data_5V04
# 
_entry.id   5V04 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5V04         
WWPDB D_1000226687 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5UZV unspecified 
PDB . 5V05 unspecified 
PDB . 5V06 unspecified 
PDB . 5V07 unspecified 
PDB . 5V08 unspecified 
PDB . 5V09 unspecified 
PDB . 5V0A unspecified 
PDB . 5V0B unspecified 
PDB . 5V0C unspecified 
PDB . 5V0D unspecified 
PDB . 5V0E unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5V04 
_pdbx_database_status.recvd_initial_deposition_date   2017-02-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, Y.'     1 0000-0002-7218-5337 
'Beese, L.S.' 2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                6010 
_citation.page_last                 6015 
_citation.title                     
'Interplay of catalysis, fidelity, threading, and processivity in the exo- and endonucleolytic reactions of human exonuclease I.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1704845114 
_citation.pdbx_database_id_PubMed   28533382 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shi, Y.'        1 ? 
primary 'Hellinga, H.W.' 2 ? 
primary 'Beese, L.S.'    3 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5V04 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     73.815 
_cell.length_a_esd                 ? 
_cell.length_b                     73.815 
_cell.length_b_esd                 ? 
_cell.length_c                     180.947 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5V04 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Exonuclease 1'                                         40354.762 1  3.1.-.- ? 'UNP residues 1-352' ? 
2 polymer     syn 
;DNA (5'-D(*CP*GP*CP*TP*AP*GP*TP*CP*GP*AP*CP*AP*T)-3')
;
3951.586  1  ?       ? ?                    ? 
3 polymer     syn 
;DNA (5'-D(P*TP*CP*GP*AP*CP*TP*AP*GP*CP*G)-3')
;
3045.005  1  ?       ? ?                    ? 
4 non-polymer syn 'SODIUM ION'                                            22.990    1  ?       ? ?                    ? 
5 water       nat water                                                   18.015    51 ?       ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hExo1, Exonuclease I, hExoI' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGC
TLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNK
AGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDS
IALQIALGNKDINTFEQIDDYNPDTAMPAHSRENLYFQ
;
;MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGC
TLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNK
AGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDS
IALQIALGNKDINTFEQIDDYNPDTAMPAHSRENLYFQ
;
Z ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DC)(DT)(DA)(DG)(DT)(DC)(DG)(DA)(DC)(DA)(DT)' CGCTAGTCGACAT A ? 
3 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DC)(DT)(DA)(DG)(DC)(DG)' TCGACTAGCG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ILE n 
1 4   GLN n 
1 5   GLY n 
1 6   LEU n 
1 7   LEU n 
1 8   GLN n 
1 9   PHE n 
1 10  ILE n 
1 11  LYS n 
1 12  GLU n 
1 13  ALA n 
1 14  SER n 
1 15  GLU n 
1 16  PRO n 
1 17  ILE n 
1 18  HIS n 
1 19  VAL n 
1 20  ARG n 
1 21  LYS n 
1 22  TYR n 
1 23  LYS n 
1 24  GLY n 
1 25  GLN n 
1 26  VAL n 
1 27  VAL n 
1 28  ALA n 
1 29  VAL n 
1 30  ASP n 
1 31  THR n 
1 32  TYR n 
1 33  CYS n 
1 34  TRP n 
1 35  LEU n 
1 36  HIS n 
1 37  LYS n 
1 38  GLY n 
1 39  ALA n 
1 40  ILE n 
1 41  ALA n 
1 42  CYS n 
1 43  ALA n 
1 44  GLU n 
1 45  LYS n 
1 46  LEU n 
1 47  ALA n 
1 48  LYS n 
1 49  GLY n 
1 50  GLU n 
1 51  PRO n 
1 52  THR n 
1 53  ASP n 
1 54  ARG n 
1 55  TYR n 
1 56  VAL n 
1 57  GLY n 
1 58  PHE n 
1 59  CYS n 
1 60  MET n 
1 61  LYS n 
1 62  PHE n 
1 63  VAL n 
1 64  ASN n 
1 65  MET n 
1 66  LEU n 
1 67  LEU n 
1 68  SER n 
1 69  HIS n 
1 70  GLY n 
1 71  ILE n 
1 72  LYS n 
1 73  PRO n 
1 74  ILE n 
1 75  LEU n 
1 76  VAL n 
1 77  PHE n 
1 78  ASP n 
1 79  GLY n 
1 80  CYS n 
1 81  THR n 
1 82  LEU n 
1 83  PRO n 
1 84  SER n 
1 85  LYS n 
1 86  LYS n 
1 87  GLU n 
1 88  VAL n 
1 89  GLU n 
1 90  ARG n 
1 91  SER n 
1 92  ARG n 
1 93  ARG n 
1 94  GLU n 
1 95  ARG n 
1 96  ARG n 
1 97  GLN n 
1 98  ALA n 
1 99  ASN n 
1 100 LEU n 
1 101 LEU n 
1 102 LYS n 
1 103 GLY n 
1 104 LYS n 
1 105 GLN n 
1 106 LEU n 
1 107 LEU n 
1 108 ARG n 
1 109 GLU n 
1 110 GLY n 
1 111 LYS n 
1 112 VAL n 
1 113 SER n 
1 114 GLU n 
1 115 ALA n 
1 116 ARG n 
1 117 GLU n 
1 118 CYS n 
1 119 PHE n 
1 120 THR n 
1 121 ARG n 
1 122 SER n 
1 123 ILE n 
1 124 ASN n 
1 125 ILE n 
1 126 THR n 
1 127 HIS n 
1 128 ALA n 
1 129 MET n 
1 130 ALA n 
1 131 HIS n 
1 132 LYS n 
1 133 VAL n 
1 134 ILE n 
1 135 LYS n 
1 136 ALA n 
1 137 ALA n 
1 138 ARG n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 VAL n 
1 143 ASP n 
1 144 CYS n 
1 145 LEU n 
1 146 VAL n 
1 147 ALA n 
1 148 PRO n 
1 149 TYR n 
1 150 GLU n 
1 151 ALA n 
1 152 ASP n 
1 153 ALA n 
1 154 GLN n 
1 155 LEU n 
1 156 ALA n 
1 157 TYR n 
1 158 LEU n 
1 159 ASN n 
1 160 LYS n 
1 161 ALA n 
1 162 GLY n 
1 163 ILE n 
1 164 VAL n 
1 165 GLN n 
1 166 ALA n 
1 167 ILE n 
1 168 ILE n 
1 169 THR n 
1 170 GLU n 
1 171 ASP n 
1 172 SER n 
1 173 ASP n 
1 174 LEU n 
1 175 LEU n 
1 176 ALA n 
1 177 PHE n 
1 178 GLY n 
1 179 CYS n 
1 180 LYS n 
1 181 LYS n 
1 182 VAL n 
1 183 ILE n 
1 184 LEU n 
1 185 LYS n 
1 186 MET n 
1 187 ASP n 
1 188 GLN n 
1 189 PHE n 
1 190 GLY n 
1 191 ASN n 
1 192 GLY n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 ASP n 
1 197 GLN n 
1 198 ALA n 
1 199 ARG n 
1 200 LEU n 
1 201 GLY n 
1 202 MET n 
1 203 CYS n 
1 204 ARG n 
1 205 GLN n 
1 206 LEU n 
1 207 GLY n 
1 208 ASP n 
1 209 VAL n 
1 210 PHE n 
1 211 THR n 
1 212 GLU n 
1 213 GLU n 
1 214 LYS n 
1 215 PHE n 
1 216 ARG n 
1 217 TYR n 
1 218 MET n 
1 219 CYS n 
1 220 ILE n 
1 221 LEU n 
1 222 SER n 
1 223 GLY n 
1 224 CYS n 
1 225 ASP n 
1 226 TYR n 
1 227 LEU n 
1 228 SER n 
1 229 SER n 
1 230 LEU n 
1 231 ARG n 
1 232 GLY n 
1 233 ILE n 
1 234 GLY n 
1 235 LEU n 
1 236 ALA n 
1 237 LYS n 
1 238 ALA n 
1 239 CYS n 
1 240 LYS n 
1 241 VAL n 
1 242 LEU n 
1 243 ARG n 
1 244 LEU n 
1 245 ALA n 
1 246 ASN n 
1 247 ASN n 
1 248 PRO n 
1 249 ASP n 
1 250 ILE n 
1 251 VAL n 
1 252 LYS n 
1 253 VAL n 
1 254 ILE n 
1 255 LYS n 
1 256 LYS n 
1 257 ILE n 
1 258 GLY n 
1 259 HIS n 
1 260 TYR n 
1 261 LEU n 
1 262 LYS n 
1 263 MET n 
1 264 ASN n 
1 265 ILE n 
1 266 THR n 
1 267 VAL n 
1 268 PRO n 
1 269 GLU n 
1 270 ASP n 
1 271 TYR n 
1 272 ILE n 
1 273 ASN n 
1 274 GLY n 
1 275 PHE n 
1 276 ILE n 
1 277 ARG n 
1 278 ALA n 
1 279 ASN n 
1 280 ASN n 
1 281 THR n 
1 282 PHE n 
1 283 LEU n 
1 284 TYR n 
1 285 GLN n 
1 286 LEU n 
1 287 VAL n 
1 288 PHE n 
1 289 ASP n 
1 290 PRO n 
1 291 ILE n 
1 292 LYS n 
1 293 ARG n 
1 294 LYS n 
1 295 LEU n 
1 296 ILE n 
1 297 PRO n 
1 298 LEU n 
1 299 ASN n 
1 300 ALA n 
1 301 TYR n 
1 302 GLU n 
1 303 ASP n 
1 304 ASP n 
1 305 VAL n 
1 306 ASP n 
1 307 PRO n 
1 308 GLU n 
1 309 THR n 
1 310 LEU n 
1 311 SER n 
1 312 TYR n 
1 313 ALA n 
1 314 GLY n 
1 315 GLN n 
1 316 TYR n 
1 317 VAL n 
1 318 ASP n 
1 319 ASP n 
1 320 SER n 
1 321 ILE n 
1 322 ALA n 
1 323 LEU n 
1 324 GLN n 
1 325 ILE n 
1 326 ALA n 
1 327 LEU n 
1 328 GLY n 
1 329 ASN n 
1 330 LYS n 
1 331 ASP n 
1 332 ILE n 
1 333 ASN n 
1 334 THR n 
1 335 PHE n 
1 336 GLU n 
1 337 GLN n 
1 338 ILE n 
1 339 ASP n 
1 340 ASP n 
1 341 TYR n 
1 342 ASN n 
1 343 PRO n 
1 344 ASP n 
1 345 THR n 
1 346 ALA n 
1 347 MET n 
1 348 PRO n 
1 349 ALA n 
1 350 HIS n 
1 351 SER n 
1 352 ARG n 
1 353 GLU n 
1 354 ASN n 
1 355 LEU n 
1 356 TYR n 
1 357 PHE n 
1 358 GLN n 
2 1   DC  n 
2 2   DG  n 
2 3   DC  n 
2 4   DT  n 
2 5   DA  n 
2 6   DG  n 
2 7   DT  n 
2 8   DC  n 
2 9   DG  n 
2 10  DA  n 
2 11  DC  n 
2 12  DA  n 
2 13  DT  n 
3 1   DT  n 
3 2   DC  n 
3 3   DG  n 
3 4   DA  n 
3 5   DC  n 
3 6   DT  n 
3 7   DA  n 
3 8   DG  n 
3 9   DC  n 
3 10  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   358 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'EXO1, EXOI, HEX1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 13 'synthetic construct' ? 32630 ? 
3 1 sample 1 10 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP EXO1_HUMAN Q9UQ84 ? 1 
;MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGC
TLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNK
AGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDS
IALQIALGNKDINTFEQIDDYNPDTAMPAHSR
;
1 
2 PDB 5V04       5V04   ? 2 ? 1 
3 PDB 5V04       5V04   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5V04 Z 1 ? 352 ? Q9UQ84 1 ? 352 ? 1 352 
2 2 5V04 A 1 ? 13  ? 5V04   1 ? 13  ? 1 13  
3 3 5V04 B 1 ? 10  ? 5V04   1 ? 10  ? 1 10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5V04 GLU Z 353 ? UNP Q9UQ84 ? ? 'expression tag' 353 1 
1 5V04 ASN Z 354 ? UNP Q9UQ84 ? ? 'expression tag' 354 2 
1 5V04 LEU Z 355 ? UNP Q9UQ84 ? ? 'expression tag' 355 3 
1 5V04 TYR Z 356 ? UNP Q9UQ84 ? ? 'expression tag' 356 4 
1 5V04 PHE Z 357 ? UNP Q9UQ84 ? ? 'expression tag' 357 5 
1 5V04 GLN Z 358 ? UNP Q9UQ84 ? ? 'expression tag' 358 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5V04 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.60 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.74 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM sodium acetate, pH 7.0, 10 mM potassium chloride, 2-4% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-03-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5V04 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.65 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       15277 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.9 
_reflns.pdbx_Rmerge_I_obs                0.081 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            26.65 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.086 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.870 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.65 
_reflns_shell.d_res_low                   2.70 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.82 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           707 
_reflns_shell.percent_possible_all        98.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.655 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.708 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5V04 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.650 
_refine.ls_d_res_low                             38.570 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     15206 
_refine.ls_number_reflns_R_free                  1232 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.52 
_refine.ls_percent_reflns_R_free                 8.10 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2314 
_refine.ls_R_factor_R_free                       0.2558 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2292 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 3QEA' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.16 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.40 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2739 
_refine_hist.pdbx_number_atoms_nucleic_acid   468 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               3259 
_refine_hist.d_res_high                       2.650 
_refine_hist.d_res_low                        38.570 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 3307 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.535  ? 4554 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.820 ? 1278 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.022  ? 513  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 505  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.6483 2.7543  . . 127 1499 99.00  . . . 0.3774 . 0.3566 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7543 2.8796  . . 136 1517 100.00 . . . 0.3644 . 0.3447 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8796 3.0314  . . 134 1519 100.00 . . . 0.3989 . 0.3117 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0314 3.2212  . . 137 1532 100.00 . . . 0.2964 . 0.2974 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2212 3.4698  . . 137 1534 100.00 . . . 0.2530 . 0.2617 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4698 3.8187  . . 133 1542 100.00 . . . 0.2682 . 0.2481 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8187 4.3706  . . 139 1565 99.00  . . . 0.2352 . 0.2314 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3706 5.5039  . . 142 1580 99.00  . . . 0.2497 . 0.2091 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5039 38.5741 . . 147 1686 99.00  . . . 0.2285 . 0.1865 . . . . . . . . . . 
# 
_struct.entry_id                     5V04 
_struct.title                        
;Crystal structure of human exonuclease 1 Exo1 (WT) in complex with 5' recessed-end DNA (rII)
;
_struct.pdbx_descriptor              'Exonuclease 1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5V04 
_struct_keywords.text            'exonuclease, endonuclease, HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 5   ? ILE A 10  ? GLY Z 5   ILE Z 10  1 ? 6  
HELX_P HELX_P2  AA2 ARG A 20  ? LYS A 23  ? ARG Z 20  LYS Z 23  5 ? 4  
HELX_P HELX_P3  AA3 THR A 31  ? ALA A 41  ? THR Z 31  ALA Z 41  1 ? 11 
HELX_P HELX_P4  AA4 CYS A 42  ? GLY A 49  ? CYS Z 42  GLY Z 49  1 ? 8  
HELX_P HELX_P5  AA5 ASP A 53  ? HIS A 69  ? ASP Z 53  HIS Z 69  1 ? 17 
HELX_P HELX_P6  AA6 LEU A 82  ? SER A 84  ? LEU Z 82  SER Z 84  5 ? 3  
HELX_P HELX_P7  AA7 LYS A 85  ? ARG A 108 ? LYS Z 85  ARG Z 108 1 ? 24 
HELX_P HELX_P8  AA8 LYS A 111 ? ARG A 121 ? LYS Z 111 ARG Z 121 1 ? 11 
HELX_P HELX_P9  AA9 THR A 126 ? SER A 139 ? THR Z 126 SER Z 139 1 ? 14 
HELX_P HELX_P10 AB1 GLU A 150 ? ALA A 161 ? GLU Z 150 ALA Z 161 1 ? 12 
HELX_P HELX_P11 AB2 SER A 172 ? PHE A 177 ? SER Z 172 PHE Z 177 1 ? 6  
HELX_P HELX_P12 AB3 ALA A 198 ? GLY A 207 ? ALA Z 198 GLY Z 207 5 ? 10 
HELX_P HELX_P13 AB4 THR A 211 ? GLY A 223 ? THR Z 211 GLY Z 223 1 ? 13 
HELX_P HELX_P14 AB5 GLY A 234 ? LEU A 244 ? GLY Z 234 LEU Z 244 1 ? 11 
HELX_P HELX_P15 AB6 ASP A 249 ? LYS A 256 ? ASP Z 249 LYS Z 256 1 ? 8  
HELX_P HELX_P16 AB7 LYS A 256 ? LEU A 261 ? LYS Z 256 LEU Z 261 1 ? 6  
HELX_P HELX_P17 AB8 PRO A 268 ? GLN A 285 ? PRO Z 268 GLN Z 285 1 ? 18 
HELX_P HELX_P18 AB9 ASP A 306 ? GLY A 314 ? ASP Z 306 GLY Z 314 5 ? 9  
HELX_P HELX_P19 AC1 ASP A 318 ? LEU A 327 ? ASP Z 318 LEU Z 327 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 222 O   ? ? ? 1_555 D NA  .  NA ? ? Z SER 222 Z NA  401 1_555 ? ? ? ? ? ? ?            2.377 ? 
metalc2  metalc ? ? A SER 229 OG  ? ? ? 1_555 D NA  .  NA ? ? Z SER 229 Z NA  401 1_555 ? ? ? ? ? ? ?            2.442 ? 
metalc3  metalc ? ? A ILE 233 O   ? ? ? 1_555 D NA  .  NA ? ? Z ILE 233 Z NA  401 1_555 ? ? ? ? ? ? ?            2.582 ? 
metalc4  metalc ? ? B DT  4   OP2 ? ? ? 1_555 D NA  .  NA ? ? A DT  4   Z NA  401 1_555 ? ? ? ? ? ? ?            2.386 ? 
metalc5  metalc ? ? D NA  .   NA  ? ? ? 1_555 F HOH .  O  ? ? Z NA  401 A HOH 104 1_555 ? ? ? ? ? ? ?            2.416 ? 
metalc6  metalc ? ? D NA  .   NA  ? ? ? 1_555 E HOH .  O  ? ? Z NA  401 Z HOH 515 1_555 ? ? ? ? ? ? ?            2.411 ? 
hydrog1  hydrog ? ? B DC  1   N3  ? ? ? 1_555 C DG  10 N1 ? ? A DC  1   B DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4  ? ? ? 1_555 C DG  10 O6 ? ? A DC  1   B DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2  ? ? ? 1_555 C DG  10 N2 ? ? A DC  1   B DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1  ? ? ? 1_555 C DC  9  N3 ? ? A DG  2   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2  ? ? ? 1_555 C DC  9  O2 ? ? A DG  2   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6  ? ? ? 1_555 C DC  9  N4 ? ? A DG  2   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  3   N3  ? ? ? 1_555 C DG  8  N1 ? ? A DC  3   B DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  3   N4  ? ? ? 1_555 C DG  8  O6 ? ? A DC  3   B DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  3   O2  ? ? ? 1_555 C DG  8  N2 ? ? A DC  3   B DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DT  4   N3  ? ? ? 1_555 C DA  7  N1 ? ? A DT  4   B DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DT  4   O4  ? ? ? 1_555 C DA  7  N6 ? ? A DT  4   B DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  5   N1  ? ? ? 1_555 C DT  6  N3 ? ? A DA  5   B DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  5   N6  ? ? ? 1_555 C DT  6  O4 ? ? A DA  5   B DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  6   N1  ? ? ? 1_555 C DC  5  N3 ? ? A DG  6   B DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  6   N2  ? ? ? 1_555 C DC  5  O2 ? ? A DG  6   B DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  6   O6  ? ? ? 1_555 C DC  5  N4 ? ? A DG  6   B DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  7   N3  ? ? ? 1_555 C DA  4  N1 ? ? A DT  7   B DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  7   O4  ? ? ? 1_555 C DA  4  N6 ? ? A DT  7   B DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8   N3  ? ? ? 1_555 C DG  3  N1 ? ? A DC  8   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  8   N4  ? ? ? 1_555 C DG  3  O6 ? ? A DC  8   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  8   O2  ? ? ? 1_555 C DG  3  N2 ? ? A DC  8   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9   N1  ? ? ? 1_555 C DC  2  N3 ? ? A DG  9   B DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9   N2  ? ? ? 1_555 C DC  2  O2 ? ? A DG  9   B DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  9   O6  ? ? ? 1_555 C DC  2  N4 ? ? A DG  9   B DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DA  10  N1  ? ? ? 1_555 C DT  1  N3 ? ? A DA  10  B DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DA  10  N6  ? ? ? 1_555 C DT  1  O4 ? ? A DA  10  B DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 14  ? HIS A 18  ? SER Z 14  HIS Z 18  
AA1 2 ASN A 191 ? ASP A 196 ? ASN Z 191 ASP Z 196 
AA1 3 LYS A 181 ? LEU A 184 ? LYS Z 181 LEU Z 184 
AA1 4 ALA A 166 ? THR A 169 ? ALA Z 166 THR Z 169 
AA1 5 VAL A 26  ? ASP A 30  ? VAL Z 26  ASP Z 30  
AA1 6 LYS A 72  ? PHE A 77  ? LYS Z 72  PHE Z 77  
AA1 7 CYS A 144 ? VAL A 146 ? CYS Z 144 VAL Z 146 
AA2 1 LEU A 286 ? ASP A 289 ? LEU Z 286 ASP Z 289 
AA2 2 LYS A 294 ? PRO A 297 ? LYS Z 294 PRO Z 297 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 15  ? N GLU Z 15  O GLU A 194 ? O GLU Z 194 
AA1 2 3 O LEU A 193 ? O LEU Z 193 N LEU A 184 ? N LEU Z 184 
AA1 3 4 O ILE A 183 ? O ILE Z 183 N ILE A 167 ? N ILE Z 167 
AA1 4 5 O ILE A 168 ? O ILE Z 168 N ASP A 30  ? N ASP Z 30  
AA1 5 6 N VAL A 27  ? N VAL Z 27  O LYS A 72  ? O LYS Z 72  
AA1 6 7 N PHE A 77  ? N PHE Z 77  O LEU A 145 ? O LEU Z 145 
AA2 1 2 N VAL A 287 ? N VAL Z 287 O ILE A 296 ? O ILE Z 296 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    Z 
_struct_site.pdbx_auth_comp_id    NA 
_struct_site.pdbx_auth_seq_id     401 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue NA Z 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 DT  B 4   ? DT  A 4   . ? 1_555 ? 
2 AC1 6 HOH F .   ? HOH A 104 . ? 1_555 ? 
3 AC1 6 SER A 222 ? SER Z 222 . ? 1_555 ? 
4 AC1 6 SER A 229 ? SER Z 229 . ? 1_555 ? 
5 AC1 6 ILE A 233 ? ILE Z 233 . ? 1_555 ? 
6 AC1 6 HOH E .   ? HOH Z 515 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5V04 
_atom_sites.fract_transf_matrix[1][1]   0.013547 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013547 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005526 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 2   ? -15.251 39.012 -7.146  1.00 99.43  ? 2   GLY Z N     1 
ATOM   2    C  CA    . GLY A 1 2   ? -14.053 39.525 -7.784  1.00 94.74  ? 2   GLY Z CA    1 
ATOM   3    C  C     . GLY A 1 2   ? -14.360 40.372 -9.003  1.00 93.97  ? 2   GLY Z C     1 
ATOM   4    O  O     . GLY A 1 2   ? -15.368 41.076 -9.037  1.00 98.90  ? 2   GLY Z O     1 
ATOM   5    N  N     . ILE A 1 3   ? -13.488 40.306 -10.005 1.00 89.18  ? 3   ILE Z N     1 
ATOM   6    C  CA    . ILE A 1 3   ? -13.702 41.038 -11.250 1.00 93.63  ? 3   ILE Z CA    1 
ATOM   7    C  C     . ILE A 1 3   ? -14.894 40.463 -12.003 1.00 93.11  ? 3   ILE Z C     1 
ATOM   8    O  O     . ILE A 1 3   ? -14.792 39.419 -12.648 1.00 91.46  ? 3   ILE Z O     1 
ATOM   9    C  CB    . ILE A 1 3   ? -12.462 41.001 -12.162 1.00 86.98  ? 3   ILE Z CB    1 
ATOM   10   C  CG1   . ILE A 1 3   ? -11.215 41.427 -11.388 1.00 81.33  ? 3   ILE Z CG1   1 
ATOM   11   C  CG2   . ILE A 1 3   ? -12.671 41.904 -13.365 1.00 84.55  ? 3   ILE Z CG2   1 
ATOM   12   C  CD1   . ILE A 1 3   ? -11.243 42.868 -10.933 1.00 79.97  ? 3   ILE Z CD1   1 
ATOM   13   N  N     . GLN A 1 4   ? -16.022 41.158 -11.915 1.00 89.20  ? 4   GLN Z N     1 
ATOM   14   C  CA    . GLN A 1 4   ? -17.286 40.671 -12.452 1.00 97.14  ? 4   GLN Z CA    1 
ATOM   15   C  C     . GLN A 1 4   ? -17.273 40.575 -13.978 1.00 97.58  ? 4   GLN Z C     1 
ATOM   16   O  O     . GLN A 1 4   ? -17.294 41.593 -14.673 1.00 98.75  ? 4   GLN Z O     1 
ATOM   17   C  CB    . GLN A 1 4   ? -18.425 41.581 -11.987 1.00 106.12 ? 4   GLN Z CB    1 
ATOM   18   C  CG    . GLN A 1 4   ? -19.782 40.904 -11.881 1.00 117.83 ? 4   GLN Z CG    1 
ATOM   19   C  CD    . GLN A 1 4   ? -20.768 41.714 -11.059 1.00 118.23 ? 4   GLN Z CD    1 
ATOM   20   O  OE1   . GLN A 1 4   ? -20.399 42.700 -10.420 1.00 114.29 ? 4   GLN Z OE1   1 
ATOM   21   N  NE2   . GLN A 1 4   ? -22.030 41.299 -11.071 1.00 127.22 ? 4   GLN Z NE2   1 
ATOM   22   N  N     . GLY A 1 5   ? -17.222 39.347 -14.489 1.00 94.99  ? 5   GLY Z N     1 
ATOM   23   C  CA    . GLY A 1 5   ? -17.322 39.100 -15.919 1.00 91.79  ? 5   GLY Z CA    1 
ATOM   24   C  C     . GLY A 1 5   ? -16.008 39.107 -16.681 1.00 88.68  ? 5   GLY Z C     1 
ATOM   25   O  O     . GLY A 1 5   ? -15.997 39.278 -17.901 1.00 88.74  ? 5   GLY Z O     1 
ATOM   26   N  N     . LEU A 1 6   ? -14.900 38.907 -15.974 1.00 95.11  ? 6   LEU Z N     1 
ATOM   27   C  CA    . LEU A 1 6   ? -13.581 38.971 -16.599 1.00 90.30  ? 6   LEU Z CA    1 
ATOM   28   C  C     . LEU A 1 6   ? -13.312 37.800 -17.542 1.00 87.61  ? 6   LEU Z C     1 
ATOM   29   O  O     . LEU A 1 6   ? -12.717 37.980 -18.604 1.00 88.33  ? 6   LEU Z O     1 
ATOM   30   C  CB    . LEU A 1 6   ? -12.490 39.026 -15.530 1.00 86.37  ? 6   LEU Z CB    1 
ATOM   31   C  CG    . LEU A 1 6   ? -11.050 39.093 -16.044 1.00 81.82  ? 6   LEU Z CG    1 
ATOM   32   C  CD1   . LEU A 1 6   ? -10.859 40.306 -16.939 1.00 79.60  ? 6   LEU Z CD1   1 
ATOM   33   C  CD2   . LEU A 1 6   ? -10.055 39.112 -14.892 1.00 79.91  ? 6   LEU Z CD2   1 
ATOM   34   N  N     . LEU A 1 7   ? -13.752 36.608 -17.152 1.00 90.44  ? 7   LEU Z N     1 
ATOM   35   C  CA    . LEU A 1 7   ? -13.468 35.392 -17.912 1.00 90.85  ? 7   LEU Z CA    1 
ATOM   36   C  C     . LEU A 1 7   ? -14.059 35.434 -19.321 1.00 94.77  ? 7   LEU Z C     1 
ATOM   37   O  O     . LEU A 1 7   ? -13.377 35.118 -20.297 1.00 94.06  ? 7   LEU Z O     1 
ATOM   38   C  CB    . LEU A 1 7   ? -13.988 34.166 -17.157 1.00 96.41  ? 7   LEU Z CB    1 
ATOM   39   C  CG    . LEU A 1 7   ? -13.836 32.798 -17.826 1.00 99.78  ? 7   LEU Z CG    1 
ATOM   40   C  CD1   . LEU A 1 7   ? -12.434 32.603 -18.375 1.00 87.05  ? 7   LEU Z CD1   1 
ATOM   41   C  CD2   . LEU A 1 7   ? -14.178 31.695 -16.844 1.00 105.64 ? 7   LEU Z CD2   1 
ATOM   42   N  N     . GLN A 1 8   ? -15.324 35.826 -19.425 1.00 88.88  ? 8   GLN Z N     1 
ATOM   43   C  CA    . GLN A 1 8   ? -15.980 35.934 -20.722 1.00 92.80  ? 8   GLN Z CA    1 
ATOM   44   C  C     . GLN A 1 8   ? -15.340 37.024 -21.575 1.00 91.36  ? 8   GLN Z C     1 
ATOM   45   O  O     . GLN A 1 8   ? -15.330 36.938 -22.800 1.00 94.02  ? 8   GLN Z O     1 
ATOM   46   C  CB    . GLN A 1 8   ? -17.475 36.212 -20.547 1.00 96.50  ? 8   GLN Z CB    1 
ATOM   47   C  CG    . GLN A 1 8   ? -18.319 34.965 -20.332 1.00 103.85 ? 8   GLN Z CG    1 
ATOM   48   C  CD    . GLN A 1 8   ? -18.387 34.089 -21.569 1.00 107.66 ? 8   GLN Z CD    1 
ATOM   49   O  OE1   . GLN A 1 8   ? -17.502 33.268 -21.814 1.00 103.09 ? 8   GLN Z OE1   1 
ATOM   50   N  NE2   . GLN A 1 8   ? -19.441 34.263 -22.358 1.00 114.84 ? 8   GLN Z NE2   1 
ATOM   51   N  N     . PHE A 1 9   ? -14.795 38.042 -20.919 1.00 88.60  ? 9   PHE Z N     1 
ATOM   52   C  CA    . PHE A 1 9   ? -14.199 39.175 -21.616 1.00 88.63  ? 9   PHE Z CA    1 
ATOM   53   C  C     . PHE A 1 9   ? -12.915 38.785 -22.341 1.00 87.18  ? 9   PHE Z C     1 
ATOM   54   O  O     . PHE A 1 9   ? -12.596 39.337 -23.393 1.00 89.45  ? 9   PHE Z O     1 
ATOM   55   C  CB    . PHE A 1 9   ? -13.920 40.314 -20.632 1.00 89.59  ? 9   PHE Z CB    1 
ATOM   56   C  CG    . PHE A 1 9   ? -13.453 41.583 -21.286 1.00 90.96  ? 9   PHE Z CG    1 
ATOM   57   C  CD1   . PHE A 1 9   ? -14.355 42.426 -21.913 1.00 96.12  ? 9   PHE Z CD1   1 
ATOM   58   C  CD2   . PHE A 1 9   ? -12.114 41.939 -21.261 1.00 88.35  ? 9   PHE Z CD2   1 
ATOM   59   C  CE1   . PHE A 1 9   ? -13.929 43.599 -22.512 1.00 97.30  ? 9   PHE Z CE1   1 
ATOM   60   C  CE2   . PHE A 1 9   ? -11.683 43.108 -21.858 1.00 89.54  ? 9   PHE Z CE2   1 
ATOM   61   C  CZ    . PHE A 1 9   ? -12.591 43.939 -22.485 1.00 95.08  ? 9   PHE Z CZ    1 
ATOM   62   N  N     . ILE A 1 10  ? -12.179 37.834 -21.774 1.00 92.18  ? 10  ILE Z N     1 
ATOM   63   C  CA    . ILE A 1 10  ? -10.925 37.389 -22.372 1.00 88.78  ? 10  ILE Z CA    1 
ATOM   64   C  C     . ILE A 1 10  ? -10.920 35.886 -22.638 1.00 86.39  ? 10  ILE Z C     1 
ATOM   65   O  O     . ILE A 1 10  ? -9.892  35.224 -22.490 1.00 78.25  ? 10  ILE Z O     1 
ATOM   66   C  CB    . ILE A 1 10  ? -9.721  37.745 -21.478 1.00 81.39  ? 10  ILE Z CB    1 
ATOM   67   C  CG1   . ILE A 1 10  ? -9.914  37.184 -20.070 1.00 79.95  ? 10  ILE Z CG1   1 
ATOM   68   C  CG2   . ILE A 1 10  ? -9.527  39.251 -21.419 1.00 81.43  ? 10  ILE Z CG2   1 
ATOM   69   C  CD1   . ILE A 1 10  ? -8.729  37.410 -19.172 1.00 75.08  ? 10  ILE Z CD1   1 
ATOM   70   N  N     . LYS A 1 11  ? -12.069 35.356 -23.048 1.00 88.38  ? 11  LYS Z N     1 
ATOM   71   C  CA    . LYS A 1 11  ? -12.213 33.925 -23.302 1.00 88.05  ? 11  LYS Z CA    1 
ATOM   72   C  C     . LYS A 1 11  ? -11.324 33.449 -24.450 1.00 83.55  ? 11  LYS Z C     1 
ATOM   73   O  O     . LYS A 1 11  ? -11.000 32.266 -24.546 1.00 80.40  ? 11  LYS Z O     1 
ATOM   74   C  CB    . LYS A 1 11  ? -13.677 33.585 -23.600 1.00 93.61  ? 11  LYS Z CB    1 
ATOM   75   C  CG    . LYS A 1 11  ? -14.246 34.301 -24.815 1.00 101.30 ? 11  LYS Z CG    1 
ATOM   76   C  CD    . LYS A 1 11  ? -15.700 33.927 -25.058 1.00 108.01 ? 11  LYS Z CD    1 
ATOM   77   C  CE    . LYS A 1 11  ? -16.250 34.658 -26.273 1.00 112.58 ? 11  LYS Z CE    1 
ATOM   78   N  NZ    . LYS A 1 11  ? -17.669 34.308 -26.548 1.00 120.98 ? 11  LYS Z NZ    1 
ATOM   79   N  N     . GLU A 1 12  ? -10.925 34.378 -25.312 1.00 88.48  ? 12  GLU Z N     1 
ATOM   80   C  CA    . GLU A 1 12  ? -10.095 34.051 -26.467 1.00 88.46  ? 12  GLU Z CA    1 
ATOM   81   C  C     . GLU A 1 12  ? -8.669  33.682 -26.060 1.00 81.93  ? 12  GLU Z C     1 
ATOM   82   O  O     . GLU A 1 12  ? -7.941  33.042 -26.819 1.00 82.97  ? 12  GLU Z O     1 
ATOM   83   C  CB    . GLU A 1 12  ? -10.081 35.223 -27.450 1.00 91.25  ? 12  GLU Z CB    1 
ATOM   84   C  CG    . GLU A 1 12  ? -11.466 35.601 -27.961 1.00 98.57  ? 12  GLU Z CG    1 
ATOM   85   C  CD    . GLU A 1 12  ? -11.455 36.836 -28.842 1.00 108.45 ? 12  GLU Z CD    1 
ATOM   86   O  OE1   . GLU A 1 12  ? -10.366 37.413 -29.046 1.00 107.18 ? 12  GLU Z OE1   1 
ATOM   87   O  OE2   . GLU A 1 12  ? -12.535 37.232 -29.330 1.00 113.96 ? 12  GLU Z OE2   1 
ATOM   88   N  N     . ALA A 1 13  ? -8.278  34.084 -24.855 1.00 76.57  ? 13  ALA Z N     1 
ATOM   89   C  CA    . ALA A 1 13  ? -6.940  33.798 -24.350 1.00 76.33  ? 13  ALA Z CA    1 
ATOM   90   C  C     . ALA A 1 13  ? -6.919  32.497 -23.557 1.00 78.28  ? 13  ALA Z C     1 
ATOM   91   O  O     . ALA A 1 13  ? -5.895  32.121 -22.984 1.00 78.86  ? 13  ALA Z O     1 
ATOM   92   C  CB    . ALA A 1 13  ? -6.442  34.947 -23.493 1.00 79.77  ? 13  ALA Z CB    1 
ATOM   93   N  N     . SER A 1 14  ? -8.056  31.810 -23.528 1.00 77.16  ? 14  SER Z N     1 
ATOM   94   C  CA    . SER A 1 14  ? -8.170  30.570 -22.774 1.00 77.44  ? 14  SER Z CA    1 
ATOM   95   C  C     . SER A 1 14  ? -7.917  29.346 -23.649 1.00 82.47  ? 14  SER Z C     1 
ATOM   96   O  O     . SER A 1 14  ? -7.867  29.443 -24.876 1.00 83.57  ? 14  SER Z O     1 
ATOM   97   C  CB    . SER A 1 14  ? -9.547  30.469 -22.121 1.00 77.15  ? 14  SER Z CB    1 
ATOM   98   O  OG    . SER A 1 14  ? -10.578 30.527 -23.089 1.00 81.94  ? 14  SER Z OG    1 
ATOM   99   N  N     . GLU A 1 15  ? -7.754  28.196 -23.003 1.00 77.65  ? 15  GLU Z N     1 
ATOM   100  C  CA    . GLU A 1 15  ? -7.486  26.949 -23.702 1.00 81.32  ? 15  GLU Z CA    1 
ATOM   101  C  C     . GLU A 1 15  ? -7.821  25.744 -22.833 1.00 82.92  ? 15  GLU Z C     1 
ATOM   102  O  O     . GLU A 1 15  ? -7.352  25.639 -21.699 1.00 81.37  ? 15  GLU Z O     1 
ATOM   103  C  CB    . GLU A 1 15  ? -6.023  26.884 -24.141 1.00 83.15  ? 15  GLU Z CB    1 
ATOM   104  C  CG    . GLU A 1 15  ? -5.581  25.505 -24.598 1.00 89.19  ? 15  GLU Z CG    1 
ATOM   105  C  CD    . GLU A 1 15  ? -4.092  25.433 -24.880 1.00 95.86  ? 15  GLU Z CD    1 
ATOM   106  O  OE1   . GLU A 1 15  ? -3.460  26.504 -25.004 1.00 96.62  ? 15  GLU Z OE1   1 
ATOM   107  O  OE2   . GLU A 1 15  ? -3.554  24.307 -24.972 1.00 101.71 ? 15  GLU Z OE2   1 
ATOM   108  N  N     . PRO A 1 16  ? -8.642  24.829 -23.366 1.00 86.54  ? 16  PRO Z N     1 
ATOM   109  C  CA    . PRO A 1 16  ? -8.966  23.572 -22.685 1.00 84.83  ? 16  PRO Z CA    1 
ATOM   110  C  C     . PRO A 1 16  ? -7.730  22.691 -22.547 1.00 88.63  ? 16  PRO Z C     1 
ATOM   111  O  O     . PRO A 1 16  ? -7.132  22.323 -23.558 1.00 92.44  ? 16  PRO Z O     1 
ATOM   112  C  CB    . PRO A 1 16  ? -10.003 22.923 -23.611 1.00 84.24  ? 16  PRO Z CB    1 
ATOM   113  C  CG    . PRO A 1 16  ? -10.530 24.043 -24.456 1.00 81.91  ? 16  PRO Z CG    1 
ATOM   114  C  CD    . PRO A 1 16  ? -9.376  24.975 -24.634 1.00 82.02  ? 16  PRO Z CD    1 
ATOM   115  N  N     . ILE A 1 17  ? -7.350  22.365 -21.315 1.00 83.32  ? 17  ILE Z N     1 
ATOM   116  C  CA    . ILE A 1 17  ? -6.155  21.565 -21.063 1.00 86.30  ? 17  ILE Z CA    1 
ATOM   117  C  C     . ILE A 1 17  ? -6.427  20.392 -20.132 1.00 87.04  ? 17  ILE Z C     1 
ATOM   118  O  O     . ILE A 1 17  ? -7.529  20.242 -19.605 1.00 86.44  ? 17  ILE Z O     1 
ATOM   119  C  CB    . ILE A 1 17  ? -5.030  22.400 -20.421 1.00 86.27  ? 17  ILE Z CB    1 
ATOM   120  C  CG1   . ILE A 1 17  ? -5.426  22.792 -18.993 1.00 84.69  ? 17  ILE Z CG1   1 
ATOM   121  C  CG2   . ILE A 1 17  ? -4.702  23.622 -21.268 1.00 86.37  ? 17  ILE Z CG2   1 
ATOM   122  C  CD1   . ILE A 1 17  ? -4.263  23.184 -18.111 1.00 84.56  ? 17  ILE Z CD1   1 
ATOM   123  N  N     . HIS A 1 18  ? -5.403  19.570 -19.930 1.00 85.78  ? 18  HIS Z N     1 
ATOM   124  C  CA    . HIS A 1 18  ? -5.426  18.563 -18.878 1.00 90.26  ? 18  HIS Z CA    1 
ATOM   125  C  C     . HIS A 1 18  ? -4.170  18.701 -18.022 1.00 90.23  ? 18  HIS Z C     1 
ATOM   126  O  O     . HIS A 1 18  ? -3.129  19.140 -18.511 1.00 89.12  ? 18  HIS Z O     1 
ATOM   127  C  CB    . HIS A 1 18  ? -5.531  17.154 -19.458 1.00 93.71  ? 18  HIS Z CB    1 
ATOM   128  C  CG    . HIS A 1 18  ? -5.871  16.116 -18.438 1.00 95.21  ? 18  HIS Z CG    1 
ATOM   129  N  ND1   . HIS A 1 18  ? -4.926  15.554 -17.603 1.00 98.69  ? 18  HIS Z ND1   1 
ATOM   130  C  CD2   . HIS A 1 18  ? -7.053  15.552 -18.098 1.00 96.50  ? 18  HIS Z CD2   1 
ATOM   131  C  CE1   . HIS A 1 18  ? -5.512  14.684 -16.803 1.00 97.07  ? 18  HIS Z CE1   1 
ATOM   132  N  NE2   . HIS A 1 18  ? -6.803  14.663 -17.081 1.00 96.09  ? 18  HIS Z NE2   1 
ATOM   133  N  N     . VAL A 1 19  ? -4.265  18.319 -16.751 1.00 91.19  ? 19  VAL Z N     1 
ATOM   134  C  CA    . VAL A 1 19  ? -3.196  18.579 -15.786 1.00 92.43  ? 19  VAL Z CA    1 
ATOM   135  C  C     . VAL A 1 19  ? -1.888  17.846 -16.081 1.00 94.34  ? 19  VAL Z C     1 
ATOM   136  O  O     . VAL A 1 19  ? -0.848  18.186 -15.518 1.00 96.85  ? 19  VAL Z O     1 
ATOM   137  C  CB    . VAL A 1 19  ? -3.632  18.211 -14.349 1.00 91.51  ? 19  VAL Z CB    1 
ATOM   138  C  CG1   . VAL A 1 19  ? -4.772  19.098 -13.900 1.00 88.24  ? 19  VAL Z CG1   1 
ATOM   139  C  CG2   . VAL A 1 19  ? -4.016  16.738 -14.261 1.00 93.45  ? 19  VAL Z CG2   1 
ATOM   140  N  N     . ARG A 1 20  ? -1.937  16.850 -16.961 1.00 91.65  ? 20  ARG Z N     1 
ATOM   141  C  CA    . ARG A 1 20  ? -0.745  16.076 -17.302 1.00 93.95  ? 20  ARG Z CA    1 
ATOM   142  C  C     . ARG A 1 20  ? 0.373   16.927 -17.896 1.00 94.46  ? 20  ARG Z C     1 
ATOM   143  O  O     . ARG A 1 20  ? 1.537   16.532 -17.870 1.00 98.96  ? 20  ARG Z O     1 
ATOM   144  C  CB    . ARG A 1 20  ? -1.095  14.958 -18.281 1.00 100.04 ? 20  ARG Z CB    1 
ATOM   145  C  CG    . ARG A 1 20  ? -1.603  13.690 -17.629 1.00 104.23 ? 20  ARG Z CG    1 
ATOM   146  C  CD    . ARG A 1 20  ? -1.717  12.586 -18.661 1.00 108.15 ? 20  ARG Z CD    1 
ATOM   147  N  NE    . ARG A 1 20  ? -2.484  13.035 -19.816 1.00 108.44 ? 20  ARG Z NE    1 
ATOM   148  C  CZ    . ARG A 1 20  ? -3.807  12.965 -19.899 1.00 107.64 ? 20  ARG Z CZ    1 
ATOM   149  N  NH1   . ARG A 1 20  ? -4.510  12.457 -18.896 1.00 107.11 ? 20  ARG Z NH1   1 
ATOM   150  N  NH2   . ARG A 1 20  ? -4.428  13.402 -20.985 1.00 108.07 ? 20  ARG Z NH2   1 
ATOM   151  N  N     . LYS A 1 21  ? 0.023   18.094 -18.429 1.00 93.59  ? 21  LYS Z N     1 
ATOM   152  C  CA    . LYS A 1 21  ? 1.022   18.980 -19.016 1.00 93.35  ? 21  LYS Z CA    1 
ATOM   153  C  C     . LYS A 1 21  ? 1.911   19.592 -17.938 1.00 94.57  ? 21  LYS Z C     1 
ATOM   154  O  O     . LYS A 1 21  ? 2.923   20.224 -18.240 1.00 97.67  ? 21  LYS Z O     1 
ATOM   155  C  CB    . LYS A 1 21  ? 0.358   20.086 -19.839 1.00 92.73  ? 21  LYS Z CB    1 
ATOM   156  C  CG    . LYS A 1 21  ? -0.500  21.034 -19.028 1.00 90.45  ? 21  LYS Z CG    1 
ATOM   157  C  CD    . LYS A 1 21  ? -0.558  22.413 -19.667 1.00 87.93  ? 21  LYS Z CD    1 
ATOM   158  C  CE    . LYS A 1 21  ? -1.202  22.375 -21.037 1.00 89.28  ? 21  LYS Z CE    1 
ATOM   159  N  NZ    . LYS A 1 21  ? -1.276  23.737 -21.632 1.00 94.78  ? 21  LYS Z NZ    1 
ATOM   160  N  N     . TYR A 1 22  ? 1.529   19.399 -16.679 1.00 92.12  ? 22  TYR Z N     1 
ATOM   161  C  CA    . TYR A 1 22  ? 2.338   19.865 -15.558 1.00 95.44  ? 22  TYR Z CA    1 
ATOM   162  C  C     . TYR A 1 22  ? 2.877   18.700 -14.733 1.00 97.65  ? 22  TYR Z C     1 
ATOM   163  O  O     . TYR A 1 22  ? 3.231   18.864 -13.563 1.00 95.96  ? 22  TYR Z O     1 
ATOM   164  C  CB    . TYR A 1 22  ? 1.531   20.808 -14.664 1.00 88.50  ? 22  TYR Z CB    1 
ATOM   165  C  CG    . TYR A 1 22  ? 1.140   22.098 -15.344 1.00 85.98  ? 22  TYR Z CG    1 
ATOM   166  C  CD1   . TYR A 1 22  ? 2.074   23.103 -15.555 1.00 84.76  ? 22  TYR Z CD1   1 
ATOM   167  C  CD2   . TYR A 1 22  ? -0.162  22.314 -15.772 1.00 84.15  ? 22  TYR Z CD2   1 
ATOM   168  C  CE1   . TYR A 1 22  ? 1.726   24.284 -16.177 1.00 82.31  ? 22  TYR Z CE1   1 
ATOM   169  C  CE2   . TYR A 1 22  ? -0.521  23.494 -16.394 1.00 81.48  ? 22  TYR Z CE2   1 
ATOM   170  C  CZ    . TYR A 1 22  ? 0.429   24.474 -16.595 1.00 80.31  ? 22  TYR Z CZ    1 
ATOM   171  O  OH    . TYR A 1 22  ? 0.081   25.650 -17.214 1.00 76.44  ? 22  TYR Z OH    1 
ATOM   172  N  N     . LYS A 1 23  ? 2.931   17.523 -15.349 1.00 96.85  ? 23  LYS Z N     1 
ATOM   173  C  CA    . LYS A 1 23  ? 3.499   16.349 -14.700 1.00 97.06  ? 23  LYS Z CA    1 
ATOM   174  C  C     . LYS A 1 23  ? 4.986   16.558 -14.429 1.00 97.07  ? 23  LYS Z C     1 
ATOM   175  O  O     . LYS A 1 23  ? 5.766   16.796 -15.352 1.00 97.27  ? 23  LYS Z O     1 
ATOM   176  C  CB    . LYS A 1 23  ? 3.285   15.101 -15.559 1.00 101.17 ? 23  LYS Z CB    1 
ATOM   177  C  CG    . LYS A 1 23  ? 3.934   13.843 -15.005 1.00 105.23 ? 23  LYS Z CG    1 
ATOM   178  C  CD    . LYS A 1 23  ? 3.735   12.664 -15.945 1.00 105.92 ? 23  LYS Z CD    1 
ATOM   179  C  CE    . LYS A 1 23  ? 4.416   11.411 -15.413 1.00 108.96 ? 23  LYS Z CE    1 
ATOM   180  N  NZ    . LYS A 1 23  ? 3.846   10.979 -14.100 1.00 110.37 ? 23  LYS Z NZ    1 
ATOM   181  N  N     . GLY A 1 24  ? 5.370   16.475 -13.160 1.00 97.56  ? 24  GLY Z N     1 
ATOM   182  C  CA    . GLY A 1 24  ? 6.754   16.665 -12.768 1.00 97.06  ? 24  GLY Z CA    1 
ATOM   183  C  C     . GLY A 1 24  ? 7.055   18.112 -12.437 1.00 93.72  ? 24  GLY Z C     1 
ATOM   184  O  O     . GLY A 1 24  ? 8.213   18.494 -12.280 1.00 95.93  ? 24  GLY Z O     1 
ATOM   185  N  N     . GLN A 1 25  ? 6.005   18.920 -12.337 1.00 97.76  ? 25  GLN Z N     1 
ATOM   186  C  CA    . GLN A 1 25  ? 6.151   20.326 -11.979 1.00 95.90  ? 25  GLN Z CA    1 
ATOM   187  C  C     . GLN A 1 25  ? 5.325   20.669 -10.746 1.00 91.01  ? 25  GLN Z C     1 
ATOM   188  O  O     . GLN A 1 25  ? 4.573   19.837 -10.240 1.00 91.23  ? 25  GLN Z O     1 
ATOM   189  C  CB    . GLN A 1 25  ? 5.748   21.226 -13.147 1.00 94.49  ? 25  GLN Z CB    1 
ATOM   190  C  CG    . GLN A 1 25  ? 6.736   21.226 -14.296 1.00 95.63  ? 25  GLN Z CG    1 
ATOM   191  C  CD    . GLN A 1 25  ? 6.433   22.304 -15.316 1.00 97.70  ? 25  GLN Z CD    1 
ATOM   192  O  OE1   . GLN A 1 25  ? 7.284   23.137 -15.628 1.00 100.56 ? 25  GLN Z OE1   1 
ATOM   193  N  NE2   . GLN A 1 25  ? 5.215   22.293 -15.842 1.00 95.67  ? 25  GLN Z NE2   1 
ATOM   194  N  N     . VAL A 1 26  ? 5.470   21.900 -10.266 1.00 89.57  ? 26  VAL Z N     1 
ATOM   195  C  CA    . VAL A 1 26  ? 4.811   22.319 -9.035  1.00 86.78  ? 26  VAL Z CA    1 
ATOM   196  C  C     . VAL A 1 26  ? 3.642   23.258 -9.314  1.00 82.76  ? 26  VAL Z C     1 
ATOM   197  O  O     . VAL A 1 26  ? 3.758   24.204 -10.095 1.00 81.72  ? 26  VAL Z O     1 
ATOM   198  C  CB    . VAL A 1 26  ? 5.800   23.012 -8.077  1.00 87.79  ? 26  VAL Z CB    1 
ATOM   199  C  CG1   . VAL A 1 26  ? 5.144   23.261 -6.730  1.00 86.88  ? 26  VAL Z CG1   1 
ATOM   200  C  CG2   . VAL A 1 26  ? 7.056   22.170 -7.908  1.00 88.41  ? 26  VAL Z CG2   1 
ATOM   201  N  N     . VAL A 1 27  ? 2.513   22.988 -8.666  1.00 82.71  ? 27  VAL Z N     1 
ATOM   202  C  CA    . VAL A 1 27  ? 1.310   23.790 -8.847  1.00 80.08  ? 27  VAL Z CA    1 
ATOM   203  C  C     . VAL A 1 27  ? 0.711   24.223 -7.510  1.00 79.89  ? 27  VAL Z C     1 
ATOM   204  O  O     . VAL A 1 27  ? 0.543   23.410 -6.604  1.00 78.86  ? 27  VAL Z O     1 
ATOM   205  C  CB    . VAL A 1 27  ? 0.248   23.018 -9.655  1.00 79.49  ? 27  VAL Z CB    1 
ATOM   206  C  CG1   . VAL A 1 27  ? -1.094  23.729 -9.604  1.00 78.13  ? 27  VAL Z CG1   1 
ATOM   207  C  CG2   . VAL A 1 27  ? 0.709   22.839 -11.095 1.00 82.47  ? 27  VAL Z CG2   1 
ATOM   208  N  N     . ALA A 1 28  ? 0.398   25.510 -7.391  1.00 78.49  ? 28  ALA Z N     1 
ATOM   209  C  CA    . ALA A 1 28  ? -0.247  26.039 -6.193  1.00 77.57  ? 28  ALA Z CA    1 
ATOM   210  C  C     . ALA A 1 28  ? -1.768  26.033 -6.349  1.00 76.14  ? 28  ALA Z C     1 
ATOM   211  O  O     . ALA A 1 28  ? -2.286  26.254 -7.444  1.00 75.89  ? 28  ALA Z O     1 
ATOM   212  C  CB    . ALA A 1 28  ? 0.256   27.442 -5.900  1.00 77.62  ? 28  ALA Z CB    1 
ATOM   213  N  N     . VAL A 1 29  ? -2.480  25.786 -5.252  1.00 74.58  ? 29  VAL Z N     1 
ATOM   214  C  CA    . VAL A 1 29  ? -3.934  25.641 -5.297  1.00 74.00  ? 29  VAL Z CA    1 
ATOM   215  C  C     . VAL A 1 29  ? -4.666  26.572 -4.333  1.00 75.39  ? 29  VAL Z C     1 
ATOM   216  O  O     . VAL A 1 29  ? -4.359  26.613 -3.144  1.00 77.25  ? 29  VAL Z O     1 
ATOM   217  C  CB    . VAL A 1 29  ? -4.359  24.191 -4.975  1.00 74.66  ? 29  VAL Z CB    1 
ATOM   218  C  CG1   . VAL A 1 29  ? -5.876  24.083 -4.910  1.00 74.23  ? 29  VAL Z CG1   1 
ATOM   219  C  CG2   . VAL A 1 29  ? -3.788  23.225 -6.003  1.00 78.40  ? 29  VAL Z CG2   1 
ATOM   220  N  N     . ASP A 1 30  ? -5.638  27.314 -4.857  1.00 76.89  ? 30  ASP Z N     1 
ATOM   221  C  CA    . ASP A 1 30  ? -6.561  28.080 -4.027  1.00 76.84  ? 30  ASP Z CA    1 
ATOM   222  C  C     . ASP A 1 30  ? -7.566  27.122 -3.395  1.00 79.24  ? 30  ASP Z C     1 
ATOM   223  O  O     . ASP A 1 30  ? -8.659  26.926 -3.921  1.00 80.29  ? 30  ASP Z O     1 
ATOM   224  C  CB    . ASP A 1 30  ? -7.281  29.144 -4.858  1.00 76.24  ? 30  ASP Z CB    1 
ATOM   225  C  CG    . ASP A 1 30  ? -7.941  30.213 -4.004  1.00 79.60  ? 30  ASP Z CG    1 
ATOM   226  O  OD1   . ASP A 1 30  ? -8.116  29.991 -2.787  1.00 80.40  ? 30  ASP Z OD1   1 
ATOM   227  O  OD2   . ASP A 1 30  ? -8.291  31.279 -4.556  1.00 80.19  ? 30  ASP Z OD2   1 
ATOM   228  N  N     . THR A 1 31  ? -7.193  26.538 -2.261  1.00 76.60  ? 31  THR Z N     1 
ATOM   229  C  CA    . THR A 1 31  ? -7.949  25.441 -1.656  1.00 80.90  ? 31  THR Z CA    1 
ATOM   230  C  C     . THR A 1 31  ? -9.386  25.818 -1.272  1.00 85.41  ? 31  THR Z C     1 
ATOM   231  O  O     . THR A 1 31  ? -10.232 24.941 -1.074  1.00 86.44  ? 31  THR Z O     1 
ATOM   232  C  CB    . THR A 1 31  ? -7.220  24.906 -0.404  1.00 79.87  ? 31  THR Z CB    1 
ATOM   233  O  OG1   . THR A 1 31  ? -5.804  24.968 -0.614  1.00 79.91  ? 31  THR Z OG1   1 
ATOM   234  C  CG2   . THR A 1 31  ? -7.620  23.463 -0.117  1.00 79.97  ? 31  THR Z CG2   1 
ATOM   235  N  N     . TYR A 1 32  ? -9.662  27.116 -1.183  1.00 86.88  ? 32  TYR Z N     1 
ATOM   236  C  CA    . TYR A 1 32  ? -10.986 27.588 -0.786  1.00 88.66  ? 32  TYR Z CA    1 
ATOM   237  C  C     . TYR A 1 32  ? -12.102 27.111 -1.711  1.00 90.50  ? 32  TYR Z C     1 
ATOM   238  O  O     . TYR A 1 32  ? -13.213 26.847 -1.257  1.00 90.29  ? 32  TYR Z O     1 
ATOM   239  C  CB    . TYR A 1 32  ? -11.020 29.116 -0.717  1.00 92.65  ? 32  TYR Z CB    1 
ATOM   240  C  CG    . TYR A 1 32  ? -12.384 29.643 -0.336  1.00 99.78  ? 32  TYR Z CG    1 
ATOM   241  C  CD1   . TYR A 1 32  ? -12.805 29.628 0.987   1.00 98.24  ? 32  TYR Z CD1   1 
ATOM   242  C  CD2   . TYR A 1 32  ? -13.259 30.137 -1.298  1.00 105.06 ? 32  TYR Z CD2   1 
ATOM   243  C  CE1   . TYR A 1 32  ? -14.050 30.095 1.345   1.00 102.01 ? 32  TYR Z CE1   1 
ATOM   244  C  CE2   . TYR A 1 32  ? -14.512 30.608 -0.948  1.00 115.74 ? 32  TYR Z CE2   1 
ATOM   245  C  CZ    . TYR A 1 32  ? -14.900 30.583 0.377   1.00 114.79 ? 32  TYR Z CZ    1 
ATOM   246  O  OH    . TYR A 1 32  ? -16.142 31.046 0.744   1.00 121.93 ? 32  TYR Z OH    1 
ATOM   247  N  N     . CYS A 1 33  ? -11.816 27.020 -3.006  1.00 89.02  ? 33  CYS Z N     1 
ATOM   248  C  CA    . CYS A 1 33  ? -12.831 26.613 -3.973  1.00 92.12  ? 33  CYS Z CA    1 
ATOM   249  C  C     . CYS A 1 33  ? -13.222 25.155 -3.760  1.00 90.63  ? 33  CYS Z C     1 
ATOM   250  O  O     . CYS A 1 33  ? -14.405 24.802 -3.793  1.00 92.69  ? 33  CYS Z O     1 
ATOM   251  C  CB    . CYS A 1 33  ? -12.336 26.831 -5.403  1.00 95.33  ? 33  CYS Z CB    1 
ATOM   252  S  SG    . CYS A 1 33  ? -10.902 25.838 -5.876  1.00 98.16  ? 33  CYS Z SG    1 
ATOM   253  N  N     . TRP A 1 34  ? -12.219 24.315 -3.527  1.00 88.18  ? 34  TRP Z N     1 
ATOM   254  C  CA    . TRP A 1 34  ? -12.446 22.909 -3.219  1.00 89.83  ? 34  TRP Z CA    1 
ATOM   255  C  C     . TRP A 1 34  ? -13.187 22.764 -1.895  1.00 88.43  ? 34  TRP Z C     1 
ATOM   256  O  O     . TRP A 1 34  ? -14.085 21.933 -1.765  1.00 89.78  ? 34  TRP Z O     1 
ATOM   257  C  CB    . TRP A 1 34  ? -11.120 22.145 -3.165  1.00 87.96  ? 34  TRP Z CB    1 
ATOM   258  C  CG    . TRP A 1 34  ? -10.407 22.057 -4.480  1.00 87.07  ? 34  TRP Z CG    1 
ATOM   259  C  CD1   . TRP A 1 34  ? -10.884 22.437 -5.701  1.00 91.03  ? 34  TRP Z CD1   1 
ATOM   260  C  CD2   . TRP A 1 34  ? -9.083  21.555 -4.705  1.00 86.80  ? 34  TRP Z CD2   1 
ATOM   261  N  NE1   . TRP A 1 34  ? -9.940  22.202 -6.672  1.00 92.85  ? 34  TRP Z NE1   1 
ATOM   262  C  CE2   . TRP A 1 34  ? -8.828  21.662 -6.087  1.00 89.53  ? 34  TRP Z CE2   1 
ATOM   263  C  CE3   . TRP A 1 34  ? -8.094  21.027 -3.873  1.00 84.78  ? 34  TRP Z CE3   1 
ATOM   264  C  CZ2   . TRP A 1 34  ? -7.618  21.257 -6.652  1.00 90.48  ? 34  TRP Z CZ2   1 
ATOM   265  C  CZ3   . TRP A 1 34  ? -6.897  20.628 -4.438  1.00 86.38  ? 34  TRP Z CZ3   1 
ATOM   266  C  CH2   . TRP A 1 34  ? -6.669  20.744 -5.812  1.00 87.75  ? 34  TRP Z CH2   1 
ATOM   267  N  N     . LEU A 1 35  ? -12.802 23.578 -0.917  1.00 94.68  ? 35  LEU Z N     1 
ATOM   268  C  CA    . LEU A 1 35  ? -13.437 23.564 0.396   1.00 92.89  ? 35  LEU Z CA    1 
ATOM   269  C  C     . LEU A 1 35  ? -14.915 23.918 0.312   1.00 96.76  ? 35  LEU Z C     1 
ATOM   270  O  O     . LEU A 1 35  ? -15.749 23.289 0.960   1.00 95.77  ? 35  LEU Z O     1 
ATOM   271  C  CB    . LEU A 1 35  ? -12.727 24.533 1.341   1.00 88.94  ? 35  LEU Z CB    1 
ATOM   272  C  CG    . LEU A 1 35  ? -11.704 23.908 2.286   1.00 85.87  ? 35  LEU Z CG    1 
ATOM   273  C  CD1   . LEU A 1 35  ? -10.875 24.985 2.961   1.00 82.76  ? 35  LEU Z CD1   1 
ATOM   274  C  CD2   . LEU A 1 35  ? -12.424 23.063 3.317   1.00 83.96  ? 35  LEU Z CD2   1 
ATOM   275  N  N     . HIS A 1 36  ? -15.229 24.926 -0.494  1.00 96.47  ? 36  HIS Z N     1 
ATOM   276  C  CA    . HIS A 1 36  ? -16.600 25.395 -0.646  1.00 102.04 ? 36  HIS Z CA    1 
ATOM   277  C  C     . HIS A 1 36  ? -17.442 24.378 -1.414  1.00 106.27 ? 36  HIS Z C     1 
ATOM   278  O  O     . HIS A 1 36  ? -18.519 23.981 -0.957  1.00 107.06 ? 36  HIS Z O     1 
ATOM   279  C  CB    . HIS A 1 36  ? -16.621 26.754 -1.350  1.00 107.32 ? 36  HIS Z CB    1 
ATOM   280  C  CG    . HIS A 1 36  ? -17.939 27.458 -1.267  1.00 117.67 ? 36  HIS Z CG    1 
ATOM   281  N  ND1   . HIS A 1 36  ? -18.973 27.207 -2.143  1.00 122.95 ? 36  HIS Z ND1   1 
ATOM   282  C  CD2   . HIS A 1 36  ? -18.389 28.410 -0.416  1.00 120.15 ? 36  HIS Z CD2   1 
ATOM   283  C  CE1   . HIS A 1 36  ? -20.005 27.972 -1.832  1.00 130.46 ? 36  HIS Z CE1   1 
ATOM   284  N  NE2   . HIS A 1 36  ? -19.677 28.711 -0.788  1.00 126.26 ? 36  HIS Z NE2   1 
ATOM   285  N  N     . LYS A 1 37  ? -16.943 23.951 -2.574  1.00 100.51 ? 37  LYS Z N     1 
ATOM   286  C  CA    . LYS A 1 37  ? -17.635 22.944 -3.378  1.00 108.38 ? 37  LYS Z CA    1 
ATOM   287  C  C     . LYS A 1 37  ? -17.846 21.649 -2.593  1.00 113.70 ? 37  LYS Z C     1 
ATOM   288  O  O     . LYS A 1 37  ? -18.832 20.942 -2.801  1.00 122.20 ? 37  LYS Z O     1 
ATOM   289  C  CB    . LYS A 1 37  ? -16.865 22.654 -4.670  1.00 106.41 ? 37  LYS Z CB    1 
ATOM   290  C  CG    . LYS A 1 37  ? -16.899 23.791 -5.682  1.00 104.97 ? 37  LYS Z CG    1 
ATOM   291  C  CD    . LYS A 1 37  ? -16.280 23.381 -7.016  1.00 107.48 ? 37  LYS Z CD    1 
ATOM   292  C  CE    . LYS A 1 37  ? -14.797 23.068 -6.876  1.00 94.92  ? 37  LYS Z CE    1 
ATOM   293  N  NZ    . LYS A 1 37  ? -14.176 22.706 -8.179  1.00 89.17  ? 37  LYS Z NZ    1 
ATOM   294  N  N     . GLY A 1 38  ? -16.920 21.350 -1.687  1.00 103.45 ? 38  GLY Z N     1 
ATOM   295  C  CA    . GLY A 1 38  ? -17.032 20.173 -0.845  1.00 105.39 ? 38  GLY Z CA    1 
ATOM   296  C  C     . GLY A 1 38  ? -17.978 20.406 0.314   1.00 108.22 ? 38  GLY Z C     1 
ATOM   297  O  O     . GLY A 1 38  ? -18.559 19.466 0.857   1.00 111.76 ? 38  GLY Z O     1 
ATOM   298  N  N     . ALA A 1 39  ? -18.137 21.671 0.690   1.00 106.41 ? 39  ALA Z N     1 
ATOM   299  C  CA    . ALA A 1 39  ? -19.013 22.039 1.794   1.00 110.65 ? 39  ALA Z CA    1 
ATOM   300  C  C     . ALA A 1 39  ? -20.467 22.104 1.345   1.00 116.97 ? 39  ALA Z C     1 
ATOM   301  O  O     . ALA A 1 39  ? -21.380 22.029 2.168   1.00 119.94 ? 39  ALA Z O     1 
ATOM   302  C  CB    . ALA A 1 39  ? -18.585 23.368 2.392   1.00 104.28 ? 39  ALA Z CB    1 
ATOM   303  N  N     . ILE A 1 40  ? -20.679 22.258 0.042   1.00 114.49 ? 40  ILE Z N     1 
ATOM   304  C  CA    . ILE A 1 40  ? -22.031 22.245 -0.508  1.00 121.98 ? 40  ILE Z CA    1 
ATOM   305  C  C     . ILE A 1 40  ? -22.688 20.886 -0.274  1.00 127.11 ? 40  ILE Z C     1 
ATOM   306  O  O     . ILE A 1 40  ? -23.879 20.801 0.033   1.00 129.20 ? 40  ILE Z O     1 
ATOM   307  C  CB    . ILE A 1 40  ? -22.036 22.566 -2.016  1.00 129.83 ? 40  ILE Z CB    1 
ATOM   308  C  CG1   . ILE A 1 40  ? -21.484 23.971 -2.267  1.00 121.89 ? 40  ILE Z CG1   1 
ATOM   309  C  CG2   . ILE A 1 40  ? -23.441 22.450 -2.589  1.00 150.72 ? 40  ILE Z CG2   1 
ATOM   310  C  CD1   . ILE A 1 40  ? -21.519 24.389 -3.724  1.00 132.33 ? 40  ILE Z CD1   1 
ATOM   311  N  N     . ALA A 1 41  ? -21.891 19.828 -0.395  1.00 125.21 ? 41  ALA Z N     1 
ATOM   312  C  CA    . ALA A 1 41  ? -22.381 18.461 -0.242  1.00 130.30 ? 41  ALA Z CA    1 
ATOM   313  C  C     . ALA A 1 41  ? -22.904 18.181 1.167   1.00 126.31 ? 41  ALA Z C     1 
ATOM   314  O  O     . ALA A 1 41  ? -23.676 17.244 1.372   1.00 129.66 ? 41  ALA Z O     1 
ATOM   315  C  CB    . ALA A 1 41  ? -21.284 17.471 -0.598  1.00 131.78 ? 41  ALA Z CB    1 
ATOM   316  N  N     . CYS A 1 42  ? -22.484 18.989 2.137   1.00 127.26 ? 42  CYS Z N     1 
ATOM   317  C  CA    . CYS A 1 42  ? -22.909 18.793 3.521   1.00 126.68 ? 42  CYS Z CA    1 
ATOM   318  C  C     . CYS A 1 42  ? -23.144 20.114 4.252   1.00 123.42 ? 42  CYS Z C     1 
ATOM   319  O  O     . CYS A 1 42  ? -22.584 20.350 5.325   1.00 119.61 ? 42  CYS Z O     1 
ATOM   320  C  CB    . CYS A 1 42  ? -21.875 17.956 4.277   1.00 121.32 ? 42  CYS Z CB    1 
ATOM   321  S  SG    . CYS A 1 42  ? -20.184 18.589 4.178   1.00 109.34 ? 42  CYS Z SG    1 
ATOM   322  N  N     . ALA A 1 43  ? -23.981 20.969 3.671   1.00 127.65 ? 43  ALA Z N     1 
ATOM   323  C  CA    . ALA A 1 43  ? -24.296 22.263 4.269   1.00 124.33 ? 43  ALA Z CA    1 
ATOM   324  C  C     . ALA A 1 43  ? -25.250 22.111 5.447   1.00 126.18 ? 43  ALA Z C     1 
ATOM   325  O  O     . ALA A 1 43  ? -25.248 22.927 6.370   1.00 124.71 ? 43  ALA Z O     1 
ATOM   326  C  CB    . ALA A 1 43  ? -24.889 23.198 3.227   1.00 127.19 ? 43  ALA Z CB    1 
ATOM   327  N  N     . GLU A 1 44  ? -26.061 21.057 5.408   1.00 123.89 ? 44  GLU Z N     1 
ATOM   328  C  CA    . GLU A 1 44  ? -27.060 20.806 6.441   1.00 126.49 ? 44  GLU Z CA    1 
ATOM   329  C  C     . GLU A 1 44  ? -26.408 20.552 7.795   1.00 124.08 ? 44  GLU Z C     1 
ATOM   330  O  O     . GLU A 1 44  ? -26.730 21.213 8.783   1.00 123.40 ? 44  GLU Z O     1 
ATOM   331  C  CB    . GLU A 1 44  ? -27.942 19.613 6.059   1.00 130.58 ? 44  GLU Z CB    1 
ATOM   332  C  CG    . GLU A 1 44  ? -28.351 19.570 4.595   1.00 130.04 ? 44  GLU Z CG    1 
ATOM   333  C  CD    . GLU A 1 44  ? -27.313 18.890 3.717   1.00 130.96 ? 44  GLU Z CD    1 
ATOM   334  O  OE1   . GLU A 1 44  ? -27.413 19.004 2.477   1.00 132.85 ? 44  GLU Z OE1   1 
ATOM   335  O  OE2   . GLU A 1 44  ? -26.398 18.242 4.269   1.00 130.87 ? 44  GLU Z OE2   1 
ATOM   336  N  N     . LYS A 1 45  ? -25.491 19.589 7.830   1.00 126.29 ? 45  LYS Z N     1 
ATOM   337  C  CA    . LYS A 1 45  ? -24.791 19.236 9.061   1.00 125.75 ? 45  LYS Z CA    1 
ATOM   338  C  C     . LYS A 1 45  ? -23.962 20.407 9.589   1.00 121.29 ? 45  LYS Z C     1 
ATOM   339  O  O     . LYS A 1 45  ? -23.880 20.624 10.798  1.00 120.89 ? 45  LYS Z O     1 
ATOM   340  C  CB    . LYS A 1 45  ? -23.894 18.012 8.842   1.00 125.63 ? 45  LYS Z CB    1 
ATOM   341  C  CG    . LYS A 1 45  ? -24.562 16.667 9.128   1.00 130.27 ? 45  LYS Z CG    1 
ATOM   342  C  CD    . LYS A 1 45  ? -25.696 16.364 8.157   1.00 136.38 ? 45  LYS Z CD    1 
ATOM   343  C  CE    . LYS A 1 45  ? -26.316 15.003 8.441   1.00 141.11 ? 45  LYS Z CE    1 
ATOM   344  N  NZ    . LYS A 1 45  ? -26.836 14.906 9.831   1.00 141.42 ? 45  LYS Z NZ    1 
ATOM   345  N  N     . LEU A 1 46  ? -23.354 21.163 8.678   1.00 127.32 ? 46  LEU Z N     1 
ATOM   346  C  CA    . LEU A 1 46  ? -22.527 22.304 9.062   1.00 123.45 ? 46  LEU Z CA    1 
ATOM   347  C  C     . LEU A 1 46  ? -23.364 23.436 9.655   1.00 122.03 ? 46  LEU Z C     1 
ATOM   348  O  O     . LEU A 1 46  ? -22.943 24.097 10.605  1.00 118.95 ? 46  LEU Z O     1 
ATOM   349  C  CB    . LEU A 1 46  ? -21.727 22.817 7.862   1.00 118.70 ? 46  LEU Z CB    1 
ATOM   350  C  CG    . LEU A 1 46  ? -20.519 21.976 7.439   1.00 116.65 ? 46  LEU Z CG    1 
ATOM   351  C  CD1   . LEU A 1 46  ? -19.884 22.542 6.178   1.00 113.45 ? 46  LEU Z CD1   1 
ATOM   352  C  CD2   . LEU A 1 46  ? -19.497 21.896 8.564   1.00 110.28 ? 46  LEU Z CD2   1 
ATOM   353  N  N     . ALA A 1 47  ? -24.549 23.654 9.093   1.00 123.99 ? 47  ALA Z N     1 
ATOM   354  C  CA    . ALA A 1 47  ? -25.441 24.705 9.572   1.00 124.59 ? 47  ALA Z CA    1 
ATOM   355  C  C     . ALA A 1 47  ? -25.965 24.403 10.973  1.00 125.80 ? 47  ALA Z C     1 
ATOM   356  O  O     . ALA A 1 47  ? -25.982 25.277 11.839  1.00 125.24 ? 47  ALA Z O     1 
ATOM   357  C  CB    . ALA A 1 47  ? -26.597 24.895 8.608   1.00 128.01 ? 47  ALA Z CB    1 
ATOM   358  N  N     . LYS A 1 48  ? -26.390 23.162 11.192  1.00 122.16 ? 48  LYS Z N     1 
ATOM   359  C  CA    . LYS A 1 48  ? -26.923 22.748 12.487  1.00 124.53 ? 48  LYS Z CA    1 
ATOM   360  C  C     . LYS A 1 48  ? -25.818 22.550 13.521  1.00 122.84 ? 48  LYS Z C     1 
ATOM   361  O  O     . LYS A 1 48  ? -26.094 22.364 14.706  1.00 121.16 ? 48  LYS Z O     1 
ATOM   362  C  CB    . LYS A 1 48  ? -27.737 21.459 12.345  1.00 129.06 ? 48  LYS Z CB    1 
ATOM   363  C  CG    . LYS A 1 48  ? -29.069 21.629 11.632  1.00 132.04 ? 48  LYS Z CG    1 
ATOM   364  C  CD    . LYS A 1 48  ? -30.035 22.479 12.445  1.00 138.13 ? 48  LYS Z CD    1 
ATOM   365  C  CE    . LYS A 1 48  ? -31.396 22.559 11.768  1.00 147.72 ? 48  LYS Z CE    1 
ATOM   366  N  NZ    . LYS A 1 48  ? -32.400 23.302 12.582  1.00 151.60 ? 48  LYS Z NZ    1 
ATOM   367  N  N     . GLY A 1 49  ? -24.569 22.589 13.066  1.00 122.09 ? 49  GLY Z N     1 
ATOM   368  C  CA    . GLY A 1 49  ? -23.432 22.387 13.945  1.00 118.91 ? 49  GLY Z CA    1 
ATOM   369  C  C     . GLY A 1 49  ? -23.102 20.916 14.105  1.00 121.12 ? 49  GLY Z C     1 
ATOM   370  O  O     . GLY A 1 49  ? -22.189 20.549 14.844  1.00 121.65 ? 49  GLY Z O     1 
ATOM   371  N  N     . GLU A 1 50  ? -23.853 20.073 13.403  1.00 119.26 ? 50  GLU Z N     1 
ATOM   372  C  CA    . GLU A 1 50  ? -23.659 18.629 13.458  1.00 123.23 ? 50  GLU Z CA    1 
ATOM   373  C  C     . GLU A 1 50  ? -22.310 18.233 12.862  1.00 121.30 ? 50  GLU Z C     1 
ATOM   374  O  O     . GLU A 1 50  ? -21.850 18.846 11.899  1.00 119.57 ? 50  GLU Z O     1 
ATOM   375  C  CB    . GLU A 1 50  ? -24.799 17.917 12.726  1.00 126.65 ? 50  GLU Z CB    1 
ATOM   376  C  CG    . GLU A 1 50  ? -26.179 18.274 13.253  1.00 127.84 ? 50  GLU Z CG    1 
ATOM   377  C  CD    . GLU A 1 50  ? -27.295 17.603 12.478  1.00 133.59 ? 50  GLU Z CD    1 
ATOM   378  O  OE1   . GLU A 1 50  ? -27.005 16.662 11.708  1.00 135.43 ? 50  GLU Z OE1   1 
ATOM   379  O  OE2   . GLU A 1 50  ? -28.463 18.019 12.638  1.00 131.24 ? 50  GLU Z OE2   1 
ATOM   380  N  N     . PRO A 1 51  ? -21.667 17.206 13.440  1.00 118.45 ? 51  PRO Z N     1 
ATOM   381  C  CA    . PRO A 1 51  ? -20.338 16.770 12.993  1.00 117.03 ? 51  PRO Z CA    1 
ATOM   382  C  C     . PRO A 1 51  ? -20.328 16.213 11.569  1.00 118.38 ? 51  PRO Z C     1 
ATOM   383  O  O     . PRO A 1 51  ? -21.181 15.396 11.218  1.00 121.58 ? 51  PRO Z O     1 
ATOM   384  C  CB    . PRO A 1 51  ? -19.968 15.680 14.006  1.00 121.25 ? 51  PRO Z CB    1 
ATOM   385  C  CG    . PRO A 1 51  ? -21.272 15.197 14.542  1.00 124.56 ? 51  PRO Z CG    1 
ATOM   386  C  CD    . PRO A 1 51  ? -22.163 16.400 14.569  1.00 121.59 ? 51  PRO Z CD    1 
ATOM   387  N  N     . THR A 1 52  ? -19.365 16.660 10.766  1.00 117.54 ? 52  THR Z N     1 
ATOM   388  C  CA    . THR A 1 52  ? -19.201 16.190 9.393   1.00 113.90 ? 52  THR Z CA    1 
ATOM   389  C  C     . THR A 1 52  ? -17.817 16.549 8.850   1.00 108.13 ? 52  THR Z C     1 
ATOM   390  O  O     . THR A 1 52  ? -17.204 17.523 9.286   1.00 103.49 ? 52  THR Z O     1 
ATOM   391  C  CB    . THR A 1 52  ? -20.275 16.779 8.458   1.00 116.01 ? 52  THR Z CB    1 
ATOM   392  O  OG1   . THR A 1 52  ? -20.041 16.332 7.117   1.00 113.46 ? 52  THR Z OG1   1 
ATOM   393  C  CG2   . THR A 1 52  ? -20.239 18.298 8.492   1.00 113.90 ? 52  THR Z CG2   1 
ATOM   394  N  N     . ASP A 1 53  ? -17.330 15.760 7.896   1.00 106.96 ? 53  ASP Z N     1 
ATOM   395  C  CA    . ASP A 1 53  ? -16.008 15.991 7.320   1.00 102.84 ? 53  ASP Z CA    1 
ATOM   396  C  C     . ASP A 1 53  ? -15.923 15.527 5.868   1.00 103.73 ? 53  ASP Z C     1 
ATOM   397  O  O     . ASP A 1 53  ? -14.875 15.068 5.411   1.00 102.09 ? 53  ASP Z O     1 
ATOM   398  C  CB    . ASP A 1 53  ? -14.934 15.287 8.153   1.00 102.82 ? 53  ASP Z CB    1 
ATOM   399  C  CG    . ASP A 1 53  ? -15.084 13.778 8.142   1.00 109.50 ? 53  ASP Z CG    1 
ATOM   400  O  OD1   . ASP A 1 53  ? -16.236 13.293 8.155   1.00 113.97 ? 53  ASP Z OD1   1 
ATOM   401  O  OD2   . ASP A 1 53  ? -14.048 13.079 8.114   1.00 110.94 ? 53  ASP Z OD2   1 
ATOM   402  N  N     . ARG A 1 54  ? -17.031 15.659 5.147   1.00 101.66 ? 54  ARG Z N     1 
ATOM   403  C  CA    . ARG A 1 54  ? -17.101 15.249 3.750   1.00 103.97 ? 54  ARG Z CA    1 
ATOM   404  C  C     . ARG A 1 54  ? -16.190 16.104 2.869   1.00 101.13 ? 54  ARG Z C     1 
ATOM   405  O  O     . ARG A 1 54  ? -15.605 15.616 1.894   1.00 100.31 ? 54  ARG Z O     1 
ATOM   406  C  CB    . ARG A 1 54  ? -18.545 15.332 3.253   1.00 106.18 ? 54  ARG Z CB    1 
ATOM   407  C  CG    . ARG A 1 54  ? -18.905 14.301 2.205   1.00 113.03 ? 54  ARG Z CG    1 
ATOM   408  C  CD    . ARG A 1 54  ? -20.381 14.380 1.859   1.00 118.61 ? 54  ARG Z CD    1 
ATOM   409  N  NE    . ARG A 1 54  ? -20.812 13.233 1.068   1.00 127.96 ? 54  ARG Z NE    1 
ATOM   410  C  CZ    . ARG A 1 54  ? -21.290 12.107 1.588   1.00 127.62 ? 54  ARG Z CZ    1 
ATOM   411  N  NH1   . ARG A 1 54  ? -21.403 11.977 2.904   1.00 122.30 ? 54  ARG Z NH1   1 
ATOM   412  N  NH2   . ARG A 1 54  ? -21.658 11.112 0.792   1.00 131.22 ? 54  ARG Z NH2   1 
ATOM   413  N  N     . TYR A 1 55  ? -16.074 17.381 3.223   1.00 105.48 ? 55  TYR Z N     1 
ATOM   414  C  CA    . TYR A 1 55  ? -15.256 18.321 2.465   1.00 101.34 ? 55  TYR Z CA    1 
ATOM   415  C  C     . TYR A 1 55  ? -13.783 17.924 2.477   1.00 99.03  ? 55  TYR Z C     1 
ATOM   416  O  O     . TYR A 1 55  ? -13.059 18.180 1.513   1.00 97.82  ? 55  TYR Z O     1 
ATOM   417  C  CB    . TYR A 1 55  ? -15.426 19.741 3.014   1.00 96.87  ? 55  TYR Z CB    1 
ATOM   418  C  CG    . TYR A 1 55  ? -15.128 19.883 4.491   1.00 95.53  ? 55  TYR Z CG    1 
ATOM   419  C  CD1   . TYR A 1 55  ? -16.133 19.734 5.439   1.00 98.08  ? 55  TYR Z CD1   1 
ATOM   420  C  CD2   . TYR A 1 55  ? -13.846 20.175 4.937   1.00 92.82  ? 55  TYR Z CD2   1 
ATOM   421  C  CE1   . TYR A 1 55  ? -15.866 19.866 6.788   1.00 95.12  ? 55  TYR Z CE1   1 
ATOM   422  C  CE2   . TYR A 1 55  ? -13.571 20.307 6.285   1.00 89.11  ? 55  TYR Z CE2   1 
ATOM   423  C  CZ    . TYR A 1 55  ? -14.584 20.152 7.205   1.00 90.93  ? 55  TYR Z CZ    1 
ATOM   424  O  OH    . TYR A 1 55  ? -14.313 20.283 8.549   1.00 92.67  ? 55  TYR Z OH    1 
ATOM   425  N  N     . VAL A 1 56  ? -13.345 17.302 3.568   1.00 94.30  ? 56  VAL Z N     1 
ATOM   426  C  CA    . VAL A 1 56  ? -11.971 16.825 3.679   1.00 93.91  ? 56  VAL Z CA    1 
ATOM   427  C  C     . VAL A 1 56  ? -11.663 15.807 2.586   1.00 97.91  ? 56  VAL Z C     1 
ATOM   428  O  O     . VAL A 1 56  ? -10.687 15.948 1.848   1.00 98.52  ? 56  VAL Z O     1 
ATOM   429  C  CB    . VAL A 1 56  ? -11.698 16.188 5.053   1.00 94.24  ? 56  VAL Z CB    1 
ATOM   430  C  CG1   . VAL A 1 56  ? -10.349 15.487 5.057   1.00 93.15  ? 56  VAL Z CG1   1 
ATOM   431  C  CG2   . VAL A 1 56  ? -11.761 17.240 6.148   1.00 92.47  ? 56  VAL Z CG2   1 
ATOM   432  N  N     . GLY A 1 57  ? -12.509 14.787 2.482   1.00 96.12  ? 57  GLY Z N     1 
ATOM   433  C  CA    . GLY A 1 57  ? -12.357 13.775 1.454   1.00 98.80  ? 57  GLY Z CA    1 
ATOM   434  C  C     . GLY A 1 57  ? -12.511 14.369 0.068   1.00 97.52  ? 57  GLY Z C     1 
ATOM   435  O  O     . GLY A 1 57  ? -11.803 13.985 -0.868  1.00 98.77  ? 57  GLY Z O     1 
ATOM   436  N  N     . PHE A 1 58  ? -13.436 15.318 -0.057  1.00 99.63  ? 58  PHE Z N     1 
ATOM   437  C  CA    . PHE A 1 58  ? -13.676 15.984 -1.332  1.00 98.84  ? 58  PHE Z CA    1 
ATOM   438  C  C     . PHE A 1 58  ? -12.420 16.686 -1.837  1.00 96.09  ? 58  PHE Z C     1 
ATOM   439  O  O     . PHE A 1 58  ? -12.092 16.611 -3.019  1.00 97.50  ? 58  PHE Z O     1 
ATOM   440  C  CB    . PHE A 1 58  ? -14.822 16.989 -1.212  1.00 100.34 ? 58  PHE Z CB    1 
ATOM   441  C  CG    . PHE A 1 58  ? -15.218 17.611 -2.522  1.00 104.62 ? 58  PHE Z CG    1 
ATOM   442  C  CD1   . PHE A 1 58  ? -16.177 17.016 -3.324  1.00 115.35 ? 58  PHE Z CD1   1 
ATOM   443  C  CD2   . PHE A 1 58  ? -14.628 18.790 -2.954  1.00 99.60  ? 58  PHE Z CD2   1 
ATOM   444  C  CE1   . PHE A 1 58  ? -16.541 17.582 -4.529  1.00 118.01 ? 58  PHE Z CE1   1 
ATOM   445  C  CE2   . PHE A 1 58  ? -14.988 19.361 -4.160  1.00 99.22  ? 58  PHE Z CE2   1 
ATOM   446  C  CZ    . PHE A 1 58  ? -15.947 18.757 -4.948  1.00 109.51 ? 58  PHE Z CZ    1 
ATOM   447  N  N     . CYS A 1 59  ? -11.723 17.376 -0.942  1.00 96.97  ? 59  CYS Z N     1 
ATOM   448  C  CA    . CYS A 1 59  ? -10.470 18.024 -1.305  1.00 93.99  ? 59  CYS Z CA    1 
ATOM   449  C  C     . CYS A 1 59  ? -9.394  16.978 -1.564  1.00 96.62  ? 59  CYS Z C     1 
ATOM   450  O  O     . CYS A 1 59  ? -8.556  17.130 -2.462  1.00 96.55  ? 59  CYS Z O     1 
ATOM   451  C  CB    . CYS A 1 59  ? -10.016 18.987 -0.204  1.00 89.14  ? 59  CYS Z CB    1 
ATOM   452  S  SG    . CYS A 1 59  ? -11.169 20.336 0.146   1.00 88.87  ? 59  CYS Z SG    1 
ATOM   453  N  N     . MET A 1 60  ? -9.431  15.906 -0.780  1.00 91.20  ? 60  MET Z N     1 
ATOM   454  C  CA    . MET A 1 60  ? -8.391  14.891 -0.847  1.00 95.47  ? 60  MET Z CA    1 
ATOM   455  C  C     . MET A 1 60  ? -8.427  14.058 -2.125  1.00 99.81  ? 60  MET Z C     1 
ATOM   456  O  O     . MET A 1 60  ? -7.408  13.495 -2.513  1.00 101.01 ? 60  MET Z O     1 
ATOM   457  C  CB    . MET A 1 60  ? -8.470  13.967 0.369   1.00 99.27  ? 60  MET Z CB    1 
ATOM   458  C  CG    . MET A 1 60  ? -7.808  14.541 1.614   1.00 97.77  ? 60  MET Z CG    1 
ATOM   459  S  SD    . MET A 1 60  ? -6.154  15.181 1.273   1.00 94.85  ? 60  MET Z SD    1 
ATOM   460  C  CE    . MET A 1 60  ? -5.346  13.716 0.631   1.00 102.65 ? 60  MET Z CE    1 
ATOM   461  N  N     . LYS A 1 61  ? -9.580  13.961 -2.779  1.00 95.58  ? 61  LYS Z N     1 
ATOM   462  C  CA    . LYS A 1 61  ? -9.621  13.229 -4.044  1.00 98.65  ? 61  LYS Z CA    1 
ATOM   463  C  C     . LYS A 1 61  ? -8.999  14.075 -5.155  1.00 96.09  ? 61  LYS Z C     1 
ATOM   464  O  O     . LYS A 1 61  ? -8.363  13.543 -6.068  1.00 96.59  ? 61  LYS Z O     1 
ATOM   465  C  CB    . LYS A 1 61  ? -11.051 12.805 -4.405  1.00 102.12 ? 61  LYS Z CB    1 
ATOM   466  C  CG    . LYS A 1 61  ? -12.030 13.932 -4.655  1.00 100.76 ? 61  LYS Z CG    1 
ATOM   467  C  CD    . LYS A 1 61  ? -13.412 13.379 -4.970  1.00 105.61 ? 61  LYS Z CD    1 
ATOM   468  C  CE    . LYS A 1 61  ? -14.422 14.488 -5.219  1.00 109.65 ? 61  LYS Z CE    1 
ATOM   469  N  NZ    . LYS A 1 61  ? -15.773 13.938 -5.531  1.00 119.41 ? 61  LYS Z NZ    1 
ATOM   470  N  N     . PHE A 1 62  ? -9.168  15.391 -5.062  1.00 98.35  ? 62  PHE Z N     1 
ATOM   471  C  CA    . PHE A 1 62  ? -8.490  16.317 -5.964  1.00 94.87  ? 62  PHE Z CA    1 
ATOM   472  C  C     . PHE A 1 62  ? -6.982  16.243 -5.755  1.00 94.38  ? 62  PHE Z C     1 
ATOM   473  O  O     . PHE A 1 62  ? -6.208  16.143 -6.717  1.00 95.73  ? 62  PHE Z O     1 
ATOM   474  C  CB    . PHE A 1 62  ? -8.978  17.752 -5.747  1.00 91.23  ? 62  PHE Z CB    1 
ATOM   475  C  CG    . PHE A 1 62  ? -10.257 18.079 -6.466  1.00 91.27  ? 62  PHE Z CG    1 
ATOM   476  C  CD1   . PHE A 1 62  ? -11.483 17.708 -5.938  1.00 92.07  ? 62  PHE Z CD1   1 
ATOM   477  C  CD2   . PHE A 1 62  ? -10.231 18.770 -7.667  1.00 87.93  ? 62  PHE Z CD2   1 
ATOM   478  C  CE1   . PHE A 1 62  ? -12.659 18.014 -6.599  1.00 94.68  ? 62  PHE Z CE1   1 
ATOM   479  C  CE2   . PHE A 1 62  ? -11.403 19.078 -8.332  1.00 87.98  ? 62  PHE Z CE2   1 
ATOM   480  C  CZ    . PHE A 1 62  ? -12.618 18.700 -7.798  1.00 91.73  ? 62  PHE Z CZ    1 
ATOM   481  N  N     . VAL A 1 63  ? -6.574  16.298 -4.488  1.00 92.29  ? 63  VAL Z N     1 
ATOM   482  C  CA    . VAL A 1 63  ? -5.162  16.192 -4.131  1.00 92.22  ? 63  VAL Z CA    1 
ATOM   483  C  C     . VAL A 1 63  ? -4.557  14.892 -4.656  1.00 95.61  ? 63  VAL Z C     1 
ATOM   484  O  O     . VAL A 1 63  ? -3.504  14.898 -5.295  1.00 93.40  ? 63  VAL Z O     1 
ATOM   485  C  CB    . VAL A 1 63  ? -4.957  16.268 -2.604  1.00 90.81  ? 63  VAL Z CB    1 
ATOM   486  C  CG1   . VAL A 1 63  ? -3.515  15.943 -2.238  1.00 91.39  ? 63  VAL Z CG1   1 
ATOM   487  C  CG2   . VAL A 1 63  ? -5.348  17.643 -2.083  1.00 85.60  ? 63  VAL Z CG2   1 
ATOM   488  N  N     . ASN A 1 64  ? -5.238  13.782 -4.391  1.00 92.66  ? 64  ASN Z N     1 
ATOM   489  C  CA    . ASN A 1 64  ? -4.779  12.470 -4.829  1.00 96.07  ? 64  ASN Z CA    1 
ATOM   490  C  C     . ASN A 1 64  ? -4.769  12.341 -6.349  1.00 98.02  ? 64  ASN Z C     1 
ATOM   491  O  O     . ASN A 1 64  ? -3.981  11.577 -6.902  1.00 98.84  ? 64  ASN Z O     1 
ATOM   492  C  CB    . ASN A 1 64  ? -5.648  11.368 -4.217  1.00 98.29  ? 64  ASN Z CB    1 
ATOM   493  C  CG    . ASN A 1 64  ? -5.426  11.210 -2.724  1.00 100.64 ? 64  ASN Z CG    1 
ATOM   494  O  OD1   . ASN A 1 64  ? -4.333  11.466 -2.216  1.00 100.25 ? 64  ASN Z OD1   1 
ATOM   495  N  ND2   . ASN A 1 64  ? -6.464  10.786 -2.012  1.00 99.91  ? 64  ASN Z ND2   1 
ATOM   496  N  N     . MET A 1 65  ? -5.644  13.083 -7.022  1.00 97.75  ? 65  MET Z N     1 
ATOM   497  C  CA    . MET A 1 65  ? -5.650  13.102 -8.481  1.00 96.27  ? 65  MET Z CA    1 
ATOM   498  C  C     . MET A 1 65  ? -4.389  13.789 -8.994  1.00 95.02  ? 65  MET Z C     1 
ATOM   499  O  O     . MET A 1 65  ? -3.654  13.239 -9.827  1.00 99.30  ? 65  MET Z O     1 
ATOM   500  C  CB    . MET A 1 65  ? -6.902  13.808 -9.008  1.00 94.75  ? 65  MET Z CB    1 
ATOM   501  C  CG    . MET A 1 65  ? -7.026  13.830 -10.527 1.00 95.56  ? 65  MET Z CG    1 
ATOM   502  S  SD    . MET A 1 65  ? -6.265  15.276 -11.299 1.00 91.25  ? 65  MET Z SD    1 
ATOM   503  C  CE    . MET A 1 65  ? -7.252  16.599 -10.604 1.00 87.36  ? 65  MET Z CE    1 
ATOM   504  N  N     . LEU A 1 66  ? -4.143  14.994 -8.484  1.00 99.88  ? 66  LEU Z N     1 
ATOM   505  C  CA    . LEU A 1 66  ? -2.955  15.756 -8.856  1.00 97.21  ? 66  LEU Z CA    1 
ATOM   506  C  C     . LEU A 1 66  ? -1.679  14.968 -8.577  1.00 99.41  ? 66  LEU Z C     1 
ATOM   507  O  O     . LEU A 1 66  ? -0.740  14.987 -9.373  1.00 99.25  ? 66  LEU Z O     1 
ATOM   508  C  CB    . LEU A 1 66  ? -2.920  17.090 -8.110  1.00 91.00  ? 66  LEU Z CB    1 
ATOM   509  C  CG    . LEU A 1 66  ? -4.041  18.077 -8.438  1.00 87.97  ? 66  LEU Z CG    1 
ATOM   510  C  CD1   . LEU A 1 66  ? -3.874  19.354 -7.632  1.00 82.38  ? 66  LEU Z CD1   1 
ATOM   511  C  CD2   . LEU A 1 66  ? -4.069  18.380 -9.928  1.00 87.35  ? 66  LEU Z CD2   1 
ATOM   512  N  N     . LEU A 1 67  ? -1.653  14.272 -7.445  1.00 96.86  ? 67  LEU Z N     1 
ATOM   513  C  CA    . LEU A 1 67  ? -0.510  13.439 -7.091  1.00 98.10  ? 67  LEU Z CA    1 
ATOM   514  C  C     . LEU A 1 67  ? -0.405  12.227 -8.010  1.00 104.89 ? 67  LEU Z C     1 
ATOM   515  O  O     . LEU A 1 67  ? 0.694   11.765 -8.317  1.00 107.14 ? 67  LEU Z O     1 
ATOM   516  C  CB    . LEU A 1 67  ? -0.605  12.987 -5.632  1.00 97.79  ? 67  LEU Z CB    1 
ATOM   517  C  CG    . LEU A 1 67  ? -0.319  14.055 -4.576  1.00 92.53  ? 67  LEU Z CG    1 
ATOM   518  C  CD1   . LEU A 1 67  ? -0.507  13.492 -3.176  1.00 96.50  ? 67  LEU Z CD1   1 
ATOM   519  C  CD2   . LEU A 1 67  ? 1.087   14.603 -4.751  1.00 88.82  ? 67  LEU Z CD2   1 
ATOM   520  N  N     . SER A 1 68  ? -1.551  11.718 -8.451  1.00 99.64  ? 68  SER Z N     1 
ATOM   521  C  CA    . SER A 1 68  ? -1.577  10.556 -9.331  1.00 103.49 ? 68  SER Z CA    1 
ATOM   522  C  C     . SER A 1 68  ? -1.018  10.911 -10.701 1.00 103.37 ? 68  SER Z C     1 
ATOM   523  O  O     . SER A 1 68  ? -0.396  10.077 -11.360 1.00 107.70 ? 68  SER Z O     1 
ATOM   524  C  CB    . SER A 1 68  ? -2.997  10.002 -9.470  1.00 106.21 ? 68  SER Z CB    1 
ATOM   525  O  OG    . SER A 1 68  ? -3.827  10.898 -10.187 1.00 104.81 ? 68  SER Z OG    1 
ATOM   526  N  N     . HIS A 1 69  ? -1.236  12.151 -11.128 1.00 105.58 ? 69  HIS Z N     1 
ATOM   527  C  CA    . HIS A 1 69  ? -0.698  12.599 -12.409 1.00 101.50 ? 69  HIS Z CA    1 
ATOM   528  C  C     . HIS A 1 69  ? 0.720   13.158 -12.275 1.00 100.69 ? 69  HIS Z C     1 
ATOM   529  O  O     . HIS A 1 69  ? 1.212   13.841 -13.173 1.00 99.32  ? 69  HIS Z O     1 
ATOM   530  C  CB    . HIS A 1 69  ? -1.623  13.640 -13.041 1.00 99.24  ? 69  HIS Z CB    1 
ATOM   531  C  CG    . HIS A 1 69  ? -2.915  13.071 -13.538 1.00 102.78 ? 69  HIS Z CG    1 
ATOM   532  N  ND1   . HIS A 1 69  ? -3.938  12.698 -12.693 1.00 105.59 ? 69  HIS Z ND1   1 
ATOM   533  C  CD2   . HIS A 1 69  ? -3.345  12.795 -14.793 1.00 106.48 ? 69  HIS Z CD2   1 
ATOM   534  C  CE1   . HIS A 1 69  ? -4.945  12.225 -13.406 1.00 108.37 ? 69  HIS Z CE1   1 
ATOM   535  N  NE2   . HIS A 1 69  ? -4.610  12.273 -14.683 1.00 109.21 ? 69  HIS Z NE2   1 
ATOM   536  N  N     . GLY A 1 70  ? 1.371   12.859 -11.154 1.00 107.40 ? 70  GLY Z N     1 
ATOM   537  C  CA    . GLY A 1 70  ? 2.763   13.221 -10.947 1.00 105.85 ? 70  GLY Z CA    1 
ATOM   538  C  C     . GLY A 1 70  ? 3.012   14.707 -10.779 1.00 100.91 ? 70  GLY Z C     1 
ATOM   539  O  O     . GLY A 1 70  ? 4.020   15.235 -11.250 1.00 98.88  ? 70  GLY Z O     1 
ATOM   540  N  N     . ILE A 1 71  ? 2.093   15.382 -10.097 1.00 101.97 ? 71  ILE Z N     1 
ATOM   541  C  CA    . ILE A 1 71  ? 2.195   16.820 -9.879  1.00 98.07  ? 71  ILE Z CA    1 
ATOM   542  C  C     . ILE A 1 71  ? 2.388   17.124 -8.399  1.00 93.71  ? 71  ILE Z C     1 
ATOM   543  O  O     . ILE A 1 71  ? 1.791   16.469 -7.548  1.00 97.31  ? 71  ILE Z O     1 
ATOM   544  C  CB    . ILE A 1 71  ? 0.941   17.557 -10.388 1.00 97.10  ? 71  ILE Z CB    1 
ATOM   545  C  CG1   . ILE A 1 71  ? 0.581   17.086 -11.797 1.00 99.90  ? 71  ILE Z CG1   1 
ATOM   546  C  CG2   . ILE A 1 71  ? 1.144   19.068 -10.356 1.00 90.51  ? 71  ILE Z CG2   1 
ATOM   547  C  CD1   . ILE A 1 71  ? -0.696  17.689 -12.322 1.00 99.28  ? 71  ILE Z CD1   1 
ATOM   548  N  N     . LYS A 1 72  ? 3.228   18.111 -8.101  1.00 88.59  ? 72  LYS Z N     1 
ATOM   549  C  CA    . LYS A 1 72  ? 3.462   18.539 -6.727  1.00 88.36  ? 72  LYS Z CA    1 
ATOM   550  C  C     . LYS A 1 72  ? 2.585   19.736 -6.373  1.00 88.13  ? 72  LYS Z C     1 
ATOM   551  O  O     . LYS A 1 72  ? 2.865   20.859 -6.795  1.00 87.13  ? 72  LYS Z O     1 
ATOM   552  C  CB    . LYS A 1 72  ? 4.936   18.887 -6.517  1.00 87.52  ? 72  LYS Z CB    1 
ATOM   553  C  CG    . LYS A 1 72  ? 5.254   19.413 -5.126  1.00 88.93  ? 72  LYS Z CG    1 
ATOM   554  C  CD    . LYS A 1 72  ? 6.721   19.794 -4.996  1.00 92.37  ? 72  LYS Z CD    1 
ATOM   555  C  CE    . LYS A 1 72  ? 7.030   20.343 -3.610  1.00 95.73  ? 72  LYS Z CE    1 
ATOM   556  N  NZ    . LYS A 1 72  ? 8.468   20.696 -3.451  1.00 102.20 ? 72  LYS Z NZ    1 
ATOM   557  N  N     . PRO A 1 73  ? 1.515   19.498 -5.598  1.00 82.47  ? 73  PRO Z N     1 
ATOM   558  C  CA    . PRO A 1 73  ? 0.581   20.563 -5.225  1.00 82.71  ? 73  PRO Z CA    1 
ATOM   559  C  C     . PRO A 1 73  ? 0.963   21.284 -3.932  1.00 82.64  ? 73  PRO Z C     1 
ATOM   560  O  O     . PRO A 1 73  ? 1.366   20.652 -2.955  1.00 83.54  ? 73  PRO Z O     1 
ATOM   561  C  CB    . PRO A 1 73  ? -0.737  19.810 -5.052  1.00 83.21  ? 73  PRO Z CB    1 
ATOM   562  C  CG    . PRO A 1 73  ? -0.316  18.469 -4.543  1.00 85.97  ? 73  PRO Z CG    1 
ATOM   563  C  CD    . PRO A 1 73  ? 1.055   18.181 -5.124  1.00 83.68  ? 73  PRO Z CD    1 
ATOM   564  N  N     . ILE A 1 74  ? 0.837   22.606 -3.938  1.00 81.61  ? 74  ILE Z N     1 
ATOM   565  C  CA    . ILE A 1 74  ? 1.036   23.398 -2.732  1.00 79.11  ? 74  ILE Z CA    1 
ATOM   566  C  C     . ILE A 1 74  ? -0.277  24.063 -2.341  1.00 79.81  ? 74  ILE Z C     1 
ATOM   567  O  O     . ILE A 1 74  ? -0.711  25.026 -2.973  1.00 79.41  ? 74  ILE Z O     1 
ATOM   568  C  CB    . ILE A 1 74  ? 2.126   24.467 -2.917  1.00 76.87  ? 74  ILE Z CB    1 
ATOM   569  C  CG1   . ILE A 1 74  ? 3.461   23.804 -3.255  1.00 77.15  ? 74  ILE Z CG1   1 
ATOM   570  C  CG2   . ILE A 1 74  ? 2.260   25.315 -1.661  1.00 79.61  ? 74  ILE Z CG2   1 
ATOM   571  C  CD1   . ILE A 1 74  ? 4.600   24.781 -3.417  1.00 76.27  ? 74  ILE Z CD1   1 
ATOM   572  N  N     . LEU A 1 75  ? -0.911  23.531 -1.303  1.00 80.13  ? 75  LEU Z N     1 
ATOM   573  C  CA    . LEU A 1 75  ? -2.194  24.044 -0.845  1.00 79.46  ? 75  LEU Z CA    1 
ATOM   574  C  C     . LEU A 1 75  ? -2.036  25.410 -0.187  1.00 81.32  ? 75  LEU Z C     1 
ATOM   575  O  O     . LEU A 1 75  ? -1.190  25.592 0.688   1.00 80.91  ? 75  LEU Z O     1 
ATOM   576  C  CB    . LEU A 1 75  ? -2.850  23.059 0.127   1.00 81.43  ? 75  LEU Z CB    1 
ATOM   577  C  CG    . LEU A 1 75  ? -3.755  21.981 -0.478  1.00 86.37  ? 75  LEU Z CG    1 
ATOM   578  C  CD1   . LEU A 1 75  ? -3.022  21.141 -1.514  1.00 83.23  ? 75  LEU Z CD1   1 
ATOM   579  C  CD2   . LEU A 1 75  ? -4.331  21.097 0.618   1.00 86.27  ? 75  LEU Z CD2   1 
ATOM   580  N  N     . VAL A 1 76  ? -2.851  26.367 -0.619  1.00 79.53  ? 76  VAL Z N     1 
ATOM   581  C  CA    . VAL A 1 76  ? -2.811  27.716 -0.069  1.00 78.13  ? 76  VAL Z CA    1 
ATOM   582  C  C     . VAL A 1 76  ? -4.169  28.107 0.507   1.00 77.77  ? 76  VAL Z C     1 
ATOM   583  O  O     . VAL A 1 76  ? -5.211  27.836 -0.089  1.00 78.73  ? 76  VAL Z O     1 
ATOM   584  C  CB    . VAL A 1 76  ? -2.378  28.741 -1.136  1.00 72.82  ? 76  VAL Z CB    1 
ATOM   585  C  CG1   . VAL A 1 76  ? -2.348  30.150 -0.555  1.00 73.54  ? 76  VAL Z CG1   1 
ATOM   586  C  CG2   . VAL A 1 76  ? -1.014  28.368 -1.690  1.00 72.40  ? 76  VAL Z CG2   1 
ATOM   587  N  N     . PHE A 1 77  ? -4.148  28.741 1.676   1.00 76.07  ? 77  PHE Z N     1 
ATOM   588  C  CA    . PHE A 1 77  ? -5.373  29.095 2.381   1.00 74.45  ? 77  PHE Z CA    1 
ATOM   589  C  C     . PHE A 1 77  ? -5.426  30.585 2.698   1.00 73.62  ? 77  PHE Z C     1 
ATOM   590  O  O     . PHE A 1 77  ? -4.392  31.242 2.811   1.00 73.08  ? 77  PHE Z O     1 
ATOM   591  C  CB    . PHE A 1 77  ? -5.496  28.285 3.675   1.00 76.52  ? 77  PHE Z CB    1 
ATOM   592  C  CG    . PHE A 1 77  ? -5.501  26.797 3.464   1.00 77.43  ? 77  PHE Z CG    1 
ATOM   593  C  CD1   . PHE A 1 77  ? -4.315  26.102 3.289   1.00 78.41  ? 77  PHE Z CD1   1 
ATOM   594  C  CD2   . PHE A 1 77  ? -6.692  26.093 3.450   1.00 79.74  ? 77  PHE Z CD2   1 
ATOM   595  C  CE1   . PHE A 1 77  ? -4.318  24.739 3.094   1.00 80.58  ? 77  PHE Z CE1   1 
ATOM   596  C  CE2   . PHE A 1 77  ? -6.702  24.726 3.260   1.00 80.29  ? 77  PHE Z CE2   1 
ATOM   597  C  CZ    . PHE A 1 77  ? -5.513  24.048 3.081   1.00 81.35  ? 77  PHE Z CZ    1 
ATOM   598  N  N     . ASP A 1 78  ? -6.639  31.109 2.842   1.00 79.68  ? 78  ASP Z N     1 
ATOM   599  C  CA    . ASP A 1 78  ? -6.844  32.494 3.256   1.00 79.26  ? 78  ASP Z CA    1 
ATOM   600  C  C     . ASP A 1 78  ? -6.457  32.694 4.717   1.00 84.10  ? 78  ASP Z C     1 
ATOM   601  O  O     . ASP A 1 78  ? -6.593  31.784 5.533   1.00 84.96  ? 78  ASP Z O     1 
ATOM   602  C  CB    . ASP A 1 78  ? -8.302  32.908 3.043   1.00 80.28  ? 78  ASP Z CB    1 
ATOM   603  C  CG    . ASP A 1 78  ? -8.623  33.196 1.588   1.00 82.12  ? 78  ASP Z CG    1 
ATOM   604  O  OD1   . ASP A 1 78  ? -7.833  33.907 0.930   1.00 77.64  ? 78  ASP Z OD1   1 
ATOM   605  O  OD2   . ASP A 1 78  ? -9.665  32.711 1.100   1.00 85.75  ? 78  ASP Z OD2   1 
ATOM   606  N  N     . GLY A 1 79  ? -5.974  33.888 5.041   1.00 80.09  ? 79  GLY Z N     1 
ATOM   607  C  CA    . GLY A 1 79  ? -5.579  34.205 6.401   1.00 84.35  ? 79  GLY Z CA    1 
ATOM   608  C  C     . GLY A 1 79  ? -6.438  35.291 7.017   1.00 85.14  ? 79  GLY Z C     1 
ATOM   609  O  O     . GLY A 1 79  ? -7.664  35.183 7.053   1.00 86.72  ? 79  GLY Z O     1 
ATOM   610  N  N     . CYS A 1 80  ? -5.790  36.343 7.506   1.00 88.41  ? 80  CYS Z N     1 
ATOM   611  C  CA    . CYS A 1 80  ? -6.499  37.470 8.098   1.00 89.98  ? 80  CYS Z CA    1 
ATOM   612  C  C     . CYS A 1 80  ? -7.252  38.249 7.029   1.00 87.43  ? 80  CYS Z C     1 
ATOM   613  O  O     . CYS A 1 80  ? -6.749  38.443 5.925   1.00 84.83  ? 80  CYS Z O     1 
ATOM   614  C  CB    . CYS A 1 80  ? -5.528  38.397 8.834   1.00 92.32  ? 80  CYS Z CB    1 
ATOM   615  S  SG    . CYS A 1 80  ? -4.550  37.592 10.122  1.00 106.54 ? 80  CYS Z SG    1 
ATOM   616  N  N     . THR A 1 81  ? -8.460  38.690 7.361   1.00 92.35  ? 81  THR Z N     1 
ATOM   617  C  CA    . THR A 1 81  ? -9.257  39.486 6.438   1.00 91.66  ? 81  THR Z CA    1 
ATOM   618  C  C     . THR A 1 81  ? -8.656  40.877 6.281   1.00 93.82  ? 81  THR Z C     1 
ATOM   619  O  O     . THR A 1 81  ? -8.416  41.572 7.266   1.00 101.34 ? 81  THR Z O     1 
ATOM   620  C  CB    . THR A 1 81  ? -10.721 39.612 6.906   1.00 97.97  ? 81  THR Z CB    1 
ATOM   621  O  OG1   . THR A 1 81  ? -11.355 38.327 6.860   1.00 100.05 ? 81  THR Z OG1   1 
ATOM   622  C  CG2   . THR A 1 81  ? -11.483 40.580 6.015   1.00 100.91 ? 81  THR Z CG2   1 
ATOM   623  N  N     . LEU A 1 82  ? -8.406  41.269 5.037   1.00 97.64  ? 82  LEU Z N     1 
ATOM   624  C  CA    . LEU A 1 82  ? -7.842  42.579 4.738   1.00 99.31  ? 82  LEU Z CA    1 
ATOM   625  C  C     . LEU A 1 82  ? -8.801  43.685 5.175   1.00 106.06 ? 82  LEU Z C     1 
ATOM   626  O  O     . LEU A 1 82  ? -10.011 43.573 4.971   1.00 108.47 ? 82  LEU Z O     1 
ATOM   627  C  CB    . LEU A 1 82  ? -7.532  42.693 3.244   1.00 91.67  ? 82  LEU Z CB    1 
ATOM   628  C  CG    . LEU A 1 82  ? -6.255  43.427 2.833   1.00 85.39  ? 82  LEU Z CG    1 
ATOM   629  C  CD1   . LEU A 1 82  ? -5.046  42.818 3.519   1.00 87.21  ? 82  LEU Z CD1   1 
ATOM   630  C  CD2   . LEU A 1 82  ? -6.090  43.380 1.327   1.00 79.27  ? 82  LEU Z CD2   1 
ATOM   631  N  N     . PRO A 1 83  ? -8.260  44.750 5.790   1.00 104.57 ? 83  PRO Z N     1 
ATOM   632  C  CA    . PRO A 1 83  ? -9.037  45.880 6.318   1.00 106.68 ? 83  PRO Z CA    1 
ATOM   633  C  C     . PRO A 1 83  ? -9.976  46.510 5.290   1.00 105.82 ? 83  PRO Z C     1 
ATOM   634  O  O     . PRO A 1 83  ? -11.038 47.011 5.657   1.00 108.38 ? 83  PRO Z O     1 
ATOM   635  C  CB    . PRO A 1 83  ? -7.955  46.877 6.738   1.00 106.39 ? 83  PRO Z CB    1 
ATOM   636  C  CG    . PRO A 1 83  ? -6.778  46.028 7.057   1.00 104.76 ? 83  PRO Z CG    1 
ATOM   637  C  CD    . PRO A 1 83  ? -6.822  44.891 6.082   1.00 103.19 ? 83  PRO Z CD    1 
ATOM   638  N  N     . SER A 1 84  ? -9.585  46.476 4.020   1.00 115.50 ? 84  SER Z N     1 
ATOM   639  C  CA    . SER A 1 84  ? -10.380 47.071 2.950   1.00 114.04 ? 84  SER Z CA    1 
ATOM   640  C  C     . SER A 1 84  ? -11.711 46.351 2.747   1.00 116.00 ? 84  SER Z C     1 
ATOM   641  O  O     . SER A 1 84  ? -12.664 46.927 2.222   1.00 114.36 ? 84  SER Z O     1 
ATOM   642  C  CB    . SER A 1 84  ? -9.591  47.067 1.639   1.00 109.03 ? 84  SER Z CB    1 
ATOM   643  O  OG    . SER A 1 84  ? -8.369  47.771 1.774   1.00 106.60 ? 84  SER Z OG    1 
