data_5VLR
# 
_entry.id   5VLR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5VLR         
WWPDB D_1000227635 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5VLR 
_pdbx_database_status.recvd_initial_deposition_date   2017-04-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Sack, J.S.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Med. Chem.' 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           1520-4804 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            60 
_citation.language                  ? 
_citation.page_first                5193 
_citation.page_last                 5208 
_citation.title                     
;Identification of a Potent, Selective, and Efficacious Phosphatidylinositol 3-Kinase delta (PI3K delta ) Inhibitor for the Treatment of Immunological Disorders.
;
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.7b00618 
_citation.pdbx_database_id_PubMed   28541707 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, Q.'               1  
primary 'Shi, Q.'               2  
primary 'Marcoux, D.'           3  
primary 'Batt, D.G.'            4  
primary 'Cornelius, L.'         5  
primary 'Qin, L.Y.'             6  
primary 'Ruan, Z.'              7  
primary 'Neels, J.'             8  
primary 'Beaudoin-Bertrand, M.' 9  
primary 'Srivastava, A.S.'      10 
primary 'Li, L.'                11 
primary 'Cherney, R.J.'         12 
primary 'Gong, H.'              13 
primary 'Watterson, S.H.'       14 
primary 'Weigelt, C.'           15 
primary 'Gillooly, K.M.'        16 
primary 'McIntyre, K.W.'        17 
primary 'Xie, J.H.'             18 
primary 'Obermeier, M.T.'       19 
primary 'Fura, A.'              20 
primary 'Sleczka, B.'           21 
primary 'Stefanski, K.'         22 
primary 'Fancher, R.M.'         23 
primary 'Padmanabhan, S.'       24 
primary 'Rp, T.'                25 
primary 'Kundu, I.'             26 
primary 'Rajareddy, K.'         27 
primary 'Smith, R.'             28 
primary 'Hennan, J.K.'          29 
primary 'Xing, D.'              30 
primary 'Fan, J.'               31 
primary 'Levesque, P.C.'        32 
primary 'Ruan, Q.'              33 
primary 'Pitt, S.'              34 
primary 'Zhang, R.'             35 
primary 'Pedicord, D.'          36 
primary 'Pan, J.'               37 
primary 'Yarde, M.'             38 
primary 'Lu, H.'                39 
primary 'Lippy, J.'             40 
primary 'Goldstine, C.'         41 
primary 'Skala, S.'             42 
primary 'Rampulla, R.A.'        43 
primary 'Mathur, A.'            44 
primary 'Gupta, A.'             45 
primary 'Arunachalam, P.N.'     46 
primary 'Sack, J.S.'            47 
primary 'Muckelbauer, J.K.'     48 
primary 'Cvijic, M.E.'          49 
primary 'Salter-Cid, L.M.'      50 
primary 'Bhide, R.S.'           51 
primary 'Poss, M.A.'            52 
primary 'Hynes, J.'             53 
primary 'Carter, P.H.'          54 
primary 'Macor, J.E.'           55 
primary 'Ruepp, S.'             56 
primary 'Schieven, G.L.'        57 
primary 'Tino, J.A.'            58 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5VLR 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     90.847 
_cell.length_a_esd                 ? 
_cell.length_b                     108.579 
_cell.length_b_esd                 ? 
_cell.length_c                     142.734 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5VLR 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform' 115958.867 1  2.7.1.153 ? ? ? 
2 polymer     man 'Phosphatidylinositol 3-kinase regulatory subunit alpha' 20993.656  1  ?         ? ? ? 
3 non-polymer syn 
;4-acetyl-1-(3-{4-amino-5-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]pyrrolo[2,1-f][1,2,4]triazin-7-yl}phenyl)-3,3-dimethylpiperazin-2-one
;
526.514    1  ?         ? ? ? 
4 water       nat water 18.015     24 ?         ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PtdIns-3-kinase subunit delta,Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta,p110delta' 
2 
;PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PtdIns-3-kinase regulatory subunit p85-alpha
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;NQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFL
PVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQ
TWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPL
CQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNAD
ERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADC
PIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGR
HSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPV
LSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMH
VPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLD
PSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCL
PTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHS
DNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLH
LFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKT
;
;NQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFL
PVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQ
TWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPL
CQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNAD
ERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADC
PIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGR
HSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPV
LSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMH
VPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLD
PSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCL
PTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHS
DNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLH
LFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKT
;
A ? 
2 'polypeptide(L)' no no 
;YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIE
KFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVR
QKKLNEWLGN
;
;YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIE
KFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVR
QKKLNEWLGN
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    ASN n 
1 2    GLN n 
1 3    SER n 
1 4    VAL n 
1 5    VAL n 
1 6    VAL n 
1 7    ASP n 
1 8    PHE n 
1 9    LEU n 
1 10   LEU n 
1 11   PRO n 
1 12   THR n 
1 13   GLY n 
1 14   VAL n 
1 15   TYR n 
1 16   LEU n 
1 17   ASN n 
1 18   PHE n 
1 19   PRO n 
1 20   VAL n 
1 21   SER n 
1 22   ARG n 
1 23   ASN n 
1 24   ALA n 
1 25   ASN n 
1 26   LEU n 
1 27   SER n 
1 28   THR n 
1 29   ILE n 
1 30   LYS n 
1 31   GLN n 
1 32   LEU n 
1 33   LEU n 
1 34   TRP n 
1 35   HIS n 
1 36   ARG n 
1 37   ALA n 
1 38   GLN n 
1 39   TYR n 
1 40   GLU n 
1 41   PRO n 
1 42   LEU n 
1 43   PHE n 
1 44   HIS n 
1 45   MET n 
1 46   LEU n 
1 47   SER n 
1 48   GLY n 
1 49   PRO n 
1 50   GLU n 
1 51   ALA n 
1 52   TYR n 
1 53   VAL n 
1 54   PHE n 
1 55   THR n 
1 56   CYS n 
1 57   ILE n 
1 58   ASN n 
1 59   GLN n 
1 60   THR n 
1 61   ALA n 
1 62   GLU n 
1 63   GLN n 
1 64   GLN n 
1 65   GLU n 
1 66   LEU n 
1 67   GLU n 
1 68   ASP n 
1 69   GLU n 
1 70   GLN n 
1 71   ARG n 
1 72   ARG n 
1 73   LEU n 
1 74   CYS n 
1 75   ASP n 
1 76   VAL n 
1 77   GLN n 
1 78   PRO n 
1 79   PHE n 
1 80   LEU n 
1 81   PRO n 
1 82   VAL n 
1 83   LEU n 
1 84   ARG n 
1 85   LEU n 
1 86   VAL n 
1 87   ALA n 
1 88   ARG n 
1 89   GLU n 
1 90   GLY n 
1 91   ASP n 
1 92   ARG n 
1 93   VAL n 
1 94   LYS n 
1 95   LYS n 
1 96   LEU n 
1 97   ILE n 
1 98   ASN n 
1 99   SER n 
1 100  GLN n 
1 101  ILE n 
1 102  SER n 
1 103  LEU n 
1 104  LEU n 
1 105  ILE n 
1 106  GLY n 
1 107  LYS n 
1 108  GLY n 
1 109  LEU n 
1 110  HIS n 
1 111  GLU n 
1 112  PHE n 
1 113  ASP n 
1 114  SER n 
1 115  LEU n 
1 116  CYS n 
1 117  ASP n 
1 118  PRO n 
1 119  GLU n 
1 120  VAL n 
1 121  ASN n 
1 122  ASP n 
1 123  PHE n 
1 124  ARG n 
1 125  ALA n 
1 126  LYS n 
1 127  MET n 
1 128  CYS n 
1 129  GLN n 
1 130  PHE n 
1 131  CYS n 
1 132  GLU n 
1 133  GLU n 
1 134  ALA n 
1 135  ALA n 
1 136  ALA n 
1 137  ARG n 
1 138  ARG n 
1 139  GLN n 
1 140  GLN n 
1 141  LEU n 
1 142  GLY n 
1 143  TRP n 
1 144  GLU n 
1 145  ALA n 
1 146  TRP n 
1 147  LEU n 
1 148  GLN n 
1 149  TYR n 
1 150  SER n 
1 151  PHE n 
1 152  PRO n 
1 153  LEU n 
1 154  GLN n 
1 155  LEU n 
1 156  GLU n 
1 157  PRO n 
1 158  SER n 
1 159  ALA n 
1 160  GLN n 
1 161  THR n 
1 162  TRP n 
1 163  GLY n 
1 164  PRO n 
1 165  GLY n 
1 166  THR n 
1 167  LEU n 
1 168  ARG n 
1 169  LEU n 
1 170  PRO n 
1 171  ASN n 
1 172  ARG n 
1 173  ALA n 
1 174  LEU n 
1 175  LEU n 
1 176  VAL n 
1 177  ASN n 
1 178  VAL n 
1 179  LYS n 
1 180  PHE n 
1 181  GLU n 
1 182  GLY n 
1 183  SER n 
1 184  GLU n 
1 185  GLU n 
1 186  SER n 
1 187  PHE n 
1 188  THR n 
1 189  PHE n 
1 190  GLN n 
1 191  VAL n 
1 192  SER n 
1 193  THR n 
1 194  LYS n 
1 195  ASP n 
1 196  VAL n 
1 197  PRO n 
1 198  LEU n 
1 199  ALA n 
1 200  LEU n 
1 201  MET n 
1 202  ALA n 
1 203  CYS n 
1 204  ALA n 
1 205  LEU n 
1 206  ARG n 
1 207  LYS n 
1 208  LYS n 
1 209  ALA n 
1 210  THR n 
1 211  VAL n 
1 212  PHE n 
1 213  ARG n 
1 214  GLN n 
1 215  PRO n 
1 216  LEU n 
1 217  VAL n 
1 218  GLU n 
1 219  GLN n 
1 220  PRO n 
1 221  GLU n 
1 222  ASP n 
1 223  TYR n 
1 224  THR n 
1 225  LEU n 
1 226  GLN n 
1 227  VAL n 
1 228  ASN n 
1 229  GLY n 
1 230  ARG n 
1 231  HIS n 
1 232  GLU n 
1 233  TYR n 
1 234  LEU n 
1 235  TYR n 
1 236  GLY n 
1 237  SER n 
1 238  TYR n 
1 239  PRO n 
1 240  LEU n 
1 241  CYS n 
1 242  GLN n 
1 243  PHE n 
1 244  GLN n 
1 245  TYR n 
1 246  ILE n 
1 247  CYS n 
1 248  SER n 
1 249  CYS n 
1 250  LEU n 
1 251  HIS n 
1 252  SER n 
1 253  GLY n 
1 254  LEU n 
1 255  THR n 
1 256  PRO n 
1 257  HIS n 
1 258  LEU n 
1 259  THR n 
1 260  MET n 
1 261  VAL n 
1 262  HIS n 
1 263  SER n 
1 264  SER n 
1 265  SER n 
1 266  ILE n 
1 267  LEU n 
1 268  ALA n 
1 269  MET n 
1 270  ARG n 
1 271  ASP n 
1 272  GLU n 
1 273  GLN n 
1 274  SER n 
1 275  ASN n 
1 276  PRO n 
1 277  ALA n 
1 278  PRO n 
1 279  GLN n 
1 280  VAL n 
1 281  GLN n 
1 282  LYS n 
1 283  PRO n 
1 284  ARG n 
1 285  ALA n 
1 286  LYS n 
1 287  PRO n 
1 288  PRO n 
1 289  PRO n 
1 290  ILE n 
1 291  PRO n 
1 292  ALA n 
1 293  LYS n 
1 294  LYS n 
1 295  PRO n 
1 296  SER n 
1 297  SER n 
1 298  VAL n 
1 299  SER n 
1 300  LEU n 
1 301  TRP n 
1 302  SER n 
1 303  LEU n 
1 304  GLU n 
1 305  GLN n 
1 306  PRO n 
1 307  PHE n 
1 308  ARG n 
1 309  ILE n 
1 310  GLU n 
1 311  LEU n 
1 312  ILE n 
1 313  GLN n 
1 314  GLY n 
1 315  SER n 
1 316  LYS n 
1 317  VAL n 
1 318  ASN n 
1 319  ALA n 
1 320  ASP n 
1 321  GLU n 
1 322  ARG n 
1 323  MET n 
1 324  LYS n 
1 325  LEU n 
1 326  VAL n 
1 327  VAL n 
1 328  GLN n 
1 329  ALA n 
1 330  GLY n 
1 331  LEU n 
1 332  PHE n 
1 333  HIS n 
1 334  GLY n 
1 335  ASN n 
1 336  GLU n 
1 337  MET n 
1 338  LEU n 
1 339  CYS n 
1 340  LYS n 
1 341  THR n 
1 342  VAL n 
1 343  SER n 
1 344  SER n 
1 345  SER n 
1 346  GLU n 
1 347  VAL n 
1 348  SER n 
1 349  VAL n 
1 350  CYS n 
1 351  SER n 
1 352  GLU n 
1 353  PRO n 
1 354  VAL n 
1 355  TRP n 
1 356  LYS n 
1 357  GLN n 
1 358  ARG n 
1 359  LEU n 
1 360  GLU n 
1 361  PHE n 
1 362  ASP n 
1 363  ILE n 
1 364  ASN n 
1 365  ILE n 
1 366  CYS n 
1 367  ASP n 
1 368  LEU n 
1 369  PRO n 
1 370  ARG n 
1 371  MET n 
1 372  ALA n 
1 373  ARG n 
1 374  LEU n 
1 375  CYS n 
1 376  PHE n 
1 377  ALA n 
1 378  LEU n 
1 379  TYR n 
1 380  ALA n 
1 381  VAL n 
1 382  ILE n 
1 383  GLU n 
1 384  LYS n 
1 385  ALA n 
1 386  LYS n 
1 387  LYS n 
1 388  ALA n 
1 389  ARG n 
1 390  SER n 
1 391  THR n 
1 392  LYS n 
1 393  LYS n 
1 394  LYS n 
1 395  SER n 
1 396  LYS n 
1 397  LYS n 
1 398  ALA n 
1 399  ASP n 
1 400  CYS n 
1 401  PRO n 
1 402  ILE n 
1 403  ALA n 
1 404  TRP n 
1 405  ALA n 
1 406  ASN n 
1 407  LEU n 
1 408  MET n 
1 409  LEU n 
1 410  PHE n 
1 411  ASP n 
1 412  TYR n 
1 413  LYS n 
1 414  ASP n 
1 415  GLN n 
1 416  LEU n 
1 417  LYS n 
1 418  THR n 
1 419  GLY n 
1 420  GLU n 
1 421  ARG n 
1 422  CYS n 
1 423  LEU n 
1 424  TYR n 
1 425  MET n 
1 426  TRP n 
1 427  PRO n 
1 428  SER n 
1 429  VAL n 
1 430  PRO n 
1 431  ASP n 
1 432  GLU n 
1 433  LYS n 
1 434  GLY n 
1 435  GLU n 
1 436  LEU n 
1 437  LEU n 
1 438  ASN n 
1 439  PRO n 
1 440  THR n 
1 441  GLY n 
1 442  THR n 
1 443  VAL n 
1 444  ARG n 
1 445  SER n 
1 446  ASN n 
1 447  PRO n 
1 448  ASN n 
1 449  THR n 
1 450  ASP n 
1 451  SER n 
1 452  ALA n 
1 453  ALA n 
1 454  ALA n 
1 455  LEU n 
1 456  LEU n 
1 457  ILE n 
1 458  CYS n 
1 459  LEU n 
1 460  PRO n 
1 461  GLU n 
1 462  VAL n 
1 463  ALA n 
1 464  PRO n 
1 465  HIS n 
1 466  PRO n 
1 467  VAL n 
1 468  TYR n 
1 469  TYR n 
1 470  PRO n 
1 471  ALA n 
1 472  LEU n 
1 473  GLU n 
1 474  LYS n 
1 475  ILE n 
1 476  LEU n 
1 477  GLU n 
1 478  LEU n 
1 479  GLY n 
1 480  ARG n 
1 481  HIS n 
1 482  SER n 
1 483  GLU n 
1 484  CYS n 
1 485  VAL n 
1 486  HIS n 
1 487  VAL n 
1 488  THR n 
1 489  GLU n 
1 490  GLU n 
1 491  GLU n 
1 492  GLN n 
1 493  LEU n 
1 494  GLN n 
1 495  LEU n 
1 496  ARG n 
1 497  GLU n 
1 498  ILE n 
1 499  LEU n 
1 500  GLU n 
1 501  ARG n 
1 502  ARG n 
1 503  GLY n 
1 504  SER n 
1 505  GLY n 
1 506  GLU n 
1 507  LEU n 
1 508  TYR n 
1 509  GLU n 
1 510  HIS n 
1 511  GLU n 
1 512  LYS n 
1 513  ASP n 
1 514  LEU n 
1 515  VAL n 
1 516  TRP n 
1 517  LYS n 
1 518  LEU n 
1 519  ARG n 
1 520  HIS n 
1 521  GLU n 
1 522  VAL n 
1 523  GLN n 
1 524  GLU n 
1 525  HIS n 
1 526  PHE n 
1 527  PRO n 
1 528  GLU n 
1 529  ALA n 
1 530  LEU n 
1 531  ALA n 
1 532  ARG n 
1 533  LEU n 
1 534  LEU n 
1 535  LEU n 
1 536  VAL n 
1 537  THR n 
1 538  LYS n 
1 539  TRP n 
1 540  ASN n 
1 541  LYS n 
1 542  HIS n 
1 543  GLU n 
1 544  ASP n 
1 545  VAL n 
1 546  ALA n 
1 547  GLN n 
1 548  MET n 
1 549  LEU n 
1 550  TYR n 
1 551  LEU n 
1 552  LEU n 
1 553  CYS n 
1 554  SER n 
1 555  TRP n 
1 556  PRO n 
1 557  GLU n 
1 558  LEU n 
1 559  PRO n 
1 560  VAL n 
1 561  LEU n 
1 562  SER n 
1 563  ALA n 
1 564  LEU n 
1 565  GLU n 
1 566  LEU n 
1 567  LEU n 
1 568  ASP n 
1 569  PHE n 
1 570  SER n 
1 571  PHE n 
1 572  PRO n 
1 573  ASP n 
1 574  CYS n 
1 575  HIS n 
1 576  VAL n 
1 577  GLY n 
1 578  SER n 
1 579  PHE n 
1 580  ALA n 
1 581  ILE n 
1 582  LYS n 
1 583  SER n 
1 584  LEU n 
1 585  ARG n 
1 586  LYS n 
1 587  LEU n 
1 588  THR n 
1 589  ASP n 
1 590  ASP n 
1 591  GLU n 
1 592  LEU n 
1 593  PHE n 
1 594  GLN n 
1 595  TYR n 
1 596  LEU n 
1 597  LEU n 
1 598  GLN n 
1 599  LEU n 
1 600  VAL n 
1 601  GLN n 
1 602  VAL n 
1 603  LEU n 
1 604  LYS n 
1 605  TYR n 
1 606  GLU n 
1 607  SER n 
1 608  TYR n 
1 609  LEU n 
1 610  ASP n 
1 611  CYS n 
1 612  GLU n 
1 613  LEU n 
1 614  THR n 
1 615  LYS n 
1 616  PHE n 
1 617  LEU n 
1 618  LEU n 
1 619  ASP n 
1 620  ARG n 
1 621  ALA n 
1 622  LEU n 
1 623  ALA n 
1 624  ASN n 
1 625  ARG n 
1 626  LYS n 
1 627  ILE n 
1 628  GLY n 
1 629  HIS n 
1 630  PHE n 
1 631  LEU n 
1 632  PHE n 
1 633  TRP n 
1 634  HIS n 
1 635  LEU n 
1 636  ARG n 
1 637  SER n 
1 638  GLU n 
1 639  MET n 
1 640  HIS n 
1 641  VAL n 
1 642  PRO n 
1 643  SER n 
1 644  VAL n 
1 645  ALA n 
1 646  LEU n 
1 647  ARG n 
1 648  PHE n 
1 649  GLY n 
1 650  LEU n 
1 651  ILE n 
1 652  LEU n 
1 653  GLU n 
1 654  ALA n 
1 655  TYR n 
1 656  CYS n 
1 657  ARG n 
1 658  GLY n 
1 659  SER n 
1 660  THR n 
1 661  HIS n 
1 662  HIS n 
1 663  MET n 
1 664  LYS n 
1 665  VAL n 
1 666  LEU n 
1 667  MET n 
1 668  LYS n 
1 669  GLN n 
1 670  GLY n 
1 671  GLU n 
1 672  ALA n 
1 673  LEU n 
1 674  SER n 
1 675  LYS n 
1 676  LEU n 
1 677  LYS n 
1 678  ALA n 
1 679  LEU n 
1 680  ASN n 
1 681  ASP n 
1 682  PHE n 
1 683  VAL n 
1 684  LYS n 
1 685  LEU n 
1 686  SER n 
1 687  SER n 
1 688  GLN n 
1 689  LYS n 
1 690  THR n 
1 691  PRO n 
1 692  LYS n 
1 693  PRO n 
1 694  GLN n 
1 695  THR n 
1 696  LYS n 
1 697  GLU n 
1 698  LEU n 
1 699  MET n 
1 700  HIS n 
1 701  LEU n 
1 702  CYS n 
1 703  MET n 
1 704  ARG n 
1 705  GLN n 
1 706  GLU n 
1 707  ALA n 
1 708  TYR n 
1 709  LEU n 
1 710  GLU n 
1 711  ALA n 
1 712  LEU n 
1 713  SER n 
1 714  HIS n 
1 715  LEU n 
1 716  GLN n 
1 717  SER n 
1 718  PRO n 
1 719  LEU n 
1 720  ASP n 
1 721  PRO n 
1 722  SER n 
1 723  THR n 
1 724  LEU n 
1 725  LEU n 
1 726  ALA n 
1 727  GLU n 
1 728  VAL n 
1 729  CYS n 
1 730  VAL n 
1 731  GLU n 
1 732  GLN n 
1 733  CYS n 
1 734  THR n 
1 735  PHE n 
1 736  MET n 
1 737  ASP n 
1 738  SER n 
1 739  LYS n 
1 740  MET n 
1 741  LYS n 
1 742  PRO n 
1 743  LEU n 
1 744  TRP n 
1 745  ILE n 
1 746  MET n 
1 747  TYR n 
1 748  SER n 
1 749  ASN n 
1 750  GLU n 
1 751  GLU n 
1 752  ALA n 
1 753  GLY n 
1 754  SER n 
1 755  GLY n 
1 756  GLY n 
1 757  SER n 
1 758  VAL n 
1 759  GLY n 
1 760  ILE n 
1 761  ILE n 
1 762  PHE n 
1 763  LYS n 
1 764  ASN n 
1 765  GLY n 
1 766  ASP n 
1 767  ASP n 
1 768  LEU n 
1 769  ARG n 
1 770  GLN n 
1 771  ASP n 
1 772  MET n 
1 773  LEU n 
1 774  THR n 
1 775  LEU n 
1 776  GLN n 
1 777  MET n 
1 778  ILE n 
1 779  GLN n 
1 780  LEU n 
1 781  MET n 
1 782  ASP n 
1 783  VAL n 
1 784  LEU n 
1 785  TRP n 
1 786  LYS n 
1 787  GLN n 
1 788  GLU n 
1 789  GLY n 
1 790  LEU n 
1 791  ASP n 
1 792  LEU n 
1 793  ARG n 
1 794  MET n 
1 795  THR n 
1 796  PRO n 
1 797  TYR n 
1 798  GLY n 
1 799  CYS n 
1 800  LEU n 
1 801  PRO n 
1 802  THR n 
1 803  GLY n 
1 804  ASP n 
1 805  ARG n 
1 806  THR n 
1 807  GLY n 
1 808  LEU n 
1 809  ILE n 
1 810  GLU n 
1 811  VAL n 
1 812  VAL n 
1 813  LEU n 
1 814  ARG n 
1 815  SER n 
1 816  ASP n 
1 817  THR n 
1 818  ILE n 
1 819  ALA n 
1 820  ASN n 
1 821  ILE n 
1 822  GLN n 
1 823  LEU n 
1 824  ASN n 
1 825  LYS n 
1 826  SER n 
1 827  ASN n 
1 828  MET n 
1 829  ALA n 
1 830  ALA n 
1 831  THR n 
1 832  ALA n 
1 833  ALA n 
1 834  PHE n 
1 835  ASN n 
1 836  LYS n 
1 837  ASP n 
1 838  ALA n 
1 839  LEU n 
1 840  LEU n 
1 841  ASN n 
1 842  TRP n 
1 843  LEU n 
1 844  LYS n 
1 845  SER n 
1 846  LYS n 
1 847  ASN n 
1 848  PRO n 
1 849  GLY n 
1 850  GLU n 
1 851  ALA n 
1 852  LEU n 
1 853  ASP n 
1 854  ARG n 
1 855  ALA n 
1 856  ILE n 
1 857  GLU n 
1 858  GLU n 
1 859  PHE n 
1 860  THR n 
1 861  LEU n 
1 862  SER n 
1 863  CYS n 
1 864  ALA n 
1 865  GLY n 
1 866  TYR n 
1 867  CYS n 
1 868  VAL n 
1 869  ALA n 
1 870  THR n 
1 871  TYR n 
1 872  VAL n 
1 873  LEU n 
1 874  GLY n 
1 875  ILE n 
1 876  GLY n 
1 877  ASP n 
1 878  ARG n 
1 879  HIS n 
1 880  SER n 
1 881  ASP n 
1 882  ASN n 
1 883  ILE n 
1 884  MET n 
1 885  ILE n 
1 886  ARG n 
1 887  GLU n 
1 888  SER n 
1 889  GLY n 
1 890  GLN n 
1 891  LEU n 
1 892  PHE n 
1 893  HIS n 
1 894  ILE n 
1 895  ASP n 
1 896  PHE n 
1 897  GLY n 
1 898  HIS n 
1 899  PHE n 
1 900  LEU n 
1 901  GLY n 
1 902  ASN n 
1 903  PHE n 
1 904  LYS n 
1 905  THR n 
1 906  LYS n 
1 907  PHE n 
1 908  GLY n 
1 909  ILE n 
1 910  ASN n 
1 911  ARG n 
1 912  GLU n 
1 913  ARG n 
1 914  VAL n 
1 915  PRO n 
1 916  PHE n 
1 917  ILE n 
1 918  LEU n 
1 919  THR n 
1 920  TYR n 
1 921  ASP n 
1 922  PHE n 
1 923  VAL n 
1 924  HIS n 
1 925  VAL n 
1 926  ILE n 
1 927  GLN n 
1 928  GLN n 
1 929  GLY n 
1 930  LYS n 
1 931  THR n 
1 932  ASN n 
1 933  ASN n 
1 934  SER n 
1 935  GLU n 
1 936  LYS n 
1 937  PHE n 
1 938  GLU n 
1 939  ARG n 
1 940  PHE n 
1 941  ARG n 
1 942  GLY n 
1 943  TYR n 
1 944  CYS n 
1 945  GLU n 
1 946  ARG n 
1 947  ALA n 
1 948  TYR n 
1 949  THR n 
1 950  ILE n 
1 951  LEU n 
1 952  ARG n 
1 953  ARG n 
1 954  HIS n 
1 955  GLY n 
1 956  LEU n 
1 957  LEU n 
1 958  PHE n 
1 959  LEU n 
1 960  HIS n 
1 961  LEU n 
1 962  PHE n 
1 963  ALA n 
1 964  LEU n 
1 965  MET n 
1 966  ARG n 
1 967  ALA n 
1 968  ALA n 
1 969  GLY n 
1 970  LEU n 
1 971  PRO n 
1 972  GLU n 
1 973  LEU n 
1 974  SER n 
1 975  CYS n 
1 976  SER n 
1 977  LYS n 
1 978  ASP n 
1 979  ILE n 
1 980  GLN n 
1 981  TYR n 
1 982  LEU n 
1 983  LYS n 
1 984  ASP n 
1 985  SER n 
1 986  LEU n 
1 987  ALA n 
1 988  LEU n 
1 989  GLY n 
1 990  LYS n 
1 991  THR n 
1 992  GLU n 
1 993  GLU n 
1 994  GLU n 
1 995  ALA n 
1 996  LEU n 
1 997  LYS n 
1 998  HIS n 
1 999  PHE n 
1 1000 ARG n 
1 1001 VAL n 
1 1002 LYS n 
1 1003 PHE n 
1 1004 ASN n 
1 1005 GLU n 
1 1006 ALA n 
1 1007 LEU n 
1 1008 ARG n 
1 1009 GLU n 
1 1010 SER n 
1 1011 TRP n 
1 1012 LYS n 
1 1013 THR n 
2 1    TYR n 
2 2    GLN n 
2 3    GLN n 
2 4    ASP n 
2 5    GLN n 
2 6    VAL n 
2 7    VAL n 
2 8    LYS n 
2 9    GLU n 
2 10   ASP n 
2 11   ASN n 
2 12   ILE n 
2 13   GLU n 
2 14   ALA n 
2 15   VAL n 
2 16   GLY n 
2 17   LYS n 
2 18   LYS n 
2 19   LEU n 
2 20   HIS n 
2 21   GLU n 
2 22   TYR n 
2 23   ASN n 
2 24   THR n 
2 25   GLN n 
2 26   PHE n 
2 27   GLN n 
2 28   GLU n 
2 29   LYS n 
2 30   SER n 
2 31   ARG n 
2 32   GLU n 
2 33   TYR n 
2 34   ASP n 
2 35   ARG n 
2 36   LEU n 
2 37   TYR n 
2 38   GLU n 
2 39   ASP n 
2 40   TYR n 
2 41   THR n 
2 42   ARG n 
2 43   THR n 
2 44   SER n 
2 45   GLN n 
2 46   GLU n 
2 47   ILE n 
2 48   GLN n 
2 49   MET n 
2 50   LYS n 
2 51   ARG n 
2 52   THR n 
2 53   ALA n 
2 54   ILE n 
2 55   GLU n 
2 56   ALA n 
2 57   PHE n 
2 58   ASN n 
2 59   GLU n 
2 60   THR n 
2 61   ILE n 
2 62   LYS n 
2 63   ILE n 
2 64   PHE n 
2 65   GLU n 
2 66   GLU n 
2 67   GLN n 
2 68   CYS n 
2 69   GLN n 
2 70   THR n 
2 71   GLN n 
2 72   GLU n 
2 73   ARG n 
2 74   TYR n 
2 75   SER n 
2 76   LYS n 
2 77   GLU n 
2 78   TYR n 
2 79   ILE n 
2 80   GLU n 
2 81   LYS n 
2 82   PHE n 
2 83   LYS n 
2 84   ARG n 
2 85   GLU n 
2 86   GLY n 
2 87   ASN n 
2 88   GLU n 
2 89   THR n 
2 90   GLU n 
2 91   ILE n 
2 92   GLN n 
2 93   ARG n 
2 94   ILE n 
2 95   MET n 
2 96   HIS n 
2 97   ASN n 
2 98   TYR n 
2 99   GLU n 
2 100  LYS n 
2 101  LEU n 
2 102  LYS n 
2 103  SER n 
2 104  ARG n 
2 105  ILE n 
2 106  SER n 
2 107  GLU n 
2 108  ILE n 
2 109  VAL n 
2 110  ASP n 
2 111  SER n 
2 112  ARG n 
2 113  ARG n 
2 114  ARG n 
2 115  LEU n 
2 116  GLU n 
2 117  GLU n 
2 118  ASP n 
2 119  LEU n 
2 120  LYS n 
2 121  LYS n 
2 122  GLN n 
2 123  ALA n 
2 124  ALA n 
2 125  GLU n 
2 126  TYR n 
2 127  ARG n 
2 128  GLU n 
2 129  ILE n 
2 130  ASP n 
2 131  LYS n 
2 132  ARG n 
2 133  MET n 
2 134  ASN n 
2 135  SER n 
2 136  ILE n 
2 137  LYS n 
2 138  PRO n 
2 139  ASP n 
2 140  LEU n 
2 141  ILE n 
2 142  GLN n 
2 143  LEU n 
2 144  ARG n 
2 145  LYS n 
2 146  THR n 
2 147  ARG n 
2 148  ASP n 
2 149  GLN n 
2 150  TYR n 
2 151  LEU n 
2 152  MET n 
2 153  TRP n 
2 154  LEU n 
2 155  THR n 
2 156  GLN n 
2 157  LYS n 
2 158  GLY n 
2 159  VAL n 
2 160  ARG n 
2 161  GLN n 
2 162  LYS n 
2 163  LYS n 
2 164  LEU n 
2 165  ASN n 
2 166  GLU n 
2 167  TRP n 
2 168  LEU n 
2 169  GLY n 
2 170  ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 1013 Human ? PIK3CD         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'unidentified baculovirus' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 170  Human ? 'PIK3R1, GRB1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'unidentified baculovirus' 10469 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PK3CD_HUMAN O00329 ? 1 
;NQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFL
PVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQ
TWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPL
CQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNAD
ERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADC
PIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGR
HSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPV
LSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMH
VPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLD
PSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCL
PTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHS
DNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLH
LFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKT
;
17  
2 UNP P85A_HUMAN  P27986 ? 2 
;YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIE
KFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVR
QKKLNEWLGN
;
431 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5VLR A 1 ? 1013 ? O00329 17  ? 1029 ? 17  1029 
2 2 5VLR B 1 ? 170  ? P27986 431 ? 600  ? 431 600  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 5VLR ASP B 39  ? UNP P27986 GLU 469 'engineered mutation' 469 1 
2 5VLR THR B 89  ? UNP P27986 LYS 519 'engineered mutation' 519 2 
2 5VLR GLU B 99  ? UNP P27986 ASP 529 'engineered mutation' 529 3 
2 5VLR VAL B 109 ? UNP P27986 ILE 539 'engineered mutation' 539 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
9EM non-polymer         . 
;4-acetyl-1-(3-{4-amino-5-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]pyrrolo[2,1-f][1,2,4]triazin-7-yl}phenyl)-3,3-dimethylpiperazin-2-one
;
? 'C25 H25 F3 N8 O2' 526.514 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5VLR 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.60 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;NULL, VAPOR DIFFUSION, TEMPERATURE
 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 1M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-12-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0000 1.0 
2 1.00   1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            89.13 
_reflns.entry_id                         5VLR 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.80 
_reflns.d_resolution_low                 86.39 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       34160 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       0.0 
_reflns.percent_possible_obs             96.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.8 
_reflns.pdbx_Rmerge_I_obs                0.0340 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.27 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.80 
_reflns_shell.d_res_low                   3.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           7593 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                .44 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -14.01350 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][2]                            -10.34500 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            24.35850 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               87.32 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.881 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5VLR 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             46.60 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     34158 
_refine.ls_number_reflns_R_free                  709 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_percent_reflns_R_free                 2.080 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.210 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.392 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.384 
_refine.pdbx_overall_SU_R_Blow_DPI               1.984 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             2.823 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5VLR 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8386 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               8448 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        46.60 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 8599  ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.15  ? 11661 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 2912  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 203   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1295  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 8599  ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 2.52  ? ?     ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 20.74 ? ?     ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1120  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 9825  ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.89 
_refine_ls_shell.number_reflns_all                2973 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_R_work             2910 
_refine_ls_shell.percent_reflns_obs               98.54 
_refine_ls_shell.percent_reflns_R_free            2.12 
_refine_ls_shell.R_factor_all                     0.2526 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3073 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2516 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   17 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5VLR 
_struct.title                        
'CRYSTAL STRUCTURE OF PI3K DELTA IN COMPLEX WITH A TRIFLUORO-ETHYL-PYRAZOL-PYROLOTRIAZINE INHIBITOR' 
_struct.pdbx_descriptor              
;Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform (E.C.2.7.1.153), Phosphatidylinositol 3-kinase regulatory subunit alpha
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5VLR 
_struct_keywords.text            
'LIPID KINASE, INHIBITOR, PI3K DELTA, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX, TRANSFERASE-TRANSFERASE REGULATOR complex' 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE REGULATOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 25  ? GLN A 38   ? ASN A 41   GLN A 54   1 ? 14 
HELX_P HELX_P2  AA2 LEU A 42  ? LEU A 46   ? LEU A 58   LEU A 62   5 ? 5  
HELX_P HELX_P3  AA3 GLY A 48  ? GLU A 50   ? GLY A 64   GLU A 66   5 ? 3  
HELX_P HELX_P4  AA4 ARG A 72  ? GLN A 77   ? ARG A 88   GLN A 93   1 ? 6  
HELX_P HELX_P5  AA5 VAL A 93  ? GLY A 106  ? VAL A 109  GLY A 122  1 ? 14 
HELX_P HELX_P6  AA6 GLY A 108 ? LEU A 115  ? GLY A 124  LEU A 131  1 ? 8  
HELX_P HELX_P7  AA7 ASP A 117 ? LEU A 141  ? ASP A 133  LEU A 157  1 ? 25 
HELX_P HELX_P8  AA8 GLY A 142 ? PHE A 151  ? GLY A 158  PHE A 167  1 ? 10 
HELX_P HELX_P9  AA9 VAL A 196 ? MET A 201  ? VAL A 212  MET A 217  1 ? 6  
HELX_P HELX_P10 AB1 MET A 201 ? THR A 210  ? MET A 217  THR A 226  1 ? 10 
HELX_P HELX_P11 AB2 PRO A 239 ? GLN A 242  ? PRO A 255  GLN A 258  5 ? 4  
HELX_P HELX_P12 AB3 PHE A 243 ? GLY A 253  ? PHE A 259  GLY A 269  1 ? 11 
HELX_P HELX_P13 AB4 HIS A 262 ? ASP A 271  ? HIS A 278  ASP A 287  1 ? 10 
HELX_P HELX_P14 AB5 CYS A 366 ? LEU A 368  ? CYS A 382  LEU A 384  5 ? 3  
HELX_P HELX_P15 AB6 ALA A 471 ? ARG A 480  ? ALA A 487  ARG A 496  1 ? 10 
HELX_P HELX_P16 AB7 GLU A 489 ? GLU A 497  ? GLU A 505  GLU A 513  1 ? 9  
HELX_P HELX_P17 AB8 TYR A 508 ? LEU A 518  ? TYR A 524  LEU A 534  1 ? 11 
HELX_P HELX_P18 AB9 LEU A 518 ? PHE A 526  ? LEU A 534  PHE A 542  1 ? 9  
HELX_P HELX_P19 AC1 ALA A 529 ? THR A 537  ? ALA A 545  THR A 553  1 ? 9  
HELX_P HELX_P20 AC2 LYS A 541 ? CYS A 553  ? LYS A 557  CYS A 569  1 ? 13 
HELX_P HELX_P21 AC3 PRO A 559 ? LEU A 566  ? PRO A 575  LEU A 582  1 ? 8  
HELX_P HELX_P22 AC4 ASP A 573 ? ARG A 585  ? ASP A 589  ARG A 601  1 ? 13 
HELX_P HELX_P23 AC5 THR A 588 ? LEU A 603  ? THR A 604  LEU A 619  1 ? 16 
HELX_P HELX_P24 AC6 LYS A 604 ? GLU A 606  ? LYS A 620  GLU A 622  5 ? 3  
HELX_P HELX_P25 AC7 CYS A 611 ? ASN A 624  ? CYS A 627  ASN A 640  1 ? 14 
HELX_P HELX_P26 AC8 ASN A 624 ? SER A 637  ? ASN A 640  SER A 653  1 ? 14 
HELX_P HELX_P27 AC9 VAL A 644 ? SER A 659  ? VAL A 660  SER A 675  1 ? 16 
HELX_P HELX_P28 AD1 SER A 659 ? SER A 687  ? SER A 675  SER A 703  1 ? 29 
HELX_P HELX_P29 AD2 PRO A 691 ? ARG A 704  ? PRO A 707  ARG A 720  1 ? 14 
HELX_P HELX_P30 AD3 GLN A 705 ? LEU A 712  ? GLN A 721  LEU A 728  1 ? 8  
HELX_P HELX_P31 AD4 LEU A 768 ? GLU A 788  ? LEU A 784  GLU A 804  1 ? 21 
HELX_P HELX_P32 AD5 ILE A 818 ? GLN A 822  ? ILE A 834  GLN A 838  1 ? 5  
HELX_P HELX_P33 AD6 ASP A 837 ? ASN A 847  ? ASP A 853  ASN A 863  1 ? 11 
HELX_P HELX_P34 AD7 GLU A 850 ? LEU A 873  ? GLU A 866  LEU A 889  1 ? 24 
HELX_P HELX_P35 AD8 THR A 919 ? GLN A 927  ? THR A 935  GLN A 943  1 ? 9  
HELX_P HELX_P36 AD9 ASN A 933 ? HIS A 954  ? ASN A 949  HIS A 970  1 ? 22 
HELX_P HELX_P37 AE1 HIS A 954 ? ARG A 966  ? HIS A 970  ARG A 982  1 ? 13 
HELX_P HELX_P38 AE2 ALA A 967 ? GLY A 969  ? ALA A 983  GLY A 985  5 ? 3  
HELX_P HELX_P39 AE3 LEU A 970 ? SER A 974  ? LEU A 986  SER A 990  5 ? 5  
HELX_P HELX_P40 AE4 CYS A 975 ? LEU A 986  ? CYS A 991  LEU A 1002 1 ? 12 
HELX_P HELX_P41 AE5 THR A 991 ? THR A 1013 ? THR A 1007 THR A 1029 1 ? 23 
HELX_P HELX_P42 AE6 ASN B 11  ? SER B 75   ? ASN B 441  SER B 505  1 ? 65 
HELX_P HELX_P43 AE7 SER B 75  ? ARG B 84   ? SER B 505  ARG B 514  1 ? 10 
HELX_P HELX_P44 AE8 ASN B 87  ? LYS B 157  ? ASN B 517  LYS B 587  1 ? 71 
HELX_P HELX_P45 AE9 ARG B 160 ? GLY B 169  ? ARG B 590  GLY B 599  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
AA9 ? 5 ? 
AB1 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 15  ? SER A 21  ? TYR A 31  SER A 37  
AA1 2 SER A 3   ? LEU A 9   ? SER A 19  LEU A 25  
AA1 3 VAL A 82  ? ALA A 87  ? VAL A 98  ALA A 103 
AA1 4 TYR A 52  ? ILE A 57  ? TYR A 68  ILE A 73  
AA1 5 GLN A 63  ? LEU A 66  ? GLN A 79  LEU A 82  
AA2 1 ALA A 173 ? VAL A 178 ? ALA A 189 VAL A 194 
AA2 2 PHE A 187 ? SER A 192 ? PHE A 203 SER A 208 
AA3 1 TYR A 233 ? LEU A 234 ? TYR A 249 LEU A 250 
AA3 2 THR A 224 ? GLN A 226 ? THR A 240 GLN A 242 
AA3 3 MET A 260 ? VAL A 261 ? MET A 276 VAL A 277 
AA4 1 VAL A 354 ? ASN A 364 ? VAL A 370 ASN A 380 
AA4 2 PRO A 306 ? SER A 315 ? PRO A 322 SER A 331 
AA4 3 ALA A 454 ? LEU A 459 ? ALA A 470 LEU A 475 
AA4 4 GLY A 419 ? TYR A 424 ? GLY A 435 TYR A 440 
AA5 1 GLU A 336 ? MET A 337 ? GLU A 352 MET A 353 
AA5 2 LYS A 324 ? HIS A 333 ? LYS A 340 HIS A 349 
AA5 3 VAL A 347 ? SER A 348 ? VAL A 363 SER A 364 
AA6 1 GLU A 336 ? MET A 337 ? GLU A 352 MET A 353 
AA6 2 LYS A 324 ? HIS A 333 ? LYS A 340 HIS A 349 
AA6 3 ARG A 373 ? VAL A 381 ? ARG A 389 VAL A 397 
AA6 4 CYS A 400 ? MET A 408 ? CYS A 416 MET A 424 
AA6 5 TRP A 426 ? PRO A 427 ? TRP A 442 PRO A 443 
AA7 1 LEU A 715 ? GLN A 716 ? LEU A 731 GLN A 732 
AA7 2 LEU A 724 ? LEU A 725 ? LEU A 740 LEU A 741 
AA8 1 GLU A 727 ? VAL A 728 ? GLU A 743 VAL A 744 
AA8 2 LEU A 743 ? SER A 748 ? LEU A 759 SER A 764 
AA8 3 THR A 734 ? PHE A 735 ? THR A 750 PHE A 751 
AA9 1 GLU A 727 ? VAL A 728 ? GLU A 743 VAL A 744 
AA9 2 LEU A 743 ? SER A 748 ? LEU A 759 SER A 764 
AA9 3 VAL A 758 ? ASN A 764 ? VAL A 774 ASN A 780 
AA9 4 THR A 806 ? GLU A 810 ? THR A 822 GLU A 826 
AA9 5 CYS A 799 ? GLY A 803 ? CYS A 815 GLY A 819 
AB1 1 SER A 815 ? THR A 817 ? SER A 831 THR A 833 
AB1 2 ILE A 883 ? ARG A 886 ? ILE A 899 ARG A 902 
AB1 3 LEU A 891 ? HIS A 893 ? LEU A 907 HIS A 909 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 20  ? O VAL A 36  N VAL A 4   ? N VAL A 20  
AA1 2 3 N ASP A 7   ? N ASP A 23  O LEU A 83  ? O LEU A 99  
AA1 3 4 O VAL A 86  ? O VAL A 102 N VAL A 53  ? N VAL A 69  
AA1 4 5 N PHE A 54  ? N PHE A 70  O LEU A 66  ? O LEU A 82  
AA2 1 2 N VAL A 178 ? N VAL A 194 O PHE A 187 ? O PHE A 203 
AA3 1 2 O LEU A 234 ? O LEU A 250 N LEU A 225 ? N LEU A 241 
AA3 2 3 N THR A 224 ? N THR A 240 O VAL A 261 ? O VAL A 277 
AA4 1 2 O TRP A 355 ? O TRP A 371 N ILE A 312 ? N ILE A 328 
AA4 2 3 N GLN A 313 ? N GLN A 329 O LEU A 456 ? O LEU A 472 
AA4 3 4 O ILE A 457 ? O ILE A 473 N ARG A 421 ? N ARG A 437 
AA5 1 2 O GLU A 336 ? O GLU A 352 N HIS A 333 ? N HIS A 349 
AA5 2 3 N LEU A 325 ? N LEU A 341 O VAL A 347 ? O VAL A 363 
AA6 1 2 O GLU A 336 ? O GLU A 352 N HIS A 333 ? N HIS A 349 
AA6 2 3 N VAL A 326 ? N VAL A 342 O TYR A 379 ? O TYR A 395 
AA6 3 4 N LEU A 374 ? N LEU A 390 O LEU A 407 ? O LEU A 423 
AA6 4 5 N TRP A 404 ? N TRP A 420 O TRP A 426 ? O TRP A 442 
AA7 1 2 N LEU A 715 ? N LEU A 731 O LEU A 725 ? O LEU A 741 
AA8 1 2 N GLU A 727 ? N GLU A 743 O SER A 748 ? O SER A 764 
AA8 2 3 O TRP A 744 ? O TRP A 760 N THR A 734 ? N THR A 750 
AA9 1 2 N GLU A 727 ? N GLU A 743 O SER A 748 ? O SER A 764 
AA9 2 3 N ILE A 745 ? N ILE A 761 O ILE A 760 ? O ILE A 776 
AA9 3 4 N LYS A 763 ? N LYS A 779 O GLY A 807 ? O GLY A 823 
AA9 4 5 O LEU A 808 ? O LEU A 824 N LEU A 800 ? N LEU A 816 
AB1 1 2 N ASP A 816 ? N ASP A 832 O ILE A 885 ? O ILE A 901 
AB1 2 3 N MET A 884 ? N MET A 900 O PHE A 892 ? O PHE A 908 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    9EM 
_struct_site.pdbx_auth_seq_id     4001 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'binding site for residue 9EM A 4001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 THR A 734 ? THR A 750 . ? 1_555 ? 
2  AC1 15 PHE A 735 ? PHE A 751 . ? 1_555 ? 
3  AC1 15 MET A 736 ? MET A 752 . ? 1_555 ? 
4  AC1 15 PRO A 742 ? PRO A 758 . ? 1_555 ? 
5  AC1 15 TRP A 744 ? TRP A 760 . ? 1_555 ? 
6  AC1 15 ILE A 761 ? ILE A 777 . ? 1_555 ? 
7  AC1 15 LYS A 763 ? LYS A 779 . ? 1_555 ? 
8  AC1 15 TYR A 797 ? TYR A 813 . ? 1_555 ? 
9  AC1 15 ILE A 809 ? ILE A 825 . ? 1_555 ? 
10 AC1 15 GLU A 810 ? GLU A 826 . ? 1_555 ? 
11 AC1 15 VAL A 812 ? VAL A 828 . ? 1_555 ? 
12 AC1 15 THR A 817 ? THR A 833 . ? 1_555 ? 
13 AC1 15 MET A 884 ? MET A 900 . ? 1_555 ? 
14 AC1 15 ILE A 894 ? ILE A 910 . ? 1_555 ? 
15 AC1 15 ASP A 895 ? ASP A 911 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5VLR 
_atom_sites.fract_transf_matrix[1][1]   0.011008 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009210 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007006 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 1    ? 54.861  6.892   0.913   1.00 100.66 ? 17   ASN A N   1 
ATOM   2    C CA  . ASN A 1 1    ? 54.958  7.869   2.001   1.00 101.04 ? 17   ASN A CA  1 
ATOM   3    C C   . ASN A 1 1    ? 53.961  9.061   1.835   1.00 105.04 ? 17   ASN A C   1 
ATOM   4    O O   . ASN A 1 1    ? 52.758  8.819   1.658   1.00 105.60 ? 17   ASN A O   1 
ATOM   5    C CB  . ASN A 1 1    ? 56.414  8.338   2.186   1.00 102.48 ? 17   ASN A CB  1 
ATOM   6    N N   . GLN A 1 2    ? 54.456  10.331  1.917   1.00 99.46  ? 18   GLN A N   1 
ATOM   7    C CA  . GLN A 1 2    ? 53.667  11.567  1.772   1.00 97.75  ? 18   GLN A CA  1 
ATOM   8    C C   . GLN A 1 2    ? 53.089  11.713  0.346   1.00 96.82  ? 18   GLN A C   1 
ATOM   9    O O   . GLN A 1 2    ? 51.908  12.026  0.201   1.00 97.06  ? 18   GLN A O   1 
ATOM   10   C CB  . GLN A 1 2    ? 54.508  12.800  2.157   1.00 99.17  ? 18   GLN A CB  1 
ATOM   11   N N   . SER A 1 3    ? 53.917  11.454  -0.694  1.00 88.31  ? 19   SER A N   1 
ATOM   12   C CA  . SER A 1 3    ? 53.526  11.502  -2.107  1.00 85.41  ? 19   SER A CA  1 
ATOM   13   C C   . SER A 1 3    ? 52.627  10.328  -2.526  1.00 84.41  ? 19   SER A C   1 
ATOM   14   O O   . SER A 1 3    ? 52.647  9.266   -1.891  1.00 83.86  ? 19   SER A O   1 
ATOM   15   C CB  . SER A 1 3    ? 54.752  11.565  -3.009  1.00 87.64  ? 19   SER A CB  1 
ATOM   16   O OG  . SER A 1 3    ? 54.865  12.838  -3.618  1.00 94.05  ? 19   SER A OG  1 
ATOM   17   N N   . VAL A 1 4    ? 51.844  10.542  -3.617  1.00 76.54  ? 20   VAL A N   1 
ATOM   18   C CA  . VAL A 1 4    ? 50.880  9.617   -4.224  1.00 73.26  ? 20   VAL A CA  1 
ATOM   19   C C   . VAL A 1 4    ? 50.755  9.878   -5.736  1.00 73.32  ? 20   VAL A C   1 
ATOM   20   O O   . VAL A 1 4    ? 50.651  11.035  -6.169  1.00 70.99  ? 20   VAL A O   1 
ATOM   21   C CB  . VAL A 1 4    ? 49.506  9.595   -3.482  1.00 75.66  ? 20   VAL A CB  1 
ATOM   22   C CG1 . VAL A 1 4    ? 48.867  10.979  -3.387  1.00 74.85  ? 20   VAL A CG1 1 
ATOM   23   C CG2 . VAL A 1 4    ? 48.547  8.589   -4.102  1.00 75.41  ? 20   VAL A CG2 1 
ATOM   24   N N   . VAL A 1 5    ? 50.788  8.776   -6.530  1.00 67.45  ? 21   VAL A N   1 
ATOM   25   C CA  . VAL A 1 5    ? 50.679  8.806   -7.991  1.00 64.77  ? 21   VAL A CA  1 
ATOM   26   C C   . VAL A 1 5    ? 49.214  9.008   -8.399  1.00 67.75  ? 21   VAL A C   1 
ATOM   27   O O   . VAL A 1 5    ? 48.340  8.188   -8.060  1.00 67.59  ? 21   VAL A O   1 
ATOM   28   C CB  . VAL A 1 5    ? 51.339  7.574   -8.651  1.00 66.44  ? 21   VAL A CB  1 
ATOM   29   C CG1 . VAL A 1 5    ? 51.131  7.581   -10.161 1.00 65.93  ? 21   VAL A CG1 1 
ATOM   30   C CG2 . VAL A 1 5    ? 52.820  7.501   -8.312  1.00 65.45  ? 21   VAL A CG2 1 
ATOM   31   N N   . VAL A 1 6    ? 48.960  10.125  -9.115  1.00 62.74  ? 22   VAL A N   1 
ATOM   32   C CA  . VAL A 1 6    ? 47.642  10.571  -9.575  1.00 60.95  ? 22   VAL A CA  1 
ATOM   33   C C   . VAL A 1 6    ? 47.508  10.446  -11.094 1.00 66.19  ? 22   VAL A C   1 
ATOM   34   O O   . VAL A 1 6    ? 48.428  10.796  -11.852 1.00 66.95  ? 22   VAL A O   1 
ATOM   35   C CB  . VAL A 1 6    ? 47.331  12.011  -9.089  1.00 63.58  ? 22   VAL A CB  1 
ATOM   36   C CG1 . VAL A 1 6    ? 45.883  12.421  -9.405  1.00 63.74  ? 22   VAL A CG1 1 
ATOM   37   C CG2 . VAL A 1 6    ? 47.635  12.181  -7.601  1.00 62.71  ? 22   VAL A CG2 1 
ATOM   38   N N   . ASP A 1 7    ? 46.348  9.935   -11.529 1.00 61.58  ? 23   ASP A N   1 
ATOM   39   C CA  . ASP A 1 7    ? 45.982  9.798   -12.930 1.00 60.16  ? 23   ASP A CA  1 
ATOM   40   C C   . ASP A 1 7    ? 45.244  11.055  -13.239 1.00 61.37  ? 23   ASP A C   1 
ATOM   41   O O   . ASP A 1 7    ? 44.417  11.491  -12.435 1.00 58.97  ? 23   ASP A O   1 
ATOM   42   C CB  . ASP A 1 7    ? 45.031  8.618   -13.133 1.00 61.97  ? 23   ASP A CB  1 
ATOM   43   C CG  . ASP A 1 7    ? 45.623  7.304   -12.723 1.00 72.28  ? 23   ASP A CG  1 
ATOM   44   O OD1 . ASP A 1 7    ? 46.689  6.942   -13.263 1.00 72.32  ? 23   ASP A OD1 1 
ATOM   45   O OD2 . ASP A 1 7    ? 45.044  6.649   -11.836 1.00 79.26  ? 23   ASP A OD2 1 
ATOM   46   N N   . PHE A 1 8    ? 45.544  11.653  -14.395 1.00 58.05  ? 24   PHE A N   1 
ATOM   47   C CA  . PHE A 1 8    ? 44.898  12.884  -14.844 1.00 57.05  ? 24   PHE A CA  1 
ATOM   48   C C   . PHE A 1 8    ? 44.329  12.622  -16.202 1.00 64.18  ? 24   PHE A C   1 
ATOM   49   O O   . PHE A 1 8    ? 44.999  12.031  -17.048 1.00 65.20  ? 24   PHE A O   1 
ATOM   50   C CB  . PHE A 1 8    ? 45.863  14.060  -14.872 1.00 57.37  ? 24   PHE A CB  1 
ATOM   51   C CG  . PHE A 1 8    ? 46.428  14.418  -13.525 1.00 57.84  ? 24   PHE A CG  1 
ATOM   52   C CD1 . PHE A 1 8    ? 47.598  13.837  -13.070 1.00 60.62  ? 24   PHE A CD1 1 
ATOM   53   C CD2 . PHE A 1 8    ? 45.814  15.371  -12.729 1.00 60.66  ? 24   PHE A CD2 1 
ATOM   54   C CE1 . PHE A 1 8    ? 48.127  14.178  -11.827 1.00 61.88  ? 24   PHE A CE1 1 
ATOM   55   C CE2 . PHE A 1 8    ? 46.342  15.711  -11.487 1.00 63.25  ? 24   PHE A CE2 1 
ATOM   56   C CZ  . PHE A 1 8    ? 47.512  15.131  -11.055 1.00 61.23  ? 24   PHE A CZ  1 
ATOM   57   N N   . LEU A 1 9    ? 43.061  12.976  -16.388 1.00 60.92  ? 25   LEU A N   1 
ATOM   58   C CA  . LEU A 1 9    ? 42.381  12.728  -17.647 1.00 60.43  ? 25   LEU A CA  1 
ATOM   59   C C   . LEU A 1 9    ? 42.005  14.081  -18.217 1.00 63.54  ? 25   LEU A C   1 
ATOM   60   O O   . LEU A 1 9    ? 41.215  14.813  -17.588 1.00 63.43  ? 25   LEU A O   1 
ATOM   61   C CB  . LEU A 1 9    ? 41.140  11.831  -17.439 1.00 60.35  ? 25   LEU A CB  1 
ATOM   62   C CG  . LEU A 1 9    ? 41.250  10.591  -16.536 1.00 64.37  ? 25   LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 9    ? 39.983  9.787   -16.603 1.00 64.01  ? 25   LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 9    ? 42.416  9.691   -16.929 1.00 68.08  ? 25   LEU A CD2 1 
ATOM   65   N N   . LEU A 1 10   ? 42.651  14.447  -19.361 1.00 57.28  ? 26   LEU A N   1 
ATOM   66   C CA  . LEU A 1 10   ? 42.468  15.749  -20.019 1.00 54.93  ? 26   LEU A CA  1 
ATOM   67   C C   . LEU A 1 10   ? 41.360  15.695  -21.040 1.00 54.43  ? 26   LEU A C   1 
ATOM   68   O O   . LEU A 1 10   ? 41.117  14.626  -21.626 1.00 52.15  ? 26   LEU A O   1 
ATOM   69   C CB  . LEU A 1 10   ? 43.776  16.333  -20.599 1.00 54.98  ? 26   LEU A CB  1 
ATOM   70   C CG  . LEU A 1 10   ? 45.067  16.131  -19.784 1.00 59.14  ? 26   LEU A CG  1 
ATOM   71   C CD1 . LEU A 1 10   ? 46.223  16.429  -20.600 1.00 59.63  ? 26   LEU A CD1 1 
ATOM   72   C CD2 . LEU A 1 10   ? 45.119  16.992  -18.552 1.00 59.29  ? 26   LEU A CD2 1 
ATOM   73   N N   . PRO A 1 11   ? 40.665  16.846  -21.249 1.00 50.22  ? 27   PRO A N   1 
ATOM   74   C CA  . PRO A 1 11   ? 39.473  16.850  -22.112 1.00 50.25  ? 27   PRO A CA  1 
ATOM   75   C C   . PRO A 1 11   ? 39.695  16.522  -23.583 1.00 60.13  ? 27   PRO A C   1 
ATOM   76   O O   . PRO A 1 11   ? 38.737  16.362  -24.333 1.00 63.10  ? 27   PRO A O   1 
ATOM   77   C CB  . PRO A 1 11   ? 38.886  18.255  -21.909 1.00 51.40  ? 27   PRO A CB  1 
ATOM   78   C CG  . PRO A 1 11   ? 39.939  19.065  -21.330 1.00 55.17  ? 27   PRO A CG  1 
ATOM   79   C CD  . PRO A 1 11   ? 40.834  18.149  -20.573 1.00 51.24  ? 27   PRO A CD  1 
ATOM   80   N N   . THR A 1 12   ? 40.941  16.392  -23.996 1.00 58.39  ? 28   THR A N   1 
ATOM   81   C CA  . THR A 1 12   ? 41.304  16.032  -25.366 1.00 58.22  ? 28   THR A CA  1 
ATOM   82   C C   . THR A 1 12   ? 41.417  14.502  -25.472 1.00 63.32  ? 28   THR A C   1 
ATOM   83   O O   . THR A 1 12   ? 41.653  13.975  -26.561 1.00 64.23  ? 28   THR A O   1 
ATOM   84   C CB  . THR A 1 12   ? 42.618  16.723  -25.718 1.00 60.78  ? 28   THR A CB  1 
ATOM   85   O OG1 . THR A 1 12   ? 43.649  16.185  -24.884 1.00 60.45  ? 28   THR A OG1 1 
ATOM   86   C CG2 . THR A 1 12   ? 42.538  18.248  -25.547 1.00 57.18  ? 28   THR A CG2 1 
ATOM   87   N N   . GLY A 1 13   ? 41.243  13.814  -24.337 1.00 58.50  ? 29   GLY A N   1 
ATOM   88   C CA  . GLY A 1 13   ? 41.370  12.369  -24.234 1.00 57.31  ? 29   GLY A CA  1 
ATOM   89   C C   . GLY A 1 13   ? 42.774  11.981  -23.813 1.00 60.39  ? 29   GLY A C   1 
ATOM   90   O O   . GLY A 1 13   ? 43.049  10.799  -23.602 1.00 59.56  ? 29   GLY A O   1 
ATOM   91   N N   . VAL A 1 14   ? 43.679  12.980  -23.670 1.00 57.11  ? 30   VAL A N   1 
ATOM   92   C CA  . VAL A 1 14   ? 45.073  12.758  -23.253 1.00 56.37  ? 30   VAL A CA  1 
ATOM   93   C C   . VAL A 1 14   ? 45.093  12.354  -21.778 1.00 59.69  ? 30   VAL A C   1 
ATOM   94   O O   . VAL A 1 14   ? 44.246  12.772  -20.984 1.00 58.71  ? 30   VAL A O   1 
ATOM   95   C CB  . VAL A 1 14   ? 46.071  13.918  -23.625 1.00 59.21  ? 30   VAL A CB  1 
ATOM   96   C CG1 . VAL A 1 14   ? 47.471  13.708  -23.020 1.00 58.22  ? 30   VAL A CG1 1 
ATOM   97   C CG2 . VAL A 1 14   ? 46.169  14.083  -25.144 1.00 58.51  ? 30   VAL A CG2 1 
ATOM   98   N N   . TYR A 1 15   ? 46.047  11.487  -21.456 1.00 56.84  ? 31   TYR A N   1 
ATOM   99   C CA  . TYR A 1 15   ? 46.238  10.887  -20.164 1.00 56.62  ? 31   TYR A CA  1 
ATOM   100  C C   . TYR A 1 15   ? 47.684  11.064  -19.655 1.00 63.99  ? 31   TYR A C   1 
ATOM   101  O O   . TYR A 1 15   ? 48.648  10.685  -20.318 1.00 64.89  ? 31   TYR A O   1 
ATOM   102  C CB  . TYR A 1 15   ? 45.834  9.420   -20.271 1.00 57.14  ? 31   TYR A CB  1 
ATOM   103  C CG  . TYR A 1 15   ? 46.287  8.606   -19.093 1.00 58.08  ? 31   TYR A CG  1 
ATOM   104  C CD1 . TYR A 1 15   ? 45.734  8.806   -17.830 1.00 58.52  ? 31   TYR A CD1 1 
ATOM   105  C CD2 . TYR A 1 15   ? 47.257  7.619   -19.237 1.00 58.55  ? 31   TYR A CD2 1 
ATOM   106  C CE1 . TYR A 1 15   ? 46.164  8.073   -16.732 1.00 56.11  ? 31   TYR A CE1 1 
ATOM   107  C CE2 . TYR A 1 15   ? 47.657  6.846   -18.151 1.00 59.05  ? 31   TYR A CE2 1 
ATOM   108  C CZ  . TYR A 1 15   ? 47.128  7.101   -16.896 1.00 59.26  ? 31   TYR A CZ  1 
ATOM   109  O OH  . TYR A 1 15   ? 47.552  6.399   -15.808 1.00 61.83  ? 31   TYR A OH  1 
