   . THR A 115 ? 0.3684 0.4377 0.3675 0.0123  0.0803  0.0748  241 THR A CG2   
855  N  N     . GLN A 116 ? 0.4284 0.4767 0.4794 -0.0066 0.0622  0.0534  242 GLN A N     
856  C  CA    . GLN A 116 ? 0.4327 0.4740 0.4878 -0.0100 0.0535  0.0445  242 GLN A CA    
857  C  C     . GLN A 116 ? 0.4296 0.4636 0.4999 -0.0148 0.0560  0.0471  242 GLN A C     
858  O  O     . GLN A 116 ? 0.4339 0.4615 0.5056 -0.0172 0.0495  0.0397  242 GLN A O     
859  C  CB    . GLN A 116 ? 0.4992 0.5469 0.5653 -0.0117 0.0484  0.0349  242 GLN A CB    
860  C  CG    . GLN A 116 ? 0.5817 0.6315 0.6314 -0.0071 0.0416  0.0293  242 GLN A CG    
861  C  CD    . GLN A 116 ? 0.6483 0.7063 0.7097 -0.0073 0.0374  0.0219  242 GLN A CD    
862  O  OE1   . GLN A 116 ? 0.6298 0.6936 0.7124 -0.0111 0.0397  0.0204  242 GLN A OE1   
863  N  NE2   . GLN A 116 ? 0.6731 0.7315 0.7220 -0.0031 0.0311  0.0173  242 GLN A NE2   
864  N  N     . ILE A 117 ? 0.3518 0.3862 0.4333 -0.0160 0.0657  0.0574  243 ILE A N     
865  C  CA    . ILE A 117 ? 0.3777 0.4033 0.4743 -0.0199 0.0688  0.0612  243 ILE A CA    
866  C  C     . ILE A 117 ? 0.3744 0.3914 0.4542 -0.0164 0.0666  0.0653  243 ILE A C     
867  O  O     . ILE A 117 ? 0.3546 0.3738 0.4174 -0.0111 0.0692  0.0735  243 ILE A O     
868  C  CB    . ILE A 117 ? 0.4134 0.4415 0.5275 -0.0219 0.0808  0.0732  243 ILE A CB    
869  C  CG1   . ILE A 117 ? 0.4447 0.4835 0.5768 -0.0254 0.0837  0.0692  243 ILE A CG1   
870  C  CG2   . ILE A 117 ? 0.4173 0.4345 0.5502 -0.0262 0.0839  0.0767  243 ILE A CG2   
871  C  CD1   . ILE A 117 ? 0.4279 0.4717 0.5747 -0.0267 0.0971  0.0824  243 ILE A CD1   
872  N  N     . PHE A 118 ? 0.3778 0.3862 0.4632 -0.0189 0.0618  0.0589  244 PHE A N     
873  C  CA    . PHE A 118 ? 0.3103 0.3106 0.3857 -0.0160 0.0607  0.0630  244 PHE A CA    
874  C  C     . PHE A 118 ? 0.3529 0.3503 0.4346 -0.0143 0.0699  0.0782  244 PHE A C     
875  O  O     . PHE A 118 ? 0.3560 0.3497 0.4599 -0.0183 0.0760  0.0823  244 PHE A O     
876  C  CB    . PHE A 118 ? 0.3595 0.3519 0.4445 -0.0195 0.0555  0.0528  244 PHE A CB    
877  C  CG    . PHE A 118 ? 0.4026 0.3872 0.4805 -0.0166 0.0545  0.0557  244 PHE A CG    
878  C  CD1   . PHE A 118 ? 0.3880 0.3742 0.4437 -0.0120 0.0498  0.0553  244 PHE A CD1   
879  C  CD2   . PHE A 118 ? 0.4071 0.3826 0.5025 -0.0183 0.0581  0.0582  244 PHE A CD2   
880  C  CE1   . PHE A 118 ? 0.4096 0.3902 0.4607 -0.0092 0.0487  0.0576  244 PHE A CE1   
881  C  CE2   . PHE A 118 ? 0.4145 0.3834 0.5047 -0.0149 0.0570  0.0607  244 PHE A CE2   
882  C  CZ    . PHE A 118 ? 0.4262 0.3985 0.4943 -0.0103 0.0523  0.0604  244 PHE A CZ    
883  N  N     . GLY A 119 ? 0.3226 0.3220 0.3850 -0.0082 0.0708  0.0869  245 GLY A N     
884  C  CA    . GLY A 119 ? 0.3170 0.3152 0.3808 -0.0051 0.0790  0.1030  245 GLY A CA    
885  C  C     . GLY A 119 ? 0.4271 0.4358 0.4824 -0.0020 0.0858  0.1121  245 GLY A C     
886  O  O     . GLY A 119 ? 0.3852 0.3945 0.4390 0.0014  0.0932  0.1270  245 GLY A O     
887  N  N     . VAL A 120 ? 0.3984 0.4158 0.4479 -0.0026 0.0837  0.1040  246 VAL A N     
888  C  CA    . VAL A 120 ? 0.3673 0.3961 0.4093 0.0005  0.0903  0.1104  246 VAL A CA    
889  C  C     . VAL A 120 ? 0.3624 0.3978 0.3800 0.0055  0.0835  0.1028  246 VAL A C     
890  O  O     . VAL A 120 ? 0.3762 0.4112 0.3925 0.0036  0.0758  0.0899  246 VAL A O     
891  C  CB    . VAL A 120 ? 0.3816 0.4157 0.4442 -0.0049 0.0954  0.1072  246 VAL A CB    
892  C  CG1   . VAL A 120 ? 0.3883 0.4352 0.4432 -0.0012 0.1034  0.1138  246 VAL A CG1   
893  C  CG2   . VAL A 120 ? 0.3783 0.4049 0.4684 -0.0109 0.1017  0.1131  246 VAL A CG2   
894  N  N     . GLY A 121 ? 0.3601 0.4017 0.3588 0.0119  0.0861  0.1108  247 GLY A N     
895  C  CA    . GLY A 121 ? 0.3628 0.4114 0.3401 0.0168  0.0805  0.1034  247 GLY A CA    
896  C  C     . GLY A 121 ? 0.3904 0.4513 0.3625 0.0197  0.0873  0.1050  247 GLY A C     
897  O  O     . GLY A 121 ? 0.4732 0.5382 0.4592 0.0175  0.0967  0.1119  247 GLY A O     
898  N  N     . VAL A 122 ? 0.4018 0.4692 0.3550 0.0246  0.0827  0.0978  248 VAL A N     
899  C  CA    . VAL A 122 ? 0.3750 0.4549 0.3218 0.0284  0.0887  0.0971  248 VAL A CA    
900  C  C     . VAL A 122 ? 0.4303 0.5179 0.3734 0.0317  0.1003  0.1126  248 VAL A C     
901  O  O     . VAL A 122 ? 0.4413 0.5373 0.3926 0.0313  0.1100  0.1166  248 VAL A O     
902  C  CB    . VAL A 122 ? 0.4043 0.4888 0.3306 0.0337  0.0815  0.0864  248 VAL A CB    
903  C  CG1   . VAL A 122 ? 0.4477 0.5456 0.3669 0.0384  0.0882  0.0848  248 VAL A CG1   
904  C  CG2   . VAL A 122 ? 0.4676 0.5441 0.3987 0.0303  0.0713  0.0728  248 VAL A CG2   
905  N  N     . LYS A 123 ? 0.4406 0.5264 0.3715 0.0355  0.0998  0.1221  249 LYS A N     
906  C  CA    . LYS A 123 ? 0.4770 0.5706 0.4011 0.0399  0.1106  0.1385  249 LYS A CA    
907  C  C     . LYS A 123 ? 0.4739 0.5637 0.4225 0.0342  0.1215  0.1500  249 LYS A C     
908  O  O     . LYS A 123 ? 0.4823 0.5816 0.4326 0.0356  0.1333  0.1599  249 LYS A O     
909  C  CB    . LYS A 123 ? 0.5037 0.5953 0.4118 0.0453  0.1064  0.1469  249 LYS A CB    
910  C  CG    . LYS A 123 ? 0.5700 0.6696 0.4527 0.0520  0.0977  0.1373  249 LYS A CG    
911  C  CD    . LYS A 123 ? 0.5870 0.6862 0.4558 0.0575  0.0927  0.1454  249 LYS A CD    
912  N  N     . THR A 124 ? 0.4775 0.5540 0.4464 0.0276  0.1180  0.1486  250 THR A N     
913  C  CA    . THR A 124 ? 0.4591 0.5311 0.4546 0.0213  0.1276  0.1578  250 THR A CA    
914  C  C     . THR A 124 ? 0.3964 0.4758 0.4077 0.0168  0.1321  0.1502  250 THR A C     
915  O  O     . THR A 124 ? 0.4382 0.5240 0.4618 0.0153  0.1444  0.1601  250 THR A O     
916  C  CB    . THR A 124 ? 0.4616 0.5179 0.4746 0.0157  0.1216  0.1551  250 THR A CB    
917  O  OG1   . THR A 124 ? 0.4512 0.5018 0.4506 0.0206  0.1174  0.1621  250 THR A OG1   
918  C  CG2   . THR A 124 ? 0.4813 0.5321 0.5240 0.0090  0.1311  0.1636  250 THR A CG2   
919  N  N     . ALA A 125 ? 0.3557 0.4345 0.3678 0.0149  0.1224  0.1331  251 ALA A N     
920  C  CA    . ALA A 125 ? 0.3521 0.4390 0.3786 0.0117  0.1249  0.1249  251 ALA A CA    
921  C  C     . ALA A 125 ? 0.4016 0.5039 0.4185 0.0169  0.1353  0.1305  251 ALA A C     
922  O  O     . ALA A 125 ? 0.4011 0.5111 0.4363 0.0139  0.1452  0.1341  251 ALA A O     
923  C  CB    . ALA A 125 ? 0.3790 0.4636 0.4006 0.0115  0.1121  0.1072  251 ALA A CB    
924  N  N     . ASP A 126 ? 0.4458 0.5537 0.4346 0.0248  0.1333  0.1305  252 ASP A N     
925  C  CA    . ASP A 126 ? 0.4867 0.6104 0.4636 0.0306  0.1428  0.1338  252 ASP A CA    
926  C  C     . ASP A 126 ? 0.4851 0.6143 0.4695 0.0303  0.1584  0.1529  252 ASP A C     
927  O  O     . ASP A 126 ? 0.5186 0.6597 0.5119 0.0301  0.1696  0.1559  252 ASP A O     
928  C  CB    . ASP A 126 ? 0.4820 0.6106 0.4269 0.0392  0.1371  0.1298  252 ASP A CB    
929  C  CG    . ASP A 126 ? 0.5322 0.6781 0.4621 0.0462  0.1473  0.1331  252 ASP A CG    
930  O  OD1   . ASP A 126 ? 0.5306 0.6852 0.4685 0.0462  0.1509  0.1245  252 ASP A OD1   
931  O  OD2   . ASP A 126 ? 0.5432 0.6948 0.4536 0.0521  0.1521  0.1446  252 ASP A OD2   
932  N  N     A ARG A 127 ? 0.4414 0.5620 0.4229 0.0304  0.1597  0.1666  253 ARG A N     
933  N  N     B ARG A 127 ? 0.4455 0.5660 0.4275 0.0303  0.1598  0.1666  253 ARG A N     
934  C  CA    A ARG A 127 ? 0.4634 0.5873 0.4526 0.0302  0.1748  0.1870  253 ARG A CA    
935  C  CA    B ARG A 127 ? 0.4645 0.5887 0.4535 0.0302  0.1750  0.1870  253 ARG A CA    
936  C  C     A ARG A 127 ? 0.4588 0.5815 0.4836 0.0210  0.1833  0.1887  253 ARG A C     
937  C  C     B ARG A 127 ? 0.4582 0.5806 0.4832 0.0210  0.1835  0.1893  253 ARG A C     
938  O  O     A ARG A 127 ? 0.4508 0.5844 0.4841 0.0207  0.1976  0.1985  253 ARG A O     
939  O  O     B ARG A 127 ? 0.4568 0.5895 0.4908 0.0205  0.1981  0.2001  253 ARG A O     
940  C  CB    A ARG A 127 ? 0.4953 0.6074 0.4792 0.0316  0.1730  0.2006  253 ARG A CB    
941  C  CB    B ARG A 127 ? 0.4946 0.6080 0.4763 0.0323  0.1735  0.2011  253 ARG A CB    
942  C  CG    A ARG A 127 ? 0.5267 0.6378 0.5244 0.0300  0.1882  0.2230  253 ARG A CG    
943  C  CG    B ARG A 127 ? 0.5292 0.6449 0.5151 0.0335  0.1880  0.2231  253 ARG A CG    
944  C  CD    A ARG A 127 ? 0.5466 0.6459 0.5357 0.0336  0.1832  0.2339  253 ARG A CD    
945  C  CD    B ARG A 127 ? 0.5441 0.6502 0.5170 0.0384  0.1825  0.2337  253 ARG A CD    
946  N  NE    A ARG A 127 ? 0.5232 0.6065 0.5271 0.0286  0.1750  0.2295  253 ARG A NE    
947  N  NE    B ARG A 127 ? 0.5392 0.6286 0.5294 0.0332  0.1769  0.2342  253 ARG A NE    
948  C  CZ    A ARG A 127 ? 0.5299 0.6005 0.5656 0.0203  0.1784  0.2326  253 ARG A CZ    
949  C  CZ    B ARG A 127 ? 0.5104 0.5933 0.4892 0.0352  0.1633  0.2241  253 ARG A CZ    
950  N  NH1   A ARG A 127 ? 0.5386 0.6108 0.5961 0.0156  0.1905  0.2413  253 ARG A NH1   
951  N  NH1   B ARG A 127 ? 0.4917 0.5837 0.4422 0.0421  0.1549  0.2147  253 ARG A NH1   
952  N  NH2   A ARG A 127 ? 0.4978 0.5540 0.5442 0.0166  0.1677  0.2236  253 ARG A NH2   
953  N  NH2   B ARG A 127 ? 0.4896 0.5565 0.4868 0.0301  0.1572  0.2214  253 ARG A NH2   
954  N  N     . TRP A 128 ? 0.4998 0.6101 0.5462 0.0135  0.1746  0.1788  254 TRP A N     
955  C  CA    . TRP A 128 ? 0.4767 0.5864 0.5586 0.0045  0.1804  0.1773  254 TRP A CA    
956  C  C     . TRP A 128 ? 0.4540 0.5800 0.5419 0.0047  0.1850  0.1689  254 TRP A C     
957  O  O     . TRP A 128 ? 0.4128 0.5466 0.5234 0.0005  0.1977  0.1759  254 TRP A O     
958  C  CB    . TRP A 128 ? 0.4374 0.5332 0.5362 -0.0022 0.1676  0.1642  254 TRP A CB    
959  C  CG    . TRP A 128 ? 0.4657 0.5455 0.5677 -0.0038 0.1655  0.1728  254 TRP A CG    
960  C  CD1   . TRP A 128 ? 0.4830 0.5592 0.5809 -0.0011 0.1748  0.1922  254 TRP A CD1   
961  C  CD2   . TRP A 128 ? 0.4372 0.5029 0.5475 -0.0078 0.1535  0.1623  254 TRP A CD2   
962  N  NE1   . TRP A 128 ? 0.4719 0.5320 0.5767 -0.0031 0.1691  0.1942  254 TRP A NE1   
963  C  CE2   . TRP A 128 ? 0.4051 0.4589 0.5173 -0.0073 0.1563  0.1754  254 TRP A CE2   
964  C  CE3   . TRP A 128 ? 0.4116 0.4740 0.5270 -0.0113 0.1410  0.1435  254 TRP A CE3   
965  C  CZ2   . TRP A 128 ? 0.3797 0.4188 0.5000 -0.0103 0.1474  0.1691  254 TRP A CZ2   
966  C  CZ3   . TRP A 128 ? 0.3806 0.4291 0.5022 -0.0143 0.1324  0.1378  254 TRP A CZ3   
967  C  CH2   . TRP A 128 ? 0.3957 0.4328 0.5201 -0.0139 0.1358  0.1499  254 TRP A CH2   
968  N  N     . TYR A 129 ? 0.4039 0.5351 0.4733 0.0097  0.1754  0.1540  255 TYR A N     
969  C  CA    . TYR A 129 ? 0.4100 0.5566 0.4847 0.0112  0.1793  0.1453  255 TYR A CA    
970  C  C     . TYR A 129 ? 0.4931 0.6549 0.5601 0.0158  0.1960  0.1586  255 TYR A C     
971  O  O     . TYR A 129 ? 0.4585 0.6325 0.5453 0.0134  0.2063  0.1593  255 TYR A O     
972  C  CB    . TYR A 129 ? 0.4290 0.5768 0.4827 0.0169  0.1663  0.1285  255 TYR A CB    
973  C  CG    . TYR A 129 ? 0.4409 0.6020 0.5048 0.0181  0.1679  0.1172  255 TYR A CG    
974  C  CD1   . TYR A 129 ? 0.4216 0.5807 0.5093 0.0126  0.1604  0.1055  255 TYR A CD1   
975  C  CD2   . TYR A 129 ? 0.4507 0.6273 0.5006 0.0252  0.1769  0.1180  255 TYR A CD2   
976  C  CE1   . TYR A 129 ? 0.4092 0.5808 0.5078 0.0144  0.1613  0.0956  255 TYR A CE1   
977  C  CE2   . TYR A 129 ? 0.4317 0.6206 0.4927 0.0269  0.1786  0.1073  255 TYR A CE2   
978  C  CZ    . TYR A 129 ? 0.4183 0.6045 0.5043 0.0215  0.1706  0.0965  255 TYR A CZ    
979  O  OH    . TYR A 129 ? 0.4594 0.6582 0.5580 0.0238  0.1718  0.0862  255 TYR A OH    
980  N  N     . ARG A 130 ? 0.5455 0.7080 0.5837 0.0229  0.1988  0.1691  256 ARG A N     
981  C  CA    . ARG A 130 ? 0.5906 0.7683 0.6177 0.0282  0.2151  0.1830  256 ARG A CA    
982  C  C     . ARG A 130 ? 0.5522 0.7276 0.6049 0.0215  0.2282  0.1997  256 ARG A C     
983  O  O     . ARG A 130 ? 0.5751 0.7608 0.6296 0.0225  0.2384  0.2046  256 ARG A O     
984  C  CB    . ARG A 130 ? 0.6385 0.8172 0.6278 0.0377  0.2127  0.1898  256 ARG A CB    
985  C  CG    . ARG A 130 ? 0.6952 0.8777 0.6590 0.0446  0.2001  0.1716  256 ARG A CG    
986  C  CD    . ARG A 130 ? 0.8169 1.0036 0.7445 0.0541  0.1979  0.1767  256 ARG A CD    
987  N  NE    . ARG A 130 ? 0.9012 1.0735 0.8201 0.0540  0.1870  0.1802  256 ARG A NE    
988  C  CZ    . ARG A 130 ? 0.9642 1.1274 0.8840 0.0531  0.1882  0.1955  256 ARG A CZ    
989  N  NH1   . ARG A 130 ? 1.0158 1.1808 0.9445 0.0518  0.1988  0.2087  256 ARG A NH1   
990  N  NH2   . ARG A 130 ? 0.9523 1.1040 0.8650 0.0538  0.1782  0.1971  256 ARG A NH2   
991  N  N     . GLU A 131 ? 0.5975 0.7573 0.6704 0.0144  0.2255  0.2052  257 GLU A N     
992  C  CA    . GLU A 131 ? 0.6013 0.7546 0.7013 0.0071  0.2339  0.2167  257 GLU A CA    
993  C  C     . GLU A 131 ? 0.5508 0.7107 0.6886 -0.0016 0.2393  0.2096  257 GLU A C     
994  O  O     . GLU A 131 ? 0.4849 0.6403 0.6490 -0.0085 0.2462  0.2171  257 GLU A O     
995  C  CB    . GLU A 131 ? 0.5968 0.7300 0.7050 0.0033  0.2282  0.2239  257 GLU A CB    
996  C  CG    . GLU A 131 ? 0.6275 0.7546 0.7041 0.0117  0.2247  0.2346  257 GLU A CG    
997  C  CD    . GLU A 131 ? 0.6801 0.7880 0.7643 0.0091  0.2177  0.2393  257 GLU A CD    
998  O  OE1   . GLU A 131 ? 0.6825 0.7809 0.7965 0.0003  0.2161  0.2342  257 GLU A OE1   
999  O  OE2   . GLU A 131 ? 0.7038 0.8067 0.7647 0.0160  0.2134  0.2473  257 GLU A OE2   
1000 N  N     . GLY A 132 ? 0.4817 0.6524 0.6236 -0.0012 0.2353  0.1943  258 GLY A N     
1001 C  CA    . GLY A 132 ? 0.4473 0.6254 0.6247 -0.0086 0.2374  0.1848  258 GLY A CA    
1002 C  C     . GLY A 132 ? 0.4471 0.6119 0.6479 -0.0167 0.2233  0.1717  258 GLY A C     
1003 O  O     . GLY A 132 ? 0.4783 0.6498 0.7092 -0.0228 0.2226  0.1619  258 GLY A O     
1004 N  N     . LEU A 133 ? 0.4213 0.5687 0.6094 -0.0165 0.2120  0.1706  259 LEU A N     
1005 C  CA    . LEU A 133 ? 0.4467 0.5820 0.6550 -0.0237 0.1990  0.1578  259 LEU A CA    
1006 C  C     . LEU A 133 ? 0.4590 0.5986 0.6591 -0.0211 0.1842  0.1373  259 LEU A C     
1007 O  O     . LEU A 133 ? 0.4388 0.5821 0.6090 -0.0129 0.1795  0.1330  259 LEU A O     
1008 C  CB    . LEU A 133 ? 0.5033 0.6196 0.7000 -0.0236 0.1924  0.1630  259 LEU A CB    
1009 C  CG    . LEU A 133 ? 0.4883 0.5981 0.6930 -0.0253 0.2064  0.1848  259 LEU A CG    
1010 C  CD1   . LEU A 133 ? 0.4888 0.5819 0.6761 -0.0223 0.1995  0.1904  259 LEU A CD1   
1011 C  CD2   . LEU A 133 ? 0.5319 0.6393 0.7807 -0.0362 0.2138  0.1870  259 LEU A CD2   
1012 N  N     . ARG A 134 ? 0.4696 0.6091 0.6975 -0.0280 0.1769  0.1246  260 ARG A N     
1013 C  CA    . ARG A 134 ? 0.4712 0.6158 0.6949 -0.0256 0.1634  0.1065  260 ARG A CA    
1014 C  C     . ARG A 134 ? 0.4308 0.5648 0.6659 -0.0308 0.1483  0.0932  260 ARG A C     
1015 O  O     . ARG A 134 ? 0.3832 0.5156 0.6025 -0.0269 0.1352  0.0811  260 ARG A O     
1016 C  CB    . ARG A 134 ? 0.4862 0.6497 0.7317 -0.0263 0.1700  0.1020  260 ARG A CB    
1017 C  CG    . ARG A 134 ? 0.4503 0.6274 0.6813 -0.0196 0.1839  0.1114  260 ARG A CG    
1018 C  CD    . ARG A 134 ? 0.4224 0.5997 0.6166 -0.0095 0.1763  0.1050  260 ARG A CD    
1019 N  NE    . ARG A 134 ? 0.4320 0.6238 0.6124 -0.0026 0.1893  0.1117  260 ARG A NE    
1020 C  CZ    . ARG A 134 ? 0.4164 0.6079 0.5747 0.0016  0.1990  0.1258  260 ARG A CZ    
1021 N  NH1   . ARG A 134 ? 0.3972 0.5740 0.5456 -0.0002 0.1972  0.1354  260 ARG A NH1   
1022 N  NH2   . ARG A 134 ? 0.4377 0.6445 0.5835 0.0082  0.2106  0.1300  260 ARG A NH2   
1023 N  N     . THR A 135 ? 0.3988 0.5254 0.6603 -0.0392 0.1497  0.0948  261 THR A N     
1024 C  CA    . THR A 135 ? 0.4085 0.5282 0.6840 -0.0443 0.1359  0.0803  261 THR A CA    
1025 C  C     . THR A 135 ? 0.4166 0.5181 0.6895 -0.0473 0.1337  0.0844  261 THR A C     
1026 O  O     . THR A 135 ? 0.4579 0.5525 0.7249 -0.0465 0.1438  0.0997  261 THR A O     
1027 C  CB    . THR A 135 ? 0.4573 0.5876 0.7738 -0.0524 0.1380  0.0737  261 THR A CB    
1028 O  OG1   . THR A 135 ? 0.4468 0.5723 0.7881 -0.0594 0.1507  0.0854  261 THR A OG1   
1029 C  CG2   . THR A 135 ? 0.4238 0.5736 0.7462 -0.0491 0.1432  0.0721  261 THR A CG2   
1030 N  N     . LEU A 136 ? 0.3815 0.4756 0.6586 -0.0502 0.1203  0.0707  262 LEU A N     
1031 C  CA    . LEU A 136 ? 0.4037 0.4809 0.6810 -0.0530 0.1178  0.0722  262 LEU A CA    
1032 C  C     . LEU A 136 ? 0.4615 0.5345 0.7737 -0.0613 0.1282  0.0793  262 LEU A C     
1033 O  O     . LEU A 136 ? 0.4466 0.5062 0.7584 -0.0619 0.1333  0.0895  262 LEU A O     
1034 C  CB    . LEU A 136 ? 0.4266 0.4990 0.7006 -0.0541 0.1016  0.0547  262 LEU A CB    
1035 C  CG    . LEU A 136 ? 0.4366 0.5105 0.6775 -0.0466 0.0907  0.0477  262 LEU A CG    
1036 C  CD1   . LEU A 136 ? 0.4202 0.4894 0.6601 -0.0483 0.0763  0.0320  262 LEU A CD1   
1037 C  CD2   . LEU A 136 ? 0.4019 0.4676 0.6117 -0.0401 0.0935  0.0586  262 LEU A CD2   
1038 N  N     . ASP A 137 ? 0.4731 0.5575 0.8173 -0.0675 0.1316  0.0744  263 ASP A N     
1039 C  CA    . ASP A 137 ? 0.5719 0.6527 0.9530 -0.0761 0.1425  0.0815  263 ASP A CA    
1040 C  C     . ASP A 137 ? 0.5518 0.6324 0.9295 -0.0741 0.1604  0.1042  263 ASP A C     
1041 O  O     . ASP A 137 ? 0.5335 0.6038 0.9309 -0.0790 0.1700  0.1155  263 ASP A O     
1042 C  CB    . ASP A 137 ? 0.6003 0.6953 1.0180 -0.0834 0.1414  0.0697  263 ASP A CB    
1043 C  CG    . ASP A 137 ? 0.6264 0.7199 1.0536 -0.0868 0.1244  0.0480  263 ASP A CG    
1044 O  OD1   . ASP A 137 ? 0.6043 0.6831 1.0178 -0.0858 0.1168  0.0437  263 ASP A OD1   
1045 O  OD2   . ASP A 137 ? 0.6237 0.7317 1.0718 -0.0901 0.1187  0.0353  263 ASP A OD2   
1046 N  N     . ASP A 138 ? 0.5057 0.5974 0.8583 -0.0666 0.1650  0.1113  264 ASP A N     
1047 C  CA    . ASP A 138 ? 0.4794 0.5711 0.8207 -0.0628 0.1808  0.1330  264 ASP A CA    
1048 C  C     . ASP A 138 ? 0.4137 0.4873 0.7358 -0.0595 0.1800  0.1432  264 ASP A C     
1049 O  O     . ASP A 138 ? 0.4065 0.4736 0.7360 -0.0604 0.1926  0.1614  264 ASP A O     
1050 C  CB    . ASP A 138 ? 0.5183 0.6248 0.8309 -0.0541 0.1832  0.1352  264 ASP A CB    
1051 C  CG    . ASP A 138 ? 0.5666 0.6921 0.8999 -0.0565 0.1859  0.1269  264 ASP A CG    
1052 O  OD1   . ASP A 138 ? 0.5610 0.6905 0.9330 -0.0653 0.1916  0.1260  264 ASP A OD1   
1053 O  OD2   . ASP A 138 ? 0.5620 0.6987 0.8744 -0.0495 0.1822  0.1210  264 ASP A OD2   
1054 N  N     . LEU A 139 ? 0.4563 0.5219 0.7553 -0.0554 0.1653  0.1322  265 LEU A N     
1055 C  CA    . LEU A 139 ? 0.5147 0.5642 0.7967 -0.0519 0.1634  0.1401  265 LEU A CA    
1056 C  C     . LEU A 139 ? 0.5480 0.5826 0.8611 -0.0597 0.1640  0.1393  265 LEU A C     
1057 O  O     . LEU A 139 ? 0.5565 0.5787 0.8699 -0.0585 0.1703  0.1536  265 LEU A O     
1058 C  CB    . LEU A 139 ? 0.4748 0.5215 0.7250 -0.0457 0.1482  0.1279  265 LEU A CB    
1059 C  CG    . LEU A 139 ? 0.4082 0.4678 0.6286 -0.0381 0.1457  0.1257  265 LEU A CG    
1060 C  CD1   . LEU A 139 ? 0.4216 0.4769 0.6177 -0.0340 0.1302  0.1119  265 LEU A CD1   
1061 C  CD2   . LEU A 139 ? 0.4364 0.4993 0.6354 -0.0312 0.1564  0.1440  265 LEU A CD2   
1062 N  N     . ARG A 140 ? 0.4830 0.5189 0.8230 -0.0672 0.1571  0.1224  266 ARG A N     
1063 C  CA    . ARG A 140 ? 0.5392 0.5614 0.9106 -0.0749 0.1568  0.1184  266 ARG A CA    
1064 C  C     . ARG A 140 ? 0.6141 0.6332 1.0170 -0.0807 0.1736  0.1353  266 ARG A C     
1065 O  O     . ARG A 140 ? 0.6235 0.6267 1.0454 -0.0844 0.1771  0.1405  266 ARG A O     
1066 C  CB    . ARG A 140 ? 0.5182 0.5455 0.9099 -0.0813 0.1448  0.0948  266 ARG A CB    
1067 C  CG    . ARG A 140 ? 0.5061 0.5280 0.8743 -0.0773 0.1284  0.0787  266 ARG A CG    
1068 C  CD    . ARG A 140 ? 0.4712 0.5063 0.8401 -0.0786 0.1159  0.0588  266 ARG A CD    
1069 N  NE    . ARG A 140 ? 0.4899 0.5199 0.8345 -0.0745 0.1016  0.0455  266 ARG A NE    
1070 C  CZ    . ARG A 140 ? 0.4861 0.5259 0.8195 -0.0727 0.0895  0.0306  266 ARG A CZ    
1071 N  NH1   . ARG A 140 ? 0.4833 0.5389 0.8284 -0.0742 0.0891  0.0263  266 ARG A NH1   
1072 N  NH2   . ARG A 140 ? 0.4823 0.5166 0.7935 -0.0691 0.0781  0.0207  266 ARG A NH2   
1073 N  N     . GLU A 141 ? 0.6726 0.7064 1.0820 -0.0815 0.1848  0.1446  267 GLU A N     
1074 C  CA    . GLU A 141 ? 0.7197 0.7509 1.1507 -0.0845 0.1969  0.1571  267 GLU A CA    
1075 C  C     . GLU A 141 ? 0.7924 0.8103 1.2044 -0.0775 0.2039  0.1775  267 GLU A C     
1076 O  O     . GLU A 141 ? 0.8269 0.8351 1.2579 -0.0796 0.2099  0.1854  267 GLU A O     
1077 C  CB    . GLU A 141 ? 0.7409 0.7918 1.1746 -0.0843 0.2051  0.1606  267 GLU A CB    
1078 C  CG    . GLU A 141 ? 0.7446 0.8094 1.2057 -0.0917 0.1990  0.1411  267 GLU A CG    
1079 C  CD    . GLU A 141 ? 0.7352 0.8219 1.1917 -0.0892 0.2055  0.1431  267 GLU A CD    
1080 O  OE1   . GLU A 141 ? 0.7520 0.8425 1.1848 -0.0823 0.2157  0.1595  267 GLU A OE1   
1081 O  OE2   . GLU A 141 ? 0.7031 0.8038 1.1794 -0.0935 0.1999  0.1275  267 GLU A OE2   
1082 N  N     . GLN A 142 ? 0.8989 0.9171 1.2744 -0.0689 0.2028  0.1862  268 GLN A N     
1083 C  CA    . GLN A 142 ? 0.9548 0.9636 1.3089 -0.0608 0.2080  0.2053  268 GLN A CA    
1084 C  C     . GLN A 142 ? 0.9705 0.9675 1.3050 -0.0563 0.1988  0.2034  268 GLN A C     
1085 O  O     . GLN A 142 ? 0.9585 0.9601 1.2588 -0.0480 0.1974  0.2102  268 GLN A O     
1086 C  CB    . GLN A 142 ? 0.9552 0.9786 1.2807 -0.0530 0.2162  0.2191  268 GLN A CB    
1087 N  N     . PRO A 143 ? 0.7785 0.7607 1.1344 -0.0614 0.1923  0.1934  269 PRO A N     
1088 C  CA    . PRO A 143 ? 0.7837 0.7548 1.1233 -0.0576 0.1836  0.1901  269 PRO A CA    
1089 C  C     . PRO A 143 ? 0.8433 0.8045 1.1641 -0.0485 0.1863  0.2078  269 PRO A C     
1090 O  O     . PRO A 143 ? 0.8474 0.8005 1.1526 -0.0441 0.1794  0.2067  269 PRO A O     
1091 C  CB    . PRO A 143 ? 0.7455 0.7048 1.1176 -0.0661 0.1768  0.1725  269 PRO A CB    
1092 C  CG    . PRO A 143 ? 0.7819 0.7395 1.1848 -0.0713 0.1840  0.1750  269 PRO A CG    
1093 C  CD    . PRO A 143 ? 0.7952 0.7701 1.1912 -0.0703 0.1926  0.1840  269 PRO A CD    
1094 N  N     . GLN A 144 ? 0.7861 0.7484 1.1086 -0.0454 0.1958  0.2240  270 GLN A N     
1095 C  CA    . GLN A 144 ? 0.8172 0.7718 1.1230 -0.0363 0.1979  0.2412  270 GLN A CA    
1096 C  C     . GLN A 144 ? 0.8126 0.7763 1.0763 -0.0266 0.1943  0.2475  270 GLN A C     
1097 O  O     . GLN A 144 ? 0.8482 0.8051 1.0957 -0.0189 0.1909  0.2559  270 GLN A O     
1098 C  CB    . GLN A 144 ? 0.8503 0.8060 1.1667 -0.0354 0.2095  0.2573  270 GLN A CB    
1099 N  N     . LYS A 145 ? 0.9946 0.9743 1.2415 -0.0264 0.1945  0.2427  271 LYS A N     
1100 C  CA    . LYS A 145 ? 0.9413 0.9316 1.1486 -0.0171 0.1910  0.2467  271 LYS A CA    
1101 C  C     . LYS A 145 ? 0.8297 0.8187 1.0242 -0.0169 0.1792  0.2318  271 LYS A C     
1102 O  O     . LYS A 145 ? 0.8611 0.8610 1.0233 -0.0100 0.1732  0.2279  271 LYS A O     
1103 C  CB    . LYS A 145 ? 0.9647 0.9738 1.1588 -0.0156 0.1976  0.2488  271 LYS A CB    
1104 N  N     . LEU A 146 ? 0.7128 0.6898 0.9279 -0.0228 0.1714  0.2170  272 LEU A N     
1105 C  CA    . LEU A 146 ? 0.5972 0.5739 0.7979 -0.0219 0.1559  0.1961  272 LEU A CA    
1106 C  C     . LEU A 146 ? 0.5807 0.5442 0.7752 -0.0173 0.1495  0.1978  272 LEU A C     
1107 O  O     . LEU A 146 ? 0.5894 0.5395 0.8052 -0.0187 0.1549  0.2074  272 LEU A O     
1108 C  CB    . LEU A 146 ? 0.4769 0.4522 0.7024 -0.0312 0.1504  0.1757  272 LEU A CB    
1109 C  CG    . LEU A 146 ? 0.4794 0.4686 0.7148 -0.0362 0.1548  0.1707  272 LEU A CG    
1110 C  CD1   . LEU A 146 ? 0.4579 0.4453 0.7189 -0.0448 0.1476  0.1503  272 LEU A CD1   
1111 C  CD2   . LEU A 146 ? 0.3948 0.3991 0.5976 -0.0298 0.1507  0.1673  272 LEU A CD2   
1112 N  N     . THR A 147 ? 0.6208 0.5883 0.7881 -0.0118 0.1383  0.1881  273 THR A N     
1113 C  CA    . THR A 147 ? 0.5961 0.5527 0.7598 -0.0083 0.1307  0.1851  273 THR A CA    
1114 C  C     . THR A 147 ? 0.5529 0.5000 0.7398 -0.0156 0.1247  0.1666  273 THR A C     
1115 O  O     . THR A 147 ? 0.5281 0.4795 0.7273 -0.0226 0.1235  0.1537  273 THR A O     
1116 C  CB    . THR A 147 ? 0.5818 0.5468 0.7116 -0.0010 0.1209  0.1795  273 THR A CB    
1117 O  OG1   . THR A 147 ? 0.5950 0.5679 0.7174 -0.0046 0.1136  0.1610  273 THR A OG1   
1118 C  CG2   . THR A 147 ? 0.5827 0.5584 0.6887 0.0068  0.1260  0.1960  273 THR A CG2   
1119 N  N     . GLN A 148 ? 0.5935 0.5285 0.7866 -0.0136 0.1209  0.1651  274 GLN A N     
1120 C  CA    . GLN A 148 ? 0.5843 0.5112 0.7952 -0.0194 0.1144  0.1458  274 GLN A CA    
1121 C  C     . GLN A 148 ? 0.5037 0.4405 0.6959 -0.0204 0.1039  0.1268  274 GLN A C     
1122 O  O     . GLN A 148 ? 0.4622 0.3990 0.6676 -0.0267 0.0997  0.1103  274 GLN A O     
1123 C  CB    . GLN A 148 ? 0.5650 0.4788 0.7818 -0.0154 0.1120  0.1472  274 GLN A CB    
1124 N  N     . GLN A 149 ? 0.4234 0.3691 0.5852 -0.0139 0.0993  0.1291  275 GLN A N     
1125 C  CA    . GLN A 149 ? 0.4387 0.3929 0.5824 -0.0144 0.0899  0.1131  275 GLN A CA    
1126 C  C     . GLN A 149 ? 0.4166 0.3802 0.5644 -0.0194 0.0913  0.1075  275 GLN A C     
1127 O  O     . GLN A 149 ? 0.4373 0.4040 0.5862 -0.0231 0.0844  0.0915  275 GLN A O     
1128 C  CB    . GLN A 149 ? 0.4584 0.4195 0.5717 -0.0067 0.0857  0.1179  275 GLN A CB    
1129 C  CG    . GLN A 149 ? 0.5155 0.4830 0.6106 -0.0066 0.0761  0.1027  275 GLN A CG    
1130 C  CD    . GLN A 149 ? 0.5298 0.5038 0.5982 0.0005  0.0723  0.1073  275 GLN A CD    
1131 O  OE1   . GLN A 149 ? 0.5424 0.5236 0.5992 0.0043  0.0761  0.1178  275 GLN A OE1   
1132 N  NE2   . GLN A 149 ? 0.5217 0.4939 0.5812 0.0022  0.0649  0.0990  275 GLN A NE2   
1133 N  N     . GLN A 150 ? 0.4273 0.3962 0.5781 -0.0190 0.1003  0.1209  276 GLN A N     
1134 C  CA    . GLN A 150 ? 0.3914 0.3707 0.5476 -0.0231 0.1025  0.1165  276 GLN A CA    
1135 C  C     . GLN A 150 ? 0.4107 0.3859 0.5997 -0.0318 0.1043  0.1083  276 GLN A C     
1136 O  O     . GLN A 150 ? 0.4076 0.3905 0.6024 -0.0359 0.1003  0.0959  276 GLN A O     
1137 C  CB    . GLN A 150 ? 0.4140 0.4014 0.5631 -0.0197 0.1127  0.1336  276 GLN A CB    
1138 C  CG    . GLN A 150 ? 0.4145 0.4098 0.5298 -0.0113 0.1094  0.1376  276 GLN A CG    
1139 C  CD    . GLN A 150 ? 0.4311 0.4326 0.5372 -0.0063 0.1197  0.1566  276 GLN A CD    
1140 O  OE1   . GLN A 150 ? 0.3981 0.3964 0.5228 -0.0087 0.1303  0.1695  276 GLN A OE1   
1141 N  NE2   . GLN A 150 ? 0.4386 0.4492 0.5159 0.0009  0.1168  0.1585  276 GLN A NE2   
1142 N  N     . LYS A 151 ? 0.4246 0.3879 0.6367 -0.0345 0.1100  0.1147  277 LYS A N     
1143 C  CA    . LYS A 151 ? 0.4226 0.3809 0.6681 -0.0431 0.1106  0.1045  277 LYS A CA    
1144 C  C     . LYS A 151 ? 0.3804 0.3382 0.6239 -0.0453 0.0983  0.0825  277 LYS A C     
1145 O  O     . LYS A 151 ? 0.3749 0.3374 0.6352 -0.0514 0.0949  0.0689  277 LYS A O     
1146 C  CB    . LYS A 151 ? 0.4947 0.4380 0.7649 -0.0448 0.1185  0.1150  277 LYS A CB    
1147 C  CG    . LYS A 151 ? 0.6191 0.5627 0.8973 -0.0441 0.1323  0.1376  277 LYS A CG    
1148 C  CD    . LYS A 151 ? 0.7289 0.6557 1.0282 -0.0442 0.1394  0.1503  277 LYS A CD    
1149 C  CE    . LYS A 151 ? 0.7886 0.7158 1.0934 -0.0427 0.1539  0.1753  277 LYS A CE    
1150 N  NZ    . LYS A 151 ? 0.8369 0.7470 1.1594 -0.0412 0.1608  0.1904  277 LYS A NZ    
1151 N  N     . ALA A 152 ? 0.4190 0.3722 0.6425 -0.0401 0.0916  0.0787  278 ALA A N     
1152 C  CA    . ALA A 152 ? 0.4546 0.4087 0.6720 -0.0414 0.0806  0.0591  278 ALA A CA    
1153 C  C     . ALA A 152 ? 0.4386 0.4063 0.6387 -0.0410 0.0743  0.0511  278 ALA A C     
1154 O  O     . ALA A 152 ? 0.4508 0.4229 0.6582 -0.0451 0.0678  0.0357  278 ALA A O     
1155 C  CB    . ALA A 152 ? 0.5252 0.4725 0.7247 -0.0356 0.0763  0.0588  278 ALA A CB    
1156 N  N     . GLY A 153 ? 0.3483 0.3228 0.5255 -0.0358 0.0758  0.0610  279 GLY A N     
1157 C  CA    . GLY A 153 ? 0.3568 0.3432 0.5188 -0.0348 0.0703  0.0540  279 GLY A CA    
1158 C  C     . GLY A 153 ? 0.3243 0.3188 0.5071 -0.0403 0.0723  0.0496  279 GLY A C     
1159 O  O     . GLY A 153 ? 0.3447 0.3468 0.5255 -0.0416 0.0649  0.0373  279 GLY A O     
1160 N  N     A LEU A 154 ? 0.3130 0.3064 0.5174 -0.0435 0.0825  0.0599  280 LEU A N     
1161 N  N     B LEU A 154 ? 0.3129 0.3066 0.5169 -0.0434 0.0826  0.0601  280 LEU A N     
1162 C  CA    A LEU A 154 ? 0.3159 0.3183 0.5436 -0.0491 0.0857  0.0566  280 LEU A CA    
1163 C  CA    B LEU A 154 ? 0.3141 0.3166 0.5416 -0.0491 0.0854  0.0561  280 LEU A CA    
1164 C  C     A LEU A 154 ? 0.3606 0.3603 0.6141 -0.0561 0.0801  0.0408  280 LEU A C     
1165 C  C     B LEU A 154 ? 0.3629 0.3626 0.6148 -0.0558 0.0793  0.0400  280 LEU A C     
1166 O  O     A LEU A 154 ? 0.3491 0.3591 0.6119 -0.0592 0.0748  0.0294  280 LEU A O     
1167 O  O     B LEU A 154 ? 0.3421 0.3518 0.6010 -0.0585 0.0729  0.0276  280 LEU A O     
1168 C  CB    A LEU A 154 ? 0.3247 0.3269 0.5672 -0.0503 0.0997  0.0742  280 LEU A CB    
1169 C  CB    B LEU A 154 ? 0.3243 0.3269 0.5686 -0.0508 0.0993  0.0730  280 LEU A CB    
1170 C  CG    A LEU A 154 ? 0.3273 0.3409 0.5925 -0.0552 0.1064  0.0753  280 LEU A CG    
1171 C  CG    B LEU A 154 ? 0.3252 0.3372 0.5487 -0.0450 0.1057  0.0861  280 LEU A CG    
1172 C  CD1   A LEU A 154 ? 0.3446 0.3730 0.5952 -0.0525 0.1003  0.0671  280 LEU A CD1   
1173 C  CD1   B LEU A 154 ? 0.3671 0.3771 0.6038 -0.0458 0.1203  0.1050  280 LEU A CD1   
1174 C  CD2   A LEU A 154 ? 0.3618 0.3754 0.6312 -0.0540 0.1213  0.0963  280 LEU A CD2   
1175 C  CD2   B LEU A 154 ? 0.3392 0.3663 0.5622 -0.0454 0.1028  0.0778  280 LEU A CD2   
1176 N  N     . GLN A 155 ? 0.3204 0.3070 0.5856 -0.0581 0.0806  0.0391  281 GLN A N     
1177 C  CA    . GLN A 155 ? 0.3884 0.3722 0.6771 -0.0643 0.0746  0.0220  281 GLN A CA    
1178 C  C     . GLN A 155 ? 0.3128 0.3037 0.5835 -0.0625 0.0612  0.0047  281 GLN A C     
1179 O  O     . GLN A 155 ? 0.3116 0.3102 0.5971 -0.0669 0.0549  -0.0098 281 GLN A O     
1180 C  CB    . GLN A 155 ? 0.4502 0.4178 0.7512 -0.0653 0.0773  0.0229  281 GLN A CB    
1181 C  CG    . GLN A 155 ? 0.5355 0.4946 0.8681 -0.0700 0.0895  0.0352  281 GLN A CG    
1182 C  CD    . GLN A 155 ? 0.6576 0.5995 0.9955 -0.0679 0.0932  0.0415  281 GLN A CD    
1183 O  OE1   . GLN A 155 ? 0.6776 0.6153 0.9911 -0.0616 0.0887  0.0415  281 GLN A OE1   
1184 N  NE2   . GLN A 155 ? 0.6944 0.6263 1.0661 -0.0733 0.1017  0.0470  281 GLN A NE2   
1185 N  N     . HIS A 156 ? 0.3070 0.2962 0.5463 -0.0560 0.0569  0.0063  282 HIS A N     
1186 C  CA    . HIS A 156 ? 0.3542 0.3483 0.5746 -0.0538 0.0453  -0.0079 282 HIS A CA    
1187 C  C     . HIS A 156 ? 0.3469 0.3530 0.5481 -0.0503 0.0413  -0.0067 282 HIS A C     
1188 O  O     . HIS A 156 ? 0.3338 0.3434 0.5153 -0.0473 0.0325  -0.0149 282 HIS A O     
1189 C  CB    . HIS A 156 ? 0.3094 0.2941 0.5095 -0.0494 0.0431  -0.0077 282 HIS A CB    
1190 C  CG    . HIS A 156 ? 0.3091 0.2821 0.5284 -0.0521 0.0457  -0.0116 282 HIS A CG    
1191 N  ND1   . HIS A 156 ? 0.3177 0.2903 0.5549 -0.0567 0.0405  -0.0286 282 HIS A ND1   
1192 C  CD2   . HIS A 156 ? 0.3154 0.2767 0.5397 -0.0504 0.0526  -0.0012 282 HIS A CD2   
1193 C  CE1   . HIS A 156 ? 0.3298 0.2901 0.5831 -0.0580 0.0446  -0.0292 282 HIS A CE1   
1194 N  NE2   . HIS A 156 ? 0.3237 0.2766 0.5698 -0.0541 0.0520  -0.0120 282 HIS A NE2   
1195 N  N     . HIS A 157 ? 0.3320 0.3445 0.5394 -0.0504 0.0480  0.0034  283 HIS A N     
1196 C  CA    . HIS A 157 ? 0.3570 0.3794 0.5447 -0.0458 0.0456  0.0061  283 HIS A CA    
1197 C  C     . HIS A 157 ? 0.2891 0.3208 0.4749 -0.0460 0.0345  -0.0083 283 HIS A C     
1198 O  O     . HIS A 157 ? 0.2739 0.3085 0.4361 -0.0411 0.0285  -0.0098 283 HIS A O     
1199 C  CB    . HIS A 157 ? 0.4349 0.4643 0.6337 -0.0463 0.0553  0.0174  283 HIS A CB    
1200 C  CG    . HIS A 157 ? 0.4597 0.4989 0.6401 -0.0411 0.0537  0.0196  283 HIS A CG    
1201 N  ND1   . HIS A 157 ? 0.4476 0.4991 0.6372 -0.0418 0.0496  0.0123  283 HIS A ND1   
1202 C  CD2   . HIS A 157 ? 0.4559 0.4945 0.6107 -0.0348 0.0552  0.0275  283 HIS A CD2   
1203 C  CE1   . HIS A 157 ? 0.4726 0.5296 0.6430 -0.0360 0.0492  0.0159  283 HIS A CE1   
1204 N  NE2   . HIS A 157 ? 0.4671 0.5165 0.6163 -0.0320 0.0526  0.0246  283 HIS A NE2   
1205 N  N     . GLN A 158 ? 0.2833 0.3198 0.4944 -0.0516 0.0314  -0.0189 284 GLN A N     
1206 C  CA    . GLN A 158 ? 0.3183 0.3657 0.5283 -0.0512 0.0202  -0.0321 284 GLN A CA    
1207 C  C     . GLN A 158 ? 0.2928 0.3363 0.4783 -0.0476 0.0108  -0.0401 284 GLN A C     
1208 O  O     . GLN A 158 ? 0.3048 0.3540 0.4708 -0.0430 0.0039  -0.0419 284 GLN A O     
1209 C  CB    . GLN A 158 ? 0.3556 0.4096 0.5991 -0.0581 0.0181  -0.0433 284 GLN A CB    
1210 C  CG    . GLN A 158 ? 0.4606 0.5286 0.7060 -0.0574 0.0061  -0.0567 284 GLN A CG    
1211 C  CD    . GLN A 158 ? 0.6328 0.7091 0.9146 -0.0646 0.0041  -0.0680 284 GLN A CD    
1212 O  OE1   . GLN A 158 ? 0.6453 0.7153 0.9520 -0.0707 0.0122  -0.0660 284 GLN A OE1   
1213 N  NE2   . GLN A 158 ? 0.7082 0.7989 0.9944 -0.0639 -0.0070 -0.0799 284 GLN A NE2   
1214 N  N     . ASP A 159 ? 0.2836 0.3172 0.4703 -0.0495 0.0110  -0.0444 285 ASP A N     
1215 C  CA    . ASP A 159 ? 0.2841 0.3142 0.4472 -0.0461 0.0039  -0.0511 285 ASP A CA    
1216 C  C     . ASP A 159 ? 0.2891 0.3156 0.4232 -0.0401 0.0054  -0.0402 285 ASP A C     
1217 O  O     . ASP A 159 ? 0.3068 0.3360 0.4197 -0.0363 -0.0015 -0.0436 285 ASP A O     
1218 C  CB    . ASP A 159 ? 0.2907 0.3103 0.4615 -0.0487 0.0058  -0.0566 285 ASP A CB    
1219 C  CG    . ASP A 159 ? 0.3500 0.3736 0.5442 -0.0539 0.0006  -0.0730 285 ASP A CG    
1220 O  OD1   . ASP A 159 ? 0.3853 0.4209 0.5889 -0.0555 -0.0056 -0.0805 285 ASP A OD1   
1221 O  OD2   . ASP A 159 ? 0.3799 0.3948 0.5839 -0.0561 0.0024  -0.0791 285 ASP A OD2   
1222 N  N     . LEU A 160 ? 0.2764 0.2968 0.4095 -0.0391 0.0144  -0.0270 286 LEU A N     
1223 C  CA    . LEU A 160 ? 0.2947 0.3119 0.4022 -0.0337 0.0156  -0.0181 286 LEU A CA    
1224 C  C     . LEU A 160 ? 0.3144 0.3402 0.4103 -0.0302 0.0122  -0.0162 286 LEU A C     
1225 O  O     . LEU A 160 ? 0.3321 0.3557 0.4063 -0.0259 0.0109  -0.0120 286 LEU A O     
1226 C  CB    . LEU A 160 ? 0.2846 0.2949 0.3943 -0.0331 0.0253  -0.0050 286 LEU A CB    
1227 C  CG    . LEU A 160 ? 0.3682 0.3683 0.4884 -0.0352 0.0288  -0.0053 286 LEU A CG    
1228 C  CD1   . LEU A 160 ? 0.3685 0.3624 0.4849 -0.0326 0.0369  0.0092  286 LEU A CD1   
1229 C  CD2   . LEU A 160 ? 0.3239 0.3203 0.4323 -0.0342 0.0224  -0.0151 286 LEU A CD2   
1230 N  N     . SER A 161 ? 0.3274 0.3627 0.4387 -0.0319 0.0106  -0.0197 287 SER A N     
1231 C  CA    A SER A 161 ? 0.3367 0.3803 0.4393 -0.0281 0.0066  -0.0193 287 SER A CA    
1232 C  CA    B SER A 161 ? 0.3311 0.3748 0.4338 -0.0281 0.0066  -0.0194 287 SER A CA    
1233 C  C     . SER A 161 ? 0.3297 0.3780 0.4235 -0.0264 -0.0046 -0.0294 287 SER A C     
1234 O  O     . SER A 161 ? 0.3157 0.3691 0.3997 -0.0222 -0.0089 -0.0286 287 SER A O     
1235 C  CB    A SER A 161 ? 0.3678 0.4211 0.4924 -0.0300 0.0109  -0.0176 287 SER A CB    
1236 C  CB    B SER A 161 ? 0.3721 0.4256 0.4970 -0.0301 0.0107  -0.0178 287 SER A CB    
1237 O  OG    A SER A 161 ? 0.3605 0.4104 0.4905 -0.0308 0.0220  -0.0066 287 SER A OG    
1238 O  OG    B SER A 161 ? 0.3547 0.4155 0.5002 -0.0342 0.0053  -0.0286 287 SER A OG    
1239 N  N     . THR A 162 ? 0.3707 0.4173 0.4676 -0.0291 -0.0092 -0.0386 288 THR A N     
1240 C  CA    A THR A 162 ? 0.3984 0.4502 0.4843 -0.0270 -0.0198 -0.0478 288 THR A CA    
1241 C  CA    B THR A 162 ? 0.4064 0.4582 0.4922 -0.0270 -0.0197 -0.0477 288 THR A CA    
1242 C  C     . THR A 162 ? 0.4224 0.4668 0.4804 -0.0230 -0.0210 -0.0439 288 THR A C     
1243 O  O     . THR A 162 ? 0.4151 0.4504 0.4676 -0.0240 -0.0160 -0.0412 288 THR A O     
1244 C  CB    A THR A 162 ? 0.4209 0.4749 0.5206 -0.0313 -0.0239 -0.0606 288 THR A CB    
1245 C  CB    B THR A 162 ? 0.4267 0.4812 0.5263 -0.0312 -0.0243 -0.0607 288 THR A CB    
1246 O  OG1   A THR A 162 ? 0.4620 0.5217 0.5914 -0.0362 -0.0214 -0.0638 288 THR A OG1   
1247 O  OG1   B THR A 162 ? 0.4467 0.4905 0.5451 -0.0334 -0.0192 -0.0610 288 THR A OG1   
1248 C  CG2   A THR A 162 ? 0.4187 0.4809 0.5069 -0.0286 -0.0355 -0.0706 288 THR A CG2   
1249 C  CG2   B THR A 162 ? 0.4454 0.5078 0.5759 -0.0359 -0.0232 -0.0652 288 THR A CG2   
1250 N  N     . PRO A 163 ? 0.4476 0.4955 0.4892 -0.0184 -0.0274 -0.0432 289 PRO A N     
1251 C  CA    . PRO A 163 ? 0.4315 0.4721 0.4487 -0.0152 -0.0276 -0.0388 289 PRO A CA    
1252 C  C     . PRO A 163 ? 0.3713 0.4084 0.3817 -0.0169 -0.0287 -0.0454 289 PRO A C     
1253 O  O     . PRO A 163 ? 0.3277 0.3708 0.3436 -0.0183 -0.0342 -0.0557 289 PRO A O     
1254 C  CB    . PRO A 163 ? 0.4534 0.4995 0.4589 -0.0104 -0.0352 -0.0380 289 PRO A CB    
1255 C  CG    . PRO A 163 ? 0.4952 0.5501 0.5183 -0.0100 -0.0365 -0.0387 289 PRO A CG    
1256 C  CD    . PRO A 163 ? 0.5085 0.5669 0.5543 -0.0156 -0.0340 -0.0452 289 PRO A CD    
1257 N  N     . VAL A 164 ? 0.3923 0.4206 0.3913 -0.0167 -0.0235 -0.0402 290 VAL A N     
1258 C  CA    . VAL A 164 ? 0.3828 0.4080 0.3719 -0.0171 -0.0238 -0.0453 290 VAL A CA    
1259 C  C     . VAL A 164 ? 0.3525 0.3803 0.3201 -0.0134 -0.0292 -0.0449 290 VAL A C     
1260 O  O     . VAL A 164 ? 0.3206 0.3463 0.2777 -0.0105 -0.0291 -0.0365 290 VAL A O     
1261 C  CB    . VAL A 164 ? 0.4016 0.4174 0.3883 -0.0178 -0.0160 -0.0393 290 VAL A CB    
1262 C  CG1   . VAL A 164 ? 0.4015 0.4152 0.3810 -0.0182 -0.0156 -0.0456 290 VAL A CG1   
1263 C  CG2   . VAL A 164 ? 0.4638 0.4765 0.4703 -0.0206 -0.0102 -0.0365 290 VAL A CG2   
1264 N  N     . LEU A 165 ? 0.3913 0.4238 0.3526 -0.0131 -0.0337 -0.0539 291 LEU A N     
1265 C  CA    . LEU A 165 ? 0.4416 0.4777 0.3817 -0.0093 -0.0387 -0.0529 291 LEU A CA    
1266 C  C     . LEU A 165 ? 0.4948 0.5257 0.4197 -0.0091 -0.0339 -0.0516 291 LEU A C     
1267 O  O     . LEU A 165 ? 0.4073 0.4342 0.3392 -0.0117 -0.0288 -0.0557 291 LEU A O     
1268 C  CB    . LEU A 165 ? 0.4105 0.4580 0.3510 -0.0082 -0.0477 -0.0638 291 LEU A CB    
1269 C  CG    . LEU A 165 ? 0.4292 0.4841 0.3882 -0.0088 -0.0530 -0.0670 291 LEU A CG    
1270 C  CD1   . LEU A 165 ? 0.4981 0.5659 0.4578 -0.0076 -0.0630 -0.0795 291 LEU A CD1   
1271 C  CD2   . LEU A 165 ? 0.4090 0.4632 0.3645 -0.0053 -0.0539 -0.0559 291 LEU A CD2   
1272 N  N     . ARG A 166 ? 0.5809 0.6119 0.4861 -0.0057 -0.0352 -0.0454 292 ARG A N     