ATOM   644  N  N     . LYS A 1 85  ? -11.766 45.089 3.159   1.00 114.94 ? 85  LYS Z N     1 
ATOM   645  C  CA    . LYS A 1 85  ? -12.957 44.271 2.972   1.00 117.34 ? 85  LYS Z CA    1 
ATOM   646  C  C     . LYS A 1 85  ? -13.535 43.805 4.306   1.00 124.97 ? 85  LYS Z C     1 
ATOM   647  O  O     . LYS A 1 85  ? -14.492 43.028 4.336   1.00 127.07 ? 85  LYS Z O     1 
ATOM   648  C  CB    . LYS A 1 85  ? -12.635 43.061 2.089   1.00 112.78 ? 85  LYS Z CB    1 
ATOM   649  C  CG    . LYS A 1 85  ? -12.173 43.418 0.682   1.00 102.98 ? 85  LYS Z CG    1 
ATOM   650  C  CD    . LYS A 1 85  ? -11.721 42.183 -0.083  1.00 95.67  ? 85  LYS Z CD    1 
ATOM   651  C  CE    . LYS A 1 85  ? -12.817 41.131 -0.139  1.00 103.81 ? 85  LYS Z CE    1 
ATOM   652  N  NZ    . LYS A 1 85  ? -12.364 39.885 -0.816  1.00 98.14  ? 85  LYS Z NZ    1 
ATOM   653  N  N     . LYS A 1 86  ? -12.954 44.292 5.402   1.00 118.20 ? 86  LYS Z N     1 
ATOM   654  C  CA    . LYS A 1 86  ? -13.347 43.882 6.751   1.00 121.49 ? 86  LYS Z CA    1 
ATOM   655  C  C     . LYS A 1 86  ? -14.838 44.088 6.996   1.00 129.55 ? 86  LYS Z C     1 
ATOM   656  O  O     . LYS A 1 86  ? -15.477 43.297 7.691   1.00 132.74 ? 86  LYS Z O     1 
ATOM   657  C  CB    . LYS A 1 86  ? -12.534 44.646 7.801   1.00 119.52 ? 86  LYS Z CB    1 
ATOM   658  C  CG    . LYS A 1 86  ? -12.790 44.197 9.233   1.00 126.04 ? 86  LYS Z CG    1 
ATOM   659  C  CD    . LYS A 1 86  ? -11.990 45.023 10.231  1.00 128.50 ? 86  LYS Z CD    1 
ATOM   660  C  CE    . LYS A 1 86  ? -12.277 44.593 11.664  1.00 132.35 ? 86  LYS Z CE    1 
ATOM   661  N  NZ    . LYS A 1 86  ? -11.533 45.412 12.662  1.00 135.53 ? 86  LYS Z NZ    1 
ATOM   662  N  N     . GLU A 1 87  ? -15.389 45.153 6.423   1.00 126.43 ? 87  GLU Z N     1 
ATOM   663  C  CA    . GLU A 1 87  ? -16.827 45.377 6.474   1.00 131.18 ? 87  GLU Z CA    1 
ATOM   664  C  C     . GLU A 1 87  ? -17.540 44.429 5.522   1.00 131.35 ? 87  GLU Z C     1 
ATOM   665  O  O     . GLU A 1 87  ? -18.483 43.739 5.915   1.00 134.95 ? 87  GLU Z O     1 
ATOM   666  C  CB    . GLU A 1 87  ? -17.172 46.825 6.124   1.00 132.39 ? 87  GLU Z CB    1 
ATOM   667  C  CG    . GLU A 1 87  ? -16.748 47.843 7.165   1.00 137.06 ? 87  GLU Z CG    1 
ATOM   668  C  CD    . GLU A 1 87  ? -17.425 49.186 6.969   1.00 141.83 ? 87  GLU Z CD    1 
ATOM   669  O  OE1   . GLU A 1 87  ? -18.205 49.322 6.001   1.00 141.99 ? 87  GLU Z OE1   1 
ATOM   670  O  OE2   . GLU A 1 87  ? -17.182 50.103 7.782   1.00 151.20 ? 87  GLU Z OE2   1 
ATOM   671  N  N     . VAL A 1 88  ? -17.067 44.399 4.277   1.00 130.75 ? 88  VAL Z N     1 
ATOM   672  C  CA    . VAL A 1 88  ? -17.679 43.606 3.213   1.00 131.93 ? 88  VAL Z CA    1 
ATOM   673  C  C     . VAL A 1 88  ? -17.938 42.171 3.654   1.00 135.60 ? 88  VAL Z C     1 
ATOM   674  O  O     . VAL A 1 88  ? -19.067 41.684 3.571   1.00 138.29 ? 88  VAL Z O     1 
ATOM   675  C  CB    . VAL A 1 88  ? -16.799 43.584 1.946   1.00 126.45 ? 88  VAL Z CB    1 
ATOM   676  C  CG1   . VAL A 1 88  ? -17.419 42.686 0.885   1.00 128.77 ? 88  VAL Z CG1   1 
ATOM   677  C  CG2   . VAL A 1 88  ? -16.599 44.994 1.412   1.00 121.31 ? 88  VAL Z CG2   1 
ATOM   678  N  N     . GLU A 1 89  ? -16.890 41.510 4.138   1.00 131.38 ? 89  GLU Z N     1 
ATOM   679  C  CA    . GLU A 1 89  ? -17.004 40.142 4.628   1.00 134.72 ? 89  GLU Z CA    1 
ATOM   680  C  C     . GLU A 1 89  ? -18.103 40.029 5.679   1.00 137.32 ? 89  GLU Z C     1 
ATOM   681  O  O     . GLU A 1 89  ? -18.960 39.147 5.600   1.00 142.20 ? 89  GLU Z O     1 
ATOM   682  C  CB    . GLU A 1 89  ? -15.668 39.663 5.202   1.00 131.55 ? 89  GLU Z CB    1 
ATOM   683  C  CG    . GLU A 1 89  ? -14.530 39.658 4.192   1.00 128.32 ? 89  GLU Z CG    1 
ATOM   684  C  CD    . GLU A 1 89  ? -14.784 38.717 3.025   1.00 132.60 ? 89  GLU Z CD    1 
ATOM   685  O  OE1   . GLU A 1 89  ? -14.337 39.033 1.901   1.00 126.83 ? 89  GLU Z OE1   1 
ATOM   686  O  OE2   . GLU A 1 89  ? -15.428 37.665 3.232   1.00 137.92 ? 89  GLU Z OE2   1 
ATOM   687  N  N     . ARG A 1 90  ? -18.088 40.938 6.650   1.00 132.77 ? 90  ARG Z N     1 
ATOM   688  C  CA    . ARG A 1 90  ? -19.113 40.946 7.685   1.00 136.05 ? 90  ARG Z CA    1 
ATOM   689  C  C     . ARG A 1 90  ? -20.478 41.223 7.063   1.00 137.76 ? 90  ARG Z C     1 
ATOM   690  O  O     . ARG A 1 90  ? -21.480 40.613 7.444   1.00 140.54 ? 90  ARG Z O     1 
ATOM   691  C  CB    . ARG A 1 90  ? -18.789 41.981 8.763   1.00 135.91 ? 90  ARG Z CB    1 
ATOM   692  C  CG    . ARG A 1 90  ? -19.815 42.060 9.883   1.00 137.10 ? 90  ARG Z CG    1 
ATOM   693  C  CD    . ARG A 1 90  ? -19.459 43.180 10.847  1.00 137.57 ? 90  ARG Z CD    1 
ATOM   694  N  NE    . ARG A 1 90  ? -18.920 44.331 10.129  1.00 135.08 ? 90  ARG Z NE    1 
ATOM   695  C  CZ    . ARG A 1 90  ? -19.663 45.248 9.520   1.00 133.89 ? 90  ARG Z CZ    1 
ATOM   696  N  NH1   . ARG A 1 90  ? -20.987 45.157 9.543   1.00 133.84 ? 90  ARG Z NH1   1 
ATOM   697  N  NH2   . ARG A 1 90  ? -19.079 46.253 8.884   1.00 133.60 ? 90  ARG Z NH2   1 
ATOM   698  N  N     . SER A 1 91  ? -20.503 42.126 6.084   1.00 136.89 ? 91  SER Z N     1 
ATOM   699  C  CA    . SER A 1 91  ? -21.732 42.444 5.363   1.00 138.76 ? 91  SER Z CA    1 
ATOM   700  C  C     . SER A 1 91  ? -22.253 41.201 4.650   1.00 140.97 ? 91  SER Z C     1 
ATOM   701  O  O     . SER A 1 91  ? -23.453 41.069 4.402   1.00 142.83 ? 91  SER Z O     1 
ATOM   702  C  CB    . SER A 1 91  ? -21.501 43.579 4.361   1.00 136.72 ? 91  SER Z CB    1 
ATOM   703  O  OG    . SER A 1 91  ? -21.053 44.757 5.012   1.00 136.69 ? 91  SER Z OG    1 
ATOM   704  N  N     . ARG A 1 92  ? -21.339 40.291 4.326   1.00 139.55 ? 92  ARG Z N     1 
ATOM   705  C  CA    . ARG A 1 92  ? -21.709 38.989 3.789   1.00 139.80 ? 92  ARG Z CA    1 
ATOM   706  C  C     . ARG A 1 92  ? -22.080 38.059 4.939   1.00 141.28 ? 92  ARG Z C     1 
ATOM   707  O  O     . ARG A 1 92  ? -23.096 37.358 4.886   1.00 142.86 ? 92  ARG Z O     1 
ATOM   708  C  CB    . ARG A 1 92  ? -20.564 38.393 2.966   1.00 145.21 ? 92  ARG Z CB    1 
ATOM   709  C  CG    . ARG A 1 92  ? -20.126 39.246 1.786   1.00 145.42 ? 92  ARG Z CG    1 
ATOM   710  C  CD    . ARG A 1 92  ? -18.767 38.803 1.261   1.00 145.35 ? 92  ARG Z CD    1 
ATOM   711  N  NE    . ARG A 1 92  ? -18.385 39.514 0.044   1.00 141.31 ? 92  ARG Z NE    1 
ATOM   712  C  CZ    . ARG A 1 92  ? -17.263 39.289 -0.632  1.00 136.28 ? 92  ARG Z CZ    1 
ATOM   713  N  NH1   . ARG A 1 92  ? -16.406 38.368 -0.209  1.00 137.01 ? 92  ARG Z NH1   1 
ATOM   714  N  NH2   . ARG A 1 92  ? -16.998 39.984 -1.730  1.00 126.02 ? 92  ARG Z NH2   1 
ATOM   715  N  N     . ARG A 1 93  ? -21.253 38.087 5.983   1.00 137.64 ? 93  ARG Z N     1 
ATOM   716  C  CA    . ARG A 1 93  ? -21.398 37.213 7.146   1.00 138.71 ? 93  ARG Z CA    1 
ATOM   717  C  C     . ARG A 1 93  ? -22.823 37.189 7.685   1.00 142.76 ? 93  ARG Z C     1 
ATOM   718  O  O     . ARG A 1 93  ? -23.447 36.127 7.770   1.00 144.49 ? 93  ARG Z O     1 
ATOM   719  C  CB    . ARG A 1 93  ? -20.438 37.652 8.254   1.00 138.88 ? 93  ARG Z CB    1 
ATOM   720  C  CG    . ARG A 1 93  ? -20.533 36.832 9.529   1.00 140.50 ? 93  ARG Z CG    1 
ATOM   721  C  CD    . ARG A 1 93  ? -20.033 37.629 10.724  1.00 141.93 ? 93  ARG Z CD    1 
ATOM   722  N  NE    . ARG A 1 93  ? -18.763 38.292 10.444  1.00 141.37 ? 93  ARG Z NE    1 
ATOM   723  C  CZ    . ARG A 1 93  ? -17.570 37.758 10.686  1.00 140.86 ? 93  ARG Z CZ    1 
ATOM   724  N  NH1   . ARG A 1 93  ? -17.478 36.546 11.217  1.00 141.48 ? 93  ARG Z NH1   1 
ATOM   725  N  NH2   . ARG A 1 93  ? -16.469 38.438 10.396  1.00 139.36 ? 93  ARG Z NH2   1 
ATOM   726  N  N     . GLU A 1 94  ? -23.327 38.369 8.033   1.00 141.89 ? 94  GLU Z N     1 
ATOM   727  C  CA    . GLU A 1 94  ? -24.681 38.522 8.553   1.00 144.06 ? 94  GLU Z CA    1 
ATOM   728  C  C     . GLU A 1 94  ? -25.701 37.817 7.671   1.00 144.54 ? 94  GLU Z C     1 
ATOM   729  O  O     . GLU A 1 94  ? -26.583 37.109 8.166   1.00 145.85 ? 94  GLU Z O     1 
ATOM   730  C  CB    . GLU A 1 94  ? -25.040 40.003 8.678   1.00 143.64 ? 94  GLU Z CB    1 
ATOM   731  C  CG    . GLU A 1 94  ? -24.032 40.823 9.462   1.00 144.09 ? 94  GLU Z CG    1 
ATOM   732  C  CD    . GLU A 1 94  ? -24.458 42.270 9.608   1.00 143.71 ? 94  GLU Z CD    1 
ATOM   733  O  OE1   . GLU A 1 94  ? -25.351 42.541 10.438  1.00 145.60 ? 94  GLU Z OE1   1 
ATOM   734  O  OE2   . GLU A 1 94  ? -23.908 43.132 8.890   1.00 140.31 ? 94  GLU Z OE2   1 
ATOM   735  N  N     . ARG A 1 95  ? -25.559 37.994 6.360   1.00 145.62 ? 95  ARG Z N     1 
ATOM   736  C  CA    . ARG A 1 95  ? -26.501 37.414 5.414   1.00 146.70 ? 95  ARG Z CA    1 
ATOM   737  C  C     . ARG A 1 95  ? -26.544 35.896 5.560   1.00 148.63 ? 95  ARG Z C     1 
ATOM   738  O  O     . ARG A 1 95  ? -27.626 35.302 5.562   1.00 150.08 ? 95  ARG Z O     1 
ATOM   739  C  CB    . ARG A 1 95  ? -26.138 37.816 3.986   1.00 144.08 ? 95  ARG Z CB    1 
ATOM   740  C  CG    . ARG A 1 95  ? -26.235 39.312 3.750   1.00 143.08 ? 95  ARG Z CG    1 
ATOM   741  C  CD    . ARG A 1 95  ? -25.916 39.677 2.316   1.00 142.67 ? 95  ARG Z CD    1 
ATOM   742  N  NE    . ARG A 1 95  ? -26.003 41.118 2.101   1.00 140.60 ? 95  ARG Z NE    1 
ATOM   743  C  CZ    . ARG A 1 95  ? -25.766 41.717 0.939   1.00 139.21 ? 95  ARG Z CZ    1 
ATOM   744  N  NH1   . ARG A 1 95  ? -25.869 43.035 0.838   1.00 137.59 ? 95  ARG Z NH1   1 
ATOM   745  N  NH2   . ARG A 1 95  ? -25.426 40.998 -0.123  1.00 138.91 ? 95  ARG Z NH2   1 
ATOM   746  N  N     . ARG A 1 96  ? -25.373 35.281 5.719   1.00 144.96 ? 96  ARG Z N     1 
ATOM   747  C  CA    . ARG A 1 96  ? -25.304 33.842 5.948   1.00 145.34 ? 96  ARG Z CA    1 
ATOM   748  C  C     . ARG A 1 96  ? -26.176 33.461 7.140   1.00 148.40 ? 96  ARG Z C     1 
ATOM   749  O  O     . ARG A 1 96  ? -26.976 32.524 7.057   1.00 150.79 ? 96  ARG Z O     1 
ATOM   750  C  CB    . ARG A 1 96  ? -23.860 33.386 6.177   1.00 142.36 ? 96  ARG Z CB    1 
ATOM   751  C  CG    . ARG A 1 96  ? -22.970 33.475 4.949   1.00 141.43 ? 96  ARG Z CG    1 
ATOM   752  C  CD    . ARG A 1 96  ? -21.654 32.738 5.161   1.00 135.52 ? 96  ARG Z CD    1 
ATOM   753  N  NE    . ARG A 1 96  ? -20.870 33.297 6.260   1.00 134.12 ? 96  ARG Z NE    1 
ATOM   754  C  CZ    . ARG A 1 96  ? -19.903 34.195 6.106   1.00 135.70 ? 96  ARG Z CZ    1 
ATOM   755  N  NH1   . ARG A 1 96  ? -19.596 34.640 4.895   1.00 138.37 ? 96  ARG Z NH1   1 
ATOM   756  N  NH2   . ARG A 1 96  ? -19.240 34.649 7.162   1.00 134.74 ? 96  ARG Z NH2   1 
ATOM   757  N  N     . GLN A 1 97  ? -26.040 34.216 8.229   1.00 146.01 ? 97  GLN Z N     1 
ATOM   758  C  CA    . GLN A 1 97  ? -26.815 33.961 9.438   1.00 147.96 ? 97  GLN Z CA    1 
ATOM   759  C  C     . GLN A 1 97  ? -28.304 33.958 9.115   1.00 150.75 ? 97  GLN Z C     1 
ATOM   760  O  O     . GLN A 1 97  ? -29.050 33.097 9.591   1.00 153.64 ? 97  GLN Z O     1 
ATOM   761  C  CB    . GLN A 1 97  ? -26.504 35.005 10.512  1.00 147.35 ? 97  GLN Z CB    1 
ATOM   762  C  CG    . GLN A 1 97  ? -25.024 35.145 10.834  1.00 145.74 ? 97  GLN Z CG    1 
ATOM   763  C  CD    . GLN A 1 97  ? -24.749 36.258 11.826  1.00 146.73 ? 97  GLN Z CD    1 
ATOM   764  O  OE1   . GLN A 1 97  ? -25.673 36.825 12.410  1.00 149.71 ? 97  GLN Z OE1   1 
ATOM   765  N  NE2   . GLN A 1 97  ? -23.474 36.580 12.019  1.00 144.60 ? 97  GLN Z NE2   1 
ATOM   766  N  N     . ALA A 1 98  ? -28.723 34.904 8.277   1.00 149.49 ? 98  ALA Z N     1 
ATOM   767  C  CA    . ALA A 1 98  ? -30.117 34.975 7.861   1.00 150.78 ? 98  ALA Z CA    1 
ATOM   768  C  C     . ALA A 1 98  ? -30.497 33.667 7.185   1.00 151.82 ? 98  ALA Z C     1 
ATOM   769  O  O     . ALA A 1 98  ? -31.458 33.005 7.586   1.00 156.03 ? 98  ALA Z O     1 
ATOM   770  C  CB    . ALA A 1 98  ? -30.348 36.156 6.932   1.00 148.50 ? 98  ALA Z CB    1 
ATOM   771  N  N     . ASN A 1 99  ? -29.695 33.269 6.201   1.00 151.03 ? 99  ASN Z N     1 
ATOM   772  C  CA    . ASN A 1 99  ? -29.955 32.044 5.455   1.00 152.57 ? 99  ASN Z CA    1 
ATOM   773  C  C     . ASN A 1 99  ? -29.848 30.802 6.332   1.00 154.82 ? 99  ASN Z C     1 
ATOM   774  O  O     . ASN A 1 99  ? -30.195 29.700 5.904   1.00 157.38 ? 99  ASN Z O     1 
ATOM   775  C  CB    . ASN A 1 99  ? -29.004 31.931 4.265   1.00 150.63 ? 99  ASN Z CB    1 
ATOM   776  C  CG    . ASN A 1 99  ? -29.331 32.921 3.165   1.00 148.79 ? 99  ASN Z CG    1 
ATOM   777  O  OD1   . ASN A 1 99  ? -29.994 33.932 3.400   1.00 147.82 ? 99  ASN Z OD1   1 
ATOM   778  N  ND2   . ASN A 1 99  ? -28.869 32.634 1.954   1.00 148.63 ? 99  ASN Z ND2   1 
ATOM   779  N  N     . LEU A 1 100 ? -29.361 30.982 7.556   1.00 152.14 ? 100 LEU Z N     1 
ATOM   780  C  CA    . LEU A 1 100 ? -29.450 29.927 8.550   1.00 154.03 ? 100 LEU Z CA    1 
ATOM   781  C  C     . LEU A 1 100 ? -30.826 30.003 9.196   1.00 159.40 ? 100 LEU Z C     1 
ATOM   782  O  O     . LEU A 1 100 ? -31.633 29.078 9.073   1.00 164.00 ? 100 LEU Z O     1 
ATOM   783  C  CB    . LEU A 1 100 ? -28.344 30.055 9.599   1.00 152.10 ? 100 LEU Z CB    1 
ATOM   784  C  CG    . LEU A 1 100 ? -28.441 29.116 10.801  1.00 152.14 ? 100 LEU Z CG    1 
ATOM   785  C  CD1   . LEU A 1 100 ? -28.374 27.663 10.359  1.00 149.78 ? 100 LEU Z CD1   1 
ATOM   786  C  CD2   . LEU A 1 100 ? -27.341 29.425 11.801  1.00 149.09 ? 100 LEU Z CD2   1 
ATOM   787  N  N     . LEU A 1 101 ? -31.098 31.135 9.843   1.00 157.08 ? 101 LEU Z N     1 
ATOM   788  C  CA    . LEU A 1 101 ? -32.331 31.324 10.605  1.00 159.07 ? 101 LEU Z CA    1 
ATOM   789  C  C     . LEU A 1 101 ? -33.565 31.149 9.733   1.00 163.28 ? 101 LEU Z C     1 
ATOM   790  O  O     . LEU A 1 101 ? -34.572 30.594 10.169  1.00 166.32 ? 101 LEU Z O     1 
ATOM   791  C  CB    . LEU A 1 101 ? -32.348 32.707 11.256  1.00 157.85 ? 101 LEU Z CB    1 
ATOM   792  C  CG    . LEU A 1 101 ? -31.202 33.014 12.220  1.00 157.14 ? 101 LEU Z CG    1 
ATOM   793  C  CD1   . LEU A 1 101 ? -31.392 34.382 12.856  1.00 156.61 ? 101 LEU Z CD1   1 
ATOM   794  C  CD2   . LEU A 1 101 ? -31.091 31.930 13.283  1.00 157.15 ? 101 LEU Z CD2   1 
ATOM   795  N  N     . LYS A 1 102 ? -33.478 31.632 8.499   1.00 161.36 ? 102 LYS Z N     1 
ATOM   796  C  CA    . LYS A 1 102 ? -34.537 31.432 7.523   1.00 162.36 ? 102 LYS Z CA    1 
ATOM   797  C  C     . LYS A 1 102 ? -34.567 29.971 7.088   1.00 166.80 ? 102 LYS Z C     1 
ATOM   798  O  O     . LYS A 1 102 ? -35.625 29.333 7.093   1.00 172.14 ? 102 LYS Z O     1 
ATOM   799  C  CB    . LYS A 1 102 ? -34.335 32.352 6.315   1.00 157.19 ? 102 LYS Z CB    1 
ATOM   800  C  CG    . LYS A 1 102 ? -35.359 32.179 5.206   1.00 158.11 ? 102 LYS Z CG    1 
ATOM   801  C  CD    . LYS A 1 102 ? -35.111 33.159 4.068   1.00 155.35 ? 102 LYS Z CD    1 
ATOM   802  C  CE    . LYS A 1 102 ? -36.136 32.987 2.958   1.00 150.30 ? 102 LYS Z CE    1 
ATOM   803  N  NZ    . LYS A 1 102 ? -35.937 33.971 1.857   1.00 145.02 ? 102 LYS Z NZ    1 
ATOM   804  N  N     . GLY A 1 103 ? -33.391 29.448 6.746   1.00 163.64 ? 103 GLY Z N     1 
ATOM   805  C  CA    . GLY A 1 103 ? -33.258 28.108 6.201   1.00 166.16 ? 103 GLY Z CA    1 
ATOM   806  C  C     . GLY A 1 103 ? -33.945 27.044 7.031   1.00 171.75 ? 103 GLY Z C     1 
ATOM   807  O  O     . GLY A 1 103 ? -34.799 26.312 6.527   1.00 175.72 ? 103 GLY Z O     1 
ATOM   808  N  N     . LYS A 1 104 ? -33.582 26.971 8.307   1.00 167.69 ? 104 LYS Z N     1 
ATOM   809  C  CA    . LYS A 1 104 ? -34.190 26.018 9.228   1.00 171.16 ? 104 LYS Z CA    1 
ATOM   810  C  C     . LYS A 1 104 ? -35.705 26.225 9.313   1.00 176.39 ? 104 LYS Z C     1 
ATOM   811  O  O     . LYS A 1 104 ? -36.470 25.257 9.354   1.00 181.62 ? 104 LYS Z O     1 
ATOM   812  C  CB    . LYS A 1 104 ? -33.547 26.130 10.615  1.00 166.87 ? 104 LYS Z CB    1 
ATOM   813  C  CG    . LYS A 1 104 ? -33.545 27.533 11.204  1.00 165.50 ? 104 LYS Z CG    1 
ATOM   814  C  CD    . LYS A 1 104 ? -32.258 27.806 11.964  1.00 160.39 ? 104 LYS Z CD    1 
ATOM   815  C  CE    . LYS A 1 104 ? -32.013 26.759 13.034  1.00 159.16 ? 104 LYS Z CE    1 
ATOM   816  N  NZ    . LYS A 1 104 ? -30.723 26.992 13.737  1.00 153.13 ? 104 LYS Z NZ    1 
ATOM   817  N  N     . GLN A 1 105 ? -36.137 27.484 9.313   1.00 171.09 ? 105 GLN Z N     1 
ATOM   818  C  CA    . GLN A 1 105 ? -37.563 27.784 9.360   1.00 174.74 ? 105 GLN Z CA    1 
ATOM   819  C  C     . GLN A 1 105 ? -38.242 27.332 8.072   1.00 178.82 ? 105 GLN Z C     1 
ATOM   820  O  O     . GLN A 1 105 ? -39.417 26.960 8.077   1.00 183.53 ? 105 GLN Z O     1 
ATOM   821  C  CB    . GLN A 1 105 ? -37.801 29.276 9.601   1.00 171.52 ? 105 GLN Z CB    1 
ATOM   822  C  CG    . GLN A 1 105 ? -37.505 29.732 11.023  1.00 170.91 ? 105 GLN Z CG    1 
ATOM   823  C  CD    . GLN A 1 105 ? -38.045 31.121 11.314  1.00 169.05 ? 105 GLN Z CD    1 
ATOM   824  O  OE1   . GLN A 1 105 ? -39.201 31.423 11.016  1.00 169.33 ? 105 GLN Z OE1   1 
ATOM   825  N  NE2   . GLN A 1 105 ? -37.208 31.975 11.894  1.00 167.32 ? 105 GLN Z NE2   1 
ATOM   826  N  N     . LEU A 1 106 ? -37.495 27.339 6.972   1.00 176.32 ? 106 LEU Z N     1 
ATOM   827  C  CA    . LEU A 1 106 ? -38.042 26.885 5.700   1.00 178.07 ? 106 LEU Z CA    1 
ATOM   828  C  C     . LEU A 1 106 ? -38.201 25.366 5.718   1.00 181.95 ? 106 LEU Z C     1 
ATOM   829  O  O     . LEU A 1 106 ? -38.919 24.798 4.892   1.00 184.81 ? 106 LEU Z O     1 
ATOM   830  C  CB    . LEU A 1 106 ? -37.157 27.325 4.530   1.00 175.63 ? 106 LEU Z CB    1 
ATOM   831  C  CG    . LEU A 1 106 ? -37.828 27.303 3.153   1.00 176.69 ? 106 LEU Z CG    1 
ATOM   832  C  CD1   . LEU A 1 106 ? -39.058 28.196 3.148   1.00 178.68 ? 106 LEU Z CD1   1 
ATOM   833  C  CD2   . LEU A 1 106 ? -36.860 27.728 2.064   1.00 174.53 ? 106 LEU Z CD2   1 
ATOM   834  N  N     . LEU A 1 107 ? -37.532 24.714 6.668   1.00 177.45 ? 107 LEU Z N     1 
ATOM   835  C  CA    . LEU A 1 107 ? -37.716 23.281 6.874   1.00 180.79 ? 107 LEU Z CA    1 
ATOM   836  C  C     . LEU A 1 107 ? -38.952 23.027 7.728   1.00 184.47 ? 107 LEU Z C     1 
ATOM   837  O  O     . LEU A 1 107 ? -39.498 21.923 7.737   1.00 186.36 ? 107 LEU Z O     1 
ATOM   838  C  CB    . LEU A 1 107 ? -36.482 22.656 7.528   1.00 179.47 ? 107 LEU Z CB    1 
ATOM   839  C  CG    . LEU A 1 107 ? -35.259 22.480 6.628   1.00 176.56 ? 107 LEU Z CG    1 
ATOM   840  C  CD1   . LEU A 1 107 ? -34.119 21.835 7.399   1.00 176.17 ? 107 LEU Z CD1   1 
ATOM   841  C  CD2   . LEU A 1 107 ? -35.616 21.656 5.399   1.00 178.72 ? 107 LEU Z CD2   1 
ATOM   842  N  N     . ARG A 1 108 ? -39.390 24.061 8.442   1.00 181.81 ? 108 ARG Z N     1 
ATOM   843  C  CA    . ARG A 1 108 ? -40.584 23.966 9.274   1.00 183.80 ? 108 ARG Z CA    1 
ATOM   844  C  C     . ARG A 1 108 ? -41.850 24.162 8.442   1.00 186.92 ? 108 ARG Z C     1 
ATOM   845  O  O     . ARG A 1 108 ? -42.963 23.982 8.937   1.00 190.19 ? 108 ARG Z O     1 
ATOM   846  C  CB    . ARG A 1 108 ? -40.530 24.990 10.411  1.00 182.24 ? 108 ARG Z CB    1 
ATOM   847  C  CG    . ARG A 1 108 ? -39.356 24.799 11.358  1.00 181.09 ? 108 ARG Z CG    1 
ATOM   848  C  CD    . ARG A 1 108 ? -39.412 25.771 12.525  1.00 180.24 ? 108 ARG Z CD    1 
ATOM   849  N  NE    . ARG A 1 108 ? -38.338 25.534 13.486  1.00 180.04 ? 108 ARG Z NE    1 
ATOM   850  C  CZ    . ARG A 1 108 ? -38.408 24.657 14.482  1.00 181.56 ? 108 ARG Z CZ    1 
ATOM   851  N  NH1   . ARG A 1 108 ? -39.502 23.927 14.650  1.00 182.96 ? 108 ARG Z NH1   1 
ATOM   852  N  NH2   . ARG A 1 108 ? -37.381 24.509 15.309  1.00 181.08 ? 108 ARG Z NH2   1 
ATOM   853  N  N     . GLU A 1 109 ? -41.670 24.529 7.176   1.00 185.66 ? 109 GLU Z N     1 
ATOM   854  C  CA    . GLU A 1 109 ? -42.791 24.701 6.258   1.00 186.80 ? 109 GLU Z CA    1 
ATOM   855  C  C     . GLU A 1 109 ? -42.816 23.593 5.207   1.00 186.70 ? 109 GLU Z C     1 
ATOM   856  O  O     . GLU A 1 109 ? -43.603 23.637 4.260   1.00 186.80 ? 109 GLU Z O     1 
ATOM   857  C  CB    . GLU A 1 109 ? -42.730 26.073 5.585   1.00 183.92 ? 109 GLU Z CB    1 
ATOM   858  C  CG    . GLU A 1 109 ? -42.916 27.238 6.545   1.00 183.50 ? 109 GLU Z CG    1 
ATOM   859  C  CD    . GLU A 1 109 ? -42.963 28.577 5.836   1.00 180.57 ? 109 GLU Z CD    1 
ATOM   860  O  OE1   . GLU A 1 109 ? -42.693 28.614 4.617   1.00 180.21 ? 109 GLU Z OE1   1 
ATOM   861  O  OE2   . GLU A 1 109 ? -43.273 29.591 6.497   1.00 178.11 ? 109 GLU Z OE2   1 
ATOM   862  N  N     . GLY A 1 110 ? -41.949 22.600 5.381   1.00 184.67 ? 110 GLY Z N     1 
ATOM   863  C  CA    . GLY A 1 110 ? -41.927 21.445 4.503   1.00 186.26 ? 110 GLY Z CA    1 
ATOM   864  C  C     . GLY A 1 110 ? -41.003 21.586 3.309   1.00 184.32 ? 110 GLY Z C     1 
ATOM   865  O  O     . GLY A 1 110 ? -40.443 20.599 2.833   1.00 184.57 ? 110 GLY Z O     1 
ATOM   866  N  N     . LYS A 1 111 ? -40.842 22.813 2.823   1.00 188.12 ? 111 LYS Z N     1 
ATOM   867  C  CA    . LYS A 1 111 ? -40.015 23.064 1.647   1.00 185.66 ? 111 LYS Z CA    1 
ATOM   868  C  C     . LYS A 1 111 ? -38.538 22.792 1.914   1.00 182.98 ? 111 LYS Z C     1 
ATOM   869  O  O     . LYS A 1 111 ? -37.786 23.693 2.289   1.00 180.02 ? 111 LYS Z O     1 
ATOM   870  C  CB    . LYS A 1 111 ? -40.197 24.502 1.158   1.00 183.46 ? 111 LYS Z CB    1 
ATOM   871  C  CG    . LYS A 1 111 ? -41.500 24.745 0.417   1.00 184.51 ? 111 LYS Z CG    1 
ATOM   872  C  CD    . LYS A 1 111 ? -41.527 26.132 -0.206  1.00 183.80 ? 111 LYS Z CD    1 
ATOM   873  C  CE    . LYS A 1 111 ? -42.762 26.325 -1.075  1.00 184.79 ? 111 LYS Z CE    1 
ATOM   874  N  NZ    . LYS A 1 111 ? -42.775 27.667 -1.725  1.00 182.29 ? 111 LYS Z NZ    1 
ATOM   875  N  N     . VAL A 1 112 ? -38.131 21.542 1.717   1.00 184.48 ? 112 VAL Z N     1 
ATOM   876  C  CA    . VAL A 1 112 ? -36.734 21.156 1.864   1.00 178.57 ? 112 VAL Z CA    1 
ATOM   877  C  C     . VAL A 1 112 ? -36.001 21.399 0.543   1.00 176.69 ? 112 VAL Z C     1 
ATOM   878  O  O     . VAL A 1 112 ? -34.785 21.596 0.517   1.00 171.75 ? 112 VAL Z O     1 
ATOM   879  C  CB    . VAL A 1 112 ? -36.601 19.674 2.302   1.00 174.81 ? 112 VAL Z CB    1 
ATOM   880  C  CG1   . VAL A 1 112 ? -37.202 18.743 1.256   1.00 169.73 ? 112 VAL Z CG1   1 
ATOM   881  C  CG2   . VAL A 1 112 ? -35.149 19.313 2.587   1.00 172.92 ? 112 VAL Z CG2   1 
ATOM   882  N  N     . SER A 1 113 ? -36.760 21.409 -0.549  1.00 178.55 ? 113 SER Z N     1 
ATOM   883  C  CA    . SER A 1 113 ? -36.206 21.642 -1.878  1.00 176.75 ? 113 SER Z CA    1 
ATOM   884  C  C     . SER A 1 113 ? -35.721 23.080 -2.033  1.00 177.83 ? 113 SER Z C     1 
ATOM   885  O  O     . SER A 1 113 ? -34.712 23.337 -2.691  1.00 174.19 ? 113 SER Z O     1 
ATOM   886  C  CB    . SER A 1 113 ? -37.246 21.320 -2.953  1.00 179.64 ? 113 SER Z CB    1 
ATOM   887  O  OG    . SER A 1 113 ? -36.730 21.556 -4.252  1.00 177.30 ? 113 SER Z OG    1 
ATOM   888  N  N     . GLU A 1 114 ? -36.449 24.015 -1.429  1.00 174.29 ? 114 GLU Z N     1 
ATOM   889  C  CA    . GLU A 1 114 ? -36.074 25.424 -1.478  1.00 176.29 ? 114 GLU Z CA    1 
ATOM   890  C  C     . GLU A 1 114 ? -35.144 25.780 -0.323  1.00 171.61 ? 114 GLU Z C     1 
ATOM   891  O  O     . GLU A 1 114 ? -34.451 26.798 -0.361  1.00 171.00 ? 114 GLU Z O     1 
ATOM   892  C  CB    . GLU A 1 114 ? -37.317 26.317 -1.454  1.00 184.99 ? 114 GLU Z CB    1 
ATOM   893  C  CG    . GLU A 1 114 ? -38.189 26.202 -2.697  1.00 189.83 ? 114 GLU Z CG    1 
ATOM   894  C  CD    . GLU A 1 114 ? -39.274 27.264 -2.754  1.00 199.41 ? 114 GLU Z CD    1 
ATOM   895  O  OE1   . GLU A 1 114 ? -39.385 28.057 -1.795  1.00 202.02 ? 114 GLU Z OE1   1 
ATOM   896  O  OE2   . GLU A 1 114 ? -40.014 27.305 -3.761  1.00 203.24 ? 114 GLU Z OE2   1 
ATOM   897  N  N     . ALA A 1 115 ? -35.131 24.932 0.702   1.00 180.57 ? 115 ALA Z N     1 
ATOM   898  C  CA    . ALA A 1 115 ? -34.215 25.102 1.824   1.00 175.28 ? 115 ALA Z CA    1 
ATOM   899  C  C     . ALA A 1 115 ? -32.806 24.695 1.414   1.00 167.58 ? 115 ALA Z C     1 
ATOM   900  O  O     . ALA A 1 115 ? -31.831 25.016 2.092   1.00 160.85 ? 115 ALA Z O     1 
ATOM   901  C  CB    . ALA A 1 115 ? -34.678 24.292 3.023   1.00 175.53 ? 115 ALA Z CB    1 
ATOM   902  N  N     . ARG A 1 116 ? -32.714 23.981 0.297   1.00 176.65 ? 116 ARG Z N     1 
ATOM   903  C  CA    . ARG A 1 116 ? -31.434 23.596 -0.283  1.00 170.80 ? 116 ARG Z CA    1 
ATOM   904  C  C     . ARG A 1 116 ? -30.606 24.835 -0.606  1.00 166.38 ? 116 ARG Z C     1 
ATOM   905  O  O     . ARG A 1 116 ? -29.457 24.964 -0.173  1.00 161.97 ? 116 ARG Z O     1 
ATOM   906  C  CB    . ARG A 1 116 ? -31.654 22.757 -1.545  1.00 172.77 ? 116 ARG Z CB    1 
ATOM   907  C  CG    . ARG A 1 116 ? -30.378 22.251 -2.198  1.00 170.70 ? 116 ARG Z CG    1 
ATOM   908  C  CD    . ARG A 1 116 ? -29.620 21.317 -1.272  1.00 168.61 ? 116 ARG Z CD    1 
ATOM   909  N  NE    . ARG A 1 116 ? -28.563 20.591 -1.971  1.00 170.46 ? 116 ARG Z NE    1 
ATOM   910  C  CZ    . ARG A 1 116 ? -28.725 19.396 -2.532  1.00 172.93 ? 116 ARG Z CZ    1 
ATOM   911  N  NH1   . ARG A 1 116 ? -27.709 18.805 -3.147  1.00 169.97 ? 116 ARG Z NH1   1 
ATOM   912  N  NH2   . ARG A 1 116 ? -29.903 18.791 -2.479  1.00 175.72 ? 116 ARG Z NH2   1 
ATOM   913  N  N     . GLU A 1 117 ? -31.206 25.748 -1.364  1.00 164.82 ? 117 GLU Z N     1 
ATOM   914  C  CA    . GLU A 1 117 ? -30.546 26.992 -1.737  1.00 162.11 ? 117 GLU Z CA    1 
ATOM   915  C  C     . GLU A 1 117 ? -30.292 27.875 -0.518  1.00 161.45 ? 117 GLU Z C     1 
ATOM   916  O  O     . GLU A 1 117 ? -29.352 28.669 -0.504  1.00 158.47 ? 117 GLU Z O     1 
ATOM   917  C  CB    . GLU A 1 117 ? -31.377 27.747 -2.777  1.00 167.14 ? 117 GLU Z CB    1 
ATOM   918  C  CG    . GLU A 1 117 ? -31.408 27.090 -4.156  1.00 165.88 ? 117 GLU Z CG    1 
ATOM   919  C  CD    . GLU A 1 117 ? -30.148 27.349 -4.971  1.00 161.10 ? 117 GLU Z CD    1 
ATOM   920  O  OE1   . GLU A 1 117 ? -30.269 27.886 -6.094  1.00 161.08 ? 117 GLU Z OE1   1 
ATOM   921  O  OE2   . GLU A 1 117 ? -29.040 27.014 -4.498  1.00 155.27 ? 117 GLU Z OE2   1 
ATOM   922  N  N     . CYS A 1 118 ? -31.129 27.730 0.505   1.00 159.90 ? 118 CYS Z N     1 
ATOM   923  C  CA    . CYS A 1 118 ? -30.969 28.496 1.738   1.00 160.01 ? 118 CYS Z CA    1 
ATOM   924  C  C     . CYS A 1 118 ? -29.735 28.053 2.519   1.00 151.15 ? 118 CYS Z C     1 
ATOM   925  O  O     . CYS A 1 118 ? -28.925 28.880 2.940   1.00 152.20 ? 118 CYS Z O     1 
ATOM   926  C  CB    . CYS A 1 118 ? -32.217 28.367 2.615   1.00 167.10 ? 118 CYS Z CB    1 
ATOM   927  S  SG    . CYS A 1 118 ? -33.659 29.263 1.994   1.00 181.03 ? 118 CYS Z SG    1 
ATOM   928  N  N     . PHE A 1 119 ? -29.599 26.745 2.713   1.00 157.70 ? 119 PHE Z N     1 
ATOM   929  C  CA    . PHE A 1 119 ? -28.485 26.202 3.481   1.00 152.18 ? 119 PHE Z CA    1 
ATOM   930  C  C     . PHE A 1 119 ? -27.182 26.212 2.684   1.00 143.19 ? 119 PHE Z C     1 
ATOM   931  O  O     . PHE A 1 119 ? -26.096 26.249 3.265   1.00 138.09 ? 119 PHE Z O     1 
ATOM   932  C  CB    . PHE A 1 119 ? -28.801 24.779 3.955   1.00 147.01 ? 119 PHE Z CB    1 
ATOM   933  C  CG    . PHE A 1 119 ? -29.733 24.723 5.136   1.00 154.49 ? 119 PHE Z CG    1 
ATOM   934  C  CD1   . PHE A 1 119 ? -29.264 24.962 6.416   1.00 157.02 ? 119 PHE Z CD1   1 
ATOM   935  C  CD2   . PHE A 1 119 ? -31.074 24.422 4.968   1.00 161.61 ? 119 PHE Z CD2   1 
ATOM   936  C  CE1   . PHE A 1 119 ? -30.113 24.909 7.506   1.00 167.04 ? 119 PHE Z CE1   1 
ATOM   937  C  CE2   . PHE A 1 119 ? -31.931 24.367 6.055   1.00 169.18 ? 119 PHE Z CE2   1 
ATOM   938  C  CZ    . PHE A 1 119 ? -31.448 24.610 7.326   1.00 172.55 ? 119 PHE Z CZ    1 
ATOM   939  N  N     . THR A 1 120 ? -27.285 26.188 1.357   1.00 149.76 ? 120 THR Z N     1 
ATOM   940  C  CA    . THR A 1 120 ? -26.087 26.198 0.521   1.00 144.24 ? 120 THR Z CA    1 
ATOM   941  C  C     . THR A 1 120 ? -25.546 27.617 0.348   1.00 144.49 ? 120 THR Z C     1 
ATOM   942  O  O     . THR A 1 120 ? -24.390 27.805 -0.031  1.00 140.04 ? 120 THR Z O     1 
ATOM   943  C  CB    . THR A 1 120 ? -26.347 25.578 -0.872  1.00 146.03 ? 120 THR Z CB    1 
ATOM   944  O  OG1   . THR A 1 120 ? -25.109 25.124 -1.432  1.00 139.87 ? 120 THR Z OG1   1 
ATOM   945  C  CG2   . THR A 1 120 ? -26.983 26.590 -1.814  1.00 152.83 ? 120 THR Z CG2   1 
ATOM   946  N  N     . ARG A 1 121 ? -26.382 28.611 0.630   1.00 138.70 ? 121 ARG Z N     1 
ATOM   947  C  CA    . ARG A 1 121 ? -25.955 30.005 0.569   1.00 141.67 ? 121 ARG Z CA    1 
ATOM   948  C  C     . ARG A 1 121 ? -25.746 30.560 1.972   1.00 145.93 ? 121 ARG Z C     1 
ATOM   949  O  O     . ARG A 1 121 ? -25.863 31.764 2.201   1.00 151.49 ? 121 ARG Z O     1 
ATOM   950  C  CB    . ARG A 1 121 ? -26.972 30.861 -0.193  1.00 148.60 ? 121 ARG Z CB    1 
ATOM   951  C  CG    . ARG A 1 121 ? -27.018 30.594 -1.688  1.00 149.25 ? 121 ARG Z CG    1 
ATOM   952  C  CD    . ARG A 1 121 ? -27.804 31.675 -2.421  1.00 156.26 ? 121 ARG Z CD    1 
ATOM   953  N  NE    . ARG A 1 121 ? -27.805 31.463 -3.866  1.00 157.54 ? 121 ARG Z NE    1 
ATOM   954  C  CZ    . ARG A 1 121 ? -28.801 30.899 -4.539  1.00 159.61 ? 121 ARG Z CZ    1 
ATOM   955  N  NH1   . ARG A 1 121 ? -29.892 30.497 -3.901  1.00 162.71 ? 121 ARG Z NH1   1 
ATOM   956  N  NH2   . ARG A 1 121 ? -28.710 30.742 -5.854  1.00 157.36 ? 121 ARG Z NH2   1 
ATOM   957  N  N     . SER A 1 122 ? -25.439 29.670 2.910   1.00 137.07 ? 122 SER Z N     1 
ATOM   958  C  CA    . SER A 1 122 ? -25.155 30.064 4.283   1.00 141.32 ? 122 SER Z CA    1 
ATOM   959  C  C     . SER A 1 122 ? -23.844 29.444 4.747   1.00 133.34 ? 122 SER Z C     1 
ATOM   960  O  O     . SER A 1 122 ? -23.456 29.576 5.907   1.00 136.71 ? 122 SER Z O     1 
ATOM   961  C  CB    . SER A 1 122 ? -26.296 29.648 5.214   1.00 148.70 ? 122 SER Z CB    1 
ATOM   962  O  OG    . SER A 1 122 ? -26.475 28.243 5.200   1.00 141.99 ? 122 SER Z OG    1 
ATOM   963  N  N     . ILE A 1 123 ? -23.166 28.770 3.824   1.00 138.62 ? 123 ILE Z N     1 
ATOM   964  C  CA    . ILE A 1 123 ? -21.927 28.064 4.126   1.00 128.48 ? 123 ILE Z CA    1 
ATOM   965  C  C     . ILE A 1 123 ? -20.804 29.012 4.531   1.00 128.37 ? 123 ILE Z C     1 
ATOM   966  O  O     . ILE A 1 123 ? -20.489 29.961 3.815   1.00 132.75 ? 123 ILE Z O     1 
ATOM   967  C  CB    . ILE A 1 123 ? -21.459 27.229 2.922   1.00 119.50 ? 123 ILE Z CB    1 
ATOM   968  C  CG1   . ILE A 1 123 ? -22.565 26.268 2.482   1.00 118.87 ? 123 ILE Z CG1   1 
ATOM   969  C  CG2   . ILE A 1 123 ? -20.187 26.472 3.261   1.00 109.71 ? 123 ILE Z CG2   1 
ATOM   970  C  CD1   . ILE A 1 123 ? -22.218 25.463 1.252   1.00 112.93 ? 123 ILE Z CD1   1 
ATOM   971  N  N     . ASN A 1 124 ? -20.204 28.745 5.686   1.00 114.95 ? 124 ASN Z N     1 
ATOM   972  C  CA    . ASN A 1 124 ? -19.079 29.538 6.162   1.00 114.30 ? 124 ASN Z CA    1 
ATOM   973  C  C     . ASN A 1 124 ? -17.853 28.670 6.414   1.00 102.67 ? 124 ASN Z C     1 
ATOM   974  O  O     . ASN A 1 124 ? -17.812 27.901 7.373   1.00 102.78 ? 124 ASN Z O     1 
ATOM   975  C  CB    . ASN A 1 124 ? -19.461 30.296 7.433   1.00 124.85 ? 124 ASN Z CB    1 
ATOM   976  C  CG    . ASN A 1 124 ? -18.269 30.952 8.099   1.00 127.19 ? 124 ASN Z CG    1 
ATOM   977  O  OD1   . ASN A 1 124 ? -17.756 30.458 9.104   1.00 127.33 ? 124 ASN Z OD1   1 
ATOM   978  N  ND2   . ASN A 1 124 ? -17.815 32.066 7.538   1.00 130.53 ? 124 ASN Z ND2   1 
ATOM   979  N  N     . ILE A 1 125 ? -16.858 28.798 5.541   1.00 102.74 ? 125 ILE Z N     1 
ATOM   980  C  CA    . ILE A 1 125 ? -15.634 28.009 5.640   1.00 100.22 ? 125 ILE Z CA    1 
ATOM   981  C  C     . ILE A 1 125 ? -14.735 28.529 6.753   1.00 100.67 ? 125 ILE Z C     1 
ATOM   982  O  O     . ILE A 1 125 ? -14.063 29.549 6.600   1.00 100.72 ? 125 ILE Z O     1 
ATOM   983  C  CB    . ILE A 1 125 ? -14.856 28.014 4.313   1.00 94.41  ? 125 ILE Z CB    1 
ATOM   984  C  CG1   . ILE A 1 125 ? -15.772 27.580 3.168   1.00 92.46  ? 125 ILE Z CG1   1 
ATOM   985  C  CG2   . ILE A 1 125 ? -13.632 27.111 4.403   1.00 91.69  ? 125 ILE Z CG2   1 
ATOM   986  C  CD1   . ILE A 1 125 ? -16.398 26.217 3.376   1.00 89.77  ? 125 ILE Z CD1   1 
ATOM   987  N  N     . THR A 1 126 ? -14.725 27.814 7.872   1.00 90.49  ? 126 THR Z N     1 
ATOM   988  C  CA    . THR A 1 126 ? -13.970 28.239 9.041   1.00 92.88  ? 126 THR Z CA    1 
ATOM   989  C  C     . THR A 1 126 ? -12.494 27.894 8.895   1.00 90.52  ? 126 THR Z C     1 
ATOM   990  O  O     . THR A 1 126 ? -12.097 27.221 7.945   1.00 86.79  ? 126 THR Z O     1 
ATOM   991  C  CB    . THR A 1 126 ? -14.519 27.591 10.321  1.00 95.34  ? 126 THR Z CB    1 
ATOM   992  O  OG1   . THR A 1 126 ? -14.123 26.215 10.372  1.00 91.18  ? 126 THR Z OG1   1 
ATOM   993  C  CG2   . THR A 1 126 ? -16.037 27.682 10.348  1.00 97.97  ? 126 THR Z CG2   1 
ATOM   994  N  N     . HIS A 1 127 ? -11.685 28.360 9.840   1.00 89.50  ? 127 HIS Z N     1 
ATOM   995  C  CA    . HIS A 1 127 ? -10.266 28.032 9.853   1.00 90.43  ? 127 HIS Z CA    1 
ATOM   996  C  C     . HIS A 1 127 ? -10.053 26.626 10.401  1.00 92.13  ? 127 HIS Z C     1 
ATOM   997  O  O     . HIS A 1 127 ? -9.027  26.000 10.143  1.00 94.11  ? 127 HIS Z O     1 
ATOM   998  C  CB    . HIS A 1 127 ? -9.481  29.050 10.683  1.00 94.21  ? 127 HIS Z CB    1 
ATOM   999  C  CG    . HIS A 1 127 ? -9.507  30.438 10.122  1.00 95.17  ? 127 HIS Z CG    1 
ATOM   1000 N  ND1   . HIS A 1 127 ? -8.777  30.805 9.012   1.00 92.96  ? 127 HIS Z ND1   1 
ATOM   1001 C  CD2   . HIS A 1 127 ? -10.168 31.550 10.521  1.00 98.16  ? 127 HIS Z CD2   1 
ATOM   1002 C  CE1   . HIS A 1 127 ? -8.992  32.082 8.748   1.00 92.35  ? 127 HIS Z CE1   1 
ATOM   1003 N  NE2   . HIS A 1 127 ? -9.831  32.557 9.650   1.00 96.55  ? 127 HIS Z NE2   1 
ATOM   1004 N  N     . ALA A 1 128 ? -11.029 26.138 11.160  1.00 89.50  ? 128 ALA Z N     1 
ATOM   1005 C  CA    . ALA A 1 128 ? -10.963 24.797 11.730  1.00 93.14  ? 128 ALA Z CA    1 
ATOM   1006 C  C     . ALA A 1 128 ? -11.070 23.743 10.636  1.00 87.20  ? 128 ALA Z C     1 
ATOM   1007 O  O     . ALA A 1 128 ? -10.255 22.824 10.568  1.00 85.93  ? 128 ALA Z O     1 
ATOM   1008 C  CB    . ALA A 1 128 ? -12.059 24.604 12.765  1.00 92.34  ? 128 ALA Z CB    1 
ATOM   1009 N  N     . MET A 1 129 ? -12.084 23.886 9.788   1.00 91.89  ? 129 MET Z N     1 
ATOM   1010 C  CA    . MET A 1 129 ? -12.276 23.010 8.638   1.00 91.50  ? 129 MET Z CA    1 
ATOM   1011 C  C     . MET A 1 129 ? -11.036 23.009 7.751   1.00 88.85  ? 129 MET Z C     1 
ATOM   1012 O  O     . MET A 1 129 ? -10.524 21.951 7.352   1.00 88.29  ? 129 MET Z O     1 
ATOM   1013 C  CB    . MET A 1 129 ? -13.497 23.459 7.834   1.00 87.77  ? 129 MET Z CB    1 
ATOM   1014 C  CG    . MET A 1 129 ? -14.777 23.557 8.649   1.00 86.94  ? 129 MET Z CG    1 
ATOM   1015 S  SD    . MET A 1 129 ? -16.032 24.583 7.857   1.00 89.28  ? 129 MET Z SD    1 
ATOM   1016 C  CE    . MET A 1 129 ? -16.182 23.768 6.269   1.00 88.24  ? 129 MET Z CE    1 
ATOM   1017 N  N     . ALA A 1 130 ? -10.557 24.214 7.458   1.00 84.58  ? 130 ALA Z N     1 
ATOM   1018 C  CA    . ALA A 1 130 ? -9.358  24.400 6.655   1.00 83.40  ? 130 ALA Z CA    1 
ATOM   1019 C  C     . ALA A 1 130 ? -8.171  23.678 7.277   1.00 86.65  ? 130 ALA Z C     1 
ATOM   1020 O  O     . ALA A 1 130 ? -7.378  23.059 6.573   1.00 86.24  ? 130 ALA Z O     1 
ATOM   1021 C  CB    . ALA A 1 130 ? -9.053  25.880 6.492   1.00 82.62  ? 130 ALA Z CB    1 
ATOM   1022 N  N     . HIS A 1 131 ? -8.061  23.745 8.599   1.00 84.18  ? 131 HIS Z N     1 
ATOM   1023 C  CA    . HIS A 1 131 ? -6.955  23.099 9.291   1.00 88.24  ? 131 HIS Z CA    1 
ATOM   1024 C  C     . HIS A 1 131 ? -7.089  21.581 9.256   1.00 86.62  ? 131 HIS Z C     1 
ATOM   1025 O  O     . HIS A 1 131 ? -6.087  20.868 9.193   1.00 85.76  ? 131 HIS Z O     1 
ATOM   1026 C  CB    . HIS A 1 131 ? -6.860  23.579 10.737  1.00 93.40  ? 131 HIS Z CB    1 
ATOM   1027 C  CG    . HIS A 1 131 ? -5.561  23.233 11.395  1.00 97.19  ? 131 HIS Z CG    1 
ATOM   1028 N  ND1   . HIS A 1 131 ? -5.357  22.043 12.059  1.00 100.06 ? 131 HIS Z ND1   1 
ATOM   1029 C  CD2   . HIS A 1 131 ? -4.393  23.913 11.473  1.00 99.09  ? 131 HIS Z CD2   1 
ATOM   1030 C  CE1   . HIS A 1 131 ? -4.122  22.008 12.527  1.00 106.61 ? 131 HIS Z CE1   1 
ATOM   1031 N  NE2   . HIS A 1 131 ? -3.515  23.131 12.184  1.00 103.08 ? 131 HIS Z NE2   1 
ATOM   1032 N  N     . LYS A 1 132 ? -8.325  21.091 9.302   1.00 89.14  ? 132 LYS Z N     1 
ATOM   1033 C  CA    . LYS A 1 132 ? -8.580  19.662 9.166   1.00 89.23  ? 132 LYS Z CA    1 
ATOM   1034 C  C     . LYS A 1 132 ? -8.071  19.198 7.808   1.00 86.15  ? 132 LYS Z C     1 
ATOM   1035 O  O     . LYS A 1 132 ? -7.393  18.168 7.701   1.00 85.36  ? 132 LYS Z O     1 
ATOM   1036 C  CB    . LYS A 1 132 ? -10.071 19.349 9.324   1.00 88.49  ? 132 LYS Z CB    1 
ATOM   1037 C  CG    . LYS A 1 132 ? -10.621 19.650 10.711  1.00 94.34  ? 132 LYS Z CG    1 
ATOM   1038 C  CD    . LYS A 1 132 ? -12.093 19.278 10.838  1.00 95.11  ? 132 LYS Z CD    1 
ATOM   1039 C  CE    . LYS A 1 132 ? -12.300 17.774 10.761  1.00 99.10  ? 132 LYS Z CE    1 
ATOM   1040 N  NZ    . LYS A 1 132 ? -13.730 17.393 10.941  1.00 102.02 ? 132 LYS Z NZ    1 
ATOM   1041 N  N     . VAL A 1 133 ? -8.388  19.979 6.777   1.00 90.21  ? 133 VAL Z N     1 
ATOM   1042 C  CA    . VAL A 1 133 ? -7.889  19.707 5.432   1.00 84.32  ? 133 VAL Z CA    1 
ATOM   1043 C  C     . VAL A 1 133 ? -6.359  19.750 5.395   1.00 87.70  ? 133 VAL Z C     1 
ATOM   1044 O  O     . VAL A 1 133 ? -5.723  18.928 4.735   1.00 88.16  ? 133 VAL Z O     1 
ATOM   1045 C  CB    . VAL A 1 133 ? -8.463  20.709 4.407   1.00 81.47  ? 133 VAL Z CB    1 
ATOM   1046 C  CG1   . VAL A 1 133 ? -7.817  20.519 3.042   1.00 70.66  ? 133 VAL Z CG1   1 
ATOM   1047 C  CG2   . VAL A 1 133 ? -9.972  20.558 4.309   1.00 81.97  ? 133 VAL Z CG2   1 
ATOM   1048 N  N     . ILE A 1 134 ? -5.777  20.702 6.120   1.00 82.27  ? 134 ILE Z N     1 
ATOM   1049 C  CA    . ILE A 1 134 ? -4.323  20.841 6.197   1.00 85.50  ? 134 ILE Z CA    1 
ATOM   1050 C  C     . ILE A 1 134 ? -3.665  19.592 6.777   1.00 90.18  ? 134 ILE Z C     1 
ATOM   1051 O  O     . ILE A 1 134 ? -2.688  19.088 6.224   1.00 88.27  ? 134 ILE Z O     1 
ATOM   1052 C  CB    . ILE A 1 134 ? -3.916  22.065 7.043   1.00 88.63  ? 134 ILE Z CB    1 
ATOM   1053 C  CG1   . ILE A 1 134 ? -4.250  23.358 6.299   1.00 83.88  ? 134 ILE Z CG1   1 
ATOM   1054 C  CG2   . ILE A 1 134 ? -2.432  22.024 7.372   1.00 91.90  ? 134 ILE Z CG2   1 
ATOM   1055 C  CD1   . ILE A 1 134 ? -3.847  24.618 7.033   1.00 87.31  ? 134 ILE Z CD1   1 
ATOM   1056 N  N     . LYS A 1 135 ? -4.199  19.099 7.891   1.00 89.77  ? 135 LYS Z N     1 
ATOM   1057 C  CA    . LYS A 1 135 ? -3.710  17.861 8.492   1.00 92.17  ? 135 LYS Z CA    1 
ATOM   1058 C  C     . LYS A 1 135 ? -3.863  16.695 7.520   1.00 91.09  ? 135 LYS Z C     1 
ATOM   1059 O  O     . LYS A 1 135 ? -2.941  15.891 7.345   1.00 92.81  ? 135 LYS Z O     1 
ATOM   1060 C  CB    . LYS A 1 135 ? -4.452  17.558 9.797   1.00 97.30  ? 135 LYS Z CB    1 
ATOM   1061 C  CG    . LYS A 1 135 ? -3.917  18.294 11.022  1.00 106.86 ? 135 LYS Z CG    1 
ATOM   1062 C  CD    . LYS A 1 135 ? -4.664  17.871 12.281  1.00 114.81 ? 135 LYS Z CD    1 
ATOM   1063 C  CE    . LYS A 1 135 ? -4.004  18.420 13.538  1.00 124.16 ? 135 LYS Z CE    1 
ATOM   1064 N  NZ    . LYS A 1 135 ? -2.612  17.908 13.708  1.00 132.38 ? 135 LYS Z NZ    1 
ATOM   1065 N  N     . ALA A 1 136 ? -5.028  16.622 6.881   1.00 95.63  ? 136 ALA Z N     1 
ATOM   1066 C  CA    . ALA A 1 136 ? -5.305  15.577 5.900   1.00 92.39  ? 136 ALA Z CA    1 
ATOM   1067 C  C     . ALA A 1 136 ? -4.313  15.610 4.740   1.00 91.16  ? 136 ALA Z C     1 
ATOM   1068 O  O     . ALA A 1 136 ? -4.034  14.584 4.122   1.00 91.96  ? 136 ALA Z O     1 
ATOM   1069 C  CB    . ALA A 1 136 ? -6.727  15.710 5.377   1.00 87.07  ? 136 ALA Z CB    1 
ATOM   1070 N  N     . ALA A 1 137 ? -3.785  16.795 4.449   1.00 93.08  ? 137 ALA Z N     1 
ATOM   1071 C  CA    . ALA A 1 137 ? -2.827  16.966 3.364   1.00 89.69  ? 137 ALA Z CA    1 
ATOM   1072 C  C     . ALA A 1 137 ? -1.410  16.619 3.812   1.00 94.37  ? 137 ALA Z C     1 
ATOM   1073 O  O     . ALA A 1 137 ? -0.650  15.997 3.070   1.00 94.96  ? 137 ALA Z O     1 
ATOM   1074 C  CB    . ALA A 1 137 ? -2.880  18.390 2.833   1.00 83.60  ? 137 ALA Z CB    1 
ATOM   1075 N  N     . ARG A 1 138 ? -1.059  17.028 5.027   1.00 91.64  ? 138 ARG Z N     1 
ATOM   1076 C  CA    . ARG A 1 138 ? 0.259   16.740 5.580   1.00 95.88  ? 138 ARG Z CA    1 
ATOM   1077 C  C     . ARG A 1 138 ? 0.448   15.246 5.784   1.00 96.30  ? 138 ARG Z C     1 
ATOM   1078 O  O     . ARG A 1 138 ? 1.557   14.730 5.646   1.00 97.15  ? 138 ARG Z O     1 
ATOM   1079 C  CB    . ARG A 1 138 ? 0.469   17.477 6.904   1.00 99.00  ? 138 ARG Z CB    1 
ATOM   1080 C  CG    . ARG A 1 138 ? 0.652   18.974 6.761   1.00 100.17 ? 138 ARG Z CG    1 
ATOM   1081 C  CD    . ARG A 1 138 ? 1.641   19.492 7.791   1.00 108.38 ? 138 ARG Z CD    1 
ATOM   1082 N  NE    . ARG A 1 138 ? 1.758   20.946 7.757   1.00 108.02 ? 138 ARG Z NE    1 
ATOM   1083 C  CZ    . ARG A 1 138 ? 1.120   21.763 8.586   1.00 110.56 ? 138 ARG Z CZ    1 
ATOM   1084 N  NH1   . ARG A 1 138 ? 0.320   21.268 9.522   1.00 113.08 ? 138 ARG Z NH1   1 
ATOM   1085 N  NH2   . ARG A 1 138 ? 1.285   23.074 8.484   1.00 106.58 ? 138 ARG Z NH2   1 
ATOM   1086 N  N     . SER A 1 139 ? -0.639  14.555 6.115   1.00 103.45 ? 139 SER Z N     1 
ATOM   1087 C  CA    . SER A 1 139 ? -0.590  13.106 6.280   1.00 107.56 ? 139 SER Z CA    1 
ATOM   1088 C  C     . SER A 1 139 ? -0.207  12.417 4.969   1.00 105.97 ? 139 SER Z C     1 
ATOM   1089 O  O     . SER A 1 139 ? 0.319   11.306 4.972   1.00 110.70 ? 139 SER Z O     1 
ATOM   1090 C  CB    . SER A 1 139 ? -1.932  12.574 6.789   1.00 106.86 ? 139 SER Z CB    1 
ATOM   1091 O  OG    . SER A 1 139 ? -2.987  12.913 5.907   1.00 103.64 ? 139 SER Z OG    1 
ATOM   1092 N  N     . GLN A 1 140 ? -0.469  13.091 3.853   1.00 107.84 ? 140 GLN Z N     1 
ATOM   1093 C  CA    . GLN A 1 140 ? -0.118  12.578 2.532   1.00 103.53 ? 140 GLN Z CA    1 
ATOM   1094 C  C     . GLN A 1 140 ? 1.157   13.225 1.997   1.00 103.97 ? 140 GLN Z C     1 
ATOM   1095 O  O     . GLN A 1 140 ? 1.488   13.081 0.819   1.00 101.37 ? 140 GLN Z O     1 
ATOM   1096 C  CB    . GLN A 1 140 ? -1.268  12.805 1.548   1.00 99.51  ? 140 GLN Z CB    1 
ATOM   1097 C  CG    . GLN A 1 140 ? -2.492  11.953 1.818   1.00 100.14 ? 140 GLN Z CG    1 
ATOM   1098 C  CD    . GLN A 1 140 ? -2.357  10.547 1.272   1.00 100.16 ? 140 GLN Z CD    1 
ATOM   1099 O  OE1   . GLN A 1 140 ? -1.770  10.336 0.210   1.00 95.83  ? 140 GLN Z OE1   1 
ATOM   1100 N  NE2   . GLN A 1 140 ? -2.899  9.576  1.996   1.00 106.08 ? 140 GLN Z NE2   1 
ATOM   1101 N  N     . GLY A 1 141 ? 1.865   13.943 2.863   1.00 103.14 ? 141 GLY Z N     1 
ATOM   1102 C  CA    . GLY A 1 141 ? 3.115   14.580 2.488   1.00 102.65 ? 141 GLY Z CA    1 
ATOM   1103 C  C     . GLY A 1 141 ? 2.958   15.729 1.508   1.00 98.36  ? 141 GLY Z C     1 
ATOM   1104 O  O     . GLY A 1 141 ? 3.830   15.962 0.671   1.00 94.50  ? 141 GLY Z O     1 
ATOM   1105 N  N     . VAL A 1 142 ? 1.848   16.451 1.614   1.00 97.13  ? 142 VAL Z N     1 
ATOM   1106 C  CA    . VAL A 1 142 ? 1.594   17.593 0.743   1.00 90.33  ? 142 VAL Z CA    1 
ATOM   1107 C  C     . VAL A 1 142 ? 1.786   18.911 1.489   1.00 93.70  ? 142 VAL Z C     1 
ATOM   1108 O  O     . VAL A 1 142 ? 1.122   19.168 2.493   1.00 96.80  ? 142 VAL Z O     1 
ATOM   1109 C  CB    . VAL A 1 142 ? 0.174   17.544 0.156   1.00 85.64  ? 142 VAL Z CB    1 
ATOM   1110 C  CG1   . VAL A 1 142 ? -0.086  18.769 -0.706  1.00 79.41  ? 142 VAL Z CG1   1 
ATOM   1111 C  CG2   . VAL A 1 142 ? -0.021  16.268 -0.645  1.00 84.49  ? 142 VAL Z CG2   1 
ATOM   1112 N  N     . ASP A 1 143 ? 2.697   19.742 0.989   1.00 90.36  ? 143 ASP Z N     1 
ATOM   1113 C  CA    . ASP A 1 143 ? 3.019   21.013 1.631   1.00 86.47  ? 143 ASP Z CA    1 
ATOM   1114 C  C     . ASP A 1 143 ? 1.837   21.974 1.619   1.00 87.57  ? 143 ASP Z C     1 
ATOM   1115 O  O     . ASP A 1 143 ? 1.112   22.073 0.629   1.00 87.22  ? 143 ASP Z O     1 
ATOM   1116 C  CB    . ASP A 1 143 ? 4.227   21.666 0.955   1.00 88.44  ? 143 ASP Z CB    1 
ATOM   1117 C  CG    . ASP A 1 143 ? 5.515   20.901 1.195   1.00 93.20  ? 143 ASP Z CG    1 
ATOM   1118 O  OD1   . ASP A 1 143 ? 5.606   20.193 2.221   1.00 92.36  ? 143 ASP Z OD1   1 
ATOM   1119 O  OD2   . ASP A 1 143 ? 6.436   21.008 0.357   1.00 98.17  ? 143 ASP Z OD2   1 
ATOM   1120 N  N     . CYS A 1 144 ? 1.653   22.680 2.729   1.00 87.17  ? 144 CYS Z N     1 
ATOM   1121 C  CA    . CYS A 1 144 ? 0.575   23.652 2.858   1.00 84.74  ? 144 CYS Z CA    1 
ATOM   1122 C  C     . CYS A 1 144 ? 1.126   25.022 3.229   1.00 84.49  ? 144 CYS Z C     1 
ATOM   1123 O  O     . CYS A 1 144 ? 2.268   25.141 3.671   1.00 89.34  ? 144 CYS Z O     1 
ATOM   1124 C  CB    . CYS A 1 144 ? -0.440  23.191 3.904   1.00 85.86  ? 144 CYS Z CB    1 
ATOM   1125 S  SG    . CYS A 1 144 ? -1.280  21.648 3.488   1.00 88.16  ? 144 CYS Z SG    1 
ATOM   1126 N  N     . LEU A 1 145 ? 0.307   26.053 3.052   1.00 76.19  ? 145 LEU Z N     1 
ATOM   1127 C  CA    . LEU A 1 145 ? 0.737   27.416 3.326   1.00 77.37  ? 145 LEU Z CA    1 
ATOM   1128 C  C     . LEU A 1 145 ? -0.451  28.347 3.524   1.00 78.15  ? 145 LEU Z C     1 
ATOM   1129 O  O     . LEU A 1 145 ? -1.186  28.640 2.583   1.00 78.76  ? 145 LEU Z O     1 
ATOM   1130 C  CB    . LEU A 1 145 ? 1.622   27.934 2.190   1.00 79.00  ? 145 LEU Z CB    1 
ATOM   1131 C  CG    . LEU A 1 145 ? 2.180   29.352 2.330   1.00 79.08  ? 145 LEU Z CG    1 
ATOM   1132 C  CD1   . LEU A 1 145 ? 3.139   29.430 3.500   1.00 85.47  ? 145 LEU Z CD1   1 
ATOM   1133 C  CD2   . LEU A 1 145 ? 2.866   29.787 1.044   1.00 81.10  ? 145 LEU Z CD2   1 
ATOM   1134 N  N     . VAL A 1 146 ? -0.637  28.807 4.756   1.00 76.58  ? 146 VAL Z N     1 
ATOM   1135 C  CA    . VAL A 1 146 ? -1.679  29.778 5.050   1.00 75.23  ? 146 VAL Z CA    1 
ATOM   1136 C  C     . VAL A 1 146 ? -1.171  31.183 4.755   1.00 74.53  ? 146 VAL Z C     1 
ATOM   1137 O  O     . VAL A 1 146 ? -0.203  31.641 5.360   1.00 77.77  ? 146 VAL Z O     1 
ATOM   1138 C  CB    . VAL A 1 146 ? -2.142  29.696 6.515   1.00 75.92  ? 146 VAL Z CB    1 
ATOM   1139 C  CG1   . VAL A 1 146 ? -3.180  30.772 6.803   1.00 75.55  ? 146 VAL Z CG1   1 
ATOM   1140 C  CG2   . VAL A 1 146 ? -2.698  28.313 6.819   1.00 75.43  ? 146 VAL Z CG2   1 
ATOM   1141 N  N     . ALA A 1 147 ? -1.823  31.855 3.813   1.00 70.71  ? 147 ALA Z N     1 
ATOM   1142 C  CA    . ALA A 1 147 ? -1.450  33.211 3.434   1.00 71.78  ? 147 ALA Z CA    1 
ATOM   1143 C  C     . ALA A 1 147 ? -1.585  34.172 4.610   1.00 73.01  ? 147 ALA Z C     1 
ATOM   1144 O  O     . ALA A 1 147 ? -2.441  33.980 5.476   1.00 72.67  ? 147 ALA Z O     1 
ATOM   1145 C  CB    . ALA A 1 147 ? -2.303  33.685 2.267   1.00 71.24  ? 147 ALA Z CB    1 
ATOM   1146 N  N     . PRO A 1 148 ? -0.729  35.205 4.650   1.00 71.35  ? 148 PRO Z N     1 
ATOM   1147 C  CA    . PRO A 1 148 ? -0.841  36.275 5.646   1.00 72.60  ? 148 PRO Z CA    1 
ATOM   1148 C  C     . PRO A 1 148 ? -2.223  36.912 5.617   1.00 72.43  ? 148 PRO Z C     1 
ATOM   1149 O  O     . PRO A 1 148 ? -2.793  37.221 6.663   1.00 72.93  ? 148 PRO Z O     1 
ATOM   1150 C  CB    . PRO A 1 148 ? 0.231   37.274 5.208   1.00 73.79  ? 148 PRO Z CB    1 
ATOM   1151 C  CG    . PRO A 1 148 ? 1.235   36.448 4.499   1.00 73.35  ? 148 PRO Z CG    1 
ATOM   1152 C  CD    . PRO A 1 148 ? 0.460   35.370 3.797   1.00 71.76  ? 148 PRO Z CD    1 
ATOM   1153 N  N     . TYR A 1 149 ? -2.753  37.097 4.413   1.00 73.43  ? 149 TYR Z N     1 
ATOM   1154 C  CA    . TYR A 1 149 ? -4.089  37.646 4.235   1.00 74.13  ? 149 TYR Z CA    1 
ATOM   1155 C  C     . TYR A 1 149 ? -4.827  36.888 3.138   1.00 71.14  ? 149 TYR Z C     1 
ATOM   1156 O  O     . TYR A 1 149 ? -5.082  35.692 3.272   1.00 70.13  ? 149 TYR Z O     1 
ATOM   1157 C  CB    . TYR A 1 149 ? -4.017  39.138 3.914   1.00 74.20  ? 149 TYR Z CB    1 
ATOM   1158 C  CG    . TYR A 1 149 ? -3.422  39.953 5.038   1.00 80.82  ? 149 TYR Z CG    1 
ATOM   1159 C  CD1   . TYR A 1 149 ? -4.213  40.396 6.091   1.00 84.32  ? 149 TYR Z CD1   1 
ATOM   1160 C  CD2   . TYR A 1 149 ? -2.070  40.271 5.054   1.00 80.15  ? 149 TYR Z CD2   1 
ATOM   1161 C  CE1   . TYR A 1 149 ? -3.678  41.137 7.124   1.00 82.21  ? 149 TYR Z CE1   1 
ATOM   1162 C  CE2   . TYR A 1 149 ? -1.525  41.012 6.085   1.00 81.75  ? 149 TYR Z CE2   1 
ATOM   1163 C  CZ    . TYR A 1 149 ? -2.334  41.442 7.117   1.00 84.76  ? 149 TYR Z CZ    1 
ATOM   1164 O  OH    . TYR A 1 149 ? -1.796  42.183 8.146   1.00 89.66  ? 149 TYR Z OH    1 
ATOM   1165 N  N     . GLU A 1 150 ? -5.165  37.579 2.055   1.00 74.66  ? 150 GLU Z N     1 
ATOM   1166 C  CA    . GLU A 1 150 ? -5.845  36.937 0.934   1.00 73.75  ? 150 GLU Z CA    1 
ATOM   1167 C  C     . GLU A 1 150 ? -4.934  35.938 0.229   1.00 69.57  ? 150 GLU Z C     1 
ATOM   1168 O  O     . GLU A 1 150 ? -3.745  36.193 0.036   1.00 68.02  ? 150 GLU Z O     1 
ATOM   1169 C  CB    . GLU A 1 150 ? -6.347  37.983 -0.062  1.00 69.46  ? 150 GLU Z CB    1 
ATOM   1170 C  CG    . GLU A 1 150 ? -7.543  38.775 0.427   1.00 73.30  ? 150 GLU Z CG    1 
ATOM   1171 C  CD    . GLU A 1 150 ? -7.955  39.866 -0.540  1.00 78.93  ? 150 GLU Z CD    1 
ATOM   1172 O  OE1   . GLU A 1 150 ? -7.158  40.193 -1.445  1.00 79.43  ? 150 GLU Z OE1   1 
ATOM   1173 O  OE2   . GLU A 1 150 ? -9.078  40.392 -0.395  1.00 83.06  ? 150 GLU Z OE2   1 
ATOM   1174 N  N     . ALA A 1 151 ? -5.501  34.798 -0.148  1.00 74.18  ? 151 ALA Z N     1 
ATOM   1175 C  CA    . ALA A 1 151 ? -4.737  33.742 -0.796  1.00 72.28  ? 151 ALA Z CA    1 
ATOM   1176 C  C     . ALA A 1 151 ? -4.364  34.107 -2.232  1.00 72.80  ? 151 ALA Z C     1 
ATOM   1177 O  O     . ALA A 1 151 ? -3.409  33.567 -2.779  1.00 70.85  ? 151 ALA Z O     1 
ATOM   1178 C  CB    . ALA A 1 151 ? -5.518  32.435 -0.767  1.00 70.16  ? 151 ALA Z CB    1 
ATOM   1179 N  N     . ASP A 1 152 ? -5.117  35.023 -2.835  1.00 73.27  ? 152 ASP Z N     1 
ATOM   1180 C  CA    . ASP A 1 152 ? -4.864  35.454 -4.210  1.00 75.26  ? 152 ASP Z CA    1 
ATOM   1181 C  C     . ASP A 1 152 ? -3.462  36.023 -4.386  1.00 74.60  ? 152 ASP Z C     1 
ATOM   1182 O  O     . ASP A 1 152 ? -2.732  35.635 -5.303  1.00 75.09  ? 152 ASP Z O     1 
ATOM   1183 C  CB    . ASP A 1 152 ? -5.889  36.505 -4.644  1.00 75.90  ? 152 ASP Z CB    1 
ATOM   1184 C  CG    . ASP A 1 152 ? -7.285  35.935 -4.796  1.00 82.32  ? 152 ASP Z CG    1 
ATOM   1185 O  OD1   . ASP A 1 152 ? -7.410  34.712 -5.022  1.00 79.49  ? 152 ASP Z OD1   1 
ATOM   1186 O  OD2   . ASP A 1 152 ? -8.256  36.716 -4.697  1.00 90.23  ? 152 ASP Z OD2   1 
ATOM   1187 N  N     . ALA A 1 153 ? -3.099  36.953 -3.508  1.00 73.50  ? 153 ALA Z N     1 
ATOM   1188 C  CA    . ALA A 1 153 ? -1.798  37.603 -3.570  1.00 73.36  ? 153 ALA Z CA    1 
ATOM   1189 C  C     . ALA A 1 153 ? -0.683  36.596 -3.322  1.00 73.21  ? 153 ALA Z C     1 
ATOM   1190 O  O     . ALA A 1 153 ? 0.351   36.622 -3.995  1.00 70.37  ? 153 ALA Z O     1 
ATOM   1191 C  CB    . ALA A 1 153 ? -1.726  38.741 -2.563  1.00 72.73  ? 153 ALA Z CB    1 
ATOM   1192 N  N     . GLN A 1 154 ? -0.905  35.712 -2.353  1.00 68.88  ? 154 GLN Z N     1 
ATOM   1193 C  CA    . GLN A 1 154 ? 0.059   34.671 -2.021  1.00 68.87  ? 154 GLN Z CA    1 
ATOM   1194 C  C     . GLN A 1 154 ? 0.336   33.757 -3.212  1.00 68.26  ? 154 GLN Z C     1 
ATOM   1195 O  O     . GLN A 1 154 ? 1.490   33.457 -3.529  1.00 68.42  ? 154 GLN Z O     1 
ATOM   1196 C  CB    . GLN A 1 154 ? -0.442  33.841 -0.841  1.00 68.52  ? 154 GLN Z CB    1 
ATOM   1197 C  CG    . GLN A 1 154 ? 0.534   32.776 -0.395  1.00 68.55  ? 154 GLN Z CG    1 
ATOM   1198 C  CD    . GLN A 1 154 ? 1.844   33.365 0.082   1.00 70.17  ? 154 GLN Z CD    1 
ATOM   1199 O  OE1   . GLN A 1 154 ? 1.862   34.257 0.930   1.00 70.80  ? 154 GLN Z OE1   1 
ATOM   1200 N  NE2   . GLN A 1 154 ? 2.950   32.880 -0.473  1.00 71.54  ? 154 GLN Z NE2   1 
ATOM   1201 N  N     . LEU A 1 155 ? -0.737  33.316 -3.861  1.00 70.42  ? 155 LEU Z N     1 
ATOM   1202 C  CA    . LEU A 1 155 ? -0.639  32.465 -5.039  1.00 69.62  ? 155 LEU Z CA    1 
ATOM   1203 C  C     . LEU A 1 155 ? 0.097   33.191 -6.155  1.00 70.04  ? 155 LEU Z C     1 
ATOM   1204 O  O     . LEU A 1 155 ? 0.990   32.629 -6.796  1.00 70.08  ? 155 LEU Z O     1 
ATOM   1205 C  CB    . LEU A 1 155 ? -2.029  32.043 -5.516  1.00 68.51  ? 155 LEU Z CB    1 
ATOM   1206 C  CG    . LEU A 1 155 ? -2.833  31.089 -4.634  1.00 67.84  ? 155 LEU Z CG    1 
ATOM   1207 C  CD1   . LEU A 1 155 ? -4.300  31.164 -5.007  1.00 68.80  ? 155 LEU Z CD1   1 
ATOM   1208 C  CD2   . LEU A 1 155 ? -2.324  29.672 -4.781  1.00 67.31  ? 155 LEU Z CD2   1 
ATOM   1209 N  N     . ALA A 1 156 ? -0.288  34.445 -6.376  1.00 73.23  ? 156 ALA Z N     1 
ATOM   1210 C  CA    . ALA A 1 156 ? 0.358   35.283 -7.380  1.00 71.48  ? 156 ALA Z CA    1 
ATOM   1211 C  C     . ALA A 1 156 ? 1.859   35.364 -7.140  1.00 73.60  ? 156 ALA Z C     1 
ATOM   1212 O  O     . ALA A 1 156 ? 2.648   35.300 -8.082  1.00 73.85  ? 156 ALA Z O     1 
ATOM   1213 C  CB    . ALA A 1 156 ? -0.251  36.671 -7.385  1.00 71.36  ? 156 ALA Z CB    1 
ATOM   1214 N  N     . TYR A 1 157 ? 2.253   35.488 -5.876  1.00 74.02  ? 157 TYR Z N     1 
ATOM   1215 C  CA    . TYR A 1 157 ? 3.671   35.529 -5.547  1.00 75.13  ? 157 TYR Z CA    1 
ATOM   1216 C  C     . TYR A 1 157 ? 4.336   34.193 -5.840  1.00 75.85  ? 157 TYR Z C     1 
ATOM   1217 O  O     . TYR A 1 157 ? 5.399   34.151 -6.456  1.00 76.31  ? 157 TYR Z O     1 
ATOM   1218 C  CB    . TYR A 1 157 ? 3.899   35.904 -4.081  1.00 72.82  ? 157 TYR Z CB    1 
ATOM   1219 C  CG    . TYR A 1 157 ? 5.351   35.768 -3.680  1.00 74.22  ? 157 TYR Z CG    1 
ATOM   1220 C  CD1   . TYR A 1 157 ? 6.285   36.728 -4.051  1.00 78.97  ? 157 TYR Z CD1   1 
ATOM   1221 C  CD2   . TYR A 1 157 ? 5.794   34.668 -2.956  1.00 74.50  ? 157 TYR Z CD2   1 
ATOM   1222 C  CE1   . TYR A 1 157 ? 7.617   36.603 -3.702  1.00 80.54  ? 157 TYR Z CE1   1 
ATOM   1223 C  CE2   . TYR A 1 157 ? 7.125   34.535 -2.602  1.00 80.32  ? 157 TYR Z CE2   1 
ATOM   1224 C  CZ    . TYR A 1 157 ? 8.030   35.506 -2.978  1.00 83.24  ? 157 TYR Z CZ    1 
ATOM   1225 O  OH    . TYR A 1 157 ? 9.353   35.380 -2.628  1.00 88.97  ? 157 TYR Z OH    1 
ATOM   1226 N  N     . LEU A 1 158 ? 3.711   33.106 -5.392  1.00 75.40  ? 158 LEU Z N     1 
ATOM   1227 C  CA    . LEU A 1 158 ? 4.256   31.769 -5.609  1.00 76.30  ? 158 LEU Z CA    1 
ATOM   1228 C  C     . LEU A 1 158 ? 4.469   31.483 -7.091  1.00 74.88  ? 158 LEU Z C     1 
ATOM   1229 O  O     . LEU A 1 158 ? 5.387   30.752 -7.465  1.00 77.96  ? 158 LEU Z O     1 
ATOM   1230 C  CB    . LEU A 1 158 ? 3.340   30.703 -5.007  1.00 74.04  ? 158 LEU Z CB    1 
ATOM   1231 C  CG    . LEU A 1 158 ? 3.216   30.667 -3.484  1.00 74.77  ? 158 LEU Z CG    1 
ATOM   1232 C  CD1   . LEU A 1 158 ? 2.403   29.457 -3.051  1.00 74.04  ? 158 LEU Z CD1   1 
ATOM   1233 C  CD2   . LEU A 1 158 ? 4.588   30.659 -2.829  1.00 75.78  ? 158 LEU Z CD2   1 
ATOM   1234 N  N     . ASN A 1 159 ? 3.623   32.065 -7.935  1.00 76.41  ? 159 ASN Z N     1 
ATOM   1235 C  CA    . ASN A 1 159 ? 3.746   31.859 -9.371  1.00 78.35  ? 159 ASN Z CA    1 
ATOM   1236 C  C     . ASN A 1 159 ? 4.764   32.798 -10.014 1.00 78.57  ? 159 ASN Z C     1 
ATOM   1237 O  O     . ASN A 1 159 ? 5.481   32.404 -10.933 1.00 77.51  ? 159 ASN Z O     1 
ATOM   1238 C  CB    . ASN A 1 159 ? 2.387   32.020 -10.048 1.00 73.64  ? 159 ASN Z CB    1 
ATOM   1239 C  CG    . ASN A 1 159 ? 2.422   31.635 -11.513 1.00 76.05  ? 159 ASN Z CG    1 
ATOM   1240 O  OD1   . ASN A 1 159 ? 2.042   32.417 -12.382 1.00 77.92  ? 159 ASN Z OD1   1 
ATOM   1241 N  ND2   . ASN A 1 159 ? 2.891   30.425 -11.793 1.00 74.59  ? 159 ASN Z ND2   1 
ATOM   1242 N  N     . LYS A 1 160 ? 4.834   34.032 -9.527  1.00 77.76  ? 160 LYS Z N     1 
ATOM   1243 C  CA    . LYS A 1 160 ? 5.763   35.016 -10.077 1.00 77.45  ? 160 LYS Z CA    1 
ATOM   1244 C  C     . LYS A 1 160 ? 7.189   34.810 -9.575  1.00 79.18  ? 160 LYS Z C     1 
ATOM   1245 O  O     . LYS A 1 160 ? 8.123   35.435 -10.075 1.00 79.90  ? 160 LYS Z O     1 
ATOM   1246 C  CB    . LYS A 1 160 ? 5.297   36.436 -9.744  1.00 77.82  ? 160 LYS Z CB    1 
ATOM   1247 C  CG    . LYS A 1 160 ? 4.014   36.846 -10.445 1.00 80.25  ? 160 LYS Z CG    1 
ATOM   1248 C  CD    . LYS A 1 160 ? 3.499   38.178 -9.925  1.00 78.01  ? 160 LYS Z CD    1 
ATOM   1249 C  CE    . LYS A 1 160 ? 4.441   39.314 -10.278 1.00 82.39  ? 160 LYS Z CE    1 
ATOM   1250 N  NZ    . LYS A 1 160 ? 3.863   40.632 -9.901  1.00 84.02  ? 160 LYS Z NZ    1 
ATOM   1251 N  N     . ALA A 1 161 ? 7.356   33.937 -8.587  1.00 76.28  ? 161 ALA Z N     1 
ATOM   1252 C  CA    . ALA A 1 161 ? 8.676   33.678 -8.025  1.00 77.71  ? 161 ALA Z CA    1 
ATOM   1253 C  C     . ALA A 1 161 ? 9.310   32.448 -8.661  1.00 79.39  ? 161 ALA Z C     1 
ATOM   1254 O  O     . ALA A 1 161 ? 10.500  32.186 -8.479  1.00 80.33  ? 161 ALA Z O     1 
ATOM   1255 C  CB    . ALA A 1 161 ? 8.587   33.508 -6.518  1.00 79.81  ? 161 ALA Z CB    1 
ATOM   1256 N  N     . GLY A 1 162 ? 8.509   31.695 -9.406  1.00 79.07  ? 162 GLY Z N     1 
ATOM   1257 C  CA    . GLY A 1 162 ? 8.989   30.489 -10.050 1.00 76.10  ? 162 GLY Z CA    1 
ATOM   1258 C  C     . GLY A 1 162 ? 8.840   29.268 -9.165  1.00 78.49  ? 162 GLY Z C     1 
ATOM   1259 O  O     . GLY A 1 162 ? 9.249   28.170 -9.541  1.00 78.64  ? 162 GLY Z O     1 
ATOM   1260 N  N     . ILE A 1 163 ? 8.255   29.459 -7.985  1.00 81.14  ? 163 ILE Z N     1 
ATOM   1261 C  CA    . ILE A 1 163 ? 8.040   28.357 -7.053  1.00 79.34  ? 163 ILE Z CA    1 
ATOM   1262 C  C     . ILE A 1 163 ? 7.016   27.374 -7.617  1.00 78.34  ? 163 ILE Z C     1 
ATOM   1263 O  O     . ILE A 1 163 ? 7.162   26.161 -7.472  1.00 78.47  ? 163 ILE Z O     1 
ATOM   1264 C  CB    . ILE A 1 163 ? 7.574   28.862 -5.672  1.00 80.43  ? 163 ILE Z CB    1 
ATOM   1265 C  CG1   . ILE A 1 163 ? 8.561   29.891 -5.121  1.00 81.23  ? 163 ILE Z CG1   1 
ATOM   1266 C  CG2   . ILE A 1 163 ? 7.429   27.704 -4.696  1.00 78.90  ? 163 ILE Z CG2   1 
ATOM   1267 C  CD1   . ILE A 1 163 ? 8.198   30.414 -3.748  1.00 80.65  ? 163 ILE Z CD1   1 
ATOM   1268 N  N     . VAL A 1 164 ? 5.981   27.906 -8.262  1.00 82.99  ? 164 VAL Z N     1 
ATOM   1269 C  CA    . VAL A 1 164 ? 5.007   27.080 -8.968  1.00 80.54  ? 164 VAL Z CA    1 
ATOM   1270 C  C     . VAL A 1 164 ? 4.863   27.572 -10.405 1.00 78.21  ? 164 VAL Z C     1 
ATOM   1271 O  O     . VAL A 1 164 ? 5.153   28.731 -10.703 1.00 78.34  ? 164 VAL Z O     1 
ATOM   1272 C  CB    . VAL A 1 164 ? 3.624   27.089 -8.277  1.00 78.15  ? 164 VAL Z CB    1 
ATOM   1273 C  CG1   . VAL A 1 164 ? 3.748   26.646 -6.826  1.00 78.99  ? 164 VAL Z CG1   1 
ATOM   1274 C  CG2   . VAL A 1 164 ? 2.985   28.466 -8.365  1.00 76.18  ? 164 VAL Z CG2   1 
ATOM   1275 N  N     . GLN A 1 165 ? 4.418   26.689 -11.294 1.00 81.44  ? 165 GLN Z N     1 
ATOM   1276 C  CA    . GLN A 1 165 ? 4.292   27.034 -12.707 1.00 83.25  ? 165 GLN Z CA    1 
ATOM   1277 C  C     . GLN A 1 165 ? 2.864   27.423 -13.078 1.00 80.41  ? 165 GLN Z C     1 
ATOM   1278 O  O     . GLN A 1 165 ? 2.648   28.203 -14.008 1.00 78.83  ? 165 GLN Z O     1 
ATOM   1279 C  CB    . GLN A 1 165 ? 4.762   25.872 -13.589 1.00 85.85  ? 165 GLN Z CB    1 
ATOM   1280 C  CG    . GLN A 1 165 ? 6.274   25.795 -13.770 1.00 87.16  ? 165 GLN Z CG    1 
ATOM   1281 C  CD    . GLN A 1 165 ? 7.013   25.514 -12.472 1.00 89.12  ? 165 GLN Z CD    1 
ATOM   1282 O  OE1   . GLN A 1 165 ? 6.532   24.768 -11.618 1.00 88.34  ? 165 GLN Z OE1   1 
ATOM   1283 N  NE2   . GLN A 1 165 ? 8.184   26.120 -12.317 1.00 89.89  ? 165 GLN Z NE2   1 
ATOM   1284 N  N     . ALA A 1 166 ? 1.892   26.879 -12.352 1.00 76.73  ? 166 ALA Z N     1 
ATOM   1285 C  CA    . ALA A 1 166 ? 0.486   27.174 -12.612 1.00 76.89  ? 166 ALA Z CA    1 
ATOM   1286 C  C     . ALA A 1 166 ? -0.304  27.289 -11.313 1.00 74.01  ? 166 ALA Z C     1 
ATOM   1287 O  O     . ALA A 1 166 ? 0.169   26.882 -10.253 1.00 73.65  ? 166 ALA Z O     1 
ATOM   1288 C  CB    . ALA A 1 166 ? -0.125  26.107 -13.509 1.00 75.68  ? 166 ALA Z CB    1 
ATOM   1289 N  N     . ILE A 1 167 ? -1.508  27.846 -11.400 1.00 74.29  ? 167 ILE Z N     1 
ATOM   1290 C  CA    . ILE A 1 167 ? -2.357  28.011 -10.227 1.00 71.52  ? 167 ILE Z CA    1 
ATOM   1291 C  C     . ILE A 1 167 ? -3.780  27.530 -10.478 1.00 72.93  ? 167 ILE Z C     1 
ATOM   1292 O  O     . ILE A 1 167 ? -4.457  28.015 -11.385 1.00 74.65  ? 167 ILE Z O     1 
ATOM   1293 C  CB    . ILE A 1 167 ? -2.414  29.478 -9.774  1.00 73.00  ? 167 ILE Z CB    1 
ATOM   1294 C  CG1   . ILE A 1 167 ? -1.042  29.941 -9.288  1.00 75.07  ? 167 ILE Z CG1   1 
ATOM   1295 C  CG2   . ILE A 1 167 ? -3.446  29.660 -8.666  1.00 74.29  ? 167 ILE Z CG2   1 
ATOM   1296 C  CD1   . ILE A 1 167 ? -0.991  31.405 -8.972  1.00 76.54  ? 167 ILE Z CD1   1 
ATOM   1297 N  N     . ILE A 1 168 ? -4.229  26.581 -9.664  1.00 72.13  ? 168 ILE Z N     1 
ATOM   1298 C  CA    . ILE A 1 168 ? -5.589  26.069 -9.761  1.00 73.86  ? 168 ILE Z CA    1 
ATOM   1299 C  C     . ILE A 1 168 ? -6.541  26.869 -8.880  1.00 77.47  ? 168 ILE Z C     1 
ATOM   1300 O  O     . ILE A 1 168 ? -6.372  26.924 -7.662  1.00 78.02  ? 168 ILE Z O     1 
ATOM   1301 C  CB    . ILE A 1 168 ? -5.656  24.586 -9.366  1.00 76.23  ? 168 ILE Z CB    1 
ATOM   1302 C  CG1   . ILE A 1 168 ? -4.741  23.761 -10.274 1.00 75.62  ? 168 ILE Z CG1   1 
ATOM   1303 C  CG2   . ILE A 1 168 ? -7.090  24.083 -9.426  1.00 75.85  ? 168 ILE Z CG2   1 
ATOM   1304 C  CD1   . ILE A 1 168 ? -4.627  22.308 -9.873  1.00 76.64  ? 168 ILE Z CD1   1 
ATOM   1305 N  N     . THR A 1 169 ? -7.538  27.488 -9.507  1.00 78.49  ? 169 THR Z N     1 
ATOM   1306 C  CA    . THR A 1 169 ? -8.506  28.312 -8.793  1.00 80.37  ? 169 THR Z CA    1 
ATOM   1307 C  C     . THR A 1 169 ? -9.774  28.531 -9.616  1.00 81.52  ? 169 THR Z C     1 
ATOM   1308 O  O     . THR A 1 169 ? -9.881  28.062 -10.749 1.00 81.85  ? 169 THR Z O     1 
ATOM   1309 C  CB    . THR A 1 169 ? -7.909  29.685 -8.417  1.00 80.61  ? 169 THR Z CB    1 
ATOM   1310 O  OG1   . THR A 1 169 ? -8.887  30.461 -7.713  1.00 86.32  ? 169 THR Z OG1   1 
ATOM   1311 C  CG2   . THR A 1 169 ? -7.472  30.440 -9.663  1.00 81.72  ? 169 THR Z CG2   1 
ATOM   1312 N  N     . GLU A 1 170 ? -10.733 29.240 -9.029  1.00 86.16  ? 170 GLU Z N     1 
ATOM   1313 C  CA    . GLU A 1 170 ? -11.967 29.599 -9.717  1.00 85.84  ? 170 GLU Z CA    1 
ATOM   1314 C  C     . GLU A 1 170 ? -12.083 31.113 -9.796  1.00 89.14  ? 170 GLU Z C     1 
ATOM   1315 O  O     . GLU A 1 170 ? -12.931 31.650 -10.509 1.00 95.84  ? 170 GLU Z O     1 
ATOM   1316 C  CB    . GLU A 1 170 ? -13.184 29.016 -8.998  1.00 86.42  ? 170 GLU Z CB    1 
ATOM   1317 C  CG    . GLU A 1 170 ? -13.156 27.507 -8.841  1.00 88.49  ? 170 GLU Z CG    1 
ATOM   1318 C  CD    . GLU A 1 170 ? -13.371 26.776 -10.150 1.00 90.14  ? 170 GLU Z CD    1 
ATOM   1319 O  OE1   . GLU A 1 170 ? -13.892 27.392 -11.105 1.00 89.07  ? 170 GLU Z OE1   1 
ATOM   1320 O  OE2   . GLU A 1 170 ? -13.018 25.580 -10.221 1.00 89.63  ? 170 GLU Z OE2   1 
ATOM   1321 N  N     . ASP A 1 171 ? -11.223 31.794 -9.047  1.00 92.28  ? 171 ASP Z N     1 
ATOM   1322 C  CA    . ASP A 1 171 ? -11.233 33.248 -8.993  1.00 92.48  ? 171 ASP Z CA    1 
ATOM   1323 C  C     . ASP A 1 171 ? -10.394 33.824 -10.128 1.00 90.01  ? 171 ASP Z C     1 
ATOM   1324 O  O     . ASP A 1 171 ? -9.240  33.437 -10.317 1.00 87.97  ? 171 ASP Z O     1 
ATOM   1325 C  CB    . ASP A 1 171 ? -10.714 33.736 -7.639  1.00 94.05  ? 171 ASP Z CB    1 
ATOM   1326 C  CG    . ASP A 1 171 ? -11.240 35.109 -7.274  1.00 97.37  ? 171 ASP Z CG    1 
ATOM   1327 O  OD1   . ASP A 1 171 ? -11.774 35.798 -8.169  1.00 97.42  ? 171 ASP Z OD1   1 
ATOM   1328 O  OD2   . ASP A 1 171 ? -11.120 35.500 -6.094  1.00 100.14 ? 171 ASP Z OD2   1 
ATOM   1329 N  N     . SER A 1 172 ? -10.983 34.745 -10.885 1.00 94.63  ? 172 SER Z N     1 
ATOM   1330 C  CA    . SER A 1 172 ? -10.307 35.357 -12.023 1.00 90.64  ? 172 SER Z CA    1 
ATOM   1331 C  C     . SER A 1 172 ? -9.376  36.484 -11.579 1.00 89.24  ? 172 SER Z C     1 
ATOM   1332 O  O     . SER A 1 172 ? -8.514  36.932 -12.342 1.00 87.91  ? 172 SER Z O     1 
ATOM   1333 C  CB    . SER A 1 172 ? -11.333 35.886 -13.027 1.00 90.51  ? 172 SER Z CB    1 
ATOM   1334 O  OG    . SER A 1 172 ? -12.166 36.865 -12.430 1.00 93.66  ? 172 SER Z OG    1 
ATOM   1335 N  N     . ASP A 1 173 ? -9.555  36.926 -10.336 1.00 86.61  ? 173 ASP Z N     1 
ATOM   1336 C  CA    . ASP A 1 173 ? -8.752  37.996 -9.752  1.00 86.48  ? 173 ASP Z CA    1 
ATOM   1337 C  C     . ASP A 1 173 ? -7.258  37.726 -9.835  1.00 85.06  ? 173 ASP Z C     1 
ATOM   1338 O  O     . ASP A 1 173 ? -6.456  38.658 -9.866  1.00 86.21  ? 173 ASP Z O     1 
ATOM   1339 C  CB    . ASP A 1 173 ? -9.149  38.212 -8.289  1.00 90.77  ? 173 ASP Z CB    1 
ATOM   1340 C  CG    . ASP A 1 173 ? -10.580 38.684 -8.136  1.00 91.89  ? 173 ASP Z CG    1 
ATOM   1341 O  OD1   . ASP A 1 173 ? -10.902 39.264 -7.077  1.00 92.51  ? 173 ASP Z OD1   1 
ATOM   1342 O  OD2   . ASP A 1 173 ? -11.375 38.478 -9.078  1.00 91.64  ? 173 ASP Z OD2   1 
ATOM   1343 N  N     . LEU A 1 174 ? -6.895  36.447 -9.866  1.00 78.27  ? 174 LEU Z N     1 
ATOM   1344 C  CA    . LEU A 1 174 ? -5.500  36.040 -9.969  1.00 78.40  ? 174 LEU Z CA    1 
ATOM   1345 C  C     . LEU A 1 174 ? -4.821  36.713 -11.155 1.00 79.79  ? 174 LEU Z C     1 
ATOM   1346 O  O     . LEU A 1 174 ? -3.642  37.063 -11.087 1.00 80.77  ? 174 LEU Z O     1 
ATOM   1347 C  CB    . LEU A 1 174 ? -5.386  34.515 -10.091 1.00 80.30  ? 174 LEU Z CB    1 
ATOM   1348 C  CG    . LEU A 1 174 ? -5.401  33.693 -8.797  1.00 76.94  ? 174 LEU Z CG    1 
ATOM   1349 C  CD1   . LEU A 1 174 ? -4.301  34.160 -7.854  1.00 78.09  ? 174 LEU Z CD1   1 
ATOM   1350 C  CD2   . LEU A 1 174 ? -6.761  33.750 -8.110  1.00 79.84  ? 174 LEU Z CD2   1 
ATOM   1351 N  N     . LEU A 1 175 ? -5.575  36.910 -12.233 1.00 78.48  ? 175 LEU Z N     1 
ATOM   1352 C  CA    . LEU A 1 175 ? -5.028  37.533 -13.432 1.00 76.05  ? 175 LEU Z CA    1 
ATOM   1353 C  C     . LEU A 1 175 ? -4.634  38.983 -13.179 1.00 76.32  ? 175 LEU Z C     1 
ATOM   1354 O  O     . LEU A 1 175 ? -3.619  39.456 -13.687 1.00 76.77  ? 175 LEU Z O     1 
ATOM   1355 C  CB    . LEU A 1 175 ? -6.033  37.452 -14.579 1.00 78.69  ? 175 LEU Z CB    1 
ATOM   1356 C  CG    . LEU A 1 175 ? -6.303  36.040 -15.099 1.00 78.51  ? 175 LEU Z CG    1 
ATOM   1357 C  CD1   . LEU A 1 175 ? -7.429  36.054 -16.114 1.00 71.08  ? 175 LEU Z CD1   1 
ATOM   1358 C  CD2   . LEU A 1 175 ? -5.041  35.439 -15.703 1.00 75.78  ? 175 LEU Z CD2   1 
ATOM   1359 N  N     . ALA A 1 176 ? -5.433  39.683 -12.381 1.00 73.50  ? 176 ALA Z N     1 
ATOM   1360 C  CA    . ALA A 1 176 ? -5.168  41.083 -12.079 1.00 71.54  ? 176 ALA Z CA    1 
ATOM   1361 C  C     . ALA A 1 176 ? -3.979  41.230 -11.134 1.00 73.59  ? 176 ALA Z C     1 
ATOM   1362 O  O     . ALA A 1 176 ? -3.407  42.312 -11.004 1.00 75.40  ? 176 ALA Z O     1 
ATOM   1363 C  CB    . ALA A 1 176 ? -6.402  41.737 -11.485 1.00 70.24  ? 176 ALA Z CB    1 
ATOM   1364 N  N     . PHE A 1 177 ? -3.610  40.136 -10.475 1.00 76.22  ? 177 PHE Z N     1 
ATOM   1365 C  CA    . PHE A 1 177 ? -2.472  40.141 -9.563  1.00 77.47  ? 177 PHE Z CA    1 
ATOM   1366 C  C     . PHE A 1 177 ? -1.166  39.876 -10.305 1.00 75.95  ? 177 PHE Z C     1 
ATOM   1367 O  O     . PHE A 1 177 ? -0.086  39.920 -9.717  1.00 79.42  ? 177 PHE Z O     1 
ATOM   1368 C  CB    . PHE A 1 177 ? -2.668  39.108 -8.451  1.00 74.96  ? 177 PHE Z CB    1 
ATOM   1369 C  CG    . PHE A 1 177 ? -3.543  39.586 -7.327  1.00 73.53  ? 177 PHE Z CG    1 
ATOM   1370 C  CD1   . PHE A 1 177 ? -2.998  40.262 -6.248  1.00 74.75  ? 177 PHE Z CD1   1 
ATOM   1371 C  CD2   . PHE A 1 177 ? -4.909  39.363 -7.349  1.00 71.69  ? 177 PHE Z CD2   1 
ATOM   1372 C  CE1   . PHE A 1 177 ? -3.803  40.705 -5.209  1.00 73.02  ? 177 PHE Z CE1   1 
ATOM   1373 C  CE2   . PHE A 1 177 ? -5.718  39.804 -6.316  1.00 74.38  ? 177 PHE Z CE2   1 
ATOM   1374 C  CZ    . PHE A 1 177 ? -5.164  40.475 -5.244  1.00 73.00  ? 177 PHE Z CZ    1 
ATOM   1375 N  N     . GLY A 1 178 ? -1.268  39.602 -11.601 1.00 78.15  ? 178 GLY Z N     1 
ATOM   1376 C  CA    . GLY A 1 178 ? -0.092  39.399 -12.425 1.00 79.88  ? 178 GLY Z CA    1 
ATOM   1377 C  C     . GLY A 1 178 ? 0.340   37.949 -12.520 1.00 80.50  ? 178 GLY Z C     1 
ATOM   1378 O  O     . GLY A 1 178 ? 1.526   37.658 -12.664 1.00 83.46  ? 178 GLY Z O     1 
ATOM   1379 N  N     . CYS A 1 179 ? -0.624  37.038 -12.436 1.00 79.28  ? 179 CYS Z N     1 
ATOM   1380 C  CA    . CYS A 1 179 ? -0.343  35.614 -12.589 1.00 80.40  ? 179 CYS Z CA    1 
ATOM   1381 C  C     . CYS A 1 179 ? 0.072   35.269 -14.012 1.00 78.91  ? 179 CYS Z C     1 
ATOM   1382 O  O     . CYS A 1 179 ? -0.378  35.897 -14.970 1.00 80.61  ? 179 CYS Z O     1 
ATOM   1383 C  CB    . CYS A 1 179 ? -1.562  34.780 -12.195 1.00 78.51  ? 179 CYS Z CB    1 
ATOM   1384 S  SG    . CYS A 1 179 ? -1.768  34.554 -10.414 1.00 100.36 ? 179 CYS Z SG    1 
ATOM   1385 N  N     . LYS A 1 180 ? 0.923   34.256 -14.141 1.00 79.56  ? 180 LYS Z N     1 
ATOM   1386 C  CA    . LYS A 1 180 ? 1.400   33.811 -15.445 1.00 80.56  ? 180 LYS Z CA    1 
ATOM   1387 C  C     . LYS A 1 180 ? 0.465   32.767 -16.043 1.00 76.76  ? 180 LYS Z C     1 
ATOM   1388 O  O     . LYS A 1 180 ? 0.002   32.911 -17.172 1.00 79.39  ? 180 LYS Z O     1 
ATOM   1389 C  CB    . LYS A 1 180 ? 2.820   33.248 -15.337 1.00 80.13  ? 180 LYS Z CB    1 
ATOM   1390 C  CG    . LYS A 1 180 ? 3.927   34.263 -15.604 1.00 85.51  ? 180 LYS Z CG    1 
ATOM   1391 C  CD    . LYS A 1 180 ? 3.772   35.519 -14.760 1.00 84.04  ? 180 LYS Z CD    1 
ATOM   1392 C  CE    . LYS A 1 180 ? 4.772   36.586 -15.171 1.00 87.77  ? 180 LYS Z CE    1 
ATOM   1393 N  NZ    . LYS A 1 180 ? 4.522   37.877 -14.474 1.00 90.16  ? 180 LYS Z NZ    1 
ATOM   1394 N  N     . LYS A 1 181 ? 0.189   31.717 -15.276 1.00 78.31  ? 181 LYS Z N     1 
ATOM   1395 C  CA    . LYS A 1 181 ? -0.689  30.645 -15.730 1.00 77.52  ? 181 LYS Z CA    1 
ATOM   1396 C  C     . LYS A 1 181 ? -1.772  30.335 -14.702 1.00 74.18  ? 181 LYS Z C     1 
ATOM   1397 O  O     . LYS A 1 181 ? -1.480  29.905 -13.587 1.00 75.11  ? 181 LYS Z O     1 
ATOM   1398 C  CB    . LYS A 1 181 ? 0.119   29.382 -16.034 1.00 78.03  ? 181 LYS Z CB    1 
ATOM   1399 C  CG    . LYS A 1 181 ? 1.116   29.545 -17.165 1.00 81.35  ? 181 LYS Z CG    1 
ATOM   1400 C  CD    . LYS A 1 181 ? 1.884   28.261 -17.418 1.00 82.72  ? 181 LYS Z CD    1 
ATOM   1401 C  CE    . LYS A 1 181 ? 2.843   28.422 -18.588 1.00 85.61  ? 181 LYS Z CE    1 
ATOM   1402 N  NZ    . LYS A 1 181 ? 3.506   27.139 -18.949 1.00 88.12  ? 181 LYS Z NZ    1 
ATOM   1403 N  N     . VAL A 1 182 ? -3.023  30.554 -15.090 1.00 73.30  ? 182 VAL Z N     1 
ATOM   1404 C  CA    . VAL A 1 182 ? -4.158  30.267 -14.220 1.00 72.10  ? 182 VAL Z CA    1 
ATOM   1405 C  C     . VAL A 1 182 ? -5.026  29.156 -14.801 1.00 73.26  ? 182 VAL Z C     1 
ATOM   1406 O  O     . VAL A 1 182 ? -5.509  29.261 -15.928 1.00 72.06  ? 182 VAL Z O     1 
ATOM   1407 C  CB    . VAL A 1 182 ? -5.029  31.519 -13.995 1.00 71.37  ? 182 VAL Z CB    1 
ATOM   1408 C  CG1   . VAL A 1 182 ? -6.243  31.175 -13.150 1.00 72.61  ? 182 VAL Z CG1   1 
ATOM   1409 C  CG2   . VAL A 1 182 ? -4.215  32.620 -13.341 1.00 75.47  ? 182 VAL Z CG2   1 
ATOM   1410 N  N     . ILE A 1 183 ? -5.220  28.092 -14.029 1.00 71.26  ? 183 ILE Z N     1 
ATOM   1411 C  CA    . ILE A 1 183 ? -6.070  26.984 -14.450 1.00 70.58  ? 183 ILE Z CA    1 
ATOM   1412 C  C     . ILE A 1 183 ? -7.460  27.099 -13.828 1.00 71.69  ? 183 ILE Z C     1 
ATOM   1413 O  O     . ILE A 1 183 ? -7.642  26.836 -12.639 1.00 71.39  ? 183 ILE Z O     1 
ATOM   1414 C  CB    . ILE A 1 183 ? -5.458  25.625 -14.070 1.00 71.07  ? 183 ILE Z CB    1 
ATOM   1415 C  CG1   . ILE A 1 183 ? -4.064  25.480 -14.679 1.00 72.89  ? 183 ILE Z CG1   1 
ATOM   1416 C  CG2   . ILE A 1 183 ? -6.357  24.489 -14.526 1.00 73.07  ? 183 ILE Z CG2   1 
ATOM   1417 C  CD1   . ILE A 1 183 ? -3.361  24.197 -14.288 1.00 72.62  ? 183 ILE Z CD1   1 
ATOM   1418 N  N     . LEU A 1 184 ? -8.435  27.496 -14.640 1.00 76.97  ? 184 LEU Z N     1 
ATOM   1419 C  CA    . LEU A 1 184 ? -9.805  27.668 -14.171 1.00 75.05  ? 184 LEU Z CA    1 
ATOM   1420 C  C     . LEU A 1 184 ? -10.664 26.442 -14.470 1.00 79.93  ? 184 LEU Z C     1 
ATOM   1421 O  O     . LEU A 1 184 ? -10.395 25.701 -15.418 1.00 80.47  ? 184 LEU Z O     1 
ATOM   1422 C  CB    . LEU A 1 184 ? -10.435 28.906 -14.814 1.00 71.23  ? 184 LEU Z CB    1 
ATOM   1423 C  CG    . LEU A 1 184 ? -9.800  30.273 -14.552 1.00 75.25  ? 184 LEU Z CG    1 
ATOM   1424 C  CD1   . LEU A 1 184 ? -10.452 31.327 -15.432 1.00 77.29  ? 184 LEU Z CD1   1 
ATOM   1425 C  CD2   . LEU A 1 184 ? -9.917  30.656 -13.087 1.00 78.26  ? 184 LEU Z CD2   1 
ATOM   1426 N  N     . LYS A 1 185 ? -11.695 26.243 -13.651 1.00 79.03  ? 185 LYS Z N     1 
ATOM   1427 C  CA    . LYS A 1 185 ? -12.700 25.199 -13.863 1.00 81.58  ? 185 LYS Z CA    1 
ATOM   1428 C  C     . LYS A 1 185 ? -12.101 23.813 -14.058 1.00 80.60  ? 185 LYS Z C     1 
ATOM   1429 O  O     . LYS A 1 185 ? -12.146 23.258 -15.155 1.00 86.87  ? 185 LYS Z O     1 
ATOM   1430 C  CB    . LYS A 1 185 ? -13.579 25.550 -15.066 1.00 86.31  ? 185 LYS Z CB    1 
ATOM   1431 C  CG    . LYS A 1 185 ? -14.218 26.923 -14.965 1.00 88.23  ? 185 LYS Z CG    1 
ATOM   1432 C  CD    . LYS A 1 185 ? -15.164 27.192 -16.118 1.00 100.18 ? 185 LYS Z CD    1 
ATOM   1433 C  CE    . LYS A 1 185 ? -15.775 28.576 -15.992 1.00 110.99 ? 185 LYS Z CE    1 
ATOM   1434 N  NZ    . LYS A 1 185 ? -16.437 28.775 -14.671 1.00 120.83 ? 185 LYS Z NZ    1 
ATOM   1435 N  N     . MET A 1 186 ? -11.550 23.254 -12.987 1.00 82.04  ? 186 MET Z N     1 
ATOM   1436 C  CA    . MET A 1 186 ? -10.955 21.927 -13.050 1.00 84.21  ? 186 MET Z CA    1 
ATOM   1437 C  C     . MET A 1 186 ? -11.757 20.922 -12.233 1.00 88.20  ? 186 MET Z C     1 
ATOM   1438 O  O     . MET A 1 186 ? -11.964 21.112 -11.035 1.00 85.95  ? 186 MET Z O     1 
ATOM   1439 C  CB    . MET A 1 186 ? -9.509  21.963 -12.557 1.00 82.03  ? 186 MET Z CB    1 
ATOM   1440 C  CG    . MET A 1 186 ? -8.752  20.669 -12.799 1.00 84.70  ? 186 MET Z CG    1 
ATOM   1441 S  SD    . MET A 1 186 ? -7.200  20.598 -11.887 1.00 77.83  ? 186 MET Z SD    1 
ATOM   1442 C  CE    . MET A 1 186 ? -7.807  20.453 -10.208 1.00 81.55  ? 186 MET Z CE    1 
ATOM   1443 N  N     . ASP A 1 187 ? -12.208 19.853 -12.883 1.00 87.31  ? 187 ASP Z N     1 
ATOM   1444 C  CA    . ASP A 1 187 ? -12.968 18.818 -12.192 1.00 88.63  ? 187 ASP Z CA    1 
ATOM   1445 C  C     . ASP A 1 187 ? -12.048 17.845 -11.460 1.00 87.65  ? 187 ASP Z C     1 
ATOM   1446 O  O     . ASP A 1 187 ? -10.830 18.026 -11.432 1.00 84.59  ? 187 ASP Z O     1 
ATOM   1447 C  CB    . ASP A 1 187 ? -13.875 18.064 -13.172 1.00 89.07  ? 187 ASP Z CB    1 
ATOM   1448 C  CG    . ASP A 1 187 ? -13.147 17.608 -14.425 1.00 93.50  ? 187 ASP Z CG    1 
ATOM   1449 O  OD1   . ASP A 1 187 ? -11.922 17.372 -14.365 1.00 92.40  ? 187 ASP Z OD1   1 
ATOM   1450 O  OD2   . ASP A 1 187 ? -13.811 17.478 -15.475 1.00 97.15  ? 187 ASP Z OD2   1 
ATOM   1451 N  N     . GLN A 1 188 ? -12.642 16.812 -10.872 1.00 95.91  ? 188 GLN Z N     1 
ATOM   1452 C  CA    . GLN A 1 188 ? -11.903 15.845 -10.069 1.00 97.05  ? 188 GLN Z CA    1 
ATOM   1453 C  C     . GLN A 1 188 ? -11.128 14.851 -10.929 1.00 97.82  ? 188 GLN Z C     1 
ATOM   1454 O  O     . GLN A 1 188 ? -10.490 13.934 -10.409 1.00 97.42  ? 188 GLN Z O     1 
ATOM   1455 C  CB    . GLN A 1 188 ? -12.859 15.096 -9.138  1.00 99.47  ? 188 GLN Z CB    1 
ATOM   1456 C  CG    . GLN A 1 188 ? -14.111 14.571 -9.828  1.00 103.69 ? 188 GLN Z CG    1 
ATOM   1457 C  CD    . GLN A 1 188 ? -15.025 13.811 -8.884  1.00 109.56 ? 188 GLN Z CD    1 
ATOM   1458 O  OE1   . GLN A 1 188 ? -14.577 12.953 -8.122  1.00 109.14 ? 188 GLN Z OE1   1 
ATOM   1459 N  NE2   . GLN A 1 188 ? -16.316 14.125 -8.928  1.00 114.42 ? 188 GLN Z NE2   1 
ATOM   1460 N  N     . PHE A 1 189 ? -11.180 15.041 -12.243 1.00 96.42  ? 189 PHE Z N     1 
ATOM   1461 C  CA    . PHE A 1 189 ? -10.521 14.132 -13.173 1.00 98.04  ? 189 PHE Z CA    1 
ATOM   1462 C  C     . PHE A 1 189 ? -9.273  14.755 -13.800 1.00 96.27  ? 189 PHE Z C     1 
ATOM   1463 O  O     . PHE A 1 189 ? -8.347  14.045 -14.191 1.00 98.54  ? 189 PHE Z O     1 
ATOM   1464 C  CB    . PHE A 1 189 ? -11.497 13.694 -14.267 1.00 104.08 ? 189 PHE Z CB    1 
ATOM   1465 C  CG    . PHE A 1 189 ? -12.761 13.071 -13.740 1.00 106.98 ? 189 PHE Z CG    1 
ATOM   1466 C  CD1   . PHE A 1 189 ? -12.722 11.872 -13.045 1.00 107.88 ? 189 PHE Z CD1   1 
ATOM   1467 C  CD2   . PHE A 1 189 ? -13.989 13.679 -13.948 1.00 106.15 ? 189 PHE Z CD2   1 
ATOM   1468 C  CE1   . PHE A 1 189 ? -13.883 11.295 -12.563 1.00 108.48 ? 189 PHE Z CE1   1 
ATOM   1469 C  CE2   . PHE A 1 189 ? -15.154 13.106 -13.468 1.00 108.96 ? 189 PHE Z CE2   1 
ATOM   1470 C  CZ    . PHE A 1 189 ? -15.101 11.913 -12.775 1.00 110.32 ? 189 PHE Z CZ    1 
ATOM   1471 N  N     . GLY A 1 190 ? -9.251  16.081 -13.894 1.00 91.43  ? 190 GLY Z N     1 
ATOM   1472 C  CA    . GLY A 1 190 ? -8.093  16.786 -14.417 1.00 86.62  ? 190 GLY Z CA    1 
ATOM   1473 C  C     . GLY A 1 190 ? -8.401  17.711 -15.581 1.00 86.24  ? 190 GLY Z C     1 
ATOM   1474 O  O     . GLY A 1 190 ? -7.521  18.424 -16.067 1.00 86.10  ? 190 GLY Z O     1 
ATOM   1475 N  N     . ASN A 1 191 ? -9.652  17.699 -16.030 1.00 86.42  ? 191 ASN Z N     1 
ATOM   1476 C  CA    . ASN A 1 191 ? -10.082 18.547 -17.137 1.00 84.93  ? 191 ASN Z CA    1 
ATOM   1477 C  C     . ASN A 1 191 ? -10.167 20.008 -16.717 1.00 85.46  ? 191 ASN Z C     1 
ATOM   1478 O  O     . ASN A 1 191 ? -10.961 20.360 -15.847 1.00 85.43  ? 191 ASN Z O     1 
ATOM   1479 C  CB    . ASN A 1 191 ? -11.436 18.076 -17.668 1.00 90.72  ? 191 ASN Z CB    1 
ATOM   1480 C  CG    . ASN A 1 191 ? -11.457 16.592 -17.972 1.00 95.07  ? 191 ASN Z CG    1 
ATOM   1481 O  OD1   . ASN A 1 191 ? -10.470 16.031 -18.446 1.00 94.70  ? 191 ASN Z OD1   1 
ATOM   1482 N  ND2   . ASN A 1 191 ? -12.583 15.945 -17.691 1.00 98.07  ? 191 ASN Z ND2   1 
ATOM   1483 N  N     . GLY A 1 192 ? -9.352  20.858 -17.334 1.00 87.01  ? 192 GLY Z N     1 
ATOM   1484 C  CA    . GLY A 1 192 ? -9.294  22.254 -16.941 1.00 83.34  ? 192 GLY Z CA    1 
ATOM   1485 C  C     . GLY A 1 192 ? -9.288  23.262 -18.074 1.00 80.10  ? 192 GLY Z C     1 
ATOM   1486 O  O     . GLY A 1 192 ? -9.235  22.904 -19.249 1.00 81.53  ? 192 GLY Z O     1 
ATOM   1487 N  N     . LEU A 1 193 ? -9.344  24.537 -17.703 1.00 83.83  ? 193 LEU Z N     1 
ATOM   1488 C  CA    . LEU A 1 193 ? -9.312  25.638 -18.658 1.00 81.02  ? 193 LEU Z CA    1 
ATOM   1489 C  C     . LEU A 1 193 ? -8.215  26.624 -18.271 1.00 80.26  ? 193 LEU Z C     1 
ATOM   1490 O  O     . LEU A 1 193 ? -8.350  27.353 -17.288 1.00 79.66  ? 193 LEU Z O     1 
ATOM   1491 C  CB    . LEU A 1 193 ? -10.669 26.343 -18.709 1.00 82.38  ? 193 LEU Z CB    1 
ATOM   1492 C  CG    . LEU A 1 193 ? -10.825 27.532 -19.658 1.00 81.33  ? 193 LEU Z CG    1 
ATOM   1493 C  CD1   . LEU A 1 193 ? -10.800 27.064 -21.103 1.00 83.42  ? 193 LEU Z CD1   1 
ATOM   1494 C  CD2   . LEU A 1 193 ? -12.107 28.296 -19.359 1.00 81.82  ? 193 LEU Z CD2   1 