ATOM   110  N N   . LEU A 1 16   ? 47.802  11.639  -18.463 1.00 62.14  ? 32   LEU A N   1 
ATOM   111  C CA  . LEU A 1 16   ? 49.024  11.966  -17.736 1.00 62.96  ? 32   LEU A CA  1 
ATOM   112  C C   . LEU A 1 16   ? 48.976  11.279  -16.378 1.00 66.91  ? 32   LEU A C   1 
ATOM   113  O O   . LEU A 1 16   ? 47.936  11.273  -15.709 1.00 65.63  ? 32   LEU A O   1 
ATOM   114  C CB  . LEU A 1 16   ? 49.046  13.479  -17.463 1.00 63.70  ? 32   LEU A CB  1 
ATOM   115  C CG  . LEU A 1 16   ? 49.992  14.291  -18.271 1.00 69.48  ? 32   LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 16   ? 49.244  15.244  -19.125 1.00 70.23  ? 32   LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 16   ? 50.890  15.064  -17.382 1.00 72.55  ? 32   LEU A CD2 1 
ATOM   118  N N   . ASN A 1 17   ? 50.125  10.810  -15.918 1.00 63.91  ? 33   ASN A N   1 
ATOM   119  C CA  . ASN A 1 17   ? 50.210  10.147  -14.627 1.00 63.65  ? 33   ASN A CA  1 
ATOM   120  C C   . ASN A 1 17   ? 51.543  10.550  -13.969 1.00 68.79  ? 33   ASN A C   1 
ATOM   121  O O   . ASN A 1 17   ? 52.605  10.196  -14.489 1.00 71.54  ? 33   ASN A O   1 
ATOM   122  C CB  . ASN A 1 17   ? 50.057  8.630   -14.877 1.00 62.02  ? 33   ASN A CB  1 
ATOM   123  C CG  . ASN A 1 17   ? 50.736  7.691   -13.929 1.00 83.14  ? 33   ASN A CG  1 
ATOM   124  O OD1 . ASN A 1 17   ? 50.115  7.155   -13.009 1.00 79.54  ? 33   ASN A OD1 1 
ATOM   125  N ND2 . ASN A 1 17   ? 51.986  7.358   -14.229 1.00 78.40  ? 33   ASN A ND2 1 
ATOM   126  N N   . PHE A 1 18   ? 51.502  11.351  -12.883 1.00 62.38  ? 34   PHE A N   1 
ATOM   127  C CA  . PHE A 1 18   ? 52.734  11.762  -12.185 1.00 60.67  ? 34   PHE A CA  1 
ATOM   128  C C   . PHE A 1 18   ? 52.556  11.831  -10.652 1.00 65.26  ? 34   PHE A C   1 
ATOM   129  O O   . PHE A 1 18   ? 51.414  11.955  -10.198 1.00 63.05  ? 34   PHE A O   1 
ATOM   130  C CB  . PHE A 1 18   ? 53.291  13.075  -12.758 1.00 61.22  ? 34   PHE A CB  1 
ATOM   131  C CG  . PHE A 1 18   ? 52.333  14.238  -12.714 1.00 61.91  ? 34   PHE A CG  1 
ATOM   132  C CD1 . PHE A 1 18   ? 52.294  15.087  -11.616 1.00 64.58  ? 34   PHE A CD1 1 
ATOM   133  C CD2 . PHE A 1 18   ? 51.506  14.519  -13.793 1.00 63.53  ? 34   PHE A CD2 1 
ATOM   134  C CE1 . PHE A 1 18   ? 51.397  16.165  -11.576 1.00 65.49  ? 34   PHE A CE1 1 
ATOM   135  C CE2 . PHE A 1 18   ? 50.629  15.610  -13.760 1.00 66.18  ? 34   PHE A CE2 1 
ATOM   136  C CZ  . PHE A 1 18   ? 50.577  16.420  -12.650 1.00 64.02  ? 34   PHE A CZ  1 
ATOM   137  N N   . PRO A 1 19   ? 53.645  11.795  -9.826  1.00 64.13  ? 35   PRO A N   1 
ATOM   138  C CA  . PRO A 1 19   ? 53.449  11.883  -8.358  1.00 63.77  ? 35   PRO A CA  1 
ATOM   139  C C   . PRO A 1 19   ? 53.336  13.304  -7.832  1.00 69.65  ? 35   PRO A C   1 
ATOM   140  O O   . PRO A 1 19   ? 54.028  14.223  -8.314  1.00 69.88  ? 35   PRO A O   1 
ATOM   141  C CB  . PRO A 1 19   ? 54.689  11.205  -7.793  1.00 64.62  ? 35   PRO A CB  1 
ATOM   142  C CG  . PRO A 1 19   ? 55.738  11.413  -8.836  1.00 68.95  ? 35   PRO A CG  1 
ATOM   143  C CD  . PRO A 1 19   ? 55.082  11.677  -10.164 1.00 64.92  ? 35   PRO A CD  1 
ATOM   144  N N   . VAL A 1 20   ? 52.454  13.471  -6.832  1.00 66.41  ? 36   VAL A N   1 
ATOM   145  C CA  . VAL A 1 20   ? 52.210  14.720  -6.099  1.00 66.42  ? 36   VAL A CA  1 
ATOM   146  C C   . VAL A 1 20   ? 52.081  14.371  -4.634  1.00 74.04  ? 36   VAL A C   1 
ATOM   147  O O   . VAL A 1 20   ? 51.825  13.215  -4.317  1.00 72.52  ? 36   VAL A O   1 
ATOM   148  C CB  . VAL A 1 20   ? 50.996  15.541  -6.601  1.00 69.82  ? 36   VAL A CB  1 
ATOM   149  C CG1 . VAL A 1 20   ? 51.058  15.775  -8.107  1.00 69.76  ? 36   VAL A CG1 1 
ATOM   150  C CG2 . VAL A 1 20   ? 49.670  14.901  -6.209  1.00 69.39  ? 36   VAL A CG2 1 
ATOM   151  N N   . SER A 1 21   ? 52.237  15.353  -3.739  1.00 75.83  ? 37   SER A N   1 
ATOM   152  C CA  . SER A 1 21   ? 52.128  15.100  -2.304  1.00 77.41  ? 37   SER A CA  1 
ATOM   153  C C   . SER A 1 21   ? 50.684  15.096  -1.879  1.00 83.07  ? 37   SER A C   1 
ATOM   154  O O   . SER A 1 21   ? 49.890  15.896  -2.397  1.00 81.90  ? 37   SER A O   1 
ATOM   155  C CB  . SER A 1 21   ? 52.915  16.125  -1.488  1.00 82.57  ? 37   SER A CB  1 
ATOM   156  O OG  . SER A 1 21   ? 52.925  15.782  -0.107  1.00 96.29  ? 37   SER A OG  1 
ATOM   157  N N   . ARG A 1 22   ? 50.358  14.223  -0.892  1.00 81.29  ? 38   ARG A N   1 
ATOM   158  C CA  . ARG A 1 22   ? 49.013  14.097  -0.330  1.00 81.79  ? 38   ARG A CA  1 
ATOM   159  C C   . ARG A 1 22   ? 48.508  15.393  0.345   1.00 87.17  ? 38   ARG A C   1 
ATOM   160  O O   . ARG A 1 22   ? 47.299  15.553  0.473   1.00 87.79  ? 38   ARG A O   1 
ATOM   161  C CB  . ARG A 1 22   ? 48.906  12.888  0.613   1.00 81.50  ? 38   ARG A CB  1 
ATOM   162  N N   . ASN A 1 23   ? 49.418  16.330  0.714   1.00 83.59  ? 39   ASN A N   1 
ATOM   163  C CA  . ASN A 1 23   ? 49.086  17.610  1.364   1.00 83.46  ? 39   ASN A CA  1 
ATOM   164  C C   . ASN A 1 23   ? 48.957  18.767  0.356   1.00 85.37  ? 39   ASN A C   1 
ATOM   165  O O   . ASN A 1 23   ? 48.706  19.914  0.756   1.00 85.23  ? 39   ASN A O   1 
ATOM   166  C CB  . ASN A 1 23   ? 50.143  17.961  2.454   1.00 87.81  ? 39   ASN A CB  1 
ATOM   167  C CG  . ASN A 1 23   ? 49.977  17.247  3.785   1.00 119.24 ? 39   ASN A CG  1 
ATOM   168  O OD1 . ASN A 1 23   ? 49.768  17.881  4.834   1.00 116.26 ? 39   ASN A OD1 1 
ATOM   169  N ND2 . ASN A 1 23   ? 50.097  15.915  3.788   1.00 110.66 ? 39   ASN A ND2 1 
ATOM   170  N N   . ALA A 1 24   ? 49.151  18.484  -0.940  1.00 79.46  ? 40   ALA A N   1 
ATOM   171  C CA  . ALA A 1 24   ? 49.074  19.534  -1.956  1.00 77.77  ? 40   ALA A CA  1 
ATOM   172  C C   . ALA A 1 24   ? 47.640  19.955  -2.173  1.00 77.35  ? 40   ALA A C   1 
ATOM   173  O O   . ALA A 1 24   ? 46.759  19.095  -2.247  1.00 76.35  ? 40   ALA A O   1 
ATOM   174  C CB  . ALA A 1 24   ? 49.691  19.057  -3.264  1.00 78.35  ? 40   ALA A CB  1 
ATOM   175  N N   . ASN A 1 25   ? 47.391  21.270  -2.264  1.00 71.16  ? 41   ASN A N   1 
ATOM   176  C CA  . ASN A 1 25   ? 46.032  21.712  -2.511  1.00 69.64  ? 41   ASN A CA  1 
ATOM   177  C C   . ASN A 1 25   ? 45.716  21.548  -3.998  1.00 72.86  ? 41   ASN A C   1 
ATOM   178  O O   . ASN A 1 25   ? 46.633  21.385  -4.810  1.00 72.36  ? 41   ASN A O   1 
ATOM   179  C CB  . ASN A 1 25   ? 45.721  23.090  -1.916  1.00 68.15  ? 41   ASN A CB  1 
ATOM   180  C CG  . ASN A 1 25   ? 46.117  24.319  -2.680  1.00 91.84  ? 41   ASN A CG  1 
ATOM   181  O OD1 . ASN A 1 25   ? 47.074  24.338  -3.448  1.00 94.42  ? 41   ASN A OD1 1 
ATOM   182  N ND2 . ASN A 1 25   ? 45.441  25.418  -2.390  1.00 79.22  ? 41   ASN A ND2 1 
ATOM   183  N N   . LEU A 1 26   ? 44.434  21.458  -4.344  1.00 69.46  ? 42   LEU A N   1 
ATOM   184  C CA  . LEU A 1 26   ? 44.050  21.153  -5.716  1.00 69.79  ? 42   LEU A CA  1 
ATOM   185  C C   . LEU A 1 26   ? 44.509  22.229  -6.692  1.00 75.35  ? 42   LEU A C   1 
ATOM   186  O O   . LEU A 1 26   ? 44.929  21.882  -7.799  1.00 75.85  ? 42   LEU A O   1 
ATOM   187  C CB  . LEU A 1 26   ? 42.556  20.811  -5.848  1.00 69.42  ? 42   LEU A CB  1 
ATOM   188  C CG  . LEU A 1 26   ? 42.218  19.332  -5.583  1.00 72.23  ? 42   LEU A CG  1 
ATOM   189  N N   . SER A 1 27   ? 44.566  23.498  -6.237  1.00 71.63  ? 43   SER A N   1 
ATOM   190  C CA  . SER A 1 27   ? 45.066  24.628  -7.016  1.00 71.15  ? 43   SER A CA  1 
ATOM   191  C C   . SER A 1 27   ? 46.524  24.383  -7.429  1.00 76.42  ? 43   SER A C   1 
ATOM   192  O O   . SER A 1 27   ? 46.892  24.623  -8.576  1.00 78.21  ? 43   SER A O   1 
ATOM   193  C CB  . SER A 1 27   ? 44.981  25.901  -6.187  1.00 74.82  ? 43   SER A CB  1 
ATOM   194  O OG  . SER A 1 27   ? 45.556  27.007  -6.863  1.00 87.44  ? 43   SER A OG  1 
ATOM   195  N N   . THR A 1 28   ? 47.343  23.898  -6.491  1.00 71.66  ? 44   THR A N   1 
ATOM   196  C CA  . THR A 1 28   ? 48.753  23.571  -6.676  1.00 70.49  ? 44   THR A CA  1 
ATOM   197  C C   . THR A 1 28   ? 48.923  22.390  -7.636  1.00 73.87  ? 44   THR A C   1 
ATOM   198  O O   . THR A 1 28   ? 49.788  22.452  -8.503  1.00 74.24  ? 44   THR A O   1 
ATOM   199  C CB  . THR A 1 28   ? 49.382  23.382  -5.294  1.00 75.97  ? 44   THR A CB  1 
ATOM   200  O OG1 . THR A 1 28   ? 49.908  24.637  -4.876  1.00 82.75  ? 44   THR A OG1 1 
ATOM   201  C CG2 . THR A 1 28   ? 50.436  22.296  -5.231  1.00 68.94  ? 44   THR A CG2 1 
ATOM   202  N N   . ILE A 1 29   ? 48.100  21.327  -7.488  1.00 69.42  ? 45   ILE A N   1 
ATOM   203  C CA  . ILE A 1 29   ? 48.142  20.131  -8.349  1.00 68.22  ? 45   ILE A CA  1 
ATOM   204  C C   . ILE A 1 29   ? 47.859  20.522  -9.831  1.00 68.17  ? 45   ILE A C   1 
ATOM   205  O O   . ILE A 1 29   ? 48.540  20.031  -10.740 1.00 66.76  ? 45   ILE A O   1 
ATOM   206  C CB  . ILE A 1 29   ? 47.185  19.021  -7.792  1.00 71.09  ? 45   ILE A CB  1 
ATOM   207  C CG1 . ILE A 1 29   ? 47.741  18.365  -6.496  1.00 70.65  ? 45   ILE A CG1 1 
ATOM   208  C CG2 . ILE A 1 29   ? 46.870  17.955  -8.832  1.00 71.14  ? 45   ILE A CG2 1 
ATOM   209  N N   . LYS A 1 30   ? 46.903  21.457  -10.044 1.00 62.10  ? 46   LYS A N   1 
ATOM   210  C CA  . LYS A 1 30   ? 46.521  21.942  -11.368 1.00 61.55  ? 46   LYS A CA  1 
ATOM   211  C C   . LYS A 1 30   ? 47.700  22.616  -12.086 1.00 67.76  ? 46   LYS A C   1 
ATOM   212  O O   . LYS A 1 30   ? 47.866  22.438  -13.306 1.00 67.81  ? 46   LYS A O   1 
ATOM   213  C CB  . LYS A 1 30   ? 45.342  22.899  -11.266 1.00 62.38  ? 46   LYS A CB  1 
ATOM   214  C CG  . LYS A 1 30   ? 44.479  22.879  -12.503 1.00 67.01  ? 46   LYS A CG  1 
ATOM   215  C CD  . LYS A 1 30   ? 43.564  24.072  -12.555 1.00 69.86  ? 46   LYS A CD  1 
ATOM   216  C CE  . LYS A 1 30   ? 42.148  23.761  -12.173 1.00 63.59  ? 46   LYS A CE  1 
ATOM   217  N NZ  . LYS A 1 30   ? 41.346  25.013  -12.093 1.00 75.53  ? 46   LYS A NZ  1 
ATOM   218  N N   . GLN A 1 31   ? 48.536  23.355  -11.314 1.00 63.53  ? 47   GLN A N   1 
ATOM   219  C CA  . GLN A 1 31   ? 49.731  24.006  -11.826 1.00 62.46  ? 47   GLN A CA  1 
ATOM   220  C C   . GLN A 1 31   ? 50.771  22.976  -12.229 1.00 65.31  ? 47   GLN A C   1 
ATOM   221  O O   . GLN A 1 31   ? 51.248  23.055  -13.360 1.00 66.69  ? 47   GLN A O   1 
ATOM   222  C CB  . GLN A 1 31   ? 50.284  25.044  -10.848 1.00 64.16  ? 47   GLN A CB  1 
ATOM   223  C CG  . GLN A 1 31   ? 49.877  26.487  -11.196 1.00 78.33  ? 47   GLN A CG  1 
ATOM   224  N N   . LEU A 1 32   ? 51.074  21.970  -11.369 1.00 60.52  ? 48   LEU A N   1 
ATOM   225  C CA  . LEU A 1 32   ? 52.025  20.897  -11.716 1.00 60.66  ? 48   LEU A CA  1 
ATOM   226  C C   . LEU A 1 32   ? 51.536  20.182  -12.957 1.00 66.39  ? 48   LEU A C   1 
ATOM   227  O O   . LEU A 1 32   ? 52.357  19.769  -13.775 1.00 67.67  ? 48   LEU A O   1 
ATOM   228  C CB  . LEU A 1 32   ? 52.227  19.867  -10.586 1.00 61.11  ? 48   LEU A CB  1 
ATOM   229  C CG  . LEU A 1 32   ? 53.124  20.287  -9.400  1.00 66.29  ? 48   LEU A CG  1 
ATOM   230  N N   . LEU A 1 33   ? 50.190  20.050  -13.111 1.00 61.51  ? 49   LEU A N   1 
ATOM   231  C CA  . LEU A 1 33   ? 49.578  19.390  -14.265 1.00 59.44  ? 49   LEU A CA  1 
ATOM   232  C C   . LEU A 1 33   ? 49.775  20.208  -15.524 1.00 61.97  ? 49   LEU A C   1 
ATOM   233  O O   . LEU A 1 33   ? 50.173  19.647  -16.537 1.00 60.90  ? 49   LEU A O   1 
ATOM   234  C CB  . LEU A 1 33   ? 48.087  19.053  -14.023 1.00 58.57  ? 49   LEU A CB  1 
ATOM   235  C CG  . LEU A 1 33   ? 47.310  18.505  -15.229 1.00 60.33  ? 49   LEU A CG  1 
ATOM   236  C CD1 . LEU A 1 33   ? 47.795  17.154  -15.638 1.00 59.07  ? 49   LEU A CD1 1 
ATOM   237  C CD2 . LEU A 1 33   ? 45.846  18.524  -14.976 1.00 60.03  ? 49   LEU A CD2 1 
ATOM   238  N N   . TRP A 1 34   ? 49.509  21.527  -15.473 1.00 58.79  ? 50   TRP A N   1 
ATOM   239  C CA  . TRP A 1 34   ? 49.701  22.367  -16.650 1.00 58.98  ? 50   TRP A CA  1 
ATOM   240  C C   . TRP A 1 34   ? 51.170  22.377  -17.050 1.00 64.56  ? 50   TRP A C   1 
ATOM   241  O O   . TRP A 1 34   ? 51.476  22.340  -18.239 1.00 64.68  ? 50   TRP A O   1 
ATOM   242  C CB  . TRP A 1 34   ? 49.112  23.766  -16.448 1.00 57.86  ? 50   TRP A CB  1 
ATOM   243  C CG  . TRP A 1 34   ? 47.931  24.004  -17.335 1.00 59.67  ? 50   TRP A CG  1 
ATOM   244  C CD1 . TRP A 1 34   ? 47.924  24.670  -18.527 1.00 62.86  ? 50   TRP A CD1 1 
ATOM   245  C CD2 . TRP A 1 34   ? 46.631  23.407  -17.203 1.00 59.95  ? 50   TRP A CD2 1 
ATOM   246  N NE1 . TRP A 1 34   ? 46.669  24.609  -19.100 1.00 62.88  ? 50   TRP A NE1 1 
ATOM   247  C CE2 . TRP A 1 34   ? 45.856  23.837  -18.308 1.00 64.46  ? 50   TRP A CE2 1 
ATOM   248  C CE3 . TRP A 1 34   ? 46.048  22.538  -16.264 1.00 60.81  ? 50   TRP A CE3 1 
ATOM   249  C CZ2 . TRP A 1 34   ? 44.525  23.449  -18.480 1.00 63.62  ? 50   TRP A CZ2 1 
ATOM   250  C CZ3 . TRP A 1 34   ? 44.727  22.183  -16.424 1.00 62.21  ? 50   TRP A CZ3 1 
ATOM   251  C CH2 . TRP A 1 34   ? 43.990  22.604  -17.539 1.00 62.98  ? 50   TRP A CH2 1 
ATOM   252  N N   . HIS A 1 35   ? 52.077  22.287  -16.050 1.00 61.63  ? 51   HIS A N   1 
ATOM   253  C CA  . HIS A 1 35   ? 53.508  22.229  -16.298 1.00 61.24  ? 51   HIS A CA  1 
ATOM   254  C C   . HIS A 1 35   ? 53.940  20.946  -17.049 1.00 63.10  ? 51   HIS A C   1 
ATOM   255  O O   . HIS A 1 35   ? 54.817  21.025  -17.899 1.00 63.83  ? 51   HIS A O   1 
ATOM   256  C CB  . HIS A 1 35   ? 54.339  22.456  -15.018 1.00 62.37  ? 51   HIS A CB  1 
ATOM   257  C CG  . HIS A 1 35   ? 55.778  22.632  -15.352 1.00 67.01  ? 51   HIS A CG  1 
ATOM   258  N ND1 . HIS A 1 35   ? 56.226  23.767  -16.032 1.00 69.80  ? 51   HIS A ND1 1 
ATOM   259  C CD2 . HIS A 1 35   ? 56.792  21.741  -15.278 1.00 69.94  ? 51   HIS A CD2 1 
ATOM   260  C CE1 . HIS A 1 35   ? 57.508  23.551  -16.289 1.00 69.70  ? 51   HIS A CE1 1 
ATOM   261  N NE2 . HIS A 1 35   ? 57.898  22.348  -15.862 1.00 70.16  ? 51   HIS A NE2 1 
ATOM   262  N N   . ARG A 1 36   ? 53.321  19.791  -16.767 1.00 57.55  ? 52   ARG A N   1 
ATOM   263  C CA  . ARG A 1 36   ? 53.676  18.530  -17.429 1.00 56.55  ? 52   ARG A CA  1 
ATOM   264  C C   . ARG A 1 36   ? 52.855  18.323  -18.704 1.00 59.84  ? 52   ARG A C   1 
ATOM   265  O O   . ARG A 1 36   ? 53.329  17.701  -19.660 1.00 60.35  ? 52   ARG A O   1 
ATOM   266  C CB  . ARG A 1 36   ? 53.541  17.333  -16.460 1.00 56.67  ? 52   ARG A CB  1 
ATOM   267  C CG  . ARG A 1 36   ? 54.162  17.538  -15.069 1.00 58.00  ? 52   ARG A CG  1 
ATOM   268  C CD  . ARG A 1 36   ? 55.401  16.707  -14.814 1.00 69.79  ? 52   ARG A CD  1 
ATOM   269  N NE  . ARG A 1 36   ? 55.430  16.248  -13.419 1.00 98.93  ? 52   ARG A NE  1 
ATOM   270  C CZ  . ARG A 1 36   ? 56.220  15.289  -12.937 1.00 118.89 ? 52   ARG A CZ  1 
ATOM   271  N NH1 . ARG A 1 36   ? 57.108  14.689  -13.724 1.00 107.42 ? 52   ARG A NH1 1 
ATOM   272  N NH2 . ARG A 1 36   ? 56.138  14.933  -11.659 1.00 105.57 ? 52   ARG A NH2 1 
ATOM   273  N N   . ALA A 1 37   ? 51.640  18.881  -18.736 1.00 54.70  ? 53   ALA A N   1 
ATOM   274  C CA  . ALA A 1 37   ? 50.748  18.790  -19.886 1.00 53.85  ? 53   ALA A CA  1 
ATOM   275  C C   . ALA A 1 37   ? 51.359  19.425  -21.119 1.00 60.92  ? 53   ALA A C   1 
ATOM   276  O O   . ALA A 1 37   ? 51.261  18.844  -22.196 1.00 61.76  ? 53   ALA A O   1 
ATOM   277  C CB  . ALA A 1 37   ? 49.399  19.408  -19.575 1.00 53.92  ? 53   ALA A CB  1 
ATOM   278  N N   . GLN A 1 38   ? 52.050  20.572  -20.972 1.00 59.36  ? 54   GLN A N   1 
ATOM   279  C CA  . GLN A 1 38   ? 52.708  21.235  -22.110 1.00 59.22  ? 54   GLN A CA  1 
ATOM   280  C C   . GLN A 1 38   ? 53.712  20.323  -22.838 1.00 65.64  ? 54   GLN A C   1 
ATOM   281  O O   . GLN A 1 38   ? 53.941  20.527  -24.023 1.00 66.58  ? 54   GLN A O   1 
ATOM   282  C CB  . GLN A 1 38   ? 53.342  22.570  -21.717 1.00 59.45  ? 54   GLN A CB  1 
ATOM   283  C CG  . GLN A 1 38   ? 54.588  22.428  -20.881 1.00 66.35  ? 54   GLN A CG  1 
ATOM   284  C CD  . GLN A 1 38   ? 55.352  23.706  -20.798 1.00 78.56  ? 54   GLN A CD  1 
ATOM   285  O OE1 . GLN A 1 38   ? 55.796  24.286  -21.805 1.00 79.64  ? 54   GLN A OE1 1 
ATOM   286  N NE2 . GLN A 1 38   ? 55.572  24.132  -19.588 1.00 65.53  ? 54   GLN A NE2 1 
ATOM   287  N N   . TYR A 1 39   ? 54.231  19.275  -22.168 1.00 62.74  ? 55   TYR A N   1 
ATOM   288  C CA  . TYR A 1 39   ? 55.183  18.363  -22.800 1.00 63.27  ? 55   TYR A CA  1 
ATOM   289  C C   . TYR A 1 39   ? 54.558  17.010  -23.234 1.00 67.97  ? 55   TYR A C   1 
ATOM   290  O O   . TYR A 1 39   ? 55.313  16.069  -23.558 1.00 67.83  ? 55   TYR A O   1 
ATOM   291  C CB  . TYR A 1 39   ? 56.443  18.187  -21.916 1.00 64.87  ? 55   TYR A CB  1 
ATOM   292  C CG  . TYR A 1 39   ? 57.264  19.463  -21.830 1.00 67.38  ? 55   TYR A CG  1 
ATOM   293  C CD1 . TYR A 1 39   ? 57.750  20.084  -22.981 1.00 68.63  ? 55   TYR A CD1 1 
ATOM   294  C CD2 . TYR A 1 39   ? 57.466  20.103  -20.613 1.00 69.29  ? 55   TYR A CD2 1 
ATOM   295  C CE1 . TYR A 1 39   ? 58.435  21.296  -22.918 1.00 69.86  ? 55   TYR A CE1 1 
ATOM   296  C CE2 . TYR A 1 39   ? 58.172  21.308  -20.535 1.00 71.14  ? 55   TYR A CE2 1 
ATOM   297  C CZ  . TYR A 1 39   ? 58.684  21.884  -21.688 1.00 81.10  ? 55   TYR A CZ  1 
ATOM   298  O OH  . TYR A 1 39   ? 59.408  23.057  -21.616 1.00 84.63  ? 55   TYR A OH  1 
ATOM   299  N N   . GLU A 1 40   ? 53.173  16.948  -23.272 1.00 62.69  ? 56   GLU A N   1 
ATOM   300  C CA  . GLU A 1 40   ? 52.321  15.827  -23.726 1.00 60.81  ? 56   GLU A CA  1 
ATOM   301  C C   . GLU A 1 40   ? 51.478  16.304  -24.930 1.00 65.77  ? 56   GLU A C   1 
ATOM   302  O O   . GLU A 1 40   ? 51.133  17.489  -24.975 1.00 67.08  ? 56   GLU A O   1 
ATOM   303  C CB  . GLU A 1 40   ? 51.383  15.300  -22.617 1.00 61.29  ? 56   GLU A CB  1 
ATOM   304  C CG  . GLU A 1 40   ? 52.042  14.419  -21.565 1.00 68.90  ? 56   GLU A CG  1 
ATOM   305  C CD  . GLU A 1 40   ? 52.707  13.123  -22.005 1.00 92.85  ? 56   GLU A CD  1 
ATOM   306  O OE1 . GLU A 1 40   ? 52.212  12.484  -22.963 1.00 99.80  ? 56   GLU A OE1 1 
ATOM   307  O OE2 . GLU A 1 40   ? 53.697  12.717  -21.353 1.00 80.54  ? 56   GLU A OE2 1 
ATOM   308  N N   . PRO A 1 41   ? 51.084  15.415  -25.890 1.00 60.53  ? 57   PRO A N   1 
ATOM   309  C CA  . PRO A 1 41   ? 50.313  15.882  -27.056 1.00 58.78  ? 57   PRO A CA  1 
ATOM   310  C C   . PRO A 1 41   ? 49.017  16.621  -26.788 1.00 58.85  ? 57   PRO A C   1 
ATOM   311  O O   . PRO A 1 41   ? 48.450  16.522  -25.732 1.00 61.51  ? 57   PRO A O   1 
ATOM   312  C CB  . PRO A 1 41   ? 50.036  14.597  -27.840 1.00 61.04  ? 57   PRO A CB  1 
ATOM   313  C CG  . PRO A 1 41   ? 50.350  13.466  -26.905 1.00 65.94  ? 57   PRO A CG  1 
ATOM   314  C CD  . PRO A 1 41   ? 51.410  13.977  -26.017 1.00 61.92  ? 57   PRO A CD  1 
ATOM   315  N N   . LEU A 1 42   ? 48.558  17.345  -27.781 1.00 52.15  ? 58   LEU A N   1 
ATOM   316  C CA  . LEU A 1 42   ? 47.320  18.101  -27.875 1.00 51.10  ? 58   LEU A CA  1 
ATOM   317  C C   . LEU A 1 42   ? 47.168  19.225  -26.880 1.00 55.77  ? 58   LEU A C   1 
ATOM   318  O O   . LEU A 1 42   ? 46.066  19.767  -26.764 1.00 57.71  ? 58   LEU A O   1 
ATOM   319  C CB  . LEU A 1 42   ? 46.102  17.185  -27.854 1.00 51.29  ? 58   LEU A CB  1 
ATOM   320  C CG  . LEU A 1 42   ? 45.886  16.402  -29.173 1.00 54.93  ? 58   LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 42   ? 45.339  15.000  -28.924 1.00 52.95  ? 58   LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 42   ? 45.092  17.211  -30.177 1.00 56.60  ? 58   LEU A CD2 1 
ATOM   323  N N   . PHE A 1 43   ? 48.283  19.713  -26.303 1.00 50.64  ? 59   PHE A N   1 
ATOM   324  C CA  . PHE A 1 43   ? 48.213  20.826  -25.358 1.00 49.11  ? 59   PHE A CA  1 
ATOM   325  C C   . PHE A 1 43   ? 47.591  22.114  -25.903 1.00 57.52  ? 59   PHE A C   1 
ATOM   326  O O   . PHE A 1 43   ? 46.837  22.762  -25.189 1.00 59.31  ? 59   PHE A O   1 
ATOM   327  C CB  . PHE A 1 43   ? 49.583  21.115  -24.791 1.00 49.28  ? 59   PHE A CB  1 
ATOM   328  C CG  . PHE A 1 43   ? 49.585  22.198  -23.745 1.00 49.41  ? 59   PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 43   ? 49.275  21.904  -22.409 1.00 50.41  ? 59   PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 43   ? 49.921  23.508  -24.079 1.00 49.52  ? 59   PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 43   ? 49.326  22.888  -21.430 1.00 50.32  ? 59   PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 43   ? 49.977  24.501  -23.095 1.00 52.37  ? 59   PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 43   ? 49.669  24.183  -21.777 1.00 50.72  ? 59   PHE A CZ  1 
ATOM   334  N N   . HIS A 1 44   ? 47.914  22.488  -27.146 1.00 56.68  ? 60   HIS A N   1 
ATOM   335  C CA  . HIS A 1 44   ? 47.484  23.730  -27.810 1.00 57.43  ? 60   HIS A CA  1 
ATOM   336  C C   . HIS A 1 44   ? 45.987  23.945  -27.778 1.00 63.12  ? 60   HIS A C   1 
ATOM   337  O O   . HIS A 1 44   ? 45.517  25.089  -27.786 1.00 62.61  ? 60   HIS A O   1 
ATOM   338  C CB  . HIS A 1 44   ? 47.978  23.747  -29.262 1.00 58.50  ? 60   HIS A CB  1 
ATOM   339  N N   . MET A 1 45   ? 45.249  22.821  -27.742 1.00 61.58  ? 61   MET A N   1 
ATOM   340  C CA  . MET A 1 45   ? 43.784  22.686  -27.763 1.00 61.07  ? 61   MET A CA  1 
ATOM   341  C C   . MET A 1 45   ? 43.105  23.058  -26.435 1.00 61.53  ? 61   MET A C   1 
ATOM   342  O O   . MET A 1 45   ? 41.987  23.580  -26.456 1.00 61.44  ? 61   MET A O   1 
ATOM   343  C CB  . MET A 1 45   ? 43.429  21.256  -28.193 1.00 63.48  ? 61   MET A CB  1 
ATOM   344  C CG  . MET A 1 45   ? 43.949  20.911  -29.585 1.00 67.26  ? 61   MET A CG  1 
ATOM   345  N N   . LEU A 1 46   ? 43.790  22.815  -25.287 1.00 55.48  ? 62   LEU A N   1 
ATOM   346  C CA  . LEU A 1 46   ? 43.297  23.158  -23.945 1.00 54.07  ? 62   LEU A CA  1 
ATOM   347  C C   . LEU A 1 46   ? 43.071  24.648  -23.771 1.00 60.57  ? 62   LEU A C   1 
ATOM   348  O O   . LEU A 1 46   ? 43.815  25.485  -24.310 1.00 63.28  ? 62   LEU A O   1 
ATOM   349  C CB  . LEU A 1 46   ? 44.278  22.720  -22.841 1.00 52.96  ? 62   LEU A CB  1 
ATOM   350  C CG  . LEU A 1 46   ? 44.598  21.254  -22.676 1.00 55.88  ? 62   LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 46   ? 45.685  21.057  -21.619 1.00 54.45  ? 62   LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 46   ? 43.339  20.435  -22.394 1.00 57.70  ? 62   LEU A CD2 1 
ATOM   353  N N   . SER A 1 47   ? 42.088  24.973  -22.955 1.00 55.24  ? 63   SER A N   1 
ATOM   354  C CA  . SER A 1 47   ? 41.780  26.329  -22.560 1.00 54.88  ? 63   SER A CA  1 
ATOM   355  C C   . SER A 1 47   ? 42.686  26.612  -21.324 1.00 59.35  ? 63   SER A C   1 
ATOM   356  O O   . SER A 1 47   ? 43.539  25.783  -20.988 1.00 59.20  ? 63   SER A O   1 
ATOM   357  C CB  . SER A 1 47   ? 40.292  26.420  -22.218 1.00 59.33  ? 63   SER A CB  1 
ATOM   358  O OG  . SER A 1 47   ? 39.690  27.540  -22.844 1.00 69.12  ? 63   SER A OG  1 
ATOM   359  N N   . GLY A 1 48   ? 42.502  27.754  -20.663 1.00 56.71  ? 64   GLY A N   1 
ATOM   360  C CA  . GLY A 1 48   ? 43.266  28.116  -19.475 1.00 57.27  ? 64   GLY A CA  1 
ATOM   361  C C   . GLY A 1 48   ? 42.992  27.202  -18.291 1.00 64.38  ? 64   GLY A C   1 
ATOM   362  O O   . GLY A 1 48   ? 41.938  26.560  -18.253 1.00 64.27  ? 64   GLY A O   1 
ATOM   363  N N   . PRO A 1 49   ? 43.904  27.121  -17.283 1.00 62.32  ? 65   PRO A N   1 
ATOM   364  C CA  . PRO A 1 49   ? 43.657  26.226  -16.124 1.00 62.00  ? 65   PRO A CA  1 
ATOM   365  C C   . PRO A 1 49   ? 42.371  26.531  -15.370 1.00 65.31  ? 65   PRO A C   1 
ATOM   366  O O   . PRO A 1 49   ? 41.681  25.621  -14.932 1.00 64.07  ? 65   PRO A O   1 
ATOM   367  C CB  . PRO A 1 49   ? 44.883  26.447  -15.227 1.00 63.70  ? 65   PRO A CB  1 
ATOM   368  C CG  . PRO A 1 49   ? 45.928  27.004  -16.129 1.00 68.63  ? 65   PRO A CG  1 
ATOM   369  C CD  . PRO A 1 49   ? 45.194  27.827  -17.148 1.00 63.94  ? 65   PRO A CD  1 
ATOM   370  N N   . GLU A 1 50   ? 42.041  27.825  -15.267 1.00 62.85  ? 66   GLU A N   1 
ATOM   371  C CA  . GLU A 1 50   ? 40.871  28.349  -14.571 1.00 62.81  ? 66   GLU A CA  1 
ATOM   372  C C   . GLU A 1 50   ? 39.592  28.064  -15.338 1.00 65.21  ? 66   GLU A C   1 
ATOM   373  O O   . GLU A 1 50   ? 38.507  28.275  -14.800 1.00 66.13  ? 66   GLU A O   1 
ATOM   374  C CB  . GLU A 1 50   ? 41.001  29.865  -14.290 1.00 64.56  ? 66   GLU A CB  1 
ATOM   375  C CG  . GLU A 1 50   ? 42.414  30.389  -14.090 1.00 76.78  ? 66   GLU A CG  1 
ATOM   376  C CD  . GLU A 1 50   ? 42.889  30.469  -12.665 1.00 102.66 ? 66   GLU A CD  1 
ATOM   377  O OE1 . GLU A 1 50   ? 42.494  31.431  -11.968 1.00 107.68 ? 66   GLU A OE1 1 
ATOM   378  O OE2 . GLU A 1 50   ? 43.710  29.612  -12.268 1.00 102.25 ? 66   GLU A OE2 1 
ATOM   379  N N   . ALA A 1 51   ? 39.702  27.591  -16.582 1.00 60.68  ? 67   ALA A N   1 
ATOM   380  C CA  . ALA A 1 51   ? 38.538  27.259  -17.406 1.00 60.52  ? 67   ALA A CA  1 
ATOM   381  C C   . ALA A 1 51   ? 37.944  25.912  -16.962 1.00 68.42  ? 67   ALA A C   1 
ATOM   382  O O   . ALA A 1 51   ? 36.778  25.616  -17.276 1.00 70.47  ? 67   ALA A O   1 
ATOM   383  C CB  . ALA A 1 51   ? 38.951  27.172  -18.866 1.00 60.63  ? 67   ALA A CB  1 
ATOM   384  N N   . TYR A 1 52   ? 38.758  25.117  -16.209 1.00 62.47  ? 68   TYR A N   1 
ATOM   385  C CA  . TYR A 1 52   ? 38.470  23.775  -15.758 1.00 60.61  ? 68   TYR A CA  1 
ATOM   386  C C   . TYR A 1 52   ? 38.407  23.583  -14.262 1.00 64.89  ? 68   TYR A C   1 
ATOM   387  O O   . TYR A 1 52   ? 39.065  24.280  -13.492 1.00 64.99  ? 68   TYR A O   1 
ATOM   388  C CB  . TYR A 1 52   ? 39.538  22.822  -16.318 1.00 61.07  ? 68   TYR A CB  1 
ATOM   389  C CG  . TYR A 1 52   ? 39.710  22.905  -17.815 1.00 61.48  ? 68   TYR A CG  1 
ATOM   390  C CD1 . TYR A 1 52   ? 38.745  22.390  -18.676 1.00 63.02  ? 68   TYR A CD1 1 
ATOM   391  C CD2 . TYR A 1 52   ? 40.856  23.464  -18.375 1.00 61.05  ? 68   TYR A CD2 1 
ATOM   392  C CE1 . TYR A 1 52   ? 38.926  22.407  -20.054 1.00 63.98  ? 68   TYR A CE1 1 
ATOM   393  C CE2 . TYR A 1 52   ? 41.049  23.486  -19.754 1.00 61.18  ? 68   TYR A CE2 1 
ATOM   394  C CZ  . TYR A 1 52   ? 40.072  22.970  -20.592 1.00 68.66  ? 68   TYR A CZ  1 
ATOM   395  O OH  . TYR A 1 52   ? 40.223  23.008  -21.954 1.00 68.82  ? 68   TYR A OH  1 
ATOM   396  N N   . VAL A 1 53   ? 37.674  22.535  -13.876 1.00 61.32  ? 69   VAL A N   1 
ATOM   397  C CA  . VAL A 1 53   ? 37.476  22.043  -12.522 1.00 60.10  ? 69   VAL A CA  1 
ATOM   398  C C   . VAL A 1 53   ? 37.795  20.526  -12.487 1.00 63.72  ? 69   VAL A C   1 
ATOM   399  O O   . VAL A 1 53   ? 37.507  19.786  -13.434 1.00 62.02  ? 69   VAL A O   1 
ATOM   400  C CB  . VAL A 1 53   ? 36.062  22.413  -11.937 1.00 62.21  ? 69   VAL A CB  1 
ATOM   401  C CG1 . VAL A 1 53   ? 34.941  21.544  -12.504 1.00 61.02  ? 69   VAL A CG1 1 
ATOM   402  C CG2 . VAL A 1 53   ? 36.064  22.351  -10.419 1.00 62.02  ? 69   VAL A CG2 1 
ATOM   403  N N   . PHE A 1 54   ? 38.418  20.087  -11.402 1.00 62.77  ? 70   PHE A N   1 
ATOM   404  C CA  . PHE A 1 54   ? 38.714  18.678  -11.207 1.00 62.97  ? 70   PHE A CA  1 
ATOM   405  C C   . PHE A 1 54   ? 37.432  17.966  -10.774 1.00 64.67  ? 70   PHE A C   1 
ATOM   406  O O   . PHE A 1 54   ? 36.587  18.534  -10.074 1.00 63.26  ? 70   PHE A O   1 
ATOM   407  C CB  . PHE A 1 54   ? 39.789  18.489  -10.132 1.00 65.10  ? 70   PHE A CB  1 
ATOM   408  C CG  . PHE A 1 54   ? 41.211  18.798  -10.529 1.00 67.34  ? 70   PHE A CG  1 
ATOM   409  C CD1 . PHE A 1 54   ? 41.825  18.113  -11.574 1.00 71.76  ? 70   PHE A CD1 1 
ATOM   410  C CD2 . PHE A 1 54   ? 41.980  19.681  -9.785  1.00 69.14  ? 70   PHE A CD2 1 
ATOM   411  C CE1 . PHE A 1 54   ? 43.172  18.339  -11.889 1.00 72.32  ? 70   PHE A CE1 1 
ATOM   412  C CE2 . PHE A 1 54   ? 43.322  19.909  -10.103 1.00 71.93  ? 70   PHE A CE2 1 
ATOM   413  C CZ  . PHE A 1 54   ? 43.906  19.241  -11.156 1.00 70.44  ? 70   PHE A CZ  1 
ATOM   414  N N   . THR A 1 55   ? 37.304  16.725  -11.219 1.00 59.87  ? 71   THR A N   1 
ATOM   415  C CA  . THR A 1 55   ? 36.229  15.804  -10.913 1.00 58.44  ? 71   THR A CA  1 
ATOM   416  C C   . THR A 1 55   ? 36.923  14.602  -10.335 1.00 63.44  ? 71   THR A C   1 
ATOM   417  O O   . THR A 1 55   ? 38.048  14.288  -10.723 1.00 61.35  ? 71   THR A O   1 
ATOM   418  C CB  . THR A 1 55   ? 35.353  15.558  -12.179 1.00 60.29  ? 71   THR A CB  1 
ATOM   419  O OG1 . THR A 1 55   ? 34.217  16.424  -12.127 1.00 66.02  ? 71   THR A OG1 1 
ATOM   420  C CG2 . THR A 1 55   ? 34.858  14.134  -12.324 1.00 49.56  ? 71   THR A CG2 1 
ATOM   421  N N   . CYS A 1 56   ? 36.286  13.964  -9.355  1.00 64.72  ? 72   CYS A N   1 
ATOM   422  C CA  . CYS A 1 56   ? 36.786  12.738  -8.724  1.00 65.43  ? 72   CYS A CA  1 
ATOM   423  C C   . CYS A 1 56   ? 35.609  11.932  -8.234  1.00 68.79  ? 72   CYS A C   1 
ATOM   424  O O   . CYS A 1 56   ? 34.528  12.497  -8.036  1.00 66.73  ? 72   CYS A O   1 
ATOM   425  C CB  . CYS A 1 56   ? 37.746  13.057  -7.582  1.00 66.04  ? 72   CYS A CB  1 
ATOM   426  S SG  . CYS A 1 56   ? 36.926  13.572  -6.051  1.00 70.64  ? 72   CYS A SG  1 
ATOM   427  N N   . ILE A 1 57   ? 35.843  10.629  -7.963  1.00 66.63  ? 73   ILE A N   1 
ATOM   428  C CA  . ILE A 1 57   ? 34.858  9.744   -7.330  1.00 66.17  ? 73   ILE A CA  1 
ATOM   429  C C   . ILE A 1 57   ? 35.211  9.738   -5.816  1.00 71.09  ? 73   ILE A C   1 
ATOM   430  O O   . ILE A 1 57   ? 36.291  9.264   -5.439  1.00 71.22  ? 73   ILE A O   1 
ATOM   431  C CB  . ILE A 1 57   ? 34.893  8.355   -7.999  1.00 68.76  ? 73   ILE A CB  1 
ATOM   432  C CG1 . ILE A 1 57   ? 34.406  8.460   -9.475  1.00 68.90  ? 73   ILE A CG1 1 
ATOM   433  C CG2 . ILE A 1 57   ? 34.110  7.307   -7.193  1.00 67.88  ? 73   ILE A CG2 1 
ATOM   434  N N   . ASN A 1 58   ? 34.366  10.377  -4.973  1.00 67.02  ? 74   ASN A N   1 
ATOM   435  C CA  . ASN A 1 58   ? 34.625  10.455  -3.525  1.00 67.09  ? 74   ASN A CA  1 
ATOM   436  C C   . ASN A 1 58   ? 34.322  9.112   -2.791  1.00 70.27  ? 74   ASN A C   1 
ATOM   437  O O   . ASN A 1 58   ? 33.839  8.153   -3.413  1.00 68.73  ? 74   ASN A O   1 
ATOM   438  C CB  . ASN A 1 58   ? 33.910  11.677  -2.853  1.00 69.60  ? 74   ASN A CB  1 
ATOM   439  C CG  . ASN A 1 58   ? 32.398  11.776  -3.021  1.00 96.08  ? 74   ASN A CG  1 
ATOM   440  O OD1 . ASN A 1 58   ? 31.678  10.767  -3.113  1.00 98.56  ? 74   ASN A OD1 1 
ATOM   441  N ND2 . ASN A 1 58   ? 31.865  13.006  -2.991  1.00 79.45  ? 74   ASN A ND2 1 
ATOM   442  N N   . GLN A 1 59   ? 34.648  9.051   -1.472  1.00 66.78  ? 75   GLN A N   1 
ATOM   443  C CA  . GLN A 1 59   ? 34.461  7.887   -0.591  1.00 65.84  ? 75   GLN A CA  1 
ATOM   444  C C   . GLN A 1 59   ? 33.039  7.266   -0.703  1.00 69.69  ? 75   GLN A C   1 
ATOM   445  O O   . GLN A 1 59   ? 32.911  6.030   -0.844  1.00 68.08  ? 75   GLN A O   1 
ATOM   446  C CB  . GLN A 1 59   ? 34.772  8.290   0.853   1.00 66.48  ? 75   GLN A CB  1 
ATOM   447  C CG  . GLN A 1 59   ? 36.257  8.518   1.118   1.00 71.68  ? 75   GLN A CG  1 
ATOM   448  C CD  . GLN A 1 59   ? 37.127  7.400   0.597   1.00 77.90  ? 75   GLN A CD  1 
ATOM   449  O OE1 . GLN A 1 59   ? 37.070  6.253   1.075   1.00 74.65  ? 75   GLN A OE1 1 
ATOM   450  N NE2 . GLN A 1 59   ? 37.929  7.704   -0.426  1.00 60.74  ? 75   GLN A NE2 1 
ATOM   451  N N   . THR A 1 60   ? 31.993  8.165   -0.742  1.00 64.49  ? 76   THR A N   1 
ATOM   452  C CA  . THR A 1 60   ? 30.566  7.863   -0.888  1.00 63.08  ? 76   THR A CA  1 
ATOM   453  C C   . THR A 1 60   ? 30.199  7.379   -2.322  1.00 66.94  ? 76   THR A C   1 
ATOM   454  O O   . THR A 1 60   ? 29.019  7.226   -2.603  1.00 65.40  ? 76   THR A O   1 
ATOM   455  C CB  . THR A 1 60   ? 29.662  9.048   -0.404  1.00 64.46  ? 76   THR A CB  1 
ATOM   456  O OG1 . THR A 1 60   ? 29.446  10.013  -1.436  1.00 60.04  ? 76   THR A OG1 1 
ATOM   457  C CG2 . THR A 1 60   ? 30.160  9.723   0.859   1.00 59.70  ? 76   THR A CG2 1 
ATOM   458  N N   . ALA A 1 61   ? 31.209  7.139   -3.213  1.00 64.64  ? 77   ALA A N   1 
ATOM   459  C CA  . ALA A 1 61   ? 31.123  6.598   -4.592  1.00 63.83  ? 77   ALA A CA  1 
ATOM   460  C C   . ALA A 1 61   ? 30.444  7.500   -5.647  1.00 67.04  ? 77   ALA A C   1 
ATOM   461  O O   . ALA A 1 61   ? 30.016  6.993   -6.687  1.00 65.61  ? 77   ALA A O   1 
ATOM   462  C CB  . ALA A 1 61   ? 30.464  5.225   -4.590  1.00 64.40  ? 77   ALA A CB  1 
ATOM   463  N N   . GLU A 1 62   ? 30.361  8.816   -5.427  1.00 64.50  ? 78   GLU A N   1 
ATOM   464  C CA  . GLU A 1 62   ? 29.769  9.650   -6.479  1.00 64.39  ? 78   GLU A CA  1 
ATOM   465  C C   . GLU A 1 62   ? 30.732  10.703  -6.982  1.00 68.86  ? 78   GLU A C   1 
ATOM   466  O O   . GLU A 1 62   ? 31.660  11.101  -6.279  1.00 68.53  ? 78   GLU A O   1 
ATOM   467  C CB  . GLU A 1 62   ? 28.393  10.254  -6.122  1.00 65.98  ? 78   GLU A CB  1 
ATOM   468  C CG  . GLU A 1 62   ? 28.204  10.838  -4.727  1.00 78.98  ? 78   GLU A CG  1 
ATOM   469  C CD  . GLU A 1 62   ? 26.900  11.604  -4.558  1.00 101.63 ? 78   GLU A CD  1 
ATOM   470  O OE1 . GLU A 1 62   ? 26.936  12.857  -4.584  1.00 102.77 ? 78   GLU A OE1 1 
ATOM   471  O OE2 . GLU A 1 62   ? 25.835  10.952  -4.449  1.00 89.64  ? 78   GLU A OE2 1 
ATOM   472  N N   . GLN A 1 63   ? 30.543  11.106  -8.240  1.00 67.13  ? 79   GLN A N   1 
ATOM   473  C CA  . GLN A 1 63   ? 31.330  12.142  -8.879  1.00 67.28  ? 79   GLN A CA  1 
ATOM   474  C C   . GLN A 1 63   ? 31.156  13.424  -8.121  1.00 71.97  ? 79   GLN A C   1 
ATOM   475  O O   . GLN A 1 63   ? 30.035  13.775  -7.724  1.00 72.55  ? 79   GLN A O   1 
ATOM   476  C CB  . GLN A 1 63   ? 30.916  12.327  -10.324 1.00 69.06  ? 79   GLN A CB  1 
ATOM   477  C CG  . GLN A 1 63   ? 31.764  11.499  -11.262 1.00 94.28  ? 79   GLN A CG  1 
ATOM   478  C CD  . GLN A 1 63   ? 31.291  11.655  -12.675 1.00 117.54 ? 79   GLN A CD  1 
ATOM   479  O OE1 . GLN A 1 63   ? 31.391  12.740  -13.265 1.00 117.26 ? 79   GLN A OE1 1 
ATOM   480  N NE2 . GLN A 1 63   ? 30.757  10.572  -13.246 1.00 104.92 ? 79   GLN A NE2 1 
ATOM   481  N N   . GLN A 1 64   ? 32.282  14.083  -7.852  1.00 67.95  ? 80   GLN A N   1 
ATOM   482  C CA  . GLN A 1 64   ? 32.314  15.316  -7.088  1.00 66.47  ? 80   GLN A CA  1 
ATOM   483  C C   . GLN A 1 64   ? 33.061  16.372  -7.843  1.00 69.00  ? 80   GLN A C   1 
ATOM   484  O O   . GLN A 1 64   ? 34.217  16.167  -8.210  1.00 67.96  ? 80   GLN A O   1 
ATOM   485  C CB  . GLN A 1 64   ? 32.986  15.076  -5.736  1.00 67.06  ? 80   GLN A CB  1 
ATOM   486  C CG  . GLN A 1 64   ? 32.449  16.000  -4.671  1.00 64.35  ? 80   GLN A CG  1 
ATOM   487  C CD  . GLN A 1 64   ? 33.386  16.316  -3.540  1.00 71.31  ? 80   GLN A CD  1 
ATOM   488  O OE1 . GLN A 1 64   ? 33.317  17.406  -2.981  1.00 60.28  ? 80   GLN A OE1 1 
ATOM   489  N NE2 . GLN A 1 64   ? 34.259  15.382  -3.144  1.00 66.64  ? 80   GLN A NE2 1 
ATOM   490  N N   . GLU A 1 65   ? 32.402  17.507  -8.068  1.00 65.74  ? 81   GLU A N   1 
ATOM   491  C CA  . GLU A 1 65   ? 33.019  18.665  -8.719  1.00 65.36  ? 81   GLU A CA  1 
ATOM   492  C C   . GLU A 1 65   ? 33.829  19.392  -7.624  1.00 66.54  ? 81   GLU A C   1 
ATOM   493  O O   . GLU A 1 65   ? 33.253  19.968  -6.686  1.00 66.78  ? 81   GLU A O   1 
ATOM   494  C CB  . GLU A 1 65   ? 31.954  19.579  -9.369  1.00 66.87  ? 81   GLU A CB  1 
ATOM   495  C CG  . GLU A 1 65   ? 31.618  19.208  -10.808 1.00 74.67  ? 81   GLU A CG  1 
ATOM   496  C CD  . GLU A 1 65   ? 31.013  20.313  -11.654 1.00 94.58  ? 81   GLU A CD  1 
ATOM   497  O OE1 . GLU A 1 65   ? 31.161  21.505  -11.288 1.00 96.47  ? 81   GLU A OE1 1 
ATOM   498  O OE2 . GLU A 1 65   ? 30.439  19.985  -12.719 1.00 83.22  ? 81   GLU A OE2 1 
ATOM   499  N N   . LEU A 1 66   ? 35.161  19.299  -7.716  1.00 59.23  ? 82   LEU A N   1 
ATOM   500  C CA  . LEU A 1 66   ? 36.065  19.855  -6.716  1.00 57.00  ? 82   LEU A CA  1 
ATOM   501  C C   . LEU A 1 66   ? 36.316  21.359  -6.897  1.00 61.22  ? 82   LEU A C   1 
ATOM   502  O O   . LEU A 1 66   ? 37.424  21.747  -7.246  1.00 60.33  ? 82   LEU A O   1 
ATOM   503  C CB  . LEU A 1 66   ? 37.381  19.031  -6.681  1.00 55.15  ? 82   LEU A CB  1 
ATOM   504  C CG  . LEU A 1 66   ? 37.264  17.528  -6.379  1.00 54.31  ? 82   LEU A CG  1 
ATOM   505  C CD1 . LEU A 1 66   ? 38.628  16.866  -6.380  1.00 52.24  ? 82   LEU A CD1 1 
ATOM   506  C CD2 . LEU A 1 66   ? 36.561  17.279  -5.082  1.00 50.31  ? 82   LEU A CD2 1 
ATOM   507  N N   . GLU A 1 67   ? 35.282  22.196  -6.621  1.00 60.09  ? 83   GLU A N   1 
ATOM   508  C CA  . GLU A 1 67   ? 35.262  23.671  -6.749  1.00 60.62  ? 83   GLU A CA  1 
ATOM   509  C C   . GLU A 1 67   ? 36.207  24.445  -5.857  1.00 68.74  ? 83   GLU A C   1 
ATOM   510  O O   . GLU A 1 67   ? 36.744  25.447  -6.319  1.00 69.91  ? 83   GLU A O   1 
ATOM   511  C CB  . GLU A 1 67   ? 33.856  24.238  -6.557  1.00 61.60  ? 83   GLU A CB  1 
ATOM   512  C CG  . GLU A 1 67   ? 33.315  24.841  -7.840  1.00 74.49  ? 83   GLU A CG  1 
ATOM   513  N N   . ASP A 1 68   ? 36.338  24.062  -4.567  1.00 67.45  ? 84   ASP A N   1 
ATOM   514  C CA  . ASP A 1 68   ? 37.206  24.753  -3.623  1.00 67.66  ? 84   ASP A CA  1 
ATOM   515  C C   . ASP A 1 68   ? 38.562  24.166  -3.833  1.00 73.79  ? 84   ASP A C   1 
ATOM   516  O O   . ASP A 1 68   ? 38.815  23.025  -3.419  1.00 73.50  ? 84   ASP A O   1 
ATOM   517  C CB  . ASP A 1 68   ? 36.718  24.582  -2.168  1.00 69.91  ? 84   ASP A CB  1 
ATOM   518  C CG  . ASP A 1 68   ? 37.646  25.084  -1.046  1.00 84.35  ? 84   ASP A CG  1 
ATOM   519  O OD1 . ASP A 1 68   ? 38.507  25.973  -1.319  1.00 84.55  ? 84   ASP A OD1 1 
ATOM   520  O OD2 . ASP A 1 68   ? 37.471  24.633  0.115   1.00 89.37  ? 84   ASP A OD2 1 
ATOM   521  N N   . GLU A 1 69   ? 39.422  24.926  -4.541  1.00 71.56  ? 85   GLU A N   1 
ATOM   522  C CA  . GLU A 1 69   ? 40.775  24.482  -4.889  1.00 72.07  ? 85   GLU A CA  1 
ATOM   523  C C   . GLU A 1 69   ? 41.784  24.765  -3.804  1.00 75.67  ? 85   GLU A C   1 
ATOM   524  O O   . GLU A 1 69   ? 42.976  24.476  -3.969  1.00 73.71  ? 85   GLU A O   1 
ATOM   525  C CB  . GLU A 1 69   ? 41.216  25.037  -6.242  1.00 73.70  ? 85   GLU A CB  1 
ATOM   526  C CG  . GLU A 1 69   ? 40.227  24.666  -7.335  1.00 77.98  ? 85   GLU A CG  1 
ATOM   527  C CD  . GLU A 1 69   ? 40.752  24.742  -8.744  1.00 79.61  ? 85   GLU A CD  1 
ATOM   528  O OE1 . GLU A 1 69   ? 41.619  25.602  -9.014  1.00 78.91  ? 85   GLU A OE1 1 
ATOM   529  O OE2 . GLU A 1 69   ? 40.305  23.925  -9.578  1.00 69.87  ? 85   GLU A OE2 1 
ATOM   530  N N   . GLN A 1 70   ? 41.283  25.247  -2.653  1.00 74.46  ? 86   GLN A N   1 
ATOM   531  C CA  . GLN A 1 70   ? 42.097  25.475  -1.463  1.00 75.10  ? 86   GLN A CA  1 
ATOM   532  C C   . GLN A 1 70   ? 42.132  24.189  -0.617  1.00 79.13  ? 86   GLN A C   1 
ATOM   533  O O   . GLN A 1 70   ? 42.760  24.169  0.444   1.00 80.22  ? 86   GLN A O   1 
ATOM   534  C CB  . GLN A 1 70   ? 41.603  26.693  -0.653  1.00 76.30  ? 86   GLN A CB  1 
ATOM   535  C CG  . GLN A 1 70   ? 41.840  28.045  -1.333  1.00 90.02  ? 86   GLN A CG  1 
ATOM   536  C CD  . GLN A 1 70   ? 43.300  28.346  -1.615  1.00 105.94 ? 86   GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 70   ? 43.779  28.185  -2.737  1.00 97.85  ? 86   GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 70   ? 44.035  28.814  -0.614  1.00 103.50 ? 86   GLN A NE2 1 
ATOM   539  N N   . ARG A 1 71   ? 41.472  23.116  -1.097  1.00 73.39  ? 87   ARG A N   1 
ATOM   540  C CA  . ARG A 1 71   ? 41.426  21.849  -0.382  1.00 72.35  ? 87   ARG A CA  1 
ATOM   541  C C   . ARG A 1 71   ? 42.617  20.989  -0.742  1.00 77.92  ? 87   ARG A C   1 
ATOM   542  O O   . ARG A 1 71   ? 43.014  20.971  -1.907  1.00 78.44  ? 87   ARG A O   1 
ATOM   543  C CB  . ARG A 1 71   ? 40.099  21.105  -0.619  1.00 66.81  ? 87   ARG A CB  1 
ATOM   544  C CG  . ARG A 1 71   ? 38.970  21.596  0.292   1.00 71.21  ? 87   ARG A CG  1 
ATOM   545  C CD  . ARG A 1 71   ? 37.684  20.773  0.195   1.00 89.72  ? 87   ARG A CD  1 
ATOM   546  N NE  . ARG A 1 71   ? 37.840  19.362  0.562   1.00 95.32  ? 87   ARG A NE  1 
ATOM   547  N N   . ARG A 1 72   ? 43.203  20.297  0.265   1.00 73.66  ? 88   ARG A N   1 
ATOM   548  C CA  . ARG A 1 72   ? 44.338  19.382  0.087   1.00 72.39  ? 88   ARG A CA  1 
ATOM   549  C C   . ARG A 1 72   ? 43.808  18.020  -0.411  1.00 75.14  ? 88   ARG A C   1 
ATOM   550  O O   . ARG A 1 72   ? 42.714  17.612  -0.018  1.00 73.48  ? 88   ARG A O   1 
ATOM   551  C CB  . ARG A 1 72   ? 45.141  19.224  1.399   1.00 69.77  ? 88   ARG A CB  1 
ATOM   552  C CG  . ARG A 1 72   ? 45.579  20.557  2.029   1.00 74.64  ? 88   ARG A CG  1 
ATOM   553  C CD  . ARG A 1 72   ? 46.138  20.414  3.438   1.00 89.16  ? 88   ARG A CD  1 
ATOM   554  N NE  . ARG A 1 72   ? 46.652  21.691  3.947   1.00 111.03 ? 88   ARG A NE  1 
ATOM   555  C CZ  . ARG A 1 72   ? 45.947  22.571  4.661   1.00 129.97 ? 88   ARG A CZ  1 
ATOM   556  N NH1 . ARG A 1 72   ? 44.682  22.319  4.983   1.00 113.73 ? 88   ARG A NH1 1 
ATOM   557  N NH2 . ARG A 1 72   ? 46.504  23.707  5.062   1.00 118.73 ? 88   ARG A NH2 1 
ATOM   558  N N   . LEU A 1 73   ? 44.573  17.332  -1.291  1.00 72.37  ? 89   LEU A N   1 
ATOM   559  C CA  . LEU A 1 73   ? 44.201  16.021  -1.844  1.00 72.16  ? 89   LEU A CA  1 
ATOM   560  C C   . LEU A 1 73   ? 43.831  15.034  -0.725  1.00 77.29  ? 89   LEU A C   1 
ATOM   561  O O   . LEU A 1 73   ? 42.906  14.231  -0.914  1.00 76.93  ? 89   LEU A O   1 
ATOM   562  C CB  . LEU A 1 73   ? 45.308  15.452  -2.757  1.00 71.59  ? 89   LEU A CB  1 
ATOM   563  C CG  . LEU A 1 73   ? 44.870  14.388  -3.771  1.00 74.81  ? 89   LEU A CG  1 
ATOM   564  N N   . CYS A 1 74   ? 44.516  15.146  0.455   1.00 73.98  ? 90   CYS A N   1 
ATOM   565  C CA  . CYS A 1 74   ? 44.259  14.346  1.654   1.00 73.49  ? 90   CYS A CA  1 
ATOM   566  C C   . CYS A 1 74   ? 42.866  14.651  2.219   1.00 75.72  ? 90   CYS A C   1 
ATOM   567  O O   . CYS A 1 74   ? 42.095  13.731  2.454   1.00 75.40  ? 90   CYS A O   1 
ATOM   568  C CB  . CYS A 1 74   ? 45.374  14.474  2.701   1.00 74.39  ? 90   CYS A CB  1 
ATOM   569  S SG  . CYS A 1 74   ? 45.597  16.135  3.427   1.00 78.89  ? 90   CYS A SG  1 
ATOM   570  N N   . ASP A 1 75   ? 42.489  15.927  2.276   1.00 72.29  ? 91   ASP A N   1 
ATOM   571  C CA  . ASP A 1 75   ? 41.156  16.351  2.715   1.00 72.67  ? 91   ASP A CA  1 
ATOM   572  C C   . ASP A 1 75   ? 40.053  16.005  1.689   1.00 76.05  ? 91   ASP A C   1 
ATOM   573  O O   . ASP A 1 75   ? 38.877  15.967  2.051   1.00 76.98  ? 91   ASP A O   1 
ATOM   574  C CB  . ASP A 1 75   ? 41.133  17.867  2.995   1.00 75.06  ? 91   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 75   ? 42.114  18.369  4.045   1.00 86.32  ? 91   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 75   ? 42.460  17.581  4.972   1.00 84.57  ? 91   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 75   ? 42.510  19.562  3.962   1.00 92.64  ? 91   ASP A OD2 1 
ATOM   578  N N   . VAL A 1 76   ? 40.413  15.834  0.405   1.00 70.99  ? 92   VAL A N   1 
ATOM   579  C CA  . VAL A 1 76   ? 39.432  15.486  -0.625  1.00 69.65  ? 92   VAL A CA  1 
ATOM   580  C C   . VAL A 1 76   ? 39.166  14.003  -0.505  1.00 76.13  ? 92   VAL A C   1 
ATOM   581  O O   . VAL A 1 76   ? 38.012  13.586  -0.597  1.00 76.59  ? 92   VAL A O   1 
ATOM   582  C CB  . VAL A 1 76   ? 39.844  15.917  -2.052  1.00 71.40  ? 92   VAL A CB  1 
ATOM   583  C CG1 . VAL A 1 76   ? 39.055  15.165  -3.121  1.00 70.56  ? 92   VAL A CG1 1 
ATOM   584  C CG2 . VAL A 1 76   ? 39.687  17.418  -2.231  1.00 70.71  ? 92   VAL A CG2 1 
ATOM   585  N N   . GLN A 1 77   ? 40.229  13.216  -0.236  1.00 73.62  ? 93   GLN A N   1 
ATOM   586  C CA  . GLN A 1 77   ? 40.177  11.762  -0.056  1.00 73.42  ? 93   GLN A CA  1 
ATOM   587  C C   . GLN A 1 77   ? 39.340  11.120  -1.188  1.00 76.61  ? 93   GLN A C   1 
ATOM   588  O O   . GLN A 1 77   ? 38.184  10.747  -0.954  1.00 75.33  ? 93   GLN A O   1 
ATOM   589  C CB  . GLN A 1 77   ? 39.637  11.419  1.340   1.00 74.77  ? 93   GLN A CB  1 
ATOM   590  C CG  . GLN A 1 77   ? 40.048  10.060  1.892   1.00 94.53  ? 93   GLN A CG  1 
ATOM   591  C CD  . GLN A 1 77   ? 39.279  9.700   3.159   1.00 111.54 ? 93   GLN A CD  1 
ATOM   592  O OE1 . GLN A 1 77   ? 38.503  10.504  3.716   1.00 101.04 ? 93   GLN A OE1 1 
ATOM   593  N NE2 . GLN A 1 77   ? 39.466  8.467   3.638   1.00 103.46 ? 93   GLN A NE2 1 
ATOM   594  N N   . PRO A 1 78   ? 39.866  11.086  -2.447  1.00 72.27  ? 94   PRO A N   1 
ATOM   595  C CA  . PRO A 1 78   ? 39.089  10.472  -3.535  1.00 71.25  ? 94   PRO A CA  1 
ATOM   596  C C   . PRO A 1 78   ? 39.293  8.973   -3.448  1.00 73.22  ? 94   PRO A C   1 
ATOM   597  O O   . PRO A 1 78   ? 40.288  8.553   -2.862  1.00 74.96  ? 94   PRO A O   1 
ATOM   598  C CB  . PRO A 1 78   ? 39.722  11.072  -4.792  1.00 73.11  ? 94   PRO A CB  1 
ATOM   599  C CG  . PRO A 1 78   ? 41.151  11.300  -4.413  1.00 77.70  ? 94   PRO A CG  1 
ATOM   600  C CD  . PRO A 1 78   ? 41.210  11.502  -2.914  1.00 73.35  ? 94   PRO A CD  1 
ATOM   601  N N   . PHE A 1 79   ? 38.390  8.178   -4.010  1.00 67.07  ? 95   PHE A N   1 
ATOM   602  C CA  . PHE A 1 79   ? 38.479  6.731   -3.944  1.00 66.97  ? 95   PHE A CA  1 
ATOM   603  C C   . PHE A 1 79   ? 39.861  6.209   -4.356  1.00 71.10  ? 95   PHE A C   1 
ATOM   604  O O   . PHE A 1 79   ? 40.620  5.723   -3.508  1.00 70.78  ? 95   PHE A O   1 
ATOM   605  C CB  . PHE A 1 79   ? 37.341  6.097   -4.736  1.00 69.43  ? 95   PHE A CB  1 
ATOM   606  C CG  . PHE A 1 79   ? 37.376  4.593   -4.703  1.00 71.67  ? 95   PHE A CG  1 
ATOM   607  C CD1 . PHE A 1 79   ? 37.114  3.902   -3.527  1.00 75.40  ? 95   PHE A CD1 1 
ATOM   608  C CD2 . PHE A 1 79   ? 37.670  3.865   -5.848  1.00 73.57  ? 95   PHE A CD2 1 
ATOM   609  C CE1 . PHE A 1 79   ? 37.168  2.509   -3.493  1.00 76.60  ? 95   PHE A CE1 1 
ATOM   610  C CE2 . PHE A 1 79   ? 37.735  2.477   -5.809  1.00 77.00  ? 95   PHE A CE2 1 
ATOM   611  C CZ  . PHE A 1 79   ? 37.476  1.807   -4.631  1.00 75.48  ? 95   PHE A CZ  1 
ATOM   612  N N   . LEU A 1 80   ? 40.192  6.349   -5.643  1.00 68.65  ? 96   LEU A N   1 
ATOM   613  C CA  . LEU A 1 80   ? 41.495  6.023   -6.236  1.00 68.08  ? 96   LEU A CA  1 
ATOM   614  C C   . LEU A 1 80   ? 42.074  7.394   -6.629  1.00 73.54  ? 96   LEU A C   1 
ATOM   615  O O   . LEU A 1 80   ? 41.277  8.341   -6.737  1.00 73.37  ? 96   LEU A O   1 
ATOM   616  C CB  . LEU A 1 80   ? 41.353  5.108   -7.468  1.00 67.47  ? 96   LEU A CB  1 
ATOM   617  C CG  . LEU A 1 80   ? 40.966  3.632   -7.236  1.00 71.08  ? 96   LEU A CG  1 
ATOM   618  C CD1 . LEU A 1 80   ? 40.603  2.953   -8.548  1.00 70.94  ? 96   LEU A CD1 1 
ATOM   619  C CD2 . LEU A 1 80   ? 42.054  2.845   -6.546  1.00 71.27  ? 96   LEU A CD2 1 
ATOM   620  N N   . PRO A 1 81   ? 43.414  7.580   -6.797  1.00 70.58  ? 97   PRO A N   1 
ATOM   621  C CA  . PRO A 1 81   ? 43.929  8.935   -7.107  1.00 70.54  ? 97   PRO A CA  1 
ATOM   622  C C   . PRO A 1 81   ? 43.779  9.284   -8.586  1.00 73.77  ? 97   PRO A C   1 