1273 C  CA    . ARG A 166 ? 0.6288 0.6561 0.5202 -0.0057 -0.0298 -0.0434 292 ARG A CA    
1274 C  C     . ARG A 166 ? 0.5406 0.5732 0.4305 -0.0064 -0.0302 -0.0558 292 ARG A C     
1275 O  O     . ARG A 166 ? 0.5511 0.5800 0.4402 -0.0078 -0.0239 -0.0575 292 ARG A O     
1276 C  CB    . ARG A 166 ? 0.7626 0.7895 0.6341 -0.0022 -0.0309 -0.0341 292 ARG A CB    
1277 C  CG    . ARG A 166 ? 0.9139 0.9374 0.7723 -0.0025 -0.0242 -0.0306 292 ARG A CG    
1278 C  CD    . ARG A 166 ? 0.9946 1.0100 0.8631 -0.0056 -0.0166 -0.0269 292 ARG A CD    
1279 N  NE    . ARG A 166 ? 1.0428 1.0574 0.9035 -0.0063 -0.0102 -0.0270 292 ARG A NE    
1280 C  CZ    . ARG A 166 ? 1.1282 1.1383 0.9827 -0.0067 -0.0051 -0.0181 292 ARG A CZ    
1281 N  NH1   . ARG A 166 ? 1.1435 1.1483 0.9980 -0.0064 -0.0060 -0.0088 292 ARG A NH1   
1282 N  NH2   . ARG A 166 ? 1.1788 1.1901 1.0284 -0.0075 0.0011  -0.0194 292 ARG A NH2   
1283 N  N     . SER A 167 ? 0.5702 0.6120 0.4609 -0.0054 -0.0378 -0.0655 293 SER A N     
1284 C  CA    . SER A 167 ? 0.6267 0.6741 0.5178 -0.0061 -0.0387 -0.0797 293 SER A CA    
1285 C  C     . SER A 167 ? 0.6029 0.6441 0.5161 -0.0104 -0.0334 -0.0860 293 SER A C     
1286 O  O     . SER A 167 ? 0.6202 0.6605 0.5335 -0.0111 -0.0295 -0.0939 293 SER A O     
1287 C  CB    . SER A 167 ? 0.7641 0.8236 0.6547 -0.0044 -0.0491 -0.0901 293 SER A CB    
1288 O  OG    . SER A 167 ? 0.7989 0.8593 0.7138 -0.0074 -0.0523 -0.0948 293 SER A OG    
1289 N  N     . ASP A 168 ? 0.5377 0.5749 0.4702 -0.0129 -0.0330 -0.0824 294 ASP A N     
1290 C  CA    . ASP A 168 ? 0.4858 0.5156 0.4390 -0.0165 -0.0270 -0.0848 294 ASP A CA    
1291 C  C     . ASP A 168 ? 0.4553 0.4768 0.4023 -0.0161 -0.0188 -0.0773 294 ASP A C     
1292 O  O     . ASP A 168 ? 0.4194 0.4366 0.3765 -0.0175 -0.0141 -0.0824 294 ASP A O     
1293 C  CB    . ASP A 168 ? 0.5133 0.5407 0.4850 -0.0187 -0.0268 -0.0788 294 ASP A CB    
1294 C  CG    . ASP A 168 ? 0.5132 0.5499 0.4942 -0.0194 -0.0348 -0.0862 294 ASP A CG    
1295 O  OD1   . ASP A 168 ? 0.5312 0.5751 0.5129 -0.0196 -0.0402 -0.0996 294 ASP A OD1   
1296 O  OD2   . ASP A 168 ? 0.4440 0.4820 0.4322 -0.0194 -0.0359 -0.0793 294 ASP A OD2   
1297 N  N     . VAL A 169 ? 0.4876 0.5071 0.4198 -0.0141 -0.0172 -0.0655 295 VAL A N     
1298 C  CA    . VAL A 169 ? 0.4517 0.4645 0.3809 -0.0140 -0.0099 -0.0581 295 VAL A CA    
1299 C  C     . VAL A 169 ? 0.4088 0.4234 0.3296 -0.0132 -0.0067 -0.0651 295 VAL A C     
1300 O  O     . VAL A 169 ? 0.3708 0.3810 0.2999 -0.0138 -0.0009 -0.0661 295 VAL A O     
1301 C  CB    . VAL A 169 ? 0.4102 0.4209 0.3268 -0.0125 -0.0095 -0.0456 295 VAL A CB    
1302 C  CG1   . VAL A 169 ? 0.4344 0.4400 0.3480 -0.0126 -0.0028 -0.0394 295 VAL A CG1   
1303 C  CG2   . VAL A 169 ? 0.4188 0.4276 0.3449 -0.0129 -0.0116 -0.0396 295 VAL A CG2   
1304 N  N     . ASP A 170 ? 0.5083 0.5303 0.4124 -0.0112 -0.0101 -0.0697 296 ASP A N     
1305 C  CA    . ASP A 170 ? 0.5738 0.5991 0.4676 -0.0099 -0.0062 -0.0763 296 ASP A CA    
1306 C  C     . ASP A 170 ? 0.5586 0.5837 0.4684 -0.0112 -0.0049 -0.0903 296 ASP A C     
1307 O  O     . ASP A 170 ? 0.5742 0.5978 0.4855 -0.0107 0.0013  -0.0939 296 ASP A O     
1308 C  CB    . ASP A 170 ? 0.6739 0.7085 0.5456 -0.0070 -0.0106 -0.0786 296 ASP A CB    
1309 C  CG    . ASP A 170 ? 0.7866 0.8200 0.6440 -0.0055 -0.0116 -0.0640 296 ASP A CG    
1310 O  OD1   . ASP A 170 ? 0.8140 0.8409 0.6717 -0.0065 -0.0058 -0.0537 296 ASP A OD1   
1311 O  OD2   . ASP A 170 ? 0.8086 0.8477 0.6558 -0.0032 -0.0185 -0.0632 296 ASP A OD2   
1312 N  N     . ALA A 171 ? 0.5365 0.5628 0.4605 -0.0129 -0.0103 -0.0983 297 ALA A N     
1313 C  CA    . ALA A 171 ? 0.5767 0.6012 0.5192 -0.0145 -0.0093 -0.1120 297 ALA A CA    
1314 C  C     . ALA A 171 ? 0.4901 0.5038 0.4512 -0.0160 -0.0024 -0.1059 297 ALA A C     
1315 O  O     . ALA A 171 ? 0.4853 0.4959 0.4546 -0.0156 0.0025  -0.1126 297 ALA A O     
1316 C  CB    . ALA A 171 ? 0.6629 0.6915 0.6188 -0.0166 -0.0169 -0.1216 297 ALA A CB    
1317 N  N     . LEU A 172 ? 0.4301 0.4386 0.3981 -0.0173 -0.0019 -0.0932 298 LEU A N     
1318 C  CA    . LEU A 172 ? 0.4485 0.4479 0.4311 -0.0179 0.0043  -0.0853 298 LEU A CA    
1319 C  C     . LEU A 172 ? 0.4168 0.4149 0.3903 -0.0155 0.0100  -0.0814 298 LEU A C     
1320 O  O     . LEU A 172 ? 0.4265 0.4194 0.4131 -0.0149 0.0148  -0.0825 298 LEU A O     
1321 C  CB    . LEU A 172 ? 0.4629 0.4592 0.4485 -0.0187 0.0038  -0.0718 298 LEU A CB    
1322 C  CG    . LEU A 172 ? 0.6142 0.6102 0.6173 -0.0214 0.0009  -0.0738 298 LEU A CG    
1323 C  CD1   . LEU A 172 ? 0.6615 0.6577 0.6614 -0.0214 0.0000  -0.0614 298 LEU A CD1   
1324 C  CD2   . LEU A 172 ? 0.6170 0.6053 0.6438 -0.0231 0.0055  -0.0757 298 LEU A CD2   
1325 N  N     . GLN A 173 ? 0.4187 0.4216 0.3716 -0.0141 0.0098  -0.0763 299 GLN A N     
1326 C  CA    . GLN A 173 ? 0.4072 0.4097 0.3537 -0.0124 0.0157  -0.0720 299 GLN A CA    
1327 C  C     . GLN A 173 ? 0.4147 0.4198 0.3638 -0.0111 0.0193  -0.0845 299 GLN A C     
1328 O  O     . GLN A 173 ? 0.4096 0.4120 0.3671 -0.0099 0.0249  -0.0838 299 GLN A O     
1329 C  CB    . GLN A 173 ? 0.4287 0.4354 0.3543 -0.0117 0.0154  -0.0642 299 GLN A CB    
1330 C  CG    . GLN A 173 ? 0.4618 0.4688 0.3843 -0.0109 0.0219  -0.0593 299 GLN A CG    
1331 C  CD    . GLN A 173 ? 0.5503 0.5582 0.4588 -0.0112 0.0223  -0.0482 299 GLN A CD    
1332 O  OE1   . GLN A 173 ? 0.4680 0.4750 0.3700 -0.0117 0.0176  -0.0427 299 GLN A OE1   
1333 N  NE2   . GLN A 173 ? 0.6130 0.6228 0.5187 -0.0109 0.0282  -0.0450 299 GLN A NE2   
1334 N  N     . GLN A 174 ? 0.5101 0.5211 0.4527 -0.0108 0.0159  -0.0968 300 GLN A N     
1335 C  CA    . GLN A 174 ? 0.5470 0.5611 0.4923 -0.0092 0.0192  -0.1110 300 GLN A CA    
1336 C  C     . GLN A 174 ? 0.4934 0.4990 0.4648 -0.0097 0.0221  -0.1157 300 GLN A C     
1337 O  O     . GLN A 174 ? 0.4793 0.4836 0.4570 -0.0076 0.0281  -0.1185 300 GLN A O     
1338 C  CB    . GLN A 174 ? 0.5841 0.6064 0.5197 -0.0089 0.0134  -0.1249 300 GLN A CB    
1339 C  CG    . GLN A 174 ? 0.6001 0.6318 0.5078 -0.0071 0.0116  -0.1209 300 GLN A CG    
1340 N  N     . VAL A 175 ? 0.4396 0.4394 0.4278 -0.0121 0.0184  -0.1157 301 VAL A N     
1341 C  CA    . VAL A 175 ? 0.5136 0.5045 0.5277 -0.0125 0.0215  -0.1198 301 VAL A CA    
1342 C  C     . VAL A 175 ? 0.4989 0.4831 0.5203 -0.0108 0.0268  -0.1058 301 VAL A C     
1343 O  O     . VAL A 175 ? 0.5006 0.4793 0.5383 -0.0090 0.0312  -0.1086 301 VAL A O     
1344 C  CB    . VAL A 175 ? 0.5389 0.5255 0.5707 -0.0160 0.0170  -0.1227 301 VAL A CB    
1345 C  CG1   . VAL A 175 ? 0.5671 0.5623 0.5915 -0.0174 0.0103  -0.1375 301 VAL A CG1   
1346 C  CG2   . VAL A 175 ? 0.5373 0.5209 0.5692 -0.0177 0.0157  -0.1062 301 VAL A CG2   
1347 N  N     . VAL A 176 ? 0.4179 0.4030 0.4283 -0.0111 0.0260  -0.0911 302 VAL A N     
1348 C  CA    . VAL A 176 ? 0.3980 0.3789 0.4140 -0.0092 0.0300  -0.0787 302 VAL A CA    
1349 C  C     . VAL A 176 ? 0.3966 0.3815 0.4078 -0.0063 0.0348  -0.0815 302 VAL A C     
1350 O  O     . VAL A 176 ? 0.3773 0.3585 0.4024 -0.0037 0.0387  -0.0793 302 VAL A O     
1351 C  CB    . VAL A 176 ? 0.3647 0.3466 0.3696 -0.0102 0.0275  -0.0646 302 VAL A CB    
1352 C  CG1   . VAL A 176 ? 0.4067 0.3866 0.4150 -0.0079 0.0305  -0.0531 302 VAL A CG1   
1353 C  CG2   . VAL A 176 ? 0.4212 0.3994 0.4345 -0.0126 0.0240  -0.0615 302 VAL A CG2   
1354 N  N     . GLU A 177 ? 0.4228 0.4159 0.4150 -0.0063 0.0350  -0.0859 303 GLU A N     
1355 C  CA    . GLU A 177 ? 0.4545 0.4531 0.4422 -0.0038 0.0408  -0.0889 303 GLU A CA    
1356 C  C     . GLU A 177 ? 0.4890 0.4859 0.4921 -0.0014 0.0444  -0.1023 303 GLU A C     
1357 O  O     . GLU A 177 ? 0.4827 0.4802 0.4947 0.0015  0.0497  -0.1020 303 GLU A O     
1358 C  CB    . GLU A 177 ? 0.4446 0.4523 0.4085 -0.0044 0.0409  -0.0908 303 GLU A CB    
1359 C  CG    . GLU A 177 ? 0.4913 0.4996 0.4422 -0.0063 0.0385  -0.0768 303 GLU A CG    
1360 C  CD    . GLU A 177 ? 0.5227 0.5383 0.4506 -0.0067 0.0379  -0.0769 303 GLU A CD    
1361 O  OE1   . GLU A 177 ? 0.5591 0.5798 0.4790 -0.0058 0.0372  -0.0880 303 GLU A OE1   
1362 O  OE2   . GLU A 177 ? 0.5657 0.5820 0.4837 -0.0078 0.0380  -0.0657 303 GLU A OE2   
1363 N  N     . GLU A 178 ? 0.3888 0.3839 0.3971 -0.0024 0.0415  -0.1148 304 GLU A N     
1364 C  CA    . GLU A 178 ? 0.5163 0.5087 0.5415 -0.0002 0.0447  -0.1291 304 GLU A CA    
1365 C  C     . GLU A 178 ? 0.4549 0.4370 0.5049 0.0016  0.0474  -0.1223 304 GLU A C     
1366 O  O     . GLU A 178 ? 0.4827 0.4642 0.5443 0.0054  0.0525  -0.1269 304 GLU A O     
1367 C  CB    . GLU A 178 ? 0.6736 0.6654 0.7029 -0.0023 0.0398  -0.1438 304 GLU A CB    
1368 C  CG    . GLU A 178 ? 0.8401 0.8292 0.8866 -0.0002 0.0428  -0.1619 304 GLU A CG    
1369 C  CD    . GLU A 178 ? 0.9790 0.9784 1.0119 0.0035  0.0479  -0.1723 304 GLU A CD    
1370 O  OE1   . GLU A 178 ? 1.0163 1.0266 1.0235 0.0033  0.0467  -0.1731 304 GLU A OE1   
1371 O  OE2   . GLU A 178 ? 1.0149 1.0117 1.0629 0.0070  0.0537  -0.1792 304 GLU A OE2   
1372 N  N     . ALA A 179 ? 0.4516 0.4263 0.5101 -0.0004 0.0441  -0.1109 305 ALA A N     
1373 C  CA    . ALA A 179 ? 0.4446 0.4096 0.5249 0.0018  0.0465  -0.1023 305 ALA A CA    
1374 C  C     . ALA A 179 ? 0.4258 0.3944 0.5027 0.0053  0.0495  -0.0909 305 ALA A C     
1375 O  O     . ALA A 179 ? 0.4512 0.4158 0.5448 0.0094  0.0529  -0.0895 305 ALA A O     
1376 C  CB    . ALA A 179 ? 0.4460 0.4039 0.5335 -0.0012 0.0430  -0.0919 305 ALA A CB    
1377 N  N     . VAL A 180 ? 0.4070 0.3830 0.4638 0.0039  0.0479  -0.0828 306 VAL A N     
1378 C  CA    . VAL A 180 ? 0.3776 0.3585 0.4316 0.0064  0.0502  -0.0735 306 VAL A CA    
1379 C  C     . VAL A 180 ? 0.3623 0.3493 0.4193 0.0095  0.0558  -0.0832 306 VAL A C     
1380 O  O     . VAL A 180 ? 0.3586 0.3468 0.4279 0.0134  0.0587  -0.0795 306 VAL A O     
1381 C  CB    . VAL A 180 ? 0.3793 0.3662 0.4124 0.0035  0.0475  -0.0647 306 VAL A CB    
1382 C  CG1   . VAL A 180 ? 0.4086 0.4024 0.4391 0.0052  0.0499  -0.0579 306 VAL A CG1   
1383 C  CG2   . VAL A 180 ? 0.3671 0.3485 0.4000 0.0016  0.0427  -0.0543 306 VAL A CG2   
1384 N  N     . GLY A 181 ? 0.4123 0.4046 0.4585 0.0084  0.0574  -0.0961 307 GLY A N     
1385 C  CA    . GLY A 181 ? 0.3891 0.3888 0.4362 0.0114  0.0638  -0.1062 307 GLY A CA    
1386 C  C     . GLY A 181 ? 0.4850 0.4790 0.5569 0.0159  0.0670  -0.1139 307 GLY A C     
1387 O  O     . GLY A 181 ? 0.5083 0.5076 0.5880 0.0199  0.0724  -0.1165 307 GLY A O     
1388 N  N     . GLN A 182 ? 0.4626 0.4457 0.5489 0.0155  0.0641  -0.1177 308 GLN A N     
1389 C  CA    . GLN A 182 ? 0.4688 0.4439 0.5815 0.0199  0.0671  -0.1237 308 GLN A CA    
1390 C  C     . GLN A 182 ? 0.3900 0.3600 0.5175 0.0234  0.0669  -0.1077 308 GLN A C     
1391 O  O     . GLN A 182 ? 0.4118 0.3806 0.5573 0.0288  0.0707  -0.1095 308 GLN A O     
1392 C  CB    . GLN A 182 ? 0.5145 0.4790 0.6396 0.0177  0.0643  -0.1331 308 GLN A CB    
1393 C  CG    . GLN A 182 ? 0.5824 0.5533 0.6947 0.0153  0.0636  -0.1514 308 GLN A CG    
1394 C  CD    . GLN A 182 ? 0.6250 0.5866 0.7508 0.0122  0.0598  -0.1614 308 GLN A CD    
1395 O  OE1   . GLN A 182 ? 0.6166 0.5657 0.7654 0.0123  0.0595  -0.1558 308 GLN A OE1   
1396 N  NE2   . GLN A 182 ? 0.7077 0.6761 0.8200 0.0096  0.0569  -0.1760 308 GLN A NE2   
1397 N  N     . ALA A 183 ? 0.3822 0.3501 0.5022 0.0208  0.0624  -0.0924 309 ALA A N     
1398 C  CA    . ALA A 183 ? 0.3947 0.3592 0.5261 0.0244  0.0614  -0.0768 309 ALA A CA    
1399 C  C     . ALA A 183 ? 0.3751 0.3506 0.5037 0.0278  0.0635  -0.0728 309 ALA A C     
1400 O  O     . ALA A 183 ? 0.4058 0.3803 0.5507 0.0334  0.0642  -0.0665 309 ALA A O     
1401 C  CB    . ALA A 183 ? 0.4144 0.3759 0.5357 0.0208  0.0564  -0.0629 309 ALA A CB    
1402 N  N     . LEU A 184 ? 0.4122 0.3985 0.5214 0.0247  0.0644  -0.0756 310 LEU A N     
1403 C  CA    . LEU A 184 ? 0.4282 0.4259 0.5361 0.0268  0.0669  -0.0723 310 LEU A CA    
1404 C  C     . LEU A 184 ? 0.3753 0.3833 0.4653 0.0234  0.0708  -0.0808 310 LEU A C     
1405 O  O     . LEU A 184 ? 0.3385 0.3495 0.4093 0.0187  0.0684  -0.0757 310 LEU A O     
1406 C  CB    . LEU A 184 ? 0.3784 0.3785 0.4813 0.0262  0.0620  -0.0566 310 LEU A CB    
1407 C  CG    . LEU A 184 ? 0.3112 0.3239 0.4146 0.0275  0.0634  -0.0529 310 LEU A CG    
1408 C  CD1   . LEU A 184 ? 0.3429 0.3584 0.4690 0.0345  0.0663  -0.0548 310 LEU A CD1   
1409 C  CD2   . LEU A 184 ? 0.3564 0.3711 0.4520 0.0259  0.0573  -0.0395 310 LEU A CD2   
1410 N  N     . PRO A 185 ? 0.3841 0.3974 0.4793 0.0260  0.0772  -0.0934 311 PRO A N     
1411 C  CA    . PRO A 185 ? 0.3978 0.4223 0.4749 0.0234  0.0821  -0.0998 311 PRO A CA    
1412 C  C     . PRO A 185 ? 0.3862 0.4194 0.4537 0.0206  0.0821  -0.0882 311 PRO A C     
1413 O  O     . PRO A 185 ? 0.3981 0.4344 0.4787 0.0229  0.0815  -0.0805 311 PRO A O     
1414 C  CB    . PRO A 185 ? 0.4559 0.4862 0.5463 0.0284  0.0898  -0.1128 311 PRO A CB    
1415 C  CG    . PRO A 185 ? 0.4984 0.5162 0.6089 0.0321  0.0876  -0.1186 311 PRO A CG    
1416 C  CD    . PRO A 185 ? 0.4230 0.4318 0.5406 0.0317  0.0807  -0.1030 311 PRO A CD    
1417 N  N     . GLY A 186 ? 0.3349 0.3722 0.3802 0.0158  0.0825  -0.0872 312 GLY A N     
1418 C  CA    . GLY A 186 ? 0.3487 0.3925 0.3846 0.0123  0.0826  -0.0767 312 GLY A CA    
1419 C  C     . GLY A 186 ? 0.3841 0.4210 0.4128 0.0090  0.0746  -0.0652 312 GLY A C     
1420 O  O     . GLY A 186 ? 0.3807 0.4214 0.3988 0.0053  0.0741  -0.0577 312 GLY A O     
1421 N  N     . ALA A 187 ? 0.3140 0.3408 0.3490 0.0103  0.0688  -0.0636 313 ALA A N     
1422 C  CA    . ALA A 187 ? 0.3289 0.3502 0.3569 0.0076  0.0618  -0.0531 313 ALA A CA    
1423 C  C     . ALA A 187 ? 0.3658 0.3859 0.3728 0.0032  0.0602  -0.0538 313 ALA A C     
1424 O  O     . ALA A 187 ? 0.4027 0.4232 0.4022 0.0029  0.0622  -0.0630 313 ALA A O     
1425 C  CB    . ALA A 187 ? 0.3585 0.3700 0.3988 0.0101  0.0573  -0.0505 313 ALA A CB    
1426 N  N     . THR A 188 ? 0.3445 0.3638 0.3423 0.0002  0.0560  -0.0443 314 THR A N     
1427 C  CA    . THR A 188 ? 0.3684 0.3868 0.3471 -0.0034 0.0541  -0.0430 314 THR A CA    
1428 C  C     . THR A 188 ? 0.3376 0.3483 0.3140 -0.0044 0.0471  -0.0378 314 THR A C     
1429 O  O     . THR A 188 ? 0.3134 0.3208 0.2998 -0.0031 0.0442  -0.0321 314 THR A O     
1430 C  CB    . THR A 188 ? 0.3883 0.4123 0.3582 -0.0063 0.0563  -0.0366 314 THR A CB    
1431 O  OG1   . THR A 188 ? 0.3602 0.3830 0.3372 -0.0068 0.0524  -0.0282 314 THR A OG1   
1432 C  CG2   . THR A 188 ? 0.4169 0.4499 0.3911 -0.0055 0.0644  -0.0409 314 THR A CG2   
1433 N  N     . VAL A 189 ? 0.3491 0.3581 0.3117 -0.0065 0.0446  -0.0396 315 VAL A N     
1434 C  CA    . VAL A 189 ? 0.3178 0.3210 0.2777 -0.0076 0.0386  -0.0357 315 VAL A CA    
1435 C  C     . VAL A 189 ? 0.3185 0.3229 0.2623 -0.0101 0.0365  -0.0303 315 VAL A C     
1436 O  O     . VAL A 189 ? 0.3572 0.3654 0.2884 -0.0108 0.0383  -0.0331 315 VAL A O     
1437 C  CB    . VAL A 189 ? 0.3339 0.3339 0.2963 -0.0074 0.0367  -0.0443 315 VAL A CB    
1438 C  CG1   . VAL A 189 ? 0.3245 0.3201 0.2854 -0.0089 0.0311  -0.0400 315 VAL A CG1   
1439 C  CG2   . VAL A 189 ? 0.3331 0.3302 0.3138 -0.0049 0.0393  -0.0498 315 VAL A CG2   
1440 N  N     . THR A 190 ? 0.3224 0.3238 0.2662 -0.0108 0.0327  -0.0223 316 THR A N     
1441 C  CA    . THR A 190 ? 0.3192 0.3202 0.2505 -0.0128 0.0304  -0.0168 316 THR A CA    
1442 C  C     . THR A 190 ? 0.3275 0.3243 0.2571 -0.0128 0.0249  -0.0148 316 THR A C     
1443 O  O     . THR A 190 ? 0.2852 0.2794 0.2238 -0.0119 0.0231  -0.0122 316 THR A O     
1444 C  CB    . THR A 190 ? 0.3512 0.3534 0.2853 -0.0137 0.0313  -0.0103 316 THR A CB    
1445 O  OG1   . THR A 190 ? 0.3445 0.3520 0.2814 -0.0141 0.0370  -0.0122 316 THR A OG1   
1446 C  CG2   . THR A 190 ? 0.3678 0.3678 0.2915 -0.0157 0.0288  -0.0047 316 THR A CG2   
1447 N  N     . LEU A 191 ? 0.2960 0.2929 0.2142 -0.0134 0.0224  -0.0154 317 LEU A N     
1448 C  CA    . LEU A 191 ? 0.3017 0.2958 0.2188 -0.0134 0.0172  -0.0134 317 LEU A CA    
1449 C  C     . LEU A 191 ? 0.3219 0.3137 0.2379 -0.0136 0.0158  -0.0057 317 LEU A C     
1450 O  O     . LEU A 191 ? 0.3540 0.3458 0.2637 -0.0146 0.0171  -0.0020 317 LEU A O     
1451 C  CB    . LEU A 191 ? 0.3055 0.3017 0.2109 -0.0132 0.0143  -0.0163 317 LEU A CB    
1452 C  CG    . LEU A 191 ? 0.3385 0.3336 0.2428 -0.0128 0.0087  -0.0148 317 LEU A CG    
1453 C  CD1   . LEU A 191 ? 0.3020 0.2964 0.2200 -0.0129 0.0073  -0.0189 317 LEU A CD1   
1454 C  CD2   . LEU A 191 ? 0.3522 0.3509 0.2433 -0.0119 0.0054  -0.0170 317 LEU A CD2   
1455 N  N     A THR A 192 ? 0.2725 0.2623 0.1954 -0.0129 0.0135  -0.0034 318 THR A N     
1456 N  N     B THR A 192 ? 0.2851 0.2749 0.2079 -0.0129 0.0135  -0.0034 318 THR A N     
1457 C  CA    A THR A 192 ? 0.2810 0.2694 0.2028 -0.0126 0.0117  0.0021  318 THR A CA    
1458 C  CA    B THR A 192 ? 0.2844 0.2727 0.2061 -0.0126 0.0117  0.0021  318 THR A CA    
1459 C  C     A THR A 192 ? 0.2687 0.2558 0.1893 -0.0118 0.0081  0.0032  318 THR A C     
1460 C  C     B THR A 192 ? 0.2778 0.2650 0.1996 -0.0117 0.0082  0.0030  318 THR A C     
1461 O  O     A THR A 192 ? 0.2822 0.2699 0.1996 -0.0118 0.0062  0.0005  318 THR A O     
1462 O  O     B THR A 192 ? 0.2942 0.2822 0.2151 -0.0117 0.0065  -0.0002 318 THR A O     
1463 C  CB    A THR A 192 ? 0.2659 0.2552 0.1962 -0.0116 0.0130  0.0043  318 THR A CB    
1464 C  CB    B THR A 192 ? 0.2787 0.2681 0.2085 -0.0118 0.0132  0.0042  318 THR A CB    
1465 O  OG1   A THR A 192 ? 0.3225 0.3113 0.2606 -0.0101 0.0130  0.0043  318 THR A OG1   
1466 O  OG1   B THR A 192 ? 0.2674 0.2565 0.1954 -0.0115 0.0110  0.0079  318 THR A OG1   
1467 C  CG2   A THR A 192 ? 0.2837 0.2754 0.2176 -0.0121 0.0166  0.0025  318 THR A CG2   
1468 C  CG2   B THR A 192 ? 0.2842 0.2735 0.2233 -0.0101 0.0137  0.0039  318 THR A CG2   
1469 N  N     . GLY A 193 ? 0.2624 0.2490 0.1855 -0.0107 0.0070  0.0066  319 GLY A N     
1470 C  CA    . GLY A 193 ? 0.3007 0.2872 0.2243 -0.0095 0.0046  0.0075  319 GLY A CA    
1471 C  C     . GLY A 193 ? 0.3175 0.3028 0.2339 -0.0093 0.0015  0.0074  319 GLY A C     
1472 O  O     . GLY A 193 ? 0.2801 0.2635 0.1897 -0.0100 0.0013  0.0085  319 GLY A O     
1473 N  N     . GLY A 194 ? 0.3035 0.2905 0.2227 -0.0082 -0.0007 0.0066  320 GLY A N     
1474 C  CA    . GLY A 194 ? 0.3296 0.3160 0.2434 -0.0070 -0.0044 0.0070  320 GLY A CA    
1475 C  C     . GLY A 194 ? 0.4068 0.3935 0.3128 -0.0075 -0.0059 0.0057  320 GLY A C     
1476 O  O     . GLY A 194 ? 0.3273 0.3118 0.2259 -0.0063 -0.0080 0.0086  320 GLY A O     
1477 N  N     . PHE A 195 ? 0.2978 0.2872 0.2051 -0.0088 -0.0047 0.0014  321 PHE A N     
1478 C  CA    . PHE A 195 ? 0.2861 0.2773 0.1838 -0.0087 -0.0060 -0.0006 321 PHE A CA    
1479 C  C     . PHE A 195 ? 0.2911 0.2791 0.1800 -0.0094 -0.0029 0.0038  321 PHE A C     
1480 O  O     . PHE A 195 ? 0.3265 0.3147 0.2049 -0.0085 -0.0041 0.0063  321 PHE A O     
1481 C  CB    . PHE A 195 ? 0.3207 0.3157 0.2224 -0.0099 -0.0053 -0.0080 321 PHE A CB    
1482 C  CG    . PHE A 195 ? 0.3255 0.3242 0.2360 -0.0097 -0.0091 -0.0129 321 PHE A CG    
1483 C  CD1   . PHE A 195 ? 0.3054 0.3086 0.2107 -0.0080 -0.0148 -0.0149 321 PHE A CD1   
1484 C  CD2   . PHE A 195 ? 0.3180 0.3163 0.2430 -0.0110 -0.0071 -0.0146 321 PHE A CD2   
1485 C  CE1   . PHE A 195 ? 0.3482 0.3563 0.2639 -0.0081 -0.0187 -0.0200 321 PHE A CE1   
1486 C  CE2   . PHE A 195 ? 0.2977 0.2997 0.2334 -0.0116 -0.0099 -0.0188 321 PHE A CE2   
1487 C  CZ    . PHE A 195 ? 0.3100 0.3174 0.2419 -0.0103 -0.0158 -0.0221 321 PHE A CZ    
1488 N  N     . ARG A 196 ? 0.2855 0.2713 0.1791 -0.0109 0.0011  0.0053  322 ARG A N     
1489 C  CA    . ARG A 196 ? 0.3058 0.2894 0.1939 -0.0122 0.0043  0.0094  322 ARG A CA    
1490 C  C     . ARG A 196 ? 0.2930 0.2717 0.1779 -0.0115 0.0023  0.0151  322 ARG A C     
1491 O  O     . ARG A 196 ? 0.3009 0.2770 0.1798 -0.0124 0.0043  0.0196  322 ARG A O     
1492 C  CB    . ARG A 196 ? 0.3183 0.3022 0.2144 -0.0138 0.0082  0.0089  322 ARG A CB    
1493 C  CG    . ARG A 196 ? 0.3211 0.3040 0.2148 -0.0159 0.0121  0.0124  322 ARG A CG    
1494 C  CD    . ARG A 196 ? 0.3283 0.3140 0.2312 -0.0172 0.0158  0.0106  322 ARG A CD    
1495 N  NE    . ARG A 196 ? 0.3096 0.2952 0.2125 -0.0197 0.0197  0.0139  322 ARG A NE    
1496 C  CZ    . ARG A 196 ? 0.3216 0.3062 0.2319 -0.0214 0.0196  0.0157  322 ARG A CZ    
1497 N  NH1   . ARG A 196 ? 0.2778 0.2620 0.1942 -0.0202 0.0158  0.0144  322 ARG A NH1   
1498 N  NH2   . ARG A 196 ? 0.3695 0.3542 0.2816 -0.0243 0.0237  0.0185  322 ARG A NH2   
1499 N  N     . ARG A 197 ? 0.2880 0.2652 0.1778 -0.0099 -0.0010 0.0152  323 ARG A N     
1500 C  CA    . ARG A 197 ? 0.3386 0.3108 0.2268 -0.0086 -0.0034 0.0194  323 ARG A CA    
1501 C  C     . ARG A 197 ? 0.3672 0.3392 0.2477 -0.0060 -0.0069 0.0219  323 ARG A C     
1502 O  O     . ARG A 197 ? 0.3635 0.3306 0.2434 -0.0041 -0.0091 0.0259  323 ARG A O     
1503 C  CB    . ARG A 197 ? 0.3305 0.3024 0.2264 -0.0070 -0.0052 0.0176  323 ARG A CB    
1504 C  CG    . ARG A 197 ? 0.2856 0.2585 0.1875 -0.0086 -0.0027 0.0159  323 ARG A CG    
1505 C  CD    . ARG A 197 ? 0.2805 0.2525 0.1867 -0.0066 -0.0045 0.0149  323 ARG A CD    
1506 N  NE    . ARG A 197 ? 0.3135 0.2885 0.2215 -0.0039 -0.0064 0.0137  323 ARG A NE    
1507 C  CZ    . ARG A 197 ? 0.3365 0.3166 0.2486 -0.0036 -0.0052 0.0122  323 ARG A CZ    
1508 N  NH1   . ARG A 197 ? 0.2732 0.2553 0.1874 -0.0051 -0.0026 0.0119  323 ARG A NH1   
1509 N  NH2   . ARG A 197 ? 0.2866 0.2698 0.2021 -0.0016 -0.0064 0.0113  323 ARG A NH2   
1510 N  N     . GLY A 198 ? 0.3287 0.3061 0.2038 -0.0055 -0.0079 0.0192  324 GLY A N     
1511 C  CA    . GLY A 198 ? 0.3578 0.3370 0.2239 -0.0026 -0.0121 0.0214  324 GLY A CA    
1512 C  C     . GLY A 198 ? 0.3903 0.3748 0.2612 0.0001  -0.0178 0.0171  324 GLY A C     
1513 O  O     . GLY A 198 ? 0.3226 0.3102 0.1868 0.0032  -0.0226 0.0184  324 GLY A O     
1514 N  N     . LYS A 199 ? 0.3443 0.3305 0.2267 -0.0009 -0.0175 0.0126  325 LYS A N     
1515 C  CA    . LYS A 199 ? 0.3405 0.3326 0.2301 0.0008  -0.0220 0.0084  325 LYS A CA    
1516 C  C     . LYS A 199 ? 0.3191 0.3183 0.2049 0.0008  -0.0250 0.0029  325 LYS A C     
1517 O  O     . LYS A 199 ? 0.3880 0.3880 0.2700 -0.0015 -0.0220 -0.0002 325 LYS A O     
1518 C  CB    . LYS A 199 ? 0.3469 0.3400 0.2494 -0.0008 -0.0192 0.0054  325 LYS A CB    
1519 C  CG    . LYS A 199 ? 0.3256 0.3144 0.2318 0.0004  -0.0177 0.0090  325 LYS A CG    
1520 C  CD    . LYS A 199 ? 0.3637 0.3552 0.2806 -0.0004 -0.0147 0.0070  325 LYS A CD    
1521 C  CE    . LYS A 199 ? 0.4468 0.4452 0.3735 0.0004  -0.0169 0.0038  325 LYS A CE    
1522 N  NZ    . LYS A 199 ? 0.5866 0.5867 0.5143 0.0041  -0.0211 0.0046  325 LYS A NZ    
1523 N  N     . LEU A 200 ? 0.3438 0.3489 0.2311 0.0036  -0.0313 0.0009  326 LEU A N     
1524 C  CA    . LEU A 200 ? 0.4150 0.4286 0.2999 0.0039  -0.0357 -0.0062 326 LEU A CA    
1525 C  C     . LEU A 200 ? 0.4124 0.4311 0.3137 0.0011  -0.0359 -0.0147 326 LEU A C     
1526 O  O     . LEU A 200 ? 0.4400 0.4644 0.3421 -0.0002 -0.0379 -0.0228 326 LEU A O     
1527 C  CB    . LEU A 200 ? 0.4662 0.4852 0.3447 0.0088  -0.0437 -0.0043 326 LEU A CB    
1528 C  CG    . LEU A 200 ? 0.5477 0.5613 0.4102 0.0120  -0.0437 0.0057  326 LEU A CG    
1529 C  CD1   . LEU A 200 ? 0.5955 0.6160 0.4510 0.0176  -0.0524 0.0073  326 LEU A CD1   
1530 C  CD2   . LEU A 200 ? 0.5525 0.5635 0.4016 0.0098  -0.0383 0.0071  326 LEU A CD2   
1531 N  N     . GLN A 201 ? 0.4238 0.4406 0.3383 0.0002  -0.0335 -0.0131 327 GLN A N     
1532 C  CA    . GLN A 201 ? 0.4605 0.4808 0.3921 -0.0028 -0.0317 -0.0188 327 GLN A CA    
1533 C  C     . GLN A 201 ? 0.4381 0.4520 0.3755 -0.0046 -0.0245 -0.0142 327 GLN A C     
1534 O  O     . GLN A 201 ? 0.4208 0.4291 0.3509 -0.0032 -0.0222 -0.0079 327 GLN A O     
1535 C  CB    . GLN A 201 ? 0.4797 0.5079 0.4239 -0.0013 -0.0367 -0.0214 327 GLN A CB    
1536 C  CG    . GLN A 201 ? 0.5670 0.6039 0.5068 0.0012  -0.0454 -0.0266 327 GLN A CG    
1537 C  CD    . GLN A 201 ? 0.5532 0.5993 0.5080 0.0028  -0.0506 -0.0296 327 GLN A CD    
1538 O  OE1   . GLN A 201 ? 0.4853 0.5311 0.4530 0.0023  -0.0469 -0.0269 327 GLN A OE1   
1539 N  NE2   . GLN A 201 ? 0.6314 0.6871 0.5848 0.0050  -0.0593 -0.0353 327 GLN A NE2   
1540 N  N     . GLY A 202 ? 0.3688 0.3837 0.3200 -0.0076 -0.0210 -0.0175 328 GLY A N     
1541 C  CA    . GLY A 202 ? 0.4070 0.4174 0.3637 -0.0086 -0.0145 -0.0124 328 GLY A CA    
1542 C  C     . GLY A 202 ? 0.3865 0.3996 0.3614 -0.0114 -0.0116 -0.0150 328 GLY A C     
1543 O  O     . GLY A 202 ? 0.4006 0.4185 0.3850 -0.0132 -0.0147 -0.0219 328 GLY A O     
1544 N  N     A HIS A 203 ? 0.4016 0.4119 0.3814 -0.0117 -0.0057 -0.0093 329 HIS A N     
1545 N  N     B HIS A 203 ? 0.4044 0.4147 0.3842 -0.0116 -0.0057 -0.0093 329 HIS A N     
1546 C  CA    A HIS A 203 ? 0.4107 0.4221 0.4079 -0.0143 -0.0011 -0.0090 329 HIS A CA    
1547 C  CA    B HIS A 203 ? 0.4085 0.4198 0.4056 -0.0142 -0.0011 -0.0090 329 HIS A CA    
1548 C  C     A HIS A 203 ? 0.3788 0.3840 0.3789 -0.0160 0.0033  -0.0081 329 HIS A C     
1549 C  C     B HIS A 203 ? 0.3790 0.3845 0.3796 -0.0162 0.0027  -0.0092 329 HIS A C     
1550 O  O     A HIS A 203 ? 0.3291 0.3334 0.3443 -0.0181 0.0078  -0.0064 329 HIS A O     
1551 O  O     B HIS A 203 ? 0.3445 0.3495 0.3614 -0.0188 0.0062  -0.0098 329 HIS A O     
1552 C  CB    A HIS A 203 ? 0.4321 0.4458 0.4332 -0.0126 0.0032  -0.0021 329 HIS A CB    
1553 C  CB    B HIS A 203 ? 0.4222 0.4350 0.4226 -0.0126 0.0039  -0.0014 329 HIS A CB    
1554 C  CG    A HIS A 203 ? 0.4565 0.4773 0.4609 -0.0110 -0.0002 -0.0039 329 HIS A CG    
1555 C  CG    B HIS A 203 ? 0.3681 0.3759 0.3579 -0.0107 0.0076  0.0052  329 HIS A CG    
1556 N  ND1   A HIS A 203 ? 0.4662 0.4885 0.4633 -0.0073 0.0002  0.0001  329 HIS A ND1   
1557 C  CD2   A HIS A 203 ? 0.4578 0.4853 0.4734 -0.0122 -0.0045 -0.0099 329 HIS A CD2   
1558 C  CE1   A HIS A 203 ? 0.4665 0.4955 0.4703 -0.0060 -0.0033 -0.0028 329 HIS A CE1   
1559 N  NE2   A HIS A 203 ? 0.4715 0.5045 0.4866 -0.0089 -0.0064 -0.0087 329 HIS A NE2   
1560 N  N     . ASP A 204 ? 0.3352 0.3363 0.3227 -0.0150 0.0025  -0.0086 330 ASP A N     
1561 C  CA    . ASP A 204 ? 0.3699 0.3659 0.3609 -0.0160 0.0061  -0.0088 330 ASP A CA    
1562 C  C     . ASP A 204 ? 0.3360 0.3303 0.3125 -0.0151 0.0040  -0.0115 330 ASP A C     
1563 O  O     . ASP A 204 ? 0.3029 0.2991 0.2668 -0.0138 0.0004  -0.0116 330 ASP A O     
1564 C  CB    . ASP A 204 ? 0.3846 0.3777 0.3789 -0.0147 0.0117  0.0004  330 ASP A CB    
1565 C  CG    . ASP A 204 ? 0.4212 0.4125 0.4010 -0.0121 0.0118  0.0048  330 ASP A CG    
1566 O  OD1   . ASP A 204 ? 0.3562 0.3490 0.3241 -0.0110 0.0085  0.0043  330 ASP A OD1   
1567 O  OD2   . ASP A 204 ? 0.4642 0.4527 0.4459 -0.0110 0.0150  0.0091  330 ASP A OD2   
1568 N  N     . VAL A 205 ? 0.2933 0.2842 0.2730 -0.0156 0.0066  -0.0137 331 VAL A N     
1569 C  CA    . VAL A 205 ? 0.3121 0.3023 0.2801 -0.0148 0.0063  -0.0162 331 VAL A CA    
1570 C  C     . VAL A 205 ? 0.2683 0.2549 0.2376 -0.0136 0.0105  -0.0107 331 VAL A C     
1571 O  O     . VAL A 205 ? 0.2839 0.2677 0.2657 -0.0135 0.0137  -0.0087 331 VAL A O     
1572 C  CB    . VAL A 205 ? 0.3620 0.3535 0.3323 -0.0161 0.0050  -0.0267 331 VAL A CB    
1573 C  CG1   . VAL A 205 ? 0.3766 0.3691 0.3324 -0.0151 0.0053  -0.0287 331 VAL A CG1   
1574 C  CG2   . VAL A 205 ? 0.3611 0.3575 0.3332 -0.0172 -0.0001 -0.0329 331 VAL A CG2   
1575 N  N     . ASP A 206 ? 0.2665 0.2535 0.2241 -0.0124 0.0104  -0.0080 332 ASP A N     
1576 C  CA    . ASP A 206 ? 0.2639 0.2497 0.2224 -0.0109 0.0132  -0.0030 332 ASP A CA    
1577 C  C     . ASP A 206 ? 0.2836 0.2700 0.2382 -0.0111 0.0148  -0.0070 332 ASP A C     
1578 O  O     . ASP A 206 ? 0.2988 0.2869 0.2427 -0.0119 0.0136  -0.0091 332 ASP A O     
1579 C  CB    . ASP A 206 ? 0.2602 0.2470 0.2107 -0.0098 0.0118  0.0032  332 ASP A CB    
1580 C  CG    . ASP A 206 ? 0.2928 0.2804 0.2460 -0.0091 0.0109  0.0066  332 ASP A CG    
1581 O  OD1   . ASP A 206 ? 0.3100 0.2971 0.2723 -0.0084 0.0134  0.0100  332 ASP A OD1   
1582 O  OD2   . ASP A 206 ? 0.3026 0.2913 0.2494 -0.0092 0.0082  0.0064  332 ASP A OD2   
1583 N  N     . PHE A 207 ? 0.2676 0.2528 0.2313 -0.0100 0.0179  -0.0073 333 PHE A N     
1584 C  CA    . PHE A 207 ? 0.2760 0.2629 0.2382 -0.0097 0.0204  -0.0111 333 PHE A CA    
1585 C  C     . PHE A 207 ? 0.2768 0.2648 0.2440 -0.0076 0.0220  -0.0058 333 PHE A C     
1586 O  O     . PHE A 207 ? 0.3020 0.2883 0.2774 -0.0056 0.0221  -0.0009 333 PHE A O     
1587 C  CB    . PHE A 207 ? 0.2976 0.2834 0.2684 -0.0097 0.0225  -0.0195 333 PHE A CB    
1588 C  CG    . PHE A 207 ? 0.3391 0.3260 0.3048 -0.0115 0.0201  -0.0270 333 PHE A CG    
1589 C  CD1   . PHE A 207 ? 0.3199 0.3110 0.2709 -0.0121 0.0193  -0.0302 333 PHE A CD1   
1590 C  CD2   . PHE A 207 ? 0.3885 0.3730 0.3646 -0.0125 0.0187  -0.0308 333 PHE A CD2   
1591 C  CE1   . PHE A 207 ? 0.3676 0.3612 0.3126 -0.0129 0.0162  -0.0371 333 PHE A CE1   
1592 C  CE2   . PHE A 207 ? 0.4244 0.4116 0.3968 -0.0140 0.0154  -0.0389 333 PHE A CE2   
1593 C  CZ    . PHE A 207 ? 0.3999 0.3921 0.3558 -0.0139 0.0137  -0.0421 333 PHE A CZ    
1594 N  N     . LEU A 208 ? 0.2679 0.2594 0.2304 -0.0079 0.0234  -0.0067 334 LEU A N     
1595 C  CA    . LEU A 208 ? 0.2656 0.2602 0.2342 -0.0061 0.0245  -0.0033 334 LEU A CA    
1596 C  C     . LEU A 208 ? 0.2977 0.2947 0.2723 -0.0054 0.0288  -0.0090 334 LEU A C     
1597 O  O     . LEU A 208 ? 0.3399 0.3390 0.3074 -0.0073 0.0311  -0.0137 334 LEU A O     
1598 C  CB    . LEU A 208 ? 0.2628 0.2603 0.2236 -0.0075 0.0227  0.0003  334 LEU A CB    
1599 C  CG    . LEU A 208 ? 0.2741 0.2766 0.2414 -0.0062 0.0226  0.0028  334 LEU A CG    
1600 C  CD1   . LEU A 208 ? 0.2814 0.2843 0.2565 -0.0022 0.0204  0.0073  334 LEU A CD1   
1601 C  CD2   . LEU A 208 ? 0.2938 0.2981 0.2545 -0.0086 0.0205  0.0048  334 LEU A CD2   
1602 N  N     . ILE A 209 ? 0.2698 0.2672 0.2575 -0.0022 0.0301  -0.0081 335 ILE A N     
1603 C  CA    . ILE A 209 ? 0.2743 0.2737 0.2713 -0.0006 0.0344  -0.0142 335 ILE A CA    
1604 C  C     . ILE A 209 ? 0.3041 0.3098 0.3086 0.0016  0.0350  -0.0109 335 ILE A C     
1605 O  O     . ILE A 209 ? 0.3460 0.3524 0.3547 0.0039  0.0317  -0.0042 335 ILE A O     
1606 C  CB    . ILE A 209 ? 0.2782 0.2715 0.2881 0.0019  0.0354  -0.0167 335 ILE A CB    
1607 C  CG1   . ILE A 209 ? 0.2816 0.2699 0.2866 -0.0008 0.0343  -0.0213 335 ILE A CG1   
1608 C  CG2   . ILE A 209 ? 0.3194 0.3145 0.3407 0.0045  0.0399  -0.0237 335 ILE A CG2   
1609 C  CD1   . ILE A 209 ? 0.2842 0.2652 0.3037 0.0007  0.0346  -0.0214 335 ILE A CD1   
1610 N  N     . THR A 210 ? 0.2948 0.3062 0.3011 0.0011  0.0393  -0.0159 336 THR A N     
1611 C  CA    . THR A 210 ? 0.3144 0.3334 0.3312 0.0032  0.0402  -0.0140 336 THR A CA    
1612 C  C     . THR A 210 ? 0.3066 0.3302 0.3312 0.0044  0.0467  -0.0217 336 THR A C     
1613 O  O     . THR A 210 ? 0.2843 0.3048 0.3054 0.0040  0.0500  -0.0286 336 THR A O     
1614 C  CB    . THR A 210 ? 0.3020 0.3261 0.3121 -0.0002 0.0383  -0.0101 336 THR A CB    
1615 O  OG1   . THR A 210 ? 0.3468 0.3792 0.3695 0.0018  0.0376  -0.0085 336 THR A OG1   
1616 C  CG2   . THR A 210 ? 0.3900 0.4158 0.3895 -0.0047 0.0429  -0.0135 336 THR A CG2   
1617 N  N     . HIS A 211 ? 0.2772 0.3094 0.3130 0.0060  0.0484  -0.0212 337 HIS A N     
1618 C  CA    . HIS A 211 ? 0.3328 0.3716 0.3776 0.0074  0.0554  -0.0283 337 HIS A CA    
1619 C  C     . HIS A 211 ? 0.3307 0.3805 0.3807 0.0055  0.0573  -0.0263 337 HIS A C     
1620 O  O     . HIS A 211 ? 0.3041 0.3574 0.3607 0.0062  0.0520  -0.0207 337 HIS A O     
1621 C  CB    . HIS A 211 ? 0.3301 0.3673 0.3928 0.0138  0.0559  -0.0308 337 HIS A CB    
1622 C  CG    . HIS A 211 ? 0.3875 0.4303 0.4595 0.0160  0.0635  -0.0401 337 HIS A CG    
1623 N  ND1   . HIS A 211 ? 0.3610 0.4157 0.4444 0.0171  0.0674  -0.0411 337 HIS A ND1   
1624 C  CD2   . HIS A 211 ? 0.4109 0.4500 0.4833 0.0174  0.0682  -0.0496 337 HIS A CD2   
1625 C  CE1   . HIS A 211 ? 0.4004 0.4585 0.4902 0.0194  0.0748  -0.0505 337 HIS A CE1   
1626 N  NE2   . HIS A 211 ? 0.3738 0.4225 0.4565 0.0197  0.0752  -0.0563 337 HIS A NE2   
1627 N  N     . PRO A 212 ? 0.3371 0.3935 0.3847 0.0030  0.0649  -0.0309 338 PRO A N     
1628 C  CA    . PRO A 212 ? 0.3639 0.4307 0.4178 -0.0002 0.0675  -0.0285 338 PRO A CA    
1629 C  C     . PRO A 212 ? 0.3614 0.4379 0.4378 0.0038  0.0665  -0.0287 338 PRO A C     
1630 O  O     . PRO A 212 ? 0.3765 0.4618 0.4608 0.0010  0.0664  -0.0263 338 PRO A O     
1631 C  CB    . PRO A 212 ? 0.3621 0.4337 0.4085 -0.0028 0.0775  -0.0333 338 PRO A CB    
1632 C  CG    . PRO A 212 ? 0.4261 0.4937 0.4703 0.0013  0.0802  -0.0411 338 PRO A CG    
1633 C  CD    . PRO A 212 ? 0.3916 0.4472 0.4311 0.0029  0.0717  -0.0388 338 PRO A CD    
1634 N  N     . LYS A 213 ? 0.3519 0.4270 0.4401 0.0103  0.0655  -0.0313 339 LYS A N     
1635 C  CA    . LYS A 213 ? 0.3418 0.4263 0.4522 0.0154  0.0637  -0.0309 339 LYS A CA    
1636 C  C     . LYS A 213 ? 0.3658 0.4458 0.4779 0.0190  0.0534  -0.0236 339 LYS A C     
1637 O  O     . LYS A 213 ? 0.3074 0.3776 0.4182 0.0231  0.0509  -0.0222 339 LYS A O     
1638 C  CB    . LYS A 213 ? 0.3232 0.4094 0.4472 0.0213  0.0698  -0.0382 339 LYS A CB    
1639 C  CG    . LYS A 213 ? 0.3589 0.4580 0.5076 0.0264  0.0702  -0.0391 339 LYS A CG    
1640 N  N     . GLU A 214 ? 0.3214 0.4089 0.4366 0.0173  0.0476  -0.0193 340 GLU A N     
1641 C  CA    . GLU A 214 ? 0.3661 0.4518 0.4806 0.0209  0.0377  -0.0125 340 GLU A CA    
1642 C  C     . GLU A 214 ? 0.3813 0.4656 0.5089 0.0298  0.0356  -0.0103 340 GLU A C     
1643 O  O     . GLU A 214 ? 0.2911 0.3838 0.4370 0.0341  0.0382  -0.0135 340 GLU A O     
1644 C  CB    . GLU A 214 ? 0.3833 0.4816 0.5054 0.0192  0.0321  -0.0111 340 GLU A CB    
1645 C  CG    . GLU A 214 ? 0.3789 0.4775 0.4970 0.0229  0.0213  -0.0048 340 GLU A CG    
1646 C  CD    . GLU A 214 ? 0.3598 0.4500 0.4576 0.0176  0.0183  -0.0025 340 GLU A CD    
1647 O  OE1   . GLU A 214 ? 0.3256 0.4105 0.4140 0.0110  0.0238  -0.0052 340 GLU A OE1   
1648 O  OE2   . GLU A 214 ? 0.3656 0.4550 0.4567 0.0206  0.0105  0.0023  340 GLU A OE2   
1649 N  N     . GLY A 215 ? 0.4130 0.4866 0.5320 0.0326  0.0312  -0.0044 341 GLY A N     
1650 C  CA    . GLY A 215 ? 0.4141 0.4840 0.5445 0.0410  0.0290  0.0001  341 GLY A CA    
1651 C  C     . GLY A 215 ? 0.3725 0.4299 0.5050 0.0422  0.0352  -0.0036 341 GLY A C     
1652 O  O     . GLY A 215 ? 0.3721 0.4212 0.5099 0.0476  0.0334  0.0019  341 GLY A O     
1653 N  N     . GLN A 216 ? 0.3512 0.4073 0.4799 0.0375  0.0427  -0.0128 342 GLN A N     
1654 C  CA    . GLN A 216 ? 0.3588 0.4042 0.4897 0.0385  0.0481  -0.0188 342 GLN A CA    
1655 C  C     . GLN A 216 ? 0.3468 0.3787 0.4642 0.0360  0.0457  -0.0150 342 GLN A C     
1656 O  O     . GLN A 216 ? 0.3239 0.3456 0.4472 0.0379  0.0481  -0.0178 342 GLN A O     
1657 C  CB    . GLN A 216 ? 0.3516 0.4010 0.4787 0.0343  0.0563  -0.0300 342 GLN A CB    
1658 C  CG    . GLN A 216 ? 0.3512 0.4126 0.4960 0.0378  0.0615  -0.0358 342 GLN A CG    
1659 C  CD    . GLN A 216 ? 0.4876 0.5448 0.6526 0.0459  0.0631  -0.0388 342 GLN A CD    
1660 O  OE1   . GLN A 216 ? 0.5353 0.5837 0.7008 0.0465  0.0676  -0.0465 342 GLN A OE1   
1661 N  NE2   . GLN A 216 ? 0.5238 0.5872 0.7063 0.0524  0.0590  -0.0329 342 GLN A NE2   
1662 N  N     . GLU A 217 ? 0.3323 0.3642 0.4336 0.0317  0.0411  -0.0093 343 GLU A N     
1663 C  CA    . GLU A 217 ? 0.3285 0.3492 0.4178 0.0291  0.0392  -0.0058 343 GLU A CA    
1664 C  C     . GLU A 217 ? 0.2873 0.3018 0.3840 0.0346  0.0354  0.0040  343 GLU A C     
1665 O  O     . GLU A 217 ? 0.3181 0.3227 0.4095 0.0331  0.0352  0.0069  343 GLU A O     
1666 C  CB    . GLU A 217 ? 0.3692 0.3923 0.4399 0.0233  0.0359  -0.0031 343 GLU A CB    
1667 C  CG    . GLU A 217 ? 0.3955 0.4242 0.4638 0.0253  0.0291  0.0058  343 GLU A CG    
1668 C  CD    . GLU A 217 ? 0.4123 0.4534 0.4927 0.0286  0.0274  0.0057  343 GLU A CD    
1669 O  OE1   . GLU A 217 ? 0.3891 0.4364 0.4757 0.0267  0.0320  -0.0012 343 GLU A OE1   
1670 O  OE2   . GLU A 217 ? 0.4564 0.5023 0.5402 0.0332  0.0215  0.0127  343 GLU A OE2   
1671 N  N     . ALA A 218 ? 0.3001 0.3209 0.4091 0.0411  0.0326  0.0097  344 ALA A N     
1672 C  CA    . ALA A 218 ? 0.4031 0.4185 0.5185 0.0473  0.0293  0.0208  344 ALA A CA    
1673 C  C     . ALA A 218 ? 0.4107 0.4122 0.5372 0.0488  0.0340  0.0194  344 ALA A C     
1674 O  O     . ALA A 218 ? 0.4016 0.4010 0.5401 0.0495  0.0388  0.0100  344 ALA A O     
1675 C  CB    . ALA A 218 ? 0.4559 0.4815 0.5851 0.0551  0.0256  0.0257  344 ALA A CB    
1676 N  N     . GLY A 219 ? 0.3954 0.3877 0.5185 0.0492  0.0329  0.0285  345 GLY A N     
1677 C  CA    . GLY A 219 ? 0.4247 0.4028 0.5604 0.0499  0.0372  0.0282  345 GLY A CA    
1678 C  C     . GLY A 219 ? 0.3773 0.3490 0.5084 0.0425  0.0411  0.0160  345 GLY A C     
1679 O  O     . GLY A 219 ? 0.3738 0.3344 0.5179 0.0425  0.0447  0.0123  345 GLY A O     
1680 N  N     . LEU A 220 ? 0.3054 0.2836 0.4189 0.0365  0.0401  0.0098  346 LEU A N     
1681 C  CA    . LEU A 220 ? 0.3384 0.3132 0.4469 0.0306  0.0433  -0.0028 346 LEU A CA    
1682 C  C     . LEU A 220 ? 0.3600 0.3254 0.4652 0.0266  0.0430  -0.0008 346 LEU A C     
1683 O  O     . LEU A 220 ? 0.3225 0.2809 0.4348 0.0242  0.0457  -0.0100 346 LEU A O     
1684 C  CB    . LEU A 220 ? 0.3541 0.3391 0.4452 0.0261  0.0425  -0.0082 346 LEU A CB    
1685 C  CG    . LEU A 220 ? 0.4334 0.4170 0.5147 0.0204  0.0449  -0.0200 346 LEU A CG    
1686 C  CD1   . LEU A 220 ? 0.4898 0.4706 0.5842 0.0222  0.0497  -0.0320 346 LEU A CD1   
1687 C  CD2   . LEU A 220 ? 0.4196 0.4129 0.4845 0.0168  0.0444  -0.0220 346 LEU A CD2   
1688 N  N     . LEU A 221 ? 0.3760 0.3417 0.4715 0.0259  0.0399  0.0104  347 LEU A N     
1689 C  CA    . LEU A 221 ? 0.4088 0.3683 0.5001 0.0212  0.0400  0.0111  347 LEU A CA    
1690 C  C     . LEU A 221 ? 0.3606 0.3081 0.4717 0.0223  0.0434  0.0122  347 LEU A C     
1691 O  O     . LEU A 221 ? 0.3362 0.2783 0.4507 0.0175  0.0447  0.0044  347 LEU A O     