ATOM   1495 N  N     . GLU A 1 194 ? -7.131  26.644 -19.039 1.00 79.29  ? 194 GLU Z N     1 
ATOM   1496 C  CA    . GLU A 1 194 ? -5.969  27.454 -18.686 1.00 76.48  ? 194 GLU Z CA    1 
ATOM   1497 C  C     . GLU A 1 194 ? -5.935  28.798 -19.412 1.00 76.63  ? 194 GLU Z C     1 
ATOM   1498 O  O     . GLU A 1 194 ? -6.217  28.881 -20.608 1.00 78.53  ? 194 GLU Z O     1 
ATOM   1499 C  CB    . GLU A 1 194 ? -4.684  26.676 -18.974 1.00 76.86  ? 194 GLU Z CB    1 
ATOM   1500 C  CG    . GLU A 1 194 ? -3.408  27.477 -18.770 1.00 77.38  ? 194 GLU Z CG    1 
ATOM   1501 C  CD    . GLU A 1 194 ? -2.164  26.644 -18.973 1.00 81.10  ? 194 GLU Z CD    1 
ATOM   1502 O  OE1   . GLU A 1 194 ? -1.266  27.085 -19.717 1.00 83.22  ? 194 GLU Z OE1   1 
ATOM   1503 O  OE2   . GLU A 1 194 ? -2.079  25.549 -18.381 1.00 82.54  ? 194 GLU Z OE2   1 
ATOM   1504 N  N     . ILE A 1 195 ? -5.584  29.846 -18.671 1.00 78.64  ? 195 ILE Z N     1 
ATOM   1505 C  CA    . ILE A 1 195 ? -5.394  31.178 -19.238 1.00 75.56  ? 195 ILE Z CA    1 
ATOM   1506 C  C     . ILE A 1 195 ? -3.993  31.695 -18.933 1.00 76.49  ? 195 ILE Z C     1 
ATOM   1507 O  O     . ILE A 1 195 ? -3.614  31.823 -17.769 1.00 77.10  ? 195 ILE Z O     1 
ATOM   1508 C  CB    . ILE A 1 195 ? -6.422  32.183 -18.691 1.00 73.20  ? 195 ILE Z CB    1 
ATOM   1509 C  CG1   . ILE A 1 195 ? -7.838  31.784 -19.103 1.00 75.36  ? 195 ILE Z CG1   1 
ATOM   1510 C  CG2   . ILE A 1 195 ? -6.102  33.589 -19.175 1.00 71.14  ? 195 ILE Z CG2   1 
ATOM   1511 C  CD1   . ILE A 1 195 ? -8.882  32.781 -18.674 1.00 75.72  ? 195 ILE Z CD1   1 
ATOM   1512 N  N     . ASP A 1 196 ? -3.228  31.989 -19.980 1.00 79.15  ? 196 ASP Z N     1 
ATOM   1513 C  CA    . ASP A 1 196 ? -1.876  32.511 -19.818 1.00 80.65  ? 196 ASP Z CA    1 
ATOM   1514 C  C     . ASP A 1 196 ? -1.833  34.018 -20.020 1.00 81.48  ? 196 ASP Z C     1 
ATOM   1515 O  O     . ASP A 1 196 ? -2.550  34.563 -20.859 1.00 82.96  ? 196 ASP Z O     1 
ATOM   1516 C  CB    . ASP A 1 196 ? -0.914  31.832 -20.792 1.00 82.96  ? 196 ASP Z CB    1 
ATOM   1517 C  CG    . ASP A 1 196 ? -0.551  30.426 -20.365 1.00 87.73  ? 196 ASP Z CG    1 
ATOM   1518 O  OD1   . ASP A 1 196 ? -1.253  29.876 -19.492 1.00 87.36  ? 196 ASP Z OD1   1 
ATOM   1519 O  OD2   . ASP A 1 196 ? 0.435   29.873 -20.901 1.00 91.43  ? 196 ASP Z OD2   1 
ATOM   1520 N  N     . GLN A 1 197 ? -0.984  34.683 -19.246 1.00 83.21  ? 197 GLN Z N     1 
ATOM   1521 C  CA    . GLN A 1 197 ? -0.814  36.125 -19.354 1.00 84.22  ? 197 GLN Z CA    1 
ATOM   1522 C  C     . GLN A 1 197 ? -0.278  36.515 -20.729 1.00 80.65  ? 197 GLN Z C     1 
ATOM   1523 O  O     . GLN A 1 197 ? -0.765  37.460 -21.349 1.00 79.73  ? 197 GLN Z O     1 
ATOM   1524 C  CB    . GLN A 1 197 ? 0.127   36.630 -18.261 1.00 79.36  ? 197 GLN Z CB    1 
ATOM   1525 C  CG    . GLN A 1 197 ? 0.409   38.117 -18.319 1.00 78.96  ? 197 GLN Z CG    1 
ATOM   1526 C  CD    . GLN A 1 197 ? 1.618   38.501 -17.495 1.00 85.97  ? 197 GLN Z CD    1 
ATOM   1527 O  OE1   . GLN A 1 197 ? 2.562   37.722 -17.359 1.00 88.72  ? 197 GLN Z OE1   1 
ATOM   1528 N  NE2   . GLN A 1 197 ? 1.594   39.702 -16.933 1.00 87.50  ? 197 GLN Z NE2   1 
ATOM   1529 N  N     . ALA A 1 198 ? 0.720   35.774 -21.202 1.00 77.73  ? 198 ALA Z N     1 
ATOM   1530 C  CA    . ALA A 1 198 ? 1.349   36.058 -22.488 1.00 79.29  ? 198 ALA Z CA    1 
ATOM   1531 C  C     . ALA A 1 198 ? 0.334   36.042 -23.629 1.00 80.56  ? 198 ALA Z C     1 
ATOM   1532 O  O     . ALA A 1 198 ? 0.454   36.804 -24.586 1.00 81.71  ? 198 ALA Z O     1 
ATOM   1533 C  CB    . ALA A 1 198 ? 2.465   35.063 -22.762 1.00 80.28  ? 198 ALA Z CB    1 
ATOM   1534 N  N     . ARG A 1 199 ? -0.675  35.185 -23.511 1.00 82.41  ? 199 ARG Z N     1 
ATOM   1535 C  CA    . ARG A 1 199 ? -1.684  35.049 -24.554 1.00 83.98  ? 199 ARG Z CA    1 
ATOM   1536 C  C     . ARG A 1 199 ? -2.839  36.036 -24.396 1.00 83.97  ? 199 ARG Z C     1 
ATOM   1537 O  O     . ARG A 1 199 ? -3.853  35.918 -25.085 1.00 84.81  ? 199 ARG Z O     1 
ATOM   1538 C  CB    . ARG A 1 199 ? -2.228  33.619 -24.585 1.00 86.43  ? 199 ARG Z CB    1 
ATOM   1539 C  CG    . ARG A 1 199 ? -1.215  32.579 -25.031 1.00 88.32  ? 199 ARG Z CG    1 
ATOM   1540 C  CD    . ARG A 1 199 ? -1.852  31.205 -25.128 1.00 89.53  ? 199 ARG Z CD    1 
ATOM   1541 N  NE    . ARG A 1 199 ? -2.505  30.822 -23.881 1.00 89.59  ? 199 ARG Z NE    1 
ATOM   1542 C  CZ    . ARG A 1 199 ? -3.064  29.637 -23.667 1.00 93.52  ? 199 ARG Z CZ    1 
ATOM   1543 N  NH1   . ARG A 1 199 ? -3.047  28.717 -24.621 1.00 96.94  ? 199 ARG Z NH1   1 
ATOM   1544 N  NH2   . ARG A 1 199 ? -3.638  29.372 -22.501 1.00 87.72  ? 199 ARG Z NH2   1 
ATOM   1545 N  N     . LEU A 1 200 ? -2.690  37.017 -23.509 1.00 87.85  ? 200 LEU Z N     1 
ATOM   1546 C  CA    . LEU A 1 200 ? -3.723  38.040 -23.357 1.00 86.45  ? 200 LEU Z CA    1 
ATOM   1547 C  C     . LEU A 1 200 ? -3.840  38.879 -24.627 1.00 89.61  ? 200 LEU Z C     1 
ATOM   1548 O  O     . LEU A 1 200 ? -4.840  39.564 -24.843 1.00 90.90  ? 200 LEU Z O     1 
ATOM   1549 C  CB    . LEU A 1 200 ? -3.436  38.938 -22.153 1.00 82.15  ? 200 LEU Z CB    1 
ATOM   1550 C  CG    . LEU A 1 200 ? -3.852  38.391 -20.786 1.00 83.74  ? 200 LEU Z CG    1 
ATOM   1551 C  CD1   . LEU A 1 200 ? -3.531  39.392 -19.685 1.00 78.51  ? 200 LEU Z CD1   1 
ATOM   1552 C  CD2   . LEU A 1 200 ? -5.332  38.036 -20.775 1.00 79.65  ? 200 LEU Z CD2   1 
ATOM   1553 N  N     . GLY A 1 201 ? -2.813  38.812 -25.468 1.00 85.21  ? 201 GLY Z N     1 
ATOM   1554 C  CA    . GLY A 1 201 ? -2.829  39.491 -26.747 1.00 89.75  ? 201 GLY Z CA    1 
ATOM   1555 C  C     . GLY A 1 201 ? -3.706  38.808 -27.778 1.00 91.38  ? 201 GLY Z C     1 
ATOM   1556 O  O     . GLY A 1 201 ? -3.947  39.357 -28.853 1.00 92.16  ? 201 GLY Z O     1 
ATOM   1557 N  N     . MET A 1 202 ? -4.187  37.611 -27.454 1.00 90.01  ? 202 MET Z N     1 
ATOM   1558 C  CA    . MET A 1 202 ? -5.065  36.882 -28.363 1.00 91.30  ? 202 MET Z CA    1 
ATOM   1559 C  C     . MET A 1 202 ? -6.483  37.447 -28.323 1.00 94.78  ? 202 MET Z C     1 
ATOM   1560 O  O     . MET A 1 202 ? -7.356  37.007 -29.068 1.00 102.52 ? 202 MET Z O     1 
ATOM   1561 C  CB    . MET A 1 202 ? -5.078  35.390 -28.022 1.00 87.92  ? 202 MET Z CB    1 
ATOM   1562 C  CG    . MET A 1 202 ? -3.771  34.678 -28.328 1.00 93.01  ? 202 MET Z CG    1 
ATOM   1563 S  SD    . MET A 1 202 ? -3.833  32.911 -27.991 1.00 96.51  ? 202 MET Z SD    1 
ATOM   1564 C  CE    . MET A 1 202 ? -5.226  32.420 -29.003 1.00 100.09 ? 202 MET Z CE    1 
ATOM   1565 N  N     . CYS A 1 203 ? -6.703  38.428 -27.453 1.00 94.35  ? 203 CYS Z N     1 
ATOM   1566 C  CA    . CYS A 1 203 ? -8.009  39.063 -27.322 1.00 96.96  ? 203 CYS Z CA    1 
ATOM   1567 C  C     . CYS A 1 203 ? -8.074  40.362 -28.114 1.00 100.59 ? 203 CYS Z C     1 
ATOM   1568 O  O     . CYS A 1 203 ? -7.425  41.349 -27.760 1.00 98.46  ? 203 CYS Z O     1 
ATOM   1569 C  CB    . CYS A 1 203 ? -8.326  39.331 -25.852 1.00 94.60  ? 203 CYS Z CB    1 
ATOM   1570 S  SG    . CYS A 1 203 ? -8.222  37.865 -24.814 1.00 88.46  ? 203 CYS Z SG    1 
ATOM   1571 N  N     . ARG A 1 204 ? -8.865  40.354 -29.184 1.00 96.22  ? 204 ARG Z N     1 
ATOM   1572 C  CA    . ARG A 1 204 ? -8.981  41.501 -30.076 1.00 101.63 ? 204 ARG Z CA    1 
ATOM   1573 C  C     . ARG A 1 204 ? -9.536  42.739 -29.373 1.00 99.52  ? 204 ARG Z C     1 
ATOM   1574 O  O     . ARG A 1 204 ? -8.978  43.832 -29.487 1.00 100.87 ? 204 ARG Z O     1 
ATOM   1575 C  CB    . ARG A 1 204 ? -9.864  41.149 -31.274 1.00 105.28 ? 204 ARG Z CB    1 
ATOM   1576 C  CG    . ARG A 1 204 ? -9.957  42.259 -32.305 1.00 113.57 ? 204 ARG Z CG    1 
ATOM   1577 C  CD    . ARG A 1 204 ? -8.565  42.709 -32.721 1.00 117.10 ? 204 ARG Z CD    1 
ATOM   1578 N  NE    . ARG A 1 204 ? -8.566  44.046 -33.306 1.00 128.15 ? 204 ARG Z NE    1 
ATOM   1579 C  CZ    . ARG A 1 204 ? -7.496  44.832 -33.359 1.00 133.60 ? 204 ARG Z CZ    1 
ATOM   1580 N  NH1   . ARG A 1 204 ? -7.577  46.039 -33.904 1.00 139.12 ? 204 ARG Z NH1   1 
ATOM   1581 N  NH2   . ARG A 1 204 ? -6.342  44.412 -32.859 1.00 135.86 ? 204 ARG Z NH2   1 
ATOM   1582 N  N     . GLN A 1 205 ? -10.633 42.560 -28.643 1.00 104.71 ? 205 GLN Z N     1 
ATOM   1583 C  CA    . GLN A 1 205 ? -11.312 43.671 -27.982 1.00 104.32 ? 205 GLN Z CA    1 
ATOM   1584 C  C     . GLN A 1 205 ? -10.473 44.272 -26.859 1.00 102.19 ? 205 GLN Z C     1 
ATOM   1585 O  O     . GLN A 1 205 ? -10.764 45.364 -26.371 1.00 103.74 ? 205 GLN Z O     1 
ATOM   1586 C  CB    . GLN A 1 205 ? -12.663 43.215 -27.432 1.00 100.95 ? 205 GLN Z CB    1 
ATOM   1587 C  CG    . GLN A 1 205 ? -12.570 42.080 -26.425 1.00 101.52 ? 205 GLN Z CG    1 
ATOM   1588 C  CD    . GLN A 1 205 ? -13.923 41.701 -25.852 1.00 102.78 ? 205 GLN Z CD    1 
ATOM   1589 O  OE1   . GLN A 1 205 ? -14.923 42.381 -26.089 1.00 105.87 ? 205 GLN Z OE1   1 
ATOM   1590 N  NE2   . GLN A 1 205 ? -13.963 40.608 -25.097 1.00 95.73  ? 205 GLN Z NE2   1 
ATOM   1591 N  N     . LEU A 1 206 ? -9.432  43.554 -26.455 1.00 100.74 ? 206 LEU Z N     1 
ATOM   1592 C  CA    . LEU A 1 206 ? -8.556  44.012 -25.385 1.00 97.54  ? 206 LEU Z CA    1 
ATOM   1593 C  C     . LEU A 1 206 ? -7.616  45.112 -25.869 1.00 99.24  ? 206 LEU Z C     1 
ATOM   1594 O  O     . LEU A 1 206 ? -7.191  45.963 -25.091 1.00 99.36  ? 206 LEU Z O     1 
ATOM   1595 C  CB    . LEU A 1 206 ? -7.751  42.840 -24.823 1.00 94.88  ? 206 LEU Z CB    1 
ATOM   1596 C  CG    . LEU A 1 206 ? -7.079  43.071 -23.472 1.00 89.57  ? 206 LEU Z CG    1 
ATOM   1597 C  CD1   . LEU A 1 206 ? -8.130  43.371 -22.422 1.00 89.97  ? 206 LEU Z CD1   1 
ATOM   1598 C  CD2   . LEU A 1 206 ? -6.253  41.862 -23.074 1.00 87.78  ? 206 LEU Z CD2   1 
ATOM   1599 N  N     . GLY A 1 207 ? -7.295  45.091 -27.157 1.00 102.92 ? 207 GLY Z N     1 
ATOM   1600 C  CA    . GLY A 1 207 ? -6.418  46.091 -27.737 1.00 104.12 ? 207 GLY Z CA    1 
ATOM   1601 C  C     . GLY A 1 207 ? -4.988  45.969 -27.249 1.00 102.59 ? 207 GLY Z C     1 
ATOM   1602 O  O     . GLY A 1 207 ? -4.413  44.883 -27.248 1.00 101.59 ? 207 GLY Z O     1 
ATOM   1603 N  N     . ASP A 1 208 ? -4.389  47.076 -26.847 1.00 105.05 ? 208 ASP Z N     1 
ATOM   1604 C  CA    . ASP A 1 208 ? -3.019  47.034 -26.368 1.00 105.62 ? 208 ASP Z CA    1 
ATOM   1605 C  C     . ASP A 1 208 ? -2.999  46.931 -24.859 1.00 103.24 ? 208 ASP Z C     1 
ATOM   1606 O  O     . ASP A 1 208 ? -1.959  47.045 -24.230 1.00 99.48  ? 208 ASP Z O     1 
ATOM   1607 C  CB    . ASP A 1 208 ? -2.249  48.261 -26.812 1.00 110.97 ? 208 ASP Z CB    1 
ATOM   1608 C  CG    . ASP A 1 208 ? -2.864  49.516 -26.313 1.00 114.37 ? 208 ASP Z CG    1 
ATOM   1609 O  OD1   . ASP A 1 208 ? -4.087  49.507 -26.125 1.00 113.47 ? 208 ASP Z OD1   1 
ATOM   1610 O  OD2   . ASP A 1 208 ? -2.143  50.504 -26.100 1.00 118.99 ? 208 ASP Z OD2   1 
ATOM   1611 N  N     . VAL A 1 209 ? -4.170  46.735 -24.285 1.00 101.83 ? 209 VAL Z N     1 
ATOM   1612 C  CA    . VAL A 1 209 ? -4.267  46.590 -22.862 1.00 97.30  ? 209 VAL Z CA    1 
ATOM   1613 C  C     . VAL A 1 209 ? -4.017  45.143 -22.505 1.00 95.25  ? 209 VAL Z C     1 
ATOM   1614 O  O     . VAL A 1 209 ? -4.872  44.470 -21.972 1.00 92.59  ? 209 VAL Z O     1 
ATOM   1615 C  CB    . VAL A 1 209 ? -5.656  47.017 -22.384 1.00 98.59  ? 209 VAL Z CB    1 
ATOM   1616 C  CG1   . VAL A 1 209 ? -5.790  46.778 -20.904 1.00 93.17  ? 209 VAL Z CG1   1 
ATOM   1617 C  CG2   . VAL A 1 209 ? -5.902  48.468 -22.709 1.00 105.20 ? 209 VAL Z CG2   1 
ATOM   1618 N  N     . PHE A 1 210 ? -2.825  44.657 -22.784 1.00 95.00  ? 210 PHE Z N     1 
ATOM   1619 C  CA    . PHE A 1 210 ? -2.491  43.298 -22.393 1.00 92.65  ? 210 PHE Z CA    1 
ATOM   1620 C  C     . PHE A 1 210 ? -1.314  43.326 -21.460 1.00 89.10  ? 210 PHE Z C     1 
ATOM   1621 O  O     . PHE A 1 210 ? -0.947  42.327 -20.877 1.00 88.49  ? 210 PHE Z O     1 
ATOM   1622 C  CB    . PHE A 1 210 ? -2.198  42.424 -23.609 1.00 92.63  ? 210 PHE Z CB    1 
ATOM   1623 C  CG    . PHE A 1 210 ? -1.301  43.069 -24.606 1.00 94.22  ? 210 PHE Z CG    1 
ATOM   1624 C  CD1   . PHE A 1 210 ? 0.054   42.910 -24.529 1.00 92.63  ? 210 PHE Z CD1   1 
ATOM   1625 C  CD2   . PHE A 1 210 ? -1.820  43.846 -25.608 1.00 98.54  ? 210 PHE Z CD2   1 
ATOM   1626 C  CE1   . PHE A 1 210 ? 0.882   43.519 -25.432 1.00 96.37  ? 210 PHE Z CE1   1 
ATOM   1627 C  CE2   . PHE A 1 210 ? -1.000  44.454 -26.519 1.00 100.08 ? 210 PHE Z CE2   1 
ATOM   1628 C  CZ    . PHE A 1 210 ? 0.354   44.293 -26.430 1.00 100.34 ? 210 PHE Z CZ    1 
ATOM   1629 N  N     . THR A 1 211 ? -0.721  44.493 -21.328 1.00 90.34  ? 211 THR Z N     1 
ATOM   1630 C  CA    . THR A 1 211 ? 0.355   44.694 -20.367 1.00 92.15  ? 211 THR Z CA    1 
ATOM   1631 C  C     . THR A 1 211 ? -0.211  44.628 -18.951 1.00 88.26  ? 211 THR Z C     1 
ATOM   1632 O  O     . THR A 1 211 ? -1.356  45.010 -18.720 1.00 88.57  ? 211 THR Z O     1 
ATOM   1633 C  CB    . THR A 1 211 ? 1.069   46.038 -20.589 1.00 93.97  ? 211 THR Z CB    1 
ATOM   1634 O  OG1   . THR A 1 211 ? 0.132   47.110 -20.432 1.00 95.53  ? 211 THR Z OG1   1 
ATOM   1635 C  CG2   . THR A 1 211 ? 1.665   46.097 -21.989 1.00 91.34  ? 211 THR Z CG2   1 
ATOM   1636 N  N     . GLU A 1 212 ? 0.592   44.139 -18.010 1.00 89.06  ? 212 GLU Z N     1 
ATOM   1637 C  CA    . GLU A 1 212 ? 0.127   43.878 -16.648 1.00 87.63  ? 212 GLU Z CA    1 
ATOM   1638 C  C     . GLU A 1 212 ? -0.438  45.116 -15.957 1.00 83.89  ? 212 GLU Z C     1 
ATOM   1639 O  O     . GLU A 1 212 ? -1.491  45.051 -15.328 1.00 81.75  ? 212 GLU Z O     1 
ATOM   1640 C  CB    . GLU A 1 212 ? 1.260   43.293 -15.800 1.00 83.89  ? 212 GLU Z CB    1 
ATOM   1641 C  CG    . GLU A 1 212 ? 0.852   42.953 -14.372 1.00 86.30  ? 212 GLU Z CG    1 
ATOM   1642 C  CD    . GLU A 1 212 ? 1.906   42.143 -13.633 1.00 87.87  ? 212 GLU Z CD    1 
ATOM   1643 O  OE1   . GLU A 1 212 ? 1.853   42.085 -12.384 1.00 85.66  ? 212 GLU Z OE1   1 
ATOM   1644 O  OE2   . GLU A 1 212 ? 2.787   41.561 -14.304 1.00 91.30  ? 212 GLU Z OE2   1 
ATOM   1645 N  N     . GLU A 1 213 ? 0.258   46.241 -16.085 1.00 81.59  ? 213 GLU Z N     1 
ATOM   1646 C  CA    . GLU A 1 213 ? -0.163  47.476 -15.433 1.00 84.40  ? 213 GLU Z CA    1 
ATOM   1647 C  C     . GLU A 1 213 ? -1.496  47.987 -15.978 1.00 83.76  ? 213 GLU Z C     1 
ATOM   1648 O  O     . GLU A 1 213 ? -2.426  48.270 -15.216 1.00 84.55  ? 213 GLU Z O     1 
ATOM   1649 C  CB    . GLU A 1 213 ? 0.915   48.549 -15.590 1.00 86.13  ? 213 GLU Z CB    1 
ATOM   1650 C  CG    . GLU A 1 213 ? 0.529   49.895 -15.004 1.00 89.29  ? 213 GLU Z CG    1 
ATOM   1651 C  CD    . GLU A 1 213 ? 1.667   50.894 -15.040 1.00 96.37  ? 213 GLU Z CD    1 
ATOM   1652 O  OE1   . GLU A 1 213 ? 2.833   50.476 -14.871 1.00 99.74  ? 213 GLU Z OE1   1 
ATOM   1653 O  OE2   . GLU A 1 213 ? 1.397   52.097 -15.245 1.00 100.35 ? 213 GLU Z OE2   1 
ATOM   1654 N  N     . LYS A 1 214 ? -1.583  48.099 -17.299 1.00 85.34  ? 214 LYS Z N     1 
ATOM   1655 C  CA    . LYS A 1 214 ? -2.806  48.560 -17.943 1.00 87.52  ? 214 LYS Z CA    1 
ATOM   1656 C  C     . LYS A 1 214 ? -3.961  47.593 -17.687 1.00 85.66  ? 214 LYS Z C     1 
ATOM   1657 O  O     . LYS A 1 214 ? -5.085  48.017 -17.423 1.00 86.22  ? 214 LYS Z O     1 
ATOM   1658 C  CB    . LYS A 1 214 ? -2.586  48.742 -19.446 1.00 90.93  ? 214 LYS Z CB    1 
ATOM   1659 C  CG    . LYS A 1 214 ? -1.631  49.874 -19.807 1.00 92.59  ? 214 LYS Z CG    1 
ATOM   1660 C  CD    . LYS A 1 214 ? -1.476  49.999 -21.314 1.00 98.45  ? 214 LYS Z CD    1 
ATOM   1661 C  CE    . LYS A 1 214 ? -0.564  51.158 -21.690 1.00 102.85 ? 214 LYS Z CE    1 
ATOM   1662 N  NZ    . LYS A 1 214 ? -0.359  51.248 -23.167 1.00 107.87 ? 214 LYS Z NZ    1 
ATOM   1663 N  N     . PHE A 1 215 ? -3.677  46.296 -17.761 1.00 85.38  ? 215 PHE Z N     1 
ATOM   1664 C  CA    . PHE A 1 215 ? -4.683  45.274 -17.490 1.00 83.46  ? 215 PHE Z CA    1 
ATOM   1665 C  C     . PHE A 1 215 ? -5.224  45.419 -16.071 1.00 80.88  ? 215 PHE Z C     1 
ATOM   1666 O  O     . PHE A 1 215 ? -6.432  45.315 -15.840 1.00 80.11  ? 215 PHE Z O     1 
ATOM   1667 C  CB    . PHE A 1 215 ? -4.098  43.874 -17.696 1.00 80.59  ? 215 PHE Z CB    1 
ATOM   1668 C  CG    . PHE A 1 215 ? -5.120  42.777 -17.669 1.00 78.83  ? 215 PHE Z CG    1 
ATOM   1669 C  CD1   . PHE A 1 215 ? -5.805  42.424 -18.821 1.00 80.88  ? 215 PHE Z CD1   1 
ATOM   1670 C  CD2   . PHE A 1 215 ? -5.392  42.094 -16.496 1.00 80.84  ? 215 PHE Z CD2   1 
ATOM   1671 C  CE1   . PHE A 1 215 ? -6.745  41.415 -18.801 1.00 79.90  ? 215 PHE Z CE1   1 
ATOM   1672 C  CE2   . PHE A 1 215 ? -6.331  41.084 -16.469 1.00 79.58  ? 215 PHE Z CE2   1 
ATOM   1673 C  CZ    . PHE A 1 215 ? -7.009  40.743 -17.623 1.00 76.79  ? 215 PHE Z CZ    1 
ATOM   1674 N  N     . ARG A 1 216 ? -4.317  45.663 -15.129 1.00 79.28  ? 216 ARG Z N     1 
ATOM   1675 C  CA    . ARG A 1 216 ? -4.688  45.882 -13.737 1.00 78.54  ? 216 ARG Z CA    1 
ATOM   1676 C  C     . ARG A 1 216 ? -5.593  47.101 -13.608 1.00 78.89  ? 216 ARG Z C     1 
ATOM   1677 O  O     . ARG A 1 216 ? -6.648  47.033 -12.973 1.00 77.18  ? 216 ARG Z O     1 
ATOM   1678 C  CB    . ARG A 1 216 ? -3.439  46.052 -12.866 1.00 77.71  ? 216 ARG Z CB    1 
ATOM   1679 C  CG    . ARG A 1 216 ? -3.733  46.400 -11.416 1.00 74.03  ? 216 ARG Z CG    1 
ATOM   1680 C  CD    . ARG A 1 216 ? -2.483  46.356 -10.548 1.00 73.80  ? 216 ARG Z CD    1 
ATOM   1681 N  NE    . ARG A 1 216 ? -1.493  47.357 -10.934 1.00 75.56  ? 216 ARG Z NE    1 
ATOM   1682 C  CZ    . ARG A 1 216 ? -0.400  47.092 -11.643 1.00 77.20  ? 216 ARG Z CZ    1 
ATOM   1683 N  NH1   . ARG A 1 216 ? -0.149  45.853 -12.043 1.00 76.49  ? 216 ARG Z NH1   1 
ATOM   1684 N  NH2   . ARG A 1 216 ? 0.446   48.065 -11.949 1.00 79.33  ? 216 ARG Z NH2   1 
ATOM   1685 N  N     . TYR A 1 217 ? -5.178  48.209 -14.220 1.00 80.98  ? 217 TYR Z N     1 
ATOM   1686 C  CA    . TYR A 1 217 ? -5.978  49.434 -14.225 1.00 82.03  ? 217 TYR Z CA    1 
ATOM   1687 C  C     . TYR A 1 217 ? -7.387  49.175 -14.740 1.00 81.83  ? 217 TYR Z C     1 
ATOM   1688 O  O     . TYR A 1 217 ? -8.366  49.683 -14.189 1.00 83.34  ? 217 TYR Z O     1 
ATOM   1689 C  CB    . TYR A 1 217 ? -5.315  50.514 -15.082 1.00 86.23  ? 217 TYR Z CB    1 
ATOM   1690 C  CG    . TYR A 1 217 ? -4.046  51.093 -14.496 1.00 87.98  ? 217 TYR Z CG    1 
ATOM   1691 C  CD1   . TYR A 1 217 ? -3.728  50.922 -13.154 1.00 81.74  ? 217 TYR Z CD1   1 
ATOM   1692 C  CD2   . TYR A 1 217 ? -3.167  51.821 -15.288 1.00 90.01  ? 217 TYR Z CD2   1 
ATOM   1693 C  CE1   . TYR A 1 217 ? -2.566  51.457 -12.625 1.00 84.09  ? 217 TYR Z CE1   1 
ATOM   1694 C  CE2   . TYR A 1 217 ? -2.007  52.358 -14.766 1.00 89.07  ? 217 TYR Z CE2   1 
ATOM   1695 C  CZ    . TYR A 1 217 ? -1.711  52.172 -13.437 1.00 88.24  ? 217 TYR Z CZ    1 
ATOM   1696 O  OH    . TYR A 1 217 ? -0.556  52.705 -12.917 1.00 88.92  ? 217 TYR Z OH    1 
ATOM   1697 N  N     . MET A 1 218 ? -7.477  48.379 -15.800 1.00 82.48  ? 218 MET Z N     1 
ATOM   1698 C  CA    . MET A 1 218 ? -8.760  48.024 -16.391 1.00 85.72  ? 218 MET Z CA    1 
ATOM   1699 C  C     . MET A 1 218 ? -9.618  47.239 -15.409 1.00 83.73  ? 218 MET Z C     1 
ATOM   1700 O  O     . MET A 1 218 ? -10.787 47.563 -15.197 1.00 84.52  ? 218 MET Z O     1 
ATOM   1701 C  CB    . MET A 1 218 ? -8.554  47.211 -17.668 1.00 85.61  ? 218 MET Z CB    1 
ATOM   1702 C  CG    . MET A 1 218 ? -9.841  46.806 -18.359 1.00 88.02  ? 218 MET Z CG    1 
ATOM   1703 S  SD    . MET A 1 218 ? -9.544  45.623 -19.683 1.00 90.40  ? 218 MET Z SD    1 
ATOM   1704 C  CE    . MET A 1 218 ? -8.993  44.200 -18.744 1.00 81.06  ? 218 MET Z CE    1 
ATOM   1705 N  N     . CYS A 1 219 ? -9.027  46.206 -14.816 1.00 82.21  ? 219 CYS Z N     1 
ATOM   1706 C  CA    . CYS A 1 219 ? -9.733  45.374 -13.849 1.00 83.12  ? 219 CYS Z CA    1 
ATOM   1707 C  C     . CYS A 1 219 ? -10.268 46.196 -12.681 1.00 83.39  ? 219 CYS Z C     1 
ATOM   1708 O  O     . CYS A 1 219 ? -11.403 46.000 -12.251 1.00 85.53  ? 219 CYS Z O     1 
ATOM   1709 C  CB    . CYS A 1 219 ? -8.820  44.259 -13.335 1.00 80.87  ? 219 CYS Z CB    1 
ATOM   1710 S  SG    . CYS A 1 219 ? -8.523  42.938 -14.530 1.00 72.61  ? 219 CYS Z SG    1 
ATOM   1711 N  N     . ILE A 1 220 ? -9.454  47.118 -12.176 1.00 79.13  ? 220 ILE Z N     1 
ATOM   1712 C  CA    . ILE A 1 220 ? -9.879  47.969 -11.069 1.00 78.37  ? 220 ILE Z CA    1 
ATOM   1713 C  C     . ILE A 1 220 ? -11.001 48.909 -11.497 1.00 81.12  ? 220 ILE Z C     1 
ATOM   1714 O  O     . ILE A 1 220 ? -11.999 49.048 -10.793 1.00 81.98  ? 220 ILE Z O     1 
ATOM   1715 C  CB    . ILE A 1 220 ? -8.708  48.800 -10.505 1.00 78.99  ? 220 ILE Z CB    1 
ATOM   1716 C  CG1   . ILE A 1 220 ? -7.598  47.883 -9.989  1.00 75.19  ? 220 ILE Z CG1   1 
ATOM   1717 C  CG2   . ILE A 1 220 ? -9.186  49.716 -9.390  1.00 78.23  ? 220 ILE Z CG2   1 
ATOM   1718 C  CD1   . ILE A 1 220 ? -6.388  48.623 -9.481  1.00 74.87  ? 220 ILE Z CD1   1 
ATOM   1719 N  N     . LEU A 1 221 ? -10.837 49.548 -12.654 1.00 82.73  ? 221 LEU Z N     1 
ATOM   1720 C  CA    . LEU A 1 221 ? -11.827 50.501 -13.147 1.00 82.56  ? 221 LEU Z CA    1 
ATOM   1721 C  C     . LEU A 1 221 ? -13.162 49.831 -13.460 1.00 85.44  ? 221 LEU Z C     1 
ATOM   1722 O  O     . LEU A 1 221 ? -14.210 50.471 -13.414 1.00 89.63  ? 221 LEU Z O     1 
ATOM   1723 C  CB    . LEU A 1 221 ? -11.303 51.221 -14.390 1.00 84.40  ? 221 LEU Z CB    1 
ATOM   1724 C  CG    . LEU A 1 221 ? -10.241 52.300 -14.171 1.00 87.63  ? 221 LEU Z CG    1 
ATOM   1725 C  CD1   . LEU A 1 221 ? -9.728  52.826 -15.503 1.00 88.94  ? 221 LEU Z CD1   1 
ATOM   1726 C  CD2   . LEU A 1 221 ? -10.801 53.436 -13.328 1.00 90.58  ? 221 LEU Z CD2   1 
ATOM   1727 N  N     . SER A 1 222 ? -13.119 48.541 -13.776 1.00 87.05  ? 222 SER Z N     1 
ATOM   1728 C  CA    . SER A 1 222 ? -14.327 47.791 -14.102 1.00 89.71  ? 222 SER Z CA    1 
ATOM   1729 C  C     . SER A 1 222 ? -15.128 47.455 -12.850 1.00 89.08  ? 222 SER Z C     1 
ATOM   1730 O  O     . SER A 1 222 ? -16.321 47.165 -12.924 1.00 94.34  ? 222 SER Z O     1 
ATOM   1731 C  CB    . SER A 1 222 ? -13.973 46.505 -14.846 1.00 87.51  ? 222 SER Z CB    1 
ATOM   1732 O  OG    . SER A 1 222 ? -13.252 45.620 -14.008 1.00 85.64  ? 222 SER Z OG    1 
ATOM   1733 N  N     . GLY A 1 223 ? -14.463 47.493 -11.700 1.00 85.13  ? 223 GLY Z N     1 
ATOM   1734 C  CA    . GLY A 1 223 ? -15.092 47.131 -10.444 1.00 87.21  ? 223 GLY Z CA    1 
ATOM   1735 C  C     . GLY A 1 223 ? -14.483 45.884 -9.834  1.00 86.79  ? 223 GLY Z C     1 
ATOM   1736 O  O     . GLY A 1 223 ? -14.419 44.839 -10.480 1.00 86.49  ? 223 GLY Z O     1 
ATOM   1737 N  N     . CYS A 1 224 ? -14.041 45.994 -8.585  1.00 86.65  ? 224 CYS Z N     1 
ATOM   1738 C  CA    . CYS A 1 224 ? -13.416 44.876 -7.888  1.00 84.98  ? 224 CYS Z CA    1 
ATOM   1739 C  C     . CYS A 1 224 ? -13.835 44.839 -6.423  1.00 86.22  ? 224 CYS Z C     1 
ATOM   1740 O  O     . CYS A 1 224 ? -14.726 45.579 -6.006  1.00 88.89  ? 224 CYS Z O     1 
ATOM   1741 C  CB    . CYS A 1 224 ? -11.892 44.964 -8.000  1.00 84.11  ? 224 CYS Z CB    1 
ATOM   1742 S  SG    . CYS A 1 224 ? -11.188 46.528 -7.429  1.00 90.14  ? 224 CYS Z SG    1 
ATOM   1743 N  N     . ASP A 1 225 ? -13.190 43.974 -5.646  1.00 85.05  ? 225 ASP Z N     1 
ATOM   1744 C  CA    . ASP A 1 225 ? -13.493 43.844 -4.223  1.00 86.84  ? 225 ASP Z CA    1 
ATOM   1745 C  C     . ASP A 1 225 ? -12.982 45.041 -3.426  1.00 86.44  ? 225 ASP Z C     1 
ATOM   1746 O  O     . ASP A 1 225 ? -13.531 45.381 -2.379  1.00 88.39  ? 225 ASP Z O     1 
ATOM   1747 C  CB    . ASP A 1 225 ? -12.891 42.555 -3.659  1.00 87.98  ? 225 ASP Z CB    1 
ATOM   1748 C  CG    . ASP A 1 225 ? -13.584 41.312 -4.176  1.00 92.36  ? 225 ASP Z CG    1 
ATOM   1749 O  OD1   . ASP A 1 225 ? -13.409 40.235 -3.570  1.00 95.49  ? 225 ASP Z OD1   1 
ATOM   1750 O  OD2   . ASP A 1 225 ? -14.308 41.413 -5.188  1.00 95.33  ? 225 ASP Z OD2   1 
ATOM   1751 N  N     . TYR A 1 226 ? -11.930 45.681 -3.927  1.00 84.64  ? 226 TYR Z N     1 
ATOM   1752 C  CA    . TYR A 1 226 ? -11.310 46.793 -3.215  1.00 82.92  ? 226 TYR Z CA    1 
ATOM   1753 C  C     . TYR A 1 226 ? -12.016 48.113 -3.499  1.00 86.01  ? 226 TYR Z C     1 
ATOM   1754 O  O     . TYR A 1 226 ? -12.098 48.981 -2.629  1.00 89.72  ? 226 TYR Z O     1 
ATOM   1755 C  CB    . TYR A 1 226 ? -9.830  46.906 -3.587  1.00 76.68  ? 226 TYR Z CB    1 
ATOM   1756 C  CG    . TYR A 1 226 ? -9.052  45.625 -3.386  1.00 78.76  ? 226 TYR Z CG    1 
ATOM   1757 C  CD1   . TYR A 1 226 ? -9.325  44.783 -2.316  1.00 77.38  ? 226 TYR Z CD1   1 
ATOM   1758 C  CD2   . TYR A 1 226 ? -8.050  45.252 -4.272  1.00 76.61  ? 226 TYR Z CD2   1 
ATOM   1759 C  CE1   . TYR A 1 226 ? -8.619  43.610 -2.132  1.00 77.77  ? 226 TYR Z CE1   1 
ATOM   1760 C  CE2   . TYR A 1 226 ? -7.341  44.081 -4.097  1.00 74.62  ? 226 TYR Z CE2   1 
ATOM   1761 C  CZ    . TYR A 1 226 ? -7.630  43.264 -3.025  1.00 75.83  ? 226 TYR Z CZ    1 
ATOM   1762 O  OH    . TYR A 1 226 ? -6.925  42.095 -2.846  1.00 75.04  ? 226 TYR Z OH    1 
ATOM   1763 N  N     . LEU A 1 227 ? -12.528 48.262 -4.716  1.00 83.41  ? 227 LEU Z N     1 
ATOM   1764 C  CA    . LEU A 1 227 ? -13.159 49.512 -5.121  1.00 84.58  ? 227 LEU Z CA    1 
ATOM   1765 C  C     . LEU A 1 227 ? -14.301 49.289 -6.103  1.00 87.37  ? 227 LEU Z C     1 
ATOM   1766 O  O     . LEU A 1 227 ? -14.108 48.708 -7.173  1.00 88.80  ? 227 LEU Z O     1 
ATOM   1767 C  CB    . LEU A 1 227 ? -12.125 50.452 -5.742  1.00 86.99  ? 227 LEU Z CB    1 
ATOM   1768 C  CG    . LEU A 1 227 ? -12.659 51.794 -6.244  1.00 89.06  ? 227 LEU Z CG    1 
ATOM   1769 C  CD1   . LEU A 1 227 ? -13.138 52.648 -5.082  1.00 88.00  ? 227 LEU Z CD1   1 
ATOM   1770 C  CD2   . LEU A 1 227 ? -11.599 52.522 -7.052  1.00 87.16  ? 227 LEU Z CD2   1 
ATOM   1771 N  N     . SER A 1 228 ? -15.490 49.757 -5.738  1.00 89.06  ? 228 SER Z N     1 
ATOM   1772 C  CA    . SER A 1 228 ? -16.635 49.682 -6.631  1.00 90.73  ? 228 SER Z CA    1 
ATOM   1773 C  C     . SER A 1 228 ? -16.431 50.632 -7.803  1.00 91.49  ? 228 SER Z C     1 
ATOM   1774 O  O     . SER A 1 228 ? -15.925 51.742 -7.629  1.00 92.97  ? 228 SER Z O     1 
ATOM   1775 C  CB    . SER A 1 228 ? -17.925 50.017 -5.885  1.00 91.85  ? 228 SER Z CB    1 
ATOM   1776 O  OG    . SER A 1 228 ? -18.122 49.142 -4.787  1.00 96.07  ? 228 SER Z OG    1 
ATOM   1777 N  N     . SER A 1 229 ? -16.817 50.192 -8.995  1.00 91.82  ? 229 SER Z N     1 
ATOM   1778 C  CA    . SER A 1 229 ? -16.643 50.997 -10.196 1.00 94.94  ? 229 SER Z CA    1 
ATOM   1779 C  C     . SER A 1 229 ? -17.661 52.125 -10.268 1.00 98.34  ? 229 SER Z C     1 
ATOM   1780 O  O     . SER A 1 229 ? -18.748 52.035 -9.694  1.00 99.52  ? 229 SER Z O     1 
ATOM   1781 C  CB    . SER A 1 229 ? -16.754 50.126 -11.448 1.00 92.88  ? 229 SER Z CB    1 
ATOM   1782 O  OG    . SER A 1 229 ? -18.049 49.562 -11.567 1.00 95.30  ? 229 SER Z OG    1 
ATOM   1783 N  N     . LEU A 1 230 ? -17.301 53.190 -10.975 1.00 99.45  ? 230 LEU Z N     1 
ATOM   1784 C  CA    . LEU A 1 230 ? -18.238 54.271 -11.239 1.00 102.31 ? 230 LEU Z CA    1 
ATOM   1785 C  C     . LEU A 1 230 ? -19.396 53.721 -12.055 1.00 106.93 ? 230 LEU Z C     1 
ATOM   1786 O  O     . LEU A 1 230 ? -19.196 52.878 -12.930 1.00 107.24 ? 230 LEU Z O     1 
ATOM   1787 C  CB    . LEU A 1 230 ? -17.553 55.422 -11.973 1.00 103.28 ? 230 LEU Z CB    1 
ATOM   1788 C  CG    . LEU A 1 230 ? -16.446 56.140 -11.202 1.00 99.28  ? 230 LEU Z CG    1 
ATOM   1789 C  CD1   . LEU A 1 230 ? -15.785 57.195 -12.073 1.00 102.88 ? 230 LEU Z CD1   1 
ATOM   1790 C  CD2   . LEU A 1 230 ? -17.004 56.764 -9.936  1.00 101.06 ? 230 LEU Z CD2   1 
ATOM   1791 N  N     . ARG A 1 231 ? -20.604 54.186 -11.756 1.00 109.29 ? 231 ARG Z N     1 
ATOM   1792 C  CA    . ARG A 1 231 ? -21.801 53.645 -12.385 1.00 113.71 ? 231 ARG Z CA    1 
ATOM   1793 C  C     . ARG A 1 231 ? -21.802 53.861 -13.895 1.00 118.40 ? 231 ARG Z C     1 
ATOM   1794 O  O     . ARG A 1 231 ? -21.766 54.995 -14.374 1.00 119.78 ? 231 ARG Z O     1 
ATOM   1795 C  CB    . ARG A 1 231 ? -23.052 54.265 -11.769 1.00 119.40 ? 231 ARG Z CB    1 
ATOM   1796 C  CG    . ARG A 1 231 ? -24.342 53.651 -12.274 1.00 123.02 ? 231 ARG Z CG    1 
ATOM   1797 C  CD    . ARG A 1 231 ? -25.480 53.966 -11.333 1.00 127.27 ? 231 ARG Z CD    1 
ATOM   1798 N  NE    . ARG A 1 231 ? -25.133 53.610 -9.961  1.00 131.20 ? 231 ARG Z NE    1 
ATOM   1799 C  CZ    . ARG A 1 231 ? -25.318 52.406 -9.431  1.00 132.40 ? 231 ARG Z CZ    1 
ATOM   1800 N  NH1   . ARG A 1 231 ? -24.970 52.174 -8.172  1.00 132.44 ? 231 ARG Z NH1   1 
ATOM   1801 N  NH2   . ARG A 1 231 ? -25.851 51.433 -10.160 1.00 132.27 ? 231 ARG Z NH2   1 
ATOM   1802 N  N     . GLY A 1 232 ? -21.842 52.759 -14.637 1.00 113.53 ? 232 GLY Z N     1 
ATOM   1803 C  CA    . GLY A 1 232 ? -21.832 52.811 -16.086 1.00 115.01 ? 232 GLY Z CA    1 
ATOM   1804 C  C     . GLY A 1 232 ? -20.487 52.412 -16.660 1.00 114.00 ? 232 GLY Z C     1 
ATOM   1805 O  O     . GLY A 1 232 ? -20.269 52.489 -17.869 1.00 116.29 ? 232 GLY Z O     1 
ATOM   1806 N  N     . ILE A 1 233 ? -19.580 51.984 -15.789 1.00 109.58 ? 233 ILE Z N     1 
ATOM   1807 C  CA    . ILE A 1 233 ? -18.249 51.578 -16.220 1.00 106.78 ? 233 ILE Z CA    1 
ATOM   1808 C  C     . ILE A 1 233 ? -18.033 50.077 -16.058 1.00 104.48 ? 233 ILE Z C     1 
ATOM   1809 O  O     . ILE A 1 233 ? -17.984 49.559 -14.942 1.00 102.21 ? 233 ILE Z O     1 
ATOM   1810 C  CB    . ILE A 1 233 ? -17.152 52.324 -15.442 1.00 101.72 ? 233 ILE Z CB    1 
ATOM   1811 C  CG1   . ILE A 1 233 ? -17.339 53.837 -15.571 1.00 104.79 ? 233 ILE Z CG1   1 
ATOM   1812 C  CG2   . ILE A 1 233 ? -15.779 51.916 -15.947 1.00 97.89  ? 233 ILE Z CG2   1 
ATOM   1813 C  CD1   . ILE A 1 233 ? -17.215 54.343 -16.986 1.00 108.59 ? 233 ILE Z CD1   1 
ATOM   1814 N  N     . GLY A 1 234 ? -17.905 49.385 -17.184 1.00 102.59 ? 234 GLY Z N     1 
ATOM   1815 C  CA    . GLY A 1 234 ? -17.615 47.965 -17.177 1.00 100.51 ? 234 GLY Z CA    1 
ATOM   1816 C  C     . GLY A 1 234 ? -16.223 47.712 -17.716 1.00 98.98  ? 234 GLY Z C     1 
ATOM   1817 O  O     . GLY A 1 234 ? -15.408 48.631 -17.806 1.00 99.67  ? 234 GLY Z O     1 
ATOM   1818 N  N     . LEU A 1 235 ? -15.951 46.465 -18.080 1.00 99.10  ? 235 LEU Z N     1 
ATOM   1819 C  CA    . LEU A 1 235 ? -14.649 46.095 -18.622 1.00 97.39  ? 235 LEU Z CA    1 
ATOM   1820 C  C     . LEU A 1 235 ? -14.390 46.773 -19.966 1.00 99.33  ? 235 LEU Z C     1 
ATOM   1821 O  O     . LEU A 1 235 ? -13.284 47.251 -20.231 1.00 100.77 ? 235 LEU Z O     1 
ATOM   1822 C  CB    . LEU A 1 235 ? -14.548 44.576 -18.770 1.00 94.11  ? 235 LEU Z CB    1 
ATOM   1823 C  CG    . LEU A 1 235 ? -14.556 43.758 -17.477 1.00 91.16  ? 235 LEU Z CG    1 
ATOM   1824 C  CD1   . LEU A 1 235 ? -15.094 42.365 -17.739 1.00 90.94  ? 235 LEU Z CD1   1 
ATOM   1825 C  CD2   . LEU A 1 235 ? -13.155 43.680 -16.894 1.00 87.70  ? 235 LEU Z CD2   1 
ATOM   1826 N  N     . ALA A 1 236 ? -15.422 46.825 -20.803 1.00 97.50  ? 236 ALA Z N     1 
ATOM   1827 C  CA    . ALA A 1 236 ? -15.287 47.336 -22.162 1.00 100.10 ? 236 ALA Z CA    1 
ATOM   1828 C  C     . ALA A 1 236 ? -14.933 48.821 -22.203 1.00 100.59 ? 236 ALA Z C     1 
ATOM   1829 O  O     . ALA A 1 236 ? -13.967 49.213 -22.854 1.00 101.35 ? 236 ALA Z O     1 
ATOM   1830 C  CB    . ALA A 1 236 ? -16.565 47.082 -22.945 1.00 107.01 ? 236 ALA Z CB    1 
ATOM   1831 N  N     . LYS A 1 237 ? -15.715 49.646 -21.515 1.00 106.38 ? 237 LYS Z N     1 
ATOM   1832 C  CA    . LYS A 1 237 ? -15.499 51.090 -21.555 1.00 107.57 ? 237 LYS Z CA    1 
ATOM   1833 C  C     . LYS A 1 237 ? -14.210 51.492 -20.840 1.00 104.66 ? 237 LYS Z C     1 
ATOM   1834 O  O     . LYS A 1 237 ? -13.568 52.472 -21.215 1.00 106.82 ? 237 LYS Z O     1 
ATOM   1835 C  CB    . LYS A 1 237 ? -16.696 51.831 -20.953 1.00 108.82 ? 237 LYS Z CB    1 
ATOM   1836 C  CG    . LYS A 1 237 ? -17.929 51.825 -21.846 1.00 113.05 ? 237 LYS Z CG    1 
ATOM   1837 C  CD    . LYS A 1 237 ? -19.067 52.625 -21.237 1.00 116.23 ? 237 LYS Z CD    1 
ATOM   1838 C  CE    . LYS A 1 237 ? -20.288 52.611 -22.142 1.00 122.41 ? 237 LYS Z CE    1 
ATOM   1839 N  NZ    . LYS A 1 237 ? -21.415 53.384 -21.551 1.00 124.49 ? 237 LYS Z NZ    1 
ATOM   1840 N  N     . ALA A 1 238 ? -13.834 50.734 -19.814 1.00 100.89 ? 238 ALA Z N     1 
ATOM   1841 C  CA    . ALA A 1 238 ? -12.562 50.957 -19.132 1.00 99.28  ? 238 ALA Z CA    1 
ATOM   1842 C  C     . ALA A 1 238 ? -11.405 50.647 -20.074 1.00 101.68 ? 238 ALA Z C     1 
ATOM   1843 O  O     . ALA A 1 238 ? -10.434 51.411 -20.172 1.00 102.51 ? 238 ALA Z O     1 
ATOM   1844 C  CB    . ALA A 1 238 ? -12.471 50.105 -17.880 1.00 94.37  ? 238 ALA Z CB    1 
ATOM   1845 N  N     . CYS A 1 239 ? -11.524 49.518 -20.767 1.00 99.50  ? 239 CYS Z N     1 
ATOM   1846 C  CA    . CYS A 1 239 ? -10.549 49.123 -21.772 1.00 101.83 ? 239 CYS Z CA    1 
ATOM   1847 C  C     . CYS A 1 239 ? -10.435 50.194 -22.850 1.00 107.02 ? 239 CYS Z C     1 
ATOM   1848 O  O     . CYS A 1 239 ? -9.342  50.486 -23.330 1.00 107.82 ? 239 CYS Z O     1 
ATOM   1849 C  CB    . CYS A 1 239 ? -10.934 47.778 -22.392 1.00 101.32 ? 239 CYS Z CB    1 
ATOM   1850 S  SG    . CYS A 1 239 ? -9.727  47.124 -23.567 1.00 104.33 ? 239 CYS Z SG    1 
ATOM   1851 N  N     . LYS A 1 240 ? -11.571 50.784 -23.213 1.00 105.73 ? 240 LYS Z N     1 
ATOM   1852 C  CA    . LYS A 1 240 ? -11.606 51.845 -24.214 1.00 111.29 ? 240 LYS Z CA    1 
ATOM   1853 C  C     . LYS A 1 240 ? -10.889 53.091 -23.708 1.00 111.76 ? 240 LYS Z C     1 
ATOM   1854 O  O     . LYS A 1 240 ? -10.165 53.751 -24.458 1.00 115.47 ? 240 LYS Z O     1 
ATOM   1855 C  CB    . LYS A 1 240 ? -13.049 52.186 -24.592 1.00 113.39 ? 240 LYS Z CB    1 
ATOM   1856 C  CG    . LYS A 1 240 ? -13.176 53.251 -25.676 1.00 120.04 ? 240 LYS Z CG    1 
ATOM   1857 C  CD    . LYS A 1 240 ? -14.633 53.598 -25.941 1.00 121.53 ? 240 LYS Z CD    1 
ATOM   1858 C  CE    . LYS A 1 240 ? -14.767 54.629 -27.049 1.00 125.94 ? 240 LYS Z CE    1 
ATOM   1859 N  NZ    . LYS A 1 240 ? -14.264 54.102 -28.348 1.00 132.88 ? 240 LYS Z NZ    1 
ATOM   1860 N  N     . VAL A 1 241 ? -11.103 53.409 -22.434 1.00 109.65 ? 241 VAL Z N     1 
ATOM   1861 C  CA    . VAL A 1 241 ? -10.423 54.529 -21.794 1.00 109.66 ? 241 VAL Z CA    1 
ATOM   1862 C  C     . VAL A 1 241 ? -8.914  54.337 -21.851 1.00 110.54 ? 241 VAL Z C     1 
ATOM   1863 O  O     . VAL A 1 241 ? -8.171  55.265 -22.175 1.00 113.67 ? 241 VAL Z O     1 
ATOM   1864 C  CB    . VAL A 1 241 ? -10.860 54.699 -20.322 1.00 106.66 ? 241 VAL Z CB    1 
ATOM   1865 C  CG1   . VAL A 1 241 ? -9.921  55.645 -19.586 1.00 107.30 ? 241 VAL Z CG1   1 
ATOM   1866 C  CG2   . VAL A 1 241 ? -12.288 55.203 -20.246 1.00 110.10 ? 241 VAL Z CG2   1 
ATOM   1867 N  N     . LEU A 1 242 ? -8.464  53.123 -21.550 1.00 109.97 ? 242 LEU Z N     1 
ATOM   1868 C  CA    . LEU A 1 242 ? -7.033  52.838 -21.547 1.00 109.84 ? 242 LEU Z CA    1 
ATOM   1869 C  C     . LEU A 1 242 ? -6.442  52.777 -22.956 1.00 115.69 ? 242 LEU Z C     1 
ATOM   1870 O  O     . LEU A 1 242 ? -5.258  53.059 -23.151 1.00 116.39 ? 242 LEU Z O     1 
ATOM   1871 C  CB    . LEU A 1 242 ? -6.760  51.533 -20.805 1.00 104.02 ? 242 LEU Z CB    1 
ATOM   1872 C  CG    . LEU A 1 242 ? -7.132  51.583 -19.323 1.00 99.80  ? 242 LEU Z CG    1 
ATOM   1873 C  CD1   . LEU A 1 242 ? -6.918  50.235 -18.680 1.00 90.82  ? 242 LEU Z CD1   1 
ATOM   1874 C  CD2   . LEU A 1 242 ? -6.325  52.653 -18.608 1.00 99.11  ? 242 LEU Z CD2   1 
ATOM   1875 N  N     . ARG A 1 243 ? -7.262  52.408 -23.935 1.00 108.79 ? 243 ARG Z N     1 
ATOM   1876 C  CA    . ARG A 1 243 ? -6.815  52.366 -25.325 1.00 113.91 ? 243 ARG Z CA    1 
ATOM   1877 C  C     . ARG A 1 243 ? -6.677  53.770 -25.906 1.00 119.15 ? 243 ARG Z C     1 
ATOM   1878 O  O     . ARG A 1 243 ? -5.746  54.051 -26.661 1.00 121.03 ? 243 ARG Z O     1 
ATOM   1879 C  CB    . ARG A 1 243 ? -7.780  51.545 -26.183 1.00 114.91 ? 243 ARG Z CB    1 
ATOM   1880 C  CG    . ARG A 1 243 ? -7.677  50.044 -25.980 1.00 112.27 ? 243 ARG Z CG    1 
ATOM   1881 C  CD    . ARG A 1 243 ? -8.613  49.297 -26.922 1.00 112.86 ? 243 ARG Z CD    1 
ATOM   1882 N  NE    . ARG A 1 243 ? -10.014 49.640 -26.691 1.00 115.40 ? 243 ARG Z NE    1 
ATOM   1883 C  CZ    . ARG A 1 243 ? -11.025 49.194 -27.430 1.00 121.08 ? 243 ARG Z CZ    1 
ATOM   1884 N  NH1   . ARG A 1 243 ? -10.792 48.384 -28.456 1.00 125.01 ? 243 ARG Z NH1   1 
ATOM   1885 N  NH2   . ARG A 1 243 ? -12.268 49.560 -27.145 1.00 118.87 ? 243 ARG Z NH2   1 
ATOM   1886 N  N     . LEU A 1 244 ? -7.609  54.648 -25.547 1.00 116.39 ? 244 LEU Z N     1 
ATOM   1887 C  CA    . LEU A 1 244 ? -7.607  56.020 -26.047 1.00 119.23 ? 244 LEU Z CA    1 
ATOM   1888 C  C     . LEU A 1 244 ? -6.660  56.919 -25.259 1.00 122.23 ? 244 LEU Z C     1 
ATOM   1889 O  O     . LEU A 1 244 ? -6.535  58.108 -25.554 1.00 127.58 ? 244 LEU Z O     1 
ATOM   1890 C  CB    . LEU A 1 244 ? -9.021  56.606 -26.008 1.00 117.92 ? 244 LEU Z CB    1 
ATOM   1891 C  CG    . LEU A 1 244 ? -9.925  56.399 -27.226 1.00 121.05 ? 244 LEU Z CG    1 
ATOM   1892 C  CD1   . LEU A 1 244 ? -10.178 54.923 -27.494 1.00 119.31 ? 244 LEU Z CD1   1 
ATOM   1893 C  CD2   . LEU A 1 244 ? -11.236 57.143 -27.034 1.00 122.55 ? 244 LEU Z CD2   1 
ATOM   1894 N  N     . ALA A 1 245 ? -5.996  56.351 -24.258 1.00 120.07 ? 245 ALA Z N     1 
ATOM   1895 C  CA    . ALA A 1 245 ? -5.104  57.128 -23.407 1.00 124.67 ? 245 ALA Z CA    1 
ATOM   1896 C  C     . ALA A 1 245 ? -3.650  57.013 -23.849 1.00 133.08 ? 245 ALA Z C     1 
ATOM   1897 O  O     . ALA A 1 245 ? -3.086  55.921 -23.894 1.00 131.17 ? 245 ALA Z O     1 
ATOM   1898 C  CB    . ALA A 1 245 ? -5.250  56.693 -21.956 1.00 118.77 ? 245 ALA Z CB    1 
ATOM   1899 N  N     . ASN A 1 246 ? -3.055  58.155 -24.178 1.00 129.46 ? 246 ASN Z N     1 
ATOM   1900 C  CA    . ASN A 1 246 ? -1.641  58.217 -24.525 1.00 139.31 ? 246 ASN Z CA    1 
ATOM   1901 C  C     . ASN A 1 246 ? -0.808  58.634 -23.318 1.00 136.73 ? 246 ASN Z C     1 
ATOM   1902 O  O     . ASN A 1 246 ? 0.384   58.920 -23.439 1.00 142.18 ? 246 ASN Z O     1 
ATOM   1903 C  CB    . ASN A 1 246 ? -1.409  59.197 -25.680 1.00 156.09 ? 246 ASN Z CB    1 
ATOM   1904 C  CG    . ASN A 1 246 ? -2.226  58.857 -26.913 1.00 155.70 ? 246 ASN Z CG    1 
ATOM   1905 O  OD1   . ASN A 1 246 ? -1.753  58.163 -27.813 1.00 157.77 ? 246 ASN Z OD1   1 
ATOM   1906 N  ND2   . ASN A 1 246 ? -3.461  59.350 -26.962 1.00 153.63 ? 246 ASN Z ND2   1 
ATOM   1907 N  N     . ASN A 1 247 ? -1.449  58.666 -22.154 1.00 140.95 ? 247 ASN Z N     1 
ATOM   1908 C  CA    . ASN A 1 247 ? -0.822  59.178 -20.942 1.00 137.18 ? 247 ASN Z CA    1 
ATOM   1909 C  C     . ASN A 1 247 ? -0.479  58.071 -19.947 1.00 132.25 ? 247 ASN Z C     1 
ATOM   1910 O  O     . ASN A 1 247 ? -1.330  57.242 -19.617 1.00 129.47 ? 247 ASN Z O     1 
ATOM   1911 C  CB    . ASN A 1 247 ? -1.740  60.214 -20.286 1.00 135.52 ? 247 ASN Z CB    1 
ATOM   1912 C  CG    . ASN A 1 247 ? -1.003  61.135 -19.331 1.00 134.21 ? 247 ASN Z CG    1 
ATOM   1913 O  OD1   . ASN A 1 247 ? -0.288  60.686 -18.436 1.00 130.45 ? 247 ASN Z OD1   1 
ATOM   1914 N  ND2   . ASN A 1 247 ? -1.176  62.438 -19.521 1.00 137.29 ? 247 ASN Z ND2   1 
ATOM   1915 N  N     . PRO A 1 248 ? 0.778   58.053 -19.469 1.00 136.28 ? 248 PRO Z N     1 
ATOM   1916 C  CA    . PRO A 1 248 ? 1.231   57.074 -18.473 1.00 130.95 ? 248 PRO Z CA    1 
ATOM   1917 C  C     . PRO A 1 248 ? 0.677   57.345 -17.073 1.00 126.62 ? 248 PRO Z C     1 
ATOM   1918 O  O     . PRO A 1 248 ? 0.371   56.398 -16.350 1.00 120.85 ? 248 PRO Z O     1 
ATOM   1919 C  CB    . PRO A 1 248 ? 2.753   57.232 -18.495 1.00 131.72 ? 248 PRO Z CB    1 
ATOM   1920 C  CG    . PRO A 1 248 ? 2.976   58.632 -18.955 1.00 135.67 ? 248 PRO Z CG    1 
ATOM   1921 C  CD    . PRO A 1 248 ? 1.878   58.917 -19.935 1.00 139.16 ? 248 PRO Z CD    1 
ATOM   1922 N  N     . ASP A 1 249 ? 0.552   58.616 -16.701 1.00 131.67 ? 249 ASP Z N     1 
ATOM   1923 C  CA    . ASP A 1 249 ? 0.017   58.977 -15.392 1.00 126.75 ? 249 ASP Z CA    1 
ATOM   1924 C  C     . ASP A 1 249 ? -1.479  58.679 -15.325 1.00 121.64 ? 249 ASP Z C     1 
ATOM   1925 O  O     . ASP A 1 249 ? -2.285  59.346 -15.975 1.00 121.98 ? 249 ASP Z O     1 
ATOM   1926 C  CB    . ASP A 1 249 ? 0.282   60.454 -15.090 1.00 128.07 ? 249 ASP Z CB    1 
ATOM   1927 C  CG    . ASP A 1 249 ? -0.043  60.822 -13.654 1.00 125.53 ? 249 ASP Z CG    1 
ATOM   1928 O  OD1   . ASP A 1 249 ? 0.810   60.589 -12.771 1.00 123.63 ? 249 ASP Z OD1   1 
ATOM   1929 O  OD2   . ASP A 1 249 ? -1.151  61.346 -13.409 1.00 124.89 ? 249 ASP Z OD2   1 
ATOM   1930 N  N     . ILE A 1 250 ? -1.840  57.678 -14.528 1.00 118.11 ? 250 ILE Z N     1 
ATOM   1931 C  CA    . ILE A 1 250 ? -3.206  57.168 -14.498 1.00 112.12 ? 250 ILE Z CA    1 
ATOM   1932 C  C     . ILE A 1 250 ? -4.200  58.149 -13.867 1.00 110.96 ? 250 ILE Z C     1 
ATOM   1933 O  O     . ILE A 1 250 ? -5.372  58.173 -14.242 1.00 109.09 ? 250 ILE Z O     1 
ATOM   1934 C  CB    . ILE A 1 250 ? -3.267  55.812 -13.747 1.00 104.11 ? 250 ILE Z CB    1 
ATOM   1935 C  CG1   . ILE A 1 250 ? -4.659  55.186 -13.861 1.00 98.83  ? 250 ILE Z CG1   1 
ATOM   1936 C  CG2   . ILE A 1 250 ? -2.847  55.975 -12.289 1.00 101.89 ? 250 ILE Z CG2   1 
ATOM   1937 C  CD1   . ILE A 1 250 ? -5.110  54.964 -15.287 1.00 99.36  ? 250 ILE Z CD1   1 
ATOM   1938 N  N     . VAL A 1 251 ? -3.732  58.964 -12.926 1.00 112.12 ? 251 VAL Z N     1 
ATOM   1939 C  CA    . VAL A 1 251 ? -4.602  59.898 -12.212 1.00 111.47 ? 251 VAL Z CA    1 
ATOM   1940 C  C     . VAL A 1 251 ? -5.255  60.904 -13.158 1.00 114.91 ? 251 VAL Z C     1 
ATOM   1941 O  O     . VAL A 1 251 ? -6.478  61.077 -13.160 1.00 112.60 ? 251 VAL Z O     1 
ATOM   1942 C  CB    . VAL A 1 251 ? -3.828  60.666 -11.123 1.00 112.60 ? 251 VAL Z CB    1 
ATOM   1943 C  CG1   . VAL A 1 251 ? -4.735  61.671 -10.432 1.00 109.37 ? 251 VAL Z CG1   1 
ATOM   1944 C  CG2   . VAL A 1 251 ? -3.230  59.697 -10.114 1.00 108.57 ? 251 VAL Z CG2   1 
ATOM   1945 N  N     . LYS A 1 252 ? -4.428  61.556 -13.969 1.00 113.82 ? 252 LYS Z N     1 
ATOM   1946 C  CA    . LYS A 1 252 ? -4.902  62.552 -14.922 1.00 115.01 ? 252 LYS Z CA    1 
ATOM   1947 C  C     . LYS A 1 252 ? -5.803  61.920 -15.979 1.00 113.75 ? 252 LYS Z C     1 
ATOM   1948 O  O     . LYS A 1 252 ? -6.675  62.583 -16.540 1.00 116.08 ? 252 LYS Z O     1 
ATOM   1949 C  CB    . LYS A 1 252 ? -3.716  63.258 -15.581 1.00 118.63 ? 252 LYS Z CB    1 
ATOM   1950 C  CG    . LYS A 1 252 ? -2.772  63.912 -14.582 1.00 121.97 ? 252 LYS Z CG    1 
ATOM   1951 C  CD    . LYS A 1 252 ? -1.467  64.326 -15.237 1.00 129.26 ? 252 LYS Z CD    1 
ATOM   1952 C  CE    . LYS A 1 252 ? -0.486  64.867 -14.211 1.00 127.95 ? 252 LYS Z CE    1 
ATOM   1953 N  NZ    . LYS A 1 252 ? 0.825   65.205 -14.830 1.00 136.12 ? 252 LYS Z NZ    1 
ATOM   1954 N  N     . VAL A 1 253 ? -5.590  60.634 -16.242 1.00 109.59 ? 253 VAL Z N     1 
ATOM   1955 C  CA    . VAL A 1 253 ? -6.428  59.891 -17.177 1.00 110.44 ? 253 VAL Z CA    1 
ATOM   1956 C  C     . VAL A 1 253 ? -7.815  59.658 -16.586 1.00 111.29 ? 253 VAL Z C     1 
ATOM   1957 O  O     . VAL A 1 253 ? -8.830  59.883 -17.247 1.00 112.22 ? 253 VAL Z O     1 
ATOM   1958 C  CB    . VAL A 1 253 ? -5.800  58.533 -17.550 1.00 109.97 ? 253 VAL Z CB    1 
ATOM   1959 C  CG1   . VAL A 1 253 ? -6.766  57.709 -18.389 1.00 109.74 ? 253 VAL Z CG1   1 
ATOM   1960 C  CG2   . VAL A 1 253 ? -4.489  58.741 -18.287 1.00 119.08 ? 253 VAL Z CG2   1 
ATOM   1961 N  N     . ILE A 1 254 ? -7.846  59.210 -15.335 1.00 112.44 ? 254 ILE Z N     1 
ATOM   1962 C  CA    . ILE A 1 254 ? -9.098  58.973 -14.624 1.00 109.39 ? 254 ILE Z CA    1 
ATOM   1963 C  C     . ILE A 1 254 ? -9.888  60.269 -14.474 1.00 111.60 ? 254 ILE Z C     1 
ATOM   1964 O  O     . ILE A 1 254 ? -11.117 60.271 -14.554 1.00 110.96 ? 254 ILE Z O     1 
ATOM   1965 C  CB    . ILE A 1 254 ? -8.844  58.354 -13.235 1.00 104.00 ? 254 ILE Z CB    1 
ATOM   1966 C  CG1   . ILE A 1 254 ? -8.175  56.988 -13.384 1.00 100.68 ? 254 ILE Z CG1   1 
ATOM   1967 C  CG2   . ILE A 1 254 ? -10.141 58.215 -12.451 1.00 99.11  ? 254 ILE Z CG2   1 
ATOM   1968 C  CD1   . ILE A 1 254 ? -7.846  56.325 -12.072 1.00 95.03  ? 254 ILE Z CD1   1 
ATOM   1969 N  N     . LYS A 1 255 ? -9.178  61.375 -14.267 1.00 112.98 ? 255 LYS Z N     1 
ATOM   1970 C  CA    . LYS A 1 255 ? -9.829  62.679 -14.197 1.00 114.61 ? 255 LYS Z CA    1 
ATOM   1971 C  C     . LYS A 1 255 ? -10.450 63.061 -15.542 1.00 117.61 ? 255 LYS Z C     1 
ATOM   1972 O  O     . LYS A 1 255 ? -11.442 63.788 -15.592 1.00 117.98 ? 255 LYS Z O     1 
ATOM   1973 C  CB    . LYS A 1 255 ? -8.835  63.755 -13.750 1.00 114.33 ? 255 LYS Z CB    1 
ATOM   1974 C  CG    . LYS A 1 255 ? -8.357  63.603 -12.311 1.00 111.42 ? 255 LYS Z CG    1 
ATOM   1975 C  CD    . LYS A 1 255 ? -7.397  64.716 -11.930 1.00 111.90 ? 255 LYS Z CD    1 
ATOM   1976 C  CE    . LYS A 1 255 ? -6.969  64.610 -10.478 1.00 110.88 ? 255 LYS Z CE    1 
ATOM   1977 N  NZ    . LYS A 1 255 ? -5.995  65.676 -10.120 1.00 115.25 ? 255 LYS Z NZ    1 
ATOM   1978 N  N     . LYS A 1 256 ? -9.863  62.564 -16.627 1.00 115.03 ? 256 LYS Z N     1 
ATOM   1979 C  CA    . LYS A 1 256 ? -10.345 62.872 -17.973 1.00 117.78 ? 256 LYS Z CA    1 
ATOM   1980 C  C     . LYS A 1 256 ? -11.206 61.751 -18.560 1.00 119.85 ? 256 LYS Z C     1 
ATOM   1981 O  O     . LYS A 1 256 ? -11.342 61.645 -19.781 1.00 121.59 ? 256 LYS Z O     1 
ATOM   1982 C  CB    . LYS A 1 256 ? -9.165  63.156 -18.910 1.00 119.47 ? 256 LYS Z CB    1 
ATOM   1983 C  CG    . LYS A 1 256 ? -8.669  64.596 -18.898 1.00 121.73 ? 256 LYS Z CG    1 
ATOM   1984 C  CD    . LYS A 1 256 ? -7.433  64.757 -19.777 1.00 123.88 ? 256 LYS Z CD    1 
ATOM   1985 C  CE    . LYS A 1 256 ? -7.129  66.223 -20.060 1.00 128.81 ? 256 LYS Z CE    1 
ATOM   1986 N  NZ    . LYS A 1 256 ? -8.201  66.861 -20.879 1.00 134.19 ? 256 LYS Z NZ    1 
ATOM   1987 N  N     . ILE A 1 257 ? -11.790 60.924 -17.696 1.00 116.53 ? 257 ILE Z N     1 
ATOM   1988 C  CA    . ILE A 1 257 ? -12.592 59.785 -18.145 1.00 117.09 ? 257 ILE Z CA    1 
ATOM   1989 C  C     . ILE A 1 257 ? -13.794 60.250 -18.974 1.00 118.60 ? 257 ILE Z C     1 
ATOM   1990 O  O     . ILE A 1 257 ? -14.206 59.576 -19.922 1.00 119.86 ? 257 ILE Z O     1 
ATOM   1991 C  CB    . ILE A 1 257 ? -13.072 58.917 -16.949 1.00 115.90 ? 257 ILE Z CB    1 
ATOM   1992 C  CG1   . ILE A 1 257 ? -13.803 57.666 -17.442 1.00 114.77 ? 257 ILE Z CG1   1 
ATOM   1993 C  CG2   . ILE A 1 257 ? -13.950 59.719 -16.003 1.00 116.34 ? 257 ILE Z CG2   1 
ATOM   1994 C  CD1   . ILE A 1 257 ? -14.342 56.796 -16.324 1.00 116.27 ? 257 ILE Z CD1   1 
ATOM   1995 N  N     . GLY A 1 258 ? -14.332 61.417 -18.633 1.00 120.18 ? 258 GLY Z N     1 
ATOM   1996 C  CA    . GLY A 1 258 ? -15.422 62.005 -19.388 1.00 121.80 ? 258 GLY Z CA    1 
ATOM   1997 C  C     . GLY A 1 258 ? -14.974 62.435 -20.773 1.00 122.43 ? 258 GLY Z C     1 
ATOM   1998 O  O     . GLY A 1 258 ? -15.769 62.467 -21.712 1.00 121.94 ? 258 GLY Z O     1 
ATOM   1999 N  N     . HIS A 1 259 ? -13.692 62.767 -20.897 1.00 122.43 ? 259 HIS Z N     1 
ATOM   2000 C  CA    . HIS A 1 259 ? -13.116 63.158 -22.180 1.00 123.60 ? 259 HIS Z CA    1 
ATOM   2001 C  C     . HIS A 1 259 ? -12.817 61.937 -23.045 1.00 123.26 ? 259 HIS Z C     1 
ATOM   2002 O  O     . HIS A 1 259 ? -13.032 61.959 -24.256 1.00 125.27 ? 259 HIS Z O     1 
ATOM   2003 C  CB    . HIS A 1 259 ? -11.841 63.981 -21.968 1.00 125.69 ? 259 HIS Z CB    1 
ATOM   2004 C  CG    . HIS A 1 259 ? -10.982 64.096 -23.189 1.00 130.79 ? 259 HIS Z CG    1 
ATOM   2005 N  ND1   . HIS A 1 259 ? -11.480 64.474 -24.418 1.00 135.19 ? 259 HIS Z ND1   1 
ATOM   2006 C  CD2   . HIS A 1 259 ? -9.656  63.885 -23.370 1.00 129.33 ? 259 HIS Z CD2   1 
ATOM   2007 C  CE1   . HIS A 1 259 ? -10.499 64.487 -25.303 1.00 135.32 ? 259 HIS Z CE1   1 
ATOM   2008 N  NE2   . HIS A 1 259 ? -9.382  64.135 -24.692 1.00 132.72 ? 259 HIS Z NE2   1 
ATOM   2009 N  N     . TYR A 1 260 ? -12.323 60.874 -22.417 1.00 123.89 ? 260 TYR Z N     1 
ATOM   2010 C  CA    . TYR A 1 260 ? -11.970 59.659 -23.147 1.00 121.36 ? 260 TYR Z CA    1 
ATOM   2011 C  C     . TYR A 1 260 ? -13.202 58.857 -23.563 1.00 121.76 ? 260 TYR Z C     1 
ATOM   2012 O  O     . TYR A 1 260 ? -13.183 58.167 -24.583 1.00 120.30 ? 260 TYR Z O     1 
ATOM   2013 C  CB    . TYR A 1 260 ? -11.033 58.782 -22.311 1.00 118.76 ? 260 TYR Z CB    1 
ATOM   2014 C  CG    . TYR A 1 260 ? -9.644  59.359 -22.141 1.00 119.12 ? 260 TYR Z CG    1 
ATOM   2015 C  CD1   . TYR A 1 260 ? -8.784  59.482 -23.226 1.00 119.58 ? 260 TYR Z CD1   1 
ATOM   2016 C  CD2   . TYR A 1 260 ? -9.188  59.769 -20.894 1.00 118.87 ? 260 TYR Z CD2   1 
ATOM   2017 C  CE1   . TYR A 1 260 ? -7.512  60.008 -23.074 1.00 120.90 ? 260 TYR Z CE1   1 
ATOM   2018 C  CE2   . TYR A 1 260 ? -7.920  60.295 -20.733 1.00 118.31 ? 260 TYR Z CE2   1 
ATOM   2019 C  CZ    . TYR A 1 260 ? -7.086  60.412 -21.824 1.00 120.07 ? 260 TYR Z CZ    1 
ATOM   2020 O  OH    . TYR A 1 260 ? -5.823  60.934 -21.658 1.00 121.14 ? 260 TYR Z OH    1 
ATOM   2021 N  N     . LEU A 1 261 ? -14.271 58.947 -22.777 1.00 119.79 ? 261 LEU Z N     1 
ATOM   2022 C  CA    . LEU A 1 261 ? -15.503 58.232 -23.101 1.00 120.03 ? 261 LEU Z CA    1 
ATOM   2023 C  C     . LEU A 1 261 ? -16.520 59.127 -23.798 1.00 122.93 ? 261 LEU Z C     1 
ATOM   2024 O  O     . LEU A 1 261 ? -17.577 58.658 -24.223 1.00 124.43 ? 261 LEU Z O     1 
ATOM   2025 C  CB    . LEU A 1 261 ? -16.128 57.634 -21.840 1.00 120.53 ? 261 LEU Z CB    1 
ATOM   2026 C  CG    . LEU A 1 261 ? -15.537 56.313 -21.347 1.00 118.19 ? 261 LEU Z CG    1 
ATOM   2027 C  CD1   . LEU A 1 261 ? -16.396 55.727 -20.240 1.00 114.14 ? 261 LEU Z CD1   1 
ATOM   2028 C  CD2   . LEU A 1 261 ? -15.387 55.326 -22.495 1.00 116.00 ? 261 LEU Z CD2   1 
ATOM   2029 N  N     . LYS A 1 262 ? -16.185 60.409 -23.916 1.00 123.74 ? 262 LYS Z N     1 
ATOM   2030 C  CA    . LYS A 1 262 ? -17.077 61.410 -24.498 1.00 124.06 ? 262 LYS Z CA    1 
ATOM   2031 C  C     . LYS A 1 262 ? -18.434 61.423 -23.799 1.00 124.79 ? 262 LYS Z C     1 
ATOM   2032 O  O     . LYS A 1 262 ? -19.477 61.530 -24.445 1.00 125.96 ? 262 LYS Z O     1 
ATOM   2033 C  CB    . LYS A 1 262 ? -17.258 61.170 -26.000 1.00 124.81 ? 262 LYS Z CB    1 
ATOM   2034 C  CG    . LYS A 1 262 ? -15.957 61.163 -26.787 1.00 125.37 ? 262 LYS Z CG    1 
ATOM   2035 C  CD    . LYS A 1 262 ? -16.210 61.229 -28.284 1.00 125.92 ? 262 LYS Z CD    1 
ATOM   2036 C  CE    . LYS A 1 262 ? -16.868 62.547 -28.673 1.00 130.65 ? 262 LYS Z CE    1 
ATOM   2037 N  NZ    . LYS A 1 262 ? -17.091 62.642 -30.150 1.00 132.46 ? 262 LYS Z NZ    1 
ATOM   2038 N  N     . MET A 1 263 ? -18.407 61.307 -22.475 1.00 123.03 ? 263 MET Z N     1 
ATOM   2039 C  CA    . MET A 1 263 ? -19.620 61.348 -21.667 1.00 122.60 ? 263 MET Z CA    1 
ATOM   2040 C  C     . MET A 1 263 ? -19.460 62.361 -20.540 1.00 123.02 ? 263 MET Z C     1 
ATOM   2041 O  O     . MET A 1 263 ? -18.356 62.835 -20.276 1.00 121.53 ? 263 MET Z O     1 
ATOM   2042 C  CB    . MET A 1 263 ? -19.938 59.964 -21.097 1.00 122.98 ? 263 MET Z CB    1 
ATOM   2043 C  CG    . MET A 1 263 ? -20.046 58.877 -22.152 1.00 124.63 ? 263 MET Z CG    1 
ATOM   2044 S  SD    . MET A 1 263 ? -20.020 57.210 -21.463 1.00 133.35 ? 263 MET Z SD    1 
ATOM   2045 C  CE    . MET A 1 263 ? -20.110 56.235 -22.967 1.00 123.20 ? 263 MET Z CE    1 
ATOM   2046 N  N     . ASN A 1 264 ? -20.561 62.693 -19.876 1.00 125.01 ? 264 ASN Z N     1 
ATOM   2047 C  CA    . ASN A 1 264 ? -20.516 63.630 -18.762 1.00 124.65 ? 264 ASN Z CA    1 
ATOM   2048 C  C     . ASN A 1 264 ? -20.240 62.901 -17.450 1.00 123.15 ? 264 ASN Z C     1 
ATOM   2049 O  O     . ASN A 1 264 ? -21.122 62.773 -16.601 1.00 126.68 ? 264 ASN Z O     1 
ATOM   2050 C  CB    . ASN A 1 264 ? -21.825 64.420 -18.672 1.00 127.46 ? 264 ASN Z CB    1 
ATOM   2051 C  CG    . ASN A 1 264 ? -21.689 65.690 -17.848 1.00 127.46 ? 264 ASN Z CG    1 
ATOM   2052 O  OD1   . ASN A 1 264 ? -20.947 65.735 -16.867 1.00 124.61 ? 264 ASN Z OD1   1 
ATOM   2053 N  ND2   . ASN A 1 264 ? -22.406 66.733 -18.251 1.00 128.09 ? 264 ASN Z ND2   1 
ATOM   2054 N  N     . ILE A 1 265 ? -19.011 62.420 -17.294 1.00 121.70 ? 265 ILE Z N     1 
ATOM   2055 C  CA    . ILE A 1 265 ? -18.626 61.676 -16.101 1.00 119.00 ? 265 ILE Z CA    1 
ATOM   2056 C  C     . ILE A 1 265 ? -17.925 62.572 -15.086 1.00 117.90 ? 265 ILE Z C     1 
ATOM   2057 O  O     . ILE A 1 265 ? -16.928 63.222 -15.401 1.00 117.19 ? 265 ILE Z O     1 
ATOM   2058 C  CB    . ILE A 1 265 ? -17.698 60.496 -16.448 1.00 118.27 ? 265 ILE Z CB    1 
ATOM   2059 C  CG1   . ILE A 1 265 ? -18.240 59.723 -17.651 1.00 121.36 ? 265 ILE Z CG1   1 
ATOM   2060 C  CG2   . ILE A 1 265 ? -17.530 59.579 -15.248 1.00 116.22 ? 265 ILE Z CG2   1 
ATOM   2061 C  CD1   . ILE A 1 265 ? -17.355 58.576 -18.082 1.00 118.99 ? 265 ILE Z CD1   1 
ATOM   2062 N  N     . THR A 1 266 ? -18.455 62.601 -13.866 1.00 120.97 ? 266 THR Z N     1 
ATOM   2063 C  CA    . THR A 1 266 ? -17.854 63.368 -12.780 1.00 115.63 ? 266 THR Z CA    1 
ATOM   2064 C  C     . THR A 1 266 ? -17.172 62.440 -11.784 1.00 113.82 ? 266 THR Z C     1 
ATOM   2065 O  O     . THR A 1 266 ? -17.802 61.541 -11.228 1.00 114.30 ? 266 THR Z O     1 
ATOM   2066 C  CB    . THR A 1 266 ? -18.896 64.225 -12.037 1.00 117.60 ? 266 THR Z CB    1 
ATOM   2067 O  OG1   . THR A 1 266 ? -19.492 65.157 -12.947 1.00 119.66 ? 266 THR Z OG1   1 
ATOM   2068 C  CG2   . THR A 1 266 ? -18.240 64.986 -10.893 1.00 117.18 ? 266 THR Z CG2   1 
ATOM   2069 N  N     . VAL A 1 267 ? -15.883 62.664 -11.560 1.00 111.26 ? 267 VAL Z N     1 
ATOM   2070 C  CA    . VAL A 1 267 ? -15.113 61.817 -10.660 1.00 109.91 ? 267 VAL Z CA    1 
ATOM   2071 C  C     . VAL A 1 267 ? -14.953 62.455 -9.284  1.00 110.97 ? 267 VAL Z C     1 
ATOM   2072 O  O     . VAL A 1 267 ? -14.321 63.502 -9.150  1.00 112.10 ? 267 VAL Z O     1 
ATOM   2073 C  CB    . VAL A 1 267 ? -13.719 61.513 -11.236 1.00 108.07 ? 267 VAL Z CB    1 
ATOM   2074 C  CG1   . VAL A 1 267 ? -12.931 60.631 -10.282 1.00 106.93 ? 267 VAL Z CG1   1 
ATOM   2075 C  CG2   . VAL A 1 267 ? -13.847 60.849 -12.592 1.00 107.34 ? 267 VAL Z CG2   1 
ATOM   2076 N  N     . PRO A 1 268 ? -15.543 61.826 -8.255  1.00 110.55 ? 268 PRO Z N     1 
ATOM   2077 C  CA    . PRO A 1 268 ? -15.348 62.274 -6.873  1.00 109.96 ? 268 PRO Z CA    1 
ATOM   2078 C  C     . PRO A 1 268 ? -13.875 62.202 -6.486  1.00 109.76 ? 268 PRO Z C     1 
ATOM   2079 O  O     . PRO A 1 268 ? -13.188 61.265 -6.892  1.00 108.32 ? 268 PRO Z O     1 
ATOM   2080 C  CB    . PRO A 1 268 ? -16.188 61.285 -6.058  1.00 108.72 ? 268 PRO Z CB    1 
ATOM   2081 C  CG    . PRO A 1 268 ? -17.195 60.753 -7.023  1.00 109.00 ? 268 PRO Z CG    1 
ATOM   2082 C  CD    . PRO A 1 268 ? -16.488 60.700 -8.342  1.00 108.94 ? 268 PRO Z CD    1 
ATOM   2083 N  N     . GLU A 1 269 ? -13.399 63.174 -5.716  1.00 117.31 ? 269 GLU Z N     1 
ATOM   2084 C  CA    . GLU A 1 269 ? -11.980 63.256 -5.382  1.00 115.72 ? 269 GLU Z CA    1 
ATOM   2085 C  C     . GLU A 1 269 ? -11.538 62.165 -4.410  1.00 111.27 ? 269 GLU Z C     1 
ATOM   2086 O  O     . GLU A 1 269 ? -10.343 61.978 -4.187  1.00 108.59 ? 269 GLU Z O     1 
ATOM   2087 C  CB    . GLU A 1 269 ? -11.650 64.636 -4.808  1.00 122.18 ? 269 GLU Z CB    1 
ATOM   2088 C  CG    . GLU A 1 269 ? -11.770 65.766 -5.822  1.00 127.40 ? 269 GLU Z CG    1 
ATOM   2089 C  CD    . GLU A 1 269 ? -11.356 67.112 -5.255  1.00 137.21 ? 269 GLU Z CD    1 
ATOM   2090 O  OE1   . GLU A 1 269 ? -11.143 67.202 -4.027  1.00 142.90 ? 269 GLU Z OE1   1 
ATOM   2091 O  OE2   . GLU A 1 269 ? -11.243 68.079 -6.039  1.00 138.52 ? 269 GLU Z OE2   1 
ATOM   2092 N  N     . ASP A 1 270 ? -12.497 61.443 -3.838  1.00 110.06 ? 270 ASP Z N     1 
ATOM   2093 C  CA    . ASP A 1 270 ? -12.171 60.320 -2.967  1.00 110.12 ? 270 ASP Z CA    1 
ATOM   2094 C  C     . ASP A 1 270 ? -12.076 59.027 -3.769  1.00 106.76 ? 270 ASP Z C     1 
ATOM   2095 O  O     . ASP A 1 270 ? -11.488 58.043 -3.316  1.00 106.58 ? 270 ASP Z O     1 
ATOM   2096 C  CB    . ASP A 1 270 ? -13.201 60.178 -1.841  1.00 110.67 ? 270 ASP Z CB    1 
ATOM   2097 C  CG    . ASP A 1 270 ? -14.635 60.228 -2.342  1.00 112.04 ? 270 ASP Z CG    1 
ATOM   2098 O  OD1   . ASP A 1 270 ? -14.874 59.902 -3.524  1.00 112.68 ? 270 ASP Z OD1   1 
ATOM   2099 O  OD2   . ASP A 1 270 ? -15.525 60.597 -1.546  1.00 111.09 ? 270 ASP Z OD2   1 
ATOM   2100 N  N     . TYR A 1 271 ? -12.659 59.034 -4.964  1.00 109.93 ? 271 TYR Z N     1 
ATOM   2101 C  CA    . TYR A 1 271 ? -12.567 57.883 -5.854  1.00 105.06 ? 271 TYR Z CA    1 
ATOM   2102 C  C     . TYR A 1 271 ? -11.149 57.746 -6.395  1.00 101.50 ? 271 TYR Z C     1 
ATOM   2103 O  O     . TYR A 1 271 ? -10.685 56.638 -6.652  1.00 98.70  ? 271 TYR Z O     1 
ATOM   2104 C  CB    . TYR A 1 271 ? -13.566 57.995 -7.007  1.00 102.43 ? 271 TYR Z CB    1 
ATOM   2105 C  CG    . TYR A 1 271 ? -13.485 56.841 -7.983  1.00 98.90  ? 271 TYR Z CG    1 
ATOM   2106 C  CD1   . TYR A 1 271 ? -14.155 55.650 -7.738  1.00 95.30  ? 271 TYR Z CD1   1 
ATOM   2107 C  CD2   . TYR A 1 271 ? -12.729 56.939 -9.145  1.00 97.29  ? 271 TYR Z CD2   1 
ATOM   2108 C  CE1   . TYR A 1 271 ? -14.077 54.589 -8.629  1.00 90.26  ? 271 TYR Z CE1   1 
ATOM   2109 C  CE2   . TYR A 1 271 ? -12.644 55.887 -10.036 1.00 93.47  ? 271 TYR Z CE2   1 
ATOM   2110 C  CZ    . TYR A 1 271 ? -13.318 54.715 -9.775  1.00 90.20  ? 271 TYR Z CZ    1 
ATOM   2111 O  OH    . TYR A 1 271 ? -13.234 53.668 -10.666 1.00 86.78  ? 271 TYR Z OH    1 
ATOM   2112 N  N     . ILE A 1 272 ? -10.470 58.875 -6.577  1.00 100.93 ? 272 ILE Z N     1 
ATOM   2113 C  CA    . ILE A 1 272 ? -9.068  58.867 -6.980  1.00 101.21 ? 272 ILE Z CA    1 
ATOM   2114 C  C     . ILE A 1 272 ? -8.229  58.150 -5.928  1.00 98.71  ? 272 ILE Z C     1 
ATOM   2115 O  O     . ILE A 1 272 ? -7.430  57.263 -6.244  1.00 97.99  ? 272 ILE Z O     1 
ATOM   2116 C  CB    . ILE A 1 272 ? -8.519  60.293 -7.178  1.00 103.94 ? 272 ILE Z CB    1 
ATOM   2117 C  CG1   . ILE A 1 272 ? -9.349  61.049 -8.216  1.00 106.97 ? 272 ILE Z CG1   1 
ATOM   2118 C  CG2   . ILE A 1 272 ? -7.054  60.248 -7.588  1.00 101.97 ? 272 ILE Z CG2   1 
ATOM   2119 C  CD1   . ILE A 1 272 ? -9.273  60.459 -9.603  1.00 106.28 ? 272 ILE Z CD1   1 
ATOM   2120 N  N     . ASN A 1 273 ? -8.426  58.544 -4.673  1.00 98.90  ? 273 ASN Z N     1 
ATOM   2121 C  CA    . ASN A 1 273 ? -7.747  57.916 -3.549  1.00 99.88  ? 273 ASN Z CA    1 
ATOM   2122 C  C     . ASN A 1 273 ? -8.100  56.437 -3.444  1.00 93.87  ? 273 ASN Z C     1 
ATOM   2123 O  O     . ASN A 1 273 ? -7.256  55.610 -3.100  1.00 91.78  ? 273 ASN Z O     1 
ATOM   2124 C  CB    . ASN A 1 273 ? -8.098  58.636 -2.247  1.00 103.81 ? 273 ASN Z CB    1 
ATOM   2125 C  CG    . ASN A 1 273 ? -7.756  60.115 -2.288  1.00 106.77 ? 273 ASN Z CG    1 
ATOM   2126 O  OD1   . ASN A 1 273 ? -6.841  60.533 -2.996  1.00 106.45 ? 273 ASN Z OD1   1 
ATOM   2127 N  ND2   . ASN A 1 273 ? -8.497  60.914 -1.528  1.00 107.78 ? 273 ASN Z ND2   1 
ATOM   2128 N  N     . GLY A 1 274 ? -9.353  56.114 -3.746  1.00 94.84  ? 274 GLY Z N     1 
ATOM   2129 C  CA    . GLY A 1 274 ? -9.809  54.738 -3.735  1.00 93.44  ? 274 GLY Z CA    1 
ATOM   2130 C  C     . GLY A 1 274 ? -9.101  53.906 -4.786  1.00 88.95  ? 274 GLY Z C     1 
ATOM   2131 O  O     . GLY A 1 274 ? -8.756  52.747 -4.549  1.00 84.39  ? 274 GLY Z O     1 
ATOM   2132 N  N     . PHE A 1 275 ? -8.882  54.503 -5.953  1.00 88.51  ? 275 PHE Z N     1 
ATOM   2133 C  CA    . PHE A 1 275 ? -8.180  53.830 -7.035  1.00 86.56  ? 275 PHE Z CA    1 
ATOM   2134 C  C     . PHE A 1 275 ? -6.716  53.628 -6.670  1.00 86.50  ? 275 PHE Z C     1 
ATOM   2135 O  O     . PHE A 1 275 ? -6.144  52.573 -6.937  1.00 82.50  ? 275 PHE Z O     1 
ATOM   2136 C  CB    . PHE A 1 275 ? -8.295  54.623 -8.338  1.00 88.70  ? 275 PHE Z CB    1 
ATOM   2137 C  CG    . PHE A 1 275 ? -7.693  53.925 -9.523  1.00 85.82  ? 275 PHE Z CG    1 
ATOM   2138 C  CD1   . PHE A 1 275 ? -8.468  53.100 -10.323 1.00 84.36  ? 275 PHE Z CD1   1 
ATOM   2139 C  CD2   . PHE A 1 275 ? -6.351  54.085 -9.836  1.00 85.61  ? 275 PHE Z CD2   1 
ATOM   2140 C  CE1   . PHE A 1 275 ? -7.915  52.451 -11.413 1.00 81.29  ? 275 PHE Z CE1   1 
ATOM   2141 C  CE2   . PHE A 1 275 ? -5.795  53.437 -10.923 1.00 86.72  ? 275 PHE Z CE2   1 
ATOM   2142 C  CZ    . PHE A 1 275 ? -6.578  52.621 -11.712 1.00 83.67  ? 275 PHE Z CZ    1 
ATOM   2143 N  N     . ILE A 1 276 ? -6.114  54.650 -6.069  1.00 84.83  ? 276 ILE Z N     1 
ATOM   2144 C  CA    . ILE A 1 276 ? -4.728  54.562 -5.624  1.00 84.77  ? 276 ILE Z CA    1 
ATOM   2145 C  C     . ILE A 1 276 ? -4.558  53.448 -4.593  1.00 81.71  ? 276 ILE Z C     1 
ATOM   2146 O  O     . ILE A 1 276 ? -3.612  52.658 -4.666  1.00 79.95  ? 276 ILE Z O     1 
ATOM   2147 C  CB    . ILE A 1 276 ? -4.244  55.902 -5.030  1.00 88.61  ? 276 ILE Z CB    1 
ATOM   2148 C  CG1   . ILE A 1 276 ? -4.210  56.981 -6.115  1.00 88.33  ? 276 ILE Z CG1   1 
ATOM   2149 C  CG2   . ILE A 1 276 ? -2.868  55.753 -4.402  1.00 84.51  ? 276 ILE Z CG2   1 
ATOM   2150 C  CD1   . ILE A 1 276 ? -3.697  58.320 -5.631  1.00 93.26  ? 276 ILE Z CD1   1 
ATOM   2151 N  N     . ARG A 1 277 ? -5.488  53.377 -3.645  1.00 82.57  ? 277 ARG Z N     1 
ATOM   2152 C  CA    . ARG A 1 277 ? -5.447  52.351 -2.610  1.00 82.63  ? 277 ARG Z CA    1 
ATOM   2153 C  C     . ARG A 1 277 ? -5.655  50.961 -3.202  1.00 76.11  ? 277 ARG Z C     1 
ATOM   2154 O  O     . ARG A 1 277 ? -4.986  50.004 -2.812  1.00 72.40  ? 277 ARG Z O     1 
ATOM   2155 C  CB    . ARG A 1 277 ? -6.497  52.631 -1.533  1.00 83.37  ? 277 ARG Z CB    1 
ATOM   2156 C  CG    . ARG A 1 277 ? -6.144  53.788 -0.604  1.00 87.60  ? 277 ARG Z CG    1 
ATOM   2157 C  CD    . ARG A 1 277 ? -7.131  53.897 0.548   1.00 90.87  ? 277 ARG Z CD    1 
ATOM   2158 N  NE    . ARG A 1 277 ? -8.450  54.340 0.103   1.00 90.90  ? 277 ARG Z NE    1 
ATOM   2159 C  CZ    . ARG A 1 277 ? -8.843  55.609 0.089   1.00 95.27  ? 277 ARG Z CZ    1 
ATOM   2160 N  NH1   . ARG A 1 277 ? -8.016  56.562 0.496   1.00 97.72  ? 277 ARG Z NH1   1 
ATOM   2161 N  NH2   . ARG A 1 277 ? -10.061 55.928 -0.328  1.00 97.60  ? 277 ARG Z NH2   1 
ATOM   2162 N  N     . ALA A 1 278 ? -6.585  50.859 -4.145  1.00 78.47  ? 278 ALA Z N     1 
ATOM   2163 C  CA    . ALA A 1 278 ? -6.855  49.593 -4.818  1.00 76.10  ? 278 ALA Z CA    1 
ATOM   2164 C  C     . ALA A 1 278 ? -5.618  49.096 -5.560  1.00 72.29  ? 278 ALA Z C     1 
ATOM   2165 O  O     . ALA A 1 278 ? -5.218  47.941 -5.417  1.00 69.80  ? 278 ALA Z O     1 
ATOM   2166 C  CB    . ALA A 1 278 ? -8.028  49.737 -5.776  1.00 73.57  ? 278 ALA Z CB    1 
ATOM   2167 N  N     . ASN A 1 279 ? -5.016  49.982 -6.349  1.00 74.33  ? 279 ASN Z N     1 
ATOM   2168 C  CA    . ASN A 1 279 ? -3.819  49.654 -7.114  1.00 75.76  ? 279 ASN Z CA    1 
ATOM   2169 C  C     . ASN A 1 279 ? -2.665  49.255 -6.204  1.00 76.26  ? 279 ASN Z C     1 
ATOM   2170 O  O     . ASN A 1 279 ? -1.947  48.289 -6.476  1.00 73.57  ? 279 ASN Z O     1 
ATOM   2171 C  CB    . ASN A 1 279 ? -3.411  50.838 -7.993  1.00 76.30  ? 279 ASN Z CB    1 
ATOM   2172 C  CG    . ASN A 1 279 ? -2.292  50.493 -8.954  1.00 74.63  ? 279 ASN Z CG    1 
ATOM   2173 O  OD1   . ASN A 1 279 ? -2.158  49.348 -9.383  1.00 73.03  ? 279 ASN Z OD1   1 
ATOM   2174 N  ND2   . ASN A 1 279 ? -1.479  51.486 -9.296  1.00 78.53  ? 279 ASN Z ND2   1 
ATOM   2175 N  N     . ASN A 1 280 ? -2.499  49.999 -5.114  1.00 75.62  ? 280 ASN Z N     1 
ATOM   2176 C  CA    . ASN A 1 280 ? -1.469  49.686 -4.134  1.00 77.10  ? 280 ASN Z CA    1 
ATOM   2177 C  C     . ASN A 1 280 ? -1.733  48.366 -3.422  1.00 76.31  ? 280 ASN Z C     1 
ATOM   2178 O  O     . ASN A 1 280 ? -0.807  47.726 -2.931  1.00 75.81  ? 280 ASN Z O     1 
ATOM   2179 C  CB    . ASN A 1 280 ? -1.346  50.814 -3.111  1.00 82.05  ? 280 ASN Z CB    1 
ATOM   2180 C  CG    . ASN A 1 280 ? -0.714  52.058 -3.696  1.00 83.87  ? 280 ASN Z CG    1 
ATOM   2181 O  OD1   . ASN A 1 280 ? 0.034   51.984 -4.670  1.00 82.84  ? 280 ASN Z OD1   1 
ATOM   2182 N  ND2   . ASN A 1 280 ? -1.004  53.209 -3.101  1.00 88.06  ? 280 ASN Z ND2   1 
ATOM   2183 N  N     . THR A 1 281 ? -2.998  47.961 -3.365  1.00 75.12  ? 281 THR Z N     1 
ATOM   2184 C  CA    . THR A 1 281 ? -3.356  46.695 -2.736  1.00 74.37  ? 281 THR Z CA    1 
ATOM   2185 C  C     . THR A 1 281 ? -3.073  45.539 -3.691  1.00 71.53  ? 281 THR Z C     1 
ATOM   2186 O  O     . THR A 1 281 ? -2.595  44.485 -3.279  1.00 71.33  ? 281 THR Z O     1 
ATOM   2187 C  CB    . THR A 1 281 ? -4.836  46.670 -2.306  1.00 73.89  ? 281 THR Z CB    1 
ATOM   2188 O  OG1   . THR A 1 281 ? -5.096  47.765 -1.419  1.00 76.21  ? 281 THR Z OG1   1 
ATOM   2189 C  CG2   . THR A 1 281 ? -5.167  45.367 -1.599  1.00 68.97  ? 281 THR Z CG2   1 
ATOM   2190 N  N     . PHE A 1 282 ? -3.366  45.745 -4.970  1.00 71.37  ? 282 PHE Z N     1 
ATOM   2191 C  CA    . PHE A 1 282 ? -3.048  44.749 -5.986  1.00 68.83  ? 282 PHE Z CA    1 
ATOM   2192 C  C     . PHE A 1 282 ? -1.537  44.579 -6.131  1.00 69.63  ? 282 PHE Z C     1 
ATOM   2193 O  O     . PHE A 1 282 ? -1.054  43.489 -6.431  1.00 68.66  ? 282 PHE Z O     1 
ATOM   2194 C  CB    . PHE A 1 282 ? -3.661  45.134 -7.335  1.00 69.25  ? 282 PHE Z CB    1 
ATOM   2195 C  CG    . PHE A 1 282 ? -5.053  44.605 -7.547  1.00 66.79  ? 282 PHE Z CG    1 
ATOM   2196 C  CD1   . PHE A 1 282 ? -6.150  45.445 -7.454  1.00 66.61  ? 282 PHE Z CD1   1 
ATOM   2197 C  CD2   . PHE A 1 282 ? -5.262  43.269 -7.845  1.00 65.46  ? 282 PHE Z CD2   1 
ATOM   2198 C  CE1   . PHE A 1 282 ? -7.431  44.961 -7.651  1.00 68.27  ? 282 PHE Z CE1   1 
ATOM   2199 C  CE2   . PHE A 1 282 ? -6.539  42.779 -8.042  1.00 64.42  ? 282 PHE Z CE2   1 
ATOM   2200 C  CZ    . PHE A 1 282 ? -7.625  43.627 -7.944  1.00 65.59  ? 282 PHE Z CZ    1 
ATOM   2201 N  N     . LEU A 1 283 ? -0.798  45.662 -5.913  1.00 70.18  ? 283 LEU Z N     1 
ATOM   2202 C  CA    . LEU A 1 283 ? 0.651   45.650 -6.094  1.00 70.51  ? 283 LEU Z CA    1 
ATOM   2203 C  C     . LEU A 1 283 ? 1.433   45.174 -4.872  1.00 73.90  ? 283 LEU Z C     1 
ATOM   2204 O  O     . LEU A 1 283 ? 2.352   44.362 -4.993  1.00 73.21  ? 283 LEU Z O     1 
ATOM   2205 C  CB    . LEU A 1 283 ? 1.141   47.049 -6.475  1.00 74.21  ? 283 LEU Z CB    1 
ATOM   2206 C  CG    . LEU A 1 283 ? 0.913   47.528 -7.906  1.00 72.09  ? 283 LEU Z CG    1 
ATOM   2207 C  CD1   . LEU A 1 283 ? 1.349   48.976 -8.038  1.00 71.68  ? 283 LEU Z CD1   1 
ATOM   2208 C  CD2   . LEU A 1 283 ? 1.678   46.646 -8.874  1.00 72.40  ? 283 LEU Z CD2   1 
ATOM   2209 N  N     . TYR A 1 284 ? 1.071   45.685 -3.700  1.00 73.39  ? 284 TYR Z N     1 
ATOM   2210 C  CA    . TYR A 1 284 ? 1.923   45.556 -2.524  1.00 75.26  ? 284 TYR Z CA    1 
ATOM   2211 C  C     . TYR A 1 284 ? 1.254   44.892 -1.324  1.00 75.90  ? 284 TYR Z C     1 
ATOM   2212 O  O     . TYR A 1 284 ? 1.640   45.145 -0.182  1.00 76.41  ? 284 TYR Z O     1 
ATOM   2213 C  CB    . TYR A 1 284 ? 2.433   46.938 -2.110  1.00 77.04  ? 284 TYR Z CB    1 
ATOM   2214 C  CG    . TYR A 1 284 ? 3.134   47.693 -3.216  1.00 81.01  ? 284 TYR Z CG    1 
ATOM   2215 C  CD1   . TYR A 1 284 ? 4.141   47.095 -3.964  1.00 80.29  ? 284 TYR Z CD1   1 
ATOM   2216 C  CD2   . TYR A 1 284 ? 2.781   49.002 -3.519  1.00 83.72  ? 284 TYR Z CD2   1 
ATOM   2217 C  CE1   . TYR A 1 284 ? 4.782   47.785 -4.977  1.00 82.64  ? 284 TYR Z CE1   1 
ATOM   2218 C  CE2   . TYR A 1 284 ? 3.414   49.699 -4.531  1.00 83.05  ? 284 TYR Z CE2   1 
ATOM   2219 C  CZ    . TYR A 1 284 ? 4.414   49.086 -5.257  1.00 85.42  ? 284 TYR Z CZ    1 
ATOM   2220 O  OH    . TYR A 1 284 ? 5.047   49.778 -6.266  1.00 89.66  ? 284 TYR Z OH    1 
ATOM   2221 N  N     . GLN A 1 285 ? 0.257   44.047 -1.569  1.00 79.15  ? 285 GLN Z N     1 
ATOM   2222 C  CA    . GLN A 1 285 ? -0.359  43.303 -0.477  1.00 75.39  ? 285 GLN Z CA    1 
ATOM   2223 C  C     . GLN A 1 285 ? 0.654   42.323 0.100   1.00 75.03  ? 285 GLN Z C     1 
ATOM   2224 O  O     . GLN A 1 285 ? 1.403   41.685 -0.642  1.00 74.15  ? 285 GLN Z O     1 
ATOM   2225 C  CB    . GLN A 1 285 ? -1.612  42.564 -0.944  1.00 73.94  ? 285 GLN Z CB    1 
ATOM   2226 C  CG    . GLN A 1 285 ? -2.303  41.784 0.166   1.00 73.34  ? 285 GLN Z CG    1 
ATOM   2227 C  CD    . GLN A 1 285 ? -3.568  41.093 -0.296  1.00 71.44  ? 285 GLN Z CD    1 
ATOM   2228 O  OE1   . GLN A 1 285 ? -4.027  40.138 0.330   1.00 71.51  ? 285 GLN Z OE1   1 
ATOM   2229 N  NE2   . GLN A 1 285 ? -4.144  41.577 -1.392  1.00 71.85  ? 285 GLN Z NE2   1 
ATOM   2230 N  N     . LEU A 1 286 ? 0.683   42.213 1.423   1.00 75.34  ? 286 LEU Z N     1 
ATOM   2231 C  CA    . LEU A 1 286 ? 1.674   41.386 2.096   1.00 76.07  ? 286 LEU Z CA    1 
ATOM   2232 C  C     . LEU A 1 286 ? 1.467   39.903 1.823   1.00 71.73  ? 286 LEU Z C     1 
ATOM   2233 O  O     . LEU A 1 286 ? 0.347   39.396 1.886   1.00 69.69  ? 286 LEU Z O     1 
ATOM   2234 C  CB    . LEU A 1 286 ? 1.650   41.643 3.603   1.00 75.34  ? 286 LEU Z CB    1 
ATOM   2235 C  CG    . LEU A 1 286 ? 1.999   43.064 4.042   1.00 82.62  ? 286 LEU Z CG    1 
ATOM   2236 C  CD1   . LEU A 1 286 ? 2.153   43.130 5.550   1.00 86.02  ? 286 LEU Z CD1   1 
ATOM   2237 C  CD2   . LEU A 1 286 ? 3.266   43.534 3.349   1.00 85.08  ? 286 LEU Z CD2   1 
ATOM   2238 N  N     . VAL A 1 287 ? 2.560   39.217 1.509   1.00 73.12  ? 287 VAL Z N     1 
ATOM   2239 C  CA    . VAL A 1 287 ? 2.548   37.771 1.331   1.00 72.18  ? 287 VAL Z CA    1 
ATOM   2240 C  C     . VAL A 1 287 ? 3.708   37.155 2.105   1.00 72.82  ? 287 VAL Z C     1 
ATOM   2241 O  O     . VAL A 1 287 ? 4.582   37.867 2.598   1.00 73.46  ? 287 VAL Z O     1 
ATOM   2242 C  CB    . VAL A 1 287 ? 2.649   37.369 -0.154  1.00 71.59  ? 287 VAL Z CB    1 
ATOM   2243 C  CG1   . VAL A 1 287 ? 1.484   37.944 -0.941  1.00 70.52  ? 287 VAL Z CG1   1 
ATOM   2244 C  CG2   . VAL A 1 287 ? 3.973   37.834 -0.740  1.00 71.30  ? 287 VAL Z CG2   1 
ATOM   2245 N  N     . PHE A 1 288 ? 3.718   35.832 2.208   1.00 79.83  ? 288 PHE Z N     1 
ATOM   2246 C  CA    . PHE A 1 288 ? 4.787   35.144 2.920   1.00 81.99  ? 288 PHE Z CA    1 
ATOM   2247 C  C     . PHE A 1 288 ? 5.745   34.436 1.965   1.00 82.76  ? 288 PHE Z C     1 
ATOM   2248 O  O     . PHE A 1 288 ? 5.324   33.653 1.113   1.00 80.30  ? 288 PHE Z O     1 
ATOM   2249 C  CB    . PHE A 1 288 ? 4.204   34.141 3.914   1.00 79.39  ? 288 PHE Z CB    1 
ATOM   2250 C  CG    . PHE A 1 288 ? 5.232   33.495 4.790   1.00 83.45  ? 288 PHE Z CG    1 
ATOM   2251 C  CD1   . PHE A 1 288 ? 5.653   32.200 4.546   1.00 83.79  ? 288 PHE Z CD1   1 
ATOM   2252 C  CD2   . PHE A 1 288 ? 5.781   34.185 5.859   1.00 86.35  ? 288 PHE Z CD2   1 
ATOM   2253 C  CE1   . PHE A 1 288 ? 6.600   31.603 5.352   1.00 85.18  ? 288 PHE Z CE1   1 
ATOM   2254 C  CE2   . PHE A 1 288 ? 6.727   33.595 6.668   1.00 87.25  ? 288 PHE Z CE2   1 
ATOM   2255 C  CZ    . PHE A 1 288 ? 7.138   32.302 6.414   1.00 87.56  ? 288 PHE Z CZ    1 
ATOM   2256 N  N     . ASP A 1 289 ? 7.034   34.724 2.111   1.00 87.74  ? 289 ASP Z N     1 
ATOM   2257 C  CA    . ASP A 1 289 ? 8.067   34.059 1.331   1.00 87.81  ? 289 ASP Z CA    1 
ATOM   2258 C  C     . ASP A 1 289 ? 8.419   32.734 1.996   1.00 88.85  ? 289 ASP Z C     1 
ATOM   2259 O  O     . ASP A 1 289 ? 8.951   32.719 3.100   1.00 91.34  ? 289 ASP Z O     1 
ATOM   2260 C  CB    . ASP A 1 289 ? 9.305   34.950 1.215   1.00 87.97  ? 289 ASP Z CB    1 
ATOM   2261 C  CG    . ASP A 1 289 ? 10.290  34.460 0.172   1.00 90.59  ? 289 ASP Z CG    1 
ATOM   2262 O  OD1   . ASP A 1 289 ? 10.194  33.291 -0.257  1.00 92.37  ? 289 ASP Z OD1   1 
ATOM   2263 O  OD2   . ASP A 1 289 ? 11.173  35.253 -0.218  1.00 90.16  ? 289 ASP Z OD2   1 
ATOM   2264 N  N     . PRO A 1 290 ? 8.116   31.614 1.327   1.00 91.05  ? 290 PRO Z N     1 
ATOM   2265 C  CA    . PRO A 1 290 ? 8.379   30.291 1.905   1.00 91.28  ? 290 PRO Z CA    1 
ATOM   2266 C  C     . PRO A 1 290 ? 9.870   30.012 2.084   1.00 94.89  ? 290 PRO Z C     1 
ATOM   2267 O  O     . PRO A 1 290 ? 10.262  29.353 3.047   1.00 96.41  ? 290 PRO Z O     1 
ATOM   2268 C  CB    . PRO A 1 290 ? 7.770   29.327 0.878   1.00 90.76  ? 290 PRO Z CB    1 
ATOM   2269 C  CG    . PRO A 1 290 ? 6.830   30.159 0.063   1.00 91.08  ? 290 PRO Z CG    1 
ATOM   2270 C  CD    . PRO A 1 290 ? 7.450   31.521 0.019   1.00 90.03  ? 290 PRO Z CD    1 
ATOM   2271 N  N     . ILE A 1 291 ? 10.686  30.517 1.165   1.00 93.95  ? 291 ILE Z N     1 
ATOM   2272 C  CA    . ILE A 1 291 ? 12.120  30.257 1.184   1.00 94.47  ? 291 ILE Z CA    1 
ATOM   2273 C  C     . ILE A 1 291 ? 12.842  31.083 2.243   1.00 96.64  ? 291 ILE Z C     1 
ATOM   2274 O  O     . ILE A 1 291 ? 13.510  30.536 3.120   1.00 98.97  ? 291 ILE Z O     1 
ATOM   2275 C  CB    . ILE A 1 291 ? 12.758  30.545 -0.188  1.00 94.16  ? 291 ILE Z CB    1 
ATOM   2276 C  CG1   . ILE A 1 291 ? 12.037  29.763 -1.289  1.00 94.03  ? 291 ILE Z CG1   1 
ATOM   2277 C  CG2   . ILE A 1 291 ? 14.244  30.220 -0.165  1.00 93.87  ? 291 ILE Z CG2   1 
ATOM   2278 C  CD1   . ILE A 1 291 ? 12.038  28.264 -1.075  1.00 96.99  ? 291 ILE Z CD1   1 
ATOM   2279 N  N     . LYS A 1 292 ? 12.708  32.402 2.153   1.00 92.47  ? 292 LYS Z N     1 
ATOM   2280 C  CA    . LYS A 1 292 ? 13.400  33.308 3.063   1.00 93.33  ? 292 LYS Z CA    1 
ATOM   2281 C  C     . LYS A 1 292 ? 12.701  33.402 4.416   1.00 95.19  ? 292 LYS Z C     1 
ATOM   2282 O  O     . LYS A 1 292 ? 13.266  33.930 5.373   1.00 96.00  ? 292 LYS Z O     1 
ATOM   2283 C  CB    . LYS A 1 292 ? 13.518  34.700 2.441   1.00 94.58  ? 292 LYS Z CB    1 
ATOM   2284 C  CG    . LYS A 1 292 ? 14.183  34.714 1.076   1.00 95.22  ? 292 LYS Z CG    1 
ATOM   2285 C  CD    . LYS A 1 292 ? 14.319  36.131 0.540   1.00 97.95  ? 292 LYS Z CD    1 
ATOM   2286 C  CE    . LYS A 1 292 ? 14.803  36.127 -0.901  1.00 100.01 ? 292 LYS Z CE    1 
ATOM   2287 N  NZ    . LYS A 1 292 ? 13.831  35.445 -1.802  1.00 92.20  ? 292 LYS Z NZ    1 
ATOM   2288 N  N     . ARG A 1 293 ? 11.474  32.889 4.481   1.00 95.53  ? 293 ARG Z N     1 
ATOM   2289 C  CA    . ARG A 1 293 ? 10.659  32.925 5.695   1.00 95.34  ? 293 ARG Z CA    1 
ATOM   2290 C  C     . ARG A 1 293 ? 10.507  34.347 6.229   1.00 97.28  ? 293 ARG Z C     1 
ATOM   2291 O  O     . ARG A 1 293 ? 10.891  34.639 7.361   1.00 101.71 ? 293 ARG Z O     1 
ATOM   2292 C  CB    . ARG A 1 293 ? 11.254  32.013 6.770   1.00 94.99  ? 293 ARG Z CB    1 
ATOM   2293 C  CG    . ARG A 1 293 ? 11.291  30.547 6.378   1.00 94.02  ? 293 ARG Z CG    1 
ATOM   2294 C  CD    . ARG A 1 293 ? 11.907  29.688 7.470   1.00 95.83  ? 293 ARG Z CD    1 
ATOM   2295 N  NE    . ARG A 1 293 ? 11.918  28.275 7.101   1.00 97.51  ? 293 ARG Z NE    1 
ATOM   2296 C  CZ    . ARG A 1 293 ? 12.411  27.305 7.865   1.00 102.77 ? 293 ARG Z CZ    1 
ATOM   2297 N  NH1   . ARG A 1 293 ? 12.938  27.591 9.048   1.00 105.89 ? 293 ARG Z NH1   1 
ATOM   2298 N  NH2   . ARG A 1 293 ? 12.377  26.048 7.445   1.00 103.80 ? 293 ARG Z NH2   1 
ATOM   2299 N  N     . LYS A 1 294 ? 9.939   35.224 5.407   1.00 91.61  ? 294 LYS Z N     1 
ATOM   2300 C  CA    . LYS A 1 294 ? 9.807   36.631 5.766   1.00 94.60  ? 294 LYS Z CA    1 
ATOM   2301 C  C     . LYS A 1 294 ? 8.550   37.255 5.157   1.00 94.44  ? 294 LYS Z C     1 
ATOM   2302 O  O     . LYS A 1 294 ? 8.149   36.902 4.048   1.00 90.95  ? 294 LYS Z O     1 
ATOM   2303 C  CB    . LYS A 1 294 ? 11.051  37.405 5.317   1.00 97.50  ? 294 LYS Z CB    1 
ATOM   2304 C  CG    . LYS A 1 294 ? 11.101  38.854 5.780   1.00 103.35 ? 294 LYS Z CG    1 
ATOM   2305 C  CD    . LYS A 1 294 ? 12.347  39.551 5.258   1.00 107.99 ? 294 LYS Z CD    1 
ATOM   2306 C  CE    . LYS A 1 294 ? 12.441  40.979 5.778   1.00 116.60 ? 294 LYS Z CE    1 
ATOM   2307 N  NZ    . LYS A 1 294 ? 12.513  41.027 7.269   1.00 117.17 ? 294 LYS Z NZ    1 
ATOM   2308 N  N     . LEU A 1 295 ? 7.928   38.174 5.891   1.00 89.38  ? 295 LEU Z N     1 
ATOM   2309 C  CA    . LEU A 1 295 ? 6.789   38.926 5.373   1.00 86.58  ? 295 LEU Z CA    1 
ATOM   2310 C  C     . LEU A 1 295 ? 7.241   39.939 4.332   1.00 88.42  ? 295 LEU Z C     1 
ATOM   2311 O  O     . LEU A 1 295 ? 7.997   40.860 4.636   1.00 94.23  ? 295 LEU Z O     1 
ATOM   2312 C  CB    . LEU A 1 295 ? 6.046   39.641 6.503   1.00 88.37  ? 295 LEU Z CB    1 
ATOM   2313 C  CG    . LEU A 1 295 ? 4.903   38.872 7.165   1.00 86.85  ? 295 LEU Z CG    1 
ATOM   2314 C  CD1   . LEU A 1 295 ? 4.206   39.737 8.204   1.00 91.50  ? 295 LEU Z CD1   1 
ATOM   2315 C  CD2   . LEU A 1 295 ? 3.914   38.386 6.119   1.00 82.14  ? 295 LEU Z CD2   1 
ATOM   2316 N  N     . ILE A 1 296 ? 6.775   39.760 3.101   1.00 86.32  ? 296 ILE Z N     1 
ATOM   2317 C  CA    . ILE A 1 296 ? 7.142   40.644 2.002   1.00 86.66  ? 296 ILE Z CA    1 
ATOM   2318 C  C     . ILE A 1 296 ? 5.912   41.084 1.214   1.00 82.67  ? 296 ILE Z C     1 
ATOM   2319 O  O     . ILE A 1 296 ? 4.913   40.365 1.165   1.00 79.42  ? 296 ILE Z O     1 
ATOM   2320 C  CB    . ILE A 1 296 ? 8.140   39.963 1.039   1.00 84.50  ? 296 ILE Z CB    1 
ATOM   2321 C  CG1   . ILE A 1 296 ? 7.536   38.681 0.460   1.00 82.28  ? 296 ILE Z CG1   1 
ATOM   2322 C  CG2   . ILE A 1 296 ? 9.454   39.664 1.746   1.00 88.45  ? 296 ILE Z CG2   1 
ATOM   2323 C  CD1   . ILE A 1 296 ? 8.421   37.998 -0.551  1.00 81.48  ? 296 ILE Z CD1   1 
ATOM   2324 N  N     . PRO A 1 297 ? 5.976   42.276 0.602   1.00 79.89  ? 297 PRO Z N     1 
ATOM   2325 C  CA    . PRO A 1 297 ? 4.904   42.681 -0.310  1.00 80.47  ? 297 PRO Z CA    1 
ATOM   2326 C  C     . PRO A 1 297 ? 4.902   41.815 -1.564  1.00 76.89  ? 297 PRO Z C     1 
ATOM   2327 O  O     . PRO A 1 297 ? 5.924   41.201 -1.878  1.00 76.99  ? 297 PRO Z O     1 
ATOM   2328 C  CB    . PRO A 1 297 ? 5.252   44.136 -0.641  1.00 84.36  ? 297 PRO Z CB    1 
ATOM   2329 C  CG    . PRO A 1 297 ? 6.717   44.235 -0.407  1.00 86.93  ? 297 PRO Z CG    1 
ATOM   2330 C  CD    . PRO A 1 297 ? 7.000   43.324 0.751   1.00 87.06  ? 297 PRO Z CD    1 
ATOM   2331 N  N     . LEU A 1 298 ? 3.767   41.765 -2.256  1.00 80.43  ? 298 LEU Z N     1 
ATOM   2332 C  CA    . LEU A 1 298 ? 3.642   40.988 -3.485  1.00 77.96  ? 298 LEU Z CA    1 
ATOM   2333 C  C     . LEU A 1 298 ? 4.718   41.388 -4.486  1.00 77.95  ? 298 LEU Z C     1 
ATOM   2334 O  O     . LEU A 1 298 ? 5.428   40.539 -5.025  1.00 75.73  ? 298 LEU Z O     1 
ATOM   2335 C  CB    . LEU A 1 298 ? 2.254   41.173 -4.096  1.00 74.82  ? 298 LEU Z CB    1 
ATOM   2336 C  CG    . LEU A 1 298 ? 1.995   40.432 -5.406  1.00 74.49  ? 298 LEU Z CG    1 
ATOM   2337 C  CD1   . LEU A 1 298 ? 2.290   38.950 -5.250  1.00 73.49  ? 298 LEU Z CD1   1 
ATOM   2338 C  CD2   . LEU A 1 298 ? 0.561   40.650 -5.849  1.00 72.21  ? 298 LEU Z CD2   1 
ATOM   2339 N  N     . ASN A 1 299 ? 4.836   42.689 -4.722  1.00 77.56  ? 299 ASN Z N     1 
ATOM   2340 C  CA    . ASN A 1 299 ? 5.905   43.225 -5.552  1.00 78.04  ? 299 ASN Z CA    1 
ATOM   2341 C  C     . ASN A 1 299 ? 6.855   44.080 -4.725  1.00 84.39  ? 299 ASN Z C     1 
ATOM   2342 O  O     . ASN A 1 299 ? 6.471   44.609 -3.683  1.00 84.06  ? 299 ASN Z O     1 
ATOM   2343 C  CB    . ASN A 1 299 ? 5.333   44.047 -6.706  1.00 77.91  ? 299 ASN Z CB    1 
ATOM   2344 C  CG    . ASN A 1 299 ? 4.381   43.251 -7.567  1.00 74.81  ? 299 ASN Z CG    1 
ATOM   2345 O  OD1   . ASN A 1 299 ? 4.805   42.441 -8.390  1.00 70.77  ? 299 ASN Z OD1   1 