ATOM   623  O O   . PRO A 1 81   ? 44.742  9.235   -9.339  1.00 75.09  ? 97   PRO A O   1 
ATOM   624  C CB  . PRO A 1 81   ? 45.391  8.882   -6.630  1.00 72.50  ? 97   PRO A CB  1 
ATOM   625  C CG  . PRO A 1 81   ? 45.634  7.462   -6.172  1.00 76.75  ? 97   PRO A CG  1 
ATOM   626  C CD  . PRO A 1 81   ? 44.519  6.614   -6.689  1.00 72.09  ? 97   PRO A CD  1 
ATOM   627  N N   . VAL A 1 82   ? 42.536  9.595   -8.997  1.00 68.10  ? 98   VAL A N   1 
ATOM   628  C CA  . VAL A 1 82   ? 42.104  9.883   -10.364 1.00 66.16  ? 98   VAL A CA  1 
ATOM   629  C C   . VAL A 1 82   ? 41.409  11.235  -10.386 1.00 70.61  ? 98   VAL A C   1 
ATOM   630  O O   . VAL A 1 82   ? 40.445  11.443  -9.656  1.00 70.92  ? 98   VAL A O   1 
ATOM   631  C CB  . VAL A 1 82   ? 41.160  8.764   -10.899 1.00 67.85  ? 98   VAL A CB  1 
ATOM   632  C CG1 . VAL A 1 82   ? 40.523  9.153   -12.230 1.00 67.05  ? 98   VAL A CG1 1 
ATOM   633  C CG2 . VAL A 1 82   ? 41.870  7.417   -10.995 1.00 67.01  ? 98   VAL A CG2 1 
ATOM   634  N N   . LEU A 1 83   ? 41.887  12.143  -11.238 1.00 67.27  ? 99   LEU A N   1 
ATOM   635  C CA  . LEU A 1 83   ? 41.289  13.470  -11.396 1.00 66.72  ? 99   LEU A CA  1 
ATOM   636  C C   . LEU A 1 83   ? 41.027  13.690  -12.871 1.00 69.11  ? 99   LEU A C   1 
ATOM   637  O O   . LEU A 1 83   ? 41.800  13.213  -13.700 1.00 70.05  ? 99   LEU A O   1 
ATOM   638  C CB  . LEU A 1 83   ? 42.146  14.605  -10.765 1.00 66.76  ? 99   LEU A CB  1 
ATOM   639  C CG  . LEU A 1 83   ? 42.438  14.533  -9.232  1.00 70.65  ? 99   LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 83   ? 43.351  15.650  -8.799  1.00 70.86  ? 99   LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 83   ? 41.175  14.587  -8.404  1.00 70.00  ? 99   LEU A CD2 1 
ATOM   642  N N   . ARG A 1 84   ? 39.892  14.315  -13.191 1.00 62.97  ? 100  ARG A N   1 
ATOM   643  C CA  . ARG A 1 84   ? 39.412  14.561  -14.536 1.00 62.56  ? 100  ARG A CA  1 
ATOM   644  C C   . ARG A 1 84   ? 39.016  16.033  -14.686 1.00 67.25  ? 100  ARG A C   1 
ATOM   645  O O   . ARG A 1 84   ? 38.255  16.575  -13.874 1.00 65.51  ? 100  ARG A O   1 
ATOM   646  C CB  . ARG A 1 84   ? 38.221  13.600  -14.826 1.00 63.73  ? 100  ARG A CB  1 
ATOM   647  C CG  . ARG A 1 84   ? 37.289  13.917  -16.021 1.00 67.02  ? 100  ARG A CG  1 
ATOM   648  N N   . LEU A 1 85   ? 39.540  16.682  -15.732 1.00 65.38  ? 101  LEU A N   1 
ATOM   649  C CA  . LEU A 1 85   ? 39.183  18.070  -16.000 1.00 65.35  ? 101  LEU A CA  1 
ATOM   650  C C   . LEU A 1 85   ? 37.851  18.146  -16.778 1.00 68.67  ? 101  LEU A C   1 
ATOM   651  O O   . LEU A 1 85   ? 37.619  17.375  -17.704 1.00 69.41  ? 101  LEU A O   1 
ATOM   652  C CB  . LEU A 1 85   ? 40.315  18.836  -16.694 1.00 65.15  ? 101  LEU A CB  1 
ATOM   653  C CG  . LEU A 1 85   ? 41.668  18.826  -15.986 1.00 68.92  ? 101  LEU A CG  1 
ATOM   654  C CD1 . LEU A 1 85   ? 42.756  19.110  -16.982 1.00 69.96  ? 101  LEU A CD1 1 
ATOM   655  C CD2 . LEU A 1 85   ? 41.729  19.850  -14.880 1.00 68.11  ? 101  LEU A CD2 1 
ATOM   656  N N   . VAL A 1 86   ? 36.975  19.044  -16.352 1.00 64.29  ? 102  VAL A N   1 
ATOM   657  C CA  . VAL A 1 86   ? 35.629  19.236  -16.866 1.00 65.00  ? 102  VAL A CA  1 
ATOM   658  C C   . VAL A 1 86   ? 35.374  20.754  -16.943 1.00 71.68  ? 102  VAL A C   1 
ATOM   659  O O   . VAL A 1 86   ? 35.848  21.505  -16.079 1.00 70.55  ? 102  VAL A O   1 
ATOM   660  C CB  . VAL A 1 86   ? 34.627  18.536  -15.868 1.00 69.14  ? 102  VAL A CB  1 
ATOM   661  C CG1 . VAL A 1 86   ? 33.175  18.956  -16.097 1.00 68.87  ? 102  VAL A CG1 1 
ATOM   662  C CG2 . VAL A 1 86   ? 34.755  17.016  -15.914 1.00 68.91  ? 102  VAL A CG2 1 
ATOM   663  N N   . ALA A 1 87   ? 34.579  21.194  -17.932 1.00 70.82  ? 103  ALA A N   1 
ATOM   664  C CA  . ALA A 1 87   ? 34.200  22.596  -18.065 1.00 72.63  ? 103  ALA A CA  1 
ATOM   665  C C   . ALA A 1 87   ? 33.455  23.011  -16.816 1.00 83.75  ? 103  ALA A C   1 
ATOM   666  O O   . ALA A 1 87   ? 32.523  22.304  -16.398 1.00 83.88  ? 103  ALA A O   1 
ATOM   667  C CB  . ALA A 1 87   ? 33.307  22.783  -19.275 1.00 73.26  ? 103  ALA A CB  1 
ATOM   668  N N   . ARG A 1 88   ? 33.887  24.138  -16.204 1.00 85.28  ? 104  ARG A N   1 
ATOM   669  C CA  . ARG A 1 88   ? 33.302  24.692  -14.978 1.00 87.34  ? 104  ARG A CA  1 
ATOM   670  C C   . ARG A 1 88   ? 31.803  24.904  -15.047 1.00 98.65  ? 104  ARG A C   1 
ATOM   671  O O   . ARG A 1 88   ? 31.107  24.441  -14.145 1.00 100.37 ? 104  ARG A O   1 
ATOM   672  C CB  . ARG A 1 88   ? 34.001  25.987  -14.530 1.00 85.70  ? 104  ARG A CB  1 
ATOM   673  C CG  . ARG A 1 88   ? 35.288  25.735  -13.754 1.00 93.79  ? 104  ARG A CG  1 
ATOM   674  C CD  . ARG A 1 88   ? 35.684  26.924  -12.903 1.00 100.88 ? 104  ARG A CD  1 
ATOM   675  N NE  . ARG A 1 88   ? 37.060  26.804  -12.417 1.00 110.06 ? 104  ARG A NE  1 
ATOM   676  C CZ  . ARG A 1 88   ? 37.409  26.257  -11.256 1.00 128.72 ? 104  ARG A CZ  1 
ATOM   677  N NH1 . ARG A 1 88   ? 36.481  25.783  -10.430 1.00 120.29 ? 104  ARG A NH1 1 
ATOM   678  N NH2 . ARG A 1 88   ? 38.686  26.183  -10.908 1.00 114.68 ? 104  ARG A NH2 1 
ATOM   679  N N   . GLU A 1 89   ? 31.310  25.551  -16.127 1.00 98.52  ? 105  GLU A N   1 
ATOM   680  C CA  . GLU A 1 89   ? 29.914  25.943  -16.366 1.00 100.22 ? 105  GLU A CA  1 
ATOM   681  C C   . GLU A 1 89   ? 28.850  24.853  -16.150 1.00 107.78 ? 105  GLU A C   1 
ATOM   682  O O   . GLU A 1 89   ? 29.041  23.680  -16.490 1.00 107.03 ? 105  GLU A O   1 
ATOM   683  C CB  . GLU A 1 89   ? 29.737  26.563  -17.757 1.00 101.79 ? 105  GLU A CB  1 
ATOM   684  N N   . GLY A 1 90   ? 27.725  25.326  -15.607 1.00 107.03 ? 106  GLY A N   1 
ATOM   685  C CA  . GLY A 1 90   ? 26.512  24.609  -15.223 1.00 107.36 ? 106  GLY A CA  1 
ATOM   686  C C   . GLY A 1 90   ? 25.947  25.295  -13.988 1.00 112.47 ? 106  GLY A C   1 
ATOM   687  O O   . GLY A 1 90   ? 26.265  26.469  -13.735 1.00 112.33 ? 106  GLY A O   1 
ATOM   688  N N   . ASP A 1 91   ? 25.123  24.583  -13.193 1.00 108.96 ? 107  ASP A N   1 
ATOM   689  C CA  . ASP A 1 91   ? 24.625  25.144  -11.938 1.00 108.79 ? 107  ASP A CA  1 
ATOM   690  C C   . ASP A 1 91   ? 25.628  24.743  -10.842 1.00 111.57 ? 107  ASP A C   1 
ATOM   691  O O   . ASP A 1 91   ? 25.430  23.738  -10.143 1.00 110.53 ? 107  ASP A O   1 
ATOM   692  C CB  . ASP A 1 91   ? 23.177  24.693  -11.606 1.00 110.87 ? 107  ASP A CB  1 
ATOM   693  C CG  . ASP A 1 91   ? 22.596  25.285  -10.311 1.00 120.86 ? 107  ASP A CG  1 
ATOM   694  O OD1 . ASP A 1 91   ? 23.122  26.326  -9.833  1.00 121.26 ? 107  ASP A OD1 1 
ATOM   695  O OD2 . ASP A 1 91   ? 21.605  24.721  -9.790  1.00 124.39 ? 107  ASP A OD2 1 
ATOM   696  N N   . ARG A 1 92   ? 26.724  25.523  -10.717 1.00 107.21 ? 108  ARG A N   1 
ATOM   697  C CA  . ARG A 1 92   ? 27.769  25.244  -9.733  1.00 106.75 ? 108  ARG A CA  1 
ATOM   698  C C   . ARG A 1 92   ? 27.331  25.612  -8.297  1.00 109.04 ? 108  ARG A C   1 
ATOM   699  O O   . ARG A 1 92   ? 28.135  26.064  -7.468  1.00 108.57 ? 108  ARG A O   1 
ATOM   700  C CB  . ARG A 1 92   ? 29.107  25.883  -10.136 1.00 108.34 ? 108  ARG A CB  1 
ATOM   701  C CG  . ARG A 1 92   ? 29.954  25.000  -11.070 1.00 120.52 ? 108  ARG A CG  1 
ATOM   702  C CD  . ARG A 1 92   ? 31.459  25.228  -10.929 1.00 132.02 ? 108  ARG A CD  1 
ATOM   703  N NE  . ARG A 1 92   ? 31.893  26.536  -11.437 1.00 143.10 ? 108  ARG A NE  1 
ATOM   704  C CZ  . ARG A 1 92   ? 32.175  27.596  -10.679 1.00 156.48 ? 108  ARG A CZ  1 
ATOM   705  N NH1 . ARG A 1 92   ? 32.068  27.526  -9.357  1.00 144.76 ? 108  ARG A NH1 1 
ATOM   706  N NH2 . ARG A 1 92   ? 32.553  28.737  -11.239 1.00 140.12 ? 108  ARG A NH2 1 
ATOM   707  N N   . VAL A 1 93   ? 26.030  25.399  -8.020  1.00 103.52 ? 109  VAL A N   1 
ATOM   708  C CA  . VAL A 1 93   ? 25.398  25.640  -6.731  1.00 101.95 ? 109  VAL A CA  1 
ATOM   709  C C   . VAL A 1 93   ? 24.774  24.336  -6.286  1.00 102.57 ? 109  VAL A C   1 
ATOM   710  O O   . VAL A 1 93   ? 25.131  23.860  -5.218  1.00 102.96 ? 109  VAL A O   1 
ATOM   711  C CB  . VAL A 1 93   ? 24.386  26.798  -6.744  1.00 105.80 ? 109  VAL A CB  1 
ATOM   712  C CG1 . VAL A 1 93   ? 23.994  27.171  -5.322  1.00 105.66 ? 109  VAL A CG1 1 
ATOM   713  C CG2 . VAL A 1 93   ? 24.932  28.016  -7.496  1.00 105.54 ? 109  VAL A CG2 1 
ATOM   714  N N   . LYS A 1 94   ? 23.888  23.728  -7.111  1.00 96.42  ? 110  LYS A N   1 
ATOM   715  C CA  . LYS A 1 94   ? 23.277  22.420  -6.802  1.00 95.09  ? 110  LYS A CA  1 
ATOM   716  C C   . LYS A 1 94   ? 24.342  21.310  -6.852  1.00 96.49  ? 110  LYS A C   1 
ATOM   717  O O   . LYS A 1 94   ? 24.346  20.439  -5.983  1.00 95.57  ? 110  LYS A O   1 
ATOM   718  C CB  . LYS A 1 94   ? 22.093  22.094  -7.736  1.00 96.63  ? 110  LYS A CB  1 
ATOM   719  C CG  . LYS A 1 94   ? 21.098  21.102  -7.138  1.00 102.16 ? 110  LYS A CG  1 
ATOM   720  N N   . LYS A 1 95   ? 25.269  21.382  -7.842  1.00 91.53  ? 111  LYS A N   1 
ATOM   721  C CA  . LYS A 1 95   ? 26.386  20.447  -7.995  1.00 90.43  ? 111  LYS A CA  1 
ATOM   722  C C   . LYS A 1 95   ? 27.257  20.505  -6.724  1.00 91.94  ? 111  LYS A C   1 
ATOM   723  O O   . LYS A 1 95   ? 27.581  19.448  -6.162  1.00 91.95  ? 111  LYS A O   1 
ATOM   724  C CB  . LYS A 1 95   ? 27.210  20.757  -9.261  1.00 92.45  ? 111  LYS A CB  1 
ATOM   725  N N   . LEU A 1 96   ? 27.553  21.741  -6.232  1.00 84.34  ? 112  LEU A N   1 
ATOM   726  C CA  . LEU A 1 96   ? 28.320  21.972  -5.014  1.00 82.44  ? 112  LEU A CA  1 
ATOM   727  C C   . LEU A 1 96   ? 27.565  21.489  -3.745  1.00 84.37  ? 112  LEU A C   1 
ATOM   728  O O   . LEU A 1 96   ? 28.123  20.714  -2.967  1.00 83.96  ? 112  LEU A O   1 
ATOM   729  C CB  . LEU A 1 96   ? 28.705  23.454  -4.910  1.00 82.45  ? 112  LEU A CB  1 
ATOM   730  C CG  . LEU A 1 96   ? 29.767  23.816  -3.854  1.00 87.01  ? 112  LEU A CG  1 
ATOM   731  N N   . ILE A 1 97   ? 26.304  21.921  -3.552  1.00 79.33  ? 113  ILE A N   1 
ATOM   732  C CA  . ILE A 1 97   ? 25.506  21.550  -2.388  1.00 78.10  ? 113  ILE A CA  1 
ATOM   733  C C   . ILE A 1 97   ? 25.309  20.048  -2.301  1.00 81.58  ? 113  ILE A C   1 
ATOM   734  O O   . ILE A 1 97   ? 25.683  19.478  -1.284  1.00 82.09  ? 113  ILE A O   1 
ATOM   735  C CB  . ILE A 1 97   ? 24.174  22.335  -2.274  1.00 80.96  ? 113  ILE A CB  1 
ATOM   736  C CG1 . ILE A 1 97   ? 24.446  23.834  -2.010  1.00 80.96  ? 113  ILE A CG1 1 
ATOM   737  C CG2 . ILE A 1 97   ? 23.299  21.757  -1.139  1.00 82.15  ? 113  ILE A CG2 1 
ATOM   738  C CD1 . ILE A 1 97   ? 23.277  24.776  -2.428  1.00 87.51  ? 113  ILE A CD1 1 
ATOM   739  N N   . ASN A 1 98   ? 24.758  19.402  -3.353  1.00 77.26  ? 114  ASN A N   1 
ATOM   740  C CA  . ASN A 1 98   ? 24.516  17.952  -3.371  1.00 76.11  ? 114  ASN A CA  1 
ATOM   741  C C   . ASN A 1 98   ? 25.709  17.124  -2.911  1.00 78.72  ? 114  ASN A C   1 
ATOM   742  O O   . ASN A 1 98   ? 25.543  16.205  -2.122  1.00 78.74  ? 114  ASN A O   1 
ATOM   743  C CB  . ASN A 1 98   ? 24.034  17.497  -4.734  1.00 76.43  ? 114  ASN A CB  1 
ATOM   744  C CG  . ASN A 1 98   ? 22.601  17.872  -5.014  1.00 96.67  ? 114  ASN A CG  1 
ATOM   745  O OD1 . ASN A 1 98   ? 22.193  19.029  -4.895  1.00 91.30  ? 114  ASN A OD1 1 
ATOM   746  N ND2 . ASN A 1 98   ? 21.801  16.895  -5.389  1.00 86.48  ? 114  ASN A ND2 1 
ATOM   747  N N   . SER A 1 99   ? 26.912  17.494  -3.358  1.00 74.43  ? 115  SER A N   1 
ATOM   748  C CA  . SER A 1 99   ? 28.187  16.875  -3.004  1.00 73.36  ? 115  SER A CA  1 
ATOM   749  C C   . SER A 1 99   ? 28.486  17.024  -1.507  1.00 75.52  ? 115  SER A C   1 
ATOM   750  O O   . SER A 1 99   ? 28.692  16.014  -0.835  1.00 76.25  ? 115  SER A O   1 
ATOM   751  C CB  . SER A 1 99   ? 29.315  17.491  -3.829  1.00 76.87  ? 115  SER A CB  1 
ATOM   752  O OG  . SER A 1 99   ? 29.235  17.072  -5.181  1.00 89.41  ? 115  SER A OG  1 
ATOM   753  N N   . GLN A 1 100  ? 28.510  18.274  -0.990  1.00 69.80  ? 116  GLN A N   1 
ATOM   754  C CA  . GLN A 1 100  ? 28.749  18.575  0.420   1.00 68.96  ? 116  GLN A CA  1 
ATOM   755  C C   . GLN A 1 100  ? 27.774  17.790  1.313   1.00 71.79  ? 116  GLN A C   1 
ATOM   756  O O   . GLN A 1 100  ? 28.239  17.218  2.296   1.00 74.16  ? 116  GLN A O   1 
ATOM   757  C CB  . GLN A 1 100  ? 28.635  20.071  0.708   1.00 70.52  ? 116  GLN A CB  1 
ATOM   758  C CG  . GLN A 1 100  ? 29.630  20.971  -0.017  1.00 96.90  ? 116  GLN A CG  1 
ATOM   759  C CD  . GLN A 1 100  ? 29.126  22.401  -0.016  1.00 125.68 ? 116  GLN A CD  1 
ATOM   760  O OE1 . GLN A 1 100  ? 28.326  22.812  -0.870  1.00 122.51 ? 116  GLN A OE1 1 
ATOM   761  N NE2 . GLN A 1 100  ? 29.543  23.182  0.973   1.00 119.56 ? 116  GLN A NE2 1 
ATOM   762  N N   . ILE A 1 101  ? 26.465  17.682  0.936   1.00 63.31  ? 117  ILE A N   1 
ATOM   763  C CA  . ILE A 1 101  ? 25.455  16.905  1.665   1.00 61.76  ? 117  ILE A CA  1 
ATOM   764  C C   . ILE A 1 101  ? 25.909  15.448  1.859   1.00 68.79  ? 117  ILE A C   1 
ATOM   765  O O   . ILE A 1 101  ? 25.939  14.975  2.996   1.00 70.16  ? 117  ILE A O   1 
ATOM   766  C CB  . ILE A 1 101  ? 24.047  16.996  1.006   1.00 63.75  ? 117  ILE A CB  1 
ATOM   767  C CG1 . ILE A 1 101  ? 23.369  18.354  1.289   1.00 62.88  ? 117  ILE A CG1 1 
ATOM   768  C CG2 . ILE A 1 101  ? 23.123  15.809  1.398   1.00 63.10  ? 117  ILE A CG2 1 
ATOM   769  C CD1 . ILE A 1 101  ? 22.089  18.601  0.494   1.00 62.84  ? 117  ILE A CD1 1 
ATOM   770  N N   . SER A 1 102  ? 26.292  14.758  0.755   1.00 66.39  ? 118  SER A N   1 
ATOM   771  C CA  . SER A 1 102  ? 26.731  13.353  0.710   1.00 65.67  ? 118  SER A CA  1 
ATOM   772  C C   . SER A 1 102  ? 27.890  13.091  1.655   1.00 69.55  ? 118  SER A C   1 
ATOM   773  O O   . SER A 1 102  ? 27.926  12.063  2.342   1.00 68.28  ? 118  SER A O   1 
ATOM   774  C CB  . SER A 1 102  ? 27.082  12.944  -0.719  1.00 68.79  ? 118  SER A CB  1 
ATOM   775  O OG  . SER A 1 102  ? 25.916  12.820  -1.523  1.00 77.16  ? 118  SER A OG  1 
ATOM   776  N N   . LEU A 1 103  ? 28.807  14.052  1.731   1.00 67.50  ? 119  LEU A N   1 
ATOM   777  C CA  . LEU A 1 103  ? 29.956  13.964  2.618   1.00 68.31  ? 119  LEU A CA  1 
ATOM   778  C C   . LEU A 1 103  ? 29.493  14.108  4.090   1.00 71.56  ? 119  LEU A C   1 
ATOM   779  O O   . LEU A 1 103  ? 29.784  13.243  4.926   1.00 71.01  ? 119  LEU A O   1 
ATOM   780  C CB  . LEU A 1 103  ? 30.978  15.063  2.244   1.00 68.51  ? 119  LEU A CB  1 
ATOM   781  N N   . LEU A 1 104  ? 28.713  15.177  4.352   1.00 66.96  ? 120  LEU A N   1 
ATOM   782  C CA  . LEU A 1 104  ? 28.188  15.619  5.633   1.00 66.35  ? 120  LEU A CA  1 
ATOM   783  C C   . LEU A 1 104  ? 27.317  14.589  6.327   1.00 71.15  ? 120  LEU A C   1 
ATOM   784  O O   . LEU A 1 104  ? 27.502  14.367  7.522   1.00 70.36  ? 120  LEU A O   1 
ATOM   785  C CB  . LEU A 1 104  ? 27.448  16.956  5.440   1.00 66.22  ? 120  LEU A CB  1 
ATOM   786  C CG  . LEU A 1 104  ? 27.045  17.790  6.650   1.00 71.25  ? 120  LEU A CG  1 
ATOM   787  C CD1 . LEU A 1 104  ? 28.234  18.114  7.554   1.00 71.22  ? 120  LEU A CD1 1 
ATOM   788  C CD2 . LEU A 1 104  ? 26.418  19.088  6.199   1.00 74.40  ? 120  LEU A CD2 1 
ATOM   789  N N   . ILE A 1 105  ? 26.399  13.944  5.588   1.00 68.41  ? 121  ILE A N   1 
ATOM   790  C CA  . ILE A 1 105  ? 25.470  12.936  6.135   1.00 67.95  ? 121  ILE A CA  1 
ATOM   791  C C   . ILE A 1 105  ? 26.082  11.522  6.181   1.00 75.10  ? 121  ILE A C   1 
ATOM   792  O O   . ILE A 1 105  ? 25.509  10.629  6.816   1.00 75.27  ? 121  ILE A O   1 
ATOM   793  C CB  . ILE A 1 105  ? 24.109  12.968  5.390   1.00 69.66  ? 121  ILE A CB  1 
ATOM   794  C CG1 . ILE A 1 105  ? 24.204  12.318  3.991   1.00 68.63  ? 121  ILE A CG1 1 
ATOM   795  C CG2 . ILE A 1 105  ? 23.562  14.416  5.332   1.00 70.15  ? 121  ILE A CG2 1 
ATOM   796  C CD1 . ILE A 1 105  ? 22.901  11.834  3.385   1.00 71.58  ? 121  ILE A CD1 1 
ATOM   797  N N   . GLY A 1 106  ? 27.225  11.347  5.503   1.00 72.83  ? 122  GLY A N   1 
ATOM   798  C CA  . GLY A 1 106  ? 27.937  10.080  5.411   1.00 73.19  ? 122  GLY A CA  1 
ATOM   799  C C   . GLY A 1 106  ? 27.167  9.012   4.652   1.00 78.72  ? 122  GLY A C   1 
ATOM   800  O O   . GLY A 1 106  ? 27.146  7.839   5.058   1.00 79.95  ? 122  GLY A O   1 
ATOM   801  N N   . LYS A 1 107  ? 26.522  9.428   3.541   1.00 73.74  ? 123  LYS A N   1 
ATOM   802  C CA  . LYS A 1 107  ? 25.730  8.599   2.630   1.00 72.83  ? 123  LYS A CA  1 
ATOM   803  C C   . LYS A 1 107  ? 25.504  9.400   1.353   1.00 77.80  ? 123  LYS A C   1 
ATOM   804  O O   . LYS A 1 107  ? 25.048  10.546  1.407   1.00 78.00  ? 123  LYS A O   1 
ATOM   805  C CB  . LYS A 1 107  ? 24.377  8.214   3.261   1.00 74.36  ? 123  LYS A CB  1 
ATOM   806  C CG  . LYS A 1 107  ? 23.640  7.118   2.502   1.00 81.09  ? 123  LYS A CG  1 
ATOM   807  C CD  . LYS A 1 107  ? 22.273  6.825   3.113   1.00 83.41  ? 123  LYS A CD  1 
ATOM   808  C CE  . LYS A 1 107  ? 21.582  5.652   2.445   1.00 83.45  ? 123  LYS A CE  1 
ATOM   809  N NZ  . LYS A 1 107  ? 22.032  4.348   2.997   1.00 88.05  ? 123  LYS A NZ  1 
ATOM   810  N N   . GLY A 1 108  ? 25.821  8.796   0.215   1.00 73.90  ? 124  GLY A N   1 
ATOM   811  C CA  . GLY A 1 108  ? 25.632  9.442   -1.074  1.00 73.16  ? 124  GLY A CA  1 
ATOM   812  C C   . GLY A 1 108  ? 24.170  9.518   -1.455  1.00 76.75  ? 124  GLY A C   1 
ATOM   813  O O   . GLY A 1 108  ? 23.434  8.541   -1.278  1.00 75.81  ? 124  GLY A O   1 
ATOM   814  N N   . LEU A 1 109  ? 23.734  10.673  -2.006  1.00 73.42  ? 125  LEU A N   1 
ATOM   815  C CA  . LEU A 1 109  ? 22.342  10.850  -2.438  1.00 72.90  ? 125  LEU A CA  1 
ATOM   816  C C   . LEU A 1 109  ? 21.943  9.837   -3.524  1.00 76.55  ? 125  LEU A C   1 
ATOM   817  O O   . LEU A 1 109  ? 20.761  9.504   -3.649  1.00 76.74  ? 125  LEU A O   1 
ATOM   818  C CB  . LEU A 1 109  ? 22.046  12.296  -2.865  1.00 72.75  ? 125  LEU A CB  1 
ATOM   819  C CG  . LEU A 1 109  ? 22.344  13.376  -1.814  1.00 77.89  ? 125  LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 109  ? 22.116  14.766  -2.368  1.00 77.65  ? 125  LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 109  ? 21.515  13.168  -0.553  1.00 81.14  ? 125  LEU A CD2 1 
ATOM   822  N N   . HIS A 1 110  ? 22.943  9.298   -4.256  1.00 71.29  ? 126  HIS A N   1 
ATOM   823  C CA  . HIS A 1 110  ? 22.729  8.292   -5.295  1.00 70.49  ? 126  HIS A CA  1 
ATOM   824  C C   . HIS A 1 110  ? 22.127  7.030   -4.708  1.00 72.83  ? 126  HIS A C   1 
ATOM   825  O O   . HIS A 1 110  ? 21.321  6.402   -5.385  1.00 73.11  ? 126  HIS A O   1 
ATOM   826  C CB  . HIS A 1 110  ? 24.019  7.991   -6.079  1.00 71.44  ? 126  HIS A CB  1 
ATOM   827  C CG  . HIS A 1 110  ? 25.098  7.338   -5.269  1.00 74.88  ? 126  HIS A CG  1 
ATOM   828  N ND1 . HIS A 1 110  ? 25.181  5.952   -5.154  1.00 76.60  ? 126  HIS A ND1 1 
ATOM   829  C CD2 . HIS A 1 110  ? 26.105  7.897   -4.556  1.00 76.14  ? 126  HIS A CD2 1 
ATOM   830  C CE1 . HIS A 1 110  ? 26.235  5.719   -4.386  1.00 75.76  ? 126  HIS A CE1 1 
ATOM   831  N NE2 . HIS A 1 110  ? 26.812  6.857   -3.991  1.00 75.98  ? 126  HIS A NE2 1 
ATOM   832  N N   . GLU A 1 111  ? 22.448  6.699   -3.428  1.00 67.31  ? 127  GLU A N   1 
ATOM   833  C CA  . GLU A 1 111  ? 21.872  5.533   -2.760  1.00 66.61  ? 127  GLU A CA  1 
ATOM   834  C C   . GLU A 1 111  ? 20.364  5.688   -2.725  1.00 73.08  ? 127  GLU A C   1 
ATOM   835  O O   . GLU A 1 111  ? 19.658  4.707   -2.968  1.00 72.87  ? 127  GLU A O   1 
ATOM   836  C CB  . GLU A 1 111  ? 22.439  5.316   -1.356  1.00 67.44  ? 127  GLU A CB  1 
ATOM   837  C CG  . GLU A 1 111  ? 23.957  5.326   -1.324  1.00 76.14  ? 127  GLU A CG  1 
ATOM   838  C CD  . GLU A 1 111  ? 24.632  4.263   -0.483  1.00 100.38 ? 127  GLU A CD  1 
ATOM   839  O OE1 . GLU A 1 111  ? 24.359  4.188   0.738   1.00 91.36  ? 127  GLU A OE1 1 
ATOM   840  O OE2 . GLU A 1 111  ? 25.495  3.548   -1.043  1.00 96.97  ? 127  GLU A OE2 1 
ATOM   841  N N   . PHE A 1 112  ? 19.870  6.944   -2.545  1.00 71.32  ? 128  PHE A N   1 
ATOM   842  C CA  . PHE A 1 112  ? 18.434  7.249   -2.552  1.00 71.62  ? 128  PHE A CA  1 
ATOM   843  C C   . PHE A 1 112  ? 17.813  7.057   -3.971  1.00 77.10  ? 128  PHE A C   1 
ATOM   844  O O   . PHE A 1 112  ? 16.709  6.494   -4.112  1.00 77.91  ? 128  PHE A O   1 
ATOM   845  C CB  . PHE A 1 112  ? 18.161  8.658   -1.992  1.00 73.10  ? 128  PHE A CB  1 
ATOM   846  C CG  . PHE A 1 112  ? 18.733  8.985   -0.622  1.00 74.63  ? 128  PHE A CG  1 
ATOM   847  C CD1 . PHE A 1 112  ? 18.707  8.046   0.406   1.00 77.44  ? 128  PHE A CD1 1 
ATOM   848  C CD2 . PHE A 1 112  ? 19.173  10.270  -0.323  1.00 76.09  ? 128  PHE A CD2 1 
ATOM   849  C CE1 . PHE A 1 112  ? 19.164  8.367   1.684   1.00 77.65  ? 128  PHE A CE1 1 
ATOM   850  C CE2 . PHE A 1 112  ? 19.643  10.583  0.952   1.00 78.61  ? 128  PHE A CE2 1 
ATOM   851  C CZ  . PHE A 1 112  ? 19.654  9.623   1.940   1.00 76.56  ? 128  PHE A CZ  1 
ATOM   852  N N   . ASP A 1 113  ? 18.543  7.488   -5.011  1.00 72.14  ? 129  ASP A N   1 
ATOM   853  C CA  . ASP A 1 113  ? 18.099  7.345   -6.392  1.00 72.01  ? 129  ASP A CA  1 
ATOM   854  C C   . ASP A 1 113  ? 18.026  5.842   -6.770  1.00 76.40  ? 129  ASP A C   1 
ATOM   855  O O   . ASP A 1 113  ? 16.965  5.370   -7.186  1.00 74.96  ? 129  ASP A O   1 
ATOM   856  C CB  . ASP A 1 113  ? 19.025  8.141   -7.323  1.00 74.24  ? 129  ASP A CB  1 
ATOM   857  C CG  . ASP A 1 113  ? 19.101  9.636   -7.016  1.00 89.24  ? 129  ASP A CG  1 
ATOM   858  O OD1 . ASP A 1 113  ? 18.048  10.323  -7.117  1.00 91.21  ? 129  ASP A OD1 1 
ATOM   859  O OD2 . ASP A 1 113  ? 20.225  10.132  -6.731  1.00 92.51  ? 129  ASP A OD2 1 
ATOM   860  N N   . SER A 1 114  ? 19.121  5.084   -6.506  1.00 74.40  ? 130  SER A N   1 
ATOM   861  C CA  . SER A 1 114  ? 19.272  3.634   -6.730  1.00 74.54  ? 130  SER A CA  1 
ATOM   862  C C   . SER A 1 114  ? 18.011  2.794   -6.399  1.00 81.41  ? 130  SER A C   1 
ATOM   863  O O   . SER A 1 114  ? 17.707  1.852   -7.145  1.00 82.89  ? 130  SER A O   1 
ATOM   864  C CB  . SER A 1 114  ? 20.427  3.073   -5.900  1.00 75.58  ? 130  SER A CB  1 
ATOM   865  O OG  . SER A 1 114  ? 21.646  3.778   -6.041  1.00 84.00  ? 130  SER A OG  1 
ATOM   866  N N   . LEU A 1 115  ? 17.320  3.111   -5.270  1.00 76.07  ? 131  LEU A N   1 
ATOM   867  C CA  . LEU A 1 115  ? 16.164  2.371   -4.751  1.00 75.50  ? 131  LEU A CA  1 
ATOM   868  C C   . LEU A 1 115  ? 14.964  2.269   -5.674  1.00 81.01  ? 131  LEU A C   1 
ATOM   869  O O   . LEU A 1 115  ? 14.172  1.328   -5.540  1.00 80.08  ? 131  LEU A O   1 
ATOM   870  C CB  . LEU A 1 115  ? 15.694  2.961   -3.401  1.00 75.02  ? 131  LEU A CB  1 
ATOM   871  C CG  . LEU A 1 115  ? 16.671  2.961   -2.232  1.00 78.52  ? 131  LEU A CG  1 
ATOM   872  C CD1 . LEU A 1 115  ? 16.112  3.752   -1.105  1.00 78.68  ? 131  LEU A CD1 1 
ATOM   873  C CD2 . LEU A 1 115  ? 17.026  1.536   -1.759  1.00 77.45  ? 131  LEU A CD2 1 
ATOM   874  N N   . CYS A 1 116  ? 14.778  3.280   -6.547  1.00 79.59  ? 132  CYS A N   1 
ATOM   875  C CA  . CYS A 1 116  ? 13.639  3.397   -7.462  1.00 80.24  ? 132  CYS A CA  1 
ATOM   876  C C   . CYS A 1 116  ? 12.331  3.211   -6.701  1.00 83.81  ? 132  CYS A C   1 
ATOM   877  O O   . CYS A 1 116  ? 11.481  2.400   -7.053  1.00 83.65  ? 132  CYS A O   1 
ATOM   878  C CB  . CYS A 1 116  ? 13.771  2.450   -8.650  1.00 81.07  ? 132  CYS A CB  1 
ATOM   879  S SG  . CYS A 1 116  ? 15.344  2.613   -9.527  1.00 85.53  ? 132  CYS A SG  1 
ATOM   880  N N   . ASP A 1 117  ? 12.238  3.940   -5.588  1.00 79.48  ? 133  ASP A N   1 
ATOM   881  C CA  . ASP A 1 117  ? 11.094  3.978   -4.710  1.00 77.93  ? 133  ASP A CA  1 
ATOM   882  C C   . ASP A 1 117  ? 10.500  5.392   -4.819  1.00 79.29  ? 133  ASP A C   1 
ATOM   883  O O   . ASP A 1 117  ? 11.173  6.383   -4.492  1.00 76.80  ? 133  ASP A O   1 
ATOM   884  C CB  . ASP A 1 117  ? 11.495  3.623   -3.264  1.00 79.26  ? 133  ASP A CB  1 
ATOM   885  C CG  . ASP A 1 117  ? 10.376  3.600   -2.226  1.00 88.45  ? 133  ASP A CG  1 
ATOM   886  O OD1 . ASP A 1 117  ? 9.214   3.933   -2.580  1.00 88.26  ? 133  ASP A OD1 1 
ATOM   887  O OD2 . ASP A 1 117  ? 10.658  3.247   -1.059  1.00 95.39  ? 133  ASP A OD2 1 
ATOM   888  N N   . PRO A 1 118  ? 9.234   5.488   -5.305  1.00 75.42  ? 134  PRO A N   1 
ATOM   889  C CA  . PRO A 1 118  ? 8.591   6.807   -5.407  1.00 74.74  ? 134  PRO A CA  1 
ATOM   890  C C   . PRO A 1 118  ? 8.404   7.475   -4.047  1.00 75.45  ? 134  PRO A C   1 
ATOM   891  O O   . PRO A 1 118  ? 8.605   8.683   -3.957  1.00 74.58  ? 134  PRO A O   1 
ATOM   892  C CB  . PRO A 1 118  ? 7.266   6.515   -6.114  1.00 76.48  ? 134  PRO A CB  1 
ATOM   893  C CG  . PRO A 1 118  ? 7.004   5.077   -5.856  1.00 80.70  ? 134  PRO A CG  1 
ATOM   894  C CD  . PRO A 1 118  ? 8.329   4.409   -5.763  1.00 76.28  ? 134  PRO A CD  1 
ATOM   895  N N   . GLU A 1 119  ? 8.112   6.695   -2.985  1.00 69.32  ? 135  GLU A N   1 
ATOM   896  C CA  . GLU A 1 119  ? 7.964   7.259   -1.637  1.00 68.46  ? 135  GLU A CA  1 
ATOM   897  C C   . GLU A 1 119  ? 9.177   8.106   -1.261  1.00 68.25  ? 135  GLU A C   1 
ATOM   898  O O   . GLU A 1 119  ? 9.025   9.206   -0.726  1.00 67.91  ? 135  GLU A O   1 
ATOM   899  C CB  . GLU A 1 119  ? 7.765   6.147   -0.597  1.00 70.40  ? 135  GLU A CB  1 
ATOM   900  C CG  . GLU A 1 119  ? 7.357   6.691   0.760   1.00 82.07  ? 135  GLU A CG  1 
ATOM   901  C CD  . GLU A 1 119  ? 6.995   5.691   1.832   1.00 90.93  ? 135  GLU A CD  1 
ATOM   902  O OE1 . GLU A 1 119  ? 7.401   4.511   1.733   1.00 80.02  ? 135  GLU A OE1 1 
ATOM   903  O OE2 . GLU A 1 119  ? 6.337   6.115   2.806   1.00 85.20  ? 135  GLU A OE2 1 
ATOM   904  N N   . VAL A 1 120  ? 10.372  7.573   -1.551  1.00 61.93  ? 136  VAL A N   1 
ATOM   905  C CA  . VAL A 1 120  ? 11.653  8.209   -1.317  1.00 60.70  ? 136  VAL A CA  1 
ATOM   906  C C   . VAL A 1 120  ? 11.763  9.461   -2.197  1.00 66.32  ? 136  VAL A C   1 
ATOM   907  O O   . VAL A 1 120  ? 12.147  10.518  -1.722  1.00 65.44  ? 136  VAL A O   1 
ATOM   908  C CB  . VAL A 1 120  ? 12.804  7.197   -1.568  1.00 63.49  ? 136  VAL A CB  1 
ATOM   909  C CG1 . VAL A 1 120  ? 14.172  7.848   -1.386  1.00 63.97  ? 136  VAL A CG1 1 
ATOM   910  C CG2 . VAL A 1 120  ? 12.682  5.982   -0.661  1.00 62.43  ? 136  VAL A CG2 1 
ATOM   911  N N   . ASN A 1 121  ? 11.360  9.348   -3.459  1.00 65.97  ? 137  ASN A N   1 
ATOM   912  C CA  . ASN A 1 121  ? 11.446  10.426  -4.437  1.00 66.59  ? 137  ASN A CA  1 
ATOM   913  C C   . ASN A 1 121  ? 10.483  11.580  -4.163  1.00 71.39  ? 137  ASN A C   1 
ATOM   914  O O   . ASN A 1 121  ? 10.875  12.744  -4.302  1.00 71.98  ? 137  ASN A O   1 
ATOM   915  C CB  . ASN A 1 121  ? 11.288  9.853   -5.840  1.00 69.79  ? 137  ASN A CB  1 
ATOM   916  C CG  . ASN A 1 121  ? 12.371  8.839   -6.173  1.00 101.07 ? 137  ASN A CG  1 
ATOM   917  O OD1 . ASN A 1 121  ? 13.555  8.981   -5.799  1.00 95.61  ? 137  ASN A OD1 1 
ATOM   918  N ND2 . ASN A 1 121  ? 11.979  7.770   -6.848  1.00 95.51  ? 137  ASN A ND2 1 
ATOM   919  N N   . ASP A 1 122  ? 9.258   11.263  -3.728  1.00 67.25  ? 138  ASP A N   1 
ATOM   920  C CA  . ASP A 1 122  ? 8.238   12.240  -3.374  1.00 67.26  ? 138  ASP A CA  1 
ATOM   921  C C   . ASP A 1 122  ? 8.628   12.964  -2.096  1.00 73.11  ? 138  ASP A C   1 
ATOM   922  O O   . ASP A 1 122  ? 8.393   14.175  -1.997  1.00 74.53  ? 138  ASP A O   1 
ATOM   923  C CB  . ASP A 1 122  ? 6.872   11.564  -3.205  1.00 69.27  ? 138  ASP A CB  1 
ATOM   924  C CG  . ASP A 1 122  ? 6.374   10.850  -4.446  1.00 83.12  ? 138  ASP A CG  1 
ATOM   925  O OD1 . ASP A 1 122  ? 6.487   11.431  -5.556  1.00 86.95  ? 138  ASP A OD1 1 
ATOM   926  O OD2 . ASP A 1 122  ? 5.888   9.712   -4.317  1.00 82.61  ? 138  ASP A OD2 1 
ATOM   927  N N   . PHE A 1 123  ? 9.233   12.233  -1.117  1.00 68.49  ? 139  PHE A N   1 
ATOM   928  C CA  . PHE A 1 123  ? 9.690   12.830  0.138   1.00 67.61  ? 139  PHE A CA  1 
ATOM   929  C C   . PHE A 1 123  ? 10.694  13.896  -0.251  1.00 71.47  ? 139  PHE A C   1 
ATOM   930  O O   . PHE A 1 123  ? 10.460  15.073  0.022   1.00 72.27  ? 139  PHE A O   1 
ATOM   931  C CB  . PHE A 1 123  ? 10.347  11.790  1.087   1.00 68.81  ? 139  PHE A CB  1 
ATOM   932  C CG  . PHE A 1 123  ? 10.853  12.382  2.392   1.00 69.98  ? 139  PHE A CG  1 
ATOM   933  C CD1 . PHE A 1 123  ? 12.064  13.071  2.445   1.00 73.02  ? 139  PHE A CD1 1 
ATOM   934  C CD2 . PHE A 1 123  ? 10.117  12.260  3.565   1.00 71.14  ? 139  PHE A CD2 1 
ATOM   935  C CE1 . PHE A 1 123  ? 12.507  13.648  3.638   1.00 73.28  ? 139  PHE A CE1 1 
ATOM   936  C CE2 . PHE A 1 123  ? 10.573  12.827  4.759   1.00 73.27  ? 139  PHE A CE2 1 
ATOM   937  C CZ  . PHE A 1 123  ? 11.765  13.508  4.789   1.00 71.36  ? 139  PHE A CZ  1 
ATOM   938  N N   . ARG A 1 124  ? 11.758  13.480  -0.972  1.00 65.90  ? 140  ARG A N   1 
ATOM   939  C CA  . ARG A 1 124  ? 12.858  14.327  -1.448  1.00 64.72  ? 140  ARG A CA  1 
ATOM   940  C C   . ARG A 1 124  ? 12.404  15.579  -2.162  1.00 68.79  ? 140  ARG A C   1 
ATOM   941  O O   . ARG A 1 124  ? 12.866  16.651  -1.804  1.00 67.91  ? 140  ARG A O   1 
ATOM   942  C CB  . ARG A 1 124  ? 13.836  13.534  -2.304  1.00 59.83  ? 140  ARG A CB  1 
ATOM   943  C CG  . ARG A 1 124  ? 14.612  12.564  -1.450  1.00 61.53  ? 140  ARG A CG  1 
ATOM   944  C CD  . ARG A 1 124  ? 15.584  11.791  -2.254  1.00 67.85  ? 140  ARG A CD  1 
ATOM   945  N NE  . ARG A 1 124  ? 16.787  12.581  -2.475  1.00 69.51  ? 140  ARG A NE  1 
ATOM   946  C CZ  . ARG A 1 124  ? 17.597  12.405  -3.502  1.00 75.74  ? 140  ARG A CZ  1 
ATOM   947  N NH1 . ARG A 1 124  ? 17.331  11.475  -4.414  1.00 64.26  ? 140  ARG A NH1 1 
ATOM   948  N NH2 . ARG A 1 124  ? 18.687  13.145  -3.625  1.00 57.87  ? 140  ARG A NH2 1 
ATOM   949  N N   . ALA A 1 125  ? 11.458  15.459  -3.114  1.00 65.60  ? 141  ALA A N   1 
ATOM   950  C CA  . ALA A 1 125  ? 10.943  16.608  -3.851  1.00 64.86  ? 141  ALA A CA  1 
ATOM   951  C C   . ALA A 1 125  ? 10.217  17.587  -2.908  1.00 71.11  ? 141  ALA A C   1 
ATOM   952  O O   . ALA A 1 125  ? 10.620  18.756  -2.808  1.00 71.59  ? 141  ALA A O   1 
ATOM   953  C CB  . ALA A 1 125  ? 10.031  16.145  -4.977  1.00 64.83  ? 141  ALA A CB  1 
ATOM   954  N N   . LYS A 1 126  ? 9.212   17.085  -2.155  1.00 67.13  ? 142  LYS A N   1 
ATOM   955  C CA  . LYS A 1 126  ? 8.389   17.889  -1.237  1.00 66.28  ? 142  LYS A CA  1 
ATOM   956  C C   . LYS A 1 126  ? 9.171   18.542  -0.115  1.00 71.30  ? 142  LYS A C   1 
ATOM   957  O O   . LYS A 1 126  ? 8.964   19.725  0.151   1.00 69.64  ? 142  LYS A O   1 
ATOM   958  C CB  . LYS A 1 126  ? 7.233   17.042  -0.670  1.00 66.23  ? 142  LYS A CB  1 
ATOM   959  C CG  . LYS A 1 126  ? 6.202   17.810  0.136   1.00 63.39  ? 142  LYS A CG  1 
ATOM   960  C CD  . LYS A 1 126  ? 5.150   16.832  0.635   1.00 73.45  ? 142  LYS A CD  1 
ATOM   961  C CE  . LYS A 1 126  ? 4.259   17.347  1.728   1.00 77.22  ? 142  LYS A CE  1 
ATOM   962  N NZ  . LYS A 1 126  ? 3.267   16.312  2.131   1.00 82.38  ? 142  LYS A NZ  1 
ATOM   963  N N   . MET A 1 127  ? 10.050  17.764  0.545   1.00 70.32  ? 143  MET A N   1 
ATOM   964  C CA  . MET A 1 127  ? 10.797  18.211  1.712   1.00 71.42  ? 143  MET A CA  1 
ATOM   965  C C   . MET A 1 127  ? 11.922  19.149  1.364   1.00 78.35  ? 143  MET A C   1 
ATOM   966  O O   . MET A 1 127  ? 12.091  20.166  2.059   1.00 78.33  ? 143  MET A O   1 
ATOM   967  C CB  . MET A 1 127  ? 11.264  17.045  2.585   1.00 73.43  ? 143  MET A CB  1 
ATOM   968  C CG  . MET A 1 127  ? 10.110  16.296  3.225   1.00 76.93  ? 143  MET A CG  1 
ATOM   969  S SD  . MET A 1 127  ? 9.153   17.276  4.408   1.00 80.87  ? 143  MET A SD  1 
ATOM   970  C CE  . MET A 1 127  ? 7.647   17.468  3.515   1.00 77.63  ? 143  MET A CE  1 
ATOM   971  N N   . CYS A 1 128  ? 12.643  18.865  0.267   1.00 75.56  ? 144  CYS A N   1 
ATOM   972  C CA  . CYS A 1 128  ? 13.705  19.765  -0.171  1.00 75.91  ? 144  CYS A CA  1 
ATOM   973  C C   . CYS A 1 128  ? 13.106  21.115  -0.614  1.00 78.15  ? 144  CYS A C   1 
ATOM   974  O O   . CYS A 1 128  ? 13.647  22.156  -0.246  1.00 76.77  ? 144  CYS A O   1 
ATOM   975  C CB  . CYS A 1 128  ? 14.576  19.128  -1.249  1.00 76.76  ? 144  CYS A CB  1 
ATOM   976  S SG  . CYS A 1 128  ? 15.513  17.666  -0.688  1.00 80.72  ? 144  CYS A SG  1 
ATOM   977  N N   . GLN A 1 129  ? 11.925  21.095  -1.274  1.00 74.43  ? 145  GLN A N   1 
ATOM   978  C CA  . GLN A 1 129  ? 11.234  22.321  -1.687  1.00 74.23  ? 145  GLN A CA  1 
ATOM   979  C C   . GLN A 1 129  ? 10.768  23.155  -0.469  1.00 77.23  ? 145  GLN A C   1 
ATOM   980  O O   . GLN A 1 129  ? 11.110  24.337  -0.406  1.00 77.13  ? 145  GLN A O   1 
ATOM   981  C CB  . GLN A 1 129  ? 10.103  22.020  -2.694  1.00 76.16  ? 145  GLN A CB  1 
ATOM   982  C CG  . GLN A 1 129  ? 8.821   22.862  -2.556  1.00 96.92  ? 145  GLN A CG  1 
ATOM   983  C CD  . GLN A 1 129  ? 8.534   23.747  -3.737  1.00 119.55 ? 145  GLN A CD  1 
ATOM   984  O OE1 . GLN A 1 129  ? 9.435   24.280  -4.400  1.00 119.04 ? 145  GLN A OE1 1 
ATOM   985  N NE2 . GLN A 1 129  ? 7.256   23.958  -3.996  1.00 110.92 ? 145  GLN A NE2 1 
ATOM   986  N N   . PHE A 1 130  ? 10.054  22.537  0.512   1.00 72.72  ? 146  PHE A N   1 
ATOM   987  C CA  . PHE A 1 130  ? 9.574   23.210  1.727   1.00 72.13  ? 146  PHE A CA  1 
ATOM   988  C C   . PHE A 1 130  ? 10.728  23.886  2.439   1.00 75.33  ? 146  PHE A C   1 
ATOM   989  O O   . PHE A 1 130  ? 10.608  25.023  2.872   1.00 75.58  ? 146  PHE A O   1 
ATOM   990  C CB  . PHE A 1 130  ? 8.892   22.213  2.684   1.00 73.92  ? 146  PHE A CB  1 
ATOM   991  N N   . CYS A 1 131  ? 11.863  23.190  2.517   1.00 71.08  ? 147  CYS A N   1 
ATOM   992  C CA  . CYS A 1 131  ? 13.068  23.687  3.165   1.00 70.05  ? 147  CYS A CA  1 
ATOM   993  C C   . CYS A 1 131  ? 13.684  24.798  2.374   1.00 72.28  ? 147  CYS A C   1 
ATOM   994  O O   . CYS A 1 131  ? 13.918  25.851  2.959   1.00 71.87  ? 147  CYS A O   1 
ATOM   995  C CB  . CYS A 1 131  ? 14.061  22.556  3.428   1.00 70.02  ? 147  CYS A CB  1 
ATOM   996  S SG  . CYS A 1 131  ? 13.453  21.294  4.574   1.00 73.27  ? 147  CYS A SG  1 
ATOM   997  N N   . GLU A 1 132  ? 13.928  24.584  1.043   1.00 68.16  ? 148  GLU A N   1 
ATOM   998  C CA  . GLU A 1 132  ? 14.507  25.583  0.133   1.00 67.61  ? 148  GLU A CA  1 
ATOM   999  C C   . GLU A 1 132  ? 13.730  26.877  0.195   1.00 71.18  ? 148  GLU A C   1 
ATOM   1000 O O   . GLU A 1 132  ? 14.357  27.920  0.366   1.00 71.47  ? 148  GLU A O   1 
ATOM   1001 C CB  . GLU A 1 132  ? 14.616  25.066  -1.300  1.00 69.12  ? 148  GLU A CB  1 
ATOM   1002 C CG  . GLU A 1 132  ? 15.888  24.280  -1.553  1.00 81.12  ? 148  GLU A CG  1 
ATOM   1003 C CD  . GLU A 1 132  ? 16.011  23.663  -2.931  1.00 111.04 ? 148  GLU A CD  1 
ATOM   1004 O OE1 . GLU A 1 132  ? 15.860  24.405  -3.929  1.00 116.78 ? 148  GLU A OE1 1 
ATOM   1005 O OE2 . GLU A 1 132  ? 16.289  22.444  -3.015  1.00 109.18 ? 148  GLU A OE2 1 
ATOM   1006 N N   . GLU A 1 133  ? 12.363  26.791  0.187   1.00 67.38  ? 149  GLU A N   1 
ATOM   1007 C CA  . GLU A 1 133  ? 11.409  27.910  0.340   1.00 67.24  ? 149  GLU A CA  1 
ATOM   1008 C C   . GLU A 1 133  ? 11.644  28.660  1.661   1.00 70.61  ? 149  GLU A C   1 
ATOM   1009 O O   . GLU A 1 133  ? 11.939  29.856  1.627   1.00 71.01  ? 149  GLU A O   1 
ATOM   1010 C CB  . GLU A 1 133  ? 9.940   27.428  0.255   1.00 68.83  ? 149  GLU A CB  1 
ATOM   1011 C CG  . GLU A 1 133  ? 9.516   26.959  -1.135  1.00 80.55  ? 149  GLU A CG  1 
ATOM   1012 C CD  . GLU A 1 133  ? 8.084   26.483  -1.325  1.00 103.43 ? 149  GLU A CD  1 
ATOM   1013 O OE1 . GLU A 1 133  ? 7.457   26.007  -0.349  1.00 87.21  ? 149  GLU A OE1 1 
ATOM   1014 O OE2 . GLU A 1 133  ? 7.599   26.563  -2.475  1.00 108.79 ? 149  GLU A OE2 1 
ATOM   1015 N N   . ALA A 1 134  ? 11.554  27.951  2.811   1.00 65.95  ? 150  ALA A N   1 
ATOM   1016 C CA  . ALA A 1 134  ? 11.786  28.506  4.151   1.00 65.53  ? 150  ALA A CA  1 
ATOM   1017 C C   . ALA A 1 134  ? 13.142  29.247  4.267   1.00 71.43  ? 150  ALA A C   1 
ATOM   1018 O O   . ALA A 1 134  ? 13.207  30.284  4.929   1.00 70.42  ? 150  ALA A O   1 
ATOM   1019 C CB  . ALA A 1 134  ? 11.693  27.407  5.192   1.00 65.53  ? 150  ALA A CB  1 
ATOM   1020 N N   . ALA A 1 135  ? 14.202  28.730  3.595   1.00 69.53  ? 151  ALA A N   1 
ATOM   1021 C CA  . ALA A 1 135  ? 15.538  29.323  3.585   1.00 70.65  ? 151  ALA A CA  1 
ATOM   1022 C C   . ALA A 1 135  ? 15.514  30.632  2.803   1.00 76.81  ? 151  ALA A C   1 
ATOM   1023 O O   . ALA A 1 135  ? 16.038  31.636  3.282   1.00 74.91  ? 151  ALA A O   1 
ATOM   1024 C CB  . ALA A 1 135  ? 16.538  28.358  2.963   1.00 71.62  ? 151  ALA A CB  1 
ATOM   1025 N N   . ALA A 1 136  ? 14.879  30.621  1.603   1.00 77.04  ? 152  ALA A N   1 
ATOM   1026 C CA  . ALA A 1 136  ? 14.714  31.797  0.729   1.00 78.24  ? 152  ALA A CA  1 
ATOM   1027 C C   . ALA A 1 136  ? 13.924  32.873  1.473   1.00 83.97  ? 152  ALA A C   1 
ATOM   1028 O O   . ALA A 1 136  ? 14.348  34.034  1.518   1.00 84.21  ? 152  ALA A O   1 
ATOM   1029 C CB  . ALA A 1 136  ? 13.986  31.407  -0.548  1.00 79.07  ? 152  ALA A CB  1 
ATOM   1030 N N   . ARG A 1 137  ? 12.817  32.448  2.117   1.00 79.98  ? 153  ARG A N   1 
ATOM   1031 C CA  . ARG A 1 137  ? 11.954  33.258  2.940   1.00 80.17  ? 153  ARG A CA  1 
ATOM   1032 C C   . ARG A 1 137  ? 12.768  33.840  4.107   1.00 87.24  ? 153  ARG A C   1 
ATOM   1033 O O   . ARG A 1 137  ? 12.572  35.009  4.443   1.00 87.88  ? 153  ARG A O   1 
ATOM   1034 C CB  . ARG A 1 137  ? 10.779  32.393  3.431   1.00 81.92  ? 153  ARG A CB  1 
ATOM   1035 C CG  . ARG A 1 137  ? 9.841   33.068  4.450   1.00 94.08  ? 153  ARG A CG  1 
ATOM   1036 C CD  . ARG A 1 137  ? 8.478   32.413  4.507   1.00 95.63  ? 153  ARG A CD  1 
ATOM   1037 N NE  . ARG A 1 137  ? 8.503   31.128  5.213   1.00 100.32 ? 153  ARG A NE  1 
ATOM   1038 C CZ  . ARG A 1 137  ? 8.428   29.941  4.617   1.00 102.38 ? 153  ARG A CZ  1 
ATOM   1039 N NH1 . ARG A 1 137  ? 8.330   29.858  3.297   1.00 85.74  ? 153  ARG A NH1 1 
ATOM   1040 N NH2 . ARG A 1 137  ? 8.460   28.827  5.337   1.00 80.13  ? 153  ARG A NH2 1 
ATOM   1041 N N   . ARG A 1 138  ? 13.696  33.034  4.702   1.00 85.01  ? 154  ARG A N   1 
ATOM   1042 C CA  . ARG A 1 138  ? 14.556  33.437  5.821   1.00 85.09  ? 154  ARG A CA  1 
ATOM   1043 C C   . ARG A 1 138  ? 15.440  34.592  5.407   1.00 92.72  ? 154  ARG A C   1 
ATOM   1044 O O   . ARG A 1 138  ? 15.609  35.550  6.169   1.00 91.66  ? 154  ARG A O   1 
ATOM   1045 C CB  . ARG A 1 138  ? 15.425  32.258  6.297   1.00 82.84  ? 154  ARG A CB  1 
ATOM   1046 C CG  . ARG A 1 138  ? 16.426  32.619  7.406   1.00 87.31  ? 154  ARG A CG  1 
ATOM   1047 C CD  . ARG A 1 138  ? 17.585  31.644  7.487   1.00 84.99  ? 154  ARG A CD  1 
ATOM   1048 N NE  . ARG A 1 138  ? 17.118  30.323  7.890   1.00 73.73  ? 154  ARG A NE  1 
ATOM   1049 C CZ  . ARG A 1 138  ? 17.363  29.207  7.227   1.00 79.61  ? 154  ARG A CZ  1 
ATOM   1050 N NH1 . ARG A 1 138  ? 18.124  29.227  6.144   1.00 72.06  ? 154  ARG A NH1 1 
ATOM   1051 N NH2 . ARG A 1 138  ? 16.864  28.057  7.648   1.00 68.58  ? 154  ARG A NH2 1 
ATOM   1052 N N   . GLN A 1 139  ? 16.001  34.486  4.189   1.00 93.50  ? 155  GLN A N   1 
ATOM   1053 C CA  . GLN A 1 139  ? 16.890  35.477  3.600   1.00 95.17  ? 155  GLN A CA  1 
ATOM   1054 C C   . GLN A 1 139  ? 16.220  36.838  3.413   1.00 103.70 ? 155  GLN A C   1 
ATOM   1055 O O   . GLN A 1 139  ? 16.908  37.853  3.560   1.00 104.31 ? 155  GLN A O   1 
ATOM   1056 C CB  . GLN A 1 139  ? 17.521  34.957  2.289   1.00 96.23  ? 155  GLN A CB  1 
ATOM   1057 C CG  . GLN A 1 139  ? 18.890  35.572  1.961   1.00 108.97 ? 155  GLN A CG  1 
ATOM   1058 C CD  . GLN A 1 139  ? 19.929  35.402  3.061   1.00 131.29 ? 155  GLN A CD  1 
ATOM   1059 O OE1 . GLN A 1 139  ? 20.021  36.212  3.988   1.00 127.34 ? 155  GLN A OE1 1 
ATOM   1060 N NE2 . GLN A 1 139  ? 20.761  34.370  2.962   1.00 123.35 ? 155  GLN A NE2 1 
ATOM   1061 N N   . GLN A 1 140  ? 14.882  36.864  3.150   1.00 102.48 ? 156  GLN A N   1 
ATOM   1062 C CA  . GLN A 1 140  ? 14.100  38.095  2.935   1.00 103.42 ? 156  GLN A CA  1 
ATOM   1063 C C   . GLN A 1 140  ? 14.108  39.033  4.136   1.00 110.45 ? 156  GLN A C   1 
ATOM   1064 O O   . GLN A 1 140  ? 14.538  40.187  3.992   1.00 110.50 ? 156  GLN A O   1 
ATOM   1065 C CB  . GLN A 1 140  ? 12.659  37.803  2.473   1.00 104.49 ? 156  GLN A CB  1 
ATOM   1066 C CG  . GLN A 1 140  ? 12.505  37.787  0.959   1.00 113.86 ? 156  GLN A CG  1 
ATOM   1067 N N   . LEU A 1 141  ? 13.677  38.531  5.324   1.00 108.25 ? 157  LEU A N   1 
ATOM   1068 C CA  . LEU A 1 141  ? 13.591  39.295  6.577   1.00 108.23 ? 157  LEU A CA  1 
ATOM   1069 C C   . LEU A 1 141  ? 14.912  39.957  7.014   1.00 114.54 ? 157  LEU A C   1 
ATOM   1070 O O   . LEU A 1 141  ? 15.997  39.609  6.521   1.00 114.19 ? 157  LEU A O   1 
ATOM   1071 C CB  . LEU A 1 141  ? 13.010  38.442  7.697   1.00 107.85 ? 157  LEU A CB  1 
ATOM   1072 C CG  . LEU A 1 141  ? 11.500  38.491  7.782   1.00 112.43 ? 157  LEU A CG  1 
ATOM   1073 N N   . GLY A 1 142  ? 14.785  40.939  7.904   1.00 112.44 ? 158  GLY A N   1 
ATOM   1074 C CA  . GLY A 1 142  ? 15.910  41.718  8.405   1.00 112.87 ? 158  GLY A CA  1 
ATOM   1075 C C   . GLY A 1 142  ? 16.486  41.247  9.718   1.00 118.30 ? 158  GLY A C   1 
ATOM   1076 O O   . GLY A 1 142  ? 15.839  40.499  10.457  1.00 118.15 ? 158  GLY A O   1 
ATOM   1077 N N   . TRP A 1 143  ? 17.710  41.738  10.010  1.00 115.93 ? 159  TRP A N   1 
ATOM   1078 C CA  . TRP A 1 143  ? 18.590  41.500  11.166  1.00 116.42 ? 159  TRP A CA  1 
ATOM   1079 C C   . TRP A 1 143  ? 17.882  40.997  12.452  1.00 117.88 ? 159  TRP A C   1 
ATOM   1080 O O   . TRP A 1 143  ? 18.402  40.084  13.090  1.00 118.01 ? 159  TRP A O   1 
ATOM   1081 C CB  . TRP A 1 143  ? 19.441  42.765  11.465  1.00 116.13 ? 159  TRP A CB  1 
ATOM   1082 C CG  . TRP A 1 143  ? 18.675  43.900  12.094  1.00 117.98 ? 159  TRP A CG  1 
ATOM   1083 C CD1 . TRP A 1 143  ? 17.570  44.529  11.592  1.00 121.00 ? 159  TRP A CD1 1 
ATOM   1084 C CD2 . TRP A 1 143  ? 18.917  44.484  13.383  1.00 118.10 ? 159  TRP A CD2 1 
ATOM   1085 N NE1 . TRP A 1 143  ? 17.099  45.454  12.494  1.00 120.57 ? 159  TRP A NE1 1 
ATOM   1086 C CE2 . TRP A 1 143  ? 17.918  45.461  13.595  1.00 122.17 ? 159  TRP A CE2 1 
ATOM   1087 C CE3 . TRP A 1 143  ? 19.886  44.279  14.382  1.00 119.37 ? 159  TRP A CE3 1 
ATOM   1088 C CZ2 . TRP A 1 143  ? 17.869  46.242  14.758  1.00 121.65 ? 159  TRP A CZ2 1 
ATOM   1089 C CZ3 . TRP A 1 143  ? 19.830  45.044  15.537  1.00 120.89 ? 159  TRP A CZ3 1 
ATOM   1090 C CH2 . TRP A 1 143  ? 18.836  46.017  15.715  1.00 121.64 ? 159  TRP A CH2 1 
ATOM   1091 N N   . GLU A 1 144  ? 16.718  41.574  12.823  1.00 111.46 ? 160  GLU A N   1 
ATOM   1092 C CA  . GLU A 1 144  ? 15.993  41.172  14.023  1.00 110.41 ? 160  GLU A CA  1 
ATOM   1093 C C   . GLU A 1 144  ? 15.526  39.711  13.973  1.00 110.84 ? 160  GLU A C   1 
ATOM   1094 O O   . GLU A 1 144  ? 15.722  38.981  14.944  1.00 110.39 ? 160  GLU A O   1 
ATOM   1095 C CB  . GLU A 1 144  ? 14.852  42.146  14.337  1.00 111.91 ? 160  GLU A CB  1 
ATOM   1096 C CG  . GLU A 1 144  ? 15.269  43.144  15.406  1.00 123.30 ? 160  GLU A CG  1 
ATOM   1097 C CD  . GLU A 1 144  ? 14.607  44.507  15.362  1.00 143.31 ? 160  GLU A CD  1 
ATOM   1098 O OE1 . GLU A 1 144  ? 13.978  44.891  16.376  1.00 135.14 ? 160  GLU A OE1 1 
ATOM   1099 O OE2 . GLU A 1 144  ? 14.754  45.210  14.336  1.00 134.65 ? 160  GLU A OE2 1 
ATOM   1100 N N   . ALA A 1 145  ? 14.986  39.273  12.828  1.00 104.58 ? 161  ALA A N   1 
ATOM   1101 C CA  . ALA A 1 145  ? 14.551  37.889  12.612  1.00 102.71 ? 161  ALA A CA  1 
ATOM   1102 C C   . ALA A 1 145  ? 15.762  36.978  12.468  1.00 100.74 ? 161  ALA A C   1 
ATOM   1103 O O   . ALA A 1 145  ? 15.733  35.844  12.950  1.00 101.27 ? 161  ALA A O   1 
ATOM   1104 C CB  . ALA A 1 145  ? 13.708  37.791  11.349  1.00 103.54 ? 161  ALA A CB  1 
ATOM   1105 N N   . TRP A 1 146  ? 16.809  37.461  11.777  1.00 90.73  ? 162  TRP A N   1 
ATOM   1106 C CA  . TRP A 1 146  ? 18.002  36.672  11.540  1.00 87.38  ? 162  TRP A CA  1 
ATOM   1107 C C   . TRP A 1 146  ? 18.818  36.426  12.801  1.00 89.65  ? 162  TRP A C   1 
ATOM   1108 O O   . TRP A 1 146  ? 19.219  35.282  13.034  1.00 90.30  ? 162  TRP A O   1 
ATOM   1109 C CB  . TRP A 1 146  ? 18.857  37.257  10.421  1.00 84.26  ? 162  TRP A CB  1 
ATOM   1110 C CG  . TRP A 1 146  ? 19.597  36.194  9.685   1.00 84.12  ? 162  TRP A CG  1 
ATOM   1111 C CD1 . TRP A 1 146  ? 19.108  35.382  8.701   1.00 87.05  ? 162  TRP A CD1 1 
ATOM   1112 C CD2 . TRP A 1 146  ? 20.945  35.788  9.908   1.00 83.42  ? 162  TRP A CD2 1 
ATOM   1113 N NE1 . TRP A 1 146  ? 20.083  34.509  8.277   1.00 86.22  ? 162  TRP A NE1 1 
ATOM   1114 C CE2 . TRP A 1 146  ? 21.229  34.748  8.988   1.00 87.59  ? 162  TRP A CE2 1 
ATOM   1115 C CE3 . TRP A 1 146  ? 21.952  36.206  10.790  1.00 84.09  ? 162  TRP A CE3 1 
ATOM   1116 C CZ2 . TRP A 1 146  ? 22.471  34.100  8.950   1.00 86.70  ? 162  TRP A CZ2 1 
ATOM   1117 C CZ3 . TRP A 1 146  ? 23.178  35.565  10.750  1.00 85.46  ? 162  TRP A CZ3 1 
ATOM   1118 C CH2 . TRP A 1 146  ? 23.432  34.530  9.834   1.00 86.24  ? 162  TRP A CH2 1 
ATOM   1119 N N   . LEU A 1 147  ? 19.043  37.466  13.628  1.00 83.15  ? 163  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 147  ? 19.805  37.307  14.871  1.00 82.39  ? 163  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 147  ? 19.015  36.395  15.825  1.00 86.47  ? 163  LEU A C   1 
ATOM   1122 O O   . LEU A 1 147  ? 19.617  35.700  16.636  1.00 85.02  ? 163  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 147  ? 20.156  38.672  15.527  1.00 81.91  ? 163  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 147  ? 21.535  38.779  16.180  1.00 85.32  ? 163  LEU A CG  1 
ATOM   1125 N N   . GLN A 1 148  ? 17.666  36.359  15.669  1.00 84.42  ? 164  GLN A N   1 
ATOM   1126 C CA  . GLN A 1 148  ? 16.733  35.530  16.441  1.00 83.66  ? 164  GLN A CA  1 
ATOM   1127 C C   . GLN A 1 148  ? 16.838  34.080  15.959  1.00 85.44  ? 164  GLN A C   1 
ATOM   1128 O O   . GLN A 1 148  ? 16.746  33.152  16.767  1.00 86.15  ? 164  GLN A O   1 
ATOM   1129 C CB  . GLN A 1 148  ? 15.305  36.065  16.265  1.00 85.05  ? 164  GLN A CB  1 
ATOM   1130 C CG  . GLN A 1 148  ? 14.232  35.380  17.116  1.00 105.83 ? 164  GLN A CG  1 
ATOM   1131 C CD  . GLN A 1 148  ? 12.839  35.639  16.575  1.00 124.27 ? 164  GLN A CD  1 
ATOM   1132 O OE1 . GLN A 1 148  ? 12.576  35.569  15.361  1.00 119.87 ? 164  GLN A OE1 1 
ATOM   1133 N NE2 . GLN A 1 148  ? 11.904  35.916  17.469  1.00 113.37 ? 164  GLN A NE2 1 
ATOM   1134 N N   . TYR A 1 149  ? 17.050  33.901  14.641  1.00 78.92  ? 165  TYR A N   1 
ATOM   1135 C CA  . TYR A 1 149  ? 17.199  32.605  13.984  1.00 76.85  ? 165  TYR A CA  1 
ATOM   1136 C C   . TYR A 1 149  ? 18.529  31.949  14.328  1.00 81.24  ? 165  TYR A C   1 