1692 C  CB    . LEU A 221 ? 0.3877 0.3510 0.4652 0.0209  0.0367  0.0227  347 LEU A CB    
1693 C  CG    . LEU A 221 ? 0.4327 0.3939 0.5006 0.0153  0.0362  0.0217  347 LEU A CG    
1694 C  CD1   . LEU A 221 ? 0.4167 0.3798 0.4769 0.0101  0.0359  0.0082  347 LEU A CD1   
1695 C  CD2   . LEU A 221 ? 0.4283 0.3960 0.4805 0.0158  0.0330  0.0308  347 LEU A CD2   
1696 N  N     . PRO A 222 ? 0.3611 0.3042 0.4868 0.0283  0.0446  0.0216  348 PRO A N     
1697 C  CA    . PRO A 222 ? 0.3554 0.2853 0.5028 0.0290  0.0486  0.0222  348 PRO A CA    
1698 C  C     . PRO A 222 ? 0.4256 0.3510 0.5849 0.0268  0.0512  0.0047  348 PRO A C     
1699 O  O     . PRO A 222 ? 0.3804 0.2962 0.5530 0.0234  0.0535  -0.0006 348 PRO A O     
1700 C  CB    . PRO A 222 ? 0.3759 0.3034 0.5357 0.0373  0.0490  0.0354  348 PRO A CB    
1701 C  CG    . PRO A 222 ? 0.4267 0.3665 0.5682 0.0402  0.0445  0.0446  348 PRO A CG    
1702 C  CD    . PRO A 222 ? 0.3966 0.3462 0.5204 0.0350  0.0421  0.0329  348 PRO A CD    
1703 N  N     . ARG A 223 ? 0.3931 0.3260 0.5488 0.0286  0.0510  -0.0051 349 ARG A N     
1704 C  CA    . ARG A 223 ? 0.3858 0.3162 0.5509 0.0273  0.0538  -0.0227 349 ARG A CA    
1705 C  C     . ARG A 223 ? 0.3749 0.3076 0.5266 0.0201  0.0526  -0.0343 349 ARG A C     
1706 O  O     . ARG A 223 ? 0.3425 0.2696 0.5044 0.0176  0.0542  -0.0473 349 ARG A O     
1707 C  CB    . ARG A 223 ? 0.4240 0.3636 0.5879 0.0315  0.0549  -0.0290 349 ARG A CB    
1708 C  CG    . ARG A 223 ? 0.4335 0.3711 0.6151 0.0397  0.0559  -0.0202 349 ARG A CG    
1709 C  CD    . ARG A 223 ? 0.3854 0.3352 0.5650 0.0435  0.0566  -0.0251 349 ARG A CD    
1710 N  NE    . ARG A 223 ? 0.3417 0.2949 0.5206 0.0412  0.0604  -0.0435 349 ARG A NE    
1711 C  CZ    . ARG A 223 ? 0.3528 0.2995 0.5505 0.0441  0.0645  -0.0550 349 ARG A CZ    
1712 N  NH1   . ARG A 223 ? 0.3682 0.3032 0.5891 0.0492  0.0654  -0.0495 349 ARG A NH1   
1713 N  NH2   . ARG A 223 ? 0.3563 0.3082 0.5497 0.0422  0.0680  -0.0722 349 ARG A NH2   
1714 N  N     . VAL A 224 ? 0.3676 0.3091 0.4970 0.0169  0.0494  -0.0302 350 VAL A N     
1715 C  CA    . VAL A 224 ? 0.3582 0.3024 0.4741 0.0107  0.0474  -0.0389 350 VAL A CA    
1716 C  C     . VAL A 224 ? 0.3415 0.2769 0.4683 0.0073  0.0471  -0.0371 350 VAL A C     
1717 O  O     . VAL A 224 ? 0.3729 0.3060 0.5045 0.0035  0.0468  -0.0498 350 VAL A O     
1718 C  CB    . VAL A 224 ? 0.3196 0.2735 0.4117 0.0088  0.0442  -0.0328 350 VAL A CB    
1719 C  CG1   . VAL A 224 ? 0.3436 0.2996 0.4229 0.0032  0.0415  -0.0392 350 VAL A CG1   
1720 C  CG2   . VAL A 224 ? 0.3486 0.3117 0.4321 0.0110  0.0453  -0.0364 350 VAL A CG2   
1721 N  N     . MET A 225 ? 0.3653 0.2965 0.4966 0.0085  0.0473  -0.0216 351 MET A N     
1722 C  CA    . MET A 225 ? 0.3933 0.3171 0.5354 0.0048  0.0480  -0.0180 351 MET A CA    
1723 C  C     . MET A 225 ? 0.4138 0.3264 0.5822 0.0044  0.0513  -0.0264 351 MET A C     
1724 O  O     . MET A 225 ? 0.4051 0.3142 0.5824 -0.0008 0.0510  -0.0349 351 MET A O     
1725 C  CB    . MET A 225 ? 0.4073 0.3297 0.5483 0.0072  0.0487  0.0014  351 MET A CB    
1726 C  CG    . MET A 225 ? 0.4791 0.4121 0.5954 0.0067  0.0452  0.0082  351 MET A CG    
1727 S  SD    . MET A 225 ? 0.4864 0.4251 0.5884 -0.0002 0.0419  -0.0018 351 MET A SD    
1728 C  CE    . MET A 225 ? 0.5140 0.4441 0.6365 -0.0043 0.0448  0.0006  351 MET A CE    
1729 N  N     A CYS A 226 ? 0.4682 0.3751 0.6510 0.0100  0.0541  -0.0245 352 CYS A N     
1730 N  N     B CYS A 226 ? 0.4683 0.3753 0.6513 0.0099  0.0542  -0.0247 352 CYS A N     
1731 C  CA    A CYS A 226 ? 0.5096 0.4046 0.7198 0.0102  0.0575  -0.0330 352 CYS A CA    
1732 C  CA    B CYS A 226 ? 0.5087 0.4035 0.7191 0.0100  0.0575  -0.0332 352 CYS A CA    
1733 C  C     A CYS A 226 ? 0.5034 0.4009 0.7137 0.0061  0.0562  -0.0557 352 CYS A C     
1734 C  C     B CYS A 226 ? 0.5036 0.4010 0.7140 0.0060  0.0562  -0.0559 352 CYS A C     
1735 O  O     A CYS A 226 ? 0.5259 0.4153 0.7554 0.0024  0.0571  -0.0652 352 CYS A O     
1736 O  O     B CYS A 226 ? 0.5268 0.4163 0.7564 0.0024  0.0571  -0.0657 352 CYS A O     
1737 C  CB    A CYS A 226 ? 0.5203 0.4109 0.7437 0.0181  0.0603  -0.0288 352 CYS A CB    
1738 C  CB    B CYS A 226 ? 0.5207 0.4103 0.7457 0.0177  0.0604  -0.0284 352 CYS A CB    
1739 S  SG    A CYS A 226 ? 0.5903 0.4648 0.8498 0.0197  0.0648  -0.0397 352 CYS A SG    
1740 S  SG    B CYS A 226 ? 0.5359 0.4187 0.7688 0.0230  0.0624  -0.0018 352 CYS A SG    
1741 N  N     . ARG A 227 ? 0.3849 0.2942 0.5742 0.0066  0.0540  -0.0645 353 ARG A N     
1742 C  CA    . ARG A 227 ? 0.3780 0.2918 0.5634 0.0037  0.0527  -0.0856 353 ARG A CA    
1743 C  C     . ARG A 227 ? 0.4083 0.3258 0.5844 -0.0030 0.0484  -0.0902 353 ARG A C     
1744 O  O     . ARG A 227 ? 0.4362 0.3521 0.6220 -0.0063 0.0470  -0.1061 353 ARG A O     
1745 C  CB    . ARG A 227 ? 0.3586 0.2841 0.5239 0.0067  0.0528  -0.0912 353 ARG A CB    
1746 C  CG    . ARG A 227 ? 0.4427 0.3653 0.6233 0.0128  0.0573  -0.0965 353 ARG A CG    
1747 C  CD    . ARG A 227 ? 0.4818 0.4153 0.6476 0.0170  0.0587  -0.0925 353 ARG A CD    
1748 N  NE    . ARG A 227 ? 0.5211 0.4515 0.7058 0.0232  0.0631  -0.0977 353 ARG A NE    
1749 C  CZ    . ARG A 227 ? 0.4957 0.4195 0.6977 0.0285  0.0646  -0.0854 353 ARG A CZ    
1750 N  NH1   . ARG A 227 ? 0.4676 0.3878 0.6682 0.0284  0.0622  -0.0668 353 ARG A NH1   
1751 N  NH2   . ARG A 227 ? 0.5022 0.4234 0.7225 0.0346  0.0685  -0.0919 353 ARG A NH2   
1752 N  N     . LEU A 228 ? 0.3819 0.3051 0.5408 -0.0047 0.0459  -0.0772 354 LEU A N     
1753 C  CA    . LEU A 228 ? 0.3992 0.3259 0.5523 -0.0104 0.0419  -0.0800 354 LEU A CA    
1754 C  C     . LEU A 228 ? 0.3713 0.2878 0.5512 -0.0140 0.0433  -0.0804 354 LEU A C     
1755 O  O     . LEU A 228 ? 0.3638 0.2818 0.5500 -0.0187 0.0403  -0.0932 354 LEU A O     
1756 C  CB    . LEU A 228 ? 0.3518 0.2850 0.4847 -0.0107 0.0399  -0.0648 354 LEU A CB    
1757 C  CG    . LEU A 228 ? 0.3780 0.3212 0.4853 -0.0084 0.0382  -0.0651 354 LEU A CG    
1758 C  CD1   . LEU A 228 ? 0.3954 0.3426 0.4877 -0.0080 0.0368  -0.0492 354 LEU A CD1   
1759 C  CD2   . LEU A 228 ? 0.3762 0.3275 0.4699 -0.0110 0.0344  -0.0800 354 LEU A CD2   
1760 N  N     . GLN A 229 ? 0.4442 0.3506 0.6408 -0.0118 0.0479  -0.0661 355 GLN A N     
1761 C  CA    . GLN A 229 ? 0.4637 0.3593 0.6880 -0.0155 0.0506  -0.0643 355 GLN A CA    
1762 C  C     . GLN A 229 ? 0.4794 0.3683 0.7261 -0.0172 0.0510  -0.0842 355 GLN A C     
1763 O  O     . GLN A 229 ? 0.4348 0.3204 0.6992 -0.0229 0.0501  -0.0927 355 GLN A O     
1764 C  CB    . GLN A 229 ? 0.4675 0.3533 0.7042 -0.0116 0.0560  -0.0438 355 GLN A CB    
1765 C  CG    . GLN A 229 ? 0.5292 0.4214 0.7466 -0.0102 0.0558  -0.0246 355 GLN A CG    
1766 N  N     . ASP A 230 ? 0.5133 0.4008 0.7606 -0.0122 0.0523  -0.0927 356 ASP A N     
1767 C  CA    . ASP A 230 ? 0.6102 0.4916 0.8784 -0.0131 0.0529  -0.1134 356 ASP A CA    
1768 C  C     . ASP A 230 ? 0.5325 0.4248 0.7893 -0.0175 0.0470  -0.1343 356 ASP A C     
1769 O  O     . ASP A 230 ? 0.5654 0.4536 0.8420 -0.0206 0.0459  -0.1523 356 ASP A O     
1770 C  CB    . ASP A 230 ? 0.7483 0.6276 1.0184 -0.0059 0.0561  -0.1178 356 ASP A CB    
1771 C  CG    . ASP A 230 ? 0.8283 0.6951 1.1170 -0.0008 0.0614  -0.0999 356 ASP A CG    
1772 O  OD1   . ASP A 230 ? 0.8598 0.7163 1.1669 -0.0034 0.0636  -0.0880 356 ASP A OD1   
1773 O  OD2   . ASP A 230 ? 0.8498 0.7177 1.1353 0.0060  0.0634  -0.0971 356 ASP A OD2   
1774 N  N     . GLN A 231 ? 0.4420 0.3483 0.6678 -0.0176 0.0429  -0.1326 357 GLN A N     
1775 C  CA    . GLN A 231 ? 0.4779 0.3954 0.6906 -0.0214 0.0366  -0.1491 357 GLN A CA    
1776 C  C     . GLN A 231 ? 0.4563 0.3737 0.6806 -0.0280 0.0331  -0.1483 357 GLN A C     
1777 O  O     . GLN A 231 ? 0.4476 0.3749 0.6640 -0.0310 0.0268  -0.1624 357 GLN A O     
1778 C  CB    . GLN A 231 ? 0.5870 0.5184 0.7638 -0.0191 0.0337  -0.1450 357 GLN A CB    
1779 C  CG    . GLN A 231 ? 0.7136 0.6489 0.8771 -0.0134 0.0368  -0.1488 357 GLN A CG    
1780 C  CD    . GLN A 231 ? 0.8378 0.7788 0.9995 -0.0126 0.0354  -0.1727 357 GLN A CD    
1781 O  OE1   . GLN A 231 ? 0.8475 0.7839 1.0295 -0.0152 0.0338  -0.1880 357 GLN A OE1   
1782 N  NE2   . GLN A 231 ? 0.8951 0.8467 1.0327 -0.0091 0.0363  -0.1764 357 GLN A NE2   
1783 N  N     . GLY A 232 ? 0.4709 0.3787 0.7132 -0.0299 0.0370  -0.1320 358 GLY A N     
1784 C  CA    . GLY A 232 ? 0.4479 0.3567 0.7021 -0.0362 0.0350  -0.1294 358 GLY A CA    
1785 C  C     . GLY A 232 ? 0.4344 0.3556 0.6630 -0.0370 0.0309  -0.1200 358 GLY A C     
1786 O  O     . GLY A 232 ? 0.4067 0.3326 0.6424 -0.0421 0.0277  -0.1221 358 GLY A O     
1787 N  N     . LEU A 233 ? 0.3682 0.2947 0.5691 -0.0323 0.0310  -0.1097 359 LEU A N     
1788 C  CA    . LEU A 233 ? 0.3974 0.3355 0.5728 -0.0325 0.0266  -0.1032 359 LEU A CA    
1789 C  C     . LEU A 233 ? 0.3667 0.3029 0.5399 -0.0322 0.0300  -0.0818 359 LEU A C     
1790 O  O     . LEU A 233 ? 0.3927 0.3376 0.5483 -0.0326 0.0267  -0.0765 359 LEU A O     
1791 C  CB    . LEU A 233 ? 0.4793 0.4250 0.6255 -0.0279 0.0248  -0.1053 359 LEU A CB    
1792 C  CG    . LEU A 233 ? 0.5582 0.5103 0.6972 -0.0273 0.0210  -0.1259 359 LEU A CG    
1793 C  CD1   . LEU A 233 ? 0.5739 0.5322 0.6861 -0.0226 0.0218  -0.1237 359 LEU A CD1   
1794 C  CD2   . LEU A 233 ? 0.5724 0.5342 0.7072 -0.0310 0.0135  -0.1372 359 LEU A CD2   
1795 N  N     . ILE A 234 ? 0.3913 0.3168 0.5809 -0.0309 0.0365  -0.0695 360 ILE A N     
1796 C  CA    . ILE A 234 ? 0.3797 0.3043 0.5637 -0.0293 0.0401  -0.0488 360 ILE A CA    
1797 C  C     . ILE A 234 ? 0.3830 0.3033 0.5908 -0.0342 0.0436  -0.0432 360 ILE A C     
1798 O  O     . ILE A 234 ? 0.4223 0.3316 0.6563 -0.0356 0.0483  -0.0426 360 ILE A O     
1799 C  CB    . ILE A 234 ? 0.3663 0.2839 0.5494 -0.0234 0.0447  -0.0367 360 ILE A CB    
1800 C  CG1   . ILE A 234 ? 0.3575 0.2811 0.5189 -0.0192 0.0418  -0.0426 360 ILE A CG1   
1801 C  CG2   . ILE A 234 ? 0.3700 0.2878 0.5472 -0.0214 0.0482  -0.0157 360 ILE A CG2   
1802 C  CD1   . ILE A 234 ? 0.3795 0.3143 0.5126 -0.0187 0.0376  -0.0391 360 ILE A CD1   
1803 N  N     . LEU A 235 ? 0.3405 0.2693 0.5406 -0.0368 0.0416  -0.0390 361 LEU A N     
1804 C  CA    . LEU A 235 ? 0.3829 0.3096 0.6046 -0.0413 0.0460  -0.0315 361 LEU A CA    
1805 C  C     . LEU A 235 ? 0.4426 0.3648 0.6627 -0.0380 0.0534  -0.0093 361 LEU A C     
1806 O  O     . LEU A 235 ? 0.4514 0.3675 0.6940 -0.0408 0.0600  -0.0003 361 LEU A O     
1807 C  CB    . LEU A 235 ? 0.3562 0.2953 0.5719 -0.0449 0.0411  -0.0367 361 LEU A CB    
1808 C  CG    . LEU A 235 ? 0.3843 0.3293 0.6058 -0.0487 0.0335  -0.0585 361 LEU A CG    
1809 C  CD1   . LEU A 235 ? 0.3922 0.3513 0.5968 -0.0492 0.0268  -0.0617 361 LEU A CD1   
1810 C  CD2   . LEU A 235 ? 0.3929 0.3321 0.6507 -0.0551 0.0358  -0.0665 361 LEU A CD2   
1811 N  N     . TYR A 236 ? 0.4476 0.3734 0.6421 -0.0322 0.0525  -0.0004 362 TYR A N     
1812 C  CA    . TYR A 236 ? 0.4608 0.3846 0.6495 -0.0279 0.0581  0.0198  362 TYR A CA    
1813 C  C     . TYR A 236 ? 0.5044 0.4311 0.6685 -0.0214 0.0552  0.0235  362 TYR A C     
1814 O  O     . TYR A 236 ? 0.3954 0.3296 0.5403 -0.0209 0.0493  0.0146  362 TYR A O     
1815 C  CB    . TYR A 236 ? 0.4549 0.3870 0.6377 -0.0295 0.0602  0.0292  362 TYR A CB    
1816 C  CG    . TYR A 236 ? 0.4543 0.3877 0.6226 -0.0238 0.0644  0.0481  362 TYR A CG    
1817 C  CD1   . TYR A 236 ? 0.4841 0.4250 0.6246 -0.0191 0.0600  0.0499  362 TYR A CD1   
1818 C  CD2   . TYR A 236 ? 0.4789 0.4063 0.6617 -0.0230 0.0727  0.0640  362 TYR A CD2   
1819 C  CE1   . TYR A 236 ? 0.5093 0.4527 0.6364 -0.0136 0.0629  0.0653  362 TYR A CE1   
1820 C  CE2   . TYR A 236 ? 0.4527 0.3826 0.6202 -0.0170 0.0761  0.0810  362 TYR A CE2   
1821 C  CZ    . TYR A 236 ? 0.5169 0.4554 0.6565 -0.0123 0.0707  0.0808  362 TYR A CZ    
1822 O  OH    . TYR A 236 ? 0.6070 0.5494 0.7312 -0.0061 0.0731  0.0961  362 TYR A OH    
1823 N  N     . HIS A 237 ? 0.4568 0.3779 0.6222 -0.0164 0.0594  0.0375  363 HIS A N     
1824 C  CA    . HIS A 237 ? 0.5372 0.4630 0.6804 -0.0100 0.0571  0.0444  363 HIS A CA    
1825 C  C     . HIS A 237 ? 0.5049 0.4260 0.6531 -0.0049 0.0625  0.0631  363 HIS A C     
1826 O  O     . HIS A 237 ? 0.5221 0.4343 0.6918 -0.0062 0.0684  0.0702  363 HIS A O     
1827 C  CB    . HIS A 237 ? 0.7009 0.6259 0.8396 -0.0079 0.0529  0.0324  363 HIS A CB    
1828 C  CG    . HIS A 237 ? 0.8966 0.8113 1.0541 -0.0048 0.0562  0.0340  363 HIS A CG    
1829 N  ND1   . HIS A 237 ? 0.9733 0.8777 1.1571 -0.0082 0.0596  0.0286  363 HIS A ND1   
1830 C  CD2   . HIS A 237 ? 0.9588 0.8718 1.1140 0.0016  0.0563  0.0400  363 HIS A CD2   
1831 C  CE1   . HIS A 237 ? 1.0059 0.9017 1.2028 -0.0037 0.0621  0.0316  363 HIS A CE1   
1832 N  NE2   . HIS A 237 ? 0.9846 0.8860 1.1644 0.0025  0.0600  0.0387  363 HIS A NE2   
1833 N  N     . GLN A 238 ? 0.6844 0.6117 0.8128 0.0010  0.0603  0.0714  364 GLN A N     
1834 C  CA    . GLN A 238 ? 0.6930 0.6185 0.8215 0.0071  0.0642  0.0898  364 GLN A CA    
1835 C  C     . GLN A 238 ? 0.7136 0.6285 0.8598 0.0109  0.0660  0.0923  364 GLN A C     
1836 O  O     . GLN A 238 ? 0.7368 0.6409 0.9061 0.0094  0.0716  0.0971  364 GLN A O     
1837 C  CB    . GLN A 238 ? 0.7098 0.6465 0.8122 0.0125  0.0599  0.0954  364 GLN A CB    
1838 N  N     . PHE A 259 ? 0.5437 0.5127 0.6284 0.0454  0.0315  0.0774  385 PHE A N     
1839 C  CA    . PHE A 259 ? 0.5548 0.5292 0.6202 0.0406  0.0296  0.0762  385 PHE A CA    
1840 C  C     . PHE A 259 ? 0.5111 0.4902 0.5688 0.0349  0.0278  0.0616  385 PHE A C     
1841 O  O     . PHE A 259 ? 0.5171 0.4943 0.5840 0.0338  0.0293  0.0523  385 PHE A O     
1842 C  CB    . PHE A 259 ? 0.6988 0.6647 0.7658 0.0366  0.0343  0.0802  385 PHE A CB    
1843 C  CG    . PHE A 259 ? 0.8604 0.8150 0.9440 0.0322  0.0388  0.0716  385 PHE A CG    
1844 C  CD1   . PHE A 259 ? 0.9445 0.8897 1.0487 0.0356  0.0423  0.0751  385 PHE A CD1   
1845 C  CD2   . PHE A 259 ? 0.9239 0.8775 1.0030 0.0249  0.0392  0.0599  385 PHE A CD2   
1846 C  CE1   . PHE A 259 ? 0.9614 0.8965 1.0819 0.0314  0.0461  0.0653  385 PHE A CE1   
1847 C  CE2   . PHE A 259 ? 0.9491 0.8940 1.0431 0.0210  0.0424  0.0506  385 PHE A CE2   
1848 C  CZ    . PHE A 259 ? 0.9458 0.8813 1.0606 0.0240  0.0459  0.0526  385 PHE A CZ    
1849 N  N     . GLU A 260 ? 0.4855 0.4707 0.5260 0.0315  0.0250  0.0600  386 GLU A N     
1850 C  CA    . GLU A 260 ? 0.4832 0.4724 0.5157 0.0263  0.0235  0.0483  386 GLU A CA    
1851 C  C     . GLU A 260 ? 0.4160 0.4028 0.4380 0.0204  0.0241  0.0443  386 GLU A C     
1852 O  O     . GLU A 260 ? 0.3516 0.3403 0.3670 0.0161  0.0233  0.0355  386 GLU A O     
1853 C  CB    . GLU A 260 ? 0.4927 0.4932 0.5167 0.0283  0.0184  0.0482  386 GLU A CB    
1854 C  CG    . GLU A 260 ? 0.5369 0.5431 0.5477 0.0304  0.0147  0.0554  386 GLU A CG    
1855 C  CD    . GLU A 260 ? 0.5504 0.5683 0.5579 0.0340  0.0088  0.0557  386 GLU A CD    
1856 O  OE1   . GLU A 260 ? 0.5761 0.5974 0.5945 0.0386  0.0077  0.0575  386 GLU A OE1   
1857 O  OE2   . GLU A 260 ? 0.5551 0.5791 0.5504 0.0324  0.0051  0.0535  386 GLU A OE2   
1858 N  N     . ARG A 261 ? 0.3761 0.3591 0.3971 0.0201  0.0259  0.0510  387 ARG A N     
1859 C  CA    . ARG A 261 ? 0.3494 0.3302 0.3639 0.0149  0.0267  0.0471  387 ARG A CA    
1860 C  C     . ARG A 261 ? 0.3902 0.3627 0.4181 0.0135  0.0313  0.0495  387 ARG A C     
1861 O  O     . ARG A 261 ? 0.3523 0.3220 0.3878 0.0171  0.0338  0.0598  387 ARG A O     
1862 C  CB    . ARG A 261 ? 0.3630 0.3500 0.3630 0.0156  0.0244  0.0521  387 ARG A CB    
1863 C  CG    . ARG A 261 ? 0.4191 0.4142 0.4079 0.0168  0.0195  0.0492  387 ARG A CG    
1864 C  CD    . ARG A 261 ? 0.4177 0.4188 0.3932 0.0182  0.0172  0.0531  387 ARG A CD    
1865 N  NE    . ARG A 261 ? 0.3917 0.4000 0.3588 0.0188  0.0122  0.0490  387 ARG A NE    
1866 C  CZ    . ARG A 261 ? 0.4140 0.4279 0.3696 0.0196  0.0093  0.0487  387 ARG A CZ    
1867 N  NH1   . ARG A 261 ? 0.4047 0.4184 0.3545 0.0203  0.0113  0.0528  387 ARG A NH1   
1868 N  NH2   . ARG A 261 ? 0.4493 0.4692 0.4004 0.0196  0.0046  0.0438  387 ARG A NH2   
1869 N  N     . SER A 262 ? 0.2981 0.2668 0.3293 0.0083  0.0321  0.0402  388 SER A N     
1870 C  CA    . SER A 262 ? 0.3326 0.2938 0.3791 0.0058  0.0360  0.0398  388 SER A CA    
1871 C  C     . SER A 262 ? 0.3172 0.2803 0.3582 0.0010  0.0351  0.0353  388 SER A C     
1872 O  O     . SER A 262 ? 0.3791 0.3450 0.4120 -0.0018 0.0320  0.0255  388 SER A O     
1873 C  CB    . SER A 262 ? 0.3406 0.2960 0.4008 0.0048  0.0373  0.0300  388 SER A CB    
1874 O  OG    . SER A 262 ? 0.4522 0.4003 0.5288 0.0016  0.0403  0.0274  388 SER A OG    
1875 N  N     . PHE A 263 ? 0.3192 0.2814 0.3650 0.0003  0.0380  0.0430  389 PHE A N     
1876 C  CA    . PHE A 263 ? 0.3510 0.3159 0.3950 -0.0039 0.0376  0.0392  389 PHE A CA    
1877 C  C     . PHE A 263 ? 0.3565 0.3151 0.4213 -0.0080 0.0406  0.0349  389 PHE A C     
1878 O  O     . PHE A 263 ? 0.3703 0.3246 0.4489 -0.0079 0.0457  0.0436  389 PHE A O     
1879 C  CB    . PHE A 263 ? 0.3284 0.2984 0.3643 -0.0020 0.0394  0.0497  389 PHE A CB    
1880 C  CG    . PHE A 263 ? 0.2841 0.2596 0.3036 0.0029  0.0370  0.0553  389 PHE A CG    
1881 C  CD1   . PHE A 263 ? 0.3361 0.3156 0.3419 0.0028  0.0318  0.0481  389 PHE A CD1   
1882 C  CD2   . PHE A 263 ? 0.3338 0.3106 0.3521 0.0076  0.0398  0.0678  389 PHE A CD2   
1883 C  CE1   . PHE A 263 ? 0.3525 0.3374 0.3457 0.0068  0.0292  0.0519  389 PHE A CE1   
1884 C  CE2   . PHE A 263 ? 0.3752 0.3584 0.3787 0.0123  0.0365  0.0715  389 PHE A CE2   
1885 C  CZ    . PHE A 263 ? 0.3525 0.3398 0.3445 0.0116  0.0311  0.0628  389 PHE A CZ    
1886 N  N     A CYS A 264 ? 0.3080 0.2662 0.3756 -0.0115 0.0376  0.0214  390 CYS A N     
1887 N  N     B CYS A 264 ? 0.2880 0.2465 0.3550 -0.0115 0.0374  0.0214  390 CYS A N     
1888 C  CA    A CYS A 264 ? 0.3414 0.2939 0.4302 -0.0153 0.0395  0.0145  390 CYS A CA    
1889 C  CA    B CYS A 264 ? 0.3335 0.2865 0.4207 -0.0154 0.0389  0.0134  390 CYS A CA    
1890 C  C     A CYS A 264 ? 0.3561 0.3137 0.4455 -0.0200 0.0360  0.0049  390 CYS A C     
1891 C  C     B CYS A 264 ? 0.3730 0.3310 0.4626 -0.0200 0.0364  0.0064  390 CYS A C     
1892 O  O     A CYS A 264 ? 0.3255 0.2901 0.3979 -0.0198 0.0316  0.0017  390 CYS A O     
1893 O  O     B CYS A 264 ? 0.2867 0.2519 0.3606 -0.0198 0.0329  0.0059  390 CYS A O     
1894 C  CB    A CYS A 264 ? 0.3698 0.3171 0.4654 -0.0146 0.0389  0.0050  390 CYS A CB    
1895 C  CB    B CYS A 264 ? 0.3643 0.3146 0.4535 -0.0152 0.0368  0.0012  390 CYS A CB    
1896 S  SG    A CYS A 264 ? 0.3626 0.3165 0.4401 -0.0152 0.0329  -0.0095 390 CYS A SG    
1897 S  SG    B CYS A 264 ? 0.3854 0.3345 0.4660 -0.0093 0.0376  0.0065  390 CYS A SG    
1898 N  N     . ILE A 265 ? 0.3597 0.3136 0.4709 -0.0241 0.0381  0.0004  391 ILE A N     
1899 C  CA    . ILE A 265 ? 0.3344 0.2936 0.4516 -0.0287 0.0342  -0.0107 391 ILE A CA    
1900 C  C     . ILE A 265 ? 0.3469 0.3030 0.4728 -0.0305 0.0313  -0.0263 391 ILE A C     
1901 O  O     . ILE A 265 ? 0.3808 0.3284 0.5269 -0.0316 0.0350  -0.0281 391 ILE A O     
1902 C  CB    . ILE A 265 ? 0.3724 0.3314 0.5099 -0.0325 0.0385  -0.0053 391 ILE A CB    
1903 C  CG1   . ILE A 265 ? 0.3454 0.3087 0.4719 -0.0297 0.0421  0.0100  391 ILE A CG1   
1904 C  CG2   . ILE A 265 ? 0.3506 0.3166 0.4971 -0.0373 0.0334  -0.0185 391 ILE A CG2   
1905 C  CD1   . ILE A 265 ? 0.3818 0.3456 0.5278 -0.0330 0.0485  0.0179  391 ILE A CD1   
1906 N  N     A PHE A 266 ? 0.3480 0.3108 0.4583 -0.0303 0.0249  -0.0374 392 PHE A N     
1907 N  N     B PHE A 266 ? 0.3535 0.3163 0.4641 -0.0303 0.0249  -0.0374 392 PHE A N     
1908 C  CA    A PHE A 266 ? 0.3622 0.3248 0.4757 -0.0313 0.0216  -0.0535 392 PHE A CA    
1909 C  CA    B PHE A 266 ? 0.3490 0.3112 0.4632 -0.0313 0.0218  -0.0534 392 PHE A CA    
1910 C  C     A PHE A 266 ? 0.3518 0.3186 0.4810 -0.0361 0.0177  -0.0660 392 PHE A C     
1911 C  C     B PHE A 266 ? 0.3565 0.3234 0.4848 -0.0360 0.0175  -0.0662 392 PHE A C     
1912 O  O     A PHE A 266 ? 0.3256 0.2989 0.4555 -0.0380 0.0153  -0.0636 392 PHE A O     
1913 O  O     B PHE A 266 ? 0.3074 0.2816 0.4337 -0.0376 0.0145  -0.0644 392 PHE A O     
1914 C  CB    A PHE A 266 ? 0.4109 0.3801 0.4979 -0.0283 0.0171  -0.0582 392 PHE A CB    
1915 C  CB    B PHE A 266 ? 0.4083 0.3764 0.4968 -0.0281 0.0177  -0.0583 392 PHE A CB    
1916 C  CG    A PHE A 266 ? 0.4463 0.4113 0.5265 -0.0247 0.0201  -0.0579 392 PHE A CG    
1917 C  CG    B PHE A 266 ? 0.4282 0.3919 0.5088 -0.0242 0.0213  -0.0535 392 PHE A CG    
1918 C  CD1   A PHE A 266 ? 0.4722 0.4341 0.5463 -0.0215 0.0239  -0.0442 392 PHE A CD1   
1919 C  CD1   B PHE A 266 ? 0.4706 0.4301 0.5512 -0.0217 0.0257  -0.0387 392 PHE A CD1   
1920 C  CD2   A PHE A 266 ? 0.4711 0.4369 0.5505 -0.0243 0.0188  -0.0719 392 PHE A CD2   
1921 C  CD2   B PHE A 266 ? 0.4675 0.4330 0.5396 -0.0226 0.0202  -0.0641 392 PHE A CD2   
1922 C  CE1   A PHE A 266 ? 0.4853 0.4450 0.5551 -0.0181 0.0262  -0.0442 392 PHE A CE1   
1923 C  CE1   B PHE A 266 ? 0.5087 0.4659 0.5830 -0.0178 0.0281  -0.0349 392 PHE A CE1   
1924 C  CE2   A PHE A 266 ? 0.4906 0.4538 0.5650 -0.0208 0.0221  -0.0718 392 PHE A CE2   
1925 C  CE2   B PHE A 266 ? 0.4864 0.4495 0.5527 -0.0189 0.0237  -0.0601 392 PHE A CE2   
1926 C  CZ    A PHE A 266 ? 0.4915 0.4518 0.5620 -0.0178 0.0257  -0.0578 392 PHE A CZ    
1927 C  CZ    B PHE A 266 ? 0.4829 0.4419 0.5512 -0.0166 0.0272  -0.0456 392 PHE A CZ    
1928 N  N     . ARG A 267 ? 0.3954 0.3590 0.5381 -0.0378 0.0167  -0.0803 393 ARG A N     
1929 C  CA    . ARG A 267 ? 0.4330 0.4024 0.5885 -0.0420 0.0110  -0.0964 393 ARG A CA    
1930 C  C     . ARG A 267 ? 0.4751 0.4543 0.6066 -0.0395 0.0037  -0.1085 393 ARG A C     
1931 O  O     . ARG A 267 ? 0.5252 0.5026 0.6498 -0.0371 0.0040  -0.1169 393 ARG A O     
1932 C  CB    . ARG A 267 ? 0.4542 0.4144 0.6389 -0.0451 0.0141  -0.1062 393 ARG A CB    
1933 C  CG    . ARG A 267 ? 0.5053 0.4710 0.7075 -0.0499 0.0082  -0.1246 393 ARG A CG    
1934 C  CD    . ARG A 267 ? 0.4696 0.4241 0.7004 -0.0524 0.0119  -0.1345 393 ARG A CD    
1935 N  NE    . ARG A 267 ? 0.4048 0.3651 0.6522 -0.0569 0.0052  -0.1560 393 ARG A NE    
1936 C  CZ    . ARG A 267 ? 0.3849 0.3411 0.6667 -0.0632 0.0064  -0.1616 393 ARG A CZ    
1937 N  NH1   . ARG A 267 ? 0.3815 0.3267 0.6851 -0.0657 0.0151  -0.1458 393 ARG A NH1   
1938 N  NH2   . ARG A 267 ? 0.4700 0.4335 0.7648 -0.0669 -0.0011 -0.1834 393 ARG A NH2   
1939 N  N     . LEU A 268 ? 0.3590 0.3488 0.4777 -0.0395 -0.0025 -0.1085 394 LEU A N     
1940 C  CA    . LEU A 268 ? 0.4575 0.4569 0.5510 -0.0364 -0.0092 -0.1165 394 LEU A CA    
1941 C  C     . LEU A 268 ? 0.5280 0.5367 0.6299 -0.0388 -0.0174 -0.1348 394 LEU A C     
1942 O  O     . LEU A 268 ? 0.4957 0.5100 0.6107 -0.0418 -0.0211 -0.1354 394 LEU A O     
1943 C  CB    . LEU A 268 ? 0.4897 0.4946 0.5620 -0.0337 -0.0113 -0.1039 394 LEU A CB    
1944 C  CG    . LEU A 268 ? 0.5701 0.5844 0.6160 -0.0303 -0.0179 -0.1094 394 LEU A CG    
1945 C  CD1   . LEU A 268 ? 0.5523 0.5634 0.5821 -0.0273 -0.0143 -0.1107 394 LEU A CD1   
1946 C  CD2   . LEU A 268 ? 0.5431 0.5618 0.5737 -0.0281 -0.0204 -0.0972 394 LEU A CD2   
1947 N  N     . PRO A 269 ? 0.6302 0.6424 0.7248 -0.0374 -0.0206 -0.1502 395 PRO A N     
1948 C  CA    . PRO A 269 ? 0.7356 0.7587 0.8364 -0.0392 -0.0297 -0.1690 395 PRO A CA    
1949 C  C     . PRO A 269 ? 0.7722 0.8083 0.8583 -0.0377 -0.0381 -0.1665 395 PRO A C     
1950 O  O     . PRO A 269 ? 0.7598 0.7981 0.8212 -0.0336 -0.0382 -0.1542 395 PRO A O     
1951 C  CB    . PRO A 269 ? 0.7504 0.7760 0.8360 -0.0359 -0.0307 -0.1830 395 PRO A CB    
1952 C  CG    . PRO A 269 ? 0.7198 0.7320 0.8095 -0.0349 -0.0206 -0.1754 395 PRO A CG    
1953 C  CD    . PRO A 269 ? 0.6657 0.6722 0.7502 -0.0343 -0.0156 -0.1528 395 PRO A CD    
1954 N  N     . GLN A 270 ? 0.7386 0.7835 0.8425 -0.0409 -0.0456 -0.1787 396 GLN A N     
1955 C  CA    . GLN A 270 ? 0.7607 0.8197 0.8563 -0.0395 -0.0550 -0.1790 396 GLN A CA    
1956 C  C     . GLN A 270 ? 0.8354 0.9074 0.9369 -0.0402 -0.0657 -0.2016 396 GLN A C     
1957 O  O     . GLN A 270 ? 0.8173 0.8858 0.9356 -0.0433 -0.0648 -0.2168 396 GLN A O     
1958 C  CB    . GLN A 270 ? 0.7344 0.7927 0.8516 -0.0430 -0.0530 -0.1684 396 GLN A CB    
1959 C  CG    . GLN A 270 ? 0.6962 0.7457 0.8031 -0.0411 -0.0447 -0.1465 396 GLN A CG    
1960 C  CD    . GLN A 270 ? 0.7103 0.7671 0.7893 -0.0355 -0.0496 -0.1376 396 GLN A CD    
1961 O  OE1   . GLN A 270 ? 0.6783 0.7441 0.7615 -0.0351 -0.0549 -0.1355 396 GLN A OE1   
1962 N  NE2   . GLN A 270 ? 0.7048 0.7578 0.7568 -0.0312 -0.0474 -0.1320 396 GLN A NE2   
1963 N  N     . PRO A 271 ? 0.7817 0.8691 0.8703 -0.0372 -0.0764 -0.2049 397 PRO A N     
1964 C  CA    . PRO A 271 ? 0.7826 0.8847 0.8773 -0.0376 -0.0881 -0.2273 397 PRO A CA    
1965 C  C     . PRO A 271 ? 0.6599 0.7601 0.7959 -0.0454 -0.0881 -0.2411 397 PRO A C     
1966 O  O     . PRO A 271 ? 0.6186 0.7213 0.7787 -0.0495 -0.0888 -0.2367 397 PRO A O     
1967 C  CB    . PRO A 271 ? 0.8187 0.9361 0.9008 -0.0336 -0.0984 -0.2227 397 PRO A CB    
1968 C  CG    . PRO A 271 ? 0.8216 0.9322 0.8765 -0.0286 -0.0926 -0.2008 397 PRO A CG    
1969 C  CD    . PRO A 271 ? 0.8038 0.8959 0.8701 -0.0323 -0.0788 -0.1888 397 PRO A CD    
1970 N  N     . GLY A 272 ? 0.7483 0.8440 0.8944 -0.0476 -0.0868 -0.2579 410 GLY A N     
1971 C  CA    . GLY A 272 ? 0.6840 0.7758 0.8714 -0.0553 -0.0862 -0.2717 410 GLY A CA    
1972 C  C     . GLY A 272 ? 0.6130 0.6885 0.8279 -0.0608 -0.0740 -0.2558 410 GLY A C     
1973 O  O     . GLY A 272 ? 0.5353 0.6083 0.7877 -0.0679 -0.0731 -0.2637 410 GLY A O     
1974 N  N     . SER A 273 ? 0.5778 0.6425 0.7757 -0.0578 -0.0645 -0.2335 411 SER A N     
1975 C  CA    . SER A 273 ? 0.4973 0.5475 0.7173 -0.0620 -0.0529 -0.2170 411 SER A CA    
1976 C  C     . SER A 273 ? 0.4802 0.5192 0.6747 -0.0571 -0.0439 -0.1974 411 SER A C     
1977 O  O     . SER A 273 ? 0.5332 0.5699 0.7057 -0.0527 -0.0435 -0.2011 411 SER A O     
1978 C  CB    . SER A 273 ? 0.4616 0.5194 0.6985 -0.0653 -0.0545 -0.2087 411 SER A CB    
1979 O  OG    . SER A 273 ? 0.4674 0.5125 0.7276 -0.0696 -0.0429 -0.1939 411 SER A OG    
1980 N  N     . TRP A 274 ? 0.4514 0.4845 0.6491 -0.0576 -0.0367 -0.1772 412 TRP A N     
1981 C  CA    . TRP A 274 ? 0.4071 0.4305 0.5831 -0.0532 -0.0288 -0.1591 412 TRP A CA    
1982 C  C     . TRP A 274 ? 0.3789 0.4019 0.5577 -0.0537 -0.0243 -0.1404 412 TRP A C     
1983 O  O     . TRP A 274 ? 0.3576 0.3864 0.5580 -0.0578 -0.0256 -0.1413 412 TRP A O     
1984 C  CB    . TRP A 274 ? 0.4308 0.4386 0.6183 -0.0541 -0.0199 -0.1579 412 TRP A CB    
1985 C  CG    . TRP A 274 ? 0.4653 0.4645 0.6907 -0.0603 -0.0140 -0.1571 412 TRP A CG    
1986 C  CD1   . TRP A 274 ? 0.4472 0.4453 0.7020 -0.0655 -0.0161 -0.1743 412 TRP A CD1   
1987 C  CD2   . TRP A 274 ? 0.4185 0.4091 0.6569 -0.0620 -0.0046 -0.1377 412 TRP A CD2   
1988 N  NE1   . TRP A 274 ? 0.3951 0.3833 0.6818 -0.0707 -0.0081 -0.1658 412 TRP A NE1   
1989 C  CE2   . TRP A 274 ? 0.3849 0.3689 0.6610 -0.0684 -0.0007 -0.1428 412 TRP A CE2   
1990 C  CE3   . TRP A 274 ? 0.4208 0.4091 0.6427 -0.0586 0.0010  -0.1170 412 TRP A CE3   
1991 C  CZ2   . TRP A 274 ? 0.3963 0.3715 0.6924 -0.0712 0.0092  -0.1262 412 TRP A CZ2   
1992 C  CZ3   . TRP A 274 ? 0.3321 0.3128 0.5726 -0.0610 0.0101  -0.1018 412 TRP A CZ3   
1993 C  CH2   . TRP A 274 ? 0.3404 0.3146 0.6170 -0.0672 0.0145  -0.1056 412 TRP A CH2   
1994 N  N     . LYS A 275 ? 0.3385 0.3554 0.4962 -0.0495 -0.0187 -0.1241 413 LYS A N     
1995 C  CA    . LYS A 275 ? 0.3379 0.3538 0.4970 -0.0493 -0.0134 -0.1067 413 LYS A CA    
1996 C  C     . LYS A 275 ? 0.3114 0.3156 0.4599 -0.0465 -0.0046 -0.0917 413 LYS A C     
1997 O  O     . LYS A 275 ? 0.3296 0.3294 0.4611 -0.0432 -0.0043 -0.0931 413 LYS A O     
1998 C  CB    . LYS A 275 ? 0.3616 0.3890 0.5009 -0.0458 -0.0199 -0.1031 413 LYS A CB    
1999 C  CG    . LYS A 275 ? 0.4388 0.4662 0.5443 -0.0399 -0.0225 -0.0998 413 LYS A CG    
2000 C  CD    . LYS A 275 ? 0.4563 0.4920 0.5453 -0.0363 -0.0272 -0.0926 413 LYS A CD    
2001 C  CE    . LYS A 275 ? 0.5369 0.5724 0.5945 -0.0310 -0.0298 -0.0898 413 LYS A CE    
2002 N  NZ    . LYS A 275 ? 0.5624 0.6031 0.6050 -0.0271 -0.0332 -0.0810 413 LYS A NZ    
2003 N  N     . ALA A 276 ? 0.3057 0.3061 0.4644 -0.0476 0.0026  -0.0775 414 ALA A N     
2004 C  CA    . ALA A 276 ? 0.3013 0.2926 0.4496 -0.0443 0.0101  -0.0623 414 ALA A CA    
2005 C  C     . ALA A 276 ? 0.2936 0.2893 0.4121 -0.0393 0.0076  -0.0548 414 ALA A C     
2006 O  O     . ALA A 276 ? 0.2896 0.2940 0.4016 -0.0386 0.0035  -0.0542 414 ALA A O     
2007 C  CB    . ALA A 276 ? 0.3004 0.2875 0.4680 -0.0466 0.0187  -0.0494 414 ALA A CB    
2008 N  N     . VAL A 277 ? 0.2921 0.2818 0.3943 -0.0357 0.0100  -0.0495 415 VAL A N     
2009 C  CA    A VAL A 277 ? 0.3010 0.2934 0.3770 -0.0313 0.0082  -0.0427 415 VAL A CA    
2010 C  CA    B VAL A 277 ? 0.3001 0.2925 0.3762 -0.0313 0.0082  -0.0426 415 VAL A CA    
2011 C  C     . VAL A 277 ? 0.2830 0.2681 0.3535 -0.0286 0.0145  -0.0305 415 VAL A C     
2012 O  O     . VAL A 277 ? 0.2870 0.2651 0.3646 -0.0285 0.0179  -0.0313 415 VAL A O     
2013 C  CB    A VAL A 277 ? 0.3139 0.3097 0.3715 -0.0294 0.0021  -0.0524 415 VAL A CB    
2014 C  CB    B VAL A 277 ? 0.3183 0.3145 0.3759 -0.0294 0.0020  -0.0522 415 VAL A CB    
2015 C  CG1   A VAL A 277 ? 0.3098 0.3072 0.3432 -0.0255 0.0010  -0.0443 415 VAL A CG1   
2016 C  CG1   B VAL A 277 ? 0.3336 0.3395 0.3916 -0.0306 -0.0057 -0.0617 415 VAL A CG1   
2017 C  CG2   A VAL A 277 ? 0.3436 0.3481 0.4053 -0.0313 -0.0053 -0.0648 415 VAL A CG2   
2018 C  CG2   B VAL A 277 ? 0.3252 0.3161 0.3872 -0.0298 0.0034  -0.0607 415 VAL A CG2   
2019 N  N     . ARG A 278 ? 0.2770 0.2642 0.3357 -0.0261 0.0158  -0.0199 416 ARG A N     
2020 C  CA    . ARG A 278 ? 0.2748 0.2575 0.3256 -0.0229 0.0203  -0.0091 416 ARG A CA    
2021 C  C     . ARG A 278 ? 0.3088 0.2906 0.3419 -0.0203 0.0177  -0.0119 416 ARG A C     
2022 O  O     . ARG A 278 ? 0.2726 0.2588 0.2910 -0.0196 0.0131  -0.0154 416 ARG A O     
2023 C  CB    . ARG A 278 ? 0.2704 0.2569 0.3140 -0.0209 0.0220  0.0011  416 ARG A CB    
2024 C  CG    . ARG A 278 ? 0.2883 0.2745 0.3486 -0.0223 0.0281  0.0087  416 ARG A CG    
2025 C  CD    . ARG A 278 ? 0.2959 0.2762 0.3585 -0.0199 0.0341  0.0196  416 ARG A CD    
2026 N  NE    . ARG A 278 ? 0.3139 0.2966 0.3569 -0.0153 0.0336  0.0265  416 ARG A NE    
2027 C  CZ    . ARG A 278 ? 0.3105 0.2907 0.3423 -0.0126 0.0316  0.0263  416 ARG A CZ    
2028 N  NH1   . ARG A 278 ? 0.3430 0.3183 0.3803 -0.0136 0.0306  0.0201  416 ARG A NH1   
2029 N  NH2   . ARG A 278 ? 0.3125 0.2959 0.3285 -0.0090 0.0306  0.0316  416 ARG A NH2   
2030 N  N     . VAL A 279 ? 0.2973 0.2736 0.3332 -0.0189 0.0209  -0.0098 417 VAL A N     
2031 C  CA    . VAL A 279 ? 0.2752 0.2513 0.2976 -0.0166 0.0198  -0.0118 417 VAL A CA    
2032 C  C     . VAL A 279 ? 0.2736 0.2470 0.2946 -0.0134 0.0233  -0.0014 417 VAL A C     
2033 O  O     . VAL A 279 ? 0.2904 0.2594 0.3251 -0.0127 0.0272  0.0040  417 VAL A O     
2034 C  CB    . VAL A 279 ? 0.2921 0.2660 0.3205 -0.0176 0.0196  -0.0230 417 VAL A CB    
2035 C  CG1   . VAL A 279 ? 0.3265 0.3020 0.3405 -0.0153 0.0193  -0.0248 417 VAL A CG1   
2036 C  CG2   . VAL A 279 ? 0.3404 0.3182 0.3714 -0.0205 0.0154  -0.0342 417 VAL A CG2   
2037 N  N     . ASP A 280 ? 0.2864 0.2629 0.2920 -0.0113 0.0216  0.0016  418 ASP A N     
2038 C  CA    . ASP A 280 ? 0.3111 0.2871 0.3141 -0.0079 0.0234  0.0096  418 ASP A CA    
2039 C  C     . ASP A 280 ? 0.3122 0.2883 0.3128 -0.0069 0.0234  0.0048  418 ASP A C     
2040 O  O     . ASP A 280 ? 0.3162 0.2951 0.3062 -0.0081 0.0213  -0.0007 418 ASP A O     
2041 C  CB    . ASP A 280 ? 0.3266 0.3071 0.3163 -0.0064 0.0214  0.0155  418 ASP A CB    
2042 C  CG    . ASP A 280 ? 0.3293 0.3110 0.3221 -0.0062 0.0229  0.0215  418 ASP A CG    
2043 O  OD1   . ASP A 280 ? 0.3314 0.3101 0.3377 -0.0068 0.0264  0.0246  418 ASP A OD1   
2044 O  OD2   . ASP A 280 ? 0.3070 0.2926 0.2898 -0.0056 0.0210  0.0233  418 ASP A OD2   
2045 N  N     . LEU A 281 ? 0.3095 0.2827 0.3203 -0.0044 0.0261  0.0076  419 LEU A N     
2046 C  CA    . LEU A 281 ? 0.2821 0.2561 0.2932 -0.0028 0.0269  0.0037  419 LEU A CA    
2047 C  C     . LEU A 281 ? 0.2717 0.2487 0.2808 0.0011  0.0265  0.0122  419 LEU A C     
2048 O  O     . LEU A 281 ? 0.3290 0.3042 0.3445 0.0039  0.0276  0.0207  419 LEU A O     
2049 C  CB    . LEU A 281 ? 0.2801 0.2488 0.3073 -0.0023 0.0299  -0.0020 419 LEU A CB    
2050 C  CG    . LEU A 281 ? 0.3517 0.3180 0.3841 -0.0059 0.0297  -0.0123 419 LEU A CG    
2051 C  CD1   . LEU A 281 ? 0.4484 0.4088 0.4987 -0.0049 0.0328  -0.0184 419 LEU A CD1   
2052 C  CD2   . LEU A 281 ? 0.3699 0.3416 0.3873 -0.0080 0.0272  -0.0210 419 LEU A CD2   
2053 N  N     . VAL A 282 ? 0.2688 0.2508 0.2698 0.0013  0.0252  0.0101  420 VAL A N     
2054 C  CA    . VAL A 282 ? 0.2669 0.2539 0.2656 0.0045  0.0236  0.0164  420 VAL A CA    
2055 C  C     . VAL A 282 ? 0.2673 0.2578 0.2702 0.0054  0.0247  0.0118  420 VAL A C     
2056 O  O     . VAL A 282 ? 0.3033 0.2947 0.3023 0.0026  0.0261  0.0045  420 VAL A O     
2057 C  CB    . VAL A 282 ? 0.2737 0.2647 0.2586 0.0031  0.0202  0.0185  420 VAL A CB    
2058 C  CG1   . VAL A 282 ? 0.3083 0.3053 0.2920 0.0066  0.0176  0.0239  420 VAL A CG1   
2059 C  CG2   . VAL A 282 ? 0.3508 0.3391 0.3318 0.0019  0.0198  0.0212  420 VAL A CG2   
2060 N  N     . VAL A 283 ? 0.2875 0.2809 0.2983 0.0097  0.0243  0.0165  421 VAL A N     
2061 C  CA    . VAL A 283 ? 0.2897 0.2882 0.3072 0.0112  0.0255  0.0126  421 VAL A CA    
2062 C  C     . VAL A 283 ? 0.2830 0.2900 0.2967 0.0126  0.0216  0.0165  421 VAL A C     
2063 O  O     . VAL A 283 ? 0.3123 0.3211 0.3235 0.0155  0.0182  0.0236  421 VAL A O     
2064 C  CB    . VAL A 283 ? 0.3281 0.3236 0.3623 0.0158  0.0281  0.0134  421 VAL A CB    
2065 C  CG1   . VAL A 283 ? 0.3847 0.3872 0.4273 0.0180  0.0293  0.0094  421 VAL A CG1   
2066 C  CG2   . VAL A 283 ? 0.3158 0.3028 0.3556 0.0139  0.0317  0.0073  421 VAL A CG2   
2067 N  N     . ALA A 284 ? 0.2637 0.2767 0.2775 0.0105  0.0224  0.0115  422 ALA A N     
2068 C  CA    . ALA A 284 ? 0.2615 0.2834 0.2758 0.0113  0.0187  0.0133  422 ALA A CA    
2069 C  C     . ALA A 284 ? 0.2750 0.3035 0.3003 0.0114  0.0217  0.0085  422 ALA A C     
2070 O  O     . ALA A 284 ? 0.3179 0.3445 0.3431 0.0086  0.0269  0.0027  422 ALA A O     
2071 C  CB    . ALA A 284 ? 0.2661 0.2888 0.2679 0.0067  0.0163  0.0125  422 ALA A CB    
2072 N  N     . PRO A 285 ? 0.2799 0.3175 0.3149 0.0148  0.0186  0.0103  423 PRO A N     
2073 C  CA    . PRO A 285 ? 0.3309 0.3768 0.3773 0.0141  0.0217  0.0053  423 PRO A CA    
2074 C  C     . PRO A 285 ? 0.2979 0.3461 0.3371 0.0073  0.0235  0.0016  423 PRO A C     
2075 O  O     . PRO A 285 ? 0.2681 0.3138 0.2963 0.0042  0.0201  0.0034  423 PRO A O     
2076 C  CB    . PRO A 285 ? 0.3554 0.4115 0.4131 0.0194  0.0160  0.0087  423 PRO A CB    
2077 C  CG    . PRO A 285 ? 0.3532 0.4081 0.3998 0.0207  0.0093  0.0144  423 PRO A CG    
2078 C  CD    . PRO A 285 ? 0.3100 0.3522 0.3452 0.0195  0.0119  0.0167  423 PRO A CD    
2079 N  N     . VAL A 286 ? 0.2602 0.3133 0.3066 0.0051  0.0294  -0.0032 424 VAL A N     
2080 C  CA    . VAL A 286 ? 0.3126 0.3665 0.3520 -0.0016 0.0329  -0.0053 424 VAL A CA    
2081 C  C     . VAL A 286 ? 0.3409 0.4006 0.3828 -0.0042 0.0277  -0.0037 424 VAL A C     
2082 O  O     . VAL A 286 ? 0.3078 0.3638 0.3408 -0.0094 0.0279  -0.0032 424 VAL A O     
2083 C  CB    . VAL A 286 ? 0.3605 0.4200 0.4074 -0.0030 0.0414  -0.0100 424 VAL A CB    
2084 C  CG1   . VAL A 286 ? 0.3837 0.4559 0.4506 -0.0008 0.0415  -0.0115 424 VAL A CG1   
2085 C  CG2   . VAL A 286 ? 0.4261 0.4840 0.4623 -0.0095 0.0462  -0.0103 424 VAL A CG2   
2086 N  N     . SER A 287 ? 0.3426 0.4114 0.3972 -0.0005 0.0225  -0.0032 425 SER A N     
2087 C  CA    . SER A 287 ? 0.3574 0.4327 0.4151 -0.0027 0.0163  -0.0035 425 SER A CA    
2088 C  C     . SER A 287 ? 0.4162 0.4835 0.4580 -0.0035 0.0110  -0.0011 425 SER A C     
2089 O  O     . SER A 287 ? 0.3646 0.4330 0.4050 -0.0076 0.0081  -0.0028 425 SER A O     
2090 C  CB    . SER A 287 ? 0.3582 0.4455 0.4305 0.0030  0.0100  -0.0035 425 SER A CB    
2091 O  OG    . SER A 287 ? 0.3214 0.4051 0.3877 0.0098  0.0054  0.0012  425 SER A OG    
2092 N  N     . GLN A 288 ? 0.3011 0.3606 0.3326 0.0004  0.0100  0.0025  426 GLN A N     
2093 C  CA    . GLN A 288 ? 0.3009 0.3538 0.3180 0.0002  0.0059  0.0049  426 GLN A CA    
2094 C  C     . GLN A 288 ? 0.2729 0.3148 0.2777 -0.0039 0.0104  0.0049  426 GLN A C     
2095 O  O     . GLN A 288 ? 0.2568 0.2935 0.2508 -0.0046 0.0076  0.0063  426 GLN A O     
2096 C  CB    . GLN A 288 ? 0.3504 0.4024 0.3643 0.0069  0.0023  0.0099  426 GLN A CB    
2097 C  CG    . GLN A 288 ? 0.3280 0.3914 0.3511 0.0124  -0.0038 0.0113  426 GLN A CG    
2098 C  CD    . GLN A 288 ? 0.3820 0.4436 0.4020 0.0196  -0.0059 0.0185  426 GLN A CD    
2099 O  OE1   . GLN A 288 ? 0.4229 0.4747 0.4345 0.0196  -0.0029 0.0219  426 GLN A OE1   
2100 N  NE2   . GLN A 288 ? 0.4163 0.4880 0.4443 0.0257  -0.0110 0.0211  426 GLN A NE2   
2101 N  N     . PHE A 289 ? 0.2552 0.2948 0.2615 -0.0063 0.0170  0.0031  427 PHE A N     
2102 C  CA    . PHE A 289 ? 0.2567 0.2871 0.2506 -0.0090 0.0206  0.0031  427 PHE A CA    
2103 C  C     . PHE A 289 ? 0.2572 0.2835 0.2420 -0.0131 0.0187  0.0039  427 PHE A C     
2104 O  O     . PHE A 289 ? 0.2625 0.2816 0.2365 -0.0128 0.0173  0.0054  427 PHE A O     
2105 C  CB    . PHE A 289 ? 0.2991 0.3306 0.2956 -0.0107 0.0280  0.0002  427 PHE A CB    
2106 C  CG    . PHE A 289 ? 0.3115 0.3357 0.2949 -0.0130 0.0311  -0.0004 427 PHE A CG    
2107 C  CD1   . PHE A 289 ? 0.3680 0.3870 0.3470 -0.0105 0.0311  -0.0016 427 PHE A CD1   
2108 C  CD2   . PHE A 289 ? 0.2735 0.2962 0.2495 -0.0174 0.0337  0.0005  427 PHE A CD2   
2109 C  CE1   . PHE A 289 ? 0.4267 0.4408 0.3941 -0.0122 0.0328  -0.0031 427 PHE A CE1   
2110 C  CE2   . PHE A 289 ? 0.3510 0.3682 0.3139 -0.0186 0.0356  0.0006  427 PHE A CE2   