ATOM   2346 N  ND2   . ASN A 1 299 ? 3.084   43.476 -7.384  1.00 73.24  ? 299 ASN Z ND2   1 
ATOM   2347 N  N     . ALA A 1 300 ? 8.094   44.209 -5.187  1.00 83.50  ? 300 ALA Z N     1 
ATOM   2348 C  CA    . ALA A 1 300 ? 9.062   45.071 -4.521  1.00 85.16  ? 300 ALA Z CA    1 
ATOM   2349 C  C     . ALA A 1 300 ? 8.589   46.520 -4.560  1.00 89.80  ? 300 ALA Z C     1 
ATOM   2350 O  O     . ALA A 1 300 ? 8.121   46.999 -5.593  1.00 91.96  ? 300 ALA Z O     1 
ATOM   2351 C  CB    . ALA A 1 300 ? 10.429  44.938 -5.167  1.00 84.99  ? 300 ALA Z CB    1 
ATOM   2352 N  N     . TYR A 1 301 ? 8.704   47.206 -3.427  1.00 90.29  ? 301 TYR Z N     1 
ATOM   2353 C  CA    . TYR A 1 301 ? 8.271   48.593 -3.320  1.00 95.00  ? 301 TYR Z CA    1 
ATOM   2354 C  C     . TYR A 1 301 ? 9.022   49.489 -4.295  1.00 102.37 ? 301 TYR Z C     1 
ATOM   2355 O  O     . TYR A 1 301 ? 10.243  49.620 -4.219  1.00 108.44 ? 301 TYR Z O     1 
ATOM   2356 C  CB    . TYR A 1 301 ? 8.464   49.106 -1.892  1.00 101.72 ? 301 TYR Z CB    1 
ATOM   2357 C  CG    . TYR A 1 301 ? 7.513   48.501 -0.887  1.00 100.15 ? 301 TYR Z CG    1 
ATOM   2358 C  CD1   . TYR A 1 301 ? 6.179   48.285 -1.205  1.00 92.11  ? 301 TYR Z CD1   1 
ATOM   2359 C  CD2   . TYR A 1 301 ? 7.950   48.142 0.381   1.00 107.95 ? 301 TYR Z CD2   1 
ATOM   2360 C  CE1   . TYR A 1 301 ? 5.308   47.733 -0.287  1.00 88.70  ? 301 TYR Z CE1   1 
ATOM   2361 C  CE2   . TYR A 1 301 ? 7.084   47.588 1.306   1.00 104.99 ? 301 TYR Z CE2   1 
ATOM   2362 C  CZ    . TYR A 1 301 ? 5.766   47.385 0.966   1.00 93.02  ? 301 TYR Z CZ    1 
ATOM   2363 O  OH    . TYR A 1 301 ? 4.900   46.833 1.881   1.00 85.60  ? 301 TYR Z OH    1 
ATOM   2364 N  N     . GLU A 1 302 ? 8.283   50.097 -5.217  1.00 100.71 ? 302 GLU Z N     1 
ATOM   2365 C  CA    . GLU A 1 302 ? 8.859   51.060 -6.147  1.00 105.63 ? 302 GLU Z CA    1 
ATOM   2366 C  C     . GLU A 1 302 ? 9.232   52.349 -5.421  1.00 114.31 ? 302 GLU Z C     1 
ATOM   2367 O  O     . GLU A 1 302 ? 8.776   52.599 -4.306  1.00 115.76 ? 302 GLU Z O     1 
ATOM   2368 C  CB    . GLU A 1 302 ? 7.887   51.352 -7.291  1.00 102.04 ? 302 GLU Z CB    1 
ATOM   2369 C  CG    . GLU A 1 302 ? 7.803   50.240 -8.324  1.00 100.01 ? 302 GLU Z CG    1 
ATOM   2370 C  CD    . GLU A 1 302 ? 9.095   50.074 -9.100  1.00 103.03 ? 302 GLU Z CD    1 
ATOM   2371 O  OE1   . GLU A 1 302 ? 9.607   51.084 -9.631  1.00 111.30 ? 302 GLU Z OE1   1 
ATOM   2372 O  OE2   . GLU A 1 302 ? 9.604   48.935 -9.169  1.00 100.67 ? 302 GLU Z OE2   1 
ATOM   2373 N  N     . ASP A 1 303 ? 10.059  53.168 -6.063  1.00 108.69 ? 303 ASP Z N     1 
ATOM   2374 C  CA    . ASP A 1 303 ? 10.586  54.374 -5.434  1.00 113.84 ? 303 ASP Z CA    1 
ATOM   2375 C  C     . ASP A 1 303 ? 9.511   55.426 -5.174  1.00 115.10 ? 303 ASP Z C     1 
ATOM   2376 O  O     . ASP A 1 303 ? 9.639   56.236 -4.257  1.00 117.93 ? 303 ASP Z O     1 
ATOM   2377 C  CB    . ASP A 1 303 ? 11.696  54.973 -6.299  1.00 116.01 ? 303 ASP Z CB    1 
ATOM   2378 C  CG    . ASP A 1 303 ? 12.800  53.976 -6.605  1.00 119.25 ? 303 ASP Z CG    1 
ATOM   2379 O  OD1   . ASP A 1 303 ? 13.099  53.131 -5.731  1.00 117.53 ? 303 ASP Z OD1   1 
ATOM   2380 O  OD2   . ASP A 1 303 ? 13.359  54.031 -7.722  1.00 124.45 ? 303 ASP Z OD2   1 
ATOM   2381 N  N     . ASP A 1 304 ? 8.454   55.409 -5.980  1.00 117.20 ? 304 ASP Z N     1 
ATOM   2382 C  CA    . ASP A 1 304 ? 7.422   56.439 -5.904  1.00 118.22 ? 304 ASP Z CA    1 
ATOM   2383 C  C     . ASP A 1 304 ? 6.391   56.171 -4.811  1.00 117.70 ? 304 ASP Z C     1 
ATOM   2384 O  O     . ASP A 1 304 ? 5.579   57.039 -4.492  1.00 119.76 ? 304 ASP Z O     1 
ATOM   2385 C  CB    . ASP A 1 304 ? 6.716   56.577 -7.254  1.00 117.12 ? 304 ASP Z CB    1 
ATOM   2386 C  CG    . ASP A 1 304 ? 6.042   55.292 -7.694  1.00 111.79 ? 304 ASP Z CG    1 
ATOM   2387 O  OD1   . ASP A 1 304 ? 6.482   54.212 -7.250  1.00 108.32 ? 304 ASP Z OD1   1 
ATOM   2388 O  OD2   . ASP A 1 304 ? 5.076   55.362 -8.483  1.00 109.49 ? 304 ASP Z OD2   1 
ATOM   2389 N  N     . VAL A 1 305 ? 6.423   54.972 -4.239  1.00 113.35 ? 305 VAL Z N     1 
ATOM   2390 C  CA    . VAL A 1 305 ? 5.448   54.598 -3.220  1.00 109.64 ? 305 VAL Z CA    1 
ATOM   2391 C  C     . VAL A 1 305 ? 6.029   54.772 -1.816  1.00 113.90 ? 305 VAL Z C     1 
ATOM   2392 O  O     . VAL A 1 305 ? 7.248   54.789 -1.635  1.00 116.80 ? 305 VAL Z O     1 
ATOM   2393 C  CB    . VAL A 1 305 ? 4.964   53.142 -3.411  1.00 101.20 ? 305 VAL Z CB    1 
ATOM   2394 C  CG1   . VAL A 1 305 ? 5.939   52.161 -2.777  1.00 100.74 ? 305 VAL Z CG1   1 
ATOM   2395 C  CG2   . VAL A 1 305 ? 3.567   52.960 -2.832  1.00 94.58  ? 305 VAL Z CG2   1 
ATOM   2396 N  N     . ASP A 1 306 ? 5.148   54.915 -0.830  1.00 109.24 ? 306 ASP Z N     1 
ATOM   2397 C  CA    . ASP A 1 306 ? 5.559   55.082 0.559   1.00 110.54 ? 306 ASP Z CA    1 
ATOM   2398 C  C     . ASP A 1 306 ? 4.941   53.996 1.436   1.00 105.89 ? 306 ASP Z C     1 
ATOM   2399 O  O     . ASP A 1 306 ? 3.764   54.075 1.795   1.00 102.13 ? 306 ASP Z O     1 
ATOM   2400 C  CB    . ASP A 1 306 ? 5.166   56.470 1.068   1.00 115.22 ? 306 ASP Z CB    1 
ATOM   2401 C  CG    . ASP A 1 306 ? 5.696   56.752 2.459   1.00 120.59 ? 306 ASP Z CG    1 
ATOM   2402 O  OD1   . ASP A 1 306 ? 6.714   56.139 2.846   1.00 126.80 ? 306 ASP Z OD1   1 
ATOM   2403 O  OD2   . ASP A 1 306 ? 5.097   57.592 3.163   1.00 124.32 ? 306 ASP Z OD2   1 
ATOM   2404 N  N     . PRO A 1 307 ? 5.741   52.975 1.782   1.00 109.56 ? 307 PRO Z N     1 
ATOM   2405 C  CA    . PRO A 1 307 ? 5.308   51.789 2.534   1.00 104.73 ? 307 PRO Z CA    1 
ATOM   2406 C  C     . PRO A 1 307 ? 4.688   52.111 3.893   1.00 102.69 ? 307 PRO Z C     1 
ATOM   2407 O  O     . PRO A 1 307 ? 3.956   51.286 4.441   1.00 98.67  ? 307 PRO Z O     1 
ATOM   2408 C  CB    . PRO A 1 307 ? 6.608   50.997 2.710   1.00 109.18 ? 307 PRO Z CB    1 
ATOM   2409 C  CG    . PRO A 1 307 ? 7.467   51.429 1.571   1.00 111.12 ? 307 PRO Z CG    1 
ATOM   2410 C  CD    . PRO A 1 307 ? 7.153   52.880 1.373   1.00 114.98 ? 307 PRO Z CD    1 
ATOM   2411 N  N     . GLU A 1 308 ? 4.978   53.292 4.427   1.00 104.40 ? 308 GLU Z N     1 
ATOM   2412 C  CA    . GLU A 1 308 ? 4.433   53.695 5.718   1.00 106.26 ? 308 GLU Z CA    1 
ATOM   2413 C  C     . GLU A 1 308 ? 2.932   53.958 5.632   1.00 99.99  ? 308 GLU Z C     1 
ATOM   2414 O  O     . GLU A 1 308 ? 2.221   53.878 6.632   1.00 96.15  ? 308 GLU Z O     1 
ATOM   2415 C  CB    . GLU A 1 308 ? 5.153   54.941 6.237   1.00 115.23 ? 308 GLU Z CB    1 
ATOM   2416 C  CG    . GLU A 1 308 ? 6.669   54.824 6.252   1.00 121.76 ? 308 GLU Z CG    1 
ATOM   2417 C  CD    . GLU A 1 308 ? 7.348   56.089 6.749   1.00 133.05 ? 308 GLU Z CD    1 
ATOM   2418 O  OE1   . GLU A 1 308 ? 7.041   56.526 7.881   1.00 136.32 ? 308 GLU Z OE1   1 
ATOM   2419 O  OE2   . GLU A 1 308 ? 8.184   56.647 6.005   1.00 136.23 ? 308 GLU Z OE2   1 
ATOM   2420 N  N     . THR A 1 309 ? 2.451   54.254 4.429   1.00 106.14 ? 309 THR Z N     1 
ATOM   2421 C  CA    . THR A 1 309 ? 1.048   54.601 4.239   1.00 99.77  ? 309 THR Z CA    1 
ATOM   2422 C  C     . THR A 1 309 ? 0.253   53.491 3.557   1.00 89.18  ? 309 THR Z C     1 
ATOM   2423 O  O     . THR A 1 309 ? -0.766  53.754 2.921   1.00 87.91  ? 309 THR Z O     1 
ATOM   2424 C  CB    . THR A 1 309 ? 0.903   55.891 3.409   1.00 103.74 ? 309 THR Z CB    1 
ATOM   2425 O  OG1   . THR A 1 309 ? 1.508   55.706 2.123   1.00 100.95 ? 309 THR Z OG1   1 
ATOM   2426 C  CG2   . THR A 1 309 ? 1.570   57.062 4.116   1.00 112.25 ? 309 THR Z CG2   1 
ATOM   2427 N  N     . LEU A 1 310 ? 0.715   52.252 3.696   1.00 97.36  ? 310 LEU Z N     1 
ATOM   2428 C  CA    . LEU A 1 310 ? 0.048   51.118 3.060   1.00 91.45  ? 310 LEU Z CA    1 
ATOM   2429 C  C     . LEU A 1 310 ? -0.410  50.072 4.073   1.00 81.93  ? 310 LEU Z C     1 
ATOM   2430 O  O     . LEU A 1 310 ? -0.245  48.869 3.854   1.00 77.86  ? 310 LEU Z O     1 
ATOM   2431 C  CB    . LEU A 1 310 ? 0.973   50.466 2.029   1.00 89.83  ? 310 LEU Z CB    1 
ATOM   2432 C  CG    . LEU A 1 310 ? 1.523   51.382 0.934   1.00 92.67  ? 310 LEU Z CG    1 
ATOM   2433 C  CD1   . LEU A 1 310 ? 2.390   50.601 -0.044  1.00 93.74  ? 310 LEU Z CD1   1 
ATOM   2434 C  CD2   . LEU A 1 310 ? 0.397   52.096 0.208   1.00 88.50  ? 310 LEU Z CD2   1 
ATOM   2435 N  N     . SER A 1 311 ? -0.991  50.533 5.177   1.00 81.53  ? 311 SER Z N     1 
ATOM   2436 C  CA    . SER A 1 311 ? -1.476  49.628 6.214   1.00 83.86  ? 311 SER Z CA    1 
ATOM   2437 C  C     . SER A 1 311 ? -2.716  48.869 5.749   1.00 80.98  ? 311 SER Z C     1 
ATOM   2438 O  O     . SER A 1 311 ? -2.982  47.756 6.206   1.00 80.77  ? 311 SER Z O     1 
ATOM   2439 C  CB    . SER A 1 311 ? -1.782  50.394 7.505   1.00 85.23  ? 311 SER Z CB    1 
ATOM   2440 O  OG    . SER A 1 311 ? -2.888  51.263 7.335   1.00 85.84  ? 311 SER Z OG    1 
ATOM   2441 N  N     . TYR A 1 312 ? -3.472  49.470 4.835   1.00 84.91  ? 312 TYR Z N     1 
ATOM   2442 C  CA    . TYR A 1 312 ? -4.673  48.831 4.308   1.00 85.15  ? 312 TYR Z CA    1 
ATOM   2443 C  C     . TYR A 1 312 ? -4.323  47.628 3.433   1.00 82.37  ? 312 TYR Z C     1 
ATOM   2444 O  O     . TYR A 1 312 ? -5.175  46.785 3.153   1.00 83.29  ? 312 TYR Z O     1 
ATOM   2445 C  CB    . TYR A 1 312 ? -5.518  49.836 3.519   1.00 79.16  ? 312 TYR Z CB    1 
ATOM   2446 C  CG    . TYR A 1 312 ? -4.758  50.610 2.465   1.00 82.68  ? 312 TYR Z CG    1 
ATOM   2447 C  CD1   . TYR A 1 312 ? -4.517  50.064 1.211   1.00 80.46  ? 312 TYR Z CD1   1 
ATOM   2448 C  CD2   . TYR A 1 312 ? -4.296  51.893 2.717   1.00 86.05  ? 312 TYR Z CD2   1 
ATOM   2449 C  CE1   . TYR A 1 312 ? -3.828  50.771 0.245   1.00 78.07  ? 312 TYR Z CE1   1 
ATOM   2450 C  CE2   . TYR A 1 312 ? -3.607  52.609 1.756   1.00 83.59  ? 312 TYR Z CE2   1 
ATOM   2451 C  CZ    . TYR A 1 312 ? -3.374  52.042 0.522   1.00 81.44  ? 312 TYR Z CZ    1 
ATOM   2452 O  OH    . TYR A 1 312 ? -2.690  52.748 -0.440  1.00 79.85  ? 312 TYR Z OH    1 
ATOM   2453 N  N     . ALA A 1 313 ? -3.067  47.553 3.006   1.00 79.75  ? 313 ALA Z N     1 
ATOM   2454 C  CA    . ALA A 1 313 ? -2.595  46.422 2.216   1.00 78.01  ? 313 ALA Z CA    1 
ATOM   2455 C  C     . ALA A 1 313 ? -2.026  45.328 3.115   1.00 78.02  ? 313 ALA Z C     1 
ATOM   2456 O  O     . ALA A 1 313 ? -1.346  44.416 2.644   1.00 76.53  ? 313 ALA Z O     1 
ATOM   2457 C  CB    . ALA A 1 313 ? -1.552  46.876 1.207   1.00 76.27  ? 313 ALA Z CB    1 
ATOM   2458 N  N     . GLY A 1 314 ? -2.305  45.426 4.411   1.00 81.62  ? 314 GLY Z N     1 
ATOM   2459 C  CA    . GLY A 1 314 ? -1.826  44.449 5.372   1.00 82.01  ? 314 GLY Z CA    1 
ATOM   2460 C  C     . GLY A 1 314 ? -0.758  45.006 6.292   1.00 84.23  ? 314 GLY Z C     1 
ATOM   2461 O  O     . GLY A 1 314 ? 0.116   45.753 5.855   1.00 85.18  ? 314 GLY Z O     1 
ATOM   2462 N  N     . GLN A 1 315 ? -0.826  44.639 7.568   1.00 86.53  ? 315 GLN Z N     1 
ATOM   2463 C  CA    . GLN A 1 315 ? 0.148   45.100 8.551   1.00 89.84  ? 315 GLN Z CA    1 
ATOM   2464 C  C     . GLN A 1 315 ? 1.244   44.063 8.767   1.00 88.57  ? 315 GLN Z C     1 
ATOM   2465 O  O     . GLN A 1 315 ? 0.987   42.860 8.735   1.00 81.93  ? 315 GLN Z O     1 
ATOM   2466 C  CB    . GLN A 1 315 ? -0.536  45.415 9.883   1.00 93.29  ? 315 GLN Z CB    1 
ATOM   2467 C  CG    . GLN A 1 315 ? 0.378   46.087 10.901  1.00 99.69  ? 315 GLN Z CG    1 
ATOM   2468 C  CD    . GLN A 1 315 ? 0.020   45.738 12.337  1.00 104.48 ? 315 GLN Z CD    1 
ATOM   2469 O  OE1   . GLN A 1 315 ? -0.345  46.608 13.129  1.00 109.52 ? 315 GLN Z OE1   1 
ATOM   2470 N  NE2   . GLN A 1 315 ? 0.128   44.458 12.679  1.00 103.77 ? 315 GLN Z NE2   1 
ATOM   2471 N  N     . TYR A 1 316 ? 2.467   44.536 8.984   1.00 91.96  ? 316 TYR Z N     1 
ATOM   2472 C  CA    . TYR A 1 316 ? 3.586   43.652 9.288   1.00 94.80  ? 316 TYR Z CA    1 
ATOM   2473 C  C     . TYR A 1 316 ? 3.530   43.125 10.722  1.00 95.97  ? 316 TYR Z C     1 
ATOM   2474 O  O     . TYR A 1 316 ? 3.117   43.831 11.642  1.00 99.14  ? 316 TYR Z O     1 
ATOM   2475 C  CB    . TYR A 1 316 ? 4.918   44.373 9.067   1.00 99.70  ? 316 TYR Z CB    1 
ATOM   2476 C  CG    . TYR A 1 316 ? 5.304   44.561 7.617   1.00 96.74  ? 316 TYR Z CG    1 
ATOM   2477 C  CD1   . TYR A 1 316 ? 4.898   45.685 6.909   1.00 99.98  ? 316 TYR Z CD1   1 
ATOM   2478 C  CD2   . TYR A 1 316 ? 6.089   43.621 6.959   1.00 95.71  ? 316 TYR Z CD2   1 
ATOM   2479 C  CE1   . TYR A 1 316 ? 5.254   45.863 5.584   1.00 98.92  ? 316 TYR Z CE1   1 
ATOM   2480 C  CE2   . TYR A 1 316 ? 6.450   43.790 5.636   1.00 96.06  ? 316 TYR Z CE2   1 
ATOM   2481 C  CZ    . TYR A 1 316 ? 6.030   44.913 4.954   1.00 97.68  ? 316 TYR Z CZ    1 
ATOM   2482 O  OH    . TYR A 1 316 ? 6.387   45.086 3.636   1.00 94.53  ? 316 TYR Z OH    1 
ATOM   2483 N  N     . VAL A 1 317 ? 3.937   41.872 10.897  1.00 96.72  ? 317 VAL Z N     1 
ATOM   2484 C  CA    . VAL A 1 317 ? 4.177   41.312 12.221  1.00 99.35  ? 317 VAL Z CA    1 
ATOM   2485 C  C     . VAL A 1 317 ? 5.552   40.658 12.209  1.00 99.58  ? 317 VAL Z C     1 
ATOM   2486 O  O     . VAL A 1 317 ? 6.235   40.673 11.183  1.00 100.47 ? 317 VAL Z O     1 
ATOM   2487 C  CB    . VAL A 1 317 ? 3.108   40.280 12.633  1.00 95.04  ? 317 VAL Z CB    1 
ATOM   2488 C  CG1   . VAL A 1 317 ? 1.734   40.928 12.698  1.00 93.99  ? 317 VAL Z CG1   1 
ATOM   2489 C  CG2   . VAL A 1 317 ? 3.109   39.100 11.673  1.00 93.95  ? 317 VAL Z CG2   1 
ATOM   2490 N  N     . ASP A 1 318 ? 5.960   40.091 13.340  1.00 99.53  ? 318 ASP Z N     1 
ATOM   2491 C  CA    . ASP A 1 318 ? 7.251   39.420 13.424  1.00 98.33  ? 318 ASP Z CA    1 
ATOM   2492 C  C     . ASP A 1 318 ? 7.290   38.237 12.463  1.00 93.41  ? 318 ASP Z C     1 
ATOM   2493 O  O     . ASP A 1 318 ? 6.291   37.538 12.287  1.00 91.51  ? 318 ASP Z O     1 
ATOM   2494 C  CB    . ASP A 1 318 ? 7.532   38.956 14.853  1.00 99.10  ? 318 ASP Z CB    1 
ATOM   2495 C  CG    . ASP A 1 318 ? 8.982   38.564 15.063  1.00 98.60  ? 318 ASP Z CG    1 
ATOM   2496 O  OD1   . ASP A 1 318 ? 9.236   37.581 15.791  1.00 100.02 ? 318 ASP Z OD1   1 
ATOM   2497 O  OD2   . ASP A 1 318 ? 9.868   39.242 14.500  1.00 100.42 ? 318 ASP Z OD2   1 
ATOM   2498 N  N     . ASP A 1 319 ? 8.444   38.019 11.841  1.00 96.26  ? 319 ASP Z N     1 
ATOM   2499 C  CA    . ASP A 1 319 ? 8.576   36.985 10.821  1.00 93.59  ? 319 ASP Z CA    1 
ATOM   2500 C  C     . ASP A 1 319 ? 8.387   35.580 11.393  1.00 91.92  ? 319 ASP Z C     1 
ATOM   2501 O  O     . ASP A 1 319 ? 7.949   34.674 10.686  1.00 90.45  ? 319 ASP Z O     1 
ATOM   2502 C  CB    . ASP A 1 319 ? 9.935   37.099 10.125  1.00 95.64  ? 319 ASP Z CB    1 
ATOM   2503 C  CG    . ASP A 1 319 ? 10.033  38.329 9.235   1.00 98.24  ? 319 ASP Z CG    1 
ATOM   2504 O  OD1   . ASP A 1 319 ? 8.994   38.746 8.677   1.00 95.65  ? 319 ASP Z OD1   1 
ATOM   2505 O  OD2   . ASP A 1 319 ? 11.147  38.877 9.091   1.00 102.23 ? 319 ASP Z OD2   1 
ATOM   2506 N  N     . SER A 1 320 ? 8.712   35.403 12.670  1.00 95.31  ? 320 SER Z N     1 
ATOM   2507 C  CA    . SER A 1 320 ? 8.513   34.120 13.339  1.00 93.75  ? 320 SER Z CA    1 
ATOM   2508 C  C     . SER A 1 320 ? 7.027   33.819 13.501  1.00 91.67  ? 320 SER Z C     1 
ATOM   2509 O  O     . SER A 1 320 ? 6.568   32.702 13.241  1.00 91.04  ? 320 SER Z O     1 
ATOM   2510 C  CB    . SER A 1 320 ? 9.203   34.111 14.704  1.00 95.58  ? 320 SER Z CB    1 
ATOM   2511 O  OG    . SER A 1 320 ? 8.719   35.158 15.526  1.00 99.64  ? 320 SER Z OG    1 
ATOM   2512 N  N     . ILE A 1 321 ? 6.282   34.831 13.934  1.00 88.95  ? 321 ILE Z N     1 
ATOM   2513 C  CA    . ILE A 1 321 ? 4.836   34.728 14.062  1.00 89.47  ? 321 ILE Z CA    1 
ATOM   2514 C  C     . ILE A 1 321 ? 4.203   34.513 12.693  1.00 84.73  ? 321 ILE Z C     1 
ATOM   2515 O  O     . ILE A 1 321 ? 3.270   33.725 12.548  1.00 82.91  ? 321 ILE Z O     1 
ATOM   2516 C  CB    . ILE A 1 321 ? 4.244   35.984 14.715  1.00 91.52  ? 321 ILE Z CB    1 
ATOM   2517 C  CG1   . ILE A 1 321 ? 4.891   36.211 16.082  1.00 94.20  ? 321 ILE Z CG1   1 
ATOM   2518 C  CG2   . ILE A 1 321 ? 2.732   35.865 14.842  1.00 90.33  ? 321 ILE Z CG2   1 
ATOM   2519 C  CD1   . ILE A 1 321 ? 4.602   37.560 16.667  1.00 96.19  ? 321 ILE Z CD1   1 
ATOM   2520 N  N     . ALA A 1 322 ? 4.729   35.212 11.691  1.00 87.92  ? 322 ALA Z N     1 
ATOM   2521 C  CA    . ALA A 1 322 ? 4.276   35.052 10.315  1.00 86.80  ? 322 ALA Z CA    1 
ATOM   2522 C  C     . ALA A 1 322 ? 4.487   33.617 9.849   1.00 85.98  ? 322 ALA Z C     1 
ATOM   2523 O  O     . ALA A 1 322 ? 3.658   33.057 9.131   1.00 80.92  ? 322 ALA Z O     1 
ATOM   2524 C  CB    . ALA A 1 322 ? 5.006   36.019 9.401   1.00 86.32  ? 322 ALA Z CB    1 
ATOM   2525 N  N     . LEU A 1 323 ? 5.607   33.032 10.263  1.00 88.32  ? 323 LEU Z N     1 
ATOM   2526 C  CA    . LEU A 1 323 ? 5.921   31.649 9.935   1.00 86.04  ? 323 LEU Z CA    1 
ATOM   2527 C  C     . LEU A 1 323 ? 4.932   30.704 10.598  1.00 86.59  ? 323 LEU Z C     1 
ATOM   2528 O  O     . LEU A 1 323 ? 4.437   29.769 9.967   1.00 86.92  ? 323 LEU Z O     1 
ATOM   2529 C  CB    . LEU A 1 323 ? 7.347   31.302 10.365  1.00 87.08  ? 323 LEU Z CB    1 
ATOM   2530 C  CG    . LEU A 1 323 ? 7.752   29.837 10.187  1.00 86.03  ? 323 LEU Z CG    1 
ATOM   2531 C  CD1   . LEU A 1 323 ? 7.677   29.443 8.720   1.00 85.53  ? 323 LEU Z CD1   1 
ATOM   2532 C  CD2   . LEU A 1 323 ? 9.143   29.589 10.747  1.00 85.40  ? 323 LEU Z CD2   1 
ATOM   2533 N  N     . GLN A 1 324 ? 4.646   30.954 11.872  1.00 86.31  ? 324 GLN Z N     1 
ATOM   2534 C  CA    . GLN A 1 324 ? 3.715   30.113 12.615  1.00 87.23  ? 324 GLN Z CA    1 
ATOM   2535 C  C     . GLN A 1 324 ? 2.305   30.187 12.039  1.00 86.01  ? 324 GLN Z C     1 
ATOM   2536 O  O     . GLN A 1 324 ? 1.583   29.191 12.028  1.00 86.25  ? 324 GLN Z O     1 
ATOM   2537 C  CB    . GLN A 1 324 ? 3.702   30.502 14.093  1.00 89.14  ? 324 GLN Z CB    1 
ATOM   2538 C  CG    . GLN A 1 324 ? 5.025   30.252 14.791  1.00 89.41  ? 324 GLN Z CG    1 
ATOM   2539 C  CD    . GLN A 1 324 ? 5.494   28.816 14.645  1.00 85.82  ? 324 GLN Z CD    1 
ATOM   2540 O  OE1   . GLN A 1 324 ? 4.700   27.877 14.730  1.00 85.28  ? 324 GLN Z OE1   1 
ATOM   2541 N  NE2   . GLN A 1 324 ? 6.790   28.638 14.415  1.00 82.40  ? 324 GLN Z NE2   1 
ATOM   2542 N  N     . ILE A 1 325 ? 1.917   31.366 11.563  1.00 86.19  ? 325 ILE Z N     1 
ATOM   2543 C  CA    . ILE A 1 325 ? 0.632   31.530 10.894  1.00 86.73  ? 325 ILE Z CA    1 
ATOM   2544 C  C     . ILE A 1 325 ? 0.635   30.769 9.575   1.00 83.84  ? 325 ILE Z C     1 
ATOM   2545 O  O     . ILE A 1 325 ? -0.321  30.063 9.249   1.00 80.85  ? 325 ILE Z O     1 
ATOM   2546 C  CB    . ILE A 1 325 ? 0.307   33.014 10.629  1.00 84.83  ? 325 ILE Z CB    1 
ATOM   2547 C  CG1   . ILE A 1 325 ? 0.100   33.763 11.944  1.00 87.64  ? 325 ILE Z CG1   1 
ATOM   2548 C  CG2   . ILE A 1 325 ? -0.935  33.147 9.760   1.00 81.19  ? 325 ILE Z CG2   1 
ATOM   2549 C  CD1   . ILE A 1 325 ? -0.255  35.219 11.758  1.00 90.40  ? 325 ILE Z CD1   1 
ATOM   2550 N  N     . ALA A 1 326 ? 1.726   30.912 8.828   1.00 86.09  ? 326 ALA Z N     1 
ATOM   2551 C  CA    . ALA A 1 326 ? 1.859   30.288 7.517   1.00 84.04  ? 326 ALA Z CA    1 
ATOM   2552 C  C     . ALA A 1 326 ? 1.793   28.766 7.602   1.00 84.66  ? 326 ALA Z C     1 
ATOM   2553 O  O     . ALA A 1 326 ? 1.258   28.111 6.707   1.00 83.85  ? 326 ALA Z O     1 
ATOM   2554 C  CB    . ALA A 1 326 ? 3.158   30.724 6.859   1.00 82.13  ? 326 ALA Z CB    1 
ATOM   2555 N  N     . LEU A 1 327 ? 2.336   28.209 8.680   1.00 85.59  ? 327 LEU Z N     1 
ATOM   2556 C  CA    . LEU A 1 327 ? 2.317   26.764 8.882   1.00 85.67  ? 327 LEU Z CA    1 
ATOM   2557 C  C     . LEU A 1 327 ? 0.955   26.296 9.383   1.00 88.81  ? 327 LEU Z C     1 
ATOM   2558 O  O     . LEU A 1 327 ? 0.664   25.103 9.386   1.00 91.30  ? 327 LEU Z O     1 
ATOM   2559 C  CB    . LEU A 1 327 ? 3.410   26.344 9.865   1.00 89.83  ? 327 LEU Z CB    1 
ATOM   2560 C  CG    . LEU A 1 327 ? 4.852   26.570 9.410   1.00 89.26  ? 327 LEU Z CG    1 
ATOM   2561 C  CD1   . LEU A 1 327 ? 5.819   26.299 10.552  1.00 89.94  ? 327 LEU Z CD1   1 
ATOM   2562 C  CD2   . LEU A 1 327 ? 5.172   25.693 8.211   1.00 88.06  ? 327 LEU Z CD2   1 
ATOM   2563 N  N     . GLY A 1 328 ? 0.123   27.242 9.806   1.00 88.13  ? 328 GLY Z N     1 
ATOM   2564 C  CA    . GLY A 1 328 ? -1.203  26.922 10.298  1.00 89.88  ? 328 GLY Z CA    1 
ATOM   2565 C  C     . GLY A 1 328 ? -1.199  26.517 11.760  1.00 95.45  ? 328 GLY Z C     1 
ATOM   2566 O  O     . GLY A 1 328 ? -2.197  26.016 12.277  1.00 94.34  ? 328 GLY Z O     1 
ATOM   2567 N  N     . ASN A 1 329 ? -0.072  26.735 12.429  1.00 92.37  ? 329 ASN Z N     1 
ATOM   2568 C  CA    . ASN A 1 329 ? 0.047   26.411 13.845  1.00 94.36  ? 329 ASN Z CA    1 
ATOM   2569 C  C     . ASN A 1 329 ? -0.612  27.466 14.733  1.00 97.44  ? 329 ASN Z C     1 
ATOM   2570 O  O     . ASN A 1 329 ? -1.125  27.150 15.806  1.00 99.06  ? 329 ASN Z O     1 
ATOM   2571 C  CB    . ASN A 1 329 ? 1.518   26.244 14.233  1.00 92.92  ? 329 ASN Z CB    1 
ATOM   2572 C  CG    . ASN A 1 329 ? 2.152   25.018 13.603  1.00 94.87  ? 329 ASN Z CG    1 
ATOM   2573 O  OD1   . ASN A 1 329 ? 1.485   24.011 13.370  1.00 94.76  ? 329 ASN Z OD1   1 
ATOM   2574 N  ND2   . ASN A 1 329 ? 3.450   25.097 13.329  1.00 92.32  ? 329 ASN Z ND2   1 
ATOM   2575 N  N     . LYS A 1 330 ? -0.600  28.717 14.282  1.00 91.15  ? 330 LYS Z N     1 
ATOM   2576 C  CA    . LYS A 1 330 ? -1.197  29.806 15.050  1.00 92.10  ? 330 LYS Z CA    1 
ATOM   2577 C  C     . LYS A 1 330 ? -2.548  30.222 14.477  1.00 92.02  ? 330 LYS Z C     1 
ATOM   2578 O  O     . LYS A 1 330 ? -2.681  30.441 13.276  1.00 91.78  ? 330 LYS Z O     1 
ATOM   2579 C  CB    . LYS A 1 330 ? -0.251  31.009 15.098  1.00 92.25  ? 330 LYS Z CB    1 
ATOM   2580 C  CG    . LYS A 1 330 ? -0.840  32.232 15.790  1.00 95.25  ? 330 LYS Z CG    1 
ATOM   2581 C  CD    . LYS A 1 330 ? 0.246   33.199 16.239  1.00 95.43  ? 330 LYS Z CD    1 
ATOM   2582 C  CE    . LYS A 1 330 ? 1.094   32.592 17.347  1.00 95.58  ? 330 LYS Z CE    1 
ATOM   2583 N  NZ    . LYS A 1 330 ? 2.138   33.534 17.833  1.00 96.61  ? 330 LYS Z NZ    1 
ATOM   2584 N  N     . ASP A 1 331 ? -3.547  30.330 15.350  1.00 95.87  ? 331 ASP Z N     1 
ATOM   2585 C  CA    . ASP A 1 331 ? -4.894  30.711 14.940  1.00 95.46  ? 331 ASP Z CA    1 
ATOM   2586 C  C     . ASP A 1 331 ? -4.901  32.127 14.373  1.00 96.71  ? 331 ASP Z C     1 
ATOM   2587 O  O     . ASP A 1 331 ? -4.228  33.018 14.887  1.00 98.45  ? 331 ASP Z O     1 
ATOM   2588 C  CB    . ASP A 1 331 ? -5.872  30.605 16.116  1.00 99.17  ? 331 ASP Z CB    1 
ATOM   2589 C  CG    . ASP A 1 331 ? -7.326  30.564 15.669  1.00 100.90 ? 331 ASP Z CG    1 
ATOM   2590 O  OD1   . ASP A 1 331 ? -7.620  30.995 14.534  1.00 99.37  ? 331 ASP Z OD1   1 
ATOM   2591 O  OD2   . ASP A 1 331 ? -8.179  30.102 16.457  1.00 102.08 ? 331 ASP Z OD2   1 
ATOM   2592 N  N     . ILE A 1 332 ? -5.666  32.319 13.304  1.00 98.73  ? 332 ILE Z N     1 
ATOM   2593 C  CA    . ILE A 1 332 ? -5.777  33.612 12.644  1.00 98.03  ? 332 ILE Z CA    1 
ATOM   2594 C  C     . ILE A 1 332 ? -6.395  34.661 13.567  1.00 101.30 ? 332 ILE Z C     1 
ATOM   2595 O  O     . ILE A 1 332 ? -5.974  35.818 13.582  1.00 100.09 ? 332 ILE Z O     1 
ATOM   2596 C  CB    . ILE A 1 332 ? -6.622  33.500 11.358  1.00 96.65  ? 332 ILE Z CB    1 
ATOM   2597 C  CG1   . ILE A 1 332 ? -5.993  32.490 10.393  1.00 96.20  ? 332 ILE Z CG1   1 
ATOM   2598 C  CG2   . ILE A 1 332 ? -6.778  34.854 10.691  1.00 95.63  ? 332 ILE Z CG2   1 
ATOM   2599 C  CD1   . ILE A 1 332 ? -4.608  32.873 9.927   1.00 94.95  ? 332 ILE Z CD1   1 
ATOM   2600 N  N     . ASN A 1 333 ? -7.385  34.241 14.347  1.00 100.65 ? 333 ASN Z N     1 
ATOM   2601 C  CA    . ASN A 1 333 ? -8.149  35.160 15.182  1.00 102.22 ? 333 ASN Z CA    1 
ATOM   2602 C  C     . ASN A 1 333 ? -7.566  35.333 16.582  1.00 103.42 ? 333 ASN Z C     1 
ATOM   2603 O  O     . ASN A 1 333 ? -7.284  36.453 17.009  1.00 103.98 ? 333 ASN Z O     1 
ATOM   2604 C  CB    . ASN A 1 333 ? -9.599  34.682 15.285  1.00 103.90 ? 333 ASN Z CB    1 
ATOM   2605 C  CG    . ASN A 1 333 ? -10.171 34.260 13.942  1.00 104.16 ? 333 ASN Z CG    1 
ATOM   2606 O  OD1   . ASN A 1 333 ? -10.605 33.121 13.771  1.00 104.94 ? 333 ASN Z OD1   1 
ATOM   2607 N  ND2   . ASN A 1 333 ? -10.169 35.178 12.981  1.00 100.96 ? 333 ASN Z ND2   1 
ATOM   2608 N  N     . THR A 1 334 ? -7.386  34.223 17.291  1.00 99.83  ? 334 THR Z N     1 
ATOM   2609 C  CA    . THR A 1 334 ? -6.968  34.271 18.688  1.00 99.68  ? 334 THR Z CA    1 
ATOM   2610 C  C     . THR A 1 334 ? -5.455  34.364 18.854  1.00 100.05 ? 334 THR Z C     1 
ATOM   2611 O  O     . THR A 1 334 ? -4.968  34.624 19.955  1.00 102.07 ? 334 THR Z O     1 
ATOM   2612 C  CB    . THR A 1 334 ? -7.465  33.037 19.467  1.00 103.05 ? 334 THR Z CB    1 
ATOM   2613 O  OG1   . THR A 1 334 ? -6.779  31.866 19.007  1.00 100.10 ? 334 THR Z OG1   1 
ATOM   2614 C  CG2   . THR A 1 334 ? -8.965  32.858 19.283  1.00 102.58 ? 334 THR Z CG2   1 
ATOM   2615 N  N     . PHE A 1 335 ? -4.722  34.144 17.764  1.00 99.19  ? 335 PHE Z N     1 
ATOM   2616 C  CA    . PHE A 1 335 ? -3.259  34.175 17.784  1.00 96.83  ? 335 PHE Z CA    1 
ATOM   2617 C  C     . PHE A 1 335 ? -2.681  33.161 18.767  1.00 96.53  ? 335 PHE Z C     1 
ATOM   2618 O  O     . PHE A 1 335 ? -1.589  33.355 19.302  1.00 94.99  ? 335 PHE Z O     1 
ATOM   2619 C  CB    . PHE A 1 335 ? -2.752  35.577 18.128  1.00 95.07  ? 335 PHE Z CB    1 
ATOM   2620 C  CG    . PHE A 1 335 ? -2.272  36.357 16.943  1.00 95.07  ? 335 PHE Z CG    1 
ATOM   2621 C  CD1   . PHE A 1 335 ? -3.173  36.908 16.047  1.00 94.47  ? 335 PHE Z CD1   1 
ATOM   2622 C  CD2   . PHE A 1 335 ? -0.918  36.549 16.730  1.00 95.64  ? 335 PHE Z CD2   1 
ATOM   2623 C  CE1   . PHE A 1 335 ? -2.730  37.629 14.955  1.00 94.10  ? 335 PHE Z CE1   1 
ATOM   2624 C  CE2   . PHE A 1 335 ? -0.469  37.271 15.639  1.00 94.72  ? 335 PHE Z CE2   1 
ATOM   2625 C  CZ    . PHE A 1 335 ? -1.377  37.812 14.751  1.00 92.85  ? 335 PHE Z CZ    1 
ATOM   2626 N  N     . GLU A 1 336 ? -3.419  32.081 19.002  1.00 94.35  ? 336 GLU Z N     1 
ATOM   2627 C  CA    . GLU A 1 336 ? -2.981  31.043 19.925  1.00 97.99  ? 336 GLU Z CA    1 
ATOM   2628 C  C     . GLU A 1 336 ? -2.548  29.786 19.180  1.00 93.81  ? 336 GLU Z C     1 
ATOM   2629 O  O     . GLU A 1 336 ? -3.122  29.434 18.149  1.00 93.99  ? 336 GLU Z O     1 
ATOM   2630 C  CB    . GLU A 1 336 ? -4.094  30.711 20.919  1.00 104.47 ? 336 GLU Z CB    1 
ATOM   2631 C  CG    . GLU A 1 336 ? -4.470  31.868 21.830  1.00 112.33 ? 336 GLU Z CG    1 
ATOM   2632 C  CD    . GLU A 1 336 ? -5.613  31.526 22.767  1.00 117.13 ? 336 GLU Z CD    1 
ATOM   2633 O  OE1   . GLU A 1 336 ? -5.864  32.303 23.713  1.00 124.54 ? 336 GLU Z OE1   1 
ATOM   2634 O  OE2   . GLU A 1 336 ? -6.261  30.479 22.554  1.00 123.75 ? 336 GLU Z OE2   1 
ATOM   2635 N  N     . GLN A 1 337 ? -1.527  29.117 19.706  1.00 98.27  ? 337 GLN Z N     1 
ATOM   2636 C  CA    . GLN A 1 337 ? -1.008  27.901 19.094  1.00 96.05  ? 337 GLN Z CA    1 
ATOM   2637 C  C     . GLN A 1 337 ? -2.008  26.757 19.202  1.00 98.56  ? 337 GLN Z C     1 
ATOM   2638 O  O     . GLN A 1 337 ? -2.385  26.356 20.303  1.00 103.25 ? 337 GLN Z O     1 
ATOM   2639 C  CB    . GLN A 1 337 ? 0.318   27.505 19.743  1.00 95.17  ? 337 GLN Z CB    1 
ATOM   2640 C  CG    . GLN A 1 337 ? 1.435   28.510 19.525  1.00 94.93  ? 337 GLN Z CG    1 
ATOM   2641 C  CD    . GLN A 1 337 ? 1.917   28.541 18.092  1.00 91.47  ? 337 GLN Z CD    1 
ATOM   2642 O  OE1   . GLN A 1 337 ? 1.738   27.580 17.345  1.00 92.95  ? 337 GLN Z OE1   1 
ATOM   2643 N  NE2   . GLN A 1 337 ? 2.540   29.647 17.700  1.00 90.07  ? 337 GLN Z NE2   1 
ATOM   2644 N  N     . ILE A 1 338 ? -2.437  26.238 18.055  1.00 101.86 ? 338 ILE Z N     1 
ATOM   2645 C  CA    . ILE A 1 338 ? -3.371  25.118 18.023  1.00 102.71 ? 338 ILE Z CA    1 
ATOM   2646 C  C     . ILE A 1 338 ? -2.720  23.882 17.406  1.00 101.22 ? 338 ILE Z C     1 
ATOM   2647 O  O     . ILE A 1 338 ? -3.348  22.830 17.290  1.00 102.38 ? 338 ILE Z O     1 
ATOM   2648 C  CB    . ILE A 1 338 ? -4.659  25.475 17.248  1.00 101.11 ? 338 ILE Z CB    1 
ATOM   2649 C  CG1   . ILE A 1 338 ? -4.324  26.141 15.912  1.00 98.25  ? 338 ILE Z CG1   1 
ATOM   2650 C  CG2   . ILE A 1 338 ? -5.543  26.395 18.075  1.00 101.67 ? 338 ILE Z CG2   1 
ATOM   2651 C  CD1   . ILE A 1 338 ? -4.274  25.187 14.742  1.00 98.18  ? 338 ILE Z CD1   1 
ATOM   2652 N  N     . ASP A 1 339 ? -1.458  24.022 17.013  1.00 97.64  ? 339 ASP Z N     1 
ATOM   2653 C  CA    . ASP A 1 339 ? -0.678  22.906 16.491  1.00 100.14 ? 339 ASP Z CA    1 
ATOM   2654 C  C     . ASP A 1 339 ? 0.809   23.222 16.631  1.00 99.46  ? 339 ASP Z C     1 
ATOM   2655 O  O     . ASP A 1 339 ? 1.175   24.331 17.014  1.00 97.15  ? 339 ASP Z O     1 
ATOM   2656 C  CB    . ASP A 1 339 ? -1.038  22.619 15.031  1.00 103.33 ? 339 ASP Z CB    1 
ATOM   2657 C  CG    . ASP A 1 339 ? -0.735  21.187 14.625  1.00 108.06 ? 339 ASP Z CG    1 
ATOM   2658 O  OD1   . ASP A 1 339 ? 0.248   20.612 15.140  1.00 109.00 ? 339 ASP Z OD1   1 
ATOM   2659 O  OD2   . ASP A 1 339 ? -1.485  20.634 13.792  1.00 109.35 ? 339 ASP Z OD2   1 
ATOM   2660 N  N     . ASP A 1 340 ? 1.661   22.250 16.323  1.00 103.45 ? 340 ASP Z N     1 
ATOM   2661 C  CA    . ASP A 1 340 ? 3.101   22.423 16.493  1.00 102.74 ? 340 ASP Z CA    1 
ATOM   2662 C  C     . ASP A 1 340 ? 3.913   21.716 15.411  1.00 105.62 ? 340 ASP Z C     1 
ATOM   2663 O  O     . ASP A 1 340 ? 4.916   21.067 15.706  1.00 107.32 ? 340 ASP Z O     1 
ATOM   2664 C  CB    . ASP A 1 340 ? 3.530   21.914 17.871  1.00 105.13 ? 340 ASP Z CB    1 
ATOM   2665 C  CG    . ASP A 1 340 ? 3.119   20.473 18.114  1.00 109.97 ? 340 ASP Z CG    1 
ATOM   2666 O  OD1   . ASP A 1 340 ? 2.090   20.045 17.550  1.00 112.82 ? 340 ASP Z OD1   1 
ATOM   2667 O  OD2   . ASP A 1 340 ? 3.825   19.768 18.865  1.00 115.50 ? 340 ASP Z OD2   1 
ATOM   2668 N  N     . TYR A 1 341 ? 3.483   21.845 14.161  1.00 106.93 ? 341 TYR Z N     1 
ATOM   2669 C  CA    . TYR A 1 341 ? 4.191   21.212 13.055  1.00 106.54 ? 341 TYR Z CA    1 
ATOM   2670 C  C     . TYR A 1 341 ? 5.560   21.848 12.833  1.00 107.98 ? 341 TYR Z C     1 
ATOM   2671 O  O     . TYR A 1 341 ? 5.693   23.072 12.826  1.00 105.75 ? 341 TYR Z O     1 
ATOM   2672 C  CB    . TYR A 1 341 ? 3.362   21.288 11.772  1.00 109.44 ? 341 TYR Z CB    1 
ATOM   2673 C  CG    . TYR A 1 341 ? 4.092   20.785 10.548  1.00 108.68 ? 341 TYR Z CG    1 
ATOM   2674 C  CD1   . TYR A 1 341 ? 4.268   19.425 10.331  1.00 110.69 ? 341 TYR Z CD1   1 
ATOM   2675 C  CD2   . TYR A 1 341 ? 4.603   21.671 9.607   1.00 106.75 ? 341 TYR Z CD2   1 
ATOM   2676 C  CE1   . TYR A 1 341 ? 4.936   18.961 9.214   1.00 110.97 ? 341 TYR Z CE1   1 
ATOM   2677 C  CE2   . TYR A 1 341 ? 5.271   21.216 8.487   1.00 109.13 ? 341 TYR Z CE2   1 
ATOM   2678 C  CZ    . TYR A 1 341 ? 5.434   19.861 8.295   1.00 110.79 ? 341 TYR Z CZ    1 
ATOM   2679 O  OH    . TYR A 1 341 ? 6.099   19.404 7.181   1.00 113.09 ? 341 TYR Z OH    1 
ATOM   2680 N  N     . ASN A 1 342 ? 6.575   21.009 12.655  1.00 113.45 ? 342 ASN Z N     1 
ATOM   2681 C  CA    . ASN A 1 342 ? 7.928   21.486 12.396  1.00 112.16 ? 342 ASN Z CA    1 
ATOM   2682 C  C     . ASN A 1 342 ? 8.510   20.842 11.143  1.00 113.50 ? 342 ASN Z C     1 
ATOM   2683 O  O     . ASN A 1 342 ? 8.831   19.654 11.141  1.00 116.22 ? 342 ASN Z O     1 
ATOM   2684 C  CB    . ASN A 1 342 ? 8.833   21.212 13.600  1.00 114.67 ? 342 ASN Z CB    1 
ATOM   2685 C  CG    . ASN A 1 342 ? 10.205  21.844 13.455  1.00 116.08 ? 342 ASN Z CG    1 
ATOM   2686 O  OD1   . ASN A 1 342 ? 10.393  22.772 12.668  1.00 114.83 ? 342 ASN Z OD1   1 
ATOM   2687 N  ND2   . ASN A 1 342 ? 11.171  21.346 14.219  1.00 115.69 ? 342 ASN Z ND2   1 
ATOM   2688 N  N     . PRO A 1 343 ? 8.650   21.632 10.068  1.00 117.39 ? 343 PRO Z N     1 
ATOM   2689 C  CA    . PRO A 1 343 ? 9.144   21.131 8.781   1.00 116.63 ? 343 PRO Z CA    1 
ATOM   2690 C  C     . PRO A 1 343 ? 10.621  20.751 8.824   1.00 118.31 ? 343 PRO Z C     1 
ATOM   2691 O  O     . PRO A 1 343 ? 11.084  19.992 7.971   1.00 120.30 ? 343 PRO Z O     1 
ATOM   2692 C  CB    . PRO A 1 343 ? 8.912   22.312 7.835   1.00 112.62 ? 343 PRO Z CB    1 
ATOM   2693 C  CG    . PRO A 1 343 ? 8.955   23.511 8.717   1.00 110.91 ? 343 PRO Z CG    1 
ATOM   2694 C  CD    . PRO A 1 343 ? 8.346   23.074 10.021  1.00 114.22 ? 343 PRO Z CD    1 
ATOM   2695 N  N     . ASP A 1 344 ? 11.345  21.273 9.809   1.00 120.77 ? 344 ASP Z N     1 
ATOM   2696 C  CA    . ASP A 1 344 ? 12.767  20.986 9.953   1.00 119.17 ? 344 ASP Z CA    1 
ATOM   2697 C  C     . ASP A 1 344 ? 12.993  19.528 10.341  1.00 121.00 ? 344 ASP Z C     1 
ATOM   2698 O  O     . ASP A 1 344 ? 13.725  18.801 9.670   1.00 122.23 ? 344 ASP Z O     1 
ATOM   2699 C  CB    . ASP A 1 344 ? 13.396  21.915 10.991  1.00 117.41 ? 344 ASP Z CB    1 
ATOM   2700 C  CG    . ASP A 1 344 ? 13.127  23.378 10.700  1.00 115.23 ? 344 ASP Z CG    1 
ATOM   2701 O  OD1   . ASP A 1 344 ? 12.902  23.719 9.520   1.00 112.36 ? 344 ASP Z OD1   1 
ATOM   2702 O  OD2   . ASP A 1 344 ? 13.139  24.187 11.650  1.00 118.01 ? 344 ASP Z OD2   1 
ATOM   2703 N  N     . THR A 1 345 ? 12.354  19.108 11.428  1.00 120.40 ? 345 THR Z N     1 
ATOM   2704 C  CA    . THR A 1 345 ? 12.454  17.731 11.896  1.00 122.64 ? 345 THR Z CA    1 
ATOM   2705 C  C     . THR A 1 345 ? 11.603  16.800 11.039  1.00 123.36 ? 345 THR Z C     1 
ATOM   2706 O  O     . THR A 1 345 ? 10.385  16.732 11.200  1.00 123.35 ? 345 THR Z O     1 
ATOM   2707 C  CB    . THR A 1 345 ? 12.023  17.606 13.369  1.00 122.56 ? 345 THR Z CB    1 
ATOM   2708 O  OG1   . THR A 1 345 ? 10.680  18.084 13.519  1.00 123.16 ? 345 THR Z OG1   1 
ATOM   2709 C  CG2   . THR A 1 345 ? 12.946  18.421 14.263  1.00 119.42 ? 345 THR Z CG2   1 
ATOM   2710 N  N     . ALA A 1 346 ? 12.251  16.085 10.125  1.00 123.63 ? 346 ALA Z N     1 
ATOM   2711 C  CA    . ALA A 1 346 ? 11.551  15.170 9.232   1.00 126.69 ? 346 ALA Z CA    1 
ATOM   2712 C  C     . ALA A 1 346 ? 12.448  14.004 8.831   1.00 127.60 ? 346 ALA Z C     1 
ATOM   2713 O  O     . ALA A 1 346 ? 13.511  14.203 8.244   1.00 127.10 ? 346 ALA Z O     1 
ATOM   2714 C  CB    . ALA A 1 346 ? 11.055  15.909 7.995   1.00 125.15 ? 346 ALA Z CB    1 
ATOM   2715 N  N     . LEU A 1 355 ? 8.671   22.548 0.451   1.00 97.61  ? 355 LEU Z N     1 
ATOM   2716 C  CA    . LEU A 1 355 ? 8.360   23.954 0.221   1.00 98.73  ? 355 LEU Z CA    1 
ATOM   2717 C  C     . LEU A 1 355 ? 9.393   24.863 0.875   1.00 98.61  ? 355 LEU Z C     1 
ATOM   2718 O  O     . LEU A 1 355 ? 9.890   25.805 0.256   1.00 97.41  ? 355 LEU Z O     1 
ATOM   2719 C  CB    . LEU A 1 355 ? 6.961   24.287 0.747   1.00 96.28  ? 355 LEU Z CB    1 
ATOM   2720 C  CG    . LEU A 1 355 ? 6.544   25.760 0.696   1.00 93.26  ? 355 LEU Z CG    1 
ATOM   2721 C  CD1   . LEU A 1 355 ? 6.570   26.293 -0.731  1.00 91.59  ? 355 LEU Z CD1   1 
ATOM   2722 C  CD2   . LEU A 1 355 ? 5.168   25.949 1.316   1.00 92.35  ? 355 LEU Z CD2   1 
ATOM   2723 N  N     . TYR A 1 356 ? 9.712   24.572 2.131   1.00 97.99  ? 356 TYR Z N     1 
ATOM   2724 C  CA    . TYR A 1 356 ? 10.654  25.384 2.890   1.00 100.69 ? 356 TYR Z CA    1 
ATOM   2725 C  C     . TYR A 1 356 ? 12.071  24.831 2.776   1.00 102.73 ? 356 TYR Z C     1 
ATOM   2726 O  O     . TYR A 1 356 ? 12.495  24.007 3.586   1.00 100.08 ? 356 TYR Z O     1 
ATOM   2727 C  CB    . TYR A 1 356 ? 10.228  25.459 4.358   1.00 98.58  ? 356 TYR Z CB    1 
ATOM   2728 C  CG    . TYR A 1 356 ? 8.787   25.883 4.552   1.00 98.44  ? 356 TYR Z CG    1 
ATOM   2729 C  CD1   . TYR A 1 356 ? 8.439   27.227 4.625   1.00 95.15  ? 356 TYR Z CD1   1 
ATOM   2730 C  CD2   . TYR A 1 356 ? 7.773   24.939 4.655   1.00 97.74  ? 356 TYR Z CD2   1 
ATOM   2731 C  CE1   . TYR A 1 356 ? 7.122   27.616 4.798   1.00 93.29  ? 356 TYR Z CE1   1 
ATOM   2732 C  CE2   . TYR A 1 356 ? 6.455   25.319 4.827   1.00 94.25  ? 356 TYR Z CE2   1 
ATOM   2733 C  CZ    . TYR A 1 356 ? 6.136   26.658 4.898   1.00 93.29  ? 356 TYR Z CZ    1 
ATOM   2734 O  OH    . TYR A 1 356 ? 4.826   27.043 5.072   1.00 90.87  ? 356 TYR Z OH    1 
ATOM   2735 N  N     . PHE A 1 357 ? 12.797  25.291 1.761   1.00 107.29 ? 357 PHE Z N     1 
ATOM   2736 C  CA    . PHE A 1 357 ? 14.164  24.841 1.528   1.00 110.08 ? 357 PHE Z CA    1 
ATOM   2737 C  C     . PHE A 1 357 ? 15.109  25.372 2.601   1.00 111.85 ? 357 PHE Z C     1 
ATOM   2738 O  O     . PHE A 1 357 ? 15.972  26.207 2.326   1.00 115.83 ? 357 PHE Z O     1 
ATOM   2739 C  CB    . PHE A 1 357 ? 14.635  25.270 0.145   1.00 107.07 ? 357 PHE Z CB    1 
ATOM   2740 O  "O5'" . DC  B 2 1   ? -23.297 44.261 -31.258 1.00 125.78 ? 1   DC  A "O5'" 1 
ATOM   2741 C  "C5'" . DC  B 2 1   ? -22.485 44.373 -30.092 1.00 129.76 ? 1   DC  A "C5'" 1 
ATOM   2742 C  "C4'" . DC  B 2 1   ? -22.329 45.825 -29.674 1.00 127.27 ? 1   DC  A "C4'" 1 
ATOM   2743 O  "O4'" . DC  B 2 1   ? -23.598 46.487 -29.790 1.00 122.15 ? 1   DC  A "O4'" 1 
ATOM   2744 C  "C3'" . DC  B 2 1   ? -21.898 46.028 -28.227 1.00 129.16 ? 1   DC  A "C3'" 1 
ATOM   2745 O  "O3'" . DC  B 2 1   ? -20.485 46.240 -28.164 1.00 129.45 ? 1   DC  A "O3'" 1 
ATOM   2746 C  "C2'" . DC  B 2 1   ? -22.663 47.278 -27.762 1.00 125.03 ? 1   DC  A "C2'" 1 
ATOM   2747 C  "C1'" . DC  B 2 1   ? -23.641 47.578 -28.904 1.00 122.53 ? 1   DC  A "C1'" 1 
ATOM   2748 N  N1    . DC  B 2 1   ? -25.058 47.757 -28.466 1.00 122.17 ? 1   DC  A N1    1 
ATOM   2749 C  C2    . DC  B 2 1   ? -25.417 48.849 -27.660 1.00 120.37 ? 1   DC  A C2    1 
ATOM   2750 O  O2    . DC  B 2 1   ? -24.550 49.658 -27.306 1.00 119.69 ? 1   DC  A O2    1 
ATOM   2751 N  N3    . DC  B 2 1   ? -26.714 48.985 -27.285 1.00 120.46 ? 1   DC  A N3    1 
ATOM   2752 C  C4    . DC  B 2 1   ? -27.624 48.095 -27.684 1.00 120.16 ? 1   DC  A C4    1 
ATOM   2753 N  N4    . DC  B 2 1   ? -28.886 48.271 -27.290 1.00 117.18 ? 1   DC  A N4    1 
ATOM   2754 C  C5    . DC  B 2 1   ? -27.279 46.984 -28.505 1.00 120.25 ? 1   DC  A C5    1 
ATOM   2755 C  C6    . DC  B 2 1   ? -26.000 46.856 -28.871 1.00 121.47 ? 1   DC  A C6    1 
ATOM   2756 P  P     . DG  B 2 2   ? -19.640 45.714 -26.901 1.00 133.04 ? 2   DG  A P     1 
ATOM   2757 O  OP1   . DG  B 2 2   ? -18.233 46.123 -27.104 1.00 131.75 ? 2   DG  A OP1   1 
ATOM   2758 O  OP2   . DG  B 2 2   ? -19.974 44.289 -26.679 1.00 133.44 ? 2   DG  A OP2   1 
ATOM   2759 O  "O5'" . DG  B 2 2   ? -20.233 46.540 -25.669 1.00 126.17 ? 2   DG  A "O5'" 1 
ATOM   2760 C  "C5'" . DG  B 2 2   ? -19.914 47.914 -25.506 1.00 123.34 ? 2   DG  A "C5'" 1 
ATOM   2761 C  "C4'" . DG  B 2 2   ? -20.517 48.452 -24.221 1.00 124.73 ? 2   DG  A "C4'" 1 
ATOM   2762 O  "O4'" . DG  B 2 2   ? -21.964 48.497 -24.346 1.00 125.24 ? 2   DG  A "O4'" 1 
ATOM   2763 C  "C3'" . DG  B 2 2   ? -20.227 47.617 -22.976 1.00 125.21 ? 2   DG  A "C3'" 1 
ATOM   2764 O  "O3'" . DG  B 2 2   ? -20.043 48.467 -21.845 1.00 128.26 ? 2   DG  A "O3'" 1 
ATOM   2765 C  "C2'" . DG  B 2 2   ? -21.483 46.758 -22.841 1.00 126.45 ? 2   DG  A "C2'" 1 
ATOM   2766 C  "C1'" . DG  B 2 2   ? -22.559 47.718 -23.329 1.00 123.16 ? 2   DG  A "C1'" 1 
ATOM   2767 N  N9    . DG  B 2 2   ? -23.743 47.057 -23.882 1.00 124.59 ? 2   DG  A N9    1 
ATOM   2768 C  C8    . DG  B 2 2   ? -23.780 46.048 -24.817 1.00 126.26 ? 2   DG  A C8    1 
ATOM   2769 N  N7    . DG  B 2 2   ? -24.993 45.669 -25.124 1.00 126.20 ? 2   DG  A N7    1 
ATOM   2770 C  C5    . DG  B 2 2   ? -25.810 46.481 -24.345 1.00 124.63 ? 2   DG  A C5    1 
ATOM   2771 C  C6    . DG  B 2 2   ? -27.224 46.536 -24.243 1.00 122.20 ? 2   DG  A C6    1 
ATOM   2772 O  O6    . DG  B 2 2   ? -28.071 45.854 -24.840 1.00 121.80 ? 2   DG  A O6    1 
ATOM   2773 N  N1    . DG  B 2 2   ? -27.632 47.507 -23.334 1.00 122.74 ? 2   DG  A N1    1 
ATOM   2774 C  C2    . DG  B 2 2   ? -26.787 48.318 -22.616 1.00 121.55 ? 2   DG  A C2    1 
ATOM   2775 N  N2    . DG  B 2 2   ? -27.364 49.196 -21.790 1.00 121.44 ? 2   DG  A N2    1 
ATOM   2776 N  N3    . DG  B 2 2   ? -25.470 48.278 -22.704 1.00 122.05 ? 2   DG  A N3    1 
ATOM   2777 C  C4    . DG  B 2 2   ? -25.053 47.341 -23.581 1.00 124.18 ? 2   DG  A C4    1 
ATOM   2778 P  P     . DC  B 2 3   ? -19.142 47.984 -20.605 1.00 121.10 ? 3   DC  A P     1 
ATOM   2779 O  OP1   . DC  B 2 3   ? -17.967 48.877 -20.503 1.00 121.26 ? 3   DC  A OP1   1 
ATOM   2780 O  OP2   . DC  B 2 3   ? -18.947 46.522 -20.726 1.00 122.92 ? 3   DC  A OP2   1 
ATOM   2781 O  "O5'" . DC  B 2 3   ? -20.079 48.235 -19.342 1.00 121.32 ? 3   DC  A "O5'" 1 
ATOM   2782 C  "C5'" . DC  B 2 3   ? -20.642 49.515 -19.127 1.00 119.78 ? 3   DC  A "C5'" 1 
ATOM   2783 C  "C4'" . DC  B 2 3   ? -21.791 49.432 -18.141 1.00 120.08 ? 3   DC  A "C4'" 1 
ATOM   2784 O  "O4'" . DC  B 2 3   ? -22.968 48.902 -18.806 1.00 119.15 ? 3   DC  A "O4'" 1 
ATOM   2785 C  "C3'" . DC  B 2 3   ? -21.544 48.527 -16.936 1.00 122.44 ? 3   DC  A "C3'" 1 
ATOM   2786 O  "O3'" . DC  B 2 3   ? -22.104 49.116 -15.778 1.00 122.76 ? 3   DC  A "O3'" 1 
ATOM   2787 C  "C2'" . DC  B 2 3   ? -22.276 47.242 -17.319 1.00 122.86 ? 3   DC  A "C2'" 1 
ATOM   2788 C  "C1'" . DC  B 2 3   ? -23.465 47.805 -18.076 1.00 120.69 ? 3   DC  A "C1'" 1 
ATOM   2789 N  N1    . DC  B 2 3   ? -24.099 46.849 -19.032 1.00 120.42 ? 3   DC  A N1    1 
ATOM   2790 C  C2    . DC  B 2 3   ? -25.484 46.698 -19.020 1.00 119.89 ? 3   DC  A C2    1 
ATOM   2791 O  O2    . DC  B 2 3   ? -26.146 47.352 -18.209 1.00 119.68 ? 3   DC  A O2    1 
ATOM   2792 N  N3    . DC  B 2 3   ? -26.063 45.838 -19.893 1.00 119.82 ? 3   DC  A N3    1 
ATOM   2793 C  C4    . DC  B 2 3   ? -25.311 45.153 -20.753 1.00 120.23 ? 3   DC  A C4    1 
ATOM   2794 N  N4    . DC  B 2 3   ? -25.931 44.316 -21.596 1.00 120.32 ? 3   DC  A N4    1 
ATOM   2795 C  C5    . DC  B 2 3   ? -23.891 45.295 -20.786 1.00 120.77 ? 3   DC  A C5    1 
ATOM   2796 C  C6    . DC  B 2 3   ? -23.332 46.149 -19.917 1.00 120.84 ? 3   DC  A C6    1 
ATOM   2797 P  P     . DT  B 2 4   ? -21.410 48.906 -14.346 1.00 125.16 ? 4   DT  A P     1 
ATOM   2798 O  OP1   . DT  B 2 4   ? -20.736 50.174 -13.989 1.00 124.97 ? 4   DT  A OP1   1 
ATOM   2799 O  OP2   . DT  B 2 4   ? -20.636 47.643 -14.396 1.00 127.02 ? 4   DT  A OP2   1 
ATOM   2800 O  "O5'" . DT  B 2 4   ? -22.651 48.692 -13.362 1.00 125.64 ? 4   DT  A "O5'" 1 
ATOM   2801 C  "C5'" . DT  B 2 4   ? -23.736 49.608 -13.393 1.00 124.06 ? 4   DT  A "C5'" 1 
ATOM   2802 C  "C4'" . DT  B 2 4   ? -25.063 48.885 -13.249 1.00 124.09 ? 4   DT  A "C4'" 1 
ATOM   2803 O  "O4'" . DT  B 2 4   ? -25.315 48.078 -14.418 1.00 123.34 ? 4   DT  A "O4'" 1 
ATOM   2804 C  "C3'" . DT  B 2 4   ? -25.155 47.932 -12.053 1.00 126.36 ? 4   DT  A "C3'" 1 
ATOM   2805 O  "O3'" . DT  B 2 4   ? -26.080 48.444 -11.105 1.00 129.17 ? 4   DT  A "O3'" 1 
ATOM   2806 C  "C2'" . DT  B 2 4   ? -25.632 46.596 -12.655 1.00 126.70 ? 4   DT  A "C2'" 1 
ATOM   2807 C  "C1'" . DT  B 2 4   ? -26.132 47.006 -14.033 1.00 124.42 ? 4   DT  A "C1'" 1 
ATOM   2808 N  N1    . DT  B 2 4   ? -26.029 45.928 -15.064 1.00 124.48 ? 4   DT  A N1    1 
ATOM   2809 C  C2    . DT  B 2 4   ? -27.173 45.481 -15.686 1.00 123.80 ? 4   DT  A C2    1 
ATOM   2810 O  O2    . DT  B 2 4   ? -28.283 45.919 -15.439 1.00 123.15 ? 4   DT  A O2    1 
ATOM   2811 N  N3    . DT  B 2 4   ? -26.973 44.494 -16.615 1.00 124.12 ? 4   DT  A N3    1 
ATOM   2812 C  C4    . DT  B 2 4   ? -25.767 43.924 -16.979 1.00 125.07 ? 4   DT  A C4    1 
ATOM   2813 O  O4    . DT  B 2 4   ? -25.688 43.040 -17.829 1.00 125.48 ? 4   DT  A O4    1 
ATOM   2814 C  C5    . DT  B 2 4   ? -24.606 44.437 -16.289 1.00 125.77 ? 4   DT  A C5    1 
ATOM   2815 C  C7    . DT  B 2 4   ? -23.244 43.890 -16.599 1.00 127.08 ? 4   DT  A C7    1 
ATOM   2816 C  C6    . DT  B 2 4   ? -24.791 45.405 -15.377 1.00 125.43 ? 4   DT  A C6    1 
ATOM   2817 P  P     . DA  B 2 5   ? -25.896 48.130 -9.540  1.00 129.59 ? 5   DA  A P     1 
ATOM   2818 O  OP1   . DA  B 2 5   ? -26.208 49.372 -8.798  1.00 130.34 ? 5   DA  A OP1   1 
ATOM   2819 O  OP2   . DA  B 2 5   ? -24.586 47.465 -9.360  1.00 130.62 ? 5   DA  A OP2   1 
ATOM   2820 O  "O5'" . DA  B 2 5   ? -27.031 47.047 -9.239  1.00 133.18 ? 5   DA  A "O5'" 1 
ATOM   2821 C  "C5'" . DA  B 2 5   ? -28.366 47.290 -9.654  1.00 132.86 ? 5   DA  A "C5'" 1 
ATOM   2822 C  "C4'" . DA  B 2 5   ? -29.115 45.984 -9.850  1.00 137.55 ? 5   DA  A "C4'" 1 
ATOM   2823 O  "O4'" . DA  B 2 5   ? -28.611 45.302 -11.034 1.00 134.74 ? 5   DA  A "O4'" 1 
ATOM   2824 C  "C3'" . DA  B 2 5   ? -28.986 44.984 -8.696  1.00 144.31 ? 5   DA  A "C3'" 1 
ATOM   2825 O  "O3'" . DA  B 2 5   ? -30.248 44.384 -8.432  1.00 149.47 ? 5   DA  A "O3'" 1 
ATOM   2826 C  "C2'" . DA  B 2 5   ? -27.989 43.964 -9.241  1.00 143.33 ? 5   DA  A "C2'" 1 
ATOM   2827 C  "C1'" . DA  B 2 5   ? -28.365 43.956 -10.712 1.00 138.67 ? 5   DA  A "C1'" 1 
ATOM   2828 N  N9    . DA  B 2 5   ? -27.317 43.435 -11.588 1.00 132.93 ? 5   DA  A N9    1 
ATOM   2829 C  C8    . DA  B 2 5   ? -25.965 43.494 -11.385 1.00 132.15 ? 5   DA  A C8    1 
ATOM   2830 N  N7    . DA  B 2 5   ? -25.262 42.934 -12.342 1.00 131.71 ? 5   DA  A N7    1 
ATOM   2831 C  C5    . DA  B 2 5   ? -26.218 42.473 -13.232 1.00 130.73 ? 5   DA  A C5    1 
ATOM   2832 C  C6    . DA  B 2 5   ? -26.123 41.784 -14.458 1.00 130.43 ? 5   DA  A C6    1 
ATOM   2833 N  N6    . DA  B 2 5   ? -24.960 41.429 -15.014 1.00 131.10 ? 5   DA  A N6    1 
ATOM   2834 N  N1    . DA  B 2 5   ? -27.273 41.472 -15.091 1.00 129.60 ? 5   DA  A N1    1 
ATOM   2835 C  C2    . DA  B 2 5   ? -28.435 41.829 -14.532 1.00 129.11 ? 5   DA  A C2    1 
ATOM   2836 N  N3    . DA  B 2 5   ? -28.652 42.477 -13.389 1.00 129.33 ? 5   DA  A N3    1 
ATOM   2837 C  C4    . DA  B 2 5   ? -27.490 42.773 -12.782 1.00 130.13 ? 5   DA  A C4    1 
ATOM   2838 P  P     . DG  B 2 6   ? -30.516 43.611 -7.048  1.00 165.27 ? 6   DG  A P     1 
ATOM   2839 O  OP1   . DG  B 2 6   ? -30.543 44.623 -5.968  1.00 169.59 ? 6   DG  A OP1   1 
ATOM   2840 O  OP2   . DG  B 2 6   ? -29.583 42.467 -6.959  1.00 162.11 ? 6   DG  A OP2   1 
ATOM   2841 O  "O5'" . DG  B 2 6   ? -31.987 43.014 -7.231  1.00 171.42 ? 6   DG  A "O5'" 1 
ATOM   2842 C  "C5'" . DG  B 2 6   ? -32.532 42.856 -8.538  1.00 170.07 ? 6   DG  A "C5'" 1 
ATOM   2843 C  "C4'" . DG  B 2 6   ? -32.274 41.458 -9.075  1.00 170.50 ? 6   DG  A "C4'" 1 
ATOM   2844 O  "O4'" . DG  B 2 6   ? -31.125 41.461 -9.938  1.00 156.88 ? 6   DG  A "O4'" 1 
ATOM   2845 C  "C3'" . DG  B 2 6   ? -31.955 40.402 -8.027  1.00 176.91 ? 6   DG  A "C3'" 1 
ATOM   2846 O  "O3'" . DG  B 2 6   ? -33.161 39.785 -7.582  1.00 190.04 ? 6   DG  A "O3'" 1 
ATOM   2847 C  "C2'" . DG  B 2 6   ? -31.054 39.407 -8.783  1.00 168.74 ? 6   DG  A "C2'" 1 
ATOM   2848 C  "C1'" . DG  B 2 6   ? -30.718 40.127 -10.098 1.00 156.34 ? 6   DG  A "C1'" 1 
ATOM   2849 N  N9    . DG  B 2 6   ? -29.296 40.095 -10.437 1.00 143.41 ? 6   DG  A N9    1 
ATOM   2850 C  C8    . DG  B 2 6   ? -28.262 40.663 -9.733  1.00 139.73 ? 6   DG  A C8    1 
ATOM   2851 N  N7    . DG  B 2 6   ? -27.092 40.468 -10.277 1.00 131.42 ? 6   DG  A N7    1 
ATOM   2852 C  C5    . DG  B 2 6   ? -27.366 39.713 -11.410 1.00 129.91 ? 6   DG  A C5    1 
ATOM   2853 C  C6    . DG  B 2 6   ? -26.492 39.194 -12.395 1.00 124.32 ? 6   DG  A C6    1 
ATOM   2854 O  O6    . DG  B 2 6   ? -25.258 39.303 -12.465 1.00 119.39 ? 6   DG  A O6    1 
ATOM   2855 N  N1    . DG  B 2 6   ? -27.184 38.489 -13.375 1.00 125.14 ? 6   DG  A N1    1 
ATOM   2856 C  C2    . DG  B 2 6   ? -28.545 38.304 -13.400 1.00 130.67 ? 6   DG  A C2    1 
ATOM   2857 N  N2    . DG  B 2 6   ? -29.029 37.593 -14.428 1.00 130.84 ? 6   DG  A N2    1 
ATOM   2858 N  N3    . DG  B 2 6   ? -29.374 38.783 -12.484 1.00 135.96 ? 6   DG  A N3    1 
ATOM   2859 C  C4    . DG  B 2 6   ? -28.718 39.475 -11.522 1.00 135.59 ? 6   DG  A C4    1 
ATOM   2860 P  P     . DT  B 2 7   ? -33.118 38.495 -6.621  1.00 199.95 ? 7   DT  A P     1 
ATOM   2861 O  OP1   . DT  B 2 7   ? -34.400 38.453 -5.882  1.00 218.76 ? 7   DT  A OP1   1 
ATOM   2862 O  OP2   . DT  B 2 7   ? -31.843 38.521 -5.867  1.00 192.25 ? 7   DT  A OP2   1 
ATOM   2863 O  "O5'" . DT  B 2 7   ? -33.075 37.262 -7.642  1.00 185.31 ? 7   DT  A "O5'" 1 
ATOM   2864 C  "C5'" . DT  B 2 7   ? -33.996 37.206 -8.727  1.00 183.67 ? 7   DT  A "C5'" 1 
ATOM   2865 C  "C4'" . DT  B 2 7   ? -33.616 36.109 -9.708  1.00 178.06 ? 7   DT  A "C4'" 1 
ATOM   2866 O  "O4'" . DT  B 2 7   ? -32.315 36.396 -10.285 1.00 166.46 ? 7   DT  A "O4'" 1 
ATOM   2867 C  "C3'" . DT  B 2 7   ? -33.521 34.706 -9.105  1.00 181.54 ? 7   DT  A "C3'" 1 
ATOM   2868 O  "O3'" . DT  B 2 7   ? -34.167 33.768 -9.958  1.00 184.36 ? 7   DT  A "O3'" 1 
ATOM   2869 C  "C2'" . DT  B 2 7   ? -32.015 34.453 -9.023  1.00 172.18 ? 7   DT  A "C2'" 1 
ATOM   2870 C  "C1'" . DT  B 2 7   ? -31.502 35.246 -10.214 1.00 162.49 ? 7   DT  A "C1'" 1 
ATOM   2871 N  N1    . DT  B 2 7   ? -30.082 35.682 -10.073 1.00 151.53 ? 7   DT  A N1    1 
ATOM   2872 C  C2    . DT  B 2 7   ? -29.198 35.446 -11.100 1.00 143.27 ? 7   DT  A C2    1 
ATOM   2873 O  O2    . DT  B 2 7   ? -29.510 34.888 -12.136 1.00 143.73 ? 7   DT  A O2    1 
ATOM   2874 N  N3    . DT  B 2 7   ? -27.923 35.890 -10.869 1.00 136.02 ? 7   DT  A N3    1 
ATOM   2875 C  C4    . DT  B 2 7   ? -27.453 36.535 -9.739  1.00 136.47 ? 7   DT  A C4    1 
ATOM   2876 O  O4    . DT  B 2 7   ? -26.286 36.897 -9.625  1.00 129.76 ? 7   DT  A O4    1 
ATOM   2877 C  C5    . DT  B 2 7   ? -28.434 36.752 -8.702  1.00 145.70 ? 7   DT  A C5    1 
ATOM   2878 C  C7    . DT  B 2 7   ? -28.044 37.442 -7.427  1.00 147.83 ? 7   DT  A C7    1 
ATOM   2879 C  C6    . DT  B 2 7   ? -29.685 36.319 -8.917  1.00 153.26 ? 7   DT  A C6    1 
ATOM   2880 P  P     . DC  B 2 8   ? -34.447 32.272 -9.446  1.00 189.34 ? 8   DC  A P     1 
ATOM   2881 O  OP1   . DC  B 2 8   ? -35.614 31.751 -10.192 1.00 193.37 ? 8   DC  A OP1   1 
ATOM   2882 O  OP2   . DC  B 2 8   ? -34.471 32.298 -7.967  1.00 192.93 ? 8   DC  A OP2   1 
ATOM   2883 O  "O5'" . DC  B 2 8   ? -33.142 31.467 -9.899  1.00 182.13 ? 8   DC  A "O5'" 1 
ATOM   2884 C  "C5'" . DC  B 2 8   ? -32.740 31.478 -11.263 1.00 175.93 ? 8   DC  A "C5'" 1 
ATOM   2885 C  "C4'" . DC  B 2 8   ? -31.475 30.663 -11.457 1.00 171.00 ? 8   DC  A "C4'" 1 
ATOM   2886 O  "O4'" . DC  B 2 8   ? -30.312 31.498 -11.221 1.00 162.51 ? 8   DC  A "O4'" 1 
ATOM   2887 C  "C3'" . DC  B 2 8   ? -31.339 29.457 -10.524 1.00 176.64 ? 8   DC  A "C3'" 1 
ATOM   2888 O  "O3'" . DC  B 2 8   ? -31.019 28.294 -11.273 1.00 178.74 ? 8   DC  A "O3'" 1 
ATOM   2889 C  "C2'" . DC  B 2 8   ? -30.203 29.852 -9.576  1.00 170.72 ? 8   DC  A "C2'" 1 
ATOM   2890 C  "C1'" . DC  B 2 8   ? -29.380 30.790 -10.442 1.00 161.28 ? 8   DC  A "C1'" 1 
ATOM   2891 N  N1    . DC  B 2 8   ? -28.581 31.771 -9.659  1.00 154.74 ? 8   DC  A N1    1 
ATOM   2892 C  C2    . DC  B 2 8   ? -27.252 32.030 -10.014 1.00 146.23 ? 8   DC  A C2    1 
ATOM   2893 O  O2    . DC  B 2 8   ? -26.756 31.435 -10.981 1.00 141.99 ? 8   DC  A O2    1 
ATOM   2894 N  N3    . DC  B 2 8   ? -26.542 32.929 -9.287  1.00 143.05 ? 8   DC  A N3    1 
ATOM   2895 C  C4    . DC  B 2 8   ? -27.111 33.549 -8.253  1.00 149.47 ? 8   DC  A C4    1 
ATOM   2896 N  N4    . DC  B 2 8   ? -26.372 34.427 -7.566  1.00 147.44 ? 8   DC  A N4    1 
ATOM   2897 C  C5    . DC  B 2 8   ? -28.463 33.297 -7.876  1.00 155.83 ? 8   DC  A C5    1 
ATOM   2898 C  C6    . DC  B 2 8   ? -29.153 32.410 -8.599  1.00 159.14 ? 8   DC  A C6    1 
ATOM   2899 P  P     . DG  B 2 9   ? -31.512 26.850 -10.772 1.00 189.31 ? 9   DG  A P     1 
ATOM   2900 O  OP1   . DG  B 2 9   ? -32.396 26.291 -11.821 1.00 192.39 ? 9   DG  A OP1   1 
ATOM   2901 O  OP2   . DG  B 2 9   ? -32.007 26.998 -9.384  1.00 196.76 ? 9   DG  A OP2   1 
ATOM   2902 O  "O5'" . DG  B 2 9   ? -30.167 25.989 -10.721 1.00 183.83 ? 9   DG  A "O5'" 1 
ATOM   2903 C  "C5'" . DG  B 2 9   ? -29.383 25.830 -11.893 1.00 178.70 ? 9   DG  A "C5'" 1 
ATOM   2904 C  "C4'" . DG  B 2 9   ? -27.921 25.630 -11.537 1.00 174.75 ? 9   DG  A "C4'" 1 
ATOM   2905 O  "O4'" . DG  B 2 9   ? -27.391 26.849 -10.953 1.00 168.26 ? 9   DG  A "O4'" 1 
ATOM   2906 C  "C3'" . DG  B 2 9   ? -27.645 24.512 -10.523 1.00 179.42 ? 9   DG  A "C3'" 1 
ATOM   2907 O  "O3'" . DG  B 2 9   ? -26.556 23.710 -10.970 1.00 178.93 ? 9   DG  A "O3'" 1 
ATOM   2908 C  "C2'" . DG  B 2 9   ? -27.298 25.275 -9.242  1.00 177.40 ? 9   DG  A "C2'" 1 
ATOM   2909 C  "C1'" . DG  B 2 9   ? -26.639 26.518 -9.812  1.00 168.61 ? 9   DG  A "C1'" 1 
ATOM   2910 N  N9    . DG  B 2 9   ? -26.630 27.661 -8.901  1.00 163.12 ? 9   DG  A N9    1 
ATOM   2911 C  C8    . DG  B 2 9   ? -27.658 28.100 -8.102  1.00 169.59 ? 9   DG  A C8    1 
ATOM   2912 N  N7    . DG  B 2 9   ? -27.350 29.153 -7.392  1.00 167.07 ? 9   DG  A N7    1 
ATOM   2913 C  C5    . DG  B 2 9   ? -26.034 29.429 -7.747  1.00 158.29 ? 9   DG  A C5    1 
ATOM   2914 C  C6    . DG  B 2 9   ? -25.161 30.456 -7.306  1.00 153.94 ? 9   DG  A C6    1 
ATOM   2915 O  O6    . DG  B 2 9   ? -25.383 31.359 -6.485  1.00 155.52 ? 9   DG  A O6    1 
ATOM   2916 N  N1    . DG  B 2 9   ? -23.914 30.368 -7.922  1.00 146.72 ? 9   DG  A N1    1 
ATOM   2917 C  C2    . DG  B 2 9   ? -23.557 29.412 -8.843  1.00 144.30 ? 9   DG  A C2    1 
ATOM   2918 N  N2    . DG  B 2 9   ? -22.310 29.486 -9.329  1.00 137.71 ? 9   DG  A N2    1 
ATOM   2919 N  N3    . DG  B 2 9   ? -24.364 28.449 -9.262  1.00 149.06 ? 9   DG  A N3    1 
ATOM   2920 C  C4    . DG  B 2 9   ? -25.581 28.519 -8.675  1.00 156.08 ? 9   DG  A C4    1 
ATOM   2921 P  P     . DA  B 2 10  ? -26.328 22.238 -10.366 1.00 180.80 ? 10  DA  A P     1 
ATOM   2922 O  OP1   . DA  B 2 10  ? -26.275 21.298 -11.507 1.00 181.32 ? 10  DA  A OP1   1 
ATOM   2923 O  OP2   . DA  B 2 10  ? -27.313 22.025 -9.280  1.00 187.97 ? 10  DA  A OP2   1 
ATOM   2924 O  "O5'" . DA  B 2 10  ? -24.874 22.318 -9.705  1.00 175.54 ? 10  DA  A "O5'" 1 
ATOM   2925 C  "C5'" . DA  B 2 10  ? -23.762 22.741 -10.486 1.00 164.50 ? 10  DA  A "C5'" 1 
ATOM   2926 C  "C4'" . DA  B 2 10  ? -22.629 23.221 -9.598  1.00 160.90 ? 10  DA  A "C4'" 1 
ATOM   2927 O  "O4'" . DA  B 2 10  ? -23.028 24.441 -8.918  1.00 158.52 ? 10  DA  A "O4'" 1 
ATOM   2928 C  "C3'" . DA  B 2 10  ? -22.202 22.238 -8.503  1.00 163.38 ? 10  DA  A "C3'" 1 
ATOM   2929 O  "O3'" . DA  B 2 10  ? -20.784 22.126 -8.477  1.00 157.40 ? 10  DA  A "O3'" 1 
ATOM   2930 C  "C2'" . DA  B 2 10  ? -22.740 22.873 -7.220  1.00 167.46 ? 10  DA  A "C2'" 1 
ATOM   2931 C  "C1'" . DA  B 2 10  ? -22.676 24.352 -7.560  1.00 160.43 ? 10  DA  A "C1'" 1 
ATOM   2932 N  N9    . DA  B 2 10  ? -23.602 25.177 -6.788  1.00 160.66 ? 10  DA  A N9    1 
ATOM   2933 C  C8    . DA  B 2 10  ? -24.910 24.904 -6.494  1.00 167.37 ? 10  DA  A C8    1 
ATOM   2934 N  N7    . DA  B 2 10  ? -25.498 25.838 -5.782  1.00 165.49 ? 10  DA  A N7    1 
ATOM   2935 C  C5    . DA  B 2 10  ? -24.509 26.791 -5.601  1.00 160.03 ? 10  DA  A C5    1 
ATOM   2936 C  C6    . DA  B 2 10  ? -24.490 28.032 -4.931  1.00 158.59 ? 10  DA  A C6    1 
ATOM   2937 N  N6    . DA  B 2 10  ? -25.546 28.545 -4.289  1.00 162.72 ? 10  DA  A N6    1 
ATOM   2938 N  N1    . DA  B 2 10  ? -23.339 28.730 -4.946  1.00 154.42 ? 10  DA  A N1    1 
ATOM   2939 C  C2    . DA  B 2 10  ? -22.280 28.222 -5.585  1.00 149.60 ? 10  DA  A C2    1 
ATOM   2940 N  N3    . DA  B 2 10  ? -22.175 27.073 -6.247  1.00 149.98 ? 10  DA  A N3    1 
ATOM   2941 C  C4    . DA  B 2 10  ? -23.335 26.399 -6.217  1.00 156.32 ? 10  DA  A C4    1 
ATOM   2942 P  P     . DC  B 2 11  ? -20.077 20.731 -8.848  1.00 141.37 ? 11  DC  A P     1 
ATOM   2943 O  OP1   . DC  B 2 11  ? -18.620 20.974 -8.930  1.00 140.22 ? 11  DC  A OP1   1 
ATOM   2944 O  OP2   . DC  B 2 11  ? -20.795 20.162 -10.010 1.00 144.59 ? 11  DC  A OP2   1 
ATOM   2945 O  "O5'" . DC  B 2 11  ? -20.368 19.800 -7.580  1.00 148.90 ? 11  DC  A "O5'" 1 
ATOM   2946 C  "C5'" . DC  B 2 11  ? -19.685 20.036 -6.351  1.00 146.95 ? 11  DC  A "C5'" 1 
ATOM   2947 C  "C4'" . DC  B 2 11  ? -20.303 19.230 -5.221  1.00 153.05 ? 11  DC  A "C4'" 1 
ATOM   2948 O  "O4'" . DC  B 2 11  ? -21.595 19.795 -4.870  1.00 156.65 ? 11  DC  A "O4'" 1 
ATOM   2949 C  "C3'" . DC  B 2 11  ? -20.556 17.753 -5.538  1.00 156.78 ? 11  DC  A "C3'" 1 
ATOM   2950 O  "O3'" . DC  B 2 11  ? -20.221 16.948 -4.410  1.00 162.98 ? 11  DC  A "O3'" 1 
ATOM   2951 C  "C2'" . DC  B 2 11  ? -22.055 17.716 -5.828  1.00 168.71 ? 11  DC  A "C2'" 1 
ATOM   2952 C  "C1'" . DC  B 2 11  ? -22.571 18.776 -4.869  1.00 168.76 ? 11  DC  A "C1'" 1 
ATOM   2953 N  N1    . DC  B 2 11  ? -23.881 19.369 -5.274  1.00 178.18 ? 11  DC  A N1    1 
ATOM   2954 C  C2    . DC  B 2 11  ? -24.877 19.569 -4.310  1.00 188.28 ? 11  DC  A C2    1 
ATOM   2955 O  O2    . DC  B 2 11  ? -24.652 19.249 -3.136  1.00 196.42 ? 11  DC  A O2    1 
ATOM   2956 N  N3    . DC  B 2 11  ? -26.061 20.110 -4.692  1.00 192.58 ? 11  DC  A N3    1 
ATOM   2957 C  C4    . DC  B 2 11  ? -26.263 20.442 -5.968  1.00 187.35 ? 11  DC  A C4    1 
ATOM   2958 N  N4    . DC  B 2 11  ? -27.447 20.973 -6.296  1.00 190.84 ? 11  DC  A N4    1 
ATOM   2959 C  C5    . DC  B 2 11  ? -25.260 20.246 -6.963  1.00 177.67 ? 11  DC  A C5    1 
ATOM   2960 C  C6    . DC  B 2 11  ? -24.097 19.711 -6.576  1.00 173.66 ? 11  DC  A C6    1 
ATOM   2961 P  P     . DA  B 2 12  ? -19.905 15.383 -4.594  1.00 150.40 ? 12  DA  A P     1 
ATOM   2962 O  OP1   . DA  B 2 12  ? -19.351 14.884 -3.315  1.00 145.94 ? 12  DA  A OP1   1 
ATOM   2963 O  OP2   . DA  B 2 12  ? -19.128 15.226 -5.844  1.00 141.21 ? 12  DA  A OP2   1 
ATOM   2964 O  "O5'" . DA  B 2 12  ? -21.345 14.718 -4.823  1.00 159.91 ? 12  DA  A "O5'" 1 
ATOM   2965 C  "C5'" . DA  B 2 12  ? -22.329 14.756 -3.786  1.00 160.41 ? 12  DA  A "C5'" 1 
ATOM   2966 C  "C4'" . DA  B 2 12  ? -23.645 14.160 -4.262  1.00 163.54 ? 12  DA  A "C4'" 1 
ATOM   2967 O  "O4'" . DA  B 2 12  ? -24.379 15.144 -5.040  1.00 167.11 ? 12  DA  A "O4'" 1 
ATOM   2968 C  "C3'" . DA  B 2 12  ? -23.517 12.918 -5.155  1.00 161.98 ? 12  DA  A "C3'" 1 
ATOM   2969 O  "O3'" . DA  B 2 12  ? -24.484 11.941 -4.774  1.00 156.14 ? 12  DA  A "O3'" 1 
ATOM   2970 C  "C2'" . DA  B 2 12  ? -23.814 13.471 -6.547  1.00 165.75 ? 12  DA  A "C2'" 1 
ATOM   2971 C  "C1'" . DA  B 2 12  ? -24.852 14.528 -6.214  1.00 169.18 ? 12  DA  A "C1'" 1 
ATOM   2972 N  N9    . DA  B 2 12  ? -25.024 15.543 -7.253  1.00 173.78 ? 12  DA  A N9    1 
ATOM   2973 C  C8    . DA  B 2 12  ? -24.128 15.888 -8.229  1.00 173.79 ? 12  DA  A C8    1 
ATOM   2974 N  N7    . DA  B 2 12  ? -24.558 16.835 -9.032  1.00 176.00 ? 12  DA  A N7    1 
ATOM   2975 C  C5    . DA  B 2 12  ? -25.824 17.129 -8.554  1.00 177.21 ? 12  DA  A C5    1 
ATOM   2976 C  C6    . DA  B 2 12  ? -26.807 18.049 -8.970  1.00 178.23 ? 12  DA  A C6    1 
ATOM   2977 N  N6    . DA  B 2 12  ? -26.651 18.875 -10.011 1.00 178.26 ? 12  DA  A N6    1 
ATOM   2978 N  N1    . DA  B 2 12  ? -27.962 18.090 -8.273  1.00 179.59 ? 12  DA  A N1    1 
ATOM   2979 C  C2    . DA  B 2 12  ? -28.117 17.265 -7.231  1.00 178.78 ? 12  DA  A C2    1 
ATOM   2980 N  N3    . DA  B 2 12  ? -27.268 16.361 -6.745  1.00 177.70 ? 12  DA  A N3    1 
ATOM   2981 C  C4    . DA  B 2 12  ? -26.129 16.342 -7.458  1.00 177.07 ? 12  DA  A C4    1 
ATOM   2982 P  P     . DT  B 2 13  ? -24.166 10.884 -3.603  1.00 168.12 ? 13  DT  A P     1 
ATOM   2983 O  OP1   . DT  B 2 13  ? -22.992 11.373 -2.843  1.00 167.06 ? 13  DT  A OP1   1 
ATOM   2984 O  OP2   . DT  B 2 13  ? -24.133 9.531  -4.208  1.00 167.13 ? 13  DT  A OP2   1 
ATOM   2985 O  "O5'" . DT  B 2 13  ? -25.457 10.963 -2.655  1.00 141.40 ? 13  DT  A "O5'" 1 
ATOM   2986 C  "C5'" . DT  B 2 13  ? -26.606 10.157 -2.934  1.00 133.60 ? 13  DT  A "C5'" 1 
ATOM   2987 C  "C4'" . DT  B 2 13  ? -27.686 10.964 -3.631  1.00 132.32 ? 13  DT  A "C4'" 1 
ATOM   2988 O  "O4'" . DT  B 2 13  ? -27.183 11.433 -4.909  1.00 133.96 ? 13  DT  A "O4'" 1 
ATOM   2989 C  "C3'" . DT  B 2 13  ? -28.957 10.188 -3.952  1.00 120.83 ? 13  DT  A "C3'" 1 
ATOM   2990 O  "O3'" . DT  B 2 13  ? -29.888 10.312 -2.880  1.00 110.22 ? 13  DT  A "O3'" 1 
ATOM   2991 C  "C2'" . DT  B 2 13  ? -29.460 10.887 -5.208  1.00 118.01 ? 13  DT  A "C2'" 1 
ATOM   2992 C  "C1'" . DT  B 2 13  ? -28.154 11.235 -5.917  1.00 127.30 ? 13  DT  A "C1'" 1 
ATOM   2993 N  N1    . DT  B 2 13  ? -27.670 10.168 -6.850  1.00 124.55 ? 13  DT  A N1    1 
ATOM   2994 C  C2    . DT  B 2 13  ? -28.340 9.958  -8.035  1.00 118.46 ? 13  DT  A C2    1 
ATOM   2995 O  O2    . DT  B 2 13  ? -29.324 10.596 -8.370  1.00 116.94 ? 13  DT  A O2    1 
ATOM   2996 N  N3    . DT  B 2 13  ? -27.818 8.965  -8.820  1.00 114.47 ? 13  DT  A N3    1 
ATOM   2997 C  C4    . DT  B 2 13  ? -26.715 8.176  -8.551  1.00 113.93 ? 13  DT  A C4    1 
ATOM   2998 O  O4    . DT  B 2 13  ? -26.325 7.307  -9.327  1.00 112.51 ? 13  DT  A O4    1 
ATOM   2999 C  C5    . DT  B 2 13  ? -26.053 8.448  -7.295  1.00 119.83 ? 13  DT  A C5    1 
ATOM   3000 C  C7    . DT  B 2 13  ? -24.844 7.655  -6.894  1.00 120.28 ? 13  DT  A C7    1 
ATOM   3001 C  C6    . DT  B 2 13  ? -26.555 9.421  -6.515  1.00 124.52 ? 13  DT  A C6    1 
ATOM   3002 O  OP3   . DT  C 3 1   ? -19.085 35.674 1.738   1.00 180.54 ? 1   DT  B OP3   1 
ATOM   3003 P  P     . DT  C 3 1   ? -19.973 35.253 0.631   1.00 171.30 ? 1   DT  B P     1 
ATOM   3004 O  OP1   . DT  C 3 1   ? -20.628 36.463 0.091   1.00 167.70 ? 1   DT  B OP1   1 
ATOM   3005 O  OP2   . DT  C 3 1   ? -20.813 34.152 1.147   1.00 169.63 ? 1   DT  B OP2   1 
ATOM   3006 O  "O5'" . DT  C 3 1   ? -19.056 34.646 -0.527  1.00 162.31 ? 1   DT  B "O5'" 1 
ATOM   3007 C  "C5'" . DT  C 3 1   ? -17.701 34.312 -0.256  1.00 165.61 ? 1   DT  B "C5'" 1 
ATOM   3008 C  "C4'" . DT  C 3 1   ? -17.195 33.272 -1.239  1.00 168.11 ? 1   DT  B "C4'" 1 
ATOM   3009 O  "O4'" . DT  C 3 1   ? -18.175 32.205 -1.365  1.00 160.14 ? 1   DT  B "O4'" 1 
ATOM   3010 C  "C3'" . DT  C 3 1   ? -16.937 33.787 -2.655  1.00 167.69 ? 1   DT  B "C3'" 1 
ATOM   3011 O  "O3'" . DT  C 3 1   ? -15.753 33.197 -3.180  1.00 181.90 ? 1   DT  B "O3'" 1 
ATOM   3012 C  "C2'" . DT  C 3 1   ? -18.179 33.338 -3.421  1.00 156.64 ? 1   DT  B "C2'" 1 
ATOM   3013 C  "C1'" . DT  C 3 1   ? -18.517 32.028 -2.722  1.00 153.62 ? 1   DT  B "C1'" 1 
ATOM   3014 N  N1    . DT  C 3 1   ? -19.961 31.671 -2.803  1.00 147.33 ? 1   DT  B N1    1 
ATOM   3015 C  C2    . DT  C 3 1   ? -20.391 30.849 -3.817  1.00 145.54 ? 1   DT  B C2    1 
ATOM   3016 O  O2    . DT  C 3 1   ? -19.648 30.389 -4.665  1.00 148.69 ? 1   DT  B O2    1 
ATOM   3017 N  N3    . DT  C 3 1   ? -21.734 30.584 -3.807  1.00 141.87 ? 1   DT  B N3    1 
ATOM   3018 C  C4    . DT  C 3 1   ? -22.674 31.043 -2.904  1.00 138.35 ? 1   DT  B C4    1 
ATOM   3019 O  O4    . DT  C 3 1   ? -23.864 30.741 -2.984  1.00 134.86 ? 1   DT  B O4    1 
ATOM   3020 C  C5    . DT  C 3 1   ? -22.157 31.902 -1.862  1.00 141.01 ? 1   DT  B C5    1 
ATOM   3021 C  C7    . DT  C 3 1   ? -23.079 32.465 -0.823  1.00 139.14 ? 1   DT  B C7    1 
ATOM   3022 C  C6    . DT  C 3 1   ? -20.840 32.171 -1.862  1.00 146.04 ? 1   DT  B C6    1 
ATOM   3023 P  P     . DC  C 3 2   ? -14.781 34.045 -4.081  1.00 164.16 ? 2   DC  B P     1 
ATOM   3024 O  OP1   . DC  C 3 2   ? -13.446 33.403 -4.075  1.00 172.67 ? 2   DC  B OP1   1 
ATOM   3025 O  OP2   . DC  C 3 2   ? -14.930 35.463 -3.688  1.00 161.94 ? 2   DC  B OP2   1 
ATOM   3026 O  "O5'" . DC  C 3 2   ? -15.374 33.801 -5.529  1.00 156.83 ? 2   DC  B "O5'" 1 
ATOM   3027 C  "C5'" . DC  C 3 2   ? -15.438 32.469 -6.057  1.00 158.36 ? 2   DC  B "C5'" 1 
ATOM   3028 C  "C4'" . DC  C 3 2   ? -16.220 32.451 -7.348  1.00 155.97 ? 2   DC  B "C4'" 1 
ATOM   3029 O  "O4'" . DC  C 3 2   ? -17.573 32.024 -7.071  1.00 152.27 ? 2   DC  B "O4'" 1 
ATOM   3030 C  "C3'" . DC  C 3 2   ? -16.352 33.816 -8.028  1.00 154.08 ? 2   DC  B "C3'" 1 
ATOM   3031 O  "O3'" . DC  C 3 2   ? -16.463 33.717 -9.437  1.00 154.40 ? 2   DC  B "O3'" 1 
ATOM   3032 C  "C2'" . DC  C 3 2   ? -17.743 34.249 -7.640  1.00 149.10 ? 2   DC  B "C2'" 1 
ATOM   3033 C  "C1'" . DC  C 3 2   ? -18.421 32.912 -7.754  1.00 148.76 ? 2   DC  B "C1'" 1 
ATOM   3034 N  N1    . DC  C 3 2   ? -19.761 32.842 -7.149  1.00 144.52 ? 2   DC  B N1    1 
ATOM   3035 C  C2    . DC  C 3 2   ? -20.629 31.833 -7.566  1.00 143.31 ? 2   DC  B C2    1 
ATOM   3036 O  O2    . DC  C 3 2   ? -20.229 31.006 -8.397  1.00 145.90 ? 2   DC  B O2    1 
ATOM   3037 N  N3    . DC  C 3 2   ? -21.874 31.773 -7.041  1.00 140.29 ? 2   DC  B N3    1 
ATOM   3038 C  C4    . DC  C 3 2   ? -22.266 32.685 -6.150  1.00 138.02 ? 2   DC  B C4    1 
ATOM   3039 N  N4    . DC  C 3 2   ? -23.500 32.586 -5.658  1.00 133.41 ? 2   DC  B N4    1 
ATOM   3040 C  C5    . DC  C 3 2   ? -21.408 33.737 -5.723  1.00 138.84 ? 2   DC  B C5    1 
ATOM   3041 C  C6    . DC  C 3 2   ? -20.179 33.783 -6.250  1.00 142.97 ? 2   DC  B C6    1 
ATOM   3042 P  P     . DG  C 3 3   ? -15.819 34.835 -10.298 1.00 154.06 ? 3   DG  B P     1 
ATOM   3043 O  OP1   . DG  C 3 3   ? -14.401 34.919 -9.889  1.00 158.17 ? 3   DG  B OP1   1 
ATOM   3044 O  OP2   . DG  C 3 3   ? -16.670 36.045 -10.239 1.00 149.90 ? 3   DG  B OP2   1 
ATOM   3045 O  "O5'" . DG  C 3 3   ? -15.897 34.242 -11.781 1.00 155.16 ? 3   DG  B "O5'" 1 
ATOM   3046 C  "C5'" . DG  C 3 3   ? -15.637 32.862 -12.007 1.00 157.80 ? 3   DG  B "C5'" 1 
ATOM   3047 C  "C4'" . DG  C 3 3   ? -16.864 32.164 -12.567 1.00 155.12 ? 3   DG  B "C4'" 1 
ATOM   3048 O  "O4'" . DG  C 3 3   ? -17.953 32.252 -11.617 1.00 151.26 ? 3   DG  B "O4'" 1 
ATOM   3049 C  "C3'" . DG  C 3 3   ? -17.394 32.746 -13.883 1.00 153.29 ? 3   DG  B "C3'" 1 
ATOM   3050 O  "O3'" . DG  C 3 3   ? -17.379 31.747 -14.900 1.00 155.04 ? 3   DG  B "O3'" 1 
ATOM   3051 C  "C2'" . DG  C 3 3   ? -18.823 33.206 -13.555 1.00 148.16 ? 3   DG  B "C2'" 1 
ATOM   3052 C  "C1'" . DG  C 3 3   ? -19.163 32.388 -12.319 1.00 147.64 ? 3   DG  B "C1'" 1 
ATOM   3053 N  N9    . DG  C 3 3   ? -20.135 33.040 -11.441 1.00 143.47 ? 3   DG  B N9    1 
ATOM   3054 C  C8    . DG  C 3 3   ? -19.917 34.139 -10.642 1.00 142.44 ? 3   DG  B C8    1 
ATOM   3055 N  N7    . DG  C 3 3   ? -20.968 34.504 -9.962  1.00 138.50 ? 3   DG  B N7    1 
ATOM   3056 C  C5    . DG  C 3 3   ? -21.950 33.592 -10.337 1.00 136.78 ? 3   DG  B C5    1 
ATOM   3057 C  C6    . DG  C 3 3   ? -23.300 33.489 -9.928  1.00 132.63 ? 3   DG  B C6    1 
ATOM   3058 O  O6    . DG  C 3 3   ? -23.917 34.207 -9.127  1.00 129.55 ? 3   DG  B O6    1 
ATOM   3059 N  N1    . DG  C 3 3   ? -23.944 32.425 -10.548 1.00 132.24 ? 3   DG  B N1    1 
ATOM   3060 C  C2    . DG  C 3 3   ? -23.361 31.568 -11.450 1.00 135.46 ? 3   DG  B C2    1 
ATOM   3061 N  N2    . DG  C 3 3   ? -24.150 30.599 -11.943 1.00 134.48 ? 3   DG  B N2    1 
ATOM   3062 N  N3    . DG  C 3 3   ? -22.096 31.651 -11.843 1.00 139.37 ? 3   DG  B N3    1 
ATOM   3063 C  C4    . DG  C 3 3   ? -21.453 32.684 -11.247 1.00 139.80 ? 3   DG  B C4    1 
ATOM   3064 P  P     . DA  C 3 4   ? -17.904 32.088 -16.381 1.00 153.62 ? 4   DA  B P     1 
ATOM   3065 O  OP1   . DA  C 3 4   ? -17.275 31.139 -17.325 1.00 157.20 ? 4   DA  B OP1   1 
ATOM   3066 O  OP2   . DA  C 3 4   ? -17.753 33.544 -16.598 1.00 152.36 ? 4   DA  B OP2   1 
ATOM   3067 O  "O5'" . DA  C 3 4   ? -19.464 31.761 -16.313 1.00 149.18 ? 4   DA  B "O5'" 1 
ATOM   3068 C  "C5'" . DA  C 3 4   ? -19.900 30.480 -15.877 1.00 149.28 ? 4   DA  B "C5'" 1 
ATOM   3069 C  "C4'" . DA  C 3 4   ? -21.379 30.306 -16.150 1.00 145.05 ? 4   DA  B "C4'" 1 
ATOM   3070 O  "O4'" . DA  C 3 4   ? -22.141 30.964 -15.107 1.00 141.43 ? 4   DA  B "O4'" 1 
ATOM   3071 C  "C3'" . DA  C 3 4   ? -21.852 30.902 -17.473 1.00 143.40 ? 4   DA  B "C3'" 1 
ATOM   3072 O  "O3'" . DA  C 3 4   ? -22.762 30.021 -18.108 1.00 142.00 ? 4   DA  B "O3'" 1 
ATOM   3073 C  "C2'" . DA  C 3 4   ? -22.521 32.214 -17.061 1.00 139.50 ? 4   DA  B "C2'" 1 
ATOM   3074 C  "C1'" . DA  C 3 4   ? -23.045 31.889 -15.670 1.00 137.71 ? 4   DA  B "C1'" 1 
ATOM   3075 N  N9    . DA  C 3 4   ? -23.111 33.054 -14.790 1.00 135.67 ? 4   DA  B N9    1 
ATOM   3076 C  C8    . DA  C 3 4   ? -22.103 33.935 -14.513 1.00 137.55 ? 4   DA  B C8    1 
ATOM   3077 N  N7    . DA  C 3 4   ? -22.445 34.889 -13.679 1.00 134.96 ? 4   DA  B N7    1 
ATOM   3078 C  C5    . DA  C 3 4   ? -23.770 34.611 -13.385 1.00 131.13 ? 4   DA  B C5    1 
ATOM   3079 C  C6    . DA  C 3 4   ? -24.711 35.250 -12.555 1.00 127.13 ? 4   DA  B C6    1 
ATOM   3080 N  N6    . DA  C 3 4   ? -24.439 36.349 -11.843 1.00 126.33 ? 4   DA  B N6    1 
ATOM   3081 N  N1    . DA  C 3 4   ? -25.947 34.716 -12.485 1.00 124.00 ? 4   DA  B N1    1 
ATOM   3082 C  C2    . DA  C 3 4   ? -26.217 33.615 -13.198 1.00 124.83 ? 4   DA  B C2    1 
ATOM   3083 N  N3    . DA  C 3 4   ? -25.418 32.926 -14.010 1.00 128.45 ? 4   DA  B N3    1 
ATOM   3084 C  C4    . DA  C 3 4   ? -24.196 33.482 -14.060 1.00 131.51 ? 4   DA  B C4    1 
ATOM   3085 P  P     . DC  C 3 5   ? -23.237 30.298 -19.618 1.00 141.62 ? 5   DC  B P     1 
ATOM   3086 O  OP1   . DC  C 3 5   ? -23.561 28.992 -20.234 1.00 143.88 ? 5   DC  B OP1   1 
ATOM   3087 O  OP2   . DC  C 3 5   ? -22.231 31.176 -20.258 1.00 135.34 ? 5   DC  B OP2   1 
ATOM   3088 O  "O5'" . DC  C 3 5   ? -24.585 31.138 -19.440 1.00 140.54 ? 5   DC  B "O5'" 1 
ATOM   3089 C  "C5'" . DC  C 3 5   ? -25.623 30.638 -18.605 1.00 140.30 ? 5   DC  B "C5'" 1 
ATOM   3090 C  "C4'" . DC  C 3 5   ? -26.711 31.676 -18.410 1.00 141.69 ? 5   DC  B "C4'" 1 
ATOM   3091 O  "O4'" . DC  C 3 5   ? -26.320 32.605 -17.378 1.00 139.59 ? 5   DC  B "O4'" 1 
ATOM   3092 C  "C3'" . DC  C 3 5   ? -27.025 32.526 -19.648 1.00 144.27 ? 5   DC  B "C3'" 1 
ATOM   3093 O  "O3'" . DC  C 3 5   ? -28.339 32.231 -20.123 1.00 146.11 ? 5   DC  B "O3'" 1 
ATOM   3094 C  "C2'" . DC  C 3 5   ? -26.900 33.982 -19.159 1.00 140.85 ? 5   DC  B "C2'" 1 
ATOM   3095 C  "C1'" . DC  C 3 5   ? -26.936 33.834 -17.645 1.00 138.37 ? 5   DC  B "C1'" 1 
ATOM   3096 N  N1    . DC  C 3 5   ? -26.201 34.909 -16.910 1.00 133.64 ? 5   DC  B N1    1 
ATOM   3097 C  C2    . DC  C 3 5   ? -26.814 35.543 -15.825 1.00 132.56 ? 5   DC  B C2    1 
ATOM   3098 O  O2    . DC  C 3 5   ? -27.955 35.198 -15.492 1.00 137.41 ? 5   DC  B O2    1 
ATOM   3099 N  N3    . DC  C 3 5   ? -26.139 36.516 -15.164 1.00 131.45 ? 5   DC  B N3    1 
ATOM   3100 C  C4    . DC  C 3 5   ? -24.911 36.860 -15.551 1.00 129.54 ? 5   DC  B C4    1 
ATOM   3101 N  N4    . DC  C 3 5   ? -24.287 37.826 -14.865 1.00 124.79 ? 5   DC  B N4    1 
ATOM   3102 C  C5    . DC  C 3 5   ? -24.267 36.226 -16.656 1.00 131.06 ? 5   DC  B C5    1 
ATOM   3103 C  C6    . DC  C 3 5   ? -24.942 35.266 -17.301 1.00 132.15 ? 5   DC  B C6    1 
ATOM   3104 P  P     . DT  C 3 6   ? -28.961 33.039 -21.367 1.00 149.65 ? 6   DT  B P     1 
ATOM   3105 O  OP1   . DT  C 3 6   ? -29.944 32.157 -22.036 1.00 151.24 ? 6   DT  B OP1   1 
ATOM   3106 O  OP2   . DT  C 3 6   ? -27.847 33.601 -22.162 1.00 146.85 ? 6   DT  B OP2   1 
ATOM   3107 O  "O5'" . DT  C 3 6   ? -29.744 34.249 -20.673 1.00 148.43 ? 6   DT  B "O5'" 1 
ATOM   3108 C  "C5'" . DT  C 3 6   ? -30.621 33.988 -19.580 1.00 146.86 ? 6   DT  B "C5'" 1 
ATOM   3109 C  "C4'" . DT  C 3 6   ? -31.323 35.257 -19.135 1.00 145.49 ? 6   DT  B "C4'" 1 
ATOM   3110 O  "O4'" . DT  C 3 6   ? -30.440 36.039 -18.286 1.00 142.66 ? 6   DT  B "O4'" 1 
ATOM   3111 C  "C3'" . DT  C 3 6   ? -31.759 36.188 -20.272 1.00 147.31 ? 6   DT  B "C3'" 1 
ATOM   3112 O  "O3'" . DT  C 3 6   ? -33.093 36.616 -20.052 1.00 149.92 ? 6   DT  B "O3'" 1 
ATOM   3113 C  "C2'" . DT  C 3 6   ? -30.771 37.353 -20.173 1.00 143.28 ? 6   DT  B "C2'" 1 
ATOM   3114 C  "C1'" . DT  C 3 6   ? -30.506 37.388 -18.680 1.00 139.82 ? 6   DT  B "C1'" 1 
ATOM   3115 N  N1    . DT  C 3 6   ? -29.228 38.060 -18.310 1.00 135.71 ? 6   DT  B N1    1 
ATOM   3116 C  C2    . DT  C 3 6   ? -29.223 38.971 -17.278 1.00 133.11 ? 6   DT  B C2    1 
ATOM   3117 O  O2    . DT  C 3 6   ? -30.219 39.260 -16.637 1.00 132.78 ? 6   DT  B O2    1 
ATOM   3118 N  N3    . DT  C 3 6   ? -28.002 39.532 -17.015 1.00 130.49 ? 6   DT  B N3    1 
ATOM   3119 C  C4    . DT  C 3 6   ? -26.809 39.283 -17.670 1.00 129.32 ? 6   DT  B C4    1 
ATOM   3120 O  O4    . DT  C 3 6   ? -25.760 39.841 -17.359 1.00 126.20 ? 6   DT  B O4    1 
ATOM   3121 C  C5    . DT  C 3 6   ? -26.884 38.320 -18.744 1.00 130.75 ? 6   DT  B C5    1 
ATOM   3122 C  C7    . DT  C 3 6   ? -25.654 37.968 -19.527 1.00 129.89 ? 6   DT  B C7    1 
ATOM   3123 C  C6    . DT  C 3 6   ? -28.076 37.763 -19.011 1.00 134.56 ? 6   DT  B C6    1 
ATOM   3124 P  P     . DA  C 3 7   ? -34.008 37.116 -21.276 1.00 155.90 ? 7   DA  B P     1 
ATOM   3125 O  OP1   . DA  C 3 7   ? -34.874 35.988 -21.685 1.00 158.75 ? 7   DA  B OP1   1 
ATOM   3126 O  OP2   . DA  C 3 7   ? -33.131 37.764 -22.277 1.00 153.45 ? 7   DA  B OP2   1 
ATOM   3127 O  "O5'" . DA  C 3 7   ? -34.913 38.258 -20.616 1.00 155.22 ? 7   DA  B "O5'" 1 
ATOM   3128 C  "C5'" . DA  C 3 7   ? -35.508 38.044 -19.341 1.00 153.53 ? 7   DA  B "C5'" 1 
ATOM   3129 C  "C4'" . DA  C 3 7   ? -35.499 39.321 -18.516 1.00 152.09 ? 7   DA  B "C4'" 1 
ATOM   3130 O  "O4'" . DA  C 3 7   ? -34.128 39.702 -18.216 1.00 149.47 ? 7   DA  B "O4'" 1 
ATOM   3131 C  "C3'" . DA  C 3 7   ? -36.142 40.533 -19.188 1.00 154.41 ? 7   DA  B "C3'" 1 
ATOM   3132 O  "O3'" . DA  C 3 7   ? -36.936 41.245 -18.249 1.00 157.63 ? 7   DA  B "O3'" 1 
ATOM   3133 C  "C2'" . DA  C 3 7   ? -34.941 41.359 -19.650 1.00 150.33 ? 7   DA  B "C2'" 1 
ATOM   3134 C  "C1'" . DA  C 3 7   ? -33.922 41.054 -18.564 1.00 146.61 ? 7   DA  B "C1'" 1 
ATOM   3135 N  N9    . DA  C 3 7   ? -32.539 41.207 -19.004 1.00 140.55 ? 7   DA  B N9    1 
ATOM   3136 C  C8    . DA  C 3 7   ? -31.962 40.647 -20.108 1.00 141.06 ? 7   DA  B C8    1 
ATOM   3137 N  N7    . DA  C 3 7   ? -30.694 40.950 -20.255 1.00 137.17 ? 7   DA  B N7    1 
ATOM   3138 C  C5    . DA  C 3 7   ? -30.417 41.761 -19.168 1.00 133.71 ? 7   DA  B C5    1 
ATOM   3139 C  C6    . DA  C 3 7   ? -29.241 42.413 -18.744 1.00 130.49 ? 7   DA  B C6    1 
ATOM   3140 N  N6    . DA  C 3 7   ? -28.080 42.342 -19.404 1.00 128.61 ? 7   DA  B N6    1 
ATOM   3141 N  N1    . DA  C 3 7   ? -29.307 43.147 -17.612 1.00 129.61 ? 7   DA  B N1    1 
ATOM   3142 C  C2    . DA  C 3 7   ? -30.471 43.218 -16.955 1.00 130.67 ? 7   DA  B C2    1 
ATOM   3143 N  N3    . DA  C 3 7   ? -31.638 42.650 -17.255 1.00 133.78 ? 7   DA  B N3    1 
ATOM   3144 C  C4    . DA  C 3 7   ? -31.543 41.929 -18.384 1.00 135.32 ? 7   DA  B C4    1 
ATOM   3145 P  P     . DG  C 3 8   ? -37.847 42.476 -18.732 1.00 159.72 ? 8   DG  B P     1 
ATOM   3146 O  OP1   . DG  C 3 8   ? -38.988 42.577 -17.792 1.00 159.70 ? 8   DG  B OP1   1 
ATOM   3147 O  OP2   . DG  C 3 8   ? -38.086 42.317 -20.186 1.00 156.96 ? 8   DG  B OP2   1 
ATOM   3148 O  "O5'" . DG  C 3 8   ? -36.904 43.753 -18.539 1.00 155.30 ? 8   DG  B "O5'" 1 
ATOM   3149 C  "C5'" . DG  C 3 8   ? -36.403 44.077 -17.249 1.00 152.30 ? 8   DG  B "C5'" 1 
ATOM   3150 C  "C4'" . DG  C 3 8   ? -35.616 45.376 -17.283 1.00 149.12 ? 8   DG  B "C4'" 1 
ATOM   3151 O  "O4'" . DG  C 3 8   ? -34.256 45.117 -17.725 1.00 143.44 ? 8   DG  B "O4'" 1 
ATOM   3152 C  "C3'" . DG  C 3 8   ? -36.170 46.450 -18.227 1.00 149.85 ? 8   DG  B "C3'" 1 
ATOM   3153 O  "O3'" . DG  C 3 8   ? -36.112 47.723 -17.591 1.00 150.72 ? 8   DG  B "O3'" 1 
ATOM   3154 C  "C2'" . DG  C 3 8   ? -35.224 46.372 -19.427 1.00 143.26 ? 8   DG  B "C2'" 1 
ATOM   3155 C  "C1'" . DG  C 3 8   ? -33.919 46.043 -18.731 1.00 138.42 ? 8   DG  B "C1'" 1 
ATOM   3156 N  N9    . DG  C 3 8   ? -32.906 45.452 -19.599 1.00 132.98 ? 8   DG  B N9    1 
ATOM   3157 C  C8    . DG  C 3 8   ? -33.098 44.567 -20.633 1.00 134.03 ? 8   DG  B C8    1 
ATOM   3158 N  N7    . DG  C 3 8   ? -31.986 44.214 -21.225 1.00 130.98 ? 8   DG  B N7    1 
ATOM   3159 C  C5    . DG  C 3 8   ? -30.998 44.907 -20.532 1.00 128.68 ? 8   DG  B C5    1 
ATOM   3160 C  C6    . DG  C 3 8   ? -29.591 44.932 -20.715 1.00 125.60 ? 8   DG  B C6    1 
ATOM   3161 O  O6    . DG  C 3 8   ? -28.909 44.319 -21.551 1.00 124.81 ? 8   DG  B O6    1 
ATOM   3162 N  N1    . DG  C 3 8   ? -28.970 45.773 -19.794 1.00 122.19 ? 8   DG  B N1    1 
ATOM   3163 C  C2    . DG  C 3 8   ? -29.625 46.497 -18.825 1.00 123.50 ? 8   DG  B C2    1 
ATOM   3164 N  N2    . DG  C 3 8   ? -28.864 47.254 -18.027 1.00 121.94 ? 8   DG  B N2    1 
ATOM   3165 N  N3    . DG  C 3 8   ? -30.934 46.482 -18.649 1.00 125.93 ? 8   DG  B N3    1 
ATOM   3166 C  C4    . DG  C 3 8   ? -31.554 45.671 -19.533 1.00 128.82 ? 8   DG  B C4    1 
ATOM   3167 P  P     . DC  C 3 9   ? -36.831 49.001 -18.251 1.00 150.13 ? 9   DC  B P     1 
ATOM   3168 O  OP1   . DC  C 3 9   ? -37.667 49.618 -17.198 1.00 152.76 ? 9   DC  B OP1   1 
ATOM   3169 O  OP2   . DC  C 3 9   ? -37.446 48.594 -19.536 1.00 150.69 ? 9   DC  B OP2   1 
ATOM   3170 O  "O5'" . DC  C 3 9   ? -35.619 49.992 -18.567 1.00 146.68 ? 9   DC  B "O5'" 1 
ATOM   3171 C  "C5'" . DC  C 3 9   ? -34.772 50.423 -17.511 1.00 142.29 ? 9   DC  B "C5'" 1 
ATOM   3172 C  "C4'" . DC  C 3 9   ? -33.437 50.913 -18.042 1.00 139.65 ? 9   DC  B "C4'" 1 
ATOM   3173 O  "O4'" . DC  C 3 9   ? -32.737 49.829 -18.712 1.00 135.37 ? 9   DC  B "O4'" 1 
ATOM   3174 C  "C3'" . DC  C 3 9   ? -33.513 52.060 -19.063 1.00 140.44 ? 9   DC  B "C3'" 1 
ATOM   3175 O  "O3'" . DC  C 3 9   ? -32.616 53.100 -18.682 1.00 142.24 ? 9   DC  B "O3'" 1 
ATOM   3176 C  "C2'" . DC  C 3 9   ? -33.068 51.396 -20.367 1.00 134.83 ? 9   DC  B "C2'" 1 
ATOM   3177 C  "C1'" . DC  C 3 9   ? -32.091 50.373 -19.829 1.00 129.97 ? 9   DC  B "C1'" 1 
ATOM   3178 N  N1    . DC  C 3 9   ? -31.744 49.295 -20.790 1.00 126.12 ? 9   DC  B N1    1 
ATOM   3179 C  C2    . DC  C 3 9   ? -30.409 48.928 -20.931 1.00 122.88 ? 9   DC  B C2    1 
ATOM   3180 O  O2    . DC  C 3 9   ? -29.560 49.498 -20.236 1.00 121.37 ? 9   DC  B O2    1 
ATOM   3181 N  N3    . DC  C 3 9   ? -30.083 47.955 -21.815 1.00 122.74 ? 9   DC  B N3    1 
ATOM   3182 C  C4    . DC  C 3 9   ? -31.032 47.367 -22.541 1.00 123.17 ? 9   DC  B C4    1 
ATOM   3183 N  N4    . DC  C 3 9   ? -30.658 46.409 -23.399 1.00 123.34 ? 9   DC  B N4    1 
ATOM   3184 C  C5    . DC  C 3 9   ? -32.408 47.730 -22.413 1.00 124.20 ? 9   DC  B C5    1 
ATOM   3185 C  C6    . DC  C 3 9   ? -32.715 48.695 -21.535 1.00 127.00 ? 9   DC  B C6    1 
ATOM   3186 P  P     . DG  C 3 10  ? -32.708 54.552 -19.366 1.00 138.62 ? 10  DG  B P     1 
ATOM   3187 O  OP1   . DG  C 3 10  ? -33.051 55.504 -18.288 1.00 138.10 ? 10  DG  B OP1   1 
ATOM   3188 O  OP2   . DG  C 3 10  ? -33.574 54.462 -20.565 1.00 136.41 ? 10  DG  B OP2   1 
ATOM   3189 O  "O5'" . DG  C 3 10  ? -31.209 54.843 -19.854 1.00 135.12 ? 10  DG  B "O5'" 1 
ATOM   3190 C  "C5'" . DG  C 3 10  ? -30.165 55.016 -18.895 1.00 126.82 ? 10  DG  B "C5'" 1 
ATOM   3191 C  "C4'" . DG  C 3 10  ? -28.802 55.090 -19.570 1.00 124.27 ? 10  DG  B "C4'" 1 
ATOM   3192 O  "O4'" . DG  C 3 10  ? -28.524 53.838 -20.249 1.00 122.98 ? 10  DG  B "O4'" 1 
ATOM   3193 C  "C3'" . DG  C 3 10  ? -28.655 56.183 -20.626 1.00 126.50 ? 10  DG  B "C3'" 1 
ATOM   3194 O  "O3'" . DG  C 3 10  ? -27.335 56.710 -20.603 1.00 125.66 ? 10  DG  B "O3'" 1 
ATOM   3195 C  "C2'" . DG  C 3 10  ? -28.936 55.441 -21.927 1.00 127.10 ? 10  DG  B "C2'" 1 
ATOM   3196 C  "C1'" . DG  C 3 10  ? -28.363 54.059 -21.636 1.00 124.38 ? 10  DG  B "C1'" 1 