ATOM   1137 O O   . TYR A 1 149  ? 18.525  30.815  14.781  1.00 81.72  ? 165  TYR A O   1 
ATOM   1138 C CB  . TYR A 1 149  ? 17.016  32.719  12.441  1.00 76.22  ? 165  TYR A CB  1 
ATOM   1139 C CG  . TYR A 1 149  ? 17.700  31.610  11.673  1.00 76.12  ? 165  TYR A CG  1 
ATOM   1140 C CD1 . TYR A 1 149  ? 17.155  30.331  11.625  1.00 78.64  ? 165  TYR A CD1 1 
ATOM   1141 C CD2 . TYR A 1 149  ? 18.939  31.814  11.067  1.00 75.83  ? 165  TYR A CD2 1 
ATOM   1142 C CE1 . TYR A 1 149  ? 17.829  29.280  11.005  1.00 80.31  ? 165  TYR A CE1 1 
ATOM   1143 C CE2 . TYR A 1 149  ? 19.624  30.770  10.448  1.00 75.97  ? 165  TYR A CE2 1 
ATOM   1144 C CZ  . TYR A 1 149  ? 19.053  29.509  10.397  1.00 82.83  ? 165  TYR A CZ  1 
ATOM   1145 O OH  . TYR A 1 149  ? 19.707  28.466  9.784   1.00 80.38  ? 165  TYR A OH  1 
ATOM   1146 N N   . SER A 1 150  ? 19.664  32.626  14.060  1.00 77.47  ? 166  SER A N   1 
ATOM   1147 C CA  . SER A 1 150  ? 20.998  32.041  14.229  1.00 76.53  ? 166  SER A CA  1 
ATOM   1148 C C   . SER A 1 150  ? 21.523  32.027  15.642  1.00 77.86  ? 166  SER A C   1 
ATOM   1149 O O   . SER A 1 150  ? 22.227  31.088  16.015  1.00 77.60  ? 166  SER A O   1 
ATOM   1150 C CB  . SER A 1 150  ? 21.997  32.716  13.307  1.00 80.55  ? 166  SER A CB  1 
ATOM   1151 O OG  . SER A 1 150  ? 21.693  34.096  13.280  1.00 94.05  ? 166  SER A OG  1 
ATOM   1152 N N   . PHE A 1 151  ? 21.208  33.057  16.427  1.00 72.95  ? 167  PHE A N   1 
ATOM   1153 C CA  . PHE A 1 151  ? 21.682  33.166  17.808  1.00 72.10  ? 167  PHE A CA  1 
ATOM   1154 C C   . PHE A 1 151  ? 20.495  33.371  18.731  1.00 74.10  ? 167  PHE A C   1 
ATOM   1155 O O   . PHE A 1 151  ? 20.324  34.475  19.253  1.00 74.23  ? 167  PHE A O   1 
ATOM   1156 C CB  . PHE A 1 151  ? 22.729  34.296  17.950  1.00 74.34  ? 167  PHE A CB  1 
ATOM   1157 C CG  . PHE A 1 151  ? 23.765  34.291  16.843  1.00 76.77  ? 167  PHE A CG  1 
ATOM   1158 C CD1 . PHE A 1 151  ? 24.824  33.378  16.859  1.00 80.26  ? 167  PHE A CD1 1 
ATOM   1159 C CD2 . PHE A 1 151  ? 23.633  35.135  15.740  1.00 78.33  ? 167  PHE A CD2 1 
ATOM   1160 C CE1 . PHE A 1 151  ? 25.732  33.317  15.796  1.00 80.93  ? 167  PHE A CE1 1 
ATOM   1161 C CE2 . PHE A 1 151  ? 24.559  35.094  14.694  1.00 81.14  ? 167  PHE A CE2 1 
ATOM   1162 C CZ  . PHE A 1 151  ? 25.606  34.190  14.732  1.00 79.72  ? 167  PHE A CZ  1 
ATOM   1163 N N   . PRO A 1 152  ? 19.645  32.326  18.943  1.00 68.42  ? 168  PRO A N   1 
ATOM   1164 C CA  . PRO A 1 152  ? 18.495  32.500  19.823  1.00 66.89  ? 168  PRO A CA  1 
ATOM   1165 C C   . PRO A 1 152  ? 18.953  32.776  21.239  1.00 70.69  ? 168  PRO A C   1 
ATOM   1166 O O   . PRO A 1 152  ? 20.009  32.302  21.648  1.00 69.31  ? 168  PRO A O   1 
ATOM   1167 C CB  . PRO A 1 152  ? 17.736  31.187  19.666  1.00 68.53  ? 168  PRO A CB  1 
ATOM   1168 C CG  . PRO A 1 152  ? 18.736  30.200  19.309  1.00 72.88  ? 168  PRO A CG  1 
ATOM   1169 C CD  . PRO A 1 152  ? 19.715  30.933  18.449  1.00 69.68  ? 168  PRO A CD  1 
ATOM   1170 N N   . LEU A 1 153  ? 18.202  33.616  21.946  1.00 69.76  ? 169  LEU A N   1 
ATOM   1171 C CA  . LEU A 1 153  ? 18.536  34.044  23.301  1.00 70.76  ? 169  LEU A CA  1 
ATOM   1172 C C   . LEU A 1 153  ? 18.714  32.886  24.256  1.00 76.89  ? 169  LEU A C   1 
ATOM   1173 O O   . LEU A 1 153  ? 17.868  31.972  24.308  1.00 78.50  ? 169  LEU A O   1 
ATOM   1174 C CB  . LEU A 1 153  ? 17.471  35.008  23.842  1.00 71.12  ? 169  LEU A CB  1 
ATOM   1175 C CG  . LEU A 1 153  ? 17.393  36.378  23.187  1.00 76.09  ? 169  LEU A CG  1 
ATOM   1176 C CD1 . LEU A 1 153  ? 15.970  36.964  23.318  1.00 77.44  ? 169  LEU A CD1 1 
ATOM   1177 C CD2 . LEU A 1 153  ? 18.465  37.313  23.733  1.00 74.25  ? 169  LEU A CD2 1 
ATOM   1178 N N   . GLN A 1 154  ? 19.827  32.910  24.995  1.00 72.13  ? 170  GLN A N   1 
ATOM   1179 C CA  . GLN A 1 154  ? 20.097  31.873  25.975  1.00 71.85  ? 170  GLN A CA  1 
ATOM   1180 C C   . GLN A 1 154  ? 19.771  32.503  27.299  1.00 75.86  ? 170  GLN A C   1 
ATOM   1181 O O   . GLN A 1 154  ? 20.555  33.302  27.834  1.00 75.28  ? 170  GLN A O   1 
ATOM   1182 C CB  . GLN A 1 154  ? 21.554  31.390  25.911  1.00 73.51  ? 170  GLN A CB  1 
ATOM   1183 C CG  . GLN A 1 154  ? 21.936  30.633  24.637  1.00 86.72  ? 170  GLN A CG  1 
ATOM   1184 C CD  . GLN A 1 154  ? 23.434  30.458  24.543  1.00 104.78 ? 170  GLN A CD  1 
ATOM   1185 O OE1 . GLN A 1 154  ? 24.085  29.863  25.415  1.00 101.27 ? 170  GLN A OE1 1 
ATOM   1186 N NE2 . GLN A 1 154  ? 24.019  30.993  23.490  1.00 96.82  ? 170  GLN A NE2 1 
ATOM   1187 N N   . LEU A 1 155  ? 18.564  32.213  27.787  1.00 73.13  ? 171  LEU A N   1 
ATOM   1188 C CA  . LEU A 1 155  ? 18.080  32.785  29.037  1.00 73.45  ? 171  LEU A CA  1 
ATOM   1189 C C   . LEU A 1 155  ? 17.958  31.748  30.123  1.00 79.82  ? 171  LEU A C   1 
ATOM   1190 O O   . LEU A 1 155  ? 17.798  30.566  29.833  1.00 78.04  ? 171  LEU A O   1 
ATOM   1191 C CB  . LEU A 1 155  ? 16.712  33.473  28.834  1.00 73.28  ? 171  LEU A CB  1 
ATOM   1192 C CG  . LEU A 1 155  ? 16.584  34.553  27.750  1.00 76.72  ? 171  LEU A CG  1 
ATOM   1193 C CD1 . LEU A 1 155  ? 15.167  34.658  27.289  1.00 76.43  ? 171  LEU A CD1 1 
ATOM   1194 C CD2 . LEU A 1 155  ? 17.131  35.909  28.209  1.00 77.28  ? 171  LEU A CD2 1 
ATOM   1195 N N   . GLU A 1 156  ? 18.021  32.207  31.383  1.00 80.72  ? 172  GLU A N   1 
ATOM   1196 C CA  . GLU A 1 156  ? 17.847  31.403  32.592  1.00 82.09  ? 172  GLU A CA  1 
ATOM   1197 C C   . GLU A 1 156  ? 16.343  31.066  32.759  1.00 90.09  ? 172  GLU A C   1 
ATOM   1198 O O   . GLU A 1 156  ? 15.497  31.877  32.357  1.00 89.05  ? 172  GLU A O   1 
ATOM   1199 C CB  . GLU A 1 156  ? 18.377  32.158  33.822  1.00 83.41  ? 172  GLU A CB  1 
ATOM   1200 C CG  . GLU A 1 156  ? 19.871  31.995  34.026  1.00 95.30  ? 172  GLU A CG  1 
ATOM   1201 C CD  . GLU A 1 156  ? 20.340  30.640  34.537  1.00 118.22 ? 172  GLU A CD  1 
ATOM   1202 O OE1 . GLU A 1 156  ? 19.830  30.180  35.587  1.00 117.60 ? 172  GLU A OE1 1 
ATOM   1203 O OE2 . GLU A 1 156  ? 21.258  30.059  33.912  1.00 101.93 ? 172  GLU A OE2 1 
ATOM   1204 N N   . PRO A 1 157  ? 15.989  29.883  33.335  1.00 90.14  ? 173  PRO A N   1 
ATOM   1205 C CA  . PRO A 1 157  ? 14.561  29.501  33.444  1.00 90.76  ? 173  PRO A CA  1 
ATOM   1206 C C   . PRO A 1 157  ? 13.614  30.492  34.142  1.00 96.68  ? 173  PRO A C   1 
ATOM   1207 O O   . PRO A 1 157  ? 12.448  30.590  33.724  1.00 96.34  ? 173  PRO A O   1 
ATOM   1208 C CB  . PRO A 1 157  ? 14.612  28.169  34.190  1.00 92.15  ? 173  PRO A CB  1 
ATOM   1209 C CG  . PRO A 1 157  ? 15.938  27.606  33.819  1.00 96.53  ? 173  PRO A CG  1 
ATOM   1210 C CD  . PRO A 1 157  ? 16.861  28.785  33.799  1.00 91.91  ? 173  PRO A CD  1 
ATOM   1211 N N   . SER A 1 158  ? 14.108  31.228  35.176  1.00 93.75  ? 174  SER A N   1 
ATOM   1212 C CA  . SER A 1 158  ? 13.342  32.193  35.984  1.00 133.04 ? 174  SER A CA  1 
ATOM   1213 C C   . SER A 1 158  ? 12.211  31.513  36.769  1.00 170.56 ? 174  SER A C   1 
ATOM   1214 O O   . SER A 1 158  ? 12.182  31.577  37.998  1.00 133.25 ? 174  SER A O   1 
ATOM   1215 C CB  . SER A 1 158  ? 12.809  33.341  35.127  1.00 136.63 ? 174  SER A CB  1 
ATOM   1216 O OG  . SER A 1 158  ? 11.802  34.094  35.785  1.00 144.99 ? 174  SER A OG  1 
ATOM   1217 N N   . LEU A 1 169  ? 13.428  37.675  43.403  1.00 126.00 ? 185  LEU A N   1 
ATOM   1218 C CA  . LEU A 1 169  ? 14.531  38.128  42.557  1.00 126.19 ? 185  LEU A CA  1 
ATOM   1219 C C   . LEU A 1 169  ? 14.960  39.562  42.924  1.00 131.31 ? 185  LEU A C   1 
ATOM   1220 O O   . LEU A 1 169  ? 14.162  40.486  42.748  1.00 130.83 ? 185  LEU A O   1 
ATOM   1221 C CB  . LEU A 1 169  ? 14.151  38.036  41.069  1.00 126.17 ? 185  LEU A CB  1 
ATOM   1222 N N   . PRO A 1 170  ? 16.204  39.781  43.425  1.00 129.18 ? 186  PRO A N   1 
ATOM   1223 C CA  . PRO A 1 170  ? 16.607  41.145  43.828  1.00 129.54 ? 186  PRO A CA  1 
ATOM   1224 C C   . PRO A 1 170  ? 17.347  41.986  42.757  1.00 133.37 ? 186  PRO A C   1 
ATOM   1225 O O   . PRO A 1 170  ? 17.576  41.508  41.637  1.00 132.65 ? 186  PRO A O   1 
ATOM   1226 C CB  . PRO A 1 170  ? 17.480  40.887  45.071  1.00 131.31 ? 186  PRO A CB  1 
ATOM   1227 C CG  . PRO A 1 170  ? 17.984  39.447  44.914  1.00 135.46 ? 186  PRO A CG  1 
ATOM   1228 C CD  . PRO A 1 170  ? 17.270  38.807  43.742  1.00 130.82 ? 186  PRO A CD  1 
ATOM   1229 N N   . ASN A 1 171  ? 17.699  43.260  43.118  1.00 129.50 ? 187  ASN A N   1 
ATOM   1230 C CA  . ASN A 1 171  ? 18.438  44.244  42.302  1.00 128.92 ? 187  ASN A CA  1 
ATOM   1231 C C   . ASN A 1 171  ? 19.841  44.465  42.890  1.00 131.54 ? 187  ASN A C   1 
ATOM   1232 O O   . ASN A 1 171  ? 19.979  44.579  44.108  1.00 131.59 ? 187  ASN A O   1 
ATOM   1233 C CB  . ASN A 1 171  ? 17.668  45.578  42.221  1.00 129.60 ? 187  ASN A CB  1 
ATOM   1234 C CG  . ASN A 1 171  ? 18.348  46.685  41.431  1.00 157.23 ? 187  ASN A CG  1 
ATOM   1235 O OD1 . ASN A 1 171  ? 18.732  46.523  40.264  1.00 152.43 ? 187  ASN A OD1 1 
ATOM   1236 N ND2 . ASN A 1 171  ? 18.459  47.861  42.034  1.00 150.65 ? 187  ASN A ND2 1 
ATOM   1237 N N   . ARG A 1 172  ? 20.875  44.519  42.031  1.00 126.83 ? 188  ARG A N   1 
ATOM   1238 C CA  . ARG A 1 172  ? 22.271  44.701  42.450  1.00 126.22 ? 188  ARG A CA  1 
ATOM   1239 C C   . ARG A 1 172  ? 23.070  45.628  41.511  1.00 129.34 ? 188  ARG A C   1 
ATOM   1240 O O   . ARG A 1 172  ? 22.599  45.968  40.417  1.00 129.05 ? 188  ARG A O   1 
ATOM   1241 C CB  . ARG A 1 172  ? 22.981  43.335  42.601  1.00 125.86 ? 188  ARG A CB  1 
ATOM   1242 C CG  . ARG A 1 172  ? 22.753  42.646  43.942  1.00 133.14 ? 188  ARG A CG  1 
ATOM   1243 N N   . ALA A 1 173  ? 24.282  46.039  41.961  1.00 124.69 ? 189  ALA A N   1 
ATOM   1244 C CA  . ALA A 1 173  ? 25.212  46.897  41.217  1.00 123.68 ? 189  ALA A CA  1 
ATOM   1245 C C   . ALA A 1 173  ? 26.105  46.023  40.338  1.00 124.09 ? 189  ALA A C   1 
ATOM   1246 O O   . ALA A 1 173  ? 26.762  45.114  40.852  1.00 123.42 ? 189  ALA A O   1 
ATOM   1247 C CB  . ALA A 1 173  ? 26.065  47.718  42.184  1.00 124.50 ? 189  ALA A CB  1 
ATOM   1248 N N   . LEU A 1 174  ? 26.120  46.288  39.019  1.00 118.32 ? 190  LEU A N   1 
ATOM   1249 C CA  . LEU A 1 174  ? 26.909  45.499  38.078  1.00 117.37 ? 190  LEU A CA  1 
ATOM   1250 C C   . LEU A 1 174  ? 27.778  46.328  37.127  1.00 119.39 ? 190  LEU A C   1 
ATOM   1251 O O   . LEU A 1 174  ? 27.251  46.932  36.186  1.00 118.59 ? 190  LEU A O   1 
ATOM   1252 C CB  . LEU A 1 174  ? 25.998  44.538  37.285  1.00 117.47 ? 190  LEU A CB  1 
ATOM   1253 N N   . LEU A 1 175  ? 29.120  46.318  37.356  1.00 115.00 ? 191  LEU A N   1 
ATOM   1254 C CA  . LEU A 1 175  ? 30.104  46.994  36.495  1.00 114.42 ? 191  LEU A CA  1 
ATOM   1255 C C   . LEU A 1 175  ? 30.254  46.141  35.235  1.00 117.66 ? 191  LEU A C   1 
ATOM   1256 O O   . LEU A 1 175  ? 30.631  44.970  35.317  1.00 117.03 ? 191  LEU A O   1 
ATOM   1257 C CB  . LEU A 1 175  ? 31.463  47.186  37.197  1.00 114.26 ? 191  LEU A CB  1 
ATOM   1258 N N   . VAL A 1 176  ? 29.875  46.706  34.085  1.00 113.60 ? 192  VAL A N   1 
ATOM   1259 C CA  . VAL A 1 176  ? 29.892  46.007  32.803  1.00 113.06 ? 192  VAL A CA  1 
ATOM   1260 C C   . VAL A 1 176  ? 30.852  46.698  31.840  1.00 116.34 ? 192  VAL A C   1 
ATOM   1261 O O   . VAL A 1 176  ? 30.696  47.888  31.570  1.00 115.94 ? 192  VAL A O   1 
ATOM   1262 C CB  . VAL A 1 176  ? 28.450  45.880  32.238  1.00 116.90 ? 192  VAL A CB  1 
ATOM   1263 C CG1 . VAL A 1 176  ? 28.444  45.456  30.772  1.00 116.85 ? 192  VAL A CG1 1 
ATOM   1264 C CG2 . VAL A 1 176  ? 27.613  44.921  33.079  1.00 116.61 ? 192  VAL A CG2 1 
ATOM   1265 N N   . ASN A 1 177  ? 31.834  45.940  31.324  1.00 112.70 ? 193  ASN A N   1 
ATOM   1266 C CA  . ASN A 1 177  ? 32.853  46.406  30.380  1.00 112.37 ? 193  ASN A CA  1 
ATOM   1267 C C   . ASN A 1 177  ? 32.348  46.378  28.934  1.00 114.24 ? 193  ASN A C   1 
ATOM   1268 O O   . ASN A 1 177  ? 32.481  45.368  28.249  1.00 113.66 ? 193  ASN A O   1 
ATOM   1269 C CB  . ASN A 1 177  ? 34.140  45.572  30.530  1.00 116.19 ? 193  ASN A CB  1 
ATOM   1270 C CG  . ASN A 1 177  ? 35.322  46.052  29.717  1.00 145.24 ? 193  ASN A CG  1 
ATOM   1271 O OD1 . ASN A 1 177  ? 35.411  45.846  28.496  1.00 137.77 ? 193  ASN A OD1 1 
ATOM   1272 N ND2 . ASN A 1 177  ? 36.296  46.634  30.401  1.00 139.86 ? 193  ASN A ND2 1 
ATOM   1273 N N   . VAL A 1 178  ? 31.810  47.501  28.463  1.00 110.19 ? 194  VAL A N   1 
ATOM   1274 C CA  . VAL A 1 178  ? 31.334  47.632  27.087  1.00 110.10 ? 194  VAL A CA  1 
ATOM   1275 C C   . VAL A 1 178  ? 32.556  47.854  26.162  1.00 114.13 ? 194  VAL A C   1 
ATOM   1276 O O   . VAL A 1 178  ? 33.664  48.109  26.654  1.00 113.81 ? 194  VAL A O   1 
ATOM   1277 C CB  . VAL A 1 178  ? 30.228  48.719  26.932  1.00 114.42 ? 194  VAL A CB  1 
ATOM   1278 C CG1 . VAL A 1 178  ? 29.449  48.545  25.626  1.00 114.19 ? 194  VAL A CG1 1 
ATOM   1279 C CG2 . VAL A 1 178  ? 29.263  48.698  28.120  1.00 114.39 ? 194  VAL A CG2 1 
ATOM   1280 N N   . LYS A 1 179  ? 32.359  47.680  24.835  1.00 110.45 ? 195  LYS A N   1 
ATOM   1281 C CA  . LYS A 1 179  ? 33.378  47.796  23.780  1.00 109.73 ? 195  LYS A CA  1 
ATOM   1282 C C   . LYS A 1 179  ? 32.693  48.057  22.417  1.00 112.47 ? 195  LYS A C   1 
ATOM   1283 O O   . LYS A 1 179  ? 31.457  48.058  22.334  1.00 111.86 ? 195  LYS A O   1 
ATOM   1284 C CB  . LYS A 1 179  ? 34.209  46.495  23.723  1.00 111.83 ? 195  LYS A CB  1 
ATOM   1285 C CG  . LYS A 1 179  ? 35.722  46.683  23.709  1.00 118.74 ? 195  LYS A CG  1 
ATOM   1286 C CD  . LYS A 1 179  ? 36.460  45.331  23.600  1.00 125.26 ? 195  LYS A CD  1 
ATOM   1287 C CE  . LYS A 1 179  ? 36.733  44.864  22.181  1.00 130.52 ? 195  LYS A CE  1 
ATOM   1288 N NZ  . LYS A 1 179  ? 38.127  45.166  21.745  1.00 136.89 ? 195  LYS A NZ  1 
ATOM   1289 N N   . PHE A 1 180  ? 33.497  48.285  21.359  1.00 108.58 ? 196  PHE A N   1 
ATOM   1290 C CA  . PHE A 1 180  ? 33.003  48.527  20.000  1.00 108.59 ? 196  PHE A CA  1 
ATOM   1291 C C   . PHE A 1 180  ? 33.806  47.775  18.925  1.00 117.07 ? 196  PHE A C   1 
ATOM   1292 O O   . PHE A 1 180  ? 34.936  47.348  19.189  1.00 116.77 ? 196  PHE A O   1 
ATOM   1293 C CB  . PHE A 1 180  ? 32.922  50.029  19.693  1.00 109.04 ? 196  PHE A CB  1 
ATOM   1294 C CG  . PHE A 1 180  ? 31.664  50.699  20.184  1.00 108.81 ? 196  PHE A CG  1 
ATOM   1295 C CD1 . PHE A 1 180  ? 31.588  51.215  21.471  1.00 110.68 ? 196  PHE A CD1 1 
ATOM   1296 C CD2 . PHE A 1 180  ? 30.570  50.854  19.348  1.00 109.69 ? 196  PHE A CD2 1 
ATOM   1297 C CE1 . PHE A 1 180  ? 30.429  51.854  21.921  1.00 110.80 ? 196  PHE A CE1 1 
ATOM   1298 C CE2 . PHE A 1 180  ? 29.414  51.506  19.795  1.00 111.92 ? 196  PHE A CE2 1 
ATOM   1299 C CZ  . PHE A 1 180  ? 29.349  51.994  21.081  1.00 109.55 ? 196  PHE A CZ  1 
ATOM   1300 N N   . GLU A 1 181  ? 33.198  47.596  17.725  1.00 116.56 ? 197  GLU A N   1 
ATOM   1301 C CA  . GLU A 1 181  ? 33.764  46.892  16.570  1.00 117.65 ? 197  GLU A CA  1 
ATOM   1302 C C   . GLU A 1 181  ? 35.121  47.478  16.139  1.00 125.08 ? 197  GLU A C   1 
ATOM   1303 O O   . GLU A 1 181  ? 35.186  48.629  15.694  1.00 124.69 ? 197  GLU A O   1 
ATOM   1304 C CB  . GLU A 1 181  ? 32.757  46.883  15.397  1.00 119.01 ? 197  GLU A CB  1 
ATOM   1305 C CG  . GLU A 1 181  ? 32.013  45.569  15.226  1.00 127.50 ? 197  GLU A CG  1 
ATOM   1306 N N   . GLY A 1 182  ? 36.184  46.684  16.323  1.00 124.43 ? 198  GLY A N   1 
ATOM   1307 C CA  . GLY A 1 182  ? 37.566  47.046  15.997  1.00 125.33 ? 198  GLY A CA  1 
ATOM   1308 C C   . GLY A 1 182  ? 38.317  47.753  17.116  1.00 131.28 ? 198  GLY A C   1 
ATOM   1309 O O   . GLY A 1 182  ? 39.517  47.525  17.304  1.00 130.25 ? 198  GLY A O   1 
ATOM   1310 N N   . SER A 1 183  ? 37.592  48.633  17.857  1.00 129.57 ? 199  SER A N   1 
ATOM   1311 C CA  . SER A 1 183  ? 38.030  49.450  18.995  1.00 129.59 ? 199  SER A CA  1 
ATOM   1312 C C   . SER A 1 183  ? 38.542  48.585  20.174  1.00 134.70 ? 199  SER A C   1 
ATOM   1313 O O   . SER A 1 183  ? 37.790  47.775  20.726  1.00 134.64 ? 199  SER A O   1 
ATOM   1314 C CB  . SER A 1 183  ? 36.886  50.375  19.435  1.00 131.62 ? 199  SER A CB  1 
ATOM   1315 O OG  . SER A 1 183  ? 37.111  51.071  20.651  1.00 136.33 ? 199  SER A OG  1 
ATOM   1316 N N   . GLU A 1 184  ? 39.834  48.759  20.539  1.00 131.38 ? 200  GLU A N   1 
ATOM   1317 C CA  . GLU A 1 184  ? 40.483  48.078  21.669  1.00 131.06 ? 200  GLU A CA  1 
ATOM   1318 C C   . GLU A 1 184  ? 40.389  48.970  22.930  1.00 135.25 ? 200  GLU A C   1 
ATOM   1319 O O   . GLU A 1 184  ? 41.199  48.830  23.855  1.00 134.43 ? 200  GLU A O   1 
ATOM   1320 C CB  . GLU A 1 184  ? 41.946  47.716  21.336  1.00 132.22 ? 200  GLU A CB  1 
ATOM   1321 C CG  . GLU A 1 184  ? 42.085  46.455  20.500  1.00 140.62 ? 200  GLU A CG  1 
ATOM   1322 N N   . GLU A 1 185  ? 39.369  49.879  22.947  1.00 132.40 ? 201  GLU A N   1 
ATOM   1323 C CA  . GLU A 1 185  ? 39.046  50.851  24.003  1.00 132.17 ? 201  GLU A CA  1 
ATOM   1324 C C   . GLU A 1 185  ? 37.722  50.502  24.707  1.00 135.54 ? 201  GLU A C   1 
ATOM   1325 O O   . GLU A 1 185  ? 36.635  50.657  24.136  1.00 134.51 ? 201  GLU A O   1 
ATOM   1326 C CB  . GLU A 1 185  ? 39.022  52.284  23.440  1.00 133.52 ? 201  GLU A CB  1 
ATOM   1327 N N   . SER A 1 186  ? 37.844  50.026  25.960  1.00 132.22 ? 202  SER A N   1 
ATOM   1328 C CA  . SER A 1 186  ? 36.757  49.574  26.830  1.00 131.77 ? 202  SER A CA  1 
ATOM   1329 C C   . SER A 1 186  ? 35.962  50.708  27.513  1.00 135.48 ? 202  SER A C   1 
ATOM   1330 O O   . SER A 1 186  ? 36.474  51.821  27.676  1.00 134.66 ? 202  SER A O   1 
ATOM   1331 C CB  . SER A 1 186  ? 37.282  48.575  27.859  1.00 134.45 ? 202  SER A CB  1 
ATOM   1332 O OG  . SER A 1 186  ? 38.635  48.809  28.220  1.00 140.64 ? 202  SER A OG  1 
ATOM   1333 N N   . PHE A 1 187  ? 34.693  50.407  27.892  1.00 131.86 ? 203  PHE A N   1 
ATOM   1334 C CA  . PHE A 1 187  ? 33.743  51.328  28.529  1.00 131.19 ? 203  PHE A CA  1 
ATOM   1335 C C   . PHE A 1 187  ? 33.014  50.701  29.735  1.00 133.32 ? 203  PHE A C   1 
ATOM   1336 O O   . PHE A 1 187  ? 31.823  50.383  29.634  1.00 132.69 ? 203  PHE A O   1 
ATOM   1337 C CB  . PHE A 1 187  ? 32.730  51.835  27.488  1.00 133.10 ? 203  PHE A CB  1 
ATOM   1338 C CG  . PHE A 1 187  ? 33.196  53.024  26.690  1.00 135.10 ? 203  PHE A CG  1 
ATOM   1339 C CD1 . PHE A 1 187  ? 34.083  52.868  25.631  1.00 138.61 ? 203  PHE A CD1 1 
ATOM   1340 C CD2 . PHE A 1 187  ? 32.720  54.297  26.971  1.00 137.71 ? 203  PHE A CD2 1 
ATOM   1341 C CE1 . PHE A 1 187  ? 34.514  53.971  24.891  1.00 139.79 ? 203  PHE A CE1 1 
ATOM   1342 C CE2 . PHE A 1 187  ? 33.147  55.400  26.228  1.00 140.78 ? 203  PHE A CE2 1 
ATOM   1343 C CZ  . PHE A 1 187  ? 34.039  55.230  25.192  1.00 139.00 ? 203  PHE A CZ  1 
ATOM   1344 N N   . THR A 1 188  ? 33.729  50.555  30.882  1.00 128.49 ? 204  THR A N   1 
ATOM   1345 C CA  . THR A 1 188  ? 33.200  49.978  32.128  1.00 127.39 ? 204  THR A CA  1 
ATOM   1346 C C   . THR A 1 188  ? 32.070  50.858  32.700  1.00 130.07 ? 204  THR A C   1 
ATOM   1347 O O   . THR A 1 188  ? 32.318  51.743  33.515  1.00 129.73 ? 204  THR A O   1 
ATOM   1348 C CB  . THR A 1 188  ? 34.334  49.657  33.143  1.00 130.83 ? 204  THR A CB  1 
ATOM   1349 O OG1 . THR A 1 188  ? 35.368  48.914  32.497  1.00 127.92 ? 204  THR A OG1 1 
ATOM   1350 C CG2 . THR A 1 188  ? 33.838  48.865  34.352  1.00 128.73 ? 204  THR A CG2 1 
ATOM   1351 N N   . PHE A 1 189  ? 30.834  50.618  32.233  1.00 125.81 ? 205  PHE A N   1 
ATOM   1352 C CA  . PHE A 1 189  ? 29.628  51.326  32.664  1.00 125.12 ? 205  PHE A CA  1 
ATOM   1353 C C   . PHE A 1 189  ? 28.824  50.404  33.590  1.00 128.91 ? 205  PHE A C   1 
ATOM   1354 O O   . PHE A 1 189  ? 28.585  49.249  33.233  1.00 129.17 ? 205  PHE A O   1 
ATOM   1355 C CB  . PHE A 1 189  ? 28.790  51.745  31.444  1.00 126.64 ? 205  PHE A CB  1 
ATOM   1356 N N   . GLN A 1 190  ? 28.446  50.889  34.788  1.00 124.57 ? 206  GLN A N   1 
ATOM   1357 C CA  . GLN A 1 190  ? 27.672  50.106  35.760  1.00 124.03 ? 206  GLN A CA  1 
ATOM   1358 C C   . GLN A 1 190  ? 26.169  50.307  35.549  1.00 127.52 ? 206  GLN A C   1 
ATOM   1359 O O   . GLN A 1 190  ? 25.753  51.422  35.228  1.00 127.15 ? 206  GLN A O   1 
ATOM   1360 C CB  . GLN A 1 190  ? 28.085  50.440  37.202  1.00 125.21 ? 206  GLN A CB  1 
ATOM   1361 N N   . VAL A 1 191  ? 25.356  49.233  35.704  1.00 123.73 ? 207  VAL A N   1 
ATOM   1362 C CA  . VAL A 1 191  ? 23.901  49.301  35.492  1.00 123.23 ? 207  VAL A CA  1 
ATOM   1363 C C   . VAL A 1 191  ? 23.081  48.393  36.436  1.00 126.91 ? 207  VAL A C   1 
ATOM   1364 O O   . VAL A 1 191  ? 23.636  47.551  37.156  1.00 125.31 ? 207  VAL A O   1 
ATOM   1365 C CB  . VAL A 1 191  ? 23.528  49.047  34.013  1.00 126.85 ? 207  VAL A CB  1 
ATOM   1366 N N   . SER A 1 192  ? 21.743  48.596  36.426  1.00 124.71 ? 208  SER A N   1 
ATOM   1367 C CA  . SER A 1 192  ? 20.780  47.854  37.241  1.00 125.16 ? 208  SER A CA  1 
ATOM   1368 C C   . SER A 1 192  ? 20.634  46.427  36.748  1.00 130.18 ? 208  SER A C   1 
ATOM   1369 O O   . SER A 1 192  ? 20.614  46.182  35.540  1.00 129.71 ? 208  SER A O   1 
ATOM   1370 C CB  . SER A 1 192  ? 19.416  48.543  37.248  1.00 128.54 ? 208  SER A CB  1 
ATOM   1371 N N   . THR A 1 193  ? 20.520  45.488  37.700  1.00 126.98 ? 209  THR A N   1 
ATOM   1372 C CA  . THR A 1 193  ? 20.350  44.058  37.465  1.00 126.50 ? 209  THR A CA  1 
ATOM   1373 C C   . THR A 1 193  ? 19.112  43.808  36.574  1.00 129.66 ? 209  THR A C   1 
ATOM   1374 O O   . THR A 1 193  ? 19.194  43.010  35.635  1.00 129.88 ? 209  THR A O   1 
ATOM   1375 C CB  . THR A 1 193  ? 20.373  43.331  38.830  1.00 135.91 ? 209  THR A CB  1 
ATOM   1376 O OG1 . THR A 1 193  ? 21.670  42.765  39.026  1.00 137.29 ? 209  THR A OG1 1 
ATOM   1377 C CG2 . THR A 1 193  ? 19.301  42.259  38.983  1.00 134.64 ? 209  THR A CG2 1 
ATOM   1378 N N   . LYS A 1 194  ? 18.000  44.543  36.824  1.00 124.49 ? 210  LYS A N   1 
ATOM   1379 C CA  . LYS A 1 194  ? 16.753  44.407  36.060  1.00 123.11 ? 210  LYS A CA  1 
ATOM   1380 C C   . LYS A 1 194  ? 16.658  45.379  34.874  1.00 124.87 ? 210  LYS A C   1 
ATOM   1381 O O   . LYS A 1 194  ? 15.555  45.795  34.523  1.00 123.74 ? 210  LYS A O   1 
ATOM   1382 C CB  . LYS A 1 194  ? 15.517  44.512  36.979  1.00 125.21 ? 210  LYS A CB  1 
ATOM   1383 C CG  . LYS A 1 194  ? 15.380  43.378  37.995  1.00 139.43 ? 210  LYS A CG  1 
ATOM   1384 N N   . ASP A 1 195  ? 17.800  45.708  34.231  1.00 121.21 ? 211  ASP A N   1 
ATOM   1385 C CA  . ASP A 1 195  ? 17.819  46.611  33.070  1.00 121.06 ? 211  ASP A CA  1 
ATOM   1386 C C   . ASP A 1 195  ? 17.618  45.894  31.726  1.00 124.14 ? 211  ASP A C   1 
ATOM   1387 O O   . ASP A 1 195  ? 18.228  44.853  31.474  1.00 123.65 ? 211  ASP A O   1 
ATOM   1388 C CB  . ASP A 1 195  ? 19.099  47.479  33.036  1.00 122.89 ? 211  ASP A CB  1 
ATOM   1389 C CG  . ASP A 1 195  ? 18.936  48.923  33.501  1.00 132.76 ? 211  ASP A CG  1 
ATOM   1390 O OD1 . ASP A 1 195  ? 17.875  49.528  33.213  1.00 133.59 ? 211  ASP A OD1 1 
ATOM   1391 O OD2 . ASP A 1 195  ? 19.900  49.474  34.077  1.00 136.69 ? 211  ASP A OD2 1 
ATOM   1392 N N   . VAL A 1 196  ? 16.779  46.477  30.855  1.00 120.22 ? 212  VAL A N   1 
ATOM   1393 C CA  . VAL A 1 196  ? 16.512  45.972  29.511  1.00 120.00 ? 212  VAL A CA  1 
ATOM   1394 C C   . VAL A 1 196  ? 17.775  46.192  28.636  1.00 125.39 ? 212  VAL A C   1 
ATOM   1395 O O   . VAL A 1 196  ? 18.629  46.993  29.031  1.00 124.84 ? 212  VAL A O   1 
ATOM   1396 C CB  . VAL A 1 196  ? 15.265  46.658  28.911  1.00 123.49 ? 212  VAL A CB  1 
ATOM   1397 N N   . PRO A 1 197  ? 17.942  45.499  27.475  1.00 122.74 ? 213  PRO A N   1 
ATOM   1398 C CA  . PRO A 1 197  ? 19.160  45.690  26.662  1.00 122.77 ? 213  PRO A CA  1 
ATOM   1399 C C   . PRO A 1 197  ? 19.498  47.128  26.236  1.00 125.70 ? 213  PRO A C   1 
ATOM   1400 O O   . PRO A 1 197  ? 20.656  47.521  26.393  1.00 125.26 ? 213  PRO A O   1 
ATOM   1401 C CB  . PRO A 1 197  ? 18.915  44.792  25.442  1.00 124.73 ? 213  PRO A CB  1 
ATOM   1402 C CG  . PRO A 1 197  ? 17.456  44.576  25.418  1.00 129.08 ? 213  PRO A CG  1 
ATOM   1403 C CD  . PRO A 1 197  ? 17.075  44.481  26.858  1.00 124.36 ? 213  PRO A CD  1 
ATOM   1404 N N   . LEU A 1 198  ? 18.519  47.908  25.714  1.00 121.17 ? 214  LEU A N   1 
ATOM   1405 C CA  . LEU A 1 198  ? 18.738  49.294  25.268  1.00 120.34 ? 214  LEU A CA  1 
ATOM   1406 C C   . LEU A 1 198  ? 19.411  50.171  26.348  1.00 123.50 ? 214  LEU A C   1 
ATOM   1407 O O   . LEU A 1 198  ? 20.326  50.935  26.035  1.00 122.99 ? 214  LEU A O   1 
ATOM   1408 C CB  . LEU A 1 198  ? 17.434  49.924  24.772  1.00 120.21 ? 214  LEU A CB  1 
ATOM   1409 N N   . ALA A 1 199  ? 19.002  50.001  27.624  1.00 119.19 ? 215  ALA A N   1 
ATOM   1410 C CA  . ALA A 1 199  ? 19.570  50.705  28.777  1.00 118.50 ? 215  ALA A CA  1 
ATOM   1411 C C   . ALA A 1 199  ? 21.090  50.509  28.852  1.00 121.90 ? 215  ALA A C   1 
ATOM   1412 O O   . ALA A 1 199  ? 21.813  51.474  29.079  1.00 121.51 ? 215  ALA A O   1 
ATOM   1413 C CB  . ALA A 1 199  ? 18.912  50.219  30.059  1.00 119.19 ? 215  ALA A CB  1 
ATOM   1414 N N   . LEU A 1 200  ? 21.565  49.269  28.620  1.00 118.19 ? 216  LEU A N   1 
ATOM   1415 C CA  . LEU A 1 200  ? 22.986  48.913  28.604  1.00 117.54 ? 216  LEU A CA  1 
ATOM   1416 C C   . LEU A 1 200  ? 23.613  49.256  27.248  1.00 120.27 ? 216  LEU A C   1 
ATOM   1417 O O   . LEU A 1 200  ? 24.836  49.249  27.131  1.00 118.93 ? 216  LEU A O   1 
ATOM   1418 C CB  . LEU A 1 200  ? 23.162  47.414  28.894  1.00 117.44 ? 216  LEU A CB  1 
ATOM   1419 N N   . MET A 1 201  ? 22.774  49.558  26.231  1.00 117.11 ? 217  MET A N   1 
ATOM   1420 C CA  . MET A 1 201  ? 23.216  49.874  24.872  1.00 116.93 ? 217  MET A CA  1 
ATOM   1421 C C   . MET A 1 201  ? 23.452  51.361  24.668  1.00 123.36 ? 217  MET A C   1 
ATOM   1422 O O   . MET A 1 201  ? 24.540  51.833  24.979  1.00 122.58 ? 217  MET A O   1 
ATOM   1423 C CB  . MET A 1 201  ? 22.244  49.312  23.808  1.00 118.63 ? 217  MET A CB  1 
ATOM   1424 C CG  . MET A 1 201  ? 22.678  47.992  23.198  1.00 121.08 ? 217  MET A CG  1 
ATOM   1425 S SD  . MET A 1 201  ? 21.734  47.557  21.717  1.00 123.90 ? 217  MET A SD  1 
ATOM   1426 C CE  . MET A 1 201  ? 20.161  47.094  22.443  1.00 120.31 ? 217  MET A CE  1 
ATOM   1427 N N   . ALA A 1 202  ? 22.437  52.094  24.146  1.00 122.66 ? 218  ALA A N   1 
ATOM   1428 C CA  . ALA A 1 202  ? 22.445  53.526  23.796  1.00 123.74 ? 218  ALA A CA  1 
ATOM   1429 C C   . ALA A 1 202  ? 23.141  54.444  24.806  1.00 129.72 ? 218  ALA A C   1 
ATOM   1430 O O   . ALA A 1 202  ? 23.632  55.506  24.407  1.00 129.48 ? 218  ALA A O   1 
ATOM   1431 C CB  . ALA A 1 202  ? 21.030  54.014  23.536  1.00 124.57 ? 218  ALA A CB  1 
ATOM   1432 N N   . CYS A 1 203  ? 23.188  54.032  26.097  1.00 127.06 ? 219  CYS A N   1 
ATOM   1433 C CA  . CYS A 1 203  ? 23.863  54.756  27.170  1.00 127.45 ? 219  CYS A CA  1 
ATOM   1434 C C   . CYS A 1 203  ? 25.372  54.766  26.911  1.00 133.94 ? 219  CYS A C   1 
ATOM   1435 O O   . CYS A 1 203  ? 25.997  55.813  27.066  1.00 133.77 ? 219  CYS A O   1 
ATOM   1436 C CB  . CYS A 1 203  ? 23.522  54.153  28.531  1.00 127.49 ? 219  CYS A CB  1 
ATOM   1437 S SG  . CYS A 1 203  ? 24.898  54.137  29.714  1.00 131.14 ? 219  CYS A SG  1 
ATOM   1438 N N   . ALA A 1 204  ? 25.946  53.603  26.513  1.00 132.36 ? 220  ALA A N   1 
ATOM   1439 C CA  . ALA A 1 204  ? 27.366  53.421  26.175  1.00 132.66 ? 220  ALA A CA  1 
ATOM   1440 C C   . ALA A 1 204  ? 27.717  54.080  24.821  1.00 137.61 ? 220  ALA A C   1 
ATOM   1441 O O   . ALA A 1 204  ? 28.888  54.410  24.591  1.00 137.19 ? 220  ALA A O   1 
ATOM   1442 C CB  . ALA A 1 204  ? 27.730  51.944  26.174  1.00 133.27 ? 220  ALA A CB  1 
ATOM   1443 N N   . LEU A 1 205  ? 26.695  54.287  23.943  1.00 134.51 ? 221  LEU A N   1 
ATOM   1444 C CA  . LEU A 1 205  ? 26.806  54.998  22.663  1.00 134.42 ? 221  LEU A CA  1 
ATOM   1445 C C   . LEU A 1 205  ? 26.866  56.514  22.984  1.00 139.56 ? 221  LEU A C   1 
ATOM   1446 O O   . LEU A 1 205  ? 27.581  57.263  22.312  1.00 139.00 ? 221  LEU A O   1 
ATOM   1447 C CB  . LEU A 1 205  ? 25.606  54.677  21.759  1.00 134.24 ? 221  LEU A CB  1 
ATOM   1448 N N   . ARG A 1 206  ? 26.132  56.940  24.044  1.00 137.05 ? 222  ARG A N   1 
ATOM   1449 C CA  . ARG A 1 206  ? 26.105  58.306  24.581  1.00 137.16 ? 222  ARG A CA  1 
ATOM   1450 C C   . ARG A 1 206  ? 27.361  58.564  25.434  1.00 142.87 ? 222  ARG A C   1 
ATOM   1451 O O   . ARG A 1 206  ? 27.799  59.711  25.539  1.00 143.12 ? 222  ARG A O   1 
ATOM   1452 C CB  . ARG A 1 206  ? 24.845  58.545  25.434  1.00 135.70 ? 222  ARG A CB  1 
ATOM   1453 C CG  . ARG A 1 206  ? 23.585  58.845  24.629  1.00 141.16 ? 222  ARG A CG  1 
ATOM   1454 C CD  . ARG A 1 206  ? 22.520  59.515  25.484  1.00 141.76 ? 222  ARG A CD  1 
ATOM   1455 N NE  . ARG A 1 206  ? 21.469  58.585  25.904  1.00 140.35 ? 222  ARG A NE  1 
ATOM   1456 C CZ  . ARG A 1 206  ? 20.242  58.554  25.393  1.00 148.56 ? 222  ARG A CZ  1 
ATOM   1457 N NH1 . ARG A 1 206  ? 19.892  59.407  24.438  1.00 134.82 ? 222  ARG A NH1 1 
ATOM   1458 N NH2 . ARG A 1 206  ? 19.353  57.678  25.838  1.00 132.01 ? 222  ARG A NH2 1 
ATOM   1459 N N   . LYS A 1 207  ? 27.926  57.498  26.046  1.00 139.92 ? 223  LYS A N   1 
ATOM   1460 C CA  . LYS A 1 207  ? 29.130  57.543  26.876  1.00 140.33 ? 223  LYS A CA  1 
ATOM   1461 C C   . LYS A 1 207  ? 30.389  57.690  26.020  1.00 147.06 ? 223  LYS A C   1 
ATOM   1462 O O   . LYS A 1 207  ? 31.417  58.145  26.524  1.00 146.93 ? 223  LYS A O   1 
ATOM   1463 C CB  . LYS A 1 207  ? 29.229  56.298  27.761  1.00 142.55 ? 223  LYS A CB  1 
ATOM   1464 N N   . LYS A 1 208  ? 30.311  57.300  24.735  1.00 145.59 ? 224  LYS A N   1 
ATOM   1465 C CA  . LYS A 1 208  ? 31.408  57.421  23.774  1.00 146.37 ? 224  LYS A CA  1 
ATOM   1466 C C   . LYS A 1 208  ? 31.444  58.851  23.210  1.00 152.35 ? 224  LYS A C   1 
ATOM   1467 O O   . LYS A 1 208  ? 32.512  59.476  23.188  1.00 152.01 ? 224  LYS A O   1 
ATOM   1468 C CB  . LYS A 1 208  ? 31.265  56.382  22.648  1.00 148.95 ? 224  LYS A CB  1 
ATOM   1469 N N   . ALA A 1 209  ? 30.264  59.371  22.786  1.00 150.11 ? 225  ALA A N   1 
ATOM   1470 C CA  . ALA A 1 209  ? 30.071  60.719  22.233  1.00 150.31 ? 225  ALA A CA  1 
ATOM   1471 C C   . ALA A 1 209  ? 30.433  61.837  23.238  1.00 153.93 ? 225  ALA A C   1 
ATOM   1472 O O   . ALA A 1 209  ? 30.940  62.883  22.822  1.00 153.47 ? 225  ALA A O   1 
ATOM   1473 C CB  . ALA A 1 209  ? 28.635  60.886  21.745  1.00 151.11 ? 225  ALA A CB  1 
ATOM   1474 N N   . THR A 1 210  ? 30.179  61.605  24.550  1.00 149.89 ? 226  THR A N   1 
ATOM   1475 C CA  . THR A 1 210  ? 30.485  62.542  25.638  1.00 162.97 ? 226  THR A CA  1 
ATOM   1476 C C   . THR A 1 210  ? 31.790  62.155  26.340  1.00 156.43 ? 226  THR A C   1 
ATOM   1477 O O   . THR A 1 210  ? 32.743  61.714  25.694  1.00 100.71 ? 226  THR A O   1 
ATOM   1478 C CB  . THR A 1 210  ? 29.320  62.622  26.628  1.00 169.22 ? 226  THR A CB  1 
ATOM   1479 N N   . GLU A 1 221  ? 18.552  52.117  19.359  1.00 118.95 ? 237  GLU A N   1 
ATOM   1480 C CA  . GLU A 1 221  ? 17.829  51.048  18.659  1.00 118.78 ? 237  GLU A CA  1 
ATOM   1481 C C   . GLU A 1 221  ? 18.649  50.400  17.526  1.00 122.68 ? 237  GLU A C   1 
ATOM   1482 O O   . GLU A 1 221  ? 18.142  49.551  16.783  1.00 121.71 ? 237  GLU A O   1 
ATOM   1483 C CB  . GLU A 1 221  ? 16.462  51.546  18.154  1.00 120.17 ? 237  GLU A CB  1 
ATOM   1484 C CG  . GLU A 1 221  ? 15.364  50.499  18.225  1.00 128.76 ? 237  GLU A CG  1 
ATOM   1485 N N   . ASP A 1 222  ? 19.915  50.795  17.394  1.00 120.21 ? 238  ASP A N   1 
ATOM   1486 C CA  . ASP A 1 222  ? 20.793  50.190  16.400  1.00 120.56 ? 238  ASP A CA  1 
ATOM   1487 C C   . ASP A 1 222  ? 21.814  49.352  17.141  1.00 122.98 ? 238  ASP A C   1 
ATOM   1488 O O   . ASP A 1 222  ? 22.116  49.652  18.301  1.00 122.45 ? 238  ASP A O   1 
ATOM   1489 C CB  . ASP A 1 222  ? 21.472  51.237  15.498  1.00 123.07 ? 238  ASP A CB  1 
ATOM   1490 C CG  . ASP A 1 222  ? 21.826  50.711  14.110  1.00 137.24 ? 238  ASP A CG  1 
ATOM   1491 O OD1 . ASP A 1 222  ? 22.205  49.516  13.997  1.00 138.18 ? 238  ASP A OD1 1 
ATOM   1492 O OD2 . ASP A 1 222  ? 21.745  51.497  13.138  1.00 144.02 ? 238  ASP A OD2 1 
ATOM   1493 N N   . TYR A 1 223  ? 22.319  48.282  16.486  1.00 118.40 ? 239  TYR A N   1 
ATOM   1494 C CA  . TYR A 1 223  ? 23.271  47.309  17.043  1.00 117.50 ? 239  TYR A CA  1 
ATOM   1495 C C   . TYR A 1 223  ? 22.650  46.468  18.208  1.00 119.03 ? 239  TYR A C   1 
ATOM   1496 O O   . TYR A 1 223  ? 21.514  46.725  18.628  1.00 118.56 ? 239  TYR A O   1 
ATOM   1497 C CB  . TYR A 1 223  ? 24.608  47.979  17.441  1.00 118.60 ? 239  TYR A CB  1 
ATOM   1498 N N   . THR A 1 224  ? 23.370  45.425  18.666  1.00 113.13 ? 240  THR A N   1 
ATOM   1499 C CA  . THR A 1 224  ? 22.977  44.543  19.779  1.00 111.78 ? 240  THR A CA  1 
ATOM   1500 C C   . THR A 1 224  ? 24.239  44.223  20.548  1.00 113.12 ? 240  THR A C   1 
ATOM   1501 O O   . THR A 1 224  ? 25.325  44.287  19.973  1.00 113.28 ? 240  THR A O   1 
ATOM   1502 C CB  . THR A 1 224  ? 22.349  43.207  19.289  1.00 119.22 ? 240  THR A CB  1 
ATOM   1503 O OG1 . THR A 1 224  ? 23.195  42.578  18.324  1.00 119.05 ? 240  THR A OG1 1 
ATOM   1504 C CG2 . THR A 1 224  ? 20.933  43.356  18.753  1.00 116.78 ? 240  THR A CG2 1 
ATOM   1505 N N   . LEU A 1 225  ? 24.124  43.858  21.821  1.00 107.55 ? 241  LEU A N   1 
ATOM   1506 C CA  . LEU A 1 225  ? 25.327  43.482  22.558  1.00 106.71 ? 241  LEU A CA  1 
ATOM   1507 C C   . LEU A 1 225  ? 25.692  42.024  22.211  1.00 108.00 ? 241  LEU A C   1 
ATOM   1508 O O   . LEU A 1 225  ? 24.803  41.218  21.934  1.00 107.65 ? 241  LEU A O   1 
ATOM   1509 C CB  . LEU A 1 225  ? 25.146  43.672  24.073  1.00 106.87 ? 241  LEU A CB  1 
ATOM   1510 N N   . GLN A 1 226  ? 26.991  41.709  22.183  1.00 102.18 ? 242  GLN A N   1 
ATOM   1511 C CA  . GLN A 1 226  ? 27.504  40.375  21.884  1.00 101.11 ? 242  GLN A CA  1 
ATOM   1512 C C   . GLN A 1 226  ? 28.554  39.996  22.922  1.00 104.00 ? 242  GLN A C   1 
ATOM   1513 O O   . GLN A 1 226  ? 29.449  40.795  23.203  1.00 104.71 ? 242  GLN A O   1 
ATOM   1514 C CB  . GLN A 1 226  ? 28.114  40.350  20.474  1.00 102.59 ? 242  GLN A CB  1 
ATOM   1515 C CG  . GLN A 1 226  ? 28.773  39.023  20.092  1.00 120.12 ? 242  GLN A CG  1 
ATOM   1516 C CD  . GLN A 1 226  ? 30.046  39.232  19.316  1.00 139.84 ? 242  GLN A CD  1 
ATOM   1517 O OE1 . GLN A 1 226  ? 31.008  39.845  19.798  1.00 133.12 ? 242  GLN A OE1 1 
ATOM   1518 N NE2 . GLN A 1 226  ? 30.089  38.699  18.103  1.00 136.16 ? 242  GLN A NE2 1 
ATOM   1519 N N   . VAL A 1 227  ? 28.458  38.783  23.483  1.00 98.66  ? 243  VAL A N   1 
ATOM   1520 C CA  . VAL A 1 227  ? 29.427  38.297  24.463  1.00 97.89  ? 243  VAL A CA  1 
ATOM   1521 C C   . VAL A 1 227  ? 30.727  38.077  23.700  1.00 103.62 ? 243  VAL A C   1 
ATOM   1522 O O   . VAL A 1 227  ? 30.714  37.416  22.663  1.00 103.83 ? 243  VAL A O   1 
ATOM   1523 C CB  . VAL A 1 227  ? 28.959  37.002  25.182  1.00 100.97 ? 243  VAL A CB  1 
ATOM   1524 C CG1 . VAL A 1 227  ? 29.965  36.564  26.244  1.00 100.23 ? 243  VAL A CG1 1 
ATOM   1525 C CG2 . VAL A 1 227  ? 27.565  37.167  25.785  1.00 100.63 ? 243  VAL A CG2 1 
ATOM   1526 N N   . ASN A 1 228  ? 31.824  38.687  24.177  1.00 101.20 ? 244  ASN A N   1 
ATOM   1527 C CA  . ASN A 1 228  ? 33.157  38.606  23.576  1.00 100.91 ? 244  ASN A CA  1 
ATOM   1528 C C   . ASN A 1 228  ? 33.585  37.150  23.406  1.00 104.35 ? 244  ASN A C   1 
ATOM   1529 O O   . ASN A 1 228  ? 33.447  36.367  24.352  1.00 104.00 ? 244  ASN A O   1 
ATOM   1530 C CB  . ASN A 1 228  ? 34.182  39.333  24.469  1.00 101.70 ? 244  ASN A CB  1 
ATOM   1531 C CG  . ASN A 1 228  ? 34.128  40.845  24.473  1.00 108.18 ? 244  ASN A CG  1 
ATOM   1532 O OD1 . ASN A 1 228  ? 33.094  41.475  24.193  1.00 93.69  ? 244  ASN A OD1 1 
ATOM   1533 N ND2 . ASN A 1 228  ? 35.243  41.452  24.883  1.00 93.73  ? 244  ASN A ND2 1 
ATOM   1534 N N   . GLY A 1 229  ? 34.066  36.809  22.202  1.00 100.66 ? 245  GLY A N   1 
ATOM   1535 C CA  . GLY A 1 229  ? 34.566  35.476  21.835  1.00 99.83  ? 245  GLY A CA  1 
ATOM   1536 C C   . GLY A 1 229  ? 33.560  34.349  21.973  1.00 100.29 ? 245  GLY A C   1 
ATOM   1537 O O   . GLY A 1 229  ? 33.910  33.205  22.305  1.00 99.03  ? 245  GLY A O   1 
ATOM   1538 N N   . ARG A 1 230  ? 32.292  34.708  21.727  1.00 94.18  ? 246  ARG A N   1 
ATOM   1539 C CA  . ARG A 1 230  ? 31.111  33.864  21.794  1.00 92.05  ? 246  ARG A CA  1 
ATOM   1540 C C   . ARG A 1 230  ? 30.152  34.322  20.728  1.00 93.54  ? 246  ARG A C   1 
ATOM   1541 O O   . ARG A 1 230  ? 30.217  35.467  20.277  1.00 92.75  ? 246  ARG A O   1 
ATOM   1542 C CB  . ARG A 1 230  ? 30.412  34.034  23.152  1.00 88.26  ? 246  ARG A CB  1 
ATOM   1543 C CG  . ARG A 1 230  ? 30.760  32.970  24.152  1.00 93.33  ? 246  ARG A CG  1 
ATOM   1544 C CD  . ARG A 1 230  ? 29.759  32.948  25.282  1.00 92.84  ? 246  ARG A CD  1 
ATOM   1545 N NE  . ARG A 1 230  ? 28.562  32.173  24.969  1.00 97.21  ? 246  ARG A NE  1 
ATOM   1546 C CZ  . ARG A 1 230  ? 28.503  30.846  25.024  1.00 118.06 ? 246  ARG A CZ  1 
ATOM   1547 N NH1 . ARG A 1 230  ? 29.581  30.138  25.338  1.00 112.16 ? 246  ARG A NH1 1 
ATOM   1548 N NH2 . ARG A 1 230  ? 27.369  30.216  24.756  1.00 104.33 ? 246  ARG A NH2 1 
ATOM   1549 N N   . HIS A 1 231  ? 29.243  33.432  20.352  1.00 88.82  ? 247  HIS A N   1 
ATOM   1550 C CA  . HIS A 1 231  ? 28.162  33.731  19.444  1.00 87.65  ? 247  HIS A CA  1 
ATOM   1551 C C   . HIS A 1 231  ? 26.889  33.820  20.290  1.00 89.08  ? 247  HIS A C   1 
ATOM   1552 O O   . HIS A 1 231  ? 25.902  33.158  19.993  1.00 89.16  ? 247  HIS A O   1 
ATOM   1553 C CB  . HIS A 1 231  ? 28.082  32.680  18.337  1.00 88.53  ? 247  HIS A CB  1 
ATOM   1554 C CG  . HIS A 1 231  ? 29.085  32.900  17.249  1.00 92.03  ? 247  HIS A CG  1 
ATOM   1555 N ND1 . HIS A 1 231  ? 29.043  34.030  16.442  1.00 93.71  ? 247  HIS A ND1 1 
ATOM   1556 C CD2 . HIS A 1 231  ? 30.129  32.126  16.865  1.00 93.59  ? 247  HIS A CD2 1 
ATOM   1557 C CE1 . HIS A 1 231  ? 30.060  33.908  15.607  1.00 93.05  ? 247  HIS A CE1 1 
ATOM   1558 N NE2 . HIS A 1 231  ? 30.744  32.779  15.826  1.00 93.32  ? 247  HIS A NE2 1 
ATOM   1559 N N   . GLU A 1 232  ? 26.944  34.610  21.386  1.00 83.83  ? 248  GLU A N   1 
ATOM   1560 C CA  . GLU A 1 232  ? 25.812  34.862  22.286  1.00 83.79  ? 248  GLU A CA  1 
ATOM   1561 C C   . GLU A 1 232  ? 25.477  36.361  22.289  1.00 89.11  ? 248  GLU A C   1 
ATOM   1562 O O   . GLU A 1 232  ? 26.321  37.194  22.632  1.00 88.65  ? 248  GLU A O   1 
ATOM   1563 C CB  . GLU A 1 232  ? 26.050  34.331  23.717  1.00 84.72  ? 248  GLU A CB  1 
ATOM   1564 C CG  . GLU A 1 232  ? 24.763  34.253  24.527  1.00 88.32  ? 248  GLU A CG  1 
ATOM   1565 C CD  . GLU A 1 232  ? 24.923  34.131  26.027  1.00 109.25 ? 248  GLU A CD  1 
ATOM   1566 O OE1 . GLU A 1 232  ? 25.906  33.493  26.470  1.00 112.18 ? 248  GLU A OE1 1 
ATOM   1567 O OE2 . GLU A 1 232  ? 24.043  34.641  26.761  1.00 100.74 ? 248  GLU A OE2 1 
ATOM   1568 N N   . TYR A 1 233  ? 24.251  36.696  21.888  1.00 86.32  ? 249  TYR A N   1 
ATOM   1569 C CA  . TYR A 1 233  ? 23.828  38.087  21.791  1.00 86.56  ? 249  TYR A CA  1 
ATOM   1570 C C   . TYR A 1 233  ? 22.767  38.450  22.841  1.00 91.30  ? 249  TYR A C   1 
ATOM   1571 O O   . TYR A 1 233  ? 21.870  37.644  23.120  1.00 91.02  ? 249  TYR A O   1 
ATOM   1572 C CB  . TYR A 1 233  ? 23.372  38.416  20.348  1.00 87.81  ? 249  TYR A CB  1 
ATOM   1573 C CG  . TYR A 1 233  ? 24.466  38.250  19.306  1.00 90.41  ? 249  TYR A CG  1 
ATOM   1574 C CD1 . TYR A 1 233  ? 24.935  36.988  18.949  1.00 92.44  ? 249  TYR A CD1 1 
ATOM   1575 C CD2 . TYR A 1 233  ? 25.013  39.354  18.657  1.00 91.46  ? 249  TYR A CD2 1 
ATOM   1576 C CE1 . TYR A 1 233  ? 25.950  36.830  18.006  1.00 93.87  ? 249  TYR A CE1 1 
ATOM   1577 C CE2 . TYR A 1 233  ? 26.028  39.210  17.710  1.00 92.33  ? 249  TYR A CE2 1 
ATOM   1578 C CZ  . TYR A 1 233  ? 26.496  37.944  17.387  1.00 99.77  ? 249  TYR A CZ  1 
ATOM   1579 O OH  . TYR A 1 233  ? 27.486  37.786  16.442  1.00 99.39  ? 249  TYR A OH  1 
ATOM   1580 N N   . LEU A 1 234  ? 22.916  39.651  23.457  1.00 87.06  ? 250  LEU A N   1 
ATOM   1581 C CA  . LEU A 1 234  ? 21.998  40.223  24.447  1.00 85.86  ? 250  LEU A CA  1 
ATOM   1582 C C   . LEU A 1 234  ? 21.053  41.190  23.708  1.00 91.07  ? 250  LEU A C   1 
ATOM   1583 O O   . LEU A 1 234  ? 21.505  42.202  23.150  1.00 91.54  ? 250  LEU A O   1 
ATOM   1584 C CB  . LEU A 1 234  ? 22.773  40.955  25.549  1.00 85.30  ? 250  LEU A CB  1 
ATOM   1585 C CG  . LEU A 1 234  ? 23.517  40.086  26.550  1.00 89.42  ? 250  LEU A CG  1 
ATOM   1586 N N   . TYR A 1 235  ? 19.756  40.837  23.645  1.00 87.16  ? 251  TYR A N   1 
ATOM   1587 C CA  . TYR A 1 235  ? 18.720  41.607  22.957  1.00 87.18  ? 251  TYR A CA  1 
ATOM   1588 C C   . TYR A 1 235  ? 17.290  41.216  23.441  1.00 92.55  ? 251  TYR A C   1 
ATOM   1589 O O   . TYR A 1 235  ? 17.150  40.392  24.344  1.00 92.54  ? 251  TYR A O   1 
ATOM   1590 C CB  . TYR A 1 235  ? 18.880  41.464  21.424  1.00 88.81  ? 251  TYR A CB  1 
ATOM   1591 C CG  . TYR A 1 235  ? 18.573  40.083  20.879  1.00 91.78  ? 251  TYR A CG  1 
ATOM   1592 C CD1 . TYR A 1 235  ? 19.566  39.105  20.792  1.00 94.34  ? 251  TYR A CD1 1 
ATOM   1593 C CD2 . TYR A 1 235  ? 17.303  39.767  20.401  1.00 92.63  ? 251  TYR A CD2 1 
ATOM   1594 C CE1 . TYR A 1 235  ? 19.288  37.830  20.288  1.00 94.77  ? 251  TYR A CE1 1 
ATOM   1595 C CE2 . TYR A 1 235  ? 17.011  38.493  19.909  1.00 94.00  ? 251  TYR A CE2 1 
ATOM   1596 C CZ  . TYR A 1 235  ? 18.009  37.531  19.843  1.00 102.20 ? 251  TYR A CZ  1 
ATOM   1597 O OH  . TYR A 1 235  ? 17.718  36.282  19.343  1.00 103.15 ? 251  TYR A OH  1 
ATOM   1598 N N   . GLY A 1 236  ? 16.256  41.818  22.843  1.00 89.75  ? 252  GLY A N   1 
ATOM   1599 C CA  . GLY A 1 236  ? 14.854  41.569  23.170  1.00 89.39  ? 252  GLY A CA  1 
ATOM   1600 C C   . GLY A 1 236  ? 14.399  42.146  24.497  1.00 93.26  ? 252  GLY A C   1 
ATOM   1601 O O   . GLY A 1 236  ? 15.217  42.585  25.308  1.00 91.83  ? 252  GLY A O   1 
ATOM   1602 N N   . SER A 1 237  ? 13.084  42.065  24.759  1.00 90.62  ? 253  SER A N   1 
ATOM   1603 C CA  . SER A 1 237  ? 12.403  42.587  25.954  1.00 90.96  ? 253  SER A CA  1 
ATOM   1604 C C   . SER A 1 237  ? 12.753  41.922  27.345  1.00 95.58  ? 253  SER A C   1 
ATOM   1605 O O   . SER A 1 237  ? 11.872  41.849  28.201  1.00 96.07  ? 253  SER A O   1 
ATOM   1606 C CB  . SER A 1 237  ? 10.893  42.526  25.729  1.00 94.35  ? 253  SER A CB  1 
ATOM   1607 O OG  . SER A 1 237  ? 10.459  41.205  25.448  1.00 100.88 ? 253  SER A OG  1 
ATOM   1608 N N   . TYR A 1 238  ? 14.016  41.549  27.623  1.00 90.94  ? 254  TYR A N   1 
ATOM   1609 C CA  . TYR A 1 238  ? 14.332  40.861  28.889  1.00 90.09  ? 254  TYR A CA  1 
ATOM   1610 C C   . TYR A 1 238  ? 15.324  41.551  29.849  1.00 96.44  ? 254  TYR A C   1 
ATOM   1611 O O   . TYR A 1 238  ? 16.320  42.105  29.368  1.00 97.37  ? 254  TYR A O   1 
ATOM   1612 C CB  . TYR A 1 238  ? 14.874  39.449  28.579  1.00 89.35  ? 254  TYR A CB  1 
ATOM   1613 C CG  . TYR A 1 238  ? 13.868  38.474  28.011  1.00 87.37  ? 254  TYR A CG  1 
ATOM   1614 C CD1 . TYR A 1 238  ? 13.115  37.659  28.846  1.00 88.68  ? 254  TYR A CD1 1 
ATOM   1615 C CD2 . TYR A 1 238  ? 13.743  38.293  26.636  1.00 87.14  ? 254  TYR A CD2 1 
ATOM   1616 C CE1 . TYR A 1 238  ? 12.230  36.715  28.333  1.00 89.36  ? 254  TYR A CE1 1 
ATOM   1617 C CE2 . TYR A 1 238  ? 12.871  37.340  26.108  1.00 87.63  ? 254  TYR A CE2 1 
ATOM   1618 C CZ  . TYR A 1 238  ? 12.114  36.552  26.963  1.00 93.02  ? 254  TYR A CZ  1 
ATOM   1619 O OH  . TYR A 1 238  ? 11.244  35.602  26.480  1.00 89.78  ? 254  TYR A OH  1 
ATOM   1620 N N   . PRO A 1 239  ? 15.156  41.406  31.201  1.00 93.15  ? 255  PRO A N   1 
ATOM   1621 C CA  . PRO A 1 239  ? 16.140  41.990  32.142  1.00 93.17  ? 255  PRO A CA  1 
ATOM   1622 C C   . PRO A 1 239  ? 17.506  41.337  32.020  1.00 98.27  ? 255  PRO A C   1 
ATOM   1623 O O   . PRO A 1 239  ? 17.588  40.143  31.746  1.00 97.22  ? 255  PRO A O   1 
ATOM   1624 C CB  . PRO A 1 239  ? 15.541  41.701  33.521  1.00 95.06  ? 255  PRO A CB  1 
ATOM   1625 C CG  . PRO A 1 239  ? 14.594  40.576  33.306  1.00 99.73  ? 255  PRO A CG  1 
ATOM   1626 C CD  . PRO A 1 239  ? 14.041  40.768  31.931  1.00 95.10  ? 255  PRO A CD  1 
ATOM   1627 N N   . LEU A 1 240  ? 18.570  42.118  32.231  1.00 96.81  ? 256  LEU A N   1 
ATOM   1628 C CA  . LEU A 1 240  ? 19.949  41.659  32.088  1.00 97.27  ? 256  LEU A CA  1 
ATOM   1629 C C   . LEU A 1 240  ? 20.260  40.389  32.879  1.00 104.50 ? 256  LEU A C   1 
ATOM   1630 O O   . LEU A 1 240  ? 20.828  39.459  32.313  1.00 104.20 ? 256  LEU A O   1 
ATOM   1631 C CB  . LEU A 1 240  ? 20.952  42.777  32.413  1.00 96.86  ? 256  LEU A CB  1 
ATOM   1632 C CG  . LEU A 1 240  ? 21.424  43.596  31.219  1.00 100.76 ? 256  LEU A CG  1 
ATOM   1633 N N   . CYS A 1 241  ? 19.835  40.323  34.153  1.00 103.82 ? 257  CYS A N   1 
ATOM   1634 C CA  . CYS A 1 241  ? 20.088  39.188  35.059  1.00 104.69 ? 257  CYS A CA  1 
ATOM   1635 C C   . CYS A 1 241  ? 19.549  37.832  34.545  1.00 106.98 ? 257  CYS A C   1 
ATOM   1636 O O   . CYS A 1 241  ? 20.079  36.791  34.951  1.00 106.80 ? 257  CYS A O   1 
ATOM   1637 C CB  . CYS A 1 241  ? 19.593  39.487  36.476  1.00 105.63 ? 257  CYS A CB  1 
ATOM   1638 S SG  . CYS A 1 241  ? 17.788  39.487  36.659  1.00 109.88 ? 257  CYS A SG  1 
ATOM   1639 N N   . GLN A 1 242  ? 18.513  37.855  33.662  1.00 101.21 ? 258  GLN A N   1 
ATOM   1640 C CA  . GLN A 1 242  ? 17.874  36.678  33.052  1.00 99.91  ? 258  GLN A CA  1 
ATOM   1641 C C   . GLN A 1 242  ? 18.668  36.059  31.874  1.00 101.26 ? 258  GLN A C   1 
ATOM   1642 O O   . GLN A 1 242  ? 18.198  35.085  31.286  1.00 100.43 ? 258  GLN A O   1 
ATOM   1643 C CB  . GLN A 1 242  ? 16.439  37.010  32.602  1.00 101.13 ? 258  GLN A CB  1 
ATOM   1644 C CG  . GLN A 1 242  ? 15.375  36.638  33.615  1.00 115.84 ? 258  GLN A CG  1 
ATOM   1645 C CD  . GLN A 1 242  ? 14.052  36.409  32.931  1.00 131.80 ? 258  GLN A CD  1 
ATOM   1646 O OE1 . GLN A 1 242  ? 13.270  37.343  32.709  1.00 124.17 ? 258  GLN A OE1 1 
ATOM   1647 N NE2 . GLN A 1 242  ? 13.784  35.159  32.560  1.00 122.46 ? 258  GLN A NE2 1 
ATOM   1648 N N   . PHE A 1 243  ? 19.843  36.631  31.522  1.00 95.83  ? 259  PHE A N   1 
ATOM   1649 C CA  . PHE A 1 243  ? 20.702  36.155  30.433  1.00 94.44  ? 259  PHE A CA  1 
ATOM   1650 C C   . PHE A 1 243  ? 21.804  35.312  31.055  1.00 99.11  ? 259  PHE A C   1 
ATOM   1651 O O   . PHE A 1 243  ? 22.557  35.835  31.880  1.00 99.69  ? 259  PHE A O   1 
ATOM   1652 C CB  . PHE A 1 243  ? 21.319  37.334  29.658  1.00 94.99  ? 259  PHE A CB  1 