2111 C  CZ    . PHE A 289 ? 0.3860 0.3996 0.3443 -0.0159 0.0347  -0.0018 427 PHE A CZ    
2112 N  N     . PRO A 290 ? 0.2933 0.3233 0.2835 -0.0167 0.0186  0.0029  428 PRO A N     
2113 C  CA    . PRO A 290 ? 0.3259 0.3499 0.3088 -0.0203 0.0169  0.0037  428 PRO A CA    
2114 C  C     . PRO A 290 ? 0.2671 0.2885 0.2436 -0.0175 0.0104  0.0041  428 PRO A C     
2115 O  O     . PRO A 290 ? 0.2611 0.2752 0.2279 -0.0184 0.0097  0.0052  428 PRO A O     
2116 C  CB    . PRO A 290 ? 0.3282 0.3580 0.3233 -0.0245 0.0175  0.0018  428 PRO A CB    
2117 C  CG    . PRO A 290 ? 0.3287 0.3665 0.3347 -0.0243 0.0225  0.0007  428 PRO A CG    
2118 C  CD    . PRO A 290 ? 0.3196 0.3590 0.3246 -0.0182 0.0207  0.0007  428 PRO A CD    
2119 N  N     . PHE A 291 ? 0.3058 0.3338 0.2872 -0.0137 0.0057  0.0033  429 PHE A N     
2120 C  CA    . PHE A 291 ? 0.3209 0.3482 0.2951 -0.0104 0.0002  0.0039  429 PHE A CA    
2121 C  C     . PHE A 291 ? 0.3025 0.3238 0.2674 -0.0075 0.0017  0.0075  429 PHE A C     
2122 O  O     . PHE A 291 ? 0.3004 0.3180 0.2569 -0.0065 -0.0003 0.0083  429 PHE A O     
2123 C  CB    . PHE A 291 ? 0.2724 0.3100 0.2529 -0.0063 -0.0052 0.0029  429 PHE A CB    
2124 C  CG    . PHE A 291 ? 0.2585 0.3036 0.2506 -0.0093 -0.0078 -0.0020 429 PHE A CG    
2125 C  CD1   . PHE A 291 ? 0.2785 0.3240 0.2699 -0.0114 -0.0123 -0.0064 429 PHE A CD1   
2126 C  CD2   . PHE A 291 ? 0.3202 0.3724 0.3257 -0.0102 -0.0056 -0.0029 429 PHE A CD2   
2127 C  CE1   . PHE A 291 ? 0.3171 0.3695 0.3217 -0.0148 -0.0150 -0.0119 429 PHE A CE1   
2128 C  CE2   . PHE A 291 ? 0.3366 0.3967 0.3553 -0.0135 -0.0078 -0.0077 429 PHE A CE2   
2129 C  CZ    . PHE A 291 ? 0.2960 0.3561 0.3147 -0.0161 -0.0127 -0.0123 429 PHE A CZ    
2130 N  N     . ALA A 292 ? 0.2987 0.3196 0.2669 -0.0061 0.0054  0.0091  430 ALA A N     
2131 C  CA    . ALA A 292 ? 0.2951 0.3104 0.2578 -0.0039 0.0069  0.0119  430 ALA A CA    
2132 C  C     . ALA A 292 ? 0.2860 0.2941 0.2410 -0.0073 0.0093  0.0107  430 ALA A C     
2133 O  O     . ALA A 292 ? 0.3009 0.3049 0.2496 -0.0066 0.0085  0.0121  430 ALA A O     
2134 C  CB    . ALA A 292 ? 0.3107 0.3271 0.2816 -0.0013 0.0098  0.0129  430 ALA A CB    
2135 N  N     . LEU A 293 ? 0.2563 0.2638 0.2118 -0.0108 0.0125  0.0087  431 LEU A N     
2136 C  CA    . LEU A 293 ? 0.2589 0.2606 0.2057 -0.0136 0.0140  0.0085  431 LEU A CA    
2137 C  C     . LEU A 293 ? 0.2812 0.2795 0.2222 -0.0141 0.0103  0.0095  431 LEU A C     
2138 O  O     . LEU A 293 ? 0.2599 0.2538 0.1941 -0.0135 0.0093  0.0103  431 LEU A O     
2139 C  CB    . LEU A 293 ? 0.2628 0.2656 0.2105 -0.0170 0.0184  0.0076  431 LEU A CB    
2140 C  CG    . LEU A 293 ? 0.3134 0.3111 0.2506 -0.0190 0.0202  0.0087  431 LEU A CG    
2141 C  CD1   . LEU A 293 ? 0.3429 0.3386 0.2744 -0.0171 0.0203  0.0070  431 LEU A CD1   
2142 C  CD2   . LEU A 293 ? 0.3220 0.3218 0.2598 -0.0221 0.0257  0.0092  431 LEU A CD2   
2143 N  N     . LEU A 294 ? 0.3030 0.3039 0.2482 -0.0150 0.0079  0.0087  432 LEU A N     
2144 C  CA    . LEU A 294 ? 0.3194 0.3169 0.2606 -0.0152 0.0044  0.0082  432 LEU A CA    
2145 C  C     . LEU A 294 ? 0.2888 0.2864 0.2251 -0.0113 0.0018  0.0088  432 LEU A C     
2146 O  O     . LEU A 294 ? 0.2605 0.2535 0.1909 -0.0108 0.0010  0.0092  432 LEU A O     
2147 C  CB    . LEU A 294 ? 0.3524 0.3539 0.3012 -0.0167 0.0018  0.0053  432 LEU A CB    
2148 C  CG    . LEU A 294 ? 0.3433 0.3414 0.2908 -0.0171 -0.0019 0.0027  432 LEU A CG    
2149 C  CD1   . LEU A 294 ? 0.3479 0.3369 0.2921 -0.0201 0.0005  0.0048  432 LEU A CD1   
2150 C  CD2   . LEU A 294 ? 0.2845 0.2885 0.2421 -0.0188 -0.0050 -0.0020 432 LEU A CD2   
2151 N  N     . GLY A 295 ? 0.2590 0.2622 0.1981 -0.0081 0.0008  0.0096  433 GLY A N     
2152 C  CA    . GLY A 295 ? 0.2827 0.2870 0.2174 -0.0043 -0.0006 0.0115  433 GLY A CA    
2153 C  C     . GLY A 295 ? 0.3217 0.3214 0.2537 -0.0042 0.0021  0.0136  433 GLY A C     
2154 O  O     . GLY A 295 ? 0.3063 0.3045 0.2340 -0.0030 0.0015  0.0142  433 GLY A O     
2155 N  N     . TRP A 296 ? 0.2850 0.2831 0.2205 -0.0055 0.0051  0.0139  434 TRP A N     
2156 C  CA    . TRP A 296 ? 0.2887 0.2834 0.2236 -0.0056 0.0069  0.0144  434 TRP A CA    
2157 C  C     . TRP A 296 ? 0.2754 0.2661 0.2046 -0.0079 0.0065  0.0126  434 TRP A C     
2158 O  O     . TRP A 296 ? 0.3093 0.2984 0.2382 -0.0079 0.0069  0.0120  434 TRP A O     
2159 C  CB    . TRP A 296 ? 0.2546 0.2494 0.1963 -0.0056 0.0099  0.0139  434 TRP A CB    
2160 C  CG    . TRP A 296 ? 0.2547 0.2518 0.2023 -0.0022 0.0103  0.0177  434 TRP A CG    
2161 C  CD1   . TRP A 296 ? 0.2950 0.2968 0.2463 0.0001  0.0093  0.0196  434 TRP A CD1   
2162 C  CD2   . TRP A 296 ? 0.3031 0.2986 0.2544 -0.0006 0.0119  0.0209  434 TRP A CD2   
2163 N  NE1   . TRP A 296 ? 0.3581 0.3609 0.3135 0.0038  0.0099  0.0247  434 TRP A NE1   
2164 C  CE2   . TRP A 296 ? 0.3529 0.3512 0.3088 0.0031  0.0121  0.0260  434 TRP A CE2   
2165 C  CE3   . TRP A 296 ? 0.2973 0.2896 0.2497 -0.0020 0.0130  0.0203  434 TRP A CE3   
2166 C  CZ2   . TRP A 296 ? 0.3588 0.3558 0.3197 0.0054  0.0144  0.0316  434 TRP A CZ2   
2167 C  CZ3   . TRP A 296 ? 0.3111 0.3025 0.2704 -0.0004 0.0154  0.0247  434 TRP A CZ3   
2168 C  CH2   . TRP A 296 ? 0.3413 0.3345 0.3045 0.0032  0.0165  0.0309  434 TRP A CH2   
2169 N  N     . THR A 297 ? 0.2581 0.2473 0.1839 -0.0097 0.0056  0.0118  435 THR A N     
2170 C  CA    . THR A 297 ? 0.2809 0.2660 0.2008 -0.0110 0.0049  0.0117  435 THR A CA    
2171 C  C     . THR A 297 ? 0.2739 0.2573 0.1915 -0.0093 0.0020  0.0121  435 THR A C     
2172 O  O     . THR A 297 ? 0.2809 0.2617 0.1949 -0.0089 0.0007  0.0124  435 THR A O     
2173 C  CB    . THR A 297 ? 0.2916 0.2750 0.2098 -0.0137 0.0065  0.0122  435 THR A CB    
2174 O  OG1   . THR A 297 ? 0.3063 0.2922 0.2262 -0.0148 0.0099  0.0111  435 THR A OG1   
2175 C  CG2   . THR A 297 ? 0.3173 0.2960 0.2283 -0.0143 0.0057  0.0140  435 THR A CG2   
2176 N  N     . GLY A 298 ? 0.3135 0.2993 0.2329 -0.0076 0.0007  0.0117  436 GLY A N     
2177 C  CA    . GLY A 298 ? 0.3275 0.3129 0.2449 -0.0053 -0.0014 0.0110  436 GLY A CA    
2178 C  C     . GLY A 298 ? 0.3529 0.3328 0.2686 -0.0062 -0.0032 0.0100  436 GLY A C     
2179 O  O     . GLY A 298 ? 0.2689 0.2458 0.1855 -0.0088 -0.0028 0.0102  436 GLY A O     
2180 N  N     . SER A 299 ? 0.3395 0.3180 0.2539 -0.0038 -0.0047 0.0094  437 SER A N     
2181 C  CA    . SER A 299 ? 0.2816 0.2645 0.1964 -0.0009 -0.0043 0.0093  437 SER A CA    
2182 C  C     . SER A 299 ? 0.2753 0.2640 0.1902 0.0012  -0.0037 0.0083  437 SER A C     
2183 O  O     . SER A 299 ? 0.2695 0.2591 0.1841 0.0009  -0.0050 0.0063  437 SER A O     
2184 C  CB    . SER A 299 ? 0.3400 0.3207 0.2547 0.0015  -0.0060 0.0082  437 SER A CB    
2185 O  OG    . SER A 299 ? 0.2725 0.2515 0.1874 0.0030  -0.0075 0.0048  437 SER A OG    
2186 N  N     . LYS A 300 ? 0.2834 0.2769 0.1988 0.0036  -0.0018 0.0098  438 LYS A N     
2187 C  CA    . LYS A 300 ? 0.3017 0.3017 0.2150 0.0066  -0.0008 0.0101  438 LYS A CA    
2188 C  C     . LYS A 300 ? 0.3194 0.3201 0.2293 0.0086  -0.0035 0.0049  438 LYS A C     
2189 O  O     . LYS A 300 ? 0.2818 0.2865 0.1895 0.0096  -0.0051 0.0030  438 LYS A O     
2190 C  CB    . LYS A 300 ? 0.3576 0.3622 0.2724 0.0088  0.0026  0.0132  438 LYS A CB    
2191 C  CG    . LYS A 300 ? 0.4362 0.4483 0.3464 0.0128  0.0044  0.0144  438 LYS A CG    
2192 C  CD    . LYS A 300 ? 0.4599 0.4770 0.3730 0.0145  0.0094  0.0191  438 LYS A CD    
2193 C  CE    . LYS A 300 ? 0.5509 0.5764 0.4572 0.0190  0.0119  0.0216  438 LYS A CE    
2194 N  NZ    . LYS A 300 ? 0.6079 0.6385 0.5174 0.0204  0.0182  0.0274  438 LYS A NZ    
2195 N  N     . LEU A 301 ? 0.2721 0.2698 0.1826 0.0098  -0.0044 0.0018  439 LEU A N     
2196 C  CA    . LEU A 301 ? 0.3127 0.3102 0.2218 0.0118  -0.0069 -0.0046 439 LEU A CA    
2197 C  C     . LEU A 301 ? 0.2927 0.2852 0.2041 0.0085  -0.0099 -0.0074 439 LEU A C     
2198 O  O     . LEU A 301 ? 0.2843 0.2797 0.1952 0.0094  -0.0124 -0.0129 439 LEU A O     
2199 C  CB    . LEU A 301 ? 0.3546 0.3484 0.2662 0.0138  -0.0072 -0.0071 439 LEU A CB    
2200 C  CG    . LEU A 301 ? 0.3641 0.3563 0.2762 0.0163  -0.0096 -0.0151 439 LEU A CG    
2201 C  CD1   . LEU A 301 ? 0.3752 0.3776 0.2814 0.0202  -0.0087 -0.0192 439 LEU A CD1   
2202 C  CD2   . LEU A 301 ? 0.3374 0.3247 0.2539 0.0187  -0.0098 -0.0168 439 LEU A CD2   
2203 N  N     . PHE A 302 ? 0.2772 0.2629 0.1916 0.0047  -0.0098 -0.0040 440 PHE A N     
2204 C  CA    . PHE A 302 ? 0.2980 0.2793 0.2161 0.0010  -0.0113 -0.0056 440 PHE A CA    
2205 C  C     . PHE A 302 ? 0.3080 0.2966 0.2265 0.0004  -0.0121 -0.0069 440 PHE A C     
2206 O  O     . PHE A 302 ? 0.2816 0.2710 0.2039 -0.0007 -0.0148 -0.0121 440 PHE A O     
2207 C  CB    . PHE A 302 ? 0.3072 0.2820 0.2265 -0.0026 -0.0097 -0.0004 440 PHE A CB    
2208 C  CG    . PHE A 302 ? 0.3243 0.2941 0.2487 -0.0067 -0.0099 -0.0008 440 PHE A CG    
2209 C  CD1   . PHE A 302 ? 0.3166 0.2906 0.2440 -0.0094 -0.0092 -0.0010 440 PHE A CD1   
2210 C  CD2   . PHE A 302 ? 0.2905 0.2512 0.2180 -0.0077 -0.0105 -0.0005 440 PHE A CD2   
2211 C  CE1   . PHE A 302 ? 0.3196 0.2899 0.2538 -0.0137 -0.0087 -0.0014 440 PHE A CE1   
2212 C  CE2   . PHE A 302 ? 0.3379 0.2935 0.2717 -0.0120 -0.0097 0.0001  440 PHE A CE2   
2213 C  CZ    . PHE A 302 ? 0.2905 0.2513 0.2279 -0.0153 -0.0086 -0.0005 440 PHE A CZ    
2214 N  N     . GLN A 303 ? 0.2766 0.2707 0.1927 0.0014  -0.0101 -0.0025 441 GLN A N     
2215 C  CA    . GLN A 303 ? 0.2723 0.2735 0.1893 0.0017  -0.0112 -0.0026 441 GLN A CA    
2216 C  C     . GLN A 303 ? 0.2777 0.2869 0.1907 0.0059  -0.0142 -0.0072 441 GLN A C     
2217 O  O     . GLN A 303 ? 0.2887 0.3030 0.2040 0.0058  -0.0177 -0.0114 441 GLN A O     
2218 C  CB    . GLN A 303 ? 0.3311 0.3349 0.2478 0.0023  -0.0082 0.0037  441 GLN A CB    
2219 C  CG    . GLN A 303 ? 0.3584 0.3564 0.2786 -0.0015 -0.0057 0.0063  441 GLN A CG    
2220 C  CD    . GLN A 303 ? 0.4075 0.4038 0.3327 -0.0052 -0.0065 0.0041  441 GLN A CD    
2221 O  OE1   . GLN A 303 ? 0.3906 0.3926 0.3198 -0.0051 -0.0083 0.0023  441 GLN A OE1   
2222 N  NE2   . GLN A 303 ? 0.4267 0.4160 0.3524 -0.0084 -0.0052 0.0047  441 GLN A NE2   
2223 N  N     . ARG A 304 ? 0.3329 0.3445 0.2399 0.0098  -0.0129 -0.0069 442 ARG A N     
2224 C  CA    . ARG A 304 ? 0.3825 0.4024 0.2835 0.0143  -0.0152 -0.0121 442 ARG A CA    
2225 C  C     . ARG A 304 ? 0.3455 0.3631 0.2502 0.0131  -0.0197 -0.0220 442 ARG A C     
2226 O  O     . ARG A 304 ? 0.3417 0.3669 0.2449 0.0149  -0.0238 -0.0282 442 ARG A O     
2227 C  CB    . ARG A 304 ? 0.3771 0.3993 0.2723 0.0183  -0.0117 -0.0105 442 ARG A CB    
2228 C  CG    . ARG A 304 ? 0.4149 0.4394 0.3089 0.0192  -0.0068 -0.0010 442 ARG A CG    
2229 C  CD    . ARG A 304 ? 0.3940 0.4212 0.2851 0.0224  -0.0027 0.0001  442 ARG A CD    
2230 N  NE    . ARG A 304 ? 0.3826 0.4202 0.2644 0.0278  -0.0024 -0.0020 442 ARG A NE    
2231 C  CZ    . ARG A 304 ? 0.4296 0.4736 0.3072 0.0315  0.0027  0.0013  442 ARG A CZ    
2232 N  NH1   . ARG A 304 ? 0.4503 0.4911 0.3343 0.0299  0.0075  0.0064  442 ARG A NH1   
2233 N  NH2   . ARG A 304 ? 0.4280 0.4825 0.2951 0.0369  0.0031  -0.0006 442 ARG A NH2   
2234 N  N     . GLU A 305 ? 0.3231 0.3305 0.2333 0.0103  -0.0191 -0.0239 443 GLU A N     
2235 C  CA    . GLU A 305 ? 0.3875 0.3905 0.3038 0.0088  -0.0227 -0.0330 443 GLU A CA    
2236 C  C     . GLU A 305 ? 0.3500 0.3531 0.2744 0.0041  -0.0254 -0.0348 443 GLU A C     
2237 O  O     . GLU A 305 ? 0.3314 0.3379 0.2603 0.0038  -0.0298 -0.0439 443 GLU A O     
2238 C  CB    . GLU A 305 ? 0.4270 0.4179 0.3481 0.0073  -0.0210 -0.0321 443 GLU A CB    
2239 C  CG    . GLU A 305 ? 0.4385 0.4306 0.3545 0.0123  -0.0191 -0.0328 443 GLU A CG    
2240 C  CD    . GLU A 305 ? 0.4504 0.4450 0.3664 0.0159  -0.0217 -0.0440 443 GLU A CD    
2241 O  OE1   . GLU A 305 ? 0.4100 0.3955 0.3346 0.0144  -0.0236 -0.0495 443 GLU A OE1   
2242 O  OE2   . GLU A 305 ? 0.4301 0.4359 0.3379 0.0205  -0.0216 -0.0472 443 GLU A OE2   
2243 N  N     . LEU A 306 ? 0.3265 0.3269 0.2537 0.0006  -0.0228 -0.0271 444 LEU A N     
2244 C  CA    . LEU A 306 ? 0.3348 0.3366 0.2711 -0.0038 -0.0242 -0.0283 444 LEU A CA    
2245 C  C     . LEU A 306 ? 0.3056 0.3206 0.2408 -0.0012 -0.0285 -0.0323 444 LEU A C     
2246 O  O     . LEU A 306 ? 0.2969 0.3156 0.2406 -0.0034 -0.0327 -0.0395 444 LEU A O     
2247 C  CB    . LEU A 306 ? 0.3532 0.3512 0.2910 -0.0071 -0.0197 -0.0194 444 LEU A CB    
2248 C  CG    . LEU A 306 ? 0.3466 0.3457 0.2949 -0.0120 -0.0194 -0.0196 444 LEU A CG    
2249 C  CD1   . LEU A 306 ? 0.3535 0.3441 0.3115 -0.0167 -0.0196 -0.0232 444 LEU A CD1   
2250 C  CD2   . LEU A 306 ? 0.3664 0.3638 0.3136 -0.0137 -0.0145 -0.0116 444 LEU A CD2   
2251 N  N     . ARG A 307 ? 0.3097 0.3322 0.2352 0.0038  -0.0277 -0.0276 445 ARG A N     
2252 C  CA    . ARG A 307 ? 0.3035 0.3391 0.2261 0.0076  -0.0321 -0.0298 445 ARG A CA    
2253 C  C     . ARG A 307 ? 0.3310 0.3730 0.2497 0.0108  -0.0374 -0.0406 445 ARG A C     
2254 O  O     . ARG A 307 ? 0.3101 0.3618 0.2320 0.0116  -0.0434 -0.0473 445 ARG A O     
2255 C  CB    . ARG A 307 ? 0.2969 0.3374 0.2102 0.0123  -0.0291 -0.0204 445 ARG A CB    
2256 C  CG    . ARG A 307 ? 0.3135 0.3489 0.2323 0.0094  -0.0247 -0.0120 445 ARG A CG    
2257 C  CD    . ARG A 307 ? 0.3024 0.3394 0.2149 0.0132  -0.0208 -0.0028 445 ARG A CD    
2258 N  NE    . ARG A 307 ? 0.3094 0.3406 0.2287 0.0100  -0.0169 0.0028  445 ARG A NE    
2259 C  CZ    . ARG A 307 ? 0.3481 0.3797 0.2672 0.0121  -0.0136 0.0104  445 ARG A CZ    
2260 N  NH1   . ARG A 307 ? 0.4151 0.4523 0.3274 0.0173  -0.0132 0.0152  445 ARG A NH1   
2261 N  NH2   . ARG A 307 ? 0.3274 0.3538 0.2535 0.0091  -0.0104 0.0131  445 ARG A NH2   
2262 N  N     . ARG A 308 ? 0.3295 0.3673 0.2419 0.0131  -0.0356 -0.0432 446 ARG A N     
2263 C  CA    . ARG A 308 ? 0.3196 0.3629 0.2287 0.0163  -0.0402 -0.0552 446 ARG A CA    
2264 C  C     . ARG A 308 ? 0.3234 0.3625 0.2468 0.0112  -0.0448 -0.0658 446 ARG A C     
2265 O  O     . ARG A 308 ? 0.3804 0.4290 0.3056 0.0125  -0.0513 -0.0765 446 ARG A O     
2266 C  CB    . ARG A 308 ? 0.3315 0.3699 0.2340 0.0194  -0.0363 -0.0559 446 ARG A CB    
2267 C  CG    . ARG A 308 ? 0.3845 0.4299 0.2817 0.0240  -0.0401 -0.0689 446 ARG A CG    
2268 C  CD    . ARG A 308 ? 0.3942 0.4385 0.2832 0.0286  -0.0352 -0.0683 446 ARG A CD    
2269 N  NE    . ARG A 308 ? 0.3993 0.4288 0.2974 0.0254  -0.0318 -0.0669 446 ARG A NE    
2270 C  CZ    . ARG A 308 ? 0.4914 0.5134 0.3974 0.0249  -0.0336 -0.0770 446 ARG A CZ    
2271 N  NH1   . ARG A 308 ? 0.4730 0.5005 0.3796 0.0269  -0.0387 -0.0910 446 ARG A NH1   
2272 N  NH2   . ARG A 308 ? 0.3961 0.4049 0.3097 0.0228  -0.0306 -0.0733 446 ARG A NH2   
2273 N  N     . PHE A 309 ? 0.3570 0.3824 0.2914 0.0052  -0.0415 -0.0629 447 PHE A N     
2274 C  CA    . PHE A 309 ? 0.3519 0.3715 0.3023 -0.0006 -0.0444 -0.0709 447 PHE A CA    
2275 C  C     . PHE A 309 ? 0.3436 0.3736 0.3021 -0.0031 -0.0488 -0.0736 447 PHE A C     
2276 O  O     . PHE A 309 ? 0.3576 0.3931 0.3250 -0.0043 -0.0549 -0.0856 447 PHE A O     
2277 C  CB    . PHE A 309 ? 0.3646 0.3685 0.3233 -0.0061 -0.0389 -0.0633 447 PHE A CB    
2278 C  CG    . PHE A 309 ? 0.3395 0.3360 0.3161 -0.0128 -0.0401 -0.0687 447 PHE A CG    
2279 C  CD1   . PHE A 309 ? 0.3482 0.3472 0.3356 -0.0183 -0.0395 -0.0658 447 PHE A CD1   
2280 C  CD2   . PHE A 309 ? 0.3918 0.3786 0.3763 -0.0137 -0.0413 -0.0767 447 PHE A CD2   
2281 C  CE1   . PHE A 309 ? 0.3963 0.3886 0.4022 -0.0251 -0.0397 -0.0701 447 PHE A CE1   
2282 C  CE2   . PHE A 309 ? 0.4226 0.4014 0.4258 -0.0203 -0.0419 -0.0810 447 PHE A CE2   
2283 C  CZ    . PHE A 309 ? 0.4439 0.4257 0.4580 -0.0263 -0.0408 -0.0774 447 PHE A CZ    
2284 N  N     . SER A 310 ? 0.3131 0.3464 0.2700 -0.0036 -0.0460 -0.0632 448 SER A N     
2285 C  CA    . SER A 310 ? 0.3339 0.3777 0.2999 -0.0054 -0.0497 -0.0646 448 SER A CA    
2286 C  C     . SER A 310 ? 0.3675 0.4271 0.3293 -0.0003 -0.0581 -0.0746 448 SER A C     
2287 O  O     . SER A 310 ? 0.3509 0.4173 0.3255 -0.0030 -0.0642 -0.0845 448 SER A O     
2288 C  CB    . SER A 310 ? 0.3103 0.3561 0.2720 -0.0043 -0.0452 -0.0521 448 SER A CB    
2289 O  OG    . SER A 310 ? 0.3986 0.4543 0.3712 -0.0059 -0.0482 -0.0530 448 SER A OG    
2290 N  N     . ARG A 311 ? 0.3715 0.4379 0.3154 0.0073  -0.0586 -0.0720 449 ARG A N     
2291 C  CA    . ARG A 311 ? 0.4038 0.4871 0.3400 0.0135  -0.0665 -0.0798 449 ARG A CA    
2292 C  C     . ARG A 311 ? 0.4536 0.5382 0.3927 0.0133  -0.0720 -0.0964 449 ARG A C     
2293 O  O     . ARG A 311 ? 0.4501 0.5454 0.3972 0.0129  -0.0802 -0.1081 449 ARG A O     
2294 C  CB    . ARG A 311 ? 0.4107 0.5003 0.3264 0.0216  -0.0640 -0.0709 449 ARG A CB    
2295 C  CG    . ARG A 311 ? 0.4286 0.5367 0.3322 0.0294  -0.0716 -0.0771 449 ARG A CG    
2296 C  CD    . ARG A 311 ? 0.4525 0.5661 0.3364 0.0372  -0.0674 -0.0652 449 ARG A CD    
2297 N  NE    . ARG A 311 ? 0.4360 0.5517 0.3213 0.0383  -0.0655 -0.0513 449 ARG A NE    
2298 C  CZ    . ARG A 311 ? 0.5448 0.6751 0.4263 0.0438  -0.0714 -0.0487 449 ARG A CZ    
2299 N  NH1   . ARG A 311 ? 0.5893 0.7351 0.4639 0.0487  -0.0802 -0.0592 449 ARG A NH1   
2300 N  NH2   . ARG A 311 ? 0.5833 0.7132 0.4683 0.0449  -0.0688 -0.0358 449 ARG A NH2   
2301 N  N     . LYS A 312 ? 0.4049 0.4791 0.3389 0.0139  -0.0680 -0.0985 450 LYS A N     
2302 C  CA    . LYS A 312 ? 0.4474 0.5236 0.3815 0.0156  -0.0728 -0.1148 450 LYS A CA    
2303 C  C     . LYS A 312 ? 0.4334 0.5007 0.3902 0.0078  -0.0757 -0.1259 450 LYS A C     
2304 O  O     . LYS A 312 ? 0.4095 0.4835 0.3718 0.0083  -0.0830 -0.1423 450 LYS A O     
2305 C  CB    . LYS A 312 ? 0.4935 0.5619 0.4160 0.0195  -0.0670 -0.1132 450 LYS A CB    
2306 C  CG    . LYS A 312 ? 0.5679 0.6442 0.4699 0.0267  -0.0626 -0.1016 450 LYS A CG    
2307 C  CD    . LYS A 312 ? 0.6182 0.7146 0.5058 0.0341  -0.0688 -0.1069 450 LYS A CD    
2308 C  CE    . LYS A 312 ? 0.6425 0.7457 0.5107 0.0410  -0.0632 -0.0934 450 LYS A CE    
2309 N  NZ    . LYS A 312 ? 0.6721 0.7953 0.5239 0.0492  -0.0688 -0.0972 450 LYS A NZ    
2310 N  N     . GLU A 313 ? 0.4568 0.5097 0.4273 0.0005  -0.0702 -0.1175 451 GLU A N     
2311 C  CA    . GLU A 313 ? 0.4429 0.4855 0.4359 -0.0073 -0.0713 -0.1259 451 GLU A CA    
2312 C  C     . GLU A 313 ? 0.4103 0.4594 0.4205 -0.0134 -0.0743 -0.1265 451 GLU A C     
2313 O  O     . GLU A 313 ? 0.4018 0.4507 0.4311 -0.0186 -0.0788 -0.1389 451 GLU A O     
2314 C  CB    . GLU A 313 ? 0.4296 0.4518 0.4277 -0.0115 -0.0629 -0.1162 451 GLU A CB    
2315 C  CG    . GLU A 313 ? 0.4263 0.4415 0.4109 -0.0058 -0.0596 -0.1153 451 GLU A CG    
2316 C  CD    . GLU A 313 ? 0.4776 0.4942 0.4645 -0.0027 -0.0648 -0.1329 451 GLU A CD    
2317 O  OE1   . GLU A 313 ? 0.4837 0.4971 0.4890 -0.0076 -0.0690 -0.1446 451 GLU A OE1   
2318 O  OE2   . GLU A 313 ? 0.4664 0.4877 0.4374 0.0046  -0.0644 -0.1354 451 GLU A OE2   
2319 N  N     . LYS A 314 ? 0.3828 0.4380 0.3885 -0.0129 -0.0717 -0.1142 452 LYS A N     
2320 C  CA    . LYS A 314 ? 0.3940 0.4560 0.4169 -0.0183 -0.0733 -0.1136 452 LYS A CA    
2321 C  C     . LYS A 314 ? 0.3881 0.4708 0.4052 -0.0128 -0.0806 -0.1157 452 LYS A C     
2322 O  O     . LYS A 314 ? 0.4084 0.4998 0.4415 -0.0165 -0.0835 -0.1172 452 LYS A O     
2323 C  CB    . LYS A 314 ? 0.4661 0.5177 0.4920 -0.0227 -0.0638 -0.0978 452 LYS A CB    
2324 C  CG    . LYS A 314 ? 0.4647 0.4964 0.4952 -0.0276 -0.0566 -0.0933 452 LYS A CG    
2325 C  CD    . LYS A 314 ? 0.4799 0.5052 0.5338 -0.0352 -0.0582 -0.1032 452 LYS A CD    
2326 C  CE    . LYS A 314 ? 0.5264 0.5312 0.5839 -0.0388 -0.0512 -0.0975 452 LYS A CE    
2327 N  NZ    . LYS A 314 ? 0.6001 0.5968 0.6831 -0.0470 -0.0512 -0.1046 452 LYS A NZ    
2328 N  N     . GLY A 315 ? 0.3850 0.4767 0.3805 -0.0039 -0.0836 -0.1152 453 GLY A N     
2329 C  CA    . GLY A 315 ? 0.3771 0.4885 0.3658 0.0024  -0.0907 -0.1155 453 GLY A CA    
2330 C  C     . GLY A 315 ? 0.3895 0.5035 0.3795 0.0028  -0.0867 -0.1009 453 GLY A C     
2331 O  O     . GLY A 315 ? 0.3636 0.4935 0.3568 0.0060  -0.0931 -0.1016 453 GLY A O     
2332 N  N     . LEU A 316 ? 0.3561 0.4554 0.3440 0.0000  -0.0767 -0.0882 454 LEU A N     
2333 C  CA    . LEU A 316 ? 0.3166 0.4166 0.3054 0.0005  -0.0719 -0.0750 454 LEU A CA    
2334 C  C     . LEU A 316 ? 0.3433 0.4386 0.3119 0.0065  -0.0665 -0.0629 454 LEU A C     
2335 O  O     . LEU A 316 ? 0.3516 0.4373 0.3096 0.0071  -0.0627 -0.0622 454 LEU A O     
2336 C  CB    . LEU A 316 ? 0.3332 0.4210 0.3382 -0.0083 -0.0644 -0.0708 454 LEU A CB    
2337 C  CG    . LEU A 316 ? 0.4372 0.5270 0.4651 -0.0158 -0.0677 -0.0816 454 LEU A CG    
2338 C  CD1   . LEU A 316 ? 0.4360 0.5124 0.4765 -0.0240 -0.0584 -0.0751 454 LEU A CD1   
2339 C  CD2   . LEU A 316 ? 0.4026 0.5118 0.4425 -0.0141 -0.0758 -0.0873 454 LEU A CD2   
2340 N  N     . TRP A 317 ? 0.3151 0.4173 0.2807 0.0108  -0.0658 -0.0534 455 TRP A N     
2341 C  CA    . TRP A 317 ? 0.3143 0.4132 0.2635 0.0165  -0.0609 -0.0416 455 TRP A CA    
2342 C  C     . TRP A 317 ? 0.3426 0.4296 0.2972 0.0125  -0.0521 -0.0317 455 TRP A C     
2343 O  O     . TRP A 317 ? 0.3257 0.4162 0.2919 0.0113  -0.0515 -0.0287 455 TRP A O     
2344 C  CB    . TRP A 317 ? 0.3426 0.4567 0.2839 0.0251  -0.0662 -0.0372 455 TRP A CB    
2345 C  CG    . TRP A 317 ? 0.4068 0.5347 0.3407 0.0298  -0.0754 -0.0474 455 TRP A CG    
2346 C  CD1   . TRP A 317 ? 0.4347 0.5613 0.3663 0.0277  -0.0782 -0.0598 455 TRP A CD1   
2347 C  CD2   . TRP A 317 ? 0.4684 0.6142 0.3957 0.0379  -0.0835 -0.0469 455 TRP A CD2   
2348 N  NE1   . TRP A 317 ? 0.4681 0.6113 0.3917 0.0339  -0.0876 -0.0683 455 TRP A NE1   
2349 C  CE2   . TRP A 317 ? 0.4814 0.6372 0.4015 0.0404  -0.0912 -0.0601 455 TRP A CE2   
2350 C  CE3   . TRP A 317 ? 0.4950 0.6495 0.4221 0.0440  -0.0851 -0.0365 455 TRP A CE3   
2351 C  CZ2   . TRP A 317 ? 0.4785 0.6539 0.3892 0.0488  -0.1008 -0.0633 455 TRP A CZ2   
2352 C  CZ3   . TRP A 317 ? 0.5245 0.6977 0.4430 0.0525  -0.0946 -0.0382 455 TRP A CZ3   
2353 C  CH2   . TRP A 317 ? 0.4942 0.6783 0.4037 0.0548  -0.1025 -0.0515 455 TRP A CH2   
2354 N  N     . LEU A 318 ? 0.3273 0.4017 0.2741 0.0110  -0.0456 -0.0274 456 LEU A N     
2355 C  CA    . LEU A 318 ? 0.2894 0.3522 0.2399 0.0071  -0.0378 -0.0199 456 LEU A CA    
2356 C  C     . LEU A 318 ? 0.3158 0.3759 0.2557 0.0116  -0.0333 -0.0099 456 LEU A C     
2357 O  O     . LEU A 318 ? 0.3287 0.3889 0.2566 0.0155  -0.0332 -0.0086 456 LEU A O     
2358 C  CB    . LEU A 318 ? 0.2903 0.3404 0.2420 0.0013  -0.0342 -0.0230 456 LEU A CB    
2359 C  CG    . LEU A 318 ? 0.2760 0.3148 0.2286 -0.0023 -0.0267 -0.0159 456 LEU A CG    
2360 C  CD1   . LEU A 318 ? 0.3133 0.3538 0.2786 -0.0061 -0.0244 -0.0146 456 LEU A CD1   
2361 C  CD2   . LEU A 318 ? 0.3225 0.3499 0.2735 -0.0060 -0.0243 -0.0179 456 LEU A CD2   
2362 N  N     . ASN A 319 ? 0.2913 0.3487 0.2369 0.0109  -0.0291 -0.0033 457 ASN A N     
2363 C  CA    . ASN A 319 ? 0.3127 0.3643 0.2523 0.0133  -0.0237 0.0055  457 ASN A CA    
2364 C  C     . ASN A 319 ? 0.3326 0.3767 0.2807 0.0090  -0.0183 0.0078  457 ASN A C     
2365 O  O     . ASN A 319 ? 0.3223 0.3653 0.2786 0.0042  -0.0179 0.0034  457 ASN A O     
2366 C  CB    . ASN A 319 ? 0.3686 0.4287 0.3040 0.0206  -0.0257 0.0121  457 ASN A CB    
2367 C  CG    . ASN A 319 ? 0.3978 0.4654 0.3443 0.0224  -0.0284 0.0133  457 ASN A CG    
2368 O  OD1   . ASN A 319 ? 0.3958 0.4608 0.3537 0.0181  -0.0263 0.0108  457 ASN A OD1   
2369 N  ND2   . ASN A 319 ? 0.4539 0.5316 0.3969 0.0295  -0.0327 0.0175  457 ASN A ND2   
2370 N  N     . SER A 320 ? 0.3328 0.3721 0.2795 0.0106  -0.0137 0.0144  458 SER A N     
2371 C  CA    . SER A 320 ? 0.3210 0.3535 0.2742 0.0070  -0.0085 0.0152  458 SER A CA    
2372 C  C     . SER A 320 ? 0.3042 0.3420 0.2688 0.0082  -0.0083 0.0157  458 SER A C     
2373 O  O     . SER A 320 ? 0.3132 0.3467 0.2835 0.0058  -0.0036 0.0155  458 SER A O     
2374 C  CB    . SER A 320 ? 0.3766 0.4018 0.3259 0.0079  -0.0040 0.0202  458 SER A CB    
2375 O  OG    . SER A 320 ? 0.4331 0.4612 0.3846 0.0130  -0.0036 0.0265  458 SER A OG    
2376 N  N     . HIS A 321 ? 0.3092 0.3571 0.2773 0.0121  -0.0134 0.0157  459 HIS A N     
2377 C  CA    . HIS A 321 ? 0.3261 0.3812 0.3071 0.0137  -0.0143 0.0154  459 HIS A CA    
2378 C  C     . HIS A 321 ? 0.3627 0.4252 0.3525 0.0100  -0.0175 0.0082  459 HIS A C     
2379 O  O     . HIS A 321 ? 0.3681 0.4352 0.3708 0.0091  -0.0160 0.0067  459 HIS A O     
2380 C  CB    . HIS A 321 ? 0.4051 0.4682 0.3865 0.0216  -0.0185 0.0212  459 HIS A CB    
2381 C  CG    . HIS A 321 ? 0.4797 0.5358 0.4582 0.0253  -0.0143 0.0296  459 HIS A CG    
2382 N  ND1   . HIS A 321 ? 0.5600 0.6096 0.5271 0.0253  -0.0120 0.0332  459 HIS A ND1   
2383 C  CD2   . HIS A 321 ? 0.5425 0.5970 0.5301 0.0291  -0.0117 0.0350  459 HIS A CD2   
2384 C  CE1   . HIS A 321 ? 0.5450 0.5892 0.5148 0.0283  -0.0080 0.0406  459 HIS A CE1   
2385 N  NE2   . HIS A 321 ? 0.5295 0.5758 0.5116 0.0307  -0.0078 0.0418  459 HIS A NE2   
2386 N  N     . GLY A 322 ? 0.3181 0.3824 0.3029 0.0079  -0.0218 0.0033  460 GLY A N     
2387 C  CA    . GLY A 322 ? 0.3730 0.4445 0.3690 0.0041  -0.0251 -0.0040 460 GLY A CA    
2388 C  C     . GLY A 322 ? 0.4021 0.4748 0.3922 0.0029  -0.0306 -0.0101 460 GLY A C     
2389 O  O     . GLY A 322 ? 0.3613 0.4288 0.3378 0.0048  -0.0309 -0.0088 460 GLY A O     
2390 N  N     . LEU A 323 ? 0.3645 0.4448 0.3670 -0.0005 -0.0347 -0.0176 461 LEU A N     
2391 C  CA    . LEU A 323 ? 0.3668 0.4491 0.3681 -0.0023 -0.0406 -0.0260 461 LEU A CA    
2392 C  C     . LEU A 323 ? 0.3543 0.4531 0.3666 -0.0001 -0.0492 -0.0327 461 LEU A C     
2393 O  O     . LEU A 323 ? 0.3422 0.4472 0.3720 -0.0035 -0.0489 -0.0350 461 LEU A O     
2394 C  CB    . LEU A 323 ? 0.3494 0.4215 0.3578 -0.0107 -0.0362 -0.0297 461 LEU A CB    
2395 C  CG    . LEU A 323 ? 0.3046 0.3770 0.3162 -0.0134 -0.0417 -0.0397 461 LEU A CG    
2396 C  CD1   . LEU A 323 ? 0.2866 0.3548 0.2805 -0.0089 -0.0439 -0.0404 461 LEU A CD1   
2397 C  CD2   . LEU A 323 ? 0.2941 0.3560 0.3169 -0.0220 -0.0363 -0.0411 461 LEU A CD2   
2398 N  N     . PHE A 324 ? 0.3558 0.4629 0.3580 0.0057  -0.0569 -0.0362 462 PHE A N     
2399 C  CA    . PHE A 324 ? 0.3695 0.4947 0.3778 0.0105  -0.0666 -0.0412 462 PHE A CA    
2400 C  C     . PHE A 324 ? 0.3625 0.4937 0.3746 0.0079  -0.0743 -0.0549 462 PHE A C     
2401 O  O     . PHE A 324 ? 0.3269 0.4520 0.3264 0.0082  -0.0747 -0.0586 462 PHE A O     
2402 C  CB    . PHE A 324 ? 0.4205 0.5522 0.4121 0.0206  -0.0696 -0.0332 462 PHE A CB    
2403 C  CG    . PHE A 324 ? 0.4208 0.5721 0.4161 0.0273  -0.0801 -0.0362 462 PHE A CG    
2404 C  CD1   . PHE A 324 ? 0.4110 0.5710 0.4228 0.0286  -0.0815 -0.0336 462 PHE A CD1   
2405 C  CD2   . PHE A 324 ? 0.4566 0.6188 0.4383 0.0333  -0.0886 -0.0414 462 PHE A CD2   
2406 C  CE1   . PHE A 324 ? 0.3942 0.5734 0.4098 0.0356  -0.0919 -0.0359 462 PHE A CE1   
2407 C  CE2   . PHE A 324 ? 0.4530 0.6347 0.4366 0.0403  -0.0991 -0.0439 462 PHE A CE2   
2408 C  CZ    . PHE A 324 ? 0.4255 0.6157 0.4265 0.0415  -0.1012 -0.0409 462 PHE A CZ    
2409 N  N     . ASP A 325 ? 0.3561 0.4995 0.3876 0.0051  -0.0803 -0.0632 463 ASP A N     
2410 C  CA    . ASP A 325 ? 0.4465 0.5989 0.4843 0.0035  -0.0896 -0.0780 463 ASP A CA    
2411 C  C     . ASP A 325 ? 0.4892 0.6609 0.5176 0.0134  -0.1007 -0.0804 463 ASP A C     
2412 O  O     . ASP A 325 ? 0.4438 0.6291 0.4826 0.0167  -0.1050 -0.0783 463 ASP A O     
2413 C  CB    . ASP A 325 ? 0.4695 0.6259 0.5356 -0.0053 -0.0903 -0.0862 463 ASP A CB    
2414 C  CG    . ASP A 325 ? 0.4848 0.6495 0.5610 -0.0081 -0.1000 -0.1032 463 ASP A CG    
2415 O  OD1   . ASP A 325 ? 0.4929 0.6663 0.5542 -0.0014 -0.1086 -0.1096 463 ASP A OD1   
2416 O  OD2   . ASP A 325 ? 0.4970 0.6597 0.5965 -0.0172 -0.0986 -0.1105 463 ASP A OD2   
2417 N  N     . PRO A 326 ? 0.4934 0.6676 0.5018 0.0190  -0.1053 -0.0842 464 PRO A N     
2418 C  CA    . PRO A 326 ? 0.4731 0.6662 0.4686 0.0296  -0.1152 -0.0843 464 PRO A CA    
2419 C  C     . PRO A 326 ? 0.4820 0.6947 0.4909 0.0298  -0.1284 -0.1001 464 PRO A C     
2420 O  O     . PRO A 326 ? 0.4732 0.7043 0.4739 0.0389  -0.1378 -0.1000 464 PRO A O     
2421 C  CB    . PRO A 326 ? 0.5273 0.7155 0.4966 0.0347  -0.1136 -0.0833 464 PRO A CB    
2422 C  CG    . PRO A 326 ? 0.5385 0.7113 0.5136 0.0260  -0.1088 -0.0921 464 PRO A CG    
2423 C  CD    . PRO A 326 ? 0.4924 0.6527 0.4881 0.0168  -0.1010 -0.0875 464 PRO A CD    
2424 N  N     . GLU A 327 ? 0.5480 0.7575 0.5775 0.0202  -0.1295 -0.1135 465 GLU A N     
2425 C  CA    . GLU A 327 ? 0.6023 0.8307 0.6497 0.0190  -0.1420 -0.1297 465 GLU A CA    
2426 C  C     . GLU A 327 ? 0.6670 0.9068 0.7372 0.0179  -0.1438 -0.1259 465 GLU A C     
2427 O  O     . GLU A 327 ? 0.6876 0.9489 0.7606 0.0247  -0.1552 -0.1296 465 GLU A O     
2428 C  CB    . GLU A 327 ? 0.5859 0.8056 0.6501 0.0086  -0.1418 -0.1452 465 GLU A CB    
2429 C  CG    . GLU A 327 ? 0.6077 0.8181 0.6522 0.0103  -0.1414 -0.1519 465 GLU A CG    
2430 N  N     . GLN A 328 ? 0.5879 0.8143 0.6740 0.0100  -0.1326 -0.1184 466 GLN A N     
2431 C  CA    . GLN A 328 ? 0.6012 0.8374 0.7104 0.0085  -0.1322 -0.1147 466 GLN A CA    
2432 C  C     . GLN A 328 ? 0.5552 0.7923 0.6527 0.0172  -0.1284 -0.0980 466 GLN A C     
2433 O  O     . GLN A 328 ? 0.5247 0.7724 0.6401 0.0183  -0.1293 -0.0950 466 GLN A O     
2434 C  CB    . GLN A 328 ? 0.7142 0.9365 0.8458 -0.0040 -0.1210 -0.1145 466 GLN A CB    
2435 C  CG    . GLN A 328 ? 0.8426 1.0610 0.9894 -0.0136 -0.1231 -0.1296 466 GLN A CG    
2436 C  CD    . GLN A 328 ? 0.9298 1.1383 1.1024 -0.0255 -0.1126 -0.1284 466 GLN A CD    
2437 O  OE1   . GLN A 328 ? 0.9041 1.1058 1.0783 -0.0266 -0.1021 -0.1157 466 GLN A OE1   
2438 N  NE2   . GLN A 328 ? 0.9633 1.1711 1.1567 -0.0345 -0.1150 -0.1417 466 GLN A NE2   
2439 N  N     . LYS A 329 ? 0.5055 0.7320 0.5757 0.0233  -0.1240 -0.0873 467 LYS A N     
2440 C  CA    . LYS A 329 ? 0.5409 0.7658 0.6011 0.0312  -0.1196 -0.0710 467 LYS A CA    
2441 C  C     . LYS A 329 ? 0.4955 0.7102 0.5730 0.0252  -0.1084 -0.0639 467 LYS A C     
2442 O  O     . LYS A 329 ? 0.5057 0.7286 0.5941 0.0295  -0.1086 -0.0578 467 LYS A O     
2443 C  CB    . LYS A 329 ? 0.6125 0.8597 0.6725 0.0421  -0.1315 -0.0697 467 LYS A CB    
2444 C  CG    . LYS A 329 ? 0.6642 0.9198 0.6973 0.0519  -0.1399 -0.0694 467 LYS A CG    
2445 C  CD    . LYS A 329 ? 0.6827 0.9508 0.7172 0.0498  -0.1510 -0.0880 467 LYS A CD    
2446 C  CE    . LYS A 329 ? 0.6741 0.9557 0.6818 0.0614  -0.1606 -0.0882 467 LYS A CE    
2447 N  N     . THR A 330 ? 0.5052 0.7023 0.5847 0.0157  -0.0984 -0.0647 468 THR A N     
2448 C  CA    . THR A 330 ? 0.4339 0.6214 0.5274 0.0096  -0.0870 -0.0589 468 THR A CA    
2449 C  C     . THR A 330 ? 0.3464 0.5119 0.4236 0.0063  -0.0759 -0.0514 468 THR A C     
2450 O  O     . THR A 330 ? 0.4004 0.5573 0.4638 0.0047  -0.0763 -0.0545 468 THR A O     
2451 C  CB    . THR A 330 ? 0.4017 0.5932 0.5218 -0.0005 -0.0860 -0.0689 468 THR A CB    
2452 O  OG1   . THR A 330 ? 0.4474 0.6287 0.5641 -0.0074 -0.0855 -0.0765 468 THR A OG1   
2453 C  CG2   . THR A 330 ? 0.4293 0.6443 0.5688 0.0021  -0.0978 -0.0780 468 THR A CG2   
2454 N  N     . PHE A 331 ? 0.3462 0.5037 0.4260 0.0057  -0.0663 -0.0424 469 PHE A N     
2455 C  CA    . PHE A 331 ? 0.3596 0.4978 0.4267 0.0022  -0.0558 -0.0358 469 PHE A CA    
2456 C  C     . PHE A 331 ? 0.3488 0.4800 0.4301 -0.0078 -0.0478 -0.0386 469 PHE A C     
2457 O  O     . PHE A 331 ? 0.3456 0.4856 0.4471 -0.0107 -0.0461 -0.0409 469 PHE A O     
2458 C  CB    . PHE A 331 ? 0.3663 0.4995 0.4261 0.0079  -0.0502 -0.0248 469 PHE A CB    
2459 C  CG    . PHE A 331 ? 0.4568 0.5924 0.5000 0.0173  -0.0554 -0.0189 469 PHE A CG    
2460 C  CD1   . PHE A 331 ? 0.4925 0.6434 0.5403 0.0253  -0.0634 -0.0175 469 PHE A CD1   
2461 C  CD2   . PHE A 331 ? 0.5242 0.6474 0.5476 0.0184  -0.0520 -0.0139 469 PHE A CD2   
2462 C  CE1   . PHE A 331 ? 0.5086 0.6617 0.5401 0.0343  -0.0675 -0.0102 469 PHE A CE1   
2463 C  CE2   . PHE A 331 ? 0.5195 0.6452 0.5281 0.0268  -0.0555 -0.0073 469 PHE A CE2   
2464 C  CZ    . PHE A 331 ? 0.5222 0.6626 0.5341 0.0347  -0.0630 -0.0049 469 PHE A CZ    
2465 N  N     A PHE A 332 ? 0.3317 0.4478 0.4029 -0.0128 -0.0427 -0.0381 470 PHE A N     
2466 N  N     B PHE A 332 ? 0.3325 0.4484 0.4035 -0.0128 -0.0425 -0.0378 470 PHE A N     
2467 C  CA    A PHE A 332 ? 0.3316 0.4391 0.4127 -0.0217 -0.0339 -0.0380 470 PHE A CA    
2468 C  CA    B PHE A 332 ? 0.3328 0.4402 0.4138 -0.0218 -0.0339 -0.0381 470 PHE A CA    
2469 C  C     A PHE A 332 ? 0.3512 0.4530 0.4298 -0.0212 -0.0241 -0.0296 470 PHE A C     
2470 C  C     B PHE A 332 ? 0.3532 0.4542 0.4314 -0.0216 -0.0238 -0.0297 470 PHE A C     
2471 O  O     A PHE A 332 ? 0.3616 0.4569 0.4245 -0.0161 -0.0223 -0.0235 470 PHE A O     
2472 O  O     B PHE A 332 ? 0.3680 0.4611 0.4296 -0.0172 -0.0215 -0.0235 470 PHE A O     
2473 C  CB    A PHE A 332 ? 0.3518 0.4447 0.4221 -0.0259 -0.0322 -0.0392 470 PHE A CB    
2474 C  CB    B PHE A 332 ? 0.3529 0.4463 0.4236 -0.0259 -0.0328 -0.0398 470 PHE A CB    
2475 C  CG    A PHE A 332 ? 0.3613 0.4587 0.4367 -0.0274 -0.0410 -0.0495 470 PHE A CG    
2476 C  CG    B PHE A 332 ? 0.3432 0.4251 0.4194 -0.0339 -0.0231 -0.0366 470 PHE A CG    
2477 C  CD1   A PHE A 332 ? 0.3392 0.4436 0.4028 -0.0203 -0.0501 -0.0532 470 PHE A CD1   
2478 C  CD1   B PHE A 332 ? 0.3534 0.4399 0.4513 -0.0411 -0.0204 -0.0403 470 PHE A CD1   
2479 C  CD2   A PHE A 332 ? 0.3759 0.4705 0.4680 -0.0358 -0.0397 -0.0555 470 PHE A CD2   
2480 C  CD2   B PHE A 332 ? 0.3351 0.4023 0.3949 -0.0340 -0.0166 -0.0296 470 PHE A CD2   
2481 C  CE1   A PHE A 332 ? 0.3601 0.4696 0.4276 -0.0212 -0.0585 -0.0644 470 PHE A CE1   
2482 C  CE1   B PHE A 332 ? 0.3727 0.4488 0.4744 -0.0481 -0.0106 -0.0357 470 PHE A CE1   
2483 C  CE2   A PHE A 332 ? 0.4049 0.5033 0.5034 -0.0372 -0.0481 -0.0667 470 PHE A CE2   
2484 C  CE2   B PHE A 332 ? 0.3374 0.3948 0.4001 -0.0405 -0.0080 -0.0257 470 PHE A CE2   
2485 C  CZ    A PHE A 332 ? 0.3978 0.5041 0.4835 -0.0298 -0.0578 -0.0720 470 PHE A CZ    
2486 C  CZ    B PHE A 332 ? 0.3722 0.4337 0.4552 -0.0474 -0.0046 -0.0281 470 PHE A CZ    
2487 N  N     . GLN A 333 ? 0.3482 0.4532 0.4433 -0.0266 -0.0175 -0.0300 471 GLN A N     
2488 C  CA    . GLN A 333 ? 0.3894 0.4894 0.4822 -0.0268 -0.0073 -0.0237 471 GLN A CA    
2489 C  C     . GLN A 333 ? 0.3800 0.4650 0.4627 -0.0327 0.0003  -0.0204 471 GLN A C     
2490 O  O     . GLN A 333 ? 0.4735 0.5558 0.5640 -0.0394 0.0014  -0.0228 471 GLN A O     
2491 C  CB    . GLN A 333 ? 0.4577 0.5703 0.5727 -0.0288 -0.0031 -0.0256 471 GLN A CB    
2492 C  CG    . GLN A 333 ? 0.5170 0.6450 0.6427 -0.0215 -0.0106 -0.0278 471 GLN A CG    
2493 C  CD    . GLN A 333 ? 0.4948 0.6188 0.6066 -0.0130 -0.0109 -0.0220 471 GLN A CD    
2494 N  N     . ALA A 334 ? 0.3098 0.3850 0.3758 -0.0301 0.0050  -0.0148 472 ALA A N     
2495 C  CA    . ALA A 334 ? 0.2903 0.3521 0.3448 -0.0344 0.0115  -0.0109 472 ALA A CA    
2496 C  C     . ALA A 334 ? 0.3016 0.3620 0.3521 -0.0338 0.0206  -0.0069 472 ALA A C     
2497 O  O     . ALA A 334 ? 0.3557 0.4183 0.4026 -0.0282 0.0202  -0.0063 472 ALA A O     
2498 C  CB    . ALA A 334 ? 0.3671 0.4183 0.4031 -0.0316 0.0071  -0.0094 472 ALA A CB    
2499 N  N     . ALA A 335 ? 0.2697 0.3265 0.3214 -0.0394 0.0288  -0.0043 473 ALA A N     
2500 C  CA    . ALA A 335 ? 0.3287 0.3835 0.3725 -0.0389 0.0377  -0.0010 473 ALA A CA    
2501 C  C     . ALA A 335 ? 0.3253 0.3671 0.3485 -0.0390 0.0393  0.0033  473 ALA A C     
2502 O  O     . ALA A 335 ? 0.2791 0.3193 0.2929 -0.0378 0.0455  0.0051  473 ALA A O     
2503 C  CB    . ALA A 335 ? 0.3376 0.3988 0.3945 -0.0444 0.0471  0.0000  473 ALA A CB    
2504 N  N     . SER A 336 ? 0.3564 0.3900 0.3730 -0.0398 0.0337  0.0042  474 SER A N     
2505 C  CA    . SER A 336 ? 0.3234 0.3455 0.3226 -0.0397 0.0346  0.0084  474 SER A CA    
2506 C  C     . SER A 336 ? 0.3126 0.3282 0.3073 -0.0384 0.0265  0.0072  474 SER A C     
2507 O  O     . SER A 336 ? 0.2759 0.2954 0.2808 -0.0389 0.0210  0.0031  474 SER A O     
2508 C  CB    . SER A 336 ? 0.2903 0.3079 0.2885 -0.0450 0.0422  0.0137  474 SER A CB    
2509 O  OG    . SER A 336 ? 0.2931 0.3098 0.3052 -0.0499 0.0408  0.0133  474 SER A OG    
2510 N  N     . GLU A 337 ? 0.2798 0.2865 0.2592 -0.0365 0.0257  0.0101  475 GLU A N     
2511 C  CA    . GLU A 337 ? 0.2886 0.2885 0.2636 -0.0356 0.0195  0.0093  475 GLU A CA    
2512 C  C     . GLU A 337 ? 0.3327 0.3286 0.3174 -0.0405 0.0197  0.0093  475 GLU A C     
2513 O  O     . GLU A 337 ? 0.2856 0.2807 0.2754 -0.0403 0.0137  0.0049  475 GLU A O     
2514 C  CB    . GLU A 337 ? 0.3135 0.3053 0.2727 -0.0331 0.0195  0.0129  475 GLU A CB    
2515 C  CG    . GLU A 337 ? 0.2858 0.2804 0.2376 -0.0285 0.0182  0.0117  475 GLU A CG    
2516 C  CD    . GLU A 337 ? 0.2974 0.2853 0.2361 -0.0263 0.0172  0.0141  475 GLU A CD    
2517 O  OE1   . GLU A 337 ? 0.2866 0.2697 0.2187 -0.0279 0.0200  0.0179  475 GLU A OE1   
2518 O  OE2   . GLU A 337 ? 0.2782 0.2663 0.2136 -0.0229 0.0135  0.0126  475 GLU A OE2   
2519 N  N     . GLU A 338 ? 0.3045 0.2977 0.2919 -0.0449 0.0267  0.0143  476 GLU A N     
2520 C  CA    . GLU A 338 ? 0.3016 0.2898 0.3008 -0.0503 0.0280  0.0153  476 GLU A CA    
2521 C  C     . GLU A 338 ? 0.3117 0.3082 0.3295 -0.0526 0.0238  0.0076  476 GLU A C     
2522 O  O     . GLU A 338 ? 0.3421 0.3345 0.3689 -0.0549 0.0197  0.0037  476 GLU A O     
2523 C  CB    . GLU A 338 ? 0.3515 0.3380 0.3522 -0.0548 0.0379  0.0230  476 GLU A CB    
2524 C  CG    . GLU A 338 ? 0.3378 0.3146 0.3207 -0.0530 0.0411  0.0314  476 GLU A CG    
2525 C  CD    . GLU A 338 ? 0.4211 0.3953 0.4056 -0.0576 0.0508  0.0404  476 GLU A CD    
2526 O  OE1   . GLU A 338 ? 0.4166 0.3940 0.3883 -0.0560 0.0567  0.0451  476 GLU A OE1   
2527 O  OE2   . GLU A 338 ? 0.3505 0.3197 0.3495 -0.0628 0.0530  0.0428  476 GLU A OE2   
2528 N  N     . ASP A 339 ? 0.2918 0.3005 0.3166 -0.0517 0.0245  0.0046  477 ASP A N     
2529 C  CA    . ASP A 339 ? 0.2885 0.3076 0.3308 -0.0528 0.0193  -0.0031 477 ASP A CA    
2530 C  C     . ASP A 339 ? 0.2857 0.3043 0.3238 -0.0488 0.0092  -0.0094 477 ASP A C     