ATOM   3197 N  N9    . DG  C 3 10  ? -29.056 52.993 -22.346 1.00 124.65 ? 10  DG  B N9    1 
ATOM   3198 C  C8    . DG  C 3 10  ? -30.397 52.703 -22.284 1.00 125.77 ? 10  DG  B C8    1 
ATOM   3199 N  N7    . DG  C 3 10  ? -30.744 51.691 -23.026 1.00 125.83 ? 10  DG  B N7    1 
ATOM   3200 C  C5    . DG  C 3 10  ? -29.558 51.279 -23.618 1.00 124.76 ? 10  DG  B C5    1 
ATOM   3201 C  C6    . DG  C 3 10  ? -29.318 50.224 -24.524 1.00 124.55 ? 10  DG  B C6    1 
ATOM   3202 O  O6    . DG  C 3 10  ? -30.132 49.419 -24.994 1.00 125.27 ? 10  DG  B O6    1 
ATOM   3203 N  N1    . DG  C 3 10  ? -27.974 50.147 -24.883 1.00 123.52 ? 10  DG  B N1    1 
ATOM   3204 C  C2    . DG  C 3 10  ? -26.988 50.985 -24.421 1.00 122.69 ? 10  DG  B C2    1 
ATOM   3205 N  N2    . DG  C 3 10  ? -25.748 50.751 -24.881 1.00 121.77 ? 10  DG  B N2    1 
ATOM   3206 N  N3    . DG  C 3 10  ? -27.200 51.980 -23.567 1.00 122.87 ? 10  DG  B N3    1 
ATOM   3207 C  C4    . DG  C 3 10  ? -28.507 52.069 -23.210 1.00 123.97 ? 10  DG  B C4    1 
HETATM 3208 NA NA    . NA  D 4 .   ? -18.601 47.795 -13.160 1.00 104.20 ? 401 NA  Z NA    1 
HETATM 3209 O  O     . HOH E 5 .   ? -20.390 9.389  1.352   1.00 115.76 ? 501 HOH Z O     1 
HETATM 3210 O  O     . HOH E 5 .   ? -9.614  33.672 -4.483  1.00 91.10  ? 502 HOH Z O     1 
HETATM 3211 O  O     . HOH E 5 .   ? -15.130 29.272 -12.207 1.00 101.17 ? 503 HOH Z O     1 
HETATM 3212 O  O     . HOH E 5 .   ? -17.344 38.272 -8.331  1.00 113.88 ? 504 HOH Z O     1 
HETATM 3213 O  O     . HOH E 5 .   ? -13.416 51.372 -9.641  1.00 84.84  ? 505 HOH Z O     1 
HETATM 3214 O  O     . HOH E 5 .   ? 4.876   24.490 -17.038 1.00 91.09  ? 506 HOH Z O     1 
HETATM 3215 O  O     . HOH E 5 .   ? -18.531 25.898 8.817   1.00 98.97  ? 507 HOH Z O     1 
HETATM 3216 O  O     . HOH E 5 .   ? -8.035  39.198 -4.044  1.00 81.90  ? 508 HOH Z O     1 
HETATM 3217 O  O     . HOH E 5 .   ? 1.859   34.649 20.155  1.00 84.10  ? 509 HOH Z O     1 
HETATM 3218 O  O     . HOH E 5 .   ? -7.377  29.719 7.108   1.00 94.95  ? 510 HOH Z O     1 
HETATM 3219 O  O     . HOH E 5 .   ? -14.883 37.742 -28.319 1.00 101.29 ? 511 HOH Z O     1 
HETATM 3220 O  O     . HOH E 5 .   ? -7.723  66.415 -23.450 1.00 134.04 ? 512 HOH Z O     1 
HETATM 3221 O  O     . HOH E 5 .   ? -0.937  22.880 11.454  1.00 98.76  ? 513 HOH Z O     1 
HETATM 3222 O  O     . HOH E 5 .   ? -4.243  20.779 15.729  1.00 99.87  ? 514 HOH Z O     1 
HETATM 3223 O  O     . HOH E 5 .   ? -18.405 46.101 -11.456 1.00 88.35  ? 515 HOH Z O     1 
HETATM 3224 O  O     . HOH E 5 .   ? -12.125 38.068 -4.896  1.00 101.12 ? 516 HOH Z O     1 
HETATM 3225 O  O     . HOH E 5 .   ? -11.046 23.104 -9.320  1.00 86.05  ? 517 HOH Z O     1 
HETATM 3226 O  O     . HOH E 5 .   ? -8.795  29.359 2.381   1.00 82.09  ? 518 HOH Z O     1 
HETATM 3227 O  O     . HOH E 5 .   ? 4.066   36.140 -19.159 1.00 84.51  ? 519 HOH Z O     1 
HETATM 3228 O  O     . HOH E 5 .   ? -8.015  66.328 -25.874 1.00 135.49 ? 520 HOH Z O     1 
HETATM 3229 O  O     . HOH E 5 .   ? 5.667   27.062 -16.996 1.00 81.92  ? 521 HOH Z O     1 
HETATM 3230 O  O     . HOH E 5 .   ? -16.681 47.003 -3.421  1.00 87.54  ? 522 HOH Z O     1 
HETATM 3231 O  O     . HOH E 5 .   ? -17.909 64.764 -31.980 1.00 133.23 ? 523 HOH Z O     1 
HETATM 3232 O  O     . HOH E 5 .   ? -10.195 25.160 -10.844 1.00 76.16  ? 524 HOH Z O     1 
HETATM 3233 O  O     . HOH E 5 .   ? -10.593 35.332 9.085   1.00 89.83  ? 525 HOH Z O     1 
HETATM 3234 O  O     . HOH E 5 .   ? -10.886 29.702 -5.698  1.00 86.63  ? 526 HOH Z O     1 
HETATM 3235 O  O     . HOH E 5 .   ? -10.966 42.183 -6.533  1.00 84.07  ? 527 HOH Z O     1 
HETATM 3236 O  O     . HOH E 5 .   ? -18.096 45.066 -16.575 1.00 104.00 ? 528 HOH Z O     1 
HETATM 3237 O  O     . HOH E 5 .   ? -23.931 51.739 -21.493 1.00 117.81 ? 529 HOH Z O     1 
HETATM 3238 O  O     . HOH E 5 .   ? -9.775  40.929 -4.706  1.00 87.10  ? 530 HOH Z O     1 
HETATM 3239 O  O     . HOH E 5 .   ? -16.312 19.115 -16.557 1.00 92.10  ? 531 HOH Z O     1 
HETATM 3240 O  O     . HOH E 5 .   ? 0.892   48.447 -24.421 1.00 103.63 ? 532 HOH Z O     1 
HETATM 3241 O  O     . HOH E 5 .   ? -9.969  25.323 -8.361  1.00 94.61  ? 533 HOH Z O     1 
HETATM 3242 O  O     . HOH E 5 .   ? -9.423  29.365 5.699   1.00 88.95  ? 534 HOH Z O     1 
HETATM 3243 O  O     . HOH E 5 .   ? -13.706 64.049 -29.842 1.00 128.85 ? 535 HOH Z O     1 
HETATM 3244 O  O     . HOH E 5 .   ? 4.304   23.411 -19.639 1.00 90.49  ? 536 HOH Z O     1 
HETATM 3245 O  O     . HOH E 5 .   ? -6.021  28.173 8.805   1.00 86.65  ? 537 HOH Z O     1 
HETATM 3246 O  O     . HOH E 5 .   ? -28.773 36.249 14.682  1.00 131.24 ? 538 HOH Z O     1 
HETATM 3247 O  O     . HOH E 5 .   ? -15.390 28.260 -5.848  1.00 96.46  ? 539 HOH Z O     1 
HETATM 3248 O  O     . HOH E 5 .   ? -10.862 28.915 3.717   1.00 94.15  ? 540 HOH Z O     1 
HETATM 3249 O  O     . HOH F 5 .   ? -20.246 45.246 -18.973 1.00 107.29 ? 101 HOH A O     1 
HETATM 3250 O  O     . HOH F 5 .   ? -27.284 35.683 -5.555  1.00 140.60 ? 102 HOH A O     1 
HETATM 3251 O  O     . HOH F 5 .   ? -30.616 46.728 -28.547 1.00 109.98 ? 103 HOH A O     1 
HETATM 3252 O  O     . HOH F 5 .   ? -18.977 45.507 -13.839 1.00 107.28 ? 104 HOH A O     1 
HETATM 3253 O  O     . HOH F 5 .   ? -27.219 43.157 -25.160 1.00 118.79 ? 105 HOH A O     1 
HETATM 3254 O  O     . HOH F 5 .   ? -23.247 42.228 -19.691 1.00 105.26 ? 106 HOH A O     1 
HETATM 3255 O  O     . HOH F 5 .   ? -28.099 45.488 -31.183 1.00 104.44 ? 107 HOH A O     1 
HETATM 3256 O  O     . HOH G 5 .   ? -11.468 31.892 -3.872  1.00 116.79 ? 101 HOH B O     1 
HETATM 3257 O  O     . HOH G 5 .   ? -21.357 29.036 -12.845 1.00 132.95 ? 102 HOH B O     1 
HETATM 3258 O  O     . HOH G 5 .   ? -13.057 30.872 -6.121  1.00 109.92 ? 103 HOH B O     1 
HETATM 3259 O  O     . HOH G 5 .   ? -25.833 29.439 -15.551 1.00 131.48 ? 104 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 2   ? 0.8177 1.6308 1.3293 -0.1455 0.1197  -0.1185 2   GLY Z N     
2    C CA    . GLY A 2   ? 0.8298 1.5059 1.2640 -0.1350 0.1347  -0.0957 2   GLY Z CA    
3    C C     . GLY A 2   ? 0.8691 1.4713 1.2299 -0.0709 0.1131  -0.1101 2   GLY Z C     
4    O O     . GLY A 2   ? 0.9181 1.5632 1.2765 -0.0265 0.0934  -0.1375 2   GLY Z O     
5    N N     . ILE A 3   ? 0.8657 1.3562 1.1666 -0.0661 0.1171  -0.0911 3   ILE Z N     
6    C CA    . ILE A 3   ? 0.9724 1.3852 1.1999 -0.0072 0.0970  -0.1021 3   ILE Z CA    
7    C C     . ILE A 3   ? 0.9358 1.4149 1.1872 0.0122  0.0625  -0.1265 3   ILE Z C     
8    O O     . ILE A 3   ? 0.9117 1.3882 1.1754 -0.0117 0.0553  -0.1190 3   ILE Z O     
9    C CB    . ILE A 3   ? 0.9556 1.2340 1.1154 -0.0102 0.1103  -0.0747 3   ILE Z CB    
10   C CG1   . ILE A 3   ? 0.9107 1.1259 1.0537 -0.0364 0.1457  -0.0480 3   ILE Z CG1   
11   C CG2   . ILE A 3   ? 0.9785 1.1748 1.0590 0.0539  0.0912  -0.0860 3   ILE Z CG2   
12   C CD1   . ILE A 3   ? 0.9151 1.1027 1.0209 0.0043  0.1519  -0.0573 3   ILE Z CD1   
13   N N     . GLN A 4   ? 0.8644 1.4021 1.1225 0.0557  0.0412  -0.1558 4   GLN Z N     
14   C CA    . GLN A 4   ? 0.9278 1.5451 1.2181 0.0743  0.0076  -0.1819 4   GLN Z CA    
15   C C     . GLN A 4   ? 0.9790 1.5191 1.2096 0.1060  -0.0136 -0.1829 4   GLN Z C     
16   O O     . GLN A 4   ? 1.0407 1.5083 1.2031 0.1586  -0.0229 -0.1894 4   GLN Z O     
17   C CB    . GLN A 4   ? 1.0126 1.7012 1.3185 0.1169  -0.0083 -0.2120 4   GLN Z CB    
18   C CG    . GLN A 4   ? 1.0952 1.9106 1.4712 0.1157  -0.0350 -0.2381 4   GLN Z CG    
19   C CD    . GLN A 4   ? 1.0626 1.9603 1.4693 0.1437  -0.0419 -0.2636 4   GLN Z CD    
20   O OE1   . GLN A 4   ? 1.0305 1.8984 1.4135 0.1569  -0.0239 -0.2608 4   GLN Z OE1   
21   N NE2   . GLN A 4   ? 1.1238 2.1257 1.5842 0.1528  -0.0679 -0.2889 4   GLN Z NE2   
22   N N     . GLY A 5   ? 0.9327 1.4876 1.1890 0.0732  -0.0206 -0.1760 5   GLY Z N     
23   C CA    . GLY A 5   ? 0.9279 1.4238 1.1360 0.0991  -0.0429 -0.1791 5   GLY Z CA    
24   C C     . GLY A 5   ? 0.9563 1.3181 1.0950 0.0928  -0.0251 -0.1508 5   GLY Z C     
25   O O     . GLY A 5   ? 1.0010 1.2913 1.0795 0.1268  -0.0414 -0.1532 5   GLY Z O     
26   N N     . LEU A 6   ? 1.0463 1.3738 1.1935 0.0490  0.0082  -0.1237 6   LEU Z N     
27   C CA    . LEU A 6   ? 1.0501 1.2481 1.1329 0.0416  0.0284  -0.0952 6   LEU Z CA    
28   C C     . LEU A 6   ? 1.0253 1.1967 1.1069 0.0166  0.0216  -0.0850 6   LEU Z C     
29   O O     . LEU A 6   ? 1.0927 1.1584 1.1049 0.0367  0.0210  -0.0742 6   LEU Z O     
30   C CB    . LEU A 6   ? 1.0028 1.1778 1.1011 -0.0013 0.0657  -0.0689 6   LEU Z CB    
31   C CG    . LEU A 6   ? 1.0097 1.0523 1.0470 -0.0134 0.0900  -0.0371 6   LEU Z CG    
32   C CD1   . LEU A 6   ? 1.0473 0.9841 0.9933 0.0472  0.0835  -0.0402 6   LEU Z CD1   
33   C CD2   . LEU A 6   ? 0.9809 1.0134 1.0421 -0.0579 0.1254  -0.0124 6   LEU Z CD2   
34   N N     . LEU A 7   ? 1.0035 1.2708 1.1620 -0.0269 0.0168  -0.0886 7   LEU Z N     
35   C CA    . LEU A 7   ? 1.0112 1.2620 1.1788 -0.0581 0.0130  -0.0780 7   LEU Z CA    
36   C C     . LEU A 7   ? 1.0887 1.3049 1.2072 -0.0135 -0.0185 -0.0951 7   LEU Z C     
37   O O     . LEU A 7   ? 1.1259 1.2524 1.1955 -0.0149 -0.0158 -0.0805 7   LEU Z O     
38   C CB    . LEU A 7   ? 1.0083 1.3814 1.2736 -0.1096 0.0115  -0.0823 7   LEU Z CB    
39   C CG    . LEU A 7   ? 1.0418 1.4182 1.3313 -0.1460 0.0063  -0.0742 7   LEU Z CG    
40   C CD1   . LEU A 7   ? 0.9389 1.1926 1.1760 -0.1660 0.0306  -0.0426 7   LEU Z CD1   
41   C CD2   . LEU A 7   ? 1.0437 1.5376 1.4326 -0.2015 0.0120  -0.0738 7   LEU Z CD2   
42   N N     . GLN A 8   ? 0.9863 1.2733 1.1176 0.0259  -0.0483 -0.1258 8   GLN Z N     
43   C CA    . GLN A 8   ? 1.0597 1.3206 1.1457 0.0712  -0.0807 -0.1440 8   GLN Z CA    
44   C C     . GLN A 8   ? 1.1185 1.2485 1.1041 0.1182  -0.0774 -0.1355 8   GLN Z C     
45   O O     . GLN A 8   ? 1.1910 1.2580 1.1232 0.1429  -0.0937 -0.1374 8   GLN Z O     
46   C CB    . GLN A 8   ? 1.0584 1.4259 1.1823 0.1043  -0.1123 -0.1784 8   GLN Z CB    
47   C CG    . GLN A 8   ? 1.0842 1.5689 1.2927 0.0700  -0.1287 -0.1921 8   GLN Z CG    
48   C CD    . GLN A 8   ? 1.1484 1.6039 1.3383 0.0677  -0.1479 -0.1935 8   GLN Z CD    
49   O OE1   . GLN A 8   ? 1.1069 1.5153 1.2946 0.0277  -0.1308 -0.1713 8   GLN Z OE1   
50   N NE2   . GLN A 8   ? 1.2347 1.7177 1.4110 0.1107  -0.1836 -0.2198 8   GLN Z NE2   
51   N N     . PHE A 9   ? 1.1057 1.1946 1.0659 0.1299  -0.0559 -0.1258 9   PHE Z N     
52   C CA    . PHE A 9   ? 1.1772 1.1452 1.0451 0.1758  -0.0512 -0.1179 9   PHE Z CA    
53   C C     . PHE A 9   ? 1.2151 1.0660 1.0314 0.1553  -0.0313 -0.0885 9   PHE Z C     
54   O O     . PHE A 9   ? 1.3030 1.0548 1.0407 0.1936  -0.0372 -0.0848 9   PHE Z O     
55   C CB    . PHE A 9   ? 1.1948 1.1538 1.0555 0.1890  -0.0313 -0.1146 9   PHE Z CB    
56   C CG    . PHE A 9   ? 1.2804 1.1251 1.0504 0.2412  -0.0286 -0.1099 9   PHE Z CG    
57   C CD1   . PHE A 9   ? 1.3577 1.2034 1.0909 0.3024  -0.0568 -0.1339 9   PHE Z CD1   
58   C CD2   . PHE A 9   ? 1.2991 1.0360 1.0220 0.2292  0.0023  -0.0810 9   PHE Z CD2   
59   C CE1   . PHE A 9   ? 1.4352 1.1761 1.0857 0.3508  -0.0540 -0.1290 9   PHE Z CE1   
60   C CE2   . PHE A 9   ? 1.3765 1.0083 1.0171 0.2773  0.0053  -0.0763 9   PHE Z CE2   
61   C CZ    . PHE A 9   ? 1.4582 1.0920 1.0624 0.3382  -0.0228 -0.1003 9   PHE Z CZ    
62   N N     . ILE A 10  ? 1.2595 1.1223 1.1207 0.0947  -0.0073 -0.0671 10  ILE Z N     
63   C CA    . ILE A 10  ? 1.2655 1.0221 1.0856 0.0699  0.0141  -0.0378 10  ILE Z CA    
64   C C     . ILE A 10  ? 1.2060 1.0021 1.0743 0.0218  0.0110  -0.0326 10  ILE Z C     
65   O O     . ILE A 10  ? 1.1141 0.8681 0.9911 -0.0239 0.0368  -0.0060 10  ILE Z O     
66   C CB    . ILE A 10  ? 1.1898 0.8952 1.0074 0.0403  0.0527  -0.0097 10  ILE Z CB    
67   C CG1   . ILE A 10  ? 1.1045 0.9199 1.0133 -0.0089 0.0654  -0.0091 10  ILE Z CG1   
68   C CG2   . ILE A 10  ? 1.2327 0.8727 0.9885 0.0895  0.0580  -0.0113 10  ILE Z CG2   
69   C CD1   . ILE A 10  ? 1.0568 0.8275 0.9684 -0.0432 0.1027  0.0192  10  ILE Z CD1   
70   N N     . LYS A 11  ? 1.1943 1.0701 1.0937 0.0328  -0.0209 -0.0581 11  LYS Z N     
71   C CA    . LYS A 11  ? 1.1571 1.0811 1.1071 -0.0103 -0.0272 -0.0570 11  LYS Z CA    
72   C C     . LYS A 11  ? 1.1555 0.9703 1.0486 -0.0173 -0.0204 -0.0380 11  LYS Z C     
73   O O     . LYS A 11  ? 1.0988 0.9274 1.0288 -0.0636 -0.0133 -0.0269 11  LYS Z O     
74   C CB    . LYS A 11  ? 1.1812 1.2068 1.1689 0.0105  -0.0655 -0.0903 11  LYS Z CB    
75   C CG    . LYS A 11  ? 1.3194 1.2948 1.2346 0.0741  -0.0950 -0.1089 11  LYS Z CG    
76   C CD    . LYS A 11  ? 1.3551 1.4359 1.3129 0.0921  -0.1330 -0.1415 11  LYS Z CD    
77   C CE    . LYS A 11  ? 1.4548 1.4838 1.3390 0.1558  -0.1629 -0.1592 11  LYS Z CE    
78   N NZ    . LYS A 11  ? 1.5142 1.6437 1.4386 0.1746  -0.2012 -0.1909 11  LYS Z NZ    
79   N N     . GLU A 12  ? 1.2842 0.9900 1.0877 0.0287  -0.0218 -0.0342 12  GLU Z N     
80   C CA    . GLU A 12  ? 1.3419 0.9365 1.0827 0.0284  -0.0158 -0.0171 12  GLU Z CA    
81   C C     . GLU A 12  ? 1.2814 0.8083 1.0232 -0.0197 0.0239  0.0184  12  GLU Z C     
82   O O     . GLU A 12  ? 1.3275 0.7830 1.0419 -0.0385 0.0331  0.0352  12  GLU Z O     
83   C CB    . GLU A 12  ? 1.4414 0.9397 1.0860 0.0930  -0.0278 -0.0226 12  GLU Z CB    
84   C CG    . GLU A 12  ? 1.5164 1.0740 1.1548 0.1430  -0.0682 -0.0567 12  GLU Z CG    
85   C CD    . GLU A 12  ? 1.7034 1.1685 1.2486 0.2077  -0.0791 -0.0614 12  GLU Z CD    
86   O OE1   . GLU A 12  ? 1.7443 1.0987 1.2296 0.2140  -0.0546 -0.0382 12  GLU Z OE1   
87   O OE2   . GLU A 12  ? 1.7647 1.2678 1.2973 0.2524  -0.1121 -0.0879 12  GLU Z OE2   
88   N N     . ALA A 13  ? 0.7449 1.1784 0.9862 -0.1167 0.0314  -0.1004 13  ALA Z N     
89   C CA    . ALA A 13  ? 0.7379 1.1752 0.9870 -0.0910 0.0253  -0.1146 13  ALA Z CA    
90   C C     . ALA A 13  ? 0.7923 1.1816 1.0006 -0.0665 0.0315  -0.1292 13  ALA Z C     
91   O O     . ALA A 13  ? 0.8009 1.1834 1.0120 -0.0437 0.0257  -0.1416 13  ALA Z O     
92   C CB    . ALA A 13  ? 0.7681 1.2137 1.0489 -0.0804 0.0037  -0.1100 13  ALA Z CB    
93   N N     . SER A 14  ? 0.8013 1.1571 0.9732 -0.0724 0.0412  -0.1260 14  SER Z N     
94   C CA    . SER A 14  ? 0.8333 1.1432 0.9659 -0.0525 0.0437  -0.1366 14  SER Z CA    
95   C C     . SER A 14  ? 0.9042 1.2120 1.0171 -0.0532 0.0562  -0.1478 14  SER Z C     
96   O O     . SER A 14  ? 0.9040 1.2438 1.0274 -0.0718 0.0663  -0.1460 14  SER Z O     
97   C CB    . SER A 14  ? 0.8515 1.1252 0.9545 -0.0565 0.0444  -0.1254 14  SER Z CB    
98   O OG    . SER A 14  ? 0.9121 1.1928 1.0085 -0.0825 0.0554  -0.1121 14  SER Z OG    
99   N N     . GLU A 15  ? 0.8651 1.1354 0.9497 -0.0334 0.0540  -0.1597 15  GLU Z N     
100  C CA    . GLU A 15  ? 0.9207 1.1830 0.9859 -0.0298 0.0622  -0.1732 15  GLU Z CA    
101  C C     . GLU A 15  ? 0.9706 1.1812 0.9988 -0.0135 0.0550  -0.1790 15  GLU Z C     
102  O O     . GLU A 15  ? 0.9573 1.1480 0.9864 0.0053  0.0425  -0.1845 15  GLU Z O     
103  C CB    . GLU A 15  ? 0.9229 1.2187 1.0175 -0.0181 0.0630  -0.1906 15  GLU Z CB    
104  C CG    . GLU A 15  ? 1.0099 1.2925 1.0864 -0.0065 0.0681  -0.2104 15  GLU Z CG    
105  C CD    . GLU A 15  ? 1.0728 1.3883 1.1813 0.0085  0.0686  -0.2288 15  GLU Z CD    
106  O OE1   . GLU A 15  ? 1.0568 1.4132 1.2013 0.0044  0.0674  -0.2231 15  GLU Z OE1   
107  O OE2   . GLU A 15  ? 1.1547 1.4558 1.2542 0.0247  0.0687  -0.2485 15  GLU Z OE2   
108  N N     . PRO A 16  ? 1.0349 1.2230 1.0302 -0.0222 0.0610  -0.1762 16  PRO Z N     
109  C CA    . PRO A 16  ? 1.0407 1.1816 1.0009 -0.0091 0.0514  -0.1803 16  PRO Z CA    
110  C C     . PRO A 16  ? 1.0879 1.2236 1.0561 0.0132  0.0438  -0.2044 16  PRO Z C     
111  O O     . PRO A 16  ? 1.1262 1.2826 1.1037 0.0134  0.0521  -0.2187 16  PRO Z O     
112  C CB    . PRO A 16  ? 1.0481 1.1749 0.9779 -0.0264 0.0596  -0.1710 16  PRO Z CB    
113  C CG    . PRO A 16  ? 1.0020 1.1620 0.9482 -0.0513 0.0728  -0.1559 16  PRO Z CG    
114  C CD    . PRO A 16  ? 0.9741 1.1788 0.9633 -0.0474 0.0747  -0.1660 16  PRO Z CD    
115  N N     . ILE A 17  ? 1.0304 1.1395 0.9959 0.0309  0.0281  -0.2091 17  ILE Z N     
116  C CA    . ILE A 17  ? 1.0666 1.1679 1.0445 0.0520  0.0182  -0.2311 17  ILE Z CA    
117  C C     . ILE A 17  ? 1.1018 1.1540 1.0513 0.0626  -0.0005 -0.2331 17  ILE Z C     
118  O O     . ILE A 17  ? 1.1128 1.1394 1.0321 0.0541  -0.0055 -0.2161 17  ILE Z O     
119  C CB    . ILE A 17  ? 1.0475 1.1686 1.0619 0.0642  0.0128  -0.2365 17  ILE Z CB    
120  C CG1   . ILE A 17  ? 1.0403 1.1341 1.0436 0.0677  -0.0007 -0.2239 17  ILE Z CG1   
121  C CG2   . ILE A 17  ? 1.0210 1.1935 1.0673 0.0530  0.0267  -0.2320 17  ILE Z CG2   
122  C CD1   . ILE A 17  ? 1.0293 1.1238 1.0597 0.0839  -0.0130 -0.2312 17  ILE Z CD1   
123  N N     . HIS A 18  ? 1.0853 1.1269 1.0472 0.0805  -0.0120 -0.2533 18  HIS Z N     
124  C CA    . HIS A 18  ? 1.1627 1.1601 1.1068 0.0908  -0.0349 -0.2556 18  HIS Z CA    
125  C C     . HIS A 18  ? 1.1526 1.1488 1.1269 0.1075  -0.0474 -0.2676 18  HIS Z C     
126  O O     . HIS A 18  ? 1.1165 1.1439 1.1256 0.1152  -0.0391 -0.2805 18  HIS Z O     
127  C CB    . HIS A 18  ? 1.2198 1.1942 1.1464 0.0951  -0.0433 -0.2682 18  HIS Z CB    
128  C CG    . HIS A 18  ? 1.2622 1.1902 1.1652 0.0996  -0.0699 -0.2641 18  HIS Z CG    
129  N ND1   . HIS A 18  ? 1.3068 1.2160 1.2271 0.1147  -0.0908 -0.2777 18  HIS Z ND1   
130  C CD2   . HIS A 18  ? 1.3011 1.1993 1.1662 0.0891  -0.0807 -0.2458 18  HIS Z CD2   
131  C CE1   . HIS A 18  ? 1.3080 1.1785 1.2019 0.1123  -0.1142 -0.2683 18  HIS Z CE1   
132  N NE2   . HIS A 18  ? 1.3091 1.1733 1.1686 0.0973  -0.1086 -0.2485 18  HIS Z NE2   
133  N N     . VAL A 19  ? 1.1809 1.1419 1.1420 0.1118  -0.0679 -0.2620 19  VAL Z N     
134  C CA    . VAL A 19  ? 1.1901 1.1452 1.1766 0.1243  -0.0811 -0.2683 19  VAL Z CA    
135  C C     . VAL A 19  ? 1.2035 1.1593 1.2217 0.1407  -0.0891 -0.2923 19  VAL Z C     
136  O O     . VAL A 19  ? 1.2249 1.1829 1.2720 0.1510  -0.0966 -0.2980 19  VAL Z O     
137  C CB    . VAL A 19  ? 1.2001 1.1152 1.1618 0.1226  -0.1032 -0.2568 19  VAL Z CB    
138  C CG1   . VAL A 19  ? 1.1656 1.0848 1.1022 0.1093  -0.0946 -0.2348 19  VAL Z CG1   
139  C CG2   . VAL A 19  ? 1.2438 1.1246 1.1825 0.1224  -0.1221 -0.2603 19  VAL Z CG2   
140  N N     . ARG A 20  ? 1.1720 1.1251 1.1852 0.1436  -0.0883 -0.3064 20  ARG Z N     
141  C CA    . ARG A 20  ? 1.1902 1.1450 1.2344 0.1606  -0.0956 -0.3321 20  ARG Z CA    
142  C C     . ARG A 20  ? 1.1672 1.1679 1.2537 0.1685  -0.0784 -0.3424 20  ARG Z C     
143  O O     . ARG A 20  ? 1.2120 1.2161 1.3319 0.1841  -0.0856 -0.3608 20  ARG Z O     
144  C CB    . ARG A 20  ? 1.2747 1.2225 1.3039 0.1622  -0.0954 -0.3465 20  ARG Z CB    
145  C CG    . ARG A 20  ? 1.3528 1.2507 1.3568 0.1627  -0.1242 -0.3455 20  ARG Z CG    
146  C CD    . ARG A 20  ? 1.4072 1.2989 1.4033 0.1682  -0.1266 -0.3640 20  ARG Z CD    
147  N NE    . ARG A 20  ? 1.4088 1.3264 1.3848 0.1563  -0.1005 -0.3575 20  ARG Z NE    
148  C CZ    . ARG A 20  ? 1.4179 1.3187 1.3533 0.1401  -0.1001 -0.3359 20  ARG Z CZ    
149  N NH1   . ARG A 20  ? 1.4327 1.2945 1.3427 0.1345  -0.1238 -0.3189 20  ARG Z NH1   
150  N NH2   . ARG A 20  ? 1.4204 1.3446 1.3413 0.1281  -0.0767 -0.3301 20  ARG Z NH2   
151  N N     . LYS A 21  ? 1.1439 1.1810 1.2311 0.1571  -0.0572 -0.3295 21  LYS Z N     
152  C CA    . LYS A 21  ? 1.1114 1.1968 1.2385 0.1616  -0.0426 -0.3350 21  LYS Z CA    
153  C C     . LYS A 21  ? 1.1201 1.1993 1.2739 0.1706  -0.0560 -0.3295 21  LYS Z C     
154  O O     . LYS A 21  ? 1.1352 1.2496 1.3265 0.1772  -0.0497 -0.3333 21  LYS Z O     
155  C CB    . LYS A 21  ? 1.0922 1.2171 1.2141 0.1439  -0.0208 -0.3200 21  LYS Z CB    
156  C CG    . LYS A 21  ? 1.0731 1.1860 1.1774 0.1316  -0.0241 -0.2954 21  LYS Z CG    
157  C CD    . LYS A 21  ? 1.0194 1.1796 1.1421 0.1189  -0.0084 -0.2828 21  LYS Z CD    
158  C CE    . LYS A 21  ? 1.0305 1.2189 1.1427 0.1034  0.0112  -0.2830 21  LYS Z CE    
159  N NZ    . LYS A 21  ? 1.0778 1.3127 1.2105 0.0879  0.0229  -0.2689 21  LYS Z NZ    
160  N N     . TYR A 22  ? 1.1106 1.1455 1.2442 0.1698  -0.0753 -0.3193 22  TYR Z N     
161  C CA    . TYR A 22  ? 1.1507 1.1711 1.3046 0.1776  -0.0911 -0.3139 22  TYR Z CA    
162  C C     . TYR A 22  ? 1.1920 1.1689 1.3494 0.1882  -0.1158 -0.3253 22  TYR Z C     
163  O O     . TYR A 22  ? 1.1789 1.1278 1.3393 0.1903  -0.1339 -0.3177 22  TYR Z O     
164  C CB    . TYR A 22  ? 1.0750 1.0826 1.2049 0.1666  -0.0943 -0.2915 22  TYR Z CB    
165  C CG    . TYR A 22  ? 1.0273 1.0770 1.1627 0.1565  -0.0750 -0.2794 22  TYR Z CG    
166  C CD1   . TYR A 22  ? 0.9881 1.0716 1.1610 0.1610  -0.0716 -0.2769 22  TYR Z CD1   
167  C CD2   . TYR A 22  ? 1.0123 1.0676 1.1175 0.1413  -0.0625 -0.2689 22  TYR Z CD2   
168  C CE1   . TYR A 22  ? 0.9413 1.0639 1.1222 0.1499  -0.0582 -0.2648 22  TYR Z CE1   
169  C CE2   . TYR A 22  ? 0.9630 1.0559 1.0770 0.1302  -0.0476 -0.2575 22  TYR Z CE2   
170  C CZ    . TYR A 22  ? 0.9242 1.0509 1.0764 0.1343  -0.0464 -0.2559 22  TYR Z CZ    
171  O OH    . TYR A 22  ? 0.8586 1.0235 1.0225 0.1215  -0.0356 -0.2437 22  TYR Z OH    
172  N N     . LYS A 23  ? 1.1842 1.1543 1.3414 0.1940  -0.1180 -0.3437 23  LYS Z N     
173  C CA    . LYS A 23  ? 1.1965 1.1278 1.3636 0.2039  -0.1439 -0.3569 23  LYS Z CA    
174  C C     . LYS A 23  ? 1.1775 1.1171 1.3935 0.2183  -0.1505 -0.3663 23  LYS Z C     
175  O O     . LYS A 23  ? 1.1556 1.1358 1.4045 0.2277  -0.1343 -0.3791 23  LYS Z O     
176  C CB    . LYS A 23  ? 1.2523 1.1787 1.4131 0.2088  -0.1452 -0.3768 23  LYS Z CB    
177  C CG    . LYS A 23  ? 1.3105 1.1991 1.4885 0.2198  -0.1746 -0.3932 23  LYS Z CG    
178  C CD    . LYS A 23  ? 1.3218 1.2075 1.4951 0.2265  -0.1766 -0.4149 23  LYS Z CD    
179  C CE    . LYS A 23  ? 1.3652 1.2137 1.5613 0.2378  -0.2091 -0.4328 23  LYS Z CE    
180  N NZ    . LYS A 23  ? 1.4076 1.2067 1.5790 0.2256  -0.2404 -0.4145 23  LYS Z NZ    
181  N N     . GLY A 24  ? 1.1947 1.0970 1.4152 0.2187  -0.1744 -0.3587 24  GLY Z N     
182  C CA    . GLY A 24  ? 1.1729 1.0758 1.4390 0.2308  -0.1841 -0.3639 24  GLY Z CA    
183  C C     . GLY A 24  ? 1.1209 1.0438 1.3962 0.2281  -0.1756 -0.3451 24  GLY Z C     
184  O O     . GLY A 24  ? 1.1327 1.0648 1.4474 0.2377  -0.1798 -0.3458 24  GLY Z O     
185  N N     . GLN A 25  ? 1.1817 1.1110 1.4218 0.2152  -0.1651 -0.3277 25  GLN Z N     
186  C CA    . GLN A 25  ? 1.1510 1.0962 1.3965 0.2120  -0.1603 -0.3095 25  GLN Z CA    
187  C C     . GLN A 25  ? 1.1142 1.0224 1.3212 0.2013  -0.1734 -0.2921 25  GLN Z C     
188  O O     . GLN A 25  ? 1.1387 1.0141 1.3135 0.1945  -0.1840 -0.2923 25  GLN Z O     
189  C CB    . GLN A 25  ? 1.1147 1.1132 1.3622 0.2069  -0.1336 -0.3055 25  GLN Z CB    
190  C CG    . GLN A 25  ? 1.0994 1.1445 1.3894 0.2168  -0.1196 -0.3191 25  GLN Z CG    
191  C CD    . GLN A 25  ? 1.1059 1.2055 1.4009 0.2083  -0.0972 -0.3106 25  GLN Z CD    
192  O OE1   . GLN A 25  ? 1.1183 1.2542 1.4484 0.2120  -0.0935 -0.3050 25  GLN Z OE1   
193  N NE2   . GLN A 25  ? 1.0894 1.1951 1.3506 0.1953  -0.0838 -0.3077 25  GLN Z NE2   
194  N N     . VAL A 26  ? 1.0926 1.0076 1.3030 0.1998  -0.1737 -0.2768 26  VAL Z N     
195  C CA    . VAL A 26  ? 1.0797 0.9615 1.2559 0.1916  -0.1861 -0.2621 26  VAL Z CA    
196  C C     . VAL A 26  ? 1.0302 0.9349 1.1795 0.1819  -0.1692 -0.2509 26  VAL Z C     
197  O O     . VAL A 26  ? 0.9972 0.9416 1.1660 0.1824  -0.1548 -0.2472 26  VAL Z O     
198  C CB    . VAL A 26  ? 1.0922 0.9552 1.2883 0.1974  -0.2038 -0.2530 26  VAL Z CB    
199  C CG1   . VAL A 26  ? 1.1066 0.9310 1.2635 0.1891  -0.2183 -0.2410 26  VAL Z CG1   
200  C CG2   . VAL A 26  ? 1.0947 0.9388 1.3258 0.2070  -0.2198 -0.2632 26  VAL Z CG2   
201  N N     . VAL A 27  ? 1.0517 0.9327 1.1582 0.1721  -0.1723 -0.2447 27  VAL Z N     
202  C CA    . VAL A 27  ? 1.0210 0.9203 1.1016 0.1627  -0.1571 -0.2344 27  VAL Z CA    
203  C C     . VAL A 27  ? 1.0389 0.9099 1.0868 0.1579  -0.1686 -0.2233 27  VAL Z C     
204  O O     . VAL A 27  ? 1.0454 0.8813 1.0697 0.1545  -0.1839 -0.2229 27  VAL Z O     
205  C CB    . VAL A 27  ? 1.0182 0.9265 1.0754 0.1541  -0.1432 -0.2374 27  VAL Z CB    
206  C CG1   . VAL A 27  ? 1.0076 0.9263 1.0348 0.1430  -0.1310 -0.2247 27  VAL Z CG1   
207  C CG2   . VAL A 27  ? 1.0344 0.9782 1.1208 0.1575  -0.1276 -0.2482 27  VAL Z CG2   
208  N N     . ALA A 28  ? 1.0156 0.9035 1.0632 0.1572  -0.1624 -0.2146 28  ALA Z N     
209  C CA    . ALA A 28  ? 1.0217 0.8882 1.0376 0.1538  -0.1705 -0.2061 28  ALA Z CA    
210  C C     . ALA A 28  ? 1.0114 0.8885 0.9930 0.1431  -0.1556 -0.2009 28  ALA Z C     
211  O O     . ALA A 28  ? 0.9952 0.9033 0.9851 0.1387  -0.1378 -0.2004 28  ALA Z O     
212  C CB    . ALA A 28  ? 1.0128 0.8885 1.0478 0.1605  -0.1754 -0.2007 28  ALA Z CB    
213  N N     . VAL A 29  ? 1.0125 0.8650 0.9562 0.1379  -0.1633 -0.1960 29  VAL Z N     
214  C CA    . VAL A 29  ? 1.0137 0.8746 0.9236 0.1276  -0.1506 -0.1894 29  VAL Z CA    
215  C C     . VAL A 29  ? 1.0397 0.8993 0.9254 0.1267  -0.1503 -0.1834 29  VAL Z C     
216  O O     . VAL A 29  ? 1.0771 0.9113 0.9469 0.1291  -0.1658 -0.1832 29  VAL Z O     
217  C CB    . VAL A 29  ? 1.0391 0.8768 0.9207 0.1196  -0.1592 -0.1878 29  VAL Z CB    
218  C CG1   . VAL A 29  ? 1.0428 0.8893 0.8883 0.1086  -0.1478 -0.1774 29  VAL Z CG1   
219  C CG2   . VAL A 29  ? 1.0784 0.9182 0.9821 0.1213  -0.1590 -0.1959 29  VAL Z CG2   
220  N N     . ASP A 30  ? 1.0504 0.9372 0.9339 0.1229  -0.1330 -0.1791 30  ASP Z N     
221  C CA    . ASP A 30  ? 1.0573 0.9464 0.9159 0.1219  -0.1300 -0.1749 30  ASP Z CA    
222  C C     . ASP A 30  ? 1.1062 0.9830 0.9217 0.1121  -0.1295 -0.1682 30  ASP Z C     
223  O O     . ASP A 30  ? 1.1180 1.0114 0.9211 0.1036  -0.1149 -0.1612 30  ASP Z O     
224  C CB    . ASP A 30  ? 1.0326 0.9556 0.9083 0.1200  -0.1130 -0.1723 30  ASP Z CB    
225  C CG    . ASP A 30  ? 1.0785 1.0054 0.9407 0.1239  -0.1129 -0.1722 30  ASP Z CG    
226  O OD1   . ASP A 30  ? 1.1062 1.0123 0.9364 0.1256  -0.1214 -0.1729 30  ASP Z OD1   
227  O OD2   . ASP A 30  ? 1.0702 1.0219 0.9546 0.1245  -0.1051 -0.1718 30  ASP Z OD2   
228  N N     . THR A 31  ? 1.0896 0.9379 0.8831 0.1117  -0.1470 -0.1686 31  THR Z N     
229  C CA    . THR A 31  ? 1.1609 0.9967 0.9162 0.1003  -0.1523 -0.1606 31  THR Z CA    
230  C C     . THR A 31  ? 1.2222 1.0765 0.9464 0.0943  -0.1386 -0.1523 31  THR Z C     
231  O O     . THR A 31  ? 1.2450 1.0989 0.9404 0.0831  -0.1388 -0.1420 31  THR Z O     
232  C CB    . THR A 31  ? 1.1642 0.9669 0.9037 0.0990  -0.1763 -0.1619 31  THR Z CB    
233  O OG1   . THR A 31  ? 1.1584 0.9454 0.9323 0.1079  -0.1883 -0.1704 31  THR Z OG1   
234  C CG2   . THR A 31  ? 1.1787 0.9670 0.8927 0.0856  -0.1885 -0.1535 31  THR Z CG2   
235  N N     . TYR A 32  ? 1.2485 0.9717 1.0810 -0.0946 0.3595  -0.1216 32  TYR Z N     
236  C CA    . TYR A 32  ? 1.2709 0.9858 1.1120 -0.0980 0.3289  -0.0988 32  TYR Z CA    
237  C C     . TYR A 32  ? 1.3520 0.9743 1.1123 -0.0539 0.2683  -0.0708 32  TYR Z C     
238  O O     . TYR A 32  ? 1.3358 0.9749 1.1199 -0.0525 0.2095  -0.0501 32  TYR Z O     
239  C CB    . TYR A 32  ? 1.3343 1.0222 1.1638 -0.1177 0.4019  -0.1025 32  TYR Z CB    
240  C CG    . TYR A 32  ? 1.4265 1.1026 1.2621 -0.1206 0.3728  -0.0787 32  TYR Z CG    
241  C CD1   . TYR A 32  ? 1.3418 1.1171 1.2738 -0.1544 0.3475  -0.0770 32  TYR Z CD1   
242  C CD2   . TYR A 32  ? 1.5601 1.1263 1.3053 -0.0893 0.3696  -0.0576 32  TYR Z CD2   
243  C CE1   . TYR A 32  ? 1.3905 1.1563 1.3290 -0.1570 0.3204  -0.0551 32  TYR Z CE1   
244  C CE2   . TYR A 32  ? 1.6968 1.2527 1.4480 -0.0918 0.3423  -0.0354 32  TYR Z CE2   
245  C CZ    . TYR A 32  ? 1.6191 1.2753 1.4673 -0.1257 0.3179  -0.0343 32  TYR Z CZ    
246  O OH    . TYR A 32  ? 1.7098 1.3576 1.5655 -0.1284 0.2908  -0.0121 32  TYR Z OH    
247  N N     . CYS A 33  ? 1.3979 0.9218 1.0626 -0.0179 0.2832  -0.0697 33  CYS Z N     
248  C CA    . CYS A 33  ? 1.4969 0.9253 1.0779 0.0254  0.2300  -0.0436 33  CYS Z CA    
249  C C     . CYS A 33  ? 1.4566 0.9229 1.0642 0.0403  0.1417  -0.0331 33  CYS Z C     
250  O O     . CYS A 33  ? 1.4950 0.9379 1.0887 0.0573  0.0784  -0.0081 33  CYS Z O     
251  C CB    . CYS A 33  ? 1.6103 0.9277 1.0842 0.0595  0.2690  -0.0469 33  CYS Z CB    
252  S SG    . CYS A 33  ? 1.6441 0.9762 1.1095 0.0708  0.2791  -0.0706 33  CYS Z SG    
253  N N     . TRP A 34  ? 1.3925 0.9186 1.0396 0.0333  0.1379  -0.0523 34  TRP Z N     
254  C CA    . TRP A 34  ? 1.3852 0.9599 1.0681 0.0431  0.0578  -0.0456 34  TRP Z CA    
255  C C     . TRP A 34  ? 1.3038 0.9741 1.0821 0.0136  0.0133  -0.0368 34  TRP Z C     
256  O O     . TRP A 34  ? 1.3161 0.9931 1.1021 0.0286  -0.0636 -0.0170 34  TRP Z O     
257  C CB    . TRP A 34  ? 1.3348 0.9605 1.0467 0.0372  0.0716  -0.0705 34  TRP Z CB    
258  C CG    . TRP A 34  ? 1.3848 0.9197 1.0038 0.0698  0.1036  -0.0780 34  TRP Z CG    
259  C CD1   . TRP A 34  ? 1.5103 0.9247 1.0236 0.1059  0.1115  -0.0636 34  TRP Z CD1   
260  C CD2   . TRP A 34  ? 1.3722 0.9299 0.9958 0.0693  0.1323  -0.1018 34  TRP Z CD2   
261  N NE1   . TRP A 34  ? 1.5718 0.9326 1.0235 0.1281  0.1432  -0.0770 34  TRP Z NE1   
262  C CE2   . TRP A 34  ? 1.4793 0.9258 0.9966 0.1064  0.1565  -0.1004 34  TRP Z CE2   
263  C CE3   . TRP A 34  ? 1.2844 0.9454 0.9914 0.0412  0.1397  -0.1239 34  TRP Z CE3   
264  C CZ2   . TRP A 34  ? 1.5028 0.9393 0.9955 0.1162  0.1878  -0.1203 34  TRP Z CZ2   
265  C CZ3   . TRP A 34  ? 1.3164 0.9669 0.9988 0.0509  0.1708  -0.1434 34  TRP Z CZ3   
266  C CH2   . TRP A 34  ? 1.4061 0.9454 0.9824 0.0881  0.1945  -0.1415 34  TRP Z CH2   
267  N N     . LEU A 35  ? 1.3342 1.0783 1.1849 -0.0284 0.0623  -0.0514 35  LEU Z N     
268  C CA    . LEU A 35  ? 1.2486 1.0872 1.1934 -0.0600 0.0286  -0.0450 35  LEU Z CA    
269  C C     . LEU A 35  ? 1.3235 1.1134 1.2394 -0.0464 -0.0108 -0.0155 35  LEU Z C     
270  O O     . LEU A 35  ? 1.2795 1.1171 1.2423 -0.0492 -0.0783 0.0002  35  LEU Z O     
271  C CB    . LEU A 35  ? 1.1498 1.0633 1.1663 -0.1061 0.0979  -0.0665 35  LEU Z CB    
272  C CG    . LEU A 35  ? 1.0414 1.0701 1.1510 -0.1371 0.1008  -0.0899 35  LEU Z CG    
273  C CD1   . LEU A 35  ? 0.9676 1.0490 1.1280 -0.1781 0.1814  -0.1127 35  LEU Z CD1   
274  C CD2   . LEU A 35  ? 0.9616 1.0769 1.1515 -0.1498 0.0248  -0.0782 35  LEU Z CD2   
275  N N     . HIS A 36  ? 1.3773 1.0723 1.2158 -0.0315 0.0319  -0.0078 36  HIS Z N     
276  C CA    . HIS A 36  ? 1.4772 1.1181 1.2818 -0.0184 0.0029  0.0198  36  HIS Z CA    
277  C C     . HIS A 36  ? 1.5711 1.1497 1.3167 0.0242  -0.0755 0.0438  36  HIS Z C     
278  O O     . HIS A 36  ? 1.5652 1.1652 1.3375 0.0266  -0.1398 0.0651  36  HIS Z O     
279  C CB    . HIS A 36  ? 1.5961 1.1502 1.3313 -0.0135 0.0736  0.0200  36  HIS Z CB    
280  C CG    . HIS A 36  ? 1.7457 1.2617 1.4636 -0.0104 0.0570  0.0450  36  HIS Z CG    
281  N ND1   . HIS A 36  ? 1.8688 1.2936 1.5090 0.0283  0.0099  0.0716  36  HIS Z ND1   
282  C CD2   . HIS A 36  ? 1.7471 1.3032 1.5148 -0.0411 0.0816  0.0474  36  HIS Z CD2   
283  C CE1   . HIS A 36  ? 1.9674 1.3785 1.6110 0.0212  0.0061  0.0896  36  HIS Z CE1   
284  N NE2   . HIS A 36  ? 1.8625 1.3521 1.5825 -0.0205 0.0491  0.0754  36  HIS Z NE2   
285  N N     . LYS A 37  ? 1.0974 1.3066 1.4150 0.1895  -0.0338 0.0549  37  LYS Z N     
286  C CA    . LYS A 37  ? 1.2320 1.3916 1.4942 0.1383  -0.0108 0.0333  37  LYS Z CA    
287  C C     . LYS A 37  ? 1.3621 1.4218 1.5364 0.1022  0.0250  0.0363  37  LYS Z C     
288  O O     . LYS A 37  ? 1.4867 1.5319 1.6243 0.0459  0.0439  0.0126  37  LYS Z O     
289  C CB    . LYS A 37  ? 1.2311 1.3376 1.4745 0.1624  -0.0117 0.0412  37  LYS Z CB    
290  C CG    . LYS A 37  ? 1.1526 1.3581 1.4776 0.1847  -0.0440 0.0310  37  LYS Z CG    
291  C CD    . LYS A 37  ? 1.2114 1.3612 1.5113 0.2001  -0.0417 0.0352  37  LYS Z CD    
292  C CE    . LYS A 37  ? 1.0941 1.1532 1.3591 0.2549  -0.0377 0.0719  37  LYS Z CE    
293  N NZ    . LYS A 37  ? 1.0461 1.0533 1.2887 0.2718  -0.0363 0.0765  37  LYS Z NZ    
294  N N     . GLY A 38  ? 1.2658 1.2577 1.4070 0.1347  0.0338  0.0658  38  GLY Z N     
295  C CA    . GLY A 38  ? 1.3487 1.2465 1.4092 0.1052  0.0667  0.0716  38  GLY Z CA    
296  C C     . GLY A 38  ? 1.3596 1.3147 1.4377 0.0727  0.0687  0.0587  38  GLY Z C     
297  O O     . GLY A 38  ? 1.4417 1.3439 1.4607 0.0289  0.0956  0.0510  38  GLY Z O     
298  N N     . ALA A 39  ? 1.2728 1.3373 1.4329 0.0942  0.0400  0.0564  39  ALA Z N     
299  C CA    . ALA A 39  ? 1.2963 1.4260 1.4821 0.0678  0.0386  0.0445  39  ALA Z CA    
300  C C     . ALA A 39  ? 1.3461 1.5463 1.5518 0.0095  0.0391  0.0073  39  ALA Z C     
301  O O     . ALA A 39  ? 1.3736 1.6057 1.5780 -0.0282 0.0472  -0.0066 39  ALA Z O     
302  C CB    . ALA A 39  ? 1.1601 1.3772 1.4248 0.1149  0.0078  0.0574  39  ALA Z CB    
303  N N     . ILE A 40  ? 1.2997 1.5256 1.5248 0.0026  0.0301  -0.0083 40  ILE Z N     
304  C CA    . ILE A 40  ? 1.3696 1.6560 1.6092 -0.0537 0.0317  -0.0434 40  ILE Z CA    
305  C C     . ILE A 40  ? 1.4902 1.6939 1.6455 -0.1104 0.0671  -0.0545 40  ILE Z C     
306  O O     . ILE A 40  ? 1.5003 1.7493 1.6592 -0.1606 0.0738  -0.0784 40  ILE Z O     
307  C CB    . ILE A 40  ? 1.4487 1.7664 1.7181 -0.0489 0.0172  -0.0561 40  ILE Z CB    
308  C CG1   . ILE A 40  ? 1.2879 1.6971 1.6462 0.0045  -0.0193 -0.0474 40  ILE Z CG1   
309  C CG2   . ILE A 40  ? 1.6922 2.0647 1.9700 -0.1100 0.0213  -0.0921 40  ILE Z CG2   
310  C CD1   . ILE A 40  ? 1.3943 1.8445 1.7891 0.0102  -0.0359 -0.0604 40  ILE Z CD1   
311  N N     . ALA A 41  ? 1.5321 1.6139 1.6114 -0.1014 0.0898  -0.0362 41  ALA Z N     
312  C CA    . ALA A 41  ? 1.6556 1.6463 1.6488 -0.1516 0.1245  -0.0441 41  ALA Z CA    
313  C C     . ALA A 41  ? 1.6130 1.6008 1.5856 -0.1773 0.1389  -0.0437 41  ALA Z C     
314  O O     . ALA A 41  ? 1.6882 1.6330 1.6054 -0.2296 0.1640  -0.0579 41  ALA Z O     
315  C CB    . ALA A 41  ? 1.7419 1.6032 1.6618 -0.1289 0.1440  -0.0210 41  ALA Z CB    
316  N N     . CYS A 42  ? 1.5951 1.6284 1.6118 -0.1407 0.1229  -0.0274 42  CYS Z N     
317  C CA    . CYS A 42  ? 1.5931 1.6263 1.5938 -0.1603 0.1350  -0.0252 42  CYS Z CA    
318  C C     . CYS A 42  ? 1.4850 1.6346 1.5697 -0.1394 0.1074  -0.0264 42  CYS Z C     
319  O O     . CYS A 42  ? 1.4381 1.5795 1.5272 -0.1099 0.1051  -0.0054 42  CYS Z O     
320  C CB    . CYS A 42  ? 1.5862 1.5038 1.5195 -0.1357 0.1558  0.0057  42  CYS Z CB    
321  S SG    . CYS A 42  ? 1.4334 1.3281 1.3930 -0.0529 0.1359  0.0423  42  CYS Z SG    
322  N N     . ALA A 43  ? 1.4805 1.7382 1.6315 -0.1552 0.0867  -0.0511 43  ALA Z N     
323  C CA    . ALA A 43  ? 1.3716 1.7467 1.6058 -0.1381 0.0596  -0.0552 43  ALA Z CA    
324  C C     . ALA A 43  ? 1.3886 1.7910 1.6148 -0.1781 0.0713  -0.0665 43  ALA Z C     
325  O O     . ALA A 43  ? 1.3331 1.7987 1.6064 -0.1581 0.0563  -0.0603 43  ALA Z O     
326  C CB    . ALA A 43  ? 1.3488 1.8290 1.6550 -0.1428 0.0344  -0.0782 43  ALA Z CB    
327  N N     . GLU A 44  ? 1.3957 1.7497 1.5617 -0.2345 0.0983  -0.0828 44  GLU Z N     
328  C CA    . GLU A 44  ? 1.4255 1.8019 1.5788 -0.2787 0.1117  -0.0956 44  GLU Z CA    
329  C C     . GLU A 44  ? 1.4224 1.7460 1.5459 -0.2557 0.1221  -0.0700 44  GLU Z C     
330  O O     . GLU A 44  ? 1.3788 1.7680 1.5420 -0.2520 0.1120  -0.0701 44  GLU Z O     
331  C CB    . GLU A 44  ? 1.5181 1.8388 1.6047 -0.3420 0.1403  -0.1158 44  GLU Z CB    
332  C CG    . GLU A 44  ? 1.5023 1.8411 1.5976 -0.3624 0.1356  -0.1365 44  GLU Z CG    
333  C CD    . GLU A 44  ? 1.5638 1.8021 1.6101 -0.3373 0.1448  -0.1204 44  GLU Z CD    
334  O OE1   . GLU A 44  ? 1.5773 1.8321 1.6382 -0.3412 0.1367  -0.1330 44  GLU Z OE1   
335  O OE2   . GLU A 44  ? 1.6121 1.7552 1.6051 -0.3137 0.1602  -0.0951 44  GLU Z OE2   
336  N N     . LYS A 45  ? 1.5135 1.7182 1.5667 -0.2404 0.1424  -0.0480 45  LYS Z N     
337  C CA    . LYS A 45  ? 1.5392 1.6820 1.5569 -0.2181 0.1545  -0.0219 45  LYS Z CA    
338  C C     . LYS A 45  ? 1.4426 1.6414 1.5246 -0.1579 0.1270  -0.0013 45  LYS Z C     
339  O O     . LYS A 45  ? 1.4316 1.6418 1.5199 -0.1479 0.1271  0.0100  45  LYS Z O     
340  C CB    . LYS A 45  ? 1.6122 1.6166 1.5446 -0.2097 0.1802  -0.0016 45  LYS Z CB    
341  C CG    . LYS A 45  ? 1.7244 1.6498 1.5754 -0.2663 0.2151  -0.0116 45  LYS Z CG    
342  C CD    . LYS A 45  ? 1.7941 1.7469 1.6406 -0.3206 0.2205  -0.0442 45  LYS Z CD    
343  C CE    . LYS A 45  ? 1.9094 1.7794 1.6728 -0.3759 0.2553  -0.0529 45  LYS Z CE    
344  N NZ    . LYS A 45  ? 1.9110 1.7954 1.6667 -0.3967 0.2650  -0.0522 45  LYS Z NZ    
345  N N     . LEU A 46  ? 1.4913 1.7253 1.6210 -0.1180 0.1031  0.0034  46  LEU Z N     
346  C CA    . LEU A 46  ? 1.4034 1.6910 1.5960 -0.0590 0.0753  0.0230  46  LEU Z CA    
347  C C     . LEU A 46  ? 1.3180 1.7318 1.5868 -0.0663 0.0536  0.0070  46  LEU Z C     
348  O O     . LEU A 46  ? 1.2579 1.7031 1.5588 -0.0336 0.0409  0.0228  46  LEU Z O     
349  C CB    . LEU A 46  ? 1.3297 1.6257 1.5549 -0.0172 0.0552  0.0304  46  LEU Z CB    
350  C CG    . LEU A 46  ? 1.3643 1.5406 1.5273 0.0121  0.0700  0.0560  46  LEU Z CG    
351  C CD1   . LEU A 46  ? 1.3043 1.5011 1.5051 0.0486  0.0487  0.0593  46  LEU Z CD1   
352  C CD2   . LEU A 46  ? 1.3086 1.4309 1.4507 0.0526  0.0740  0.0887  46  LEU Z CD2   
353  N N     . ALA A 47  ? 1.3096 1.7951 1.6065 -0.1095 0.0495  -0.0243 47  ALA Z N     
354  C CA    . ALA A 47  ? 1.2524 1.8601 1.6212 -0.1206 0.0297  -0.0420 47  ALA Z CA    
355  C C     . ALA A 47  ? 1.2768 1.8805 1.6225 -0.1459 0.0449  -0.0417 47  ALA Z C     
356  O O     . ALA A 47  ? 1.2306 1.9018 1.6260 -0.1254 0.0284  -0.0369 47  ALA Z O     
357  C CB    . ALA A 47  ? 1.2629 1.9404 1.6606 -0.1639 0.0244  -0.0752 47  ALA Z CB    
358  N N     . LYS A 48  ? 1.2826 1.8066 1.5524 -0.1903 0.0763  -0.0468 48  LYS Z N     
359  C CA    . LYS A 48  ? 1.3262 1.8386 1.5668 -0.2185 0.0936  -0.0472 48  LYS Z CA    
360  C C     . LYS A 48  ? 1.3369 1.7818 1.5487 -0.1775 0.0997  -0.0144 48  LYS Z C     
361  O O     . LYS A 48  ? 1.3225 1.7629 1.5181 -0.1906 0.1103  -0.0104 48  LYS Z O     
362  C CB    . LYS A 48  ? 1.4295 1.8768 1.5972 -0.2801 0.1255  -0.0633 48  LYS Z CB    
363  C CG    . LYS A 48  ? 1.4332 1.9557 1.6280 -0.3305 0.1221  -0.0979 48  LYS Z CG    
364  C CD    . LYS A 48  ? 1.4544 2.0868 1.7071 -0.3479 0.1090  -0.1134 48  LYS Z CD    
365  C CE    . LYS A 48  ? 1.5453 2.2478 1.8197 -0.4014 0.1081  -0.1475 48  LYS Z CE    
366  N NZ    . LYS A 48  ? 1.5428 2.3485 1.8686 -0.4222 0.0979  -0.1632 48  LYS Z NZ    
367  N N     . GLY A 49  ? 1.3469 1.7397 1.5524 -0.1280 0.0929  0.0094  49  GLY Z N     
368  C CA    . GLY A 49  ? 1.3388 1.6633 1.5160 -0.0863 0.0983  0.0422  49  GLY Z CA    
369  C C     . GLY A 49  ? 1.4426 1.6358 1.5235 -0.1058 0.1330  0.0539  49  GLY Z C     
370  O O     . GLY A 49  ? 1.4847 1.6073 1.5301 -0.0769 0.1425  0.0813  49  GLY Z O     
371  N N     . GLU A 50  ? 1.4439 1.6049 1.4827 -0.1553 0.1520  0.0331  50  GLU Z N     
372  C CA    . GLU A 50  ? 1.5664 1.6038 1.5121 -0.1797 0.1859  0.0408  50  GLU Z CA    
373  C C     . GLU A 50  ? 1.5836 1.5301 1.4952 -0.1356 0.1891  0.0669  50  GLU Z C     
374  O O     . GLU A 50  ? 1.5385 1.5147 1.4897 -0.1049 0.1689  0.0681  50  GLU Z O     
375  C CB    . GLU A 50  ? 1.6216 1.6539 1.5365 -0.2422 0.2024  0.0109  50  GLU Z CB    
376  C CG    . GLU A 50  ? 1.5959 1.7181 1.5432 -0.2884 0.2000  -0.0158 50  GLU Z CG    
377  C CD    . GLU A 50  ? 1.6790 1.7988 1.5981 -0.3495 0.2150  -0.0451 50  GLU Z CD    
378  O OE1   . GLU A 50  ? 1.7511 1.7831 1.6116 -0.3605 0.2328  -0.0434 50  GLU Z OE1   
379  O OE2   . GLU A 50  ? 1.6085 1.8143 1.5638 -0.3865 0.2090  -0.0697 50  GLU Z OE2   
380  N N     . PRO A 51  ? 1.6090 1.4444 1.4470 -0.1319 0.2147  0.0884  51  PRO Z N     
381  C CA    . PRO A 51  ? 1.6346 1.3768 1.4352 -0.0889 0.2199  0.1159  51  PRO Z CA    
382  C C     . PRO A 51  ? 1.6758 1.3742 1.4480 -0.1024 0.2268  0.1052  51  PRO Z C     
383  O O     . PRO A 51  ? 1.7398 1.4103 1.4694 -0.1552 0.2469  0.0843  51  PRO Z O     
384  C CB    . PRO A 51  ? 1.7485 1.3865 1.4721 -0.0970 0.2498  0.1352  51  PRO Z CB    
385  C CG    . PRO A 51  ? 1.7913 1.4479 1.4937 -0.1592 0.2668  0.1109  51  PRO Z CG    
386  C CD    . PRO A 51  ? 1.6806 1.4727 1.4667 -0.1681 0.2403  0.0883  51  PRO Z CD    
387  N N     . THR A 52  ? 1.6592 1.3519 1.4549 -0.0547 0.2101  0.1197  52  THR Z N     
388  C CA    . THR A 52  ? 1.6360 1.2850 1.4068 -0.0598 0.2150  0.1128  52  THR Z CA    
389  C C     . THR A 52  ? 1.5688 1.1869 1.3528 0.0034  0.2005  0.1398  52  THR Z C     
390  O O     . THR A 52  ? 1.4746 1.1441 1.3133 0.0498  0.1773  0.1561  52  THR Z O     
391  C CB    . THR A 52  ? 1.6134 1.3583 1.4360 -0.0914 0.1991  0.0791  52  THR Z CB    
392  O OG1   . THR A 52  ? 1.6043 1.3043 1.4025 -0.0933 0.2033  0.0740  52  THR Z OG1   
393  C CG2   . THR A 52  ? 1.5142 1.3801 1.4336 -0.0564 0.1625  0.0775  52  THR Z CG2   
394  N N     . ASP A 53  ? 1.5989 1.1329 1.3324 0.0051  0.2144  0.1446  53  ASP Z N     
395  C CA    . ASP A 53  ? 1.5575 1.0534 1.2967 0.0633  0.2031  0.1705  53  ASP Z CA    
396  C C     . ASP A 53  ? 1.5900 1.0462 1.3052 0.0556  0.2078  0.1610  53  ASP Z C     
397  O O     . ASP A 53  ? 1.6089 0.9828 1.2871 0.0882  0.2148  0.1828  53  ASP Z O     
398  C CB    . ASP A 53  ? 1.6115 1.0029 1.2921 0.0923  0.2217  0.2045  53  ASP Z CB    
399  C CG    . ASP A 53  ? 1.7668 1.0419 1.3519 0.0537  0.2591  0.2035  53  ASP Z CG    
400  O OD1   . ASP A 53  ? 1.8269 1.1123 1.3910 -0.0038 0.2735  0.1770  53  ASP Z OD1   
401  O OD2   . ASP A 53  ? 1.8368 1.0103 1.3680 0.0808  0.2741  0.2294  53  ASP Z OD2   
402  N N     . ARG A 54  ? 1.4463 0.9779 1.4383 -0.1318 0.0477  0.0080  54  ARG Z N     
403  C CA    . ARG A 54  ? 1.4930 0.9844 1.4730 -0.1425 0.0353  -0.0262 54  ARG Z CA    
404  C C     . ARG A 54  ? 1.4503 0.9876 1.4045 -0.1275 0.0142  -0.0417 54  ARG Z C     
405  O O     . ARG A 54  ? 1.4598 0.9645 1.3870 -0.1152 0.0116  -0.0596 54  ARG Z O     
406  C CB    . ARG A 54  ? 1.5143 0.9910 1.5290 -0.1869 0.0213  -0.0496 54  ARG Z CB    
407  C CG    . ARG A 54  ? 1.6280 1.0300 1.6366 -0.2001 0.0206  -0.0764 54  ARG Z CG    
408  C CD    . ARG A 54  ? 1.6907 1.0792 1.7368 -0.2450 0.0079  -0.0950 54  ARG Z CD    
409  N NE    . ARG A 54  ? 1.8370 1.1451 1.8800 -0.2581 0.0104  -0.1155 54  ARG Z NE    
410  C CZ    . ARG A 54  ? 1.8493 1.0957 1.9039 -0.2629 0.0299  -0.1025 54  ARG Z CZ    
411  N NH1   . ARG A 54  ? 1.7726 1.0304 1.8437 -0.2555 0.0495  -0.0688 54  ARG Z NH1   
412  N NH2   . ARG A 54  ? 1.9208 1.0941 1.9710 -0.2750 0.0291  -0.1229 54  ARG Z NH2   
413  N N     . TYR A 55  ? 1.4772 1.0906 1.4401 -0.1279 -0.0011 -0.0341 55  TYR Z N     
414  C CA    . TYR A 55  ? 1.4137 1.0796 1.3571 -0.1152 -0.0233 -0.0461 55  TYR Z CA    
415  C C     . TYR A 55  ? 1.4002 1.0592 1.3033 -0.0722 -0.0113 -0.0305 55  TYR Z C     
416  O O     . TYR A 55  ? 1.3881 1.0604 1.2683 -0.0593 -0.0251 -0.0459 55  TYR Z O     
417  C CB    . TYR A 55  ? 1.3237 1.0714 1.2857 -0.1231 -0.0409 -0.0367 55  TYR Z CB    
418  C CG    . TYR A 55  ? 1.2980 1.0696 1.2622 -0.1045 -0.0240 0.0010  55  TYR Z CG    
419  C CD1   . TYR A 55  ? 1.3232 1.0863 1.3170 -0.1232 -0.0124 0.0145  55  TYR Z CD1   
420  C CD2   . TYR A 55  ? 1.2621 1.0656 1.1990 -0.0680 -0.0201 0.0240  55  TYR Z CD2   
421  C CE1   . TYR A 55  ? 1.2779 1.0633 1.2731 -0.1054 0.0029  0.0487  55  TYR Z CE1   
422  C CE2   . TYR A 55  ? 1.2076 1.0323 1.1458 -0.0509 -0.0052 0.0582  55  TYR Z CE2   
423  C CZ    . TYR A 55  ? 1.2242 1.0397 1.1912 -0.0694 0.0064  0.0699  55  TYR Z CZ    
424  O OH    . TYR A 55  ? 1.2389 1.0757 1.2065 -0.0514 0.0213  0.1039  55  TYR Z OH    
425  N N     . VAL A 56  ? 1.3495 0.9890 1.2446 -0.0497 0.0147  0.0008  56  VAL Z N     
426  C CA    . VAL A 56  ? 1.3607 0.9892 1.2182 -0.0086 0.0294  0.0188  56  VAL Z CA    
427  C C     . VAL A 56  ? 1.4410 1.0054 1.2738 -0.0010 0.0342  -0.0028 56  VAL Z C     
428  O O     . VAL A 56  ? 1.4548 1.0308 1.2577 0.0218  0.0265  -0.0090 56  VAL Z O     
429  C CB    . VAL A 56  ? 1.3714 0.9814 1.2279 0.0107  0.0589  0.0552  56  VAL Z CB    
430  C CG1   . VAL A 56  ? 1.3788 0.9644 1.1961 0.0512  0.0765  0.0714  56  VAL Z CG1   
431  C CG2   . VAL A 56  ? 1.3210 0.9982 1.1942 0.0110  0.0539  0.0791  56  VAL Z CG2   
432  N N     . GLY A 57  ? 1.4368 0.9335 1.2819 -0.0198 0.0461  -0.0137 57  GLY Z N     
433  C CA    . GLY A 57  ? 1.5005 0.9301 1.3235 -0.0155 0.0497  -0.0361 57  GLY Z CA    
434  C C     . GLY A 57  ? 1.4799 0.9267 1.2988 -0.0302 0.0215  -0.0718 57  GLY Z C     
435  O O     . GLY A 57  ? 1.5141 0.9369 1.3016 -0.0116 0.0188  -0.0863 57  GLY Z O     
436  N N     . PHE A 58  ? 1.4817 0.9715 1.3325 -0.0630 0.0004  -0.0854 58  PHE Z N     
437  C CA    . PHE A 58  ? 1.4635 0.9763 1.3155 -0.0804 -0.0277 -0.1191 58  PHE Z CA    
438  C C     . PHE A 58  ? 1.4213 0.9853 1.2442 -0.0503 -0.0399 -0.1173 58  PHE Z C     
439  O O     . PHE A 58  ? 1.4494 1.0024 1.2527 -0.0454 -0.0522 -0.1416 58  PHE Z O     
440  C CB    . PHE A 58  ? 1.4535 1.0128 1.3461 -0.1188 -0.0470 -0.1288 58  PHE Z CB    
441  C CG    . PHE A 58  ? 1.4993 1.0780 1.3976 -0.1411 -0.0752 -0.1648 58  PHE Z CG    
442  C CD1   . PHE A 58  ? 1.6493 1.1742 1.5592 -0.1703 -0.0804 -0.1935 58  PHE Z CD1   
443  C CD2   . PHE A 58  ? 1.4136 1.0646 1.3062 -0.1331 -0.0971 -0.1694 58  PHE Z CD2   
444  C CE1   . PHE A 58  ? 1.6753 1.2180 1.5904 -0.1908 -0.1060 -0.2265 58  PHE Z CE1   
445  C CE2   . PHE A 58  ? 1.4001 1.0705 1.2991 -0.1534 -0.1228 -0.2021 58  PHE Z CE2   
446  C CZ    . PHE A 58  ? 1.5448 1.1612 1.4548 -0.1823 -0.1269 -0.2310 58  PHE Z CZ    
447  N N     . CYS A 59  ? 1.4146 1.0349 1.2347 -0.0300 -0.0372 -0.0880 59  CYS Z N     
448  C CA    . CYS A 59  ? 1.3693 1.0394 1.1624 0.0006  -0.0478 -0.0809 59  CYS Z CA    
449  C C     . CYS A 59  ? 1.4326 1.0535 1.1851 0.0373  -0.0285 -0.0729 59  CYS Z C     
450  O O     . CYS A 59  ? 1.4362 1.0699 1.1623 0.0576  -0.0387 -0.0822 59  CYS Z O     
451  C CB    . CYS A 59  ? 1.2823 1.0215 1.0831 0.0128  -0.0497 -0.0495 59  CYS Z CB    
452  S SG    . CYS A 59  ? 1.2424 1.0467 1.0876 -0.0262 -0.0735 -0.0566 59  CYS Z SG    
453  N N     . MET A 60  ? 1.3841 0.9488 1.1323 0.0461  -0.0004 -0.0552 60  MET Z N     
454  C CA    . MET A 60  ? 1.4663 0.9845 1.1764 0.0826  0.0208  -0.0431 60  MET Z CA    
455  C C     . MET A 60  ? 1.5488 1.0058 1.2376 0.0827  0.0185  -0.0740 60  MET Z C     
456  O O     . MET A 60  ? 1.5842 1.0177 1.2361 0.1157  0.0283  -0.0693 60  MET Z O     
457  C CB    . MET A 60  ? 1.5278 1.0026 1.2416 0.0905  0.0516  -0.0156 60  MET Z CB    
458  C CG    . MET A 60  ? 1.4908 1.0186 1.2056 0.1107  0.0606  0.0227  60  MET Z CG    
459  S SD    . MET A 60  ? 1.4483 1.0302 1.1253 0.1526  0.0525  0.0380  60  MET Z SD    
460  C CE    . MET A 60  ? 1.5876 1.0902 1.2224 0.1832  0.0747  0.0345  60  MET Z CE    
461  N N     . LYS A 61  ? 1.4971 0.9271 1.2075 0.0471  0.0058  -0.1050 61  LYS Z N     
462  C CA    . LYS A 61  ? 1.5621 0.9352 1.2510 0.0470  0.0010  -0.1361 61  LYS Z CA    
463  C C     . LYS A 61  ? 1.5188 0.9414 1.1907 0.0573  -0.0233 -0.1537 61  LYS Z C     
464  O O     . LYS A 61  ? 1.5469 0.9378 1.1853 0.0787  -0.0230 -0.1670 61  LYS Z O     
465  C CB    . LYS A 61  ? 1.6129 0.9375 1.3297 0.0054  -0.0051 -0.1631 61  LYS Z CB    
466  C CG    . LYS A 61  ? 1.5657 0.9435 1.3193 -0.0326 -0.0309 -0.1805 61  LYS Z CG    
467  C CD    . LYS A 61  ? 1.6366 0.9595 1.4164 -0.0722 -0.0343 -0.2041 61  LYS Z CD    
468  C CE    . LYS A 61  ? 1.6580 1.0331 1.4752 -0.1110 -0.0592 -0.2211 61  LYS Z CE    
469  N NZ    . LYS A 61  ? 1.7910 1.1122 1.6340 -0.1501 -0.0626 -0.2426 61  LYS Z NZ    
470  N N     . PHE A 62  ? 1.5135 1.0147 1.2085 0.0433  -0.0444 -0.1527 62  PHE Z N     
471  C CA    . PHE A 62  ? 1.4542 1.0142 1.1364 0.0551  -0.0677 -0.1634 62  PHE Z CA    
472  C C     . PHE A 62  ? 1.4538 1.0326 1.0997 0.1020  -0.0567 -0.1362 62  PHE Z C     
473  O O     . PHE A 62  ? 1.4812 1.0589 1.0973 0.1248  -0.0631 -0.1464 62  PHE Z O     
474  C CB    . PHE A 62  ? 1.3693 1.0110 1.0859 0.0306  -0.0916 -0.1639 62  PHE Z CB    
475  C CG    . PHE A 62  ? 1.3610 0.9996 1.1074 -0.0125 -0.1114 -0.1983 62  PHE Z CG    
476  C CD1   . PHE A 62  ? 1.3730 0.9759 1.1492 -0.0454 -0.1041 -0.2026 62  PHE Z CD1   
477  C CD2   . PHE A 62  ? 1.3073 0.9806 1.0531 -0.0200 -0.1376 -0.2252 62  PHE Z CD2   
478  C CE1   . PHE A 62  ? 1.3976 0.9982 1.2016 -0.0855 -0.1224 -0.2330 62  PHE Z CE1   
479  C CE2   . PHE A 62  ? 1.2994 0.9706 1.0729 -0.0601 -0.1557 -0.2565 62  PHE Z CE2   
480  C CZ    . PHE A 62  ? 1.3496 0.9839 1.1519 -0.0931 -0.1481 -0.2603 62  PHE Z CZ    
481  N N     . VAL A 63  ? 1.4204 1.0174 1.0690 0.1165  -0.0402 -0.1006 63  VAL Z N     
482  C CA    . VAL A 63  ? 1.4248 1.0383 1.0408 0.1604  -0.0274 -0.0703 63  VAL Z CA    
483  C C     . VAL A 63  ? 1.5049 1.0454 1.0823 0.1874  -0.0077 -0.0743 63  VAL Z C     
484  O O     . VAL A 63  ? 1.4838 1.0361 1.0290 0.2186  -0.0103 -0.0713 63  VAL Z O     
485  C CB    . VAL A 63  ? 1.3978 1.0291 1.0237 0.1690  -0.0093 -0.0320 63  VAL Z CB    
486  C CG1   . VAL A 63  ? 1.4158 1.0510 1.0058 0.2146  0.0076  -0.0004 63  VAL Z CG1   
487  C CG2   . VAL A 63  ? 1.2949 1.0048 0.9529 0.1491  -0.0301 -0.0251 63  VAL Z CG2   
488  N N     . ASN A 64  ? 1.4915 0.9566 1.0725 0.1753  0.0113  -0.0806 64  ASN Z N     
489  C CA    . ASN A 64  ? 1.5720 0.9603 1.1179 0.1985  0.0306  -0.0854 64  ASN Z CA    
490  C C     . ASN A 64  ? 1.6103 0.9778 1.1362 0.1986  0.0136  -0.1210 64  ASN Z C     
491  O O     . ASN A 64  ? 1.6470 0.9743 1.1343 0.2290  0.0240  -0.1226 64  ASN Z O     
492  C CB    . ASN A 64  ? 1.6203 0.9340 1.1801 0.1806  0.0515  -0.0859 64  ASN Z CB    
493  C CG    . ASN A 64  ? 1.6440 0.9659 1.2139 0.1905  0.0747  -0.0474 64  ASN Z CG    
494  O OD1   . ASN A 64  ? 1.6334 0.9910 1.1846 0.2224  0.0834  -0.0184 64  ASN Z OD1   
495  N ND2   . ASN A 64  ? 1.6357 0.9249 1.2357 0.1635  0.0846  -0.0459 64  ASN Z ND2   
496  N N     . MET A 65  ? 1.5893 0.9839 1.1409 0.1653  -0.0123 -0.1495 65  MET Z N     
497  C CA    . MET A 65  ? 1.5796 0.9635 1.1146 0.1643  -0.0310 -0.1837 65  MET Z CA    
498  C C     . MET A 65  ? 1.5526 0.9963 1.0615 0.1986  -0.0414 -0.1736 65  MET Z C     
499  O O     . MET A 65  ? 1.6289 1.0438 1.1002 0.2269  -0.0383 -0.1815 65  MET Z O     
500  C CB    . MET A 65  ? 1.5411 0.9458 1.1131 0.1189  -0.0564 -0.2145 65  MET Z CB    
501  C CG    . MET A 65  ? 1.5602 0.9525 1.1181 0.1142  -0.0766 -0.2520 65  MET Z CG    
502  S SD    . MET A 65  ? 1.4732 0.9653 1.0287 0.1268  -0.1052 -0.2548 65  MET Z SD    
503  C CE    . MET A 65  ? 1.3813 0.9463 0.9918 0.0847  -0.1236 -0.2518 65  MET Z CE    
504  N N     . LEU A 66  ? 1.5796 1.1067 1.1086 0.1966  -0.0543 -0.1550 66  LEU Z N     
505  C CA    . LEU A 66  ? 1.5307 1.1228 1.0400 0.2276  -0.0659 -0.1409 66  LEU Z CA    
506  C C     . LEU A 66  ? 1.5813 1.1468 1.0490 0.2742  -0.0417 -0.1132 66  LEU Z C     
507  O O     . LEU A 66  ? 1.5852 1.1637 1.0222 0.3043  -0.0466 -0.1133 66  LEU Z O     
508  C CB    . LEU A 66  ? 1.4129 1.0927 0.9519 0.2177  -0.0809 -0.1204 66  LEU Z CB    
509  C CG    . LEU A 66  ? 1.3472 1.0684 0.9267 0.1748  -0.1079 -0.1456 66  LEU Z CG    
510  C CD1   . LEU A 66  ? 1.2400 1.0459 0.8441 0.1703  -0.1215 -0.1220 66  LEU Z CD1   
511  C CD2   . LEU A 66  ? 1.3379 1.0709 0.9100 0.1709  -0.1311 -0.1787 66  LEU Z CD2   
512  N N     . LEU A 67  ? 1.5612 1.0904 1.0285 0.2802  -0.0155 -0.0888 67  LEU Z N     
513  C CA    . LEU A 67  ? 1.5999 1.0984 1.0293 0.3225  0.0102  -0.0616 67  LEU Z CA    
514  C C     . LEU A 67  ? 1.7241 1.1422 1.1192 0.3369  0.0211  -0.0836 67  LEU Z C     
515  O O     . LEU A 67  ? 1.7697 1.1753 1.1257 0.3761  0.0323  -0.0709 67  LEU Z O     
516  C CB    . LEU A 67  ? 1.5987 1.0774 1.0396 0.3224  0.0356  -0.0313 67  LEU Z CB    
517  C CG    . LEU A 67  ? 1.4992 1.0548 0.9616 0.3223  0.0304  0.0002  67  LEU Z CG    
518  C CD1   . LEU A 67  ? 1.5551 1.0832 1.0284 0.3213  0.0568  0.0272  67  LEU Z CD1   
519  C CD2   . LEU A 67  ? 1.4428 1.0533 0.8786 0.3606  0.0253  0.0244  67  LEU Z CD2   
520  N N     . SER A 68  ? 1.6711 1.0344 1.0802 0.3054  0.0173  -0.1162 68  SER Z N     
521  C CA    . SER A 68  ? 1.7575 1.0392 1.1354 0.3156  0.0256  -0.1401 68  SER Z CA    
522  C C     . SER A 68  ? 1.7573 1.0611 1.1092 0.3331  0.0062  -0.1606 68  SER Z C     
523  O O     . SER A 68  ? 1.8418 1.0971 1.1531 0.3623  0.0160  -0.1668 68  SER Z O     
524  C CB    . SER A 68  ? 1.8040 1.0248 1.2065 0.2748  0.0232  -0.1698 68  SER Z CB    
525  O OG    . SER A 68  ? 1.7647 1.0233 1.1944 0.2413  -0.0059 -0.1986 68  SER Z OG    
526  N N     . HIS A 69  ? 1.7530 1.1304 1.1282 0.3159  -0.0213 -0.1708 69  HIS Z N     
527  C CA    . HIS A 69  ? 1.6980 1.1061 1.0523 0.3321  -0.0412 -0.1885 69  HIS Z CA    
528  C C     . HIS A 69  ? 1.6738 1.1454 1.0065 0.3731  -0.0403 -0.1555 69  HIS Z C     
529  O O     . HIS A 69  ? 1.6428 1.1639 0.9668 0.3853  -0.0601 -0.1631 69  HIS Z O     
530  C CB    . HIS A 69  ? 1.6417 1.0975 1.0316 0.2937  -0.0724 -0.2172 69  HIS Z CB    
531  C CG    . HIS A 69  ? 1.7031 1.0950 1.1072 0.2573  -0.0771 -0.2545 69  HIS Z CG    
532  N ND1   . HIS A 69  ? 1.7414 1.0961 1.1744 0.2254  -0.0670 -0.2544 69  HIS Z ND1   
533  C CD2   . HIS A 69  ? 1.7651 1.1227 1.1581 0.2482  -0.0910 -0.2922 69  HIS Z CD2   
534  C CE1   . HIS A 69  ? 1.7922 1.0929 1.2323 0.1974  -0.0751 -0.2897 69  HIS Z CE1   
535  N NE2   . HIS A 69  ? 1.8111 1.1116 1.2268 0.2103  -0.0898 -0.3138 69  HIS Z NE2   
536  N N     . GLY A 70  ? 1.7619 1.2322 1.0868 0.3941  -0.0174 -0.1181 70  GLY Z N     
537  C CA    . GLY A 70  ? 1.7333 1.2538 1.0346 0.4352  -0.0130 -0.0833 70  GLY Z CA    
538  C C     . GLY A 70  ? 1.6283 1.2499 0.9557 0.4289  -0.0372 -0.0689 70  GLY Z C     
539  O O     . GLY A 70  ? 1.5916 1.2643 0.9012 0.4576  -0.0472 -0.0551 70  GLY Z O     
540  N N     . ILE A 71  ? 1.6181 1.2685 0.9879 0.3917  -0.0471 -0.0711 71  ILE Z N     
541  C CA    . ILE A 71  ? 1.5280 1.2722 0.9260 0.3815  -0.0717 -0.0594 71  ILE Z CA    
542  C C     . ILE A 71  ? 1.4585 1.2299 0.8722 0.3824  -0.0598 -0.0222 71  ILE Z C     
543  O O     . ILE A 71  ? 1.5169 1.2402 0.9403 0.3685  -0.0400 -0.0182 71  ILE Z O     
544  C CB    . ILE A 71  ? 1.4956 1.2620 0.9317 0.3360  -0.0978 -0.0944 71  ILE Z CB    
545  C CG1   . ILE A 71  ? 1.5498 1.2752 0.9710 0.3313  -0.1068 -0.1342 71  ILE Z CG1   
546  C CG2   . ILE A 71  ? 1.3707 1.2361 0.8324 0.3288  -0.1260 -0.0845 71  ILE Z CG2   
547  C CD1   . ILE A 71  ? 1.5251 1.2642 0.9829 0.2856  -0.1305 -0.1697 71  ILE Z CD1   
548  N N     . LYS A 72  ? 1.1351 0.8929 1.3380 -0.0460 -0.1172 -0.1023 72  LYS Z N     
549  C CA    . LYS A 72  ? 1.1086 0.9427 1.3061 -0.0530 -0.1026 -0.0796 72  LYS Z CA    
550  C C     . LYS A 72  ? 1.1344 0.9492 1.2649 -0.0467 -0.1060 -0.0947 72  LYS Z C     
551  O O     . LYS A 72  ? 1.1725 0.9322 1.2060 -0.0550 -0.1033 -0.1277 72  LYS Z O     
552  C CB    . LYS A 72  ? 1.1072 0.9580 1.2602 -0.0755 -0.0840 -0.0837 72  LYS Z CB    
553  C CG    . LYS A 72  ? 1.1048 1.0305 1.2436 -0.0845 -0.0682 -0.0624 72  LYS Z CG    
554  C CD    . LYS A 72  ? 1.1609 1.0973 1.2512 -0.1070 -0.0503 -0.0689 72  LYS Z CD    
555  C CE    . LYS A 72  ? 1.1845 1.1943 1.2584 -0.1163 -0.0347 -0.0479 72  LYS Z CE    
556  N NZ    . LYS A 72  ? 1.2771 1.3000 1.3059 -0.1383 -0.0173 -0.0529 72  LYS Z NZ    
557  N N     . PRO A 73  ? 1.0303 0.8905 1.2128 -0.0319 -0.1118 -0.0708 73  PRO Z N     
558  C CA    . PRO A 73  ? 1.0566 0.9017 1.1842 -0.0244 -0.1157 -0.0828 73  PRO Z CA    
559  C C     . PRO A 73  ? 1.0453 0.9539 1.1408 -0.0354 -0.0986 -0.0682 73  PRO Z C     
560  O O     . PRO A 73  ? 1.0094 0.9995 1.1653 -0.0402 -0.0880 -0.0333 73  PRO Z O     
561  C CB    . PRO A 73  ? 1.0292 0.8941 1.2384 -0.0029 -0.1305 -0.0622 73  PRO Z CB    
562  C CG    . PRO A 73  ? 1.0058 0.9435 1.3172 -0.0036 -0.1255 -0.0238 73  PRO Z CG    
563  C CD    . PRO A 73  ? 0.9865 0.9088 1.2840 -0.0204 -0.1166 -0.0326 73  PRO Z CD    
564  N N     . ILE A 74  ? 1.0769 0.9471 1.0767 -0.0397 -0.0960 -0.0950 74  ILE Z N     
565  C CA    . ILE A 74  ? 1.0394 0.9638 1.0027 -0.0487 -0.0809 -0.0835 74  ILE Z CA    
566  C C     . ILE A 74  ? 1.0563 0.9742 1.0018 -0.0344 -0.0891 -0.0869 74  ILE Z C     
567  O O     . ILE A 74  ? 1.1000 0.9483 0.9691 -0.0313 -0.0963 -0.1205 74  ILE Z O     
568  C CB    . ILE A 74  ? 1.0554 0.9486 0.9167 -0.0683 -0.0677 -0.1104 74  ILE Z CB    
569  C CG1   . ILE A 74  ? 1.0493 0.9522 0.9299 -0.0831 -0.0587 -0.1061 74  ILE Z CG1   
570  C CG2   . ILE A 74  ? 1.0849 1.0329 0.9072 -0.0770 -0.0526 -0.0986 74  ILE Z CG2   
571  C CD1   . ILE A 74  ? 1.0789 0.9550 0.8640 -0.1030 -0.0449 -0.1309 74  ILE Z CD1   
572  N N     . LEU A 75  ? 1.0122 1.0026 1.0298 -0.0257 -0.0881 -0.0519 75  LEU Z N     
573  C CA    . LEU A 75  ? 1.0048 0.9970 1.0173 -0.0115 -0.0955 -0.0509 75  LEU Z CA    
574  C C     . LEU A 75  ? 1.0570 1.0529 0.9800 -0.0218 -0.0833 -0.0636 75  LEU Z C     
575  O O     . LEU A 75  ? 1.0369 1.0886 0.9487 -0.0369 -0.0660 -0.0477 75  LEU Z O     
576  C CB    . LEU A 75  ? 0.9684 1.0409 1.0848 -0.0006 -0.0966 -0.0086 75  LEU Z CB    
577  C CG    . LEU A 75  ? 1.0083 1.0657 1.2076 0.0186  -0.1149 -0.0002 75  LEU Z CG    
578  C CD1   . LEU A 75  ? 0.9706 0.9951 1.1967 0.0151  -0.1195 -0.0071 75  LEU Z CD1   
579  C CD2   . LEU A 75  ? 0.9463 1.0892 1.2426 0.0275  -0.1136 0.0425  75  LEU Z CD2   
580  N N     . VAL A 76  ? 1.0757 1.0113 0.9349 -0.0137 -0.0924 -0.0922 76  VAL Z N     
581  C CA    . VAL A 76  ? 1.0886 1.0206 0.8595 -0.0220 -0.0822 -0.1069 76  VAL Z CA    
582  C C     . VAL A 76  ? 1.0771 1.0206 0.8573 -0.0068 -0.0891 -0.1010 76  VAL Z C     
583  O O     . VAL A 76  ? 1.0926 0.9979 0.9009 0.0107  -0.1065 -0.1085 76  VAL Z O     
584  C CB    . VAL A 76  ? 1.0863 0.9289 0.7517 -0.0298 -0.0845 -0.1522 76  VAL Z CB    
585  C CG1   . VAL A 76  ? 1.1272 0.9666 0.7005 -0.0383 -0.0737 -0.1673 76  VAL Z CG1   
586  C CG2   . VAL A 76  ? 1.0880 0.9196 0.7433 -0.0455 -0.0768 -0.1584 76  VAL Z CG2   
587  N N     . PHE A 77  ? 1.0455 1.0423 0.8026 -0.0137 -0.0752 -0.0872 77  PHE Z N     
588  C CA    . PHE A 77  ? 1.0136 1.0317 0.7834 -0.0008 -0.0792 -0.0779 77  PHE Z CA    
589  C C     . PHE A 77  ? 1.0444 1.0399 0.7130 -0.0081 -0.0710 -0.1006 77  PHE Z C     
590  O O     . PHE A 77  ? 1.0603 1.0541 0.6622 -0.0258 -0.0571 -0.1114 77  PHE Z O     
591  C CB    . PHE A 77  ? 0.9780 1.0947 0.8347 0.0001  -0.0705 -0.0325 77  PHE Z CB    
592  C CG    . PHE A 77  ? 0.9454 1.0905 0.9062 0.0079  -0.0782 -0.0074 77  PHE Z CG    
593  C CD1   . PHE A 77  ? 0.9431 1.1080 0.9280 -0.0046 -0.0709 0.0023  77  PHE Z CD1   
594  C CD2   . PHE A 77  ? 0.9475 1.1000 0.9824 0.0276  -0.0926 0.0064  77  PHE Z CD2   
595  C CE1   . PHE A 77  ? 0.9301 1.1209 1.0105 0.0025  -0.0778 0.0252  77  PHE Z CE1   
596  C CE2   . PHE A 77  ? 0.9138 1.0927 1.0442 0.0348  -0.0996 0.0295  77  PHE Z CE2   
597  C CZ    . PHE A 77  ? 0.9133 1.1113 1.0663 0.0222  -0.0921 0.0389  77  PHE Z CZ    
598  N N     . ASP A 78  ? 1.1303 1.1087 0.7885 0.0057  -0.0796 -0.1076 78  ASP Z N     
599  C CA    . ASP A 78  ? 1.1595 1.1226 0.7295 0.0006  -0.0721 -0.1259 78  ASP Z CA    
600  C C     . ASP A 78  ? 1.1904 1.2387 0.7664 -0.0112 -0.0522 -0.0969 78  ASP Z C     
601  O O     . ASP A 78  ? 1.1489 1.2693 0.8097 -0.0083 -0.0486 -0.0603 78  ASP Z O     
602  C CB    . ASP A 78  ? 1.1861 1.1115 0.7528 0.0195  -0.0873 -0.1388 78  ASP Z CB    
603  C CG    . ASP A 78  ? 1.2566 1.0836 0.7801 0.0277  -0.1051 -0.1771 78  ASP Z CG    
604  O OD1   . ASP A 78  ? 1.2445 1.0195 0.6860 0.0157  -0.1015 -0.2064 78  ASP Z OD1   
605  O OD2   . ASP A 78  ? 1.2952 1.0964 0.8663 0.0460  -0.1227 -0.1780 78  ASP Z OD2   
606  N N     . GLY A 79  ? 1.1729 1.2121 0.6582 -0.0247 -0.0393 -0.1134 79  GLY Z N     
607  C CA    . GLY A 79  ? 1.2033 1.3181 0.6835 -0.0372 -0.0199 -0.0888 79  GLY Z CA    
608  C C     . GLY A 79  ? 1.2302 1.3434 0.6612 -0.0332 -0.0170 -0.0966 79  GLY Z C     
609  O O     . GLY A 79  ? 1.2407 1.3475 0.7067 -0.0161 -0.0288 -0.0938 79  GLY Z O     
610  N N     . CYS A 80  ? 1.0086 0.8920 1.4586 0.1122  0.0465  -0.0030 80  CYS Z N     
611  C CA    . CYS A 80  ? 1.0620 0.8930 1.4638 0.0975  0.0759  -0.0165 80  CYS Z CA    
612  C C     . CYS A 80  ? 1.0413 0.7967 1.4839 0.0646  0.0788  -0.0341 80  CYS Z C     
613  O O     . CYS A 80  ? 0.9976 0.7601 1.4656 0.0352  0.0510  -0.0611 80  CYS Z O     
614  C CB    . CYS A 80  ? 1.1083 0.9890 1.4104 0.0741  0.0699  -0.0591 80  CYS Z CB    
615  S SG    . CYS A 80  ? 1.2751 1.2527 1.5202 0.1101  0.0652  -0.0427 80  CYS Z SG    
616  N N     . THR A 81  ? 1.1252 0.8093 1.5745 0.0702  0.1128  -0.0181 81  THR Z N     
617  C CA    . THR A 81  ? 1.1293 0.7392 1.6140 0.0407  0.1196  -0.0327 81  THR Z CA    
618  C C     . THR A 81  ? 1.1779 0.7896 1.5972 -0.0065 0.1113  -0.0880 81  THR Z C     
619  O O     . THR A 81  ? 1.2944 0.9195 1.6364 -0.0122 0.1257  -0.1058 81  THR Z O     
620  C CB    . THR A 81  ? 1.2276 0.7611 1.7335 0.0602  0.1601  -0.0001 81  THR Z CB    
621  O OG1   . THR A 81  ? 1.2328 0.7574 1.8112 0.1010  0.1672  0.0505  81  THR Z OG1   
622  C CG2   . THR A 81  ? 1.2806 0.7405 1.8130 0.0270  0.1678  -0.0191 81  THR Z CG2   
623  N N     . LEU A 82  ? 1.2197 0.8192 1.6712 -0.0403 0.0883  -0.1153 82  LEU Z N     
624  C CA    . LEU A 82  ? 1.2591 0.8572 1.6570 -0.0869 0.0794  -0.1682 82  LEU Z CA    
625  C C     . LEU A 82  ? 1.3780 0.9055 1.7462 -0.0997 0.1151  -0.1752 82  LEU Z C     
626  O O     . LEU A 82  ? 1.4134 0.8750 1.8330 -0.0865 0.1377  -0.1458 82  LEU Z O     
627  C CB    . LEU A 82  ? 1.1469 0.7395 1.5966 -0.1171 0.0498  -0.1899 82  LEU Z CB    
628  C CG    . LEU A 82  ? 1.0678 0.7082 1.4684 -0.1574 0.0204  -0.2427 82  LEU Z CG    
629  C CD1   . LEU A 82  ? 1.0765 0.8057 1.4313 -0.1433 0.0004  -0.2475 82  LEU Z CD1   
630  C CD2   . LEU A 82  ? 0.9726 0.6038 1.4357 -0.1813 -0.0072 -0.2560 82  LEU Z CD2   
631  N N     . PRO A 83  ? 1.3818 0.9239 1.6672 -0.1254 0.1208  -0.2142 83  PRO Z N     
632  C CA    . PRO A 83  ? 1.4420 0.9233 1.6881 -0.1396 0.1552  -0.2257 83  PRO Z CA    
633  C C     . PRO A 83  ? 1.4403 0.8416 1.7389 -0.1616 0.1650  -0.2284 83  PRO Z C     
634  O O     . PRO A 83  ? 1.4943 0.8313 1.7924 -0.1573 0.1985  -0.2154 83  PRO Z O     
635  C CB    . PRO A 83  ? 1.4531 0.9776 1.6116 -0.1733 0.1463  -0.2781 83  PRO Z CB    
636  C CG    . PRO A 83  ? 1.4094 1.0242 1.5469 -0.1583 0.1181  -0.2785 83  PRO Z CG    
637  C CD    . PRO A 83  ? 1.3585 0.9814 1.5809 -0.1409 0.0947  -0.2497 83  PRO Z CD    
638  N N     . SER A 84  ? 1.5461 0.9534 1.8891 -0.1840 0.1360  -0.2441 84  SER Z N     
639  C CA    . SER A 84  ? 1.5275 0.9460 1.8596 -0.1800 0.1182  -0.2140 84  SER Z CA    
640  C C     . SER A 84  ? 1.5427 0.9517 1.9129 -0.1432 0.1263  -0.1601 84  SER Z C     
641  O O     . SER A 84  ? 1.5283 0.9369 1.8797 -0.1391 0.1238  -0.1415 84  SER Z O     
642  C CB    . SER A 84  ? 1.4480 0.9189 1.7758 -0.1929 0.0766  -0.2198 84  SER Z CB    
643  O OG    . SER A 84  ? 1.4239 0.9186 1.7077 -0.2252 0.0634  -0.2668 84  SER Z OG    
644  N N     . LYS A 85  ? 1.5123 0.9212 1.9336 -0.1160 0.1339  -0.1368 85  LYS Z N     
645  C CA    . LYS A 85  ? 1.5295 0.9471 1.9819 -0.0820 0.1383  -0.0888 85  LYS Z CA    
646  C C     . LYS A 85  ? 1.6345 1.0143 2.0993 -0.0539 0.1738  -0.0646 85  LYS Z C     
647  O O     . LYS A 85  ? 1.6488 1.0426 2.1367 -0.0258 0.1779  -0.0268 85  LYS Z O     
648  C CB    . LYS A 85  ? 1.4393 0.9063 1.9393 -0.0682 0.1127  -0.0720 85  LYS Z CB    
649  C CG    . LYS A 85  ? 1.3073 0.8146 1.7909 -0.0888 0.0823  -0.0881 85  LYS Z CG    
650  C CD    . LYS A 85  ? 1.1816 0.7379 1.7156 -0.0755 0.0614  -0.0758 85  LYS Z CD    
651  C CE    . LYS A 85  ? 1.2668 0.8412 1.8362 -0.0455 0.0705  -0.0380 85  LYS Z CE    
652  N NZ    . LYS A 85  ? 1.1609 0.7856 1.7826 -0.0336 0.0520  -0.0271 85  LYS Z NZ    
653  N N     . LYS A 86  ? 1.4579 1.3632 1.6698 0.0611  -0.1288 -0.1102 86  LYS Z N     
654  C CA    . LYS A 86  ? 1.5276 1.3764 1.7122 0.0730  -0.0981 -0.0964 86  LYS Z CA    
655  C C     . LYS A 86  ? 1.6321 1.4601 1.8301 0.0902  -0.0674 -0.1087 86  LYS Z C     
656  O O     . LYS A 86  ? 1.6690 1.4807 1.8938 0.1028  -0.0329 -0.1062 86  LYS Z O     
657  C CB    . LYS A 86  ? 1.5576 1.3433 1.6402 0.0682  -0.1170 -0.0697 86  LYS Z CB    
658  C CG    . LYS A 86  ? 1.6701 1.3980 1.7208 0.0808  -0.0872 -0.0532 86  LYS Z CG    
659  C CD    . LYS A 86  ? 1.7578 1.4213 1.7032 0.0755  -0.1086 -0.0276 86  LYS Z CD    
660  C CE    . LYS A 86  ? 1.8366 1.4426 1.7497 0.0901  -0.0782 -0.0116 86  LYS Z CE    
661  N NZ    . LYS A 86  ? 1.9344 1.4736 1.7414 0.0853  -0.0994 0.0128  86  LYS Z NZ    
662  N N     . GLU A 87  ? 1.5979 1.4282 1.7779 0.0912  -0.0798 -0.1204 87  GLU Z N     
663  C CA    . GLU A 87  ? 1.6551 1.4755 1.8537 0.1074  -0.0516 -0.1322 87  GLU Z CA    
664  C C     . GLU A 87  ? 1.6001 1.4852 1.9053 0.1085  -0.0327 -0.1546 87  GLU Z C     
665  O O     . GLU A 87  ? 1.6334 1.5142 1.9799 0.1212  0.0018  -0.1568 87  GLU Z O     
666  C CB    . GLU A 87  ? 1.6936 1.4977 1.8388 0.1080  -0.0707 -0.1372 87  GLU Z CB    
667  C CG    . GLU A 87  ? 1.8152 1.5434 1.8489 0.1103  -0.0852 -0.1161 87  GLU Z CG    
668  C CD    . GLU A 87  ? 1.9007 1.6040 1.8842 0.1168  -0.0932 -0.1218 87  GLU Z CD    
669  O OE1   . GLU A 87  ? 1.8690 1.6186 1.9074 0.1189  -0.0871 -0.1418 87  GLU Z OE1   
670  O OE2   . GLU A 87  ? 2.0734 1.7101 1.9615 0.1200  -0.1056 -0.1061 87  GLU Z OE2   
671  N N     . VAL A 88  ? 1.5584 1.5030 1.9067 0.0954  -0.0567 -0.1700 88  VAL Z N     
672  C CA    . VAL A 88  ? 1.5194 1.5276 1.9656 0.0949  -0.0449 -0.1935 88  VAL Z CA    
673  C C     . VAL A 88  ? 1.5451 1.5576 2.0493 0.1004  -0.0141 -0.1923 88  VAL Z C     
674  O O     . VAL A 88  ? 1.5571 1.5812 2.1160 0.1093  0.0139  -0.2027 88  VAL Z O     
675  C CB    . VAL A 88  ? 1.4191 1.4878 1.8976 0.0803  -0.0775 -0.2056 88  VAL Z CB    
676  C CG1   . VAL A 88  ? 1.3949 1.5253 1.9727 0.0805  -0.0650 -0.2303 88  VAL Z CG1   
677  C CG2   . VAL A 88  ? 1.3694 1.4405 1.7991 0.0746  -0.1083 -0.2078 88  VAL Z CG2   
678  N N     . GLU A 89  ? 1.4989 1.5022 1.9906 0.0949  -0.0194 -0.1778 89  GLU Z N     
679  C CA    . GLU A 89  ? 1.5243 1.5287 2.0657 0.0998  0.0086  -0.1743 89  GLU Z CA    
680  C C     . GLU A 89  ? 1.5739 1.5348 2.1088 0.1160  0.0442  -0.1659 89  GLU Z C     
681  O O     . GLU A 89  ? 1.6069 1.5860 2.2103 0.1225  0.0713  -0.1746 89  GLU Z O     
682  C CB    . GLU A 89  ? 1.4996 1.4898 2.0089 0.0927  -0.0023 -0.1546 89  GLU Z CB    
683  C CG    . GLU A 89  ? 1.4401 1.4765 1.9589 0.0785  -0.0361 -0.1589 89  GLU Z CG    
684  C CD    . GLU A 89  ? 1.4430 1.5413 2.0538 0.0767  -0.0319 -0.1824 89  GLU Z CD    
685  O OE1   . GLU A 89  ? 1.3499 1.4930 1.9762 0.0690  -0.0589 -0.1940 89  GLU Z OE1   
686  O OE2   . GLU A 89  ? 1.4906 1.5921 2.1576 0.0835  -0.0023 -0.1887 89  GLU Z OE2   
687  N N     . ARG A 90  ? 1.5633 1.4664 2.0148 0.1230  0.0432  -0.1482 90  ARG Z N     
688  C CA    . ARG A 90  ? 1.6246 1.4837 2.0608 0.1414  0.0760  -0.1377 90  ARG Z CA    
689  C C     . ARG A 90  ? 1.6239 1.5062 2.1042 0.1496  0.0911  -0.1540 90  ARG Z C     
690  O O     . ARG A 90  ? 1.6455 1.5259 2.1685 0.1622  0.1235  -0.1522 90  ARG Z O     
691  C CB    . ARG A 90  ? 1.6810 1.4718 2.0113 0.1481  0.0680  -0.1166 90  ARG Z CB    
692  C CG    . ARG A 90  ? 1.7206 1.4623 2.0265 0.1704  0.1013  -0.1034 90  ARG Z CG    
693  C CD    . ARG A 90  ? 1.7870 1.4588 1.9813 0.1771  0.0893  -0.0848 90  ARG Z CD    
694  N NE    . ARG A 90  ? 1.7705 1.4450 1.9169 0.1638  0.0519  -0.0920 90  ARG Z NE    
695  C CZ    . ARG A 90  ? 1.7562 1.4367 1.8941 0.1677  0.0470  -0.1040 90  ARG Z CZ    
696  N NH1   . ARG A 90  ? 1.7426 1.4273 1.9155 0.1846  0.0776  -0.1092 90  ARG Z NH1   
697  N NH2   . ARG A 90  ? 1.7654 1.4496 1.8611 0.1547  0.0117  -0.1094 90  ARG Z NH2   
698  N N     . SER A 91  ? 1.6072 1.5145 2.0796 0.1419  0.0675  -0.1686 91  SER Z N     
699  C CA    . SER A 91  ? 1.6071 1.5428 2.1222 0.1475  0.0792  -0.1847 91  SER Z CA    
700  C C     . SER A 91  ? 1.5818 1.5723 2.2023 0.1440  0.0957  -0.2008 91  SER Z C     
701  O O     . SER A 91  ? 1.5840 1.5915 2.2514 0.1516  0.1174  -0.2081 91  SER Z O     
702  C CB    . SER A 91  ? 1.5816 1.5403 2.0730 0.1379  0.0480  -0.1982 91  SER Z CB    
703  O OG    . SER A 91  ? 1.6323 1.5370 2.0242 0.1405  0.0313  -0.1833 91  SER Z OG    
704  N N     . ARG A 92  ? 1.5433 1.5602 2.1989 0.1325  0.0849  -0.2051 92  ARG Z N     
705  C CA    . ARG A 92  ? 1.5009 1.5607 2.2502 0.1294  0.1002  -0.2184 92  ARG Z CA    
706  C C     . ARG A 92  ? 1.5255 1.5536 2.2888 0.1405  0.1329  -0.2015 92  ARG Z C     
707  O O     . ARG A 92  ? 1.5189 1.5626 2.3463 0.1462  0.1580  -0.2061 92  ARG Z O     
708  C CB    . ARG A 92  ? 1.5468 1.6461 2.3243 0.1147  0.0757  -0.2290 92  ARG Z CB    
709  C CG    . ARG A 92  ? 1.5400 1.6764 2.3090 0.1044  0.0422  -0.2446 92  ARG Z CG    
710  C CD    . ARG A 92  ? 1.5288 1.6921 2.3017 0.0931  0.0161  -0.2460 92  ARG Z CD    
711  N NE    . ARG A 92  ? 1.4623 1.6689 2.2380 0.0845  -0.0154 -0.2611 92  ARG Z NE    
712  C CZ    . ARG A 92  ? 1.3858 1.6251 2.1672 0.0759  -0.0416 -0.2633 92  ARG Z CZ    
713  N NH1   . ARG A 92  ? 1.3967 1.6292 2.1798 0.0742  -0.0394 -0.2514 92  ARG Z NH1   
714  N NH2   . ARG A 92  ? 1.2408 1.5211 2.0264 0.0700  -0.0693 -0.2762 92  ARG Z NH2   
715  N N     . ARG A 93  ? 1.5143 1.4984 2.2168 0.1433  0.1317  -0.1809 93  ARG Z N     
716  C CA    . ARG A 93  ? 1.5360 1.4890 2.2454 0.1539  0.1605  -0.1627 93  ARG Z CA    
717  C C     . ARG A 93  ? 1.5855 1.5230 2.3158 0.1710  0.1932  -0.1563 93  ARG Z C     
718  O O     . ARG A 93  ? 1.5786 1.5330 2.3785 0.1747  0.2173  -0.1569 93  ARG Z O     
719  C CB    . ARG A 93  ? 1.5850 1.4852 2.2066 0.1566  0.1528  -0.1397 93  ARG Z CB    
720  C CG    . ARG A 93  ? 1.6167 1.4830 2.2387 0.1688  0.1824  -0.1194 93  ARG Z CG    
721  C CD    . ARG A 93  ? 1.6886 1.4925 2.2118 0.1769  0.1788  -0.0962 93  ARG Z CD    
722  N NE    . ARG A 93  ? 1.7027 1.5020 2.1667 0.1617  0.1426  -0.0946 93  ARG Z NE    
723  C CZ    . ARG A 93  ? 1.6998 1.4998 2.1523 0.1515  0.1319  -0.0848 93  ARG Z CZ    
724  N NH1   . ARG A 93  ? 1.6920 1.4959 2.1876 0.1553  0.1555  -0.0772 93  ARG Z NH1   
725  N NH2   . ARG A 93  ? 1.6996 1.4974 2.0980 0.1376  0.0976  -0.0812 93  ARG Z NH2   
726  N N     . GLU A 94  ? 1.6056 1.5110 2.2746 0.1815  0.1932  -0.1490 94  GLU Z N     
727  C CA    . GLU A 94  ? 1.6356 1.5246 2.3135 0.2003  0.2233  -0.1397 94  GLU Z CA    
728  C C     . GLU A 94  ? 1.5913 1.5334 2.3672 0.1971  0.2373  -0.1554 94  GLU Z C     
729  O O     . GLU A 94  ? 1.5931 1.5346 2.4141 0.2083  0.2669  -0.1452 94  GLU Z O     
730  C CB    . GLU A 94  ? 1.6665 1.5237 2.2675 0.2096  0.2152  -0.1354 94  GLU Z CB    
731  C CG    . GLU A 94  ? 1.7247 1.5269 2.2230 0.2108  0.1964  -0.1211 94  GLU Z CG    
732  C CD    . GLU A 94  ? 1.7579 1.5240 2.1786 0.2213  0.1894  -0.1169 94  GLU Z CD    
733  O OE1   . GLU A 94  ? 1.8030 1.5326 2.1964 0.2432  0.2149  -0.1013 94  GLU Z OE1   
734  O OE2   . GLU A 94  ? 1.7233 1.4977 2.1103 0.2085  0.1587  -0.1282 94  GLU Z OE2   
735  N N     . ARG A 95  ? 1.5781 1.5670 2.3878 0.1814  0.2151  -0.1792 95  ARG Z N     
736  C CA    . ARG A 95  ? 1.5448 1.5850 2.4442 0.1763  0.2244  -0.1960 95  ARG Z CA    
737  C C     . ARG A 95  ? 1.5391 1.5956 2.5127 0.1732  0.2411  -0.1955 95  ARG Z C     
738  O O     . ARG A 95  ? 1.5318 1.6040 2.5667 0.1783  0.2643  -0.1935 95  ARG Z O     
739  C CB    . ARG A 95  ? 1.4893 1.5765 2.4085 0.1597  0.1947  -0.2223 95  ARG Z CB    
740  C CG    . ARG A 95  ? 1.5018 1.5780 2.3564 0.1625  0.1794  -0.2238 95  ARG Z CG    
741  C CD    . ARG A 95  ? 1.4708 1.5984 2.3516 0.1470  0.1510  -0.2493 95  ARG Z CD    
742  N NE    . ARG A 95  ? 1.4685 1.5856 2.2879 0.1496  0.1365  -0.2502 95  ARG Z NE    
743  C CZ    . ARG A 95  ? 1.4345 1.5919 2.2631 0.1386  0.1114  -0.2696 95  ARG Z CZ    
744  N NH1   . ARG A 95  ? 1.4380 1.5817 2.2081 0.1420  0.0998  -0.2684 95  ARG Z NH1   
745  N NH2   . ARG A 95  ? 1.3906 1.6013 2.2860 0.1254  0.0978  -0.2899 95  ARG Z NH2   
746  N N     . ARG A 96  ? 1.4965 1.5483 2.4629 0.1651  0.2295  -0.1953 96  ARG Z N     
747  C CA    . ARG A 96  ? 1.4771 1.5388 2.5063 0.1629  0.2453  -0.1934 96  ARG Z CA    
748  C C     . ARG A 96  ? 1.5236 1.5548 2.5601 0.1804  0.2800  -0.1699 96  ARG Z C     
749  O O     . ARG A 96  ? 1.5223 1.5738 2.6331 0.1814  0.2995  -0.1705 96  ARG Z O     
750  C CB    . ARG A 96  ? 1.4514 1.5034 2.4541 0.1552  0.2305  -0.1904 96  ARG Z CB    
751  C CG    . ARG A 96  ? 1.4244 1.5142 2.4351 0.1388  0.1979  -0.2121 96  ARG Z CG    
752  C CD    . ARG A 96  ? 1.3540 1.4404 2.3548 0.1323  0.1886  -0.2068 96  ARG Z CD    
753  N NE    . ARG A 96  ? 1.3793 1.4195 2.2972 0.1375  0.1862  -0.1836 96  ARG Z NE    
754  C CZ    . ARG A 96  ? 1.4237 1.4564 2.2760 0.1310  0.1580  -0.1809 96  ARG Z CZ    
755  N NH1   . ARG A 96  ? 1.4418 1.5125 2.3033 0.1203  0.1306  -0.1996 96  ARG Z NH1   
756  N NH2   . ARG A 96  ? 1.4514 1.4391 2.2291 0.1351  0.1564  -0.1586 96  ARG Z NH2   
757  N N     . GLN A 97  ? 1.5356 1.5179 2.4942 0.1947  0.2867  -0.1487 97  GLN Z N     
758  C CA    . GLN A 97  ? 1.5719 1.5221 2.5277 0.2148  0.3192  -0.1238 97  GLN Z CA    
759  C C     . GLN A 97  ? 1.5814 1.5548 2.5916 0.2224  0.3384  -0.1238 97  GLN Z C     
760  O O     . GLN A 97  ? 1.5986 1.5762 2.6629 0.2308  0.3646  -0.1112 97  GLN Z O     
761  C CB    . GLN A 97  ? 1.6171 1.5103 2.4714 0.2301  0.3195  -0.1035 97  GLN Z CB    
762  C CG    . GLN A 97  ? 1.6250 1.4942 2.4183 0.2213  0.2979  -0.1011 97  GLN Z CG    
763  C CD    . GLN A 97  ? 1.6919 1.5023 2.3810 0.2349  0.2948  -0.0825 97  GLN Z CD    
764  O OE1   . GLN A 97  ? 1.7477 1.5311 2.4094 0.2543  0.3127  -0.0694 97  GLN Z OE1   
765  N NE2   . GLN A 97  ? 1.6920 1.4814 2.3207 0.2251  0.2713  -0.0800 97  GLN Z NE2   
766  N N     . ALA A 98  ? 1.5636 1.5546 2.5617 0.2186  0.3249  -0.1372 98  ALA Z N     
767  C CA    . ALA A 98  ? 1.5543 1.5718 2.6029 0.2240  0.3413  -0.1373 98  ALA Z CA    
768  C C     . ALA A 98  ? 1.5176 1.5808 2.6699 0.2108  0.3470  -0.1494 98  ALA Z C     
769  O O     . ALA A 98  ? 1.5518 1.6208 2.7561 0.2193  0.3725  -0.1350 98  ALA Z O     
770  C CB    . ALA A 98  ? 1.5285 1.5632 2.5505 0.2188  0.3229  -0.1530 98  ALA Z CB    
771  N N     . ASN A 99  ? 1.4884 1.5817 2.6685 0.1906  0.3225  -0.1744 99  ASN Z N     
772  C CA    . ASN A 99  ? 1.4632 1.5972 2.7366 0.1769  0.3236  -0.1893 99  ASN Z CA    
773  C C     . ASN A 99  ? 1.4855 1.6038 2.7930 0.1815  0.3438  -0.1737 99  ASN Z C     
774  O O     . ASN A 99  ? 1.4830 1.6281 2.8688 0.1725  0.3491  -0.1815 99  ASN Z O     
775  C CB    . ASN A 99  ? 1.4245 1.5894 2.7095 0.1575  0.2922  -0.2182 99  ASN Z CB    
776  C CG    . ASN A 99  ? 1.3929 1.5881 2.6725 0.1507  0.2738  -0.2370 99  ASN Z CG    
777  O OD1   . ASN A 99  ? 1.3967 1.5804 2.6395 0.1610  0.2809  -0.2274 99  ASN Z OD1   
778  N ND2   . ASN A 99  ? 1.3658 1.6000 2.6815 0.1346  0.2505  -0.2635 99  ASN Z ND2   
779  N N     . LEU A 100 ? 1.4862 1.5602 2.7342 0.1955  0.3546  -0.1517 100 LEU Z N     
780  C CA    . LEU A 100 ? 1.5058 1.5630 2.7834 0.2043  0.3790  -0.1320 100 LEU Z CA    
781  C C     . LEU A 100 ? 1.5688 1.6200 2.8677 0.2221  0.4079  -0.1091 100 LEU Z C     
782  O O     . LEU A 100 ? 1.5930 1.6678 2.9705 0.2200  0.4230  -0.1056 100 LEU Z O     
783  C CB    . LEU A 100 ? 1.5194 1.5337 2.7261 0.2121  0.3789  -0.1172 100 LEU Z CB    
784  C CG    . LEU A 100 ? 1.5205 1.5131 2.7471 0.2250  0.4068  -0.0931 100 LEU Z CG    
785  C CD1   . LEU A 100 ? 1.4516 1.4743 2.7651 0.2119  0.4105  -0.1034 100 LEU Z CD1   
786  C CD2   . LEU A 100 ? 1.5224 1.4724 2.6700 0.2324  0.4047  -0.0788 100 LEU Z CD2   
787  N N     . LEU A 101 ? 1.5738 1.5935 2.8010 0.2396  0.4143  -0.0930 101 LEU Z N     
788  C CA    . LEU A 101 ? 1.6011 1.6093 2.8337 0.2615  0.4430  -0.0664 101 LEU Z CA    
789  C C     . LEU A 101 ? 1.6149 1.6675 2.9217 0.2554  0.4486  -0.0722 101 LEU Z C     
790  O O     . LEU A 101 ? 1.6337 1.6949 2.9910 0.2659  0.4731  -0.0518 101 LEU Z O     
791  C CB    . LEU A 101 ? 1.6324 1.5987 2.7666 0.2807  0.4442  -0.0524 101 LEU Z CB    
792  C CG    . LEU A 101 ? 1.6676 1.5843 2.7188 0.2883  0.4386  -0.0432 101 LEU Z CG    
793  C CD1   . LEU A 101 ? 1.7077 1.5799 2.6629 0.3086  0.4405  -0.0285 101 LEU Z CD1   
794  C CD2   . LEU A 101 ? 1.6635 1.5654 2.7420 0.2985  0.4615  -0.0226 101 LEU Z CD2   
795  N N     . LYS A 102 ? 1.5783 1.6607 2.8919 0.2382  0.4253  -0.0988 102 LYS Z N     
796  C CA    . LYS A 102 ? 1.5512 1.6799 2.9377 0.2282  0.4267  -0.1082 102 LYS Z CA    
797  C C     . LYS A 102 ? 1.5669 1.7253 3.0455 0.2118  0.4267  -0.1181 102 LYS Z C     
798  O O     . LYS A 102 ? 1.6048 1.7843 3.1515 0.2127  0.4439  -0.1060 102 LYS Z O     
799  C CB    . LYS A 102 ? 1.4844 1.6372 2.8509 0.2145  0.4005  -0.1353 102 LYS Z CB    
800  C CG    . LYS A 102 ? 1.4544 1.6579 2.8951 0.2021  0.3993  -0.1478 102 LYS Z CG    
801  C CD    . LYS A 102 ? 1.4199 1.6467 2.8359 0.1906  0.3742  -0.1737 102 LYS Z CD    
802  C CE    . LYS A 102 ? 1.3139 1.5926 2.8042 0.1779  0.3733  -0.1860 102 LYS Z CE    
803  N NZ    . LYS A 102 ? 1.2461 1.5502 2.7139 0.1682  0.3503  -0.2105 102 LYS Z NZ    
804  N N     . GLY A 103 ? 1.5272 1.6855 3.0049 0.1974  0.4074  -0.1381 103 GLY Z N     
805  C CA    . GLY A 103 ? 1.5243 1.7080 3.0811 0.1806  0.4030  -0.1522 103 GLY Z CA    
806  C C     . GLY A 103 ? 1.5781 1.7567 3.1911 0.1887  0.4300  -0.1281 103 GLY Z C     
807  O O     . GLY A 103 ? 1.5923 1.8005 3.2836 0.1794  0.4347  -0.1301 103 GLY Z O     
808  N N     . LYS A 104 ? 1.5525 1.6937 3.1254 0.2059  0.4471  -0.1043 104 LYS Z N     
809  C CA    . LYS A 104 ? 1.5824 1.7171 3.2036 0.2168  0.4743  -0.0779 104 LYS Z CA    
810  C C     . LYS A 104 ? 1.6301 1.7822 3.2896 0.2268  0.4932  -0.0573 104 LYS Z C     
811  O O     . LYS A 104 ? 1.6641 1.8357 3.4011 0.2237  0.5062  -0.0462 104 LYS Z O     
812  C CB    . LYS A 104 ? 1.5632 1.6539 3.1232 0.2365  0.4894  -0.0548 104 LYS Z CB    
813  C CG    . LYS A 104 ? 1.5871 1.6464 3.0549 0.2555  0.4920  -0.0419 104 LYS Z CG    
814  C CD    . LYS A 104 ? 1.5615 1.5808 2.9519 0.2613  0.4861  -0.0393 104 LYS Z CD    
815  C CE    . LYS A 104 ? 1.5436 1.5465 2.9573 0.2708  0.5073  -0.0190 104 LYS Z CE    
816  N NZ    . LYS A 104 ? 1.5039 1.4704 2.8438 0.2745  0.5009  -0.0164 104 LYS Z NZ    
817  N N     . GLN A 105 ? 1.5831 1.7290 3.1885 0.2384  0.4940  -0.0513 105 GLN Z N     
818  C CA    . GLN A 105 ? 1.6134 1.7772 3.2487 0.2492  0.5121  -0.0300 105 GLN Z CA    
819  C C     . GLN A 105 ? 1.6218 1.8346 3.3378 0.2261  0.5002  -0.0489 105 GLN Z C     
820  O O     . GLN A 105 ? 1.6536 1.8898 3.4298 0.2283  0.5157  -0.0301 105 GLN Z O     
821  C CB    . GLN A 105 ? 1.6067 1.7507 3.1595 0.2672  0.5148  -0.0210 105 GLN Z CB    
822  C CG    . GLN A 105 ? 1.6410 1.7348 3.1182 0.2952  0.5324  0.0061  105 GLN Z CG    
823  C CD    . GLN A 105 ? 1.6484 1.7223 3.0526 0.3164  0.5398  0.0205  105 GLN Z CD    