ATOM   1653 C CG  . PHE A 1 243  ? 20.371  38.138  28.801  1.00 95.50  ? 259  PHE A CG  1 
ATOM   1654 C CD1 . PHE A 1 243  ? 19.648  39.195  29.338  1.00 98.05  ? 259  PHE A CD1 1 
ATOM   1655 C CD2 . PHE A 1 243  ? 20.261  37.892  27.440  1.00 96.44  ? 259  PHE A CD2 1 
ATOM   1656 C CE1 . PHE A 1 243  ? 18.792  39.962  28.534  1.00 98.38  ? 259  PHE A CE1 1 
ATOM   1657 C CE2 . PHE A 1 243  ? 19.424  38.673  26.636  1.00 98.58  ? 259  PHE A CE2 1 
ATOM   1658 C CZ  . PHE A 1 243  ? 18.689  39.696  27.188  1.00 96.50  ? 259  PHE A CZ  1 
ATOM   1659 N N   . GLN A 1 244  ? 21.905  34.015  30.664  1.00 94.27  ? 260  GLN A N   1 
ATOM   1660 C CA  . GLN A 1 244  ? 22.880  33.047  31.185  1.00 93.05  ? 260  GLN A CA  1 
ATOM   1661 C C   . GLN A 1 244  ? 24.264  33.620  31.473  1.00 96.21  ? 260  GLN A C   1 
ATOM   1662 O O   . GLN A 1 244  ? 24.827  33.309  32.525  1.00 95.89  ? 260  GLN A O   1 
ATOM   1663 C CB  . GLN A 1 244  ? 23.007  31.831  30.265  1.00 94.16  ? 260  GLN A CB  1 
ATOM   1664 C CG  . GLN A 1 244  ? 22.118  30.657  30.648  1.00 104.95 ? 260  GLN A CG  1 
ATOM   1665 C CD  . GLN A 1 244  ? 22.163  29.555  29.617  1.00 124.41 ? 260  GLN A CD  1 
ATOM   1666 O OE1 . GLN A 1 244  ? 23.231  29.044  29.253  1.00 126.58 ? 260  GLN A OE1 1 
ATOM   1667 N NE2 . GLN A 1 244  ? 21.003  29.155  29.126  1.00 110.51 ? 260  GLN A NE2 1 
ATOM   1668 N N   . TYR A 1 245  ? 24.803  34.456  30.551  1.00 91.90  ? 261  TYR A N   1 
ATOM   1669 C CA  . TYR A 1 245  ? 26.130  35.066  30.678  1.00 91.20  ? 261  TYR A CA  1 
ATOM   1670 C C   . TYR A 1 245  ? 26.205  36.001  31.877  1.00 94.38  ? 261  TYR A C   1 
ATOM   1671 O O   . TYR A 1 245  ? 26.981  35.751  32.804  1.00 92.31  ? 261  TYR A O   1 
ATOM   1672 C CB  . TYR A 1 245  ? 26.560  35.780  29.368  1.00 91.92  ? 261  TYR A CB  1 
ATOM   1673 C CG  . TYR A 1 245  ? 27.891  36.505  29.462  1.00 93.50  ? 261  TYR A CG  1 
ATOM   1674 C CD1 . TYR A 1 245  ? 29.064  35.817  29.773  1.00 95.56  ? 261  TYR A CD1 1 
ATOM   1675 C CD2 . TYR A 1 245  ? 27.980  37.876  29.240  1.00 94.13  ? 261  TYR A CD2 1 
ATOM   1676 C CE1 . TYR A 1 245  ? 30.291  36.477  29.862  1.00 96.42  ? 261  TYR A CE1 1 
ATOM   1677 C CE2 . TYR A 1 245  ? 29.205  38.542  29.299  1.00 94.98  ? 261  TYR A CE2 1 
ATOM   1678 C CZ  . TYR A 1 245  ? 30.355  37.844  29.640  1.00 103.33 ? 261  TYR A CZ  1 
ATOM   1679 O OH  . TYR A 1 245  ? 31.567  38.490  29.726  1.00 104.08 ? 261  TYR A OH  1 
ATOM   1680 N N   . ILE A 1 246  ? 25.372  37.058  31.860  1.00 91.88  ? 262  ILE A N   1 
ATOM   1681 C CA  . ILE A 1 246  ? 25.273  38.072  32.904  1.00 92.30  ? 262  ILE A CA  1 
ATOM   1682 C C   . ILE A 1 246  ? 25.074  37.373  34.238  1.00 100.24 ? 262  ILE A C   1 
ATOM   1683 O O   . ILE A 1 246  ? 25.814  37.630  35.189  1.00 100.14 ? 262  ILE A O   1 
ATOM   1684 C CB  . ILE A 1 246  ? 24.117  39.046  32.564  1.00 95.05  ? 262  ILE A CB  1 
ATOM   1685 C CG1 . ILE A 1 246  ? 24.462  39.942  31.356  1.00 94.47  ? 262  ILE A CG1 1 
ATOM   1686 C CG2 . ILE A 1 246  ? 23.714  39.881  33.778  1.00 97.28  ? 262  ILE A CG2 1 
ATOM   1687 N N   . CYS A 1 247  ? 24.098  36.446  34.270  1.00 99.83  ? 263  CYS A N   1 
ATOM   1688 C CA  . CYS A 1 247  ? 23.704  35.605  35.400  1.00 100.82 ? 263  CYS A CA  1 
ATOM   1689 C C   . CYS A 1 247  ? 24.904  34.857  35.997  1.00 105.70 ? 263  CYS A C   1 
ATOM   1690 O O   . CYS A 1 247  ? 25.116  34.941  37.204  1.00 105.05 ? 263  CYS A O   1 
ATOM   1691 C CB  . CYS A 1 247  ? 22.599  34.643  34.967  1.00 101.46 ? 263  CYS A CB  1 
ATOM   1692 S SG  . CYS A 1 247  ? 21.797  33.765  36.329  1.00 105.45 ? 263  CYS A SG  1 
ATOM   1693 N N   . SER A 1 248  ? 25.699  34.155  35.146  1.00 103.97 ? 264  SER A N   1 
ATOM   1694 C CA  . SER A 1 248  ? 26.889  33.395  35.560  1.00 104.38 ? 264  SER A CA  1 
ATOM   1695 C C   . SER A 1 248  ? 28.001  34.326  36.010  1.00 110.52 ? 264  SER A C   1 
ATOM   1696 O O   . SER A 1 248  ? 28.753  33.979  36.923  1.00 109.83 ? 264  SER A O   1 
ATOM   1697 C CB  . SER A 1 248  ? 27.367  32.442  34.461  1.00 106.90 ? 264  SER A CB  1 
ATOM   1698 O OG  . SER A 1 248  ? 27.972  33.090  33.354  1.00 114.11 ? 264  SER A OG  1 
ATOM   1699 N N   . CYS A 1 249  ? 28.073  35.529  35.387  1.00 108.99 ? 265  CYS A N   1 
ATOM   1700 C CA  . CYS A 1 249  ? 29.036  36.582  35.705  1.00 108.93 ? 265  CYS A CA  1 
ATOM   1701 C C   . CYS A 1 249  ? 28.778  37.081  37.113  1.00 113.14 ? 265  CYS A C   1 
ATOM   1702 O O   . CYS A 1 249  ? 29.696  37.036  37.927  1.00 112.20 ? 265  CYS A O   1 
ATOM   1703 C CB  . CYS A 1 249  ? 28.966  37.713  34.684  1.00 109.08 ? 265  CYS A CB  1 
ATOM   1704 S SG  . CYS A 1 249  ? 29.805  37.351  33.124  1.00 112.83 ? 265  CYS A SG  1 
ATOM   1705 N N   . LEU A 1 250  ? 27.510  37.469  37.418  1.00 110.79 ? 266  LEU A N   1 
ATOM   1706 C CA  . LEU A 1 250  ? 27.057  37.921  38.737  1.00 111.54 ? 266  LEU A CA  1 
ATOM   1707 C C   . LEU A 1 250  ? 27.485  36.915  39.819  1.00 120.01 ? 266  LEU A C   1 
ATOM   1708 O O   . LEU A 1 250  ? 28.223  37.287  40.733  1.00 120.38 ? 266  LEU A O   1 
ATOM   1709 C CB  . LEU A 1 250  ? 25.527  38.094  38.764  1.00 111.23 ? 266  LEU A CB  1 
ATOM   1710 C CG  . LEU A 1 250  ? 24.958  39.315  38.064  1.00 115.51 ? 266  LEU A CG  1 
ATOM   1711 N N   . HIS A 1 251  ? 27.088  35.632  39.663  1.00 119.25 ? 267  HIS A N   1 
ATOM   1712 C CA  . HIS A 1 251  ? 27.409  34.541  40.589  1.00 120.09 ? 267  HIS A CA  1 
ATOM   1713 C C   . HIS A 1 251  ? 28.918  34.284  40.737  1.00 124.20 ? 267  HIS A C   1 
ATOM   1714 O O   . HIS A 1 251  ? 29.403  34.229  41.868  1.00 124.18 ? 267  HIS A O   1 
ATOM   1715 C CB  . HIS A 1 251  ? 26.652  33.254  40.219  1.00 121.32 ? 267  HIS A CB  1 
ATOM   1716 C CG  . HIS A 1 251  ? 26.332  32.415  41.414  1.00 124.99 ? 267  HIS A CG  1 
ATOM   1717 N ND1 . HIS A 1 251  ? 27.148  31.364  41.796  1.00 126.81 ? 267  HIS A ND1 1 
ATOM   1718 C CD2 . HIS A 1 251  ? 25.327  32.540  42.313  1.00 126.87 ? 267  HIS A CD2 1 
ATOM   1719 C CE1 . HIS A 1 251  ? 26.607  30.875  42.901  1.00 126.30 ? 267  HIS A CE1 1 
ATOM   1720 N NE2 . HIS A 1 251  ? 25.506  31.545  43.247  1.00 126.64 ? 267  HIS A NE2 1 
ATOM   1721 N N   . SER A 1 252  ? 29.662  34.175  39.611  1.00 120.52 ? 268  SER A N   1 
ATOM   1722 C CA  . SER A 1 252  ? 31.117  33.959  39.622  1.00 120.30 ? 268  SER A CA  1 
ATOM   1723 C C   . SER A 1 252  ? 31.915  35.256  39.942  1.00 124.50 ? 268  SER A C   1 
ATOM   1724 O O   . SER A 1 252  ? 33.149  35.227  39.968  1.00 124.49 ? 268  SER A O   1 
ATOM   1725 C CB  . SER A 1 252  ? 31.582  33.336  38.305  1.00 123.21 ? 268  SER A CB  1 
ATOM   1726 O OG  . SER A 1 252  ? 32.921  32.873  38.366  1.00 129.11 ? 268  SER A OG  1 
ATOM   1727 N N   . GLY A 1 253  ? 31.199  36.361  40.188  1.00 120.24 ? 269  GLY A N   1 
ATOM   1728 C CA  . GLY A 1 253  ? 31.772  37.667  40.506  1.00 119.46 ? 269  GLY A CA  1 
ATOM   1729 C C   . GLY A 1 253  ? 32.084  38.521  39.289  1.00 121.56 ? 269  GLY A C   1 
ATOM   1730 O O   . GLY A 1 253  ? 31.635  39.671  39.208  1.00 120.62 ? 269  GLY A O   1 
ATOM   1731 N N   . LEU A 1 254  ? 32.846  37.927  38.327  1.00 116.84 ? 270  LEU A N   1 
ATOM   1732 C CA  . LEU A 1 254  ? 33.369  38.448  37.050  1.00 115.85 ? 270  LEU A CA  1 
ATOM   1733 C C   . LEU A 1 254  ? 32.473  39.465  36.333  1.00 119.73 ? 270  LEU A C   1 
ATOM   1734 O O   . LEU A 1 254  ? 31.250  39.343  36.370  1.00 120.53 ? 270  LEU A O   1 
ATOM   1735 C CB  . LEU A 1 254  ? 33.709  37.291  36.100  1.00 115.58 ? 270  LEU A CB  1 
ATOM   1736 C CG  . LEU A 1 254  ? 34.899  36.419  36.506  1.00 119.90 ? 270  LEU A CG  1 
ATOM   1737 N N   . THR A 1 255  ? 33.097  40.474  35.687  1.00 114.65 ? 271  THR A N   1 
ATOM   1738 C CA  . THR A 1 255  ? 32.420  41.569  34.982  1.00 113.29 ? 271  THR A CA  1 
ATOM   1739 C C   . THR A 1 255  ? 32.158  41.234  33.502  1.00 115.65 ? 271  THR A C   1 
ATOM   1740 O O   . THR A 1 255  ? 33.078  40.848  32.777  1.00 114.63 ? 271  THR A O   1 
ATOM   1741 C CB  . THR A 1 255  ? 33.173  42.888  35.175  1.00 118.29 ? 271  THR A CB  1 
ATOM   1742 O OG1 . THR A 1 255  ? 34.500  42.740  34.678  1.00 118.55 ? 271  THR A OG1 1 
ATOM   1743 C CG2 . THR A 1 255  ? 33.206  43.339  36.637  1.00 114.83 ? 271  THR A CG2 1 
ATOM   1744 N N   . PRO A 1 256  ? 30.892  41.361  33.047  1.00 111.66 ? 272  PRO A N   1 
ATOM   1745 C CA  . PRO A 1 256  ? 30.560  41.007  31.655  1.00 110.86 ? 272  PRO A CA  1 
ATOM   1746 C C   . PRO A 1 256  ? 31.130  41.929  30.577  1.00 112.76 ? 272  PRO A C   1 
ATOM   1747 O O   . PRO A 1 256  ? 30.889  43.133  30.613  1.00 111.92 ? 272  PRO A O   1 
ATOM   1748 C CB  . PRO A 1 256  ? 29.024  41.017  31.641  1.00 112.74 ? 272  PRO A CB  1 
ATOM   1749 C CG  . PRO A 1 256  ? 28.601  41.034  33.077  1.00 117.50 ? 272  PRO A CG  1 
ATOM   1750 C CD  . PRO A 1 256  ? 29.684  41.765  33.792  1.00 113.20 ? 272  PRO A CD  1 
ATOM   1751 N N   . HIS A 1 257  ? 31.857  41.354  29.598  1.00 108.40 ? 273  HIS A N   1 
ATOM   1752 C CA  . HIS A 1 257  ? 32.428  42.114  28.483  1.00 107.55 ? 273  HIS A CA  1 
ATOM   1753 C C   . HIS A 1 257  ? 31.624  41.940  27.208  1.00 109.20 ? 273  HIS A C   1 
ATOM   1754 O O   . HIS A 1 257  ? 31.681  40.896  26.562  1.00 107.70 ? 273  HIS A O   1 
ATOM   1755 C CB  . HIS A 1 257  ? 33.902  41.778  28.254  1.00 108.66 ? 273  HIS A CB  1 
ATOM   1756 C CG  . HIS A 1 257  ? 34.807  42.183  29.374  1.00 112.63 ? 273  HIS A CG  1 
ATOM   1757 N ND1 . HIS A 1 257  ? 34.458  41.982  30.701  1.00 114.72 ? 273  HIS A ND1 1 
ATOM   1758 C CD2 . HIS A 1 257  ? 36.050  42.709  29.325  1.00 114.65 ? 273  HIS A CD2 1 
ATOM   1759 C CE1 . HIS A 1 257  ? 35.486  42.411  31.411  1.00 114.15 ? 273  HIS A CE1 1 
ATOM   1760 N NE2 . HIS A 1 257  ? 36.468  42.856  30.627  1.00 114.50 ? 273  HIS A NE2 1 
ATOM   1761 N N   . LEU A 1 258  ? 30.845  42.968  26.875  1.00 105.74 ? 274  LEU A N   1 
ATOM   1762 C CA  . LEU A 1 258  ? 30.001  43.023  25.683  1.00 105.20 ? 274  LEU A CA  1 
ATOM   1763 C C   . LEU A 1 258  ? 30.763  43.721  24.531  1.00 109.06 ? 274  LEU A C   1 
ATOM   1764 O O   . LEU A 1 258  ? 31.943  44.048  24.689  1.00 108.75 ? 274  LEU A O   1 
ATOM   1765 C CB  . LEU A 1 258  ? 28.669  43.744  26.003  1.00 104.70 ? 274  LEU A CB  1 
ATOM   1766 C CG  . LEU A 1 258  ? 27.740  43.028  26.979  1.00 108.40 ? 274  LEU A CG  1 
ATOM   1767 N N   . THR A 1 259  ? 30.106  43.880  23.365  1.00 105.03 ? 275  THR A N   1 
ATOM   1768 C CA  . THR A 1 259  ? 30.612  44.537  22.156  1.00 104.87 ? 275  THR A CA  1 
ATOM   1769 C C   . THR A 1 259  ? 29.384  45.002  21.385  1.00 109.96 ? 275  THR A C   1 
ATOM   1770 O O   . THR A 1 259  ? 28.403  44.263  21.287  1.00 108.48 ? 275  THR A O   1 
ATOM   1771 C CB  . THR A 1 259  ? 31.491  43.588  21.281  1.00 113.11 ? 275  THR A CB  1 
ATOM   1772 O OG1 . THR A 1 259  ? 32.497  42.940  22.060  1.00 113.57 ? 275  THR A OG1 1 
ATOM   1773 C CG2 . THR A 1 259  ? 32.176  44.314  20.121  1.00 110.41 ? 275  THR A CG2 1 
ATOM   1774 N N   . MET A 1 260  ? 29.426  46.222  20.851  1.00 109.42 ? 276  MET A N   1 
ATOM   1775 C CA  . MET A 1 260  ? 28.318  46.764  20.069  1.00 110.68 ? 276  MET A CA  1 
ATOM   1776 C C   . MET A 1 260  ? 28.545  46.480  18.574  1.00 117.08 ? 276  MET A C   1 
ATOM   1777 O O   . MET A 1 260  ? 29.385  47.134  17.935  1.00 117.18 ? 276  MET A O   1 
ATOM   1778 C CB  . MET A 1 260  ? 28.160  48.261  20.337  1.00 113.19 ? 276  MET A CB  1 
ATOM   1779 C CG  . MET A 1 260  ? 27.293  48.575  21.518  1.00 117.09 ? 276  MET A CG  1 
ATOM   1780 S SD  . MET A 1 260  ? 25.559  48.644  21.038  1.00 121.83 ? 276  MET A SD  1 
ATOM   1781 C CE  . MET A 1 260  ? 25.500  50.246  20.208  1.00 118.53 ? 276  MET A CE  1 
ATOM   1782 N N   . VAL A 1 261  ? 27.833  45.457  18.039  1.00 113.99 ? 277  VAL A N   1 
ATOM   1783 C CA  . VAL A 1 261  ? 27.926  45.041  16.637  1.00 113.50 ? 277  VAL A CA  1 
ATOM   1784 C C   . VAL A 1 261  ? 26.756  45.614  15.864  1.00 117.67 ? 277  VAL A C   1 
ATOM   1785 O O   . VAL A 1 261  ? 25.611  45.266  16.137  1.00 116.82 ? 277  VAL A O   1 
ATOM   1786 C CB  . VAL A 1 261  ? 28.050  43.511  16.470  1.00 117.03 ? 277  VAL A CB  1 
ATOM   1787 N N   . HIS A 1 262  ? 27.057  46.523  14.926  1.00 115.23 ? 278  HIS A N   1 
ATOM   1788 C CA  . HIS A 1 262  ? 26.109  47.250  14.079  1.00 115.40 ? 278  HIS A CA  1 
ATOM   1789 C C   . HIS A 1 262  ? 25.249  46.342  13.186  1.00 116.53 ? 278  HIS A C   1 
ATOM   1790 O O   . HIS A 1 262  ? 25.656  45.223  12.884  1.00 115.56 ? 278  HIS A O   1 
ATOM   1791 C CB  . HIS A 1 262  ? 26.879  48.278  13.218  1.00 116.84 ? 278  HIS A CB  1 
ATOM   1792 C CG  . HIS A 1 262  ? 26.010  49.370  12.673  1.00 120.65 ? 278  HIS A CG  1 
ATOM   1793 N ND1 . HIS A 1 262  ? 25.389  49.251  11.440  1.00 122.49 ? 278  HIS A ND1 1 
ATOM   1794 C CD2 . HIS A 1 262  ? 25.634  50.540  13.239  1.00 122.63 ? 278  HIS A CD2 1 
ATOM   1795 C CE1 . HIS A 1 262  ? 24.677  50.356  11.286  1.00 121.98 ? 278  HIS A CE1 1 
ATOM   1796 N NE2 . HIS A 1 262  ? 24.795  51.164  12.341  1.00 122.37 ? 278  HIS A NE2 1 
ATOM   1797 N N   . SER A 1 263  ? 24.077  46.848  12.740  1.00 111.95 ? 279  SER A N   1 
ATOM   1798 C CA  . SER A 1 263  ? 23.160  46.159  11.827  1.00 111.79 ? 279  SER A CA  1 
ATOM   1799 C C   . SER A 1 263  ? 23.876  45.707  10.536  1.00 116.68 ? 279  SER A C   1 
ATOM   1800 O O   . SER A 1 263  ? 23.579  44.633  10.010  1.00 116.25 ? 279  SER A O   1 
ATOM   1801 C CB  . SER A 1 263  ? 21.980  47.060  11.483  1.00 114.80 ? 279  SER A CB  1 
ATOM   1802 O OG  . SER A 1 263  ? 21.226  47.367  12.643  1.00 123.30 ? 279  SER A OG  1 
ATOM   1803 N N   . SER A 1 264  ? 24.837  46.528  10.064  1.00 113.88 ? 280  SER A N   1 
ATOM   1804 C CA  . SER A 1 264  ? 25.693  46.323  8.889   1.00 113.74 ? 280  SER A CA  1 
ATOM   1805 C C   . SER A 1 264  ? 26.569  45.052  9.019   1.00 118.11 ? 280  SER A C   1 
ATOM   1806 O O   . SER A 1 264  ? 26.759  44.316  8.042   1.00 116.98 ? 280  SER A O   1 
ATOM   1807 C CB  . SER A 1 264  ? 26.576  47.555  8.672   1.00 116.19 ? 280  SER A CB  1 
ATOM   1808 O OG  . SER A 1 264  ? 27.273  47.940  9.849   1.00 120.04 ? 280  SER A OG  1 
ATOM   1809 N N   . SER A 1 265  ? 27.103  44.820  10.235  1.00 115.59 ? 281  SER A N   1 
ATOM   1810 C CA  . SER A 1 265  ? 27.953  43.683  10.596  1.00 115.48 ? 281  SER A CA  1 
ATOM   1811 C C   . SER A 1 265  ? 27.137  42.375  10.635  1.00 119.51 ? 281  SER A C   1 
ATOM   1812 O O   . SER A 1 265  ? 27.675  41.313  10.295  1.00 119.38 ? 281  SER A O   1 
ATOM   1813 C CB  . SER A 1 265  ? 28.631  43.946  11.940  1.00 118.79 ? 281  SER A CB  1 
ATOM   1814 O OG  . SER A 1 265  ? 29.531  42.912  12.298  1.00 129.02 ? 281  SER A OG  1 
ATOM   1815 N N   . ILE A 1 266  ? 25.841  42.464  11.051  1.00 115.03 ? 282  ILE A N   1 
ATOM   1816 C CA  . ILE A 1 266  ? 24.896  41.344  11.123  1.00 113.90 ? 282  ILE A CA  1 
ATOM   1817 C C   . ILE A 1 266  ? 24.479  40.925  9.710   1.00 116.35 ? 282  ILE A C   1 
ATOM   1818 O O   . ILE A 1 266  ? 24.465  39.727  9.412   1.00 115.32 ? 282  ILE A O   1 
ATOM   1819 C CB  . ILE A 1 266  ? 23.676  41.688  12.010  1.00 116.76 ? 282  ILE A CB  1 
ATOM   1820 N N   . LEU A 1 267  ? 24.170  41.920  8.832   1.00 112.16 ? 283  LEU A N   1 
ATOM   1821 C CA  . LEU A 1 267  ? 23.791  41.706  7.425   1.00 111.21 ? 283  LEU A CA  1 
ATOM   1822 C C   . LEU A 1 267  ? 24.926  41.073  6.649   1.00 114.70 ? 283  LEU A C   1 
ATOM   1823 O O   . LEU A 1 267  ? 24.671  40.325  5.709   1.00 114.27 ? 283  LEU A O   1 
ATOM   1824 C CB  . LEU A 1 267  ? 23.348  43.005  6.739   1.00 110.90 ? 283  LEU A CB  1 
ATOM   1825 C CG  . LEU A 1 267  ? 22.042  43.628  7.209   1.00 115.34 ? 283  LEU A CG  1 
ATOM   1826 C CD1 . LEU A 1 267  ? 21.806  44.951  6.515   1.00 115.64 ? 283  LEU A CD1 1 
ATOM   1827 C CD2 . LEU A 1 267  ? 20.860  42.700  6.978   1.00 117.48 ? 283  LEU A CD2 1 
ATOM   1828 N N   . ALA A 1 268  ? 26.178  41.363  7.059   1.00 111.61 ? 284  ALA A N   1 
ATOM   1829 C CA  . ALA A 1 268  ? 27.400  40.782  6.506   1.00 111.84 ? 284  ALA A CA  1 
ATOM   1830 C C   . ALA A 1 268  ? 27.449  39.269  6.861   1.00 116.77 ? 284  ALA A C   1 
ATOM   1831 O O   . ALA A 1 268  ? 27.858  38.458  6.021   1.00 117.05 ? 284  ALA A O   1 
ATOM   1832 C CB  . ALA A 1 268  ? 28.619  41.507  7.058   1.00 112.54 ? 284  ALA A CB  1 
ATOM   1833 N N   . MET A 1 269  ? 26.981  38.896  8.089   1.00 112.54 ? 285  MET A N   1 
ATOM   1834 C CA  . MET A 1 269  ? 26.869  37.504  8.545   1.00 111.61 ? 285  MET A CA  1 
ATOM   1835 C C   . MET A 1 269  ? 25.742  36.822  7.737   1.00 113.64 ? 285  MET A C   1 
ATOM   1836 O O   . MET A 1 269  ? 25.957  35.754  7.146   1.00 113.04 ? 285  MET A O   1 
ATOM   1837 C CB  . MET A 1 269  ? 26.556  37.437  10.057  1.00 113.80 ? 285  MET A CB  1 
ATOM   1838 C CG  . MET A 1 269  ? 27.761  37.601  10.952  1.00 117.31 ? 285  MET A CG  1 
ATOM   1839 S SD  . MET A 1 269  ? 27.304  37.600  12.708  1.00 121.19 ? 285  MET A SD  1 
ATOM   1840 N N   . ARG A 1 270  ? 24.556  37.488  7.680   1.00 108.63 ? 286  ARG A N   1 
ATOM   1841 C CA  . ARG A 1 270  ? 23.340  37.084  6.962   1.00 107.78 ? 286  ARG A CA  1 
ATOM   1842 C C   . ARG A 1 270  ? 23.615  36.714  5.491   1.00 111.97 ? 286  ARG A C   1 
ATOM   1843 O O   . ARG A 1 270  ? 22.879  35.907  4.923   1.00 112.02 ? 286  ARG A O   1 
ATOM   1844 C CB  . ARG A 1 270  ? 22.316  38.224  7.026   1.00 106.52 ? 286  ARG A CB  1 
ATOM   1845 C CG  . ARG A 1 270  ? 20.885  37.810  6.733   1.00 114.74 ? 286  ARG A CG  1 
ATOM   1846 C CD  . ARG A 1 270  ? 19.997  38.996  6.429   1.00 123.82 ? 286  ARG A CD  1 
ATOM   1847 N NE  . ARG A 1 270  ? 20.344  39.615  5.149   1.00 135.56 ? 286  ARG A NE  1 
ATOM   1848 C CZ  . ARG A 1 270  ? 19.508  40.344  4.417   1.00 151.37 ? 286  ARG A CZ  1 
ATOM   1849 N NH1 . ARG A 1 270  ? 18.260  40.547  4.825   1.00 141.51 ? 286  ARG A NH1 1 
ATOM   1850 N NH2 . ARG A 1 270  ? 19.910  40.868  3.267   1.00 133.26 ? 286  ARG A NH2 1 
ATOM   1851 N N   . ASP A 1 271  ? 24.667  37.311  4.884   1.00 107.77 ? 287  ASP A N   1 
ATOM   1852 C CA  . ASP A 1 271  ? 25.070  37.077  3.502   1.00 115.95 ? 287  ASP A CA  1 
ATOM   1853 C C   . ASP A 1 271  ? 26.546  36.674  3.413   1.00 145.10 ? 287  ASP A C   1 
ATOM   1854 O O   . ASP A 1 271  ? 26.866  35.486  3.322   1.00 103.15 ? 287  ASP A O   1 
ATOM   1855 C CB  . ASP A 1 271  ? 24.789  38.327  2.662   1.00 117.38 ? 287  ASP A CB  1 
ATOM   1856 C CG  . ASP A 1 271  ? 23.319  38.691  2.608   1.00 127.38 ? 287  ASP A CG  1 
ATOM   1857 O OD1 . ASP A 1 271  ? 22.792  39.189  3.627   1.00 128.67 ? 287  ASP A OD1 1 
ATOM   1858 O OD2 . ASP A 1 271  ? 22.693  38.479  1.547   1.00 132.31 ? 287  ASP A OD2 1 
ATOM   1859 N N   . LEU A 1 300  ? -14.489 1.071   -3.161  1.00 109.33 ? 316  LEU A N   1 
ATOM   1860 C CA  . LEU A 1 300  ? -14.731 1.747   -1.888  1.00 109.94 ? 316  LEU A CA  1 
ATOM   1861 C C   . LEU A 1 300  ? -15.293 0.790   -0.813  1.00 116.22 ? 316  LEU A C   1 
ATOM   1862 O O   . LEU A 1 300  ? -16.411 0.303   -0.982  1.00 117.05 ? 316  LEU A O   1 
ATOM   1863 C CB  . LEU A 1 300  ? -15.685 2.932   -2.109  1.00 109.83 ? 316  LEU A CB  1 
ATOM   1864 N N   . TRP A 1 301  ? -14.533 0.547   0.294   1.00 113.10 ? 317  TRP A N   1 
ATOM   1865 C CA  . TRP A 1 301  ? -14.855 -0.359  1.425   1.00 113.34 ? 317  TRP A CA  1 
ATOM   1866 C C   . TRP A 1 301  ? -15.110 -1.798  0.963   1.00 117.05 ? 317  TRP A C   1 
ATOM   1867 O O   . TRP A 1 301  ? -14.209 -2.629  1.088   1.00 116.67 ? 317  TRP A O   1 
ATOM   1868 C CB  . TRP A 1 301  ? -15.998 0.161   2.340   1.00 112.29 ? 317  TRP A CB  1 
ATOM   1869 C CG  . TRP A 1 301  ? -15.503 0.633   3.676   1.00 113.41 ? 317  TRP A CG  1 
ATOM   1870 C CD1 . TRP A 1 301  ? -14.736 -0.072  4.554   1.00 116.47 ? 317  TRP A CD1 1 
ATOM   1871 C CD2 . TRP A 1 301  ? -15.678 1.936   4.253   1.00 113.22 ? 317  TRP A CD2 1 
ATOM   1872 N NE1 . TRP A 1 301  ? -14.403 0.715   5.631   1.00 116.12 ? 317  TRP A NE1 1 
ATOM   1873 C CE2 . TRP A 1 301  ? -14.998 1.940   5.491   1.00 117.32 ? 317  TRP A CE2 1 
ATOM   1874 C CE3 . TRP A 1 301  ? -16.329 3.109   3.837   1.00 114.44 ? 317  TRP A CE3 1 
ATOM   1875 C CZ2 . TRP A 1 301  ? -14.967 3.064   6.326   1.00 116.52 ? 317  TRP A CZ2 1 
ATOM   1876 C CZ3 . TRP A 1 301  ? -16.295 4.224   4.663   1.00 115.86 ? 317  TRP A CZ3 1 
ATOM   1877 C CH2 . TRP A 1 301  ? -15.603 4.202   5.880   1.00 116.50 ? 317  TRP A CH2 1 
ATOM   1878 N N   . SER A 1 302  ? -16.348 -2.056  0.432   1.00 112.40 ? 318  SER A N   1 
ATOM   1879 C CA  . SER A 1 302  ? -16.951 -3.249  -0.192  1.00 110.77 ? 318  SER A CA  1 
ATOM   1880 C C   . SER A 1 302  ? -16.380 -4.620  0.223   1.00 111.67 ? 318  SER A C   1 
ATOM   1881 O O   . SER A 1 302  ? -17.123 -5.394  0.814   1.00 111.10 ? 318  SER A O   1 
ATOM   1882 C CB  . SER A 1 302  ? -16.926 -3.125  -1.714  1.00 112.91 ? 318  SER A CB  1 
ATOM   1883 O OG  . SER A 1 302  ? -17.609 -1.960  -2.149  1.00 117.34 ? 318  SER A OG  1 
ATOM   1884 N N   . LEU A 1 303  ? -15.108 -4.927  -0.134  1.00 106.02 ? 319  LEU A N   1 
ATOM   1885 C CA  . LEU A 1 303  ? -14.364 -6.173  0.116   1.00 105.42 ? 319  LEU A CA  1 
ATOM   1886 C C   . LEU A 1 303  ? -14.664 -6.851  1.494   1.00 109.42 ? 319  LEU A C   1 
ATOM   1887 O O   . LEU A 1 303  ? -13.960 -6.643  2.487   1.00 108.77 ? 319  LEU A O   1 
ATOM   1888 C CB  . LEU A 1 303  ? -12.854 -5.933  -0.081  1.00 105.28 ? 319  LEU A CB  1 
ATOM   1889 C CG  . LEU A 1 303  ? -12.402 -5.637  -1.503  1.00 109.58 ? 319  LEU A CG  1 
ATOM   1890 N N   . GLU A 1 304  ? -15.737 -7.667  1.521   1.00 106.19 ? 320  GLU A N   1 
ATOM   1891 C CA  . GLU A 1 304  ? -16.232 -8.377  2.707   1.00 105.38 ? 320  GLU A CA  1 
ATOM   1892 C C   . GLU A 1 304  ? -15.664 -9.778  2.776   1.00 108.45 ? 320  GLU A C   1 
ATOM   1893 O O   . GLU A 1 304  ? -16.018 -10.553 3.663   1.00 107.51 ? 320  GLU A O   1 
ATOM   1894 C CB  . GLU A 1 304  ? -17.772 -8.402  2.730   1.00 106.59 ? 320  GLU A CB  1 
ATOM   1895 C CG  . GLU A 1 304  ? -18.406 -7.037  2.920   1.00 113.59 ? 320  GLU A CG  1 
ATOM   1896 C CD  . GLU A 1 304  ? -19.630 -6.986  3.808   1.00 131.67 ? 320  GLU A CD  1 
ATOM   1897 O OE1 . GLU A 1 304  ? -19.507 -7.323  5.008   1.00 106.04 ? 320  GLU A OE1 1 
ATOM   1898 O OE2 . GLU A 1 304  ? -20.697 -6.549  3.318   1.00 133.77 ? 320  GLU A OE2 1 
ATOM   1899 N N   . GLN A 1 305  ? -14.774 -10.097 1.832   1.00 105.74 ? 321  GLN A N   1 
ATOM   1900 C CA  . GLN A 1 305  ? -14.063 -11.366 1.763   1.00 106.23 ? 321  GLN A CA  1 
ATOM   1901 C C   . GLN A 1 305  ? -12.876 -11.310 2.778   1.00 111.08 ? 321  GLN A C   1 
ATOM   1902 O O   . GLN A 1 305  ? -12.490 -10.195 3.158   1.00 110.92 ? 321  GLN A O   1 
ATOM   1903 C CB  . GLN A 1 305  ? -13.575 -11.600 0.321   1.00 107.75 ? 321  GLN A CB  1 
ATOM   1904 C CG  . GLN A 1 305  ? -14.685 -12.052 -0.631  1.00 122.87 ? 321  GLN A CG  1 
ATOM   1905 N N   . PRO A 1 306  ? -12.289 -12.448 3.263   1.00 107.08 ? 322  PRO A N   1 
ATOM   1906 C CA  . PRO A 1 306  ? -11.183 -12.331 4.239   1.00 105.80 ? 322  PRO A CA  1 
ATOM   1907 C C   . PRO A 1 306  ? -9.891  -11.749 3.672   1.00 106.10 ? 322  PRO A C   1 
ATOM   1908 O O   . PRO A 1 306  ? -9.724  -11.660 2.451   1.00 105.53 ? 322  PRO A O   1 
ATOM   1909 C CB  . PRO A 1 306  ? -10.962 -13.771 4.742   1.00 107.62 ? 322  PRO A CB  1 
ATOM   1910 C CG  . PRO A 1 306  ? -12.026 -14.594 4.141   1.00 112.87 ? 322  PRO A CG  1 
ATOM   1911 C CD  . PRO A 1 306  ? -12.578 -13.864 2.956   1.00 108.71 ? 322  PRO A CD  1 
ATOM   1912 N N   . PHE A 1 307  ? -8.980  -11.340 4.580   1.00 99.75  ? 323  PHE A N   1 
ATOM   1913 C CA  . PHE A 1 307  ? -7.667  -10.850 4.203   1.00 97.62  ? 323  PHE A CA  1 
ATOM   1914 C C   . PHE A 1 307  ? -6.850  -12.081 3.846   1.00 99.41  ? 323  PHE A C   1 
ATOM   1915 O O   . PHE A 1 307  ? -6.648  -12.963 4.693   1.00 97.69  ? 323  PHE A O   1 
ATOM   1916 C CB  . PHE A 1 307  ? -6.988  -10.032 5.326   1.00 98.66  ? 323  PHE A CB  1 
ATOM   1917 C CG  . PHE A 1 307  ? -5.564  -9.689  4.961   1.00 98.94  ? 323  PHE A CG  1 
ATOM   1918 C CD1 . PHE A 1 307  ? -5.287  -8.660  4.069   1.00 101.26 ? 323  PHE A CD1 1 
ATOM   1919 C CD2 . PHE A 1 307  ? -4.506  -10.467 5.419   1.00 99.74  ? 323  PHE A CD2 1 
ATOM   1920 C CE1 . PHE A 1 307  ? -3.973  -8.395  3.670   1.00 102.01 ? 323  PHE A CE1 1 
ATOM   1921 C CE2 . PHE A 1 307  ? -3.200  -10.222 4.998   1.00 102.29 ? 323  PHE A CE2 1 
ATOM   1922 C CZ  . PHE A 1 307  ? -2.939  -9.179  4.136   1.00 100.54 ? 323  PHE A CZ  1 
ATOM   1923 N N   . ARG A 1 308  ? -6.401  -12.132 2.581   1.00 96.04  ? 324  ARG A N   1 
ATOM   1924 C CA  . ARG A 1 308  ? -5.616  -13.230 2.007   1.00 96.18  ? 324  ARG A CA  1 
ATOM   1925 C C   . ARG A 1 308  ? -4.160  -12.819 1.740   1.00 97.31  ? 324  ARG A C   1 
ATOM   1926 O O   . ARG A 1 308  ? -3.914  -11.698 1.284   1.00 95.92  ? 324  ARG A O   1 
ATOM   1927 C CB  . ARG A 1 308  ? -6.261  -13.696 0.672   1.00 98.81  ? 324  ARG A CB  1 
ATOM   1928 C CG  . ARG A 1 308  ? -7.284  -14.828 0.779   1.00 110.20 ? 324  ARG A CG  1 
ATOM   1929 C CD  . ARG A 1 308  ? -8.009  -15.067 -0.545  1.00 120.01 ? 324  ARG A CD  1 
ATOM   1930 N NE  . ARG A 1 308  ? -9.252  -15.824 -0.362  1.00 129.91 ? 324  ARG A NE  1 
ATOM   1931 C CZ  . ARG A 1 308  ? -10.436 -15.280 -0.078  1.00 143.66 ? 324  ARG A CZ  1 
ATOM   1932 N NH1 . ARG A 1 308  ? -10.555 -13.964 0.056   1.00 135.78 ? 324  ARG A NH1 1 
ATOM   1933 N NH2 . ARG A 1 308  ? -11.507 -16.048 0.077   1.00 123.33 ? 324  ARG A NH2 1 
ATOM   1934 N N   . ILE A 1 309  ? -3.209  -13.746 1.982   1.00 93.15  ? 325  ILE A N   1 
ATOM   1935 C CA  . ILE A 1 309  ? -1.787  -13.547 1.681   1.00 93.36  ? 325  ILE A CA  1 
ATOM   1936 C C   . ILE A 1 309  ? -1.166  -14.869 1.198   1.00 97.91  ? 325  ILE A C   1 
ATOM   1937 O O   . ILE A 1 309  ? -1.361  -15.920 1.823   1.00 97.82  ? 325  ILE A O   1 
ATOM   1938 C CB  . ILE A 1 309  ? -0.957  -12.823 2.788   1.00 96.19  ? 325  ILE A CB  1 
ATOM   1939 C CG1 . ILE A 1 309  ? -0.095  -11.725 2.153   1.00 96.66  ? 325  ILE A CG1 1 
ATOM   1940 C CG2 . ILE A 1 309  ? -0.110  -13.765 3.685   1.00 95.52  ? 325  ILE A CG2 1 
ATOM   1941 N N   . GLU A 1 310  ? -0.440  -14.813 0.070   1.00 93.04  ? 326  GLU A N   1 
ATOM   1942 C CA  . GLU A 1 310  ? 0.170   -16.009 -0.484  1.00 92.11  ? 326  GLU A CA  1 
ATOM   1943 C C   . GLU A 1 310  ? 1.654   -16.086 -0.140  1.00 94.58  ? 326  GLU A C   1 
ATOM   1944 O O   . GLU A 1 310  ? 2.480   -15.400 -0.759  1.00 94.09  ? 326  GLU A O   1 
ATOM   1945 C CB  . GLU A 1 310  ? -0.086  -16.108 -2.004  1.00 93.35  ? 326  GLU A CB  1 
ATOM   1946 C CG  . GLU A 1 310  ? -0.409  -17.516 -2.475  1.00 101.27 ? 326  GLU A CG  1 
ATOM   1947 N N   . LEU A 1 311  ? 1.990   -16.899 0.877   1.00 90.21  ? 327  LEU A N   1 
ATOM   1948 C CA  . LEU A 1 311  ? 3.389   -17.117 1.244   1.00 89.94  ? 327  LEU A CA  1 
ATOM   1949 C C   . LEU A 1 311  ? 3.995   -18.021 0.159   1.00 92.87  ? 327  LEU A C   1 
ATOM   1950 O O   . LEU A 1 311  ? 3.783   -19.239 0.155   1.00 93.93  ? 327  LEU A O   1 
ATOM   1951 C CB  . LEU A 1 311  ? 3.569   -17.707 2.673   1.00 89.96  ? 327  LEU A CB  1 
ATOM   1952 C CG  . LEU A 1 311  ? 4.966   -18.318 2.997   1.00 94.78  ? 327  LEU A CG  1 
ATOM   1953 C CD1 . LEU A 1 311  ? 6.079   -17.269 3.003   1.00 94.86  ? 327  LEU A CD1 1 
ATOM   1954 C CD2 . LEU A 1 311  ? 4.951   -19.065 4.295   1.00 97.29  ? 327  LEU A CD2 1 
ATOM   1955 N N   . ILE A 1 312  ? 4.687   -17.404 -0.790  1.00 86.61  ? 328  ILE A N   1 
ATOM   1956 C CA  . ILE A 1 312  ? 5.278   -18.123 -1.900  1.00 85.56  ? 328  ILE A CA  1 
ATOM   1957 C C   . ILE A 1 312  ? 6.608   -18.795 -1.453  1.00 88.45  ? 328  ILE A C   1 
ATOM   1958 O O   . ILE A 1 312  ? 6.599   -19.980 -1.130  1.00 87.79  ? 328  ILE A O   1 
ATOM   1959 C CB  . ILE A 1 312  ? 5.356   -17.201 -3.179  1.00 88.39  ? 328  ILE A CB  1 
ATOM   1960 C CG1 . ILE A 1 312  ? 3.948   -16.987 -3.787  1.00 87.95  ? 328  ILE A CG1 1 
ATOM   1961 C CG2 . ILE A 1 312  ? 6.313   -17.722 -4.259  1.00 89.44  ? 328  ILE A CG2 1 
ATOM   1962 N N   . GLN A 1 313  ? 7.706   -18.039 -1.365  1.00 85.24  ? 329  GLN A N   1 
ATOM   1963 C CA  . GLN A 1 313  ? 9.042   -18.566 -1.071  1.00 84.91  ? 329  GLN A CA  1 
ATOM   1964 C C   . GLN A 1 313  ? 9.807   -17.805 0.078   1.00 86.55  ? 329  GLN A C   1 
ATOM   1965 O O   . GLN A 1 313  ? 9.328   -16.812 0.635   1.00 84.69  ? 329  GLN A O   1 
ATOM   1966 C CB  . GLN A 1 313  ? 9.842   -18.473 -2.402  1.00 86.46  ? 329  GLN A CB  1 
ATOM   1967 C CG  . GLN A 1 313  ? 10.996  -19.458 -2.587  1.00 106.35 ? 329  GLN A CG  1 
ATOM   1968 C CD  . GLN A 1 313  ? 12.026  -19.009 -3.607  1.00 126.84 ? 329  GLN A CD  1 
ATOM   1969 O OE1 . GLN A 1 313  ? 13.242  -19.086 -3.373  1.00 122.58 ? 329  GLN A OE1 1 
ATOM   1970 N NE2 . GLN A 1 313  ? 11.571  -18.569 -4.777  1.00 119.30 ? 329  GLN A NE2 1 
ATOM   1971 N N   . GLY A 1 314  ? 10.984  -18.328 0.396   1.00 82.37  ? 330  GLY A N   1 
ATOM   1972 C CA  . GLY A 1 314  ? 11.976  -17.800 1.318   1.00 81.90  ? 330  GLY A CA  1 
ATOM   1973 C C   . GLY A 1 314  ? 13.318  -17.825 0.610   1.00 85.63  ? 330  GLY A C   1 
ATOM   1974 O O   . GLY A 1 314  ? 13.456  -18.531 -0.394  1.00 85.70  ? 330  GLY A O   1 
ATOM   1975 N N   . SER A 1 315  ? 14.306  -17.033 1.079   1.00 81.86  ? 331  SER A N   1 
ATOM   1976 C CA  . SER A 1 315  ? 15.634  -16.956 0.438   1.00 81.11  ? 331  SER A CA  1 
ATOM   1977 C C   . SER A 1 315  ? 16.765  -16.848 1.429   1.00 83.77  ? 331  SER A C   1 
ATOM   1978 O O   . SER A 1 315  ? 16.538  -16.450 2.566   1.00 84.94  ? 331  SER A O   1 
ATOM   1979 C CB  . SER A 1 315  ? 15.709  -15.759 -0.497  1.00 84.66  ? 331  SER A CB  1 
ATOM   1980 O OG  . SER A 1 315  ? 14.598  -15.715 -1.377  1.00 98.64  ? 331  SER A OG  1 
ATOM   1981 N N   . LYS A 1 316  ? 17.984  -17.195 0.997   1.00 78.11  ? 332  LYS A N   1 
ATOM   1982 C CA  . LYS A 1 316  ? 19.234  -17.113 1.761   1.00 77.50  ? 332  LYS A CA  1 
ATOM   1983 C C   . LYS A 1 316  ? 19.095  -17.435 3.284   1.00 81.40  ? 332  LYS A C   1 
ATOM   1984 O O   . LYS A 1 316  ? 19.696  -16.749 4.125   1.00 82.51  ? 332  LYS A O   1 
ATOM   1985 C CB  . LYS A 1 316  ? 19.889  -15.735 1.543   1.00 79.76  ? 332  LYS A CB  1 
ATOM   1986 C CG  . LYS A 1 316  ? 20.504  -15.510 0.173   1.00 81.33  ? 332  LYS A CG  1 
ATOM   1987 C CD  . LYS A 1 316  ? 20.361  -14.056 -0.203  1.00 90.34  ? 332  LYS A CD  1 
ATOM   1988 C CE  . LYS A 1 316  ? 20.876  -13.742 -1.581  1.00 104.34 ? 332  LYS A CE  1 
ATOM   1989 N NZ  . LYS A 1 316  ? 20.548  -12.342 -1.964  1.00 114.09 ? 332  LYS A NZ  1 
ATOM   1990 N N   . VAL A 1 317  ? 18.308  -18.487 3.625   1.00 75.45  ? 333  VAL A N   1 
ATOM   1991 C CA  . VAL A 1 317  ? 18.116  -18.928 5.009   1.00 73.86  ? 333  VAL A CA  1 
ATOM   1992 C C   . VAL A 1 317  ? 19.371  -19.684 5.497   1.00 82.08  ? 333  VAL A C   1 
ATOM   1993 O O   . VAL A 1 317  ? 20.009  -20.389 4.721   1.00 82.42  ? 333  VAL A O   1 
ATOM   1994 C CB  . VAL A 1 317  ? 16.800  -19.716 5.216   1.00 74.22  ? 333  VAL A CB  1 
ATOM   1995 C CG1 . VAL A 1 317  ? 16.596  -20.082 6.683   1.00 72.98  ? 333  VAL A CG1 1 
ATOM   1996 C CG2 . VAL A 1 317  ? 15.594  -18.933 4.683   1.00 73.19  ? 333  VAL A CG2 1 
ATOM   1997 N N   . ASN A 1 318  ? 19.757  -19.472 6.756   1.00 80.74  ? 334  ASN A N   1 
ATOM   1998 C CA  . ASN A 1 318  ? 20.927  -20.102 7.357   1.00 81.75  ? 334  ASN A CA  1 
ATOM   1999 C C   . ASN A 1 318  ? 20.511  -20.768 8.651   1.00 90.17  ? 334  ASN A C   1 
ATOM   2000 O O   . ASN A 1 318  ? 20.608  -20.168 9.720   1.00 90.87  ? 334  ASN A O   1 
ATOM   2001 C CB  . ASN A 1 318  ? 22.059  -19.074 7.574   1.00 80.27  ? 334  ASN A CB  1 
ATOM   2002 C CG  . ASN A 1 318  ? 22.469  -18.416 6.288   1.00 100.29 ? 334  ASN A CG  1 
ATOM   2003 O OD1 . ASN A 1 318  ? 23.176  -19.016 5.468   1.00 90.51  ? 334  ASN A OD1 1 
ATOM   2004 N ND2 . ASN A 1 318  ? 21.937  -17.222 6.035   1.00 92.03  ? 334  ASN A ND2 1 
ATOM   2005 N N   . ALA A 1 319  ? 20.009  -21.997 8.552   1.00 89.58  ? 335  ALA A N   1 
ATOM   2006 C CA  . ALA A 1 319  ? 19.544  -22.744 9.718   1.00 90.99  ? 335  ALA A CA  1 
ATOM   2007 C C   . ALA A 1 319  ? 20.074  -24.203 9.777   1.00 98.66  ? 335  ALA A C   1 
ATOM   2008 O O   . ALA A 1 319  ? 20.618  -24.708 8.787   1.00 97.49  ? 335  ALA A O   1 
ATOM   2009 C CB  . ALA A 1 319  ? 18.020  -22.714 9.768   1.00 91.61  ? 335  ALA A CB  1 
ATOM   2010 N N   . ASP A 1 320  ? 19.934  -24.855 10.960  1.00 98.46  ? 336  ASP A N   1 
ATOM   2011 C CA  . ASP A 1 320  ? 20.328  -26.244 11.210  1.00 99.38  ? 336  ASP A CA  1 
ATOM   2012 C C   . ASP A 1 320  ? 19.476  -27.149 10.305  1.00 105.39 ? 336  ASP A C   1 
ATOM   2013 O O   . ASP A 1 320  ? 18.245  -27.136 10.386  1.00 103.74 ? 336  ASP A O   1 
ATOM   2014 C CB  . ASP A 1 320  ? 20.132  -26.605 12.700  1.00 101.13 ? 336  ASP A CB  1 
ATOM   2015 C CG  . ASP A 1 320  ? 20.988  -27.761 13.199  1.00 112.26 ? 336  ASP A CG  1 
ATOM   2016 O OD1 . ASP A 1 320  ? 20.905  -28.865 12.609  1.00 114.16 ? 336  ASP A OD1 1 
ATOM   2017 O OD2 . ASP A 1 320  ? 21.731  -27.566 14.189  1.00 115.57 ? 336  ASP A OD2 1 
ATOM   2018 N N   . GLU A 1 321  ? 20.149  -27.886 9.405   1.00 104.56 ? 337  GLU A N   1 
ATOM   2019 C CA  . GLU A 1 321  ? 19.535  -28.759 8.402   1.00 105.40 ? 337  GLU A CA  1 
ATOM   2020 C C   . GLU A 1 321  ? 18.596  -29.831 8.992   1.00 110.77 ? 337  GLU A C   1 
ATOM   2021 O O   . GLU A 1 321  ? 17.627  -30.243 8.324   1.00 110.28 ? 337  GLU A O   1 
ATOM   2022 C CB  . GLU A 1 321  ? 20.608  -29.382 7.500   1.00 106.86 ? 337  GLU A CB  1 
ATOM   2023 C CG  . GLU A 1 321  ? 21.020  -28.475 6.353   1.00 117.74 ? 337  GLU A CG  1 
ATOM   2024 N N   . ARG A 1 322  ? 18.869  -30.246 10.253  1.00 106.96 ? 338  ARG A N   1 
ATOM   2025 C CA  . ARG A 1 322  ? 18.093  -31.246 10.995  1.00 105.98 ? 338  ARG A CA  1 
ATOM   2026 C C   . ARG A 1 322  ? 16.661  -30.766 11.204  1.00 109.15 ? 338  ARG A C   1 
ATOM   2027 O O   . ARG A 1 322  ? 15.726  -31.540 11.000  1.00 109.36 ? 338  ARG A O   1 
ATOM   2028 C CB  . ARG A 1 322  ? 18.770  -31.555 12.334  1.00 105.12 ? 338  ARG A CB  1 
ATOM   2029 C CG  . ARG A 1 322  ? 20.200  -32.071 12.175  1.00 113.58 ? 338  ARG A CG  1 
ATOM   2030 C CD  . ARG A 1 322  ? 20.846  -32.433 13.491  1.00 122.78 ? 338  ARG A CD  1 
ATOM   2031 N NE  . ARG A 1 322  ? 21.279  -31.262 14.257  1.00 133.84 ? 338  ARG A NE  1 
ATOM   2032 C CZ  . ARG A 1 322  ? 20.603  -30.734 15.273  1.00 150.14 ? 338  ARG A CZ  1 
ATOM   2033 N NH1 . ARG A 1 322  ? 19.435  -31.247 15.643  1.00 139.36 ? 338  ARG A NH1 1 
ATOM   2034 N NH2 . ARG A 1 322  ? 21.086  -29.683 15.924  1.00 137.07 ? 338  ARG A NH2 1 
ATOM   2035 N N   . MET A 1 323  ? 16.503  -29.464 11.537  1.00 103.97 ? 339  MET A N   1 
ATOM   2036 C CA  . MET A 1 323  ? 15.252  -28.744 11.773  1.00 102.56 ? 339  MET A CA  1 
ATOM   2037 C C   . MET A 1 323  ? 14.311  -28.662 10.569  1.00 101.65 ? 339  MET A C   1 
ATOM   2038 O O   . MET A 1 323  ? 14.630  -29.141 9.479   1.00 101.33 ? 339  MET A O   1 
ATOM   2039 C CB  . MET A 1 323  ? 15.586  -27.320 12.240  1.00 105.53 ? 339  MET A CB  1 
ATOM   2040 C CG  . MET A 1 323  ? 15.196  -27.044 13.644  1.00 110.42 ? 339  MET A CG  1 
ATOM   2041 S SD  . MET A 1 323  ? 15.779  -28.351 14.713  1.00 116.53 ? 339  MET A SD  1 
ATOM   2042 C CE  . MET A 1 323  ? 17.535  -27.999 14.775  1.00 113.29 ? 339  MET A CE  1 
ATOM   2043 N N   . LYS A 1 324  ? 13.155  -28.015 10.785  1.00 94.95  ? 340  LYS A N   1 
ATOM   2044 C CA  . LYS A 1 324  ? 12.119  -27.709 9.803   1.00 93.95  ? 340  LYS A CA  1 
ATOM   2045 C C   . LYS A 1 324  ? 11.830  -26.201 9.903   1.00 96.52  ? 340  LYS A C   1 
ATOM   2046 O O   . LYS A 1 324  ? 11.877  -25.643 10.997  1.00 95.66  ? 340  LYS A O   1 
ATOM   2047 C CB  . LYS A 1 324  ? 10.843  -28.517 10.081  1.00 96.18  ? 340  LYS A CB  1 
ATOM   2048 C CG  . LYS A 1 324  ? 10.904  -29.950 9.579   1.00 113.82 ? 340  LYS A CG  1 
ATOM   2049 C CD  . LYS A 1 324  ? 10.094  -30.137 8.299   1.00 126.04 ? 340  LYS A CD  1 
ATOM   2050 N N   . LEU A 1 325  ? 11.559  -25.536 8.775   1.00 92.22  ? 341  LEU A N   1 
ATOM   2051 C CA  . LEU A 1 325  ? 11.281  -24.103 8.783   1.00 91.32  ? 341  LEU A CA  1 
ATOM   2052 C C   . LEU A 1 325  ? 9.797   -23.784 8.777   1.00 93.84  ? 341  LEU A C   1 
ATOM   2053 O O   . LEU A 1 325  ? 9.044   -24.342 7.977   1.00 93.64  ? 341  LEU A O   1 
ATOM   2054 C CB  . LEU A 1 325  ? 12.009  -23.372 7.643   1.00 91.28  ? 341  LEU A CB  1 
ATOM   2055 C CG  . LEU A 1 325  ? 13.445  -22.978 7.954   1.00 95.88  ? 341  LEU A CG  1 
ATOM   2056 N N   . VAL A 1 326  ? 9.379   -22.875 9.674   1.00 89.57  ? 342  VAL A N   1 
ATOM   2057 C CA  . VAL A 1 326  ? 8.002   -22.384 9.771   1.00 88.77  ? 342  VAL A CA  1 
ATOM   2058 C C   . VAL A 1 326  ? 7.980   -20.855 9.628   1.00 90.76  ? 342  VAL A C   1 
ATOM   2059 O O   . VAL A 1 326  ? 8.928   -20.191 10.045  1.00 90.72  ? 342  VAL A O   1 
ATOM   2060 C CB  . VAL A 1 326  ? 7.320   -22.838 11.083  1.00 92.40  ? 342  VAL A CB  1 
ATOM   2061 N N   . VAL A 1 327  ? 6.918   -20.305 9.022   1.00 85.16  ? 343  VAL A N   1 
ATOM   2062 C CA  . VAL A 1 327  ? 6.738   -18.859 8.917   1.00 83.96  ? 343  VAL A CA  1 
ATOM   2063 C C   . VAL A 1 327  ? 5.435   -18.468 9.660   1.00 88.01  ? 343  VAL A C   1 
ATOM   2064 O O   . VAL A 1 327  ? 4.336   -18.794 9.196   1.00 87.96  ? 343  VAL A O   1 
ATOM   2065 C CB  . VAL A 1 327  ? 6.801   -18.327 7.461   1.00 86.73  ? 343  VAL A CB  1 
ATOM   2066 N N   . GLN A 1 328  ? 5.558   -17.836 10.847  1.00 84.18  ? 344  GLN A N   1 
ATOM   2067 C CA  . GLN A 1 328  ? 4.392   -17.374 11.634  1.00 83.25  ? 344  GLN A CA  1 
ATOM   2068 C C   . GLN A 1 328  ? 4.002   -15.950 11.177  1.00 84.45  ? 344  GLN A C   1 
ATOM   2069 O O   . GLN A 1 328  ? 4.875   -15.104 10.959  1.00 82.88  ? 344  GLN A O   1 
ATOM   2070 C CB  . GLN A 1 328  ? 4.680   -17.428 13.152  1.00 84.16  ? 344  GLN A CB  1 
ATOM   2071 C CG  . GLN A 1 328  ? 3.433   -17.411 14.028  1.00 89.14  ? 344  GLN A CG  1 
ATOM   2072 N N   . ALA A 1 329  ? 2.707   -15.717 10.964  1.00 80.55  ? 345  ALA A N   1 
ATOM   2073 C CA  . ALA A 1 329  ? 2.210   -14.418 10.509  1.00 80.19  ? 345  ALA A CA  1 
ATOM   2074 C C   . ALA A 1 329  ? 1.029   -13.918 11.324  1.00 85.95  ? 345  ALA A C   1 
ATOM   2075 O O   . ALA A 1 329  ? 0.121   -14.685 11.658  1.00 86.14  ? 345  ALA A O   1 
ATOM   2076 C CB  . ALA A 1 329  ? 1.830   -14.482 9.047   1.00 80.50  ? 345  ALA A CB  1 
ATOM   2077 N N   . GLY A 1 330  ? 1.041   -12.624 11.612  1.00 82.31  ? 346  GLY A N   1 
ATOM   2078 C CA  . GLY A 1 330  ? -0.031  -11.963 12.347  1.00 81.31  ? 346  GLY A CA  1 
ATOM   2079 C C   . GLY A 1 330  ? -0.349  -10.599 11.782  1.00 83.25  ? 346  GLY A C   1 
ATOM   2080 O O   . GLY A 1 330  ? 0.448   -10.025 11.028  1.00 81.56  ? 346  GLY A O   1 
ATOM   2081 N N   . LEU A 1 331  ? -1.538  -10.097 12.098  1.00 80.14  ? 347  LEU A N   1 
ATOM   2082 C CA  . LEU A 1 331  ? -1.919  -8.761  11.662  1.00 80.42  ? 347  LEU A CA  1 
ATOM   2083 C C   . LEU A 1 331  ? -1.953  -7.904  12.907  1.00 85.83  ? 347  LEU A C   1 
ATOM   2084 O O   . LEU A 1 331  ? -2.323  -8.408  13.980  1.00 86.41  ? 347  LEU A O   1 
ATOM   2085 C CB  . LEU A 1 331  ? -3.257  -8.754  10.918  1.00 80.32  ? 347  LEU A CB  1 
ATOM   2086 C CG  . LEU A 1 331  ? -3.172  -9.110  9.440   1.00 84.74  ? 347  LEU A CG  1 
ATOM   2087 N N   . PHE A 1 332  ? -1.480  -6.642  12.793  1.00 81.60  ? 348  PHE A N   1 
ATOM   2088 C CA  . PHE A 1 332  ? -1.394  -5.705  13.925  1.00 80.50  ? 348  PHE A CA  1 
ATOM   2089 C C   . PHE A 1 332  ? -1.774  -4.261  13.614  1.00 83.19  ? 348  PHE A C   1 
ATOM   2090 O O   . PHE A 1 332  ? -1.738  -3.840  12.456  1.00 83.58  ? 348  PHE A O   1 
ATOM   2091 C CB  . PHE A 1 332  ? 0.033   -5.711  14.485  1.00 81.78  ? 348  PHE A CB  1 
ATOM   2092 C CG  . PHE A 1 332  ? 0.379   -6.940  15.278  1.00 82.57  ? 348  PHE A CG  1 
ATOM   2093 C CD1 . PHE A 1 332  ? 0.890   -8.066  14.654  1.00 85.29  ? 348  PHE A CD1 1 
ATOM   2094 C CD2 . PHE A 1 332  ? 0.214   -6.965  16.654  1.00 83.66  ? 348  PHE A CD2 1 
ATOM   2095 C CE1 . PHE A 1 332  ? 1.222   -9.199  15.390  1.00 86.03  ? 348  PHE A CE1 1 
ATOM   2096 C CE2 . PHE A 1 332  ? 0.537   -8.099  17.385  1.00 86.57  ? 348  PHE A CE2 1 
ATOM   2097 C CZ  . PHE A 1 332  ? 1.054   -9.203  16.749  1.00 84.92  ? 348  PHE A CZ  1 
ATOM   2098 N N   . HIS A 1 333  ? -2.119  -3.507  14.670  1.00 77.99  ? 349  HIS A N   1 
ATOM   2099 C CA  . HIS A 1 333  ? -2.367  -2.064  14.671  1.00 77.52  ? 349  HIS A CA  1 
ATOM   2100 C C   . HIS A 1 333  ? -1.712  -1.547  15.946  1.00 83.70  ? 349  HIS A C   1 
ATOM   2101 O O   . HIS A 1 333  ? -2.258  -1.670  17.047  1.00 81.97  ? 349  HIS A O   1 
ATOM   2102 C CB  . HIS A 1 333  ? -3.849  -1.686  14.570  1.00 77.67  ? 349  HIS A CB  1 
ATOM   2103 C CG  . HIS A 1 333  ? -4.046  -0.218  14.346  1.00 80.82  ? 349  HIS A CG  1 
ATOM   2104 N ND1 . HIS A 1 333  ? -4.556  0.603   15.336  1.00 82.37  ? 349  HIS A ND1 1 
ATOM   2105 C CD2 . HIS A 1 333  ? -3.724  0.543   13.272  1.00 82.32  ? 349  HIS A CD2 1 
ATOM   2106 C CE1 . HIS A 1 333  ? -4.586  1.818   14.812  1.00 81.57  ? 349  HIS A CE1 1 
ATOM   2107 N NE2 . HIS A 1 333  ? -4.090  1.830   13.573  1.00 81.92  ? 349  HIS A NE2 1 
ATOM   2108 N N   . GLY A 1 334  ? -0.479  -1.089  15.788  1.00 83.89  ? 350  GLY A N   1 
ATOM   2109 C CA  . GLY A 1 334  ? 0.361   -0.671  16.900  1.00 85.03  ? 350  GLY A CA  1 
ATOM   2110 C C   . GLY A 1 334  ? 0.820   -1.912  17.631  1.00 91.44  ? 350  GLY A C   1 
ATOM   2111 O O   . GLY A 1 334  ? 1.381   -2.835  17.023  1.00 90.29  ? 350  GLY A O   1 
ATOM   2112 N N   . ASN A 1 335  ? 0.527   -1.969  18.920  1.00 90.92  ? 351  ASN A N   1 
ATOM   2113 C CA  . ASN A 1 335  ? 0.884   -3.144  19.705  1.00 91.67  ? 351  ASN A CA  1 
ATOM   2114 C C   . ASN A 1 335  ? -0.215  -4.237  19.637  1.00 95.77  ? 351  ASN A C   1 
ATOM   2115 O O   . ASN A 1 335  ? 0.103   -5.421  19.764  1.00 95.03  ? 351  ASN A O   1 
ATOM   2116 C CB  . ASN A 1 335  ? 1.216   -2.752  21.155  1.00 93.22  ? 351  ASN A CB  1 
ATOM   2117 C CG  . ASN A 1 335  ? 2.097   -3.755  21.867  1.00 125.52 ? 351  ASN A CG  1 
ATOM   2118 O OD1 . ASN A 1 335  ? 2.924   -4.463  21.260  1.00 116.80 ? 351  ASN A OD1 1 
ATOM   2119 N ND2 . ASN A 1 335  ? 1.941   -3.834  23.183  1.00 122.41 ? 351  ASN A ND2 1 
ATOM   2120 N N   . GLU A 1 336  ? -1.496  -3.831  19.412  1.00 92.54  ? 352  GLU A N   1 
ATOM   2121 C CA  . GLU A 1 336  ? -2.672  -4.716  19.369  1.00 92.02  ? 352  GLU A CA  1 
ATOM   2122 C C   . GLU A 1 336  ? -2.723  -5.665  18.188  1.00 93.42  ? 352  GLU A C   1 
ATOM   2123 O O   . GLU A 1 336  ? -2.450  -5.282  17.056  1.00 92.48  ? 352  GLU A O   1 
ATOM   2124 C CB  . GLU A 1 336  ? -3.999  -3.925  19.449  1.00 93.69  ? 352  GLU A CB  1 
ATOM   2125 C CG  . GLU A 1 336  ? -4.294  -3.307  20.811  1.00 110.30 ? 352  GLU A CG  1 
ATOM   2126 C CD  . GLU A 1 336  ? -4.696  -4.247  21.935  1.00 145.43 ? 352  GLU A CD  1 
ATOM   2127 O OE1 . GLU A 1 336  ? -5.887  -4.223  22.319  1.00 151.58 ? 352  GLU A OE1 1 
ATOM   2128 O OE2 . GLU A 1 336  ? -3.817  -4.969  22.463  1.00 143.96 ? 352  GLU A OE2 1 
ATOM   2129 N N   . MET A 1 337  ? -3.127  -6.901  18.462  1.00 89.68  ? 353  MET A N   1 
ATOM   2130 C CA  . MET A 1 337  ? -3.316  -7.913  17.442  1.00 89.48  ? 353  MET A CA  1 
ATOM   2131 C C   . MET A 1 337  ? -4.686  -7.687  16.837  1.00 90.99  ? 353  MET A C   1 
ATOM   2132 O O   . MET A 1 337  ? -5.685  -7.599  17.564  1.00 89.98  ? 353  MET A O   1 
ATOM   2133 C CB  . MET A 1 337  ? -3.231  -9.300  18.055  1.00 92.39  ? 353  MET A CB  1 
ATOM   2134 C CG  . MET A 1 337  ? -2.591  -10.303 17.153  1.00 96.90  ? 353  MET A CG  1 
ATOM   2135 S SD  . MET A 1 337  ? -2.380  -11.848 18.053  1.00 101.92 ? 353  MET A SD  1 
ATOM   2136 C CE  . MET A 1 337  ? -0.688  -11.659 18.668  1.00 98.38  ? 353  MET A CE  1 
ATOM   2137 N N   . LEU A 1 338  ? -4.727  -7.544  15.514  1.00 86.90  ? 354  LEU A N   1 
ATOM   2138 C CA  . LEU A 1 338  ? -5.966  -7.286  14.792  1.00 87.10  ? 354  LEU A CA  1 
ATOM   2139 C C   . LEU A 1 338  ? -6.844  -8.528  14.589  1.00 91.40  ? 354  LEU A C   1 
ATOM   2140 O O   . LEU A 1 338  ? -8.020  -8.375  14.238  1.00 91.17  ? 354  LEU A O   1 
ATOM   2141 C CB  . LEU A 1 338  ? -5.691  -6.585  13.450  1.00 87.31  ? 354  LEU A CB  1 
ATOM   2142 C CG  . LEU A 1 338  ? -5.363  -5.083  13.476  1.00 91.74  ? 354  LEU A CG  1 
ATOM   2143 C CD1 . LEU A 1 338  ? -5.029  -4.598  12.081  1.00 91.56  ? 354  LEU A CD1 1 
ATOM   2144 C CD2 . LEU A 1 338  ? -6.513  -4.247  14.059  1.00 93.27  ? 354  LEU A CD2 1 
ATOM   2145 N N   . CYS A 1 339  ? -6.265  -9.749  14.792  1.00 87.84  ? 355  CYS A N   1 
ATOM   2146 C CA  . CYS A 1 339  ? -6.895  -11.078 14.677  1.00 87.65  ? 355  CYS A CA  1 
ATOM   2147 C C   . CYS A 1 339  ? -5.891  -12.190 15.020  1.00 92.06  ? 355  CYS A C   1 
ATOM   2148 O O   . CYS A 1 339  ? -4.705  -11.900 15.206  1.00 91.40  ? 355  CYS A O   1 
ATOM   2149 C CB  . CYS A 1 339  ? -7.517  -11.290 13.292  1.00 87.85  ? 355  CYS A CB  1 
ATOM   2150 S SG  . CYS A 1 339  ? -6.316  -11.397 11.938  1.00 91.52  ? 355  CYS A SG  1 
ATOM   2151 N N   . LYS A 1 340  ? -6.366  -13.460 15.069  1.00 89.45  ? 356  LYS A N   1 
ATOM   2152 C CA  . LYS A 1 340  ? -5.561  -14.666 15.342  1.00 89.97  ? 356  LYS A CA  1 
ATOM   2153 C C   . LYS A 1 340  ? -4.377  -14.843 14.332  1.00 93.61  ? 356  LYS A C   1 
ATOM   2154 O O   . LYS A 1 340  ? -4.518  -14.522 13.150  1.00 92.51  ? 356  LYS A O   1 
ATOM   2155 C CB  . LYS A 1 340  ? -6.478  -15.911 15.403  1.00 93.14  ? 356  LYS A CB  1 
ATOM   2156 C CG  . LYS A 1 340  ? -5.784  -17.241 15.715  1.00 109.29 ? 356  LYS A CG  1 
ATOM   2157 N N   . THR A 1 341  ? -3.220  -15.333 14.836  1.00 90.59  ? 357  THR A N   1 
ATOM   2158 C CA  . THR A 1 341  ? -1.958  -15.524 14.113  1.00 90.64  ? 357  THR A CA  1 
ATOM   2159 C C   . THR A 1 341  ? -1.830  -16.834 13.331  1.00 96.37  ? 357  THR A C   1 
ATOM   2160 O O   . THR A 1 341  ? -1.354  -17.846 13.878  1.00 96.29  ? 357  THR A O   1 
ATOM   2161 C CB  . THR A 1 341  ? -0.753  -15.384 15.057  1.00 95.15  ? 357  THR A CB  1 
ATOM   2162 O OG1 . THR A 1 341  ? -0.874  -16.340 16.111  1.00 89.54  ? 357  THR A OG1 1 
ATOM   2163 C CG2 . THR A 1 341  ? -0.571  -13.972 15.593  1.00 94.57  ? 357  THR A CG2 1 
ATOM   2164 N N   . VAL A 1 342  ? -2.173  -16.778 12.021  1.00 93.00  ? 358  VAL A N   1 
ATOM   2165 C CA  . VAL A 1 342  ? -2.097  -17.889 11.065  1.00 92.36  ? 358  VAL A CA  1 
ATOM   2166 C C   . VAL A 1 342  ? -0.645  -18.320 10.863  1.00 96.57  ? 358  VAL A C   1 
ATOM   2167 O O   . VAL A 1 342  ? 0.238   -17.468 10.806  1.00 96.63  ? 358  VAL A O   1 