2531 O  O     . ASP A 339 ? 0.2883 0.3100 0.3391 -0.0511 0.0039  -0.0163 477 ASP A O     
2532 C  CB    . ASP A 339 ? 0.3069 0.3391 0.3545 -0.0501 0.0204  -0.0046 477 ASP A CB    
2533 C  CG    . ASP A 339 ? 0.3324 0.3722 0.3974 -0.0555 0.0279  -0.0038 477 ASP A CG    
2534 O  OD1   . ASP A 339 ? 0.3162 0.3518 0.3913 -0.0620 0.0322  -0.0019 477 ASP A OD1   
2535 O  OD2   . ASP A 339 ? 0.3256 0.3759 0.3953 -0.0529 0.0300  -0.0048 477 ASP A OD2   
2536 N  N     . ILE A 340 ? 0.2814 0.2971 0.3021 -0.0429 0.0067  -0.0077 478 ILE A N     
2537 C  CA    . ILE A 340 ? 0.2850 0.3023 0.3001 -0.0382 -0.0018 -0.0130 478 ILE A CA    
2538 C  C     . ILE A 340 ? 0.3000 0.3075 0.3149 -0.0402 -0.0043 -0.0157 478 ILE A C     
2539 O  O     . ILE A 340 ? 0.3277 0.3388 0.3489 -0.0399 -0.0109 -0.0237 478 ILE A O     
2540 C  CB    . ILE A 340 ? 0.2817 0.2980 0.2800 -0.0319 -0.0023 -0.0093 478 ILE A CB    
2541 C  CG1   . ILE A 340 ? 0.2917 0.3166 0.2926 -0.0296 0.0002  -0.0073 478 ILE A CG1   
2542 C  CG2   . ILE A 340 ? 0.2811 0.2997 0.2728 -0.0270 -0.0097 -0.0137 478 ILE A CG2   
2543 C  CD1   . ILE A 340 ? 0.2651 0.2871 0.2525 -0.0248 0.0017  -0.0029 478 ILE A CD1   
2544 N  N     . PHE A 341 ? 0.2900 0.2854 0.2979 -0.0419 0.0004  -0.0096 479 PHE A N     
2545 C  CA    . PHE A 341 ? 0.3125 0.2974 0.3228 -0.0437 -0.0013 -0.0116 479 PHE A CA    
2546 C  C     . PHE A 341 ? 0.3608 0.3470 0.3918 -0.0498 -0.0023 -0.0173 479 PHE A C     
2547 O  O     . PHE A 341 ? 0.3086 0.2928 0.3459 -0.0499 -0.0079 -0.0254 479 PHE A O     
2548 C  CB    . PHE A 341 ? 0.3030 0.2754 0.3045 -0.0446 0.0045  -0.0023 479 PHE A CB    
2549 C  CG    . PHE A 341 ? 0.2992 0.2685 0.2830 -0.0387 0.0030  0.0005  479 PHE A CG    
2550 C  CD1   . PHE A 341 ? 0.2931 0.2669 0.2663 -0.0360 0.0056  0.0047  479 PHE A CD1   
2551 C  CD2   . PHE A 341 ? 0.3025 0.2645 0.2820 -0.0358 -0.0010 -0.0019 479 PHE A CD2   
2552 C  CE1   . PHE A 341 ? 0.3071 0.2784 0.2666 -0.0312 0.0041  0.0067  479 PHE A CE1   
2553 C  CE2   . PHE A 341 ? 0.2990 0.2594 0.2644 -0.0306 -0.0021 0.0005  479 PHE A CE2   
2554 C  CZ    . PHE A 341 ? 0.2927 0.2579 0.2486 -0.0286 0.0003  0.0048  479 PHE A CZ    
2555 N  N     . ARG A 342 ? 0.3049 0.2952 0.3478 -0.0549 0.0034  -0.0142 480 ARG A N     
2556 C  CA    . ARG A 342 ? 0.3484 0.3409 0.4144 -0.0615 0.0031  -0.0197 480 ARG A CA    
2557 C  C     . ARG A 342 ? 0.3296 0.3348 0.4044 -0.0597 -0.0064 -0.0321 480 ARG A C     
2558 O  O     . ARG A 342 ? 0.3230 0.3268 0.4110 -0.0626 -0.0113 -0.0409 480 ARG A O     
2559 C  CB    . ARG A 342 ? 0.3520 0.3492 0.4292 -0.0669 0.0118  -0.0136 480 ARG A CB    
2560 C  CG    . ARG A 342 ? 0.3627 0.3470 0.4358 -0.0705 0.0214  -0.0019 480 ARG A CG    
2561 C  CD    . ARG A 342 ? 0.4149 0.4050 0.5030 -0.0769 0.0308  0.0030  480 ARG A CD    
2562 N  NE    . ARG A 342 ? 0.3582 0.3599 0.4387 -0.0737 0.0343  0.0051  480 ARG A NE    
2563 C  CZ    . ARG A 342 ? 0.3466 0.3458 0.4111 -0.0717 0.0416  0.0139  480 ARG A CZ    
2564 N  NH1   . ARG A 342 ? 0.3490 0.3354 0.4018 -0.0722 0.0459  0.0227  480 ARG A NH1   
2565 N  NH2   . ARG A 342 ? 0.3708 0.3809 0.4311 -0.0687 0.0443  0.0136  480 ARG A NH2   
2566 N  N     A HIS A 343 ? 0.3489 0.3667 0.4169 -0.0546 -0.0093 -0.0330 481 HIS A N     
2567 N  N     B HIS A 343 ? 0.3499 0.3676 0.4176 -0.0545 -0.0095 -0.0331 481 HIS A N     
2568 C  CA    A HIS A 343 ? 0.3723 0.4037 0.4457 -0.0515 -0.0189 -0.0433 481 HIS A CA    
2569 C  CA    B HIS A 343 ? 0.3722 0.4036 0.4472 -0.0520 -0.0189 -0.0438 481 HIS A CA    
2570 C  C     A HIS A 343 ? 0.4030 0.4302 0.4688 -0.0482 -0.0262 -0.0511 481 HIS A C     
2571 C  C     B HIS A 343 ? 0.4008 0.4291 0.4652 -0.0474 -0.0266 -0.0510 481 HIS A C     
2572 O  O     A HIS A 343 ? 0.3729 0.4080 0.4490 -0.0485 -0.0339 -0.0624 481 HIS A O     
2573 O  O     B HIS A 343 ? 0.3733 0.4117 0.4444 -0.0460 -0.0350 -0.0617 481 HIS A O     
2574 C  CB    A HIS A 343 ? 0.3865 0.4288 0.4491 -0.0447 -0.0203 -0.0402 481 HIS A CB    
2575 C  CB    B HIS A 343 ? 0.3913 0.4359 0.4607 -0.0465 -0.0202 -0.0415 481 HIS A CB    
2576 C  CG    A HIS A 343 ? 0.3871 0.4375 0.4609 -0.0470 -0.0149 -0.0361 481 HIS A CG    
2577 C  CG    B HIS A 343 ? 0.3975 0.4588 0.4798 -0.0451 -0.0287 -0.0508 481 HIS A CG    
2578 N  ND1   A HIS A 343 ? 0.3935 0.4483 0.4896 -0.0542 -0.0119 -0.0387 481 HIS A ND1   
2579 N  ND1   B HIS A 343 ? 0.4217 0.4921 0.4931 -0.0375 -0.0373 -0.0550 481 HIS A ND1   
2580 C  CD2   A HIS A 343 ? 0.3567 0.4120 0.4239 -0.0430 -0.0114 -0.0302 481 HIS A CD2   
2581 C  CD2   B HIS A 343 ? 0.3921 0.4638 0.4978 -0.0501 -0.0301 -0.0566 481 HIS A CD2   
2582 C  CE1   A HIS A 343 ? 0.3924 0.4553 0.4943 -0.0541 -0.0066 -0.0345 481 HIS A CE1   
2583 C  CE1   B HIS A 343 ? 0.3918 0.4777 0.4780 -0.0373 -0.0444 -0.0630 481 HIS A CE1   
2584 N  NE2   A HIS A 343 ? 0.3860 0.4489 0.4705 -0.0472 -0.0064 -0.0297 481 HIS A NE2   
2585 N  NE2   B HIS A 343 ? 0.4032 0.4905 0.5114 -0.0451 -0.0405 -0.0647 481 HIS A NE2   
2586 N  N     . LEU A 344 ? 0.3858 0.4016 0.4341 -0.0448 -0.0240 -0.0459 482 LEU A N     
2587 C  CA    . LEU A 344 ? 0.3595 0.3718 0.3987 -0.0405 -0.0298 -0.0526 482 LEU A CA    
2588 C  C     . LEU A 344 ? 0.3903 0.3894 0.4398 -0.0451 -0.0292 -0.0567 482 LEU A C     
2589 O  O     . LEU A 344 ? 0.4183 0.4132 0.4614 -0.0415 -0.0333 -0.0628 482 LEU A O     
2590 C  CB    . LEU A 344 ? 0.3209 0.3289 0.3381 -0.0341 -0.0278 -0.0452 482 LEU A CB    
2591 C  CG    . LEU A 344 ? 0.2937 0.3129 0.3000 -0.0286 -0.0286 -0.0411 482 LEU A CG    
2592 C  CD1   . LEU A 344 ? 0.3354 0.3486 0.3240 -0.0240 -0.0254 -0.0336 482 LEU A CD1   
2593 C  CD2   . LEU A 344 ? 0.3125 0.3455 0.3181 -0.0241 -0.0371 -0.0499 482 LEU A CD2   
2594 N  N     . GLY A 345 ? 0.3428 0.3351 0.4087 -0.0526 -0.0238 -0.0532 483 GLY A N     
2595 C  CA    . GLY A 345 ? 0.3480 0.3257 0.4251 -0.0569 -0.0225 -0.0555 483 GLY A CA    
2596 C  C     . GLY A 345 ? 0.3647 0.3273 0.4273 -0.0536 -0.0189 -0.0475 483 GLY A C     
2597 O  O     . GLY A 345 ? 0.3805 0.3316 0.4493 -0.0542 -0.0202 -0.0516 483 GLY A O     
2598 N  N     . LEU A 346 ? 0.3268 0.2893 0.3717 -0.0500 -0.0147 -0.0368 484 LEU A N     
2599 C  CA    . LEU A 346 ? 0.3481 0.2986 0.3793 -0.0465 -0.0118 -0.0288 484 LEU A CA    
2600 C  C     . LEU A 346 ? 0.3777 0.3197 0.4094 -0.0504 -0.0034 -0.0157 484 LEU A C     
2601 O  O     . LEU A 346 ? 0.3773 0.3263 0.4104 -0.0533 0.0009  -0.0109 484 LEU A O     
2602 C  CB    . LEU A 346 ? 0.3394 0.2967 0.3503 -0.0393 -0.0136 -0.0269 484 LEU A CB    
2603 C  CG    . LEU A 346 ? 0.3297 0.2953 0.3351 -0.0338 -0.0207 -0.0374 484 LEU A CG    
2604 C  CD1   . LEU A 346 ? 0.3105 0.2846 0.2989 -0.0280 -0.0208 -0.0333 484 LEU A CD1   
2605 C  CD2   . LEU A 346 ? 0.3796 0.3350 0.3851 -0.0314 -0.0229 -0.0423 484 LEU A CD2   
2606 N  N     . GLU A 347 ? 0.3433 0.2709 0.3729 -0.0500 -0.0011 -0.0096 485 GLU A N     
2607 C  CA    . GLU A 347 ? 0.4431 0.3635 0.4673 -0.0517 0.0064  0.0044  485 GLU A CA    
2608 C  C     . GLU A 347 ? 0.3530 0.2808 0.3571 -0.0470 0.0075  0.0098  485 GLU A C     
2609 O  O     . GLU A 347 ? 0.3291 0.2604 0.3220 -0.0413 0.0029  0.0060  485 GLU A O     
2610 C  CB    . GLU A 347 ? 0.5878 0.4917 0.6125 -0.0505 0.0074  0.0103  485 GLU A CB    
2611 C  CG    . GLU A 347 ? 0.7771 0.6705 0.8240 -0.0558 0.0077  0.0066  485 GLU A CG    
2612 C  CD    . GLU A 347 ? 0.9579 0.8338 1.0058 -0.0538 0.0092  0.0145  485 GLU A CD    
2613 O  OE1   . GLU A 347 ? 1.0030 0.8747 1.0370 -0.0513 0.0132  0.0276  485 GLU A OE1   
2614 O  OE2   . GLU A 347 ? 1.0108 0.8772 1.0733 -0.0544 0.0061  0.0071  485 GLU A OE2   
2615 N  N     . TYR A 348 ? 0.4060 0.3367 0.4069 -0.0496 0.0141  0.0182  486 TYR A N     
2616 C  CA    . TYR A 348 ? 0.3908 0.3285 0.3747 -0.0457 0.0154  0.0219  486 TYR A CA    
2617 C  C     . TYR A 348 ? 0.3918 0.3226 0.3607 -0.0403 0.0136  0.0268  486 TYR A C     
2618 O  O     . TYR A 348 ? 0.3570 0.2767 0.3260 -0.0404 0.0150  0.0333  486 TYR A O     
2619 C  CB    . TYR A 348 ? 0.4007 0.3422 0.3840 -0.0493 0.0234  0.0295  486 TYR A CB    
2620 C  CG    . TYR A 348 ? 0.3722 0.3205 0.3389 -0.0453 0.0247  0.0320  486 TYR A CG    
2621 C  CD1   . TYR A 348 ? 0.3586 0.3178 0.3244 -0.0432 0.0223  0.0254  486 TYR A CD1   
2622 C  CD2   . TYR A 348 ? 0.3771 0.3209 0.3295 -0.0433 0.0280  0.0406  486 TYR A CD2   
2623 C  CE1   . TYR A 348 ? 0.4240 0.3881 0.3772 -0.0398 0.0235  0.0267  486 TYR A CE1   
2624 C  CE2   . TYR A 348 ? 0.3885 0.3389 0.3270 -0.0398 0.0286  0.0409  486 TYR A CE2   
2625 C  CZ    . TYR A 348 ? 0.4399 0.3999 0.3799 -0.0384 0.0266  0.0336  486 TYR A CZ    
2626 O  OH    . TYR A 348 ? 0.4500 0.4155 0.3787 -0.0352 0.0273  0.0331  486 TYR A OH    
2627 N  N     . LEU A 349 ? 0.3303 0.2678 0.2876 -0.0356 0.0105  0.0241  487 LEU A N     
2628 C  CA    . LEU A 349 ? 0.3363 0.2703 0.2803 -0.0305 0.0086  0.0278  487 LEU A CA    
2629 C  C     . LEU A 349 ? 0.3639 0.3054 0.2963 -0.0292 0.0111  0.0306  487 LEU A C     
2630 O  O     . LEU A 349 ? 0.3074 0.2579 0.2404 -0.0288 0.0105  0.0256  487 LEU A O     
2631 C  CB    . LEU A 349 ? 0.3333 0.2683 0.2765 -0.0260 0.0025  0.0206  487 LEU A CB    
2632 C  CG    . LEU A 349 ? 0.3524 0.2792 0.3056 -0.0260 -0.0004 0.0165  487 LEU A CG    
2633 C  CD1   . LEU A 349 ? 0.3662 0.2970 0.3175 -0.0213 -0.0054 0.0083  487 LEU A CD1   
2634 C  CD2   . LEU A 349 ? 0.3786 0.2932 0.3310 -0.0251 0.0009  0.0245  487 LEU A CD2   
2635 N  N     . PRO A 350 ? 0.3680 0.3068 0.2902 -0.0281 0.0136  0.0381  488 PRO A N     
2636 C  CA    . PRO A 350 ? 0.3566 0.3029 0.2679 -0.0263 0.0149  0.0384  488 PRO A CA    
2637 C  C     . PRO A 350 ? 0.3394 0.2892 0.2464 -0.0219 0.0096  0.0333  488 PRO A C     
2638 O  O     . PRO A 350 ? 0.3110 0.2569 0.2204 -0.0195 0.0053  0.0315  488 PRO A O     
2639 C  CB    . PRO A 350 ? 0.3971 0.3395 0.2977 -0.0256 0.0178  0.0474  488 PRO A CB    
2640 C  CG    . PRO A 350 ? 0.4450 0.3766 0.3490 -0.0244 0.0152  0.0517  488 PRO A CG    
2641 C  CD    . PRO A 350 ? 0.3912 0.3199 0.3111 -0.0278 0.0148  0.0466  488 PRO A CD    
2642 N  N     . PRO A 351 ? 0.3203 0.2776 0.2222 -0.0208 0.0101  0.0306  489 PRO A N     
2643 C  CA    . PRO A 351 ? 0.3394 0.3001 0.2396 -0.0173 0.0059  0.0262  489 PRO A CA    
2644 C  C     . PRO A 351 ? 0.3019 0.2587 0.1974 -0.0138 0.0019  0.0282  489 PRO A C     
2645 O  O     . PRO A 351 ? 0.3195 0.2774 0.2181 -0.0113 -0.0015 0.0248  489 PRO A O     
2646 C  CB    . PRO A 351 ? 0.3504 0.3177 0.2462 -0.0173 0.0082  0.0243  489 PRO A CB    
2647 C  CG    . PRO A 351 ? 0.4125 0.3818 0.3112 -0.0207 0.0134  0.0253  489 PRO A CG    
2648 C  CD    . PRO A 351 ? 0.3809 0.3437 0.2798 -0.0228 0.0152  0.0312  489 PRO A CD    
2649 N  N     . GLU A 352 ? 0.3217 0.2747 0.2099 -0.0132 0.0023  0.0340  490 GLU A N     
2650 C  CA    A GLU A 352 ? 0.3720 0.3225 0.2563 -0.0090 -0.0022 0.0363  490 GLU A CA    
2651 C  CA    B GLU A 352 ? 0.3744 0.3247 0.2585 -0.0091 -0.0021 0.0366  490 GLU A CA    
2652 C  C     . GLU A 352 ? 0.3350 0.2779 0.2269 -0.0077 -0.0045 0.0368  490 GLU A C     
2653 O  O     . GLU A 352 ? 0.3623 0.3037 0.2536 -0.0036 -0.0085 0.0374  490 GLU A O     
2654 C  CB    A GLU A 352 ? 0.3995 0.3489 0.2726 -0.0078 -0.0017 0.0433  490 GLU A CB    
2655 C  CB    B GLU A 352 ? 0.4006 0.3489 0.2740 -0.0082 -0.0011 0.0442  490 GLU A CB    
2656 C  CG    A GLU A 352 ? 0.4389 0.3802 0.3117 -0.0098 0.0023  0.0516  490 GLU A CG    
2657 C  CG    B GLU A 352 ? 0.4181 0.3746 0.2819 -0.0086 0.0007  0.0427  490 GLU A CG    
2658 C  CD    A GLU A 352 ? 0.4354 0.3798 0.3060 -0.0141 0.0090  0.0533  490 GLU A CD    
2659 C  CD    B GLU A 352 ? 0.4343 0.3930 0.2995 -0.0129 0.0074  0.0422  490 GLU A CD    
2660 O  OE1   A GLU A 352 ? 0.3971 0.3489 0.2690 -0.0157 0.0105  0.0468  490 GLU A OE1   
2661 O  OE1   B GLU A 352 ? 0.3905 0.3450 0.2649 -0.0160 0.0102  0.0430  490 GLU A OE1   
2662 O  OE2   A GLU A 352 ? 0.3975 0.3368 0.2660 -0.0158 0.0133  0.0616  490 GLU A OE2   
2663 O  OE2   B GLU A 352 ? 0.4607 0.4260 0.3187 -0.0131 0.0096  0.0400  490 GLU A OE2   
2664 N  N     . GLN A 353 ? 0.3189 0.2579 0.2190 -0.0108 -0.0023 0.0355  491 GLN A N     
2665 C  CA    . GLN A 353 ? 0.3680 0.3004 0.2767 -0.0097 -0.0046 0.0333  491 GLN A CA    
2666 C  C     . GLN A 353 ? 0.3444 0.2821 0.2591 -0.0097 -0.0059 0.0247  491 GLN A C     
2667 O  O     . GLN A 353 ? 0.3308 0.2645 0.2532 -0.0095 -0.0073 0.0208  491 GLN A O     
2668 C  CB    . GLN A 353 ? 0.3734 0.2967 0.2883 -0.0132 -0.0017 0.0376  491 GLN A CB    
2669 C  CG    . GLN A 353 ? 0.4192 0.3368 0.3272 -0.0127 0.0004  0.0482  491 GLN A CG    
2670 C  CD    . GLN A 353 ? 0.4188 0.3322 0.3231 -0.0068 -0.0041 0.0516  491 GLN A CD    
2671 O  OE1   . GLN A 353 ? 0.4184 0.3293 0.3296 -0.0039 -0.0077 0.0466  491 GLN A OE1   
2672 N  NE2   . GLN A 353 ? 0.4418 0.3555 0.3352 -0.0046 -0.0041 0.0598  491 GLN A NE2   
2673 N  N     . ARG A 354 ? 0.3363 0.2828 0.2479 -0.0096 -0.0055 0.0218  492 ARG A N     
2674 C  CA    . ARG A 354 ? 0.3161 0.2686 0.2314 -0.0087 -0.0065 0.0155  492 ARG A CA    
2675 C  C     . ARG A 354 ? 0.3018 0.2588 0.2148 -0.0046 -0.0084 0.0137  492 ARG A C     
2676 O  O     . ARG A 354 ? 0.3097 0.2734 0.2233 -0.0038 -0.0081 0.0108  492 ARG A O     
2677 C  CB    . ARG A 354 ? 0.3270 0.2859 0.2428 -0.0115 -0.0041 0.0145  492 ARG A CB    
2678 C  CG    . ARG A 354 ? 0.3277 0.2844 0.2478 -0.0159 -0.0015 0.0159  492 ARG A CG    
2679 C  CD    . ARG A 354 ? 0.3090 0.2734 0.2309 -0.0176 0.0008  0.0145  492 ARG A CD    
2680 N  NE    . ARG A 354 ? 0.3299 0.2934 0.2552 -0.0218 0.0047  0.0171  492 ARG A NE    
2681 C  CZ    . ARG A 354 ? 0.3394 0.3087 0.2659 -0.0233 0.0079  0.0171  492 ARG A CZ    
2682 N  NH1   . ARG A 354 ? 0.2921 0.2674 0.2172 -0.0210 0.0074  0.0149  492 ARG A NH1   
2683 N  NH2   . ARG A 354 ? 0.3272 0.2964 0.2575 -0.0271 0.0123  0.0197  492 ARG A NH2   
2684 N  N     . ASN A 355 ? 0.3016 0.2556 0.2128 -0.0020 -0.0103 0.0162  493 ASN A N     
2685 C  CA    . ASN A 355 ? 0.3603 0.3196 0.2716 0.0016  -0.0119 0.0145  493 ASN A CA    
2686 C  C     . ASN A 355 ? 0.4159 0.3751 0.3320 0.0050  -0.0131 0.0102  493 ASN A C     
2687 O  O     . ASN A 355 ? 0.4036 0.3626 0.3220 0.0087  -0.0150 0.0100  493 ASN A O     
2688 C  CB    . ASN A 355 ? 0.3162 0.2743 0.2241 0.0034  -0.0142 0.0185  493 ASN A CB    
2689 C  CG    . ASN A 355 ? 0.3730 0.3346 0.2752 0.0010  -0.0131 0.0204  493 ASN A CG    
2690 O  OD1   . ASN A 355 ? 0.3565 0.3247 0.2598 0.0003  -0.0122 0.0177  493 ASN A OD1   
2691 N  ND2   . ASN A 355 ? 0.3574 0.3146 0.2538 -0.0001 -0.0127 0.0252  493 ASN A ND2   
2692 N  N     . ALA A 356 ? 0.3427 0.3034 0.2606 0.0042  -0.0121 0.0061  494 ALA A N     
2693 C  CA    . ALA A 356 ? 0.3925 0.3547 0.3135 0.0077  -0.0129 0.0005  494 ALA A CA    
2694 C  C     . ALA A 356 ? 0.4393 0.4104 0.3597 0.0108  -0.0117 -0.0002 494 ALA A C     
2695 O  O     . ALA A 356 ? 0.3703 0.3472 0.2888 0.0093  -0.0097 0.0020  494 ALA A O     
2696 C  CB    . ALA A 356 ? 0.3856 0.3494 0.3074 0.0062  -0.0129 -0.0044 494 ALA A CB    
2697 O  OXT   . ALA A 356 ? 0.4324 0.4048 0.3558 0.0148  -0.0121 -0.0030 494 ALA A OXT   
2698 O  "O5'" . DC  B 1   ? 1.0917 1.3302 0.7902 0.1321  -0.0208 -0.1901 1   DC  T "O5'" 
2699 C  "C5'" . DC  B 1   ? 1.0740 1.3199 0.7693 0.1321  -0.0329 -0.1976 1   DC  T "C5'" 
2700 C  "C4'" . DC  B 1   ? 0.9887 1.2218 0.6996 0.1245  -0.0422 -0.1985 1   DC  T "C4'" 
2701 O  "O4'" . DC  B 1   ? 0.9699 1.1868 0.7012 0.1198  -0.0439 -0.2136 1   DC  T "O4'" 
2702 C  "C3'" . DC  B 1   ? 0.8708 1.0974 0.5809 0.1210  -0.0379 -0.1762 1   DC  T "C3'" 
2703 O  "O3'" . DC  B 1   ? 0.7545 0.9909 0.4545 0.1222  -0.0429 -0.1649 1   DC  T "O3'" 
2704 C  "C2'" . DC  B 1   ? 0.8381 1.0460 0.5691 0.1131  -0.0424 -0.1828 1   DC  T "C2'" 
2705 C  "C1'" . DC  B 1   ? 0.8458 1.0488 0.5898 0.1126  -0.0476 -0.2073 1   DC  T "C1'" 
2706 N  N1    . DC  B 1   ? 0.7412 0.9267 0.5018 0.1092  -0.0435 -0.2136 1   DC  T N1    
2707 C  C2    . DC  B 1   ? 0.6431 0.8120 0.4216 0.1017  -0.0492 -0.2165 1   DC  T C2    
2708 O  O2    . DC  B 1   ? 0.6159 0.7859 0.3967 0.0976  -0.0572 -0.2139 1   DC  T O2    
2709 N  N3    . DC  B 1   ? 0.5162 0.6686 0.3097 0.0994  -0.0457 -0.2220 1   DC  T N3    
2710 C  C4    . DC  B 1   ? 0.5223 0.6751 0.3144 0.1045  -0.0371 -0.2250 1   DC  T C4    
2711 N  N4    . DC  B 1   ? 0.5125 0.6472 0.3238 0.1016  -0.0339 -0.2272 1   DC  T N4    
2712 C  C5    . DC  B 1   ? 0.6824 0.8528 0.4570 0.1118  -0.0308 -0.2225 1   DC  T C5    
2713 C  C6    . DC  B 1   ? 0.7323 0.9181 0.4911 0.1138  -0.0342 -0.2167 1   DC  T C6    
2714 P  P     . DG  B 2   ? 0.9620 1.1975 0.6549 0.1216  -0.0362 -0.1382 2   DG  T P     
2715 O  OP1   . DG  B 2   ? 1.0534 1.3047 0.7297 0.1273  -0.0379 -0.1281 2   DG  T OP1   
2716 O  OP2   . DG  B 2   ? 0.8984 1.1268 0.5924 0.1212  -0.0233 -0.1292 2   DG  T OP2   
2717 O  "O5'" . DG  B 2   ? 0.9040 1.1271 0.6121 0.1141  -0.0443 -0.1375 2   DG  T "O5'" 
2718 C  "C5'" . DG  B 2   ? 0.7714 0.9960 0.4884 0.1116  -0.0573 -0.1524 2   DG  T "C5'" 
2719 C  "C4'" . DG  B 2   ? 0.6242 0.8365 0.3561 0.1041  -0.0624 -0.1490 2   DG  T "C4'" 
2720 O  "O4'" . DG  B 2   ? 0.5389 0.7350 0.2855 0.0988  -0.0600 -0.1579 2   DG  T "O4'" 
2721 C  "C3'" . DG  B 2   ? 0.6167 0.8272 0.3431 0.1037  -0.0570 -0.1251 2   DG  T "C3'" 
2722 O  "O3'" . DG  B 2   ? 0.6379 0.8449 0.3747 0.0989  -0.0655 -0.1234 2   DG  T "O3'" 
2723 C  "C2'" . DG  B 2   ? 0.5847 0.7827 0.3148 0.1014  -0.0464 -0.1198 2   DG  T "C2'" 
2724 C  "C1'" . DG  B 2   ? 0.5331 0.7202 0.2790 0.0970  -0.0512 -0.1410 2   DG  T "C1'" 
2725 N  N9    . DG  B 2   ? 0.5075 0.6869 0.2571 0.0976  -0.0422 -0.1451 2   DG  T N9    
2726 C  C8    . DG  B 2   ? 0.5239 0.7129 0.2594 0.1045  -0.0330 -0.1422 2   DG  T C8    
2727 N  N7    . DG  B 2   ? 0.4951 0.6758 0.2387 0.1043  -0.0270 -0.1491 2   DG  T N7    
2728 C  C5    . DG  B 2   ? 0.4822 0.6436 0.2496 0.0957  -0.0325 -0.1543 2   DG  T C5    
2729 C  C6    . DG  B 2   ? 0.4720 0.6162 0.2591 0.0917  -0.0300 -0.1607 2   DG  T C6    
2730 O  O6    . DG  B 2   ? 0.4754 0.6183 0.2638 0.0952  -0.0227 -0.1640 2   DG  T O6    
2731 N  N1    . DG  B 2   ? 0.4771 0.6048 0.2842 0.0832  -0.0368 -0.1626 2   DG  T N1    
2732 C  C2    . DG  B 2   ? 0.4553 0.5841 0.2644 0.0789  -0.0446 -0.1598 2   DG  T C2    
2733 N  N2    . DG  B 2   ? 0.4608 0.5733 0.2909 0.0706  -0.0491 -0.1618 2   DG  T N2    
2734 N  N3    . DG  B 2   ? 0.4622 0.6075 0.2544 0.0828  -0.0475 -0.1549 2   DG  T N3    
2735 C  C4    . DG  B 2   ? 0.4829 0.6435 0.2543 0.0913  -0.0414 -0.1520 2   DG  T C4    
2736 P  P     . DG  B 3   ? 0.6473 0.8498 0.3835 0.0972  -0.0615 -0.1009 3   DG  T P     
2737 O  OP1   . DG  B 3   ? 0.7352 0.9432 0.4778 0.0958  -0.0724 -0.1014 3   DG  T OP1   
2738 O  OP2   . DG  B 3   ? 0.6494 0.8560 0.3710 0.1024  -0.0501 -0.0828 3   DG  T OP2   
2739 O  "O5'" . DG  B 3   ? 0.5502 0.7289 0.3100 0.0871  -0.0560 -0.0991 3   DG  T "O5'" 
2740 C  "C5'" . DG  B 3   ? 0.4972 0.6651 0.2776 0.0795  -0.0631 -0.1117 3   DG  T "C5'" 
2741 C  "C4'" . DG  B 3   ? 0.4533 0.5998 0.2516 0.0715  -0.0560 -0.1052 3   DG  T "C4'" 
2742 O  "O4'" . DG  B 3   ? 0.4426 0.5848 0.2385 0.0735  -0.0496 -0.1115 3   DG  T "O4'" 
2743 C  "C3'" . DG  B 3   ? 0.4521 0.5922 0.2509 0.0696  -0.0484 -0.0832 3   DG  T "C3'" 
2744 O  "O3'" . DG  B 3   ? 0.4832 0.6109 0.3002 0.0616  -0.0507 -0.0794 3   DG  T "O3'" 
2745 C  "C2'" . DG  B 3   ? 0.4511 0.5836 0.2485 0.0700  -0.0378 -0.0781 3   DG  T "C2'" 
2746 C  "C1'" . DG  B 3   ? 0.4568 0.5864 0.2590 0.0701  -0.0402 -0.0972 3   DG  T "C1'" 
2747 N  N9    . DG  B 3   ? 0.4637 0.5969 0.2568 0.0754  -0.0325 -0.0992 3   DG  T N9    
2748 C  C8    . DG  B 3   ? 0.4386 0.5883 0.2114 0.0837  -0.0280 -0.0960 3   DG  T C8    
2749 N  N7    . DG  B 3   ? 0.4434 0.5936 0.2138 0.0869  -0.0207 -0.0997 3   DG  T N7    
2750 C  C5    . DG  B 3   ? 0.4320 0.5646 0.2226 0.0807  -0.0213 -0.1059 3   DG  T C5    
2751 C  C6    . DG  B 3   ? 0.4304 0.5558 0.2292 0.0812  -0.0159 -0.1117 3   DG  T C6    
2752 O  O6    . DG  B 3   ? 0.4397 0.5735 0.2302 0.0871  -0.0087 -0.1136 3   DG  T O6    
2753 N  N1    . DG  B 3   ? 0.4183 0.5252 0.2375 0.0743  -0.0191 -0.1152 3   DG  T N1    
2754 C  C2    . DG  B 3   ? 0.4086 0.5059 0.2384 0.0673  -0.0258 -0.1134 3   DG  T C2    
2755 N  N2    . DG  B 3   ? 0.3998 0.4797 0.2478 0.0616  -0.0271 -0.1158 3   DG  T N2    
2756 N  N3    . DG  B 3   ? 0.4085 0.5130 0.2319 0.0665  -0.0305 -0.1088 3   DG  T N3    
2757 C  C4    . DG  B 3   ? 0.4222 0.5442 0.2260 0.0736  -0.0284 -0.1053 3   DG  T C4    
2758 P  P     . DC  B 4   ? 0.5007 0.6222 0.3216 0.0589  -0.0454 -0.0594 4   DC  T P     
2759 O  OP1   . DC  B 4   ? 0.5223 0.6388 0.3587 0.0529  -0.0514 -0.0613 4   DC  T OP1   
2760 O  OP2   . DC  B 4   ? 0.4439 0.5775 0.2476 0.0663  -0.0418 -0.0471 4   DC  T OP2   
2761 O  "O5'" . DC  B 4   ? 0.4844 0.5901 0.3131 0.0545  -0.0363 -0.0538 4   DC  T "O5'" 
2762 C  "C5'" . DC  B 4   ? 0.4761 0.5685 0.3190 0.0486  -0.0374 -0.0630 4   DC  T "C5'" 
2763 C  "C4'" . DC  B 4   ? 0.4158 0.4984 0.2612 0.0476  -0.0292 -0.0579 4   DC  T "C4'" 
2764 O  "O4'" . DC  B 4   ? 0.3995 0.4906 0.2336 0.0541  -0.0262 -0.0638 4   DC  T "O4'" 
2765 C  "C3'" . DC  B 4   ? 0.3713 0.4510 0.2162 0.0466  -0.0222 -0.0408 4   DC  T "C3'" 
2766 O  "O3'" . DC  B 4   ? 0.3533 0.4182 0.2114 0.0403  -0.0198 -0.0370 4   DC  T "O3'" 
2767 C  "C2'" . DC  B 4   ? 0.4110 0.4987 0.2443 0.0526  -0.0153 -0.0372 4   DC  T "C2'" 
2768 C  "C1'" . DC  B 4   ? 0.4536 0.5420 0.2864 0.0548  -0.0174 -0.0527 4   DC  T "C1'" 
2769 N  N1    . DC  B 4   ? 0.3943 0.4951 0.2133 0.0622  -0.0127 -0.0553 4   DC  T N1    
2770 C  C2    . DC  B 4   ? 0.3811 0.4788 0.2039 0.0637  -0.0095 -0.0639 4   DC  T C2    
2771 O  O2    . DC  B 4   ? 0.3948 0.4788 0.2319 0.0590  -0.0112 -0.0682 4   DC  T O2    
2772 N  N3    . DC  B 4   ? 0.3941 0.5041 0.2047 0.0706  -0.0043 -0.0668 4   DC  T N3    
2773 C  C4    . DC  B 4   ? 0.4049 0.5298 0.1988 0.0760  -0.0022 -0.0605 4   DC  T C4    
2774 N  N4    . DC  B 4   ? 0.4646 0.6023 0.2458 0.0830  0.0038  -0.0633 4   DC  T N4    
2775 C  C5    . DC  B 4   ? 0.4030 0.5307 0.1924 0.0749  -0.0060 -0.0508 4   DC  T C5    
2776 C  C6    . DC  B 4   ? 0.3891 0.5046 0.1921 0.0680  -0.0112 -0.0490 4   DC  T C6    
2777 P  P     . DA  B 5   ? 0.3514 0.4109 0.2141 0.0370  -0.0152 -0.0224 5   DA  T P     
2778 O  OP1   . DA  B 5   ? 0.3589 0.4263 0.2128 0.0415  -0.0092 -0.0125 5   DA  T OP1   
2779 O  OP2   . DA  B 5   ? 0.3236 0.3696 0.1976 0.0315  -0.0136 -0.0222 5   DA  T OP2   
2780 O  "O5'" . DA  B 5   ? 0.3694 0.4313 0.2351 0.0351  -0.0205 -0.0209 5   DA  T "O5'" 
2781 C  "C5'" . DA  B 5   ? 0.3573 0.4132 0.2332 0.0302  -0.0257 -0.0286 5   DA  T "C5'" 
2782 C  "C4'" . DA  B 5   ? 0.3527 0.4089 0.2347 0.0274  -0.0276 -0.0230 5   DA  T "C4'" 
2783 O  "O4'" . DA  B 5   ? 0.3026 0.3514 0.1884 0.0250  -0.0218 -0.0122 5   DA  T "O4'" 
2784 C  "C3'" . DA  B 5   ? 0.3951 0.4649 0.2696 0.0327  -0.0310 -0.0202 5   DA  T "C3'" 
2785 O  "O3'" . DA  B 5   ? 0.3705 0.4424 0.2543 0.0300  -0.0362 -0.0226 5   DA  T "O3'" 
2786 C  "C2'" . DA  B 5   ? 0.3478 0.4171 0.2179 0.0351  -0.0244 -0.0063 5   DA  T "C2'" 
2787 C  "C1'" . DA  B 5   ? 0.3978 0.4534 0.2786 0.0288  -0.0199 -0.0028 5   DA  T "C1'" 
2788 N  N9    . DA  B 5   ? 0.3781 0.4297 0.2571 0.0293  -0.0129 0.0053  5   DA  T N9    
2789 C  C8    . DA  B 5   ? 0.3747 0.4309 0.2454 0.0334  -0.0091 0.0071  5   DA  T C8    
2790 N  N7    . DA  B 5   ? 0.3812 0.4325 0.2554 0.0321  -0.0028 0.0144  5   DA  T N7    
2791 C  C5    . DA  B 5   ? 0.3534 0.3961 0.2376 0.0271  -0.0031 0.0168  5   DA  T C5    
2792 C  C6    . DA  B 5   ? 0.3287 0.3639 0.2210 0.0235  0.0013  0.0224  5   DA  T C6    
2793 N  N6    . DA  B 5   ? 0.4043 0.4392 0.2978 0.0240  0.0068  0.0272  5   DA  T N6    
2794 N  N1    . DA  B 5   ? 0.3748 0.4037 0.2746 0.0194  -0.0002 0.0222  5   DA  T N1    
2795 C  C2    . DA  B 5   ? 0.3489 0.3791 0.2496 0.0186  -0.0050 0.0176  5   DA  T C2    
2796 N  N3    . DA  B 5   ? 0.2946 0.3315 0.1903 0.0211  -0.0096 0.0121  5   DA  T N3    
2797 C  C4    . DA  B 5   ? 0.3294 0.3723 0.2162 0.0255  -0.0087 0.0116  5   DA  T C4    
2798 P  P     . DT  B 6   ? 0.3475 0.4336 0.2270 0.0353  -0.0413 -0.0196 6   DT  T P     
2799 O  OP1   . DT  B 6   ? 0.3215 0.4100 0.2137 0.0314  -0.0478 -0.0280 6   DT  T OP1   
2800 O  OP2   . DT  B 6   ? 0.3726 0.4705 0.2356 0.0431  -0.0424 -0.0197 6   DT  T OP2   
2801 O  "O5'" . DT  B 6   ? 0.3551 0.4368 0.2377 0.0354  -0.0357 -0.0051 6   DT  T "O5'" 
2802 C  "C5'" . DT  B 6   ? 0.3230 0.3953 0.2193 0.0293  -0.0335 -0.0033 6   DT  T "C5'" 
2803 C  "C4'" . DT  B 6   ? 0.3139 0.3823 0.2118 0.0304  -0.0280 0.0091  6   DT  T "C4'" 
2804 O  "O4'" . DT  B 6   ? 0.3187 0.3797 0.2116 0.0300  -0.0213 0.0138  6   DT  T "O4'" 
2805 C  "C3'" . DT  B 6   ? 0.3697 0.4486 0.2618 0.0378  -0.0298 0.0173  6   DT  T "C3'" 
2806 O  "O3'" . DT  B 6   ? 0.3882 0.4667 0.2914 0.0374  -0.0302 0.0220  6   DT  T "O3'" 
2807 C  "C2'" . DT  B 6   ? 0.3797 0.4554 0.2633 0.0406  -0.0228 0.0269  6   DT  T "C2'" 
2808 C  "C1'" . DT  B 6   ? 0.3828 0.4452 0.2738 0.0338  -0.0174 0.0252  6   DT  T "C1'" 
2809 N  N1    . DT  B 6   ? 0.3801 0.4384 0.2657 0.0343  -0.0109 0.0302  6   DT  T N1    
2810 C  C2    . DT  B 6   ? 0.4019 0.4500 0.2958 0.0301  -0.0054 0.0342  6   DT  T C2    
2811 O  O2    . DT  B 6   ? 0.3498 0.3917 0.2532 0.0263  -0.0054 0.0335  6   DT  T O2    
2812 N  N3    . DT  B 6   ? 0.4176 0.4639 0.3085 0.0307  0.0003  0.0385  6   DT  T N3    
2813 C  C4    . DT  B 6   ? 0.4515 0.5053 0.3317 0.0351  0.0019  0.0396  6   DT  T C4    
2814 O  O4    . DT  B 6   ? 0.4687 0.5212 0.3488 0.0351  0.0078  0.0436  6   DT  T O4    
2815 C  C5    . DT  B 6   ? 0.4048 0.4692 0.2745 0.0399  -0.0038 0.0351  6   DT  T C5    
2816 C  C7    . DT  B 6   ? 0.4228 0.4971 0.2787 0.0455  -0.0022 0.0350  6   DT  T C7    
2817 C  C6    . DT  B 6   ? 0.3804 0.4466 0.2537 0.0392  -0.0103 0.0304  6   DT  T C6    
2818 P  P     . DA  B 7   ? 0.4220 0.5131 0.3242 0.0448  -0.0353 0.0278  7   DA  T P     
2819 O  OP1   . DA  B 7   ? 0.4747 0.5746 0.3846 0.0436  -0.0434 0.0177  7   DA  T OP1   
2820 O  OP2   . DA  B 7   ? 0.3850 0.4832 0.2714 0.0520  -0.0349 0.0347  7   DA  T OP2   
2821 O  "O5'" . DA  B 7   ? 0.4562 0.5399 0.3699 0.0445  -0.0303 0.0375  7   DA  T "O5'" 
2822 C  "C5'" . DA  B 7   ? 0.4674 0.5446 0.3779 0.0469  -0.0234 0.0490  7   DA  T "C5'" 
2823 C  "C4'" . DA  B 7   ? 0.4440 0.5070 0.3639 0.0402  -0.0165 0.0487  7   DA  T "C4'" 
2824 O  "O4'" . DA  B 7   ? 0.4602 0.5180 0.3726 0.0368  -0.0131 0.0456  7   DA  T "O4'" 
2825 C  "C3'" . DA  B 7   ? 0.4564 0.5125 0.3832 0.0421  -0.0105 0.0597  7   DA  T "C3'" 
2826 O  "O3'" . DA  B 7   ? 0.4407 0.4962 0.3809 0.0424  -0.0116 0.0600  7   DA  T "O3'" 
2827 C  "C2'" . DA  B 7   ? 0.4614 0.5060 0.3902 0.0360  -0.0041 0.0580  7   DA  T "C2'" 
2828 C  "C1'" . DA  B 7   ? 0.4287 0.4760 0.3464 0.0340  -0.0060 0.0507  7   DA  T "C1'" 
2829 N  N9    . DA  B 7   ? 0.4216 0.4698 0.3301 0.0364  -0.0020 0.0562  7   DA  T N9    
2830 C  C8    . DA  B 7   ? 0.4353 0.4933 0.3306 0.0414  -0.0041 0.0573  7   DA  T C8    
2831 N  N7    . DA  B 7   ? 0.4375 0.4947 0.3274 0.0425  0.0017  0.0628  7   DA  T N7    
2832 C  C5    . DA  B 7   ? 0.4113 0.4575 0.3129 0.0375  0.0072  0.0650  7   DA  T C5    
2833 C  C6    . DA  B 7   ? 0.4376 0.4786 0.3430 0.0354  0.0144  0.0699  7   DA  T C6    
2834 N  N6    . DA  B 7   ? 0.4529 0.4992 0.3500 0.0384  0.0185  0.0747  7   DA  T N6    
2835 N  N1    . DA  B 7   ? 0.4492 0.4802 0.3678 0.0303  0.0173  0.0692  7   DA  T N1    
2836 C  C2    . DA  B 7   ? 0.4636 0.4902 0.3894 0.0277  0.0140  0.0643  7   DA  T C2    
2837 N  N3    . DA  B 7   ? 0.4111 0.4418 0.3348 0.0292  0.0083  0.0601  7   DA  T N3    
2838 C  C4    . DA  B 7   ? 0.4135 0.4541 0.3257 0.0339  0.0047  0.0607  7   DA  T C4    
2839 P  P     . DC  B 8   ? 0.4390 0.4931 0.3869 0.0486  -0.0094 0.0722  8   DC  T P     
2840 O  OP1   . DC  B 8   ? 0.4308 0.4870 0.3926 0.0488  -0.0121 0.0684  8   DC  T OP1   
2841 O  OP2   . DC  B 8   ? 0.4066 0.4690 0.3424 0.0560  -0.0113 0.0817  8   DC  T OP2   
2842 O  "O5'" . DC  B 8   ? 0.3988 0.4388 0.3536 0.0445  -0.0008 0.0758  8   DC  T "O5'" 
2843 C  "C5'" . DC  B 8   ? 0.3817 0.4135 0.3450 0.0376  0.0019  0.0671  8   DC  T "C5'" 
2844 C  "C4'" . DC  B 8   ? 0.3744 0.3949 0.3438 0.0347  0.0090  0.0705  8   DC  T "C4'" 
2845 O  "O4'" . DC  B 8   ? 0.3639 0.3845 0.3226 0.0336  0.0109  0.0728  8   DC  T "O4'" 
2846 C  "C3'" . DC  B 8   ? 0.3542 0.3698 0.3344 0.0393  0.0127  0.0813  8   DC  T "C3'" 
2847 O  "O3'" . DC  B 8   ? 0.3858 0.3903 0.3788 0.0349  0.0179  0.0784  8   DC  T "O3'" 
2848 C  "C2'" . DC  B 8   ? 0.3773 0.3959 0.3474 0.0429  0.0145  0.0919  8   DC  T "C2'" 
2849 C  "C1'" . DC  B 8   ? 0.4070 0.4246 0.3686 0.0369  0.0157  0.0845  8   DC  T "C1'" 
2850 N  N1    . DC  B 8   ? 0.4373 0.4621 0.3843 0.0397  0.0159  0.0894  8   DC  T N1    
2851 C  C2    . DC  B 8   ? 0.4327 0.4534 0.3797 0.0374  0.0222  0.0933  8   DC  T C2    
2852 O  O2    . DC  B 8   ? 0.3832 0.3945 0.3430 0.0328  0.0266  0.0922  8   DC  T O2    
2853 N  N3    . DC  B 8   ? 0.3919 0.4202 0.3255 0.0403  0.0232  0.0974  8   DC  T N3    
2854 C  C4    . DC  B 8   ? 0.3750 0.4143 0.2946 0.0455  0.0177  0.0969  8   DC  T C4    
2855 N  N4    . DC  B 8   ? 0.3975 0.4448 0.3032 0.0486  0.0192  0.1000  8   DC  T N4    
2856 C  C5    . DC  B 8   ? 0.4108 0.4543 0.3310 0.0476  0.0104  0.0923  8   DC  T C5    
2857 C  C6    . DC  B 8   ? 0.4459 0.4819 0.3804 0.0446  0.0101  0.0892  8   DC  T C6    
2858 P  P     . DG  B 9   ? 0.3992 0.3946 0.4075 0.0377  0.0234  0.0881  9   DG  T P     
2859 O  OP1   . DG  B 9   ? 0.4252 0.4122 0.4474 0.0331  0.0259  0.0786  9   DG  T OP1   
2860 O  OP2   . DG  B 9   ? 0.3871 0.3872 0.3967 0.0459  0.0212  0.0991  9   DG  T OP2   
2861 O  "O5'" . DG  B 9   ? 0.4143 0.4065 0.4186 0.0358  0.0283  0.0951  9   DG  T "O5'" 
2862 C  "C5'" . DG  B 9   ? 0.4660 0.4531 0.4721 0.0287  0.0310  0.0872  9   DG  T "C5'" 
2863 C  "C4'" . DG  B 9   ? 0.4455 0.4245 0.4642 0.0271  0.0379  0.0946  9   DG  T "C4'" 
2864 O  "O4'" . DG  B 9   ? 0.4510 0.4351 0.4596 0.0288  0.0405  0.1041  9   DG  T "O4'" 
2865 C  "C3'" . DG  B 9   ? 0.4931 0.4649 0.5275 0.0313  0.0411  0.1040  9   DG  T "C3'" 
2866 O  "O3'" . DG  B 9   ? 0.5438 0.5050 0.5961 0.0269  0.0470  0.1037  9   DG  T "O3'" 
2867 C  "C2'" . DG  B 9   ? 0.4951 0.4734 0.5193 0.0382  0.0418  0.1197  9   DG  T "C2'" 
2868 C  "C1'" . DG  B 9   ? 0.4397 0.4232 0.4516 0.0350  0.0438  0.1196  9   DG  T "C1'" 
2869 N  N9    . DG  B 9   ? 0.4473 0.4426 0.4391 0.0403  0.0411  0.1257  9   DG  T N9    
2870 C  C8    . DG  B 9   ? 0.4462 0.4509 0.4249 0.0446  0.0336  0.1222  9   DG  T C8    
2871 N  N7    . DG  B 9   ? 0.4385 0.4538 0.4000 0.0487  0.0322  0.1270  9   DG  T N7    
2872 C  C5    . DG  B 9   ? 0.4236 0.4364 0.3861 0.0471  0.0400  0.1348  9   DG  T C5    
2873 C  C6    . DG  B 9   ? 0.4229 0.4444 0.3705 0.0502  0.0431  0.1421  9   DG  T C6    
2874 O  O6    . DG  B 9   ? 0.4302 0.4637 0.3593 0.0554  0.0389  0.1424  9   DG  T O6    
2875 N  N1    . DG  B 9   ? 0.4179 0.4341 0.3748 0.0467  0.0523  0.1488  9   DG  T N1    
2876 C  C2    . DG  B 9   ? 0.4138 0.4175 0.3925 0.0407  0.0569  0.1476  9   DG  T C2    
2877 N  N2    . DG  B 9   ? 0.4008 0.4018 0.3881 0.0375  0.0656  0.1544  9   DG  T N2    
2878 N  N3    . DG  B 9   ? 0.4013 0.3966 0.3930 0.0380  0.0534  0.1397  9   DG  T N3    
2879 C  C4    . DG  B 9   ? 0.4287 0.4293 0.4108 0.0416  0.0454  0.1341  9   DG  T C4    
2880 O  "O5'" . DC  C 1   ? 0.6287 0.7080 0.5156 0.0571  0.0921  0.1709  1   DC  P "O5'" 
2881 C  "C5'" . DC  C 1   ? 0.5600 0.6350 0.4632 0.0545  0.1042  0.1860  1   DC  P "C5'" 
2882 C  "C4'" . DC  C 1   ? 0.5393 0.5976 0.4681 0.0478  0.1031  0.1868  1   DC  P "C4'" 
2883 O  "O4'" . DC  C 1   ? 0.5244 0.5776 0.4496 0.0526  0.0982  0.1950  1   DC  P "O4'" 
2884 C  "C3'" . DC  C 1   ? 0.5333 0.5842 0.4724 0.0410  0.0942  0.1675  1   DC  P "C3'" 
2885 O  "O3'" . DC  C 1   ? 0.4628 0.5140 0.4154 0.0346  0.0987  0.1603  1   DC  P "O3'" 
2886 C  "C2'" . DC  C 1   ? 0.5215 0.5583 0.4777 0.0384  0.0919  0.1710  1   DC  P "C2'" 
2887 C  "C1'" . DC  C 1   ? 0.5125 0.5527 0.4546 0.0471  0.0914  0.1851  1   DC  P "C1'" 
2888 N  N1    . DC  C 1   ? 0.4693 0.5122 0.3970 0.0511  0.0791  0.1756  1   DC  P N1    
2889 C  C2    . DC  C 1   ? 0.4725 0.5046 0.4131 0.0485  0.0729  0.1698  1   DC  P C2    
2890 O  O2    . DC  C 1   ? 0.4884 0.5087 0.4509 0.0432  0.0772  0.1720  1   DC  P O2    
2891 N  N3    . DC  C 1   ? 0.5069 0.5422 0.4367 0.0516  0.0625  0.1614  1   DC  P N3    
2892 C  C4    . DC  C 1   ? 0.4838 0.5321 0.3917 0.0569  0.0577  0.1579  1   DC  P C4    
2893 N  N4    . DC  C 1   ? 0.4262 0.4775 0.3269 0.0592  0.0474  0.1491  1   DC  P N4    
2894 C  C5    . DC  C 1   ? 0.4749 0.5341 0.3683 0.0600  0.0633  0.1624  1   DC  P C5    
2895 C  C6    . DC  C 1   ? 0.4661 0.5224 0.3696 0.0571  0.0743  0.1716  1   DC  P C6    
2896 P  P     . DG  C 2   ? 0.4442 0.4940 0.3981 0.0301  0.0896  0.1398  2   DG  P P     
2897 O  OP1   . DG  C 2   ? 0.4064 0.4585 0.3756 0.0247  0.0958  0.1364  2   DG  P OP1   
2898 O  OP2   . DG  C 2   ? 0.4205 0.4782 0.3507 0.0357  0.0819  0.1318  2   DG  P OP2   
2899 O  "O5'" . DG  C 2   ? 0.3867 0.4228 0.3540 0.0256  0.0826  0.1340  2   DG  P "O5'" 
2900 C  "C5'" . DG  C 2   ? 0.3775 0.4038 0.3698 0.0194  0.0870  0.1365  2   DG  P "C5'" 
2901 C  "C4'" . DG  C 2   ? 0.3550 0.3701 0.3549 0.0174  0.0800  0.1309  2   DG  P "C4'" 
2902 O  "O4'" . DG  C 2   ? 0.3902 0.4048 0.3789 0.0238  0.0779  0.1396  2   DG  P "O4'" 
2903 C  "C3'" . DG  C 2   ? 0.3726 0.3869 0.3662 0.0152  0.0700  0.1141  2   DG  P "C3'" 
2904 O  "O3'" . DG  C 2   ? 0.3471 0.3591 0.3551 0.0087  0.0696  0.1043  2   DG  P "O3'" 
2905 C  "C2'" . DG  C 2   ? 0.4335 0.4398 0.4293 0.0164  0.0652  0.1139  2   DG  P "C2'" 
2906 C  "C1'" . DG  C 2   ? 0.4237 0.4334 0.4102 0.0234  0.0685  0.1290  2   DG  P "C1'" 
2907 N  N9    . DG  C 2   ? 0.3768 0.3953 0.3408 0.0292  0.0621  0.1266  2   DG  P N9    
2908 C  C8    . DG  C 2   ? 0.4155 0.4455 0.3615 0.0339  0.0632  0.1294  2   DG  P C8    
2909 N  N7    . DG  C 2   ? 0.4012 0.4372 0.3309 0.0383  0.0556  0.1243  2   DG  P N7    
2910 C  C5    . DG  C 2   ? 0.3836 0.4118 0.3214 0.0362  0.0497  0.1188  2   DG  P C5    
2911 C  C6    . DG  C 2   ? 0.4171 0.4476 0.3468 0.0386  0.0409  0.1120  2   DG  P C6    
2912 O  O6    . DG  C 2   ? 0.3979 0.4378 0.3116 0.0430  0.0357  0.1088  2   DG  P O6    
2913 N  N1    . DG  C 2   ? 0.3889 0.4101 0.3321 0.0354  0.0384  0.1080  2   DG  P N1    
2914 C  C2    . DG  C 2   ? 0.4017 0.4126 0.3633 0.0307  0.0431  0.1092  2   DG  P C2    
2915 N  N2    . DG  C 2   ? 0.3767 0.3806 0.3485 0.0287  0.0400  0.1036  2   DG  P N2    
2916 N  N3    . DG  C 2   ? 0.3713 0.3796 0.3416 0.0281  0.0506  0.1147  2   DG  P N3    
2917 C  C4    . DG  C 2   ? 0.3661 0.3835 0.3240 0.0310  0.0537  0.1199  2   DG  P C4    
2918 P  P     . DT  C 3   ? 0.3918 0.4055 0.3916 0.0069  0.0608  0.0884  3   DT  P P     
2919 O  OP1   . DT  C 3   ? 0.3786 0.3898 0.3963 0.0006  0.0611  0.0810  3   DT  P OP1   
2920 O  OP2   . DT  C 3   ? 0.3620 0.3851 0.3428 0.0115  0.0595  0.0876  3   DT  P OP2   
2921 O  "O5'" . DT  C 3   ? 0.3258 0.3329 0.3200 0.0078  0.0536  0.0837  3   DT  P "O5'" 
2922 C  "C5'" . DT  C 3   ? 0.3257 0.3238 0.3352 0.0044  0.0534  0.0819  3   DT  P "C5'" 
2923 C  "C4'" . DT  C 3   ? 0.3125 0.3072 0.3143 0.0061  0.0469  0.0766  3   DT  P "C4'" 
2924 O  "O4'" . DT  C 3   ? 0.3322 0.3298 0.3233 0.0121  0.0469  0.0856  3   DT  P "O4'" 
2925 C  "C3'" . DT  C 3   ? 0.2833 0.2813 0.2720 0.0055  0.0400  0.0658  3   DT  P "C3'" 
2926 O  "O3'" . DT  C 3   ? 0.3005 0.2954 0.2969 0.0006  0.0376  0.0560  3   DT  P "O3'" 
2927 C  "C2'" . DT  C 3   ? 0.3045 0.3015 0.2854 0.0086  0.0360  0.0657  3   DT  P "C2'" 
2928 C  "C1'" . DT  C 3   ? 0.3631 0.3630 0.3415 0.0138  0.0397  0.0784  3   DT  P "C1'" 
2929 N  N1    . DT  C 3   ? 0.4000 0.4092 0.3611 0.0181  0.0380  0.0805  3   DT  P N1    
2930 C  C2    . DT  C 3   ? 0.3982 0.4110 0.3479 0.0210  0.0319  0.0767  3   DT  P C2    
2931 O  O2    . DT  C 3   ? 0.3959 0.4052 0.3494 0.0201  0.0283  0.0726  3   DT  P O2    
2932 N  N3    . DT  C 3   ? 0.3430 0.3646 0.2779 0.0249  0.0302  0.0772  3   DT  P N3    
2933 C  C4    . DT  C 3   ? 0.3976 0.4251 0.3268 0.0266  0.0346  0.0809  3   DT  P C4    
2934 O  O4    . DT  C 3   ? 0.4253 0.4612 0.3405 0.0306  0.0326  0.0796  3   DT  P O4    
2935 C  C5    . DT  C 3   ? 0.3791 0.4028 0.3210 0.0234  0.0417  0.0857  3   DT  P C5    
2936 C  C7    . DT  C 3   ? 0.4050 0.4357 0.3436 0.0248  0.0479  0.0903  3   DT  P C7    
2937 C  C6    . DT  C 3   ? 0.3989 0.4136 0.3566 0.0191  0.0428  0.0851  3   DT  P C6    
2938 P  P     . DA  C 4   ? 0.3304 0.3289 0.3155 -0.0003 0.0321  0.0469  4   DA  P P     
2939 O  OP1   . DA  C 4   ? 0.3100 0.3054 0.3044 -0.0048 0.0299  0.0383  4   DA  P OP1   
2940 O  OP2   . DA  C 4   ? 0.3650 0.3704 0.3435 0.0021  0.0341  0.0504  4   DA  P OP2   
2941 O  "O5'" . DA  C 4   ? 0.3126 0.3107 0.2849 0.0021  0.0274  0.0446  4   DA  P "O5'" 
2942 C  "C5'" . DA  C 4   ? 0.3761 0.3691 0.3524 0.0006  0.0256  0.0408  4   DA  P "C5'" 
2943 C  "C4'" . DA  C 4   ? 0.3351 0.3296 0.3002 0.0023  0.0215  0.0382  4   DA  P "C4'" 
2944 O  "O4'" . DA  C 4   ? 0.3311 0.3294 0.2914 0.0067  0.0220  0.0452  4   DA  P "O4'" 
2945 C  "C3'" . DA  C 4   ? 0.3184 0.3154 0.2727 0.0017  0.0177  0.0331  4   DA  P "C3'" 
2946 O  "O3'" . DA  C 4   ? 0.3504 0.3444 0.3057 -0.0016 0.0156  0.0262  4   DA  P "O3'" 
2947 C  "C2'" . DA  C 4   ? 0.3477 0.3474 0.2938 0.0043  0.0150  0.0338  4   DA  P "C2'" 
2948 C  "C1'" . DA  C 4   ? 0.3678 0.3702 0.3163 0.0081  0.0177  0.0420  4   DA  P "C1'" 
2949 N  N9    . DA  C 4   ? 0.3773 0.3856 0.3180 0.0115  0.0184  0.0461  4   DA  P N9    