824  O OE1   . GLN A 105 ? 1.6345 1.7325 3.0666 0.3223  0.5511  0.0324  105 GLN Z OE1   
825  N NE2   . GLN A 105 ? 1.6732 1.7021 2.9821 0.3279  0.5330  0.0203  105 GLN Z NE2   
826  N N     . LEU A 106 ? 1.5842 1.8131 3.3022 0.2041  0.4723  -0.0848 106 LEU Z N     
827  C CA    . LEU A 106 ? 1.5668 1.8404 3.3586 0.1814  0.4584  -0.1058 106 LEU Z CA    
828  C C     . LEU A 106 ? 1.5846 1.8692 3.4596 0.1699  0.4630  -0.1039 106 LEU Z C     
829  O O     . LEU A 106 ? 1.5853 1.9039 3.5328 0.1534  0.4573  -0.1124 106 LEU Z O     
830  C CB    . LEU A 106 ? 1.5391 1.8267 3.3073 0.1637  0.4269  -0.1443 106 LEU Z CB    
831  C CG    . LEU A 106 ? 1.5178 1.8521 3.3436 0.1441  0.4120  -0.1662 106 LEU Z CG    
832  C CD1   . LEU A 106 ? 1.5387 1.8888 3.3615 0.1540  0.4263  -0.1478 106 LEU Z CD1   
833  C CD2   . LEU A 106 ? 1.4949 1.8422 3.2942 0.1295  0.3812  -0.2029 106 LEU Z CD2   
834  N N     . LEU A 107 ? 1.5412 1.7962 3.4049 0.1784  0.4730  -0.0923 107 LEU Z N     
835  C CA    . LEU A 107 ? 1.5565 1.8172 3.4957 0.1708  0.4811  -0.0855 107 LEU Z CA    
836  C C     . LEU A 107 ? 1.5887 1.8529 3.5674 0.1862  0.5096  -0.0464 107 LEU Z C     
837  O O     . LEU A 107 ? 1.5821 1.8610 3.6379 0.1781  0.5162  -0.0373 107 LEU Z O     
838  C CB    . LEU A 107 ? 1.5584 1.7888 3.4719 0.1736  0.4813  -0.0884 107 LEU Z CB    
839  C CG    . LEU A 107 ? 1.5265 1.7589 3.4233 0.1558  0.4533  -0.1250 107 LEU Z CG    
840  C CD1   . LEU A 107 ? 1.5393 1.7426 3.4119 0.1606  0.4577  -0.1215 107 LEU Z CD1   
841  C CD2   . LEU A 107 ? 1.5171 1.7827 3.4906 0.1323  0.4367  -0.1492 107 LEU Z CD2   
842  N N     . ARG A 108 ? 1.5778 1.8279 3.5021 0.2093  0.5258  -0.0223 108 ARG Z N     
843  C CA    . ARG A 108 ? 1.5918 1.8462 3.5455 0.2282  0.5538  0.0183  108 ARG Z CA    
844  C C     . ARG A 108 ? 1.6002 1.8955 3.6066 0.2188  0.5527  0.0222  108 ARG Z C     
845  O O     . ARG A 108 ? 1.6242 1.9326 3.6696 0.2307  0.5738  0.0565  108 ARG Z O     
846  C CB    . ARG A 108 ? 1.6120 1.8314 3.4809 0.2596  0.5723  0.0439  108 ARG Z CB    
847  C CG    . ARG A 108 ? 1.6285 1.8069 3.4451 0.2704  0.5757  0.0451  108 ARG Z CG    
848  C CD    . ARG A 108 ? 1.6573 1.7990 3.3919 0.3026  0.5946  0.0728  108 ARG Z CD    
849  N NE    . ARG A 108 ? 1.6830 1.7864 3.3712 0.3127  0.5989  0.0766  108 ARG Z NE    
850  C CZ    . ARG A 108 ? 1.6950 1.7891 3.4141 0.3255  0.6199  0.1013  108 ARG Z CZ    
851  N NH1   . ARG A 108 ? 1.6780 1.7983 3.4756 0.3296  0.6375  0.1253  108 ARG Z NH1   
852  N NH2   . ARG A 108 ? 1.7158 1.7760 3.3885 0.3338  0.6229  0.1033  108 ARG Z NH2   
853  N N     . GLU A 109 ? 1.5764 1.8936 3.5844 0.1977  0.5282  -0.0115 109 GLU Z N     
854  C CA    . GLU A 109 ? 1.5599 1.9188 3.6189 0.1853  0.5244  -0.0118 109 GLU Z CA    
855  C C     . GLU A 109 ? 1.5218 1.9091 3.6628 0.1547  0.5046  -0.0369 109 GLU Z C     
856  O O     . GLU A 109 ? 1.4957 1.9191 3.6827 0.1389  0.4957  -0.0443 109 GLU Z O     
857  C CB    . GLU A 109 ? 1.5410 1.9069 3.5401 0.1862  0.5130  -0.0289 109 GLU Z CB    
858  C CG    . GLU A 109 ? 1.5716 1.9100 3.4907 0.2167  0.5328  -0.0023 109 GLU Z CG    
859  C CD    . GLU A 109 ? 1.5495 1.8968 3.4146 0.2169  0.5219  -0.0180 109 GLU Z CD    
860  O OE1   . GLU A 109 ? 1.5291 1.9032 3.4149 0.1934  0.4978  -0.0518 109 GLU Z OE1   
861  O OE2   . GLU A 109 ? 1.5464 1.8733 3.3477 0.2413  0.5376  0.0038  109 GLU Z OE2   
862  N N     . GLY A 110 ? 1.4967 1.8661 3.6536 0.1469  0.4977  -0.0497 110 GLY Z N     
863  C CA    . GLY A 110 ? 1.4858 1.8743 3.7169 0.1203  0.4799  -0.0719 110 GLY Z CA    
864  C C     . GLY A 110 ? 1.4653 1.8602 3.6777 0.1014  0.4494  -0.1176 110 GLY Z C     
865  O O     . GLY A 110 ? 1.4575 1.8508 3.7046 0.0852  0.4344  -0.1395 110 GLY Z O     
866  N N     . LYS A 111 ? 1.5295 1.9318 3.6866 0.1046  0.4403  -0.1311 111 LYS Z N     
867  C CA    . LYS A 111 ? 1.5007 1.9141 3.6394 0.0885  0.4111  -0.1727 111 LYS Z CA    
868  C C     . LYS A 111 ? 1.4921 1.8751 3.5850 0.0909  0.4012  -0.1893 111 LYS Z C     
869  O O     . LYS A 111 ? 1.4867 1.8497 3.5035 0.1034  0.4000  -0.1903 111 LYS Z O     
870  C CB    . LYS A 111 ? 1.4848 1.9131 3.5729 0.0933  0.4054  -0.1798 111 LYS Z CB    
871  C CG    . LYS A 111 ? 1.4676 1.9365 3.6064 0.0838  0.4065  -0.1755 111 LYS Z CG    
872  C CD    . LYS A 111 ? 1.4700 1.9553 3.5585 0.0867  0.3980  -0.1882 111 LYS Z CD    
873  C CE    . LYS A 111 ? 1.4495 1.9796 3.5919 0.0746  0.3974  -0.1871 111 LYS Z CE    
874  N NZ    . LYS A 111 ? 1.4275 1.9758 3.5229 0.0771  0.3894  -0.2006 111 LYS Z NZ    
875  N N     . VAL A 112 ? 1.9139 2.0331 3.0625 0.3095  0.0496  0.6540  112 VAL Z N     
876  C CA    . VAL A 112 ? 1.8676 1.9908 2.9263 0.2944  0.0104  0.6288  112 VAL Z CA    
877  C C     . VAL A 112 ? 1.8575 1.9569 2.8992 0.2804  -0.0117 0.6117  112 VAL Z C     
878  O O     . VAL A 112 ? 1.8237 1.9035 2.7986 0.2770  -0.0296 0.5836  112 VAL Z O     
879  C CB    . VAL A 112 ? 1.8135 1.9969 2.8315 0.2647  -0.0324 0.6433  112 VAL Z CB    
880  C CG1   . VAL A 112 ? 1.7267 1.9392 2.7832 0.2341  -0.0569 0.6658  112 VAL Z CG1   
881  C CG2   . VAL A 112 ? 1.8198 2.0076 2.7429 0.2500  -0.0675 0.6162  112 VAL Z CG2   
882  N N     . SER A 113 ? 1.8594 1.9613 2.9632 0.2731  -0.0094 0.6290  113 SER Z N     
883  C CA    . SER A 113 ? 1.8448 1.9280 2.9430 0.2605  -0.0284 0.6155  113 SER Z CA    
884  C C     . SER A 113 ? 1.8794 1.9040 2.9732 0.2878  0.0055  0.5908  113 SER Z C     
885  O O     . SER A 113 ? 1.8549 1.8583 2.9053 0.2803  -0.0138 0.5674  113 SER Z O     
886  C CB    . SER A 113 ? 1.8504 1.9530 3.0220 0.2484  -0.0313 0.6419  113 SER Z CB    
887  O OG    . SER A 113 ? 1.8274 1.9134 2.9959 0.2369  -0.0492 0.6289  113 SER Z OG    
888  N N     . GLU A 114 ? 1.8287 1.8242 2.9695 0.3177  0.0599  0.5946  114 GLU Z N     
889  C CA    . GLU A 114 ? 1.8745 1.8064 3.0175 0.3420  0.1044  0.5690  114 GLU Z CA    
890  C C     . GLU A 114 ? 1.8461 1.7483 2.9262 0.3536  0.1173  0.5385  114 GLU Z C     
891  O O     . GLU A 114 ? 1.8642 1.7104 2.9228 0.3657  0.1453  0.5079  114 GLU Z O     
892  C CB    . GLU A 114 ? 1.9645 1.8708 3.1936 0.3651  0.1664  0.5833  114 GLU Z CB    
893  C CG    . GLU A 114 ? 1.9979 1.9240 3.2909 0.3581  0.1592  0.6101  114 GLU Z CG    
894  C CD    . GLU A 114 ? 2.1041 1.9966 3.4761 0.3824  0.2242  0.6201  114 GLU Z CD    
895  O OE1   . GLU A 114 ? 2.1479 2.0004 3.5275 0.4022  0.2785  0.6047  114 GLU Z OE1   
896  O OE2   . GLU A 114 ? 2.1304 2.0347 3.5572 0.3806  0.2235  0.6416  114 GLU Z OE2   
897  N N     . ALA A 115 ? 1.9569 1.8963 3.0078 0.3488  0.0984  0.5459  115 ALA Z N     
898  C CA    . ALA A 115 ? 1.9173 1.8382 2.9045 0.3583  0.1030  0.5177  115 ALA Z CA    
899  C C     . ALA A 115 ? 1.8467 1.7727 2.7479 0.3393  0.0498  0.4979  115 ALA Z C     
900  O O     . ALA A 115 ? 1.7898 1.6900 2.6317 0.3472  0.0515  0.4689  115 ALA Z O     
901  C CB    . ALA A 115 ? 1.9057 1.8733 2.8903 0.3599  0.0973  0.5347  115 ALA Z CB    
902  N N     . ARG A 116 ? 1.9523 1.9098 2.8498 0.3132  0.0059  0.5110  116 ARG Z N     
903  C CA    . ARG A 116 ? 1.9016 1.8619 2.7261 0.2915  -0.0402 0.4908  116 ARG Z CA    
904  C C     . ARG A 116 ? 1.8753 1.7704 2.6761 0.3083  -0.0173 0.4588  116 ARG Z C     
905  O O     . ARG A 116 ? 1.8501 1.7260 2.5781 0.3088  -0.0305 0.4322  116 ARG Z O     
906  C CB    . ARG A 116 ? 1.9080 1.9021 2.7543 0.2606  -0.0762 0.5064  116 ARG Z CB    
907  C CG    . ARG A 116 ? 1.9032 1.9007 2.6819 0.2333  -0.1198 0.4844  116 ARG Z CG    
908  C CD    . ARG A 116 ? 1.8905 1.9187 2.5972 0.2164  -0.1484 0.4767  116 ARG Z CD    
909  N NE    . ARG A 116 ? 1.9280 1.9646 2.5840 0.1821  -0.1869 0.4592  116 ARG Z NE    
910  C CZ    . ARG A 116 ? 1.9443 2.0125 2.6139 0.1456  -0.2125 0.4701  116 ARG Z CZ    
911  N NH1   . ARG A 116 ? 1.9216 1.9867 2.5498 0.1141  -0.2404 0.4506  116 ARG Z NH1   
912  N NH2   . ARG A 116 ? 1.9503 2.0485 2.6780 0.1396  -0.2071 0.5000  116 ARG Z NH2   
913  N N     . GLU A 117 ? 1.8463 1.7073 2.7089 0.3210  0.0190  0.4615  117 GLU Z N     
914  C CA    . GLU A 117 ? 1.8381 1.6336 2.6879 0.3349  0.0495  0.4318  117 GLU Z CA    
915  C C     . GLU A 117 ? 1.8527 1.5932 2.6884 0.3562  0.1024  0.4030  117 GLU Z C     
916  O O     . GLU A 117 ? 1.8470 1.5325 2.6416 0.3601  0.1200  0.3677  117 GLU Z O     
917  C CB    . GLU A 117 ? 1.8827 1.6596 2.8082 0.3428  0.0817  0.4442  117 GLU Z CB    
918  C CG    . GLU A 117 ? 1.8504 1.6657 2.7864 0.3211  0.0348  0.4607  117 GLU Z CG    
919  C CD    . GLU A 117 ? 1.8166 1.6097 2.6947 0.3114  0.0082  0.4349  117 GLU Z CD    
920  O OE1   . GLU A 117 ? 1.8107 1.5894 2.7202 0.3129  0.0148  0.4365  117 GLU Z OE1   
921  O OE2   . GLU A 117 ? 1.7691 1.5602 2.5701 0.3027  -0.0189 0.4136  117 GLU Z OE2   
922  N N     . CYS A 118 ? 1.8170 1.5698 2.6885 0.3674  0.1319  0.4139  118 CYS Z N     
923  C CA    . CYS A 118 ? 1.8375 1.5387 2.7035 0.3844  0.1909  0.3788  118 CYS Z CA    
924  C C     . CYS A 118 ? 1.7497 1.4560 2.5374 0.3802  0.1611  0.3566  118 CYS Z C     
925  O O     . CYS A 118 ? 1.7657 1.4224 2.5949 0.3838  0.2343  0.3360  118 CYS Z O     
926  C CB    . CYS A 118 ? 1.8994 1.6204 2.8291 0.3975  0.2302  0.3963  118 CYS Z CB    
927  S SG    . CYS A 118 ? 2.0492 1.7446 3.0845 0.4079  0.2948  0.4147  118 CYS Z SG    
928  N N     . PHE A 119 ? 1.8245 1.6029 2.5647 0.3682  0.0907  0.3819  119 PHE Z N     
929  C CA    . PHE A 119 ? 1.7506 1.5661 2.4652 0.3628  0.0715  0.3915  119 PHE Z CA    
930  C C     . PHE A 119 ? 1.6838 1.4705 2.2861 0.3476  0.0158  0.3573  119 PHE Z C     
931  O O     . PHE A 119 ? 1.6117 1.4095 2.2254 0.3467  0.0267  0.3666  119 PHE Z O     
932  C CB    . PHE A 119 ? 1.6710 1.5748 2.3399 0.3482  0.0072  0.4174  119 PHE Z CB    
933  C CG    . PHE A 119 ? 1.7074 1.6610 2.5016 0.3668  0.0703  0.4655  119 PHE Z CG    
934  C CD1   . PHE A 119 ? 1.6926 1.6900 2.5836 0.3907  0.1443  0.4977  119 PHE Z CD1   
935  C CD2   . PHE A 119 ? 1.7898 1.7499 2.6007 0.3668  0.0663  0.4715  119 PHE Z CD2   
936  C CE1   . PHE A 119 ? 1.7643 1.8163 2.7663 0.4160  0.2179  0.5277  119 PHE Z CE1   
937  C CE2   . PHE A 119 ? 1.8333 1.8388 2.7561 0.3849  0.1273  0.5141  119 PHE Z CE2   
938  C CZ    . PHE A 119 ? 1.8297 1.8804 2.8459 0.4098  0.2038  0.5413  119 PHE Z CZ    
939  N N     . THR A 120 ? 1.7691 1.5528 2.3683 0.3341  -0.0080 0.3613  120 THR Z N     
940  C CA    . THR A 120 ? 1.7251 1.4953 2.2601 0.3192  -0.0436 0.3434  120 THR Z CA    
941  C C     . THR A 120 ? 1.7597 1.4389 2.2912 0.3336  0.0041  0.3052  120 THR Z C     
942  O O     . THR A 120 ? 1.7339 1.3867 2.2004 0.3260  -0.0170 0.2823  120 THR Z O     
943  C CB    . THR A 120 ? 1.7256 1.5366 2.2863 0.2955  -0.0774 0.3644  120 THR Z CB    
944  O OG1   . THR A 120 ? 1.6674 1.4901 2.1570 0.2733  -0.1202 0.3482  120 THR Z OG1   
945  C CG2   . THR A 120 ? 1.8023 1.5724 2.4323 0.3076  -0.0391 0.3659  120 THR Z CG2   
946  N N     . ARG A 121 ? 1.6789 1.3103 2.2809 0.3499  0.0750  0.2946  121 ARG Z N     
947  C CA    . ARG A 121 ? 1.7439 1.2882 2.3506 0.3539  0.1388  0.2483  121 ARG Z CA    
948  C C     . ARG A 121 ? 1.7756 1.2833 2.4856 0.3568  0.2652  0.2329  121 ARG Z C     
949  O O     . ARG A 121 ? 1.8540 1.2905 2.6112 0.3518  0.3737  0.1883  121 ARG Z O     
950  C CB    . ARG A 121 ? 1.8091 1.3350 2.5019 0.3608  0.1899  0.2606  121 ARG Z CB    
951  C CG    . ARG A 121 ? 1.8020 1.3621 2.5067 0.3545  0.1431  0.2914  121 ARG Z CG    
952  C CD    . ARG A 121 ? 1.8763 1.4040 2.6569 0.3635  0.2001  0.2950  121 ARG Z CD    
953  N NE    . ARG A 121 ? 1.8788 1.4360 2.6712 0.3578  0.1585  0.3180  121 ARG Z NE    
954  C CZ    . ARG A 121 ? 1.8693 1.4770 2.7183 0.3566  0.1386  0.3559  121 ARG Z CZ    
955  N NH1   . ARG A 121 ? 1.8825 1.5182 2.7814 0.3624  0.1542  0.3794  121 ARG Z NH1   
956  N NH2   . ARG A 121 ? 1.8312 1.4595 2.6882 0.3482  0.1055  0.3681  121 ARG Z NH2   
957  N N     . SER A 122 ? 1.6415 1.1961 2.3704 0.3605  0.2622  0.2577  122 SER Z N     
958  C CA    . SER A 122 ? 1.6870 1.2027 2.4796 0.3599  0.4030  0.2107  122 SER Z CA    
959  C C     . SER A 122 ? 1.6029 1.2216 2.2420 0.2900  0.3394  0.1746  122 SER Z C     
960  O O     . SER A 122 ? 1.6485 1.3451 2.2007 0.2149  0.3960  0.0968  122 SER Z O     
961  C CB    . SER A 122 ? 1.7355 1.3295 2.5847 0.3604  0.4354  0.2333  122 SER Z CB    
962  O OG    . SER A 122 ? 1.6177 1.3170 2.4603 0.3790  0.3149  0.3209  122 SER Z OG    
963  N N     . ILE A 123 ? 1.6805 1.2992 2.2871 0.3165  0.2213  0.2320  123 ILE Z N     
964  C CA    . ILE A 123 ? 1.5664 1.2837 2.0313 0.2598  0.1445  0.2118  123 ILE Z CA    
965  C C     . ILE A 123 ? 1.6077 1.3024 1.9675 0.1866  0.2214  0.0943  123 ILE Z C     
966  O O     . ILE A 123 ? 1.6960 1.2716 2.0765 0.2011  0.2658  0.0610  123 ILE Z O     
967  C CB    . ILE A 123 ? 1.4580 1.1633 1.9191 0.3105  0.0043  0.3002  123 ILE Z CB    
968  C CG1   . ILE A 123 ? 1.4440 1.2099 1.8624 0.3130  -0.0685 0.3220  123 ILE Z CG1   
969  C CG2   . ILE A 123 ? 1.3481 1.1597 1.6608 0.2524  -0.0756 0.2805  123 ILE Z CG2   
970  C CD1   . ILE A 123 ? 1.4146 1.1956 1.6807 0.2938  -0.1392 0.2866  123 ILE Z CD1   
971  N N     . ASN A 124 ? 1.4369 1.2475 1.6832 0.1080  0.2373  0.0314  124 ASN Z N     
972  C CA    . ASN A 124 ? 1.4663 1.2746 1.6019 0.0318  0.3037  -0.0820 124 ASN Z CA    
973  C C     . ASN A 124 ? 1.3279 1.2504 1.3226 -0.0182 0.2099  -0.0902 124 ASN Z C     
974  O O     . ASN A 124 ? 1.3071 1.3598 1.2382 -0.0580 0.1851  -0.0921 124 ASN Z O     
975  C CB    . ASN A 124 ? 1.5949 1.4276 1.7211 -0.0257 0.4385  -0.1735 124 ASN Z CB    
976  C CG    . ASN A 124 ? 1.6587 1.5168 1.6570 -0.1136 0.5003  -0.2920 124 ASN Z CG    
977  O OD1   . ASN A 124 ? 1.6529 1.6367 1.5485 -0.1776 0.4902  -0.3316 124 ASN Z OD1   
978  N ND2   . ASN A 124 ? 1.7391 1.4785 1.7419 -0.1172 0.5646  -0.3494 124 ASN Z ND2   
979  N N     . ILE A 125 ? 1.3568 0.9389 1.6079 -0.0618 0.2791  0.0372  125 ILE Z N     
980  C CA    . ILE A 125 ? 1.3350 0.9272 1.5459 -0.0296 0.2438  0.0219  125 ILE Z CA    
981  C C     . ILE A 125 ? 1.3467 0.9602 1.5182 0.0256  0.1941  -0.0400 125 ILE Z C     
982  O O     . ILE A 125 ? 1.3030 0.9653 1.5588 0.0138  0.1543  -0.0879 125 ILE Z O     
983  C CB    . ILE A 125 ? 1.2104 0.8444 1.5323 -0.0786 0.2238  0.0213  125 ILE Z CB    
984  C CG1   . ILE A 125 ? 1.1723 0.8542 1.4866 -0.1102 0.2332  0.0660  125 ILE Z CG1   
985  C CG2   . ILE A 125 ? 1.1887 0.8298 1.4652 -0.0449 0.1911  0.0103  125 ILE Z CG2   
986  C CD1   . ILE A 125 ? 1.1839 0.8303 1.3965 -0.0896 0.2592  0.1079  125 ILE Z CD1   
987  N N     . THR A 126 ? 1.2735 0.8492 1.3155 0.0856  0.1963  -0.0383 126 THR Z N     
988  C CA    . THR A 126 ? 1.3173 0.9053 1.3065 0.1419  0.1525  -0.0936 126 THR Z CA    
989  C C     . THR A 126 ? 1.2717 0.8942 1.2733 0.1599  0.1018  -0.1240 126 THR Z C     
990  O O     . THR A 126 ? 1.2088 0.8404 1.2483 0.1327  0.1042  -0.0991 126 THR Z O     
991  C CB    . THR A 126 ? 1.4158 0.9484 1.2582 0.2004  0.1740  -0.0801 126 THR Z CB    
992  O OG1   . THR A 126 ? 1.3993 0.9056 1.1595 0.2270  0.1786  -0.0517 126 THR Z OG1   
993  C CG2   . THR A 126 ? 1.4685 0.9609 1.2928 0.1803  0.2314  -0.0381 126 THR Z CG2   
994  N N     . HIS A 127 ? 1.2634 0.9042 1.2329 0.2057  0.0560  -0.1775 127 HIS Z N     
995  C CA    . HIS A 127 ? 1.2640 0.9360 1.2357 0.2297  0.0058  -0.2084 127 HIS Z CA    
996  C C     . HIS A 127 ? 1.3406 0.9717 1.1883 0.2763  0.0146  -0.1818 127 HIS Z C     
997  O O     . HIS A 127 ? 1.3601 1.0082 1.2074 0.2876  -0.0131 -0.1875 127 HIS Z O     
998  C CB    . HIS A 127 ? 1.2975 1.0032 1.2788 0.2617  -0.0474 -0.2750 127 HIS Z CB    
999  C CG    . HIS A 127 ? 1.2521 1.0037 1.3601 0.2172  -0.0631 -0.3062 127 HIS Z CG    
1000 N ND1   . HIS A 127 ? 1.1668 0.9693 1.3959 0.1733  -0.0880 -0.3190 127 HIS Z ND1   
1001 C CD2   . HIS A 127 ? 1.2812 1.0352 1.4132 0.2103  -0.0574 -0.3275 127 HIS Z CD2   
1002 C CE1   . HIS A 127 ? 1.1171 0.9519 1.4397 0.1408  -0.0972 -0.3467 127 HIS Z CE1   
1003 N NE2   . HIS A 127 ? 1.1985 1.0050 1.4648 0.1624  -0.0790 -0.3524 127 HIS Z NE2   
1004 N N     . ALA A 128 ? 1.3603 0.9372 1.1032 0.3035  0.0536  -0.1526 128 ALA Z N     
1005 C CA    . ALA A 128 ? 1.4623 0.9956 1.0809 0.3482  0.0668  -0.1243 128 ALA Z CA    
1006 C C     . ALA A 128 ? 1.3849 0.9065 1.0219 0.3139  0.0961  -0.0710 128 ALA Z C     
1007 O O     . ALA A 128 ? 1.3814 0.9025 0.9812 0.3348  0.0797  -0.0655 128 ALA Z O     
1008 C CB    . ALA A 128 ? 1.5072 0.9856 1.0156 0.3818  0.1038  -0.1051 128 ALA Z CB    
1009 N N     . MET A 129 ? 1.4287 0.9399 1.1227 0.2610  0.1397  -0.0316 129 MET Z N     
1010 C CA    . MET A 129 ? 1.4173 0.9179 1.1413 0.2199  0.1697  0.0200  129 MET Z CA    
1011 C C     . MET A 129 ? 1.3385 0.8877 1.1498 0.1978  0.1304  -0.0003 129 MET Z C     
1012 O O     . MET A 129 ? 1.3435 0.8837 1.1274 0.2022  0.1312  0.0236  129 MET Z O     
1013 C CB    . MET A 129 ? 1.3500 0.8415 1.1432 0.1612  0.2153  0.0561  129 MET Z CB    
1014 C CG    . MET A 129 ? 1.3798 0.8256 1.0981 0.1786  0.2559  0.0768  129 MET Z CG    
1015 S SD    . MET A 129 ? 1.3721 0.8240 1.1960 0.1118  0.2939  0.0976  129 MET Z SD    
1016 C CE    . MET A 129 ? 1.3378 0.7873 1.2276 0.0494  0.3229  0.1543  129 MET Z CE    
1017 N N     . ALA A 130 ? 1.2323 0.8328 1.1485 0.1745  0.0961  -0.0450 130 ALA Z N     
1018 C CA    . ALA A 130 ? 1.1694 0.8211 1.1781 0.1531  0.0551  -0.0708 130 ALA Z CA    
1019 C C     . ALA A 130 ? 1.2326 0.8886 1.1711 0.2071  0.0165  -0.0931 130 ALA Z C     
1020 O O     . ALA A 130 ? 1.2125 0.8843 1.1800 0.1962  0.0033  -0.0845 130 ALA Z O     
1021 C CB    . ALA A 130 ? 1.1058 0.8097 1.2237 0.1292  0.0216  -0.1210 130 ALA Z CB    
1022 N N     . HIS A 131 ? 1.2376 0.8781 1.0826 0.2655  -0.0007 -0.1206 131 HIS Z N     
1023 C CA    . HIS A 131 ? 1.3118 0.9554 1.0854 0.3199  -0.0387 -0.1435 131 HIS Z CA    
1024 C C     . HIS A 131 ? 1.3373 0.9362 1.0179 0.3383  -0.0089 -0.0938 131 HIS Z C     
1025 O O     . HIS A 131 ? 1.3296 0.9386 0.9904 0.3596  -0.0345 -0.0986 131 HIS Z O     
1026 C CB    . HIS A 131 ? 1.4064 1.0418 1.1007 0.3768  -0.0637 -0.1850 131 HIS Z CB    
1027 C CG    . HIS A 131 ? 1.4641 1.1166 1.1119 0.4274  -0.1144 -0.2208 131 HIS Z CG    
1028 N ND1   . HIS A 131 ? 1.5525 1.1678 1.0814 0.4757  -0.1096 -0.2019 131 HIS Z ND1   
1029 C CD2   . HIS A 131 ? 1.4520 1.1550 1.1578 0.4363  -0.1712 -0.2735 131 HIS Z CD2   
1030 C CE1   . HIS A 131 ? 1.6310 1.2732 1.1466 0.5125  -0.1613 -0.2414 131 HIS Z CE1   
1031 N NE2   . HIS A 131 ? 1.5330 1.2285 1.1549 0.4896  -0.1995 -0.2851 131 HIS Z NE2   
1032 N N     . LYS A 132 ? 1.4046 0.9540 1.0284 0.3304  0.0450  -0.0459 132 LYS Z N     
1033 C CA    . LYS A 132 ? 1.4482 0.9530 0.9890 0.3413  0.0786  0.0062  132 LYS Z CA    
1034 C C     . LYS A 132 ? 1.3750 0.9010 0.9974 0.2956  0.0798  0.0294  132 LYS Z C     
1035 O O     . LYS A 132 ? 1.3822 0.9000 0.9609 0.3152  0.0725  0.0434  132 LYS Z O     
1036 C CB    . LYS A 132 ? 1.4761 0.9276 0.9586 0.3320  0.1378  0.0545  132 LYS Z CB    
1037 C CG    . LYS A 132 ? 1.5915 1.0142 0.9787 0.3810  0.1416  0.0370  132 LYS Z CG    
1038 C CD    . LYS A 132 ? 1.6384 1.0075 0.9677 0.3718  0.2018  0.0878  132 LYS Z CD    
1039 C CE    . LYS A 132 ? 1.7346 1.0580 0.9725 0.3867  0.2332  0.1399  132 LYS Z CE    
1040 N NZ    . LYS A 132 ? 1.8097 1.0799 0.9866 0.3804  0.2912  0.1895  132 LYS Z NZ    
1041 N N     . VAL A 133 ? 1.3776 0.9309 1.1190 0.2348  0.0885  0.0325  133 VAL Z N     
1042 C CA    . VAL A 133 ? 1.2646 0.8422 1.0969 0.1866  0.0873  0.0499  133 VAL Z CA    
1043 C C     . VAL A 133 ? 1.2807 0.9037 1.1478 0.2064  0.0311  0.0071  133 VAL Z C     
1044 O O     . VAL A 133 ? 1.2828 0.9084 1.1586 0.1984  0.0282  0.0257  133 VAL Z O     
1045 C CB    . VAL A 133 ? 1.1777 0.7808 1.1371 0.1188  0.1014  0.0534  133 VAL Z CB    
1046 C CG1   . VAL A 133 ? 0.9980 0.6305 1.0562 0.0705  0.0939  0.0644  133 VAL Z CG1   
1047 C CG2   . VAL A 133 ? 1.2091 0.7665 1.1389 0.0948  0.1596  0.1022  133 VAL Z CG2   
1048 N N     . ILE A 134 ? 1.1945 0.8519 1.0796 0.2328  -0.0130 -0.0498 134 ILE Z N     
1049 C CA    . ILE A 134 ? 1.2096 0.9119 1.1271 0.2548  -0.0696 -0.0943 134 ILE Z CA    
1050 C C     . ILE A 134 ? 1.3126 0.9907 1.1233 0.3073  -0.0789 -0.0840 134 ILE Z C     
1051 O O     . ILE A 134 ? 1.2712 0.9706 1.1119 0.3047  -0.1003 -0.0852 134 ILE Z O     
1052 C CB    . ILE A 134 ? 1.2307 0.9675 1.1696 0.2794  -0.1138 -0.1562 134 ILE Z CB    
1053 C CG1   . ILE A 134 ? 1.1152 0.8892 1.1825 0.2238  -0.1154 -0.1737 134 ILE Z CG1   
1054 C CG2   . ILE A 134 ? 1.2582 1.0323 1.2012 0.3149  -0.1718 -0.1995 134 ILE Z CG2   
1055 C CD1   . ILE A 134 ? 1.1366 0.9466 1.2344 0.2429  -0.1588 -0.2346 134 ILE Z CD1   
1056 N N     . LYS A 135 ? 1.3635 0.9969 1.0503 0.3551  -0.0626 -0.0740 135 LYS Z N     
1057 C CA    . LYS A 135 ? 1.4406 1.0451 1.0164 0.4058  -0.0663 -0.0599 135 LYS Z CA    
1058 C C     . LYS A 135 ? 1.4365 1.0166 1.0079 0.3787  -0.0307 -0.0044 135 LYS Z C     
1059 O O     . LYS A 135 ? 1.4621 1.0483 1.0159 0.3960  -0.0489 -0.0014 135 LYS Z O     
1060 C CB    . LYS A 135 ? 1.5654 1.1214 1.0102 0.4560  -0.0474 -0.0534 135 LYS Z CB    
1061 C CG    . LYS A 135 ? 1.6925 1.2659 1.1020 0.5052  -0.0925 -0.1104 135 LYS Z CG    
1062 C CD    . LYS A 135 ? 1.8563 1.3766 1.1293 0.5550  -0.0704 -0.0995 135 LYS Z CD    
1063 C CE    . LYS A 135 ? 1.9865 1.5200 1.2108 0.6094  -0.1177 -0.1545 135 LYS Z CE    
1064 N NZ    . LYS A 135 ? 2.0873 1.6451 1.2974 0.6425  -0.1643 -0.1781 135 LYS Z NZ    
1065 N N     . ALA A 136 ? 1.4974 1.0499 1.0864 0.3354  0.0196  0.0397  136 ALA Z N     
1066 C CA    . ALA A 136 ? 1.4653 0.9915 1.0535 0.3037  0.0573  0.0954  136 ALA Z CA    
1067 C C     . ALA A 136 ? 1.4001 0.9692 1.0942 0.2671  0.0333  0.0876  136 ALA Z C     
1068 O O     . ALA A 136 ? 1.4207 0.9740 1.0992 0.2590  0.0475  0.1217  136 ALA Z O     
1069 C CB    . ALA A 136 ? 1.4025 0.8979 1.0077 0.2581  0.1114  0.1389  136 ALA Z CB    
1070 N N     . ALA A 137 ? 1.3710 0.9934 1.1724 0.2450  -0.0026 0.0428  137 ALA Z N     
1071 C CA    . ALA A 137 ? 1.2768 0.9439 1.1870 0.2094  -0.0280 0.0307  137 ALA Z CA    
1072 C C     . ALA A 137 ? 1.3349 1.0282 1.2226 0.2550  -0.0773 -0.0034 137 ALA Z C     
1073 O O     . ALA A 137 ? 1.3284 1.0332 1.2465 0.2432  -0.0849 0.0083  137 ALA Z O     
1074 C CB    . ALA A 137 ? 1.1418 0.8554 1.1792 0.1648  -0.0449 -0.0019 137 ALA Z CB    
1075 N N     . ARG A 138 ? 1.3151 1.0171 1.1496 0.3067  -0.1107 -0.0452 138 ARG Z N     
1076 C CA    . ARG A 138 ? 1.3700 1.0960 1.1769 0.3539  -0.1595 -0.0794 138 ARG Z CA    
1077 C C     . ARG A 138 ? 1.4234 1.1090 1.1264 0.3874  -0.1424 -0.0425 138 ARG Z C     
1078 O O     . ARG A 138 ? 1.4265 1.1313 1.1335 0.4054  -0.1713 -0.0524 138 ARG Z O     
1079 C CB    . ARG A 138 ? 1.4209 1.1581 1.1825 0.4026  -0.1955 -0.1291 138 ARG Z CB    
1080 C CG    . ARG A 138 ? 1.3833 1.1704 1.2523 0.3770  -0.2267 -0.1764 138 ARG Z CG    
1081 C CD    . ARG A 138 ? 1.4842 1.3014 1.3323 0.4271  -0.2843 -0.2338 138 ARG Z CD    
1082 N NE    . ARG A 138 ? 1.4333 1.2953 1.3755 0.4057  -0.3137 -0.2799 138 ARG Z NE    
1083 C CZ    . ARG A 138 ? 1.4775 1.3310 1.3925 0.4197  -0.3138 -0.3023 138 ARG Z CZ    
1084 N NH1   . ARG A 138 ? 1.5661 1.3681 1.3623 0.4556  -0.2858 -0.2830 138 ARG Z NH1   
1085 N NH2   . ARG A 138 ? 1.3826 1.2786 1.3883 0.3982  -0.3415 -0.3442 138 ARG Z NH2   
1086 N N     . SER A 139 ? 1.5635 1.1932 1.1739 0.3959  -0.0951 0.0002  139 SER Z N     
1087 C CA    . SER A 139 ? 1.6639 1.2507 1.1722 0.4250  -0.0734 0.0399  139 SER Z CA    
1088 C C     . SER A 139 ? 1.6228 1.2144 1.1894 0.3844  -0.0595 0.0731  139 SER Z C     
1089 O O     . SER A 139 ? 1.7080 1.2818 1.2161 0.4087  -0.0583 0.0933  139 SER Z O     
1090 C CB    . SER A 139 ? 1.7088 1.2350 1.1162 0.4350  -0.0221 0.0816  139 SER Z CB    
1091 O OG    . SER A 139 ? 1.6516 1.1667 1.1196 0.3765  0.0195  0.1139  139 SER Z OG    
1092 N N     . GLN A 140 ? 1.6002 1.2153 1.2821 0.3224  -0.0491 0.0783  140 GLN Z N     
1093 C CA    . GLN A 140 ? 1.5208 1.1429 1.2702 0.2780  -0.0366 0.1072  140 GLN Z CA    
1094 C C     . GLN A 140 ? 1.4693 1.1532 1.3278 0.2649  -0.0860 0.0643  140 GLN Z C     
1095 O O     . GLN A 140 ? 1.4047 1.1037 1.3432 0.2211  -0.0805 0.0802  140 GLN Z O     
1096 C CB    . GLN A 140 ? 1.4574 1.0611 1.2625 0.2143  0.0106  0.1466  140 GLN Z CB    
1097 C CG    . GLN A 140 ? 1.5205 1.0603 1.2239 0.2196  0.0646  0.1998  140 GLN Z CG    
1098 C CD    . GLN A 140 ? 1.5497 1.0540 1.2018 0.2182  0.0910  0.2482  140 GLN Z CD    
1099 O OE1   . GLN A 140 ? 1.4650 0.9874 1.1888 0.1838  0.0870  0.2574  140 GLN Z OE1   
1100 N NE2   . GLN A 140 ? 1.6727 1.1435 1.2143 0.2479  0.1153  0.2696  140 GLN Z NE2   
1101 N N     . GLY A 141 ? 1.4461 1.1650 1.3076 0.3024  -0.1342 0.0103  141 GLY Z N     
1102 C CA    . GLY A 141 ? 1.3874 1.1662 1.3466 0.2957  -0.1848 -0.0337 141 GLY Z CA    
1103 C C     . GLY A 141 ? 1.2741 1.0921 1.3709 0.2342  -0.1881 -0.0484 141 GLY Z C     
1104 O O     . GLY A 141 ? 1.1801 1.0385 1.3718 0.2081  -0.2122 -0.0631 141 GLY Z O     
1105 N N     . VAL A 142 ? 1.2587 1.0648 1.3669 0.2112  -0.1637 -0.0444 142 VAL Z N     
1106 C CA    . VAL A 142 ? 1.1184 0.9597 1.3541 0.1529  -0.1650 -0.0582 142 VAL Z CA    
1107 C C     . VAL A 142 ? 1.1363 1.0160 1.4078 0.1686  -0.2044 -0.1155 142 VAL Z C     
1108 O O     . VAL A 142 ? 1.2066 1.0640 1.4074 0.1981  -0.1973 -0.1232 142 VAL Z O     
1109 C CB    . VAL A 142 ? 1.0701 0.8735 1.3102 0.1065  -0.1077 -0.0108 142 VAL Z CB    
1110 C CG1   . VAL A 142 ? 0.9345 0.7755 1.3072 0.0470  -0.1106 -0.0270 142 VAL Z CG1   
1111 C CG2   . VAL A 142 ? 1.0786 0.8438 1.2877 0.0872  -0.0688 0.0464  142 VAL Z CG2   
1112 N N     . ASP A 143 ? 1.0478 1.2509 1.1344 0.1241  -0.2203 -0.1109 143 ASP Z N     
1113 C CA    . ASP A 143 ? 0.9956 1.1992 1.0906 0.1079  -0.2060 -0.1207 143 ASP Z CA    
1114 C C     . ASP A 143 ? 1.0230 1.1959 1.1081 0.1044  -0.1933 -0.1120 143 ASP Z C     
1115 O O     . ASP A 143 ? 1.0278 1.1807 1.1054 0.1108  -0.1876 -0.0993 143 ASP Z O     
1116 C CB    . ASP A 143 ? 1.0120 1.2285 1.1196 0.0997  -0.1928 -0.1289 143 ASP Z CB    
1117 C CG    . ASP A 143 ? 1.0566 1.3071 1.1775 0.1006  -0.2028 -0.1374 143 ASP Z CG    
1118 O OD1   . ASP A 143 ? 1.0401 1.3061 1.1631 0.1013  -0.2174 -0.1412 143 ASP Z OD1   
1119 O OD2   . ASP A 143 ? 1.1127 1.3750 1.2425 0.1006  -0.1958 -0.1395 143 ASP Z OD2   
1120 N N     . CYS A 144 ? 1.0199 1.1882 1.1042 0.0940  -0.1883 -0.1181 144 CYS Z N     
1121 C CA    . CYS A 144 ? 1.0021 1.1409 1.0768 0.0908  -0.1741 -0.1101 144 CYS Z CA    
1122 C C     . CYS A 144 ? 1.0001 1.1330 1.0770 0.0738  -0.1555 -0.1212 144 CYS Z C     
1123 O O     . CYS A 144 ? 1.0522 1.2053 1.1370 0.0630  -0.1570 -0.1350 144 CYS Z O     
1124 C CB    . CYS A 144 ? 1.0221 1.1528 1.0875 0.0964  -0.1849 -0.1036 144 CYS Z CB    
1125 S SG    . CYS A 144 ? 1.0529 1.1858 1.1110 0.1156  -0.2074 -0.0876 144 CYS Z SG    
1126 N N     . LEU A 145 ? 0.9070 1.0119 0.9758 0.0708  -0.1379 -0.1140 145 LEU Z N     
1127 C CA    . LEU A 145 ? 0.9264 1.0202 0.9930 0.0548  -0.1189 -0.1234 145 LEU Z CA    
1128 C C     . LEU A 145 ? 0.9520 1.0116 1.0059 0.0547  -0.1019 -0.1134 145 LEU Z C     
1129 O O     . LEU A 145 ? 0.9651 1.0089 1.0185 0.0613  -0.0924 -0.1000 145 LEU Z O     
1130 C CB    . LEU A 145 ? 0.9412 1.0431 1.0174 0.0492  -0.1091 -0.1281 145 LEU Z CB    
1131 C CG    . LEU A 145 ? 0.9465 1.0384 1.0197 0.0317  -0.0902 -0.1379 145 LEU Z CG    
1132 C CD1   . LEU A 145 ? 1.0227 1.1300 1.0950 0.0174  -0.0962 -0.1524 145 LEU Z CD1   
1133 C CD2   . LEU A 145 ? 0.9661 1.0655 1.0496 0.0291  -0.0815 -0.1394 145 LEU Z CD2   
1134 N N     . VAL A 146 ? 0.9398 0.9872 0.9828 0.0469  -0.0977 -0.1189 146 VAL Z N     
1135 C CA    . VAL A 146 ? 0.9387 0.9519 0.9679 0.0464  -0.0789 -0.1099 146 VAL Z CA    
1136 C C     . VAL A 146 ? 0.9366 0.9343 0.9610 0.0318  -0.0566 -0.1178 146 VAL Z C     
1137 O O     . VAL A 146 ? 0.9773 0.9800 0.9975 0.0162  -0.0549 -0.1333 146 VAL Z O     
1138 C CB    . VAL A 146 ? 0.9554 0.9576 0.9716 0.0448  -0.0823 -0.1120 146 VAL Z CB    
1139 C CG1   . VAL A 146 ? 0.9686 0.9328 0.9691 0.0450  -0.0597 -0.1021 146 VAL Z CG1   
1140 C CG2   . VAL A 146 ? 0.9426 0.9603 0.9633 0.0594  -0.1051 -0.1037 146 VAL Z CG2   
1141 N N     . ALA A 147 ? 0.8943 0.8733 0.9189 0.0360  -0.0404 -0.1061 147 ALA Z N     
1142 C CA    . ALA A 147 ? 0.9150 0.8776 0.9347 0.0232  -0.0186 -0.1120 147 ALA Z CA    
1143 C C     . ALA A 147 ? 0.9468 0.8820 0.9453 0.0120  -0.0040 -0.1185 147 ALA Z C     
1144 O O     . ALA A 147 ? 0.9513 0.8709 0.9389 0.0184  -0.0041 -0.1114 147 ALA Z O     
1145 C CB    . ALA A 147 ? 0.9120 0.8585 0.9363 0.0311  -0.0042 -0.0958 147 ALA Z CB    
1146 N N     . PRO A 148 ? 0.9306 0.8589 0.9213 -0.0053 0.0084  -0.1315 148 PRO Z N     
1147 C CA    . PRO A 148 ? 0.9660 0.8614 0.9312 -0.0179 0.0253  -0.1373 148 PRO Z CA    
1148 C C     . PRO A 148 ? 0.9797 0.8389 0.9335 -0.0076 0.0458  -0.1212 148 PRO Z C     
1149 O O     . PRO A 148 ? 1.0017 0.8342 0.9352 -0.0082 0.0542  -0.1195 148 PRO Z O     
1150 C CB    . PRO A 148 ? 0.9820 0.8777 0.9439 -0.0359 0.0354  -0.1498 148 PRO Z CB    
1151 C CG    . PRO A 148 ? 0.9545 0.8922 0.9402 -0.0357 0.0165  -0.1556 148 PRO Z CG    
1152 C CD    . PRO A 148 ? 0.9238 0.8753 0.9275 -0.0146 0.0056  -0.1416 148 PRO Z CD    
1153 N N     . TYR A 149 ? 0.9883 0.8465 0.9552 0.0017  0.0541  -0.1084 149 TYR Z N     
1154 C CA    . TYR A 149 ? 1.0093 0.8373 0.9700 0.0126  0.0734  -0.0894 149 TYR Z CA    
1155 C C     . TYR A 149 ? 0.9592 0.8025 0.9414 0.0287  0.0653  -0.0704 149 TYR Z C     
1156 O O     . TYR A 149 ? 0.9372 0.7995 0.9279 0.0393  0.0448  -0.0644 149 TYR Z O     
1157 C CB    . TYR A 149 ? 1.0239 0.8235 0.9721 0.0019  0.1002  -0.0921 149 TYR Z CB    
1158 C CG    . TYR A 149 ? 1.1246 0.9014 1.0450 -0.0148 0.1099  -0.1082 149 TYR Z CG    
1159 C CD1   . TYR A 149 ? 1.1890 0.9300 1.0848 -0.0125 0.1243  -0.1028 149 TYR Z CD1   
1160 C CD2   . TYR A 149 ? 1.1128 0.9028 1.0298 -0.0335 0.1044  -0.1277 149 TYR Z CD2   
1161 C CE1   . TYR A 149 ? 1.1806 0.8963 1.0466 -0.0291 0.1333  -0.1171 149 TYR Z CE1   
1162 C CE2   . TYR A 149 ? 1.1502 0.9173 1.0387 -0.0510 0.1121  -0.1410 149 TYR Z CE2   
1163 C CZ    . TYR A 149 ? 1.2100 0.9385 1.0718 -0.0492 0.1266  -0.1362 149 TYR Z CZ    
1164 O OH    . TYR A 149 ? 1.2921 0.9935 1.1211 -0.0680 0.1346  -0.1491 149 TYR Z OH    
1165 N N     . GLU A 150 ? 1.0044 0.8383 0.9940 0.0296  0.0808  -0.0606 150 GLU Z N     
1166 C CA    . GLU A 150 ? 0.9828 0.8285 0.9909 0.0420  0.0739  -0.0415 150 GLU Z CA    
1167 C C     . GLU A 150 ? 0.9130 0.7933 0.9369 0.0416  0.0511  -0.0505 150 GLU Z C     
1168 O O     . GLU A 150 ? 0.8879 0.7819 0.9148 0.0300  0.0492  -0.0691 150 GLU Z O     
1169 C CB    . GLU A 150 ? 0.9329 0.7606 0.9457 0.0406  0.0966  -0.0297 150 GLU Z CB    
1170 C CG    . GLU A 150 ? 0.9968 0.7908 0.9975 0.0465  0.1193  -0.0124 150 GLU Z CG    
1171 C CD    . GLU A 150 ? 1.0719 0.8490 1.0781 0.0439  0.1428  -0.0016 150 GLU Z CD    
1172 O OE1   . GLU A 150 ? 1.0710 0.8599 1.0870 0.0343  0.1431  -0.0126 150 GLU Z OE1   
1173 O OE2   . GLU A 150 ? 1.1339 0.8867 1.1354 0.0516  0.1612  0.0186  150 GLU Z OE2   
1174 N N     . ALA A 151 ? 0.9641 0.8575 0.9969 0.0544  0.0341  -0.0360 151 ALA Z N     
1175 C CA    . ALA A 151 ? 0.9264 0.8490 0.9710 0.0564  0.0127  -0.0424 151 ALA Z CA    
1176 C C     . ALA A 151 ? 0.9273 0.8545 0.9841 0.0522  0.0192  -0.0414 151 ALA Z C     
1177 O O     . ALA A 151 ? 0.8925 0.8419 0.9576 0.0501  0.0072  -0.0522 151 ALA Z O     
1178 C CB    . ALA A 151 ? 0.8965 0.8271 0.9423 0.0708  -0.0071 -0.0261 151 ALA Z CB    
1179 N N     . ASP A 152 ? 0.9399 0.8461 0.9978 0.0513  0.0389  -0.0279 152 ASP Z N     
1180 C CA    . ASP A 152 ? 0.9605 0.8689 1.0303 0.0465  0.0465  -0.0258 152 ASP Z CA    
1181 C C     . ASP A 152 ? 0.9466 0.8679 1.0198 0.0335  0.0498  -0.0498 152 ASP Z C     
1182 O O     . ASP A 152 ? 0.9433 0.8827 1.0272 0.0320  0.0415  -0.0554 152 ASP Z O     
1183 C CB    . ASP A 152 ? 0.9770 0.8597 1.0473 0.0459  0.0695  -0.0082 152 ASP Z CB    
1184 C CG    . ASP A 152 ? 1.0612 0.9344 1.1323 0.0582  0.0660  0.0207  152 ASP Z CG    
1185 O OD1   . ASP A 152 ? 1.0201 0.9071 1.0930 0.0659  0.0448  0.0280  152 ASP Z OD1   
1186 O OD2   . ASP A 152 ? 1.1693 1.0207 1.2383 0.0600  0.0847  0.0372  152 ASP Z OD2   
1187 N N     . ALA A 153 ? 0.9401 0.8504 1.0023 0.0238  0.0622  -0.0628 153 ALA Z N     
1188 C CA    . ALA A 153 ? 0.9345 0.8554 0.9974 0.0095  0.0658  -0.0839 153 ALA Z CA    
1189 C C     . ALA A 153 ? 0.9204 0.8724 0.9887 0.0090  0.0439  -0.0977 153 ALA Z C     
1190 O O     . ALA A 153 ? 0.8746 0.8462 0.9530 0.0029  0.0403  -0.1082 153 ALA Z O     
1191 C CB    . ALA A 153 ? 0.9402 0.8386 0.9847 -0.0015 0.0824  -0.0930 153 ALA Z CB    
1192 N N     . GLN A 154 ? 0.8660 0.8231 0.9282 0.0159  0.0298  -0.0968 154 GLN Z N     
1193 C CA    . GLN A 154 ? 0.8541 0.8409 0.9219 0.0167  0.0088  -0.1079 154 GLN Z CA    
1194 C C     . GLN A 154 ? 0.8347 0.8415 0.9173 0.0255  -0.0034 -0.1031 154 GLN Z C     
1195 O O     . GLN A 154 ? 0.8259 0.8567 0.9173 0.0217  -0.0113 -0.1145 154 GLN Z O     
1196 C CB    . GLN A 154 ? 0.8525 0.8391 0.9118 0.0241  -0.0042 -0.1050 154 GLN Z CB    
1197 C CG    . GLN A 154 ? 0.8406 0.8580 0.9060 0.0246  -0.0255 -0.1162 154 GLN Z CG    
1198 C CD    . GLN A 154 ? 0.8569 0.8872 0.9219 0.0079  -0.0235 -0.1345 154 GLN Z CD    
1199 O OE1   . GLN A 154 ? 0.8753 0.8885 0.9264 -0.0040 -0.0126 -0.1409 154 GLN Z OE1   
1200 N NE2   . GLN A 154 ? 0.8600 0.9195 0.9387 0.0065  -0.0334 -0.1418 154 GLN Z NE2   
1201 N N     . LEU A 155 ? 0.8656 0.8609 0.9492 0.0369  -0.0046 -0.0847 155 LEU Z N     
1202 C CA    . LEU A 155 ? 0.8487 0.8553 0.9411 0.0449  -0.0149 -0.0775 155 LEU Z CA    
1203 C C     . LEU A 155 ? 0.8493 0.8604 0.9517 0.0365  -0.0039 -0.0841 155 LEU Z C     
1204 O O     . LEU A 155 ? 0.8405 0.8713 0.9508 0.0379  -0.0127 -0.0906 155 LEU Z O     
1205 C CB    . LEU A 155 ? 0.8419 0.8305 0.9305 0.0554  -0.0163 -0.0540 155 LEU Z CB    
1206 C CG    . LEU A 155 ? 0.8372 0.8238 0.9166 0.0661  -0.0309 -0.0437 155 LEU Z CG    
1207 C CD1   . LEU A 155 ? 0.8582 0.8225 0.9335 0.0725  -0.0255 -0.0182 155 LEU Z CD1   
1208 C CD2   . LEU A 155 ? 0.8237 0.8305 0.9032 0.0744  -0.0536 -0.0464 155 LEU Z CD2   
1209 N N     . ALA A 156 ? 0.8961 0.8885 0.9980 0.0284  0.0158  -0.0819 156 ALA Z N     
1210 C CA    . ALA A 156 ? 0.8698 0.8651 0.9811 0.0191  0.0274  -0.0885 156 ALA Z CA    
1211 C C     . ALA A 156 ? 0.8869 0.9069 1.0027 0.0106  0.0224  -0.1087 156 ALA Z C     
1212 O O     . ALA A 156 ? 0.8814 0.9166 1.0080 0.0088  0.0209  -0.1135 156 ALA Z O     
1213 C CB    . ALA A 156 ? 0.8776 0.8486 0.9852 0.0108  0.0496  -0.0849 156 ALA Z CB    
1214 N N     . TYR A 157 ? 0.8936 0.9176 1.0011 0.0050  0.0196  -0.1191 157 TYR Z N     
1215 C CA    . TYR A 157 ? 0.8979 0.9470 1.0096 -0.0044 0.0135  -0.1356 157 TYR Z CA    
1216 C C     . TYR A 157 ? 0.8944 0.9713 1.0162 0.0055  -0.0052 -0.1365 157 TYR Z C     
1217 O O     . TYR A 157 ? 0.8894 0.9878 1.0222 0.0025  -0.0075 -0.1435 157 TYR Z O     
1218 C CB    . TYR A 157 ? 0.8744 0.9196 0.9728 -0.0142 0.0135  -0.1448 157 TYR Z CB    
1219 C CG    . TYR A 157 ? 0.8807 0.9550 0.9842 -0.0241 0.0040  -0.1587 157 TYR Z CG    
1220 C CD1   . TYR A 157 ? 0.9375 1.0190 1.0438 -0.0385 0.0124  -0.1677 157 TYR Z CD1   
1221 C CD2   . TYR A 157 ? 0.8761 0.9721 0.9824 -0.0193 -0.0139 -0.1615 157 TYR Z CD2   
1222 C CE1   . TYR A 157 ? 0.9461 1.0561 1.0580 -0.0482 0.0032  -0.1775 157 TYR Z CE1   
1223 C CE2   . TYR A 157 ? 0.9380 1.0627 1.0510 -0.0288 -0.0225 -0.1716 157 TYR Z CE2   
1224 C CZ    . TYR A 157 ? 0.9717 1.1034 1.0875 -0.0433 -0.0139 -0.1788 157 TYR Z CZ    
1225 O OH    . TYR A 157 ? 1.0318 1.1936 1.1550 -0.0533 -0.0227 -0.1861 157 TYR Z OH    
1226 N N     . LEU A 158 ? 0.8904 0.9666 1.0078 0.0178  -0.0182 -0.1288 158 LEU Z N     
1227 C CA    . LEU A 158 ? 0.8918 0.9913 1.0157 0.0285  -0.0359 -0.1287 158 LEU Z CA    
1228 C C     . LEU A 158 ? 0.8700 0.9728 1.0021 0.0346  -0.0348 -0.1235 158 LEU Z C     
1229 O O     . LEU A 158 ? 0.8992 1.0242 1.0388 0.0394  -0.0437 -0.1277 158 LEU Z O     
1230 C CB    . LEU A 158 ? 0.8683 0.9612 0.9836 0.0410  -0.0493 -0.1190 158 LEU Z CB    
1231 C CG    . LEU A 158 ? 0.8800 0.9735 0.9875 0.0372  -0.0547 -0.1246 158 LEU Z CG    
1232 C CD1   . LEU A 158 ? 0.8734 0.9651 0.9746 0.0511  -0.0706 -0.1147 158 LEU Z CD1   
1233 C CD2   . LEU A 158 ? 0.8815 1.0021 0.9955 0.0275  -0.0606 -0.1400 158 LEU Z CD2   
1234 N N     . ASN A 159 ? 0.8975 0.9777 1.0281 0.0342  -0.0230 -0.1136 159 ASN Z N     
1235 C CA    . ASN A 159 ? 0.9202 0.9997 1.0569 0.0383  -0.0211 -0.1079 159 ASN Z CA    
1236 C C     . ASN A 159 ? 0.9154 1.0064 1.0636 0.0274  -0.0099 -0.1189 159 ASN Z C     
1237 O O     . ASN A 159 ? 0.8951 0.9989 1.0508 0.0309  -0.0125 -0.1205 159 ASN Z O     
1238 C CB    . ASN A 159 ? 0.8719 0.9232 1.0029 0.0414  -0.0146 -0.0904 159 ASN Z CB    
1239 C CG    . ASN A 159 ? 0.9028 0.9502 1.0367 0.0454  -0.0149 -0.0827 159 ASN Z CG    
1240 O OD1   . ASN A 159 ? 0.9296 0.9631 1.0678 0.0391  -0.0023 -0.0770 159 ASN Z OD1   
1241 N ND2   . ASN A 159 ? 0.8818 0.9401 1.0123 0.0554  -0.0290 -0.0824 159 ASN Z ND2   
1242 N N     . LYS A 160 ? 0.9071 0.9925 1.0551 0.0143  0.0026  -0.1260 160 LYS Z N     
1243 C CA    . LYS A 160 ? 0.8966 0.9923 1.0540 0.0024  0.0128  -0.1361 160 LYS Z CA    
1244 C C     . LYS A 160 ? 0.9060 1.0329 1.0697 -0.0021 0.0046  -0.1489 160 LYS Z C     
1245 O O     . LYS A 160 ? 0.9072 1.0485 1.0800 -0.0107 0.0098  -0.1563 160 LYS Z O     
1246 C CB    . LYS A 160 ? 0.9100 0.9854 1.0615 -0.0105 0.0295  -0.1383 160 LYS Z CB    
1247 C CG    . LYS A 160 ? 0.9506 0.9981 1.1004 -0.0078 0.0410  -0.1245 160 LYS Z CG    
1248 C CD    . LYS A 160 ? 0.9322 0.9579 1.0737 -0.0187 0.0581  -0.1258 160 LYS Z CD    
1249 C CE    . LYS A 160 ? 0.9837 1.0168 1.1299 -0.0334 0.0682  -0.1386 160 LYS Z CE    
1250 N NZ    . LYS A 160 ? 1.0164 1.0237 1.1521 -0.0435 0.0865  -0.1387 160 LYS Z NZ    
1251 N N     . ALA A 161 ? 0.8667 1.0053 1.0265 0.0031  -0.0087 -0.1503 161 ALA Z N     
1252 C CA    . ALA A 161 ? 0.8719 1.0418 1.0389 -0.0016 -0.0173 -0.1600 161 ALA Z CA    
1253 C C     . ALA A 161 ? 0.8827 1.0745 1.0594 0.0122  -0.0285 -0.1570 161 ALA Z C     
1254 O O     . ALA A 161 ? 0.8815 1.1026 1.0682 0.0102  -0.0343 -0.1624 161 ALA Z O     
1255 C CB    . ALA A 161 ? 0.9012 1.0724 1.0589 -0.0061 -0.0247 -0.1638 161 ALA Z CB    
1256 N N     . GLY A 162 ? 0.8851 1.0615 1.0577 0.0260  -0.0311 -0.1470 162 GLY Z N     
1257 C CA    . GLY A 162 ? 0.8417 1.0317 1.0181 0.0402  -0.0406 -0.1432 162 GLY Z CA    
1258 C C     . GLY A 162 ? 0.8715 1.0689 1.0418 0.0507  -0.0562 -0.1408 162 GLY Z C     
1259 O O     . GLY A 162 ? 0.8695 1.0778 1.0405 0.0634  -0.0649 -0.1377 162 GLY Z O     
1260 N N     . ILE A 163 ? 0.9098 1.1001 1.0731 0.0456  -0.0594 -0.1423 163 ILE Z N     
1261 C CA    . ILE A 163 ? 0.8866 1.0836 1.0442 0.0543  -0.0748 -0.1406 163 ILE Z CA    
1262 C C     . ILE A 163 ? 0.8847 1.0616 1.0303 0.0695  -0.0819 -0.1281 163 ILE Z C     
1263 O O     . ILE A 163 ? 0.8843 1.0707 1.0266 0.0814  -0.0954 -0.1255 163 ILE Z O     
1264 C CB    . ILE A 163 ? 0.9047 1.0953 1.0559 0.0445  -0.0755 -0.1448 163 ILE Z CB    
1265 C CG1   . ILE A 163 ? 0.9074 1.1133 1.0656 0.0268  -0.0686 -0.1561 163 ILE Z CG1   
1266 C CG2   . ILE A 163 ? 0.8834 1.0839 1.0306 0.0529  -0.0925 -0.1439 163 ILE Z CG2   
1267 C CD1   . ILE A 163 ? 0.9065 1.1031 1.0549 0.0155  -0.0684 -0.1608 163 ILE Z CD1   
1268 N N     . VAL A 164 ? 0.9552 1.1043 1.0936 0.0685  -0.0730 -0.1194 164 VAL Z N     
1269 C CA    . VAL A 164 ? 0.9355 1.0634 1.0613 0.0803  -0.0790 -0.1049 164 VAL Z CA    
1270 C C     . VAL A 164 ? 0.9108 1.0233 1.0376 0.0782  -0.0673 -0.0989 164 VAL Z C     
1271 O O     . VAL A 164 ? 0.9090 1.0219 1.0455 0.0671  -0.0533 -0.1046 164 VAL Z O     
1272 C CB    . VAL A 164 ? 0.9162 1.0228 1.0304 0.0814  -0.0821 -0.0947 164 VAL Z CB    
1273 C CG1   . VAL A 164 ? 0.9223 1.0433 1.0355 0.0823  -0.0935 -0.1014 164 VAL Z CG1   
1274 C CG2   . VAL A 164 ? 0.8967 0.9849 1.0130 0.0702  -0.0649 -0.0924 164 VAL Z CG2   
1275 N N     . GLN A 165 ? 0.8674 1.1389 1.0881 0.1584  -0.0857 -0.1827 165 GLN Z N     
1276 C CA    . GLN A 165 ? 0.8785 1.1716 1.1132 0.1452  -0.0866 -0.1797 165 GLN Z CA    
1277 C C     . GLN A 165 ? 0.8547 1.1078 1.0927 0.1398  -0.0805 -0.1749 165 GLN Z C     
1278 O O     . GLN A 165 ? 0.8298 1.0907 1.0749 0.1234  -0.0815 -0.1709 165 GLN Z O     
1279 C CB    . GLN A 165 ? 0.8964 1.2248 1.1408 0.1594  -0.0855 -0.1846 165 GLN Z CB    
1280 C CG    . GLN A 165 ? 0.8948 1.2771 1.1397 0.1582  -0.0924 -0.1860 165 GLN Z CG    
1281 C CD    . GLN A 165 ? 0.9232 1.3076 1.1551 0.1674  -0.0945 -0.1899 165 GLN Z CD    
1282 O OE1   . GLN A 165 ? 0.9264 1.2806 1.1497 0.1849  -0.0889 -0.1944 165 GLN Z OE1   
1283 N NE2   . GLN A 165 ? 0.9214 1.3417 1.1523 0.1558  -0.1028 -0.1878 165 GLN Z NE2   
1284 N N     . ALA A 166 ? 0.8237 1.0348 1.0568 0.1540  -0.0736 -0.1748 166 ALA Z N     
1285 C CA    . ALA A 166 ? 0.8377 1.0101 1.0738 0.1507  -0.0673 -0.1689 166 ALA Z CA    
1286 C C     . ALA A 166 ? 0.8218 0.9457 1.0446 0.1592  -0.0625 -0.1642 166 ALA Z C     
1287 O O     . ALA A 166 ? 0.8220 0.9412 1.0350 0.1721  -0.0631 -0.1673 166 ALA Z O     
1288 C CB    . ALA A 166 ? 0.8167 0.9908 1.0678 0.1623  -0.0628 -0.1718 166 ALA Z CB    
1289 N N     . ILE A 167 ? 0.8376 0.9259 1.0591 0.1534  -0.0574 -0.1563 167 ILE Z N     
1290 C CA    . ILE A 167 ? 0.8228 0.8636 1.0310 0.1628  -0.0522 -0.1492 167 ILE Z CA    
1291 C C     . ILE A 167 ? 0.8477 0.8573 1.0659 0.1709  -0.0432 -0.1428 167 ILE Z C     
1292 O O     . ILE A 167 ? 0.8681 0.8749 1.0932 0.1585  -0.0414 -0.1385 167 ILE Z O     
1293 C CB    . ILE A 167 ? 0.8546 0.8757 1.0434 0.1467  -0.0558 -0.1420 167 ILE Z CB    
1294 C CG1   . ILE A 167 ? 0.8760 0.9221 1.0540 0.1397  -0.0659 -0.1473 167 ILE Z CG1   
1295 C CG2   . ILE A 167 ? 0.8935 0.8622 1.0669 0.1585  -0.0496 -0.1324 167 ILE Z CG2   
1296 C CD1   . ILE A 167 ? 0.9067 0.9359 1.0654 0.1216  -0.0717 -0.1411 167 ILE Z CD1   
1297 N N     . ILE A 168 ? 0.8447 0.8316 1.0642 0.1920  -0.0374 -0.1417 168 ILE Z N     
1298 C CA    . ILE A 168 ? 0.8733 0.8293 1.1038 0.2008  -0.0291 -0.1339 168 ILE Z CA    
1299 C C     . ILE A 168 ? 0.9388 0.8503 1.1544 0.2021  -0.0238 -0.1203 168 ILE Z C     
1300 O O     . ILE A 168 ? 0.9575 0.8490 1.1577 0.2144  -0.0227 -0.1176 168 ILE Z O     
1301 C CB    . ILE A 168 ? 0.9008 0.8537 1.1419 0.2236  -0.0250 -0.1382 168 ILE Z CB    
1302 C CG1   . ILE A 168 ? 0.8753 0.8704 1.1275 0.2241  -0.0303 -0.1509 168 ILE Z CG1   
1303 C CG2   . ILE A 168 ? 0.9024 0.8226 1.1570 0.2316  -0.0171 -0.1285 168 ILE Z CG2   
1304 C CD1   . ILE A 168 ? 0.8865 0.8807 1.1446 0.2466  -0.0270 -0.1566 168 ILE Z CD1   
1305 N N     . THR A 169 ? 0.9559 0.8519 1.1745 0.1907  -0.0203 -0.1114 169 THR Z N     
1306 C CA    . THR A 169 ? 0.9991 0.8533 1.2013 0.1916  -0.0149 -0.0967 169 THR Z CA    
1307 C C     . THR A 169 ? 1.0148 0.8549 1.2278 0.1840  -0.0089 -0.0872 169 THR Z C     
1308 O O     . THR A 169 ? 1.0047 0.8670 1.2383 0.1777  -0.0099 -0.0931 169 THR Z O     
1309 C CB    . THR A 169 ? 1.0121 0.8630 1.1876 0.1777  -0.0208 -0.0954 169 THR Z CB    
1310 O OG1   . THR A 169 ? 1.1058 0.9129 1.2613 0.1809  -0.0154 -0.0802 169 THR Z OG1   
1311 C CG2   . THR A 169 ? 1.0147 0.8961 1.1942 0.1534  -0.0261 -0.1010 169 THR Z CG2   
1312 N N     . GLU A 170 ? 1.0912 0.8938 1.2888 0.1860  -0.0029 -0.0721 170 GLU Z N     
1313 C CA    . GLU A 170 ? 1.0899 0.8775 1.2939 0.1785  0.0033  -0.0612 170 GLU Z CA    
1314 C C     . GLU A 170 ? 1.1445 0.9200 1.3222 0.1622  0.0029  -0.0547 170 GLU Z C     
1315 O O     . GLU A 170 ? 1.2314 1.0000 1.4100 0.1520  0.0075  -0.0476 170 GLU Z O     
1316 C CB    . GLU A 170 ? 1.1070 0.8594 1.3171 0.1971  0.0126  -0.0457 170 GLU Z CB    
1317 C CG    . GLU A 170 ? 1.1225 0.8820 1.3576 0.2141  0.0136  -0.0508 170 GLU Z CG    
1318 C CD    . GLU A 170 ? 1.1260 0.9096 1.3895 0.2065  0.0114  -0.0586 170 GLU Z CD    
1319 O OE1   . GLU A 170 ? 1.1099 0.8978 1.3766 0.1911  0.0117  -0.0561 170 GLU Z OE1   
1320 O OE2   . GLU A 170 ? 1.1092 0.9063 1.3902 0.2170  0.0092  -0.0674 170 GLU Z OE2   
1321 N N     . ASP A 171 ? 1.1935 0.9658 1.3468 0.1602  -0.0029 -0.0573 171 ASP Z N     
1322 C CA    . ASP A 171 ? 1.2108 0.9682 1.3349 0.1453  -0.0047 -0.0514 171 ASP Z CA    
1323 C C     . ASP A 171 ? 1.1652 0.9602 1.2944 0.1221  -0.0115 -0.0633 171 ASP Z C     
1324 O O     . ASP A 171 ? 1.1246 0.9534 1.2643 0.1189  -0.0192 -0.0765 171 ASP Z O     
1325 C CB    . ASP A 171 ? 1.2487 0.9820 1.3429 0.1542  -0.0094 -0.0482 171 ASP Z CB    
1326 C CG    . ASP A 171 ? 1.3143 1.0123 1.3730 0.1472  -0.0084 -0.0354 171 ASP Z CG    
1327 O OD1   . ASP A 171 ? 1.3151 1.0147 1.3718 0.1315  -0.0050 -0.0316 171 ASP Z OD1   
1328 O OD2   . ASP A 171 ? 1.3689 1.0364 1.3997 0.1585  -0.0112 -0.0292 171 ASP Z OD2   
1329 N N     . SER A 172 ? 1.2280 1.0179 1.3497 0.1068  -0.0079 -0.0579 172 SER Z N     
1330 C CA    . SER A 172 ? 1.1644 0.9883 1.2914 0.0854  -0.0126 -0.0675 172 SER Z CA    
1331 C C     . SER A 172 ? 1.1557 0.9790 1.2561 0.0722  -0.0210 -0.0692 172 SER Z C     
1332 O O     . SER A 172 ? 1.1261 0.9821 1.2321 0.0553  -0.0269 -0.0778 172 SER Z O     
1333 C CB    . SER A 172 ? 1.1637 0.9820 1.2932 0.0753  -0.0045 -0.0615 172 SER Z CB    
1334 O OG    . SER A 172 ? 1.2275 1.0050 1.3260 0.0747  0.0010  -0.0469 172 SER Z OG    
1335 N N     . ASP A 173 ? 1.1445 0.9300 1.2161 0.0807  -0.0221 -0.0603 173 ASP Z N     
1336 C CA    . ASP A 173 ? 1.1555 0.9323 1.1980 0.0699  -0.0316 -0.0608 173 ASP Z CA    
1337 C C     . ASP A 173 ? 1.1195 0.9370 1.1752 0.0627  -0.0431 -0.0748 173 ASP Z C     
1338 O O     . ASP A 173 ? 1.1360 0.9620 1.1776 0.0459  -0.0521 -0.0775 173 ASP Z O     
1339 C CB    . ASP A 173 ? 1.2362 0.9650 1.2477 0.0869  -0.0318 -0.0499 173 ASP Z CB    
1340 C CG    . ASP A 173 ? 1.2709 0.9576 1.2629 0.0934  -0.0209 -0.0332 173 ASP Z CG    
1341 O OD1   . ASP A 173 ? 1.3042 0.9487 1.2619 0.1033  -0.0218 -0.0222 173 ASP Z OD1   
1342 O OD2   . ASP A 173 ? 1.2587 0.9545 1.2688 0.0894  -0.0118 -0.0306 173 ASP Z OD2   
1343 N N     . LEU A 174 ? 1.0163 0.8588 1.0987 0.0758  -0.0429 -0.0828 174 LEU Z N     
1344 C CA    . LEU A 174 ? 0.9994 0.8838 1.0957 0.0719  -0.0526 -0.0953 174 LEU Z CA    
1345 C C     . LEU A 174 ? 1.0012 0.9234 1.1072 0.0483  -0.0572 -0.1007 174 LEU Z C     
1346 O O     . LEU A 174 ? 1.0055 0.9532 1.1101 0.0376  -0.0674 -0.1063 174 LEU Z O     
1347 C CB    . LEU A 174 ? 1.0069 0.9134 1.1308 0.0895  -0.0493 -0.1026 174 LEU Z CB    
1348 C CG    . LEU A 174 ? 0.9734 0.8584 1.0914 0.1132  -0.0484 -0.1020 174 LEU Z CG    
1349 C CD1   . LEU A 174 ? 0.9939 0.8805 1.0927 0.1116  -0.0592 -0.1059 174 LEU Z CD1   
1350 C CD2   . LEU A 174 ? 1.0313 0.8662 1.1359 0.1271  -0.0390 -0.0885 174 LEU Z CD2   
1351 N N     . LEU A 175 ? 0.9800 0.9058 1.0960 0.0407  -0.0495 -0.0982 175 LEU Z N     
1352 C CA    . LEU A 175 ? 0.9341 0.8951 1.0605 0.0205  -0.0520 -0.1026 175 LEU Z CA    
1353 C C     . LEU A 175 ? 0.9500 0.8992 1.0504 0.0012  -0.0583 -0.0983 175 LEU Z C     
1354 O O     . LEU A 175 ? 0.9423 0.9251 1.0494 -0.0147 -0.0657 -0.1028 175 LEU Z O     
1355 C CB    . LEU A 175 ? 0.9625 0.9247 1.1027 0.0189  -0.0416 -0.1007 175 LEU Z CB    
1356 C CG    . LEU A 175 ? 0.9446 0.9247 1.1137 0.0347  -0.0377 -0.1064 175 LEU Z CG    
1357 C CD1   . LEU A 175 ? 0.8493 0.8231 1.0285 0.0333  -0.0283 -0.1034 175 LEU Z CD1   
1358 C CD2   . LEU A 175 ? 0.8861 0.9167 1.0764 0.0337  -0.0450 -0.1172 175 LEU Z CD2   
1359 N N     . ALA A 176 ? 0.9408 0.8414 1.0106 0.0032  -0.0556 -0.0886 176 ALA Z N     
1360 C CA    . ALA A 176 ? 0.9323 0.8137 0.9720 -0.0141 -0.0620 -0.0837 176 ALA Z CA    
1361 C C     . ALA A 176 ? 0.9601 0.8464 0.9896 -0.0162 -0.0765 -0.0876 176 ALA Z C     
1362 O O     . ALA A 176 ? 0.9905 0.8728 1.0014 -0.0338 -0.0856 -0.0861 176 ALA Z O     
1363 C CB    . ALA A 176 ? 0.9456 0.7713 0.9520 -0.0085 -0.0549 -0.0712 176 ALA Z CB    
1364 N N     . PHE A 177 ? 0.9866 0.8813 1.0281 0.0017  -0.0788 -0.0926 177 PHE Z N     
1365 C CA    . PHE A 177 ? 1.0025 0.9046 1.0365 0.0022  -0.0922 -0.0973 177 PHE Z CA    
1366 C C     . PHE A 177 ? 0.9542 0.9156 1.0159 -0.0101 -0.0997 -0.1065 177 PHE Z C     
1367 O O     . PHE A 177 ? 0.9937 0.9706 1.0532 -0.0130 -0.1117 -0.1106 177 PHE Z O     
1368 C CB    . PHE A 177 ? 0.9780 0.8606 1.0097 0.0289  -0.0904 -0.0982 177 PHE Z CB    
1369 C CG    . PHE A 177 ? 0.9914 0.8142 0.9881 0.0412  -0.0885 -0.0879 177 PHE Z CG    
1370 C CD1   . PHE A 177 ? 1.0249 0.8230 0.9922 0.0408  -0.1007 -0.0866 177 PHE Z CD1   
1371 C CD2   . PHE A 177 ? 0.9800 0.7712 0.9726 0.0541  -0.0752 -0.0787 177 PHE Z CD2   
1372 C CE1   . PHE A 177 ? 1.0336 0.7748 0.9658 0.0548  -0.0993 -0.0763 177 PHE Z CE1   
1373 C CE2   . PHE A 177 ? 1.0433 0.7800 1.0026 0.0674  -0.0730 -0.0672 177 PHE Z CE2   
1374 C CZ    . PHE A 177 ? 1.0449 0.7559 0.9728 0.0687  -0.0849 -0.0660 177 PHE Z CZ    
1375 N N     . GLY A 178 ? 0.9623 0.9574 1.0498 -0.0161 -0.0929 -0.1090 178 GLY Z N     
1376 C CA    . GLY A 178 ? 0.9565 1.0087 1.0698 -0.0267 -0.0987 -0.1155 178 GLY Z CA    
1377 C C     . GLY A 178 ? 0.9455 1.0299 1.0833 -0.0084 -0.0971 -0.1231 178 GLY Z C     
1378 O O     . GLY A 178 ? 0.9640 1.0909 1.1159 -0.0116 -0.1048 -0.1280 178 GLY Z O     
1379 N N     . CYS A 179 ? 0.9352 0.9994 1.0775 0.0108  -0.0870 -0.1234 179 CYS Z N     
1380 C CA    . CYS A 179 ? 0.9336 1.0241 1.0973 0.0291  -0.0845 -0.1306 179 CYS Z CA    
1381 C C     . CYS A 179 ? 0.8902 1.0281 1.0800 0.0237  -0.0831 -0.1347 179 CYS Z C     
1382 O O     . CYS A 179 ? 0.9094 1.0499 1.1036 0.0115  -0.0791 -0.1318 179 CYS Z O     
1383 C CB    . CYS A 179 ? 0.9220 0.9764 1.0847 0.0496  -0.0743 -0.1285 179 CYS Z CB    
1384 S SG    . CYS A 179 ? 1.2212 1.2316 1.3604 0.0678  -0.0755 -0.1257 179 CYS Z SG    
1385 N N     . LYS A 180 ? 0.8810 1.0557 1.0862 0.0346  -0.0862 -0.1414 180 LYS Z N     
1386 C CA    . LYS A 180 ? 0.8707 1.0913 1.0987 0.0337  -0.0856 -0.1449 180 LYS Z CA    
1387 C C     . LYS A 180 ? 0.8217 1.0330 1.0617 0.0504  -0.0768 -0.1477 180 LYS Z C     
1388 O O     . LYS A 180 ? 0.8487 1.0681 1.0998 0.0458  -0.0726 -0.1471 180 LYS Z O     
1389 C CB    . LYS A 180 ? 0.8473 1.1137 1.0837 0.0380  -0.0935 -0.1495 180 LYS Z CB    
1390 C CG    . LYS A 180 ? 0.9033 1.2037 1.1419 0.0170  -0.1025 -0.1460 180 LYS Z CG    
1391 C CD    . LYS A 180 ? 0.9028 1.1697 1.1207 0.0003  -0.1074 -0.1410 180 LYS Z CD    
1392 C CE    . LYS A 180 ? 0.9377 1.2371 1.1601 -0.0230 -0.1164 -0.1366 180 LYS Z CE    
1393 N NZ    . LYS A 180 ? 0.9878 1.2503 1.1877 -0.0404 -0.1216 -0.1315 180 LYS Z NZ    
1394 N N     . LYS A 181 ? 0.8480 1.0417 1.0858 0.0699  -0.0744 -0.1508 181 LYS Z N     
1395 C CA    . LYS A 181 ? 0.8380 1.0203 1.0873 0.0861  -0.0675 -0.1533 181 LYS Z CA    
1396 C C     . LYS A 181 ? 0.8155 0.9482 1.0547 0.0979  -0.0614 -0.1496 181 LYS Z C     
1397 O O     . LYS A 181 ? 0.8340 0.9555 1.0642 0.1095  -0.0626 -0.1509 181 LYS Z O     
1398 C CB    . LYS A 181 ? 0.8290 1.0462 1.0896 0.1019  -0.0702 -0.1609 181 LYS Z CB    
1399 C CG    . LYS A 181 ? 0.8505 1.1182 1.1225 0.0942  -0.0753 -0.1628 181 LYS Z CG    
1400 C CD    . LYS A 181 ? 0.8549 1.1544 1.1337 0.1124  -0.0777 -0.1692 181 LYS Z CD    
1401 C CE    . LYS A 181 ? 0.8710 1.2211 1.1606 0.1071  -0.0822 -0.1690 181 LYS Z CE    
1402 N NZ    . LYS A 181 ? 0.8919 1.2711 1.1851 0.1271  -0.0841 -0.1742 181 LYS Z NZ    
1403 N N     . VAL A 182 ? 0.8132 0.9173 1.0546 0.0960  -0.0545 -0.1443 182 VAL Z N     
1404 C CA    . VAL A 182 ? 0.8157 0.8736 1.0500 0.1076  -0.0478 -0.1382 182 VAL Z CA    
1405 C C     . VAL A 182 ? 0.8267 0.8778 1.0790 0.1209  -0.0426 -0.1395 182 VAL Z C     
1406 O O     . VAL A 182 ? 0.8051 0.8640 1.0690 0.1143  -0.0409 -0.1397 182 VAL Z O     
1407 C CB    . VAL A 182 ? 0.8234 0.8468 1.0415 0.0950  -0.0438 -0.1279 182 VAL Z CB    
1408 C CG1   . VAL A 182 ? 0.8564 0.8340 1.0685 0.1091  -0.0362 -0.1194 182 VAL Z CG1   
1409 C CG2   . VAL A 182 ? 0.8819 0.9061 1.0796 0.0822  -0.0505 -0.1264 182 VAL Z CG2   
1410 N N     . ILE A 183 ? 0.8056 0.8417 1.0602 0.1398  -0.0403 -0.1405 183 ILE Z N     
1411 C CA    . ILE A 183 ? 0.7950 0.8204 1.0664 0.1527  -0.0363 -0.1410 183 ILE Z CA    
1412 C C     . ILE A 183 ? 0.8250 0.8046 1.0942 0.1575  -0.0283 -0.1292 183 ILE Z C     
1413 O O     . ILE A 183 ? 0.8323 0.7871 1.0930 0.1700  -0.0250 -0.1246 183 ILE Z O     
1414 C CB    . ILE A 183 ? 0.7953 0.8331 1.0721 0.1718  -0.0382 -0.1489 183 ILE Z CB    
1415 C CG1   . ILE A 183 ? 0.8024 0.8873 1.0798 0.1688  -0.0457 -0.1588 183 ILE Z CG1   
1416 C CG2   . ILE A 183 ? 0.8195 0.8436 1.1131 0.1841  -0.0353 -0.1491 183 ILE Z CG2   
1417 C CD1   . ILE A 183 ? 0.7940 0.8931 1.0721 0.1879  -0.0472 -0.1667 183 ILE Z CD1   
1418 N N     . LEU A 184 ? 0.8929 0.8621 1.1697 0.1487  -0.0249 -0.1238 184 LEU Z N     
1419 C CA    . LEU A 184 ? 0.8826 0.8111 1.1580 0.1522  -0.0170 -0.1107 184 LEU Z CA    
1420 C C     . LEU A 184 ? 0.9406 0.8585 1.2379 0.1650  -0.0146 -0.1097 184 LEU Z C     
1421 O O     . LEU A 184 ? 0.9345 0.8755 1.2474 0.1664  -0.0193 -0.1191 184 LEU Z O     
1422 C CB    . LEU A 184 ? 0.8389 0.7602 1.1073 0.1347  -0.0140 -0.1040 184 LEU Z CB    
1423 C CG    . LEU A 184 ? 0.8965 0.8212 1.1415 0.1197  -0.0160 -0.1027 184 LEU Z CG    
1424 C CD1   . LEU A 184 ? 0.9250 0.8461 1.1658 0.1033  -0.0122 -0.0978 184 LEU Z CD1   
1425 C CD2   . LEU A 184 ? 0.9530 0.8448 1.1755 0.1271  -0.0138 -0.0936 184 LEU Z CD2   
1426 N N     . LYS A 185 ? 1.0983 0.9919 0.9126 0.0017  -0.0953 -0.1580 185 LYS Z N     
1427 C CA    . LYS A 185 ? 1.1173 1.0304 0.9520 -0.0077 -0.1080 -0.1771 185 LYS Z CA    
1428 C C     . LYS A 185 ? 1.1004 0.9950 0.9669 -0.0182 -0.1189 -0.1797 185 LYS Z C     
1429 O O     . LYS A 185 ? 1.1785 1.0735 1.0488 -0.0016 -0.1235 -0.1976 185 LYS Z O     
1430 C CB    . LYS A 185 ? 1.1753 1.1123 0.9918 0.0191  -0.1066 -0.2014 185 LYS Z CB    
1431 C CG    . LYS A 185 ? 1.2037 1.1606 0.9881 0.0312  -0.0959 -0.2007 185 LYS Z CG    
1432 C CD    . LYS A 185 ? 1.3521 1.3333 1.1208 0.0554  -0.0959 -0.2255 185 LYS Z CD    
1433 C CE    . LYS A 185 ? 1.4932 1.4939 1.2298 0.0669  -0.0851 -0.2244 185 LYS Z CE    
1434 N NZ    . LYS A 185 ? 1.6125 1.6263 1.3521 0.0420  -0.0860 -0.2120 185 LYS Z NZ    
1435 N N     . MET A 186 ? 1.1172 0.9944 1.0054 -0.0457 -0.1235 -0.1620 186 MET Z N     
1436 C CA    . MET A 186 ? 1.1404 0.9993 1.0599 -0.0585 -0.1343 -0.1628 186 MET Z CA    
1437 C C     . MET A 186 ? 1.1775 1.0492 1.1245 -0.0886 -0.1484 -0.1656 186 MET Z C     
1438 O O     . MET A 186 ? 1.1468 1.0210 1.0977 -0.1116 -0.1481 -0.1508 186 MET Z O     
1439 C CB    . MET A 186 ? 1.1219 0.9466 1.0481 -0.0658 -0.1293 -0.1398 186 MET Z CB    
1440 C CG    . MET A 186 ? 1.1530 0.9563 1.1087 -0.0740 -0.1387 -0.1409 186 MET Z CG    
1441 S SD    . MET A 186 ? 1.0742 0.8391 1.0440 -0.0917 -0.1350 -0.1111 186 MET Z SD    
1442 C CE    . MET A 186 ? 1.1148 0.8865 1.0974 -0.1304 -0.1417 -0.0975 186 MET Z CE    
1443 N N     . ASP A 187 ? 1.1575 1.0368 1.1233 -0.0882 -0.1610 -0.1841 187 ASP Z N     
1444 C CA    . ASP A 187 ? 1.1603 1.0524 1.1548 -0.1161 -0.1758 -0.1874 187 ASP Z CA    
1445 C C     . ASP A 187 ? 1.1468 1.0129 1.1704 -0.1411 -0.1831 -0.1732 187 ASP Z C     
1446 O O     . ASP A 187 ? 1.1182 0.9565 1.1394 -0.1375 -0.1762 -0.1596 187 ASP Z O     
1447 C CB    . ASP A 187 ? 1.1568 1.0674 1.1599 -0.1060 -0.1882 -0.2127 187 ASP Z CB    
1448 C CG    . ASP A 187 ? 1.2199 1.1114 1.2213 -0.0829 -0.1900 -0.2246 187 ASP Z CG    
1449 O OD1   . ASP A 187 ? 1.2133 1.0761 1.2212 -0.0840 -0.1867 -0.2127 187 ASP Z OD1   
1450 O OD2   . ASP A 187 ? 1.2642 1.1690 1.2578 -0.0633 -0.1949 -0.2458 187 ASP Z OD2   
1451 N N     . GLN A 188 ? 1.2388 1.1145 1.2908 -0.1667 -0.1975 -0.1761 188 GLN Z N     
1452 C CA    . GLN A 188 ? 1.2508 1.1047 1.3322 -0.1938 -0.2059 -0.1631 188 GLN Z CA    
1453 C C     . GLN A 188 ? 1.2621 1.0954 1.3594 -0.1859 -0.2139 -0.1719 188 GLN Z C     
1454 O O     . GLN A 188 ? 1.2546 1.0691 1.3778 -0.2068 -0.2221 -0.1635 188 GLN Z O     
1455 C CB    . GLN A 188 ? 1.2667 1.1397 1.3730 -0.2238 -0.2186 -0.1632 188 GLN Z CB    
1456 C CG    . GLN A 188 ? 1.3080 1.2102 1.4216 -0.2177 -0.2304 -0.1858 188 GLN Z CG    
1457 C CD    . GLN A 188 ? 1.3668 1.2883 1.5076 -0.2479 -0.2432 -0.1841 188 GLN Z CD    
1458 O OE1   . GLN A 188 ? 1.3574 1.2650 1.5246 -0.2734 -0.2517 -0.1741 188 GLN Z OE1   
1459 N NE2   . GLN A 188 ? 1.4194 1.3734 1.5546 -0.2450 -0.2446 -0.1933 188 GLN Z NE2   
1460 N N     . PHE A 189 ? 1.2490 1.0849 1.3296 -0.1552 -0.2114 -0.1887 189 PHE Z N     
1461 C CA    . PHE A 189 ? 1.2722 1.0890 1.3638 -0.1437 -0.2186 -0.1988 189 PHE Z CA    
1462 C C     . PHE A 189 ? 1.2644 1.0557 1.3378 -0.1198 -0.2041 -0.1907 189 PHE Z C     
1463 O O     . PHE A 189 ? 1.2971 1.0641 1.3828 -0.1166 -0.2072 -0.1894 189 PHE Z O     
1464 C CB    . PHE A 189 ? 1.3434 1.1791 1.4319 -0.1266 -0.2290 -0.2249 189 PHE Z CB    
1465 C CG    . PHE A 189 ? 1.3648 1.2271 1.4728 -0.1484 -0.2440 -0.2330 189 PHE Z CG    
1466 C CD1   . PHE A 189 ? 1.3667 1.2237 1.5085 -0.1774 -0.2593 -0.2291 189 PHE Z CD1   
1467 C CD2   . PHE A 189 ? 1.3490 1.2418 1.4423 -0.1399 -0.2431 -0.2440 189 PHE Z CD2   
1468 C CE1   . PHE A 189 ? 1.3595 1.2416 1.5207 -0.1974 -0.2733 -0.2354 189 PHE Z CE1   
1469 C CE2   . PHE A 189 ? 1.3697 1.2875 1.4826 -0.1596 -0.2567 -0.2501 189 PHE Z CE2   
1470 C CZ    . PHE A 189 ? 1.3773 1.2900 1.5244 -0.1883 -0.2719 -0.2455 189 PHE Z CZ    
1471 N N     . GLY A 190 ? 1.2109 1.0078 1.2552 -0.1027 -0.1885 -0.1848 190 GLY Z N     
1472 C CA    . GLY A 190 ? 1.1633 0.9379 1.1901 -0.0804 -0.1741 -0.1749 190 GLY Z CA    
1473 C C     . GLY A 190 ? 1.1653 0.9516 1.1600 -0.0446 -0.1638 -0.1885 190 GLY Z C     
1474 O O     . GLY A 190 ? 1.1744 0.9452 1.1520 -0.0236 -0.1508 -0.1805 190 GLY Z O     
1475 N N     . ASN A 191 ? 1.1610 0.9744 1.1481 -0.0379 -0.1700 -0.2087 191 ASN Z N     
1476 C CA    . ASN A 191 ? 1.1479 0.9744 1.1046 -0.0049 -0.1617 -0.2237 191 ASN Z CA    
1477 C C     . ASN A 191 ? 1.1600 0.9965 1.0905 0.0013  -0.1465 -0.2119 191 ASN Z C     
1478 O O     . ASN A 191 ? 1.1535 1.0092 1.0835 -0.0161 -0.1476 -0.2076 191 ASN Z O     
1479 C CB    . ASN A 191 ? 1.2121 1.0644 1.1703 -0.0019 -0.1742 -0.2480 191 ASN Z CB    
1480 C CG    . ASN A 191 ? 1.2614 1.1046 1.2463 -0.0110 -0.1918 -0.2593 191 ASN Z CG    
1481 O OD1   . ASN A 191 ? 1.2631 1.0805 1.2546 -0.0031 -0.1923 -0.2576 191 ASN Z OD1   
1482 N ND2   . ASN A 191 ? 1.2869 1.1513 1.2879 -0.0277 -0.2067 -0.2703 191 ASN Z ND2   
1483 N N     . GLY A 192 ? 1.1913 1.0147 1.0999 0.0264  -0.1325 -0.2061 192 GLY Z N     
1484 C CA    . GLY A 192 ? 1.1511 0.9806 1.0347 0.0328  -0.1186 -0.1932 192 GLY Z CA    
1485 C C     . GLY A 192 ? 1.1187 0.9541 0.9705 0.0687  -0.1067 -0.2028 192 GLY Z C     
1486 O O     . GLY A 192 ? 1.1394 0.9717 0.9867 0.0913  -0.1080 -0.2194 192 GLY Z O     
1487 N N     . LEU A 193 ? 1.1712 1.0144 0.9996 0.0739  -0.0954 -0.1921 193 LEU Z N     
1488 C CA    . LEU A 193 ? 1.1440 0.9935 0.9409 0.1066  -0.0832 -0.1987 193 LEU Z CA    
1489 C C     . LEU A 193 ? 1.1446 0.9758 0.9291 0.1115  -0.0704 -0.1742 193 LEU Z C     
1490 O O     . LEU A 193 ? 1.1383 0.9738 0.9148 0.0975  -0.0670 -0.1593 193 LEU Z O     
1491 C CB    . LEU A 193 ? 1.1571 1.0391 0.9337 0.1114  -0.0827 -0.2129 193 LEU Z CB    
1492 C CG    . LEU A 193 ? 1.1517 1.0444 0.8942 0.1440  -0.0710 -0.2218 193 LEU Z CG    
1493 C CD1   . LEU A 193 ? 1.1805 1.0701 0.9191 0.1707  -0.0726 -0.2430 193 LEU Z CD1   
1494 C CD2   . LEU A 193 ? 1.1535 1.0772 0.8783 0.1420  -0.0702 -0.2300 193 LEU Z CD2   
1495 N N     . GLU A 194 ? 1.1399 0.9499 0.9226 0.1316  -0.0635 -0.1695 194 GLU Z N     
1496 C CA    . GLU A 194 ? 1.1135 0.9031 0.8894 0.1354  -0.0527 -0.1442 194 GLU Z CA    
1497 C C     . GLU A 194 ? 1.1236 0.9217 0.8663 0.1655  -0.0397 -0.1456 194 GLU Z C     
1498 O O     . GLU A 194 ? 1.1492 0.9564 0.8781 0.1923  -0.0365 -0.1647 194 GLU Z O     
1499 C CB    . GLU A 194 ? 1.1212 0.8807 0.9183 0.1373  -0.0524 -0.1337 194 GLU Z CB    
1500 C CG    . GLU A 194 ? 1.1370 0.8741 0.9290 0.1444  -0.0413 -0.1074 194 GLU Z CG    
1501 C CD    . GLU A 194 ? 1.1859 0.8937 1.0019 0.1440  -0.0414 -0.0958 194 GLU Z CD    
1502 O OE1   . GLU A 194 ? 1.2198 0.9143 1.0279 0.1683  -0.0310 -0.0881 194 GLU Z OE1   
1503 O OE2   . GLU A 194 ? 1.1983 0.8963 1.0415 0.1193  -0.0518 -0.0938 194 GLU Z OE2   
1504 N N     . ILE A 195 ? 1.1548 0.9490 0.8843 0.1609  -0.0329 -0.1250 195 ILE Z N     
1505 C CA    . ILE A 195 ? 1.1241 0.9234 0.8233 0.1876  -0.0207 -0.1220 195 ILE Z CA    
1506 C C     . ILE A 195 ? 1.1443 0.9162 0.8457 0.1898  -0.0133 -0.0936 195 ILE Z C     
1507 O O     . ILE A 195 ? 1.1536 0.9126 0.8634 0.1664  -0.0159 -0.0721 195 ILE Z O     
1508 C CB    . ILE A 195 ? 1.0943 0.9178 0.7694 0.1834  -0.0194 -0.1247 195 ILE Z CB    
1509 C CG1   . ILE A 195 ? 1.1131 0.9657 0.7847 0.1845  -0.0258 -0.1528 195 ILE Z CG1   
1510 C CG2   . ILE A 195 ? 1.0775 0.9036 0.7221 0.2092  -0.0074 -0.1185 195 ILE Z CG2   
1511 C CD1   . ILE A 195 ? 1.1173 0.9952 0.7645 0.1832  -0.0235 -0.1567 195 ILE Z CD1   
1512 N N     . ASP A 196 ? 1.1077 0.9231 0.9765 0.0805  0.0316  -0.1969 196 ASP Z N     
1513 C CA    . ASP A 196 ? 1.1300 0.9365 0.9978 0.0799  0.0463  -0.1840 196 ASP Z CA    
1514 C C     . ASP A 196 ? 1.1564 0.9575 0.9818 0.0856  0.0499  -0.1736 196 ASP Z C     
1515 O O     . ASP A 196 ? 1.1881 0.9880 0.9759 0.0939  0.0462  -0.1807 196 ASP Z O     
1516 C CB    . ASP A 196 ? 1.1605 0.9578 1.0336 0.0829  0.0605  -0.1974 196 ASP Z CB    
1517 C CG    . ASP A 196 ? 1.2026 1.0018 1.1291 0.0764  0.0612  -0.2022 196 ASP Z CG    
1518 O OD1   . ASP A 196 ? 1.1855 0.9934 1.1406 0.0701  0.0492  -0.1974 196 ASP Z OD1   
1519 O OD2   . ASP A 196 ? 1.2469 1.0387 1.1884 0.0778  0.0750  -0.2098 196 ASP Z OD2   
1520 N N     . GLN A 197 ? 1.1764 0.9748 1.0102 0.0811  0.0567  -0.1568 197 GLN Z N     
1521 C CA    . GLN A 197 ? 1.2026 0.9935 1.0039 0.0851  0.0622  -0.1463 197 GLN Z CA    
1522 C C     . GLN A 197 ? 1.1723 0.9510 0.9411 0.0940  0.0765  -0.1520 197 GLN Z C     
1523 O O     . GLN A 197 ? 1.1753 0.9485 0.9054 0.1022  0.0769  -0.1497 197 GLN Z O     
1524 C CB    . GLN A 197 ? 1.1338 0.9249 0.9568 0.0768  0.0668  -0.1304 197 GLN Z CB    
1525 C CG    . GLN A 197 ? 1.1407 0.9220 0.9376 0.0794  0.0741  -0.1206 197 GLN Z CG    
1526 C CD    . GLN A 197 ? 1.2213 1.0023 1.0430 0.0707  0.0809  -0.1094 197 GLN Z CD    
1527 O OE1   . GLN A 197 ? 1.2447 1.0293 1.0971 0.0660  0.0859  -0.1090 197 GLN Z OE1   
1528 N NE2   . GLN A 197 ? 1.2452 1.0227 1.0566 0.0685  0.0807  -0.1010 197 GLN Z NE2   
1529 N N     . ALA A 198 ? 1.1311 0.9058 0.9164 0.0931  0.0891  -0.1584 198 ALA Z N     
1530 C CA    . ALA A 198 ? 1.1643 0.9283 0.9200 0.1011  0.1062  -0.1637 198 ALA Z CA    
1531 C C     . ALA A 198 ? 1.1948 0.9591 0.9071 0.1113  0.1000  -0.1776 198 ALA Z C     
1532 O O     . ALA A 198 ? 1.2258 0.9822 0.8966 0.1201  0.1098  -0.1751 198 ALA Z O     
1533 C CB    . ALA A 198 ? 1.1671 0.9294 0.9537 0.0984  0.1202  -0.1718 198 ALA Z CB    
1534 N N     . ARG A 199 ? 1.2113 0.9859 0.9342 0.1102  0.0832  -0.1912 199 ARG Z N     
1535 C CA    . ARG A 199 ? 1.2418 1.0207 0.9285 0.1190  0.0736  -0.2072 199 ARG Z CA    
1536 C C     . ARG A 199 ? 1.2487 1.0327 0.9089 0.1242  0.0587  -0.1979 199 ARG Z C     
1537 O O     . ARG A 199 ? 1.2648 1.0568 0.9009 0.1310  0.0456  -0.2100 199 ARG Z O     
1538 C CB    . ARG A 199 ? 1.2601 1.0481 0.9757 0.1147  0.0627  -0.2292 199 ARG Z CB    
1539 C CG    . ARG A 199 ? 1.2786 1.0607 1.0165 0.1124  0.0777  -0.2434 199 ARG Z CG    
1540 C CD    . ARG A 199 ? 1.2818 1.0709 1.0491 0.1085  0.0666  -0.2669 199 ARG Z CD    
1541 N NE    . ARG A 199 ? 1.2656 1.0632 1.0752 0.0995  0.0520  -0.2582 199 ARG Z NE    
1542 C CZ    . ARG A 199 ? 1.3008 1.1041 1.1485 0.0937  0.0427  -0.2730 199 ARG Z CZ    
1543 N NH1   . ARG A 199 ? 1.3442 1.1451 1.1940 0.0956  0.0454  -0.3000 199 ARG Z NH1   
1544 N NH2   . ARG A 199 ? 1.2127 1.0239 1.0966 0.0858  0.0317  -0.2611 199 ARG Z NH2   
1545 N N     . LEU A 200 ? 1.2973 1.0775 0.9631 0.1214  0.0605  -0.1777 200 LEU Z N     
1546 C CA    . LEU A 200 ? 1.2861 1.0693 0.9293 0.1274  0.0491  -0.1683 200 LEU Z CA    
1547 C C     . LEU A 200 ? 1.3458 1.1217 0.9372 0.1410  0.0540  -0.1654 200 LEU Z C     
1548 O O     . LEU A 200 ? 1.3684 1.1485 0.9367 0.1493  0.0424  -0.1609 200 LEU Z O     
1549 C CB    . LEU A 200 ? 1.2273 1.0061 0.8878 0.1212  0.0523  -0.1497 200 LEU Z CB    
1550 C CG    . LEU A 200 ? 1.2301 1.0208 0.9310 0.1105  0.0412  -0.1492 200 LEU Z CG    
1551 C CD1   . LEU A 200 ? 1.1622 0.9488 0.8721 0.1052  0.0449  -0.1332 200 LEU Z CD1   
1552 C CD2   . LEU A 200 ? 1.1735 0.9785 0.8746 0.1135  0.0229  -0.1584 200 LEU Z CD2   
1553 N N     . GLY A 201 ? 1.2993 1.0651 0.8734 0.1437  0.0720  -0.1668 201 GLY Z N     
1554 C CA    . GLY A 201 ? 1.3763 1.1356 0.8980 0.1568  0.0791  -0.1630 201 GLY Z CA    
1555 C C     . GLY A 201 ? 1.4026 1.1742 0.8954 0.1649  0.0652  -0.1831 201 GLY Z C     
1556 O O     . GLY A 201 ? 1.4291 1.1995 0.8731 0.1773  0.0662  -0.1800 201 GLY Z O     
1557 N N     . MET A 202 ? 1.3708 1.1548 0.8943 0.1579  0.0517  -0.2035 202 MET Z N     
1558 C CA    . MET A 202 ? 1.3895 1.1870 0.8924 0.1635  0.0360  -0.2266 202 MET Z CA    
1559 C C     . MET A 202 ? 1.4337 1.2445 0.9231 0.1704  0.0128  -0.2225 202 MET Z C     
1560 O O     . MET A 202 ? 1.5330 1.3582 1.0041 0.1760  -0.0041 -0.2402 202 MET Z O     
1561 C CB    . MET A 202 ? 1.3295 1.1343 0.8768 0.1527  0.0308  -0.2503 202 MET Z CB    
1562 C CG    . MET A 202 ? 1.3936 1.1877 0.9526 0.1486  0.0525  -0.2595 202 MET Z CG    
1563 S SD    . MET A 202 ? 1.4173 1.2176 1.0321 0.1373  0.0466  -0.2871 202 MET Z SD    
1564 C CE    . MET A 202 ? 1.4665 1.2835 1.0530 0.1436  0.0230  -0.3157 202 MET Z CE    
1565 N N     . CYS A 203 ? 1.4260 1.2328 0.9263 0.1701  0.0119  -0.2004 203 CYS Z N     
1566 C CA    . CYS A 203 ? 1.4575 1.2760 0.9505 0.1773  -0.0078 -0.1942 203 CYS Z CA    
1567 C C     . CYS A 203 ? 1.5223 1.3331 0.9664 0.1924  -0.0039 -0.1751 203 CYS Z C     
1568 O O     . CYS A 203 ? 1.5020 1.2960 0.9432 0.1931  0.0119  -0.1536 203 CYS Z O     
1569 C CB    . CYS A 203 ? 1.4126 1.2325 0.9492 0.1683  -0.0110 -0.1832 203 CYS Z CB    
1570 S SG    . CYS A 203 ? 1.3125 1.1407 0.9077 0.1509  -0.0140 -0.1989 203 CYS Z SG    
1571 N N     . ARG A 204 ? 1.4751 1.2986 0.8821 0.2045  -0.0190 -0.1829 204 ARG Z N     
1572 C CA    . ARG A 204 ? 1.5624 1.3802 0.9187 0.2208  -0.0169 -0.1635 204 ARG Z CA    
1573 C C     . ARG A 204 ? 1.5337 1.3465 0.9013 0.2261  -0.0202 -0.1391 204 ARG Z C     
1574 O O     . ARG A 204 ? 1.5630 1.3573 0.9121 0.2322  -0.0040 -0.1156 204 ARG Z O     
1575 C CB    . ARG A 204 ? 1.6151 1.4529 0.9323 0.2325  -0.0376 -0.1782 204 ARG Z CB    
1576 C CG    . ARG A 204 ? 1.7407 1.5744 1.0002 0.2509  -0.0359 -0.1564 204 ARG Z CG    
1577 C CD    . ARG A 204 ? 1.8024 1.6121 1.0348 0.2517  -0.0047 -0.1413 204 ARG Z CD    
1578 N NE    . ARG A 204 ? 1.9595 1.7583 1.1512 0.2673  0.0024  -0.1102 204 ARG Z NE    
1579 C CZ    . ARG A 204 ? 2.0402 1.8149 1.2213 0.2679  0.0304  -0.0876 204 ARG Z CZ    
1580 N NH1   . ARG A 204 ? 2.1249 1.8892 1.2717 0.2825  0.0365  -0.0579 204 ARG Z NH1   
1581 N NH2   . ARG A 204 ? 2.0641 1.8255 1.2726 0.2539  0.0524  -0.0936 204 ARG Z NH2   
1582 N N     . GLN A 205 ? 1.5829 1.4118 0.9837 0.2234  -0.0397 -0.1455 205 GLN Z N     
1583 C CA    . GLN A 205 ? 1.5742 1.4010 0.9885 0.2293  -0.0441 -0.1261 205 GLN Z CA    
1584 C C     . GLN A 205 ? 1.5450 1.3511 0.9867 0.2194  -0.0237 -0.1121 205 GLN Z C     
1585 O O     . GLN A 205 ? 1.5651 1.3629 1.0136 0.2244  -0.0211 -0.0948 205 GLN Z O     
1586 C CB    . GLN A 205 ? 1.5122 1.3634 0.9601 0.2275  -0.0679 -0.1388 205 GLN Z CB    
1587 C CG    . GLN A 205 ? 1.5012 1.3594 0.9966 0.2094  -0.0681 -0.1567 205 GLN Z CG    
1588 C CD    . GLN A 205 ? 1.4972 1.3793 1.0286 0.2074  -0.0888 -0.1667 205 GLN Z CD    
1589 O OE1   . GLN A 205 ? 1.5347 1.4280 1.0600 0.2196  -0.1027 -0.1595 205 GLN Z OE1   
1590 N NE2   . GLN A 205 ? 1.3917 1.2821 0.9635 0.1925  -0.0903 -0.1820 205 GLN Z NE2   
1591 N N     . LEU A 206 ? 1.5233 1.3219 0.9823 0.2055  -0.0099 -0.1207 206 LEU Z N     
1592 C CA    . LEU A 206 ? 1.4793 1.2614 0.9653 0.1947  0.0075  -0.1100 206 LEU Z CA    
1593 C C     . LEU A 206 ? 1.5173 1.2761 0.9772 0.2007  0.0282  -0.0897 206 LEU Z C     
1594 O O     . LEU A 206 ? 1.5178 1.2623 0.9951 0.1963  0.0395  -0.0767 206 LEU Z O     
1595 C CB    . LEU A 206 ? 1.4351 1.2192 0.9508 0.1788  0.0137  -0.1244 206 LEU Z CB    
1596 C CG    . LEU A 206 ? 1.3584 1.1342 0.9104 0.1656  0.0242  -0.1174 206 LEU Z CG    
1597 C CD1   . LEU A 206 ? 1.3519 1.1381 0.9283 0.1637  0.0116  -0.1161 206 LEU Z CD1   
1598 C CD2   . LEU A 206 ? 1.3256 1.1046 0.9050 0.1523  0.0294  -0.1293 206 LEU Z CD2   
1599 N N     . GLY A 207 ? 1.5789 1.3342 0.9972 0.2103  0.0337  -0.0876 207 GLY Z N     
1600 C CA    . GLY A 207 ? 1.6102 1.3439 1.0021 0.2166  0.0552  -0.0667 207 GLY Z CA    
1601 C C     . GLY A 207 ? 1.5882 1.3072 1.0028 0.2030  0.0780  -0.0656 207 GLY Z C     
1602 O O     . GLY A 207 ? 1.5694 1.2947 0.9957 0.1941  0.0811  -0.0820 207 GLY Z O     
1603 N N     . ASP A 208 ? 1.6225 1.3222 1.0466 0.2014  0.0940  -0.0468 208 ASP Z N     
1604 C CA    . ASP A 208 ? 1.6253 1.3130 1.0748 0.1883  0.1146  -0.0454 208 ASP Z CA    
1605 C C     . ASP A 208 ? 1.5780 1.2695 1.0751 0.1739  0.1081  -0.0520 208 ASP Z C     
1606 O O     . ASP A 208 ? 1.5240 1.2075 1.0483 0.1623  0.1214  -0.0500 208 ASP Z O     
1607 C CB    . ASP A 208 ? 1.7053 1.3698 1.1413 0.1929  0.1374  -0.0224 208 ASP Z CB    
1608 C CG    . ASP A 208 ? 1.7496 1.4030 1.1931 0.1978  0.1341  -0.0070 208 ASP Z CG    
1609 O OD1   . ASP A 208 ? 1.7353 1.4004 1.1756 0.2046  0.1137  -0.0111 208 ASP Z OD1   
1610 O OD2   . ASP A 208 ? 1.8107 1.4439 1.2665 0.1947  0.1522  0.0081  208 ASP Z OD2   
1611 N N     . VAL A 209 ? 1.5523 1.2578 1.0592 0.1750  0.0876  -0.0596 209 VAL Z N     
1612 C CA    . VAL A 209 ? 1.4795 1.1913 1.0263 0.1623  0.0811  -0.0660 209 VAL Z CA    
1613 C C     . VAL A 209 ? 1.4411 1.1686 1.0094 0.1517  0.0747  -0.0829 209 VAL Z C     
1614 O O     . VAL A 209 ? 1.3970 1.1407 0.9802 0.1489  0.0585  -0.0934 209 VAL Z O     
1615 C CB    . VAL A 209 ? 1.4918 1.2123 1.0419 0.1685  0.0643  -0.0660 209 VAL Z CB    
1616 C CG1   . VAL A 209 ? 1.4077 1.1370 0.9953 0.1553  0.0585  -0.0736 209 VAL Z CG1   
1617 C CG2   . VAL A 209 ? 1.5865 1.2899 1.1205 0.1800  0.0712  -0.0482 209 VAL Z CG2   
1618 N N     . PHE A 210 ? 1.4379 1.1601 1.0114 0.1456  0.0886  -0.0848 210 PHE Z N     
1619 C CA    . PHE A 210 ? 1.3951 1.1302 0.9951 0.1356  0.0841  -0.0992 210 PHE Z CA    
1620 C C     . PHE A 210 ? 1.3401 1.0709 0.9742 0.1224  0.0947  -0.0949 210 PHE Z C     
1621 O O     . PHE A 210 ? 1.3193 1.0602 0.9826 0.1131  0.0911  -0.1027 210 PHE Z O     
1622 C CB    . PHE A 210 ? 1.4009 1.1379 0.9808 0.1409  0.0890  -0.1097 210 PHE Z CB    
1623 C CG    . PHE A 210 ? 1.4353 1.1567 0.9878 0.1473  0.1098  -0.0997 210 PHE Z CG    
1624 C CD1   . PHE A 210 ? 1.4112 1.1252 0.9832 0.1397  0.1284  -0.0973 210 PHE Z CD1   
1625 C CD2   . PHE A 210 ? 1.5068 1.2218 1.0156 0.1613  0.1111  -0.0909 210 PHE Z CD2   
1626 C CE1   . PHE A 210 ? 1.4707 1.1708 1.0200 0.1451  0.1500  -0.0870 210 PHE Z CE1   
1627 C CE2   . PHE A 210 ? 1.5399 1.2403 1.0224 0.1673  0.1322  -0.0789 210 PHE Z CE2   
1628 C CZ    . PHE A 210 ? 1.5389 1.2315 1.0420 0.1588  0.1527  -0.0772 210 PHE Z CZ    
1629 N N     . THR A 211 ? 1.3614 1.0775 0.9938 0.1218  0.1073  -0.0818 211 THR Z N     
1630 C CA    . THR A 211 ? 1.3737 1.0874 1.0401 0.1087  0.1150  -0.0780 211 THR Z CA    
1631 C C     . THR A 211 ? 1.3126 1.0383 1.0027 0.1002  0.0996  -0.0816 211 THR Z C     
1632 O O     . THR A 211 ? 1.3194 1.0480 0.9980 0.1054  0.0888  -0.0822 211 THR Z O     
1633 C CB    . THR A 211 ? 1.4050 1.0993 1.0663 0.1095  0.1324  -0.0645 211 THR Z CB    
1634 O OG1   . THR A 211 ? 1.4323 1.1189 1.0783 0.1162  0.1271  -0.0581 211 THR Z OG1   
1635 C CG2   . THR A 211 ? 1.3837 1.0668 1.0198 0.1180  0.1504  -0.0587 211 THR Z CG2   
1636 N N     . GLU A 212 ? 1.3089 1.0428 1.0321 0.0876  0.0988  -0.0833 212 GLU Z N     
1637 C CA    . GLU A 212 ? 1.2791 1.0276 1.0228 0.0790  0.0844  -0.0864 212 GLU Z CA    
1638 C C     . GLU A 212 ? 1.2358 0.9788 0.9728 0.0789  0.0820  -0.0833 212 GLU Z C     
1639 O O     . GLU A 212 ? 1.2060 0.9589 0.9413 0.0797  0.0703  -0.0870 212 GLU Z O     
1640 C CB    . GLU A 212 ? 1.2171 0.9750 0.9955 0.0663  0.0848  -0.0856 212 GLU Z CB    
1641 C CG    . GLU A 212 ? 1.2360 1.0109 1.0323 0.0575  0.0702  -0.0867 212 GLU Z CG    
1642 C CD    . GLU A 212 ? 1.2404 1.0279 1.0703 0.0468  0.0677  -0.0841 212 GLU Z CD    
1643 O OE1   . GLU A 212 ? 1.2036 1.0045 1.0466 0.0384  0.0576  -0.0823 212 GLU Z OE1   
1644 O OE2   . GLU A 212 ? 1.2804 1.0652 1.1234 0.0474  0.0761  -0.0836 212 GLU Z OE2   
1645 N N     . GLU A 213 ? 1.2124 0.9393 0.9483 0.0779  0.0945  -0.0773 213 GLU Z N     
1646 C CA    . GLU A 213 ? 1.2513 0.9701 0.9854 0.0773  0.0944  -0.0762 213 GLU Z CA    
1647 C C     . GLU A 213 ? 1.2537 0.9668 0.9620 0.0911  0.0906  -0.0745 213 GLU Z C     
1648 O O     . GLU A 213 ? 1.2611 0.9807 0.9706 0.0916  0.0817  -0.0789 213 GLU Z O     
1649 C CB    . GLU A 213 ? 1.2764 0.9769 1.0192 0.0732  0.1102  -0.0701 213 GLU Z CB    
1650 C CG    . GLU A 213 ? 1.3203 1.0086 1.0639 0.0727  0.1123  -0.0705 213 GLU Z CG    
1651 C CD    . GLU A 213 ? 1.4102 1.0810 1.1705 0.0659  0.1276  -0.0662 213 GLU Z CD    
1652 O OE1   . GLU A 213 ? 1.4435 1.1204 1.2256 0.0555  0.1313  -0.0669 213 GLU Z OE1   
1653 O OE2   . GLU A 213 ? 1.4688 1.1198 1.2241 0.0709  0.1363  -0.0617 213 GLU Z OE2   
1654 N N     . LYS A 214 ? 1.2850 0.9874 0.9700 0.1029  0.0976  -0.0681 214 LYS Z N     
1655 C CA    . LYS A 214 ? 1.3222 1.0209 0.9823 0.1177  0.0925  -0.0646 214 LYS Z CA    
1656 C C     . LYS A 214 ? 1.2916 1.0117 0.9514 0.1199  0.0746  -0.0741 214 LYS Z C     
1657 O O     . LYS A 214 ? 1.2985 1.0226 0.9549 0.1264  0.0663  -0.0750 214 LYS Z O     
1658 C CB    . LYS A 214 ? 1.3792 1.0653 1.0106 0.1297  0.1024  -0.0550 214 LYS Z CB    
1659 C CG    . LYS A 214 ? 1.4082 1.0708 1.0390 0.1297  0.1223  -0.0420 214 LYS Z CG    
1660 C CD    . LYS A 214 ? 1.4970 1.1491 1.0947 0.1427  0.1331  -0.0305 214 LYS Z CD    
1661 C CE    . LYS A 214 ? 1.5604 1.1880 1.1595 0.1428  0.1552  -0.0147 214 LYS Z CE    
1662 N NZ    . LYS A 214 ? 1.6390 1.2574 1.2023 0.1555  0.1679  -0.0013 214 LYS Z NZ    
1663 N N     . PHE A 215 ? 1.2810 1.0146 0.9485 0.1145  0.0696  -0.0813 215 PHE Z N     
1664 C CA    . PHE A 215 ? 1.2479 1.0015 0.9217 0.1146  0.0539  -0.0906 215 PHE Z CA    
1665 C C     . PHE A 215 ? 1.2048 0.9693 0.8988 0.1069  0.0468  -0.0934 215 PHE Z C     
1666 O O     . PHE A 215 ? 1.1911 0.9671 0.8856 0.1113  0.0365  -0.0971 215 PHE Z O     
1667 C CB    . PHE A 215 ? 1.2043 0.9674 0.8904 0.1082  0.0525  -0.0976 215 PHE Z CB    
1668 C CG    . PHE A 215 ? 1.1736 0.9547 0.8670 0.1090  0.0378  -0.1074 215 PHE Z CG    
1669 C CD1   . PHE A 215 ? 1.2053 0.9893 0.8785 0.1195  0.0317  -0.1137 215 PHE Z CD1   
1670 C CD2   . PHE A 215 ? 1.1848 0.9808 0.9058 0.0990  0.0301  -0.1102 215 PHE Z CD2   
1671 C CE1   . PHE A 215 ? 1.1833 0.9843 0.8681 0.1191  0.0178  -0.1245 215 PHE Z CE1   
1672 C CE2   . PHE A 215 ? 1.1598 0.9716 0.8924 0.0989  0.0183  -0.1183 215 PHE Z CE2   
1673 C CZ    . PHE A 215 ? 1.1289 0.9431 0.8457 0.1085  0.0120  -0.1265 215 PHE Z CZ    
1674 N N     . ARG A 216 ? 1.1797 0.9419 0.8905 0.0953  0.0525  -0.0919 216 ARG Z N     
1675 C CA    . ARG A 216 ? 1.1622 0.9345 0.8875 0.0873  0.0475  -0.0949 216 ARG Z CA    
1676 C C     . ARG A 216 ? 1.1726 0.9372 0.8877 0.0954  0.0487  -0.0947 216 ARG Z C     
1677 O O     . ARG A 216 ? 1.1453 0.9226 0.8647 0.0966  0.0415  -0.0990 216 ARG Z O     
1678 C CB    . ARG A 216 ? 1.1466 0.9177 0.8882 0.0740  0.0527  -0.0939 216 ARG Z CB    
1679 C CG    . ARG A 216 ? 1.0934 0.8750 0.8443 0.0656  0.0482  -0.0982 216 ARG Z CG    
1680 C CD    . ARG A 216 ? 1.0836 0.8695 0.8510 0.0518  0.0492  -0.0981 216 ARG Z CD    
1681 N NE    . ARG A 216 ? 1.1118 0.8787 0.8806 0.0503  0.0602  -0.0967 216 ARG Z NE    
1682 C CZ    . ARG A 216 ? 1.1320 0.8921 0.9089 0.0486  0.0671  -0.0918 216 ARG Z CZ    
1683 N NH1   . ARG A 216 ? 1.1176 0.8876 0.9011 0.0488  0.0638  -0.0892 216 ARG Z NH1   
1684 N NH2   . ARG A 216 ? 1.1632 0.9063 0.9445 0.0466  0.0786  -0.0899 216 ARG Z NH2   
1685 N N     . TYR A 217 ? 1.2098 0.9531 0.9141 0.1012  0.0593  -0.0888 217 TYR Z N     
1686 C CA    . TYR A 217 ? 1.2290 0.9612 0.9265 0.1107  0.0621  -0.0869 217 TYR Z CA    
1687 C C     . TYR A 217 ? 1.2261 0.9689 0.9140 0.1237  0.0517  -0.0871 217 TYR Z C     
1688 O O     . TYR A 217 ? 1.2418 0.9893 0.9354 0.1280  0.0485  -0.0903 217 TYR Z O     
1689 C CB    . TYR A 217 ? 1.2943 1.0006 0.9816 0.1169  0.0757  -0.0768 217 TYR Z CB    
1690 C CG    . TYR A 217 ? 1.3154 1.0095 1.0181 0.1043  0.0869  -0.0775 217 TYR Z CG    
1691 C CD1   . TYR A 217 ? 1.2262 0.9321 0.9474 0.0900  0.0828  -0.0878 217 TYR Z CD1   
1692 C CD2   . TYR A 217 ? 1.3496 1.0216 1.0488 0.1064  0.1014  -0.0676 217 TYR Z CD2   
1693 C CE1   . TYR A 217 ? 1.2536 0.9509 0.9905 0.0780  0.0907  -0.0901 217 TYR Z CE1   
1694 C CE2   . TYR A 217 ? 1.3345 0.9967 1.0531 0.0940  0.1112  -0.0692 217 TYR Z CE2   
1695 C CZ    . TYR A 217 ? 1.3131 0.9886 1.0511 0.0797  0.1047  -0.0815 217 TYR Z CZ    
1696 O OH    . TYR A 217 ? 1.3171 0.9853 1.0759 0.0669  0.1122  -0.0849 217 TYR Z OH    
1697 N N     . MET A 218 ? 1.2370 0.9847 0.9120 0.1298  0.0464  -0.0852 218 MET Z N     
1698 C CA    . MET A 218 ? 1.2762 1.0370 0.9436 0.1415  0.0340  -0.0870 218 MET Z CA    
1699 C C     . MET A 218 ? 1.2363 1.0205 0.9245 0.1350  0.0236  -0.0966 218 MET Z C     
1700 O O     . MET A 218 ? 1.2416 1.0348 0.9352 0.1422  0.0174  -0.0983 218 MET Z O     
1701 C CB    . MET A 218 ? 1.2802 1.0432 0.9293 0.1469  0.0301  -0.0868 218 MET Z CB    
1702 C CG    . MET A 218 ? 1.3081 1.0868 0.9493 0.1584  0.0149  -0.0907 218 MET Z CG    
1703 S SD    . MET A 218 ? 1.3427 1.1276 0.9645 0.1611  0.0092  -0.0972 218 MET Z SD    
1704 C CE    . MET A 218 ? 1.2098 1.0071 0.8628 0.1427  0.0083  -0.1089 218 MET Z CE    
1705 N N     . CYS A 219 ? 1.2092 1.0033 0.9110 0.1218  0.0225  -0.1013 219 CYS Z N     
1706 C CA    . CYS A 219 ? 1.2066 1.0225 0.9291 0.1144  0.0146  -0.1076 219 CYS Z CA    
1707 C C     . CYS A 219 ? 1.2062 1.0251 0.9370 0.1124  0.0180  -0.1088 219 CYS Z C     
1708 O O     . CYS A 219 ? 1.2242 1.0593 0.9662 0.1147  0.0123  -0.1126 219 CYS Z O     
1709 C CB    . CYS A 219 ? 1.1712 0.9939 0.9077 0.1007  0.0149  -0.1087 219 CYS Z CB    
1710 S SG    . CYS A 219 ? 1.0659 0.8913 0.8018 0.1022  0.0097  -0.1124 219 CYS Z SG    
1711 N N     . ILE A 220 ? 1.1584 0.9625 0.8857 0.1078  0.0279  -0.1071 220 ILE Z N     
1712 C CA    . ILE A 220 ? 1.1463 0.9516 0.8797 0.1056  0.0325  -0.1115 220 ILE Z CA    
1713 C C     . ILE A 220 ? 1.1838 0.9839 0.9144 0.1206  0.0329  -0.1111 220 ILE Z C     