ATOM   2168 C CB  . VAL A 1 342  ? -2.758  -17.516 9.715   1.00 95.77  ? 358  VAL A CB  1 
ATOM   2169 N N   . SER A 1 343  ? -0.394  -19.635 10.775  1.00 92.82  ? 359  SER A N   1 
ATOM   2170 C CA  . SER A 1 343  ? 0.957   -20.162 10.549  1.00 92.15  ? 359  SER A CA  1 
ATOM   2171 C C   . SER A 1 343  ? 1.060   -21.036 9.259   1.00 95.03  ? 359  SER A C   1 
ATOM   2172 O O   . SER A 1 343  ? 0.047   -21.513 8.727   1.00 93.47  ? 359  SER A O   1 
ATOM   2173 C CB  . SER A 1 343  ? 1.479   -20.892 11.787  1.00 94.65  ? 359  SER A CB  1 
ATOM   2174 O OG  . SER A 1 343  ? 1.334   -20.101 12.957  1.00 103.63 ? 359  SER A OG  1 
ATOM   2175 N N   . SER A 1 344  ? 2.293   -21.180 8.742   1.00 91.74  ? 360  SER A N   1 
ATOM   2176 C CA  . SER A 1 344  ? 2.619   -21.971 7.558   1.00 91.57  ? 360  SER A CA  1 
ATOM   2177 C C   . SER A 1 344  ? 2.908   -23.437 7.936   1.00 97.34  ? 360  SER A C   1 
ATOM   2178 O O   . SER A 1 344  ? 3.035   -23.777 9.121   1.00 96.86  ? 360  SER A O   1 
ATOM   2179 C CB  . SER A 1 344  ? 3.824   -21.372 6.830   1.00 93.37  ? 360  SER A CB  1 
ATOM   2180 O OG  . SER A 1 344  ? 5.071   -21.722 7.414   1.00 100.01 ? 360  SER A OG  1 
ATOM   2181 N N   . SER A 1 345  ? 3.026   -24.300 6.918   1.00 94.68  ? 361  SER A N   1 
ATOM   2182 C CA  . SER A 1 345  ? 3.371   -25.689 7.158   1.00 94.79  ? 361  SER A CA  1 
ATOM   2183 C C   . SER A 1 345  ? 4.895   -25.797 7.362   1.00 96.80  ? 361  SER A C   1 
ATOM   2184 O O   . SER A 1 345  ? 5.657   -24.885 7.003   1.00 95.62  ? 361  SER A O   1 
ATOM   2185 C CB  . SER A 1 345  ? 2.911   -26.568 5.999   1.00 100.15 ? 361  SER A CB  1 
ATOM   2186 O OG  . SER A 1 345  ? 3.838   -26.592 4.923   1.00 114.47 ? 361  SER A OG  1 
ATOM   2187 N N   . GLU A 1 346  ? 5.326   -26.905 7.956   1.00 92.00  ? 362  GLU A N   1 
ATOM   2188 C CA  . GLU A 1 346  ? 6.741   -27.151 8.138   1.00 91.01  ? 362  GLU A CA  1 
ATOM   2189 C C   . GLU A 1 346  ? 7.248   -27.655 6.753   1.00 95.79  ? 362  GLU A C   1 
ATOM   2190 O O   . GLU A 1 346  ? 6.501   -28.322 6.020   1.00 95.41  ? 362  GLU A O   1 
ATOM   2191 C CB  . GLU A 1 346  ? 6.984   -28.156 9.283   1.00 91.92  ? 362  GLU A CB  1 
ATOM   2192 C CG  . GLU A 1 346  ? 6.184   -27.864 10.551  1.00 98.27  ? 362  GLU A CG  1 
ATOM   2193 C CD  . GLU A 1 346  ? 6.290   -28.861 11.697  1.00 115.14 ? 362  GLU A CD  1 
ATOM   2194 O OE1 . GLU A 1 346  ? 6.087   -30.075 11.466  1.00 105.68 ? 362  GLU A OE1 1 
ATOM   2195 O OE2 . GLU A 1 346  ? 6.519   -28.414 12.844  1.00 103.76 ? 362  GLU A OE2 1 
ATOM   2196 N N   . VAL A 1 347  ? 8.462   -27.204 6.360   1.00 91.32  ? 363  VAL A N   1 
ATOM   2197 C CA  . VAL A 1 347  ? 9.197   -27.485 5.118   1.00 89.94  ? 363  VAL A CA  1 
ATOM   2198 C C   . VAL A 1 347  ? 10.655  -27.723 5.575   1.00 94.31  ? 363  VAL A C   1 
ATOM   2199 O O   . VAL A 1 347  ? 11.070  -27.131 6.574   1.00 93.30  ? 363  VAL A O   1 
ATOM   2200 C CB  . VAL A 1 347  ? 9.039   -26.298 4.122   1.00 93.30  ? 363  VAL A CB  1 
ATOM   2201 C CG1 . VAL A 1 347  ? 10.094  -26.308 3.019   1.00 93.45  ? 363  VAL A CG1 1 
ATOM   2202 C CG2 . VAL A 1 347  ? 7.643   -26.272 3.516   1.00 92.89  ? 363  VAL A CG2 1 
ATOM   2203 N N   . SER A 1 348  ? 11.404  -28.633 4.912   1.00 92.08  ? 364  SER A N   1 
ATOM   2204 C CA  . SER A 1 348  ? 12.776  -28.943 5.341   1.00 92.59  ? 364  SER A CA  1 
ATOM   2205 C C   . SER A 1 348  ? 13.753  -27.770 5.198   1.00 94.74  ? 364  SER A C   1 
ATOM   2206 O O   . SER A 1 348  ? 13.668  -26.991 4.238   1.00 93.56  ? 364  SER A O   1 
ATOM   2207 C CB  . SER A 1 348  ? 13.312  -30.194 4.649   1.00 98.34  ? 364  SER A CB  1 
ATOM   2208 O OG  . SER A 1 348  ? 13.158  -31.342 5.473   1.00 111.84 ? 364  SER A OG  1 
ATOM   2209 N N   . VAL A 1 349  ? 14.665  -27.646 6.187   1.00 89.92  ? 365  VAL A N   1 
ATOM   2210 C CA  . VAL A 1 349  ? 15.683  -26.597 6.244   1.00 88.76  ? 365  VAL A CA  1 
ATOM   2211 C C   . VAL A 1 349  ? 16.631  -26.648 5.046   1.00 93.90  ? 365  VAL A C   1 
ATOM   2212 O O   . VAL A 1 349  ? 17.400  -27.599 4.866   1.00 93.66  ? 365  VAL A O   1 
ATOM   2213 C CB  . VAL A 1 349  ? 16.442  -26.557 7.589   1.00 91.58  ? 365  VAL A CB  1 
ATOM   2214 C CG1 . VAL A 1 349  ? 17.701  -25.712 7.484   1.00 91.04  ? 365  VAL A CG1 1 
ATOM   2215 C CG2 . VAL A 1 349  ? 15.546  -26.015 8.687   1.00 91.55  ? 365  VAL A CG2 1 
ATOM   2216 N N   . CYS A 1 350  ? 16.556  -25.585 4.240   1.00 91.22  ? 366  CYS A N   1 
ATOM   2217 C CA  . CYS A 1 350  ? 17.358  -25.305 3.048   1.00 90.66  ? 366  CYS A CA  1 
ATOM   2218 C C   . CYS A 1 350  ? 17.456  -23.768 2.881   1.00 93.02  ? 366  CYS A C   1 
ATOM   2219 O O   . CYS A 1 350  ? 16.668  -23.029 3.491   1.00 92.73  ? 366  CYS A O   1 
ATOM   2220 C CB  . CYS A 1 350  ? 16.730  -25.957 1.822   1.00 90.90  ? 366  CYS A CB  1 
ATOM   2221 S SG  . CYS A 1 350  ? 15.048  -25.392 1.475   1.00 95.13  ? 366  CYS A SG  1 
ATOM   2222 N N   . SER A 1 351  ? 18.398  -23.308 2.034   1.00 86.93  ? 367  SER A N   1 
ATOM   2223 C CA  . SER A 1 351  ? 18.648  -21.906 1.718   1.00 85.24  ? 367  SER A CA  1 
ATOM   2224 C C   . SER A 1 351  ? 17.415  -21.203 1.085   1.00 91.18  ? 367  SER A C   1 
ATOM   2225 O O   . SER A 1 351  ? 17.002  -20.154 1.577   1.00 91.34  ? 367  SER A O   1 
ATOM   2226 C CB  . SER A 1 351  ? 19.890  -21.798 0.839   1.00 85.66  ? 367  SER A CB  1 
ATOM   2227 O OG  . SER A 1 351  ? 20.318  -20.469 0.611   1.00 89.04  ? 367  SER A OG  1 
ATOM   2228 N N   . GLU A 1 352  ? 16.799  -21.782 0.045   1.00 89.91  ? 368  GLU A N   1 
ATOM   2229 C CA  . GLU A 1 352  ? 15.624  -21.156 -0.593  1.00 91.10  ? 368  GLU A CA  1 
ATOM   2230 C C   . GLU A 1 352  ? 14.350  -22.010 -0.384  1.00 98.51  ? 368  GLU A C   1 
ATOM   2231 O O   . GLU A 1 352  ? 13.956  -22.744 -1.303  1.00 99.50  ? 368  GLU A O   1 
ATOM   2232 C CB  . GLU A 1 352  ? 15.860  -20.850 -2.096  1.00 92.08  ? 368  GLU A CB  1 
ATOM   2233 C CG  . GLU A 1 352  ? 17.295  -20.546 -2.485  1.00 100.30 ? 368  GLU A CG  1 
ATOM   2234 C CD  . GLU A 1 352  ? 17.849  -19.221 -2.005  1.00 123.03 ? 368  GLU A CD  1 
ATOM   2235 O OE1 . GLU A 1 352  ? 17.239  -18.172 -2.312  1.00 125.87 ? 368  GLU A OE1 1 
ATOM   2236 O OE2 . GLU A 1 352  ? 18.931  -19.228 -1.373  1.00 112.97 ? 368  GLU A OE2 1 
ATOM   2237 N N   . PRO A 1 353  ? 13.699  -21.961 0.810   1.00 95.01  ? 369  PRO A N   1 
ATOM   2238 C CA  . PRO A 1 353  ? 12.524  -22.822 1.030   1.00 94.39  ? 369  PRO A CA  1 
ATOM   2239 C C   . PRO A 1 353  ? 11.288  -22.323 0.318   1.00 97.71  ? 369  PRO A C   1 
ATOM   2240 O O   . PRO A 1 353  ? 11.071  -21.118 0.246   1.00 98.64  ? 369  PRO A O   1 
ATOM   2241 C CB  . PRO A 1 353  ? 12.360  -22.841 2.551   1.00 96.26  ? 369  PRO A CB  1 
ATOM   2242 C CG  . PRO A 1 353  ? 13.516  -22.040 3.110   1.00 101.02 ? 369  PRO A CG  1 
ATOM   2243 C CD  . PRO A 1 353  ? 13.996  -21.160 2.011   1.00 96.58  ? 369  PRO A CD  1 
ATOM   2244 N N   . VAL A 1 354  ? 10.497  -23.246 -0.239  1.00 92.99  ? 370  VAL A N   1 
ATOM   2245 C CA  . VAL A 1 354  ? 9.277   -22.905 -0.982  1.00 92.30  ? 370  VAL A CA  1 
ATOM   2246 C C   . VAL A 1 354  ? 8.062   -23.387 -0.218  1.00 94.80  ? 370  VAL A C   1 
ATOM   2247 O O   . VAL A 1 354  ? 8.068   -24.507 0.307   1.00 94.67  ? 370  VAL A O   1 
ATOM   2248 C CB  . VAL A 1 354  ? 9.293   -23.441 -2.438  1.00 95.99  ? 370  VAL A CB  1 
ATOM   2249 C CG1 . VAL A 1 354  ? 8.119   -22.890 -3.243  1.00 95.70  ? 370  VAL A CG1 1 
ATOM   2250 C CG2 . VAL A 1 354  ? 10.615  -23.110 -3.135  1.00 95.87  ? 370  VAL A CG2 1 
ATOM   2251 N N   . TRP A 1 355  ? 7.033   -22.532 -0.128  1.00 89.58  ? 371  TRP A N   1 
ATOM   2252 C CA  . TRP A 1 355  ? 5.798   -22.861 0.580   1.00 88.39  ? 371  TRP A CA  1 
ATOM   2253 C C   . TRP A 1 355  ? 4.601   -22.854 -0.339  1.00 93.41  ? 371  TRP A C   1 
ATOM   2254 O O   . TRP A 1 355  ? 3.724   -23.703 -0.157  1.00 92.76  ? 371  TRP A O   1 
ATOM   2255 C CB  . TRP A 1 355  ? 5.551   -21.918 1.773   1.00 85.85  ? 371  TRP A CB  1 
ATOM   2256 C CG  . TRP A 1 355  ? 6.407   -22.192 2.972   1.00 85.66  ? 371  TRP A CG  1 
ATOM   2257 C CD1 . TRP A 1 355  ? 6.124   -23.035 4.005   1.00 88.43  ? 371  TRP A CD1 1 
ATOM   2258 C CD2 . TRP A 1 355  ? 7.667   -21.582 3.283   1.00 84.96  ? 371  TRP A CD2 1 
ATOM   2259 N NE1 . TRP A 1 355  ? 7.134   -22.992 4.943   1.00 87.58  ? 371  TRP A NE1 1 
ATOM   2260 C CE2 . TRP A 1 355  ? 8.096   -22.113 4.521   1.00 88.58  ? 371  TRP A CE2 1 
ATOM   2261 C CE3 . TRP A 1 355  ? 8.467   -20.620 2.646   1.00 85.91  ? 371  TRP A CE3 1 
ATOM   2262 C CZ2 . TRP A 1 355  ? 9.293   -21.721 5.129   1.00 87.60  ? 371  TRP A CZ2 1 
ATOM   2263 C CZ3 . TRP A 1 355  ? 9.660   -20.241 3.243   1.00 87.21  ? 371  TRP A CZ3 1 
ATOM   2264 C CH2 . TRP A 1 355  ? 10.056  -20.778 4.476   1.00 87.79  ? 371  TRP A CH2 1 
ATOM   2265 N N   . LYS A 1 356  ? 4.541   -21.878 -1.298  1.00 91.27  ? 372  LYS A N   1 
ATOM   2266 C CA  . LYS A 1 356  ? 3.432   -21.647 -2.253  1.00 92.00  ? 372  LYS A CA  1 
ATOM   2267 C C   . LYS A 1 356  ? 2.061   -21.975 -1.590  1.00 99.32  ? 372  LYS A C   1 
ATOM   2268 O O   . LYS A 1 356  ? 1.232   -22.717 -2.142  1.00 99.83  ? 372  LYS A O   1 
ATOM   2269 C CB  . LYS A 1 356  ? 3.665   -22.392 -3.584  1.00 93.87  ? 372  LYS A CB  1 
ATOM   2270 C CG  . LYS A 1 356  ? 4.694   -21.733 -4.497  1.00 103.03 ? 372  LYS A CG  1 
ATOM   2271 C CD  . LYS A 1 356  ? 5.020   -22.589 -5.716  1.00 110.92 ? 372  LYS A CD  1 
ATOM   2272 N N   . GLN A 1 357  ? 1.874   -21.437 -0.358  1.00 96.41  ? 373  GLN A N   1 
ATOM   2273 C CA  . GLN A 1 357  ? 0.734   -21.690 0.513   1.00 96.37  ? 373  GLN A CA  1 
ATOM   2274 C C   . GLN A 1 357  ? -0.084  -20.438 0.785   1.00 99.78  ? 373  GLN A C   1 
ATOM   2275 O O   . GLN A 1 357  ? 0.491   -19.386 1.060   1.00 100.14 ? 373  GLN A O   1 
ATOM   2276 C CB  . GLN A 1 357  ? 1.260   -22.268 1.834   1.00 97.82  ? 373  GLN A CB  1 
ATOM   2277 C CG  . GLN A 1 357  ? 0.275   -23.158 2.561   1.00 109.11 ? 373  GLN A CG  1 
ATOM   2278 C CD  . GLN A 1 357  ? 0.730   -23.419 3.966   1.00 121.28 ? 373  GLN A CD  1 
ATOM   2279 O OE1 . GLN A 1 357  ? 1.830   -23.925 4.206   1.00 114.79 ? 373  GLN A OE1 1 
ATOM   2280 N NE2 . GLN A 1 357  ? -0.111  -23.074 4.930   1.00 113.76 ? 373  GLN A NE2 1 
ATOM   2281 N N   . ARG A 1 358  ? -1.423  -20.549 0.725   1.00 95.50  ? 374  ARG A N   1 
ATOM   2282 C CA  . ARG A 1 358  ? -2.316  -19.417 0.993   1.00 94.80  ? 374  ARG A CA  1 
ATOM   2283 C C   . ARG A 1 358  ? -2.580  -19.302 2.489   1.00 98.17  ? 374  ARG A C   1 
ATOM   2284 O O   . ARG A 1 358  ? -2.766  -20.314 3.165   1.00 97.23  ? 374  ARG A O   1 
ATOM   2285 C CB  . ARG A 1 358  ? -3.634  -19.526 0.208   1.00 93.66  ? 374  ARG A CB  1 
ATOM   2286 N N   . LEU A 1 359  ? -2.545  -18.061 3.005   1.00 94.83  ? 375  LEU A N   1 
ATOM   2287 C CA  . LEU A 1 359  ? -2.785  -17.695 4.402   1.00 93.89  ? 375  LEU A CA  1 
ATOM   2288 C C   . LEU A 1 359  ? -3.969  -16.745 4.467   1.00 97.22  ? 375  LEU A C   1 
ATOM   2289 O O   . LEU A 1 359  ? -3.972  -15.702 3.806   1.00 97.37  ? 375  LEU A O   1 
ATOM   2290 C CB  . LEU A 1 359  ? -1.533  -17.068 5.055   1.00 93.47  ? 375  LEU A CB  1 
ATOM   2291 C CG  . LEU A 1 359  ? -0.430  -18.035 5.495   1.00 97.26  ? 375  LEU A CG  1 
ATOM   2292 C CD1 . LEU A 1 359  ? 0.783   -17.284 5.984   1.00 96.64  ? 375  LEU A CD1 1 
ATOM   2293 C CD2 . LEU A 1 359  ? -0.915  -18.976 6.586   1.00 100.59 ? 375  LEU A CD2 1 
ATOM   2294 N N   . GLU A 1 360  ? -5.002  -17.148 5.207   1.00 92.77  ? 376  GLU A N   1 
ATOM   2295 C CA  . GLU A 1 360  ? -6.235  -16.384 5.386   1.00 92.30  ? 376  GLU A CA  1 
ATOM   2296 C C   . GLU A 1 360  ? -6.312  -15.924 6.828   1.00 95.38  ? 376  GLU A C   1 
ATOM   2297 O O   . GLU A 1 360  ? -5.805  -16.608 7.728   1.00 96.01  ? 376  GLU A O   1 
ATOM   2298 C CB  . GLU A 1 360  ? -7.458  -17.238 5.034   1.00 93.71  ? 376  GLU A CB  1 
ATOM   2299 C CG  . GLU A 1 360  ? -8.516  -16.481 4.253   1.00 104.60 ? 376  GLU A CG  1 
ATOM   2300 C CD  . GLU A 1 360  ? -9.432  -17.360 3.421   1.00 113.63 ? 376  GLU A CD  1 
ATOM   2301 O OE1 . GLU A 1 360  ? -10.276 -18.072 4.017   1.00 99.45  ? 376  GLU A OE1 1 
ATOM   2302 O OE2 . GLU A 1 360  ? -9.298  -17.346 2.175   1.00 90.56  ? 376  GLU A OE2 1 
ATOM   2303 N N   . PHE A 1 361  ? -6.924  -14.764 7.052   1.00 90.10  ? 377  PHE A N   1 
ATOM   2304 C CA  . PHE A 1 361  ? -7.011  -14.208 8.386   1.00 89.51  ? 377  PHE A CA  1 
ATOM   2305 C C   . PHE A 1 361  ? -8.432  -13.890 8.769   1.00 95.40  ? 377  PHE A C   1 
ATOM   2306 O O   . PHE A 1 361  ? -9.219  -13.470 7.911   1.00 95.18  ? 377  PHE A O   1 
ATOM   2307 C CB  . PHE A 1 361  ? -6.130  -12.956 8.493   1.00 90.84  ? 377  PHE A CB  1 
ATOM   2308 C CG  . PHE A 1 361  ? -4.646  -13.212 8.343   1.00 91.92  ? 377  PHE A CG  1 
ATOM   2309 C CD1 . PHE A 1 361  ? -3.857  -13.504 9.452   1.00 94.37  ? 377  PHE A CD1 1 
ATOM   2310 C CD2 . PHE A 1 361  ? -4.037  -13.165 7.091   1.00 93.36  ? 377  PHE A CD2 1 
ATOM   2311 C CE1 . PHE A 1 361  ? -2.484  -13.735 9.314   1.00 94.91  ? 377  PHE A CE1 1 
ATOM   2312 C CE2 . PHE A 1 361  ? -2.667  -13.390 6.953   1.00 95.89  ? 377  PHE A CE2 1 
ATOM   2313 C CZ  . PHE A 1 361  ? -1.898  -13.669 8.067   1.00 94.10  ? 377  PHE A CZ  1 
ATOM   2314 N N   . ASP A 1 362  ? -8.748  -14.052 10.076  1.00 92.70  ? 378  ASP A N   1 
ATOM   2315 C CA  . ASP A 1 362  ? -10.057 -13.757 10.658  1.00 92.93  ? 378  ASP A CA  1 
ATOM   2316 C C   . ASP A 1 362  ? -10.329 -12.237 10.746  1.00 97.84  ? 378  ASP A C   1 
ATOM   2317 O O   . ASP A 1 362  ? -10.672 -11.721 11.816  1.00 98.20  ? 378  ASP A O   1 
ATOM   2318 C CB  . ASP A 1 362  ? -10.212 -14.448 12.026  1.00 94.92  ? 378  ASP A CB  1 
ATOM   2319 C CG  . ASP A 1 362  ? -11.642 -14.797 12.425  1.00 102.61 ? 378  ASP A CG  1 
ATOM   2320 O OD1 . ASP A 1 362  ? -12.572 -14.565 11.604  1.00 101.60 ? 378  ASP A OD1 1 
ATOM   2321 O OD2 . ASP A 1 362  ? -11.830 -15.333 13.539  1.00 106.67 ? 378  ASP A OD2 1 
ATOM   2322 N N   . ILE A 1 363  ? -10.165 -11.534 9.605   1.00 94.62  ? 379  ILE A N   1 
ATOM   2323 C CA  . ILE A 1 363  ? -10.390 -10.101 9.409   1.00 95.14  ? 379  ILE A CA  1 
ATOM   2324 C C   . ILE A 1 363  ? -10.835 -9.862  7.945   1.00 99.81  ? 379  ILE A C   1 
ATOM   2325 O O   . ILE A 1 363  ? -10.141 -10.279 7.012   1.00 98.58  ? 379  ILE A O   1 
ATOM   2326 C CB  . ILE A 1 363  ? -9.180  -9.221  9.879   1.00 98.33  ? 379  ILE A CB  1 
ATOM   2327 C CG1 . ILE A 1 363  ? -9.518  -7.709  9.921   1.00 98.54  ? 379  ILE A CG1 1 
ATOM   2328 C CG2 . ILE A 1 363  ? -7.875  -9.513  9.113   1.00 99.65  ? 379  ILE A CG2 1 
ATOM   2329 N N   . ASN A 1 364  ? -12.021 -9.249  7.756   1.00 97.46  ? 380  ASN A N   1 
ATOM   2330 C CA  . ASN A 1 364  ? -12.569 -8.995  6.420   1.00 97.86  ? 380  ASN A CA  1 
ATOM   2331 C C   . ASN A 1 364  ? -12.125 -7.616  5.903   1.00 101.90 ? 380  ASN A C   1 
ATOM   2332 O O   . ASN A 1 364  ? -12.569 -6.608  6.439   1.00 101.36 ? 380  ASN A O   1 
ATOM   2333 C CB  . ASN A 1 364  ? -14.110 -9.173  6.398   1.00 100.38 ? 380  ASN A CB  1 
ATOM   2334 C CG  . ASN A 1 364  ? -14.591 -10.570 6.777   1.00 126.03 ? 380  ASN A CG  1 
ATOM   2335 O OD1 . ASN A 1 364  ? -14.669 -11.476 5.938   1.00 125.32 ? 380  ASN A OD1 1 
ATOM   2336 N ND2 . ASN A 1 364  ? -14.917 -10.784 8.054   1.00 112.02 ? 380  ASN A ND2 1 
ATOM   2337 N N   . ILE A 1 365  ? -11.222 -7.607  4.882   1.00 97.87  ? 381  ILE A N   1 
ATOM   2338 C CA  . ILE A 1 365  ? -10.552 -6.507  4.152   1.00 97.17  ? 381  ILE A CA  1 
ATOM   2339 C C   . ILE A 1 365  ? -11.049 -5.068  4.432   1.00 101.06 ? 381  ILE A C   1 
ATOM   2340 O O   . ILE A 1 365  ? -10.216 -4.180  4.622   1.00 100.60 ? 381  ILE A O   1 
ATOM   2341 C CB  . ILE A 1 365  ? -10.560 -6.776  2.636   1.00 100.09 ? 381  ILE A CB  1 
ATOM   2342 N N   . CYS A 1 366  ? -12.371 -4.828  4.428   1.00 97.90  ? 382  CYS A N   1 
ATOM   2343 C CA  . CYS A 1 366  ? -12.984 -3.516  4.709   1.00 97.87  ? 382  CYS A CA  1 
ATOM   2344 C C   . CYS A 1 366  ? -12.788 -3.037  6.186   1.00 101.23 ? 382  CYS A C   1 
ATOM   2345 O O   . CYS A 1 366  ? -12.941 -1.845  6.478   1.00 100.10 ? 382  CYS A O   1 
ATOM   2346 C CB  . CYS A 1 366  ? -14.458 -3.523  4.306   1.00 98.24  ? 382  CYS A CB  1 
ATOM   2347 S SG  . CYS A 1 366  ? -15.400 -4.934  4.950   1.00 102.26 ? 382  CYS A SG  1 
ATOM   2348 N N   . ASP A 1 367  ? -12.441 -3.982  7.095   1.00 97.18  ? 383  ASP A N   1 
ATOM   2349 C CA  . ASP A 1 367  ? -12.212 -3.800  8.531   1.00 96.48  ? 383  ASP A CA  1 
ATOM   2350 C C   . ASP A 1 367  ? -10.759 -3.408  8.866   1.00 97.93  ? 383  ASP A C   1 
ATOM   2351 O O   . ASP A 1 367  ? -10.491 -2.916  9.975   1.00 96.91  ? 383  ASP A O   1 
ATOM   2352 C CB  . ASP A 1 367  ? -12.544 -5.100  9.273   1.00 98.86  ? 383  ASP A CB  1 
ATOM   2353 C CG  . ASP A 1 367  ? -13.976 -5.580  9.182   1.00 110.18 ? 383  ASP A CG  1 
ATOM   2354 O OD1 . ASP A 1 367  ? -14.899 -4.751  9.385   1.00 109.79 ? 383  ASP A OD1 1 
ATOM   2355 O OD2 . ASP A 1 367  ? -14.175 -6.801  8.998   1.00 116.85 ? 383  ASP A OD2 1 
ATOM   2356 N N   . LEU A 1 368  ? -9.822  -3.663  7.924   1.00 92.40  ? 384  LEU A N   1 
ATOM   2357 C CA  . LEU A 1 368  ? -8.402  -3.354  8.087   1.00 90.91  ? 384  LEU A CA  1 
ATOM   2358 C C   . LEU A 1 368  ? -8.206  -1.838  8.246   1.00 94.21  ? 384  LEU A C   1 
ATOM   2359 O O   . LEU A 1 368  ? -8.627  -1.091  7.349   1.00 93.21  ? 384  LEU A O   1 
ATOM   2360 C CB  . LEU A 1 368  ? -7.578  -3.860  6.889   1.00 90.36  ? 384  LEU A CB  1 
ATOM   2361 C CG  . LEU A 1 368  ? -7.588  -5.348  6.578   1.00 93.91  ? 384  LEU A CG  1 
ATOM   2362 C CD1 . LEU A 1 368  ? -7.001  -5.592  5.230   1.00 93.70  ? 384  LEU A CD1 1 
ATOM   2363 C CD2 . LEU A 1 368  ? -6.810  -6.138  7.604   1.00 96.32  ? 384  LEU A CD2 1 
ATOM   2364 N N   . PRO A 1 369  ? -7.616  -1.357  9.388   1.00 89.93  ? 385  PRO A N   1 
ATOM   2365 C CA  . PRO A 1 369  ? -7.423  0.097   9.554   1.00 89.01  ? 385  PRO A CA  1 
ATOM   2366 C C   . PRO A 1 369  ? -6.315  0.620   8.644   1.00 90.25  ? 385  PRO A C   1 
ATOM   2367 O O   . PRO A 1 369  ? -5.589  -0.175  8.050   1.00 88.71  ? 385  PRO A O   1 
ATOM   2368 C CB  . PRO A 1 369  ? -7.108  0.257   11.048  1.00 90.47  ? 385  PRO A CB  1 
ATOM   2369 C CG  . PRO A 1 369  ? -6.546  -1.028  11.458  1.00 94.94  ? 385  PRO A CG  1 
ATOM   2370 C CD  . PRO A 1 369  ? -7.077  -2.102  10.543  1.00 90.81  ? 385  PRO A CD  1 
ATOM   2371 N N   . ARG A 1 370  ? -6.207  1.951   8.515   1.00 85.57  ? 386  ARG A N   1 
ATOM   2372 C CA  . ARG A 1 370  ? -5.216  2.607   7.659   1.00 84.46  ? 386  ARG A CA  1 
ATOM   2373 C C   . ARG A 1 370  ? -3.791  2.180   7.971   1.00 87.04  ? 386  ARG A C   1 
ATOM   2374 O O   . ARG A 1 370  ? -2.979  2.017   7.060   1.00 86.59  ? 386  ARG A O   1 
ATOM   2375 C CB  . ARG A 1 370  ? -5.353  4.145   7.795   1.00 84.10  ? 386  ARG A CB  1 
ATOM   2376 C CG  . ARG A 1 370  ? -4.422  4.999   6.921   1.00 84.46  ? 386  ARG A CG  1 
ATOM   2377 C CD  . ARG A 1 370  ? -4.458  4.588   5.467   1.00 80.33  ? 386  ARG A CD  1 
ATOM   2378 N NE  . ARG A 1 370  ? -3.626  5.434   4.626   1.00 79.87  ? 386  ARG A NE  1 
ATOM   2379 C CZ  . ARG A 1 370  ? -2.315  5.296   4.471   1.00 88.62  ? 386  ARG A CZ  1 
ATOM   2380 N NH1 . ARG A 1 370  ? -1.653  4.369   5.152   1.00 69.37  ? 386  ARG A NH1 1 
ATOM   2381 N NH2 . ARG A 1 370  ? -1.651  6.104   3.656   1.00 74.04  ? 386  ARG A NH2 1 
ATOM   2382 N N   . MET A 1 371  ? -3.500  1.998   9.261   1.00 83.63  ? 387  MET A N   1 
ATOM   2383 C CA  . MET A 1 371  ? -2.169  1.706   9.763   1.00 83.04  ? 387  MET A CA  1 
ATOM   2384 C C   . MET A 1 371  ? -1.918  0.222   10.053  1.00 85.54  ? 387  MET A C   1 
ATOM   2385 O O   . MET A 1 371  ? -0.935  -0.110  10.724  1.00 85.57  ? 387  MET A O   1 
ATOM   2386 C CB  . MET A 1 371  ? -1.882  2.605   10.980  1.00 85.30  ? 387  MET A CB  1 
ATOM   2387 C CG  . MET A 1 371  ? -1.892  4.092   10.619  1.00 88.59  ? 387  MET A CG  1 
ATOM   2388 S SD  . MET A 1 371  ? -0.401  4.603   9.713   1.00 92.40  ? 387  MET A SD  1 
ATOM   2389 C CE  . MET A 1 371  ? -1.094  5.612   8.541   1.00 89.14  ? 387  MET A CE  1 
ATOM   2390 N N   . ALA A 1 372  ? -2.742  -0.666  9.460   1.00 81.00  ? 388  ALA A N   1 
ATOM   2391 C CA  . ALA A 1 372  ? -2.616  -2.124  9.600   1.00 80.34  ? 388  ALA A CA  1 
ATOM   2392 C C   . ALA A 1 372  ? -1.300  -2.609  9.042   1.00 81.98  ? 388  ALA A C   1 
ATOM   2393 O O   . ALA A 1 372  ? -0.946  -2.269  7.918   1.00 80.88  ? 388  ALA A O   1 
ATOM   2394 C CB  . ALA A 1 372  ? -3.767  -2.840  8.903   1.00 81.11  ? 388  ALA A CB  1 
ATOM   2395 N N   . ARG A 1 373  ? -0.573  -3.387  9.847   1.00 78.72  ? 389  ARG A N   1 
ATOM   2396 C CA  . ARG A 1 373  ? 0.717   -3.952  9.484   1.00 78.82  ? 389  ARG A CA  1 
ATOM   2397 C C   . ARG A 1 373  ? 0.747   -5.475  9.563   1.00 85.30  ? 389  ARG A C   1 
ATOM   2398 O O   . ARG A 1 373  ? 0.311   -6.052  10.560  1.00 85.50  ? 389  ARG A O   1 
ATOM   2399 C CB  . ARG A 1 373  ? 1.863   -3.332  10.305  1.00 76.81  ? 389  ARG A CB  1 
ATOM   2400 C CG  . ARG A 1 373  ? 1.589   -3.206  11.804  1.00 83.38  ? 389  ARG A CG  1 
ATOM   2401 C CD  . ARG A 1 373  ? 2.842   -2.856  12.583  1.00 85.22  ? 389  ARG A CD  1 
ATOM   2402 N NE  . ARG A 1 373  ? 3.375   -1.548  12.204  1.00 81.62  ? 389  ARG A NE  1 
ATOM   2403 C CZ  . ARG A 1 373  ? 4.663   -1.221  12.246  1.00 82.14  ? 389  ARG A CZ  1 
ATOM   2404 N NH1 . ARG A 1 373  ? 5.568   -2.106  12.646  1.00 62.83  ? 389  ARG A NH1 1 
ATOM   2405 N NH2 . ARG A 1 373  ? 5.059   -0.009  11.881  1.00 55.58  ? 389  ARG A NH2 1 
ATOM   2406 N N   . LEU A 1 374  ? 1.249   -6.118  8.492   1.00 82.93  ? 390  LEU A N   1 
ATOM   2407 C CA  . LEU A 1 374  ? 1.436   -7.560  8.395   1.00 82.58  ? 390  LEU A CA  1 
ATOM   2408 C C   . LEU A 1 374  ? 2.815   -7.835  8.926   1.00 85.06  ? 390  LEU A C   1 
ATOM   2409 O O   . LEU A 1 374  ? 3.800   -7.318  8.402   1.00 83.99  ? 390  LEU A O   1 
ATOM   2410 C CB  . LEU A 1 374  ? 1.332   -8.070  6.938   1.00 82.88  ? 390  LEU A CB  1 
ATOM   2411 C CG  . LEU A 1 374  ? 0.644   -9.456  6.734   1.00 87.66  ? 390  LEU A CG  1 
ATOM   2412 C CD1 . LEU A 1 374  ? 0.523   -9.794  5.267   1.00 87.37  ? 390  LEU A CD1 1 
ATOM   2413 C CD2 . LEU A 1 374  ? 1.370   -10.596 7.466   1.00 89.74  ? 390  LEU A CD2 1 
ATOM   2414 N N   . CYS A 1 375  ? 2.881   -8.675  9.948   1.00 81.52  ? 391  CYS A N   1 
ATOM   2415 C CA  . CYS A 1 375  ? 4.111   -9.050  10.626  1.00 80.92  ? 391  CYS A CA  1 
ATOM   2416 C C   . CYS A 1 375  ? 4.460   -10.502 10.382  1.00 83.21  ? 391  CYS A C   1 
ATOM   2417 O O   . CYS A 1 375  ? 3.599   -11.372 10.477  1.00 83.12  ? 391  CYS A O   1 
ATOM   2418 C CB  . CYS A 1 375  ? 3.990   -8.735  12.111  1.00 81.39  ? 391  CYS A CB  1 
ATOM   2419 S SG  . CYS A 1 375  ? 3.469   -7.035  12.447  1.00 85.48  ? 391  CYS A SG  1 
ATOM   2420 N N   . PHE A 1 376  ? 5.734   -10.757 10.080  1.00 79.13  ? 392  PHE A N   1 
ATOM   2421 C CA  . PHE A 1 376  ? 6.282   -12.079 9.782   1.00 78.52  ? 392  PHE A CA  1 
ATOM   2422 C C   . PHE A 1 376  ? 7.473   -12.380 10.640  1.00 82.20  ? 392  PHE A C   1 
ATOM   2423 O O   . PHE A 1 376  ? 8.302   -11.502 10.893  1.00 81.48  ? 392  PHE A O   1 
ATOM   2424 C CB  . PHE A 1 376  ? 6.750   -12.181 8.313   1.00 80.13  ? 392  PHE A CB  1 
ATOM   2425 C CG  . PHE A 1 376  ? 5.692   -11.994 7.258   1.00 82.03  ? 392  PHE A CG  1 
ATOM   2426 C CD1 . PHE A 1 376  ? 4.796   -13.016 6.959   1.00 85.70  ? 392  PHE A CD1 1 
ATOM   2427 C CD2 . PHE A 1 376  ? 5.638   -10.827 6.506   1.00 84.31  ? 392  PHE A CD2 1 
ATOM   2428 C CE1 . PHE A 1 376  ? 3.836   -12.852 5.958   1.00 86.74  ? 392  PHE A CE1 1 
ATOM   2429 C CE2 . PHE A 1 376  ? 4.670   -10.660 5.510   1.00 87.58  ? 392  PHE A CE2 1 
ATOM   2430 C CZ  . PHE A 1 376  ? 3.781   -11.675 5.239   1.00 85.84  ? 392  PHE A CZ  1 
ATOM   2431 N N   . ALA A 1 377  ? 7.590   -13.657 11.019  1.00 78.89  ? 393  ALA A N   1 
ATOM   2432 C CA  . ALA A 1 377  ? 8.707   -14.233 11.753  1.00 78.20  ? 393  ALA A CA  1 
ATOM   2433 C C   . ALA A 1 377  ? 8.957   -15.624 11.146  1.00 82.58  ? 393  ALA A C   1 
ATOM   2434 O O   . ALA A 1 377  ? 8.001   -16.361 10.889  1.00 81.12  ? 393  ALA A O   1 
ATOM   2435 C CB  . ALA A 1 377  ? 8.370   -14.337 13.232  1.00 78.64  ? 393  ALA A CB  1 
ATOM   2436 N N   . LEU A 1 378  ? 10.224  -15.924 10.815  1.00 80.85  ? 394  LEU A N   1 
ATOM   2437 C CA  . LEU A 1 378  ? 10.681  -17.210 10.280  1.00 81.48  ? 394  LEU A CA  1 
ATOM   2438 C C   . LEU A 1 378  ? 11.329  -17.933 11.469  1.00 89.82  ? 394  LEU A C   1 
ATOM   2439 O O   . LEU A 1 378  ? 12.184  -17.371 12.170  1.00 88.79  ? 394  LEU A O   1 
ATOM   2440 C CB  . LEU A 1 378  ? 11.687  -17.028 9.104   1.00 80.98  ? 394  LEU A CB  1 
ATOM   2441 C CG  . LEU A 1 378  ? 12.167  -18.306 8.384   1.00 83.95  ? 394  LEU A CG  1 
ATOM   2442 N N   . TYR A 1 379  ? 10.867  -19.152 11.721  1.00 90.29  ? 395  TYR A N   1 
ATOM   2443 C CA  . TYR A 1 379  ? 11.309  -19.971 12.833  1.00 92.13  ? 395  TYR A CA  1 
ATOM   2444 C C   . TYR A 1 379  ? 11.849  -21.286 12.352  1.00 96.12  ? 395  TYR A C   1 
ATOM   2445 O O   . TYR A 1 379  ? 11.341  -21.828 11.372  1.00 94.37  ? 395  TYR A O   1 
ATOM   2446 C CB  . TYR A 1 379  ? 10.112  -20.258 13.753  1.00 95.22  ? 395  TYR A CB  1 
ATOM   2447 C CG  . TYR A 1 379  ? 9.863   -19.223 14.822  1.00 99.39  ? 395  TYR A CG  1 
ATOM   2448 C CD1 . TYR A 1 379  ? 10.513  -19.292 16.050  1.00 102.16 ? 395  TYR A CD1 1 
ATOM   2449 C CD2 . TYR A 1 379  ? 8.909   -18.223 14.643  1.00 100.82 ? 395  TYR A CD2 1 
ATOM   2450 C CE1 . TYR A 1 379  ? 10.257  -18.365 17.061  1.00 104.59 ? 395  TYR A CE1 1 
ATOM   2451 C CE2 . TYR A 1 379  ? 8.641   -17.288 15.647  1.00 102.34 ? 395  TYR A CE2 1 
ATOM   2452 C CZ  . TYR A 1 379  ? 9.317   -17.367 16.858  1.00 113.11 ? 395  TYR A CZ  1 
ATOM   2453 O OH  . TYR A 1 379  ? 9.076   -16.460 17.863  1.00 117.33 ? 395  TYR A OH  1 
ATOM   2454 N N   . ALA A 1 380  ? 12.839  -21.830 13.080  1.00 94.79  ? 396  ALA A N   1 
ATOM   2455 C CA  . ALA A 1 380  ? 13.416  -23.156 12.831  1.00 95.29  ? 396  ALA A CA  1 
ATOM   2456 C C   . ALA A 1 380  ? 12.908  -24.074 13.960  1.00 101.70 ? 396  ALA A C   1 
ATOM   2457 O O   . ALA A 1 380  ? 13.443  -24.085 15.080  1.00 100.91 ? 396  ALA A O   1 
ATOM   2458 C CB  . ALA A 1 380  ? 14.943  -23.096 12.799  1.00 95.86  ? 396  ALA A CB  1 
ATOM   2459 N N   . VAL A 1 381  ? 11.809  -24.782 13.655  1.00 100.65 ? 397  VAL A N   1 
ATOM   2460 C CA  . VAL A 1 381  ? 11.066  -25.698 14.527  1.00 101.42 ? 397  VAL A CA  1 
ATOM   2461 C C   . VAL A 1 381  ? 11.599  -27.139 14.431  1.00 108.23 ? 397  VAL A C   1 
ATOM   2462 O O   . VAL A 1 381  ? 11.832  -27.646 13.336  1.00 107.89 ? 397  VAL A O   1 
ATOM   2463 C CB  . VAL A 1 381  ? 9.543   -25.633 14.187  1.00 105.28 ? 397  VAL A CB  1 
ATOM   2464 C CG1 . VAL A 1 381  ? 8.714   -26.540 15.094  1.00 105.23 ? 397  VAL A CG1 1 
ATOM   2465 C CG2 . VAL A 1 381  ? 9.018   -24.201 14.250  1.00 105.13 ? 397  VAL A CG2 1 
ATOM   2466 N N   . ILE A 1 382  ? 11.759  -27.799 15.585  1.00 107.60 ? 398  ILE A N   1 
ATOM   2467 C CA  . ILE A 1 382  ? 12.141  -29.209 15.674  1.00 108.72 ? 398  ILE A CA  1 
ATOM   2468 C C   . ILE A 1 382  ? 10.826  -29.970 15.331  1.00 117.61 ? 398  ILE A C   1 
ATOM   2469 O O   . ILE A 1 382  ? 9.844   -29.838 16.083  1.00 117.52 ? 398  ILE A O   1 
ATOM   2470 C CB  . ILE A 1 382  ? 12.675  -29.570 17.096  1.00 111.18 ? 398  ILE A CB  1 
ATOM   2471 C CG1 . ILE A 1 382  ? 13.766  -28.592 17.598  1.00 111.07 ? 398  ILE A CG1 1 
ATOM   2472 C CG2 . ILE A 1 382  ? 13.173  -31.007 17.138  1.00 112.10 ? 398  ILE A CG2 1 
ATOM   2473 C CD1 . ILE A 1 382  ? 13.276  -27.289 18.394  1.00 112.47 ? 398  ILE A CD1 1 
ATOM   2474 N N   . GLU A 1 383  ? 10.785  -30.676 14.154  1.00 116.39 ? 399  GLU A N   1 
ATOM   2475 C CA  . GLU A 1 383  ? 9.619   -31.429 13.639  1.00 116.85 ? 399  GLU A CA  1 
ATOM   2476 C C   . GLU A 1 383  ? 8.935   -32.242 14.763  1.00 123.12 ? 399  GLU A C   1 
ATOM   2477 O O   . GLU A 1 383  ? 9.612   -33.000 15.471  1.00 123.29 ? 399  GLU A O   1 
ATOM   2478 C CB  . GLU A 1 383  ? 10.033  -32.314 12.443  1.00 118.15 ? 399  GLU A CB  1 
ATOM   2479 C CG  . GLU A 1 383  ? 8.924   -33.162 11.832  1.00 128.48 ? 399  GLU A CG  1 
ATOM   2480 C CD  . GLU A 1 383  ? 9.224   -34.652 11.798  1.00 146.59 ? 399  GLU A CD  1 
ATOM   2481 O OE1 . GLU A 1 383  ? 8.608   -35.401 12.590  1.00 139.51 ? 399  GLU A OE1 1 
ATOM   2482 O OE2 . GLU A 1 383  ? 10.089  -35.069 10.992  1.00 137.03 ? 399  GLU A OE2 1 
ATOM   2483 N N   . LYS A 1 384  ? 7.607   -32.014 14.947  1.00 120.41 ? 400  LYS A N   1 
ATOM   2484 C CA  . LYS A 1 384  ? 6.703   -32.561 15.979  1.00 120.52 ? 400  LYS A CA  1 
ATOM   2485 C C   . LYS A 1 384  ? 7.062   -33.964 16.548  1.00 124.86 ? 400  LYS A C   1 
ATOM   2486 O O   . LYS A 1 384  ? 7.284   -34.924 15.796  1.00 124.07 ? 400  LYS A O   1 
ATOM   2487 C CB  . LYS A 1 384  ? 5.246   -32.555 15.488  1.00 123.02 ? 400  LYS A CB  1 
ATOM   2488 C CG  . LYS A 1 384  ? 4.553   -31.207 15.665  1.00 131.63 ? 400  LYS A CG  1 
ATOM   2489 C CD  . LYS A 1 384  ? 3.042   -31.333 15.535  1.00 140.00 ? 400  LYS A CD  1 
ATOM   2490 N N   . ALA A 1 385  ? 7.099   -34.045 17.904  1.00 121.68 ? 401  ALA A N   1 
ATOM   2491 C CA  . ALA A 1 385  ? 7.415   -35.236 18.702  1.00 147.43 ? 401  ALA A CA  1 
ATOM   2492 C C   . ALA A 1 385  ? 6.194   -35.681 19.526  1.00 164.69 ? 401  ALA A C   1 
ATOM   2493 O O   . ALA A 1 385  ? 6.087   -36.842 19.933  1.00 115.95 ? 401  ALA A O   1 
ATOM   2494 C CB  . ALA A 1 385  ? 8.588   -34.939 19.628  1.00 148.10 ? 401  ALA A CB  1 
ATOM   2495 N N   . LYS A 1 397  ? 14.455  -28.083 22.764  1.00 111.81 ? 413  LYS A N   1 
ATOM   2496 C CA  . LYS A 1 397  ? 13.143  -27.872 23.381  1.00 111.81 ? 413  LYS A CA  1 
ATOM   2497 C C   . LYS A 1 397  ? 12.557  -26.458 23.147  1.00 115.57 ? 413  LYS A C   1 
ATOM   2498 O O   . LYS A 1 397  ? 11.396  -26.214 23.506  1.00 114.92 ? 413  LYS A O   1 
ATOM   2499 C CB  . LYS A 1 397  ? 13.182  -28.214 24.882  1.00 114.60 ? 413  LYS A CB  1 
ATOM   2500 N N   . ALA A 1 398  ? 13.357  -25.538 22.532  1.00 111.58 ? 414  ALA A N   1 
ATOM   2501 C CA  . ALA A 1 398  ? 12.958  -24.152 22.234  1.00 110.42 ? 414  ALA A CA  1 
ATOM   2502 C C   . ALA A 1 398  ? 12.927  -23.823 20.722  1.00 111.05 ? 414  ALA A C   1 
ATOM   2503 O O   . ALA A 1 398  ? 13.856  -24.173 19.991  1.00 110.64 ? 414  ALA A O   1 
ATOM   2504 C CB  . ALA A 1 398  ? 13.866  -23.181 22.969  1.00 111.10 ? 414  ALA A CB  1 
ATOM   2505 N N   . ASP A 1 399  ? 11.853  -23.157 20.265  1.00 104.94 ? 415  ASP A N   1 
ATOM   2506 C CA  . ASP A 1 399  ? 11.687  -22.758 18.866  1.00 103.76 ? 415  ASP A CA  1 
ATOM   2507 C C   . ASP A 1 399  ? 12.620  -21.583 18.525  1.00 106.04 ? 415  ASP A C   1 
ATOM   2508 O O   . ASP A 1 399  ? 12.499  -20.506 19.116  1.00 106.69 ? 415  ASP A O   1 
ATOM   2509 C CB  . ASP A 1 399  ? 10.206  -22.437 18.550  1.00 105.41 ? 415  ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 399  ? 9.272   -23.646 18.519  1.00 112.17 ? 415  ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 399  ? 9.324   -24.467 19.467  1.00 113.43 ? 415  ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 399  ? 8.447   -23.737 17.582  1.00 112.98 ? 415  ASP A OD2 1 
ATOM   2513 N N   . CYS A 1 400  ? 13.581  -21.821 17.602  1.00 99.83  ? 416  CYS A N   1 
ATOM   2514 C CA  . CYS A 1 400  ? 14.597  -20.866 17.149  1.00 98.22  ? 416  CYS A CA  1 
ATOM   2515 C C   . CYS A 1 400  ? 13.998  -19.714 16.325  1.00 99.94  ? 416  CYS A C   1 
ATOM   2516 O O   . CYS A 1 400  ? 13.474  -19.967 15.228  1.00 99.29  ? 416  CYS A O   1 
ATOM   2517 C CB  . CYS A 1 400  ? 15.715  -21.583 16.385  1.00 98.24  ? 416  CYS A CB  1 
ATOM   2518 S SG  . CYS A 1 400  ? 16.891  -20.483 15.532  1.00 101.63 ? 416  CYS A SG  1 
ATOM   2519 N N   . PRO A 1 401  ? 14.116  -18.440 16.809  1.00 94.19  ? 417  PRO A N   1 
ATOM   2520 C CA  . PRO A 1 401  ? 13.616  -17.306 16.017  1.00 92.35  ? 417  PRO A CA  1 
ATOM   2521 C C   . PRO A 1 401  ? 14.728  -16.873 15.061  1.00 92.90  ? 417  PRO A C   1 
ATOM   2522 O O   . PRO A 1 401  ? 15.824  -16.495 15.487  1.00 91.73  ? 417  PRO A O   1 
ATOM   2523 C CB  . PRO A 1 401  ? 13.235  -16.270 17.083  1.00 93.89  ? 417  PRO A CB  1 
ATOM   2524 C CG  . PRO A 1 401  ? 14.077  -16.617 18.287  1.00 98.91  ? 417  PRO A CG  1 
ATOM   2525 C CD  . PRO A 1 401  ? 14.731  -17.967 18.068  1.00 95.11  ? 417  PRO A CD  1 
ATOM   2526 N N   . ILE A 1 402  ? 14.477  -17.043 13.759  1.00 87.97  ? 418  ILE A N   1 
ATOM   2527 C CA  . ILE A 1 402  ? 15.472  -16.780 12.720  1.00 86.45  ? 418  ILE A CA  1 
ATOM   2528 C C   . ILE A 1 402  ? 15.513  -15.292 12.395  1.00 84.26  ? 418  ILE A C   1 
ATOM   2529 O O   . ILE A 1 402  ? 16.482  -14.594 12.717  1.00 82.32  ? 418  ILE A O   1 
ATOM   2530 C CB  . ILE A 1 402  ? 15.230  -17.694 11.457  1.00 89.89  ? 418  ILE A CB  1 
ATOM   2531 C CG1 . ILE A 1 402  ? 15.122  -19.199 11.824  1.00 90.34  ? 418  ILE A CG1 1 
ATOM   2532 C CG2 . ILE A 1 402  ? 16.258  -17.460 10.341  1.00 90.65  ? 418  ILE A CG2 1 
ATOM   2533 N N   . ALA A 1 403  ? 14.454  -14.826 11.745  1.00 77.86  ? 419  ALA A N   1 
ATOM   2534 C CA  . ALA A 1 403  ? 14.333  -13.464 11.274  1.00 76.30  ? 419  ALA A CA  1 
ATOM   2535 C C   . ALA A 1 403  ? 12.889  -13.024 11.293  1.00 75.48  ? 419  ALA A C   1 
ATOM   2536 O O   . ALA A 1 403  ? 11.988  -13.843 11.467  1.00 76.10  ? 419  ALA A O   1 
ATOM   2537 C CB  . ALA A 1 403  ? 14.886  -13.367 9.853   1.00 77.29  ? 419  ALA A CB  1 
ATOM   2538 N N   . TRP A 1 404  ? 12.671  -11.729 11.124  1.00 67.47  ? 420  TRP A N   1 
ATOM   2539 C CA  . TRP A 1 404  ? 11.350  -11.136 11.113  1.00 66.01  ? 420  TRP A CA  1 
ATOM   2540 C C   . TRP A 1 404  ? 11.329  -10.037 10.061  1.00 70.22  ? 420  TRP A C   1 
ATOM   2541 O O   . TRP A 1 404  ? 12.400  -9.577  9.620   1.00 71.29  ? 420  TRP A O   1 
ATOM   2542 C CB  . TRP A 1 404  ? 11.003  -10.567 12.514  1.00 64.27  ? 420  TRP A CB  1 
ATOM   2543 C CG  . TRP A 1 404  ? 11.935  -9.482  12.977  1.00 64.23  ? 420  TRP A CG  1 
ATOM   2544 C CD1 . TRP A 1 404  ? 13.118  -9.642  13.635  1.00 66.84  ? 420  TRP A CD1 1 
ATOM   2545 C CD2 . TRP A 1 404  ? 11.801  -8.074  12.722  1.00 63.59  ? 420  TRP A CD2 1 
ATOM   2546 N NE1 . TRP A 1 404  ? 13.710  -8.419  13.846  1.00 66.19  ? 420  TRP A NE1 1 
ATOM   2547 C CE2 . TRP A 1 404  ? 12.936  -7.441  13.270  1.00 67.26  ? 420  TRP A CE2 1 
ATOM   2548 C CE3 . TRP A 1 404  ? 10.825  -7.283  12.077  1.00 64.41  ? 420  TRP A CE3 1 
ATOM   2549 C CZ2 . TRP A 1 404  ? 13.137  -6.059  13.179  1.00 66.18  ? 420  TRP A CZ2 1 
ATOM   2550 C CZ3 . TRP A 1 404  ? 11.038  -5.920  11.963  1.00 65.70  ? 420  TRP A CZ3 1 
ATOM   2551 C CH2 . TRP A 1 404  ? 12.186  -5.322  12.503  1.00 66.31  ? 420  TRP A CH2 1 
ATOM   2552 N N   . ALA A 1 405  ? 10.110  -9.586  9.701   1.00 64.30  ? 421  ALA A N   1 
ATOM   2553 C CA  . ALA A 1 405  ? 9.842   -8.528  8.737   1.00 63.57  ? 421  ALA A CA  1 
ATOM   2554 C C   . ALA A 1 405  ? 8.416   -8.044  8.920   1.00 69.27  ? 421  ALA A C   1 
ATOM   2555 O O   . ALA A 1 405  ? 7.520   -8.855  9.148   1.00 67.06  ? 421  ALA A O   1 
ATOM   2556 C CB  . ALA A 1 405  ? 10.018  -9.048  7.315   1.00 64.19  ? 421  ALA A CB  1 
ATOM   2557 N N   . ASN A 1 406  ? 8.205   -6.714  8.851   1.00 68.63  ? 422  ASN A N   1 
ATOM   2558 C CA  . ASN A 1 406  ? 6.864   -6.135  8.963   1.00 68.78  ? 422  ASN A CA  1 
ATOM   2559 C C   . ASN A 1 406  ? 6.570   -5.404  7.698   1.00 73.65  ? 422  ASN A C   1 
ATOM   2560 O O   . ASN A 1 406  ? 7.490   -4.966  7.002   1.00 72.33  ? 422  ASN A O   1 
ATOM   2561 C CB  . ASN A 1 406  ? 6.675   -5.248  10.219  1.00 67.04  ? 422  ASN A CB  1 
ATOM   2562 C CG  . ASN A 1 406  ? 7.038   -5.950  11.498  1.00 86.28  ? 422  ASN A CG  1 
ATOM   2563 O OD1 . ASN A 1 406  ? 6.752   -7.131  11.709  1.00 79.20  ? 422  ASN A OD1 1 
ATOM   2564 N ND2 . ASN A 1 406  ? 7.773   -5.271  12.337  1.00 83.02  ? 422  ASN A ND2 1 
ATOM   2565 N N   . LEU A 1 407  ? 5.292   -5.314  7.361   1.00 72.51  ? 423  LEU A N   1 
ATOM   2566 C CA  . LEU A 1 407  ? 4.890   -4.700  6.114   1.00 73.77  ? 423  LEU A CA  1 
ATOM   2567 C C   . LEU A 1 407  ? 3.603   -3.920  6.311   1.00 80.10  ? 423  LEU A C   1 
ATOM   2568 O O   . LEU A 1 407  ? 2.691   -4.410  6.974   1.00 78.95  ? 423  LEU A O   1 
ATOM   2569 C CB  . LEU A 1 407  ? 4.739   -5.824  5.052   1.00 73.78  ? 423  LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 407  ? 4.103   -5.486  3.700   1.00 78.99  ? 423  LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 407  ? 5.139   -4.968  2.687   1.00 78.80  ? 423  LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 407  ? 3.353   -6.693  3.150   1.00 82.52  ? 423  LEU A CD2 1 
ATOM   2573 N N   . MET A 1 408  ? 3.523   -2.705  5.733   1.00 78.53  ? 424  MET A N   1 
ATOM   2574 C CA  . MET A 1 408  ? 2.283   -1.925  5.814   1.00 78.95  ? 424  MET A CA  1 
ATOM   2575 C C   . MET A 1 408  ? 1.294   -2.504  4.786   1.00 84.55  ? 424  MET A C   1 
ATOM   2576 O O   . MET A 1 408  ? 1.691   -2.721  3.639   1.00 84.53  ? 424  MET A O   1 
ATOM   2577 C CB  . MET A 1 408  ? 2.540   -0.417  5.568   1.00 80.85  ? 424  MET A CB  1 
ATOM   2578 C CG  . MET A 1 408  ? 3.346   0.279   6.673   1.00 83.54  ? 424  MET A CG  1 
ATOM   2579 S SD  . MET A 1 408  ? 2.658   0.131   8.341   1.00 86.91  ? 424  MET A SD  1 
ATOM   2580 C CE  . MET A 1 408  ? 1.256   1.169   8.208   1.00 83.57  ? 424  MET A CE  1 
ATOM   2581 N N   . LEU A 1 409  ? 0.036   -2.800  5.197   1.00 82.22  ? 425  LEU A N   1 
ATOM   2582 C CA  . LEU A 1 409  ? -1.000  -3.360  4.297   1.00 82.58  ? 425  LEU A CA  1 
ATOM   2583 C C   . LEU A 1 409  ? -1.445  -2.364  3.212   1.00 88.78  ? 425  LEU A C   1 
ATOM   2584 O O   . LEU A 1 409  ? -1.861  -2.787  2.135   1.00 88.72  ? 425  LEU A O   1 
ATOM   2585 C CB  . LEU A 1 409  ? -2.205  -3.934  5.068   1.00 82.47  ? 425  LEU A CB  1 
ATOM   2586 C CG  . LEU A 1 409  ? -1.985  -5.295  5.752   1.00 86.60  ? 425  LEU A CG  1 
ATOM   2587 N N   . PHE A 1 410  ? -1.322  -1.045  3.499   1.00 87.01  ? 426  PHE A N   1 
ATOM   2588 C CA  . PHE A 1 410  ? -1.601  0.088   2.603   1.00 86.41  ? 426  PHE A CA  1 
ATOM   2589 C C   . PHE A 1 410  ? -0.297  0.873   2.387   1.00 88.85  ? 426  PHE A C   1 
ATOM   2590 O O   . PHE A 1 410  ? 0.497   1.002   3.317   1.00 89.38  ? 426  PHE A O   1 
ATOM   2591 C CB  . PHE A 1 410  ? -2.630  1.043   3.226   1.00 88.05  ? 426  PHE A CB  1 
ATOM   2592 C CG  . PHE A 1 410  ? -4.042  0.533   3.379   1.00 89.75  ? 426  PHE A CG  1 
ATOM   2593 C CD1 . PHE A 1 410  ? -4.436  -0.138  4.531   1.00 92.63  ? 426  PHE A CD1 1 
ATOM   2594 C CD2 . PHE A 1 410  ? -5.007  0.814   2.419   1.00 92.17  ? 426  PHE A CD2 1 
ATOM   2595 C CE1 . PHE A 1 410  ? -5.761  -0.565  4.697   1.00 93.32  ? 426  PHE A CE1 1 
ATOM   2596 C CE2 . PHE A 1 410  ? -6.332  0.388   2.585   1.00 94.73  ? 426  PHE A CE2 1 
ATOM   2597 C CZ  . PHE A 1 410  ? -6.701  -0.294  3.725   1.00 92.32  ? 426  PHE A CZ  1 
ATOM   2598 N N   . ASP A 1 411  ? -0.091  1.415   1.177   1.00 82.94  ? 427  ASP A N   1 
ATOM   2599 C CA  . ASP A 1 411  ? 1.081   2.226   0.845   1.00 81.08  ? 427  ASP A CA  1 
ATOM   2600 C C   . ASP A 1 411  ? 0.942   3.677   1.353   1.00 83.49  ? 427  ASP A C   1 
ATOM   2601 O O   . ASP A 1 411  ? -0.104  4.044   1.896   1.00 83.04  ? 427  ASP A O   1 
ATOM   2602 C CB  . ASP A 1 411  ? 1.383   2.163   -0.670  1.00 82.14  ? 427  ASP A CB  1 
ATOM   2603 C CG  . ASP A 1 411  ? 0.430   2.868   -1.644  1.00 82.02  ? 427  ASP A CG  1 
ATOM   2604 O OD1 . ASP A 1 411  ? -0.484  3.609   -1.179  1.00 81.79  ? 427  ASP A OD1 1 
ATOM   2605 O OD2 . ASP A 1 411  ? 0.622   2.716   -2.865  1.00 79.60  ? 427  ASP A OD2 1 
ATOM   2606 N N   . TYR A 1 412  ? 1.984   4.497   1.151   1.00 79.10  ? 428  TYR A N   1 
ATOM   2607 C CA  . TYR A 1 412  ? 2.008   5.902   1.552   1.00 79.14  ? 428  TYR A CA  1 
ATOM   2608 C C   . TYR A 1 412  ? 0.986   6.825   0.827   1.00 87.16  ? 428  TYR A C   1 
ATOM   2609 O O   . TYR A 1 412  ? 0.904   8.012   1.162   1.00 88.06  ? 428  TYR A O   1 
ATOM   2610 C CB  . TYR A 1 412  ? 3.428   6.446   1.362   1.00 79.27  ? 428  TYR A CB  1 
ATOM   2611 C CG  . TYR A 1 412  ? 3.812   6.679   -0.082  1.00 78.74  ? 428  TYR A CG  1 
ATOM   2612 C CD1 . TYR A 1 412  ? 4.223   5.626   -0.892  1.00 80.62  ? 428  TYR A CD1 1 
ATOM   2613 C CD2 . TYR A 1 412  ? 3.786   7.957   -0.632  1.00 78.76  ? 428  TYR A CD2 1 
ATOM   2614 C CE1 . TYR A 1 412  ? 4.582   5.835   -2.223  1.00 81.39  ? 428  TYR A CE1 1 
ATOM   2615 C CE2 . TYR A 1 412  ? 4.143   8.180   -1.962  1.00 79.48  ? 428  TYR A CE2 1 
ATOM   2616 C CZ  . TYR A 1 412  ? 4.547   7.115   -2.752  1.00 87.05  ? 428  TYR A CZ  1 
ATOM   2617 O OH  . TYR A 1 412  ? 4.921   7.318   -4.055  1.00 85.74  ? 428  TYR A OH  1 
ATOM   2618 N N   . LYS A 1 413  ? 0.265   6.318   -0.193  1.00 84.69  ? 429  LYS A N   1 
ATOM   2619 C CA  . LYS A 1 413  ? -0.682  7.134   -0.959  1.00 84.51  ? 429  LYS A CA  1 
ATOM   2620 C C   . LYS A 1 413  ? -2.135  6.734   -0.670  1.00 89.48  ? 429  LYS A C   1 
ATOM   2621 O O   . LYS A 1 413  ? -3.042  7.108   -1.428  1.00 89.26  ? 429  LYS A O   1 
ATOM   2622 C CB  . LYS A 1 413  ? -0.342  7.083   -2.466  1.00 86.32  ? 429  LYS A CB  1 
ATOM   2623 N N   . ASP A 1 414  ? -2.344  6.017   0.470   1.00 85.75  ? 430  ASP A N   1 
ATOM   2624 C CA  . ASP A 1 414  ? -3.606  5.456   0.979   1.00 85.85  ? 430  ASP A CA  1 
ATOM   2625 C C   . ASP A 1 414  ? -4.069  4.182   0.220   1.00 91.02  ? 430  ASP A C   1 
ATOM   2626 O O   . ASP A 1 414  ? -5.062  3.574   0.618   1.00 91.06  ? 430  ASP A O   1 
ATOM   2627 C CB  . ASP A 1 414  ? -4.756  6.496   1.064   1.00 87.43  ? 430  ASP A CB  1 
ATOM   2628 C CG  . ASP A 1 414  ? -4.478  7.747   1.876   1.00 100.23 ? 430  ASP A CG  1 
ATOM   2629 O OD1 . ASP A 1 414  ? -4.042  7.621   3.041   1.00 99.97  ? 430  ASP A OD1 1 
ATOM   2630 O OD2 . ASP A 1 414  ? -4.785  8.852   1.383   1.00 109.98 ? 430  ASP A OD2 1 
ATOM   2631 N N   . GLN A 1 415  ? -3.341  3.754   -0.819  1.00 88.43  ? 431  GLN A N   1 
ATOM   2632 C CA  . GLN A 1 415  ? -3.716  2.592   -1.636  1.00 89.33  ? 431  GLN A CA  1 
ATOM   2633 C C   . GLN A 1 415  ? -3.315  1.239   -1.048  1.00 93.53  ? 431  GLN A C   1 
ATOM   2634 O O   . GLN A 1 415  ? -2.155  1.064   -0.679  1.00 92.20  ? 431  GLN A O   1 
ATOM   2635 C CB  . GLN A 1 415  ? -3.130  2.734   -3.049  1.00 91.04  ? 431  GLN A CB  1 
ATOM   2636 C CG  . GLN A 1 415  ? -3.800  1.869   -4.100  1.00 106.80 ? 431  GLN A CG  1 
ATOM   2637 C CD  . GLN A 1 415  ? -2.931  1.790   -5.321  1.00 126.89 ? 431  GLN A CD  1 
ATOM   2638 O OE1 . GLN A 1 415  ? -2.635  2.807   -5.959  1.00 119.94 ? 431  GLN A OE1 1 
ATOM   2639 N NE2 . GLN A 1 415  ? -2.475  0.583   -5.651  1.00 120.73 ? 431  GLN A NE2 1 
ATOM   2640 N N   . LEU A 1 416  ? -4.261  0.261   -1.038  1.00 91.64  ? 432  LEU A N   1 
ATOM   2641 C CA  . LEU A 1 416  ? -4.010  -1.105  -0.548  1.00 92.16  ? 432  LEU A CA  1 
ATOM   2642 C C   . LEU A 1 416  ? -3.039  -1.849  -1.476  1.00 97.29  ? 432  LEU A C   1 
ATOM   2643 O O   . LEU A 1 416  ? -3.264  -1.929  -2.687  1.00 97.98  ? 432  LEU A O   1 
ATOM   2644 C CB  . LEU A 1 416  ? -5.310  -1.915  -0.309  1.00 91.94  ? 432  LEU A CB  1 
ATOM   2645 C CG  . LEU A 1 416  ? -5.115  -3.274  0.398   1.00 95.61  ? 432  LEU A CG  1 
ATOM   2646 C CD1 . LEU A 1 416  ? -5.370  -3.167  1.891   1.00 95.01  ? 432  LEU A CD1 1 
ATOM   2647 C CD2 . LEU A 1 416  ? -5.987  -4.339  -0.216  1.00 96.98  ? 432  LEU A CD2 1 
ATOM   2648 N N   . LYS A 1 417  ? -1.941  -2.343  -0.905  1.00 93.59  ? 433  LYS A N   1 
ATOM   2649 C CA  . LYS A 1 417  ? -0.898  -3.015  -1.663  1.00 93.85  ? 433  LYS A CA  1 
ATOM   2650 C C   . LYS A 1 417  ? -1.373  -4.309  -2.294  1.00 99.28  ? 433  LYS A C   1 
ATOM   2651 O O   . LYS A 1 417  ? -1.974  -5.142  -1.617  1.00 99.71  ? 433  LYS A O   1 
ATOM   2652 C CB  . LYS A 1 417  ? 0.353   -3.270  -0.793  1.00 95.32  ? 433  LYS A CB  1 
ATOM   2653 C CG  . LYS A 1 417  ? 1.264   -2.066  -0.651  1.00 95.14  ? 433  LYS A CG  1 
ATOM   2654 C CD  . LYS A 1 417  ? 2.370   -2.344  0.343   1.00 92.90  ? 433  LYS A CD  1 
ATOM   2655 C CE  . LYS A 1 417  ? 2.812   -1.089  1.036   1.00 83.20  ? 433  LYS A CE  1 
ATOM   2656 N NZ  . LYS A 1 417  ? 3.689   -1.399  2.177   1.00 89.98  ? 433  LYS A NZ  1 
ATOM   2657 N N   . THR A 1 418  ? -1.123  -4.462  -3.600  1.00 95.90  ? 434  THR A N   1 
ATOM   2658 C CA  . THR A 1 418  ? -1.429  -5.695  -4.327  1.00 95.65  ? 434  THR A CA  1 
ATOM   2659 C C   . THR A 1 418  ? -0.171  -6.140  -5.052  1.00 97.16  ? 434  THR A C   1 
ATOM   2660 O O   . THR A 1 418  ? 0.716   -5.327  -5.341  1.00 97.27  ? 434  THR A O   1 
ATOM   2661 C CB  . THR A 1 418  ? -2.633  -5.568  -5.273  1.00 107.18 ? 434  THR A CB  1 
ATOM   2662 O OG1 . THR A 1 418  ? -2.374  -4.538  -6.221  1.00 111.17 ? 434  THR A OG1 1 
ATOM   2663 C CG2 . THR A 1 418  ? -3.952  -5.326  -4.540  1.00 106.70 ? 434  THR A CG2 1 
ATOM   2664 N N   . GLY A 1 419  ? -0.106  -7.429  -5.315  1.00 90.62  ? 435  GLY A N   1 
ATOM   2665 C CA  . GLY A 1 419  ? 1.008   -8.049  -5.998  1.00 89.35  ? 435  GLY A CA  1 
ATOM   2666 C C   . GLY A 1 419  ? 2.029   -8.641  -5.060  1.00 92.09  ? 435  GLY A C   1 
ATOM   2667 O O   . GLY A 1 419  ? 1.896   -8.595  -3.838  1.00 91.26  ? 435  GLY A O   1 
ATOM   2668 N N   . GLU A 1 420  ? 3.050   -9.212  -5.667  1.00 88.64  ? 436  GLU A N   1 
ATOM   2669 C CA  . GLU A 1 420  ? 4.203   -9.816  -5.048  1.00 88.57  ? 436  GLU A CA  1 
ATOM   2670 C C   . GLU A 1 420  ? 5.036   -8.725  -4.347  1.00 91.06  ? 436  GLU A C   1 
ATOM   2671 O O   . GLU A 1 420  ? 5.034   -7.566  -4.773  1.00 89.39  ? 436  GLU A O   1 
ATOM   2672 C CB  . GLU A 1 420  ? 5.039   -10.494 -6.156  1.00 90.36  ? 436  GLU A CB  1 
ATOM   2673 C CG  . GLU A 1 420  ? 5.867   -11.683 -5.705  1.00 106.10 ? 436  GLU A CG  1 
ATOM   2674 C CD  . GLU A 1 420  ? 6.236   -12.625 -6.835  1.00 138.20 ? 436  GLU A CD  1 
ATOM   2675 O OE1 . GLU A 1 420  ? 7.353   -12.489 -7.386  1.00 142.50 ? 436  GLU A OE1 1 
ATOM   2676 O OE2 . GLU A 1 420  ? 5.399   -13.491 -7.181  1.00 132.76 ? 436  GLU A OE2 1 
ATOM   2677 N N   . ARG A 1 421  ? 5.725   -9.112  -3.253  1.00 87.23  ? 437  ARG A N   1 
ATOM   2678 C CA  . ARG A 1 421  ? 6.659   -8.301  -2.463  1.00 85.92  ? 437  ARG A CA  1 
ATOM   2679 C C   . ARG A 1 421  ? 7.776   -9.225  -2.010  1.00 87.44  ? 437  ARG A C   1 
ATOM   2680 O O   . ARG A 1 421  ? 7.508   -10.359 -1.592  1.00 87.69  ? 437  ARG A O   1 
ATOM   2681 C CB  . ARG A 1 421  ? 6.002   -7.652  -1.217  1.00 85.68  ? 437  ARG A CB  1 
ATOM   2682 C CG  . ARG A 1 421  ? 4.755   -6.794  -1.451  1.00 95.93  ? 437  ARG A CG  1 