2950 C  C8    . DA  C 4   ? 0.3406 0.3507 0.2831 0.0119  0.0225  0.0501  4   DA  P C8    
2951 N  N7    . DA  C 4   ? 0.3522 0.3690 0.2851 0.0157  0.0229  0.0528  4   DA  P N7    
2952 C  C5    . DA  C 4   ? 0.3509 0.3705 0.2757 0.0178  0.0178  0.0496  4   DA  P C5    
2953 C  C6    . DA  C 4   ? 0.3404 0.3677 0.2536 0.0221  0.0149  0.0488  4   DA  P C6    
2954 N  N6    . DA  C 4   ? 0.3725 0.4065 0.2780 0.0256  0.0175  0.0516  4   DA  P N6    
2955 N  N1    . DA  C 4   ? 0.3168 0.3458 0.2271 0.0226  0.0094  0.0445  4   DA  P N1    
2956 C  C2    . DA  C 4   ? 0.3379 0.3613 0.2560 0.0192  0.0079  0.0420  4   DA  P C2    
2957 N  N3    . DA  C 4   ? 0.3380 0.3541 0.2655 0.0155  0.0107  0.0424  4   DA  P N3    
2958 C  C4    . DA  C 4   ? 0.3467 0.3611 0.2771 0.0150  0.0152  0.0460  4   DA  P C4    
2959 P  P     . DT  C 5   ? 0.4015 0.3965 0.3520 -0.0028 0.0129  0.0220  5   DT  P P     
2960 O  OP1   . DT  C 5   ? 0.2784 0.2710 0.2330 -0.0058 0.0116  0.0166  5   DT  P OP1   
2961 O  OP2   . DT  C 5   ? 0.4032 0.4021 0.3544 -0.0010 0.0147  0.0253  5   DT  P OP2   
2962 O  "O5'" . DT  C 5   ? 0.3759 0.3709 0.3155 -0.0019 0.0096  0.0203  5   DT  P "O5'" 
2963 C  "C5'" . DT  C 5   ? 0.4020 0.3946 0.3396 -0.0034 0.0085  0.0179  5   DT  P "C5'" 
2964 C  "C4'" . DT  C 5   ? 0.3852 0.3789 0.3162 -0.0025 0.0063  0.0177  5   DT  P "C4'" 
2965 O  "O4'" . DT  C 5   ? 0.3650 0.3626 0.2964 0.0004  0.0069  0.0211  5   DT  P "O4'" 
2966 C  "C3'" . DT  C 5   ? 0.3491 0.3425 0.2746 -0.0018 0.0040  0.0161  5   DT  P "C3'" 
2967 O  "O3'" . DT  C 5   ? 0.3301 0.3196 0.2530 -0.0039 0.0024  0.0137  5   DT  P "O3'" 
2968 C  "C2'" . DT  C 5   ? 0.3802 0.3761 0.3026 -0.0002 0.0024  0.0159  5   DT  P "C2'" 
2969 C  "C1'" . DT  C 5   ? 0.4132 0.4132 0.3386 0.0019  0.0042  0.0197  5   DT  P "C1'" 
2970 N  N1    . DT  C 5   ? 0.3728 0.3775 0.2958 0.0054  0.0053  0.0227  5   DT  P N1    
2971 C  C2    . DT  C 5   ? 0.3870 0.3969 0.3049 0.0085  0.0033  0.0225  5   DT  P C2    
2972 O  O2    . DT  C 5   ? 0.3891 0.4001 0.3062 0.0080  0.0002  0.0195  5   DT  P O2    
2973 N  N3    . DT  C 5   ? 0.3670 0.3821 0.2811 0.0121  0.0051  0.0256  5   DT  P N3    
2974 C  C4    . DT  C 5   ? 0.3575 0.3727 0.2743 0.0125  0.0093  0.0293  5   DT  P C4    
2975 O  O4    . DT  C 5   ? 0.4022 0.4230 0.3152 0.0159  0.0119  0.0326  5   DT  P O4    
2976 C  C5    . DT  C 5   ? 0.3580 0.3673 0.2826 0.0086  0.0107  0.0287  5   DT  P C5    
2977 C  C7    . DT  C 5   ? 0.4014 0.4112 0.3325 0.0080  0.0148  0.0316  5   DT  P C7    
2978 C  C6    . DT  C 5   ? 0.3491 0.3536 0.2753 0.0056  0.0083  0.0251  5   DT  P C6    
2979 O  OP3   . DG  D 1   ? 0.4786 0.5922 0.3669 0.1004  0.0436  -0.1105 1   DG  D OP3   
2980 P  P     . DG  D 1   ? 0.4796 0.6024 0.3504 0.0979  0.0461  -0.0997 1   DG  D P     
2981 O  OP1   . DG  D 1   ? 0.5158 0.6465 0.3913 0.0962  0.0552  -0.0846 1   DG  D OP1   
2982 O  OP2   . DG  D 1   ? 0.4555 0.5908 0.3072 0.1040  0.0469  -0.1107 1   DG  D OP2   
2983 O  "O5'" . DG  D 1   ? 0.4295 0.5370 0.3004 0.0900  0.0363  -0.0937 1   DG  D "O5'" 
2984 C  "C5'" . DG  D 1   ? 0.3837 0.4781 0.2693 0.0837  0.0334  -0.0840 1   DG  D "C5'" 
2985 C  "C4'" . DG  D 1   ? 0.4034 0.4805 0.2952 0.0796  0.0232  -0.0893 1   DG  D "C4'" 
2986 O  "O4'" . DG  D 1   ? 0.4365 0.5127 0.3167 0.0755  0.0186  -0.0859 1   DG  D "O4'" 
2987 C  "C3'" . DG  D 1   ? 0.4126 0.4851 0.3081 0.0840  0.0191  -0.1067 1   DG  D "C3'" 
2988 O  "O3'" . DG  D 1   ? 0.3891 0.4432 0.2985 0.0799  0.0121  -0.1076 1   DG  D "O3'" 
2989 C  "C2'" . DG  D 1   ? 0.4031 0.4833 0.2819 0.0852  0.0163  -0.1144 1   DG  D "C2'" 
2990 C  "C1'" . DG  D 1   ? 0.4051 0.4835 0.2777 0.0786  0.0140  -0.1002 1   DG  D "C1'" 
2991 N  N9    . DG  D 1   ? 0.4362 0.5294 0.2900 0.0807  0.0160  -0.0974 1   DG  D N9    
2992 C  C8    . DG  D 1   ? 0.4745 0.5852 0.3151 0.0874  0.0234  -0.0983 1   DG  D C8    
2993 N  N7    . DG  D 1   ? 0.4803 0.6014 0.3041 0.0884  0.0234  -0.0933 1   DG  D N7    
2994 C  C5    . DG  D 1   ? 0.4520 0.5621 0.2797 0.0819  0.0152  -0.0895 1   DG  D C5    
2995 C  C6    . DG  D 1   ? 0.4100 0.5245 0.2265 0.0804  0.0111  -0.0834 1   DG  D C6    
2996 O  O6    . DG  D 1   ? 0.4445 0.5735 0.2441 0.0848  0.0134  -0.0793 1   DG  D O6    
2997 N  N1    . DG  D 1   ? 0.3954 0.4961 0.2224 0.0734  0.0037  -0.0817 1   DG  D N1    
2998 C  C2    . DG  D 1   ? 0.4184 0.5028 0.2627 0.0684  0.0010  -0.0844 1   DG  D C2    
2999 N  N2    . DG  D 1   ? 0.4314 0.5052 0.2829 0.0620  -0.0052 -0.0814 1   DG  D N2    
3000 N  N3    . DG  D 1   ? 0.4249 0.5045 0.2789 0.0702  0.0043  -0.0891 1   DG  D N3    
3001 C  C4    . DG  D 1   ? 0.4428 0.5359 0.2884 0.0769  0.0112  -0.0919 1   DG  D C4    
3002 P  P     . DC  D 2   ? 0.4282 0.4719 0.3494 0.0837  0.0081  -0.1233 2   DC  D P     
3003 O  OP1   . DC  D 2   ? 0.4304 0.4595 0.3683 0.0813  0.0057  -0.1159 2   DC  D OP1   
3004 O  OP2   . DC  D 2   ? 0.4121 0.4691 0.3291 0.0921  0.0133  -0.1361 2   DC  D OP2   
3005 O  "O5'" . DC  D 2   ? 0.4022 0.4378 0.3198 0.0794  0.0002  -0.1304 2   DC  D "O5'" 
3006 C  "C5'" . DC  D 2   ? 0.4459 0.4693 0.3676 0.0715  -0.0046 -0.1202 2   DC  D "C5'" 
3007 C  "C4'" . DC  D 2   ? 0.4719 0.4980 0.3841 0.0677  -0.0093 -0.1235 2   DC  D "C4'" 
3008 O  "O4'" . DC  D 2   ? 0.4680 0.5124 0.3626 0.0710  -0.0059 -0.1231 2   DC  D "O4'" 
3009 C  "C3'" . DC  D 2   ? 0.4408 0.4610 0.3588 0.0682  -0.0152 -0.1408 2   DC  D "C3'" 
3010 O  "O3'" . DC  D 2   ? 0.4703 0.4728 0.4021 0.0616  -0.0201 -0.1375 2   DC  D "O3'" 
3011 C  "C2'" . DC  D 2   ? 0.4729 0.5086 0.3743 0.0691  -0.0174 -0.1467 2   DC  D "C2'" 
3012 C  "C1'" . DC  D 2   ? 0.4678 0.5149 0.3558 0.0690  -0.0119 -0.1304 2   DC  D "C1'" 
3013 N  N1    . DC  D 2   ? 0.4722 0.5395 0.3406 0.0746  -0.0093 -0.1333 2   DC  D N1    
3014 C  C2    . DC  D 2   ? 0.4502 0.5251 0.3071 0.0724  -0.0127 -0.1285 2   DC  D C2    
3015 O  O2    . DC  D 2   ? 0.4015 0.4668 0.2657 0.0657  -0.0176 -0.1232 2   DC  D O2    
3016 N  N3    . DC  D 2   ? 0.4217 0.5151 0.2598 0.0781  -0.0105 -0.1294 2   DC  D N3    
3017 C  C4    . DC  D 2   ? 0.4442 0.5486 0.2744 0.0854  -0.0041 -0.1349 2   DC  D C4    
3018 N  N4    . DC  D 2   ? 0.4892 0.6123 0.2991 0.0912  -0.0015 -0.1344 2   DC  D N4    
3019 C  C5    . DC  D 2   ? 0.4677 0.5651 0.3106 0.0876  0.0000  -0.1408 2   DC  D C5    
3020 C  C6    . DC  D 2   ? 0.4840 0.5626 0.3460 0.0822  -0.0032 -0.1396 2   DC  D C6    
3021 P  P     A DC  D 3   ? 0.4928 0.4851 0.4362 0.0592  -0.0267 -0.1529 3   DC  D P     
3022 P  P     B DC  D 3   ? 0.4841 0.4760 0.4281 0.0595  -0.0265 -0.1532 3   DC  D P     
3023 O  OP1   A DC  D 3   ? 0.4433 0.4160 0.4028 0.0532  -0.0285 -0.1444 3   DC  D OP1   
3024 O  OP1   B DC  D 3   ? 0.4443 0.4162 0.4048 0.0539  -0.0283 -0.1450 3   DC  D OP1   
3025 O  OP2   A DC  D 3   ? 0.4788 0.4760 0.4235 0.0665  -0.0265 -0.1714 3   DC  D OP2   
3026 O  OP2   B DC  D 3   ? 0.4791 0.4766 0.4238 0.0671  -0.0260 -0.1713 3   DC  D OP2   
3027 O  "O5'" A DC  D 3   ? 0.4713 0.4740 0.4040 0.0552  -0.0310 -0.1544 3   DC  D "O5'" 
3028 O  "O5'" B DC  D 3   ? 0.4793 0.4806 0.4134 0.0553  -0.0310 -0.1552 3   DC  D "O5'" 
3029 C  "C5'" A DC  D 3   ? 0.5095 0.5116 0.4384 0.0492  -0.0309 -0.1387 3   DC  D "C5'" 
3030 C  "C5'" B DC  D 3   ? 0.5141 0.5144 0.4450 0.0490  -0.0312 -0.1397 3   DC  D "C5'" 
3031 C  "C4'" A DC  D 3   ? 0.5790 0.5863 0.5060 0.0450  -0.0369 -0.1441 3   DC  D "C4'" 
3032 C  "C4'" B DC  D 3   ? 0.5759 0.5824 0.5041 0.0451  -0.0370 -0.1453 3   DC  D "C4'" 
3033 O  "O4'" A DC  D 3   ? 0.5760 0.6033 0.4844 0.0501  -0.0369 -0.1475 3   DC  D "O4'" 
3034 O  "O4'" B DC  D 3   ? 0.5729 0.5992 0.4818 0.0499  -0.0364 -0.1461 3   DC  D "O4'" 
3035 C  "C3'" A DC  D 3   ? 0.6164 0.6164 0.5577 0.0432  -0.0429 -0.1615 3   DC  D "C3'" 
3036 C  "C3'" B DC  D 3   ? 0.6162 0.6175 0.5570 0.0442  -0.0431 -0.1641 3   DC  D "C3'" 
3037 O  "O3'" A DC  D 3   ? 0.6463 0.6424 0.5958 0.0355  -0.0475 -0.1596 3   DC  D "O3'" 
3038 O  "O3'" B DC  D 3   ? 0.6487 0.6370 0.6051 0.0356  -0.0465 -0.1610 3   DC  D "O3'" 
3039 C  "C2'" A DC  D 3   ? 0.5969 0.6138 0.5259 0.0503  -0.0450 -0.1780 3   DC  D "C2'" 
3040 C  "C2'" B DC  D 3   ? 0.6024 0.6233 0.5287 0.0486  -0.0470 -0.1770 3   DC  D "C2'" 
3041 C  "C1'" A DC  D 3   ? 0.5831 0.6174 0.4909 0.0528  -0.0425 -0.1667 3   DC  D "C1'" 
3042 C  "C1'" B DC  D 3   ? 0.5805 0.6162 0.4862 0.0520  -0.0425 -0.1630 3   DC  D "C1'" 
3043 N  N1    A DC  D 3   ? 0.5579 0.6095 0.4476 0.0619  -0.0391 -0.1725 3   DC  D N1    
3044 N  N1    B DC  D 3   ? 0.5520 0.6042 0.4406 0.0611  -0.0393 -0.1699 3   DC  D N1    
3045 C  C2    A DC  D 3   ? 0.5254 0.5957 0.3958 0.0651  -0.0401 -0.1699 3   DC  D C2    
3046 C  C2    B DC  D 3   ? 0.5286 0.5999 0.3976 0.0648  -0.0401 -0.1679 3   DC  D C2    
3047 O  O2    A DC  D 3   ? 0.5224 0.5947 0.3924 0.0606  -0.0446 -0.1640 3   DC  D O2    
3048 O  O2    B DC  D 3   ? 0.5203 0.5944 0.3876 0.0606  -0.0442 -0.1612 3   DC  D O2    
3049 N  N3    A DC  D 3   ? 0.5166 0.6029 0.3695 0.0735  -0.0359 -0.1734 3   DC  D N3    
3050 N  N3    B DC  D 3   ? 0.5246 0.6113 0.3770 0.0732  -0.0361 -0.1727 3   DC  D N3    
3051 C  C4    A DC  D 3   ? 0.5294 0.6141 0.3846 0.0784  -0.0305 -0.1801 3   DC  D C4    
3052 C  C4    B DC  D 3   ? 0.5322 0.6162 0.3882 0.0778  -0.0312 -0.1803 3   DC  D C4    
3053 N  N4    A DC  D 3   ? 0.5481 0.6501 0.3855 0.0867  -0.0254 -0.1831 3   DC  D N4    
3054 N  N4    B DC  D 3   ? 0.5517 0.6525 0.3908 0.0863  -0.0264 -0.1849 3   DC  D N4    
3055 C  C5    A DC  D 3   ? 0.5183 0.5840 0.3943 0.0756  -0.0299 -0.1834 3   DC  D C5    
3056 C  C5    B DC  D 3   ? 0.5257 0.5901 0.4030 0.0745  -0.0309 -0.1830 3   DC  D C5    
3057 C  C6    A DC  D 3   ? 0.5326 0.5820 0.4246 0.0675  -0.0343 -0.1788 3   DC  D C6    
3058 C  C6    B DC  D 3   ? 0.5373 0.5862 0.4296 0.0662  -0.0350 -0.1770 3   DC  D C6    
3059 P  P     A DG  D 4   ? 0.6236 0.6082 0.5944 0.0304  -0.0532 -0.1742 4   DG  D P     
3060 P  P     B DG  D 4   ? 0.5469 0.5421 0.4998 0.0295  -0.0495 -0.1533 4   DG  D P     
3061 O  OP1   A DG  D 4   ? 0.5638 0.5347 0.5478 0.0219  -0.0522 -0.1610 4   DG  D OP1   
3062 O  OP1   B DG  D 4   ? 0.4762 0.4824 0.4115 0.0320  -0.0455 -0.1388 4   DG  D OP1   
3063 O  OP2   A DG  D 4   ? 0.5142 0.4919 0.4932 0.0354  -0.0529 -0.1882 4   DG  D OP2   
3064 O  OP2   B DG  D 4   ? 0.5380 0.5166 0.5101 0.0213  -0.0502 -0.1484 4   DG  D OP2   
3065 O  "O5'" A DG  D 4   ? 0.6088 0.6110 0.5731 0.0305  -0.0603 -0.1872 4   DG  D "O5'" 
3066 O  "O5'" B DG  D 4   ? 0.6012 0.6105 0.5516 0.0312  -0.0569 -0.1719 4   DG  D "O5'" 
3067 C  "C5'" A DG  D 4   ? 0.6083 0.6234 0.5601 0.0292  -0.0612 -0.1766 4   DG  D "C5'" 
3068 C  "C5'" B DG  D 4   ? 0.5914 0.6152 0.5333 0.0298  -0.0609 -0.1695 4   DG  D "C5'" 
3069 C  "C4'" A DG  D 4   ? 0.6098 0.6449 0.5511 0.0330  -0.0681 -0.1905 4   DG  D "C4'" 
3070 C  "C4'" B DG  D 4   ? 0.6088 0.6480 0.5458 0.0338  -0.0683 -0.1891 4   DG  D "C4'" 
3071 O  "O4'" A DG  D 4   ? 0.6034 0.6514 0.5244 0.0426  -0.0655 -0.1944 4   DG  D "O4'" 
3072 O  "O4'" B DG  D 4   ? 0.6063 0.6567 0.5248 0.0432  -0.0656 -0.1943 4   DG  D "O4'" 
3073 C  "C3'" A DG  D 4   ? 0.6302 0.6637 0.5880 0.0306  -0.0759 -0.2124 4   DG  D "C3'" 
3074 C  "C3'" B DG  D 4   ? 0.6269 0.6568 0.5852 0.0302  -0.0739 -0.2083 4   DG  D "C3'" 
3075 O  "O3'" A DG  D 4   ? 0.6339 0.6829 0.5898 0.0291  -0.0838 -0.2190 4   DG  D "O3'" 
3076 O  "O3'" B DG  D 4   ? 0.6356 0.6761 0.5998 0.0268  -0.0825 -0.2188 4   DG  D "O3'" 
3077 C  "C2'" A DG  D 4   ? 0.6442 0.6827 0.5934 0.0391  -0.0754 -0.2277 4   DG  D "C2'" 
3078 C  "C2'" B DG  D 4   ? 0.6370 0.6709 0.5879 0.0384  -0.0734 -0.2237 4   DG  D "C2'" 
3079 C  "C1'" A DG  D 4   ? 0.6310 0.6863 0.5527 0.0466  -0.0711 -0.2169 4   DG  D "C1'" 
3080 C  "C1'" B DG  D 4   ? 0.6286 0.6825 0.5515 0.0464  -0.0708 -0.2169 4   DG  D "C1'" 
3081 N  N9    A DG  D 4   ? 0.6098 0.6683 0.5205 0.0549  -0.0656 -0.2217 4   DG  D N9    
3082 N  N9    B DG  D 4   ? 0.6104 0.6682 0.5216 0.0549  -0.0654 -0.2218 4   DG  D N9    
3083 C  C8    A DG  D 4   ? 0.6072 0.6507 0.5299 0.0559  -0.0612 -0.2254 4   DG  D C8    
3084 C  C8    B DG  D 4   ? 0.6081 0.6514 0.5308 0.0562  -0.0610 -0.2257 4   DG  D C8    
3085 N  N7    A DG  D 4   ? 0.6027 0.6550 0.5122 0.0644  -0.0564 -0.2298 4   DG  D N7    
3086 N  N7    B DG  D 4   ? 0.6062 0.6589 0.5153 0.0648  -0.0562 -0.2301 4   DG  D N7    
3087 C  C5    A DG  D 4   ? 0.6131 0.6873 0.4993 0.0692  -0.0574 -0.2282 4   DG  D C5    
3088 C  C5    B DG  D 4   ? 0.6124 0.6868 0.4983 0.0693  -0.0573 -0.2282 4   DG  D C5    
3089 C  C6    A DG  D 4   ? 0.6149 0.7073 0.4787 0.0786  -0.0527 -0.2303 4   DG  D C6    
3090 C  C6    B DG  D 4   ? 0.6161 0.7090 0.4793 0.0787  -0.0527 -0.2300 4   DG  D C6    
3091 O  O6    A DG  D 4   ? 0.6109 0.7041 0.4719 0.0847  -0.0464 -0.2350 4   DG  D O6    
3092 O  O6    B DG  D 4   ? 0.6164 0.7107 0.4762 0.0849  -0.0464 -0.2348 4   DG  D O6    
3093 N  N1    A DG  D 4   ? 0.5933 0.7048 0.4370 0.0812  -0.0555 -0.2256 4   DG  D N1    
3094 N  N1    B DG  D 4   ? 0.6007 0.7122 0.4442 0.0810  -0.0556 -0.2250 4   DG  D N1    
3095 C  C2    A DG  D 4   ? 0.5995 0.7126 0.4456 0.0756  -0.0624 -0.2204 4   DG  D C2    
3096 C  C2    B DG  D 4   ? 0.6026 0.7152 0.4493 0.0752  -0.0626 -0.2199 4   DG  D C2    
3097 N  N2    A DG  D 4   ? 0.6272 0.7600 0.4524 0.0802  -0.0646 -0.2156 4   DG  D N2    
3098 N  N2    B DG  D 4   ? 0.6232 0.7552 0.4493 0.0795  -0.0649 -0.2149 4   DG  D N2    
3099 N  N3    A DG  D 4   ? 0.5847 0.6818 0.4528 0.0665  -0.0666 -0.2193 4   DG  D N3    
3100 N  N3    B DG  D 4   ? 0.5916 0.6879 0.4605 0.0662  -0.0666 -0.2190 4   DG  D N3    
3101 C  C4    A DG  D 4   ? 0.6038 0.6819 0.4905 0.0637  -0.0635 -0.2231 4   DG  D C4    
3102 C  C4    B DG  D 4   ? 0.6065 0.6841 0.4935 0.0635  -0.0634 -0.2230 4   DG  D C4    
3103 MN MN    . MN  E .   ? 0.3150 0.3069 0.2647 -0.0083 0.0067  0.0083  501 MN  A MN    
3104 MN MN    . MN  F .   ? 0.3777 0.3667 0.3487 -0.0075 0.0158  0.0164  502 MN  A MN    
3105 MN MN    . MN  G .   ? 0.6398 0.7587 0.5490 0.1103  0.0506  -0.1244 503 MN  A MN    
3106 MN MN    . MN  H .   ? 1.0439 1.1171 1.2120 0.1676  0.0185  -0.1268 504 MN  A MN    
3107 MN MN    . MN  I .   ? 0.4962 0.5376 0.4980 0.0379  -0.0033 0.0513  505 MN  A MN    
3108 NA NA    . NA  J .   ? 0.4005 0.4249 0.4229 -0.0020 0.0616  0.0710  506 NA  A NA    
3109 S  S1    A DTT K .   ? 0.9167 0.7921 1.1876 0.0247  0.0670  -0.0635 507 DTT A S1    
3110 S  S1    . DTT L .   ? 1.2415 1.2549 1.1629 0.0245  0.0036  -0.0046 508 DTT A S1    
3111 C  C10   . EPE M .   ? 0.5455 0.5630 0.4693 0.0138  -0.0436 0.0010  509 EPE A C10   
3112 S  S     . EPE M .   ? 0.5308 0.5381 0.4440 0.0096  -0.0360 0.0039  509 EPE A S     
3113 O  O1S   . EPE M .   ? 0.4834 0.4873 0.3812 0.0107  -0.0378 0.0079  509 EPE A O1S   
3114 O  O2S   . EPE M .   ? 0.6144 0.6247 0.5332 0.0051  -0.0328 -0.0016 509 EPE A O2S   
3115 O  O3S   . EPE M .   ? 0.5286 0.5292 0.4446 0.0098  -0.0316 0.0075  509 EPE A O3S   
3116 C  C1    . EDO N .   ? 0.5124 0.5213 0.4465 0.0054  0.0029  0.0237  510 EDO A C1    
3117 O  O1    . EDO N .   ? 0.5117 0.5259 0.4406 0.0072  -0.0009 0.0218  510 EDO A O1    
3118 C  C2    . EDO N .   ? 0.4772 0.4861 0.4124 0.0081  0.0058  0.0298  510 EDO A C2    
3119 O  O2    . EDO N .   ? 0.5059 0.5205 0.4411 0.0126  0.0049  0.0347  510 EDO A O2    
3120 C  C1    . EDO O .   ? 0.7665 0.7991 0.7329 -0.0192 0.0566  -0.0087 511 EDO A C1    
3121 O  O1    . EDO O .   ? 0.8196 0.8451 0.7699 -0.0201 0.0537  -0.0065 511 EDO A O1    
3122 C  C2    . EDO O .   ? 0.7140 0.7454 0.6894 -0.0147 0.0530  -0.0128 511 EDO A C2    
3123 O  O2    . EDO O .   ? 0.6909 0.7214 0.6613 -0.0126 0.0559  -0.0190 511 EDO A O2    
3124 C  C1    . EDO P .   ? 0.5735 0.4152 0.6025 0.0623  -0.0359 0.0068  512 EDO A C1    
3125 O  O1    . EDO P .   ? 0.5368 0.3683 0.5618 0.0551  -0.0342 0.0164  512 EDO A O1    
3126 C  C2    . EDO P .   ? 0.5891 0.4173 0.6364 0.0701  -0.0376 0.0041  512 EDO A C2    
3127 O  O2    . EDO P .   ? 0.6245 0.4375 0.6831 0.0660  -0.0355 -0.0016 512 EDO A O2    
3128 C  C     . GOA Q .   ? 0.3351 0.3272 0.2684 -0.0046 0.0025  0.0115  513 GOA A C     
3129 C  CA    . GOA Q .   ? 0.4678 0.4637 0.4090 -0.0039 0.0036  0.0120  513 GOA A CA    
3130 O  O     . GOA Q .   ? 0.3525 0.3431 0.2866 -0.0065 0.0031  0.0098  513 GOA A O     
3131 O  OXT   . GOA Q .   ? 0.3625 0.3531 0.2896 -0.0035 0.0012  0.0122  513 GOA A OXT   
3132 O  O2    . GOA Q .   ? 0.5316 0.5279 0.4820 -0.0060 0.0057  0.0110  513 GOA A O2    
3133 MN MN    . MN  R .   ? 1.1231 1.3177 0.8502 0.1143  -0.0043 -0.1370 101 MN  T MN    
3134 O  O     . HOH S .   ? 0.6692 0.7359 0.7662 0.0389  0.0126  0.0163  601 HOH A O     
3135 O  O     . HOH S .   ? 0.5326 0.5429 0.6432 0.0002  0.1533  0.2091  602 HOH A O     
3136 O  O     . HOH S .   ? 0.6036 0.6291 0.5239 0.0167  0.0217  0.0384  603 HOH A O     
3137 O  O     . HOH S .   ? 0.5011 0.4736 0.4348 0.0195  -0.0234 -0.0578 604 HOH A O     
3138 O  O     . HOH S .   ? 0.5008 0.6058 0.3993 0.0366  -0.0543 -0.0191 605 HOH A O     
3139 O  O     . HOH S .   ? 0.5343 0.5585 0.5047 0.0265  -0.0057 -0.0013 606 HOH A O     
3140 O  O     . HOH S .   ? 0.6673 0.7218 0.6323 -0.0175 -0.0464 -0.1230 607 HOH A O     
3141 O  O     . HOH S .   ? 0.3298 0.3198 0.2627 -0.0116 0.0036  -0.0049 608 HOH A O     
3142 O  O     . HOH S .   ? 0.5264 0.5563 0.5756 -0.0272 -0.0200 -0.0583 609 HOH A O     
3143 O  O     . HOH S .   ? 0.3341 0.3370 0.3821 -0.0253 0.0077  -0.0210 610 HOH A O     
3144 O  O     B HOH S .   ? 0.3186 0.2542 0.2597 0.0109  -0.0182 -0.0121 611 HOH A O     
3145 O  O     . HOH S .   ? 0.5515 0.6265 0.6613 -0.0575 0.0327  -0.0116 612 HOH A O     
3146 O  O     . HOH S .   ? 0.5280 0.6453 0.7005 0.0317  0.0477  -0.0236 613 HOH A O     
3147 O  O     . HOH S .   ? 0.6119 0.6590 0.7427 -0.0697 -0.0040 -0.0407 614 HOH A O     
3148 O  O     . HOH S .   ? 0.5385 0.7113 0.6755 -0.0285 -0.1107 -0.1393 615 HOH A O     
3149 O  O     . HOH S .   ? 0.7632 0.7493 0.6037 0.0082  -0.0257 0.0305  616 HOH A O     
3150 O  O     . HOH S .   ? 0.6422 0.6048 0.7644 0.0016  0.0466  -0.1928 617 HOH A O     
3151 O  O     . HOH S .   ? 0.5208 0.4510 0.7150 0.0205  0.0657  -0.1430 618 HOH A O     
3152 O  O     . HOH S .   ? 0.6910 0.7523 0.8114 -0.0216 0.0552  0.0312  619 HOH A O     
3153 O  O     . HOH S .   ? 0.7820 0.7172 0.6502 -0.0226 0.0271  0.0754  620 HOH A O     
3154 O  O     . HOH S .   ? 0.3792 0.3305 0.4232 -0.0626 0.0154  0.0037  621 HOH A O     
3155 O  O     . HOH S .   ? 0.5999 0.6536 0.4965 -0.0083 -0.0322 -0.1185 622 HOH A O     
3156 O  O     A HOH S .   ? 0.3303 0.4669 0.3003 0.0474  0.0949  0.0299  623 HOH A O     
3157 O  O     B HOH S .   ? 0.3371 0.4892 0.3139 0.0566  0.0991  0.0147  623 HOH A O     
3158 O  O     . HOH S .   ? 0.6360 0.4655 0.6754 0.0891  -0.0504 0.0467  624 HOH A O     
3159 O  O     . HOH S .   ? 0.3658 0.4566 0.4425 0.0812  0.0066  -0.0382 625 HOH A O     
3160 O  O     . HOH S .   ? 0.3648 0.3179 0.3797 -0.0643 0.0412  0.0361  626 HOH A O     
3161 O  O     . HOH S .   ? 0.4411 0.4377 0.5687 0.0391  0.0474  -0.0136 627 HOH A O     
3162 O  O     . HOH S .   ? 0.3215 0.3141 0.2668 -0.0099 0.0021  0.0009  628 HOH A O     
3163 O  O     . HOH S .   ? 0.4186 0.4605 0.3580 0.0228  -0.0103 0.0328  629 HOH A O     
3164 O  O     . HOH S .   ? 0.4203 0.4361 0.4004 0.0215  0.0081  0.0436  630 HOH A O     
3165 O  O     . HOH S .   ? 0.6121 0.6301 0.7012 -0.0245 0.0399  0.0238  631 HOH A O     
3166 O  O     . HOH S .   ? 0.5594 0.5470 0.6298 0.0053  0.0981  0.1491  632 HOH A O     
3167 O  O     . HOH S .   ? 0.3894 0.5041 0.5225 -0.0043 0.0634  0.0233  633 HOH A O     
3168 O  O     . HOH S .   ? 0.5817 0.6727 0.7289 0.1571  0.0276  -0.1224 634 HOH A O     
3169 O  O     . HOH S .   ? 0.5132 0.4961 0.4455 -0.0342 0.0316  0.0254  635 HOH A O     
3170 O  O     . HOH S .   ? 0.4971 0.4588 0.4005 -0.0327 0.0327  0.0449  636 HOH A O     
3171 O  O     . HOH S .   ? 0.2752 0.3683 0.3093 -0.0025 -0.0298 -0.0162 637 HOH A O     
3172 O  O     . HOH S .   ? 0.3607 0.4452 0.4249 -0.0152 0.0042  -0.0103 638 HOH A O     
3173 O  O     . HOH S .   ? 0.3919 0.2839 0.3332 0.0241  -0.0258 0.0383  639 HOH A O     
3174 O  O     . HOH S .   ? 0.4846 0.4973 0.4099 -0.0188 0.0442  -0.0057 640 HOH A O     
3175 O  O     . HOH S .   ? 0.3439 0.3240 0.2673 -0.0141 0.0009  0.0105  641 HOH A O     
3176 O  O     . HOH S .   ? 0.3928 0.3879 0.2825 -0.0160 0.0218  -0.0002 642 HOH A O     
3177 O  O     . HOH S .   ? 0.5169 0.3549 0.4657 0.0365  -0.0276 0.0909  643 HOH A O     
3178 O  O     . HOH S .   ? 0.5031 0.4375 0.5184 0.0819  -0.0450 0.0043  644 HOH A O     
3179 O  O     . HOH S .   ? 0.4425 0.4870 0.4738 0.0637  -0.0188 -0.0179 645 HOH A O     
3180 O  O     . HOH S .   ? 0.4982 0.5915 0.3774 0.0465  0.0615  0.0562  646 HOH A O     
3181 O  O     . HOH S .   ? 0.4317 0.3091 0.3968 0.0039  -0.0162 0.0198  647 HOH A O     
3182 O  O     . HOH S .   ? 0.2775 0.3313 0.3477 0.0141  0.0385  -0.0098 648 HOH A O     
3183 O  O     . HOH S .   ? 0.6354 0.5559 0.5132 -0.0116 0.0073  0.0700  649 HOH A O     
3184 O  O     . HOH S .   ? 0.3776 0.3853 0.5038 -0.0306 0.0551  0.0370  650 HOH A O     
3185 O  O     . HOH S .   ? 0.7186 0.6096 0.9101 0.0161  0.0693  0.0861  651 HOH A O     
3186 O  O     . HOH S .   ? 0.6811 0.8683 0.5938 0.0591  0.1690  0.1247  652 HOH A O     
3187 O  O     . HOH S .   ? 0.4125 0.5017 0.3866 0.0224  -0.0386 0.0040  653 HOH A O     
3188 O  O     . HOH S .   ? 0.3687 0.4542 0.3999 0.0043  -0.0193 -0.0032 654 HOH A O     
3189 O  O     . HOH S .   ? 0.4389 0.4963 0.4377 -0.0002 0.0860  -0.0559 655 HOH A O     
3190 O  O     . HOH S .   ? 0.4692 0.3595 0.3894 0.0027  -0.0111 0.0567  656 HOH A O     
3191 O  O     . HOH S .   ? 0.7043 0.5067 0.7519 0.0459  -0.0300 0.0107  657 HOH A O     
3192 O  O     . HOH S .   ? 0.3685 0.3871 0.3029 -0.0006 -0.0125 0.0018  658 HOH A O     
3193 O  O     . HOH S .   ? 0.5219 0.5822 0.6846 0.0636  0.0229  0.0167  659 HOH A O     
3194 O  O     . HOH S .   ? 0.3504 0.3293 0.2649 0.0037  -0.0123 0.0122  660 HOH A O     
3195 O  O     . HOH S .   ? 0.5703 0.5503 0.6871 -0.0754 -0.0042 -0.0395 661 HOH A O     
3196 O  O     . HOH S .   ? 0.3842 0.3271 0.2628 0.0043  -0.0156 0.0453  662 HOH A O     
3197 O  O     . HOH S .   ? 0.4507 0.6672 0.5753 0.0587  0.1176  -0.0044 663 HOH A O     
3198 O  O     . HOH S .   ? 0.7095 0.6863 0.5759 -0.0160 0.0145  0.0269  664 HOH A O     
3199 O  O     . HOH S .   ? 0.5024 0.4468 0.3773 0.0185  -0.0295 0.0531  665 HOH A O     
3200 O  O     . HOH S .   ? 0.5541 0.5509 0.4374 0.0194  -0.0447 0.0212  666 HOH A O     
3201 O  O     . HOH S .   ? 0.4548 0.5438 0.5084 0.0220  0.0238  0.0003  667 HOH A O     
3202 O  O     . HOH S .   ? 0.4078 0.4054 0.2732 -0.0043 -0.0133 0.0012  668 HOH A O     
3203 O  O     . HOH S .   ? 0.6341 0.6900 0.7556 -0.0586 -0.0383 -0.0753 669 HOH A O     
3204 O  O     . HOH S .   ? 0.6617 0.7117 0.5516 0.0315  0.0230  0.0257  670 HOH A O     
3205 O  O     . HOH S .   ? 0.4918 0.5448 0.6121 -0.0738 0.0413  -0.0050 671 HOH A O     
3206 O  O     . HOH S .   ? 0.6491 0.6090 0.7371 -0.0535 -0.0353 -0.0826 672 HOH A O     
3207 O  O     . HOH S .   ? 0.5948 0.5158 0.6249 -0.0626 0.0256  0.0273  673 HOH A O     
3208 O  O     . HOH S .   ? 0.3909 0.4000 0.4368 -0.0209 0.0175  0.0020  674 HOH A O     
3209 O  O     . HOH S .   ? 0.3686 0.3273 0.2877 0.0150  -0.0209 0.0159  675 HOH A O     
3210 O  O     . HOH S .   ? 0.4135 0.5233 0.3498 0.0778  0.0547  -0.0489 676 HOH A O     
3211 O  O     . HOH S .   ? 0.4979 0.5363 0.5760 -0.0450 -0.0499 -0.0866 677 HOH A O     
3212 O  O     . HOH S .   ? 0.4142 0.4982 0.4786 -0.0122 0.0693  -0.0196 678 HOH A O     
3213 O  O     . HOH S .   ? 0.3306 0.3468 0.4044 -0.0311 -0.0031 -0.0433 679 HOH A O     
3214 O  O     . HOH S .   ? 0.2810 0.2918 0.2453 -0.0091 0.0401  -0.0178 680 HOH A O     
3215 O  O     . HOH S .   ? 0.5334 0.5520 0.5484 0.1210  0.0140  -0.1637 681 HOH A O     
3216 O  O     . HOH S .   ? 0.5007 0.4269 0.7808 -0.0545 0.0605  -0.0106 682 HOH A O     
3217 O  O     . HOH S .   ? 0.6178 0.6656 0.5243 0.0273  -0.0520 -0.1102 683 HOH A O     
3218 O  O     . HOH S .   ? 0.4051 0.4092 0.2994 -0.0140 0.0275  -0.0175 684 HOH A O     
3219 O  O     . HOH S .   ? 0.3866 0.4953 0.3194 0.0660  0.0575  -0.0250 685 HOH A O     
3220 O  O     . HOH S .   ? 0.5792 0.7904 0.6722 0.0196  0.2312  0.1612  686 HOH A O     
3221 O  O     . HOH S .   ? 0.6611 0.6907 0.5878 0.0176  -0.0043 0.0307  687 HOH A O     
3222 O  O     B HOH S .   ? 0.5439 0.6084 0.6673 -0.0018 0.2042  0.2421  688 HOH A O     
3223 O  O     . HOH S .   ? 0.5477 0.6539 0.6685 0.0048  0.0580  -0.0237 689 HOH A O     
3224 O  O     . HOH S .   ? 0.5964 0.5722 0.4428 -0.0066 -0.0002 0.0320  690 HOH A O     
3225 O  O     A HOH S .   ? 0.5474 0.6945 0.3404 0.0868  0.0421  -0.0348 691 HOH A O     
3226 O  O     B HOH S .   ? 0.5578 0.6864 0.3728 0.0789  0.0380  -0.0346 691 HOH A O     
3227 O  O     . HOH S .   ? 0.4136 0.3527 0.3461 -0.0048 -0.0125 0.0031  692 HOH A O     
3228 O  O     . HOH S .   ? 0.3835 0.3222 0.3701 0.0792  -0.0595 0.0356  693 HOH A O     
3229 O  O     . HOH S .   ? 0.6673 0.5922 0.6853 -0.0080 -0.0391 -0.0974 694 HOH A O     
3230 O  O     . HOH S .   ? 0.3926 0.4558 0.4348 -0.0208 0.0313  -0.0047 695 HOH A O     
3231 O  O     A HOH S .   ? 0.3283 0.5629 0.4867 0.0360  0.1533  0.0338  696 HOH A O     
3232 O  O     B HOH S .   ? 0.3372 0.5773 0.4691 0.0502  0.1527  0.0215  696 HOH A O     
3233 O  O     . HOH S .   ? 0.4963 0.6008 0.6051 0.0011  0.0295  -0.0123 697 HOH A O     
3234 O  O     . HOH S .   ? 0.3637 0.3323 0.2944 0.0380  -0.0434 0.0271  698 HOH A O     
3235 O  O     . HOH S .   ? 0.6622 0.7718 0.7899 0.1270  0.0231  -0.0823 699 HOH A O     
3236 O  O     . HOH S .   ? 0.7262 0.7409 0.6279 -0.0135 0.0423  -0.0259 700 HOH A O     
3237 O  O     . HOH S .   ? 0.4975 0.4791 0.4410 0.0291  -0.0261 0.0081  701 HOH A O     
3238 O  O     . HOH S .   ? 0.5641 0.6418 0.6433 -0.0351 -0.0747 -0.1152 702 HOH A O     
3239 O  O     . HOH S .   ? 0.5612 0.5877 0.5918 0.0171  0.1229  0.1826  703 HOH A O     
3240 O  O     . HOH S .   ? 0.3482 0.3760 0.6219 -0.0646 0.0459  -0.0164 704 HOH A O     
3241 O  O     A HOH S .   ? 0.5375 0.7358 0.8058 -0.0192 0.1565  0.0693  705 HOH A O     
3242 O  O     . HOH S .   ? 0.4318 0.4229 0.3546 0.0160  -0.0060 -0.0007 706 HOH A O     
3243 O  O     . HOH S .   ? 0.5664 0.5601 0.4582 -0.0199 0.0283  0.0097  707 HOH A O     
3244 O  O     . HOH S .   ? 0.4877 0.5378 0.4720 0.0258  0.0160  0.0023  708 HOH A O     
3245 O  O     . HOH S .   ? 0.7601 0.8894 0.6646 0.0514  0.1439  0.1667  709 HOH A O     
3246 O  O     . HOH S .   ? 0.3318 0.2565 0.3218 -0.0322 -0.0079 -0.0080 710 HOH A O     
3247 O  O     . HOH S .   ? 0.3696 0.2744 0.3280 0.0419  -0.0339 0.0253  711 HOH A O     
3248 O  O     . HOH S .   ? 0.4121 0.3705 0.4736 -0.0794 0.0504  0.0343  712 HOH A O     
3249 O  O     . HOH S .   ? 0.3674 0.3641 0.6211 -0.0635 0.0270  -0.0525 713 HOH A O     
3250 O  O     . HOH S .   ? 0.5133 0.4800 0.5942 -0.0098 0.0325  -0.1341 714 HOH A O     
3251 O  O     . HOH S .   ? 0.3458 0.3420 0.3719 -0.0123 0.0334  0.0325  715 HOH A O     
3252 O  O     . HOH S .   ? 0.4610 0.4249 0.3952 -0.0494 0.0573  0.0594  716 HOH A O     
3253 O  O     . HOH S .   ? 0.3883 0.3683 0.3078 0.0076  -0.0102 0.0082  717 HOH A O     
3254 O  O     . HOH S .   ? 0.6331 0.6327 0.7308 0.0515  0.0231  0.0508  718 HOH A O     
3255 O  O     . HOH S .   ? 0.3087 0.3021 0.2316 0.0017  0.0004  0.0127  719 HOH A O     
3256 O  O     . HOH S .   ? 0.5435 0.5658 0.5701 0.0268  0.0123  0.0332  720 HOH A O     
3257 O  O     . HOH S .   ? 0.4618 0.5545 0.5194 0.0223  -0.0127 0.0100  721 HOH A O     
3258 O  O     . HOH S .   ? 0.4254 0.3565 0.6529 0.0391  0.0765  -0.1304 722 HOH A O     
3259 O  O     . HOH S .   ? 0.4899 0.4794 0.7255 -0.0584 -0.0181 -0.2083 723 HOH A O     
3260 O  O     . HOH S .   ? 0.5886 0.5511 0.4575 -0.0217 0.0235  0.0466  724 HOH A O     
3261 O  O     . HOH S .   ? 0.3440 0.3594 0.3088 0.0116  0.0058  0.0301  725 HOH A O     
3262 O  O     . HOH S .   ? 0.3779 0.4910 0.6614 -0.0487 0.0973  0.0402  726 HOH A O     
3263 O  O     . HOH S .   ? 0.7144 0.5650 0.8620 0.1328  -0.0310 -0.1022 727 HOH A O     
3264 O  O     . HOH S .   ? 0.6663 0.7481 0.7891 -0.0563 0.0130  -0.0243 728 HOH A O     
3265 O  O     . HOH S .   ? 0.6307 0.5531 0.6492 0.0704  -0.0240 -0.1436 729 HOH A O     
3266 O  O     . HOH S .   ? 0.7495 0.8166 0.7774 -0.0165 -0.0526 -0.0726 730 HOH A O     
3267 O  O     . HOH S .   ? 0.3933 0.3846 0.3206 0.0243  -0.0068 -0.0104 731 HOH A O     
3268 O  O     . HOH S .   ? 0.3852 0.4112 0.2820 0.0490  -0.0157 -0.0907 732 HOH A O     
3269 O  O     . HOH S .   ? 0.4108 0.4991 0.5875 0.0478  0.0460  -0.0194 733 HOH A O     
3270 O  O     . HOH S .   ? 0.5199 0.4035 0.4444 0.0262  -0.0268 0.0645  734 HOH A O     
3271 O  O     . HOH S .   ? 0.3947 0.3592 0.4124 -0.0577 0.0239  0.0152  735 HOH A O     
3272 O  O     . HOH S .   ? 0.4709 0.5065 0.6003 0.0360  0.0843  -0.0836 736 HOH A O     
3273 O  O     . HOH S .   ? 0.4178 0.3998 0.4983 0.0326  0.0317  0.0304  737 HOH A O     
3274 O  O     . HOH S .   ? 0.5920 0.8022 0.6803 0.0383  -0.0936 -0.0319 738 HOH A O     
3275 O  O     . HOH S .   ? 0.6367 0.5679 0.6676 0.0888  -0.0168 -0.1419 739 HOH A O     
3276 O  O     . HOH S .   ? 0.6624 0.7041 0.5461 0.0035  -0.0500 -0.0364 740 HOH A O     
3277 O  O     . HOH S .   ? 0.6249 0.7573 0.7399 0.0227  0.0433  -0.0010 741 HOH A O     
3278 O  O     . HOH S .   ? 0.7735 0.8862 0.6766 0.1407  0.0324  -0.2387 742 HOH A O     
3279 O  O     . HOH S .   ? 0.5836 0.5791 0.5387 0.0319  -0.0186 -0.0004 743 HOH A O     
3280 O  O     . HOH S .   ? 0.3517 0.3586 0.3113 -0.0326 0.0346  0.0131  744 HOH A O     
3281 O  O     B HOH S .   ? 0.4330 0.4659 0.5449 -0.0292 0.0302  0.0059  745 HOH A O     
3282 O  O     . HOH S .   ? 0.6678 0.7695 0.6717 0.1064  0.0471  -0.0940 746 HOH A O     
3283 O  O     . HOH S .   ? 0.2618 0.2849 0.2154 -0.0061 -0.0101 0.0013  747 HOH A O     
3284 O  O     . HOH S .   ? 0.4411 0.3392 0.6894 -0.0310 0.0469  -0.0727 748 HOH A O     
3285 O  O     . HOH S .   ? 0.4437 0.6267 0.5589 0.0126  -0.0682 -0.0388 749 HOH A O     
3286 O  O     . HOH S .   ? 0.5728 0.7498 0.9188 -0.0496 0.1983  0.1173  750 HOH A O     
3287 O  O     A HOH S .   ? 0.2923 0.2829 0.2489 -0.0058 0.0161  0.0090  751 HOH A O     
3288 O  O     . HOH S .   ? 0.4373 0.5618 0.5768 -0.0383 -0.0237 -0.0456 752 HOH A O     
3289 O  O     . HOH S .   ? 0.4483 0.5482 0.4065 0.0242  -0.0500 -0.0088 753 HOH A O     
3290 O  O     . HOH S .   ? 0.5402 0.6090 0.7804 -0.0519 0.0390  -0.0117 754 HOH A O     
3291 O  O     . HOH S .   ? 0.4984 0.5575 0.7969 -0.0660 0.0544  -0.0076 755 HOH A O     
3292 O  O     . HOH S .   ? 0.4647 0.4842 0.4039 -0.0064 0.0514  -0.0561 756 HOH A O     
3293 O  O     . HOH S .   ? 0.5798 0.5400 0.4469 0.0024  -0.0154 0.0381  757 HOH A O     
3294 O  O     . HOH S .   ? 0.7681 0.9275 0.6419 0.0607  -0.0794 -0.0216 758 HOH A O     
3295 O  O     . HOH S .   ? 0.7214 0.8829 0.7677 0.1170  0.0779  -0.0904 759 HOH A O     
3296 O  O     . HOH S .   ? 0.4291 0.4971 0.3639 0.0300  0.0481  0.0312  760 HOH A O     
3297 O  O     . HOH S .   ? 0.4232 0.4557 0.4112 0.0120  0.0026  0.0216  761 HOH A O     
3298 O  O     . HOH S .   ? 0.3358 0.3319 0.2534 0.0104  -0.0022 0.0054  762 HOH A O     
3299 O  O     . HOH S .   ? 0.5742 0.5031 0.7402 0.0047  0.1228  0.1977  763 HOH A O     
3300 O  O     . HOH S .   ? 0.5398 0.5339 0.4704 -0.0005 -0.0048 0.0091  764 HOH A O     
3301 O  O     A HOH S .   ? 0.3754 0.4082 0.3903 0.0124  0.0802  -0.1060 765 HOH A O     
3302 O  O     B HOH S .   ? 0.3654 0.3919 0.3712 0.0076  0.0717  -0.0871 765 HOH A O     
3303 O  O     . HOH S .   ? 0.6440 0.5429 0.8828 0.0380  0.0640  -0.0350 766 HOH A O     
3304 O  O     . HOH S .   ? 0.4303 0.6424 0.5149 0.0421  0.1530  0.0455  767 HOH A O     
3305 O  O     . HOH S .   ? 0.5352 0.6741 0.4301 0.0535  0.1163  0.0957  768 HOH A O     
3306 O  O     . HOH S .   ? 0.4920 0.6436 0.4598 0.0804  0.0844  -0.0337 769 HOH A O     
3307 O  O     . HOH S .   ? 0.4390 0.4298 0.3645 0.0065  -0.0154 0.0092  770 HOH A O     
3308 O  O     . HOH S .   ? 0.5932 0.6760 0.7340 -0.0275 -0.0146 -0.0423 771 HOH A O     
3309 O  O     . HOH S .   ? 0.6381 0.7030 0.8417 -0.0521 -0.0183 -0.0840 772 HOH A O     
3310 O  O     . HOH S .   ? 0.5913 0.6174 0.5721 -0.0297 0.0414  0.0059  773 HOH A O     
3311 O  O     . HOH S .   ? 0.5690 0.5566 0.4605 -0.0254 0.0337  0.0238  774 HOH A O     
3312 O  O     . HOH S .   ? 0.5640 0.5801 0.5509 0.0138  0.0097  0.0284  775 HOH A O     
3313 O  O     . HOH S .   ? 0.5651 0.6715 0.6426 0.0316  0.0201  -0.0084 776 HOH A O     
3314 O  O     A HOH S .   ? 0.4438 0.5790 0.2361 0.0793  0.0297  -0.0216 777 HOH A O     
3315 O  O     B HOH S .   ? 0.4569 0.5955 0.2462 0.0780  0.0396  0.0099  777 HOH A O     
3316 O  O     . HOH S .   ? 0.4505 0.3657 0.4745 -0.0396 -0.0115 -0.0233 778 HOH A O     
3317 O  O     . HOH S .   ? 0.6405 0.5599 0.9238 -0.0499 0.0812  0.0381  779 HOH A O     
3318 O  O     . HOH S .   ? 0.5630 0.6061 0.4930 0.1017  0.0020  -0.1880 780 HOH A O     
3319 O  O     . HOH S .   ? 0.5738 0.4703 0.8001 -0.0203 0.0738  0.0511  781 HOH A O     
3320 O  O     . HOH S .   ? 0.4994 0.5669 0.5902 0.0230  0.0947  -0.0780 782 HOH A O     
3321 O  O     . HOH S .   ? 0.5177 0.5609 0.5071 0.0319  0.0025  -0.0047 783 HOH A O     
3322 O  O     A HOH S .   ? 0.3797 0.4243 0.2713 0.0289  0.0205  0.0379  784 HOH A O     
3323 O  O     B HOH S .   ? 0.3674 0.4255 0.2364 0.0370  0.0113  0.0283  784 HOH A O     
3324 O  O     . HOH S .   ? 0.6101 0.6192 0.4819 -0.0117 0.0202  -0.0248 785 HOH A O     
3325 O  O     . HOH S .   ? 0.6419 0.7641 0.6897 0.1118  0.0527  -0.0878 786 HOH A O     
3326 O  O     . HOH S .   ? 0.5942 0.5036 0.7237 0.1386  -0.0300 -0.0808 787 HOH A O     
3327 O  O     . HOH S .   ? 0.6387 0.5824 0.7703 0.0039  0.1023  0.1620  788 HOH A O     
3328 O  O     . HOH S .   ? 0.3255 0.3184 0.2865 -0.0421 0.0390  0.0239  789 HOH A O     
3329 O  O     B HOH S .   ? 0.4375 0.4747 0.5446 0.0020  0.1797  0.2326  790 HOH A O     
3330 O  O     . HOH S .   ? 0.6122 0.6523 0.6284 0.0306  0.0011  0.0374  791 HOH A O     
3331 O  O     . HOH S .   ? 0.4011 0.3948 0.7486 -0.0751 0.1001  0.0463  792 HOH A O     
3332 O  O     A HOH S .   ? 0.5028 0.5638 0.4843 0.0325  0.1386  0.2042  793 HOH A O     
3333 O  O     . HOH S .   ? 0.5877 0.6435 0.5174 0.0268  0.0603  0.0805  794 HOH A O     
3334 O  O     . HOH S .   ? 0.4121 0.3801 0.4174 0.0740  -0.0427 0.0018  795 HOH A O     
3335 O  O     . HOH S .   ? 0.5452 0.5783 0.6538 -0.0709 0.0183  -0.0168 796 HOH A O     
3336 O  O     . HOH S .   ? 0.5360 0.4561 0.5772 -0.0375 -0.0236 -0.0528 797 HOH A O     
3337 O  O     . HOH S .   ? 0.5069 0.5787 0.5692 0.0727  -0.0095 -0.0271 798 HOH A O     
3338 O  O     . HOH S .   ? 0.7668 0.7818 0.7427 -0.0002 0.0556  -0.0782 799 HOH A O     
3339 O  O     . HOH S .   ? 0.5034 0.6149 0.8548 -0.0662 0.1054  0.0380  800 HOH A O     
3340 O  O     . HOH S .   ? 0.7309 0.7319 0.6747 0.0178  -0.0116 0.0042  801 HOH A O     
3341 O  O     A HOH S .   ? 0.6092 0.7800 0.6218 0.0571  0.1097  0.0126  802 HOH A O     
3342 O  O     . HOH S .   ? 0.5779 0.7259 1.0598 -0.0918 0.0971  0.0014  803 HOH A O     
3343 O  O     . HOH S .   ? 0.3967 0.4141 0.4224 -0.0070 0.0481  0.0517  804 HOH A O     
3344 O  O     A HOH S .   ? 0.3338 0.3548 0.2365 0.0221  0.0046  0.0021  805 HOH A O     
3345 O  O     B HOH S .   ? 0.3433 0.3579 0.2575 0.0183  0.0056  0.0056  805 HOH A O     
3346 O  O     . HOH S .   ? 0.6045 0.6250 0.8458 -0.0633 -0.0395 -0.2363 806 HOH A O     
3347 O  O     . HOH S .   ? 0.5454 0.6377 0.6642 -0.0094 0.0435  0.0144  807 HOH A O     
3348 O  O     . HOH S .   ? 0.7606 0.7754 0.7188 0.0004  -0.0168 -0.0023 808 HOH A O     
3349 O  O     . HOH S .   ? 0.6247 0.6070 0.5565 0.0282  -0.0357 0.0170  809 HOH A O     
3350 O  O     . HOH S .   ? 0.7039 0.6806 0.6319 0.0179  -0.0202 0.0100  810 HOH A O     
3351 O  O     . HOH S .   ? 0.6483 0.6612 0.7577 -0.0590 -0.0425 -0.0891 811 HOH A O     
3352 O  O     A HOH S .   ? 0.4839 0.4397 0.5100 -0.0157 -0.0500 -0.1176 812 HOH A O     
3353 O  O     B HOH S .   ? 0.4882 0.4530 0.4928 -0.0024 -0.0523 -0.1296 812 HOH A O     
3354 O  O     . HOH S .   ? 0.4747 0.3727 0.4639 -0.0303 -0.0033 0.0088  813 HOH A O     
3355 O  O     . HOH S .   ? 0.7219 0.6733 0.8113 -0.0712 0.0042  -0.0207 814 HOH A O     
3356 O  O     . HOH S .   ? 0.7349 0.7013 0.7395 0.0948  -0.0119 -0.1783 815 HOH A O     
3357 O  O     . HOH S .   ? 0.7263 0.7672 0.9854 -0.0669 -0.0579 -0.2826 816 HOH A O     
3358 O  O     . HOH S .   ? 0.4885 0.3684 0.4308 0.0105  -0.0175 0.0438  817 HOH A O     
3359 O  O     . HOH S .   ? 0.7652 0.5496 0.7910 0.0516  -0.0312 0.0711  818 HOH A O     
3360 O  O     A HOH S .   ? 0.2621 0.2585 0.1996 -0.0064 -0.0053 0.0022  819 HOH A O     
3361 O  O     B HOH S .   ? 0.2844 0.2864 0.2388 -0.0066 -0.0028 0.0024  819 HOH A O     
3362 O  O     A HOH S .   ? 0.4971 0.5948 0.4361 0.1157  0.0424  -0.1429 820 HOH A O     
3363 O  O     B HOH S .   ? 0.4600 0.5500 0.4341 0.1193  0.0427  -0.1385 820 HOH A O     
3364 O  O     . HOH S .   ? 0.4891 0.5518 0.5032 0.0453  -0.0133 0.0498  821 HOH A O     
3365 O  O     . HOH S .   ? 0.7263 0.7758 0.6927 -0.0003 0.0827  -0.0677 822 HOH A O     
3366 O  O     A HOH S .   ? 0.4930 0.4217 0.3620 0.0091  -0.0166 0.0644  823 HOH A O     
3367 O  O     B HOH S .   ? 0.5118 0.4316 0.3847 0.0183  -0.0239 0.0727  823 HOH A O     
3368 O  O     . HOH S .   ? 0.6407 0.7367 0.7309 -0.0199 0.0202  -0.0124 824 HOH A O     