1714 O O     . ILE A 220 ? 1.1869 0.9998 0.9280 0.1224  0.0319  -0.1164 220 ILE Z O     
1715 C CB    . ILE A 220 ? 1.1599 0.9494 0.8919 0.0969  0.0423  -0.1124 220 ILE Z CB    
1716 C CG1   . ILE A 220 ? 1.1067 0.9047 0.8453 0.0825  0.0403  -0.1118 220 ILE Z CG1   
1717 C CG2   . ILE A 220 ? 1.1485 0.9387 0.8853 0.0949  0.0475  -0.1205 220 ILE Z CG2   
1718 C CD1   . ILE A 220 ? 1.1061 0.8919 0.8467 0.0731  0.0477  -0.1136 220 ILE Z CD1   
1719 N N     . LEU A 221 ? 1.2147 0.9967 0.9320 0.1319  0.0352  -0.1038 221 LEU Z N     
1720 C CA    . LEU A 221 ? 1.2153 0.9908 0.9307 0.1479  0.0351  -0.1002 221 LEU Z CA    
1721 C C     . LEU A 221 ? 1.2419 1.0402 0.9642 0.1563  0.0219  -0.1023 221 LEU Z C     
1722 O O     . LEU A 221 ? 1.2908 1.0928 1.0218 0.1673  0.0204  -0.1022 221 LEU Z O     
1723 C CB    . LEU A 221 ? 1.2525 1.0048 0.9497 0.1585  0.0400  -0.0882 221 LEU Z CB    
1724 C CG    . LEU A 221 ? 1.3023 1.0282 0.9991 0.1539  0.0552  -0.0846 221 LEU Z CG    
1725 C CD1   . LEU A 221 ? 1.3321 1.0370 1.0102 0.1643  0.0611  -0.0697 221 LEU Z CD1   
1726 C CD2   . LEU A 221 ? 1.3373 1.0554 1.0490 0.1566  0.0621  -0.0897 221 LEU Z CD2   
1727 N N     . SER A 222 ? 1.2571 1.0709 0.9795 0.1511  0.0125  -0.1048 222 SER Z N     
1728 C CA    . SER A 222 ? 1.2796 1.1164 1.0126 0.1570  -0.0010 -0.1088 222 SER Z CA    
1729 C C     . SER A 222 ? 1.2566 1.1136 1.0146 0.1498  -0.0008 -0.1159 222 SER Z C     
1730 O O     . SER A 222 ? 1.3115 1.1876 1.0855 0.1559  -0.0092 -0.1191 222 SER Z O     
1731 C CB    . SER A 222 ? 1.2507 1.0956 0.9786 0.1526  -0.0098 -0.1115 222 SER Z CB    
1732 O OG    . SER A 222 ? 1.2217 1.0715 0.9607 0.1364  -0.0061 -0.1151 222 SER Z OG    
1733 N N     . GLY A 223 ? 1.2063 1.0606 0.9678 0.1369  0.0089  -0.1182 223 GLY Z N     
1734 C CA    . GLY A 223 ? 1.2199 1.0937 1.0001 0.1290  0.0114  -0.1237 223 GLY Z CA    
1735 C C     . GLY A 223 ? 1.2087 1.0940 0.9950 0.1135  0.0100  -0.1236 223 GLY Z C     
1736 O O     . GLY A 223 ? 1.2012 1.0929 0.9921 0.1119  0.0015  -0.1226 223 GLY Z O     
1737 N N     . CYS A 224 ? 1.2060 1.0940 0.9925 0.1026  0.0180  -0.1249 224 CYS Z N     
1738 C CA    . CYS A 224 ? 1.1791 1.0783 0.9715 0.0885  0.0167  -0.1216 224 CYS Z CA    
1739 C C     . CYS A 224 ? 1.1871 1.1033 0.9857 0.0805  0.0232  -0.1231 224 CYS Z C     
1740 O O     . CYS A 224 ? 1.2185 1.1393 1.0195 0.0862  0.0289  -0.1287 224 CYS Z O     
1741 C CB    . CYS A 224 ? 1.1778 1.0607 0.9572 0.0817  0.0186  -0.1184 224 CYS Z CB    
1742 S SG    . CYS A 224 ? 1.2655 1.1300 1.0296 0.0805  0.0289  -0.1231 224 CYS Z SG    
1743 N N     . ASP A 225 ? 1.1682 1.0941 0.9691 0.0681  0.0228  -0.1176 225 ASP Z N     
1744 C CA    . ASP A 225 ? 1.1847 1.1285 0.9864 0.0598  0.0290  -0.1167 225 ASP Z CA    
1745 C C     . ASP A 225 ? 1.1889 1.1244 0.9708 0.0573  0.0366  -0.1244 225 ASP Z C     
1746 O O     . ASP A 225 ? 1.2109 1.1588 0.9888 0.0549  0.0443  -0.1293 225 ASP Z O     
1747 C CB    . ASP A 225 ? 1.1924 1.1488 1.0016 0.0481  0.0253  -0.1054 225 ASP Z CB    
1748 C CG    . ASP A 225 ? 1.2357 1.2031 1.0704 0.0488  0.0200  -0.0996 225 ASP Z CG    
1749 O OD1   . ASP A 225 ? 1.2669 1.2472 1.1140 0.0399  0.0193  -0.0890 225 ASP Z OD1   
1750 O OD2   . ASP A 225 ? 1.2717 1.2352 1.1151 0.0582  0.0162  -0.1055 225 ASP Z OD2   
1751 N N     . TYR A 226 ? 1.1768 1.0917 0.9476 0.0574  0.0354  -0.1267 226 TYR Z N     
1752 C CA    . TYR A 226 ? 1.1630 1.0687 0.9189 0.0532  0.0416  -0.1359 226 TYR Z CA    
1753 C C     . TYR A 226 ? 1.2074 1.0989 0.9618 0.0642  0.0495  -0.1466 226 TYR Z C     
1754 O O     . TYR A 226 ? 1.2571 1.1477 1.0042 0.0619  0.0574  -0.1579 226 TYR Z O     
1755 C CB    . TYR A 226 ? 1.0908 0.9812 0.8415 0.0473  0.0379  -0.1334 226 TYR Z CB    
1756 C CG    . TYR A 226 ? 1.1109 1.0139 0.8676 0.0379  0.0300  -0.1220 226 TYR Z CG    
1757 C CD1   . TYR A 226 ? 1.0851 1.0117 0.8434 0.0303  0.0281  -0.1161 226 TYR Z CD1   
1758 C CD2   . TYR A 226 ? 1.0859 0.9770 0.8481 0.0372  0.0257  -0.1159 226 TYR Z CD2   
1759 C CE1   . TYR A 226 ? 1.0836 1.0206 0.8507 0.0227  0.0210  -0.1033 226 TYR Z CE1   
1760 C CE2   . TYR A 226 ? 1.0537 0.9556 0.8259 0.0297  0.0192  -0.1055 226 TYR Z CE2   
1761 C CZ    . TYR A 226 ? 1.0604 0.9848 0.8362 0.0227  0.0163  -0.0987 226 TYR Z CZ    
1762 O OH    . TYR A 226 ? 1.0426 0.9769 0.8317 0.0161  0.0099  -0.0861 226 TYR Z OH    
1763 N N     . LEU A 227 ? 1.1756 1.0562 0.9372 0.0766  0.0471  -0.1433 227 LEU Z N     
1764 C CA    . LEU A 227 ? 1.1950 1.0605 0.9582 0.0891  0.0536  -0.1498 227 LEU Z CA    
1765 C C     . LEU A 227 ? 1.2248 1.0949 1.0000 0.1031  0.0484  -0.1449 227 LEU Z C     
1766 O O     . LEU A 227 ? 1.2442 1.1108 1.0189 0.1069  0.0397  -0.1369 227 LEU Z O     
1767 C CB    . LEU A 227 ? 1.2378 1.0750 0.9926 0.0905  0.0565  -0.1501 227 LEU Z CB    
1768 C CG    . LEU A 227 ? 1.2695 1.0865 1.0280 0.1042  0.0639  -0.1537 227 LEU Z CG    
1769 C CD1   . LEU A 227 ? 1.2541 1.0733 1.0162 0.1025  0.0745  -0.1686 227 LEU Z CD1   
1770 C CD2   . LEU A 227 ? 1.2567 1.0457 1.0093 0.1055  0.0669  -0.1491 227 LEU Z CD2   
1771 N N     . SER A 228 ? 1.2393 1.1185 1.0260 0.1110  0.0537  -0.1507 228 SER Z N     
1772 C CA    . SER A 228 ? 1.2533 1.1390 1.0549 0.1252  0.0476  -0.1469 228 SER Z CA    
1773 C C     . SER A 228 ? 1.2733 1.1343 1.0686 0.1385  0.0460  -0.1424 228 SER Z C     
1774 O O     . SER A 228 ? 1.3014 1.1411 1.0901 0.1400  0.0552  -0.1459 228 SER Z O     
1775 C CB    . SER A 228 ? 1.2559 1.1584 1.0756 0.1306  0.0553  -0.1543 228 SER Z CB    
1776 O OG    . SER A 228 ? 1.3002 1.2260 1.1239 0.1184  0.0589  -0.1562 228 SER Z OG    
1777 N N     . SER A 229 ? 1.2758 1.1398 1.0731 0.1480  0.0343  -0.1346 229 SER Z N     
1778 C CA    . SER A 229 ? 1.3259 1.1684 1.1132 0.1617  0.0319  -0.1268 229 SER Z CA    
1779 C C     . SER A 229 ? 1.3655 1.2041 1.1669 0.1776  0.0361  -0.1272 229 SER Z C     
1780 O O     . SER A 229 ? 1.3669 1.2253 1.1890 0.1806  0.0367  -0.1332 229 SER Z O     
1781 C CB    . SER A 229 ? 1.2994 1.1492 1.0804 0.1670  0.0171  -0.1196 229 SER Z CB    
1782 O OG    . SER A 229 ? 1.3150 1.1903 1.1158 0.1731  0.0071  -0.1220 229 SER Z OG    
1783 N N     . LEU A 230 ? 1.6052 0.8107 1.3629 -0.0066 -0.0553 -0.1478 230 LEU Z N     
1784 C CA    . LEU A 230 ? 1.6749 0.8356 1.3767 0.0128  -0.0500 -0.1481 230 LEU Z CA    
1785 C C     . LEU A 230 ? 1.7145 0.8951 1.4532 0.0604  -0.0747 -0.1838 230 LEU Z C     
1786 O O     . LEU A 230 ? 1.6927 0.9171 1.4649 0.0873  -0.0930 -0.2058 230 LEU Z O     
1787 C CB    . LEU A 230 ? 1.7264 0.8604 1.3374 0.0164  -0.0315 -0.1290 230 LEU Z CB    
1788 C CG    . LEU A 230 ? 1.6972 0.8059 1.2690 -0.0300 -0.0064 -0.0945 230 LEU Z CG    
1789 C CD1   . LEU A 230 ? 1.7770 0.8633 1.2687 -0.0217 0.0119  -0.0771 230 LEU Z CD1   
1790 C CD2   . LEU A 230 ? 1.7368 0.8021 1.3008 -0.0579 0.0039  -0.0807 230 LEU Z CD2   
1791 N N     . ARG A 231 ? 1.7564 0.9055 1.4908 0.0715  -0.0764 -0.1906 231 ARG Z N     
1792 C CA    . ARG A 231 ? 1.7914 0.9584 1.5706 0.1146  -0.1009 -0.2266 231 ARG Z CA    
1793 C C     . ARG A 231 ? 1.8611 1.0407 1.5968 0.1617  -0.1113 -0.2457 231 ARG Z C     
1794 O O     . ARG A 231 ? 1.9186 1.0633 1.5691 0.1725  -0.0964 -0.2328 231 ARG Z O     
1795 C CB    . ARG A 231 ? 1.8796 1.0054 1.6516 0.1163  -0.0975 -0.2266 231 ARG Z CB    
1796 C CG    . ARG A 231 ? 1.8942 1.0517 1.7284 0.1546  -0.1198 -0.2609 231 ARG Z CG    
1797 C CD    . ARG A 231 ? 1.9395 1.0960 1.8000 0.1393  -0.1064 -0.2482 231 ARG Z CD    
1798 N NE    . ARG A 231 ? 1.9761 1.1327 1.8762 0.0972  -0.0918 -0.2247 231 ARG Z NE    
1799 C CZ    . ARG A 231 ? 1.9466 1.1510 1.9331 0.0886  -0.0956 -0.2281 231 ARG Z CZ    
1800 N NH1   . ARG A 231 ? 1.9406 1.1436 1.9480 0.0537  -0.0788 -0.2037 231 ARG Z NH1   
1801 N NH2   . ARG A 231 ? 1.9069 1.1642 1.9547 0.1163  -0.1162 -0.2540 231 ARG Z NH2   
1802 N N     . GLY A 232 ? 1.7627 0.9927 1.5582 0.1917  -0.1368 -0.2765 232 GLY Z N     
1803 C CA    . GLY A 232 ? 1.7866 1.0353 1.5478 0.2421  -0.1502 -0.2980 232 GLY Z CA    
1804 C C     . GLY A 232 ? 1.7668 1.0487 1.5158 0.2400  -0.1481 -0.2888 232 GLY Z C     
1805 O O     . GLY A 232 ? 1.8026 1.1009 1.5149 0.2814  -0.1557 -0.3009 232 GLY Z O     
1806 N N     . ILE A 233 ? 1.6973 0.9899 1.4762 0.1935  -0.1375 -0.2671 233 ILE Z N     
1807 C CA    . ILE A 233 ? 1.6539 0.9785 1.4247 0.1863  -0.1343 -0.2561 233 ILE Z CA    
1808 C C     . ILE A 233 ? 1.5750 0.9536 1.4412 0.1829  -0.1568 -0.2766 233 ILE Z C     
1809 O O     . ILE A 233 ? 1.5265 0.9086 1.4484 0.1455  -0.1534 -0.2688 233 ILE Z O     
1810 C CB    . ILE A 233 ? 1.6156 0.9117 1.3375 0.1355  -0.1027 -0.2134 233 ILE Z CB    
1811 C CG1   . ILE A 233 ? 1.7036 0.9442 1.3339 0.1368  -0.0791 -0.1919 233 ILE Z CG1   
1812 C CG2   . ILE A 233 ? 1.5585 0.8885 1.2723 0.1300  -0.0992 -0.2022 233 ILE Z CG2   
1813 C CD1   . ILE A 233 ? 1.7722 1.0142 1.3393 0.1837  -0.0782 -0.1968 233 ILE Z CD1   
1814 N N     . GLY A 234 ? 1.5312 0.9519 1.4149 0.2246  -0.1795 -0.3028 234 GLY Z N     
1815 C CA    . GLY A 234 ? 1.4582 0.9323 1.4285 0.2251  -0.2018 -0.3232 234 GLY Z CA    
1816 C C     . GLY A 234 ? 1.4385 0.9412 1.3812 0.2215  -0.1970 -0.3087 234 GLY Z C     
1817 O O     . GLY A 234 ? 1.4812 0.9593 1.3465 0.2063  -0.1717 -0.2771 234 GLY Z O     
1818 N N     . LEU A 235 ? 1.4007 0.9555 1.4092 0.2359  -0.2211 -0.3318 235 LEU Z N     
1819 C CA    . LEU A 235 ? 1.3748 0.9620 1.3635 0.2353  -0.2195 -0.3204 235 LEU Z CA    
1820 C C     . LEU A 235 ? 1.4270 1.0119 1.3351 0.2815  -0.2186 -0.3202 235 LEU Z C     
1821 O O     . LEU A 235 ? 1.4663 1.0475 1.3148 0.2705  -0.1982 -0.2909 235 LEU Z O     
1822 C CB    . LEU A 235 ? 1.2840 0.9281 1.3638 0.2459  -0.2487 -0.3492 235 LEU Z CB    
1823 C CG    . LEU A 235 ? 1.2159 0.8697 1.3780 0.2005  -0.2466 -0.3453 235 LEU Z CG    
1824 C CD1   . LEU A 235 ? 1.1635 0.8647 1.4271 0.2258  -0.2807 -0.3855 235 LEU Z CD1   
1825 C CD2   . LEU A 235 ? 1.1761 0.8372 1.3187 0.1551  -0.2251 -0.3114 235 LEU Z CD2   
1826 N N     . ALA A 236 ? 1.4035 0.9902 1.3109 0.3348  -0.2399 -0.3528 236 ALA Z N     
1827 C CA    . ALA A 236 ? 1.4590 1.0489 1.2956 0.3894  -0.2428 -0.3580 236 ALA Z CA    
1828 C C     . ALA A 236 ? 1.5159 1.0551 1.2510 0.3788  -0.2060 -0.3195 236 ALA Z C     
1829 O O     . ALA A 236 ? 1.5444 1.0869 1.2197 0.3889  -0.1903 -0.2971 236 ALA Z O     
1830 C CB    . ALA A 236 ? 1.5344 1.1356 1.3958 0.4489  -0.2745 -0.4042 236 ALA Z CB    
1831 N N     . LYS A 237 ? 1.6107 1.1031 1.3282 0.3593  -0.1917 -0.3113 237 LYS Z N     
1832 C CA    . LYS A 237 ? 1.6739 1.1154 1.2980 0.3512  -0.1578 -0.2773 237 LYS Z CA    
1833 C C     . LYS A 237 ? 1.6503 1.0773 1.2488 0.2947  -0.1265 -0.2333 237 LYS Z C     
1834 O O     . LYS A 237 ? 1.7112 1.1126 1.2350 0.2947  -0.0994 -0.2036 237 LYS Z O     
1835 C CB    . LYS A 237 ? 1.7081 1.1037 1.3228 0.3442  -0.1523 -0.2811 237 LYS Z CB    
1836 C CG    . LYS A 237 ? 1.7610 1.1605 1.3737 0.4064  -0.1764 -0.3198 237 LYS Z CG    
1837 C CD    . LYS A 237 ? 1.8221 1.1742 1.4200 0.3977  -0.1686 -0.3204 237 LYS Z CD    
1838 C CE    . LYS A 237 ? 1.8989 1.2565 1.4956 0.4609  -0.1935 -0.3609 237 LYS Z CE    
1839 N NZ    . LYS A 237 ? 1.9455 1.2573 1.5274 0.4528  -0.1861 -0.3614 237 LYS Z NZ    
1840 N N     . ALA A 238 ? 1.5756 1.0193 1.2384 0.2479  -0.1298 -0.2295 238 ALA Z N     
1841 C CA    . ALA A 238 ? 1.5624 0.9998 1.2100 0.1959  -0.1045 -0.1927 238 ALA Z CA    
1842 C C     . ALA A 238 ? 1.5886 1.0609 1.2138 0.2144  -0.1032 -0.1839 238 ALA Z C     
1843 O O     . ALA A 238 ? 1.6235 1.0781 1.1931 0.1970  -0.0755 -0.1501 238 ALA Z O     
1844 C CB    . ALA A 238 ? 1.4699 0.9223 1.1935 0.1492  -0.1108 -0.1946 238 ALA Z CB    
1845 N N     . CYS A 239 ? 1.5288 1.0511 1.2004 0.2508  -0.1336 -0.2149 239 CYS Z N     
1846 C CA    . CYS A 239 ? 1.5524 1.1122 1.2046 0.2781  -0.1373 -0.2113 239 CYS Z CA    
1847 C C     . CYS A 239 ? 1.6554 1.1921 1.2189 0.3193  -0.1194 -0.1961 239 CYS Z C     
1848 O O     . CYS A 239 ? 1.6778 1.2204 1.1985 0.3197  -0.1005 -0.1691 239 CYS Z O     
1849 C CB    . CYS A 239 ? 1.5062 1.1205 1.2231 0.3187  -0.1773 -0.2532 239 CYS Z CB    
1850 S SG    . CYS A 239 ? 1.5326 1.1986 1.2328 0.3531  -0.1861 -0.2508 239 CYS Z SG    
1851 N N     . LYS A 240 ? 1.6568 1.1667 1.1937 0.3544  -0.1239 -0.2126 240 LYS Z N     
1852 C CA    . LYS A 240 ? 1.7644 1.2488 1.2154 0.3976  -0.1056 -0.1993 240 LYS Z CA    
1853 C C     . LYS A 240 ? 1.8061 1.2426 1.1978 0.3547  -0.0624 -0.1519 240 LYS Z C     
1854 O O     . LYS A 240 ? 1.8764 1.3048 1.2062 0.3738  -0.0390 -0.1259 240 LYS Z O     
1855 C CB    . LYS A 240 ? 1.8012 1.2664 1.2405 0.4415  -0.1206 -0.2294 240 LYS Z CB    
1856 C CG    . LYS A 240 ? 1.9240 1.3640 1.2731 0.4931  -0.1024 -0.2184 240 LYS Z CG    
1857 C CD    . LYS A 240 ? 1.9532 1.3727 1.2917 0.5329  -0.1173 -0.2492 240 LYS Z CD    
1858 C CE    . LYS A 240 ? 2.0475 1.4434 1.2941 0.5889  -0.0987 -0.2391 240 LYS Z CE    
1859 N NZ    . LYS A 240 ? 2.1266 1.5666 1.3556 0.6506  -0.1120 -0.2503 240 LYS Z NZ    
1860 N N     . VAL A 241 ? 1.7828 1.1877 1.1958 0.2985  -0.0518 -0.1410 241 VAL Z N     
1861 C CA    . VAL A 241 ? 1.8128 1.1728 1.1809 0.2519  -0.0140 -0.0992 241 VAL Z CA    
1862 C C     . VAL A 241 ? 1.8172 1.1994 1.1834 0.2268  0.0018  -0.0713 241 VAL Z C     
1863 O O     . VAL A 241 ? 1.8834 1.2418 1.1938 0.2227  0.0328  -0.0382 241 VAL Z O     
1864 C CB    . VAL A 241 ? 1.7737 1.1037 1.1753 0.1958  -0.0108 -0.0960 241 VAL Z CB    
1865 C CG1   . VAL A 241 ? 1.8048 1.0985 1.1734 0.1430  0.0239  -0.0551 241 VAL Z CG1   
1866 C CG2   . VAL A 241 ? 1.8327 1.1295 1.2212 0.2172  -0.0179 -0.1146 241 VAL Z CG2   
1867 N N     . LEU A 242 ? 1.7736 1.2018 1.2028 0.2109  -0.0189 -0.0846 242 LEU Z N     
1868 C CA    . LEU A 242 ? 1.7626 1.2155 1.1953 0.1854  -0.0063 -0.0603 242 LEU Z CA    
1869 C C     . LEU A 242 ? 1.8410 1.3205 1.2343 0.2375  -0.0041 -0.0547 242 LEU Z C     
1870 O O     . LEU A 242 ? 1.8566 1.3399 1.2256 0.2228  0.0187  -0.0237 242 LEU Z O     
1871 C CB    . LEU A 242 ? 1.6490 1.1436 1.1596 0.1550  -0.0291 -0.0769 242 LEU Z CB    
1872 C CG    . LEU A 242 ? 1.5911 1.0610 1.1398 0.1006  -0.0265 -0.0760 242 LEU Z CG    
1873 C CD1   . LEU A 242 ? 1.4371 0.9505 1.0632 0.0783  -0.0484 -0.0933 242 LEU Z CD1   
1874 C CD2   . LEU A 242 ? 1.6082 1.0382 1.1193 0.0518  0.0080  -0.0379 242 LEU Z CD2   
1875 N N     . ARG A 243 ? 1.7490 1.2475 1.1372 0.3002  -0.0279 -0.0849 243 ARG Z N     
1876 C CA    . ARG A 243 ? 1.8195 1.3429 1.1656 0.3590  -0.0274 -0.0818 243 ARG Z CA    
1877 C C     . ARG A 243 ? 1.9281 1.4076 1.1914 0.3787  0.0092  -0.0498 243 ARG Z C     
1878 O O     . ARG A 243 ? 1.9624 1.4503 1.1859 0.3979  0.0296  -0.0232 243 ARG Z O     
1879 C CB    . ARG A 243 ? 1.8137 1.3714 1.1809 0.4238  -0.0667 -0.1276 243 ARG Z CB    
1880 C CG    . ARG A 243 ? 1.7358 1.3478 1.1823 0.4184  -0.1027 -0.1575 243 ARG Z CG    
1881 C CD    . ARG A 243 ? 1.7251 1.3705 1.1925 0.4871  -0.1422 -0.2043 243 ARG Z CD    
1882 N NE    . ARG A 243 ? 1.7641 1.3812 1.2395 0.4999  -0.1534 -0.2302 243 ARG Z NE    
1883 C CZ    . ARG A 243 ? 1.8239 1.4605 1.3159 0.5589  -0.1862 -0.2731 243 ARG Z CZ    
1884 N NH1   . ARG A 243 ? 1.8546 1.5393 1.3557 0.6124  -0.2124 -0.2959 243 ARG Z NH1   
1885 N NH2   . ARG A 243 ? 1.8027 1.4113 1.3026 0.5658  -0.1939 -0.2942 243 ARG Z NH2   
1886 N N     . LEU A 244 ? 1.9171 1.3495 1.1557 0.3745  0.0188  -0.0513 244 LEU Z N     
1887 C CA    . LEU A 244 ? 1.9942 1.3806 1.1553 0.3933  0.0541  -0.0224 244 LEU Z CA    
1888 C C     . LEU A 244 ? 2.0497 1.3995 1.1950 0.3313  0.0929  0.0217  244 LEU Z C     
1889 O O     . LEU A 244 ? 2.1507 1.4593 1.2376 0.3380  0.1265  0.0503  244 LEU Z O     
1890 C CB    . LEU A 244 ? 1.9969 1.3475 1.1361 0.4161  0.0478  -0.0433 244 LEU Z CB    
1891 C CG    . LEU A 244 ? 2.0394 1.4074 1.1527 0.4976  0.0260  -0.0753 244 LEU Z CG    
1892 C CD1   . LEU A 244 ? 1.9761 1.4032 1.1540 0.5228  -0.0192 -0.1175 244 LEU Z CD1   
1893 C CD2   . LEU A 244 ? 2.0808 1.4063 1.1690 0.5100  0.0257  -0.0901 244 LEU Z CD2   
1894 N N     . ALA A 245 ? 1.9994 1.3643 1.1984 0.2724  0.0883  0.0263  245 ALA Z N     
1895 C CA    . ALA A 245 ? 2.0703 1.4032 1.2632 0.2111  0.1206  0.0632  245 ALA Z CA    
1896 C C     . ALA A 245 ? 2.1702 1.5280 1.3581 0.2044  0.1393  0.0924  245 ALA Z C     
1897 O O     . ALA A 245 ? 2.1163 1.5226 1.3451 0.2013  0.1199  0.0821  245 ALA Z O     
1898 C CB    . ALA A 245 ? 1.9772 1.3074 1.2281 0.1501  0.1070  0.0522  245 ALA Z CB    
1899 N N     . ASN A 246 ? 2.1521 1.4758 1.2909 0.2025  0.1780  0.1297  246 ASN Z N     
1900 C CA    . ASN A 246 ? 2.2728 1.6132 1.4073 0.1913  0.2016  0.1628  246 ASN Z CA    
1901 C C     . ASN A 246 ? 2.2379 1.5569 1.4003 0.1158  0.2204  0.1854  246 ASN Z C     
1902 O O     . ASN A 246 ? 2.3065 1.6290 1.4668 0.0966  0.2455  0.2166  246 ASN Z O     
1903 C CB    . ASN A 246 ? 2.5145 1.8330 1.5832 0.2384  0.2356  0.1925  246 ASN Z CB    
1904 C CG    . ASN A 246 ? 2.5142 1.8529 1.5490 0.3191  0.2179  0.1698  246 ASN Z CG    
1905 O OD1   . ASN A 246 ? 2.5266 1.9090 1.5589 0.3606  0.2088  0.1680  246 ASN Z OD1   
1906 N ND2   . ASN A 246 ? 2.5072 1.8148 1.5150 0.3436  0.2120  0.1515  246 ASN Z ND2   
1907 N N     . ASN A 247 ? 2.2896 1.5868 1.4792 0.0750  0.2077  0.1689  247 ASN Z N     
1908 C CA    . ASN A 247 ? 2.2433 1.5141 1.4549 0.0070  0.2238  0.1868  247 ASN Z CA    
1909 C C     . ASN A 247 ? 2.1478 1.4543 1.4227 -0.0350 0.1986  0.1688  247 ASN Z C     
1910 O O     . ASN A 247 ? 2.0965 1.4213 1.4014 -0.0274 0.1680  0.1370  247 ASN Z O     
1911 C CB    . ASN A 247 ? 2.2492 1.4621 1.4379 -0.0089 0.2330  0.1864  247 ASN Z CB    
1912 C CG    . ASN A 247 ? 2.2436 1.4189 1.4370 -0.0680 0.2589  0.2125  247 ASN Z CG    
1913 O OD1   . ASN A 247 ? 2.1758 1.3678 1.4129 -0.1149 0.2528  0.2124  247 ASN Z OD1   
1914 N ND2   . ASN A 247 ? 2.3144 1.4387 1.4633 -0.0645 0.2879  0.2341  247 ASN Z ND2   
1915 N N     . PRO A 248 ? 2.1878 1.5049 1.4853 -0.0785 0.2125  0.1893  248 PRO Z N     
1916 C CA    . PRO A 248 ? 2.0905 1.4401 1.4451 -0.1206 0.1927  0.1755  248 PRO Z CA    
1917 C C     . PRO A 248 ? 2.0390 1.3571 1.4150 -0.1646 0.1867  0.1650  248 PRO Z C     
1918 O O     . PRO A 248 ? 1.9432 1.2859 1.3625 -0.1790 0.1618  0.1419  248 PRO Z O     
1919 C CB    . PRO A 248 ? 2.0934 1.4562 1.4552 -0.1497 0.2148  0.2043  248 PRO Z CB    
1920 C CG    . PRO A 248 ? 2.1740 1.4908 1.4901 -0.1448 0.2507  0.2353  248 PRO Z CG    
1921 C CD    . PRO A 248 ? 2.2379 1.5400 1.5097 -0.0859 0.2485  0.2271  248 PRO Z CD    
1922 N N     . ASP A 249 ? 2.1306 1.3951 1.4770 -0.1838 0.2099  0.1825  249 ASP Z N     
1923 C CA    . ASP A 249 ? 2.0747 1.3059 1.4352 -0.2220 0.2052  0.1741  249 ASP Z CA    
1924 C C     . ASP A 249 ? 2.0132 1.2365 1.3721 -0.1941 0.1828  0.1469  249 ASP Z C     
1925 O O     . ASP A 249 ? 2.0410 1.2356 1.3581 -0.1601 0.1893  0.1474  249 ASP Z O     
1926 C CB    . ASP A 249 ? 2.1209 1.2962 1.4491 -0.2468 0.2354  0.1997  249 ASP Z CB    
1927 C CG    . ASP A 249 ? 2.0936 1.2375 1.4384 -0.2902 0.2306  0.1929  249 ASP Z CG    
1928 O OD1   . ASP A 249 ? 2.0541 1.2101 1.4332 -0.3324 0.2297  0.1955  249 ASP Z OD1   
1929 O OD2   . ASP A 249 ? 2.1052 1.2126 1.4275 -0.2801 0.2275  0.1847  249 ASP Z OD2   
1930 N N     . ILE A 250 ? 1.9444 1.1931 1.3503 -0.2079 0.1574  0.1237  250 ILE Z N     
1931 C CA    . ILE A 250 ? 1.8638 1.1147 1.2817 -0.1801 0.1336  0.0958  250 ILE Z CA    
1932 C C     . ILE A 250 ? 1.8761 1.0717 1.2683 -0.1879 0.1400  0.0961  250 ILE Z C     
1933 O O     . ILE A 250 ? 1.8603 1.0451 1.2397 -0.1538 0.1290  0.0797  250 ILE Z O     
1934 C CB    . ILE A 250 ? 1.7268 1.0199 1.2090 -0.1951 0.1077  0.0737  250 ILE Z CB    
1935 C CG1   . ILE A 250 ? 1.6503 0.9511 1.1537 -0.1619 0.0828  0.0441  250 ILE Z CG1   
1936 C CG2   . ILE A 250 ? 1.6962 0.9738 1.2015 -0.2486 0.1134  0.0812  250 ILE Z CG2   
1937 C CD1   . ILE A 250 ? 1.6576 0.9767 1.1408 -0.1051 0.0733  0.0317  250 ILE Z CD1   
1938 N N     . VAL A 251 ? 1.9047 1.0659 1.2893 -0.2313 0.1568  0.1136  251 VAL Z N     
1939 C CA    . VAL A 251 ? 1.9220 1.0304 1.2829 -0.2422 0.1623  0.1147  251 VAL Z CA    
1940 C C     . VAL A 251 ? 1.9972 1.0688 1.2998 -0.2068 0.1766  0.1223  251 VAL Z C     
1941 O O     . VAL A 251 ? 1.9800 1.0306 1.2679 -0.1844 0.1674  0.1083  251 VAL Z O     
1942 C CB    . VAL A 251 ? 1.9462 1.0249 1.3072 -0.2932 0.1784  0.1330  251 VAL Z CB    
1943 C CG1   . VAL A 251 ? 1.9334 0.9563 1.2658 -0.3015 0.1835  0.1344  251 VAL Z CG1   
1944 C CG2   . VAL A 251 ? 1.8654 0.9790 1.2807 -0.3260 0.1644  0.1244  251 VAL Z CG2   
1945 N N     . LYS A 252 ? 1.9967 1.0610 1.2670 -0.2005 0.2003  0.1453  252 LYS Z N     
1946 C CA    . LYS A 252 ? 2.0426 1.0724 1.2548 -0.1654 0.2188  0.1566  252 LYS Z CA    
1947 C C     . LYS A 252 ? 2.0218 1.0765 1.2237 -0.1073 0.2010  0.1349  252 LYS Z C     
1948 O O     . LYS A 252 ? 2.0758 1.1011 1.2337 -0.0736 0.2069  0.1331  252 LYS Z O     
1949 C CB    . LYS A 252 ? 2.0990 1.1216 1.2870 -0.1697 0.2497  0.1878  252 LYS Z CB    
1950 C CG    . LYS A 252 ? 2.1441 1.1429 1.3471 -0.2264 0.2666  0.2074  252 LYS Z CG    
1951 C CD    . LYS A 252 ? 2.2367 1.2414 1.4333 -0.2321 0.2942  0.2362  252 LYS Z CD    
1952 C CE    . LYS A 252 ? 2.2118 1.2084 1.4412 -0.2865 0.3042  0.2485  252 LYS Z CE    
1953 N NZ    . LYS A 252 ? 2.3028 1.3230 1.5462 -0.2892 0.3258  0.2721  252 LYS Z NZ    
1954 N N     . VAL A 253 ? 1.9369 1.0465 1.1804 -0.0947 0.1786  0.1172  253 VAL Z N     
1955 C CA    . VAL A 253 ? 1.9374 1.0765 1.1821 -0.0401 0.1563  0.0914  253 VAL Z CA    
1956 C C     . VAL A 253 ? 1.9466 1.0731 1.2089 -0.0341 0.1342  0.0645  253 VAL Z C     
1957 O O     . VAL A 253 ? 1.9714 1.0861 1.2061 0.0088  0.1279  0.0503  253 VAL Z O     
1958 C CB    . VAL A 253 ? 1.8952 1.0973 1.1858 -0.0306 0.1364  0.0784  253 VAL Z CB    
1959 C CG1   . VAL A 253 ? 1.8786 1.1113 1.1796 0.0246  0.1084  0.0461  253 VAL Z CG1   
1960 C CG2   . VAL A 253 ? 2.0125 1.2294 1.2827 -0.0285 0.1580  0.1051  253 VAL Z CG2   
1961 N N     . ILE A 254 ? 1.9448 1.0742 1.2534 -0.0758 0.1234  0.0580  254 ILE Z N     
1962 C CA    . ILE A 254 ? 1.9025 1.0195 1.2342 -0.0750 0.1048  0.0361  254 ILE Z CA    
1963 C C     . ILE A 254 ? 1.9681 1.0258 1.2462 -0.0720 0.1202  0.0453  254 ILE Z C     
1964 O O     . ILE A 254 ? 1.9654 1.0110 1.2396 -0.0458 0.1072  0.0263  254 ILE Z O     
1965 C CB    . ILE A 254 ? 1.8121 0.9401 1.1991 -0.1218 0.0960  0.0336  254 ILE Z CB    
1966 C CG1   . ILE A 254 ? 1.7316 0.9198 1.1739 -0.1221 0.0791  0.0218  254 ILE Z CG1   
1967 C CG2   . ILE A 254 ? 1.7487 0.8593 1.1577 -0.1210 0.0811  0.0157  254 ILE Z CG2   
1968 C CD1   . ILE A 254 ? 1.6376 0.8401 1.1332 -0.1646 0.0723  0.0203  254 ILE Z CD1   
1969 N N     . LYS A 255 ? 2.0112 1.0318 1.2498 -0.0984 0.1479  0.0741  255 LYS Z N     
1970 C CA    . LYS A 255 ? 2.0695 1.0321 1.2532 -0.0952 0.1650  0.0853  255 LYS Z CA    
1971 C C     . LYS A 255 ? 2.1260 1.0818 1.2608 -0.0387 0.1695  0.0806  255 LYS Z C     
1972 O O     . LYS A 255 ? 2.1559 1.0738 1.2532 -0.0213 0.1728  0.0771  255 LYS Z O     
1973 C CB    . LYS A 255 ? 2.0865 1.0133 1.2444 -0.1351 0.1940  0.1169  255 LYS Z CB    
1974 C CG    . LYS A 255 ? 2.0375 0.9612 1.2346 -0.1891 0.1900  0.1203  255 LYS Z CG    
1975 C CD    . LYS A 255 ? 2.0633 0.9511 1.2373 -0.2256 0.2170  0.1484  255 LYS Z CD    
1976 C CE    . LYS A 255 ? 2.0250 0.9362 1.2518 -0.2681 0.2060  0.1435  255 LYS Z CE    
1977 N NZ    . LYS A 255 ? 2.0668 1.0002 1.3120 -0.2871 0.2185  0.1563  255 LYS Z NZ    
1978 N N     . LYS A 256 ? 1.5261 1.3929 1.4515 0.0486  -0.1748 0.2456  256 LYS Z N     
1979 C CA    . LYS A 256 ? 1.5444 1.4297 1.5011 0.0395  -0.2011 0.2388  256 LYS Z CA    
1980 C C     . LYS A 256 ? 1.5883 1.4454 1.5200 0.0380  -0.1527 0.2017  256 LYS Z C     
1981 O O     . LYS A 256 ? 1.6040 1.4739 1.5420 0.0365  -0.1599 0.2074  256 LYS Z O     
1982 C CB    . LYS A 256 ? 1.5555 1.4777 1.5061 0.0489  -0.2274 0.3025  256 LYS Z CB    
1983 C CG    . LYS A 256 ? 1.5550 1.5148 1.5555 0.0433  -0.2951 0.3303  256 LYS Z CG    
1984 C CD    . LYS A 256 ? 1.5748 1.5691 1.5631 0.0543  -0.3152 0.3957  256 LYS Z CD    
1985 C CE    . LYS A 256 ? 1.6052 1.6388 1.6504 0.0461  -0.3863 0.4180  256 LYS Z CE    
1986 N NZ    . LYS A 256 ? 1.6531 1.6950 1.7507 0.0296  -0.4201 0.3803  256 LYS Z NZ    
1987 N N     . ILE A 257 ? 1.5684 1.3870 1.4722 0.0387  -0.1038 0.1636  257 ILE Z N     
1988 C CA    . ILE A 257 ? 1.5946 1.3833 1.4709 0.0380  -0.0535 0.1277  257 ILE Z CA    
1989 C C     . ILE A 257 ? 1.5959 1.3887 1.5219 0.0210  -0.0795 0.0834  257 ILE Z C     
1990 O O     . ILE A 257 ? 1.6185 1.4041 1.5318 0.0210  -0.0571 0.0716  257 ILE Z O     
1991 C CB    . ILE A 257 ? 1.6051 1.3511 1.4476 0.0404  0.0006  0.0910  257 ILE Z CB    
1992 C CG1   . ILE A 257 ? 1.6121 1.3272 1.4214 0.0410  0.0554  0.0584  257 ILE Z CG1   
1993 C CG2   . ILE A 257 ? 1.5984 1.3357 1.4863 0.0263  -0.0235 0.0454  257 ILE Z CG2   
1994 C CD1   . ILE A 257 ? 1.6559 1.3284 1.4333 0.0426  0.1092  0.0199  257 ILE Z CD1   
1995 N N     . GLY A 258 ? 1.5929 1.3981 1.5754 0.0071  -0.1278 0.0601  258 GLY Z N     
1996 C CA    . GLY A 258 ? 1.5939 1.4064 1.6274 -0.0093 -0.1589 0.0201  258 GLY Z CA    
1997 C C     . GLY A 258 ? 1.5845 1.4317 1.6353 -0.0083 -0.1942 0.0552  258 GLY Z C     
1998 O O     . GLY A 258 ? 1.5698 1.4191 1.6441 -0.0170 -0.2025 0.0280  258 GLY Z O     
1999 N N     . HIS A 259 ? 1.5793 1.4540 1.6185 0.0028  -0.2149 0.1159  259 HIS Z N     
2000 C CA    . HIS A 259 ? 1.5785 1.4875 1.6303 0.0058  -0.2475 0.1560  259 HIS Z CA    
2001 C C     . HIS A 259 ? 1.5939 1.4935 1.5958 0.0182  -0.2017 0.1738  259 HIS Z C     
2002 O O     . HIS A 259 ? 1.6102 1.5238 1.6256 0.0163  -0.2143 0.1759  259 HIS Z O     
2003 C CB    . HIS A 259 ? 1.5917 1.5340 1.6501 0.0131  -0.2872 0.2151  259 HIS Z CB    
2004 C CG    . HIS A 259 ? 1.6470 1.6214 1.7010 0.0213  -0.3074 0.2668  259 HIS Z CG    
2005 N ND1   . HIS A 259 ? 1.6859 1.6775 1.7732 0.0137  -0.3351 0.2576  259 HIS Z ND1   
2006 C CD2   . HIS A 259 ? 1.6338 1.6263 1.6538 0.0368  -0.3040 0.3284  259 HIS Z CD2   
2007 C CE1   . HIS A 259 ? 1.6828 1.7017 1.7571 0.0244  -0.3477 0.3115  259 HIS Z CE1   
2008 N NE2   . HIS A 259 ? 1.6630 1.6832 1.6966 0.0383  -0.3294 0.3553  259 HIS Z NE2   
2009 N N     . TYR A 260 ? 1.6291 1.5049 1.5732 0.0312  -0.1486 0.1864  260 TYR Z N     
2010 C CA    . TYR A 260 ? 1.6181 1.4835 1.5096 0.0442  -0.1023 0.2054  260 TYR Z CA    
2011 C C     . TYR A 260 ? 1.6344 1.4701 1.5217 0.0371  -0.0662 0.1504  260 TYR Z C     
2012 O O     . TYR A 260 ? 1.6233 1.4586 1.4887 0.0431  -0.0460 0.1590  260 TYR Z O     
2013 C CB    . TYR A 260 ? 1.6113 1.4602 1.4408 0.0605  -0.0569 0.2364  260 TYR Z CB    
2014 C CG    . TYR A 260 ? 1.6076 1.4875 1.4308 0.0711  -0.0860 0.2999  260 TYR Z CG    
2015 C CD1   . TYR A 260 ? 1.6050 1.5158 1.4225 0.0795  -0.1060 0.3507  260 TYR Z CD1   
2016 C CD2   . TYR A 260 ? 1.6054 1.4832 1.4278 0.0730  -0.0930 0.3092  260 TYR Z CD2   
2017 C CE1   . TYR A 260 ? 1.6141 1.5535 1.4259 0.0890  -0.1324 0.4088  260 TYR Z CE1   
2018 C CE2   . TYR A 260 ? 1.5908 1.4968 1.4076 0.0826  -0.1195 0.3668  260 TYR Z CE2   
2019 C CZ    . TYR A 260 ? 1.6045 1.5414 1.4162 0.0904  -0.1390 0.4164  260 TYR Z CZ    
2020 O OH    . TYR A 260 ? 1.6105 1.5756 1.4168 0.0998  -0.1652 0.4737  260 TYR Z OH    
2021 N N     . LEU A 261 ? 1.6108 1.4217 1.5190 0.0247  -0.0583 0.0942  261 LEU Z N     
2022 C CA    . LEU A 261 ? 1.6238 1.4058 1.5311 0.0168  -0.0251 0.0385  261 LEU Z CA    
2023 C C     . LEU A 261 ? 1.6349 1.4309 1.6048 -0.0002 -0.0695 0.0017  261 LEU Z C     
2024 O O     . LEU A 261 ? 1.6584 1.4349 1.6346 -0.0078 -0.0492 -0.0445 261 LEU Z O     
2025 C CB    . LEU A 261 ? 1.6497 1.3924 1.5374 0.0141  0.0176  -0.0042 261 LEU Z CB    
2026 C CG    . LEU A 261 ? 1.6525 1.3682 1.4699 0.0300  0.0809  0.0133  261 LEU Z CG    
2027 C CD1   . LEU A 261 ? 1.6191 1.2941 1.4235 0.0249  0.1225  -0.0385 261 LEU Z CD1   
2028 C CD2   . LEU A 261 ? 1.6380 1.3503 1.4193 0.0390  0.1125  0.0278  261 LEU Z CD2   
2029 N N     . LYS A 262 ? 1.6189 1.4487 1.6341 -0.0058 -0.1300 0.0226  262 LYS Z N     
2030 C CA    . LYS A 262 ? 1.5968 1.4427 1.6743 -0.0221 -0.1783 -0.0096 262 LYS Z CA    
2031 C C     . LYS A 262 ? 1.6077 1.4250 1.7086 -0.0370 -0.1672 -0.0785 262 LYS Z C     
2032 O O     . LYS A 262 ? 1.6140 1.4273 1.7447 -0.0483 -0.1751 -0.1204 262 LYS Z O     
2033 C CB    . LYS A 262 ? 1.6007 1.4592 1.6825 -0.0209 -0.1822 -0.0048 262 LYS Z CB    
2034 C CG    . LYS A 262 ? 1.6051 1.4930 1.6653 -0.0062 -0.1944 0.0628  262 LYS Z CG    
2035 C CD    . LYS A 262 ? 1.6001 1.5059 1.6785 -0.0071 -0.2118 0.0654  262 LYS Z CD    
2036 C CE    . LYS A 262 ? 1.6296 1.5583 1.7761 -0.0230 -0.2725 0.0426  262 LYS Z CE    
2037 N NZ    . LYS A 262 ? 1.6403 1.5873 1.8052 -0.0230 -0.2909 0.0462  262 LYS Z NZ    
2038 N N     . MET A 263 ? 1.5968 1.3941 1.6837 -0.0365 -0.1485 -0.0897 263 MET Z N     
2039 C CA    . MET A 263 ? 1.5935 1.3635 1.7013 -0.0498 -0.1381 -0.1525 263 MET Z CA    
2040 C C     . MET A 263 ? 1.5863 1.3648 1.7230 -0.0551 -0.1736 -0.1518 263 MET Z C     
2041 O O     . MET A 263 ? 1.5619 1.3624 1.6934 -0.0467 -0.1964 -0.1021 263 MET Z O     
2042 C CB    . MET A 263 ? 1.6294 1.3578 1.6856 -0.0435 -0.0679 -0.1769 263 MET Z CB    
2043 C CG    . MET A 263 ? 1.6650 1.3829 1.6876 -0.0369 -0.0289 -0.1761 263 MET Z CG    
2044 S SD    . MET A 263 ? 1.8142 1.4871 1.7654 -0.0251 0.0542  -0.1868 263 MET Z SD    
2045 C CE    . MET A 263 ? 1.6951 1.3662 1.6198 -0.0187 0.0826  -0.1806 263 MET Z CE    
2046 N N     . ASN A 264 ? 1.6071 1.3683 1.7744 -0.0689 -0.1786 -0.2068 264 ASN Z N     
2047 C CA    . ASN A 264 ? 1.5914 1.3580 1.7869 -0.0743 -0.2110 -0.2113 264 ASN Z CA    
2048 C C     . ASN A 264 ? 1.5962 1.3334 1.7494 -0.0652 -0.1651 -0.2129 264 ASN Z C     
2049 O O     . ASN A 264 ? 1.6474 1.3581 1.8077 -0.0728 -0.1479 -0.2608 264 ASN Z O     
2050 C CB    . ASN A 264 ? 1.6093 1.3733 1.8602 -0.0934 -0.2424 -0.2690 264 ASN Z CB    
2051 C CG    . ASN A 264 ? 1.5901 1.3716 1.8814 -0.1000 -0.2938 -0.2653 264 ASN Z CG    
2052 O OD1   . ASN A 264 ? 1.5609 1.3403 1.8335 -0.0915 -0.2889 -0.2399 264 ASN Z OD1   
2053 N ND2   . ASN A 264 ? 1.5736 1.3725 1.9206 -0.1149 -0.3439 -0.2910 264 ASN Z ND2   
2054 N N     . ILE A 265 ? 1.5911 1.3329 1.6999 -0.0487 -0.1452 -0.1603 265 ILE Z N     
2055 C CA    . ILE A 265 ? 1.5809 1.2957 1.6449 -0.0380 -0.0999 -0.1565 265 ILE Z CA    
2056 C C     . ILE A 265 ? 1.5571 1.2868 1.6359 -0.0351 -0.1336 -0.1308 265 ILE Z C     
2057 O O     . ILE A 265 ? 1.5348 1.2966 1.6214 -0.0296 -0.1702 -0.0807 265 ILE Z O     
2058 C CB    . ILE A 265 ? 1.5954 1.3026 1.5956 -0.0202 -0.0518 -0.1158 265 ILE Z CB    
2059 C CG1   . ILE A 265 ? 1.6410 1.3406 1.6294 -0.0220 -0.0268 -0.1320 265 ILE Z CG1   
2060 C CG2   . ILE A 265 ? 1.5970 1.2699 1.5490 -0.0103 0.0026  -0.1228 265 ILE Z CG2   
2061 C CD1   . ILE A 265 ? 1.6337 1.3269 1.5603 -0.0047 0.0186  -0.0921 265 ILE Z CD1   
2062 N N     . THR A 266 ? 1.6026 1.3085 1.6853 -0.0388 -0.1210 -0.1656 266 THR Z N     
2063 C CA    . THR A 266 ? 1.5279 1.2434 1.6222 -0.0354 -0.1480 -0.1457 266 THR Z CA    
2064 C C     . THR A 266 ? 1.5321 1.2231 1.5694 -0.0193 -0.0966 -0.1280 266 THR Z C     
2065 O O     . THR A 266 ? 1.5591 1.2142 1.5697 -0.0185 -0.0468 -0.1647 266 THR Z O     
2066 C CB    . THR A 266 ? 1.5383 1.2475 1.6823 -0.0506 -0.1777 -0.1957 266 THR Z CB    
2067 O OG1   . THR A 266 ? 1.5384 1.2719 1.7361 -0.0654 -0.2286 -0.2107 266 THR Z OG1   
2068 C CG2   . THR A 266 ? 1.5267 1.2451 1.6806 -0.0458 -0.2045 -0.1738 266 THR Z CG2   
2069 N N     . VAL A 267 ? 1.4993 1.2098 1.5183 -0.0064 -0.1090 -0.0720 267 VAL Z N     
2070 C CA    . VAL A 267 ? 1.5075 1.1977 1.4709 0.0103  -0.0625 -0.0497 267 VAL Z CA    
2071 C C     . VAL A 267 ? 1.5174 1.2039 1.4949 0.0117  -0.0791 -0.0532 267 VAL Z C     
2072 O O     . VAL A 267 ? 1.5122 1.2283 1.5188 0.0117  -0.1292 -0.0224 267 VAL Z O     
2073 C CB    . VAL A 267 ? 1.4896 1.2010 1.4157 0.0259  -0.0585 0.0162  267 VAL Z CB    
2074 C CG1   . VAL A 267 ? 1.5019 1.1916 1.3694 0.0434  -0.0097 0.0381  267 VAL Z CG1   
2075 C CG2   . VAL A 267 ? 1.4845 1.1992 1.3947 0.0258  -0.0409 0.0211  267 VAL Z CG2   
2076 N N     . PRO A 268 ? 1.5309 1.1809 1.4884 0.0131  -0.0371 -0.0915 268 PRO Z N     
2077 C CA    . PRO A 268 ? 1.5240 1.1665 1.4872 0.0171  -0.0449 -0.0942 268 PRO Z CA    
2078 C C     . PRO A 268 ? 1.5289 1.1845 1.4569 0.0352  -0.0421 -0.0339 268 PRO Z C     
2079 O O     . PRO A 268 ? 1.5291 1.1798 1.4069 0.0476  -0.0038 -0.0038 268 PRO Z O     
2080 C CB    . PRO A 268 ? 1.5327 1.1304 1.4677 0.0179  0.0131  -0.1428 268 PRO Z CB    
2081 C CG    . PRO A 268 ? 1.5384 1.1246 1.4784 0.0067  0.0316  -0.1800 268 PRO Z CG    
2082 C CD    . PRO A 268 ? 1.5313 1.1450 1.4628 0.0102  0.0183  -0.1368 268 PRO Z CD    
2083 N N     . GLU A 269 ? 1.6104 1.2827 1.5641 0.0367  -0.0821 -0.0165 269 GLU Z N     
2084 C CA    . GLU A 269 ? 1.5938 1.2828 1.5204 0.0530  -0.0869 0.0423  269 GLU Z CA    
2085 C C     . GLU A 269 ? 1.5682 1.2252 1.4344 0.0697  -0.0263 0.0472  269 GLU Z C     
2086 O O     . GLU A 269 ? 1.5422 1.2087 1.3749 0.0851  -0.0188 0.0958  269 GLU Z O     
2087 C CB    . GLU A 269 ? 1.6512 1.3663 1.6249 0.0494  -0.1482 0.0569  269 GLU Z CB    
2088 C CG    . GLU A 269 ? 1.6865 1.4389 1.7151 0.0358  -0.2118 0.0665  269 GLU Z CG    
2089 C CD    . GLU A 269 ? 1.7873 1.5661 1.8597 0.0332  -0.2720 0.0848  269 GLU Z CD    
2090 O OE1   . GLU A 269 ? 1.8663 1.6322 1.9311 0.0405  -0.2652 0.0824  269 GLU Z OE1   
2091 O OE2   . GLU A 269 ? 1.7789 1.5912 1.8932 0.0242  -0.3261 0.1015  269 GLU Z OE2   
2092 N N     . ASP A 270 ? 1.5701 1.1895 1.4223 0.0668  0.0170  -0.0031 270 ASP Z N     
2093 C CA    . ASP A 270 ? 1.6016 1.1878 1.3947 0.0823  0.0787  -0.0026 270 ASP Z CA    
2094 C C     . ASP A 270 ? 1.5814 1.1522 1.3229 0.0886  0.1318  0.0039  270 ASP Z C     
2095 O O     . ASP A 270 ? 1.6051 1.1553 1.2894 0.1041  0.1818  0.0203  270 ASP Z O     
2096 C CB    . ASP A 270 ? 1.6171 1.1692 1.4188 0.0774  0.1004  -0.0587 270 ASP Z CB    
2097 C CG    . ASP A 270 ? 1.6263 1.1675 1.4630 0.0587  0.0972  -0.1153 270 ASP Z CG    
2098 O OD1   . ASP A 270 ? 1.6327 1.1807 1.4681 0.0526  0.1012  -0.1156 270 ASP Z OD1   
2099 O OD2   . ASP A 270 ? 1.6099 1.1355 1.4755 0.0503  0.0904  -0.1597 270 ASP Z OD2   
2100 N N     . TYR A 271 ? 1.9116 1.0949 1.1702 0.2107  -0.0422 -0.2935 271 TYR Z N     
2101 C CA    . TYR A 271 ? 1.8089 1.0420 1.1409 0.2094  -0.0207 -0.2931 271 TYR Z CA    
2102 C C     . TYR A 271 ? 1.7651 0.9818 1.1098 0.1692  -0.0276 -0.2825 271 TYR Z C     
2103 O O     . TYR A 271 ? 1.6783 0.9659 1.1061 0.1547  -0.0142 -0.2684 271 TYR Z O     
2104 C CB    . TYR A 271 ? 1.7489 1.0224 1.1205 0.2250  -0.0069 -0.2932 271 TYR Z CB    
2105 C CG    . TYR A 271 ? 1.6590 0.9876 1.1110 0.2244  0.0140  -0.2916 271 TYR Z CG    
2106 C CD1   . TYR A 271 ? 1.5692 0.9669 1.0848 0.2422  0.0339  -0.2914 271 TYR Z CD1   
2107 C CD2   . TYR A 271 ? 1.6394 0.9527 1.1045 0.2056  0.0125  -0.2891 271 TYR Z CD2   
2108 C CE1   . TYR A 271 ? 1.4621 0.9125 1.0549 0.2419  0.0512  -0.2880 271 TYR Z CE1   
2109 C CE2   . TYR A 271 ? 1.5478 0.9147 1.0890 0.2078  0.0297  -0.2871 271 TYR Z CE2   
2110 C CZ    . TYR A 271 ? 1.4617 0.8975 1.0681 0.2263  0.0487  -0.2863 271 TYR Z CZ    
2111 O OH    . TYR A 271 ? 1.3729 0.8654 1.0589 0.2283  0.0639  -0.2823 271 TYR Z OH    
2112 N N     . ILE A 272 ? 1.8048 0.9484 1.0816 0.1459  -0.0494 -0.2824 272 ILE Z N     
2113 C CA    . ILE A 272 ? 1.7994 0.9491 1.0972 0.0984  -0.0584 -0.2639 272 ILE Z CA    
2114 C C     . ILE A 272 ? 1.7381 0.9370 1.0753 0.0750  -0.0589 -0.2471 272 ILE Z C     
2115 O O     . ILE A 272 ? 1.6847 0.9467 1.0918 0.0515  -0.0511 -0.2319 272 ILE Z O     
2116 C CB    . ILE A 272 ? 1.8956 0.9516 1.1022 0.0753  -0.0845 -0.2662 272 ILE Z CB    
2117 C CG1   . ILE A 272 ? 1.9487 0.9807 1.1348 0.0968  -0.0827 -0.2740 272 ILE Z CG1   
2118 C CG2   . ILE A 272 ? 1.8575 0.9294 1.0875 0.0235  -0.0936 -0.2461 272 ILE Z CG2   
2119 C CD1   . ILE A 272 ? 1.9092 0.9768 1.1523 0.0946  -0.0673 -0.2739 272 ILE Z CD1   
2120 N N     . ASN A 273 ? 1.7657 0.9363 1.0559 0.0841  -0.0688 -0.2511 273 ASN Z N     
2121 C CA    . ASN A 273 ? 1.7532 0.9671 1.0748 0.0675  -0.0686 -0.2376 273 ASN Z CA    
2122 C C     . ASN A 273 ? 1.6164 0.9211 1.0292 0.0820  -0.0446 -0.2311 273 ASN Z C     
2123 O O     . ASN A 273 ? 1.5545 0.9127 1.0199 0.0595  -0.0404 -0.2160 273 ASN Z O     
2124 C CB    . ASN A 273 ? 1.8410 1.0084 1.0948 0.0831  -0.0830 -0.2457 273 ASN Z CB    
2125 C CG    . ASN A 273 ? 1.9430 1.0134 1.1005 0.0693  -0.1101 -0.2524 273 ASN Z CG    
2126 O OD1   . ASN A 273 ? 1.9512 0.9965 1.0971 0.0333  -0.1200 -0.2443 273 ASN Z OD1   
2127 N ND2   . ASN A 273 ? 1.9977 1.0139 1.0835 0.0980  -0.1238 -0.2670 273 ASN Z ND2   
2128 N N     . GLY A 274 ? 1.6181 0.9390 1.0463 0.1196  -0.0299 -0.2431 274 GLY Z N     
2129 C CA    . GLY A 274 ? 1.5458 0.9476 1.0568 0.1340  -0.0080 -0.2376 274 GLY Z CA    
2130 C C     . GLY A 274 ? 1.4484 0.8997 1.0316 0.1128  0.0005  -0.2258 274 GLY Z C     
2131 O O     . GLY A 274 ? 1.3465 0.8628 0.9970 0.1053  0.0101  -0.2134 274 GLY Z O     
2132 N N     . PHE A 275 ? 1.4584 0.8788 1.0257 0.1042  -0.0045 -0.2299 275 PHE Z N     
2133 C CA    . PHE A 275 ? 1.3967 0.8638 1.0282 0.0854  0.0006  -0.2195 275 PHE Z CA    
2134 C C     . PHE A 275 ? 1.3845 0.8728 1.0295 0.0446  -0.0110 -0.2021 275 PHE Z C     
2135 O O     . PHE A 275 ? 1.2888 0.8431 1.0025 0.0338  -0.0049 -0.1906 275 PHE Z O     
2136 C CB    . PHE A 275 ? 1.4459 0.8729 1.0515 0.0862  -0.0032 -0.2280 275 PHE Z CB    
2137 C CG    . PHE A 275 ? 1.3683 0.8494 1.0430 0.0726  0.0022  -0.2187 275 PHE Z CG    
2138 C CD1   . PHE A 275 ? 1.3138 0.8414 1.0502 0.1002  0.0203  -0.2242 275 PHE Z CD1   
2139 C CD2   . PHE A 275 ? 1.3619 0.8512 1.0398 0.0330  -0.0117 -0.2046 275 PHE Z CD2   
2140 C CE1   . PHE A 275 ? 1.2359 0.8156 1.0370 0.0907  0.0232  -0.2161 275 PHE Z CE1   
2141 C CE2   . PHE A 275 ? 1.3361 0.8815 1.0774 0.0230  -0.0087 -0.1964 275 PHE Z CE2   
2142 C CZ    . PHE A 275 ? 1.2620 0.8518 1.0653 0.0530  0.0082  -0.2022 275 PHE Z CZ    
2143 N N     . ILE A 276 ? 1.4050 0.8369 0.9814 0.0229  -0.0290 -0.2012 276 ILE Z N     
2144 C CA    . ILE A 276 ? 1.3970 0.8466 0.9773 -0.0164 -0.0405 -0.1864 276 ILE Z CA    
2145 C C     . ILE A 276 ? 1.3221 0.8314 0.9511 -0.0129 -0.0312 -0.1782 276 ILE Z C     
2146 O O     . ILE A 276 ? 1.2653 0.8302 0.9423 -0.0341 -0.0306 -0.1659 276 ILE Z O     
2147 C CB    . ILE A 276 ? 1.5006 0.8733 0.9927 -0.0376 -0.0617 -0.1884 276 ILE Z CB    
2148 C CG1   . ILE A 276 ? 1.5335 0.8463 0.9762 -0.0484 -0.0735 -0.1936 276 ILE Z CG1   
2149 C CG2   . ILE A 276 ? 1.4392 0.8360 0.9358 -0.0763 -0.0716 -0.1743 276 ILE Z CG2   
2150 C CD1   . ILE A 276 ? 1.6533 0.8844 1.0057 -0.0726 -0.0973 -0.1947 276 ILE Z CD1   
2151 N N     . ARG A 277 ? 1.3409 0.8405 0.9559 0.0152  -0.0247 -0.1853 277 ARG Z N     
2152 C CA    . ARG A 277 ? 1.3100 0.8623 0.9673 0.0208  -0.0156 -0.1776 277 ARG Z CA    
2153 C C     . ARG A 277 ? 1.1753 0.7998 0.9168 0.0307  0.0005  -0.1715 277 ARG Z C     
2154 O O     . ARG A 277 ? 1.0959 0.7722 0.8828 0.0188  0.0033  -0.1602 277 ARG Z O     
2155 C CB    . ARG A 277 ? 1.3389 0.8676 0.9612 0.0506  -0.0130 -0.1867 277 ARG Z CB    
2156 C CG    . ARG A 277 ? 1.4384 0.9062 0.9839 0.0413  -0.0310 -0.1903 277 ARG Z CG    
2157 C CD    . ARG A 277 ? 1.4909 0.9509 1.0108 0.0732  -0.0289 -0.1980 277 ARG Z CD    
2158 N NE    . ARG A 277 ? 1.5098 0.9422 1.0016 0.1076  -0.0254 -0.2137 277 ARG Z NE    
2159 C CZ    . ARG A 277 ? 1.6157 0.9757 1.0283 0.1189  -0.0408 -0.2276 277 ARG Z CZ    
2160 N NH1   . ARG A 277 ? 1.6843 0.9895 1.0391 0.0965  -0.0615 -0.2264 277 ARG Z NH1   
2161 N NH2   . ARG A 277 ? 1.6596 1.0010 1.0478 0.1530  -0.0365 -0.2434 277 ARG Z NH2   
2162 N N     . ALA A 278 ? 1.1986 0.8246 0.9584 0.0537  0.0103  -0.1800 278 ALA Z N     
2163 C CA    . ALA A 278 ? 1.1211 0.8109 0.9593 0.0649  0.0241  -0.1755 278 ALA Z CA    
2164 C C     . ALA A 278 ? 1.0462 0.7750 0.9257 0.0377  0.0175  -0.1642 278 ALA Z C     
2165 O O     . ALA A 278 ? 0.9769 0.7628 0.9124 0.0343  0.0213  -0.1545 278 ALA Z O     
2166 C CB    . ALA A 278 ? 1.0906 0.7700 0.9345 0.0936  0.0348  -0.1885 278 ALA Z CB    
2167 N N     . ASN A 279 ? 1.0926 0.7906 0.9411 0.0187  0.0062  -0.1655 279 ASN Z N     
2168 C CA    . ASN A 279 ? 1.0867 0.8239 0.9677 -0.0080 -0.0023 -0.1554 279 ASN Z CA    
2169 C C     . ASN A 279 ? 1.0825 0.8484 0.9666 -0.0338 -0.0104 -0.1440 279 ASN Z C     
2170 O O     . ASN A 279 ? 1.0109 0.8378 0.9467 -0.0423 -0.0116 -0.1353 279 ASN Z O     
2171 C CB    . ASN A 279 ? 1.1235 0.8163 0.9593 -0.0267 -0.0144 -0.1582 279 ASN Z CB    
2172 C CG    . ASN A 279 ? 1.0735 0.8155 0.9467 -0.0512 -0.0229 -0.1482 279 ASN Z CG    
2173 O OD1   . ASN A 279 ? 1.0085 0.8166 0.9498 -0.0424 -0.0174 -0.1433 279 ASN Z OD1   
2174 N ND2   . ASN A 279 ? 1.1486 0.8596 0.9756 -0.0821 -0.0380 -0.1449 279 ASN Z ND2   
2175 N N     . ASN A 280 ? 1.1081 0.8303 0.9349 -0.0440 -0.0168 -0.1451 280 ASN Z N     
2176 C CA    . ASN A 280 ? 1.1195 0.8655 0.9443 -0.0660 -0.0229 -0.1363 280 ASN Z CA    
2177 C C     . ASN A 280 ? 1.0748 0.8727 0.9519 -0.0483 -0.0111 -0.1317 280 ASN Z C     
2178 O O     . ASN A 280 ? 1.0486 0.8866 0.9451 -0.0635 -0.0143 -0.1237 280 ASN Z O     
2179 C CB    . ASN A 280 ? 1.2273 0.9115 0.9786 -0.0768 -0.0323 -0.1399 280 ASN Z CB    
2180 C CG    . ASN A 280 ? 1.2852 0.9206 0.9810 -0.1051 -0.0485 -0.1408 280 ASN Z CG    
2181 O OD1   . ASN A 280 ? 1.2567 0.9190 0.9717 -0.1262 -0.0543 -0.1351 280 ASN Z OD1   
2182 N ND2   . ASN A 280 ? 1.3855 0.9496 1.0107 -0.1057 -0.0576 -0.1477 280 ASN Z ND2   
2183 N N     . THR A 281 ? 1.0531 0.8505 0.9505 -0.0167 0.0021  -0.1370 281 THR Z N     
2184 C CA    . THR A 281 ? 1.0119 0.8557 0.9581 -0.0005 0.0130  -0.1316 281 THR Z CA    
2185 C C     . THR A 281 ? 0.9339 0.8361 0.9478 0.0013  0.0151  -0.1259 281 THR Z C     
2186 O O     . THR A 281 ? 0.9044 0.8513 0.9546 -0.0012 0.0153  -0.1179 281 THR Z O     
2187 C CB    . THR A 281 ? 1.0129 0.8398 0.9548 0.0309  0.0257  -0.1386 281 THR Z CB    
2188 O OG1   . THR A 281 ? 1.0818 0.8558 0.9581 0.0326  0.0210  -0.1450 281 THR Z OG1   
2189 C CG2   . THR A 281 ? 0.9189 0.7931 0.9084 0.0433  0.0357  -0.1309 281 THR Z CG2   
2190 N N     . PHE A 282 ? 0.9275 0.8281 0.9562 0.0073  0.0154  -0.1307 282 PHE Z N     
2191 C CA    . PHE A 282 ? 0.8562 0.8118 0.9475 0.0102  0.0143  -0.1262 282 PHE Z CA    
2192 C C     . PHE A 282 ? 0.8533 0.8430 0.9493 -0.0178 -0.0004 -0.1182 282 PHE Z C     
2193 O O     . PHE A 282 ? 0.8064 0.8510 0.9512 -0.0159 -0.0040 -0.1124 282 PHE Z O     
2194 C CB    . PHE A 282 ? 0.8608 0.8064 0.9640 0.0233  0.0176  -0.1339 282 PHE Z CB    
2195 C CG    . PHE A 282 ? 0.8180 0.7674 0.9521 0.0559  0.0332  -0.1404 282 PHE Z CG    
2196 C CD1   . PHE A 282 ? 0.8449 0.7462 0.9399 0.0728  0.0421  -0.1518 282 PHE Z CD1   
2197 C CD2   . PHE A 282 ? 0.7621 0.7637 0.9616 0.0698  0.0377  -0.1356 282 PHE Z CD2   
2198 C CE1   . PHE A 282 ? 0.8539 0.7644 0.9757 0.1022  0.0570  -0.1586 282 PHE Z CE1   
2199 C CE2   . PHE A 282 ? 0.7378 0.7447 0.9652 0.0972  0.0520  -0.1412 282 PHE Z CE2   
2200 C CZ    . PHE A 282 ? 0.7797 0.7436 0.9688 0.1130  0.0625  -0.1528 282 PHE Z CZ    
2201 N N     . LEU A 283 ? 0.8890 0.8464 0.9312 -0.0435 -0.0103 -0.1183 283 LEU Z N     
2202 C CA    . LEU A 283 ? 0.8829 0.8739 0.9224 -0.0731 -0.0248 -0.1116 283 LEU Z CA    
2203 C C     . LEU A 283 ? 0.9215 0.9333 0.9532 -0.0851 -0.0275 -0.1064 283 LEU Z C     
2204 O O     . LEU A 283 ? 0.8845 0.9519 0.9450 -0.0933 -0.0347 -0.1012 283 LEU Z O     
2205 C CB    . LEU A 283 ? 0.9629 0.9106 0.9463 -0.0993 -0.0353 -0.1133 283 LEU Z CB    
2206 C CG    . LEU A 283 ? 0.9355 0.8772 0.9265 -0.0980 -0.0382 -0.1161 283 LEU Z CG    
2207 C CD1   . LEU A 283 ? 0.9709 0.8576 0.8948 -0.1262 -0.0494 -0.1170 283 LEU Z CD1   
2208 C CD2   . LEU A 283 ? 0.8956 0.9124 0.9430 -0.1016 -0.0454 -0.1101 283 LEU Z CD2   
2209 N N     . TYR A 284 ? 0.9430 0.9116 0.9341 -0.0841 -0.0224 -0.1086 284 TYR Z N     
2210 C CA    . TYR A 284 ? 0.9698 0.9489 0.9407 -0.0995 -0.0260 -0.1049 284 TYR Z CA    
2211 C C     . TYR A 284 ? 0.9743 0.9535 0.9560 -0.0785 -0.0143 -0.1041 284 TYR Z C     
2212 O O     . TYR A 284 ? 0.9950 0.9619 0.9462 -0.0868 -0.0149 -0.1035 284 TYR Z O     
2213 C CB    . TYR A 284 ? 1.0315 0.9605 0.9352 -0.1251 -0.0350 -0.1073 284 TYR Z CB    
2214 C CG    . TYR A 284 ? 1.0891 1.0143 0.9747 -0.1509 -0.0477 -0.1065 284 TYR Z CG    
2215 C CD1   . TYR A 284 ? 1.0485 1.0360 0.9662 -0.1660 -0.0559 -0.1012 284 TYR Z CD1   
2216 C CD2   . TYR A 284 ? 1.1622 1.0225 0.9963 -0.1594 -0.0530 -0.1110 284 TYR Z CD2   
2217 C CE1   . TYR A 284 ? 1.0826 1.0727 0.9845 -0.1908 -0.0681 -0.0992 284 TYR Z CE1   
2218 C CE2   . TYR A 284 ? 1.1613 1.0170 0.9772 -0.1850 -0.0652 -0.1089 284 TYR Z CE2   
2219 C CZ    . TYR A 284 ? 1.1569 1.0801 1.0085 -0.2015 -0.0722 -0.1023 284 TYR Z CZ    
2220 O OH    . TYR A 284 ? 1.2160 1.1404 1.0503 -0.2281 -0.0848 -0.0989 284 TYR Z OH    
2221 N N     . GLN A 285 ? 0.9959 0.9904 1.0209 -0.0519 -0.0040 -0.1038 285 GLN Z N     
2222 C CA    . GLN A 285 ? 0.9412 0.9430 0.9803 -0.0339 0.0064  -0.1009 285 GLN Z CA    
2223 C C     . GLN A 285 ? 0.9146 0.9623 0.9739 -0.0428 0.0023  -0.0943 285 GLN Z C     
2224 O O     . GLN A 285 ? 0.8801 0.9691 0.9683 -0.0494 -0.0057 -0.0918 285 GLN Z O     
2225 C CB    . GLN A 285 ? 0.9052 0.9173 0.9870 -0.0068 0.0172  -0.1011 285 GLN Z CB    
2226 C CG    . GLN A 285 ? 0.8895 0.9114 0.9856 0.0095  0.0275  -0.0965 285 GLN Z CG    
2227 C CD    . GLN A 285 ? 0.8488 0.8815 0.9840 0.0333  0.0380  -0.0964 285 GLN Z CD    
2228 O OE1   . GLN A 285 ? 0.8340 0.8880 0.9950 0.0440  0.0444  -0.0899 285 GLN Z OE1   
2229 N NE2   . GLN A 285 ? 0.8578 0.8757 0.9964 0.0412  0.0397  -0.1037 285 GLN Z NE2   
2230 N N     . LEU A 286 ? 0.9261 0.9682 0.9684 -0.0410 0.0071  -0.0921 286 LEU Z N     
2231 C CA    . LEU A 286 ? 0.9191 0.9996 0.9716 -0.0487 0.0038  -0.0875 286 LEU Z CA    
2232 C C     . LEU A 286 ? 0.8324 0.9549 0.9383 -0.0330 0.0055  -0.0819 286 LEU Z C     
2233 O O     . LEU A 286 ? 0.7999 0.9176 0.9304 -0.0134 0.0146  -0.0792 286 LEU Z O     
2234 C CB    . LEU A 286 ? 0.9258 0.9886 0.9483 -0.0475 0.0097  -0.0869 286 LEU Z CB    
2235 C CG    . LEU A 286 ? 1.0509 1.0717 1.0166 -0.0635 0.0050  -0.0925 286 LEU Z CG    
2236 C CD1   . LEU A 286 ? 1.1032 1.1184 1.0466 -0.0607 0.0096  -0.0918 286 LEU Z CD1   
2237 C CD2   . LEU A 286 ? 1.0842 1.1159 1.0327 -0.0916 -0.0078 -0.0946 286 LEU Z CD2   
2238 N N     . VAL A 287 ? 0.8310 0.9953 0.9520 -0.0418 -0.0048 -0.0805 287 VAL Z N     
2239 C CA    . VAL A 287 ? 0.7916 0.9943 0.9565 -0.0273 -0.0074 -0.0757 287 VAL Z CA    
2240 C C     . VAL A 287 ? 0.7928 1.0263 0.9476 -0.0346 -0.0137 -0.0749 287 VAL Z C     
2241 O O     . VAL A 287 ? 0.8140 1.0452 0.9319 -0.0525 -0.0162 -0.0786 287 VAL Z O     
2242 C CB    . VAL A 287 ? 0.7632 0.9934 0.9635 -0.0231 -0.0175 -0.0768 287 VAL Z CB    
2243 C CG1   . VAL A 287 ? 0.7558 0.9569 0.9668 -0.0136 -0.0099 -0.0790 287 VAL Z CG1   
2244 C CG2   . VAL A 287 ? 0.7567 1.0131 0.9394 -0.0438 -0.0316 -0.0807 287 VAL Z CG2   
2245 N N     . PHE A 288 ? 0.8623 1.1234 1.0474 -0.0205 -0.0170 -0.0707 288 PHE Z N     
2246 C CA    . PHE A 288 ? 0.8834 1.1740 1.0576 -0.0235 -0.0235 -0.0713 288 PHE Z CA    
2247 C C     . PHE A 288 ? 0.8720 1.2099 1.0628 -0.0232 -0.0417 -0.0745 288 PHE Z C     
2248 O O     . PHE A 288 ? 0.8239 1.1756 1.0515 -0.0086 -0.0488 -0.0721 288 PHE Z O     
2249 C CB    . PHE A 288 ? 0.8480 1.1335 1.0352 -0.0076 -0.0159 -0.0644 288 PHE Z CB    
2250 C CG    . PHE A 288 ? 0.8970 1.2064 1.0673 -0.0086 -0.0204 -0.0659 288 PHE Z CG    
2251 C CD1   . PHE A 288 ? 0.8851 1.2243 1.0744 0.0031  -0.0328 -0.0649 288 PHE Z CD1   
2252 C CD2   . PHE A 288 ? 0.9488 1.2500 1.0821 -0.0196 -0.0132 -0.0693 288 PHE Z CD2   
2253 C CE1   . PHE A 288 ? 0.9023 1.2624 1.0716 0.0044  -0.0372 -0.0679 288 PHE Z CE1   
2254 C CE2   . PHE A 288 ? 0.9579 1.2825 1.0747 -0.0190 -0.0160 -0.0722 288 PHE Z CE2   
2255 C CZ    . PHE A 288 ? 0.9463 1.3005 1.0801 -0.0066 -0.0277 -0.0719 288 PHE Z CZ    
2256 N N     . ASP A 289 ? 0.9355 1.3005 1.0978 -0.0387 -0.0502 -0.0804 289 ASP Z N     
2257 C CA    . ASP A 289 ? 0.9156 1.3338 1.0870 -0.0375 -0.0692 -0.0848 289 ASP Z CA    
2258 C C     . ASP A 289 ? 0.9202 1.3597 1.0961 -0.0209 -0.0748 -0.0847 289 ASP Z C     
2259 O O     . ASP A 289 ? 0.9613 1.4005 1.1085 -0.0253 -0.0694 -0.0872 289 ASP Z O     
2260 C CB    . ASP A 289 ? 0.9214 1.3645 1.0567 -0.0627 -0.0762 -0.0916 289 ASP Z CB    
2261 C CG    . ASP A 289 ? 0.9308 1.4350 1.0762 -0.0625 -0.0973 -0.0962 289 ASP Z CG    
2262 O OD1   . ASP A 289 ? 0.9350 1.4640 1.1104 -0.0402 -0.1083 -0.0957 289 ASP Z OD1   
2263 O OD2   . ASP A 289 ? 0.9250 1.4538 1.0466 -0.0851 -0.1044 -0.1002 289 ASP Z OD2   
2264 N N     . PRO A 290 ? 0.9309 1.3869 1.1415 -0.0007 -0.0865 -0.0823 290 PRO Z N     
2265 C CA    . PRO A 290 ? 0.9287 1.3981 1.1413 0.0168  -0.0946 -0.0819 290 PRO Z CA    
2266 C C     . PRO A 290 ? 0.9689 1.4853 1.1513 0.0138  -0.1091 -0.0919 290 PRO Z C     
2267 O O     . PRO A 290 ? 0.9939 1.5122 1.1569 0.0212  -0.1088 -0.0938 290 PRO Z O     
2268 C CB    . PRO A 290 ? 0.9054 1.3822 1.1608 0.0370  -0.1079 -0.0781 290 PRO Z CB    
2269 C CG    . PRO A 290 ? 0.9088 1.3640 1.1879 0.0318  -0.0984 -0.0747 290 PRO Z CG    
2270 C CD    . PRO A 290 ? 0.9042 1.3630 1.1534 0.0082  -0.0930 -0.0800 290 PRO Z CD    
2271 N N     . ILE A 291 ? 0.9455 1.5017 1.1224 0.0030  -0.1217 -0.0985 291 ILE Z N     
2272 C CA    . ILE A 291 ? 0.9433 1.5547 1.0916 0.0004  -0.1376 -0.1091 291 ILE Z CA    
2273 C C     . ILE A 291 ? 0.9862 1.5955 1.0901 -0.0209 -0.1248 -0.1142 291 ILE Z C     
2274 O O     . ILE A 291 ? 1.0192 1.6433 1.0977 -0.0145 -0.1257 -0.1204 291 ILE Z O     
2275 C CB    . ILE A 291 ? 0.9191 1.5817 1.0768 -0.0053 -0.1563 -0.1136 291 ILE Z CB    
2276 C CG1   . ILE A 291 ? 0.9005 1.5670 1.1051 0.0177  -0.1695 -0.1093 291 ILE Z CG1   
2277 C CG2   . ILE A 291 ? 0.9042 1.6321 1.0302 -0.0065 -0.1743 -0.1254 291 ILE Z CG2   
2278 C CD1   . ILE A 291 ? 0.9325 1.6067 1.1461 0.0469  -0.1842 -0.1107 291 ILE Z CD1   
2279 N N     . LYS A 292 ? 0.9438 1.5332 1.0367 -0.0455 -0.1137 -0.1123 292 LYS Z N     
2280 C CA    . LYS A 292 ? 0.9699 1.5560 1.0204 -0.0680 -0.1033 -0.1172 292 LYS Z CA    
2281 C C     . LYS A 292 ? 1.0133 1.5481 1.0553 -0.0634 -0.0827 -0.1130 292 LYS Z C     
2282 O O     . LYS A 292 ? 1.0357 1.5679 1.0439 -0.0759 -0.0739 -0.1178 292 LYS Z O     
2283 C CB    . LYS A 292 ? 0.9922 1.5714 1.0302 -0.0968 -0.1021 -0.1161 292 LYS Z CB    
2284 C CG    . LYS A 292 ? 0.9791 1.6123 1.0266 -0.1037 -0.1220 -0.1188 292 LYS Z CG    
2285 C CD    . LYS A 292 ? 1.0232 1.6452 1.0533 -0.1353 -0.1206 -0.1166 292 LYS Z CD    
2286 C CE    . LYS A 292 ? 1.0261 1.7012 1.0726 -0.1404 -0.1399 -0.1168 292 LYS Z CE    
2287 N NZ    . LYS A 292 ? 0.9133 1.5805 1.0095 -0.1141 -0.1441 -0.1117 292 LYS Z NZ    
2288 N N     . ARG A 293 ? 1.0197 1.5174 1.0928 -0.0454 -0.0756 -0.1040 293 ARG Z N     
2289 C CA    . ARG A 293 ? 1.0331 1.4860 1.1033 -0.0390 -0.0569 -0.0981 293 ARG Z CA    
2290 C C     . ARG A 293 ? 1.0773 1.4974 1.1216 -0.0591 -0.0432 -0.0984 293 ARG Z C     
2291 O O     . ARG A 293 ? 1.1446 1.5585 1.1615 -0.0636 -0.0340 -0.1017 293 ARG Z O     
2292 C CB    . ARG A 293 ? 1.0288 1.4979 1.0826 -0.0266 -0.0562 -0.1020 293 ARG Z CB    
2293 C CG    . ARG A 293 ? 1.0024 1.4930 1.0768 -0.0038 -0.0711 -0.1014 293 ARG Z CG    
2294 C CD    . ARG A 293 ? 1.0290 1.5314 1.0807 0.0088  -0.0707 -0.1062 293 ARG Z CD    
2295 N NE    . ARG A 293 ? 1.0410 1.5569 1.1071 0.0315  -0.0877 -0.1056 293 ARG Z NE    
2296 C CZ    . ARG A 293 ? 1.1111 1.6356 1.1581 0.0471  -0.0921 -0.1099 293 ARG Z CZ    
2297 N NH1   . ARG A 293 ? 1.1609 1.6858 1.1768 0.0429  -0.0787 -0.1154 293 ARG Z NH1   
2298 N NH2   . ARG A 293 ? 1.1184 1.6494 1.1760 0.0679  -0.1107 -0.1092 293 ARG Z NH2   
2299 N N     . LYS A 294 ? 1.0104 1.4082 1.0622 -0.0695 -0.0429 -0.0955 294 LYS Z N     
2300 C CA    . LYS A 294 ? 1.0698 1.4321 1.0923 -0.0886 -0.0342 -0.0964 294 LYS Z CA    
2301 C C     . LYS A 294 ? 1.0768 1.3961 1.1153 -0.0859 -0.0289 -0.0906 294 LYS Z C     
2302 O O     . LYS A 294 ? 1.0197 1.3480 1.0882 -0.0790 -0.0355 -0.0882 294 LYS Z O     
2303 C CB    . LYS A 294 ? 1.1076 1.4976 1.0993 -0.1154 -0.0448 -0.1036 294 LYS Z CB    
2304 C CG    . LYS A 294 ? 1.2071 1.5590 1.1606 -0.1379 -0.0388 -0.1053 294 LYS Z CG    
2305 C CD    . LYS A 294 ? 1.2657 1.6484 1.1892 -0.1678 -0.0508 -0.1110 294 LYS Z CD    
2306 C CE    . LYS A 294 ? 1.4031 1.7430 1.2841 -0.1917 -0.0470 -0.1124 294 LYS Z CE    
2307 N NZ    . LYS A 294 ? 1.4224 1.7462 1.2832 -0.1852 -0.0353 -0.1157 294 LYS Z NZ    
2308 N N     . LEU A 295 ? 1.0349 1.3091 1.0522 -0.0892 -0.0177 -0.0896 295 LEU Z N     
2309 C CA    . LEU A 295 ? 1.0121 1.2436 1.0340 -0.0865 -0.0132 -0.0867 295 LEU Z CA    
2310 C C     . LEU A 295 ? 1.0433 1.2693 1.0469 -0.1086 -0.0231 -0.0903 295 LEU Z C     
2311 O O     . LEU A 295 ? 1.1329 1.3503 1.0973 -0.1306 -0.0267 -0.0944 295 LEU Z O     
2312 C CB    . LEU A 295 ? 1.0573 1.2445 1.0558 -0.0813 -0.0012 -0.0859 295 LEU Z CB    
2313 C CG    . LEU A 295 ? 1.0322 1.2112 1.0567 -0.0562 0.0103  -0.0793 295 LEU Z CG    
2314 C CD1   . LEU A 295 ? 1.1128 1.2531 1.1105 -0.0509 0.0196  -0.0795 295 LEU Z CD1   
2315 C CD2   . LEU A 295 ? 0.9605 1.1381 1.0225 -0.0433 0.0103  -0.0751 295 LEU Z CD2   
2316 N N     . ILE A 296 ? 1.0055 1.2368 1.0377 -0.1031 -0.0278 -0.0885 296 ILE Z N     
2317 C CA    . ILE A 296 ? 1.0150 1.2437 1.0342 -0.1227 -0.0375 -0.0907 296 ILE Z CA    
2318 C C     . ILE A 296 ? 0.9721 1.1634 1.0055 -0.1117 -0.0329 -0.0894 296 ILE Z C     
2319 O O     . ILE A 296 ? 0.9208 1.1086 0.9880 -0.0877 -0.0251 -0.0867 296 ILE Z O     
2320 C CB    . ILE A 296 ? 0.9600 1.2503 1.0003 -0.1287 -0.0521 -0.0915 296 ILE Z CB    
2321 C CG1   . ILE A 296 ? 0.9062 1.2214 0.9987 -0.1014 -0.0530 -0.0884 296 ILE Z CG1   
2322 C CG2   . ILE A 296 ? 1.0041 1.3343 1.0222 -0.1413 -0.0578 -0.0952 296 ILE Z CG2   
2323 C CD1   . ILE A 296 ? 0.8683 1.2446 0.9829 -0.1021 -0.0699 -0.0899 296 ILE Z CD1   
2324 N N     . PRO A 297 ? 0.9561 1.1186 0.9610 -0.1296 -0.0378 -0.0917 297 PRO Z N     
2325 C CA    . PRO A 297 ? 0.9696 1.1011 0.9869 -0.1184 -0.0345 -0.0922 297 PRO Z CA    
2326 C C     . PRO A 297 ? 0.8925 1.0689 0.9600 -0.1077 -0.0401 -0.0905 297 PRO Z C     
2327 O O     . PRO A 297 ? 0.8715 1.1007 0.9531 -0.1156 -0.0508 -0.0894 297 PRO Z O     
2328 C CB    . PRO A 297 ? 1.0479 1.1411 1.0164 -0.1441 -0.0418 -0.0950 297 PRO Z CB    
2329 C CG    . PRO A 297 ? 1.0762 1.2038 1.0230 -0.1721 -0.0526 -0.0944 297 PRO Z CG    
2330 C CD    . PRO A 297 ? 1.0657 1.2195 1.0227 -0.1613 -0.0466 -0.0940 297 PRO Z CD    
2331 N N     . LEU A 298 ? 0.9351 1.0929 1.0279 -0.0883 -0.0334 -0.0912 298 LEU Z N     
2332 C CA    . LEU A 298 ? 0.8741 1.0711 1.0168 -0.0751 -0.0385 -0.0902 298 LEU Z CA    
2333 C C     . LEU A 298 ? 0.8648 1.0943 1.0026 -0.0963 -0.0538 -0.0903 298 LEU Z C     
2334 O O     . LEU A 298 ? 0.8073 1.0946 0.9756 -0.0939 -0.0649 -0.0888 298 LEU Z O     
2335 C CB    . LEU A 298 ? 0.8387 1.0040 1.0001 -0.0541 -0.0279 -0.0928 298 LEU Z CB    
2336 C CG    . LEU A 298 ? 0.8043 1.0065 1.0195 -0.0376 -0.0319 -0.0927 298 LEU Z CG    
2337 C CD1   . LEU A 298 ? 0.7613 1.0125 1.0184 -0.0241 -0.0373 -0.0885 298 LEU Z CD1   
2338 C CD2   . LEU A 298 ? 0.7820 0.9505 1.0112 -0.0160 -0.0186 -0.0968 298 LEU Z CD2   
2339 N N     . ASN A 299 ? 0.8859 1.0785 0.9826 -0.1169 -0.0557 -0.0921 299 ASN Z N     
2340 C CA    . ASN A 299 ? 0.8871 1.1077 0.9702 -0.1432 -0.0705 -0.0907 299 ASN Z CA    
2341 C C     . ASN A 299 ? 0.9917 1.1965 1.0181 -0.1757 -0.0760 -0.0903 299 ASN Z C     
2342 O O     . ASN A 299 ? 1.0160 1.1702 1.0076 -0.1770 -0.0679 -0.0922 299 ASN Z O     
2343 C CB    . ASN A 299 ? 0.8952 1.0880 0.9771 -0.1437 -0.0709 -0.0921 299 ASN Z CB    
2344 C CG    . ASN A 299 ? 0.8315 1.0408 0.9701 -0.1111 -0.0647 -0.0937 299 ASN Z CG    
2345 O OD1   . ASN A 299 ? 0.7460 1.0149 0.9281 -0.1034 -0.0737 -0.0918 299 ASN Z OD1   
2346 N ND2   . ASN A 299 ? 0.8287 0.9878 0.9662 -0.0907 -0.0502 -0.0979 299 ASN Z ND2   
2347 N N     . ALA A 300 ? 0.9680 1.2194 0.9851 -0.2014 -0.0906 -0.0881 300 ALA Z N     
2348 C CA    . ALA A 300 ? 1.0110 1.2512 0.9733 -0.2361 -0.0970 -0.0876 300 ALA Z CA    
2349 C C     . ALA A 300 ? 1.1116 1.2754 1.0250 -0.2530 -0.0962 -0.0880 300 ALA Z C     
2350 O O     . ALA A 300 ? 1.1435 1.2889 1.0617 -0.2524 -0.0985 -0.0871 300 ALA Z O     
2351 C CB    . ALA A 300 ? 0.9850 1.2966 0.9477 -0.2609 -0.1136 -0.0850 300 ALA Z CB    
2352 N N     . TYR A 301 ? 1.0484 1.1545 1.2277 -0.1856 0.0300  -0.0751 301 TYR Z N     
2353 C CA    . TYR A 301 ? 1.1183 1.1618 1.3295 -0.2079 0.0319  -0.0862 301 TYR Z CA    
2354 C C     . TYR A 301 ? 1.1841 1.2276 1.4779 -0.2531 0.0491  -0.0716 301 TYR Z C     
2355 O O     . TYR A 301 ? 1.2243 1.3181 1.5780 -0.2744 0.0386  -0.0932 301 TYR Z O     
2356 C CB    . TYR A 301 ? 1.2015 1.2438 1.4194 -0.2023 -0.0016 -0.1440 301 TYR Z CB    
2357 C CG    . TYR A 301 ? 1.2148 1.2391 1.3512 -0.1597 -0.0172 -0.1592 301 TYR Z CG    
2358 C CD1   . TYR A 301 ? 1.1516 1.1229 1.2251 -0.1384 0.0002  -0.1263 301 TYR Z CD1   
2359 C CD2   . TYR A 301 ? 1.3064 1.3665 1.4286 -0.1405 -0.0493 -0.2063 301 TYR Z CD2   
2360 C CE1   . TYR A 301 ? 1.1386 1.0935 1.1382 -0.0995 -0.0135 -0.1398 301 TYR Z CE1   
2361 C CE2   . TYR A 301 ? 1.2994 1.3430 1.3466 -0.1013 -0.0632 -0.2200 301 TYR Z CE2   
2362 C CZ    . TYR A 301 ? 1.1855 1.1768 1.1721 -0.0811 -0.0450 -0.1864 301 TYR Z CZ    
2363 O OH    . TYR A 301 ? 1.1217 1.0965 1.0342 -0.0422 -0.0582 -0.1995 301 TYR Z OH    
2364 N N     . GLU A 302 ? 1.1811 1.1677 1.4777 -0.2674 0.0758  -0.0346 302 GLU Z N     
2365 C CA    . GLU A 302 ? 1.2214 1.1979 1.5942 -0.3106 0.0937  -0.0194 302 GLU Z CA    
2366 C C     . GLU A 302 ? 1.3194 1.2751 1.7488 -0.3354 0.0751  -0.0627 302 GLU Z C     
2367 O O     . GLU A 302 ? 1.3543 1.2874 1.7564 -0.3183 0.0526  -0.0980 302 GLU Z O     
2368 C CB    . GLU A 302 ? 1.2014 1.1188 1.5566 -0.3168 0.1267  0.0316  302 GLU Z CB    
2369 C CG    . GLU A 302 ? 1.1779 1.1212 1.5008 -0.3041 0.1498  0.0797  302 GLU Z CG    
2370 C CD    . GLU A 302 ? 1.1757 1.1778 1.5613 -0.3312 0.1588  0.0905  302 GLU Z CD    
2371 O OE1   . GLU A 302 ? 1.2617 1.2512 1.7162 -0.3690 0.1688  0.0926  302 GLU Z OE1   
2372 O OE2   . GLU A 302 ? 1.1325 1.1937 1.4988 -0.3146 0.1558  0.0965  302 GLU Z OE2   
2373 N N     . ASP A 303 ? 1.2195 1.1823 1.7278 -0.3758 0.0845  -0.0595 303 ASP Z N     
2374 C CA    . ASP A 303 ? 1.2679 1.2187 1.8389 -0.4025 0.0665  -0.1007 303 ASP Z CA    
2375 C C     . ASP A 303 ? 1.3150 1.1854 1.8728 -0.4050 0.0680  -0.1050 303 ASP Z C     
2376 O O     . ASP A 303 ? 1.3479 1.2027 1.9303 -0.4121 0.0454  -0.1472 303 ASP Z O     
2377 C CB    . ASP A 303 ? 1.2576 1.2341 1.9163 -0.4457 0.0794  -0.0911 303 ASP Z CB    
2378 C CG    . ASP A 303 ? 1.2660 1.3226 1.9423 -0.4454 0.0789  -0.0864 303 ASP Z CG    
2379 O OD1   . ASP A 303 ? 1.2396 1.3411 1.8850 -0.4192 0.0557  -0.1139 303 ASP Z OD1   
2380 O OD2   . ASP A 303 ? 1.3114 1.3856 2.0316 -0.4708 0.1019  -0.0548 303 ASP Z OD2   
2381 N N     . ASP A 304 ? 1.3716 1.1911 1.8905 -0.3987 0.0941  -0.0616 304 ASP Z N     
2382 C CA    . ASP A 304 ? 1.4139 1.1546 1.9234 -0.4039 0.0993  -0.0600 304 ASP Z CA    
2383 C C     . ASP A 304 ? 1.4419 1.1518 1.8783 -0.3661 0.0812  -0.0818 304 ASP Z C     
2384 O O     . ASP A 304 ? 1.4916 1.1394 1.9193 -0.3677 0.0793  -0.0905 304 ASP Z O     
2385 C CB    . ASP A 304 ? 1.4177 1.1144 1.9179 -0.4141 0.1353  -0.0041 304 ASP Z CB    
2386 C CG    . ASP A 304 ? 1.3721 1.0775 1.7981 -0.3804 0.1498  0.0330  304 ASP Z CG    
2387 O OD1   . ASP A 304 ? 1.3178 1.0806 1.7171 -0.3575 0.1365  0.0219  304 ASP Z OD1   
2388 O OD2   . ASP A 304 ? 1.3701 1.0251 1.7650 -0.3768 0.1741  0.0731  304 ASP Z OD2   
2389 N N     . VAL A 305 ? 1.3899 1.1431 1.7739 -0.3321 0.0681  -0.0906 305 VAL Z N     
2390 C CA    . VAL A 305 ? 1.3758 1.1036 1.6864 -0.2938 0.0519  -0.1090 305 VAL Z CA    
2391 C C     . VAL A 305 ? 1.4165 1.1717 1.7394 -0.2868 0.0156  -0.1682 305 VAL Z C     
2392 O O     . VAL A 305 ? 1.4173 1.2264 1.7941 -0.3041 0.0023  -0.1920 305 VAL Z O     
2393 C CB    . VAL A 305 ? 1.2856 1.0377 1.5218 -0.2567 0.0599  -0.0809 305 VAL Z CB    
2394 C CG1   . VAL A 305 ? 1.2548 1.0846 1.4884 -0.2418 0.0384  -0.1070 305 VAL Z CG1   
2395 C CG2   . VAL A 305 ? 1.2452 0.9450 1.4035 -0.2222 0.0572  -0.0797 305 VAL Z CG2   
2396 N N     . ASP A 306 ? 1.3868 1.1039 1.6600 -0.2615 -0.0002 -0.1918 306 ASP Z N     
2397 C CA    . ASP A 306 ? 1.3956 1.1321 1.6724 -0.2511 -0.0351 -0.2481 306 ASP Z CA    
2398 C C     . ASP A 306 ? 1.3606 1.1090 1.5539 -0.2046 -0.0495 -0.2587 306 ASP Z C     
2399 O O     . ASP A 306 ? 1.3488 1.0453 1.4863 -0.1821 -0.0481 -0.2551 306 ASP Z O     
2400 C CB    . ASP A 306 ? 1.4654 1.1429 1.7694 -0.2673 -0.0447 -0.2746 306 ASP Z CB    
2401 C CG    . ASP A 306 ? 1.5224 1.2203 1.8392 -0.2606 -0.0811 -0.3340 306 ASP Z CG    
2402 O OD1   . ASP A 306 ? 1.5737 1.3368 1.9074 -0.2576 -0.0977 -0.3561 306 ASP Z OD1   
2403 O OD2   . ASP A 306 ? 1.5883 1.2367 1.8985 -0.2583 -0.0933 -0.3589 306 ASP Z OD2   
2404 N N     . PRO A 307 ? 1.3870 1.2040 1.5719 -0.1899 -0.0632 -0.2719 307 PRO Z N     
2405 C CA    . PRO A 307 ? 1.3442 1.1832 1.4519 -0.1461 -0.0761 -0.2796 307 PRO Z CA    
2406 C C     . PRO A 307 ? 1.3415 1.1493 1.4110 -0.1225 -0.1015 -0.3212 307 PRO Z C     
2407 O O     . PRO A 307 ? 1.3161 1.1207 1.3123 -0.0848 -0.1070 -0.3207 307 PRO Z O     
2408 C CB    . PRO A 307 ? 1.3647 1.2858 1.4978 -0.1468 -0.0906 -0.2968 307 PRO Z CB    
2409 C CG    . PRO A 307 ? 1.3583 1.2983 1.5655 -0.1869 -0.0720 -0.2740 307 PRO Z CG    
2410 C CD    . PRO A 307 ? 1.4123 1.2919 1.6643 -0.2164 -0.0653 -0.2772 307 PRO Z CD    
2411 N N     . GLU A 308 ? 1.3543 1.1394 1.4728 -0.1442 -0.1168 -0.3565 308 GLU Z N     
2412 C CA    . GLU A 308 ? 1.3987 1.1527 1.4858 -0.1240 -0.1415 -0.3978 308 GLU Z CA    
2413 C C     . GLU A 308 ? 1.3622 1.0435 1.3937 -0.1073 -0.1267 -0.3754 308 GLU Z C     
2414 O O     . GLU A 308 ? 1.3388 0.9964 1.3181 -0.0785 -0.1426 -0.3987 308 GLU Z O     
2415 C CB    . GLU A 308 ? 1.4908 1.2382 1.6492 -0.1537 -0.1608 -0.4398 308 GLU Z CB    
2416 C CG    . GLU A 308 ? 1.5292 1.3451 1.7520 -0.1749 -0.1743 -0.4617 308 GLU Z CG    
2417 C CD    . GLU A 308 ? 1.6514 1.4580 1.9460 -0.2046 -0.1933 -0.5027 308 GLU Z CD    
2418 O OE1   . GLU A 308 ? 1.7062 1.4896 1.9835 -0.1906 -0.2174 -0.5427 308 GLU Z OE1   
2419 O OE2   . GLU A 308 ? 1.6618 1.4841 2.0302 -0.2419 -0.1840 -0.4946 308 GLU Z OE2   
2420 N N     . THR A 309 ? 1.4481 1.0945 1.4901 -0.1248 -0.0961 -0.3296 309 THR Z N     
2421 C CA    . THR A 309 ? 1.4068 0.9812 1.4030 -0.1130 -0.0804 -0.3064 309 THR Z CA    
2422 C C     . THR A 309 ? 1.2949 0.8673 1.2261 -0.0871 -0.0577 -0.2594 309 THR Z C     
2423 O O     . THR A 309 ? 1.3052 0.8225 1.2125 -0.0863 -0.0356 -0.2257 309 THR Z O     
2424 C CB    . THR A 309 ? 1.4553 0.9787 1.5075 -0.1511 -0.0622 -0.2894 309 THR Z CB    
2425 O OG1   . THR A 309 ? 1.3978 0.9467 1.4910 -0.1765 -0.0385 -0.2514 309 THR Z OG1   
2426 C CG2   . THR A 309 ? 1.5443 1.0623 1.6585 -0.1758 -0.0850 -0.3361 309 THR Z CG2   
2427 N N     . LEU A 310 ? 1.3881 1.0202 1.2909 -0.0658 -0.0636 -0.2575 310 LEU Z N     
2428 C CA    . LEU A 310 ? 1.3320 0.9683 1.1744 -0.0406 -0.0436 -0.2137 310 LEU Z CA    
2429 C C     . LEU A 310 ? 1.2306 0.8850 0.9974 0.0042  -0.0610 -0.2304 310 LEU Z C     
2430 O O     . LEU A 310 ? 1.1756 0.8739 0.9088 0.0240  -0.0573 -0.2123 310 LEU Z O     
2431 C CB    . LEU A 310 ? 1.2821 0.9738 1.1574 -0.0566 -0.0288 -0.1848 310 LEU Z CB    
2432 C CG    . LEU A 310 ? 1.2964 0.9773 1.2474 -0.1012 -0.0097 -0.1647 310 LEU Z CG    
2433 C CD1   . LEU A 310 ? 1.2826 1.0210 1.2579 -0.1122 0.0048  -0.1353 310 LEU Z CD1   
2434 C CD2   . LEU A 310 ? 1.2722 0.8781 1.2124 -0.1094 0.0148  -0.1311 310 LEU Z CD2   
2435 N N     . SER A 311 ? 1.0832 0.9108 1.1038 -0.0264 0.0629  -0.1924 311 SER Z N     
2436 C CA    . SER A 311 ? 1.1236 0.9505 1.1122 -0.0281 0.0699  -0.1912 311 SER Z CA    
2437 C C     . SER A 311 ? 1.0681 0.9228 1.0860 -0.0107 0.0924  -0.1850 311 SER Z C     
2438 O O     . SER A 311 ? 1.0627 0.9328 1.0735 -0.0121 0.0934  -0.1768 311 SER Z O     
2439 C CB    . SER A 311 ? 1.1779 0.9578 1.1024 -0.0335 0.0795  -0.2075 311 SER Z CB    
2440 O OG    . SER A 311 ? 1.1925 0.9560 1.1130 -0.0178 0.1059  -0.2192 311 SER Z OG    
2441 N N     . TYR A 312 ? 1.1053 0.9656 1.1554 0.0052  0.1096  -0.1887 312 TYR Z N     
2442 C CA    . TYR A 312 ? 1.0887 0.9759 1.1707 0.0220  0.1303  -0.1825 312 TYR Z CA    
2443 C C     . TYR A 312 ? 1.0251 0.9520 1.1526 0.0238  0.1158  -0.1631 312 TYR Z C     
2444 O O     . TYR A 312 ? 1.0219 0.9723 1.1705 0.0335  0.1272  -0.1543 312 TYR Z O     
2445 C CB    . TYR A 312 ? 1.0073 0.8885 1.1118 0.0392  0.1507  -0.1923 312 TYR Z CB    
2446 C CG    . TYR A 312 ? 1.0429 0.9215 1.1771 0.0398  0.1375  -0.1932 312 TYR Z CG    
2447 C CD1   . TYR A 312 ? 0.9857 0.8963 1.1750 0.0469  0.1287  -0.1794 312 TYR Z CD1   
2448 C CD2   . TYR A 312 ? 1.1074 0.9497 1.2123 0.0335  0.1338  -0.2074 312 TYR Z CD2   
2449 C CE1   . TYR A 312 ? 0.9474 0.8556 1.1635 0.0477  0.1177  -0.1798 312 TYR Z CE1   
2450 C CE2   . TYR A 312 ? 1.0684 0.9081 1.1996 0.0327  0.1219  -0.2078 312 TYR Z CE2   
2451 C CZ    . TYR A 312 ? 1.0110 0.8847 1.1986 0.0399  0.1146  -0.1940 312 TYR Z CZ    
2452 O OH    . TYR A 312 ? 0.9830 0.8542 1.1966 0.0394  0.1037  -0.1939 312 TYR Z OH    
2453 N N     . ALA A 313 ? 0.9849 0.9189 1.1261 0.0147  0.0902  -0.1558 313 ALA Z N     
2454 C CA    . ALA A 313 ? 0.9389 0.9076 1.1174 0.0172  0.0738  -0.1368 313 ALA Z CA    
2455 C C     . ALA A 313 ? 0.9474 0.9214 1.0956 0.0041  0.0576  -0.1287 313 ALA Z C     
2456 O O     . ALA A 313 ? 0.9140 0.9120 1.0817 0.0034  0.0383  -0.1134 313 ALA Z O     
2457 C CB    . ALA A 313 ? 0.9029 0.8802 1.1146 0.0168  0.0557  -0.1316 313 ALA Z CB    
2458 N N     . GLY A 314 ? 1.0178 0.9674 1.1159 -0.0051 0.0653  -0.1390 314 GLY Z N     
2459 C CA    . GLY A 314 ? 1.0347 0.9837 1.0977 -0.0178 0.0513  -0.1338 314 GLY Z CA    
2460 C C     . GLY A 314 ? 1.0859 1.0073 1.1074 -0.0352 0.0340  -0.1427 314 GLY Z C     
2461 O O     . GLY A 314 ? 1.0947 1.0127 1.1292 -0.0400 0.0200  -0.1443 314 GLY Z O     
2462 N N     . GLN A 315 ? 1.1386 1.0396 1.1096 -0.0450 0.0346  -0.1480 315 GLN Z N     
2463 C CA    . GLN A 315 ? 1.2054 1.0764 1.1319 -0.0619 0.0174  -0.1566 315 GLN Z CA    
2464 C C     . GLN A 315 ? 1.1861 1.0726 1.1066 -0.0727 -0.0108 -0.1453 315 GLN Z C     
2465 O O     . GLN A 315 ? 1.0938 1.0008 1.0183 -0.0691 -0.0120 -0.1348 315 GLN Z O     
2466 C CB    . GLN A 315 ? 1.2810 1.1139 1.1499 -0.0654 0.0343  -0.1705 315 GLN Z CB    
2467 C CG    . GLN A 315 ? 1.3916 1.1852 1.2109 -0.0817 0.0179  -0.1812 315 GLN Z CG    
2468 C CD    . GLN A 315 ? 1.4831 1.2454 1.2412 -0.0875 0.0250  -0.1888 315 GLN Z CD    
2469 O OE1   . GLN A 315 ? 1.5744 1.2966 1.2903 -0.0880 0.0370  -0.2026 315 GLN Z OE1   
2470 N NE2   . GLN A 315 ? 1.4713 1.2497 1.2217 -0.0913 0.0173  -0.1798 315 GLN Z NE2   
2471 N N     . TYR A 316 ? 1.2361 1.1124 1.1457 -0.0861 -0.0341 -0.1474 316 TYR Z N     
2472 C CA    . TYR A 316 ? 1.2711 1.1602 1.1707 -0.0968 -0.0621 -0.1382 316 TYR Z CA    
2473 C C     . TYR A 316 ? 1.3154 1.1763 1.1546 -0.1068 -0.0640 -0.1452 316 TYR Z C     
2474 O O     . TYR A 316 ? 1.3824 1.2046 1.1800 -0.1116 -0.0520 -0.1595 316 TYR Z O     
2475 C CB    . TYR A 316 ? 1.3298 1.2192 1.2392 -0.1087 -0.0867 -0.1376 316 TYR Z CB    
2476 C CG    . TYR A 316 ? 1.2602 1.1851 1.2305 -0.1002 -0.0924 -0.1261 316 TYR Z CG    
2477 C CD1   . TYR A 316 ? 1.2951 1.2132 1.2904 -0.0942 -0.0782 -0.1321 316 TYR Z CD1   
2478 C CD2   . TYR A 316 ? 1.2244 1.1876 1.2246 -0.0971 -0.1122 -0.1093 316 TYR Z CD2   
2479 C CE1   . TYR A 316 ? 1.2536 1.2018 1.3032 -0.0862 -0.0830 -0.1218 316 TYR Z CE1   
2480 C CE2   . TYR A 316 ? 1.2004 1.1947 1.2546 -0.0880 -0.1168 -0.0982 316 TYR Z CE2   
2481 C CZ    . TYR A 316 ? 1.2152 1.2016 1.2945 -0.0830 -0.1020 -0.1045 316 TYR Z CZ    
2482 O OH    . TYR A 316 ? 1.1483 1.1633 1.2800 -0.0736 -0.1062 -0.0936 316 TYR Z OH    
2483 N N     . VAL A 317 ? 1.3214 1.1999 1.1537 -0.1089 -0.0792 -0.1351 317 VAL Z N     
2484 C CA    . VAL A 317 ? 1.3827 1.2350 1.1573 -0.1202 -0.0877 -0.1409 317 VAL Z CA    
2485 C C     . VAL A 317 ? 1.3798 1.2492 1.1547 -0.1288 -0.1210 -0.1319 317 VAL Z C     
2486 O O     . VAL A 317 ? 1.3652 1.2672 1.1852 -0.1251 -0.1349 -0.1210 317 VAL Z O     
2487 C CB    . VAL A 317 ? 1.3345 1.1871 1.0894 -0.1138 -0.0701 -0.1386 317 VAL Z CB    
2488 C CG1   . VAL A 317 ? 1.3259 1.1646 1.0805 -0.1048 -0.0364 -0.1470 317 VAL Z CG1   
2489 C CG2   . VAL A 317 ? 1.2944 1.1886 1.0866 -0.1042 -0.0778 -0.1209 317 VAL Z CG2   
2490 N N     . ASP A 318 ? 1.4033 1.2508 1.1276 -0.1393 -0.1337 -0.1365 318 ASP Z N     
2491 C CA    . ASP A 318 ? 1.3845 1.2473 1.1043 -0.1468 -0.1657 -0.1288 318 ASP Z CA    
2492 C C     . ASP A 318 ? 1.2963 1.2023 1.0507 -0.1342 -0.1726 -0.1114 318 ASP Z C     
2493 O O     . ASP A 318 ? 1.2698 1.1815 1.0255 -0.1245 -0.1556 -0.1072 318 ASP Z O     
2494 C CB    . ASP A 318 ? 1.4277 1.2552 1.0825 -0.1587 -0.1758 -0.1381 318 ASP Z CB    
2495 C CG    . ASP A 318 ? 1.4208 1.2582 1.0673 -0.1684 -0.2106 -0.1335 318 ASP Z CG    
2496 O OD1   . ASP A 318 ? 1.4547 1.2831 1.0624 -0.1717 -0.2226 -0.1337 318 ASP Z OD1   
2497 O OD2   . ASP A 318 ? 1.4275 1.2821 1.1060 -0.1727 -0.2259 -0.1295 318 ASP Z OD2   
2498 N N     . ASP A 319 ? 1.3132 1.2493 1.0947 -0.1343 -0.1979 -0.1004 319 ASP Z N     
2499 C CA    . ASP A 319 ? 1.2548 1.2312 1.0700 -0.1202 -0.2063 -0.0826 319 ASP Z CA    
2500 C C     . ASP A 319 ? 1.2481 1.2201 1.0243 -0.1182 -0.2127 -0.0788 319 ASP Z C     
2501 O O     . ASP A 319 ? 1.2166 1.2101 1.0099 -0.1050 -0.2101 -0.0662 319 ASP Z O     
2502 C CB    . ASP A 319 ? 1.2589 1.2677 1.1073 -0.1204 -0.2326 -0.0718 319 ASP Z CB    
2503 C CG    . ASP A 319 ? 1.2718 1.2925 1.1685 -0.1191 -0.2253 -0.0714 319 ASP Z CG    
2504 O OD1   . ASP A 319 ? 1.2322 1.2504 1.1517 -0.1100 -0.2007 -0.0733 319 ASP Z OD1   
2505 O OD2   . ASP A 319 ? 1.3133 1.3462 1.2248 -0.1275 -0.2443 -0.0689 319 ASP Z OD2   
2506 N N     . SER A 320 ? 1.3196 1.2608 1.0409 -0.1313 -0.2216 -0.0896 320 SER Z N     
2507 C CA    . SER A 320 ? 1.3184 1.2487 0.9949 -0.1311 -0.2272 -0.0882 320 SER Z CA    
2508 C C     . SER A 320 ? 1.3007 1.2168 0.9657 -0.1262 -0.1982 -0.0906 320 SER Z C     
2509 O O     . SER A 320 ? 1.2905 1.2177 0.9508 -0.1185 -0.1976 -0.0807 320 SER Z O     
2510 C CB    . SER A 320 ? 1.3722 1.2685 0.9911 -0.1466 -0.2428 -0.1009 320 SER Z CB    
2511 O OG    . SER A 320 ? 1.4442 1.3023 1.0396 -0.1565 -0.2256 -0.1170 320 SER Z OG    
2512 N N     . ILE A 321 ? 1.2763 1.1676 0.9356 -0.1307 -0.1745 -0.1033 321 ILE Z N     
2513 C CA    . ILE A 321 ? 1.2881 1.1693 0.9420 -0.1257 -0.1442 -0.1058 321 ILE Z CA    
2514 C C     . ILE A 321 ? 1.1971 1.1146 0.9076 -0.1104 -0.1336 -0.0917 321 ILE Z C     
2515 O O     . ILE A 321 ? 1.1724 1.0959 0.8816 -0.1044 -0.1208 -0.0850 321 ILE Z O     
2516 C CB    . ILE A 321 ? 1.3297 1.1788 0.9686 -0.1309 -0.1217 -0.1220 321 ILE Z CB    
2517 C CG1   . ILE A 321 ? 1.3971 1.2053 0.9768 -0.1455 -0.1337 -0.1356 321 ILE Z CG1   
2518 C CG2   . ILE A 321 ? 1.3179 1.1610 0.9531 -0.1244 -0.0894 -0.1235 321 ILE Z CG2   
2519 C CD1   . ILE A 321 ? 1.4393 1.2131 1.0024 -0.1504 -0.1184 -0.1509 321 ILE Z CD1   
2520 N N     . ALA A 322 ? 1.2135 1.1540 0.9729 -0.1047 -0.1398 -0.0869 322 ALA Z N     
2521 C CA    . ALA A 322 ? 1.1699 1.1435 0.9845 -0.0892 -0.1328 -0.0733 322 ALA Z CA    
2522 C C     . ALA A 322 ? 1.1524 1.1475 0.9670 -0.0814 -0.1497 -0.0567 322 ALA Z C     
2523 O O     . ALA A 322 ? 1.0759 1.0859 0.9128 -0.0702 -0.1393 -0.0461 322 ALA Z O     
2524 C CB    . ALA A 322 ? 1.1423 1.1342 1.0034 -0.0857 -0.1402 -0.0712 322 ALA Z CB    
2525 N N     . LEU A 323 ? 1.1909 1.1863 0.9787 -0.0869 -0.1768 -0.0543 323 LEU Z N     
2526 C CA    . LEU A 323 ? 1.1601 1.1712 0.9379 -0.0792 -0.1960 -0.0394 323 LEU Z CA    
2527 C C     . LEU A 323 ? 1.1870 1.1789 0.9240 -0.0819 -0.1850 -0.0400 323 LEU Z C     
2528 O O     . LEU A 323 ? 1.1840 1.1892 0.9293 -0.0720 -0.1858 -0.0262 323 LEU Z O     
2529 C CB    . LEU A 323 ? 1.1807 1.1940 0.9337 -0.0849 -0.2270 -0.0390 323 LEU Z CB    
2530 C CG    . LEU A 323 ? 1.1711 1.1955 0.9021 -0.0767 -0.2491 -0.0253 323 LEU Z CG    
2531 C CD1   . LEU A 323 ? 1.1376 1.1954 0.9166 -0.0575 -0.2525 -0.0062 323 LEU Z CD1   
2532 C CD2   . LEU A 323 ? 1.1722 1.1972 0.8755 -0.0828 -0.2785 -0.0274 323 LEU Z CD2   
2533 N N     . GLN A 324 ? 1.2096 1.1688 0.9010 -0.0956 -0.1751 -0.0553 324 GLN Z N     
2534 C CA    . GLN A 324 ? 1.2419 1.1811 0.8913 -0.1002 -0.1634 -0.0567 324 GLN Z CA    
2535 C C     . GLN A 324 ? 1.2131 1.1622 0.8929 -0.0929 -0.1353 -0.0513 324 GLN Z C     
2536 O O     . GLN A 324 ? 1.2207 1.1704 0.8861 -0.0914 -0.1313 -0.0426 324 GLN Z O     
2537 C CB    . GLN A 324 ? 1.2971 1.1974 0.8926 -0.1152 -0.1566 -0.0748 324 GLN Z CB    
2538 C CG    . GLN A 324 ? 1.3175 1.2043 0.8752 -0.1235 -0.1857 -0.0802 324 GLN Z CG    
2539 C CD    . GLN A 324 ? 1.2765 1.1726 0.8116 -0.1194 -0.2095 -0.0682 324 GLN Z CD    
2540 O OE1   . GLN A 324 ? 1.2782 1.1693 0.7928 -0.1180 -0.2025 -0.0622 324 GLN Z OE1   
2541 N NE2   . GLN A 324 ? 1.2278 1.1376 0.7656 -0.1174 -0.2385 -0.0642 324 GLN Z NE2   
2542 N N     . ILE A 325 ? 1.1993 1.1554 0.9200 -0.0887 -0.1167 -0.0565 325 ILE Z N     
2543 C CA    . ILE A 325 ? 1.1899 1.1591 0.9462 -0.0800 -0.0910 -0.0513 325 ILE Z CA    
2544 C C     . ILE A 325 ? 1.1302 1.1296 0.9258 -0.0662 -0.1025 -0.0319 325 ILE Z C     
2545 O O     . ILE A 325 ? 1.0879 1.0944 0.8894 -0.0617 -0.0928 -0.0219 325 ILE Z O     
2546 C CB    . ILE A 325 ? 1.1550 1.1234 0.9449 -0.0770 -0.0705 -0.0621 325 ILE Z CB    
2547 C CG1   . ILE A 325 ? 1.2163 1.1504 0.9631 -0.0887 -0.0561 -0.0807 325 ILE Z CG1   
2548 C CG2   . ILE A 325 ? 1.0884 1.0751 0.9213 -0.0654 -0.0469 -0.0554 325 ILE Z CG2   
2549 C CD1   . ILE A 325 ? 1.2451 1.1733 1.0165 -0.0853 -0.0363 -0.0919 325 ILE Z CD1   
2550 N N     . ALA A 326 ? 1.1445 1.1609 0.9657 -0.0595 -0.1239 -0.0258 326 ALA Z N     
2551 C CA    . ALA A 326 ? 1.0970 1.1403 0.9557 -0.0440 -0.1363 -0.0071 326 ALA Z CA    
2552 C C     . ALA A 326 ? 1.1165 1.1582 0.9420 -0.0424 -0.1521 0.0060  326 ALA Z C     
2553 O O     . ALA A 326 ? 1.0946 1.1497 0.9415 -0.0310 -0.1528 0.0213  326 ALA Z O     
2554 C CB    . ALA A 326 ? 1.0581 1.1188 0.9437 -0.0381 -0.1570 -0.0036 326 ALA Z CB    
2555 N N     . LEU A 327 ? 1.1529 1.1756 0.9236 -0.0538 -0.1658 0.0000  327 LEU Z N     
2556 C CA    . LEU A 327 ? 1.1696 1.1856 0.8997 -0.0537 -0.1821 0.0107  327 LEU Z CA    
2557 C C     . LEU A 327 ? 1.2213 1.2229 0.9300 -0.0610 -0.1610 0.0106  327 LEU Z C     
2558 O O     . LEU A 327 ? 1.2638 1.2604 0.9447 -0.0607 -0.1709 0.0217  327 LEU Z O     
2559 C CB    . LEU A 327 ? 1.2455 1.2449 0.9227 -0.0629 -0.2050 0.0034  327 LEU Z CB    
2560 C CG    . LEU A 327 ? 1.2271 1.2440 0.9203 -0.0561 -0.2304 0.0064  327 LEU Z CG    
2561 C CD1   . LEU A 327 ? 1.2599 1.2577 0.8996 -0.0675 -0.2496 -0.0040 327 LEU Z CD1   
2562 C CD2   . LEU A 327 ? 1.1974 1.2377 0.9109 -0.0378 -0.2493 0.0273  327 LEU Z CD2   
2563 N N     . GLY A 328 ? 1.2110 1.2059 0.9316 -0.0673 -0.1322 -0.0016 328 GLY Z N     
2564 C CA    . GLY A 328 ? 1.2416 1.2269 0.9465 -0.0741 -0.1091 -0.0018 328 GLY Z CA    
2565 C C     . GLY A 328 ? 1.3440 1.2991 0.9835 -0.0899 -0.1083 -0.0128 328 GLY Z C     
2566 O O     . GLY A 328 ? 1.3408 1.2865 0.9574 -0.0971 -0.0928 -0.0113 328 GLY Z O     
2567 N N     . ASN A 329 ? 1.3203 1.2599 0.9296 -0.0955 -0.1251 -0.0236 329 ASN Z N     
2568 C CA    . ASN A 329 ? 1.3781 1.2847 0.9226 -0.1099 -0.1261 -0.0356 329 ASN Z CA    
2569 C C     . ASN A 329 ? 1.4262 1.3139 0.9620 -0.1178 -0.0971 -0.0523 329 ASN Z C     
2570 O O     . ASN A 329 ? 1.4708 1.3333 0.9595 -0.1281 -0.0859 -0.0592 329 ASN Z O     
2571 C CB    . ASN A 329 ? 1.3732 1.2694 0.8881 -0.1126 -0.1565 -0.0409 329 ASN Z CB    
2572 C CG    . ASN A 329 ? 1.3965 1.3052 0.9030 -0.1048 -0.1859 -0.0253 329 ASN Z CG    
2573 O OD1   . ASN A 329 ? 1.3989 1.3084 0.8931 -0.1032 -0.1860 -0.0133 329 ASN Z OD1   
2574 N ND2   . ASN A 329 ? 1.3592 1.2774 0.8709 -0.0997 -0.2115 -0.0247 329 ASN Z ND2   
2575 N N     . LYS A 330 ? 1.3289 1.2269 0.9074 -0.1121 -0.0851 -0.0584 330 LYS Z N     
2576 C CA    . LYS A 330 ? 1.3504 1.2290 0.9200 -0.1169 -0.0583 -0.0740 330 LYS Z CA    
2577 C C     . LYS A 330 ? 1.3296 1.2266 0.9402 -0.1092 -0.0277 -0.0697 330 LYS Z C     
2578 O O     . LYS A 330 ? 1.2991 1.2243 0.9640 -0.0981 -0.0273 -0.0604 330 LYS Z O     
2579 C CB    . LYS A 330 ? 1.3514 1.2221 0.9316 -0.1172 -0.0660 -0.0861 330 LYS Z CB    
2580 C CG    . LYS A 330 ? 1.4000 1.2481 0.9708 -0.1198 -0.0396 -0.1019 330 LYS Z CG    
2581 C CD    . LYS A 330 ? 1.4141 1.2409 0.9708 -0.1255 -0.0535 -0.1150 330 LYS Z CD    
2582 C CE    . LYS A 330 ? 1.4458 1.2435 0.9423 -0.1374 -0.0748 -0.1213 330 LYS Z CE    
2583 N NZ    . LYS A 330 ? 1.4714 1.2466 0.9527 -0.1443 -0.0895 -0.1337 330 LYS Z NZ    
2584 N N     . ASP A 331 ? 1.3928 1.2735 0.9763 -0.1146 -0.0018 -0.0765 331 ASP Z N     
2585 C CA    . ASP A 331 ? 1.3700 1.2686 0.9885 -0.1077 0.0289  -0.0729 331 ASP Z CA    
2586 C C     . ASP A 331 ? 1.3693 1.2752 1.0300 -0.0979 0.0411  -0.0812 331 ASP Z C     
2587 O O     . ASP A 331 ? 1.4048 1.2883 1.0477 -0.1006 0.0377  -0.0952 331 ASP Z O     
2588 C CB    . ASP A 331 ? 1.4376 1.3164 1.0139 -0.1153 0.0544  -0.0792 331 ASP Z CB    
2589 C CG    . ASP A 331 ? 1.4398 1.3441 1.0501 -0.1094 0.0829  -0.0702 331 ASP Z CG    
2590 O OD1   . ASP A 331 ? 1.3921 1.3240 1.0595 -0.0980 0.0875  -0.0641 331 ASP Z OD1   
2591 O OD2   . ASP A 331 ? 1.4671 1.3641 1.0472 -0.1163 0.1007  -0.0691 331 ASP Z OD2   
2592 N N     . ILE A 332 ? 1.3670 1.3022 1.0819 -0.0867 0.0543  -0.0723 332 ILE Z N     
2593 C CA    . ILE A 332 ? 1.3415 1.2847 1.0986 -0.0761 0.0666  -0.0794 332 ILE Z CA    
2594 C C     . ILE A 332 ? 1.3987 1.3188 1.1316 -0.0766 0.0939  -0.0958 332 ILE Z C     
2595 O O     . ILE A 332 ? 1.3867 1.2929 1.1232 -0.0736 0.0955  -0.1081 332 ILE Z O     
2596 C CB    . ILE A 332 ? 1.2926 1.2701 1.1094 -0.0634 0.0769  -0.0664 332 ILE Z CB    
2597 C CG1   . ILE A 332 ? 1.2732 1.2701 1.1117 -0.0606 0.0490  -0.0493 332 ILE Z CG1   
2598 C CG2   . ILE A 332 ? 1.2643 1.2474 1.1218 -0.0519 0.0905  -0.0749 332 ILE Z CG2   
2599 C CD1   . ILE A 332 ? 1.2542 1.2499 1.1034 -0.0584 0.0235  -0.0515 332 ILE Z CD1   
2600 N N     . ASN A 333 ? 1.4013 1.3161 1.1070 -0.0804 0.1148  -0.0955 333 ASN Z N     
2601 C CA    . ASN A 333 ? 1.4349 1.3308 1.1182 -0.0778 0.1442  -0.1089 333 ASN Z CA    
2602 C C     . ASN A 333 ? 1.4867 1.3395 1.1032 -0.0883 0.1397  -0.1225 333 ASN Z C     