ATOM   2683 C CD  . ARG A 1 421  ? 5.011   -5.392  -1.980  1.00 105.75 ? 437  ARG A CD  1 
ATOM   2684 N NE  . ARG A 1 421  ? 3.879   -4.975  -2.816  1.00 117.08 ? 437  ARG A NE  1 
ATOM   2685 C CZ  . ARG A 1 421  ? 3.509   -3.717  -3.031  1.00 123.24 ? 437  ARG A CZ  1 
ATOM   2686 N NH1 . ARG A 1 421  ? 4.183   -2.715  -2.478  1.00 116.59 ? 437  ARG A NH1 1 
ATOM   2687 N NH2 . ARG A 1 421  ? 2.463   -3.450  -3.805  1.00 94.93  ? 437  ARG A NH2 1 
ATOM   2688 N N   . CYS A 1 422  ? 9.023   -8.757  -2.113  1.00 82.19  ? 438  CYS A N   1 
ATOM   2689 C CA  . CYS A 1 422  ? 10.188  -9.503  -1.648  1.00 81.48  ? 438  CYS A CA  1 
ATOM   2690 C C   . CYS A 1 422  ? 10.703  -8.736  -0.425  1.00 85.90  ? 438  CYS A C   1 
ATOM   2691 O O   . CYS A 1 422  ? 11.305  -7.665  -0.587  1.00 86.72  ? 438  CYS A O   1 
ATOM   2692 C CB  . CYS A 1 422  ? 11.245  -9.614  -2.741  1.00 81.46  ? 438  CYS A CB  1 
ATOM   2693 S SG  . CYS A 1 422  ? 12.788  -10.394 -2.198  1.00 85.52  ? 438  CYS A SG  1 
ATOM   2694 N N   . LEU A 1 423  ? 10.407  -9.250  0.793   1.00 80.37  ? 439  LEU A N   1 
ATOM   2695 C CA  . LEU A 1 423  ? 10.750  -8.598  2.063   1.00 79.44  ? 439  LEU A CA  1 
ATOM   2696 C C   . LEU A 1 423  ? 12.069  -9.040  2.647   1.00 81.72  ? 439  LEU A C   1 
ATOM   2697 O O   . LEU A 1 423  ? 12.111  -10.071 3.318   1.00 81.68  ? 439  LEU A O   1 
ATOM   2698 C CB  . LEU A 1 423  ? 9.641   -8.815  3.119   1.00 79.64  ? 439  LEU A CB  1 
ATOM   2699 C CG  . LEU A 1 423  ? 8.209   -8.448  2.754   1.00 84.31  ? 439  LEU A CG  1 
ATOM   2700 C CD1 . LEU A 1 423  ? 7.255   -8.937  3.810   1.00 83.50  ? 439  LEU A CD1 1 
ATOM   2701 C CD2 . LEU A 1 423  ? 8.059   -6.943  2.527   1.00 88.42  ? 439  LEU A CD2 1 
ATOM   2702 N N   . TYR A 1 424  ? 13.131  -8.238  2.470   1.00 77.10  ? 440  TYR A N   1 
ATOM   2703 C CA  . TYR A 1 424  ? 14.443  -8.549  3.044   1.00 76.92  ? 440  TYR A CA  1 
ATOM   2704 C C   . TYR A 1 424  ? 14.369  -8.412  4.585   1.00 79.76  ? 440  TYR A C   1 
ATOM   2705 O O   . TYR A 1 424  ? 14.062  -7.330  5.115   1.00 79.09  ? 440  TYR A O   1 
ATOM   2706 C CB  . TYR A 1 424  ? 15.542  -7.709  2.384   1.00 79.04  ? 440  TYR A CB  1 
ATOM   2707 C CG  . TYR A 1 424  ? 15.745  -8.052  0.920   1.00 82.46  ? 440  TYR A CG  1 
ATOM   2708 C CD1 . TYR A 1 424  ? 14.867  -7.584  -0.056  1.00 84.90  ? 440  TYR A CD1 1 
ATOM   2709 C CD2 . TYR A 1 424  ? 16.798  -8.866  0.513   1.00 83.70  ? 440  TYR A CD2 1 
ATOM   2710 C CE1 . TYR A 1 424  ? 15.050  -7.893  -1.404  1.00 86.76  ? 440  TYR A CE1 1 
ATOM   2711 C CE2 . TYR A 1 424  ? 16.999  -9.174  -0.833  1.00 84.84  ? 440  TYR A CE2 1 
ATOM   2712 C CZ  . TYR A 1 424  ? 16.118  -8.690  -1.790  1.00 95.17  ? 440  TYR A CZ  1 
ATOM   2713 O OH  . TYR A 1 424  ? 16.298  -8.997  -3.123  1.00 97.73  ? 440  TYR A OH  1 
ATOM   2714 N N   . MET A 1 425  ? 14.525  -9.572  5.279   1.00 74.66  ? 441  MET A N   1 
ATOM   2715 C CA  . MET A 1 425  ? 14.333  -9.765  6.726   1.00 73.09  ? 441  MET A CA  1 
ATOM   2716 C C   . MET A 1 425  ? 15.495  -9.464  7.596   1.00 73.56  ? 441  MET A C   1 
ATOM   2717 O O   . MET A 1 425  ? 16.641  -9.650  7.181   1.00 72.69  ? 441  MET A O   1 
ATOM   2718 C CB  . MET A 1 425  ? 13.888  -11.194 7.043   1.00 75.48  ? 441  MET A CB  1 
ATOM   2719 C CG  . MET A 1 425  ? 12.622  -11.605 6.357   1.00 79.18  ? 441  MET A CG  1 
ATOM   2720 S SD  . MET A 1 425  ? 12.070  -13.189 6.953   1.00 82.70  ? 441  MET A SD  1 
ATOM   2721 C CE  . MET A 1 425  ? 13.402  -14.221 6.370   1.00 79.29  ? 441  MET A CE  1 
ATOM   2722 N N   . TRP A 1 426  ? 15.167  -9.111  8.864   1.00 67.76  ? 442  TRP A N   1 
ATOM   2723 C CA  . TRP A 1 426  ? 16.083  -8.761  9.961   1.00 65.83  ? 442  TRP A CA  1 
ATOM   2724 C C   . TRP A 1 426  ? 16.187  -9.915  10.935  1.00 69.55  ? 442  TRP A C   1 
ATOM   2725 O O   . TRP A 1 426  ? 15.164  -10.513 11.248  1.00 69.54  ? 442  TRP A O   1 
ATOM   2726 C CB  . TRP A 1 426  ? 15.542  -7.561  10.770  1.00 62.63  ? 442  TRP A CB  1 
ATOM   2727 C CG  . TRP A 1 426  ? 15.156  -6.363  9.972   1.00 61.48  ? 442  TRP A CG  1 
ATOM   2728 C CD1 . TRP A 1 426  ? 13.911  -6.064  9.498   1.00 64.41  ? 442  TRP A CD1 1 
ATOM   2729 C CD2 . TRP A 1 426  ? 15.992  -5.237  9.666   1.00 59.98  ? 442  TRP A CD2 1 
ATOM   2730 N NE1 . TRP A 1 426  ? 13.928  -4.839  8.865   1.00 64.43  ? 442  TRP A NE1 1 
ATOM   2731 C CE2 . TRP A 1 426  ? 15.196  -4.304  8.960   1.00 65.21  ? 442  TRP A CE2 1 
ATOM   2732 C CE3 . TRP A 1 426  ? 17.333  -4.917  9.929   1.00 59.54  ? 442  TRP A CE3 1 
ATOM   2733 C CZ2 . TRP A 1 426  ? 15.708  -3.074  8.500   1.00 63.40  ? 442  TRP A CZ2 1 
ATOM   2734 C CZ3 . TRP A 1 426  ? 17.840  -3.713  9.462   1.00 60.52  ? 442  TRP A CZ3 1 
ATOM   2735 C CH2 . TRP A 1 426  ? 17.031  -2.801  8.769   1.00 61.40  ? 442  TRP A CH2 1 
ATOM   2736 N N   . PRO A 1 427  ? 17.361  -10.147 11.541  1.00 66.46  ? 443  PRO A N   1 
ATOM   2737 C CA  . PRO A 1 427  ? 17.471  -11.230 12.532  1.00 67.03  ? 443  PRO A CA  1 
ATOM   2738 C C   . PRO A 1 427  ? 16.665  -11.002 13.804  1.00 70.84  ? 443  PRO A C   1 
ATOM   2739 O O   . PRO A 1 427  ? 16.539  -9.892  14.306  1.00 70.16  ? 443  PRO A O   1 
ATOM   2740 C CB  . PRO A 1 427  ? 18.970  -11.276 12.853  1.00 68.85  ? 443  PRO A CB  1 
ATOM   2741 C CG  . PRO A 1 427  ? 19.455  -9.937  12.527  1.00 73.25  ? 443  PRO A CG  1 
ATOM   2742 C CD  . PRO A 1 427  ? 18.661  -9.491  11.329  1.00 68.30  ? 443  PRO A CD  1 
ATOM   2743 N N   . SER A 1 428  ? 16.105  -12.074 14.303  1.00 68.13  ? 444  SER A N   1 
ATOM   2744 C CA  . SER A 1 428  ? 15.354  -12.035 15.522  1.00 67.85  ? 444  SER A CA  1 
ATOM   2745 C C   . SER A 1 428  ? 16.370  -12.150 16.626  1.00 76.77  ? 444  SER A C   1 
ATOM   2746 O O   . SER A 1 428  ? 17.253  -13.002 16.573  1.00 74.92  ? 444  SER A O   1 
ATOM   2747 C CB  . SER A 1 428  ? 14.338  -13.173 15.571  1.00 67.74  ? 444  SER A CB  1 
ATOM   2748 O OG  . SER A 1 428  ? 13.281  -13.020 14.632  1.00 67.16  ? 444  SER A OG  1 
ATOM   2749 N N   . VAL A 1 429  ? 16.300  -11.216 17.578  1.00 79.23  ? 445  VAL A N   1 
ATOM   2750 C CA  . VAL A 1 429  ? 17.151  -11.210 18.756  1.00 81.10  ? 445  VAL A CA  1 
ATOM   2751 C C   . VAL A 1 429  ? 16.420  -12.008 19.865  1.00 90.62  ? 445  VAL A C   1 
ATOM   2752 O O   . VAL A 1 429  ? 15.238  -11.753 20.134  1.00 90.04  ? 445  VAL A O   1 
ATOM   2753 C CB  . VAL A 1 429  ? 17.552  -9.772  19.174  1.00 84.13  ? 445  VAL A CB  1 
ATOM   2754 C CG1 . VAL A 1 429  ? 17.803  -9.664  20.676  1.00 83.68  ? 445  VAL A CG1 1 
ATOM   2755 C CG2 . VAL A 1 429  ? 18.775  -9.315  18.391  1.00 83.67  ? 445  VAL A CG2 1 
ATOM   2756 N N   . PRO A 1 430  ? 17.076  -13.023 20.468  1.00 91.44  ? 446  PRO A N   1 
ATOM   2757 C CA  . PRO A 1 430  ? 16.413  -13.757 21.562  1.00 92.90  ? 446  PRO A CA  1 
ATOM   2758 C C   . PRO A 1 430  ? 16.347  -12.875 22.817  1.00 100.12 ? 446  PRO A C   1 
ATOM   2759 O O   . PRO A 1 430  ? 17.345  -12.252 23.207  1.00 98.78  ? 446  PRO A O   1 
ATOM   2760 C CB  . PRO A 1 430  ? 17.273  -15.013 21.732  1.00 94.38  ? 446  PRO A CB  1 
ATOM   2761 C CG  . PRO A 1 430  ? 18.609  -14.659 21.161  1.00 98.27  ? 446  PRO A CG  1 
ATOM   2762 C CD  . PRO A 1 430  ? 18.479  -13.448 20.287  1.00 93.31  ? 446  PRO A CD  1 
ATOM   2763 N N   . ASP A 1 431  ? 15.149  -12.740 23.390  1.00 99.98  ? 447  ASP A N   1 
ATOM   2764 C CA  . ASP A 1 431  ? 14.966  -11.856 24.539  1.00 101.89 ? 447  ASP A CA  1 
ATOM   2765 C C   . ASP A 1 431  ? 13.908  -12.379 25.517  1.00 107.80 ? 447  ASP A C   1 
ATOM   2766 O O   . ASP A 1 431  ? 13.252  -13.396 25.230  1.00 106.90 ? 447  ASP A O   1 
ATOM   2767 C CB  . ASP A 1 431  ? 14.571  -10.448 24.040  1.00 104.48 ? 447  ASP A CB  1 
ATOM   2768 C CG  . ASP A 1 431  ? 13.150  -10.391 23.501  1.00 118.25 ? 447  ASP A CG  1 
ATOM   2769 O OD1 . ASP A 1 431  ? 12.894  -10.999 22.433  1.00 120.16 ? 447  ASP A OD1 1 
ATOM   2770 O OD2 . ASP A 1 431  ? 12.281  -9.798  24.181  1.00 122.57 ? 447  ASP A OD2 1 
ATOM   2771 N N   . GLU A 1 432  ? 13.721  -11.626 26.646  1.00 105.73 ? 448  GLU A N   1 
ATOM   2772 C CA  . GLU A 1 432  ? 12.765  -11.853 27.745  1.00 106.10 ? 448  GLU A CA  1 
ATOM   2773 C C   . GLU A 1 432  ? 11.362  -12.122 27.190  1.00 110.73 ? 448  GLU A C   1 
ATOM   2774 O O   . GLU A 1 432  ? 10.789  -13.183 27.461  1.00 110.73 ? 448  GLU A O   1 
ATOM   2775 C CB  . GLU A 1 432  ? 12.732  -10.648 28.715  1.00 107.60 ? 448  GLU A CB  1 
ATOM   2776 C CG  . GLU A 1 432  ? 14.053  -10.312 29.390  1.00 117.21 ? 448  GLU A CG  1 
ATOM   2777 N N   . LYS A 1 433  ? 10.832  -11.186 26.375  1.00 107.33 ? 449  LYS A N   1 
ATOM   2778 C CA  . LYS A 1 433  ? 9.535   -11.355 25.723  1.00 107.12 ? 449  LYS A CA  1 
ATOM   2779 C C   . LYS A 1 433  ? 9.771   -12.242 24.496  1.00 110.82 ? 449  LYS A C   1 
ATOM   2780 O O   . LYS A 1 433  ? 10.169  -11.746 23.429  1.00 110.25 ? 449  LYS A O   1 
ATOM   2781 C CB  . LYS A 1 433  ? 8.925   -9.992  25.334  1.00 109.74 ? 449  LYS A CB  1 
ATOM   2782 N N   . GLY A 1 434  ? 9.602   -13.556 24.695  1.00 106.77 ? 450  GLY A N   1 
ATOM   2783 C CA  . GLY A 1 434  ? 9.787   -14.579 23.665  1.00 106.05 ? 450  GLY A CA  1 
ATOM   2784 C C   . GLY A 1 434  ? 9.169   -14.180 22.339  1.00 108.37 ? 450  GLY A C   1 
ATOM   2785 O O   . GLY A 1 434  ? 9.861   -14.178 21.311  1.00 108.33 ? 450  GLY A O   1 
ATOM   2786 N N   . GLU A 1 435  ? 7.867   -13.762 22.406  1.00 102.75 ? 451  GLU A N   1 
ATOM   2787 C CA  . GLU A 1 435  ? 6.956   -13.259 21.372  1.00 101.53 ? 451  GLU A CA  1 
ATOM   2788 C C   . GLU A 1 435  ? 7.176   -13.837 20.000  1.00 104.10 ? 451  GLU A C   1 
ATOM   2789 O O   . GLU A 1 435  ? 8.269   -13.702 19.432  1.00 103.87 ? 451  GLU A O   1 
ATOM   2790 C CB  . GLU A 1 435  ? 6.986   -11.730 21.304  1.00 103.04 ? 451  GLU A CB  1 
ATOM   2791 C CG  . GLU A 1 435  ? 6.023   -11.044 22.259  1.00 116.30 ? 451  GLU A CG  1 
ATOM   2792 C CD  . GLU A 1 435  ? 6.145   -9.530  22.362  1.00 141.27 ? 451  GLU A CD  1 
ATOM   2793 O OE1 . GLU A 1 435  ? 6.314   -8.857  21.318  1.00 131.28 ? 451  GLU A OE1 1 
ATOM   2794 O OE2 . GLU A 1 435  ? 6.028   -9.013  23.497  1.00 136.63 ? 451  GLU A OE2 1 
ATOM   2795 N N   . LEU A 1 436  ? 6.120   -14.447 19.434  1.00 99.28  ? 452  LEU A N   1 
ATOM   2796 C CA  . LEU A 1 436  ? 6.216   -15.025 18.092  1.00 97.81  ? 452  LEU A CA  1 
ATOM   2797 C C   . LEU A 1 436  ? 6.644   -13.946 17.082  1.00 95.86  ? 452  LEU A C   1 
ATOM   2798 O O   . LEU A 1 436  ? 7.686   -14.090 16.440  1.00 95.13  ? 452  LEU A O   1 
ATOM   2799 C CB  . LEU A 1 436  ? 4.914   -15.735 17.677  1.00 98.13  ? 452  LEU A CB  1 
ATOM   2800 N N   . LEU A 1 437  ? 5.926   -12.812 17.074  1.00 87.89  ? 453  LEU A N   1 
ATOM   2801 C CA  . LEU A 1 437  ? 6.186   -11.697 16.170  1.00 85.83  ? 453  LEU A CA  1 
ATOM   2802 C C   . LEU A 1 437  ? 6.774   -10.435 16.833  1.00 85.73  ? 453  LEU A C   1 
ATOM   2803 O O   . LEU A 1 437  ? 6.784   -10.309 18.063  1.00 85.80  ? 453  LEU A O   1 
ATOM   2804 C CB  . LEU A 1 437  ? 4.907   -11.359 15.400  1.00 85.68  ? 453  LEU A CB  1 
ATOM   2805 C CG  . LEU A 1 437  ? 4.295   -12.512 14.623  1.00 90.37  ? 453  LEU A CG  1 
ATOM   2806 C CD1 . LEU A 1 437  ? 2.823   -12.330 14.486  1.00 90.81  ? 453  LEU A CD1 1 
ATOM   2807 C CD2 . LEU A 1 437  ? 4.956   -12.689 13.273  1.00 92.21  ? 453  LEU A CD2 1 
ATOM   2808 N N   . ASN A 1 438  ? 7.271   -9.511  15.995  1.00 78.31  ? 454  ASN A N   1 
ATOM   2809 C CA  . ASN A 1 438  ? 7.851   -8.249  16.423  1.00 76.59  ? 454  ASN A CA  1 
ATOM   2810 C C   . ASN A 1 438  ? 7.083   -7.060  15.785  1.00 79.34  ? 454  ASN A C   1 
ATOM   2811 O O   . ASN A 1 438  ? 7.612   -6.409  14.869  1.00 77.47  ? 454  ASN A O   1 
ATOM   2812 C CB  . ASN A 1 438  ? 9.356   -8.216  16.115  1.00 72.08  ? 454  ASN A CB  1 
ATOM   2813 C CG  . ASN A 1 438  ? 10.057  -7.000  16.656  1.00 79.20  ? 454  ASN A CG  1 
ATOM   2814 O OD1 . ASN A 1 438  ? 9.764   -6.502  17.762  1.00 78.26  ? 454  ASN A OD1 1 
ATOM   2815 N ND2 . ASN A 1 438  ? 10.976  -6.480  15.872  1.00 58.38  ? 454  ASN A ND2 1 
ATOM   2816 N N   . PRO A 1 439  ? 5.827   -6.766  16.258  1.00 75.44  ? 455  PRO A N   1 
ATOM   2817 C CA  . PRO A 1 439  ? 5.036   -5.665  15.654  1.00 74.99  ? 455  PRO A CA  1 
ATOM   2818 C C   . PRO A 1 439  ? 5.608   -4.261  15.827  1.00 78.86  ? 455  PRO A C   1 
ATOM   2819 O O   . PRO A 1 439  ? 5.233   -3.353  15.095  1.00 78.27  ? 455  PRO A O   1 
ATOM   2820 C CB  . PRO A 1 439  ? 3.680   -5.778  16.360  1.00 76.36  ? 455  PRO A CB  1 
ATOM   2821 C CG  . PRO A 1 439  ? 3.994   -6.425  17.655  1.00 80.28  ? 455  PRO A CG  1 
ATOM   2822 C CD  . PRO A 1 439  ? 5.055   -7.431  17.328  1.00 75.87  ? 455  PRO A CD  1 
ATOM   2823 N N   . THR A 1 440  ? 6.478   -4.077  16.822  1.00 75.91  ? 456  THR A N   1 
ATOM   2824 C CA  . THR A 1 440  ? 7.094   -2.783  17.097  1.00 75.63  ? 456  THR A CA  1 
ATOM   2825 C C   . THR A 1 440  ? 8.276   -2.555  16.143  1.00 77.96  ? 456  THR A C   1 
ATOM   2826 O O   . THR A 1 440  ? 8.780   -1.438  16.022  1.00 78.61  ? 456  THR A O   1 
ATOM   2827 C CB  . THR A 1 440  ? 7.447   -2.645  18.591  1.00 84.42  ? 456  THR A CB  1 
ATOM   2828 O OG1 . THR A 1 440  ? 8.768   -3.128  18.826  1.00 82.58  ? 456  THR A OG1 1 
ATOM   2829 C CG2 . THR A 1 440  ? 6.440   -3.350  19.514  1.00 84.91  ? 456  THR A CG2 1 
ATOM   2830 N N   . GLY A 1 441  ? 8.689   -3.618  15.466  1.00 71.89  ? 457  GLY A N   1 
ATOM   2831 C CA  . GLY A 1 441  ? 9.776   -3.572  14.511  1.00 70.63  ? 457  GLY A CA  1 
ATOM   2832 C C   . GLY A 1 441  ? 9.466   -2.695  13.320  1.00 72.86  ? 457  GLY A C   1 
ATOM   2833 O O   . GLY A 1 441  ? 8.302   -2.423  13.016  1.00 71.72  ? 457  GLY A O   1 
ATOM   2834 N N   . THR A 1 442  ? 10.528  -2.248  12.654  1.00 69.04  ? 458  THR A N   1 
ATOM   2835 C CA  . THR A 1 442  ? 10.517  -1.365  11.501  1.00 68.64  ? 458  THR A CA  1 
ATOM   2836 C C   . THR A 1 442  ? 9.795   -2.031  10.286  1.00 74.42  ? 458  THR A C   1 
ATOM   2837 O O   . THR A 1 442  ? 9.893   -3.238  10.089  1.00 75.73  ? 458  THR A O   1 
ATOM   2838 C CB  . THR A 1 442  ? 11.984  -0.905  11.252  1.00 70.01  ? 458  THR A CB  1 
ATOM   2839 O OG1 . THR A 1 442  ? 12.020  0.443   10.812  1.00 72.44  ? 458  THR A OG1 1 
ATOM   2840 C CG2 . THR A 1 442  ? 12.783  -1.820  10.307  1.00 64.65  ? 458  THR A CG2 1 
ATOM   2841 N N   . VAL A 1 443  ? 9.069   -1.237  9.506   1.00 70.81  ? 459  VAL A N   1 
ATOM   2842 C CA  . VAL A 1 443  ? 8.381   -1.664  8.291   1.00 71.22  ? 459  VAL A CA  1 
ATOM   2843 C C   . VAL A 1 443  ? 9.307   -1.582  7.045   1.00 81.32  ? 459  VAL A C   1 
ATOM   2844 O O   . VAL A 1 443  ? 8.942   -2.074  5.964   1.00 82.11  ? 459  VAL A O   1 
ATOM   2845 C CB  . VAL A 1 443  ? 7.058   -0.912  8.052   1.00 73.32  ? 459  VAL A CB  1 
ATOM   2846 C CG1 . VAL A 1 443  ? 5.947   -1.466  8.916   1.00 72.79  ? 459  VAL A CG1 1 
ATOM   2847 C CG2 . VAL A 1 443  ? 7.215   0.591   8.234   1.00 72.64  ? 459  VAL A CG2 1 
ATOM   2848 N N   . ARG A 1 444  ? 10.495  -0.963  7.194   1.00 80.34  ? 460  ARG A N   1 
ATOM   2849 C CA  . ARG A 1 444  ? 11.451  -0.831  6.084   1.00 81.06  ? 460  ARG A CA  1 
ATOM   2850 C C   . ARG A 1 444  ? 12.238  -2.137  5.941   1.00 85.25  ? 460  ARG A C   1 
ATOM   2851 O O   . ARG A 1 444  ? 12.441  -2.842  6.938   1.00 86.51  ? 460  ARG A O   1 
ATOM   2852 C CB  . ARG A 1 444  ? 12.407  0.383   6.271   1.00 82.75  ? 460  ARG A CB  1 
ATOM   2853 C CG  . ARG A 1 444  ? 11.808  1.680   6.914   1.00 97.78  ? 460  ARG A CG  1 
ATOM   2854 C CD  . ARG A 1 444  ? 10.603  2.370   6.222   1.00 101.73 ? 460  ARG A CD  1 
ATOM   2855 N NE  . ARG A 1 444  ? 10.813  2.655   4.797   1.00 105.09 ? 460  ARG A NE  1 
ATOM   2856 C CZ  . ARG A 1 444  ? 9.895   3.166   3.974   1.00 116.62 ? 460  ARG A CZ  1 
ATOM   2857 N NH1 . ARG A 1 444  ? 8.680   3.474   4.426   1.00 83.73  ? 460  ARG A NH1 1 
ATOM   2858 N NH2 . ARG A 1 444  ? 10.181  3.366   2.692   1.00 114.64 ? 460  ARG A NH2 1 
ATOM   2859 N N   . SER A 1 445  ? 12.659  -2.473  4.714   1.00 80.10  ? 461  SER A N   1 
ATOM   2860 C CA  . SER A 1 445  ? 13.428  -3.694  4.453   1.00 79.45  ? 461  SER A CA  1 
ATOM   2861 C C   . SER A 1 445  ? 14.872  -3.573  4.916   1.00 78.42  ? 461  SER A C   1 
ATOM   2862 O O   . SER A 1 445  ? 15.437  -2.475  4.901   1.00 77.84  ? 461  SER A O   1 
ATOM   2863 C CB  . SER A 1 445  ? 13.411  -4.029  2.965   1.00 86.34  ? 461  SER A CB  1 
ATOM   2864 O OG  . SER A 1 445  ? 14.317  -3.211  2.235   1.00 101.23 ? 461  SER A OG  1 
ATOM   2865 N N   . ASN A 1 446  ? 15.485  -4.717  5.269   1.00 71.91  ? 462  ASN A N   1 
ATOM   2866 C CA  . ASN A 1 446  ? 16.896  -4.797  5.657   1.00 69.57  ? 462  ASN A CA  1 
ATOM   2867 C C   . ASN A 1 446  ? 17.681  -4.253  4.465   1.00 76.44  ? 462  ASN A C   1 
ATOM   2868 O O   . ASN A 1 446  ? 17.467  -4.724  3.344   1.00 77.23  ? 462  ASN A O   1 
ATOM   2869 C CB  . ASN A 1 446  ? 17.291  -6.235  5.975   1.00 55.55  ? 462  ASN A CB  1 
ATOM   2870 C CG  . ASN A 1 446  ? 18.640  -6.391  6.618   1.00 78.13  ? 462  ASN A CG  1 
ATOM   2871 O OD1 . ASN A 1 446  ? 19.564  -5.576  6.438   1.00 72.43  ? 462  ASN A OD1 1 
ATOM   2872 N ND2 . ASN A 1 446  ? 18.800  -7.464  7.396   1.00 71.35  ? 462  ASN A ND2 1 
ATOM   2873 N N   . PRO A 1 447  ? 18.480  -3.170  4.645   1.00 73.63  ? 463  PRO A N   1 
ATOM   2874 C CA  . PRO A 1 447  ? 19.195  -2.581  3.498   1.00 73.04  ? 463  PRO A CA  1 
ATOM   2875 C C   . PRO A 1 447  ? 20.253  -3.479  2.873   1.00 78.69  ? 463  PRO A C   1 
ATOM   2876 O O   . PRO A 1 447  ? 20.711  -3.203  1.767   1.00 78.98  ? 463  PRO A O   1 
ATOM   2877 C CB  . PRO A 1 447  ? 19.816  -1.319  4.092   1.00 74.66  ? 463  PRO A CB  1 
ATOM   2878 C CG  . PRO A 1 447  ? 19.986  -1.617  5.515   1.00 79.09  ? 463  PRO A CG  1 
ATOM   2879 C CD  . PRO A 1 447  ? 18.807  -2.454  5.894   1.00 75.07  ? 463  PRO A CD  1 
ATOM   2880 N N   . ASN A 1 448  ? 20.631  -4.555  3.581   1.00 77.22  ? 464  ASN A N   1 
ATOM   2881 C CA  . ASN A 1 448  ? 21.615  -5.541  3.150   1.00 77.47  ? 464  ASN A CA  1 
ATOM   2882 C C   . ASN A 1 448  ? 20.968  -6.504  2.162   1.00 83.63  ? 464  ASN A C   1 
ATOM   2883 O O   . ASN A 1 448  ? 21.121  -7.709  2.312   1.00 83.94  ? 464  ASN A O   1 
ATOM   2884 C CB  . ASN A 1 448  ? 22.177  -6.284  4.363   1.00 75.31  ? 464  ASN A CB  1 
ATOM   2885 C CG  . ASN A 1 448  ? 23.576  -6.811  4.158   1.00 111.39 ? 464  ASN A CG  1 
ATOM   2886 O OD1 . ASN A 1 448  ? 23.793  -7.847  3.508   1.00 103.60 ? 464  ASN A OD1 1 
ATOM   2887 N ND2 . ASN A 1 448  ? 24.559  -6.112  4.730   1.00 107.47 ? 464  ASN A ND2 1 
ATOM   2888 N N   . THR A 1 449  ? 20.278  -5.978  1.119   1.00 81.95  ? 465  THR A N   1 
ATOM   2889 C CA  . THR A 1 449  ? 19.603  -6.785  0.092   1.00 82.94  ? 465  THR A CA  1 
ATOM   2890 C C   . THR A 1 449  ? 20.585  -7.781  -0.535  1.00 91.45  ? 465  THR A C   1 
ATOM   2891 O O   . THR A 1 449  ? 20.177  -8.816  -1.071  1.00 92.37  ? 465  THR A O   1 
ATOM   2892 C CB  . THR A 1 449  ? 18.843  -5.918  -0.923  1.00 87.19  ? 465  THR A CB  1 
ATOM   2893 O OG1 . THR A 1 449  ? 19.724  -4.958  -1.485  1.00 87.30  ? 465  THR A OG1 1 
ATOM   2894 C CG2 . THR A 1 449  ? 17.639  -5.208  -0.309  1.00 84.97  ? 465  THR A CG2 1 
ATOM   2895 N N   . ASP A 1 450  ? 21.885  -7.482  -0.361  1.00 89.51  ? 466  ASP A N   1 
ATOM   2896 C CA  . ASP A 1 450  ? 23.066  -8.238  -0.741  1.00 90.06  ? 466  ASP A CA  1 
ATOM   2897 C C   . ASP A 1 450  ? 23.045  -9.672  -0.155  1.00 93.87  ? 466  ASP A C   1 
ATOM   2898 O O   . ASP A 1 450  ? 22.623  -10.594 -0.860  1.00 93.53  ? 466  ASP A O   1 
ATOM   2899 C CB  . ASP A 1 450  ? 24.333  -7.443  -0.297  1.00 92.51  ? 466  ASP A CB  1 
ATOM   2900 C CG  . ASP A 1 450  ? 25.680  -8.104  -0.548  1.00 104.38 ? 466  ASP A CG  1 
ATOM   2901 O OD1 . ASP A 1 450  ? 26.155  -8.834  0.345   1.00 103.41 ? 466  ASP A OD1 1 
ATOM   2902 O OD2 . ASP A 1 450  ? 26.283  -7.844  -1.617  1.00 114.35 ? 466  ASP A OD2 1 
ATOM   2903 N N   . SER A 1 451  ? 23.463  -9.847  1.129   1.00 90.14  ? 467  SER A N   1 
ATOM   2904 C CA  . SER A 1 451  ? 23.617  -11.141 1.804   1.00 89.67  ? 467  SER A CA  1 
ATOM   2905 C C   . SER A 1 451  ? 22.476  -11.588 2.781   1.00 93.17  ? 467  SER A C   1 
ATOM   2906 O O   . SER A 1 451  ? 22.514  -12.733 3.254   1.00 93.93  ? 467  SER A O   1 
ATOM   2907 C CB  . SER A 1 451  ? 24.950  -11.166 2.545   1.00 92.52  ? 467  SER A CB  1 
ATOM   2908 O OG  . SER A 1 451  ? 25.540  -12.455 2.492   1.00 102.98 ? 467  SER A OG  1 
ATOM   2909 N N   . ALA A 1 452  ? 21.472  -10.734 3.056   1.00 87.48  ? 468  ALA A N   1 
ATOM   2910 C CA  . ALA A 1 452  ? 20.398  -11.035 4.014   1.00 86.44  ? 468  ALA A CA  1 
ATOM   2911 C C   . ALA A 1 452  ? 19.289  -11.979 3.511   1.00 89.94  ? 468  ALA A C   1 
ATOM   2912 O O   . ALA A 1 452  ? 19.002  -12.006 2.312   1.00 90.41  ? 468  ALA A O   1 
ATOM   2913 C CB  . ALA A 1 452  ? 19.781  -9.743  4.528   1.00 86.75  ? 468  ALA A CB  1 
ATOM   2914 N N   . ALA A 1 453  ? 18.638  -12.719 4.455   1.00 84.62  ? 469  ALA A N   1 
ATOM   2915 C CA  . ALA A 1 453  ? 17.498  -13.603 4.190   1.00 83.63  ? 469  ALA A CA  1 
ATOM   2916 C C   . ALA A 1 453  ? 16.300  -12.760 3.807   1.00 87.00  ? 469  ALA A C   1 
ATOM   2917 O O   . ALA A 1 453  ? 16.237  -11.596 4.187   1.00 88.42  ? 469  ALA A O   1 
ATOM   2918 C CB  . ALA A 1 453  ? 17.164  -14.431 5.417   1.00 84.11  ? 469  ALA A CB  1 
ATOM   2919 N N   . ALA A 1 454  ? 15.366  -13.323 3.045   1.00 82.08  ? 470  ALA A N   1 
ATOM   2920 C CA  . ALA A 1 454  ? 14.183  -12.608 2.575   1.00 81.68  ? 470  ALA A CA  1 
ATOM   2921 C C   . ALA A 1 454  ? 13.023  -13.567 2.454   1.00 85.05  ? 470  ALA A C   1 
ATOM   2922 O O   . ALA A 1 454  ? 13.228  -14.775 2.497   1.00 85.32  ? 470  ALA A O   1 
ATOM   2923 C CB  . ALA A 1 454  ? 14.467  -11.965 1.224   1.00 82.64  ? 470  ALA A CB  1 
ATOM   2924 N N   . LEU A 1 455  ? 11.814  -13.037 2.312   1.00 81.40  ? 471  LEU A N   1 
ATOM   2925 C CA  . LEU A 1 455  ? 10.600  -13.822 2.191   1.00 82.47  ? 471  LEU A CA  1 
ATOM   2926 C C   . LEU A 1 455  ? 9.786   -13.255 1.036   1.00 91.74  ? 471  LEU A C   1 
ATOM   2927 O O   . LEU A 1 455  ? 9.577   -12.035 0.969   1.00 91.94  ? 471  LEU A O   1 
ATOM   2928 C CB  . LEU A 1 455  ? 9.793   -13.787 3.497   1.00 82.44  ? 471  LEU A CB  1 
ATOM   2929 C CG  . LEU A 1 455  ? 9.457   -15.142 4.096   1.00 87.02  ? 471  LEU A CG  1 
ATOM   2930 N N   . LEU A 1 456  ? 9.382   -14.142 0.088   1.00 90.98  ? 472  LEU A N   1 
ATOM   2931 C CA  . LEU A 1 456  ? 8.604   -13.799 -1.105  1.00 90.96  ? 472  LEU A CA  1 
ATOM   2932 C C   . LEU A 1 456  ? 7.138   -14.026 -0.835  1.00 92.14  ? 472  LEU A C   1 
ATOM   2933 O O   . LEU A 1 456  ? 6.731   -15.148 -0.534  1.00 90.45  ? 472  LEU A O   1 
ATOM   2934 C CB  . LEU A 1 456  ? 9.080   -14.591 -2.331  1.00 91.48  ? 472  LEU A CB  1 
ATOM   2935 C CG  . LEU A 1 456  ? 9.637   -13.724 -3.460  1.00 96.87  ? 472  LEU A CG  1 
ATOM   2936 C CD1 . LEU A 1 456  ? 11.177  -13.832 -3.545  1.00 96.98  ? 472  LEU A CD1 1 
ATOM   2937 C CD2 . LEU A 1 456  ? 8.955   -14.049 -4.775  1.00 99.21  ? 472  LEU A CD2 1 
ATOM   2938 N N   . ILE A 1 457  ? 6.373   -12.932 -0.838  1.00 88.61  ? 473  ILE A N   1 
ATOM   2939 C CA  . ILE A 1 457  ? 4.938   -12.941 -0.555  1.00 89.21  ? 473  ILE A CA  1 
ATOM   2940 C C   . ILE A 1 457  ? 4.196   -12.319 -1.704  1.00 94.49  ? 473  ILE A C   1 
ATOM   2941 O O   . ILE A 1 457  ? 4.784   -11.589 -2.490  1.00 92.39  ? 473  ILE A O   1 
ATOM   2942 C CB  . ILE A 1 457  ? 4.534   -12.271 0.814   1.00 92.08  ? 473  ILE A CB  1 
ATOM   2943 C CG1 . ILE A 1 457  ? 5.060   -10.823 0.967   1.00 92.39  ? 473  ILE A CG1 1 
ATOM   2944 C CG2 . ILE A 1 457  ? 4.879   -13.141 2.013   1.00 91.91  ? 473  ILE A CG2 1 
ATOM   2945 N N   . CYS A 1 458  ? 2.904   -12.595 -1.791  1.00 94.32  ? 474  CYS A N   1 
ATOM   2946 C CA  . CYS A 1 458  ? 2.084   -12.019 -2.827  1.00 96.23  ? 474  CYS A CA  1 
ATOM   2947 C C   . CYS A 1 458  ? 0.721   -11.674 -2.272  1.00 102.36 ? 474  CYS A C   1 
ATOM   2948 O O   . CYS A 1 458  ? -0.039  -12.561 -1.869  1.00 102.08 ? 474  CYS A O   1 
ATOM   2949 C CB  . CYS A 1 458  ? 1.995   -12.940 -4.044  1.00 97.24  ? 474  CYS A CB  1 
ATOM   2950 S SG  . CYS A 1 458  ? 1.184   -12.194 -5.486  1.00 101.39 ? 474  CYS A SG  1 
ATOM   2951 N N   . LEU A 1 459  ? 0.443   -10.367 -2.194  1.00 100.76 ? 475  LEU A N   1 
ATOM   2952 C CA  . LEU A 1 459  ? -0.851  -9.849  -1.764  1.00 101.81 ? 475  LEU A CA  1 
ATOM   2953 C C   . LEU A 1 459  ? -1.698  -9.902  -3.048  1.00 108.37 ? 475  LEU A C   1 
ATOM   2954 O O   . LEU A 1 459  ? -1.171  -9.590  -4.114  1.00 107.87 ? 475  LEU A O   1 
ATOM   2955 C CB  . LEU A 1 459  ? -0.725  -8.411  -1.226  1.00 101.85 ? 475  LEU A CB  1 
ATOM   2956 C CG  . LEU A 1 459  ? -0.035  -8.258  0.133   1.00 106.10 ? 475  LEU A CG  1 
ATOM   2957 N N   . PRO A 1 460  ? -2.945  -10.408 -3.031  1.00 106.30 ? 476  PRO A N   1 
ATOM   2958 C CA  . PRO A 1 460  ? -3.669  -10.554 -4.299  1.00 106.64 ? 476  PRO A CA  1 
ATOM   2959 C C   . PRO A 1 460  ? -4.511  -9.347  -4.708  1.00 112.60 ? 476  PRO A C   1 
ATOM   2960 O O   . PRO A 1 460  ? -4.923  -8.560  -3.849  1.00 113.01 ? 476  PRO A O   1 
ATOM   2961 C CB  . PRO A 1 460  ? -4.523  -11.798 -4.057  1.00 108.12 ? 476  PRO A CB  1 
ATOM   2962 C CG  . PRO A 1 460  ? -4.746  -11.825 -2.567  1.00 112.28 ? 476  PRO A CG  1 
ATOM   2963 C CD  . PRO A 1 460  ? -3.748  -10.911 -1.900  1.00 107.83 ? 476  PRO A CD  1 
ATOM   2964 N N   . GLU A 1 461  ? -4.785  -9.215  -6.026  1.00 109.13 ? 477  GLU A N   1 
ATOM   2965 C CA  . GLU A 1 461  ? -5.652  -8.158  -6.542  1.00 109.21 ? 477  GLU A CA  1 
ATOM   2966 C C   . GLU A 1 461  ? -7.072  -8.494  -6.076  1.00 114.62 ? 477  GLU A C   1 
ATOM   2967 O O   . GLU A 1 461  ? -7.392  -9.675  -5.877  1.00 113.42 ? 477  GLU A O   1 
ATOM   2968 C CB  . GLU A 1 461  ? -5.569  -8.054  -8.074  1.00 110.45 ? 477  GLU A CB  1 
ATOM   2969 C CG  . GLU A 1 461  ? -4.410  -7.209  -8.574  1.00 119.25 ? 477  GLU A CG  1 
ATOM   2970 N N   . VAL A 1 462  ? -7.897  -7.465  -5.828  1.00 112.84 ? 478  VAL A N   1 
ATOM   2971 C CA  . VAL A 1 462  ? -9.242  -7.698  -5.304  1.00 113.29 ? 478  VAL A CA  1 
ATOM   2972 C C   . VAL A 1 462  ? -10.306 -6.796  -5.998  1.00 119.31 ? 478  VAL A C   1 
ATOM   2973 O O   . VAL A 1 462  ? -11.470 -6.772  -5.579  1.00 118.76 ? 478  VAL A O   1 
ATOM   2974 C CB  . VAL A 1 462  ? -9.216  -7.591  -3.746  1.00 116.84 ? 478  VAL A CB  1 
ATOM   2975 C CG1 . VAL A 1 462  ? -9.083  -6.145  -3.256  1.00 116.30 ? 478  VAL A CG1 1 
ATOM   2976 C CG2 . VAL A 1 462  ? -10.390 -8.321  -3.099  1.00 116.55 ? 478  VAL A CG2 1 
ATOM   2977 N N   . ALA A 1 463  ? -9.899  -6.107  -7.096  1.00 117.67 ? 479  ALA A N   1 
ATOM   2978 C CA  . ALA A 1 463  ? -10.734 -5.207  -7.911  1.00 118.10 ? 479  ALA A CA  1 
ATOM   2979 C C   . ALA A 1 463  ? -10.064 -4.839  -9.263  1.00 123.44 ? 479  ALA A C   1 
ATOM   2980 O O   . ALA A 1 463  ? -8.833  -4.749  -9.316  1.00 122.64 ? 479  ALA A O   1 
ATOM   2981 C CB  . ALA A 1 463  ? -11.041 -3.932  -7.131  1.00 118.83 ? 479  ALA A CB  1 
ATOM   2982 N N   . PRO A 1 464  ? -10.839 -4.555  -10.348 1.00 121.28 ? 480  PRO A N   1 
ATOM   2983 C CA  . PRO A 1 464  ? -10.202 -4.156  -11.624 1.00 121.38 ? 480  PRO A CA  1 
ATOM   2984 C C   . PRO A 1 464  ? -9.511  -2.785  -11.561 1.00 125.00 ? 480  PRO A C   1 
ATOM   2985 O O   . PRO A 1 464  ? -8.603  -2.508  -12.353 1.00 125.08 ? 480  PRO A O   1 
ATOM   2986 C CB  . PRO A 1 464  ? -11.364 -4.167  -12.620 1.00 123.23 ? 480  PRO A CB  1 
ATOM   2987 C CG  . PRO A 1 464  ? -12.572 -3.918  -11.786 1.00 127.55 ? 480  PRO A CG  1 
ATOM   2988 C CD  . PRO A 1 464  ? -12.312 -4.597  -10.476 1.00 122.96 ? 480  PRO A CD  1 
ATOM   2989 N N   . HIS A 1 465  ? -9.949  -1.933  -10.616 1.00 120.35 ? 481  HIS A N   1 
ATOM   2990 C CA  . HIS A 1 465  ? -9.381  -0.617  -10.340 1.00 119.52 ? 481  HIS A CA  1 
ATOM   2991 C C   . HIS A 1 465  ? -8.676  -0.678  -8.961  1.00 121.48 ? 481  HIS A C   1 
ATOM   2992 O O   . HIS A 1 465  ? -9.154  -1.410  -8.085  1.00 120.76 ? 481  HIS A O   1 
ATOM   2993 C CB  . HIS A 1 465  ? -10.490 0.452   -10.338 1.00 120.25 ? 481  HIS A CB  1 
ATOM   2994 N N   . PRO A 1 466  ? -7.546  0.047   -8.731  1.00 116.58 ? 482  PRO A N   1 
ATOM   2995 C CA  . PRO A 1 466  ? -6.910  -0.005  -7.391  1.00 115.21 ? 482  PRO A CA  1 
ATOM   2996 C C   . PRO A 1 466  ? -7.778  0.651   -6.306  1.00 114.32 ? 482  PRO A C   1 
ATOM   2997 O O   . PRO A 1 466  ? -8.418  1.684   -6.562  1.00 112.90 ? 482  PRO A O   1 
ATOM   2998 C CB  . PRO A 1 466  ? -5.573  0.723   -7.589  1.00 117.07 ? 482  PRO A CB  1 
ATOM   2999 C CG  . PRO A 1 466  ? -5.798  1.627   -8.757  1.00 122.17 ? 482  PRO A CG  1 
ATOM   3000 C CD  . PRO A 1 466  ? -6.824  0.963   -9.643  1.00 118.02 ? 482  PRO A CD  1 
ATOM   3001 N N   . VAL A 1 467  ? -7.834  0.023   -5.109  1.00 107.60 ? 483  VAL A N   1 
ATOM   3002 C CA  . VAL A 1 467  ? -8.649  0.518   -3.992  1.00 105.78 ? 483  VAL A CA  1 
ATOM   3003 C C   . VAL A 1 467  ? -7.776  1.253   -2.945  1.00 105.46 ? 483  VAL A C   1 
ATOM   3004 O O   . VAL A 1 467  ? -6.691  0.791   -2.585  1.00 104.35 ? 483  VAL A O   1 
ATOM   3005 C CB  . VAL A 1 467  ? -9.567  -0.591  -3.390  1.00 109.56 ? 483  VAL A CB  1 
ATOM   3006 C CG1 . VAL A 1 467  ? -8.774  -1.827  -2.958  1.00 109.37 ? 483  VAL A CG1 1 
ATOM   3007 C CG2 . VAL A 1 467  ? -10.468 -0.062  -2.263  1.00 109.23 ? 483  VAL A CG2 1 
ATOM   3008 N N   . TYR A 1 468  ? -8.253  2.430   -2.516  1.00 99.84  ? 484  TYR A N   1 
ATOM   3009 C CA  . TYR A 1 468  ? -7.615  3.306   -1.538  1.00 98.73  ? 484  TYR A CA  1 
ATOM   3010 C C   . TYR A 1 468  ? -8.471  3.333   -0.280  1.00 100.41 ? 484  TYR A C   1 
ATOM   3011 O O   . TYR A 1 468  ? -9.673  3.057   -0.342  1.00 100.10 ? 484  TYR A O   1 
ATOM   3012 C CB  . TYR A 1 468  ? -7.485  4.745   -2.087  1.00 100.28 ? 484  TYR A CB  1 
ATOM   3013 C CG  . TYR A 1 468  ? -6.725  4.875   -3.393  1.00 102.91 ? 484  TYR A CG  1 
ATOM   3014 C CD1 . TYR A 1 468  ? -7.326  4.554   -4.607  1.00 104.69 ? 484  TYR A CD1 1 
ATOM   3015 C CD2 . TYR A 1 468  ? -5.441  5.410   -3.426  1.00 104.24 ? 484  TYR A CD2 1 
ATOM   3016 C CE1 . TYR A 1 468  ? -6.638  4.677   -5.814  1.00 104.82 ? 484  TYR A CE1 1 
ATOM   3017 C CE2 . TYR A 1 468  ? -4.744  5.549   -4.631  1.00 105.52 ? 484  TYR A CE2 1 
ATOM   3018 C CZ  . TYR A 1 468  ? -5.352  5.185   -5.825  1.00 111.23 ? 484  TYR A CZ  1 
ATOM   3019 O OH  . TYR A 1 468  ? -4.700  5.320   -7.031  1.00 110.52 ? 484  TYR A OH  1 
ATOM   3020 N N   . TYR A 1 469  ? -7.853  3.664   0.867   1.00 95.37  ? 485  TYR A N   1 
ATOM   3021 C CA  . TYR A 1 469  ? -8.532  3.803   2.156   1.00 93.89  ? 485  TYR A CA  1 
ATOM   3022 C C   . TYR A 1 469  ? -9.450  5.051   2.048   1.00 97.04  ? 485  TYR A C   1 
ATOM   3023 O O   . TYR A 1 469  ? -9.057  5.995   1.352   1.00 97.25  ? 485  TYR A O   1 
ATOM   3024 C CB  . TYR A 1 469  ? -7.487  3.971   3.273   1.00 93.95  ? 485  TYR A CB  1 
ATOM   3025 C CG  . TYR A 1 469  ? -8.068  3.985   4.670   1.00 94.17  ? 485  TYR A CG  1 
ATOM   3026 C CD1 . TYR A 1 469  ? -8.304  2.802   5.360   1.00 95.46  ? 485  TYR A CD1 1 
ATOM   3027 C CD2 . TYR A 1 469  ? -8.372  5.184   5.308   1.00 94.76  ? 485  TYR A CD2 1 
ATOM   3028 C CE1 . TYR A 1 469  ? -8.852  2.809   6.640   1.00 95.31  ? 485  TYR A CE1 1 
ATOM   3029 C CE2 . TYR A 1 469  ? -8.930  5.203   6.584   1.00 95.28  ? 485  TYR A CE2 1 
ATOM   3030 C CZ  . TYR A 1 469  ? -9.157  4.013   7.250   1.00 100.59 ? 485  TYR A CZ  1 
ATOM   3031 O OH  . TYR A 1 469  ? -9.682  4.030   8.514   1.00 101.88 ? 485  TYR A OH  1 
ATOM   3032 N N   . PRO A 1 470  ? -10.673 5.086   2.654   1.00 91.78  ? 486  PRO A N   1 
ATOM   3033 C CA  . PRO A 1 470  ? -11.537 6.275   2.484   1.00 90.79  ? 486  PRO A CA  1 
ATOM   3034 C C   . PRO A 1 470  ? -10.904 7.603   2.874   1.00 92.21  ? 486  PRO A C   1 
ATOM   3035 O O   . PRO A 1 470  ? -9.968  7.637   3.668   1.00 91.84  ? 486  PRO A O   1 
ATOM   3036 C CB  . PRO A 1 470  ? -12.765 5.966   3.350   1.00 92.40  ? 486  PRO A CB  1 
ATOM   3037 C CG  . PRO A 1 470  ? -12.343 4.861   4.252   1.00 97.06  ? 486  PRO A CG  1 
ATOM   3038 C CD  . PRO A 1 470  ? -11.345 4.063   3.479   1.00 92.78  ? 486  PRO A CD  1 
ATOM   3039 N N   . ALA A 1 471  ? -11.398 8.684   2.271   1.00 87.22  ? 487  ALA A N   1 
ATOM   3040 C CA  . ALA A 1 471  ? -10.970 10.052  2.543   1.00 86.85  ? 487  ALA A CA  1 
ATOM   3041 C C   . ALA A 1 471  ? -11.613 10.471  3.877   1.00 91.93  ? 487  ALA A C   1 
ATOM   3042 O O   . ALA A 1 471  ? -12.604 9.843   4.278   1.00 91.13  ? 487  ALA A O   1 
ATOM   3043 C CB  . ALA A 1 471  ? -11.437 10.974  1.423   1.00 87.26  ? 487  ALA A CB  1 
ATOM   3044 N N   . LEU A 1 472  ? -11.062 11.521  4.560   1.00 89.16  ? 488  LEU A N   1 
ATOM   3045 C CA  . LEU A 1 472  ? -11.581 12.015  5.845   1.00 89.49  ? 488  LEU A CA  1 
ATOM   3046 C C   . LEU A 1 472  ? -13.103 12.278  5.808   1.00 96.92  ? 488  LEU A C   1 
ATOM   3047 O O   . LEU A 1 472  ? -13.794 11.967  6.788   1.00 97.03  ? 488  LEU A O   1 
ATOM   3048 C CB  . LEU A 1 472  ? -10.815 13.259  6.329   1.00 88.94  ? 488  LEU A CB  1 
ATOM   3049 C CG  . LEU A 1 472  ? -11.130 13.732  7.754   1.00 92.82  ? 488  LEU A CG  1 
ATOM   3050 N N   . GLU A 1 473  ? -13.618 12.805  4.665   1.00 94.55  ? 489  GLU A N   1 
ATOM   3051 C CA  . GLU A 1 473  ? -15.036 13.133  4.463   1.00 94.72  ? 489  GLU A CA  1 
ATOM   3052 C C   . GLU A 1 473  ? -15.940 11.902  4.496   1.00 97.48  ? 489  GLU A C   1 
ATOM   3053 O O   . GLU A 1 473  ? -17.010 11.948  5.111   1.00 96.37  ? 489  GLU A O   1 
ATOM   3054 C CB  . GLU A 1 473  ? -15.244 13.953  3.179   1.00 96.44  ? 489  GLU A CB  1 
ATOM   3055 C CG  . GLU A 1 473  ? -14.665 15.361  3.249   1.00 108.76 ? 489  GLU A CG  1 
ATOM   3056 N N   . LYS A 1 474  ? -15.484 10.796  3.880   1.00 94.03  ? 490  LYS A N   1 
ATOM   3057 C CA  . LYS A 1 474  ? -16.207 9.524   3.835   1.00 94.21  ? 490  LYS A CA  1 
ATOM   3058 C C   . LYS A 1 474  ? -16.058 8.752   5.152   1.00 99.97  ? 490  LYS A C   1 
ATOM   3059 O O   . LYS A 1 474  ? -16.830 7.818   5.407   1.00 100.27 ? 490  LYS A O   1 
ATOM   3060 C CB  . LYS A 1 474  ? -15.757 8.681   2.627   1.00 96.58  ? 490  LYS A CB  1 
ATOM   3061 N N   . ILE A 1 475  ? -15.067 9.153   5.988   1.00 96.94  ? 491  ILE A N   1 
ATOM   3062 C CA  . ILE A 1 475  ? -14.783 8.584   7.312   1.00 96.68  ? 491  ILE A CA  1 
ATOM   3063 C C   . ILE A 1 475  ? -15.687 9.289   8.331   1.00 102.31 ? 491  ILE A C   1 
ATOM   3064 O O   . ILE A 1 475  ? -16.387 8.623   9.101   1.00 102.47 ? 491  ILE A O   1 
ATOM   3065 C CB  . ILE A 1 475  ? -13.263 8.695   7.666   1.00 99.34  ? 491  ILE A CB  1 
ATOM   3066 C CG1 . ILE A 1 475  ? -12.417 7.705   6.840   1.00 99.69  ? 491  ILE A CG1 1 
ATOM   3067 C CG2 . ILE A 1 475  ? -12.997 8.494   9.161   1.00 99.71  ? 491  ILE A CG2 1 
ATOM   3068 N N   . LEU A 1 476  ? -15.686 10.634  8.311   1.00 99.56  ? 492  LEU A N   1 
ATOM   3069 C CA  . LEU A 1 476  ? -16.488 11.472  9.198   1.00 100.13 ? 492  LEU A CA  1 
ATOM   3070 C C   . LEU A 1 476  ? -18.005 11.351  8.932   1.00 106.22 ? 492  LEU A C   1 
ATOM   3071 O O   . LEU A 1 476  ? -18.800 11.688  9.818   1.00 106.62 ? 492  LEU A O   1 
ATOM   3072 C CB  . LEU A 1 476  ? -16.029 12.932  9.114   1.00 100.10 ? 492  LEU A CB  1 
ATOM   3073 C CG  . LEU A 1 476  ? -14.738 13.240  9.842   1.00 104.73 ? 492  LEU A CG  1 
ATOM   3074 N N   . GLU A 1 477  ? -18.399 10.863  7.720   1.00 102.75 ? 493  GLU A N   1 
ATOM   3075 C CA  . GLU A 1 477  ? -19.797 10.657  7.299   1.00 102.03 ? 493  GLU A CA  1 
ATOM   3076 C C   . GLU A 1 477  ? -20.374 9.477   8.088   1.00 103.51 ? 493  GLU A C   1 
ATOM   3077 O O   . GLU A 1 477  ? -21.294 9.651   8.888   1.00 102.72 ? 493  GLU A O   1 
ATOM   3078 C CB  . GLU A 1 477  ? -19.879 10.415  5.770   1.00 103.39 ? 493  GLU A CB  1 
ATOM   3079 C CG  . GLU A 1 477  ? -21.237 10.716  5.157   1.00 113.52 ? 493  GLU A CG  1 
ATOM   3080 N N   . LEU A 1 478  ? -19.767 8.299   7.907   1.00 99.15  ? 494  LEU A N   1 
ATOM   3081 C CA  . LEU A 1 478  ? -20.087 7.056   8.597   1.00 98.83  ? 494  LEU A CA  1 
ATOM   3082 C C   . LEU A 1 478  ? -19.898 7.213   10.127  1.00 104.02 ? 494  LEU A C   1 
ATOM   3083 O O   . LEU A 1 478  ? -20.633 6.602   10.893  1.00 103.97 ? 494  LEU A O   1 
ATOM   3084 C CB  . LEU A 1 478  ? -19.174 5.943   8.025   1.00 98.56  ? 494  LEU A CB  1 
ATOM   3085 C CG  . LEU A 1 478  ? -19.132 4.586   8.728   1.00 102.82 ? 494  LEU A CG  1 
ATOM   3086 C CD1 . LEU A 1 478  ? -20.469 3.870   8.667   1.00 103.08 ? 494  LEU A CD1 1 
ATOM   3087 C CD2 . LEU A 1 478  ? -18.089 3.712   8.128   1.00 104.41 ? 494  LEU A CD2 1 
ATOM   3088 N N   . GLY A 1 479  ? -18.939 8.048   10.528  1.00 101.48 ? 495  GLY A N   1 
ATOM   3089 C CA  . GLY A 1 479  ? -18.591 8.327   11.914  1.00 102.10 ? 495  GLY A CA  1 
ATOM   3090 C C   . GLY A 1 479  ? -19.660 8.964   12.777  1.00 108.45 ? 495  GLY A C   1 
ATOM   3091 O O   . GLY A 1 479  ? -19.722 8.667   13.976  1.00 106.80 ? 495  GLY A O   1 
ATOM   3092 N N   . ARG A 1 480  ? -20.498 9.856   12.187  1.00 108.81 ? 496  ARG A N   1 
ATOM   3093 C CA  . ARG A 1 480  ? -21.580 10.562  12.903  1.00 110.41 ? 496  ARG A CA  1 
ATOM   3094 C C   . ARG A 1 480  ? -22.533 9.587   13.617  1.00 117.90 ? 496  ARG A C   1 
ATOM   3095 O O   . ARG A 1 480  ? -23.077 8.672   12.978  1.00 117.67 ? 496  ARG A O   1 
ATOM   3096 C CB  . ARG A 1 480  ? -22.418 11.449  11.961  1.00 112.19 ? 496  ARG A CB  1 
ATOM   3097 C CG  . ARG A 1 480  ? -21.701 12.587  11.235  1.00 125.37 ? 496  ARG A CG  1 
ATOM   3098 C CD  . ARG A 1 480  ? -22.663 13.374  10.337  1.00 136.25 ? 496  ARG A CD  1 
ATOM   3099 N NE  . ARG A 1 480  ? -23.495 12.509  9.483   1.00 142.09 ? 496  ARG A NE  1 
ATOM   3100 C CZ  . ARG A 1 480  ? -23.331 12.337  8.171   1.00 148.73 ? 496  ARG A CZ  1 
ATOM   3101 N NH1 . ARG A 1 480  ? -22.375 12.992  7.522   1.00 125.32 ? 496  ARG A NH1 1 
ATOM   3102 N NH2 . ARG A 1 480  ? -24.132 11.521  7.498   1.00 134.85 ? 496  ARG A NH2 1 
ATOM   3103 N N   . HIS A 1 481  ? -22.740 9.810   14.943  1.00 116.43 ? 497  HIS A N   1 
ATOM   3104 C CA  . HIS A 1 481  ? -23.633 9.045   15.834  1.00 161.92 ? 497  HIS A CA  1 
ATOM   3105 C C   . HIS A 1 481  ? -23.318 7.531   15.878  1.00 159.89 ? 497  HIS A C   1 
ATOM   3106 O O   . HIS A 1 481  ? -23.601 6.783   14.938  1.00 109.88 ? 497  HIS A O   1 
ATOM   3107 C CB  . HIS A 1 481  ? -25.124 9.305   15.497  1.00 163.06 ? 497  HIS A CB  1 
ATOM   3108 C CG  . HIS A 1 481  ? -25.479 10.757  15.338  1.00 166.65 ? 497  HIS A CG  1 
ATOM   3109 N ND1 . HIS A 1 481  ? -25.109 11.474  14.210  1.00 168.46 ? 497  HIS A ND1 1 
ATOM   3110 C CD2 . HIS A 1 481  ? -26.180 11.572  16.161  1.00 168.54 ? 497  HIS A CD2 1 
ATOM   3111 C CE1 . HIS A 1 481  ? -25.575 12.699  14.392  1.00 167.95 ? 497  HIS A CE1 1 
ATOM   3112 N NE2 . HIS A 1 481  ? -26.229 12.806  15.550  1.00 168.30 ? 497  HIS A NE2 1 
ATOM   3113 N N   . THR A 1 488  ? -25.810 6.771   31.513  1.00 127.13 ? 504  THR A N   1 
ATOM   3114 C CA  . THR A 1 488  ? -26.682 6.801   32.694  1.00 127.25 ? 504  THR A CA  1 
ATOM   3115 C C   . THR A 1 488  ? -25.893 7.119   33.989  1.00 131.90 ? 504  THR A C   1 
ATOM   3116 O O   . THR A 1 488  ? -24.697 6.831   34.056  1.00 132.28 ? 504  THR A O   1 
ATOM   3117 C CB  . THR A 1 488  ? -27.538 5.515   32.804  1.00 133.32 ? 504  THR A CB  1 
ATOM   3118 O OG1 . THR A 1 488  ? -26.822 4.473   33.479  1.00 130.36 ? 504  THR A OG1 1 
ATOM   3119 C CG2 . THR A 1 488  ? -28.086 5.038   31.453  1.00 130.92 ? 504  THR A CG2 1 
ATOM   3120 N N   . GLU A 1 489  ? -26.568 7.702   35.011  1.00 127.70 ? 505  GLU A N   1 
ATOM   3121 C CA  . GLU A 1 489  ? -25.977 8.119   36.300  1.00 127.24 ? 505  GLU A CA  1 
ATOM   3122 C C   . GLU A 1 489  ? -25.231 6.985   37.065  1.00 129.40 ? 505  GLU A C   1 
ATOM   3123 O O   . GLU A 1 489  ? -24.278 7.277   37.799  1.00 128.51 ? 505  GLU A O   1 
ATOM   3124 C CB  . GLU A 1 489  ? -27.046 8.795   37.193  1.00 128.69 ? 505  GLU A CB  1 
ATOM   3125 C CG  . GLU A 1 489  ? -26.502 9.641   38.342  1.00 139.15 ? 505  GLU A CG  1 
ATOM   3126 C CD  . GLU A 1 489  ? -25.557 10.778  37.989  1.00 154.67 ? 505  GLU A CD  1 
ATOM   3127 O OE1 . GLU A 1 489  ? -26.019 11.781  37.397  1.00 131.87 ? 505  GLU A OE1 1 
ATOM   3128 O OE2 . GLU A 1 489  ? -24.360 10.682  38.345  1.00 151.12 ? 505  GLU A OE2 1 
ATOM   3129 N N   . GLU A 1 490  ? -25.648 5.710   36.873  1.00 124.66 ? 506  GLU A N   1 
ATOM   3130 C CA  . GLU A 1 490  ? -25.023 4.537   37.498  1.00 123.62 ? 506  GLU A CA  1 
ATOM   3131 C C   . GLU A 1 490  ? -23.633 4.293   36.882  1.00 126.35 ? 506  GLU A C   1 
ATOM   3132 O O   . GLU A 1 490  ? -22.648 4.159   37.614  1.00 125.85 ? 506  GLU A O   1 
ATOM   3133 C CB  . GLU A 1 490  ? -25.927 3.296   37.339  1.00 124.66 ? 506  GLU A CB  1 
ATOM   3134 C CG  . GLU A 1 490  ? -25.397 2.043   38.010  1.00 132.47 ? 506  GLU A CG  1 
ATOM   3135 N N   . GLU A 1 491  ? -23.568 4.256   35.535  1.00 121.52 ? 507  GLU A N   1 
ATOM   3136 C CA  . GLU A 1 491  ? -22.341 4.037   34.767  1.00 120.35 ? 507  GLU A CA  1 
ATOM   3137 C C   . GLU A 1 491  ? -21.430 5.292   34.706  1.00 122.24 ? 507  GLU A C   1 
ATOM   3138 O O   . GLU A 1 491  ? -20.229 5.155   34.457  1.00 121.48 ? 507  GLU A O   1 
ATOM   3139 C CB  . GLU A 1 491  ? -22.653 3.465   33.372  1.00 121.49 ? 507  GLU A CB  1 
ATOM   3140 C CG  . GLU A 1 491  ? -23.682 4.251   32.577  1.00 130.62 ? 507  GLU A CG  1 
ATOM   3141 C CD  . GLU A 1 491  ? -24.437 3.515   31.488  1.00 153.16 ? 507  GLU A CD  1 
ATOM   3142 O OE1 . GLU A 1 491  ? -24.520 2.266   31.549  1.00 146.71 ? 507  GLU A OE1 1 
ATOM   3143 O OE2 . GLU A 1 491  ? -24.986 4.197   30.591  1.00 147.47 ? 507  GLU A OE2 1 
ATOM   3144 N N   . GLN A 1 492  ? -21.993 6.497   34.979  1.00 117.28 ? 508  GLN A N   1 
ATOM   3145 C CA  . GLN A 1 492  ? -21.260 7.770   35.015  1.00 116.13 ? 508  GLN A CA  1 
ATOM   3146 C C   . GLN A 1 492  ? -20.274 7.795   36.184  1.00 118.03 ? 508  GLN A C   1 
ATOM   3147 O O   . GLN A 1 492  ? -19.222 8.426   36.084  1.00 117.98 ? 508  GLN A O   1 
ATOM   3148 C CB  . GLN A 1 492  ? -22.218 8.967   35.050  1.00 117.37 ? 508  GLN A CB  1 
ATOM   3149 C CG  . GLN A 1 492  ? -22.561 9.479   33.651  1.00 133.80 ? 508  GLN A CG  1 
ATOM   3150 C CD  . GLN A 1 492  ? -23.976 10.012  33.495  1.00 151.80 ? 508  GLN A CD  1 
ATOM   3151 O OE1 . GLN A 1 492  ? -24.506 10.742  34.347  1.00 146.11 ? 508  GLN A OE1 1 
ATOM   3152 N NE2 . GLN A 1 492  ? -24.600 9.701   32.362  1.00 140.75 ? 508  GLN A NE2 1 
ATOM   3153 N N   . LEU A 1 493  ? -20.602 7.072   37.268  1.00 112.72 ? 509  LEU A N   1 
ATOM   3154 C CA  . LEU A 1 493  ? -19.734 6.878   38.429  1.00 111.86 ? 509  LEU A CA  1 
ATOM   3155 C C   . LEU A 1 493  ? -18.683 5.814   38.013  1.00 114.56 ? 509  LEU A C   1 
ATOM   3156 O O   . LEU A 1 493  ? -17.480 6.000   38.248  1.00 113.43 ? 509  LEU A O   1 
ATOM   3157 C CB  . LEU A 1 493  ? -20.569 6.376   39.631  1.00 111.62 ? 509  LEU A CB  1 
ATOM   3158 C CG  . LEU A 1 493  ? -19.834 6.227   40.961  1.00 115.89 ? 509  LEU A CG  1 
ATOM   3159 N N   . GLN A 1 494  ? -19.163 4.729   37.332  1.00 110.18 ? 510  GLN A N   1 
ATOM   3160 C CA  . GLN A 1 494  ? -18.390 3.579   36.833  1.00 109.20 ? 510  GLN A CA  1 
ATOM   3161 C C   . GLN A 1 494  ? -17.353 3.953   35.763  1.00 111.03 ? 510  GLN A C   1 
ATOM   3162 O O   . GLN A 1 494  ? -16.523 3.113   35.406  1.00 110.59 ? 510  GLN A O   1 
ATOM   3163 C CB  . GLN A 1 494  ? -19.330 2.458   36.340  1.00 110.47 ? 510  GLN A CB  1 
ATOM   3164 C CG  . GLN A 1 494  ? -18.885 1.047   36.738  1.00 119.90 ? 510  GLN A CG  1 
ATOM   3165 C CD  . GLN A 1 494  ? -19.982 0.017   36.556  1.00 130.08 ? 510  GLN A CD  1 
ATOM   3166 O OE1 . GLN A 1 494  ? -20.557 -0.499  37.530  1.00 124.35 ? 510  GLN A OE1 1 
ATOM   3167 N NE2 . GLN A 1 494  ? -20.280 -0.329  35.306  1.00 114.31 ? 510  GLN A NE2 1 
ATOM   3168 N N   . LEU A 1 495  ? -17.410 5.208   35.255  1.00 105.46 ? 511  LEU A N   1 
ATOM   3169 C CA  . LEU A 1 495  ? -16.453 5.770   34.300  1.00 103.79 ? 511  LEU A CA  1 
ATOM   3170 C C   . LEU A 1 495  ? -15.443 6.620   35.073  1.00 106.02 ? 511  LEU A C   1 
ATOM   3171 O O   . LEU A 1 495  ? -14.257 6.628   34.734  1.00 104.70 ? 511  LEU A O   1 
ATOM   3172 C CB  . LEU A 1 495  ? -17.147 6.606   33.214  1.00 103.26 ? 511  LEU A CB  1 
ATOM   3173 C CG  . LEU A 1 495  ? -16.257 7.077   32.054  1.00 106.93 ? 511  LEU A CG  1 
ATOM   3174 C CD1 . LEU A 1 495  ? -16.043 5.972   31.024  1.00 106.81 ? 511  LEU A CD1 1 
ATOM   3175 C CD2 . LEU A 1 495  ? -16.845 8.282   31.393  1.00 108.81 ? 511  LEU A CD2 1 
ATOM   3176 N N   . ARG A 1 496  ? -15.912 7.322   36.121  1.00 102.30 ? 512  ARG A N   1 
ATOM   3177 C CA  . ARG A 1 496  ? -15.038 8.127   36.971  1.00 101.87 ? 512  ARG A CA  1 
ATOM   3178 C C   . ARG A 1 496  ? -14.073 7.202   37.711  1.00 104.63 ? 512  ARG A C   1 
ATOM   3179 O O   . ARG A 1 496  ? -12.872 7.466   37.693  1.00 103.33 ? 512  ARG A O   1 
ATOM   3180 C CB  . ARG A 1 496  ? -15.847 8.977   37.958  1.00 101.60 ? 512  ARG A CB  1 
ATOM   3181 C CG  . ARG A 1 496  ? -16.462 10.219  37.333  1.00 108.43 ? 512  ARG A CG  1 
ATOM   3182 C CD  . ARG A 1 496  ? -16.592 11.354  38.327  1.00 115.42 ? 512  ARG A CD  1 
ATOM   3183 N NE  . ARG A 1 496  ? -15.292 11.814  38.821  1.00 120.21 ? 512  ARG A NE  1 
ATOM   3184 C CZ  . ARG A 1 496  ? -14.600 12.818  38.295  1.00 135.22 ? 512  ARG A CZ  1 
ATOM   3185 N NH1 . ARG A 1 496  ? -15.078 13.490  37.252  1.00 116.55 ? 512  ARG A NH1 1 
ATOM   3186 N NH2 . ARG A 1 496  ? -13.426 13.162  38.808  1.00 127.66 ? 512  ARG A NH2 1 
ATOM   3187 N N   . GLU A 1 497  ? -14.593 6.074   38.275  1.00 101.37 ? 513  GLU A N   1 
ATOM   3188 C CA  . GLU A 1 497  ? -13.799 5.073   38.999  1.00 101.35 ? 513  GLU A CA  1 
ATOM   3189 C C   . GLU A 1 497  ? -12.711 4.429   38.107  1.00 105.02 ? 513  GLU A C   1 
ATOM   3190 O O   . GLU A 1 497  ? -11.586 4.238   38.577  1.00 105.84 ? 513  GLU A O   1 
ATOM   3191 C CB  . GLU A 1 497  ? -14.685 4.022   39.714  1.00 102.82 ? 513  GLU A CB  1 
ATOM   3192 C CG  . GLU A 1 497  ? -15.312 2.950   38.834  1.00 113.84 ? 513  GLU A CG  1 
ATOM   3193 N N   . ILE A 1 498  ? -13.027 4.162   36.820  1.00 99.95  ? 514  ILE A N   1 
ATOM   3194 C CA  . ILE A 1 498  ? -12.080 3.598   35.851  1.00 98.88  ? 514  ILE A CA  1 
ATOM   3195 C C   . ILE A 1 498  ? -11.067 4.679   35.422  1.00 102.84 ? 514  ILE A C   1 
ATOM   3196 O O   . ILE A 1 498  ? -9.863  4.433   35.501  1.00 102.15 ? 514  ILE A O   1 
ATOM   3197 C CB  . ILE A 1 498  ? -12.782 2.873   34.658  1.00 101.32 ? 514  ILE A CB  1 