3369 O  O     . HOH S .   ? 0.6161 0.6546 0.5438 0.0279  0.0198  0.0057  825 HOH A O     
3370 O  O     . HOH S .   ? 0.5704 0.6719 0.6353 0.0018  -0.0150 -0.0081 826 HOH A O     
3371 O  O     . HOH S .   ? 0.6894 0.7719 0.7800 -0.0140 -0.0327 -0.0429 827 HOH A O     
3372 O  O     . HOH S .   ? 0.6292 0.7737 0.9047 -0.0373 0.1047  0.0410  828 HOH A O     
3373 O  O     . HOH S .   ? 0.6536 0.6973 0.6178 0.0144  0.0569  0.0682  829 HOH A O     
3374 O  O     . HOH S .   ? 0.5910 0.5847 0.6295 0.0884  -0.0422 -0.0101 830 HOH A O     
3375 O  O     . HOH S .   ? 0.7904 0.7531 0.6489 0.0164  -0.0309 0.0476  831 HOH A O     
3376 O  O     . HOH S .   ? 0.7278 0.8342 0.7556 0.0295  -0.0347 0.0120  832 HOH A O     
3377 O  O     . HOH S .   ? 0.6664 0.8496 0.6876 0.0713  0.1084  -0.0111 833 HOH A O     
3378 O  O     . HOH S .   ? 0.5610 0.5543 0.4859 0.0060  -0.0034 0.0094  834 HOH A O     
3379 O  O     A HOH S .   ? 0.5183 0.6038 0.4507 0.0466  0.1380  0.2056  835 HOH A O     
3380 O  O     . HOH S .   ? 0.5872 0.5921 0.5091 -0.0226 0.0383  0.0057  836 HOH A O     
3381 O  O     . HOH S .   ? 0.6579 0.7577 0.6435 0.0344  -0.0400 0.0178  837 HOH A O     
3382 O  O     . HOH S .   ? 0.5932 0.5210 0.6000 -0.0637 0.0431  0.0504  838 HOH A O     
3383 O  O     . HOH S .   ? 0.5391 0.4864 0.5577 0.0912  -0.0578 0.0194  839 HOH A O     
3384 O  O     . HOH S .   ? 0.5984 0.5661 0.4391 0.0017  -0.0114 0.0440  840 HOH A O     
3385 O  O     . HOH S .   ? 0.4328 0.4893 0.4202 -0.0091 0.0813  -0.0359 841 HOH A O     
3386 O  O     . HOH S .   ? 0.7475 0.7271 0.8055 0.1036  -0.0494 -0.0081 842 HOH A O     
3387 O  O     . HOH S .   ? 0.7282 0.7122 0.5888 0.0184  -0.0394 0.0339  843 HOH A O     
3388 O  O     . HOH S .   ? 0.7426 0.6851 0.8921 0.0113  0.1407  0.2348  844 HOH A O     
3389 O  O     . HOH S .   ? 0.6757 0.7533 0.6973 0.0046  0.1028  -0.0672 845 HOH A O     
3390 O  O     . HOH S .   ? 0.6470 0.5867 0.5885 -0.0506 0.0517  0.0688  846 HOH A O     
3391 O  O     . HOH S .   ? 0.6120 0.7342 0.7269 0.0101  0.0506  0.0099  847 HOH A O     
3392 O  O     . HOH S .   ? 0.5223 0.5157 0.3896 -0.0135 0.0139  0.0047  848 HOH A O     
3393 O  O     . HOH S .   ? 0.4361 0.4877 0.5674 -0.0841 0.0641  0.0086  849 HOH A O     
3394 O  O     . HOH S .   ? 0.7686 0.8970 0.6365 0.0574  0.1024  0.1024  850 HOH A O     
3395 O  O     . HOH S .   ? 0.7108 0.5632 0.6886 -0.0038 -0.0098 0.0385  851 HOH A O     
3396 O  O     . HOH S .   ? 0.6707 0.6774 0.6045 -0.0292 0.0434  0.0133  852 HOH A O     
3397 O  O     . HOH S .   ? 0.6584 0.7680 0.5185 0.0550  0.0770  0.0859  853 HOH A O     
3398 O  O     . HOH S .   ? 0.5351 0.5986 0.5560 -0.0171 0.0699  -0.0157 854 HOH A O     
3399 O  O     . HOH S .   ? 0.7161 0.7951 0.7810 -0.0269 0.0495  -0.0078 855 HOH A O     
3400 O  O     . HOH S .   ? 0.5054 0.4436 0.6008 -0.0878 0.0456  0.0290  856 HOH A O     
3401 O  O     . HOH S .   ? 0.7468 0.8499 0.8941 0.1720  0.0441  -0.1553 857 HOH A O     
3402 O  O     . HOH S .   ? 0.7009 0.8008 0.6988 -0.0056 -0.0851 -0.0945 858 HOH A O     
3403 O  O     . HOH T .   ? 0.5381 0.5883 0.5274 0.0497  -0.0090 0.0683  201 HOH T O     
3404 O  O     . HOH T .   ? 0.5559 0.7346 0.2920 0.1012  -0.0085 -0.0931 202 HOH T O     
3405 O  O     . HOH T .   ? 0.7713 0.9383 0.5269 0.1022  0.0028  -0.1133 203 HOH T O     
3406 O  O     . HOH T .   ? 0.6046 0.6819 0.4671 0.0539  0.0015  0.0686  204 HOH T O     
3407 O  O     . HOH T .   ? 0.5586 0.6468 0.3931 0.0510  -0.0084 0.0007  205 HOH T O     
3408 O  O     . HOH T .   ? 0.5710 0.6528 0.4236 0.0521  -0.0397 -0.1076 206 HOH T O     
3409 O  O     . HOH T .   ? 0.4951 0.5458 0.4053 0.0653  0.0221  0.1358  207 HOH T O     
3410 O  O     . HOH T .   ? 0.7606 0.8711 0.6894 0.0496  -0.0483 0.0265  208 HOH T O     
3411 O  O     . HOH T .   ? 0.5738 0.6651 0.4938 0.0308  -0.0453 -0.0036 209 HOH T O     
3412 O  O     . HOH T .   ? 0.6642 0.8377 0.4202 0.1115  -0.0062 -0.1645 210 HOH T O     
3413 O  O     . HOH T .   ? 0.3580 0.4300 0.2801 0.0167  -0.0476 -0.0368 211 HOH T O     
3414 O  O     . HOH T .   ? 0.6221 0.6875 0.4889 0.0431  0.0196  0.0574  212 HOH T O     
3415 O  O     . HOH T .   ? 0.5751 0.6124 0.5139 0.0617  0.0179  0.1289  213 HOH T O     
3416 O  O     . HOH T .   ? 0.4029 0.4328 0.2916 0.0264  -0.0201 -0.0403 214 HOH T O     
3417 O  O     . HOH T .   ? 0.3974 0.4603 0.2583 0.0477  -0.0247 -0.0803 215 HOH T O     
3418 O  O     . HOH T .   ? 0.5940 0.7625 0.3380 0.0951  0.0118  -0.0424 216 HOH T O     
3419 O  O     A HOH T .   ? 0.4033 0.4836 0.3646 0.0495  -0.0275 0.0523  217 HOH T O     
3420 O  O     B HOH T .   ? 0.3832 0.4679 0.3399 0.0421  -0.0320 0.0369  217 HOH T O     
3421 O  O     . HOH T .   ? 0.5456 0.6397 0.4135 0.0594  -0.0208 0.0578  218 HOH T O     
3422 O  O     . HOH T .   ? 0.5747 0.6449 0.4396 0.0507  0.0184  0.0786  219 HOH T O     
3423 O  O     . HOH T .   ? 0.6812 0.8345 0.4850 0.0760  -0.0695 -0.1655 220 HOH T O     
3424 O  O     . HOH T .   ? 0.6725 0.6789 0.6686 0.0586  0.0247  0.1311  221 HOH T O     
3425 O  O     . HOH T .   ? 0.6073 0.7357 0.3999 0.0699  -0.0197 -0.0264 222 HOH T O     
3426 O  O     . HOH T .   ? 0.6115 0.7979 0.3982 0.0839  -0.0868 -0.1830 223 HOH T O     
3427 O  O     . HOH T .   ? 0.5602 0.6561 0.4064 0.0521  -0.0230 0.0186  224 HOH T O     
3428 O  O     . HOH T .   ? 0.6512 0.7524 0.4825 0.0540  -0.0234 -0.0032 225 HOH T O     
3429 O  O     A HOH T .   ? 0.4776 0.6059 0.4224 0.0408  -0.0642 -0.0046 226 HOH T O     
3430 O  O     B HOH T .   ? 0.4721 0.6146 0.4287 0.0472  -0.0702 0.0001  226 HOH T O     
3431 O  O     . HOH U .   ? 0.5574 0.6076 0.4531 0.0356  0.0344  0.0759  101 HOH P O     
3432 O  O     . HOH U .   ? 0.5675 0.6245 0.4648 0.0456  0.0544  0.1193  102 HOH P O     
3433 O  O     . HOH U .   ? 0.5544 0.5570 0.5615 0.0319  0.0933  0.1812  103 HOH P O     
3434 O  O     . HOH U .   ? 0.3339 0.3396 0.2948 0.0213  0.0221  0.0677  104 HOH P O     
3435 O  O     . HOH U .   ? 0.3849 0.3784 0.3646 -0.0068 0.0197  0.0233  105 HOH P O     
3436 O  O     . HOH U .   ? 0.4492 0.5209 0.3603 0.0377  0.0758  0.1086  106 HOH P O     
3437 O  O     . HOH U .   ? 0.5791 0.5853 0.5902 -0.0035 0.0454  0.0570  107 HOH P O     
3438 O  O     . HOH U .   ? 0.4111 0.4367 0.3431 0.0176  0.0316  0.0577  108 HOH P O     
3439 O  O     . HOH U .   ? 0.6977 0.7614 0.5761 0.0529  0.0352  0.1093  109 HOH P O     
3440 O  O     . HOH U .   ? 0.4075 0.4259 0.3698 0.0107  0.0414  0.0649  110 HOH P O     
3441 O  O     . HOH U .   ? 0.5309 0.5177 0.5434 0.0178  0.0565  0.1105  111 HOH P O     
3442 O  O     . HOH U .   ? 0.3741 0.4027 0.3597 0.0065  0.0537  0.0674  112 HOH P O     
3443 O  O     . HOH U .   ? 0.5945 0.6027 0.5536 0.0024  0.0235  0.0357  113 HOH P O     
3444 O  O     . HOH U .   ? 0.8120 0.8914 0.6699 0.0695  0.0337  0.1344  114 HOH P O     
3445 O  O     . HOH U .   ? 0.6394 0.6413 0.5734 0.0025  0.0086  0.0199  115 HOH P O     
3446 O  O     . HOH U .   ? 0.4893 0.4966 0.5190 0.0189  0.1049  0.1721  116 HOH P O     
3447 O  O     B HOH U .   ? 0.5334 0.5763 0.4387 0.0275  0.0314  0.0569  117 HOH P O     
3448 O  O     . HOH V .   ? 0.6183 0.6459 0.5393 0.0772  -0.0268 -0.1977 101 HOH D O     
3449 O  O     A HOH V .   ? 0.6370 0.7889 0.4582 0.1021  0.0509  -0.0903 102 HOH D O     
3450 O  O     . HOH V .   ? 0.6034 0.7686 0.4440 0.1186  0.0633  -0.1241 103 HOH D O     
3451 O  O     . HOH V .   ? 0.6482 0.7407 0.5418 0.1042  0.0268  -0.1460 104 HOH D O     
3452 O  O     A HOH V .   ? 0.4404 0.5958 0.2358 0.1000  0.0409  -0.0839 105 HOH D O     
3453 O  O     . HOH V .   ? 0.6400 0.5911 0.6245 0.0415  -0.0381 -0.1557 106 HOH D O     
3454 O  O     . HOH V .   ? 0.7571 0.7997 0.6746 0.0760  -0.0460 -0.2431 107 HOH D O     
3455 O  O     . HOH V .   ? 0.4986 0.5371 0.3869 0.0502  -0.0267 -0.1139 108 HOH D O     
3456 O  O     . HOH V .   ? 0.5839 0.6136 0.4867 0.0382  -0.0380 -0.1160 109 HOH D O     
3457 O  O     . HOH V .   ? 0.5989 0.6997 0.4460 0.0985  -0.0136 -0.2016 110 HOH D O     
3458 O  O     . HOH V .   ? 0.8334 0.9810 0.7304 0.1088  0.0691  -0.0998 111 HOH D O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   127 ?   ?   ?   A . n 
A 1 2   SER 2   128 ?   ?   ?   A . n 
A 1 3   ALA 3   129 ?   ?   ?   A . n 
A 1 4   ALA 4   130 ?   ?   ?   A . n 
A 1 5   ALA 5   131 ?   ?   ?   A . n 
A 1 6   PRO 6   132 ?   ?   ?   A . n 
A 1 7   LEU 7   133 ?   ?   ?   A . n 
A 1 8   SER 8   134 ?   ?   ?   A . n 
A 1 9   PRO 9   135 ?   ?   ?   A . n 
A 1 10  ALA 10  136 ?   ?   ?   A . n 
A 1 11  TRP 11  137 137 TRP TRP A . n 
A 1 12  MET 12  138 138 MET MET A . n 
A 1 13  PRO 13  139 139 PRO PRO A . n 
A 1 14  ALA 14  140 140 ALA ALA A . n 
A 1 15  TYR 15  141 141 TYR TYR A . n 
A 1 16  ALA 16  142 142 ALA ALA A . n 
A 1 17  CYS 17  143 143 CYS CYS A . n 
A 1 18  GLN 18  144 144 GLN GLN A . n 
A 1 19  ARG 19  145 145 ARG ARG A . n 
A 1 20  PRO 20  146 146 PRO PRO A . n 
A 1 21  THR 21  147 147 THR THR A . n 
A 1 22  PRO 22  148 148 PRO PRO A . n 
A 1 23  LEU 23  149 149 LEU LEU A . n 
A 1 24  THR 24  150 150 THR THR A . n 
A 1 25  HIS 25  151 151 HIS HIS A . n 
A 1 26  HIS 26  152 152 HIS HIS A . n 
A 1 27  ASN 27  153 153 ASN ASN A . n 
A 1 28  THR 28  154 154 THR THR A . n 
A 1 29  GLY 29  155 155 GLY GLY A . n 
A 1 30  LEU 30  156 156 LEU LEU A . n 
A 1 31  SER 31  157 157 SER SER A . n 
A 1 32  GLU 32  158 158 GLU GLU A . n 
A 1 33  ALA 33  159 159 ALA ALA A . n 
A 1 34  LEU 34  160 160 LEU LEU A . n 
A 1 35  GLU 35  161 161 GLU GLU A . n 
A 1 36  ILE 36  162 162 ILE ILE A . n 
A 1 37  LEU 37  163 163 LEU LEU A . n 
A 1 38  ALA 38  164 164 ALA ALA A . n 
A 1 39  GLU 39  165 165 GLU GLU A . n 
A 1 40  ALA 40  166 166 ALA ALA A . n 
A 1 41  ALA 41  167 167 ALA ALA A . n 
A 1 42  GLY 42  168 168 GLY GLY A . n 
A 1 43  PHE 43  169 169 PHE PHE A . n 
A 1 44  GLU 44  170 170 GLU GLU A . n 
A 1 45  GLY 45  171 171 GLY GLY A . n 
A 1 46  SER 46  172 172 SER SER A . n 
A 1 47  GLU 47  173 173 GLU GLU A . n 
A 1 48  GLY 48  174 174 GLY GLY A . n 
A 1 49  ARG 49  175 175 ARG ARG A . n 
A 1 50  LEU 50  176 176 LEU LEU A . n 
A 1 51  LEU 51  177 177 LEU LEU A . n 
A 1 52  THR 52  178 178 THR THR A . n 
A 1 53  PHE 53  179 179 PHE PHE A . n 
A 1 54  CYS 54  180 180 CYS CYS A . n 
A 1 55  ARG 55  181 181 ARG ARG A . n 
A 1 56  ALA 56  182 182 ALA ALA A . n 
A 1 57  ALA 57  183 183 ALA ALA A . n 
A 1 58  SER 58  184 184 SER SER A . n 
A 1 59  VAL 59  185 185 VAL VAL A . n 
A 1 60  LEU 60  186 186 LEU LEU A . n 
A 1 61  LYS 61  187 187 LYS LYS A . n 
A 1 62  ALA 62  188 188 ALA ALA A . n 
A 1 63  LEU 63  189 189 LEU LEU A . n 
A 1 64  PRO 64  190 190 PRO PRO A . n 
A 1 65  SER 65  191 191 SER SER A . n 
A 1 66  PRO 66  192 192 PRO PRO A . n 
A 1 67  VAL 67  193 193 VAL VAL A . n 
A 1 68  THR 68  194 194 THR THR A . n 
A 1 69  THR 69  195 195 THR THR A . n 
A 1 70  LEU 70  196 196 LEU LEU A . n 
A 1 71  SER 71  197 197 SER SER A . n 
A 1 72  GLN 72  198 198 GLN GLN A . n 
A 1 73  LEU 73  199 199 LEU LEU A . n 
A 1 74  GLN 74  200 200 GLN GLN A . n 
A 1 75  GLY 75  201 201 GLY GLY A . n 
A 1 76  LEU 76  202 202 LEU LEU A . n 
A 1 77  PRO 77  203 203 PRO PRO A . n 
A 1 78  HIS 78  204 204 HIS HIS A . n 
A 1 79  PHE 79  205 205 PHE PHE A . n 
A 1 80  GLY 80  206 206 GLY GLY A . n 
A 1 81  GLU 81  207 207 GLU GLU A . n 
A 1 82  HIS 82  208 208 HIS HIS A . n 
A 1 83  SER 83  209 209 SER SER A . n 
A 1 84  SER 84  210 210 SER SER A . n 
A 1 85  ARG 85  211 211 ARG ARG A . n 
A 1 86  VAL 86  212 212 VAL VAL A . n 
A 1 87  VAL 87  213 213 VAL VAL A . n 
A 1 88  GLN 88  214 214 GLN GLN A . n 
A 1 89  GLU 89  215 215 GLU GLU A . n 
A 1 90  LEU 90  216 216 LEU LEU A . n 
A 1 91  LEU 91  217 217 LEU LEU A . n 
A 1 92  GLU 92  218 218 GLU GLU A . n 
A 1 93  HIS 93  219 219 HIS HIS A . n 
A 1 94  GLY 94  220 220 GLY GLY A . n 
A 1 95  VAL 95  221 221 VAL VAL A . n 
A 1 96  CYS 96  222 222 CYS CYS A . n 
A 1 97  GLU 97  223 223 GLU GLU A . n 
A 1 98  GLU 98  224 224 GLU GLU A . n 
A 1 99  VAL 99  225 225 VAL VAL A . n 
A 1 100 GLU 100 226 226 GLU GLU A . n 
A 1 101 ARG 101 227 227 ARG ARG A . n 
A 1 102 VAL 102 228 228 VAL VAL A . n 
A 1 103 ARG 103 229 229 ARG ARG A . n 
A 1 104 ARG 104 230 230 ARG ARG A . n 
A 1 105 SER 105 231 231 SER SER A . n 
A 1 106 GLU 106 232 232 GLU GLU A . n 
A 1 107 ARG 107 233 233 ARG ARG A . n 
A 1 108 TYR 108 234 234 TYR TYR A . n 
A 1 109 GLN 109 235 235 GLN GLN A . n 
A 1 110 THR 110 236 236 THR THR A . n 
A 1 111 MET 111 237 237 MET MET A . n 
A 1 112 LYS 112 238 238 LYS LYS A . n 
A 1 113 LEU 113 239 239 LEU LEU A . n 
A 1 114 PHE 114 240 240 PHE PHE A . n 
A 1 115 THR 115 241 241 THR THR A . n 
A 1 116 GLN 116 242 242 GLN GLN A . n 
A 1 117 ILE 117 243 243 ILE ILE A . n 
A 1 118 PHE 118 244 244 PHE PHE A . n 
A 1 119 GLY 119 245 245 GLY GLY A . n 
A 1 120 VAL 120 246 246 VAL VAL A . n 
A 1 121 GLY 121 247 247 GLY GLY A . n 
A 1 122 VAL 122 248 248 VAL VAL A . n 
A 1 123 LYS 123 249 249 LYS LYS A . n 
A 1 124 THR 124 250 250 THR THR A . n 
A 1 125 ALA 125 251 251 ALA ALA A . n 
A 1 126 ASP 126 252 252 ASP ASP A . n 
A 1 127 ARG 127 253 253 ARG ARG A . n 
A 1 128 TRP 128 254 254 TRP TRP A . n 
A 1 129 TYR 129 255 255 TYR TYR A . n 
A 1 130 ARG 130 256 256 ARG ARG A . n 
A 1 131 GLU 131 257 257 GLU GLU A . n 
A 1 132 GLY 132 258 258 GLY GLY A . n 
A 1 133 LEU 133 259 259 LEU LEU A . n 
A 1 134 ARG 134 260 260 ARG ARG A . n 
A 1 135 THR 135 261 261 THR THR A . n 
A 1 136 LEU 136 262 262 LEU LEU A . n 
A 1 137 ASP 137 263 263 ASP ASP A . n 
A 1 138 ASP 138 264 264 ASP ASP A . n 
A 1 139 LEU 139 265 265 LEU LEU A . n 
A 1 140 ARG 140 266 266 ARG ARG A . n 
A 1 141 GLU 141 267 267 GLU GLU A . n 
A 1 142 GLN 142 268 268 GLN GLN A . n 
A 1 143 PRO 143 269 269 PRO PRO A . n 
A 1 144 GLN 144 270 270 GLN GLN A . n 
A 1 145 LYS 145 271 271 LYS LYS A . n 
A 1 146 LEU 146 272 272 LEU LEU A . n 
A 1 147 THR 147 273 273 THR THR A . n 
A 1 148 GLN 148 274 274 GLN GLN A . n 
A 1 149 GLN 149 275 275 GLN GLN A . n 
A 1 150 GLN 150 276 276 GLN GLN A . n 
A 1 151 LYS 151 277 277 LYS LYS A . n 
A 1 152 ALA 152 278 278 ALA ALA A . n 
A 1 153 GLY 153 279 279 GLY GLY A . n 
A 1 154 LEU 154 280 280 LEU LEU A . n 
A 1 155 GLN 155 281 281 GLN GLN A . n 
A 1 156 HIS 156 282 282 HIS HIS A . n 
A 1 157 HIS 157 283 283 HIS HIS A . n 
A 1 158 GLN 158 284 284 GLN GLN A . n 
A 1 159 ASP 159 285 285 ASP ASP A . n 
A 1 160 LEU 160 286 286 LEU LEU A . n 
A 1 161 SER 161 287 287 SER SER A . n 
A 1 162 THR 162 288 288 THR THR A . n 
A 1 163 PRO 163 289 289 PRO PRO A . n 
A 1 164 VAL 164 290 290 VAL VAL A . n 
A 1 165 LEU 165 291 291 LEU LEU A . n 
A 1 166 ARG 166 292 292 ARG ARG A . n 
A 1 167 SER 167 293 293 SER SER A . n 
A 1 168 ASP 168 294 294 ASP ASP A . n 
A 1 169 VAL 169 295 295 VAL VAL A . n 
A 1 170 ASP 170 296 296 ASP ASP A . n 
A 1 171 ALA 171 297 297 ALA ALA A . n 
A 1 172 LEU 172 298 298 LEU LEU A . n 
A 1 173 GLN 173 299 299 GLN GLN A . n 
A 1 174 GLN 174 300 300 GLN GLN A . n 
A 1 175 VAL 175 301 301 VAL VAL A . n 
A 1 176 VAL 176 302 302 VAL VAL A . n 
A 1 177 GLU 177 303 303 GLU GLU A . n 
A 1 178 GLU 178 304 304 GLU GLU A . n 
A 1 179 ALA 179 305 305 ALA ALA A . n 
A 1 180 VAL 180 306 306 VAL VAL A . n 
A 1 181 GLY 181 307 307 GLY GLY A . n 
A 1 182 GLN 182 308 308 GLN GLN A . n 
A 1 183 ALA 183 309 309 ALA ALA A . n 
A 1 184 LEU 184 310 310 LEU LEU A . n 
A 1 185 PRO 185 311 311 PRO PRO A . n 
A 1 186 GLY 186 312 312 GLY GLY A . n 
A 1 187 ALA 187 313 313 ALA ALA A . n 
A 1 188 THR 188 314 314 THR THR A . n 
A 1 189 VAL 189 315 315 VAL VAL A . n 
A 1 190 THR 190 316 316 THR THR A . n 
A 1 191 LEU 191 317 317 LEU LEU A . n 
A 1 192 THR 192 318 318 THR THR A . n 
A 1 193 GLY 193 319 319 GLY GLY A . n 
A 1 194 GLY 194 320 320 GLY GLY A . n 
A 1 195 PHE 195 321 321 PHE PHE A . n 
A 1 196 ARG 196 322 322 ARG ARG A . n 
A 1 197 ARG 197 323 323 ARG ARG A . n 
A 1 198 GLY 198 324 324 GLY GLY A . n 
A 1 199 LYS 199 325 325 LYS LYS A . n 
A 1 200 LEU 200 326 326 LEU LEU A . n 
A 1 201 GLN 201 327 327 GLN GLN A . n 
A 1 202 GLY 202 328 328 GLY GLY A . n 
A 1 203 HIS 203 329 329 HIS HIS A . n 
A 1 204 ASP 204 330 330 ASP ASP A . n 
A 1 205 VAL 205 331 331 VAL VAL A . n 
A 1 206 ASP 206 332 332 ASP ASP A . n 
A 1 207 PHE 207 333 333 PHE PHE A . n 
A 1 208 LEU 208 334 334 LEU LEU A . n 
A 1 209 ILE 209 335 335 ILE ILE A . n 
A 1 210 THR 210 336 336 THR THR A . n 
A 1 211 HIS 211 337 337 HIS HIS A . n 
A 1 212 PRO 212 338 338 PRO PRO A . n 
A 1 213 LYS 213 339 339 LYS LYS A . n 
A 1 214 GLU 214 340 340 GLU GLU A . n 
A 1 215 GLY 215 341 341 GLY GLY A . n 
A 1 216 GLN 216 342 342 GLN GLN A . n 
A 1 217 GLU 217 343 343 GLU GLU A . n 
A 1 218 ALA 218 344 344 ALA ALA A . n 
A 1 219 GLY 219 345 345 GLY GLY A . n 
A 1 220 LEU 220 346 346 LEU LEU A . n 
A 1 221 LEU 221 347 347 LEU LEU A . n 
A 1 222 PRO 222 348 348 PRO PRO A . n 
A 1 223 ARG 223 349 349 ARG ARG A . n 
A 1 224 VAL 224 350 350 VAL VAL A . n 
A 1 225 MET 225 351 351 MET MET A . n 
A 1 226 CYS 226 352 352 CYS CYS A . n 
A 1 227 ARG 227 353 353 ARG ARG A . n 
A 1 228 LEU 228 354 354 LEU LEU A . n 
A 1 229 GLN 229 355 355 GLN GLN A . n 
A 1 230 ASP 230 356 356 ASP ASP A . n 
A 1 231 GLN 231 357 357 GLN GLN A . n 
A 1 232 GLY 232 358 358 GLY GLY A . n 
A 1 233 LEU 233 359 359 LEU LEU A . n 
A 1 234 ILE 234 360 360 ILE ILE A . n 
A 1 235 LEU 235 361 361 LEU LEU A . n 
A 1 236 TYR 236 362 362 TYR TYR A . n 
A 1 237 HIS 237 363 363 HIS HIS A . n 
A 1 238 GLN 238 364 364 GLN GLN A . n 
A 1 239 HIS 239 365 ?   ?   ?   A . n 
A 1 240 GLN 240 366 ?   ?   ?   A . n 
A 1 241 HIS 241 367 ?   ?   ?   A . n 
A 1 242 SER 242 368 ?   ?   ?   A . n 
A 1 243 CYS 243 369 ?   ?   ?   A . n 
A 1 244 CYS 244 370 ?   ?   ?   A . n 
A 1 245 GLU 245 371 ?   ?   ?   A . n 
A 1 246 SER 246 372 ?   ?   ?   A . n 
A 1 247 PRO 247 373 ?   ?   ?   A . n 
A 1 248 THR 248 374 ?   ?   ?   A . n 
A 1 249 ARG 249 375 ?   ?   ?   A . n 
A 1 250 LEU 250 376 ?   ?   ?   A . n 
A 1 251 ALA 251 377 ?   ?   ?   A . n 
A 1 252 GLN 252 378 ?   ?   ?   A . n 
A 1 253 GLN 253 379 ?   ?   ?   A . n 
A 1 254 SER 254 380 ?   ?   ?   A . n 
A 1 255 HIS 255 381 ?   ?   ?   A . n 
A 1 256 MET 256 382 ?   ?   ?   A . n 
A 1 257 ASP 257 383 ?   ?   ?   A . n 
A 1 258 ALA 258 384 ?   ?   ?   A . n 
A 1 259 PHE 259 385 385 PHE PHE A . n 
A 1 260 GLU 260 386 386 GLU GLU A . n 
A 1 261 ARG 261 387 387 ARG ARG A . n 
A 1 262 SER 262 388 388 SER SER A . n 
A 1 263 PHE 263 389 389 PHE PHE A . n 
A 1 264 CYS 264 390 390 CYS CYS A . n 
A 1 265 ILE 265 391 391 ILE ILE A . n 
A 1 266 PHE 266 392 392 PHE PHE A . n 
A 1 267 ARG 267 393 393 ARG ARG A . n 
A 1 268 LEU 268 394 394 LEU LEU A . n 
A 1 269 PRO 269 395 395 PRO PRO A . n 
A 1 270 GLN 270 396 396 GLN GLN A . n 
A 1 271 PRO 271 397 397 PRO PRO A . n 
A 1 272 GLY 272 410 410 GLY GLY A . n 
A 1 273 SER 273 411 411 SER SER A . n 
A 1 274 TRP 274 412 412 TRP TRP A . n 
A 1 275 LYS 275 413 413 LYS LYS A . n 
A 1 276 ALA 276 414 414 ALA ALA A . n 
A 1 277 VAL 277 415 415 VAL VAL A . n 
A 1 278 ARG 278 416 416 ARG ARG A . n 
A 1 279 VAL 279 417 417 VAL VAL A . n 
A 1 280 ASP 280 418 418 ASP ASP A . n 
A 1 281 LEU 281 419 419 LEU LEU A . n 
A 1 282 VAL 282 420 420 VAL VAL A . n 
A 1 283 VAL 283 421 421 VAL VAL A . n 
A 1 284 ALA 284 422 422 ALA ALA A . n 
A 1 285 PRO 285 423 423 PRO PRO A . n 
A 1 286 VAL 286 424 424 VAL VAL A . n 
A 1 287 SER 287 425 425 SER SER A . n 
A 1 288 GLN 288 426 426 GLN GLN A . n 
A 1 289 PHE 289 427 427 PHE PHE A . n 
A 1 290 PRO 290 428 428 PRO PRO A . n 
A 1 291 PHE 291 429 429 PHE PHE A . n 
A 1 292 ALA 292 430 430 ALA ALA A . n 
A 1 293 LEU 293 431 431 LEU LEU A . n 
A 1 294 LEU 294 432 432 LEU LEU A . n 
A 1 295 GLY 295 433 433 GLY GLY A . n 
A 1 296 TRP 296 434 434 TRP TRP A . n 
A 1 297 THR 297 435 435 THR THR A . n 
A 1 298 GLY 298 436 436 GLY GLY A . n 
A 1 299 SER 299 437 437 SER SER A . n 
A 1 300 LYS 300 438 438 LYS LYS A . n 
A 1 301 LEU 301 439 439 LEU LEU A . n 
A 1 302 PHE 302 440 440 PHE PHE A . n 
A 1 303 GLN 303 441 441 GLN GLN A . n 
A 1 304 ARG 304 442 442 ARG ARG A . n 
A 1 305 GLU 305 443 443 GLU GLU A . n 
A 1 306 LEU 306 444 444 LEU LEU A . n 
A 1 307 ARG 307 445 445 ARG ARG A . n 
A 1 308 ARG 308 446 446 ARG ARG A . n 
A 1 309 PHE 309 447 447 PHE PHE A . n 
A 1 310 SER 310 448 448 SER SER A . n 
A 1 311 ARG 311 449 449 ARG ARG A . n 
A 1 312 LYS 312 450 450 LYS LYS A . n 
A 1 313 GLU 313 451 451 GLU GLU A . n 
A 1 314 LYS 314 452 452 LYS LYS A . n 
A 1 315 GLY 315 453 453 GLY GLY A . n 
A 1 316 LEU 316 454 454 LEU LEU A . n 
A 1 317 TRP 317 455 455 TRP TRP A . n 
A 1 318 LEU 318 456 456 LEU LEU A . n 
A 1 319 ASN 319 457 457 ASN ASN A . n 
A 1 320 SER 320 458 458 SER SER A . n 
A 1 321 HIS 321 459 459 HIS HIS A . n 
A 1 322 GLY 322 460 460 GLY GLY A . n 
A 1 323 LEU 323 461 461 LEU LEU A . n 
A 1 324 PHE 324 462 462 PHE PHE A . n 
A 1 325 ASP 325 463 463 ASP ASP A . n 
A 1 326 PRO 326 464 464 PRO PRO A . n 
A 1 327 GLU 327 465 465 GLU GLU A . n 
A 1 328 GLN 328 466 466 GLN GLN A . n 
A 1 329 LYS 329 467 467 LYS LYS A . n 
A 1 330 THR 330 468 468 THR THR A . n 
A 1 331 PHE 331 469 469 PHE PHE A . n 
A 1 332 PHE 332 470 470 PHE PHE A . n 
A 1 333 GLN 333 471 471 GLN GLN A . n 
A 1 334 ALA 334 472 472 ALA ALA A . n 
A 1 335 ALA 335 473 473 ALA ALA A . n 
A 1 336 SER 336 474 474 SER SER A . n 
A 1 337 GLU 337 475 475 GLU GLU A . n 
A 1 338 GLU 338 476 476 GLU GLU A . n 
A 1 339 ASP 339 477 477 ASP ASP A . n 
A 1 340 ILE 340 478 478 ILE ILE A . n 
A 1 341 PHE 341 479 479 PHE PHE A . n 
A 1 342 ARG 342 480 480 ARG ARG A . n 
A 1 343 HIS 343 481 481 HIS HIS A . n 
A 1 344 LEU 344 482 482 LEU LEU A . n 
A 1 345 GLY 345 483 483 GLY GLY A . n 
A 1 346 LEU 346 484 484 LEU LEU A . n 
A 1 347 GLU 347 485 485 GLU GLU A . n 
A 1 348 TYR 348 486 486 TYR TYR A . n 
A 1 349 LEU 349 487 487 LEU LEU A . n 
A 1 350 PRO 350 488 488 PRO PRO A . n 
A 1 351 PRO 351 489 489 PRO PRO A . n 
A 1 352 GLU 352 490 490 GLU GLU A . n 
A 1 353 GLN 353 491 491 GLN GLN A . n 
A 1 354 ARG 354 492 492 ARG ARG A . n 
A 1 355 ASN 355 493 493 ASN ASN A . n 
A 1 356 ALA 356 494 494 ALA ALA A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DG  2   2   2   DG  DG  T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DC  8   8   8   DC  DC  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
C 3 1   DC  1   1   1   DC  DC  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DA  4   4   4   DA  DA  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DC  3   3   3   DC  DC  D . n 
D 4 4   DG  4   4   4   DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  MN  1   501 1   MN  MN  A . 
F 5  MN  1   502 2   MN  MN  A . 
G 5  MN  1   503 3   MN  MN  A . 
H 5  MN  1   504 4   MN  MN  A . 
I 5  MN  1   505 5   MN  MN  A . 
J 6  NA  1   506 1   NA  NA  A . 
K 7  DTT 1   507 2   DTT DTT A . 
L 7  DTT 1   508 3   DTT DTT A . 
M 8  EPE 1   509 1   EPE EPE A . 
N 9  EDO 1   510 2   EDO EDO A . 
O 9  EDO 1   511 3   EDO EDO A . 
P 9  EDO 1   512 4   EDO EDO A . 
Q 10 GOA 1   513 1   GOA GOA A . 
R 5  MN  1   101 6   MN  MN  T . 
S 11 HOH 1   601 234 HOH HOH A . 
S 11 HOH 2   602 221 HOH HOH A . 
S 11 HOH 3   603 310 HOH HOH A . 
S 11 HOH 4   604 35  HOH HOH A . 
S 11 HOH 5   605 124 HOH HOH A . 
S 11 HOH 6   606 101 HOH HOH A . 
S 11 HOH 7   607 369 HOH HOH A . 
S 11 HOH 8   608 15  HOH HOH A . 
S 11 HOH 9   609 219 HOH HOH A . 
S 11 HOH 10  610 39  HOH HOH A . 
S 11 HOH 11  611 4   HOH HOH A . 
S 11 HOH 12  612 114 HOH HOH A . 
S 11 HOH 13  613 154 HOH HOH A . 
S 11 HOH 14  614 407 HOH HOH A . 
S 11 HOH 15  615 157 HOH HOH A . 
S 11 HOH 16  616 279 HOH HOH A . 
S 11 HOH 17  617 285 HOH HOH A . 
S 11 HOH 18  618 104 HOH HOH A . 
S 11 HOH 19  619 222 HOH HOH A . 
S 11 HOH 20  620 329 HOH HOH A . 
S 11 HOH 21  621 33  HOH HOH A . 
S 11 HOH 22  622 136 HOH HOH A . 
S 11 HOH 23  623 155 HOH HOH A . 
S 11 HOH 24  624 139 HOH HOH A . 
S 11 HOH 25  625 58  HOH HOH A . 
S 11 HOH 26  626 30  HOH HOH A . 
S 11 HOH 27  627 83  HOH HOH A . 
S 11 HOH 28  628 22  HOH HOH A . 
S 11 HOH 29  629 38  HOH HOH A . 
S 11 HOH 30  630 54  HOH HOH A . 
S 11 HOH 31  631 215 HOH HOH A . 
S 11 HOH 32  632 159 HOH HOH A . 
S 11 HOH 33  633 98  HOH HOH A . 
S 11 HOH 34  634 413 HOH HOH A . 
S 11 HOH 35  635 65  HOH HOH A . 
S 11 HOH 36  636 59  HOH HOH A . 
S 11 HOH 37  637 16  HOH HOH A . 
S 11 HOH 38  638 79  HOH HOH A . 
S 11 HOH 39  639 29  HOH HOH A . 
S 11 HOH 40  640 180 HOH HOH A . 
S 11 HOH 41  641 3   HOH HOH A . 
S 11 HOH 42  642 14  HOH HOH A . 
S 11 HOH 43  643 53  HOH HOH A . 
S 11 HOH 44  644 126 HOH HOH A . 
S 11 HOH 45  645 89  HOH HOH A . 
S 11 HOH 46  646 176 HOH HOH A . 
S 11 HOH 47  647 45  HOH HOH A . 
S 11 HOH 48  648 26  HOH HOH A . 
S 11 HOH 49  649 118 HOH HOH A . 
S 11 HOH 50  650 48  HOH HOH A . 
S 11 HOH 51  651 252 HOH HOH A . 
S 11 HOH 52  652 240 HOH HOH A . 
S 11 HOH 53  653 57  HOH HOH A . 
S 11 HOH 54  654 27  HOH HOH A . 
S 11 HOH 55  655 73  HOH HOH A . 
S 11 HOH 56  656 52  HOH HOH A . 
S 11 HOH 57  657 269 HOH HOH A . 
S 11 HOH 58  658 13  HOH HOH A . 
S 11 HOH 59  659 190 HOH HOH A . 
S 11 HOH 60  660 19  HOH HOH A . 
S 11 HOH 61  661 416 HOH HOH A . 
S 11 HOH 62  662 10  HOH HOH A . 
S 11 HOH 63  663 95  HOH HOH A . 
S 11 HOH 64  664 174 HOH HOH A . 
S 11 HOH 65  665 201 HOH HOH A . 
S 11 HOH 66  666 268 HOH HOH A . 
S 11 HOH 67  667 170 HOH HOH A . 
S 11 HOH 68  668 68  HOH HOH A . 
S 11 HOH 69  669 181 HOH HOH A . 
S 11 HOH 70  670 346 HOH HOH A . 
S 11 HOH 71  671 128 HOH HOH A . 
S 11 HOH 72  672 125 HOH HOH A . 
S 11 HOH 73  673 278 HOH HOH A . 
S 11 HOH 74  674 97  HOH HOH A . 
S 11 HOH 75  675 21  HOH HOH A . 
S 11 HOH 76  676 77  HOH HOH A . 
S 11 HOH 77  677 237 HOH HOH A . 
S 11 HOH 78  678 163 HOH HOH A . 
S 11 HOH 79  679 44  HOH HOH A . 
S 11 HOH 80  680 7   HOH HOH A . 
S 11 HOH 81  681 129 HOH HOH A . 
S 11 HOH 82  682 103 HOH HOH A . 
S 11 HOH 83  683 75  HOH HOH A . 
S 11 HOH 84  684 74  HOH HOH A . 
S 11 HOH 85  685 106 HOH HOH A . 
S 11 HOH 86  686 81  HOH HOH A . 
S 11 HOH 87  687 186 HOH HOH A . 
S 11 HOH 88  688 318 HOH HOH A . 
S 11 HOH 89  689 241 HOH HOH A . 
S 11 HOH 90  690 249 HOH HOH A . 
S 11 HOH 91  691 301 HOH HOH A . 
S 11 HOH 92  692 46  HOH HOH A . 
S 11 HOH 93  693 24  HOH HOH A . 
S 11 HOH 94  694 259 HOH HOH A . 
S 11 HOH 95  695 42  HOH HOH A . 
S 11 HOH 96  696 323 HOH HOH A . 
S 11 HOH 97  697 188 HOH HOH A . 
S 11 HOH 98  698 47  HOH HOH A . 
S 11 HOH 99  699 403 HOH HOH A . 
S 11 HOH 100 700 313 HOH HOH A . 
S 11 HOH 101 701 71  HOH HOH A . 
S 11 HOH 102 702 206 HOH HOH A . 
S 11 HOH 103 703 85  HOH HOH A . 
S 11 HOH 104 704 84  HOH HOH A . 
S 11 HOH 105 705 187 HOH HOH A . 
S 11 HOH 106 706 43  HOH HOH A . 
S 11 HOH 107 707 108 HOH HOH A . 
S 11 HOH 108 708 107 HOH HOH A . 
S 11 HOH 109 709 207 HOH HOH A . 
S 11 HOH 110 710 6   HOH HOH A . 
S 11 HOH 111 711 5   HOH HOH A . 
S 11 HOH 112 712 37  HOH HOH A . 
S 11 HOH 113 713 62  HOH HOH A . 
S 11 HOH 114 714 316 HOH HOH A . 
S 11 HOH 115 715 41  HOH HOH A . 
S 11 HOH 116 716 50  HOH HOH A . 
S 11 HOH 117 717 40  HOH HOH A . 
S 11 HOH 118 718 127 HOH HOH A . 
S 11 HOH 119 719 18  HOH HOH A . 
S 11 HOH 120 720 232 HOH HOH A . 
S 11 HOH 121 721 109 HOH HOH A . 
S 11 HOH 122 722 70  HOH HOH A . 
S 11 HOH 123 723 88  HOH HOH A . 
S 11 HOH 124 724 165 HOH HOH A . 
S 11 HOH 125 725 36  HOH HOH A . 
S 11 HOH 126 726 100 HOH HOH A . 
S 11 HOH 127 727 246 HOH HOH A . 
S 11 HOH 128 728 260 HOH HOH A . 
S 11 HOH 129 729 184 HOH HOH A . 
S 11 HOH 130 730 196 HOH HOH A . 
S 11 HOH 131 731 69  HOH HOH A . 
S 11 HOH 132 732 51  HOH HOH A . 
S 11 HOH 133 733 138 HOH HOH A . 
S 11 HOH 134 734 56  HOH HOH A . 
S 11 HOH 135 735 143 HOH HOH A . 
S 11 HOH 136 736 140 HOH HOH A . 
S 11 HOH 137 737 142 HOH HOH A . 
S 11 HOH 138 738 178 HOH HOH A . 
S 11 HOH 139 739 294 HOH HOH A . 
S 11 HOH 140 740 273 HOH HOH A . 
S 11 HOH 141 741 270 HOH HOH A . 
S 11 HOH 142 742 271 HOH HOH A . 
S 11 HOH 143 743 251 HOH HOH A . 
S 11 HOH 144 744 25  HOH HOH A . 
S 11 HOH 145 745 175 HOH HOH A . 
S 11 HOH 146 746 415 HOH HOH A . 
S 11 HOH 147 747 8   HOH HOH A . 
S 11 HOH 148 748 86  HOH HOH A . 
S 11 HOH 149 749 169 HOH HOH A . 
S 11 HOH 150 750 277 HOH HOH A . 
S 11 HOH 151 751 336 HOH HOH A . 
S 11 HOH 152 752 119 HOH HOH A . 
S 11 HOH 153 753 115 HOH HOH A . 
S 11 HOH 154 754 307 HOH HOH A . 
S 11 HOH 155 755 168 HOH HOH A . 
S 11 HOH 156 756 172 HOH HOH A . 
S 11 HOH 157 757 223 HOH HOH A . 
S 11 HOH 158 758 382 HOH HOH A . 
S 11 HOH 159 759 328 HOH HOH A . 
S 11 HOH 160 760 134 HOH HOH A . 
S 11 HOH 161 761 82  HOH HOH A . 
S 11 HOH 162 762 12  HOH HOH A . 
S 11 HOH 163 763 244 HOH HOH A . 
S 11 HOH 164 764 117 HOH HOH A . 
S 11 HOH 165 765 161 HOH HOH A . 
S 11 HOH 166 766 303 HOH HOH A . 
S 11 HOH 167 767 148 HOH HOH A . 
S 11 HOH 168 768 229 HOH HOH A . 
S 11 HOH 169 769 405 HOH HOH A . 
S 11 HOH 170 770 63  HOH HOH A . 
S 11 HOH 171 771 265 HOH HOH A . 
S 11 HOH 172 772 262 HOH HOH A . 
S 11 HOH 173 773 204 HOH HOH A . 
S 11 HOH 174 774 120 HOH HOH A . 
S 11 HOH 175 775 145 HOH HOH A . 
S 11 HOH 176 776 324 HOH HOH A . 
S 11 HOH 177 777 258 HOH HOH A . 
S 11 HOH 178 778 61  HOH HOH A . 
S 11 HOH 179 779 332 HOH HOH A . 
S 11 HOH 180 780 235 HOH HOH A . 
S 11 HOH 181 781 151 HOH HOH A . 
S 11 HOH 182 782 291 HOH HOH A . 
S 11 HOH 183 783 214 HOH HOH A . 
S 11 HOH 184 784 311 HOH HOH A . 
S 11 HOH 185 785 243 HOH HOH A . 
S 11 HOH 186 786 173 HOH HOH A . 
S 11 HOH 187 787 200 HOH HOH A . 
S 11 HOH 188 788 226 HOH HOH A . 
S 11 HOH 189 789 23  HOH HOH A . 
S 11 HOH 190 790 149 HOH HOH A . 
S 11 HOH 191 791 182 HOH HOH A . 
S 11 HOH 192 792 192 HOH HOH A . 
S 11 HOH 193 793 320 HOH HOH A . 
S 11 HOH 194 794 76  HOH HOH A . 
S 11 HOH 195 795 64  HOH HOH A . 
S 11 HOH 196 796 315 HOH HOH A . 
S 11 HOH 197 797 105 HOH HOH A . 
S 11 HOH 198 798 90  HOH HOH A . 
S 11 HOH 199 799 185 HOH HOH A . 
S 11 HOH 200 800 199 HOH HOH A . 
S 11 HOH 201 801 304 HOH HOH A . 
S 11 HOH 202 802 356 HOH HOH A . 
S 11 HOH 203 803 216 HOH HOH A . 
S 11 HOH 204 804 32  HOH HOH A . 
S 11 HOH 205 805 116 HOH HOH A . 
S 11 HOH 206 806 283 HOH HOH A . 
S 11 HOH 207 807 254 HOH HOH A . 
S 11 HOH 208 808 248 HOH HOH A . 
S 11 HOH 209 809 276 HOH HOH A . 
S 11 HOH 210 810 167 HOH HOH A . 
S 11 HOH 211 811 218 HOH HOH A . 
S 11 HOH 212 812 322 HOH HOH A . 
S 11 HOH 213 813 91  HOH HOH A . 
S 11 HOH 214 814 381 HOH HOH A . 
S 11 HOH 215 815 179 HOH HOH A . 
S 11 HOH 216 816 338 HOH HOH A . 
S 11 HOH 217 817 122 HOH HOH A . 
S 11 HOH 218 818 317 HOH HOH A . 
S 11 HOH 219 819 132 HOH HOH A . 
S 11 HOH 220 820 383 HOH HOH A . 
S 11 HOH 221 821 162 HOH HOH A . 
S 11 HOH 222 822 335 HOH HOH A . 
S 11 HOH 223 823 245 HOH HOH A . 
S 11 HOH 224 824 330 HOH HOH A . 
S 11 HOH 225 825 290 HOH HOH A . 
S 11 HOH 226 826 257 HOH HOH A . 
S 11 HOH 227 827 373 HOH HOH A . 
S 11 HOH 228 828 406 HOH HOH A . 
S 11 HOH 229 829 409 HOH HOH A . 
S 11 HOH 230 830 153 HOH HOH A . 
S 11 HOH 231 831 401 HOH HOH A . 
S 11 HOH 232 832 337 HOH HOH A . 
S 11 HOH 233 833 355 HOH HOH A . 
S 11 HOH 234 834 94  HOH HOH A . 
S 11 HOH 235 835 319 HOH HOH A . 
S 11 HOH 236 836 312 HOH HOH A . 
S 11 HOH 237 837 391 HOH HOH A . 
S 11 HOH 238 838 410 HOH HOH A . 
S 11 HOH 239 839 211 HOH HOH A . 
S 11 HOH 240 840 292 HOH HOH A . 
S 11 HOH 241 841 72  HOH HOH A . 
S 11 HOH 242 842 210 HOH HOH A . 
S 11 HOH 243 843 287 HOH HOH A . 
S 11 HOH 244 844 366 HOH HOH A . 
S 11 HOH 245 845 137 HOH HOH A . 
S 11 HOH 246 846 227 HOH HOH A . 
S 11 HOH 247 847 349 HOH HOH A . 
S 11 HOH 248 848 247 HOH HOH A . 
S 11 HOH 249 849 224 HOH HOH A . 
S 11 HOH 250 850 286 HOH HOH A . 
S 11 HOH 251 851 197 HOH HOH A . 
S 11 HOH 252 852 253 HOH HOH A . 
S 11 HOH 253 853 399 HOH HOH A . 
S 11 HOH 254 854 160 HOH HOH A . 
S 11 HOH 255 855 274 HOH HOH A . 
S 11 HOH 256 856 288 HOH HOH A . 
S 11 HOH 257 857 354 HOH HOH A . 
S 11 HOH 258 858 375 HOH HOH A . 
T 11 HOH 1   201 220 HOH HOH T . 
T 11 HOH 2   202 87  HOH HOH T . 
T 11 HOH 3   203 423 HOH HOH T . 
T 11 HOH 4   204 111 HOH HOH T . 
T 11 HOH 5   205 144 HOH HOH T . 
T 11 HOH 6   206 341 HOH HOH T . 
T 11 HOH 7   207 147 HOH HOH T . 
T 11 HOH 8   208 202 HOH HOH T . 
T 11 HOH 9   209 208 HOH HOH T . 
T 11 HOH 10  210 411 HOH HOH T . 
T 11 HOH 11  211 17  HOH HOH T . 
T 11 HOH 12  212 379 HOH HOH T . 
T 11 HOH 13  213 141 HOH HOH T . 
T 11 HOH 14  214 49  HOH HOH T . 
T 11 HOH 15  215 31  HOH HOH T . 
T 11 HOH 16  216 212 HOH HOH T . 
T 11 HOH 17  217 398 HOH HOH T . 
T 11 HOH 18  218 99  HOH HOH T . 
T 11 HOH 19  219 239 HOH HOH T . 
T 11 HOH 20  220 133 HOH HOH T . 
T 11 HOH 21  221 295 HOH HOH T . 
T 11 HOH 22  222 298 HOH HOH T . 
T 11 HOH 23  223 284 HOH HOH T . 
T 11 HOH 24  224 191 HOH HOH T . 
T 11 HOH 25  225 123 HOH HOH T . 
T 11 HOH 26  226 326 HOH HOH T . 
U 11 HOH 1   101 102 HOH HOH P . 
U 11 HOH 2   102 158 HOH HOH P . 
U 11 HOH 3   103 164 HOH HOH P . 
U 11 HOH 4   104 20  HOH HOH P . 
U 11 HOH 5   105 80  HOH HOH P . 
U 11 HOH 6   106 28  HOH HOH P . 
U 11 HOH 7   107 150 HOH HOH P . 
U 11 HOH 8   108 93  HOH HOH P . 
U 11 HOH 9   109 193 HOH HOH P . 
U 11 HOH 10  110 121 HOH HOH P . 
U 11 HOH 11  111 96  HOH HOH P . 
U 11 HOH 12  112 9   HOH HOH P . 
U 11 HOH 13  113 146 HOH HOH P . 
U 11 HOH 14  114 380 HOH HOH P . 
U 11 HOH 15  115 289 HOH HOH P . 
U 11 HOH 16  116 230 HOH HOH P . 
U 11 HOH 17  117 378 HOH HOH P . 
V 11 HOH 1   101 238 HOH HOH D . 
V 11 HOH 2   102 255 HOH HOH D . 
V 11 HOH 3   103 263 HOH HOH D . 
V 11 HOH 4   104 266 HOH HOH D . 
V 11 HOH 5   105 194 HOH HOH D . 
V 11 HOH 6   106 281 HOH HOH D . 
V 11 HOH 7   107 421 HOH HOH D . 
V 11 HOH 8   108 113 HOH HOH D . 
V 11 HOH 9   109 112 HOH HOH D . 
V 11 HOH 10  110 135 HOH HOH D . 
V 11 HOH 11  111 414 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6080  ? 
1 MORE         -54   ? 
1 'SSA (A^2)'  16020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 82  ? A HIS 208 ? 1_555 MN ? G MN . ? A MN 503 ? 1_555 O   A S HOH .   ? A HOH 820 ? 1_555 96.9  ? 
2  ND1 ? A HIS 82  ? A HIS 208 ? 1_555 MN ? G MN . ? A MN 503 ? 1_555 OP3 ? D DG  1   ? D DG  1   ? 1_555 68.1  ? 
3  O   A S HOH .   ? A HOH 820 ? 1_555 MN ? G MN . ? A MN 503 ? 1_555 OP3 ? D DG  1   ? D DG  1   ? 1_555 133.0 ? 
4  ND1 ? A HIS 82  ? A HIS 208 ? 1_555 MN ? G MN . ? A MN 503 ? 1_555 O   ? V HOH .   ? D HOH 111 ? 1_555 81.6  ? 
5  O   A S HOH .   ? A HOH 820 ? 1_555 MN ? G MN . ? A MN 503 ? 1_555 O   ? V HOH .   ? D HOH 111 ? 1_555 143.6 ? 
6  OP3 ? D DG  1   ? D DG  1   ? 1_555 MN ? G MN . ? A MN 503 ? 1_555 O   ? V HOH .   ? D HOH 111 ? 1_555 80.4  ? 
7  OE1 ? A GLU 92  ? A GLU 218 ? 1_555 MN ? H MN . ? A MN 504 ? 1_555 NE2 ? A HIS 93  ? A HIS 219 ? 1_555 85.7  ? 
8  OE1 ? A GLU 92  ? A GLU 218 ? 1_555 MN ? H MN . ? A MN 504 ? 1_555 O   ? S HOH .   ? A HOH 634 ? 1_555 112.8 ? 
9  NE2 ? A HIS 93  ? A HIS 219 ? 1_555 MN ? H MN . ? A MN 504 ? 1_555 O   ? S HOH .   ? A HOH 634 ? 1_555 76.6  ? 
10 O   ? A THR 115 ? A THR 241 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? A ILE 117 ? A ILE 243 ? 1_555 94.5  ? 
11 O   ? A THR 115 ? A THR 241 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? A VAL 120 ? A VAL 246 ? 1_555 86.5  ? 
12 O   ? A ILE 117 ? A ILE 243 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? A VAL 120 ? A VAL 246 ? 1_555 92.3  ? 
13 O   ? A THR 115 ? A THR 241 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? S HOH .   ? A HOH 804 ? 1_555 84.9  ? 
14 O   ? A ILE 117 ? A ILE 243 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? S HOH .   ? A HOH 804 ? 1_555 87.6  ? 
15 O   ? A VAL 120 ? A VAL 246 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? S HOH .   ? A HOH 804 ? 1_555 171.4 ? 
16 O   ? A THR 115 ? A THR 241 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 174.6 ? 
17 O   ? A ILE 117 ? A ILE 243 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 90.8  ? 
18 O   ? A VAL 120 ? A VAL 246 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 92.1  ? 
19 O   ? S HOH .   ? A HOH 804 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 96.5  ? 
20 O   ? A THR 115 ? A THR 241 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? U HOH .   ? P HOH 112 ? 1_555 90.0  ? 
21 O   ? A ILE 117 ? A ILE 243 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? U HOH .   ? P HOH 112 ? 1_555 175.3 ? 
22 O   ? A VAL 120 ? A VAL 246 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? U HOH .   ? P HOH 112 ? 1_555 86.9  ? 
23 O   ? S HOH .   ? A HOH 804 ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? U HOH .   ? P HOH 112 ? 1_555 93.8  ? 
24 OP1 ? C DT  3   ? P DT  3   ? 1_555 NA ? J NA . ? A NA 506 ? 1_555 O   ? U HOH .   ? P HOH 112 ? 1_555 84.7  ? 
25 OD1 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 101.7 ? 
26 OD1 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O2  ? Q GOA .   ? A GOA 513 ? 1_555 94.3  ? 
27 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O2  ? Q GOA .   ? A GOA 513 ? 1_555 163.6 ? 
28 OD1 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O   ? Q GOA .   ? A GOA 513 ? 1_555 158.4 ? 
29 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O   ? Q GOA .   ? A GOA 513 ? 1_555 92.1  ? 
30 O2  ? Q GOA .   ? A GOA 513 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O   ? Q GOA .   ? A GOA 513 ? 1_555 73.7  ? 
31 OD1 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O   ? S HOH .   ? A HOH 628 ? 1_555 77.2  ? 
32 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O   ? S HOH .   ? A HOH 628 ? 1_555 86.4  ? 
33 O2  ? Q GOA .   ? A GOA 513 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O   ? S HOH .   ? A HOH 628 ? 1_555 100.9 ? 
34 O   ? Q GOA .   ? A GOA 513 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 O   ? S HOH .   ? A HOH 628 ? 1_555 87.2  ? 
35 OD1 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 93.8  ? 
36 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 89.8  ? 