2603 O O     . ASN A 333 ? 1.5082 1.3351 1.1077 -0.0859 0.1448  -0.1370 333 ASN Z O     
2604 C CB    . ASN A 333 ? 1.4469 1.3625 1.1383 -0.0751 0.1720  -0.1005 333 ASN Z CB    
2605 C CG    . ASN A 333 ? 1.4158 1.3726 1.1692 -0.0669 0.1725  -0.0846 333 ASN Z CG    
2606 O OD1   . ASN A 333 ? 1.4186 1.3928 1.1758 -0.0719 0.1689  -0.0698 333 ASN Z OD1   
2607 N ND2   . ASN A 333 ? 1.3555 1.3253 1.1554 -0.0542 0.1759  -0.0875 333 ASN Z ND2   
2608 N N     . THR A 334 ? 1.4582 1.3006 1.0343 -0.0997 0.1292  -0.1179 334 THR Z N     
2609 C CA    . THR A 334 ? 1.4931 1.2924 1.0019 -0.1095 0.1269  -0.1304 334 THR Z CA    
2610 C C     . THR A 334 ? 1.5119 1.2894 1.0000 -0.1167 0.0937  -0.1369 334 THR Z C     
2611 O O     . THR A 334 ? 1.5686 1.3065 1.0032 -0.1239 0.0891  -0.1493 334 THR Z O     
2612 C CB    . THR A 334 ? 1.5510 1.3447 1.0198 -0.1192 0.1312  -0.1237 334 THR Z CB    
2613 O OG1   . THR A 334 ? 1.5082 1.3147 0.9804 -0.1259 0.1020  -0.1119 334 THR Z OG1   
2614 C CG2   . THR A 334 ? 1.5283 1.3486 1.0206 -0.1137 0.1630  -0.1148 334 THR Z CG2   
2615 N N     . PHE A 335 ? 1.4784 1.2818 1.0085 -0.1144 0.0705  -0.1281 335 PHE Z N     
2616 C CA    . PHE A 335 ? 1.4565 1.2478 0.9749 -0.1206 0.0377  -0.1316 335 PHE Z CA    
2617 C C     . PHE A 335 ? 1.4800 1.2472 0.9405 -0.1328 0.0194  -0.1328 335 PHE Z C     
2618 O O     . PHE A 335 ? 1.4786 1.2216 0.9092 -0.1399 -0.0023 -0.1412 335 PHE Z O     
2619 C CB    . PHE A 335 ? 1.4460 1.2108 0.9554 -0.1206 0.0386  -0.1471 335 PHE Z CB    
2620 C CG    . PHE A 335 ? 1.4197 1.2078 0.9848 -0.1133 0.0301  -0.1445 335 PHE Z CG    
2621 C CD1   . PHE A 335 ? 1.3879 1.2001 1.0015 -0.1009 0.0519  -0.1411 335 PHE Z CD1   
2622 C CD2   . PHE A 335 ? 1.4263 1.2123 0.9951 -0.1189 0.0002  -0.1455 335 PHE Z CD2   
2623 C CE1   . PHE A 335 ? 1.3605 1.1915 1.0233 -0.0942 0.0442  -0.1392 335 PHE Z CE1   
2624 C CE2   . PHE A 335 ? 1.3905 1.1981 1.0102 -0.1129 -0.0071 -0.1425 335 PHE Z CE2   
2625 C CZ    . PHE A 335 ? 1.3445 1.1731 1.0102 -0.1005 0.0151  -0.1396 335 PHE Z CZ    
2626 N N     . GLU A 336 ? 1.4558 1.2290 0.9000 -0.1355 0.0275  -0.1242 336 GLU Z N     
2627 C CA    . GLU A 336 ? 1.5293 1.2782 0.9156 -0.1467 0.0116  -0.1252 336 GLU Z CA    
2628 C C     . GLU A 336 ? 1.4637 1.2373 0.8632 -0.1471 -0.0133 -0.1096 336 GLU Z C     
2629 O O     . GLU A 336 ? 1.4395 1.2473 0.8845 -0.1398 -0.0084 -0.0954 336 GLU Z O     
2630 C CB    . GLU A 336 ? 1.6313 1.3612 0.9769 -0.1513 0.0383  -0.1279 336 GLU Z CB    
2631 C CG    . GLU A 336 ? 1.7503 1.4484 1.0694 -0.1498 0.0618  -0.1438 336 GLU Z CG    
2632 C CD    . GLU A 336 ? 1.8286 1.5118 1.1100 -0.1526 0.0902  -0.1448 336 GLU Z CD    
2633 O OE1   . GLU A 336 ? 1.9457 1.5953 1.1909 -0.1515 0.1077  -0.1579 336 GLU Z OE1   
2634 O OE2   . GLU A 336 ? 1.9036 1.6078 1.1904 -0.1558 0.0949  -0.1318 336 GLU Z OE2   
2635 N N     . GLN A 337 ? 1.5407 1.2949 0.8982 -0.1546 -0.0410 -0.1122 337 GLN Z N     
2636 C CA    . GLN A 337 ? 1.5056 1.2780 0.8658 -0.1539 -0.0674 -0.0983 337 GLN Z CA    
2637 C C     . GLN A 337 ? 1.5424 1.3181 0.8844 -0.1573 -0.0571 -0.0873 337 GLN Z C     
2638 O O     . GLN A 337 ? 1.6293 1.3758 0.9177 -0.1669 -0.0483 -0.0938 337 GLN Z O     
2639 C CB    . GLN A 337 ? 1.5178 1.2661 0.8320 -0.1606 -0.0987 -0.1054 337 GLN Z CB    
2640 C CG    . GLN A 337 ? 1.5071 1.2570 0.8427 -0.1586 -0.1143 -0.1131 337 GLN Z CG    
2641 C CD    . GLN A 337 ? 1.4287 1.2208 0.8258 -0.1476 -0.1287 -0.0995 337 GLN Z CD    
2642 O OE1   . GLN A 337 ? 1.4349 1.2500 0.8470 -0.1415 -0.1367 -0.0844 337 GLN Z OE1   
2643 N NE2   . GLN A 337 ? 1.3970 1.1975 0.8279 -0.1449 -0.1326 -0.1045 337 GLN Z NE2   
2644 N N     . ILE A 338 ? 1.5583 1.3681 0.9438 -0.1498 -0.0588 -0.0703 338 ILE Z N     
2645 C CA    . ILE A 338 ? 1.5718 1.3870 0.9438 -0.1538 -0.0521 -0.0572 338 ILE Z CA    
2646 C C     . ILE A 338 ? 1.5533 1.3765 0.9162 -0.1517 -0.0845 -0.0431 338 ILE Z C     
2647 O O     . ILE A 338 ? 1.5720 1.3977 0.9201 -0.1554 -0.0856 -0.0305 338 ILE Z O     
2648 C CB    . ILE A 338 ? 1.5232 1.3687 0.9496 -0.1473 -0.0243 -0.0476 338 ILE Z CB    
2649 C CG1   . ILE A 338 ? 1.4545 1.3309 0.9475 -0.1331 -0.0304 -0.0418 338 ILE Z CG1   
2650 C CG2   . ILE A 338 ? 1.5367 1.3704 0.9561 -0.1503 0.0104  -0.0599 338 ILE Z CG2   
2651 C CD1   . ILE A 338 ? 1.4365 1.3374 0.9565 -0.1260 -0.0496 -0.0219 338 ILE Z CD1   
2652 N N     . ASP A 339 ? 1.2394 1.5363 0.9341 0.2145  -0.1932 -0.0711 339 ASP Z N     
2653 C CA    . ASP A 339 ? 1.2238 1.5408 1.0403 0.1977  -0.1839 -0.0558 339 ASP Z CA    
2654 C C     . ASP A 339 ? 1.2493 1.4952 1.0347 0.1721  -0.1965 0.0203  339 ASP Z C     
2655 O O     . ASP A 339 ? 1.2795 1.4642 0.9477 0.1733  -0.2120 0.0547  339 ASP Z O     
2656 C CB    . ASP A 339 ? 1.2313 1.6011 1.0936 0.2503  -0.1769 -0.1225 339 ASP Z CB    
2657 C CG    . ASP A 339 ? 1.2245 1.6422 1.2391 0.2317  -0.1612 -0.1274 339 ASP Z CG    
2658 O OD1   . ASP A 339 ? 1.2271 1.6176 1.2969 0.1848  -0.1608 -0.0661 339 ASP Z OD1   
2659 O OD2   . ASP A 339 ? 1.1974 1.6804 1.2771 0.2641  -0.1492 -0.1929 339 ASP Z OD2   
2660 N N     . ASP A 340 ? 1.2620 1.5160 1.1525 0.1490  -0.1897 0.0465  340 ASP Z N     
2661 C CA    . ASP A 340 ? 1.2803 1.4694 1.1538 0.1205  -0.2003 0.1207  340 ASP Z CA    
2662 C C     . ASP A 340 ? 1.2828 1.4872 1.2431 0.1305  -0.1957 0.1200  340 ASP Z C     
2663 O O     . ASP A 340 ? 1.2896 1.4729 1.3152 0.0895  -0.1943 0.1745  340 ASP Z O     
2664 C CB    . ASP A 340 ? 1.3066 1.4708 1.2171 0.0542  -0.1981 0.1851  340 ASP Z CB    
2665 C CG    . ASP A 340 ? 1.2987 1.5258 1.3539 0.0252  -0.1791 0.1684  340 ASP Z CG    
2666 O OD1   . ASP A 340 ? 1.2967 1.5896 1.4004 0.0554  -0.1675 0.0993  340 ASP Z OD1   
2667 O OD2   . ASP A 340 ? 1.3525 1.5632 1.4730 -0.0277 -0.1757 0.2242  340 ASP Z OD2   
2668 N N     . TYR A 341 ? 1.2869 1.5279 1.2479 0.1847  -0.1935 0.0584  341 TYR Z N     
2669 C CA    . TYR A 341 ? 1.2495 1.5081 1.2903 0.1986  -0.1892 0.0521  341 TYR Z CA    
2670 C C     . TYR A 341 ? 1.3118 1.4990 1.2920 0.1939  -0.2047 0.1114  341 TYR Z C     
2671 O O     . TYR A 341 ? 1.3419 1.4800 1.1962 0.2154  -0.2200 0.1223  341 TYR Z O     
2672 C CB    . TYR A 341 ? 1.2660 1.5796 1.3127 0.2600  -0.1839 -0.0295 341 TYR Z CB    
2673 C CG    . TYR A 341 ? 1.2285 1.5572 1.3434 0.2798  -0.1812 -0.0384 341 TYR Z CG    
2674 C CD1   . TYR A 341 ? 1.1905 1.5662 1.4491 0.2580  -0.1658 -0.0432 341 TYR Z CD1   
2675 C CD2   . TYR A 341 ? 1.2414 1.5376 1.2771 0.3204  -0.1940 -0.0424 341 TYR Z CD2   
2676 C CE1   . TYR A 341 ? 1.1682 1.5582 1.4900 0.2758  -0.1632 -0.0515 341 TYR Z CE1   
2677 C CE2   . TYR A 341 ? 1.2463 1.5564 1.3439 0.3384  -0.1916 -0.0507 341 TYR Z CE2   
2678 C CZ    . TYR A 341 ? 1.2038 1.5610 1.4446 0.3159  -0.1762 -0.0553 341 TYR Z CZ    
2679 O OH    . TYR A 341 ? 1.2075 1.5790 1.5107 0.3335  -0.1738 -0.0638 341 TYR Z OH    
2680 N N     . ASN A 342 ? 1.3526 1.5346 1.4234 0.1656  -0.2007 0.1495  342 ASN Z N     
2681 C CA    . ASN A 342 ? 1.3723 1.4900 1.3991 0.1594  -0.2142 0.2059  342 ASN Z CA    
2682 C C     . ASN A 342 ? 1.3530 1.4969 1.4626 0.1801  -0.2091 0.1882  342 ASN Z C     
2683 O O     . ASN A 342 ? 1.3359 1.5105 1.5693 0.1514  -0.1971 0.1982  342 ASN Z O     
2684 C CB    . ASN A 342 ? 1.4154 1.4839 1.4576 0.0957  -0.2174 0.2876  342 ASN Z CB    
2685 C CG    . ASN A 342 ? 1.4782 1.4736 1.4587 0.0882  -0.2328 0.3493  342 ASN Z CG    
2686 O OD1   . ASN A 342 ? 1.4995 1.4699 1.3936 0.1302  -0.2442 0.3353  342 ASN Z OD1   
2687 N ND2   . ASN A 342 ? 1.4702 1.4310 1.4946 0.0344  -0.2333 0.4181  342 ASN Z ND2   
2688 N N     . PRO A 343 ? 1.4292 1.5610 1.4700 0.2302  -0.2185 0.1618  343 PRO Z N     
2689 C CA    . PRO A 343 ? 1.3882 1.5456 1.4975 0.2561  -0.2146 0.1393  343 PRO Z CA    
2690 C C     . PRO A 343 ? 1.4105 1.5236 1.5610 0.2204  -0.2191 0.2077  343 PRO Z C     
2691 O O     . PRO A 343 ? 1.3965 1.5372 1.6372 0.2267  -0.2123 0.1971  343 PRO Z O     
2692 C CB    . PRO A 343 ? 1.3793 1.5224 1.3773 0.3159  -0.2265 0.1016  343 PRO Z CB    
2693 C CG    . PRO A 343 ? 1.4238 1.5034 1.2869 0.3078  -0.2417 0.1384  343 PRO Z CG    
2694 C CD    . PRO A 343 ? 1.4520 1.5442 1.3437 0.2652  -0.2337 0.1521  343 PRO Z CD    
2695 N N     . ASP A 344 ? 1.4859 1.5317 1.5711 0.1833  -0.2304 0.2768  344 ASP Z N     
2696 C CA    . ASP A 344 ? 1.4716 1.4696 1.5868 0.1470  -0.2358 0.3464  344 ASP Z CA    
2697 C C     . ASP A 344 ? 1.4335 1.4677 1.6962 0.1011  -0.2203 0.3640  344 ASP Z C     
2698 O O     . ASP A 344 ? 1.4168 1.4629 1.7646 0.0969  -0.2158 0.3720  344 ASP Z O     
2699 C CB    . ASP A 344 ? 1.5119 1.4306 1.5187 0.1176  -0.2511 0.4146  344 ASP Z CB    
2700 C CG    . ASP A 344 ? 1.5460 1.4281 1.4041 0.1610  -0.2665 0.3984  344 ASP Z CG    
2701 O OD1   . ASP A 344 ? 1.5100 1.4125 1.3466 0.2125  -0.2685 0.3495  344 ASP Z OD1   
2702 O OD2   . ASP A 344 ? 1.6293 1.4625 1.3921 0.1435  -0.2765 0.4343  344 ASP Z OD2   
2703 N N     . THR A 345 ? 1.4101 1.4622 1.7024 0.0669  -0.2123 0.3695  345 THR Z N     
2704 C CA    . THR A 345 ? 1.3803 1.4689 1.8106 0.0221  -0.1972 0.3844  345 THR Z CA    
2705 C C     . THR A 345 ? 1.3258 1.4988 1.8625 0.0493  -0.1803 0.3119  345 THR Z C     
2706 O O     . THR A 345 ? 1.3092 1.5286 1.8489 0.0645  -0.1722 0.2605  345 THR Z O     
2707 C CB    . THR A 345 ? 1.3840 1.4640 1.8088 -0.0238 -0.1943 0.4140  345 THR Z CB    
2708 O OG1   . THR A 345 ? 1.3990 1.5107 1.7699 0.0046  -0.1918 0.3585  345 THR Z OG1   
2709 C CG2   . THR A 345 ? 1.4034 1.4001 1.7339 -0.0559 -0.2100 0.4906  345 THR Z CG2   
2710 N N     . ALA A 346 ? 1.2936 1.4864 1.9174 0.0553  -0.1752 0.3078  346 ALA Z N     
2711 C CA    . ALA A 346 ? 1.2707 1.5427 2.0002 0.0812  -0.1592 0.2411  346 ALA Z CA    
2712 C C     . ALA A 346 ? 1.2338 1.5221 2.0923 0.0561  -0.1507 0.2640  346 ALA Z C     
2713 O O     . ALA A 346 ? 1.2434 1.4955 2.0904 0.0607  -0.1592 0.2939  346 ALA Z O     
2714 C CB    . ALA A 346 ? 1.2660 1.5562 1.9327 0.1473  -0.1637 0.1790  346 ALA Z CB    
2740 O "O5'" . DC  B 1   ? 1.7711 1.2807 1.7271 0.6012  -0.3368 0.3730  1   DC  A "O5'" 
2741 C "C5'" . DC  B 1   ? 1.8393 1.3629 1.7281 0.6492  -0.3359 0.3197  1   DC  A "C5'" 
2742 C "C4'" . DC  B 1   ? 1.7700 1.3365 1.7292 0.6723  -0.2739 0.3052  1   DC  A "C4'" 
2743 O "O4'" . DC  B 1   ? 1.6755 1.2068 1.7587 0.6137  -0.2481 0.3695  1   DC  A "O4'" 
2744 C "C3'" . DC  B 1   ? 1.7973 1.3923 1.7179 0.7157  -0.2474 0.2734  1   DC  A "C3'" 
2745 O "O3'" . DC  B 1   ? 1.7947 1.4772 1.6467 0.7840  -0.2367 0.1916  1   DC  A "O3'" 
2746 C "C2'" . DC  B 1   ? 1.7022 1.3066 1.7418 0.6974  -0.1634 0.3114  1   DC  A "C2'" 
2747 C "C1'" . DC  B 1   ? 1.6583 1.2149 1.7825 0.6334  -0.1734 0.3603  1   DC  A "C1'" 
2748 N N1    . DC  B 1   ? 1.6626 1.1494 1.8298 0.5701  -0.1637 0.4128  1   DC  A N1    
2749 C C2    . DC  B 1   ? 1.5889 1.1255 1.8592 0.5508  -0.0507 0.4386  1   DC  A C2    
2750 O O2    . DC  B 1   ? 1.5308 1.1572 1.8595 0.5914  0.0339  0.4118  1   DC  A O2    
2751 N N3    . DC  B 1   ? 1.5900 1.0853 1.9017 0.4824  -0.0327 0.4841  1   DC  A N3    
2752 C C4    . DC  B 1   ? 1.6485 1.0530 1.8642 0.4520  -0.1131 0.4938  1   DC  A C4    
2753 N N4    . DC  B 1   ? 1.6038 0.9912 1.8575 0.3918  -0.0843 0.5291  1   DC  A N4    
2754 C C5    . DC  B 1   ? 1.7240 1.0521 1.7929 0.4872  -0.2175 0.4600  1   DC  A C5    
2755 C C6    . DC  B 1   ? 1.7105 1.0951 1.8097 0.5249  -0.2522 0.4272  1   DC  A C6    
2756 P P     . DG  B 2   ? 1.8587 1.5833 1.6130 0.8356  -0.2531 0.1383  2   DG  A P     
2757 O OP1   . DG  B 2   ? 1.8153 1.6583 1.5323 0.8934  -0.2336 0.0531  2   DG  A OP1   
2758 O OP2   . DG  B 2   ? 1.9202 1.5573 1.5924 0.8085  -0.3266 0.1618  2   DG  A OP2   
2759 O "O5'" . DG  B 2   ? 1.7348 1.4867 1.5726 0.8202  -0.1771 0.1609  2   DG  A "O5'" 
2760 C "C5'" . DG  B 2   ? 1.6228 1.4959 1.5678 0.7772  -0.0650 0.1206  2   DG  A "C5'" 
2761 C "C4'" . DG  B 2   ? 1.6085 1.5045 1.6260 0.7146  0.0093  0.1363  2   DG  A "C4'" 
2762 O "O4'" . DG  B 2   ? 1.6253 1.4161 1.7169 0.6684  0.0121  0.2274  2   DG  A "O4'" 
2763 C "C3'" . DG  B 2   ? 1.6452 1.5405 1.5716 0.7322  -0.0287 0.1167  2   DG  A "C3'" 
2764 O "O3'" . DG  B 2   ? 1.6303 1.6251 1.6177 0.6836  0.0663  0.0801  2   DG  A "O3'" 
2765 C "C2'" . DG  B 2   ? 1.7159 1.4639 1.6247 0.7194  -0.0924 0.2050  2   DG  A "C2'" 
2766 C "C1'" . DG  B 2   ? 1.6363 1.3592 1.6841 0.6580  -0.0251 0.2632  2   DG  A "C1'" 
2767 N N9    . DG  B 2   ? 1.7012 1.2849 1.7478 0.6510  -0.0899 0.3528  2   DG  A N9    
2768 C C8    . DG  B 2   ? 1.7733 1.2800 1.7442 0.6731  -0.1904 0.3687  2   DG  A C8    
2769 N N7    . DG  B 2   ? 1.7786 1.2137 1.8027 0.5987  -0.2261 0.4271  2   DG  A N7    
2770 C C5    . DG  B 2   ? 1.7398 1.1629 1.8329 0.5676  -0.1531 0.4623  2   DG  A C5    
2771 C C6    . DG  B 2   ? 1.7212 1.0808 1.8410 0.4936  -0.1501 0.5032  2   DG  A C6    
2772 O O6    . DG  B 2   ? 1.7763 1.0474 1.8043 0.4665  -0.2117 0.5044  2   DG  A O6    
2773 N N1    . DG  B 2   ? 1.6701 1.0815 1.9122 0.4602  -0.0437 0.5350  2   DG  A N1    
2774 C C2    . DG  B 2   ? 1.6028 1.1035 1.9122 0.4870  0.0488  0.5119  2   DG  A C2    
2775 N N2    . DG  B 2   ? 1.5529 1.0924 1.9690 0.4264  0.1437  0.5253  2   DG  A N2    
2776 N N3    . DG  B 2   ? 1.6063 1.1851 1.8459 0.5325  0.0408  0.4302  2   DG  A N3    
2777 C C4    . DG  B 2   ? 1.6863 1.2099 1.8222 0.5922  -0.0578 0.4277  2   DG  A C4    
2778 P P     . DC  B 3   ? 1.5451 1.6133 1.4429 0.7056  0.0543  0.0198  3   DC  A P     
2779 O OP1   . DC  B 3   ? 1.4889 1.7116 1.4067 0.7047  0.1266  -0.0666 3   DC  A OP1   
2780 O OP2   . DC  B 3   ? 1.6414 1.6248 1.4041 0.7728  -0.0670 0.0334  3   DC  A OP2   
2781 O "O5'" . DC  B 3   ? 1.5355 1.5815 1.4925 0.6383  0.1070  0.0581  3   DC  A "O5'" 
2782 C "C5'" . DC  B 3   ? 1.4572 1.5450 1.5491 0.5664  0.2195  0.0681  3   DC  A "C5'" 
2783 C "C4'" . DC  B 3   ? 1.4683 1.4907 1.6034 0.5121  0.2403  0.1269  3   DC  A "C4'" 
2784 O "O4'" . DC  B 3   ? 1.4967 1.3821 1.6482 0.5107  0.1833  0.2154  3   DC  A "O4'" 
2785 C "C3'" . DC  B 3   ? 1.5318 1.5509 1.5694 0.5256  0.1933  0.1131  3   DC  A "C3'" 
2786 O "O3'" . DC  B 3   ? 1.5040 1.5494 1.6110 0.4577  0.2730  0.1220  3   DC  A "O3'" 
2787 C "C2'" . DC  B 3   ? 1.6110 1.4824 1.5747 0.5598  0.0796  0.1834  3   DC  A "C2'" 
2788 C "C1'" . DC  B 3   ? 1.5701 1.3702 1.6455 0.5181  0.1116  0.2543  3   DC  A "C1'" 
2789 N N1    . DC  B 3   ? 1.6273 1.2949 1.6531 0.5520  0.0112  0.3197  3   DC  A N1    
2790 C C2    . DC  B 3   ? 1.6374 1.2011 1.7168 0.5107  0.0026  0.4064  3   DC  A C2    
2791 O O2    . DC  B 3   ? 1.5986 1.1825 1.7662 0.4499  0.0785  0.4265  3   DC  A O2    
2792 N N3    . DC  B 3   ? 1.6917 1.1370 1.7237 0.5371  -0.0877 0.4656  3   DC  A N3    
2793 C C4    . DC  B 3   ? 1.7362 1.1609 1.6712 0.6025  -0.1653 0.4397  3   DC  A C4    
2794 N N4    . DC  B 3   ? 1.7676 1.1142 1.6898 0.5794  -0.2472 0.4776  3   DC  A N4    
2795 C C5    . DC  B 3   ? 1.7260 1.2555 1.6072 0.6486  -0.1573 0.3512  3   DC  A C5    
2796 C C6    . DC  B 3   ? 1.6703 1.3209 1.6000 0.6208  -0.0689 0.2944  3   DC  A C6    
2797 P P     . DT  B 4   ? 1.5279 1.6556 1.5719 0.4502  0.2875  0.0675  4   DT  A P     
2798 O OP1   . DT  B 4   ? 1.4562 1.7225 1.5697 0.4105  0.4014  -0.0005 4   DT  A OP1   
2799 O OP2   . DT  B 4   ? 1.6055 1.7149 1.5058 0.5253  0.1768  0.0469  4   DT  A OP2   
2800 O "O5'" . DT  B 4   ? 1.5491 1.5971 1.6274 0.3950  0.2986  0.1323  4   DT  A "O5'" 
2801 C "C5'" . DT  B 4   ? 1.4943 1.5147 1.7048 0.3292  0.3810  0.1794  4   DT  A "C5'" 
2802 C "C4'" . DT  B 4   ? 1.5384 1.4241 1.7525 0.3122  0.3283  0.2695  4   DT  A "C4'" 
2803 O "O4'" . DT  B 4   ? 1.5781 1.3644 1.7437 0.3629  0.2312  0.3146  4   DT  A "O4'" 
2804 C "C3'" . DT  B 4   ? 1.6071 1.4621 1.7319 0.3113  0.2770  0.2769  4   DT  A "C3'" 
2805 O "O3'" . DT  B 4   ? 1.6174 1.4655 1.8248 0.2391  0.3492  0.3090  4   DT  A "O3'" 
2806 C "C2'" . DT  B 4   ? 1.6865 1.4059 1.7215 0.3594  0.1504  0.3375  4   DT  A "C2'" 
2807 C "C1'" . DT  B 4   ? 1.6490 1.3217 1.7565 0.3643  0.1531  0.3772  4   DT  A "C1'" 
2808 N N1    . DT  B 4   ? 1.7125 1.2929 1.7243 0.4294  0.0369  0.4028  4   DT  A N1    
2809 C C2    . DT  B 4   ? 1.7387 1.1963 1.7689 0.4200  -0.0117 0.4864  4   DT  A C2    
2810 O O2    . DT  B 4   ? 1.7106 1.1338 1.8349 0.3627  0.0345  0.5430  4   DT  A O2    
2811 N N3    . DT  B 4   ? 1.8019 1.1790 1.7350 0.4798  -0.1163 0.5018  4   DT  A N3    
2812 C C4    . DT  B 4   ? 1.8408 1.2467 1.6647 0.5497  -0.1747 0.4431  4   DT  A C4    
2813 O O4    . DT  B 4   ? 1.9016 1.2247 1.6416 0.6003  -0.2662 0.4619  4   DT  A O4    
2814 C C5    . DT  B 4   ? 1.8078 1.3491 1.6217 0.5583  -0.1199 0.3580  4   DT  A C5    
2815 C C7    . DT  B 4   ? 1.8452 1.4358 1.5473 0.6336  -0.1753 0.2904  4   DT  A C7    
2816 C C6    . DT  B 4   ? 1.7459 1.3674 1.6523 0.4968  -0.0181 0.3420  4   DT  A C6    
2817 P P     . DA  B 5   ? 1.6272 1.5147 1.7822 0.2113  0.3605  0.2833  5   DA  A P     
2818 O OP1   . DA  B 5   ? 1.5739 1.5343 1.8442 0.1361  0.4897  0.2663  5   DA  A OP1   
2819 O OP2   . DA  B 5   ? 1.6617 1.6093 1.6919 0.2703  0.3007  0.2188  5   DA  A OP2   
2820 O "O5'" . DA  B 5   ? 1.7323 1.4823 1.8456 0.2057  0.2799  0.3665  5   DA  A "O5'" 
2821 C "C5'" . DA  B 5   ? 1.7261 1.3895 1.9327 0.1675  0.2972  0.4453  5   DA  A "C5'" 
2822 C "C4'" . DA  B 5   ? 1.8578 1.3837 1.9849 0.1915  0.1830  0.5166  5   DA  A "C4'" 
2823 O "O4'" . DA  B 5   ? 1.8634 1.3432 1.9128 0.2620  0.0928  0.5154  5   DA  A "O4'" 
2824 C "C3'" . DA  B 5   ? 1.9884 1.4896 2.0053 0.1959  0.1251  0.5128  5   DA  A "C3'" 
2825 O "O3'" . DA  B 5   ? 2.0903 1.4781 2.1107 0.1648  0.0861  0.5939  5   DA  A "O3'" 
2826 C "C2'" . DA  B 5   ? 2.0288 1.5099 1.9070 0.2787  0.0200  0.4821  5   DA  A "C2'" 
2827 C "C1'" . DA  B 5   ? 1.9827 1.3953 1.8909 0.3055  -0.0144 0.5219  5   DA  A "C1'" 
2828 N N9    . DA  B 5   ? 1.9384 1.3579 1.7544 0.3826  -0.0832 0.4812  5   DA  A N9    
2829 C C8    . DA  B 5   ? 1.9141 1.4364 1.6706 0.4235  -0.0788 0.3999  5   DA  A C8    
2830 N N7    . DA  B 5   ? 1.9411 1.4436 1.6198 0.4932  -0.1500 0.3805  5   DA  A N7    
2831 C C5    . DA  B 5   ? 1.9689 1.3444 1.6539 0.4961  -0.2051 0.4534  5   DA  A C5    
2832 C C6    . DA  B 5   ? 2.0132 1.3075 1.6351 0.5521  -0.2896 0.4729  5   DA  A C6    
2833 N N6    . DA  B 5   ? 2.0373 1.3682 1.5758 0.6216  -0.3340 0.4173  5   DA  A N6    
2834 N N1    . DA  B 5   ? 2.0336 1.2096 1.6809 0.5328  -0.3262 0.5520  5   DA  A N1    
2835 C C2    . DA  B 5   ? 2.0093 1.1541 1.7423 0.4644  -0.2811 0.6083  5   DA  A C2    
2836 N N3    . DA  B 5   ? 1.9676 1.1792 1.7672 0.4095  -0.2005 0.5970  5   DA  A N3    
2837 C C4    . DA  B 5   ? 1.9498 1.2752 1.7194 0.4282  -0.1657 0.5169  5   DA  A C4    
2838 P P     . DG  B 6   ? 2.5726 1.6364 2.0704 0.1274  0.5932  0.5610  6   DG  A P     
2839 O OP1   . DG  B 6   ? 2.6924 1.6696 2.0817 0.0734  0.7495  0.5582  6   DG  A OP1   
2840 O OP2   . DG  B 6   ? 2.6091 1.5978 1.9526 0.1177  0.4475  0.5527  6   DG  A OP2   
2841 O "O5'" . DG  B 6   ? 2.5667 1.6795 2.2670 0.1064  0.6208  0.5934  6   DG  A "O5'" 
2842 C "C5'" . DG  B 6   ? 2.4246 1.6877 2.3495 0.1768  0.5513  0.6008  6   DG  A "C5'" 
2843 C "C4'" . DG  B 6   ? 2.4330 1.6960 2.3494 0.1904  0.3850  0.6021  6   DG  A "C4'" 
2844 O "O4'" . DG  B 6   ? 2.2639 1.5727 2.1240 0.2624  0.2646  0.5747  6   DG  A "O4'" 
2845 C "C3'" . DG  B 6   ? 2.6271 1.7386 2.3560 0.1135  0.3503  0.6072  6   DG  A "C3'" 
2846 O "O3'" . DG  B 6   ? 2.7700 1.8558 2.5948 0.0560  0.3997  0.6376  6   DG  A "O3'" 
2847 C "C2'" . DG  B 6   ? 2.5374 1.6618 2.2121 0.1584  0.1691  0.5924  6   DG  A "C2'" 
2848 C "C1'" . DG  B 6   ? 2.2942 1.5589 2.0871 0.2565  0.1247  0.5742  6   DG  A "C1'" 
2849 N N9    . DG  B 6   ? 2.1834 1.4308 1.8347 0.3011  0.0252  0.5454  6   DG  A N9    
2850 C C8    . DG  B 6   ? 2.2262 1.3925 1.6905 0.2851  0.0569  0.5270  6   DG  A C8    
2851 N N7    . DG  B 6   ? 2.1458 1.3180 1.5293 0.3356  -0.0532 0.5047  6   DG  A N7    
2852 C C5    . DG  B 6   ? 2.0540 1.3115 1.5706 0.3879  -0.1626 0.5070  6   DG  A C5    
2853 C C6    . DG  B 6   ? 1.9745 1.2691 1.4802 0.4545  -0.3016 0.4884  6   DG  A C6    
2854 O O6    . DG  B 6   ? 1.9328 1.2431 1.3602 0.4560  -0.3391 0.4510  6   DG  A O6    
2855 N N1    . DG  B 6   ? 1.9070 1.2803 1.5674 0.4881  -0.3772 0.4977  6   DG  A N1    
2856 C C2    . DG  B 6   ? 1.9117 1.3271 1.7261 0.4607  -0.3295 0.5235  6   DG  A C2    
2857 N N2    . DG  B 6   ? 1.8455 1.3329 1.7929 0.4984  -0.4227 0.5296  6   DG  A N2    
2858 N N3    . DG  B 6   ? 1.9809 1.3665 1.8185 0.3999  -0.1984 0.5424  6   DG  A N3    
2859 C C4    . DG  B 6   ? 2.0557 1.3602 1.7357 0.3665  -0.1190 0.5320  6   DG  A C4    
2860 P P     . DT  B 7   ? 2.9933 1.9352 2.6688 -0.0242 0.3568  0.6499  7   DT  A P     
2861 O OP1   . DT  B 7   ? 3.2155 2.1191 2.9772 -0.0912 0.4818  0.6793  7   DT  A OP1   
2862 O OP2   . DT  B 7   ? 3.0228 1.8436 2.4383 -0.0507 0.3318  0.6293  7   DT  A OP2   
2863 O "O5'" . DT  B 7   ? 2.7578 1.7637 2.5193 0.0189  0.1853  0.6521  7   DT  A "O5'" 
2864 C "C5'" . DT  B 7   ? 2.6091 1.7528 2.6165 0.0679  0.1588  0.6657  7   DT  A "C5'" 
2865 C "C4'" . DT  B 7   ? 2.5147 1.7015 2.5494 0.1138  -0.0165 0.6590  7   DT  A "C4'" 
2866 O "O4'" . DT  B 7   ? 2.3966 1.6024 2.3258 0.1758  -0.1002 0.6275  7   DT  A "O4'" 
2867 C "C3'" . DT  B 7   ? 2.6321 1.7091 2.5565 0.0557  -0.0924 0.6687  7   DT  A "C3'" 
2868 O "O3'" . DT  B 7   ? 2.5937 1.7390 2.6721 0.0778  -0.1899 0.6822  7   DT  A "O3'" 
2869 C "C2'" . DT  B 7   ? 2.6067 1.6157 2.3197 0.0732  -0.1875 0.6415  7   DT  A "C2'" 
2870 C "C1'" . DT  B 7   ? 2.4177 1.5478 2.2084 0.1665  -0.2279 0.6189  7   DT  A "C1'" 
2871 N N1    . DT  B 7   ? 2.3542 1.4389 1.9643 0.1910  -0.2587 0.5908  7   DT  A N1    
2872 C C2    . DT  B 7   ? 2.2339 1.3716 1.8380 0.2642  -0.3832 0.5690  7   DT  A C2    
2873 O O2    . DT  B 7   ? 2.1719 1.3878 1.9014 0.3097  -0.4718 0.5702  7   DT  A O2    
2874 N N3    . DT  B 7   ? 2.2113 1.3022 1.6548 0.2812  -0.3997 0.5460  7   DT  A N3    
2875 C C4    . DT  B 7   ? 2.3004 1.2977 1.5872 0.2317  -0.3109 0.5428  7   DT  A C4    
2876 O O4    . DT  B 7   ? 2.2715 1.2332 1.4254 0.2510  -0.3388 0.5229  7   DT  A O4    
2877 C C5    . DT  B 7   ? 2.4352 1.3752 1.7257 0.1542  -0.1822 0.5650  7   DT  A C5    
2878 C C7    . DT  B 7   ? 2.5586 1.3848 1.6735 0.0922  -0.0766 0.5628  7   DT  A C7    
2879 C C6    . DT  B 7   ? 2.4613 1.4478 1.9141 0.1388  -0.1603 0.5876  7   DT  A C6    
2880 P P     . DC  B 8   ? 2.7042 1.7578 2.7320 0.0170  -0.2580 0.6995  8   DC  A P     
2881 O OP1   . DC  B 8   ? 2.6507 1.7942 2.9023 0.0291  -0.2904 0.7220  8   DC  A OP1   
2882 O OP2   . DC  B 8   ? 2.8471 1.7623 2.7213 -0.0693 -0.1545 0.7093  8   DC  A OP2   
2883 O "O5'" . DC  B 8   ? 2.6723 1.6924 2.5552 0.0532  -0.4173 0.6750  8   DC  A "O5'" 
2884 C "C5'" . DC  B 8   ? 2.5310 1.6567 2.4968 0.1390  -0.5241 0.6571  8   DC  A "C5'" 
2885 C "C4'" . DC  B 8   ? 2.5411 1.6077 2.3484 0.1600  -0.6583 0.6361  8   DC  A "C4'" 
2886 O "O4'" . DC  B 8   ? 2.4911 1.5297 2.1539 0.1831  -0.6365 0.6121  8   DC  A "O4'" 
2887 C "C3'" . DC  B 8   ? 2.6996 1.6368 2.3752 0.0884  -0.6988 0.6485  8   DC  A "C3'" 
2888 O "O3'" . DC  B 8   ? 2.7175 1.6693 2.4044 0.1161  -0.8394 0.6380  8   DC  A "O3'" 
2889 C "C2'" . DC  B 8   ? 2.7335 1.5650 2.1879 0.0614  -0.6691 0.6350  8   DC  A "C2'" 
2890 C "C1'" . DC  B 8   ? 2.5833 1.4974 2.0473 0.1434  -0.6898 0.6075  8   DC  A "C1'" 
2891 N N1    . DC  B 8   ? 2.5701 1.4258 1.8837 0.1282  -0.6118 0.5951  8   DC  A N1    
2892 C C2    . DC  B 8   ? 2.4705 1.3725 1.7130 0.1718  -0.6500 0.5472  8   DC  A C2    
2893 O O2    . DC  B 8   ? 2.3422 1.3759 1.6770 0.2086  -0.7004 0.4915  8   DC  A O2    
2894 N N3    . DC  B 8   ? 2.4979 1.3352 1.6022 0.1573  -0.5899 0.5432  8   DC  A N3    
2895 C C4    . DC  B 8   ? 2.6335 1.3772 1.6684 0.0978  -0.4773 0.5726  8   DC  A C4    
2896 N N4    . DC  B 8   ? 2.6740 1.3596 1.5684 0.0815  -0.4144 0.5613  8   DC  A N4    
2897 C C5    . DC  B 8   ? 2.6801 1.4227 1.8183 0.0469  -0.4015 0.5978  8   DC  A C5    
2898 C C6    . DC  B 8   ? 2.6552 1.4569 1.9345 0.0645  -0.4731 0.6089  8   DC  A C6    
2899 P P     . DG  B 9   ? 2.8851 1.7541 2.5537 0.0537  -0.8953 0.6612  9   DG  A P     
2900 O OP1   . DG  B 9   ? 2.8223 1.8025 2.6851 0.0817  -0.9429 0.6571  9   DG  A OP1   
2901 O OP2   . DG  B 9   ? 3.0377 1.8059 2.6325 -0.0318 -0.7810 0.6854  9   DG  A OP2   
2902 O "O5'" . DG  B 9   ? 2.8593 1.7339 2.3917 0.0495  -0.9450 0.5885  9   DG  A "O5'" 
2903 C "C5'" . DG  B 9   ? 2.7307 1.7413 2.3178 0.1038  -0.9632 0.5116  9   DG  A "C5'" 
2904 C "C4'" . DG  B 9   ? 2.7310 1.7196 2.1891 0.0952  -0.9579 0.4603  9   DG  A "C4'" 
2905 O "O4'" . DG  B 9   ? 2.6872 1.6468 2.0592 0.1020  -0.9023 0.4690  9   DG  A "O4'" 
2906 C "C3'" . DG  B 9   ? 2.8674 1.7373 2.2123 0.0314  -0.9981 0.4676  9   DG  A "C3'" 
2907 O "O3'" . DG  B 9   ? 2.8504 1.7585 2.1897 0.0403  -1.0160 0.4059  9   DG  A "O3'" 
2908 C "C2'" . DG  B 9   ? 2.9301 1.6886 2.1216 -0.0061 -0.9548 0.4979  9   DG  A "C2'" 
2909 C "C1'" . DG  B 9   ? 2.7796 1.6295 1.9973 0.0509  -0.9048 0.4671  9   DG  A "C1'" 
2910 N N9    . DG  B 9   ? 2.7743 1.5409 1.8825 0.0318  -0.8431 0.5033  9   DG  A N9    
2911 C C8    . DG  B 9   ? 2.9123 1.5611 1.9704 -0.0128 -0.7945 0.5750  9   DG  A C8    
2912 N N7    . DG  B 9   ? 2.9405 1.5215 1.8859 -0.0304 -0.7184 0.5879  9   DG  A N7    
2913 C C5    . DG  B 9   ? 2.8050 1.4742 1.7352 0.0116  -0.7359 0.5233  9   DG  A C5    
2914 C C6    . DG  B 9   ? 2.7853 1.4420 1.6217 0.0153  -0.6822 0.5037  9   DG  A C6    
2915 O O6    . DG  B 9   ? 2.8735 1.4341 1.6015 -0.0191 -0.6013 0.5356  9   DG  A O6    
2916 N N1    . DG  B 9   ? 2.6399 1.4075 1.5272 0.0568  -0.7130 0.4379  9   DG  A N1    
2917 C C2    . DG  B 9   ? 2.5392 1.4040 1.5397 0.0843  -0.7666 0.3966  9   DG  A C2    
2918 N N2    . DG  B 9   ? 2.4158 1.3617 1.4549 0.1113  -0.7607 0.3435  9   DG  A N2    
2919 N N3    . DG  B 9   ? 2.5730 1.4465 1.6444 0.0802  -0.8113 0.4093  9   DG  A N3    
2920 C C4    . DG  B 9   ? 2.7048 1.4846 1.7410 0.0465  -0.8029 0.4728  9   DG  A C4    
2921 P P     . DA  B 10  ? 2.9239 1.7433 2.2025 -0.0123 -1.0690 0.4013  10  DA  A P     
2922 O OP1   . DA  B 10  ? 2.8737 1.7640 2.2518 0.0128  -1.0927 0.3638  10  DA  A OP1   
2923 O OP2   . DA  B 10  ? 3.0749 1.7792 2.2878 -0.0711 -1.0900 0.4655  10  DA  A OP2   
2924 O "O5'" . DA  B 10  ? 2.9063 1.6849 2.0784 -0.0252 -1.0481 0.3686  10  DA  A "O5'" 
2925 C "C5'" . DA  B 10  ? 2.7222 1.5906 1.9374 0.0221  -1.0099 0.3198  10  DA  A "C5'" 
2926 C "C4'" . DA  B 10  ? 2.7262 1.5453 1.8419 0.0051  -0.9846 0.3086  10  DA  A "C4'" 
2927 O "O4'" . DA  B 10  ? 2.7297 1.5159 1.7774 -0.0028 -0.9529 0.3409  10  DA  A "O4'" 
2928 C "C3'" . DA  B 10  ? 2.8287 1.5320 1.8471 -0.0530 -1.0209 0.3139  10  DA  A "C3'" 
2929 O "O3'" . DA  B 10  ? 2.7568 1.4610 1.7628 -0.0457 -1.0101 0.2774  10  DA  A "O3'" 
2930 C "C2'" . DA  B 10  ? 2.9577 1.5572 1.8477 -0.1024 -1.0118 0.3577  10  DA  A "C2'" 
2931 C "C1'" . DA  B 10  ? 2.8406 1.5061 1.7487 -0.0602 -0.9564 0.3569  10  DA  A "C1'" 
2932 N N9    . DA  B 10  ? 2.8975 1.4879 1.7189 -0.0899 -0.9268 0.4091  10  DA  A N9    
2933 C C8    . DA  B 10  ? 3.0077 1.5346 1.8168 -0.1227 -0.9349 0.4631  10  DA  A C8    
2934 N N7    . DA  B 10  ? 3.0377 1.4876 1.7627 -0.1504 -0.8728 0.5097  10  DA  A N7    
2935 C C5    . DA  B 10  ? 2.9795 1.4501 1.6508 -0.1319 -0.8329 0.4793  10  DA  A C5    
2936 C C6    . DA  B 10  ? 3.0129 1.4274 1.5853 -0.1482 -0.7525 0.4988  10  DA  A C6    
2937 N N6    . DA  B 10  ? 3.1185 1.4350 1.6293 -0.1934 -0.6757 0.5553  10  DA  A N6    
2938 N N1    . DA  B 10  ? 2.9515 1.4122 1.5035 -0.1217 -0.7367 0.4564  10  DA  A N1    
2939 C C2    . DA  B 10  ? 2.8326 1.3841 1.4674 -0.0846 -0.7853 0.4031  10  DA  A C2    
2940 N N3    . DA  B 10  ? 2.7891 1.3918 1.5177 -0.0697 -0.8430 0.3812  10  DA  A N3    
2941 C C4    . DA  B 10  ? 2.8806 1.4408 1.6182 -0.0938 -0.8695 0.4189  10  DA  A C4    
2942 P P     . DC  B 11  ? 2.5726 1.2075 1.5914 -0.0592 -1.0722 0.2481  11  DC  A P     
2943 O OP1   . DC  B 11  ? 2.5817 1.1716 1.5742 -0.0501 -1.0773 0.2139  11  DC  A OP1   
2944 O OP2   . DC  B 11  ? 2.5637 1.2518 1.6784 -0.0327 -1.0925 0.2404  11  DC  A OP2   
2945 O "O5'" . DC  B 11  ? 2.7237 1.2721 1.6617 -0.1204 -1.0972 0.2775  11  DC  A "O5'" 
2946 C "C5'" . DC  B 11  ? 2.7605 1.2310 1.5918 -0.1603 -1.0893 0.2847  11  DC  A "C5'" 
2947 C "C4'" . DC  B 11  ? 2.9053 1.2675 1.6422 -0.2279 -1.1245 0.3169  11  DC  A "C4'" 
2948 O "O4'" . DC  B 11  ? 2.9782 1.3098 1.6641 -0.2517 -1.1188 0.3562  11  DC  A "O4'" 
2949 C "C3'" . DC  B 11  ? 2.9436 1.2867 1.7266 -0.2399 -1.1740 0.3152  11  DC  A "C3'" 
2950 O "O3'" . DC  B 11  ? 3.0922 1.3214 1.7788 -0.3012 -1.2071 0.3263  11  DC  A "O3'" 
2951 C "C2'" . DC  B 11  ? 3.0836 1.4351 1.8914 -0.2464 -1.1917 0.3458  11  DC  A "C2'" 
2952 C "C1'" . DC  B 11  ? 3.1404 1.4342 1.8376 -0.2812 -1.1641 0.3802  11  DC  A "C1'" 
2953 N N1    . DC  B 11  ? 3.2356 1.5630 1.9714 -0.2683 -1.1520 0.4151  11  DC  A N1    
2954 C C2    . DC  B 11  ? 3.4296 1.6606 2.0636 -0.3256 -1.1405 0.4696  11  DC  A C2    
2955 O O2    . DC  B 11  ? 3.6128 1.7356 2.1147 -0.3880 -1.1400 0.4811  11  DC  A O2    
2956 N N3    . DC  B 11  ? 3.4578 1.7130 2.1465 -0.3124 -1.1187 0.5112  11  DC  A N3    
2957 C C4    . DC  B 11  ? 3.3023 1.6791 2.1370 -0.2450 -1.1227 0.4940  11  DC  A C4    
2958 N N4    . DC  B 11  ? 3.3180 1.7128 2.2203 -0.2340 -1.1020 0.5401  11  DC  A N4    
2959 C C5    . DC  B 11  ? 3.1157 1.5953 2.0394 -0.1887 -1.1334 0.4317  11  DC  A C5    
2960 C C6    . DC  B 11  ? 3.0933 1.5406 1.9646 -0.2029 -1.1421 0.3974  11  DC  A C6    
3002 O OP3   . DT  C 1   ? 2.4166 2.3372 2.1061 0.7037  -0.1374 0.6079  1   DT  B OP3   
3003 P P     . DT  C 1   ? 2.3148 2.1535 2.0404 0.6965  -0.1401 0.6064  1   DT  B P     
3004 O OP1   . DT  C 1   ? 2.2895 2.0777 2.0047 0.5994  -0.1405 0.6280  1   DT  B OP1   
3005 O OP2   . DT  C 1   ? 2.3266 2.0284 2.0902 0.7573  -0.1303 0.6104  1   DT  B OP2   
3006 O "O5'" . DT  C 1   ? 2.1451 2.1370 1.8848 0.7119  -0.1542 0.5551  1   DT  B "O5'" 
3007 C "C5'" . DT  C 1   ? 2.1379 2.2928 1.8618 0.7496  -0.1605 0.5207  1   DT  B "C5'" 
3008 C "C4'" . DT  C 1   ? 2.1307 2.3738 1.8828 0.7953  -0.1709 0.4775  1   DT  B "C4'" 
3009 O "O4'" . DT  C 1   ? 2.0623 2.1677 1.8547 0.8553  -0.1658 0.4879  1   DT  B "O4'" 
3010 C "C3'" . DT  C 1   ? 2.0939 2.4295 1.8479 0.7262  -0.1828 0.4517  1   DT  B "C3'" 
3011 O "O3'" . DT  C 1   ? 2.2173 2.7200 1.9739 0.7588  -0.1940 0.4039  1   DT  B "O3'" 
3012 C "C2'" . DT  C 1   ? 1.9881 2.1835 1.7801 0.7276  -0.1809 0.4649  1   DT  B "C2'" 
3013 C "C1'" . DT  C 1   ? 1.9701 2.0783 1.7885 0.8294  -0.1737 0.4702  1   DT  B "C1'" 
3014 N N1    . DT  C 1   ? 1.9438 1.8615 1.7928 0.8411  -0.1654 0.5020  1   DT  B N1    
3015 C C2    . DT  C 1   ? 1.9183 1.8063 1.8053 0.8657  -0.1704 0.4847  1   DT  B C2    
3016 O O2    . DT  C 1   ? 1.9138 1.9245 1.8111 0.8788  -0.1813 0.4442  1   DT  B O2    
3017 N N3    . DT  C 1   ? 1.9185 1.6334 1.8383 0.8502  -0.1609 0.5034  1   DT  B N3    
3018 C C4    . DT  C 1   ? 1.9128 1.5022 1.8415 0.7862  -0.1499 0.5178  1   DT  B C4    
3019 O O4    . DT  C 1   ? 1.8907 1.3680 1.8655 0.7343  -0.1508 0.5037  1   DT  B O4    
3020 C C5    . DT  C 1   ? 1.9518 1.5718 1.8343 0.7812  -0.1446 0.5439  1   DT  B C5    
3021 C C7    . DT  C 1   ? 1.9640 1.4689 1.8539 0.7132  -0.1371 0.5531  1   DT  B C7    
3022 C C6    . DT  C 1   ? 1.9783 1.7533 1.8171 0.8270  -0.1529 0.5479  1   DT  B C6    
3023 P P     . DC  C 2   ? 1.9428 2.6177 1.6767 0.6857  -0.2064 0.3727  2   DC  B P     
3024 O OP1   . DC  C 2   ? 1.9964 2.8385 1.7257 0.7367  -0.2145 0.3294  2   DC  B OP1   
3025 O OP2   . DC  C 2   ? 1.9318 2.5905 1.6308 0.6019  -0.2026 0.4015  2   DC  B OP2   
3026 O "O5'" . DC  C 2   ? 1.8483 2.4965 1.6141 0.6599  -0.2133 0.3594  2   DC  B "O5'" 
3027 C "C5'" . DC  C 2   ? 1.8567 2.4994 1.6607 0.7333  -0.2170 0.3345  2   DC  B "C5'" 
3028 C "C4'" . DC  C 2   ? 1.8354 2.4240 1.6669 0.6956  -0.2216 0.3316  2   DC  B "C4'" 
3029 O "O4'" . DC  C 2   ? 1.8444 2.2390 1.7023 0.7224  -0.2115 0.3667  2   DC  B "O4'" 
3030 C "C3'" . DC  C 2   ? 1.8101 2.4243 1.6198 0.5870  -0.2258 0.3407  2   DC  B "C3'" 
3031 O "O3'" . DC  C 2   ? 1.7946 2.4469 1.6249 0.5558  -0.2354 0.3171  2   DC  B "O3'" 
3032 C "C2'" . DC  C 2   ? 1.8094 2.2311 1.6248 0.5601  -0.2147 0.3897  2   DC  B "C2'" 
3033 C "C1'" . DC  C 2   ? 1.8247 2.1450 1.6826 0.6408  -0.2114 0.3881  2   DC  B "C1'" 
3034 N N1    . DC  C 2   ? 1.8329 1.9534 1.7049 0.6527  -0.1988 0.4330  2   DC  B N1    
3035 C C2    . DC  C 2   ? 1.8406 1.8503 1.7542 0.7025  -0.1966 0.4351  2   DC  B C2    
3036 O O2    . DC  C 2   ? 1.8411 1.9241 1.7783 0.7377  -0.2053 0.3990  2   DC  B O2    
3037 N N3    . DC  C 2   ? 1.8591 1.6851 1.7863 0.7122  -0.1852 0.4762  2   DC  B N3    
3038 C C4    . DC  C 2   ? 1.8634 1.6165 1.7643 0.6731  -0.1762 0.5138  2   DC  B C4    
3039 N N4    . DC  C 2   ? 1.8602 1.4327 1.7760 0.6844  -0.1650 0.5532  2   DC  B N4    
3040 C C5    . DC  C 2   ? 1.8512 1.7141 1.7099 0.6209  -0.1784 0.5125  2   DC  B C5    
3041 C C6    . DC  C 2   ? 1.8475 1.8915 1.6931 0.6119  -0.1897 0.4719  2   DC  B C6    
3042 P P     . DG  C 3   ? 1.7549 2.5389 1.5597 0.4632  -0.2456 0.2997  3   DG  B P     
3043 O OP1   . DG  C 3   ? 1.7587 2.7152 1.5360 0.4771  -0.2509 0.2707  3   DG  B OP1   
3044 O OP2   . DG  C 3   ? 1.7411 2.4250 1.5295 0.3798  -0.2405 0.3393  3   DG  B OP2   
3045 O "O5'" . DG  C 3   ? 1.7448 2.5687 1.5819 0.4627  -0.2559 0.2674  3   DG  B "O5'" 
3046 C "C5'" . DG  C 3   ? 1.7588 2.6093 1.6276 0.5495  -0.2591 0.2376  3   DG  B "C5'" 
3047 C "C4'" . DG  C 3   ? 1.7607 2.4624 1.6707 0.5734  -0.2560 0.2504  3   DG  B "C4'" 
3048 O "O4'" . DG  C 3   ? 1.7709 2.2928 1.6835 0.5859  -0.2426 0.2975  3   DG  B "O4'" 
3049 C "C3'" . DG  C 3   ? 1.7383 2.4286 1.6574 0.4971  -0.2625 0.2486  3   DG  B "C3'" 
3050 O "O3'" . DG  C 3   ? 1.7384 2.4589 1.6933 0.5365  -0.2701 0.2159  3   DG  B "O3'" 
3051 C "C2'" . DG  C 3   ? 1.7366 2.2307 1.6620 0.4667  -0.2518 0.2984  3   DG  B "C2'" 
3052 C "C1'" . DG  C 3   ? 1.7609 2.1522 1.6964 0.5511  -0.2406 0.3183  3   DG  B "C1'" 
3053 N N9    . DG  C 3   ? 1.7633 2.0005 1.6874 0.5252  -0.2285 0.3683  3   DG  B N9    
3054 C C8    . DG  C 3   ? 1.7593 2.0079 1.6449 0.4752  -0.2240 0.3915  3   DG  B C8    
3055 N N7    . DG  C 3   ? 1.7628 1.8518 1.6476 0.4626  -0.2129 0.4356  3   DG  B N7    
3056 C C5    . DG  C 3   ? 1.7696 1.7327 1.6947 0.5067  -0.2097 0.4424  3   DG  B C5    
3057 C C6    . DG  C 3   ? 1.7757 1.5450 1.7187 0.5158  -0.1986 0.4831  3   DG  B C6    
3058 O O6    . DG  C 3   ? 1.7763 1.4435 1.7024 0.4859  -0.1892 0.5224  3   DG  B O6    
3059 N N1    . DG  C 3   ? 1.7814 1.4767 1.7665 0.5655  -0.1991 0.4747  3   DG  B N1    
3060 C C2    . DG  C 3   ? 1.7813 1.5768 1.7886 0.6019  -0.2092 0.4322  3   DG  B C2    
3061 N N2    . DG  C 3   ? 1.7875 1.4863 1.8357 0.6477  -0.2081 0.4308  3   DG  B N2    
3062 N N3    . DG  C 3   ? 1.7756 1.7533 1.7667 0.5940  -0.2197 0.3934  3   DG  B N3    
3063 C C4    . DG  C 3   ? 1.7700 1.8220 1.7198 0.5456  -0.2192 0.4012  3   DG  B C4    
3064 P P     . DA  C 4   ? 1.7172 2.4311 1.6887 0.4717  -0.2779 0.2078  4   DA  B P     
3065 O OP1   . DA  C 4   ? 1.7175 2.5413 1.7139 0.5135  -0.2885 0.1605  4   DA  B OP1   
3066 O OP2   . DA  C 4   ? 1.6975 2.4572 1.6341 0.3705  -0.2805 0.2205  4   DA  B OP2   
3067 O "O5'" . DA  C 4   ? 1.7218 2.2227 1.7235 0.4859  -0.2684 0.2454  4   DA  B "O5'" 
3068 C "C5'" . DA  C 4   ? 1.7423 2.1528 1.7766 0.5794  -0.2626 0.2468  4   DA  B "C5'" 
3069 C "C4'" . DA  C 4   ? 1.7412 1.9651 1.8049 0.5748  -0.2560 0.2781  4   DA  B "C4'" 
3070 O "O4'" . DA  C 4   ? 1.7455 1.8358 1.7923 0.5539  -0.2438 0.3261  4   DA  B "O4'" 
3071 C "C3'" . DA  C 4   ? 1.7186 1.9398 1.7902 0.4980  -0.2631 0.2746  4   DA  B "C3'" 
3072 O "O3'" . DA  C 4   ? 1.7218 1.8376 1.8360 0.5342  -0.2625 0.2743  4   DA  B "O3'" 
3073 C "C2'" . DA  C 4   ? 1.7078 1.8399 1.7527 0.4183  -0.2564 0.3179  4   DA  B "C2'" 
3074 C "C1'" . DA  C 4   ? 1.7278 1.7322 1.7723 0.4729  -0.2428 0.3520  4   DA  B "C1'" 
3075 N N9    . DA  C 4   ? 1.7241 1.6993 1.7314 0.4188  -0.2362 0.3856  4   DA  B N9    
3076 C C8    . DA  C 4   ? 1.7168 1.8245 1.6848 0.3740  -0.2402 0.3765  4   DA  B C8    
3077 N N7    . DA  C 4   ? 1.7152 1.7568 1.6561 0.3311  -0.2324 0.4131  4   DA  B N7    
3078 C C5    . DA  C 4   ? 1.7218 1.5746 1.6859 0.3492  -0.2224 0.4486  4   DA  B C5    
3079 C C6    . DA  C 4   ? 1.7238 1.4290 1.6776 0.3234  -0.2111 0.4958  4   DA  B C6    
3080 N N6    . DA  C 4   ? 1.7190 1.4458 1.6351 0.2716  -0.2080 0.5158  4   DA  B N6    
3081 N N1    . DA  C 4   ? 1.7309 1.2651 1.7153 0.3529  -0.2031 0.5214  4   DA  B N1    
3082 C C2    . DA  C 4   ? 1.7358 1.2486 1.7584 0.4049  -0.2063 0.5011  4   DA  B C2    
3083 N N3    . DA  C 4   ? 1.7346 1.3750 1.7708 0.4337  -0.2168 0.4570  4   DA  B N3    
3084 C C4    . DA  C 4   ? 1.7274 1.5368 1.7324 0.4032  -0.2245 0.4323  4   DA  B C4    
3085 P P     . DC  C 5   ? 2.2491 1.2583 1.8735 0.0599  -0.8541 0.2343  5   DC  B P     
3086 O OP1   . DC  C 5   ? 2.2620 1.2936 1.9110 0.0782  -0.9106 0.1901  5   DC  B OP1   
3087 O OP2   . DC  C 5   ? 2.1431 1.2249 1.7745 0.1050  -0.8088 0.2500  5   DC  B OP2   
3088 O "O5'" . DC  C 5   ? 2.2342 1.2372 1.8686 0.0542  -0.8174 0.2733  5   DC  B "O5'" 
3089 C "C5'" . DC  C 5   ? 2.2608 1.1869 1.8832 -0.0004 -0.8419 0.2720  5   DC  B "C5'" 
3090 C "C4'" . DC  C 5   ? 2.2765 1.1971 1.9101 -0.0067 -0.7870 0.3122  5   DC  B "C4'" 
3091 O "O4'" . DC  C 5   ? 2.2730 1.1477 1.8831 -0.0544 -0.7254 0.3350  5   DC  B "O4'" 
3092 C "C3'" . DC  C 5   ? 2.2610 1.2836 1.9370 0.0691  -0.7524 0.3356  5   DC  B "C3'" 
3093 O "O3'" . DC  C 5   ? 2.2659 1.3143 1.9712 0.0880  -0.7719 0.3348  5   DC  B "O3'" 
3094 C "C2'" . DC  C 5   ? 2.2239 1.2292 1.8985 0.0544  -0.6726 0.3792  5   DC  B "C2'" 
3095 C "C1'" . DC  C 5   ? 2.2391 1.1422 1.8761 -0.0329 -0.6608 0.3721  5   DC  B "C1'" 
3096 N N1    . DC  C 5   ? 2.1876 1.0762 1.8138 -0.0591 -0.5919 0.3897  5   DC  B N1    
3097 C C2    . DC  C 5   ? 2.1875 1.0365 1.8126 -0.1161 -0.5341 0.3977  5   DC  B C2    
3098 O O2    . DC  C 5   ? 2.2560 1.0794 1.8857 -0.1466 -0.5408 0.3924  5   DC  B O2    
3099 N N3    . DC  C 5   ? 2.1738 1.0233 1.7975 -0.1343 -0.4702 0.4067  5   DC  B N3    
3100 C C4    . DC  C 5   ? 2.1416 1.0190 1.7614 -0.1013 -0.4649 0.4125  5   DC  B C4    
3101 N N4    . DC  C 5   ? 2.0806 0.9576 1.7032 -0.1193 -0.4018 0.4200  5   DC  B N4    
3102 C C5    . DC  C 5   ? 2.1487 1.0648 1.7663 -0.0465 -0.5218 0.4065  5   DC  B C5    
3103 C C6    . DC  C 5   ? 2.1575 1.0832 1.7804 -0.0260 -0.5823 0.3927  5   DC  B C6    
3104 P P     . DT  C 6   ? 2.2548 1.4195 2.0118 0.1622  -0.7383 0.3586  6   DT  B P     
3105 O OP1   . DT  C 6   ? 2.2485 1.4633 2.0347 0.1882  -0.7842 0.3304  6   DT  B OP1   
3106 O OP2   . DT  C 6   ? 2.1862 1.4393 1.9543 0.2130  -0.7098 0.3648  6   DT  B OP2   
3107 O "O5'" . DT  C 6   ? 2.2545 1.3669 2.0182 0.1289  -0.6715 0.4054  6   DT  B "O5'" 
3108 C "C5'" . DT  C 6   ? 2.2677 1.2957 2.0166 0.0557  -0.6615 0.3966  6   DT  B "C5'" 
3109 C "C4'" . DT  C 6   ? 2.2436 1.2668 2.0174 0.0322  -0.5764 0.4277  6   DT  B "C4'" 
3110 O "O4'" . DT  C 6   ? 2.2393 1.1965 1.9846 -0.0050 -0.5357 0.4498  6   DT  B "O4'" 
3111 C "C3'" . DT  C 6   ? 2.2088 1.3454 2.0427 0.1014  -0.5327 0.4529  6   DT  B "C3'" 
3112 O "O3'" . DT  C 6   ? 2.2279 1.3715 2.0967 0.0807  -0.4887 0.4583  6   DT  B "O3'" 
3113 C "C2'" . DT  C 6   ? 2.1586 1.2928 1.9926 0.1113  -0.4821 0.4887  6   DT  B "C2'" 
3114 C "C1'" . DT  C 6   ? 2.1711 1.1822 1.9591 0.0270  -0.4660 0.4848  6   DT  B "C1'" 
3115 N N1    . DT  C 6   ? 2.1351 1.1200 1.9011 0.0206  -0.4381 0.5013  6   DT  B N1    
3116 C C2    . DT  C 6   ? 2.1157 1.0588 1.8829 -0.0310 -0.3677 0.5080  6   DT  B C2    
3117 O O2    . DT  C 6   ? 2.1175 1.0286 1.8991 -0.0738 -0.3336 0.5078  6   DT  B O2    
3118 N N3    . DT  C 6   ? 2.0848 1.0340 1.8391 -0.0295 -0.3367 0.5094  6   DT  B N3    
3119 C C4    . DT  C 6   ? 2.0620 1.0505 1.8012 0.0141  -0.3674 0.5074  6   DT  B C4    
3120 O O4    . DT  C 6   ? 2.0252 1.0150 1.7548 0.0110  -0.3351 0.5095  6   DT  B O4    
3121 C C5    . DT  C 6   ? 2.0637 1.1009 1.8035 0.0649  -0.4376 0.4974  6   DT  B C5    
3122 C C7    . DT  C 6   ? 2.0361 1.1337 1.7655 0.1134  -0.4696 0.4861  6   DT  B C7    
3123 C C6    . DT  C 6   ? 2.1076 1.1436 1.8616 0.0675  -0.4694 0.4934  6   DT  B C6    
3124 P P     . DA  C 7   ? 2.2409 1.5057 2.1767 0.1477  -0.4642 0.4728  7   DA  B P     
3125 O OP1   . DA  C 7   ? 2.2657 1.5587 2.2072 0.1570  -0.5174 0.4382  7   DA  B OP1   
3126 O OP2   . DA  C 7   ? 2.1744 1.5237 2.1324 0.2161  -0.4538 0.5004  7   DA  B OP2   
3127 O "O5'" . DA  C 7   ? 2.2289 1.4695 2.1992 0.1104  -0.3836 0.4965  7   DA  B "O5'" 
3128 C "C5'" . DA  C 7   ? 2.2480 1.3930 2.1925 0.0300  -0.3712 0.4797  7   DA  B "C5'" 
3129 C "C4'" . DA  C 7   ? 2.2384 1.3411 2.1991 -0.0085 -0.2939 0.5051  7   DA  B "C4'" 
3130 O "O4'" . DA  C 7   ? 2.2277 1.2933 2.1581 -0.0123 -0.2885 0.5201  7   DA  B "O4'" 
3131 C "C3'" . DA  C 7   ? 2.2164 1.3982 2.2522 0.0348  -0.2311 0.5364  7   DA  B "C3'" 
3132 O "O3'" . DA  C 7   ? 2.2653 1.4009 2.3231 -0.0203 -0.1720 0.5378  7   DA  B "O3'" 
3133 C "C2'" . DA  C 7   ? 2.1511 1.3629 2.1977 0.0767  -0.2107 0.5698  7   DA  B "C2'" 
3134 C "C1'" . DA  C 7   ? 2.1603 1.2697 2.1407 0.0196  -0.2255 0.5571  7   DA  B "C1'" 
3135 N N9    . DA  C 7   ? 2.0846 1.2096 2.0462 0.0566  -0.2415 0.5739  7   DA  B N9    
3136 C C8    . DA  C 7   ? 2.0691 1.2648 2.0256 0.1202  -0.2921 0.5732  7   DA  B C8    
3137 N N7    . DA  C 7   ? 2.0261 1.2216 1.9641 0.1400  -0.2950 0.5895  7   DA  B N7    
3138 C C5    . DA  C 7   ? 2.0110 1.1277 1.9417 0.0858  -0.2429 0.6021  7   DA  B C5    
3139 C C6    . DA  C 7   ? 1.9870 1.0743 1.8969 0.0756  -0.2138 0.6121  7   DA  B C6    
3140 N N6    . DA  C 7   ? 1.9540 1.0872 1.8452 0.1210  -0.2348 0.6140  7   DA  B N6    
3141 N N1    . DA  C 7   ? 1.9968 1.0265 1.9014 0.0187  -0.1534 0.6021  7   DA  B N1    
3142 C C2    . DA  C 7   ? 2.0158 1.0101 1.9387 -0.0271 -0.1293 0.5937  7   DA  B C2    
3143 N N3    . DA  C 7   ? 2.0444 1.0477 1.9909 -0.0265 -0.1563 0.5950  7   DA  B N3    
3144 C C4    . DA  C 7   ? 2.0405 1.1149 1.9862 0.0338  -0.2094 0.5914  7   DA  B C4    
3145 P P     . DG  C 8   ? 2.2405 1.4442 2.3841 0.0107  -0.1043 0.5656  8   DG  B P     
3146 O OP1   . DG  C 8   ? 2.2522 1.4093 2.4064 -0.0516 -0.0718 0.5460  8   DG  B OP1   
3147 O OP2   . DG  C 8   ? 2.1563 1.4703 2.3374 0.0912  -0.1286 0.5792  8   DG  B OP2   
3148 O "O5'" . DG  C 8   ? 2.1797 1.3733 2.3478 0.0166  -0.0503 0.6001  8   DG  B "O5'" 
3149 C "C5'" . DG  C 8   ? 2.1839 1.2830 2.3199 -0.0514 -0.0229 0.5917  8   DG  B "C5'" 
3150 C "C4'" . DG  C 8   ? 2.1273 1.2350 2.3036 -0.0331 0.0307  0.6271  8   DG  B "C4'" 
3151 O "O4'" . DG  C 8   ? 2.0666 1.1800 2.2035 -0.0001 -0.0055 0.6397  8   DG  B "O4'" 
3152 C "C3'" . DG  C 8   ? 2.0754 1.2733 2.3451 0.0253  0.0763  0.6637  8   DG  B "C3'" 
3153 O "O3'" . DG  C 8   ? 2.0786 1.2529 2.3953 -0.0004 0.1443  0.6757  8   DG  B "O3'" 
3154 C "C2'" . DG  C 8   ? 1.9680 1.2385 2.2366 0.0987  0.0436  0.6921  8   DG  B "C2'" 
3155 C "C1'" . DG  C 8   ? 1.9557 1.1503 2.1533 0.0662  0.0214  0.6816  8   DG  B "C1'" 
3156 N N9    . DG  C 8   ? 1.8842 1.1220 2.0466 0.1176  -0.0323 0.6891  8   DG  B N9    
3157 C C8    . DG  C 8   ? 1.8765 1.1864 2.0296 0.1679  -0.0874 0.6805  8   DG  B C8    
3158 N N7    . DG  C 8   ? 1.8385 1.1775 1.9607 0.2061  -0.1269 0.6865  8   DG  B N7    
3159 C C5    . DG  C 8   ? 1.8343 1.1145 1.9404 0.1785  -0.0956 0.6993  8   DG  B C5    
3160 C C6    . DG  C 8   ? 1.8080 1.0957 1.8686 0.1946  -0.1125 0.6912  8   DG  B C6    
3161 O O6    . DG  C 8   ? 1.7887 1.1292 1.8245 0.2404  -0.1609 0.6870  8   DG  B O6    
3162 N N1    . DG  C 8   ? 1.7895 1.0203 1.8330 0.1502  -0.0669 0.6811  8   DG  B N1    
3163 C C2    . DG  C 8   ? 1.8148 0.9967 1.8809 0.0976  -0.0137 0.6730  8   DG  B C2    
3164 N N2    . DG  C 8   ? 1.8154 0.9586 1.8591 0.0619  0.0189  0.6561  8   DG  B N2    
3165 N N3    . DG  C 8   ? 1.8333 1.0104 1.9411 0.0812  0.0042  0.6766  8   DG  B N3    
3166 C C4    . DG  C 8   ? 1.8483 1.0717 1.9747 0.1233  -0.0376 0.6930  8   DG  B C4    
3167 P P     . DC  C 9   ? 2.0087 1.2635 2.4320 0.0415  0.2013  0.7064  9   DC  B P     
3168 O OP1   . DC  C 9   ? 2.0454 1.2643 2.4944 -0.0173 0.2498  0.6742  9   DC  B OP1   
3169 O OP2   . DC  C 9   ? 1.9757 1.3173 2.4325 0.1067  0.1741  0.7308  9   DC  B OP2   
3170 O "O5'" . DC  C 9   ? 1.9467 1.2439 2.3825 0.0713  0.2186  0.7201  9   DC  B "O5'" 
3171 C "C5'" . DC  C 9   ? 1.9239 1.1673 2.3151 0.0220  0.2324  0.6861  9   DC  B "C5'" 
3172 C "C4'" . DC  C 9   ? 1.8797 1.1615 2.2647 0.0590  0.2256  0.7033  9   DC  B "C4'" 
3173 O "O4'" . DC  C 9   ? 1.8439 1.1305 2.1690 0.0905  0.1672  0.7137  9   DC  B "O4'" 
3174 C "C3'" . DC  C 9   ? 1.8244 1.2048 2.3069 0.1169  0.2597  0.7439  9   DC  B "C3'" 
3175 O "O3'" . DC  C 9   ? 1.8411 1.2251 2.3382 0.1071  0.2872  0.7367  9   DC  B "O3'" 
3176 C "C2'" . DC  C 9   ? 1.7364 1.1829 2.2037 0.1798  0.2145  0.7750  9   DC  B "C2'" 
3177 C "C1'" . DC  C 9   ? 1.7338 1.1082 2.0962 0.1521  0.1668  0.7463  9   DC  B "C1'" 
3178 N N1    . DC  C 9   ? 1.6857 1.0981 2.0081 0.1987  0.1073  0.7579  9   DC  B N1    
3179 C C2    . DC  C 9   ? 1.6673 1.0737 1.9279 0.2081  0.0721  0.7482  9   DC  B C2    
3180 O O2    . DC  C 9   ? 1.6690 1.0343 1.9080 0.1765  0.0920  0.7335  9   DC  B O2    
3181 N N3    . DC  C 9   ? 1.6625 1.1124 1.8888 0.2517  0.0153  0.7506  9   DC  B N3    
3182 C C4    . DC  C 9   ? 1.6421 1.1446 1.8933 0.2863  -0.0080 0.7610  9   DC  B C4    
3183 N N4    . DC  C 9   ? 1.6384 1.1932 1.8547 0.3288  -0.0675 0.7525  9   DC  B N4    
3184 C C5    . DC  C 9   ? 1.6326 1.1402 1.9462 0.2784  0.0277  0.7751  9   DC  B C5    
3185 C C6    . DC  C 9   ? 1.6726 1.1322 2.0207 0.2338  0.0858  0.7737  9   DC  B C6    
3186 P P     . DG  C 10  ? 1.7288 1.2007 2.3376 0.1477  0.3337  0.7706  10  DG  B P     
3187 O OP1   . DG  C 10  ? 1.7209 1.1577 2.3686 0.1047  0.3792  0.7425  10  DG  B OP1   
3188 O OP2   . DG  C 10  ? 1.6534 1.2059 2.3236 0.2002  0.3324  0.8113  10  DG  B OP2   
3189 O "O5'" . DG  C 10  ? 1.6808 1.1864 2.2668 0.1740  0.3177  0.7829  10  DG  B "O5'" 
3190 C "C5'" . DG  C 10  ? 1.6148 1.0592 2.1446 0.1346  0.3158  0.7503  10  DG  B "C5'" 
3191 C "C4'" . DG  C 10  ? 1.5776 1.0607 2.0833 0.1663  0.2939  0.7660  10  DG  B "C4'" 
3192 O "O4'" . DG  C 10  ? 1.5816 1.0704 2.0208 0.1902  0.2409  0.7716  10  DG  B "O4'" 
3193 C "C3'" . DG  C 10  ? 1.5401 1.1264 2.1400 0.2154  0.3211  0.8077  10  DG  B "C3'" 
3194 O "O3'" . DG  C 10  ? 1.5313 1.1258 2.1174 0.2173  0.3208  0.8059  10  DG  B "O3'" 
3195 C "C2'" . DG  C 10  ? 1.5251 1.1826 2.1215 0.2645  0.2888  0.8372  10  DG  B "C2'" 
3196 C "C1'" . DG  C 10  ? 1.5497 1.1428 2.0334 0.2495  0.2343  0.8093  10  DG  B "C1'" 
3197 N N9    . DG  C 10  ? 1.5513 1.1707 2.0140 0.2773  0.1974  0.8174  10  DG  B N9    
3198 C C8    . DG  C 10  ? 1.5577 1.1711 2.0498 0.2743  0.2052  0.8214  10  DG  B C8    
3199 N N7    . DG  C 10  ? 1.5567 1.2032 2.0211 0.3059  0.1623  0.8260  10  DG  B N7    
3200 C C5    . DG  C 10  ? 1.5500 1.2276 1.9628 0.3306  0.1235  0.8216  10  DG  B C5    
3201 C C6    . DG  C 10  ? 1.5462 1.2726 1.9137 0.3691  0.0669  0.8152  10  DG  B C6    
3202 O O6    . DG  C 10  ? 1.5469 1.3016 1.9111 0.3910  0.0375  0.8128  10  DG  B O6    
3203 N N1    . DG  C 10  ? 1.5407 1.2866 1.8658 0.3815  0.0430  0.8060  10  DG  B N1    
3204 C C2    . DG  C 10  ? 1.5384 1.2587 1.8645 0.3604  0.0704  0.8070  10  DG  B C2    
3205 N N2    . DG  C 10  ? 1.5334 1.2773 1.8159 0.3764  0.0409  0.7971  10  DG  B N2    
3206 N N3    . DG  C 10  ? 1.5408 1.2181 1.9096 0.3260  0.1217  0.8126  10  DG  B N3    
3207 C C4    . DG  C 10  ? 1.5469 1.2057 1.9576 0.3126  0.1457  0.8181  10  DG  B C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   Z . n 
A 1 2   GLY 2   2   2   GLY GLY Z . n 
A 1 3   ILE 3   3   3   ILE ILE Z . n 
A 1 4   GLN 4   4   4   GLN GLN Z . n 
A 1 5   GLY 5   5   5   GLY GLY Z . n 
A 1 6   LEU 6   6   6   LEU LEU Z . n 
A 1 7   LEU 7   7   7   LEU LEU Z . n 
A 1 8   GLN 8   8   8   GLN GLN Z . n 
A 1 9   PHE 9   9   9   PHE PHE Z . n 
A 1 10  ILE 10  10  10  ILE ILE Z . n 
A 1 11  LYS 11  11  11  LYS LYS Z . n 
A 1 12  GLU 12  12  12  GLU GLU Z . n 
A 1 13  ALA 13  13  13  ALA ALA Z . n 
A 1 14  SER 14  14  14  SER SER Z . n 
A 1 15  GLU 15  15  15  GLU GLU Z . n 
A 1 16  PRO 16  16  16  PRO PRO Z . n 
A 1 17  ILE 17  17  17  ILE ILE Z . n 
A 1 18  HIS 18  18  18  HIS HIS Z . n 
A 1 19  VAL 19  19  19  VAL VAL Z . n 
A 1 20  ARG 20  20  20  ARG ARG Z . n 
A 1 21  LYS 21  21  21  LYS LYS Z . n 
A 1 22  TYR 22  22  22  TYR TYR Z . n 
A 1 23  LYS 23  23  23  LYS LYS Z . n 
A 1 24  GLY 24  24  24  GLY GLY Z . n 
A 1 25  GLN 25  25  25  GLN GLN Z . n 
A 1 26  VAL 26  26  26  VAL VAL Z . n 
A 1 27  VAL 27  27  27  VAL VAL Z . n 
A 1 28  ALA 28  28  28  ALA ALA Z . n 
A 1 29  VAL 29  29  29  VAL VAL Z . n 
A 1 30  ASP 30  30  30  ASP ASP Z . n 
A 1 31  THR 31  31  31  THR THR Z . n 
A 1 32  TYR 32  32  32  TYR TYR Z . n 
A 1 33  CYS 33  33  33  CYS CYS Z . n 
A 1 34  TRP 34  34  34  TRP TRP Z . n 
A 1 35  LEU 35  35  35  LEU LEU Z . n 
A 1 36  HIS 36  36  36  HIS HIS Z . n 
A 1 37  LYS 37  37  37  LYS LYS Z . n 
A 1 38  GLY 38  38  38  GLY GLY Z . n 
A 1 39  ALA 39  39  39  ALA ALA Z . n 
A 1 40  ILE 40  40  40  ILE ILE Z . n 
A 1 41  ALA 41  41  41  ALA ALA Z . n 
A 1 42  CYS 42  42  42  CYS CYS Z . n 
A 1 43  ALA 43  43  43  ALA ALA Z . n 
A 1 44  GLU 44  44  44  GLU GLU Z . n 
A 1 45  LYS 45  45  45  LYS LYS Z . n 
A 1 46  LEU 46  46  46  LEU LEU Z . n 
A 1 47  ALA 47  47  47  ALA ALA Z . n 
A 1 48  LYS 48  48  48  LYS LYS Z . n 
A 1 49  GLY 49  49  49  GLY GLY Z . n 
A 1 50  GLU 50  50  50  GLU GLU Z . n 
A 1 51  PRO 51  51  51  PRO PRO Z . n 
A 1 52  THR 52  52  52  THR THR Z . n 
A 1 53  ASP 53  53  53  ASP ASP Z . n 
A 1 54  ARG 54  54  54  ARG ARG Z . n 
A 1 55  TYR 55  55  55  TYR TYR Z . n 
A 1 56  VAL 56  56  56  VAL VAL Z . n 
A 1 57  GLY 57  57  57  GLY GLY Z . n 
A 1 58  PHE 58  58  58  PHE PHE Z . n 
A 1 59  CYS 59  59  59  CYS CYS Z . n 
A 1 60  MET 60  60  60  MET MET Z . n 
A 1 61  LYS 61  61  61  LYS LYS Z . n 
A 1 62  PHE 62  62  62  PHE PHE Z . n 
A 1 63  VAL 63  63  63  VAL VAL Z . n 
A 1 64  ASN 64  64  64  ASN ASN Z . n 
A 1 65  MET 65  65  65  MET MET Z . n 
A 1 66  LEU 66  66  66  LEU LEU Z . n 
A 1 67  LEU 67  67  67  LEU LEU Z . n 
A 1 68  SER 68  68  68  SER SER Z . n 
A 1 69  HIS 69  69  69  HIS HIS Z . n 
A 1 70  GLY 70  70  70  GLY GLY Z . n 
A 1 71  ILE 71  71  71  ILE ILE Z . n 
A 1 72  LYS 72  72  72  LYS LYS Z . n 
A 1 73  PRO 73  73  73  PRO PRO Z . n 
A 1 74  ILE 74  74  74  ILE ILE Z . n 
A 1 75  LEU 75  75  75  LEU LEU Z . n 
A 1 76  VAL 76  76  76  VAL VAL Z . n 
A 1 77  PHE 77  77  77  PHE PHE Z . n 
A 1 78  ASP 78  78  78  ASP ASP Z . n 
A 1 79  GLY 79  79  79  GLY GLY Z . n 
A 1 80  CYS 80  80  80  CYS CYS Z . n 
A 1 81  THR 81  81  81  THR THR Z . n 
A 1 82  LEU 82  82  82  LEU LEU Z . n 
A 1 83  PRO 83  83  83  PRO PRO Z . n 
A 1 84  SER 84  84  84  SER SER Z . n 
A 1 85  LYS 85  85  85  LYS LYS Z . n 
A 1 86  LYS 86  86  86  LYS LYS Z . n 
A 1 87  GLU 87  87  87  GLU GLU Z . n 
A 1 88  VAL 88  88  88  VAL VAL Z . n 
A 1 89  GLU 89  89  89  GLU GLU Z . n 
A 1 90  ARG 90  90  90  ARG ARG Z . n 
A 1 91  SER 91  91  91  SER SER Z . n 
A 1 92  ARG 92  92  92  ARG ARG Z . n 
A 1 93  ARG 93  93  93  ARG ARG Z . n 
A 1 94  GLU 94  94  94  GLU GLU Z . n 
A 1 95  ARG 95  95  95  ARG ARG Z . n 
A 1 96  ARG 96  96  96  ARG ARG Z . n 
A 1 97  GLN 97  97  97  GLN GLN Z . n 
A 1 98  ALA 98  98  98  ALA ALA Z . n 
A 1 99  ASN 99  99  99  ASN ASN Z . n 
A 1 100 LEU 100 100 100 LEU LEU Z . n 
A 1 101 LEU 101 101 101 LEU LEU Z . n 
A 1 102 LYS 102 102 102 LYS LYS Z . n 
A 1 103 GLY 103 103 103 GLY GLY Z . n 
A 1 104 LYS 104 104 104 LYS LYS Z . n 
A 1 105 GLN 105 105 105 GLN GLN Z . n 
A 1 106 LEU 106 106 106 LEU LEU Z . n 
A 1 107 LEU 107 107 107 LEU LEU Z . n 
A 1 108 ARG 108 108 108 ARG ARG Z . n 
A 1 109 GLU 109 109 109 GLU GLU Z . n 
A 1 110 GLY 110 110 110 GLY GLY Z . n 
A 1 111 LYS 111 111 111 LYS LYS Z . n 
A 1 112 VAL 112 112 112 VAL VAL Z . n 
A 1 113 SER 113 113 113 SER SER Z . n 
A 1 114 GLU 114 114 114 GLU GLU Z . n 
A 1 115 ALA 115 115 115 ALA ALA Z . n 
A 1 116 ARG 116 116 116 ARG ARG Z . n 
A 1 117 GLU 117 117 117 GLU GLU Z . n 
A 1 118 CYS 118 118 118 CYS CYS Z . n 
A 1 119 PHE 119 119 119 PHE PHE Z . n 
A 1 120 THR 120 120 120 THR THR Z . n 
A 1 121 ARG 121 121 121 ARG ARG Z . n 
A 1 122 SER 122 122 122 SER SER Z . n 
A 1 123 ILE 123 123 123 ILE ILE Z . n 
A 1 124 ASN 124 124 124 ASN ASN Z . n 
A 1 125 ILE 125 125 125 ILE ILE Z . n 
A 1 126 THR 126 126 126 THR THR Z . n 
A 1 127 HIS 127 127 127 HIS HIS Z . n 
A 1 128 ALA 128 128 128 ALA ALA Z . n 
A 1 129 MET 129 129 129 MET MET Z . n 
A 1 130 ALA 130 130 130 ALA ALA Z . n 
A 1 131 HIS 131 131 131 HIS HIS Z . n 
A 1 132 LYS 132 132 132 LYS LYS Z . n 
A 1 133 VAL 133 133 133 VAL VAL Z . n 
A 1 134 ILE 134 134 134 ILE ILE Z . n 
A 1 135 LYS 135 135 135 LYS LYS Z . n 
A 1 136 ALA 136 136 136 ALA ALA Z . n 
A 1 137 ALA 137 137 137 ALA ALA Z . n 
A 1 138 ARG 138 138 138 ARG ARG Z . n 
A 1 139 SER 139 139 139 SER SER Z . n 
A 1 140 GLN 140 140 140 GLN GLN Z . n 
A 1 141 GLY 141 141 141 GLY GLY Z . n 
A 1 142 VAL 142 142 142 VAL VAL Z . n 
A 1 143 ASP 143 143 143 ASP ASP Z . n 
A 1 144 CYS 144 144 144 CYS CYS Z . n 
A 1 145 LEU 145 145 145 LEU LEU Z . n 
A 1 146 VAL 146 146 146 VAL VAL Z . n 
A 1 147 ALA 147 147 147 ALA ALA Z . n 
A 1 148 PRO 148 148 148 PRO PRO Z . n 
A 1 149 TYR 149 149 149 TYR TYR Z . n 
A 1 150 GLU 150 150 150 GLU GLU Z . n 
A 1 151 ALA 151 151 151 ALA ALA Z . n 
A 1 152 ASP 152 152 152 ASP ASP Z . n 
A 1 153 ALA 153 153 153 ALA ALA Z . n 
A 1 154 GLN 154 154 154 GLN GLN Z . n 
A 1 155 LEU 155 155 155 LEU LEU Z . n 
A 1 156 ALA 156 156 156 ALA ALA Z . n 
A 1 157 TYR 157 157 157 TYR TYR Z . n 
A 1 158 LEU 158 158 158 LEU LEU Z . n 
A 1 159 ASN 159 159 159 ASN ASN Z . n 
A 1 160 LYS 160 160 160 LYS LYS Z . n 
A 1 161 ALA 161 161 161 ALA ALA Z . n 
A 1 162 GLY 162 162 162 GLY GLY Z . n 
A 1 163 ILE 163 163 163 ILE ILE Z . n 
A 1 164 VAL 164 164 164 VAL VAL Z . n 
A 1 165 GLN 165 165 165 GLN GLN Z . n 
A 1 166 ALA 166 166 166 ALA ALA Z . n 
A 1 167 ILE 167 167 167 ILE ILE Z . n 
A 1 168 ILE 168 168 168 ILE ILE Z . n 
A 1 169 THR 169 169 169 THR THR Z . n 
A 1 170 GLU 170 170 170 GLU GLU Z . n 
A 1 171 ASP 171 171 171 ASP ASP Z . n 
A 1 172 SER 172 172 172 SER SER Z . n 
A 1 173 ASP 173 173 173 ASP ASP Z . n 
A 1 174 LEU 174 174 174 LEU LEU Z . n 
A 1 175 LEU 175 175 175 LEU LEU Z . n 
A 1 176 ALA 176 176 176 ALA ALA Z . n 
A 1 177 PHE 177 177 177 PHE PHE Z . n 
A 1 178 GLY 178 178 178 GLY GLY Z . n 
A 1 179 CYS 179 179 179 CYS CYS Z . n 
A 1 180 LYS 180 180 180 LYS LYS Z . n 
A 1 181 LYS 181 181 181 LYS LYS Z . n 
A 1 182 VAL 182 182 182 VAL VAL Z . n 
A 1 183 ILE 183 183 183 ILE ILE Z . n 
A 1 184 LEU 184 184 184 LEU LEU Z . n 
A 1 185 LYS 185 185 185 LYS LYS Z . n 
A 1 186 MET 186 186 186 MET MET Z . n 
A 1 187 ASP 187 187 187 ASP ASP Z . n 
A 1 188 GLN 188 188 188 GLN GLN Z . n 
A 1 189 PHE 189 189 189 PHE PHE Z . n 
A 1 190 GLY 190 190 190 GLY GLY Z . n 
A 1 191 ASN 191 191 191 ASN ASN Z . n 
A 1 192 GLY 192 192 192 GLY GLY Z . n 
A 1 193 LEU 193 193 193 LEU LEU Z . n 
A 1 194 GLU 194 194 194 GLU GLU Z . n 
A 1 195 ILE 195 195 195 ILE ILE Z . n 
A 1 196 ASP 196 196 196 ASP ASP Z . n 
A 1 197 GLN 197 197 197 GLN GLN Z . n 
A 1 198 ALA 198 198 198 ALA ALA Z . n 
A 1 199 ARG 199 199 199 ARG ARG Z . n 
A 1 200 LEU 200 200 200 LEU LEU Z . n 
A 1 201 GLY 201 201 201 GLY GLY Z . n 
A 1 202 MET 202 202 202 MET MET Z . n 
A 1 203 CYS 203 203 203 CYS CYS Z . n 
A 1 204 ARG 204 204 204 ARG ARG Z . n 
A 1 205 GLN 205 205 205 GLN GLN Z . n 
A 1 206 LEU 206 206 206 LEU LEU Z . n 
A 1 207 GLY 207 207 207 GLY GLY Z . n 
A 1 208 ASP 208 208 208 ASP ASP Z . n 
A 1 209 VAL 209 209 209 VAL VAL Z . n 
A 1 210 PHE 210 210 210 PHE PHE Z . n 
A 1 211 THR 211 211 211 THR THR Z . n 
A 1 212 GLU 212 212 212 GLU GLU Z . n 
A 1 213 GLU 213 213 213 GLU GLU Z . n 
A 1 214 LYS 214 214 214 LYS LYS Z . n 
A 1 215 PHE 215 215 215 PHE PHE Z . n 
A 1 216 ARG 216 216 216 ARG ARG Z . n 
A 1 217 TYR 217 217 217 TYR TYR Z . n 
A 1 218 MET 218 218 218 MET MET Z . n 
A 1 219 CYS 219 219 219 CYS CYS Z . n 
A 1 220 ILE 220 220 220 ILE ILE Z . n 
A 1 221 LEU 221 221 221 LEU LEU Z . n 
A 1 222 SER 222 222 222 SER SER Z . n 
A 1 223 GLY 223 223 223 GLY GLY Z . n 
A 1 224 CYS 224 224 224 CYS CYS Z . n 
A 1 225 ASP 225 225 225 ASP ASP Z . n 
A 1 226 TYR 226 226 226 TYR TYR Z . n 
A 1 227 LEU 227 227 227 LEU LEU Z . n 
A 1 228 SER 228 228 228 SER SER Z . n 
A 1 229 SER 229 229 229 SER SER Z . n 
A 1 230 LEU 230 230 230 LEU LEU Z . n 
A 1 231 ARG 231 231 231 ARG ARG Z . n 
A 1 232 GLY 232 232 232 GLY GLY Z . n 
A 1 233 ILE 233 233 233 ILE ILE Z . n 
A 1 234 GLY 234 234 234 GLY GLY Z . n 
A 1 235 LEU 235 235 235 LEU LEU Z . n 
A 1 236 ALA 236 236 236 ALA ALA Z . n 
A 1 237 LYS 237 237 237 LYS LYS Z . n 
A 1 238 ALA 238 238 238 ALA ALA Z . n 
A 1 239 CYS 239 239 239 CYS CYS Z . n 
A 1 240 LYS 240 240 240 LYS LYS Z . n 
A 1 241 VAL 241 241 241 VAL VAL Z . n 
A 1 242 LEU 242 242 242 LEU LEU Z . n 
A 1 243 ARG 243 243 243 ARG ARG Z . n 
A 1 244 LEU 244 244 244 LEU LEU Z . n 
A 1 245 ALA 245 245 245 ALA ALA Z . n 
A 1 246 ASN 246 246 246 ASN ASN Z . n 
A 1 247 ASN 247 247 247 ASN ASN Z . n 
A 1 248 PRO 248 248 248 PRO PRO Z . n 
A 1 249 ASP 249 249 249 ASP ASP Z . n 
A 1 250 ILE 250 250 250 ILE ILE Z . n 
A 1 251 VAL 251 251 251 VAL VAL Z . n 
A 1 252 LYS 252 252 252 LYS LYS Z . n 
A 1 253 VAL 253 253 253 VAL VAL Z . n 
A 1 254 ILE 254 254 254 ILE ILE Z . n 
A 1 255 LYS 255 255 255 LYS LYS Z . n 
A 1 256 LYS 256 256 256 LYS LYS Z . n 
A 1 257 ILE 257 257 257 ILE ILE Z . n 
A 1 258 GLY 258 258 258 GLY GLY Z . n 
A 1 259 HIS 259 259 259 HIS HIS Z . n 
A 1 260 TYR 260 260 260 TYR TYR Z . n 
A 1 261 LEU 261 261 261 LEU LEU Z . n 
A 1 262 LYS 262 262 262 LYS LYS Z . n 
A 1 263 MET 263 263 263 MET MET Z . n 
A 1 264 ASN 264 264 264 ASN ASN Z . n 
A 1 265 ILE 265 265 265 ILE ILE Z . n 
A 1 266 THR 266 266 266 THR THR Z . n 
A 1 267 VAL 267 267 267 VAL VAL Z . n 
A 1 268 PRO 268 268 268 PRO PRO Z . n 
A 1 269 GLU 269 269 269 GLU GLU Z . n 
A 1 270 ASP 270 270 270 ASP ASP Z . n 
A 1 271 TYR 271 271 271 TYR TYR Z . n 
A 1 272 ILE 272 272 272 ILE ILE Z . n 
A 1 273 ASN 273 273 273 ASN ASN Z . n 
A 1 274 GLY 274 274 274 GLY GLY Z . n 
A 1 275 PHE 275 275 275 PHE PHE Z . n 
A 1 276 ILE 276 276 276 ILE ILE Z . n 
A 1 277 ARG 277 277 277 ARG ARG Z . n 
A 1 278 ALA 278 278 278 ALA ALA Z . n 
A 1 279 ASN 279 279 279 ASN ASN Z . n 
A 1 280 ASN 280 280 280 ASN ASN Z . n 
A 1 281 THR 281 281 281 THR THR Z . n 
A 1 282 PHE 282 282 282 PHE PHE Z . n 
A 1 283 LEU 283 283 283 LEU LEU Z . n 
A 1 284 TYR 284 284 284 TYR TYR Z . n 
A 1 285 GLN 285 285 285 GLN GLN Z . n 
A 1 286 LEU 286 286 286 LEU LEU Z . n 
A 1 287 VAL 287 287 287 VAL VAL Z . n 
A 1 288 PHE 288 288 288 PHE PHE Z . n 
A 1 289 ASP 289 289 289 ASP ASP Z . n 
A 1 290 PRO 290 290 290 PRO PRO Z . n 
A 1 291 ILE 291 291 291 ILE ILE Z . n 
A 1 292 LYS 292 292 292 LYS LYS Z . n 
A 1 293 ARG 293 293 293 ARG ARG Z . n 
A 1 294 LYS 294 294 294 LYS LYS Z . n 
A 1 295 LEU 295 295 295 LEU LEU Z . n 
A 1 296 ILE 296 296 296 ILE ILE Z . n 
A 1 297 PRO 297 297 297 PRO PRO Z . n 
A 1 298 LEU 298 298 298 LEU LEU Z . n 
A 1 299 ASN 299 299 299 ASN ASN Z . n 
A 1 300 ALA 300 300 300 ALA ALA Z . n 
A 1 301 TYR 301 301 301 TYR TYR Z . n 
A 1 302 GLU 302 302 302 GLU GLU Z . n 
A 1 303 ASP 303 303 303 ASP ASP Z . n 
A 1 304 ASP 304 304 304 ASP ASP Z . n 
A 1 305 VAL 305 305 305 VAL VAL Z . n 
A 1 306 ASP 306 306 306 ASP ASP Z . n 
A 1 307 PRO 307 307 307 PRO PRO Z . n 
A 1 308 GLU 308 308 308 GLU GLU Z . n 
A 1 309 THR 309 309 309 THR THR Z . n 
A 1 310 LEU 310 310 310 LEU LEU Z . n 
A 1 311 SER 311 311 311 SER SER Z . n 
A 1 312 TYR 312 312 312 TYR TYR Z . n 
A 1 313 ALA 313 313 313 ALA ALA Z . n 
A 1 314 GLY 314 314 314 GLY GLY Z . n 
A 1 315 GLN 315 315 315 GLN GLN Z . n 
A 1 316 TYR 316 316 316 TYR TYR Z . n 
A 1 317 VAL 317 317 317 VAL VAL Z . n 
A 1 318 ASP 318 318 318 ASP ASP Z . n 
A 1 319 ASP 319 319 319 ASP ASP Z . n 
A 1 320 SER 320 320 320 SER SER Z . n 
A 1 321 ILE 321 321 321 ILE ILE Z . n 
A 1 322 ALA 322 322 322 ALA ALA Z . n 
A 1 323 LEU 323 323 323 LEU LEU Z . n 
A 1 324 GLN 324 324 324 GLN GLN Z . n 
A 1 325 ILE 325 325 325 ILE ILE Z . n 
A 1 326 ALA 326 326 326 ALA ALA Z . n 
A 1 327 LEU 327 327 327 LEU LEU Z . n 
A 1 328 GLY 328 328 328 GLY GLY Z . n 
A 1 329 ASN 329 329 329 ASN ASN Z . n 
A 1 330 LYS 330 330 330 LYS LYS Z . n 
A 1 331 ASP 331 331 331 ASP ASP Z . n 
A 1 332 ILE 332 332 332 ILE ILE Z . n 
A 1 333 ASN 333 333 333 ASN ASN Z . n 
A 1 334 THR 334 334 334 THR THR Z . n 
A 1 335 PHE 335 335 335 PHE PHE Z . n 
A 1 336 GLU 336 336 336 GLU GLU Z . n 
A 1 337 GLN 337 337 337 GLN GLN Z . n 
A 1 338 ILE 338 338 338 ILE ILE Z . n 
A 1 339 ASP 339 339 339 ASP ASP Z . n 
A 1 340 ASP 340 340 340 ASP ASP Z . n 
A 1 341 TYR 341 341 341 TYR TYR Z . n 
A 1 342 ASN 342 342 342 ASN ASN Z . n 
A 1 343 PRO 343 343 343 PRO PRO Z . n 
A 1 344 ASP 344 344 344 ASP ASP Z . n 
A 1 345 THR 345 345 345 THR THR Z . n 
A 1 346 ALA 346 346 346 ALA ALA Z . n 
A 1 347 MET 347 347 ?   ?   ?   Z . n 
A 1 348 PRO 348 348 ?   ?   ?   Z . n 
A 1 349 ALA 349 349 ?   ?   ?   Z . n 
A 1 350 HIS 350 350 ?   ?   ?   Z . n 
A 1 351 SER 351 351 ?   ?   ?   Z . n 
A 1 352 ARG 352 352 ?   ?   ?   Z . n 
A 1 353 GLU 353 353 ?   ?   ?   Z . n 
A 1 354 ASN 354 354 ?   ?   ?   Z . n 
A 1 355 LEU 355 355 355 LEU LEU Z . n 
A 1 356 TYR 356 356 356 TYR TYR Z . n 
A 1 357 PHE 357 357 357 PHE PHE Z . n 
A 1 358 GLN 358 358 ?   ?   ?   Z . n 
B 2 1   DC  1   1   1   DC  DC  A . n 
B 2 2   DG  2   2   2   DG  DG  A . n 
B 2 3   DC  3   3   3   DC  DC  A . n 
B 2 4   DT  4   4   4   DT  DT  A . n 
B 2 5   DA  5   5   5   DA  DA  A . n 
B 2 6   DG  6   6   6   DG  DG  A . n 
B 2 7   DT  7   7   7   DT  DT  A . n 
B 2 8   DC  8   8   8   DC  DC  A . n 
B 2 9   DG  9   9   9   DG  DG  A . n 
B 2 10  DA  10  10  10  DA  DA  A . n 
B 2 11  DC  11  11  11  DC  DC  A . n 
B 2 12  DA  12  12  12  DA  DA  A . n 
B 2 13  DT  13  13  13  DT  DT  A . n 
C 3 1   DT  1   1   1   DT  DT  B . n 
C 3 2   DC  2   2   2   DC  DC  B . n 
C 3 3   DG  3   3   3   DG  DG  B . n 
C 3 4   DA  4   4   4   DA  DA  B . n 
C 3 5   DC  5   5   5   DC  DC  B . n 
C 3 6   DT  6   6   6   DT  DT  B . n 
C 3 7   DA  7   7   7   DA  DA  B . n 
C 3 8   DG  8   8   8   DG  DG  B . n 
C 3 9   DC  9   9   9   DC  DC  B . n 
C 3 10  DG  10  10  10  DG  DG  B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NA  1  401 1  NA  NA  Z . 
E 5 HOH 1  501 13 HOH HOH Z . 
E 5 HOH 2  502 5  HOH HOH Z . 
E 5 HOH 3  503 16 HOH HOH Z . 
E 5 HOH 4  504 43 HOH HOH Z . 
E 5 HOH 5  505 17 HOH HOH Z . 
E 5 HOH 6  506 35 HOH HOH Z . 
E 5 HOH 7  507 26 HOH HOH Z . 
E 5 HOH 8  508 50 HOH HOH Z . 
E 5 HOH 9  509 24 HOH HOH Z . 
E 5 HOH 10 510 33 HOH HOH Z . 
E 5 HOH 11 511 4  HOH HOH Z . 
E 5 HOH 12 512 47 HOH HOH Z . 
E 5 HOH 13 513 39 HOH HOH Z . 
E 5 HOH 14 514 27 HOH HOH Z . 
E 5 HOH 15 515 1  HOH HOH Z . 
E 5 HOH 16 516 42 HOH HOH Z . 
E 5 HOH 17 517 31 HOH HOH Z . 
E 5 HOH 18 518 11 HOH HOH Z . 
E 5 HOH 19 519 23 HOH HOH Z . 
E 5 HOH 20 520 19 HOH HOH Z . 
E 5 HOH 21 521 3  HOH HOH Z . 
E 5 HOH 22 522 9  HOH HOH Z . 
E 5 HOH 23 523 45 HOH HOH Z . 
E 5 HOH 24 524 12 HOH HOH Z . 
E 5 HOH 25 525 7  HOH HOH Z . 
E 5 HOH 26 526 32 HOH HOH Z . 
E 5 HOH 27 527 14 HOH HOH Z . 
E 5 HOH 28 528 29 HOH HOH Z . 
E 5 HOH 29 529 38 HOH HOH Z . 
E 5 HOH 30 530 15 HOH HOH Z . 
E 5 HOH 31 531 37 HOH HOH Z . 
E 5 HOH 32 532 20 HOH HOH Z . 
E 5 HOH 33 533 40 HOH HOH Z . 
E 5 HOH 34 534 10 HOH HOH Z . 
E 5 HOH 35 535 46 HOH HOH Z . 
E 5 HOH 36 536 36 HOH HOH Z . 
E 5 HOH 37 537 8  HOH HOH Z . 
E 5 HOH 38 538 22 HOH HOH Z . 
E 5 HOH 39 539 41 HOH HOH Z . 
E 5 HOH 40 540 49 HOH HOH Z . 
F 5 HOH 1  101 30 HOH HOH A . 
F 5 HOH 2  102 51 HOH HOH A . 
F 5 HOH 3  103 28 HOH HOH A . 
F 5 HOH 4  104 2  HOH HOH A . 
F 5 HOH 5  105 48 HOH HOH A . 
F 5 HOH 6  106 34 HOH HOH A . 
F 5 HOH 7  107 18 HOH HOH A . 
G 5 HOH 1  101 6  HOH HOH B . 
G 5 HOH 2  102 21 HOH HOH B . 
G 5 HOH 3  103 44 HOH HOH B . 
G 5 HOH 4  104 25 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3440  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  19450 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A SER 222 ? Z SER 222 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 OG  ? A SER 229 ? Z SER 229 ? 1_555 84.8  ? 
2  O   ? A SER 222 ? Z SER 222 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? A ILE 233 ? Z ILE 233 ? 1_555 91.2  ? 
3  OG  ? A SER 229 ? Z SER 229 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? A ILE 233 ? Z ILE 233 ? 1_555 84.4  ? 
4  O   ? A SER 222 ? Z SER 222 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 OP2 ? B DT  4   ? A DT  4   ? 1_555 148.5 ? 
5  OG  ? A SER 229 ? Z SER 229 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 OP2 ? B DT  4   ? A DT  4   ? 1_555 125.2 ? 
6  O   ? A ILE 233 ? Z ILE 233 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 OP2 ? B DT  4   ? A DT  4   ? 1_555 83.7  ? 
7  O   ? A SER 222 ? Z SER 222 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? F HOH .   ? A HOH 104 ? 1_555 85.8  ? 
8  OG  ? A SER 229 ? Z SER 229 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? F HOH .   ? A HOH 104 ? 1_555 154.6 ? 
9  O   ? A ILE 233 ? Z ILE 233 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? F HOH .   ? A HOH 104 ? 1_555 119.4 ? 
10 OP2 ? B DT  4   ? A DT  4   ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? F HOH .   ? A HOH 104 ? 1_555 70.2  ? 
11 O   ? A SER 222 ? Z SER 222 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? E HOH .   ? Z HOH 515 ? 1_555 70.5  ? 
12 OG  ? A SER 229 ? Z SER 229 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? E HOH .   ? Z HOH 515 ? 1_555 91.7  ? 
13 O   ? A ILE 233 ? Z ILE 233 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? E HOH .   ? Z HOH 515 ? 1_555 161.5 ? 
14 OP2 ? B DT  4   ? A DT  4   ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? E HOH .   ? Z HOH 515 ? 1_555 113.0 ? 
15 O   ? F HOH .   ? A HOH 104 ? 1_555 NA ? D NA . ? Z NA 401 ? 1_555 O   ? E HOH .   ? Z HOH 515 ? 1_555 63.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-05-24 
2 'Structure model' 1 1 2017-06-07 
3 'Structure model' 1 2 2017-06-21 
4 'Structure model' 1 3 2017-09-13 
5 'Structure model' 1 4 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation           
2 4 'Structure model' pdbx_audit_support 
3 5 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.country'                        
2 3 'Structure model' '_citation.journal_id_ASTM'                
3 3 'Structure model' '_citation.journal_id_CSD'                 
4 3 'Structure model' '_citation.journal_volume'                 
5 3 'Structure model' '_citation.page_first'                     
6 3 'Structure model' '_citation.page_last'                      
7 4 'Structure model' '_pdbx_audit_support.funding_organization' 
8 5 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined -24.3032 46.5895 -19.1515 1.6440 1.2770 1.6568 0.5567  -0.0124 0.3376  1.6378  0.8219  3.6122  
1.3095  -0.9957 -0.5631 1.9672  -0.8940 0.6847  0.1425  0.7586  1.3826  1.9233  1.9752  0.4195  
'X-RAY DIFFRACTION' 2  ? refined -27.5956 30.2577 -8.7199  2.5923 1.2769 1.6740 0.0650  -0.7251 0.6003  1.1115  6.4004  0.5097  
1.3423  -0.7978 -1.3120 2.5850  -0.4314 -0.5687 3.0035  -0.8872 3.0649  1.0430  -0.9245 0.1614  
'X-RAY DIFFRACTION' 3  ? refined -19.7782 33.0451 -8.6747  1.7960 1.9745 1.6819 0.5994  -0.2100 0.4087  0.4568  0.0999  0.2108  
0.0378  0.1804  0.1526  -0.5012 0.7445  -1.0278 0.3419  0.9962  0.4251  0.3570  3.7631  0.0105  
'X-RAY DIFFRACTION' 4  ? refined -30.8197 43.1266 -19.6054 1.7564 0.9331 1.7608 0.1168  -0.1741 0.6412  4.9214  0.1042  0.4598  
0.7877  0.9769  0.4077  2.0366  1.5375  0.7257  0.7366  -1.1882 0.7656  0.4148  -0.3842 1.6606  
'X-RAY DIFFRACTION' 5  ? refined -13.9017 37.8387 -18.9997 0.8847 1.0193 0.9158 0.0623  -0.0104 -0.1013 0.7323  0.8258  0.0159  
0.0401  -0.1784 -0.1544 0.4445  -0.2509 -0.1051 -1.2760 -0.8734 0.7520  -1.0434 -2.0510 -0.0000 
'X-RAY DIFFRACTION' 6  ? refined -2.1784  22.2444 -14.9009 0.8751 0.8920 0.9190 0.1244  -0.0657 -0.2475 1.7474  1.1775  0.5176  
0.9615  2.1446  -0.8579 0.0525  0.4349  -0.2465 0.2547  0.2414  -0.7333 0.5629  0.1831  -0.0000 
'X-RAY DIFFRACTION' 7  ? refined -13.1506 25.4058 -1.9671  1.0794 0.6909 0.8246 -0.0156 0.1455  -0.0440 0.1200  0.1460  0.1256  
-0.0229 0.0716  -0.2384 1.4968  -0.1494 0.2827  -2.2238 -0.1718 -0.3627 -0.5859 0.6712  0.0000  
'X-RAY DIFFRACTION' 8  ? refined -22.3357 19.9395 6.3968   1.1602 1.2551 1.2148 -0.1075 0.1191  0.0096  0.1748  0.0330  0.2746  
0.0205  -0.0078 -0.3186 -0.4830 -0.0957 -0.4721 0.1538  -0.4036 0.2601  2.3147  -1.2717 -0.0000 
'X-RAY DIFFRACTION' 9  ? refined -7.9409  15.2999 -4.1608  1.3676 0.8877 1.0394 0.0832  -0.0255 -0.1143 0.5312  0.2743  0.4064  
-0.4659 0.5048  -0.9496 -0.3696 0.0492  -1.3407 -0.2810 -0.2270 0.7164  1.7233  0.3987  0.0000  
'X-RAY DIFFRACTION' 10 ? refined -2.0547  25.7893 -0.4936  0.9280 0.8946 0.8172 -0.0224 -0.0850 -0.0782 -0.0949 0.3897  -0.0129 
0.3108  -0.0373 0.0528  0.1178  -1.1550 -1.3081 -0.5874 -0.0420 0.5325  -0.7939 0.2637  -0.0000 
'X-RAY DIFFRACTION' 11 ? refined -9.2237  42.5872 4.8558   1.0203 0.5445 1.4564 -0.0703 0.1118  -0.1364 1.3472  0.1185  0.5667  
-0.1264 -0.8116 0.0198  -0.1774 -1.6405 -0.4414 1.2622  0.7348  0.9069  -0.6223 1.5546  0.0059  
'X-RAY DIFFRACTION' 12 ? refined -28.1503 34.0829 6.8270   1.1998 1.2480 2.2720 0.1922  0.3013  -0.1688 0.4865  0.2257  1.3431  
-0.7448 0.2613  -1.6800 -0.3927 0.0683  -1.1106 0.9149  0.3161  0.8416  -0.3856 -0.2349 -0.0005 
'X-RAY DIFFRACTION' 13 ? refined -29.3251 26.3609 0.9956   0.8200 0.3443 2.0908 0.7148  0.0180  0.7282  0.4939  0.2903  1.4506  
-0.3962 -0.9231 0.2809  2.6432  -3.1904 2.6704  1.3082  -0.2999 2.7082  -2.1776 0.3070  0.2869  
'X-RAY DIFFRACTION' 14 ? refined -6.1945  20.6655 6.8833   1.1318 0.7658 0.9502 0.2607  -0.0046 -0.0503 -0.1185 0.8203  0.2030  
0.2124  -0.0503 -0.4927 -1.1458 -1.7204 0.9753  2.1178  1.3518  -0.5611 0.8083  0.8226  0.0000  
'X-RAY DIFFRACTION' 15 ? refined 1.1602   32.5866 -2.3849  0.8128 0.8472 0.8969 0.0282  -0.0255 -0.1134 -0.2839 0.6420  1.0332  
0.5916  -0.0968 -1.4481 0.3310  -0.1664 0.2703  0.1996  0.1642  -0.1529 -0.3603 0.5005  0.0000  
'X-RAY DIFFRACTION' 16 ? refined -4.6266  32.3765 -11.7061 0.7103 0.6912 0.8893 0.0992  -0.0484 -0.1208 -0.0528 0.5028  1.1421  
-1.2495 0.1299  -0.8027 -0.1933 0.2296  -0.1499 0.3781  0.2764  -0.0316 -0.2252 0.7497  0.0000  
'X-RAY DIFFRACTION' 17 ? refined -10.1419 21.4034 -15.2070 0.9556 0.7978 0.8709 -0.0166 -0.1336 -0.1847 -0.0750 0.8631  0.1388  
-0.3383 0.4759  -0.6023 0.6096  0.2884  -0.7540 -0.2552 -0.6343 -0.0747 0.1326  -0.6339 -0.0000 
'X-RAY DIFFRACTION' 18 ? refined -6.4511  44.0879 -17.7390 1.0014 0.7801 0.6751 0.1213  0.0321  -0.1027 3.5609  2.6535  1.1465  
-0.1855 -0.5536 0.0347  0.2454  0.3825  0.0046  -0.5256 -0.2019 -0.0610 -0.2917 -0.2420 0.0000  
'X-RAY DIFFRACTION' 19 ? refined -9.6800  55.1776 -18.6078 1.5017 0.8030 0.9155 0.1013  0.0195  -0.0543 1.8267  1.4615  0.3638  
-2.4922 -0.2838 0.2001  1.1500  1.0555  -0.2870 -0.6969 -1.1120 0.1531  -1.0766 0.2839  -0.0000 
'X-RAY DIFFRACTION' 20 ? refined -14.7020 61.5995 -16.6803 1.2485 1.0250 1.2333 0.0038  -0.1150 0.0253  -0.1317 -0.0528 0.1747  
-0.4185 0.0869  0.0720  -0.9083 0.2153  0.5497  0.1862  -0.8341 0.5854  0.6134  0.4100  0.0000  
'X-RAY DIFFRACTION' 21 ? refined 1.2253   44.2897 -1.8768  0.7896 0.7964 0.8044 -0.0723 -0.0138 -0.1024 0.5917  -1.1729 3.1122  
-0.9486 1.3879  0.5055  -0.0637 -0.1972 -0.0409 0.4850  -0.0408 0.1825  -1.0748 0.5769  -0.0000 
'X-RAY DIFFRACTION' 22 ? refined 6.0063   52.9379 -0.8634  1.1592 0.9768 1.3965 -0.2325 -0.0054 -0.1828 0.1948  0.5149  0.0871  
-0.3174 0.2241  0.0874  -0.2813 -0.5803 2.0062  0.4415  0.5519  -1.2980 -0.9130 1.2522  -0.0000 
'X-RAY DIFFRACTION' 23 ? refined 0.3124   35.4109 12.2626  1.1070 1.0212 0.8567 -0.0919 -0.0454 -0.0979 -0.5938 1.1268  1.9322  
-0.5492 0.6835  -0.4702 0.3233  -0.4977 0.5015  1.1998  -0.1694 0.1208  -0.2417 -0.0104 -0.0000 
'X-RAY DIFFRACTION' 24 ? refined 7.3853   20.5669 12.2303  1.0305 1.2058 1.1536 0.1572  -0.2000 0.1712  0.1568  -0.1104 -0.0511 
0.1297  -0.0026 0.0865  0.4416  0.2341  -1.9306 0.3449  -1.5591 -0.0488 -1.0370 -1.1070 -0.0000 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(chain A and resid 1:5)'     
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(chain A and resid 6:11)'    
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(chain B and resid 1:4)'     
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(chain B and resid 5:10)'    
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(chain Z and resid 2:12)'    
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(chain Z and resid 13:31)'   
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(chain Z and resid 32:36)'   
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(chain Z and resid 37:53)'   
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(chain Z and resid 54:71)'   
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain Z and resid 72:79)'   
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(chain Z and resid 80:85)'   
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(chain Z and resid 86:111)'  
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(chain Z and resid 112:124)' 
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(chain Z and resid 125:142)' 
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(chain Z and resid 143:164)' 
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(chain Z and resid 165:184)' 
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(chain Z and resid 185:195)' 
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(chain Z and resid 196:229)' 
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(chain Z and resid 230:255)' 
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(chain Z and resid 256:270)' 
'X-RAY DIFFRACTION' 21 21 ? ? ? ? ? ? ? ? ? '(chain Z and resid 271:300)' 
'X-RAY DIFFRACTION' 22 22 ? ? ? ? ? ? ? ? ? '(chain Z and resid 301:310)' 
'X-RAY DIFFRACTION' 23 23 ? ? ? ? ? ? ? ? ? '(chain Z and resid 311:338)' 
'X-RAY DIFFRACTION' 24 24 ? ? ? ? ? ? ? ? ? '(chain Z and resid 339:346)' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? dev_1839 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .        4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.480 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.127 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS Z 42  ? ? -142.53 54.04   
2 1 ASP Z 53  ? ? -150.21 33.81   
3 1 LYS Z 111 ? ? -67.05  87.66   
4 1 LEU Z 145 ? ? -160.19 110.75  
5 1 TYR Z 149 ? ? -138.21 -116.51 
6 1 LYS Z 185 ? ? 52.64   70.28   
7 1 ASP Z 340 ? ? -144.71 44.08   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 Z PHE 357 ? CG  ? A PHE 357 CG  
2 1 Y 1 Z PHE 357 ? CD1 ? A PHE 357 CD1 
3 1 Y 1 Z PHE 357 ? CD2 ? A PHE 357 CD2 
4 1 Y 1 Z PHE 357 ? CE1 ? A PHE 357 CE1 
5 1 Y 1 Z PHE 357 ? CE2 ? A PHE 357 CE2 
6 1 Y 1 Z PHE 357 ? CZ  ? A PHE 357 CZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 Z MET 1   ? A MET 1   
2  1 Y 1 Z MET 347 ? A MET 347 
3  1 Y 1 Z PRO 348 ? A PRO 348 
4  1 Y 1 Z ALA 349 ? A ALA 349 
5  1 Y 1 Z HIS 350 ? A HIS 350 
6  1 Y 1 Z SER 351 ? A SER 351 
7  1 Y 1 Z ARG 352 ? A ARG 352 
8  1 Y 1 Z GLU 353 ? A GLU 353 
9  1 Y 1 Z ASN 354 ? A ASN 354 
10 1 Y 1 Z GLN 358 ? A GLN 358 
# 
_ndb_struct_conf_na.entry_id   5V04 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 10 1_555 -0.723 -0.257 -1.050 4.362  -2.534  -2.546 1  A_DC1:DG10_B A 1  ? B 10 ? 19 1 
1 B DG 2  1_555 C DC 9  1_555 0.662  -0.198 -0.971 -7.185 -4.213  4.145  2  A_DG2:DC9_B  A 2  ? B 9  ? 19 1 
1 B DC 3  1_555 C DG 8  1_555 0.278  -0.114 0.178  -0.149 -2.341  1.962  3  A_DC3:DG8_B  A 3  ? B 8  ? 19 1 
1 B DT 4  1_555 C DA 7  1_555 -0.014 -0.112 -0.180 7.800  -23.072 -2.946 4  A_DT4:DA7_B  A 4  ? B 7  ? 20 1 
1 B DA 5  1_555 C DT 6  1_555 0.751  -0.145 -0.091 13.760 -11.644 0.338  5  A_DA5:DT6_B  A 5  ? B 6  ? 20 1 
1 B DG 6  1_555 C DC 5  1_555 0.372  -0.168 -0.501 2.343  -19.003 5.715  6  A_DG6:DC5_B  A 6  ? B 5  ? 19 1 
1 B DT 7  1_555 C DA 4  1_555 0.083  -0.168 -0.467 14.262 -23.995 0.031  7  A_DT7:DA4_B  A 7  ? B 4  ? 20 1 
1 B DC 8  1_555 C DG 3  1_555 1.180  -0.478 -0.142 0.863  -11.227 -0.589 8  A_DC8:DG3_B  A 8  ? B 3  ? 19 1 
1 B DG 9  1_555 C DC 2  1_555 0.328  -0.459 -0.516 -1.052 -0.128  -6.117 9  A_DG9:DC2_B  A 9  ? B 2  ? 19 1 
1 B DA 10 1_555 C DT 1  1_555 1.076  -0.232 0.405  25.899 1.450   7.083  10 A_DA10:DT1_B A 10 ? B 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 C DG 10 1_555 B DG 2  1_555 C DC 9 1_555 0.695  0.145  3.878 4.320  13.672 45.710 -1.134 -0.443 3.817 17.111 -5.406 
47.791 1 AA_DC1DG2:DC9DG10_BB A 1 ? B 10 ? A 2  ? B 9 ? 
1 B DG 2 1_555 C DC 9  1_555 B DC 3  1_555 C DG 8 1_555 -0.772 -0.116 3.144 -8.368 5.041  31.560 -1.051 -0.047 3.184 9.002  14.944 
33.001 2 AA_DG2DC3:DG8DC9_BB  A 2 ? B 9  ? A 3  ? B 8 ? 
1 B DC 3 1_555 C DG 8  1_555 B DT 4  1_555 C DA 7 1_555 -0.742 -0.238 3.050 1.573  0.457  31.756 -0.511 1.620  3.007 0.834  -2.873 
31.798 3 AA_DC3DT4:DA7DG8_BB  A 3 ? B 8  ? A 4  ? B 7 ? 
1 B DT 4 1_555 C DA 7  1_555 B DA 5  1_555 C DT 6 1_555 0.800  1.149  3.286 3.659  2.861  39.929 1.339  -0.737 3.415 4.173  -5.336 
40.187 4 AA_DT4DA5:DT6DA7_BB  A 4 ? B 7  ? A 5  ? B 6 ? 
1 B DA 5 1_555 C DT 6  1_555 B DG 6  1_555 C DC 5 1_555 -0.007 -0.158 3.634 -0.689 9.638  29.753 -2.314 -0.131 3.417 18.176 1.299  
31.249 5 AA_DA5DG6:DC5DT6_BB  A 5 ? B 6  ? A 6  ? B 5 ? 
1 B DG 6 1_555 C DC 5  1_555 B DT 7  1_555 C DA 4 1_555 -0.585 -0.219 2.908 -0.680 2.201  30.122 -0.817 0.999  2.897 4.227  1.305  
30.208 6 AA_DG6DT7:DA4DC5_BB  A 6 ? B 5  ? A 7  ? B 4 ? 
1 B DT 7 1_555 C DA 4  1_555 B DC 8  1_555 C DG 3 1_555 0.422  -0.404 3.626 -0.561 6.345  41.294 -1.300 -0.657 3.523 8.933  0.790  
41.761 7 AA_DT7DC8:DG3DA4_BB  A 7 ? B 4  ? A 8  ? B 3 ? 
1 B DC 8 1_555 C DG 3  1_555 B DG 9  1_555 C DC 2 1_555 -0.180 0.505  3.495 4.340  4.636  30.632 -0.008 1.218  3.474 8.658  -8.106 
31.268 8 AA_DC8DG9:DC2DG3_BB  A 8 ? B 3  ? A 9  ? B 2 ? 
1 B DG 9 1_555 C DC 2  1_555 B DA 10 1_555 C DT 1 1_555 0.599  -0.042 2.805 -5.950 2.907  33.043 -0.470 -1.849 2.647 5.047  10.332 
33.682 9 AA_DG9DA10:DT1DC2_BB A 9 ? B 2  ? A 10 ? B 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM091487' 1 
'National Institutes of Health/National Cancer Institute (NIH/NCI)'                        'United States' 'P01 CA092584' 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION' NA  
5 water        HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#