37 O2  ? Q GOA .   ? A GOA 513 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 85.4  ? 
38 O   ? Q GOA .   ? A GOA 513 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 102.9 ? 
39 O   ? S HOH .   ? A HOH 628 ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 169.3 ? 
40 OD2 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 95.6  ? 
41 OD2 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 OD2 ? A ASP 280 ? A ASP 418 ? 1_555 104.4 ? 
42 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 OD2 ? A ASP 280 ? A ASP 418 ? 1_555 95.2  ? 
43 OD2 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 115.8 ? 
44 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 90.9  ? 
45 OD2 ? A ASP 280 ? A ASP 418 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 138.6 ? 
46 OD2 ? A ASP 204 ? A ASP 330 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 O   ? U HOH .   ? P HOH 105 ? 1_555 83.2  ? 
47 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 O   ? U HOH .   ? P HOH 105 ? 1_555 172.8 ? 
48 OD2 ? A ASP 280 ? A ASP 418 ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 O   ? U HOH .   ? P HOH 105 ? 1_555 92.0  ? 
49 OP1 ? C DT  5   ? P DT  5   ? 1_555 MN ? F MN . ? A MN 502 ? 1_555 O   ? U HOH .   ? P HOH 105 ? 1_555 83.3  ? 
50 OE1 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OE2 ? A GLU 260 ? A GLU 386 ? 1_555 52.0  ? 
51 OE1 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 NE2 ? A HIS 321 ? A HIS 459 ? 1_555 139.7 ? 
52 OE2 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 NE2 ? A HIS 321 ? A HIS 459 ? 1_555 88.7  ? 
53 OE1 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? S HOH .   ? A HOH 791 ? 1_555 87.2  ? 
54 OE2 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? S HOH .   ? A HOH 791 ? 1_555 102.1 ? 
55 NE2 ? A HIS 321 ? A HIS 459 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? S HOH .   ? A HOH 791 ? 1_555 94.3  ? 
56 OE1 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? S HOH .   ? A HOH 821 ? 1_555 122.0 ? 
57 OE2 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? S HOH .   ? A HOH 821 ? 1_555 172.2 ? 
58 NE2 ? A HIS 321 ? A HIS 459 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? S HOH .   ? A HOH 821 ? 1_555 97.9  ? 
59 O   ? S HOH .   ? A HOH 791 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? S HOH .   ? A HOH 821 ? 1_555 81.7  ? 
60 OE1 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? T HOH .   ? T HOH 201 ? 1_555 97.2  ? 
61 OE2 ? A GLU 260 ? A GLU 386 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? T HOH .   ? T HOH 201 ? 1_555 96.4  ? 
62 NE2 ? A HIS 321 ? A HIS 459 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? T HOH .   ? T HOH 201 ? 1_555 95.1  ? 
63 O   ? S HOH .   ? A HOH 791 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? T HOH .   ? T HOH 201 ? 1_555 159.4 ? 
64 O   ? S HOH .   ? A HOH 821 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 O   ? T HOH .   ? T HOH 201 ? 1_555 78.9  ? 
65 N7  ? B DG  2   ? T DG  2   ? 1_555 MN ? R MN . ? T MN 101 ? 1_555 O   ? T HOH .   ? T HOH 203 ? 1_555 88.9  ? 
66 N7  ? B DG  2   ? T DG  2   ? 1_555 MN ? R MN . ? T MN 101 ? 1_555 O   ? T HOH .   ? T HOH 210 ? 1_555 89.0  ? 
67 O   ? T HOH .   ? T HOH 203 ? 1_555 MN ? R MN . ? T MN 101 ? 1_555 O   ? T HOH .   ? T HOH 210 ? 1_555 80.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-08-30 
2 'Structure model' 1 1 2017-09-27 
3 'Structure model' 1 2 2019-12-18 
4 'Structure model' 1 3 2023-10-04 
5 'Structure model' 2 0 2023-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Author supporting evidence' 
2  2 'Structure model' 'Data collection'            
3  3 'Structure model' Advisory                     
4  3 'Structure model' 'Author supporting evidence' 
5  4 'Structure model' 'Data collection'            
6  4 'Structure model' 'Database references'        
7  4 'Structure model' 'Derived calculations'       
8  4 'Structure model' 'Refinement description'     
9  5 'Structure model' 'Atomic model'               
10 5 'Structure model' 'Data collection'            
11 5 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' diffrn_detector               
2  2 'Structure model' pdbx_audit_support            
3  3 'Structure model' pdbx_audit_support            
4  3 'Structure model' pdbx_unobs_or_zero_occ_atoms  
5  4 'Structure model' chem_comp_atom                
6  4 'Structure model' chem_comp_bond                
7  4 'Structure model' database_2                    
8  4 'Structure model' pdbx_initial_refinement_model 
9  4 'Structure model' pdbx_struct_conn_angle        
10 4 'Structure model' struct_conn                   
11 5 'Structure model' atom_site                     
12 5 'Structure model' atom_site_anisotrop           
13 5 'Structure model' chem_comp_atom                
14 5 'Structure model' chem_comp_bond                
15 5 'Structure model' pdbx_struct_conn_angle        
16 5 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_diffrn_detector.detector'                   
2  2 'Structure model' '_pdbx_audit_support.funding_organization'    
3  3 'Structure model' '_pdbx_audit_support.funding_organization'    
4  4 'Structure model' '_database_2.pdbx_DOI'                        
5  4 'Structure model' '_database_2.pdbx_database_accession'         
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id'  
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
22 4 'Structure model' '_pdbx_struct_conn_angle.value'               
23 4 'Structure model' '_struct_conn.conn_type_id'                   
24 4 'Structure model' '_struct_conn.id'                             
25 4 'Structure model' '_struct_conn.pdbx_dist_value'                
26 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
27 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id'        
28 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id'        
29 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
30 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
31 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
32 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
33 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
34 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
35 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
36 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
37 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
38 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
39 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
40 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
41 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
42 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
43 5 'Structure model' '_atom_site.auth_atom_id'                     
44 5 'Structure model' '_atom_site.label_atom_id'                    
45 5 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id'      
46 5 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id'     
47 5 'Structure model' '_chem_comp_atom.atom_id'                     
48 5 'Structure model' '_chem_comp_bond.atom_id_1'                   
49 5 'Structure model' '_chem_comp_bond.atom_id_2'                   
50 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
51 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
52 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         2.9425 
_pdbx_refine_tls.origin_y         -4.4109 
_pdbx_refine_tls.origin_z         -11.6661 
_pdbx_refine_tls.T[1][1]          0.2603 
_pdbx_refine_tls.T[2][2]          0.2649 
_pdbx_refine_tls.T[3][3]          0.1837 
_pdbx_refine_tls.T[1][2]          0.0063 
_pdbx_refine_tls.T[1][3]          0.0070 
_pdbx_refine_tls.T[2][3]          0.0193 
_pdbx_refine_tls.L[1][1]          1.9074 
_pdbx_refine_tls.L[2][2]          1.1676 
_pdbx_refine_tls.L[3][3]          0.7541 
_pdbx_refine_tls.L[1][2]          -0.3492 
_pdbx_refine_tls.L[1][3]          -0.1215 
_pdbx_refine_tls.L[2][3]          0.1908 
_pdbx_refine_tls.S[1][1]          0.0912 
_pdbx_refine_tls.S[2][2]          -0.0480 
_pdbx_refine_tls.S[3][3]          -0.0407 
_pdbx_refine_tls.S[1][2]          0.1823 
_pdbx_refine_tls.S[1][3]          0.0826 
_pdbx_refine_tls.S[2][3]          -0.0712 
_pdbx_refine_tls.S[2][1]          -0.0699 
_pdbx_refine_tls.S[3][1]          0.0249 
_pdbx_refine_tls.S[3][2]          0.0352 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1 A 137 A 494 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 T 1   T 9   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  1 P 1   P 5   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 D 1   D 4   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 B 1   B 6   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 C 1   C 1   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 F 2   F 3   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 S 3   S 423 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 G 1   G 1   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 H 2   H 4   all ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 1 I 1   I 1   all ? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.11.1_2575 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20        3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .           6 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.479 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.128 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             T 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_1              6 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             T 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_2              6 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             T 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_3              6 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                111.07 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            2.77 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 153 ? ? -143.64 43.87   
2 1 THR A 318 ? A -124.46 -150.64 
3 1 PRO A 397 ? ? -49.61  106.46  
4 1 SER A 411 ? ? -164.18 -142.85 
5 1 ASN A 493 ? ? -85.60  49.41   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       858 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.29 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TRP 137 ? CG  ? A TRP 11  CG  
2  1 Y 1 A TRP 137 ? CD1 ? A TRP 11  CD1 
3  1 Y 1 A TRP 137 ? CD2 ? A TRP 11  CD2 
4  1 Y 1 A TRP 137 ? NE1 ? A TRP 11  NE1 
5  1 Y 1 A TRP 137 ? CE2 ? A TRP 11  CE2 
6  1 Y 1 A TRP 137 ? CE3 ? A TRP 11  CE3 
7  1 Y 1 A TRP 137 ? CZ2 ? A TRP 11  CZ2 
8  1 Y 1 A TRP 137 ? CZ3 ? A TRP 11  CZ3 
9  1 Y 1 A TRP 137 ? CH2 ? A TRP 11  CH2 
10 1 Y 1 A GLN 200 ? CG  ? A GLN 74  CG  
11 1 Y 1 A GLN 200 ? CD  ? A GLN 74  CD  
12 1 Y 1 A GLN 200 ? OE1 ? A GLN 74  OE1 
13 1 Y 1 A GLN 200 ? NE2 ? A GLN 74  NE2 
14 1 Y 1 A ARG 211 ? NE  ? A ARG 85  NE  
15 1 Y 1 A ARG 211 ? CZ  ? A ARG 85  CZ  
16 1 Y 1 A ARG 211 ? NH1 ? A ARG 85  NH1 
17 1 Y 1 A ARG 211 ? NH2 ? A ARG 85  NH2 
18 1 Y 1 A GLU 223 ? CD  ? A GLU 97  CD  
19 1 Y 1 A GLU 223 ? OE1 ? A GLU 97  OE1 
20 1 Y 1 A GLU 223 ? OE2 ? A GLU 97  OE2 
21 1 Y 1 A LYS 249 ? CE  ? A LYS 123 CE  
22 1 Y 1 A LYS 249 ? NZ  ? A LYS 123 NZ  
23 1 Y 1 A GLN 268 ? CG  ? A GLN 142 CG  
24 1 Y 1 A GLN 268 ? CD  ? A GLN 142 CD  
25 1 Y 1 A GLN 268 ? OE1 ? A GLN 142 OE1 
26 1 Y 1 A GLN 268 ? NE2 ? A GLN 142 NE2 
27 1 Y 1 A GLN 270 ? CG  ? A GLN 144 CG  
28 1 Y 1 A GLN 270 ? CD  ? A GLN 144 CD  
29 1 Y 1 A GLN 270 ? OE1 ? A GLN 144 OE1 
30 1 Y 1 A GLN 270 ? NE2 ? A GLN 144 NE2 
31 1 Y 1 A LYS 271 ? CG  ? A LYS 145 CG  
32 1 Y 1 A LYS 271 ? CD  ? A LYS 145 CD  
33 1 Y 1 A LYS 271 ? CE  ? A LYS 145 CE  
34 1 Y 1 A LYS 271 ? NZ  ? A LYS 145 NZ  
35 1 Y 1 A GLN 274 ? CG  ? A GLN 148 CG  
36 1 Y 1 A GLN 274 ? CD  ? A GLN 148 CD  
37 1 Y 1 A GLN 274 ? OE1 ? A GLN 148 OE1 
38 1 Y 1 A GLN 274 ? NE2 ? A GLN 148 NE2 
39 1 Y 1 A GLN 300 ? CD  ? A GLN 174 CD  
40 1 Y 1 A GLN 300 ? OE1 ? A GLN 174 OE1 
41 1 Y 1 A GLN 300 ? NE2 ? A GLN 174 NE2 
42 1 Y 1 A LYS 339 ? CD  ? A LYS 213 CD  
43 1 Y 1 A LYS 339 ? CE  ? A LYS 213 CE  
44 1 Y 1 A LYS 339 ? NZ  ? A LYS 213 NZ  
45 1 Y 1 A GLN 355 ? CD  ? A GLN 229 CD  
46 1 Y 1 A GLN 355 ? OE1 ? A GLN 229 OE1 
47 1 Y 1 A GLN 355 ? NE2 ? A GLN 229 NE2 
48 1 Y 1 A GLN 364 ? CG  ? A GLN 238 CG  
49 1 Y 1 A GLN 364 ? CD  ? A GLN 238 CD  
50 1 Y 1 A GLN 364 ? OE1 ? A GLN 238 OE1 
51 1 Y 1 A GLN 364 ? NE2 ? A GLN 238 NE2 
52 1 Y 1 A GLU 465 ? CD  ? A GLU 327 CD  
53 1 Y 1 A GLU 465 ? OE1 ? A GLU 327 OE1 
54 1 Y 1 A GLU 465 ? OE2 ? A GLU 327 OE2 
55 1 Y 1 A LYS 467 ? NZ  ? A LYS 329 NZ  
56 1 Y 1 A GLN 471 ? OE1 ? A GLN 333 OE1 
57 1 Y 1 A GLN 471 ? NE2 ? A GLN 333 NE2 
58 1 N 1 A EPE 509 ? N1  ? M EPE 1   N1  
59 1 N 1 A EPE 509 ? C2  ? M EPE 1   C2  
60 1 N 1 A EPE 509 ? C3  ? M EPE 1   C3  
61 1 N 1 A EPE 509 ? N4  ? M EPE 1   N4  
62 1 N 1 A EPE 509 ? C5  ? M EPE 1   C5  
63 1 N 1 A EPE 509 ? C6  ? M EPE 1   C6  
64 1 N 1 A EPE 509 ? C7  ? M EPE 1   C7  
65 1 N 1 A EPE 509 ? C8  ? M EPE 1   C8  
66 1 N 1 A EPE 509 ? O8  ? M EPE 1   O8  
67 1 N 1 A EPE 509 ? C9  ? M EPE 1   C9  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 127 ? A GLY 1   
2  1 Y 1 A SER 128 ? A SER 2   
3  1 Y 1 A ALA 129 ? A ALA 3   
4  1 Y 1 A ALA 130 ? A ALA 4   
5  1 Y 1 A ALA 131 ? A ALA 5   
6  1 Y 1 A PRO 132 ? A PRO 6   
7  1 Y 1 A LEU 133 ? A LEU 7   
8  1 Y 1 A SER 134 ? A SER 8   
9  1 Y 1 A PRO 135 ? A PRO 9   
10 1 Y 1 A ALA 136 ? A ALA 10  
11 1 Y 1 A HIS 365 ? A HIS 239 
12 1 Y 1 A GLN 366 ? A GLN 240 
13 1 Y 1 A HIS 367 ? A HIS 241 
14 1 Y 1 A SER 368 ? A SER 242 
15 1 Y 1 A CYS 369 ? A CYS 243 
16 1 Y 1 A CYS 370 ? A CYS 244 
17 1 Y 1 A GLU 371 ? A GLU 245 
18 1 Y 1 A SER 372 ? A SER 246 
19 1 Y 1 A PRO 373 ? A PRO 247 
20 1 Y 1 A THR 374 ? A THR 248 
21 1 Y 1 A ARG 375 ? A ARG 249 
22 1 Y 1 A LEU 376 ? A LEU 250 
23 1 Y 1 A ALA 377 ? A ALA 251 
24 1 Y 1 A GLN 378 ? A GLN 252 
25 1 Y 1 A GLN 379 ? A GLN 253 
26 1 Y 1 A SER 380 ? A SER 254 
27 1 Y 1 A HIS 381 ? A HIS 255 
28 1 Y 1 A MET 382 ? A MET 256 
29 1 Y 1 A ASP 383 ? A ASP 257 
30 1 Y 1 A ALA 384 ? A ALA 258 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
DA  OP3    O  N N 88  
DA  P      P  N N 89  
DA  OP1    O  N N 90  
DA  OP2    O  N N 91  
DA  "O5'"  O  N N 92  
DA  "C5'"  C  N N 93  
DA  "C4'"  C  N R 94  
DA  "O4'"  O  N N 95  
DA  "C3'"  C  N S 96  
DA  "O3'"  O  N N 97  
DA  "C2'"  C  N N 98  
DA  "C1'"  C  N R 99  
DA  N9     N  Y N 100 
DA  C8     C  Y N 101 
DA  N7     N  Y N 102 
DA  C5     C  Y N 103 
DA  C6     C  Y N 104 
DA  N6     N  N N 105 
DA  N1     N  Y N 106 
DA  C2     C  Y N 107 
DA  N3     N  Y N 108 
DA  C4     C  Y N 109 
DA  HOP3   H  N N 110 
DA  HOP2   H  N N 111 
DA  "H5'"  H  N N 112 
DA  "H5''" H  N N 113 
DA  "H4'"  H  N N 114 
DA  "H3'"  H  N N 115 
DA  "HO3'" H  N N 116 
DA  "H2'"  H  N N 117 
DA  "H2''" H  N N 118 
DA  "H1'"  H  N N 119 
DA  H8     H  N N 120 
DA  H61    H  N N 121 
DA  H62    H  N N 122 
DA  H2     H  N N 123 
DC  OP3    O  N N 124 
DC  P      P  N N 125 
DC  OP1    O  N N 126 
DC  OP2    O  N N 127 
DC  "O5'"  O  N N 128 
DC  "C5'"  C  N N 129 
DC  "C4'"  C  N R 130 
DC  "O4'"  O  N N 131 
DC  "C3'"  C  N S 132 
DC  "O3'"  O  N N 133 
DC  "C2'"  C  N N 134 
DC  "C1'"  C  N R 135 
DC  N1     N  N N 136 
DC  C2     C  N N 137 
DC  O2     O  N N 138 
DC  N3     N  N N 139 
DC  C4     C  N N 140 
DC  N4     N  N N 141 
DC  C5     C  N N 142 
DC  C6     C  N N 143 
DC  HOP3   H  N N 144 
DC  HOP2   H  N N 145 
DC  "H5'"  H  N N 146 
DC  "H5''" H  N N 147 
DC  "H4'"  H  N N 148 
DC  "H3'"  H  N N 149 
DC  "HO3'" H  N N 150 
DC  "H2'"  H  N N 151 
DC  "H2''" H  N N 152 
DC  "H1'"  H  N N 153 
DC  H41    H  N N 154 
DC  H42    H  N N 155 
DC  H5     H  N N 156 
DC  H6     H  N N 157 
DG  OP3    O  N N 158 
DG  P      P  N N 159 
DG  OP1    O  N N 160 
DG  OP2    O  N N 161 
DG  "O5'"  O  N N 162 
DG  "C5'"  C  N N 163 
DG  "C4'"  C  N R 164 
DG  "O4'"  O  N N 165 
DG  "C3'"  C  N S 166 
DG  "O3'"  O  N N 167 
DG  "C2'"  C  N N 168 
DG  "C1'"  C  N R 169 
DG  N9     N  Y N 170 
DG  C8     C  Y N 171 
DG  N7     N  Y N 172 
DG  C5     C  Y N 173 
DG  C6     C  N N 174 
DG  O6     O  N N 175 
DG  N1     N  N N 176 
DG  C2     C  N N 177 
DG  N2     N  N N 178 
DG  N3     N  N N 179 
DG  C4     C  Y N 180 
DG  HOP3   H  N N 181 
DG  HOP2   H  N N 182 
DG  "H5'"  H  N N 183 
DG  "H5''" H  N N 184 
DG  "H4'"  H  N N 185 
DG  "H3'"  H  N N 186 
DG  "HO3'" H  N N 187 
DG  "H2'"  H  N N 188 
DG  "H2''" H  N N 189 
DG  "H1'"  H  N N 190 
DG  H8     H  N N 191 
DG  H1     H  N N 192 
DG  H21    H  N N 193 
DG  H22    H  N N 194 
DT  OP3    O  N N 195 
DT  P      P  N N 196 
DT  OP1    O  N N 197 
DT  OP2    O  N N 198 
DT  "O5'"  O  N N 199 
DT  "C5'"  C  N N 200 
DT  "C4'"  C  N R 201 
DT  "O4'"  O  N N 202 
DT  "C3'"  C  N S 203 
DT  "O3'"  O  N N 204 
DT  "C2'"  C  N N 205 
DT  "C1'"  C  N R 206 
DT  N1     N  N N 207 
DT  C2     C  N N 208 
DT  O2     O  N N 209 
DT  N3     N  N N 210 
DT  C4     C  N N 211 
DT  O4     O  N N 212 
DT  C5     C  N N 213 
DT  C7     C  N N 214 
DT  C6     C  N N 215 
DT  HOP3   H  N N 216 
DT  HOP2   H  N N 217 
DT  "H5'"  H  N N 218 
DT  "H5''" H  N N 219 
DT  "H4'"  H  N N 220 
DT  "H3'"  H  N N 221 
DT  "HO3'" H  N N 222 
DT  "H2'"  H  N N 223 
DT  "H2''" H  N N 224 
DT  "H1'"  H  N N 225 
DT  H3     H  N N 226 
DT  H71    H  N N 227 
DT  H72    H  N N 228 
DT  H73    H  N N 229 
DT  H6     H  N N 230 
DTT S1     S  N N 231 
DTT C1     C  N N 232 
DTT C2     C  N R 233 
DTT O2     O  N N 234 
DTT C3     C  N R 235 
DTT O3     O  N N 236 
DTT C4     C  N N 237 
DTT S4     S  N N 238 
DTT HS1    H  N N 239 
DTT H11    H  N N 240 
DTT H12    H  N N 241 
DTT H2     H  N N 242 
DTT HO2    H  N N 243 
DTT H3     H  N N 244 
DTT HO3    H  N N 245 
DTT H41    H  N N 246 
DTT H42    H  N N 247 
DTT HS2    H  N N 248 
EDO C1     C  N N 249 
EDO O1     O  N N 250 
EDO C2     C  N N 251 
EDO O2     O  N N 252 
EDO H11    H  N N 253 
EDO H12    H  N N 254 
EDO HO1    H  N N 255 
EDO H21    H  N N 256 
EDO H22    H  N N 257 
EDO HO2    H  N N 258 
EPE N1     N  N N 259 
EPE C2     C  N N 260 
EPE C3     C  N N 261 
EPE N4     N  N N 262 
EPE C5     C  N N 263 
EPE C6     C  N N 264 
EPE C7     C  N N 265 
EPE C8     C  N N 266 
EPE O8     O  N N 267 
EPE C9     C  N N 268 
EPE C10    C  N N 269 
EPE S      S  N N 270 
EPE O1S    O  N N 271 
EPE O2S    O  N N 272 
EPE O3S    O  N N 273 
EPE H21    H  N N 274 
EPE H22    H  N N 275 
EPE H31    H  N N 276 
EPE H32    H  N N 277 
EPE H51    H  N N 278 
EPE H52    H  N N 279 
EPE H61    H  N N 280 
EPE H62    H  N N 281 
EPE H71    H  N N 282 
EPE H72    H  N N 283 
EPE H81    H  N N 284 
EPE H82    H  N N 285 
EPE HO8    H  N N 286 
EPE H91    H  N N 287 
EPE H92    H  N N 288 
EPE H101   H  N N 289 
EPE H102   H  N N 290 
EPE HOS3   H  N N 291 
GLN N      N  N N 292 
GLN CA     C  N S 293 
GLN C      C  N N 294 
GLN O      O  N N 295 
GLN CB     C  N N 296 
GLN CG     C  N N 297 
GLN CD     C  N N 298 
GLN OE1    O  N N 299 
GLN NE2    N  N N 300 
GLN OXT    O  N N 301 
GLN H      H  N N 302 
GLN H2     H  N N 303 
GLN HA     H  N N 304 
GLN HB2    H  N N 305 
GLN HB3    H  N N 306 
GLN HG2    H  N N 307 
GLN HG3    H  N N 308 
GLN HE21   H  N N 309 
GLN HE22   H  N N 310 
GLN HXT    H  N N 311 
GLU N      N  N N 312 
GLU CA     C  N S 313 
GLU C      C  N N 314 
GLU O      O  N N 315 
GLU CB     C  N N 316 
GLU CG     C  N N 317 
GLU CD     C  N N 318 
GLU OE1    O  N N 319 
GLU OE2    O  N N 320 
GLU OXT    O  N N 321 
GLU H      H  N N 322 
GLU H2     H  N N 323 
GLU HA     H  N N 324 
GLU HB2    H  N N 325 
GLU HB3    H  N N 326 
GLU HG2    H  N N 327 
GLU HG3    H  N N 328 
GLU HE2    H  N N 329 
GLU HXT    H  N N 330 
GLY N      N  N N 331 
GLY CA     C  N N 332 
GLY C      C  N N 333 
GLY O      O  N N 334 
GLY OXT    O  N N 335 
GLY H      H  N N 336 
GLY H2     H  N N 337 
GLY HA2    H  N N 338 
GLY HA3    H  N N 339 
GLY HXT    H  N N 340 
GOA C      C  N N 341 
GOA CA     C  N N 342 
GOA O      O  N N 343 
GOA OXT    O  N N 344 
GOA O2     O  N N 345 
GOA H22    H  N N 346 
GOA H21    H  N N 347 
GOA HXT    H  N N 348 
GOA H20    H  N N 349 
HIS N      N  N N 350 
HIS CA     C  N S 351 
HIS C      C  N N 352 
HIS O      O  N N 353 
HIS CB     C  N N 354 
HIS CG     C  Y N 355 
HIS ND1    N  Y N 356 
HIS CD2    C  Y N 357 
HIS CE1    C  Y N 358 
HIS NE2    N  Y N 359 
HIS OXT    O  N N 360 
HIS H      H  N N 361 
HIS H2     H  N N 362 
HIS HA     H  N N 363 
HIS HB2    H  N N 364 
HIS HB3    H  N N 365 
HIS HD1    H  N N 366 
HIS HD2    H  N N 367 
HIS HE1    H  N N 368 
HIS HE2    H  N N 369 
HIS HXT    H  N N 370 
HOH O      O  N N 371 
HOH H1     H  N N 372 
HOH H2     H  N N 373 
ILE N      N  N N 374 
ILE CA     C  N S 375 
ILE C      C  N N 376 
ILE O      O  N N 377 
ILE CB     C  N S 378 
ILE CG1    C  N N 379 
ILE CG2    C  N N 380 
ILE CD1    C  N N 381 
ILE OXT    O  N N 382 
ILE H      H  N N 383 
ILE H2     H  N N 384 
ILE HA     H  N N 385 
ILE HB     H  N N 386 
ILE HG12   H  N N 387 
ILE HG13   H  N N 388 
ILE HG21   H  N N 389 
ILE HG22   H  N N 390 
ILE HG23   H  N N 391 
ILE HD11   H  N N 392 
ILE HD12   H  N N 393 
ILE HD13   H  N N 394 
ILE HXT    H  N N 395 
LEU N      N  N N 396 
LEU CA     C  N S 397 
LEU C      C  N N 398 
LEU O      O  N N 399 
LEU CB     C  N N 400 
LEU CG     C  N N 401 
LEU CD1    C  N N 402 
LEU CD2    C  N N 403 
LEU OXT    O  N N 404 
LEU H      H  N N 405 
LEU H2     H  N N 406 
LEU HA     H  N N 407 
LEU HB2    H  N N 408 
LEU HB3    H  N N 409 
LEU HG     H  N N 410 
LEU HD11   H  N N 411 
LEU HD12   H  N N 412 
LEU HD13   H  N N 413 
LEU HD21   H  N N 414 
LEU HD22   H  N N 415 
LEU HD23   H  N N 416 
LEU HXT    H  N N 417 
LYS N      N  N N 418 
LYS CA     C  N S 419 
LYS C      C  N N 420 
LYS O      O  N N 421 
LYS CB     C  N N 422 
LYS CG     C  N N 423 
LYS CD     C  N N 424 
LYS CE     C  N N 425 
LYS NZ     N  N N 426 
LYS OXT    O  N N 427 
LYS H      H  N N 428 
LYS H2     H  N N 429 
LYS HA     H  N N 430 
LYS HB2    H  N N 431 
LYS HB3    H  N N 432 
LYS HG2    H  N N 433 
LYS HG3    H  N N 434 
LYS HD2    H  N N 435 
LYS HD3    H  N N 436 
LYS HE2    H  N N 437 
LYS HE3    H  N N 438 
LYS HZ1    H  N N 439 
LYS HZ2    H  N N 440 
LYS HZ3    H  N N 441 
LYS HXT    H  N N 442 
MET N      N  N N 443 
MET CA     C  N S 444 
MET C      C  N N 445 
MET O      O  N N 446 
MET CB     C  N N 447 
MET CG     C  N N 448 
MET SD     S  N N 449 
MET CE     C  N N 450 
MET OXT    O  N N 451 
MET H      H  N N 452 
MET H2     H  N N 453 
MET HA     H  N N 454 
MET HB2    H  N N 455 
MET HB3    H  N N 456 
MET HG2    H  N N 457 
MET HG3    H  N N 458 
MET HE1    H  N N 459 
MET HE2    H  N N 460 
MET HE3    H  N N 461 
MET HXT    H  N N 462 
MN  MN     MN N N 463 
NA  NA     NA N N 464 
PHE N      N  N N 465 
PHE CA     C  N S 466 
PHE C      C  N N 467 
PHE O      O  N N 468 
PHE CB     C  N N 469 
PHE CG     C  Y N 470 
PHE CD1    C  Y N 471 
PHE CD2    C  Y N 472 
PHE CE1    C  Y N 473 
PHE CE2    C  Y N 474 
PHE CZ     C  Y N 475 
PHE OXT    O  N N 476 
PHE H      H  N N 477 
PHE H2     H  N N 478 
PHE HA     H  N N 479 
PHE HB2    H  N N 480 
PHE HB3    H  N N 481 
PHE HD1    H  N N 482 
PHE HD2    H  N N 483 
PHE HE1    H  N N 484 
PHE HE2    H  N N 485 
PHE HZ     H  N N 486 
PHE HXT    H  N N 487 
PRO N      N  N N 488 
PRO CA     C  N S 489 
PRO C      C  N N 490 
PRO O      O  N N 491 
PRO CB     C  N N 492 
PRO CG     C  N N 493 
PRO CD     C  N N 494 
PRO OXT    O  N N 495 
PRO H      H  N N 496 
PRO HA     H  N N 497 
PRO HB2    H  N N 498 
PRO HB3    H  N N 499 
PRO HG2    H  N N 500 
PRO HG3    H  N N 501 
PRO HD2    H  N N 502 
PRO HD3    H  N N 503 
PRO HXT    H  N N 504 
SER N      N  N N 505 
SER CA     C  N S 506 
SER C      C  N N 507 
SER O      O  N N 508 
SER CB     C  N N 509 
SER OG     O  N N 510 
SER OXT    O  N N 511 
SER H      H  N N 512 
SER H2     H  N N 513 
SER HA     H  N N 514 
SER HB2    H  N N 515 
SER HB3    H  N N 516 
SER HG     H  N N 517 
SER HXT    H  N N 518 
THR N      N  N N 519 
THR CA     C  N S 520 
THR C      C  N N 521 
THR O      O  N N 522 
THR CB     C  N R 523 
THR OG1    O  N N 524 
THR CG2    C  N N 525 
THR OXT    O  N N 526 
THR H      H  N N 527 
THR H2     H  N N 528 
THR HA     H  N N 529 
THR HB     H  N N 530 
THR HG1    H  N N 531 
THR HG21   H  N N 532 
THR HG22   H  N N 533 
THR HG23   H  N N 534 
THR HXT    H  N N 535 
TRP N      N  N N 536 
TRP CA     C  N S 537 
TRP C      C  N N 538 
TRP O      O  N N 539 
TRP CB     C  N N 540 
TRP CG     C  Y N 541 
TRP CD1    C  Y N 542 
TRP CD2    C  Y N 543 
TRP NE1    N  Y N 544 
TRP CE2    C  Y N 545 
TRP CE3    C  Y N 546 
TRP CZ2    C  Y N 547 
TRP CZ3    C  Y N 548 
TRP CH2    C  Y N 549 
TRP OXT    O  N N 550 
TRP H      H  N N 551 
TRP H2     H  N N 552 
TRP HA     H  N N 553 
TRP HB2    H  N N 554 
TRP HB3    H  N N 555 
TRP HD1    H  N N 556 
TRP HE1    H  N N 557 
TRP HE3    H  N N 558 
TRP HZ2    H  N N 559 
TRP HZ3    H  N N 560 
TRP HH2    H  N N 561 
TRP HXT    H  N N 562 
TYR N      N  N N 563 
TYR CA     C  N S 564 
TYR C      C  N N 565 
TYR O      O  N N 566 
TYR CB     C  N N 567 
TYR CG     C  Y N 568 
TYR CD1    C  Y N 569 
TYR CD2    C  Y N 570 
TYR CE1    C  Y N 571 
TYR CE2    C  Y N 572 
TYR CZ     C  Y N 573 
TYR OH     O  N N 574 
TYR OXT    O  N N 575 
TYR H      H  N N 576 
TYR H2     H  N N 577 
TYR HA     H  N N 578 
TYR HB2    H  N N 579 
TYR HB3    H  N N 580 
TYR HD1    H  N N 581 
TYR HD2    H  N N 582 
TYR HE1    H  N N 583 
TYR HE2    H  N N 584 
TYR HH     H  N N 585 
TYR HXT    H  N N 586 
VAL N      N  N N 587 
VAL CA     C  N S 588 
VAL C      C  N N 589 
VAL O      O  N N 590 
VAL CB     C  N N 591 
VAL CG1    C  N N 592 
VAL CG2    C  N N 593 
VAL OXT    O  N N 594 
VAL H      H  N N 595 
VAL H2     H  N N 596 
VAL HA     H  N N 597 
VAL HB     H  N N 598 
VAL HG11   H  N N 599 
VAL HG12   H  N N 600 
VAL HG13   H  N N 601 
VAL HG21   H  N N 602 
VAL HG22   H  N N 603 
VAL HG23   H  N N 604 
VAL HXT    H  N N 605 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
DA  OP3   P      sing N N 83  
DA  OP3   HOP3   sing N N 84  
DA  P     OP1    doub N N 85  
DA  P     OP2    sing N N 86  
DA  P     "O5'"  sing N N 87  
DA  OP2   HOP2   sing N N 88  
DA  "O5'" "C5'"  sing N N 89  
DA  "C5'" "C4'"  sing N N 90  
DA  "C5'" "H5'"  sing N N 91  
DA  "C5'" "H5''" sing N N 92  
DA  "C4'" "O4'"  sing N N 93  
DA  "C4'" "C3'"  sing N N 94  
DA  "C4'" "H4'"  sing N N 95  
DA  "O4'" "C1'"  sing N N 96  
DA  "C3'" "O3'"  sing N N 97  
DA  "C3'" "C2'"  sing N N 98  
DA  "C3'" "H3'"  sing N N 99  
DA  "O3'" "HO3'" sing N N 100 
DA  "C2'" "C1'"  sing N N 101 
DA  "C2'" "H2'"  sing N N 102 
DA  "C2'" "H2''" sing N N 103 
DA  "C1'" N9     sing N N 104 
DA  "C1'" "H1'"  sing N N 105 
DA  N9    C8     sing Y N 106 
DA  N9    C4     sing Y N 107 
DA  C8    N7     doub Y N 108 
DA  C8    H8     sing N N 109 
DA  N7    C5     sing Y N 110 
DA  C5    C6     sing Y N 111 
DA  C5    C4     doub Y N 112 
DA  C6    N6     sing N N 113 
DA  C6    N1     doub Y N 114 
DA  N6    H61    sing N N 115 
DA  N6    H62    sing N N 116 
DA  N1    C2     sing Y N 117 
DA  C2    N3     doub Y N 118 
DA  C2    H2     sing N N 119 
DA  N3    C4     sing Y N 120 
DC  OP3   P      sing N N 121 
DC  OP3   HOP3   sing N N 122 
DC  P     OP1    doub N N 123 
DC  P     OP2    sing N N 124 
DC  P     "O5'"  sing N N 125 
DC  OP2   HOP2   sing N N 126 
DC  "O5'" "C5'"  sing N N 127 
DC  "C5'" "C4'"  sing N N 128 
DC  "C5'" "H5'"  sing N N 129 
DC  "C5'" "H5''" sing N N 130 
DC  "C4'" "O4'"  sing N N 131 
DC  "C4'" "C3'"  sing N N 132 
DC  "C4'" "H4'"  sing N N 133 
DC  "O4'" "C1'"  sing N N 134 
DC  "C3'" "O3'"  sing N N 135 
DC  "C3'" "C2'"  sing N N 136 
DC  "C3'" "H3'"  sing N N 137 
DC  "O3'" "HO3'" sing N N 138 
DC  "C2'" "C1'"  sing N N 139 
DC  "C2'" "H2'"  sing N N 140 
DC  "C2'" "H2''" sing N N 141 
DC  "C1'" N1     sing N N 142 
DC  "C1'" "H1'"  sing N N 143 
DC  N1    C2     sing N N 144 
DC  N1    C6     sing N N 145 
DC  C2    O2     doub N N 146 
DC  C2    N3     sing N N 147 
DC  N3    C4     doub N N 148 
DC  C4    N4     sing N N 149 
DC  C4    C5     sing N N 150 
DC  N4    H41    sing N N 151 
DC  N4    H42    sing N N 152 
DC  C5    C6     doub N N 153 
DC  C5    H5     sing N N 154 
DC  C6    H6     sing N N 155 
DG  OP3   P      sing N N 156 
DG  OP3   HOP3   sing N N 157 
DG  P     OP1    doub N N 158 
DG  P     OP2    sing N N 159 
DG  P     "O5'"  sing N N 160 
DG  OP2   HOP2   sing N N 161 
DG  "O5'" "C5'"  sing N N 162 
DG  "C5'" "C4'"  sing N N 163 
DG  "C5'" "H5'"  sing N N 164 
DG  "C5'" "H5''" sing N N 165 
DG  "C4'" "O4'"  sing N N 166 
DG  "C4'" "C3'"  sing N N 167 
DG  "C4'" "H4'"  sing N N 168 
DG  "O4'" "C1'"  sing N N 169 
DG  "C3'" "O3'"  sing N N 170 
DG  "C3'" "C2'"  sing N N 171 
DG  "C3'" "H3'"  sing N N 172 
DG  "O3'" "HO3'" sing N N 173 
DG  "C2'" "C1'"  sing N N 174 
DG  "C2'" "H2'"  sing N N 175 
DG  "C2'" "H2''" sing N N 176 
DG  "C1'" N9     sing N N 177 
DG  "C1'" "H1'"  sing N N 178 
DG  N9    C8     sing Y N 179 
DG  N9    C4     sing Y N 180 
DG  C8    N7     doub Y N 181 
DG  C8    H8     sing N N 182 
DG  N7    C5     sing Y N 183 
DG  C5    C6     sing N N 184 
DG  C5    C4     doub Y N 185 
DG  C6    O6     doub N N 186 
DG  C6    N1     sing N N 187 
DG  N1    C2     sing N N 188 
DG  N1    H1     sing N N 189 
DG  C2    N2     sing N N 190 
DG  C2    N3     doub N N 191 
DG  N2    H21    sing N N 192 
DG  N2    H22    sing N N 193 
DG  N3    C4     sing N N 194 
DT  OP3   P      sing N N 195 
DT  OP3   HOP3   sing N N 196 
DT  P     OP1    doub N N 197 
DT  P     OP2    sing N N 198 
DT  P     "O5'"  sing N N 199 
DT  OP2   HOP2   sing N N 200 
DT  "O5'" "C5'"  sing N N 201 
DT  "C5'" "C4'"  sing N N 202 
DT  "C5'" "H5'"  sing N N 203 
DT  "C5'" "H5''" sing N N 204 
DT  "C4'" "O4'"  sing N N 205 
DT  "C4'" "C3'"  sing N N 206 
DT  "C4'" "H4'"  sing N N 207 
DT  "O4'" "C1'"  sing N N 208 
DT  "C3'" "O3'"  sing N N 209 
DT  "C3'" "C2'"  sing N N 210 
DT  "C3'" "H3'"  sing N N 211 
DT  "O3'" "HO3'" sing N N 212 
DT  "C2'" "C1'"  sing N N 213 
DT  "C2'" "H2'"  sing N N 214 
DT  "C2'" "H2''" sing N N 215 
DT  "C1'" N1     sing N N 216 
DT  "C1'" "H1'"  sing N N 217 
DT  N1    C2     sing N N 218 
DT  N1    C6     sing N N 219 
DT  C2    O2     doub N N 220 
DT  C2    N3     sing N N 221 
DT  N3    C4     sing N N 222 
DT  N3    H3     sing N N 223 
DT  C4    O4     doub N N 224 
DT  C4    C5     sing N N 225 
DT  C5    C7     sing N N 226 
DT  C5    C6     doub N N 227 
DT  C7    H71    sing N N 228 
DT  C7    H72    sing N N 229 
DT  C7    H73    sing N N 230 
DT  C6    H6     sing N N 231 
DTT S1    C1     sing N N 232 
DTT S1    HS1    sing N N 233 
DTT C1    C2     sing N N 234 
DTT C1    H11    sing N N 235 
DTT C1    H12    sing N N 236 
DTT C2    O2     sing N N 237 
DTT C2    C3     sing N N 238 
DTT C2    H2     sing N N 239 
DTT O2    HO2    sing N N 240 
DTT C3    O3     sing N N 241 
DTT C3    C4     sing N N 242 
DTT C3    H3     sing N N 243 
DTT O3    HO3    sing N N 244 
DTT C4    S4     sing N N 245 
DTT C4    H41    sing N N 246 
DTT C4    H42    sing N N 247 
DTT S4    HS2    sing N N 248 
EDO C1    O1     sing N N 249 
EDO C1    C2     sing N N 250 
EDO C1    H11    sing N N 251 
EDO C1    H12    sing N N 252 
EDO O1    HO1    sing N N 253 
EDO C2    O2     sing N N 254 
EDO C2    H21    sing N N 255 
EDO C2    H22    sing N N 256 
EDO O2    HO2    sing N N 257 
EPE N1    C2     sing N N 258 
EPE N1    C6     sing N N 259 
EPE N1    C9     sing N N 260 
EPE C2    C3     sing N N 261 
EPE C2    H21    sing N N 262 
EPE C2    H22    sing N N 263 
EPE C3    N4     sing N N 264 
EPE C3    H31    sing N N 265 
EPE C3    H32    sing N N 266 
EPE N4    C5     sing N N 267 
EPE N4    C7     sing N N 268 
EPE C5    C6     sing N N 269 
EPE C5    H51    sing N N 270 
EPE C5    H52    sing N N 271 
EPE C6    H61    sing N N 272 
EPE C6    H62    sing N N 273 
EPE C7    C8     sing N N 274 
EPE C7    H71    sing N N 275 
EPE C7    H72    sing N N 276 
EPE C8    O8     sing N N 277 
EPE C8    H81    sing N N 278 
EPE C8    H82    sing N N 279 
EPE O8    HO8    sing N N 280 
EPE C9    C10    sing N N 281 
EPE C9    H91    sing N N 282 
EPE C9    H92    sing N N 283 
EPE C10   S      sing N N 284 
EPE C10   H101   sing N N 285 
EPE C10   H102   sing N N 286 
EPE S     O1S    doub N N 287 
EPE S     O2S    doub N N 288 
EPE S     O3S    sing N N 289 
EPE O3S   HOS3   sing N N 290 
GLN N     CA     sing N N 291 
GLN N     H      sing N N 292 
GLN N     H2     sing N N 293 
GLN CA    C      sing N N 294 
GLN CA    CB     sing N N 295 
GLN CA    HA     sing N N 296 
GLN C     O      doub N N 297 
GLN C     OXT    sing N N 298 
GLN CB    CG     sing N N 299 
GLN CB    HB2    sing N N 300 
GLN CB    HB3    sing N N 301 
GLN CG    CD     sing N N 302 
GLN CG    HG2    sing N N 303 
GLN CG    HG3    sing N N 304 
GLN CD    OE1    doub N N 305 
GLN CD    NE2    sing N N 306 
GLN NE2   HE21   sing N N 307 
GLN NE2   HE22   sing N N 308 
GLN OXT   HXT    sing N N 309 
GLU N     CA     sing N N 310 
GLU N     H      sing N N 311 
GLU N     H2     sing N N 312 
GLU CA    C      sing N N 313 
GLU CA    CB     sing N N 314 
GLU CA    HA     sing N N 315 
GLU C     O      doub N N 316 
GLU C     OXT    sing N N 317 
GLU CB    CG     sing N N 318 
GLU CB    HB2    sing N N 319 
GLU CB    HB3    sing N N 320 
GLU CG    CD     sing N N 321 
GLU CG    HG2    sing N N 322 
GLU CG    HG3    sing N N 323 
GLU CD    OE1    doub N N 324 
GLU CD    OE2    sing N N 325 
GLU OE2   HE2    sing N N 326 
GLU OXT   HXT    sing N N 327 
GLY N     CA     sing N N 328 
GLY N     H      sing N N 329 
GLY N     H2     sing N N 330 
GLY CA    C      sing N N 331 
GLY CA    HA2    sing N N 332 
GLY CA    HA3    sing N N 333 
GLY C     O      doub N N 334 
GLY C     OXT    sing N N 335 
GLY OXT   HXT    sing N N 336 
GOA C     CA     sing N N 337 
GOA C     O      doub N N 338 
GOA C     OXT    sing N N 339 
GOA CA    O2     sing N N 340 
GOA CA    H22    sing N N 341 
GOA CA    H21    sing N N 342 
GOA OXT   HXT    sing N N 343 
GOA O2    H20    sing N N 344 
HIS N     CA     sing N N 345 
HIS N     H      sing N N 346 
HIS N     H2     sing N N 347 
HIS CA    C      sing N N 348 
HIS CA    CB     sing N N 349 
HIS CA    HA     sing N N 350 
HIS C     O      doub N N 351 
HIS C     OXT    sing N N 352 
HIS CB    CG     sing N N 353 
HIS CB    HB2    sing N N 354 
HIS CB    HB3    sing N N 355 
HIS CG    ND1    sing Y N 356 
HIS CG    CD2    doub Y N 357 
HIS ND1   CE1    doub Y N 358 
HIS ND1   HD1    sing N N 359 
HIS CD2   NE2    sing Y N 360 
HIS CD2   HD2    sing N N 361 
HIS CE1   NE2    sing Y N 362 
HIS CE1   HE1    sing N N 363 
HIS NE2   HE2    sing N N 364 
HIS OXT   HXT    sing N N 365 
HOH O     H1     sing N N 366 
HOH O     H2     sing N N 367 
ILE N     CA     sing N N 368 
ILE N     H      sing N N 369 
ILE N     H2     sing N N 370 
ILE CA    C      sing N N 371 
ILE CA    CB     sing N N 372 
ILE CA    HA     sing N N 373 
ILE C     O      doub N N 374 
ILE C     OXT    sing N N 375 
ILE CB    CG1    sing N N 376 
ILE CB    CG2    sing N N 377 
ILE CB    HB     sing N N 378 
ILE CG1   CD1    sing N N 379 
ILE CG1   HG12   sing N N 380 
ILE CG1   HG13   sing N N 381 
ILE CG2   HG21   sing N N 382 
ILE CG2   HG22   sing N N 383 
ILE CG2   HG23   sing N N 384 
ILE CD1   HD11   sing N N 385 
ILE CD1   HD12   sing N N 386 
ILE CD1   HD13   sing N N 387 
ILE OXT   HXT    sing N N 388 
LEU N     CA     sing N N 389 
LEU N     H      sing N N 390 
LEU N     H2     sing N N 391 
LEU CA    C      sing N N 392 
LEU CA    CB     sing N N 393 
LEU CA    HA     sing N N 394 
LEU C     O      doub N N 395 
LEU C     OXT    sing N N 396 
LEU CB    CG     sing N N 397 
LEU CB    HB2    sing N N 398 
LEU CB    HB3    sing N N 399 
LEU CG    CD1    sing N N 400 
LEU CG    CD2    sing N N 401 
LEU CG    HG     sing N N 402 
LEU CD1   HD11   sing N N 403 
LEU CD1   HD12   sing N N 404 
LEU CD1   HD13   sing N N 405 
LEU CD2   HD21   sing N N 406 
LEU CD2   HD22   sing N N 407 
LEU CD2   HD23   sing N N 408 
LEU OXT   HXT    sing N N 409 
LYS N     CA     sing N N 410 
LYS N     H      sing N N 411 
LYS N     H2     sing N N 412 
LYS CA    C      sing N N 413 
LYS CA    CB     sing N N 414 
LYS CA    HA     sing N N 415 
LYS C     O      doub N N 416 
LYS C     OXT    sing N N 417 
LYS CB    CG     sing N N 418 
LYS CB    HB2    sing N N 419 
LYS CB    HB3    sing N N 420 
LYS CG    CD     sing N N 421 
LYS CG    HG2    sing N N 422 
LYS CG    HG3    sing N N 423 
LYS CD    CE     sing N N 424 
LYS CD    HD2    sing N N 425 
LYS CD    HD3    sing N N 426 
LYS CE    NZ     sing N N 427 
LYS CE    HE2    sing N N 428 
LYS CE    HE3    sing N N 429 
LYS NZ    HZ1    sing N N 430 
LYS NZ    HZ2    sing N N 431 
LYS NZ    HZ3    sing N N 432 
LYS OXT   HXT    sing N N 433 
MET N     CA     sing N N 434 
MET N     H      sing N N 435 
MET N     H2     sing N N 436 
MET CA    C      sing N N 437 
MET CA    CB     sing N N 438 
MET CA    HA     sing N N 439 
MET C     O      doub N N 440 
MET C     OXT    sing N N 441 
MET CB    CG     sing N N 442 
MET CB    HB2    sing N N 443 
MET CB    HB3    sing N N 444 
MET CG    SD     sing N N 445 
MET CG    HG2    sing N N 446 
MET CG    HG3    sing N N 447 
MET SD    CE     sing N N 448 
MET CE    HE1    sing N N 449 
MET CE    HE2    sing N N 450 
MET CE    HE3    sing N N 451 
MET OXT   HXT    sing N N 452 
PHE N     CA     sing N N 453 
PHE N     H      sing N N 454 
PHE N     H2     sing N N 455 
PHE CA    C      sing N N 456 
PHE CA    CB     sing N N 457 
PHE CA    HA     sing N N 458 
PHE C     O      doub N N 459 
PHE C     OXT    sing N N 460 
PHE CB    CG     sing N N 461 
PHE CB    HB2    sing N N 462 
PHE CB    HB3    sing N N 463 
PHE CG    CD1    doub Y N 464 
PHE CG    CD2    sing Y N 465 
PHE CD1   CE1    sing Y N 466 
PHE CD1   HD1    sing N N 467 
PHE CD2   CE2    doub Y N 468 
PHE CD2   HD2    sing N N 469 
PHE CE1   CZ     doub Y N 470 
PHE CE1   HE1    sing N N 471 
PHE CE2   CZ     sing Y N 472 
PHE CE2   HE2    sing N N 473 
PHE CZ    HZ     sing N N 474 
PHE OXT   HXT    sing N N 475 
PRO N     CA     sing N N 476 
PRO N     CD     sing N N 477 
PRO N     H      sing N N 478 
PRO CA    C      sing N N 479 
PRO CA    CB     sing N N 480 
PRO CA    HA     sing N N 481 
PRO C     O      doub N N 482 
PRO C     OXT    sing N N 483 
PRO CB    CG     sing N N 484 
PRO CB    HB2    sing N N 485 
PRO CB    HB3    sing N N 486 
PRO CG    CD     sing N N 487 
PRO CG    HG2    sing N N 488 
PRO CG    HG3    sing N N 489 
PRO CD    HD2    sing N N 490 
PRO CD    HD3    sing N N 491 
PRO OXT   HXT    sing N N 492 
SER N     CA     sing N N 493 
SER N     H      sing N N 494 
SER N     H2     sing N N 495 
SER CA    C      sing N N 496 
SER CA    CB     sing N N 497 
SER CA    HA     sing N N 498 
SER C     O      doub N N 499 
SER C     OXT    sing N N 500 
SER CB    OG     sing N N 501 
SER CB    HB2    sing N N 502 
SER CB    HB3    sing N N 503 
SER OG    HG     sing N N 504 
SER OXT   HXT    sing N N 505 
THR N     CA     sing N N 506 
THR N     H      sing N N 507 
THR N     H2     sing N N 508 
THR CA    C      sing N N 509 
THR CA    CB     sing N N 510 
THR CA    HA     sing N N 511 
THR C     O      doub N N 512 
THR C     OXT    sing N N 513 
THR CB    OG1    sing N N 514 
THR CB    CG2    sing N N 515 
THR CB    HB     sing N N 516 
THR OG1   HG1    sing N N 517 
THR CG2   HG21   sing N N 518 
THR CG2   HG22   sing N N 519 
THR CG2   HG23   sing N N 520 
THR OXT   HXT    sing N N 521 
TRP N     CA     sing N N 522 
TRP N     H      sing N N 523 
TRP N     H2     sing N N 524 
TRP CA    C      sing N N 525 
TRP CA    CB     sing N N 526 
TRP CA    HA     sing N N 527 
TRP C     O      doub N N 528 
TRP C     OXT    sing N N 529 
TRP CB    CG     sing N N 530 
TRP CB    HB2    sing N N 531 
TRP CB    HB3    sing N N 532 
TRP CG    CD1    doub Y N 533 
TRP CG    CD2    sing Y N 534 
TRP CD1   NE1    sing Y N 535 
TRP CD1   HD1    sing N N 536 
TRP CD2   CE2    doub Y N 537 
TRP CD2   CE3    sing Y N 538 
TRP NE1   CE2    sing Y N 539 
TRP NE1   HE1    sing N N 540 
TRP CE2   CZ2    sing Y N 541 
TRP CE3   CZ3    doub Y N 542 
TRP CE3   HE3    sing N N 543 
TRP CZ2   CH2    doub Y N 544 
TRP CZ2   HZ2    sing N N 545 
TRP CZ3   CH2    sing Y N 546 
TRP CZ3   HZ3    sing N N 547 
TRP CH2   HH2    sing N N 548 
TRP OXT   HXT    sing N N 549 
TYR N     CA     sing N N 550 
TYR N     H      sing N N 551 
TYR N     H2     sing N N 552 
TYR CA    C      sing N N 553 
TYR CA    CB     sing N N 554 
TYR CA    HA     sing N N 555 
TYR C     O      doub N N 556 
TYR C     OXT    sing N N 557 
TYR CB    CG     sing N N 558 
TYR CB    HB2    sing N N 559 
TYR CB    HB3    sing N N 560 
TYR CG    CD1    doub Y N 561 
TYR CG    CD2    sing Y N 562 
TYR CD1   CE1    sing Y N 563 
TYR CD1   HD1    sing N N 564 
TYR CD2   CE2    doub Y N 565 
TYR CD2   HD2    sing N N 566 
TYR CE1   CZ     doub Y N 567 
TYR CE1   HE1    sing N N 568 
TYR CE2   CZ     sing Y N 569 
TYR CE2   HE2    sing N N 570 
TYR CZ    OH     sing N N 571 
TYR OH    HH     sing N N 572 
TYR OXT   HXT    sing N N 573 
VAL N     CA     sing N N 574 
VAL N     H      sing N N 575 
VAL N     H2     sing N N 576 
VAL CA    C      sing N N 577 
VAL CA    CB     sing N N 578 
VAL CA    HA     sing N N 579 
VAL C     O      doub N N 580 
VAL C     OXT    sing N N 581 
VAL CB    CG1    sing N N 582 
VAL CB    CG2    sing N N 583 
VAL CB    HB     sing N N 584 
VAL CG1   HG11   sing N N 585 
VAL CG1   HG12   sing N N 586 
VAL CG1   HG13   sing N N 587 
VAL CG2   HG21   sing N N 588 
VAL CG2   HG22   sing N N 589 
VAL CG2   HG23   sing N N 590 
VAL OXT   HXT    sing N N 591 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5TYZ 'double helix'        
5TYZ 'a-form double helix' 
5TYZ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 D DG 4 1_555 -0.219 -0.148 0.557  -12.566 -9.180  -1.473 1 T_DC1:DG4_D T 1 ? D 4 ? 19 1 
1 B DG 2 1_555 D DC 3 1_555 0.089  0.095  0.208  -1.063  -10.666 1.659  2 T_DG2:DC3_D T 2 ? D 3 ? 19 1 
1 B DG 3 1_555 D DC 2 1_555 -0.324 -0.188 0.302  0.502   -9.320  -2.898 3 T_DG3:DC2_D T 3 ? D 2 ? 19 1 
1 B DC 4 1_555 D DG 1 1_555 0.343  -0.100 -0.251 12.686  0.130   0.738  4 T_DC4:DG1_D T 4 ? D 1 ? 19 1 
1 B DA 5 1_555 C DT 5 1_555 0.174  -0.248 -0.184 -16.290 9.613   0.140  5 T_DA5:DT5_P T 5 ? P 5 ? 20 1 
1 B DT 6 1_555 C DA 4 1_555 -0.073 -0.120 -0.183 8.806   3.127   2.911  6 T_DT6:DA4_P T 6 ? P 4 ? 20 1 
1 B DA 7 1_555 C DT 3 1_555 0.059  -0.166 0.360  11.847  -15.001 0.631  7 T_DA7:DT3_P T 7 ? P 3 ? 20 1 
1 B DC 8 1_555 C DG 2 1_555 0.375  -0.204 -0.089 11.321  -10.055 0.702  8 T_DC8:DG2_P T 8 ? P 2 ? 19 1 
1 B DG 9 1_555 C DC 1 1_555 -0.091 -0.153 0.123  -4.332  -9.007  -1.578 9 T_DG9:DC1_P T 9 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 4 1_555 B DG 2 1_555 D DC 3 1_555 -0.465 1.014  3.239 4.258  2.025 37.804 1.299  1.248  3.218 3.111  -6.541  
38.086 1 TT_DC1DG2:DC3DG4_DD T 1 ? D 4 ? T 2 ? D 3 ? 
1 B DG 2 1_555 D DC 3 1_555 B DG 3 1_555 D DC 2 1_555 0.237  -0.129 3.296 -3.935 4.960 33.174 -1.028 -1.046 3.196 8.590  6.814   
33.756 2 TT_DG2DG3:DC2DC3_DD T 2 ? D 3 ? T 3 ? D 2 ? 
1 B DG 3 1_555 D DC 2 1_555 B DC 4 1_555 D DG 1 1_555 0.537  0.015  3.097 5.271  2.265 27.101 -0.497 0.106  3.134 4.765  -11.091 
27.690 3 TT_DG3DC4:DG1DC2_DD T 3 ? D 2 ? T 4 ? D 1 ? 
1 B DA 5 1_555 C DT 5 1_555 B DT 6 1_555 C DA 4 1_555 0.650  -0.377 2.854 -2.653 8.737 19.172 -4.051 -2.685 2.347 24.513 7.442   
21.217 4 TT_DA5DT6:DA4DT5_PP T 5 ? P 5 ? T 6 ? P 4 ? 
1 B DT 6 1_555 C DA 4 1_555 B DA 7 1_555 C DT 3 1_555 0.115  -1.239 3.201 -6.068 3.460 28.558 -3.151 -1.469 2.947 6.884  12.074  
29.383 5 TT_DT6DA7:DT3DA4_PP T 6 ? P 4 ? T 7 ? P 3 ? 
1 B DA 7 1_555 C DT 3 1_555 B DC 8 1_555 C DG 2 1_555 -0.460 -1.404 3.396 1.999  3.462 37.009 -2.668 0.991  3.228 5.435  -3.138  
37.217 6 TT_DA7DC8:DG2DT3_PP T 7 ? P 3 ? T 8 ? P 2 ? 
1 B DC 8 1_555 C DG 2 1_555 B DG 9 1_555 C DC 1 1_555 -0.869 -1.403 3.567 -5.160 5.672 34.987 -3.162 0.614  3.395 9.296  8.458   
35.792 7 TT_DC8DG9:DC1DG2_PP T 8 ? P 2 ? T 9 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           Z01-ES050158 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'MANGANESE (II) ION'                                  MN  
6  'SODIUM ION'                                          NA  
7  2,3-DIHYDROXY-1,4-DITHIOBUTANE                        DTT 
8  '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
9  1,2-ETHANEDIOL                                        EDO 
10 'GLYCOLIC ACID'                                       GOA 
11 water                                                 HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4M04 
_pdbx_initial_refinement_model.details          ? 
#