ATOM   3198 C CG1 . ILE A 1 498  ? -13.683 1.719   35.152  1.00 101.24 ? 514  ILE A CG1 1 
ATOM   3199 C CG2 . ILE A 1 498  ? -11.765 2.342   33.634  1.00 101.50 ? 514  ILE A CG2 1 
ATOM   3200 N N   . LEU A 1 499  ? -11.546 5.887   35.028  1.00 99.87  ? 515  LEU A N   1 
ATOM   3201 C CA  . LEU A 1 499  ? -10.668 7.009   34.640  1.00 99.36  ? 515  LEU A CA  1 
ATOM   3202 C C   . LEU A 1 499  ? -10.158 7.777   35.889  1.00 104.81 ? 515  LEU A C   1 
ATOM   3203 O O   . LEU A 1 499  ? -10.385 8.990   36.029  1.00 103.85 ? 515  LEU A O   1 
ATOM   3204 C CB  . LEU A 1 499  ? -11.318 7.946   33.578  1.00 98.52  ? 515  LEU A CB  1 
ATOM   3205 C CG  . LEU A 1 499  ? -11.892 7.290   32.303  1.00 101.10 ? 515  LEU A CG  1 
ATOM   3206 C CD1 . LEU A 1 499  ? -12.598 8.288   31.458  1.00 100.59 ? 515  LEU A CD1 1 
ATOM   3207 C CD2 . LEU A 1 499  ? -10.830 6.627   31.474  1.00 100.88 ? 515  LEU A CD2 1 
ATOM   3208 N N   . GLU A 1 500  ? -9.486  7.010   36.806  1.00 102.22 ? 516  GLU A N   1 
ATOM   3209 C CA  . GLU A 1 500  ? -8.854  7.414   38.073  1.00 125.06 ? 516  GLU A CA  1 
ATOM   3210 C C   . GLU A 1 500  ? -7.848  6.368   38.607  1.00 140.53 ? 516  GLU A C   1 
ATOM   3211 O O   . GLU A 1 500  ? -8.072  5.155   38.545  1.00 92.97  ? 516  GLU A O   1 
ATOM   3212 C CB  . GLU A 1 500  ? -9.893  7.762   39.142  1.00 126.33 ? 516  GLU A CB  1 
ATOM   3213 C CG  . GLU A 1 500  ? -10.004 9.258   39.378  1.00 136.62 ? 516  GLU A CG  1 
ATOM   3214 C CD  . GLU A 1 500  ? -11.416 9.811   39.369  1.00 156.83 ? 516  GLU A CD  1 
ATOM   3215 O OE1 . GLU A 1 500  ? -12.220 9.412   40.243  1.00 147.29 ? 516  GLU A OE1 1 
ATOM   3216 O OE2 . GLU A 1 500  ? -11.712 10.663  38.500  1.00 150.68 ? 516  GLU A OE2 1 
ATOM   3217 N N   . GLY A 1 505  ? -3.901  2.484   33.209  1.00 135.27 ? 521  GLY A N   1 
ATOM   3218 C CA  . GLY A 1 505  ? -2.960  2.066   32.176  1.00 134.99 ? 521  GLY A CA  1 
ATOM   3219 C C   . GLY A 1 505  ? -3.413  0.849   31.392  1.00 138.35 ? 521  GLY A C   1 
ATOM   3220 O O   . GLY A 1 505  ? -3.451  0.878   30.156  1.00 137.62 ? 521  GLY A O   1 
ATOM   3221 N N   . GLU A 1 506  ? -3.740  -0.239  32.121  1.00 134.48 ? 522  GLU A N   1 
ATOM   3222 C CA  . GLU A 1 506  ? -4.241  -1.498  31.566  1.00 133.82 ? 522  GLU A CA  1 
ATOM   3223 C C   . GLU A 1 506  ? -5.698  -1.716  32.042  1.00 135.56 ? 522  GLU A C   1 
ATOM   3224 O O   . GLU A 1 506  ? -5.930  -2.252  33.137  1.00 134.75 ? 522  GLU A O   1 
ATOM   3225 C CB  . GLU A 1 506  ? -3.318  -2.686  31.940  1.00 135.34 ? 522  GLU A CB  1 
ATOM   3226 C CG  . GLU A 1 506  ? -3.528  -3.930  31.083  1.00 146.15 ? 522  GLU A CG  1 
ATOM   3227 C CD  . GLU A 1 506  ? -3.623  -5.256  31.820  1.00 160.81 ? 522  GLU A CD  1 
ATOM   3228 O OE1 . GLU A 1 506  ? -2.616  -5.675  32.437  1.00 153.52 ? 522  GLU A OE1 1 
ATOM   3229 O OE2 . GLU A 1 506  ? -4.690  -5.906  31.729  1.00 147.43 ? 522  GLU A OE2 1 
ATOM   3230 N N   . LEU A 1 507  ? -6.671  -1.242  31.226  1.00 130.67 ? 523  LEU A N   1 
ATOM   3231 C CA  . LEU A 1 507  ? -8.113  -1.367  31.490  1.00 129.36 ? 523  LEU A CA  1 
ATOM   3232 C C   . LEU A 1 507  ? -8.582  -2.784  31.151  1.00 131.78 ? 523  LEU A C   1 
ATOM   3233 O O   . LEU A 1 507  ? -8.157  -3.355  30.140  1.00 131.44 ? 523  LEU A O   1 
ATOM   3234 C CB  . LEU A 1 507  ? -8.930  -0.317  30.712  1.00 128.97 ? 523  LEU A CB  1 
ATOM   3235 C CG  . LEU A 1 507  ? -8.971  1.072   31.326  1.00 133.08 ? 523  LEU A CG  1 
ATOM   3236 N N   . TYR A 1 508  ? -9.429  -3.357  32.021  1.00 126.75 ? 524  TYR A N   1 
ATOM   3237 C CA  . TYR A 1 508  ? -9.966  -4.715  31.881  1.00 125.63 ? 524  TYR A CA  1 
ATOM   3238 C C   . TYR A 1 508  ? -11.122 -4.713  30.883  1.00 124.91 ? 524  TYR A C   1 
ATOM   3239 O O   . TYR A 1 508  ? -11.798 -3.697  30.763  1.00 124.39 ? 524  TYR A O   1 
ATOM   3240 C CB  . TYR A 1 508  ? -10.323 -5.295  33.265  1.00 127.63 ? 524  TYR A CB  1 
ATOM   3241 C CG  . TYR A 1 508  ? -9.114  -5.389  34.183  1.00 130.09 ? 524  TYR A CG  1 
ATOM   3242 C CD1 . TYR A 1 508  ? -8.686  -4.289  34.921  1.00 132.25 ? 524  TYR A CD1 1 
ATOM   3243 C CD2 . TYR A 1 508  ? -8.356  -6.556  34.254  1.00 130.95 ? 524  TYR A CD2 1 
ATOM   3244 C CE1 . TYR A 1 508  ? -7.545  -4.351  35.720  1.00 133.77 ? 524  TYR A CE1 1 
ATOM   3245 C CE2 . TYR A 1 508  ? -7.218  -6.633  35.058  1.00 131.93 ? 524  TYR A CE2 1 
ATOM   3246 C CZ  . TYR A 1 508  ? -6.818  -5.528  35.794  1.00 138.92 ? 524  TYR A CZ  1 
ATOM   3247 O OH  . TYR A 1 508  ? -5.698  -5.591  36.593  1.00 137.17 ? 524  TYR A OH  1 
ATOM   3248 N N   . GLU A 1 509  ? -11.300 -5.808  30.114  1.00 118.43 ? 525  GLU A N   1 
ATOM   3249 C CA  . GLU A 1 509  ? -12.287 -5.906  29.020  1.00 117.02 ? 525  GLU A CA  1 
ATOM   3250 C C   . GLU A 1 509  ? -13.726 -5.504  29.396  1.00 118.39 ? 525  GLU A C   1 
ATOM   3251 O O   . GLU A 1 509  ? -14.434 -4.977  28.534  1.00 117.61 ? 525  GLU A O   1 
ATOM   3252 C CB  . GLU A 1 509  ? -12.280 -7.284  28.341  1.00 118.30 ? 525  GLU A CB  1 
ATOM   3253 C CG  . GLU A 1 509  ? -10.912 -7.761  27.861  1.00 127.94 ? 525  GLU A CG  1 
ATOM   3254 C CD  . GLU A 1 509  ? -10.156 -6.884  26.880  1.00 136.58 ? 525  GLU A CD  1 
ATOM   3255 O OE1 . GLU A 1 509  ? -10.622 -6.742  25.726  1.00 119.07 ? 525  GLU A OE1 1 
ATOM   3256 O OE2 . GLU A 1 509  ? -9.064  -6.391  27.247  1.00 125.07 ? 525  GLU A OE2 1 
ATOM   3257 N N   . HIS A 1 510  ? -14.143 -5.702  30.660  1.00 113.40 ? 526  HIS A N   1 
ATOM   3258 C CA  . HIS A 1 510  ? -15.477 -5.274  31.092  1.00 112.94 ? 526  HIS A CA  1 
ATOM   3259 C C   . HIS A 1 510  ? -15.522 -3.737  31.202  1.00 112.83 ? 526  HIS A C   1 
ATOM   3260 O O   . HIS A 1 510  ? -16.518 -3.115  30.809  1.00 111.99 ? 526  HIS A O   1 
ATOM   3261 C CB  . HIS A 1 510  ? -15.932 -5.994  32.394  1.00 114.43 ? 526  HIS A CB  1 
ATOM   3262 C CG  . HIS A 1 510  ? -15.154 -5.652  33.637  1.00 118.41 ? 526  HIS A CG  1 
ATOM   3263 N ND1 . HIS A 1 510  ? -13.804 -5.986  33.773  1.00 120.43 ? 526  HIS A ND1 1 
ATOM   3264 C CD2 . HIS A 1 510  ? -15.575 -5.069  34.786  1.00 120.40 ? 526  HIS A CD2 1 
ATOM   3265 C CE1 . HIS A 1 510  ? -13.448 -5.561  34.979  1.00 119.86 ? 526  HIS A CE1 1 
ATOM   3266 N NE2 . HIS A 1 510  ? -14.478 -5.004  35.627  1.00 120.20 ? 526  HIS A NE2 1 
ATOM   3267 N N   . GLU A 1 511  ? -14.403 -3.144  31.680  1.00 106.79 ? 527  GLU A N   1 
ATOM   3268 C CA  . GLU A 1 511  ? -14.191 -1.703  31.857  1.00 105.80 ? 527  GLU A CA  1 
ATOM   3269 C C   . GLU A 1 511  ? -14.033 -1.028  30.498  1.00 107.22 ? 527  GLU A C   1 
ATOM   3270 O O   . GLU A 1 511  ? -14.498 0.099   30.330  1.00 106.65 ? 527  GLU A O   1 
ATOM   3271 C CB  . GLU A 1 511  ? -12.948 -1.417  32.733  1.00 107.15 ? 527  GLU A CB  1 
ATOM   3272 C CG  . GLU A 1 511  ? -12.991 -2.006  34.139  1.00 116.43 ? 527  GLU A CG  1 
ATOM   3273 C CD  . GLU A 1 511  ? -11.818 -1.658  35.039  1.00 136.50 ? 527  GLU A CD  1 
ATOM   3274 O OE1 . GLU A 1 511  ? -10.658 -1.747  34.576  1.00 137.26 ? 527  GLU A OE1 1 
ATOM   3275 O OE2 . GLU A 1 511  ? -12.059 -1.319  36.221  1.00 123.40 ? 527  GLU A OE2 1 
ATOM   3276 N N   . LYS A 1 512  ? -13.390 -1.727  29.532  1.00 102.33 ? 528  LYS A N   1 
ATOM   3277 C CA  . LYS A 1 512  ? -13.149 -1.274  28.152  1.00 101.47 ? 528  LYS A CA  1 
ATOM   3278 C C   . LYS A 1 512  ? -14.455 -0.902  27.438  1.00 105.30 ? 528  LYS A C   1 
ATOM   3279 O O   . LYS A 1 512  ? -14.579 0.216   26.929  1.00 104.72 ? 528  LYS A O   1 
ATOM   3280 C CB  . LYS A 1 512  ? -12.402 -2.352  27.341  1.00 102.86 ? 528  LYS A CB  1 
ATOM   3281 C CG  . LYS A 1 512  ? -10.896 -2.365  27.526  1.00 105.86 ? 528  LYS A CG  1 
ATOM   3282 C CD  . LYS A 1 512  ? -10.232 -3.086  26.371  1.00 113.99 ? 528  LYS A CD  1 
ATOM   3283 C CE  . LYS A 1 512  ? -8.731  -3.085  26.489  1.00 134.62 ? 528  LYS A CE  1 
ATOM   3284 N NZ  . LYS A 1 512  ? -8.077  -3.696  25.298  1.00 149.45 ? 528  LYS A NZ  1 
ATOM   3285 N N   . ASP A 1 513  ? -15.436 -1.833  27.425  1.00 101.79 ? 529  ASP A N   1 
ATOM   3286 C CA  . ASP A 1 513  ? -16.746 -1.637  26.796  1.00 101.29 ? 529  ASP A CA  1 
ATOM   3287 C C   . ASP A 1 513  ? -17.526 -0.502  27.453  1.00 102.52 ? 529  ASP A C   1 
ATOM   3288 O O   . ASP A 1 513  ? -18.296 0.168   26.770  1.00 101.93 ? 529  ASP A O   1 
ATOM   3289 C CB  . ASP A 1 513  ? -17.565 -2.934  26.814  1.00 103.99 ? 529  ASP A CB  1 
ATOM   3290 C CG  . ASP A 1 513  ? -16.822 -4.178  26.347  1.00 121.02 ? 529  ASP A CG  1 
ATOM   3291 O OD1 . ASP A 1 513  ? -16.277 -4.159  25.214  1.00 122.85 ? 529  ASP A OD1 1 
ATOM   3292 O OD2 . ASP A 1 513  ? -16.850 -5.197  27.080  1.00 127.52 ? 529  ASP A OD2 1 
ATOM   3293 N N   . LEU A 1 514  ? -17.317 -0.274  28.771  1.00 97.51  ? 530  LEU A N   1 
ATOM   3294 C CA  . LEU A 1 514  ? -17.978 0.807   29.504  1.00 96.44  ? 530  LEU A CA  1 
ATOM   3295 C C   . LEU A 1 514  ? -17.451 2.131   28.998  1.00 98.78  ? 530  LEU A C   1 
ATOM   3296 O O   . LEU A 1 514  ? -18.234 3.053   28.793  1.00 97.85  ? 530  LEU A O   1 
ATOM   3297 C CB  . LEU A 1 514  ? -17.786 0.678   31.029  1.00 96.11  ? 530  LEU A CB  1 
ATOM   3298 C CG  . LEU A 1 514  ? -18.636 1.622   31.888  1.00 100.15 ? 530  LEU A CG  1 
ATOM   3299 N N   . VAL A 1 515  ? -16.129 2.206   28.760  1.00 95.20  ? 531  VAL A N   1 
ATOM   3300 C CA  . VAL A 1 515  ? -15.471 3.405   28.235  1.00 94.86  ? 531  VAL A CA  1 
ATOM   3301 C C   . VAL A 1 515  ? -15.931 3.686   26.792  1.00 98.93  ? 531  VAL A C   1 
ATOM   3302 O O   . VAL A 1 515  ? -16.218 4.844   26.477  1.00 99.30  ? 531  VAL A O   1 
ATOM   3303 C CB  . VAL A 1 515  ? -13.927 3.362   28.381  1.00 98.41  ? 531  VAL A CB  1 
ATOM   3304 C CG1 . VAL A 1 515  ? -13.282 4.619   27.803  1.00 98.25  ? 531  VAL A CG1 1 
ATOM   3305 C CG2 . VAL A 1 515  ? -13.515 3.186   29.839  1.00 98.11  ? 531  VAL A CG2 1 
ATOM   3306 N N   . TRP A 1 516  ? -16.046 2.633   25.942  1.00 94.56  ? 532  TRP A N   1 
ATOM   3307 C CA  . TRP A 1 516  ? -16.484 2.787   24.551  1.00 94.36  ? 532  TRP A CA  1 
ATOM   3308 C C   . TRP A 1 516  ? -17.944 3.213   24.415  1.00 98.59  ? 532  TRP A C   1 
ATOM   3309 O O   . TRP A 1 516  ? -18.256 3.999   23.524  1.00 98.20  ? 532  TRP A O   1 
ATOM   3310 C CB  . TRP A 1 516  ? -16.201 1.532   23.716  1.00 93.14  ? 532  TRP A CB  1 
ATOM   3311 C CG  . TRP A 1 516  ? -16.631 1.653   22.277  1.00 93.83  ? 532  TRP A CG  1 
ATOM   3312 C CD1 . TRP A 1 516  ? -17.716 1.069   21.699  1.00 96.63  ? 532  TRP A CD1 1 
ATOM   3313 C CD2 . TRP A 1 516  ? -16.041 2.491   21.270  1.00 93.50  ? 532  TRP A CD2 1 
ATOM   3314 N NE1 . TRP A 1 516  ? -17.812 1.447   20.379  1.00 95.93  ? 532  TRP A NE1 1 
ATOM   3315 C CE2 . TRP A 1 516  ? -16.783 2.302   20.082  1.00 97.28  ? 532  TRP A CE2 1 
ATOM   3316 C CE3 . TRP A 1 516  ? -14.936 3.361   21.246  1.00 94.47  ? 532  TRP A CE3 1 
ATOM   3317 C CZ2 . TRP A 1 516  ? -16.448 2.940   18.879  1.00 96.39  ? 532  TRP A CZ2 1 
ATOM   3318 C CZ3 . TRP A 1 516  ? -14.626 4.015   20.061  1.00 95.63  ? 532  TRP A CZ3 1 
ATOM   3319 C CH2 . TRP A 1 516  ? -15.377 3.806   18.899  1.00 96.25  ? 532  TRP A CH2 1 
ATOM   3320 N N   . LYS A 1 517  ? -18.836 2.675   25.271  1.00 95.28  ? 533  LYS A N   1 
ATOM   3321 C CA  . LYS A 1 517  ? -20.268 3.008   25.284  1.00 94.55  ? 533  LYS A CA  1 
ATOM   3322 C C   . LYS A 1 517  ? -20.402 4.492   25.641  1.00 95.33  ? 533  LYS A C   1 
ATOM   3323 O O   . LYS A 1 517  ? -21.007 5.252   24.875  1.00 93.97  ? 533  LYS A O   1 
ATOM   3324 C CB  . LYS A 1 517  ? -21.030 2.113   26.298  1.00 97.42  ? 533  LYS A CB  1 
ATOM   3325 C CG  . LYS A 1 517  ? -22.555 2.229   26.268  1.00 108.47 ? 533  LYS A CG  1 
ATOM   3326 N N   . LEU A 1 518  ? -19.745 4.906   26.755  1.00 90.18  ? 534  LEU A N   1 
ATOM   3327 C CA  . LEU A 1 518  ? -19.760 6.284   27.252  1.00 89.52  ? 534  LEU A CA  1 
ATOM   3328 C C   . LEU A 1 518  ? -18.643 7.157   26.626  1.00 94.69  ? 534  LEU A C   1 
ATOM   3329 O O   . LEU A 1 518  ? -18.172 8.107   27.261  1.00 94.73  ? 534  LEU A O   1 
ATOM   3330 C CB  . LEU A 1 518  ? -19.722 6.338   28.801  1.00 89.00  ? 534  LEU A CB  1 
ATOM   3331 C CG  . LEU A 1 518  ? -20.582 5.363   29.637  1.00 93.14  ? 534  LEU A CG  1 
ATOM   3332 C CD1 . LEU A 1 518  ? -20.603 5.788   31.108  1.00 92.84  ? 534  LEU A CD1 1 
ATOM   3333 C CD2 . LEU A 1 518  ? -22.016 5.206   29.092  1.00 93.73  ? 534  LEU A CD2 1 
ATOM   3334 N N   . ARG A 1 519  ? -18.251 6.851   25.366  1.00 90.33  ? 535  ARG A N   1 
ATOM   3335 C CA  . ARG A 1 519  ? -17.210 7.569   24.632  1.00 89.00  ? 535  ARG A CA  1 
ATOM   3336 C C   . ARG A 1 519  ? -17.517 9.057   24.436  1.00 91.71  ? 535  ARG A C   1 
ATOM   3337 O O   . ARG A 1 519  ? -16.596 9.861   24.486  1.00 91.14  ? 535  ARG A O   1 
ATOM   3338 C CB  . ARG A 1 519  ? -16.876 6.877   23.302  1.00 88.11  ? 535  ARG A CB  1 
ATOM   3339 C CG  . ARG A 1 519  ? -17.975 6.890   22.250  1.00 96.13  ? 535  ARG A CG  1 
ATOM   3340 C CD  . ARG A 1 519  ? -17.542 6.106   21.038  1.00 97.12  ? 535  ARG A CD  1 
ATOM   3341 N NE  . ARG A 1 519  ? -18.622 5.970   20.068  1.00 107.42 ? 535  ARG A NE  1 
ATOM   3342 C CZ  . ARG A 1 519  ? -19.555 5.023   20.108  1.00 124.86 ? 535  ARG A CZ  1 
ATOM   3343 N NH1 . ARG A 1 519  ? -19.563 4.127   21.090  1.00 106.76 ? 535  ARG A NH1 1 
ATOM   3344 N NH2 . ARG A 1 519  ? -20.491 4.967   19.169  1.00 116.06 ? 535  ARG A NH2 1 
ATOM   3345 N N   . HIS A 1 520  ? -18.792 9.431   24.258  1.00 88.85  ? 536  HIS A N   1 
ATOM   3346 C CA  . HIS A 1 520  ? -19.176 10.837  24.102  1.00 89.04  ? 536  HIS A CA  1 
ATOM   3347 C C   . HIS A 1 520  ? -19.050 11.570  25.441  1.00 92.76  ? 536  HIS A C   1 
ATOM   3348 O O   . HIS A 1 520  ? -18.807 12.779  25.453  1.00 92.44  ? 536  HIS A O   1 
ATOM   3349 C CB  . HIS A 1 520  ? -20.601 10.951  23.561  1.00 90.17  ? 536  HIS A CB  1 
ATOM   3350 C CG  . HIS A 1 520  ? -20.733 10.569  22.122  1.00 94.41  ? 536  HIS A CG  1 
ATOM   3351 N ND1 . HIS A 1 520  ? -20.539 9.260   21.698  1.00 96.59  ? 536  HIS A ND1 1 
ATOM   3352 C CD2 . HIS A 1 520  ? -21.061 11.332  21.051  1.00 96.82  ? 536  HIS A CD2 1 
ATOM   3353 C CE1 . HIS A 1 520  ? -20.735 9.275   20.387  1.00 96.30  ? 536  HIS A CE1 1 
ATOM   3354 N NE2 . HIS A 1 520  ? -21.059 10.499  19.953  1.00 96.66  ? 536  HIS A NE2 1 
ATOM   3355 N N   . GLU A 1 521  ? -19.200 10.826  26.564  1.00 88.71  ? 537  GLU A N   1 
ATOM   3356 C CA  . GLU A 1 521  ? -19.093 11.363  27.923  1.00 88.50  ? 537  GLU A CA  1 
ATOM   3357 C C   . GLU A 1 521  ? -17.638 11.627  28.256  1.00 91.48  ? 537  GLU A C   1 
ATOM   3358 O O   . GLU A 1 521  ? -17.347 12.591  28.960  1.00 92.33  ? 537  GLU A O   1 
ATOM   3359 C CB  . GLU A 1 521  ? -19.759 10.439  28.959  1.00 89.85  ? 537  GLU A CB  1 
ATOM   3360 C CG  . GLU A 1 521  ? -21.273 10.377  28.828  1.00 97.40  ? 537  GLU A CG  1 
ATOM   3361 N N   . VAL A 1 522  ? -16.726 10.787  27.711  1.00 85.69  ? 538  VAL A N   1 
ATOM   3362 C CA  . VAL A 1 522  ? -15.267 10.895  27.813  1.00 83.68  ? 538  VAL A CA  1 
ATOM   3363 C C   . VAL A 1 522  ? -14.847 12.161  27.050  1.00 85.76  ? 538  VAL A C   1 
ATOM   3364 O O   . VAL A 1 522  ? -14.100 12.946  27.604  1.00 85.88  ? 538  VAL A O   1 
ATOM   3365 C CB  . VAL A 1 522  ? -14.519 9.615   27.314  1.00 86.49  ? 538  VAL A CB  1 
ATOM   3366 C CG1 . VAL A 1 522  ? -13.000 9.782   27.362  1.00 85.87  ? 538  VAL A CG1 1 
ATOM   3367 C CG2 . VAL A 1 522  ? -14.936 8.383   28.112  1.00 86.09  ? 538  VAL A CG2 1 
ATOM   3368 N N   . GLN A 1 523  ? -15.373 12.412  25.836  1.00 80.91  ? 539  GLN A N   1 
ATOM   3369 C CA  . GLN A 1 523  ? -15.006 13.630  25.106  1.00 80.86  ? 539  GLN A CA  1 
ATOM   3370 C C   . GLN A 1 523  ? -15.493 14.903  25.810  1.00 90.38  ? 539  GLN A C   1 
ATOM   3371 O O   . GLN A 1 523  ? -14.766 15.901  25.877  1.00 90.12  ? 539  GLN A O   1 
ATOM   3372 C CB  . GLN A 1 523  ? -15.495 13.581  23.664  1.00 81.22  ? 539  GLN A CB  1 
ATOM   3373 C CG  . GLN A 1 523  ? -14.904 14.702  22.818  1.00 89.37  ? 539  GLN A CG  1 
ATOM   3374 C CD  . GLN A 1 523  ? -15.613 14.919  21.506  1.00 91.89  ? 539  GLN A CD  1 
ATOM   3375 O OE1 . GLN A 1 523  ? -16.842 14.965  21.440  1.00 81.69  ? 539  GLN A OE1 1 
ATOM   3376 N NE2 . GLN A 1 523  ? -14.847 15.140  20.445  1.00 77.59  ? 539  GLN A NE2 1 
ATOM   3377 N N   . GLU A 1 524  ? -16.711 14.844  26.363  1.00 90.93  ? 540  GLU A N   1 
ATOM   3378 C CA  . GLU A 1 524  ? -17.343 15.967  27.035  1.00 92.34  ? 540  GLU A CA  1 
ATOM   3379 C C   . GLU A 1 524  ? -16.796 16.263  28.421  1.00 98.80  ? 540  GLU A C   1 
ATOM   3380 O O   . GLU A 1 524  ? -16.625 17.438  28.754  1.00 99.03  ? 540  GLU A O   1 
ATOM   3381 C CB  . GLU A 1 524  ? -18.869 15.782  27.091  1.00 93.87  ? 540  GLU A CB  1 
ATOM   3382 N N   . HIS A 1 525  ? -16.548 15.230  29.243  1.00 96.59  ? 541  HIS A N   1 
ATOM   3383 C CA  . HIS A 1 525  ? -16.109 15.464  30.620  1.00 97.43  ? 541  HIS A CA  1 
ATOM   3384 C C   . HIS A 1 525  ? -14.696 14.967  30.959  1.00 100.89 ? 541  HIS A C   1 
ATOM   3385 O O   . HIS A 1 525  ? -14.161 15.360  32.005  1.00 101.60 ? 541  HIS A O   1 
ATOM   3386 C CB  . HIS A 1 525  ? -17.135 14.891  31.620  1.00 99.03  ? 541  HIS A CB  1 
ATOM   3387 C CG  . HIS A 1 525  ? -18.557 15.229  31.283  1.00 103.12 ? 541  HIS A CG  1 
ATOM   3388 N ND1 . HIS A 1 525  ? -18.988 16.547  31.186  1.00 105.11 ? 541  HIS A ND1 1 
ATOM   3389 C CD2 . HIS A 1 525  ? -19.600 14.408  31.014  1.00 105.40 ? 541  HIS A CD2 1 
ATOM   3390 C CE1 . HIS A 1 525  ? -20.265 16.482  30.846  1.00 104.82 ? 541  HIS A CE1 1 
ATOM   3391 N NE2 . HIS A 1 525  ? -20.681 15.217  30.739  1.00 105.28 ? 541  HIS A NE2 1 
ATOM   3392 N N   . PHE A 1 526  ? -14.085 14.136  30.097  1.00 95.31  ? 542  PHE A N   1 
ATOM   3393 C CA  . PHE A 1 526  ? -12.739 13.599  30.338  1.00 94.21  ? 542  PHE A CA  1 
ATOM   3394 C C   . PHE A 1 526  ? -11.791 13.824  29.126  1.00 94.49  ? 542  PHE A C   1 
ATOM   3395 O O   . PHE A 1 526  ? -11.216 12.839  28.677  1.00 94.34  ? 542  PHE A O   1 
ATOM   3396 C CB  . PHE A 1 526  ? -12.866 12.091  30.618  1.00 96.35  ? 542  PHE A CB  1 
ATOM   3397 C CG  . PHE A 1 526  ? -13.594 11.705  31.883  1.00 98.61  ? 542  PHE A CG  1 
ATOM   3398 C CD1 . PHE A 1 526  ? -14.978 11.587  31.899  1.00 102.16 ? 542  PHE A CD1 1 
ATOM   3399 C CD2 . PHE A 1 526  ? -12.889 11.382  33.039  1.00 101.41 ? 542  PHE A CD2 1 
ATOM   3400 C CE1 . PHE A 1 526  ? -15.647 11.215  33.068  1.00 103.44 ? 542  PHE A CE1 1 
ATOM   3401 C CE2 . PHE A 1 526  ? -13.557 10.989  34.200  1.00 104.49 ? 542  PHE A CE2 1 
ATOM   3402 C CZ  . PHE A 1 526  ? -14.931 10.912  34.206  1.00 102.86 ? 542  PHE A CZ  1 
ATOM   3403 N N   . PRO A 1 527  ? -11.618 15.045  28.538  1.00 88.01  ? 543  PRO A N   1 
ATOM   3404 C CA  . PRO A 1 527  ? -10.793 15.162  27.311  1.00 86.66  ? 543  PRO A CA  1 
ATOM   3405 C C   . PRO A 1 527  ? -9.360  14.654  27.401  1.00 88.12  ? 543  PRO A C   1 
ATOM   3406 O O   . PRO A 1 527  ? -8.811  14.196  26.389  1.00 87.07  ? 543  PRO A O   1 
ATOM   3407 C CB  . PRO A 1 527  ? -10.826 16.653  27.000  1.00 88.25  ? 543  PRO A CB  1 
ATOM   3408 C CG  . PRO A 1 527  ? -12.052 17.133  27.643  1.00 92.86  ? 543  PRO A CG  1 
ATOM   3409 C CD  . PRO A 1 527  ? -12.197 16.354  28.899  1.00 88.73  ? 543  PRO A CD  1 
ATOM   3410 N N   . GLU A 1 528  ? -8.771  14.718  28.620  1.00 82.28  ? 544  GLU A N   1 
ATOM   3411 C CA  . GLU A 1 528  ? -7.408  14.280  28.910  1.00 80.57  ? 544  GLU A CA  1 
ATOM   3412 C C   . GLU A 1 528  ? -7.296  12.759  28.923  1.00 81.10  ? 544  GLU A C   1 
ATOM   3413 O O   . GLU A 1 528  ? -6.181  12.225  28.923  1.00 80.80  ? 544  GLU A O   1 
ATOM   3414 C CB  . GLU A 1 528  ? -6.889  14.921  30.203  1.00 82.05  ? 544  GLU A CB  1 
ATOM   3415 C CG  . GLU A 1 528  ? -6.806  16.440  30.094  1.00 99.05  ? 544  GLU A CG  1 
ATOM   3416 C CD  . GLU A 1 528  ? -5.935  17.183  31.095  1.00 128.13 ? 544  GLU A CD  1 
ATOM   3417 O OE1 . GLU A 1 528  ? -6.472  18.064  31.808  1.00 127.25 ? 544  GLU A OE1 1 
ATOM   3418 O OE2 . GLU A 1 528  ? -4.704  16.946  31.109  1.00 118.21 ? 544  GLU A OE2 1 
ATOM   3419 N N   . ALA A 1 529  ? -8.458  12.065  28.877  1.00 74.35  ? 545  ALA A N   1 
ATOM   3420 C CA  . ALA A 1 529  ? -8.553  10.610  28.834  1.00 73.01  ? 545  ALA A CA  1 
ATOM   3421 C C   . ALA A 1 529  ? -8.738  10.069  27.384  1.00 74.81  ? 545  ALA A C   1 
ATOM   3422 O O   . ALA A 1 529  ? -9.208  8.932   27.193  1.00 75.83  ? 545  ALA A O   1 
ATOM   3423 C CB  . ALA A 1 529  ? -9.665  10.130  29.754  1.00 73.74  ? 545  ALA A CB  1 
ATOM   3424 N N   . LEU A 1 530  ? -8.329  10.884  26.369  1.00 66.51  ? 546  LEU A N   1 
ATOM   3425 C CA  . LEU A 1 530  ? -8.332  10.535  24.947  1.00 63.48  ? 546  LEU A CA  1 
ATOM   3426 C C   . LEU A 1 530  ? -7.435  9.306   24.709  1.00 67.72  ? 546  LEU A C   1 
ATOM   3427 O O   . LEU A 1 530  ? -7.802  8.445   23.928  1.00 67.85  ? 546  LEU A O   1 
ATOM   3428 C CB  . LEU A 1 530  ? -7.894  11.741  24.065  1.00 62.49  ? 546  LEU A CB  1 
ATOM   3429 C CG  . LEU A 1 530  ? -7.634  11.472  22.555  1.00 66.50  ? 546  LEU A CG  1 
ATOM   3430 C CD1 . LEU A 1 530  ? -8.856  10.894  21.858  1.00 67.03  ? 546  LEU A CD1 1 
ATOM   3431 C CD2 . LEU A 1 530  ? -7.135  12.697  21.829  1.00 65.46  ? 546  LEU A CD2 1 
ATOM   3432 N N   . ALA A 1 531  ? -6.291  9.203   25.396  1.00 65.93  ? 547  ALA A N   1 
ATOM   3433 C CA  . ALA A 1 531  ? -5.394  8.053   25.234  1.00 66.73  ? 547  ALA A CA  1 
ATOM   3434 C C   . ALA A 1 531  ? -6.102  6.762   25.644  1.00 74.25  ? 547  ALA A C   1 
ATOM   3435 O O   . ALA A 1 531  ? -6.086  5.780   24.890  1.00 74.94  ? 547  ALA A O   1 
ATOM   3436 C CB  . ALA A 1 531  ? -4.124  8.244   26.054  1.00 67.21  ? 547  ALA A CB  1 
ATOM   3437 N N   . ARG A 1 532  ? -6.791  6.800   26.805  1.00 71.57  ? 548  ARG A N   1 
ATOM   3438 C CA  . ARG A 1 532  ? -7.572  5.691   27.345  1.00 71.39  ? 548  ARG A CA  1 
ATOM   3439 C C   . ARG A 1 532  ? -8.679  5.282   26.358  1.00 74.89  ? 548  ARG A C   1 
ATOM   3440 O O   . ARG A 1 532  ? -8.830  4.086   26.062  1.00 74.78  ? 548  ARG A O   1 
ATOM   3441 C CB  . ARG A 1 532  ? -8.127  6.068   28.720  1.00 71.90  ? 548  ARG A CB  1 
ATOM   3442 C CG  . ARG A 1 532  ? -7.075  5.993   29.832  1.00 80.74  ? 548  ARG A CG  1 
ATOM   3443 C CD  . ARG A 1 532  ? -7.238  7.111   30.846  1.00 88.49  ? 548  ARG A CD  1 
ATOM   3444 N NE  . ARG A 1 532  ? -6.871  6.687   32.195  1.00 93.31  ? 548  ARG A NE  1 
ATOM   3445 N N   . LEU A 1 533  ? -9.364  6.287   25.762  1.00 70.12  ? 549  LEU A N   1 
ATOM   3446 C CA  . LEU A 1 533  ? -10.403 6.047   24.772  1.00 69.20  ? 549  LEU A CA  1 
ATOM   3447 C C   . LEU A 1 533  ? -9.868  5.409   23.496  1.00 74.55  ? 549  LEU A C   1 
ATOM   3448 O O   . LEU A 1 533  ? -10.505 4.484   22.990  1.00 75.76  ? 549  LEU A O   1 
ATOM   3449 C CB  . LEU A 1 533  ? -11.223 7.304   24.477  1.00 68.90  ? 549  LEU A CB  1 
ATOM   3450 C CG  . LEU A 1 533  ? -12.476 7.125   23.578  1.00 73.56  ? 549  LEU A CG  1 
ATOM   3451 C CD1 . LEU A 1 533  ? -13.410 6.007   24.061  1.00 72.73  ? 549  LEU A CD1 1 
ATOM   3452 C CD2 . LEU A 1 533  ? -13.215 8.423   23.401  1.00 77.96  ? 549  LEU A CD2 1 
ATOM   3453 N N   . LEU A 1 534  ? -8.691  5.834   23.000  1.00 70.22  ? 550  LEU A N   1 
ATOM   3454 C CA  . LEU A 1 534  ? -8.128  5.240   21.777  1.00 69.98  ? 550  LEU A CA  1 
ATOM   3455 C C   . LEU A 1 534  ? -7.752  3.778   21.933  1.00 76.53  ? 550  LEU A C   1 
ATOM   3456 O O   . LEU A 1 534  ? -7.831  3.039   20.965  1.00 76.70  ? 550  LEU A O   1 
ATOM   3457 C CB  . LEU A 1 534  ? -6.926  6.030   21.231  1.00 69.77  ? 550  LEU A CB  1 
ATOM   3458 C CG  . LEU A 1 534  ? -7.174  7.473   20.812  1.00 73.80  ? 550  LEU A CG  1 
ATOM   3459 C CD1 . LEU A 1 534  ? -5.888  8.280   20.882  1.00 73.58  ? 550  LEU A CD1 1 
ATOM   3460 C CD2 . LEU A 1 534  ? -7.834  7.549   19.452  1.00 75.31  ? 550  LEU A CD2 1 
ATOM   3461 N N   . LEU A 1 535  ? -7.338  3.359   23.137  1.00 75.74  ? 551  LEU A N   1 
ATOM   3462 C CA  . LEU A 1 535  ? -6.931  1.978   23.418  1.00 76.11  ? 551  LEU A CA  1 
ATOM   3463 C C   . LEU A 1 535  ? -8.126  1.023   23.623  1.00 81.02  ? 551  LEU A C   1 
ATOM   3464 O O   . LEU A 1 535  ? -7.974  -0.194  23.434  1.00 82.14  ? 551  LEU A O   1 
ATOM   3465 C CB  . LEU A 1 535  ? -5.949  1.922   24.611  1.00 76.22  ? 551  LEU A CB  1 
ATOM   3466 C CG  . LEU A 1 535  ? -4.604  2.662   24.439  1.00 80.44  ? 551  LEU A CG  1 
ATOM   3467 C CD1 . LEU A 1 535  ? -4.059  3.105   25.760  1.00 80.50  ? 551  LEU A CD1 1 
ATOM   3468 C CD2 . LEU A 1 535  ? -3.583  1.815   23.718  1.00 81.74  ? 551  LEU A CD2 1 
ATOM   3469 N N   . VAL A 1 536  ? -9.309  1.559   23.999  1.00 75.81  ? 552  VAL A N   1 
ATOM   3470 C CA  . VAL A 1 536  ? -10.494 0.713   24.194  1.00 74.53  ? 552  VAL A CA  1 
ATOM   3471 C C   . VAL A 1 536  ? -11.173 0.396   22.859  1.00 79.36  ? 552  VAL A C   1 
ATOM   3472 O O   . VAL A 1 536  ? -11.844 -0.637  22.767  1.00 79.46  ? 552  VAL A O   1 
ATOM   3473 C CB  . VAL A 1 536  ? -11.493 1.216   25.263  1.00 76.77  ? 552  VAL A CB  1 
ATOM   3474 C CG1 . VAL A 1 536  ? -10.792 1.472   26.594  1.00 76.46  ? 552  VAL A CG1 1 
ATOM   3475 C CG2 . VAL A 1 536  ? -12.259 2.442   24.803  1.00 76.24  ? 552  VAL A CG2 1 
ATOM   3476 N N   . THR A 1 537  ? -10.978 1.282   21.838  1.00 75.70  ? 553  THR A N   1 
ATOM   3477 C CA  . THR A 1 537  ? -11.501 1.224   20.463  1.00 75.79  ? 553  THR A CA  1 
ATOM   3478 C C   . THR A 1 537  ? -11.054 -0.057  19.755  1.00 83.20  ? 553  THR A C   1 
ATOM   3479 O O   . THR A 1 537  ? -9.875  -0.434  19.837  1.00 84.02  ? 553  THR A O   1 
ATOM   3480 C CB  . THR A 1 537  ? -10.989 2.452   19.689  1.00 81.48  ? 553  THR A CB  1 
ATOM   3481 O OG1 . THR A 1 537  ? -11.210 3.601   20.485  1.00 80.48  ? 553  THR A OG1 1 
ATOM   3482 C CG2 . THR A 1 537  ? -11.630 2.629   18.305  1.00 79.25  ? 553  THR A CG2 1 
ATOM   3483 N N   . LYS A 1 538  ? -11.993 -0.726  19.069  1.00 80.43  ? 554  LYS A N   1 
ATOM   3484 C CA  . LYS A 1 538  ? -11.668 -1.945  18.329  1.00 80.64  ? 554  LYS A CA  1 
ATOM   3485 C C   . LYS A 1 538  ? -11.244 -1.500  16.922  1.00 84.57  ? 554  LYS A C   1 
ATOM   3486 O O   . LYS A 1 538  ? -12.089 -1.147  16.098  1.00 84.16  ? 554  LYS A O   1 
ATOM   3487 C CB  . LYS A 1 538  ? -12.859 -2.945  18.315  1.00 83.62  ? 554  LYS A CB  1 
ATOM   3488 C CG  . LYS A 1 538  ? -13.286 -3.452  19.705  1.00 95.79  ? 554  LYS A CG  1 
ATOM   3489 C CD  . LYS A 1 538  ? -14.697 -4.040  19.716  1.00 100.48 ? 554  LYS A CD  1 
ATOM   3490 N N   . TRP A 1 539  ? -9.923  -1.464  16.674  1.00 81.38  ? 555  TRP A N   1 
ATOM   3491 C CA  . TRP A 1 539  ? -9.352  -1.026  15.397  1.00 81.36  ? 555  TRP A CA  1 
ATOM   3492 C C   . TRP A 1 539  ? -9.484  -2.107  14.280  1.00 84.85  ? 555  TRP A C   1 
ATOM   3493 O O   . TRP A 1 539  ? -9.114  -1.848  13.140  1.00 84.35  ? 555  TRP A O   1 
ATOM   3494 C CB  . TRP A 1 539  ? -7.896  -0.509  15.572  1.00 80.17  ? 555  TRP A CB  1 
ATOM   3495 C CG  . TRP A 1 539  ? -7.753  0.569   16.616  1.00 80.87  ? 555  TRP A CG  1 
ATOM   3496 C CD1 . TRP A 1 539  ? -7.580  0.383   17.955  1.00 83.90  ? 555  TRP A CD1 1 
ATOM   3497 C CD2 . TRP A 1 539  ? -7.835  1.989   16.418  1.00 80.53  ? 555  TRP A CD2 1 
ATOM   3498 N NE1 . TRP A 1 539  ? -7.549  1.595   18.607  1.00 83.16  ? 555  TRP A NE1 1 
ATOM   3499 C CE2 . TRP A 1 539  ? -7.710  2.600   17.690  1.00 84.29  ? 555  TRP A CE2 1 
ATOM   3500 C CE3 . TRP A 1 539  ? -8.002  2.811   15.292  1.00 81.71  ? 555  TRP A CE3 1 
ATOM   3501 C CZ2 . TRP A 1 539  ? -7.755  3.990   17.869  1.00 83.13  ? 555  TRP A CZ2 1 
ATOM   3502 C CZ3 . TRP A 1 539  ? -8.046  4.191   15.472  1.00 82.96  ? 555  TRP A CZ3 1 
ATOM   3503 C CH2 . TRP A 1 539  ? -7.931  4.766   16.749  1.00 83.33  ? 555  TRP A CH2 1 
ATOM   3504 N N   . ASN A 1 540  ? -10.052 -3.289  14.605  1.00 81.36  ? 556  ASN A N   1 
ATOM   3505 C CA  . ASN A 1 540  ? -10.337 -4.377  13.655  1.00 80.80  ? 556  ASN A CA  1 
ATOM   3506 C C   . ASN A 1 540  ? -11.804 -4.327  13.121  1.00 86.48  ? 556  ASN A C   1 
ATOM   3507 O O   . ASN A 1 540  ? -12.200 -5.187  12.327  1.00 85.69  ? 556  ASN A O   1 
ATOM   3508 C CB  . ASN A 1 540  ? -9.969  -5.769  14.225  1.00 76.33  ? 556  ASN A CB  1 
ATOM   3509 C CG  . ASN A 1 540  ? -10.485 -6.129  15.611  1.00 85.48  ? 556  ASN A CG  1 
ATOM   3510 O OD1 . ASN A 1 540  ? -11.242 -5.395  16.255  1.00 75.94  ? 556  ASN A OD1 1 
ATOM   3511 N ND2 . ASN A 1 540  ? -10.062 -7.285  16.113  1.00 75.89  ? 556  ASN A ND2 1 
ATOM   3512 N N   . LYS A 1 541  ? -12.594 -3.300  13.547  1.00 83.79  ? 557  LYS A N   1 
ATOM   3513 C CA  . LYS A 1 541  ? -13.979 -3.055  13.123  1.00 83.64  ? 557  LYS A CA  1 
ATOM   3514 C C   . LYS A 1 541  ? -14.035 -1.603  12.621  1.00 87.99  ? 557  LYS A C   1 
ATOM   3515 O O   . LYS A 1 541  ? -14.030 -0.689  13.447  1.00 87.65  ? 557  LYS A O   1 
ATOM   3516 C CB  . LYS A 1 541  ? -14.960 -3.266  14.301  1.00 86.44  ? 557  LYS A CB  1 
ATOM   3517 C CG  . LYS A 1 541  ? -14.994 -4.679  14.887  1.00 98.59  ? 557  LYS A CG  1 
ATOM   3518 C CD  . LYS A 1 541  ? -16.103 -4.827  15.909  1.00 106.98 ? 557  LYS A CD  1 
ATOM   3519 N N   . HIS A 1 542  ? -14.042 -1.392  11.277  1.00 85.05  ? 558  HIS A N   1 
ATOM   3520 C CA  . HIS A 1 542  ? -14.009 -0.072  10.621  1.00 85.54  ? 558  HIS A CA  1 
ATOM   3521 C C   . HIS A 1 542  ? -15.146 0.868   11.029  1.00 89.80  ? 558  HIS A C   1 
ATOM   3522 O O   . HIS A 1 542  ? -15.039 2.089   10.878  1.00 88.33  ? 558  HIS A O   1 
ATOM   3523 C CB  . HIS A 1 542  ? -13.945 -0.209  9.094   1.00 87.23  ? 558  HIS A CB  1 
ATOM   3524 C CG  . HIS A 1 542  ? -15.245 -0.626  8.475   1.00 91.50  ? 558  HIS A CG  1 
ATOM   3525 N ND1 . HIS A 1 542  ? -15.488 -1.946  8.126   1.00 93.54  ? 558  HIS A ND1 1 
ATOM   3526 C CD2 . HIS A 1 542  ? -16.340 0.116   8.173   1.00 93.11  ? 558  HIS A CD2 1 
ATOM   3527 C CE1 . HIS A 1 542  ? -16.722 -1.964  7.645   1.00 92.70  ? 558  HIS A CE1 1 
ATOM   3528 N NE2 . HIS A 1 542  ? -17.270 -0.746  7.649   1.00 92.83  ? 558  HIS A NE2 1 
ATOM   3529 N N   . GLU A 1 543  ? -16.249 0.286   11.504  1.00 88.49  ? 559  GLU A N   1 
ATOM   3530 C CA  . GLU A 1 543  ? -17.421 1.000   12.008  1.00 88.99  ? 559  GLU A CA  1 
ATOM   3531 C C   . GLU A 1 543  ? -16.951 1.757   13.268  1.00 91.86  ? 559  GLU A C   1 
ATOM   3532 O O   . GLU A 1 543  ? -17.143 2.973   13.352  1.00 91.06  ? 559  GLU A O   1 
ATOM   3533 C CB  . GLU A 1 543  ? -18.575 0.011   12.369  1.00 90.84  ? 559  GLU A CB  1 
ATOM   3534 C CG  . GLU A 1 543  ? -18.765 -1.209  11.459  1.00 102.60 ? 559  GLU A CG  1 
ATOM   3535 C CD  . GLU A 1 543  ? -18.050 -2.480  11.894  1.00 124.84 ? 559  GLU A CD  1 
ATOM   3536 O OE1 . GLU A 1 543  ? -18.231 -2.906  13.060  1.00 115.92 ? 559  GLU A OE1 1 
ATOM   3537 O OE2 . GLU A 1 543  ? -17.324 -3.064  11.055  1.00 116.50 ? 559  GLU A OE2 1 
ATOM   3538 N N   . ASP A 1 544  ? -16.264 1.027   14.197  1.00 87.92  ? 560  ASP A N   1 
ATOM   3539 C CA  . ASP A 1 544  ? -15.692 1.520   15.459  1.00 87.92  ? 560  ASP A CA  1 
ATOM   3540 C C   . ASP A 1 544  ? -14.586 2.562   15.233  1.00 89.96  ? 560  ASP A C   1 
ATOM   3541 O O   . ASP A 1 544  ? -14.499 3.547   15.974  1.00 89.61  ? 560  ASP A O   1 
ATOM   3542 C CB  . ASP A 1 544  ? -15.137 0.347   16.289  1.00 90.40  ? 560  ASP A CB  1 
ATOM   3543 C CG  . ASP A 1 544  ? -16.171 -0.651  16.779  1.00 105.75 ? 560  ASP A CG  1 
ATOM   3544 O OD1 . ASP A 1 544  ? -17.173 -0.875  16.058  1.00 107.71 ? 560  ASP A OD1 1 
ATOM   3545 O OD2 . ASP A 1 544  ? -15.954 -1.247  17.864  1.00 111.54 ? 560  ASP A OD2 1 
ATOM   3546 N N   . VAL A 1 545  ? -13.741 2.331   14.219  1.00 84.52  ? 561  VAL A N   1 
ATOM   3547 C CA  . VAL A 1 545  ? -12.654 3.229   13.835  1.00 83.76  ? 561  VAL A CA  1 
ATOM   3548 C C   . VAL A 1 545  ? -13.246 4.586   13.354  1.00 89.41  ? 561  VAL A C   1 
ATOM   3549 O O   . VAL A 1 545  ? -12.837 5.634   13.868  1.00 89.17  ? 561  VAL A O   1 
ATOM   3550 C CB  . VAL A 1 545  ? -11.705 2.584   12.783  1.00 86.36  ? 561  VAL A CB  1 
ATOM   3551 C CG1 . VAL A 1 545  ? -10.526 3.495   12.467  1.00 86.04  ? 561  VAL A CG1 1 
ATOM   3552 C CG2 . VAL A 1 545  ? -11.212 1.212   13.232  1.00 85.73  ? 561  VAL A CG2 1 
ATOM   3553 N N   . ALA A 1 546  ? -14.233 4.556   12.405  1.00 86.01  ? 562  ALA A N   1 
ATOM   3554 C CA  . ALA A 1 546  ? -14.887 5.757   11.859  1.00 85.48  ? 562  ALA A CA  1 
ATOM   3555 C C   . ALA A 1 546  ? -15.494 6.602   12.963  1.00 88.74  ? 562  ALA A C   1 
ATOM   3556 O O   . ALA A 1 546  ? -15.352 7.826   12.941  1.00 88.53  ? 562  ALA A O   1 
ATOM   3557 C CB  . ALA A 1 546  ? -15.956 5.373   10.847  1.00 86.25  ? 562  ALA A CB  1 
ATOM   3558 N N   . GLN A 1 547  ? -16.120 5.934   13.952  1.00 84.86  ? 563  GLN A N   1 
ATOM   3559 C CA  . GLN A 1 547  ? -16.746 6.536   15.127  1.00 84.33  ? 563  GLN A CA  1 
ATOM   3560 C C   . GLN A 1 547  ? -15.719 7.303   15.962  1.00 87.40  ? 563  GLN A C   1 
ATOM   3561 O O   . GLN A 1 547  ? -15.914 8.498   16.219  1.00 89.08  ? 563  GLN A O   1 
ATOM   3562 C CB  . GLN A 1 547  ? -17.484 5.468   15.961  1.00 85.83  ? 563  GLN A CB  1 
ATOM   3563 C CG  . GLN A 1 547  ? -18.827 5.043   15.341  1.00 102.53 ? 563  GLN A CG  1 
ATOM   3564 C CD  . GLN A 1 547  ? -19.524 3.904   16.056  1.00 122.64 ? 563  GLN A CD  1 
ATOM   3565 O OE1 . GLN A 1 547  ? -18.906 3.080   16.734  1.00 123.46 ? 563  GLN A OE1 1 
ATOM   3566 N NE2 . GLN A 1 547  ? -20.833 3.798   15.873  1.00 107.74 ? 563  GLN A NE2 1 
ATOM   3567 N N   . MET A 1 548  ? -14.596 6.647   16.312  1.00 80.35  ? 564  MET A N   1 
ATOM   3568 C CA  . MET A 1 548  ? -13.500 7.253   17.078  1.00 78.26  ? 564  MET A CA  1 
ATOM   3569 C C   . MET A 1 548  ? -12.906 8.466   16.354  1.00 78.75  ? 564  MET A C   1 
ATOM   3570 O O   . MET A 1 548  ? -12.798 9.559   16.927  1.00 76.44  ? 564  MET A O   1 
ATOM   3571 C CB  . MET A 1 548  ? -12.417 6.195   17.355  1.00 80.23  ? 564  MET A CB  1 
ATOM   3572 C CG  . MET A 1 548  ? -11.222 6.727   18.100  1.00 83.19  ? 564  MET A CG  1 
ATOM   3573 S SD  . MET A 1 548  ? -11.644 7.688   19.568  1.00 86.60  ? 564  MET A SD  1 
ATOM   3574 C CE  . MET A 1 548  ? -12.004 6.469   20.587  1.00 82.82  ? 564  MET A CE  1 
ATOM   3575 N N   . LEU A 1 549  ? -12.559 8.264   15.075  1.00 75.59  ? 565  LEU A N   1 
ATOM   3576 C CA  . LEU A 1 549  ? -11.997 9.297   14.219  1.00 75.86  ? 565  LEU A CA  1 
ATOM   3577 C C   . LEU A 1 549  ? -12.906 10.511  14.119  1.00 83.35  ? 565  LEU A C   1 
ATOM   3578 O O   . LEU A 1 549  ? -12.388 11.624  14.079  1.00 83.92  ? 565  LEU A O   1 
ATOM   3579 C CB  . LEU A 1 549  ? -11.606 8.752   12.834  1.00 75.34  ? 565  LEU A CB  1 
ATOM   3580 C CG  . LEU A 1 549  ? -10.455 7.736   12.814  1.00 78.83  ? 565  LEU A CG  1 
ATOM   3581 C CD1 . LEU A 1 549  ? -10.212 7.205   11.437  1.00 78.64  ? 565  LEU A CD1 1 
ATOM   3582 C CD2 . LEU A 1 549  ? -9.182  8.339   13.325  1.00 81.63  ? 565  LEU A CD2 1 
ATOM   3583 N N   . TYR A 1 550  ? -14.251 10.316  14.168  1.00 80.95  ? 566  TYR A N   1 
ATOM   3584 C CA  . TYR A 1 550  ? -15.215 11.418  14.128  1.00 81.13  ? 566  TYR A CA  1 
ATOM   3585 C C   . TYR A 1 550  ? -15.075 12.272  15.387  1.00 81.92  ? 566  TYR A C   1 
ATOM   3586 O O   . TYR A 1 550  ? -15.159 13.500  15.307  1.00 80.08  ? 566  TYR A O   1 
ATOM   3587 C CB  . TYR A 1 550  ? -16.664 10.897  13.937  1.00 84.03  ? 566  TYR A CB  1 
ATOM   3588 C CG  . TYR A 1 550  ? -17.742 11.956  14.118  1.00 88.50  ? 566  TYR A CG  1 
ATOM   3589 C CD1 . TYR A 1 550  ? -17.979 12.916  13.136  1.00 91.37  ? 566  TYR A CD1 1 
ATOM   3590 C CD2 . TYR A 1 550  ? -18.526 11.994  15.270  1.00 89.35  ? 566  TYR A CD2 1 
ATOM   3591 C CE1 . TYR A 1 550  ? -18.952 13.901  13.306  1.00 92.55  ? 566  TYR A CE1 1 
ATOM   3592 C CE2 . TYR A 1 550  ? -19.504 12.972  15.448  1.00 90.39  ? 566  TYR A CE2 1 
ATOM   3593 C CZ  . TYR A 1 550  ? -19.715 13.922  14.461  1.00 100.31 ? 566  TYR A CZ  1 
ATOM   3594 O OH  . TYR A 1 550  ? -20.672 14.895  14.629  1.00 104.47 ? 566  TYR A OH  1 
ATOM   3595 N N   . LEU A 1 551  ? -14.846 11.619  16.541  1.00 77.50  ? 567  LEU A N   1 
ATOM   3596 C CA  . LEU A 1 551  ? -14.688 12.327  17.806  1.00 76.99  ? 567  LEU A CA  1 
ATOM   3597 C C   . LEU A 1 551  ? -13.336 12.977  17.848  1.00 82.27  ? 567  LEU A C   1 
ATOM   3598 O O   . LEU A 1 551  ? -13.195 14.049  18.447  1.00 82.80  ? 567  LEU A O   1 
ATOM   3599 C CB  . LEU A 1 551  ? -14.825 11.381  19.003  1.00 76.53  ? 567  LEU A CB  1 
ATOM   3600 C CG  . LEU A 1 551  ? -16.202 10.840  19.301  1.00 79.84  ? 567  LEU A CG  1 
ATOM   3601 C CD1 . LEU A 1 551  ? -16.102 9.494   19.954  1.00 79.70  ? 567  LEU A CD1 1 
ATOM   3602 C CD2 . LEU A 1 551  ? -16.983 11.790  20.175  1.00 81.06  ? 567  LEU A CD2 1 
ATOM   3603 N N   . LEU A 1 552  ? -12.332 12.331  17.221  1.00 77.99  ? 568  LEU A N   1 
ATOM   3604 C CA  . LEU A 1 552  ? -10.977 12.874  17.183  1.00 77.86  ? 568  LEU A CA  1 
ATOM   3605 C C   . LEU A 1 552  ? -10.927 14.236  16.469  1.00 85.73  ? 568  LEU A C   1 
ATOM   3606 O O   . LEU A 1 552  ? -10.313 15.184  16.971  1.00 86.22  ? 568  LEU A O   1 
ATOM   3607 C CB  . LEU A 1 552  ? -10.021 11.863  16.523  1.00 76.99  ? 568  LEU A CB  1 
ATOM   3608 C CG  . LEU A 1 552  ? -8.512  12.128  16.642  1.00 79.60  ? 568  LEU A CG  1 
ATOM   3609 C CD1 . LEU A 1 552  ? -8.063  12.234  18.098  1.00 79.42  ? 568  LEU A CD1 1 
ATOM   3610 C CD2 . LEU A 1 552  ? -7.748  11.045  15.976  1.00 79.76  ? 568  LEU A CD2 1 
ATOM   3611 N N   . CYS A 1 553  ? -11.642 14.341  15.343  1.00 84.65  ? 569  CYS A N   1 
ATOM   3612 C CA  . CYS A 1 553  ? -11.719 15.527  14.498  1.00 86.29  ? 569  CYS A CA  1 
ATOM   3613 C C   . CYS A 1 553  ? -12.583 16.641  15.081  1.00 89.73  ? 569  CYS A C   1 
ATOM   3614 O O   . CYS A 1 553  ? -12.851 17.628  14.396  1.00 90.74  ? 569  CYS A O   1 
ATOM   3615 C CB  . CYS A 1 553  ? -12.159 15.140  13.090  1.00 88.02  ? 569  CYS A CB  1 
ATOM   3616 S SG  . CYS A 1 553  ? -11.064 13.928  12.288  1.00 92.79  ? 569  CYS A SG  1 
ATOM   3617 N N   . SER A 1 554  ? -12.970 16.504  16.356  1.00 84.44  ? 570  SER A N   1 
ATOM   3618 C CA  . SER A 1 554  ? -13.771 17.469  17.118  1.00 83.93  ? 570  SER A CA  1 
ATOM   3619 C C   . SER A 1 554  ? -13.280 17.539  18.588  1.00 82.06  ? 570  SER A C   1 
ATOM   3620 O O   . SER A 1 554  ? -13.888 18.216  19.431  1.00 81.14  ? 570  SER A O   1 
ATOM   3621 C CB  . SER A 1 554  ? -15.268 17.130  17.033  1.00 91.07  ? 570  SER A CB  1 
ATOM   3622 O OG  . SER A 1 554  ? -15.587 15.750  17.170  1.00 107.30 ? 570  SER A OG  1 
ATOM   3623 N N   . TRP A 1 555  ? -12.153 16.851  18.867  1.00 73.96  ? 571  TRP A N   1 
ATOM   3624 C CA  . TRP A 1 555  ? -11.551 16.762  20.191  1.00 71.02  ? 571  TRP A CA  1 
ATOM   3625 C C   . TRP A 1 555  ? -10.876 18.049  20.651  1.00 69.17  ? 571  TRP A C   1 
ATOM   3626 O O   . TRP A 1 555  ? -10.059 18.584  19.901  1.00 68.30  ? 571  TRP A O   1 
ATOM   3627 C CB  . TRP A 1 555  ? -10.542 15.599  20.244  1.00 69.39  ? 571  TRP A CB  1 
ATOM   3628 C CG  . TRP A 1 555  ? -10.400 15.045  21.625  1.00 69.67  ? 571  TRP A CG  1 
ATOM   3629 C CD1 . TRP A 1 555  ? -9.684  15.580  22.652  1.00 72.53  ? 571  TRP A CD1 1 
ATOM   3630 C CD2 . TRP A 1 555  ? -11.097 13.919  22.163  1.00 69.28  ? 571  TRP A CD2 1 
ATOM   3631 N NE1 . TRP A 1 555  ? -9.921  14.877  23.808  1.00 72.54  ? 571  TRP A NE1 1 
ATOM   3632 C CE2 . TRP A 1 555  ? -10.771 13.839  23.532  1.00 73.60  ? 571  TRP A CE2 1 
ATOM   3633 C CE3 . TRP A 1 555  ? -11.958 12.956  21.615  1.00 70.61  ? 571  TRP A CE3 1 
ATOM   3634 C CZ2 . TRP A 1 555  ? -11.277 12.833  24.366  1.00 72.92  ? 571  TRP A CZ2 1 
ATOM   3635 C CZ3 . TRP A 1 555  ? -12.440 11.945  22.436  1.00 72.28  ? 571  TRP A CZ3 1 
ATOM   3636 C CH2 . TRP A 1 555  ? -12.076 11.873  23.787  1.00 72.81  ? 571  TRP A CH2 1 
ATOM   3637 N N   . PRO A 1 556  ? -11.099 18.514  21.904  1.00 64.02  ? 572  PRO A N   1 
ATOM   3638 C CA  . PRO A 1 556  ? -10.381 19.721  22.374  1.00 63.69  ? 572  PRO A CA  1 
ATOM   3639 C C   . PRO A 1 556  ? -8.848  19.551  22.430  1.00 67.67  ? 572  PRO A C   1 
ATOM   3640 O O   . PRO A 1 556  ? -8.338  18.445  22.663  1.00 68.32  ? 572  PRO A O   1 
ATOM   3641 C CB  . PRO A 1 556  ? -10.990 20.002  23.761  1.00 64.61  ? 572  PRO A CB  1 
ATOM   3642 C CG  . PRO A 1 556  ? -11.626 18.772  24.170  1.00 68.37  ? 572  PRO A CG  1 
ATOM   3643 C CD  . PRO A 1 556  ? -12.036 18.023  22.936  1.00 64.94  ? 572  PRO A CD  1 
ATOM   3644 N N   . GLU A 1 557  ? -8.122  20.644  22.162  1.00 61.81  ? 573  GLU A N   1 
ATOM   3645 C CA  . GLU A 1 557  ? -6.669  20.665  22.141  1.00 60.34  ? 573  GLU A CA  1 
ATOM   3646 C C   . GLU A 1 557  ? -6.130  20.287  23.510  1.00 64.52  ? 573  GLU A C   1 
ATOM   3647 O O   . GLU A 1 557  ? -6.549  20.863  24.524  1.00 64.25  ? 573  GLU A O   1 
ATOM   3648 C CB  . GLU A 1 557  ? -6.192  22.045  21.723  1.00 61.14  ? 573  GLU A CB  1 
ATOM   3649 C CG  . GLU A 1 557  ? -4.694  22.130  21.568  1.00 67.23  ? 573  GLU A CG  1 
ATOM   3650 C CD  . GLU A 1 557  ? -4.256  23.508  21.149  1.00 83.12  ? 573  GLU A CD  1 
ATOM   3651 O OE1 . GLU A 1 557  ? -4.405  23.862  19.955  1.00 84.50  ? 573  GLU A OE1 1 
ATOM   3652 O OE2 . GLU A 1 557  ? -3.802  24.255  22.040  1.00 79.30  ? 573  GLU A OE2 1 
ATOM   3653 N N   . LEU A 1 558  ? -5.221  19.293  23.541  1.00 60.41  ? 574  LEU A N   1 
ATOM   3654 C CA  . LEU A 1 558  ? -4.675  18.788  24.802  1.00 59.28  ? 574  LEU A CA  1 
ATOM   3655 C C   . LEU A 1 558  ? -3.386  19.475  25.201  1.00 62.50  ? 574  LEU A C   1 
ATOM   3656 O O   . LEU A 1 558  ? -2.757  20.079  24.331  1.00 61.76  ? 574  LEU A O   1 
ATOM   3657 C CB  . LEU A 1 558  ? -4.529  17.253  24.765  1.00 59.26  ? 574  LEU A CB  1 
ATOM   3658 C CG  . LEU A 1 558  ? -5.866  16.443  24.829  1.00 63.83  ? 574  LEU A CG  1 
ATOM   3659 C CD1 . LEU A 1 558  ? -5.612  14.977  25.029  1.00 62.98  ? 574  LEU A CD1 1 
ATOM   3660 C CD2 . LEU A 1 558  ? -6.807  16.960  25.948  1.00 66.79  ? 574  LEU A CD2 1 
ATOM   3661 N N   . PRO A 1 559  ? -2.966  19.467  26.498  1.00 59.10  ? 575  PRO A N   1 
ATOM   3662 C CA  . PRO A 1 559  ? -1.694  20.128  26.838  1.00 58.52  ? 575  PRO A CA  1 
ATOM   3663 C C   . PRO A 1 559  ? -0.520  19.338  26.269  1.00 63.30  ? 575  PRO A C   1 
ATOM   3664 O O   . PRO A 1 559  ? -0.681  18.186  25.894  1.00 62.93  ? 575  PRO A O   1 
ATOM   3665 C CB  . PRO A 1 559  ? -1.686  20.120  28.376  1.00 59.18  ? 575  PRO A CB  1 
ATOM   3666 C CG  . PRO A 1 559  ? -3.055  19.686  28.783  1.00 62.31  ? 575  PRO A CG  1 
ATOM   3667 C CD  . PRO A 1 559  ? -3.562  18.838  27.697  1.00 58.81  ? 575  PRO A CD  1 
ATOM   3668 N N   . VAL A 1 560  ? 0.657   19.951  26.214  1.00 61.37  ? 576  VAL A N   1 
ATOM   3669 C CA  . VAL A 1 560  ? 1.899   19.339  25.733  1.00 61.27  ? 576  VAL A CA  1 
ATOM   3670 C C   . VAL A 1 560  ? 2.111   17.959  26.365  1.00 64.54  ? 576  VAL A C   1 
ATOM   3671 O O   . VAL A 1 560  ? 2.427   17.000  25.652  1.00 64.40  ? 576  VAL A O   1 
ATOM   3672 C CB  . VAL A 1 560  ? 3.063   20.306  26.030  1.00 65.91  ? 576  VAL A CB  1 
ATOM   3673 C CG1 . VAL A 1 560  ? 4.411   19.584  26.102  1.00 65.97  ? 576  VAL A CG1 1 
ATOM   3674 C CG2 . VAL A 1 560  ? 3.082   21.451  25.015  1.00 65.84  ? 576  VAL A CG2 1 
ATOM   3675 N N   . LEU A 1 561  ? 1.881   17.864  27.696  1.00 59.74  ? 577  LEU A N   1 
ATOM   3676 C CA  . LEU A 1 561  ? 2.026   16.638  28.460  1.00 58.88  ? 577  LEU A CA  1 
ATOM   3677 C C   . LEU A 1 561  ? 1.158   15.499  27.943  1.00 62.02  ? 577  LEU A C   1 
ATOM   3678 O O   . LEU A 1 561  ? 1.658   14.386  27.817  1.00 63.08  ? 577  LEU A O   1 
ATOM   3679 C CB  . LEU A 1 561  ? 1.794   16.898  29.947  1.00 58.97  ? 577  LEU A CB  1 
ATOM   3680 C CG  . LEU A 1 561  ? 2.098   15.745  30.891  1.00 63.29  ? 577  LEU A CG  1 
ATOM   3681 C CD1 . LEU A 1 561  ? 3.559   15.410  30.883  1.00 63.46  ? 577  LEU A CD1 1 
ATOM   3682 C CD2 . LEU A 1 561  ? 1.755   16.116  32.256  1.00 65.68  ? 577  LEU A CD2 1 
ATOM   3683 N N   . SER A 1 562  ? -0.099  15.769  27.591  1.00 57.23  ? 578  SER A N   1 
ATOM   3684 C CA  . SER A 1 562  ? -0.972  14.724  27.051  1.00 57.86  ? 578  SER A CA  1 
ATOM   3685 C C   . SER A 1 562  ? -0.584  14.305  25.604  1.00 62.69  ? 578  SER A C   1 
ATOM   3686 O O   . SER A 1 562  ? -0.607  13.111  25.257  1.00 62.89  ? 578  SER A O   1 
ATOM   3687 C CB  . SER A 1 562  ? -2.433  15.140  27.171  1.00 62.50  ? 578  SER A CB  1 
ATOM   3688 O OG  . SER A 1 562  ? -2.737  15.339  28.545  1.00 74.22  ? 578  SER A OG  1 
ATOM   3689 N N   . ALA A 1 563  ? -0.162  15.293  24.797  1.00 58.33  ? 579  ALA A N   1 
ATOM   3690 C CA  . ALA A 1 563  ? 0.284   15.123  23.426  1.00 57.88  ? 579  ALA A CA  1 
ATOM   3691 C C   . ALA A 1 563  ? 1.518   14.204  23.353  1.00 60.98  ? 579  ALA A C   1 
ATOM   3692 O O   . ALA A 1 563  ? 1.593   13.350  22.458  1.00 59.26  ? 579  ALA A O   1 
ATOM   3693 C CB  . ALA A 1 563  ? 0.616   16.480  22.842  1.00 58.82  ? 579  ALA A CB  1 
ATOM   3694 N N   . LEU A 1 564  ? 2.472   14.361  24.324  1.00 57.04  ? 580  LEU A N   1 
ATOM   3695 C CA  . LEU A 1 564  ? 3.714   13.572  24.396  1.00 55.33  ? 580  LEU A CA  1 
ATOM   3696 C C   . LEU A 1 564  ? 3.407   12.103  24.464  1.00 62.63  ? 580  LEU A C   1 
ATOM   3697 O O   . LEU A 1 564  ? 4.031   11.324  23.745  1.00 62.68  ? 580  LEU A O   1 
ATOM   3698 C CB  . LEU A 1 564  ? 4.589   13.996  25.584  1.00 54.00  ? 580  LEU A CB  1 
ATOM   3699 C CG  . LEU A 1 564  ? 5.356   15.332  25.457  1.00 55.43  ? 580  LEU A CG  1 
ATOM   3700 C CD1 . LEU A 1 564  ? 5.956   15.727  26.764  1.00 53.44  ? 580  LEU A CD1 1 
ATOM   3701 C CD2 . LEU A 1 564  ? 6.426   15.280  24.373  1.00 54.68  ? 580  LEU A CD2 1 
ATOM   3702 N N   . GLU A 1 565  ? 2.366   11.737  25.251  1.00 61.29  ? 581  GLU A N   1 
ATOM   3703 C CA  . GLU A 1 565  ? 1.890   10.364  25.410  1.00 60.75  ? 581  GLU A CA  1 
ATOM   3704 C C   . GLU A 1 565  ? 1.397   9.761   24.120  1.00 64.70  ? 581  GLU A C   1 
ATOM   3705 O O   . GLU A 1 565  ? 1.584   8.558   23.954  1.00 65.18  ? 581  GLU A O   1 
ATOM   3706 C CB  . GLU A 1 565  ? 0.779   10.281  26.456  1.00 62.09  ? 581  GLU A CB  1 
ATOM   3707 C CG  . GLU A 1 565  ? 0.557   8.872   26.980  1.00 71.95  ? 581  GLU A CG  1 
ATOM   3708 C CD  . GLU A 1 565  ? -0.719  8.578   27.749  1.00 93.25  ? 581  GLU A CD  1 
ATOM   3709 O OE1 . GLU A 1 565  ? -1.342  9.513   28.307  1.00 88.04  ? 581  GLU A OE1 1 
ATOM   3710 O OE2 . GLU A 1 565  ? -1.078  7.381   27.818  1.00 83.41  ? 581  GLU A OE2 1 
ATOM   3711 N N   . LEU A 1 566  ? 0.772   10.569  23.204  1.00 61.39  ? 582  LEU A N   1 
ATOM   3712 C CA  . LEU A 1 566  ? 0.163   10.081  21.935  1.00 60.80  ? 582  LEU A CA  1 
ATOM   3713 C C   . LEU A 1 566  ? 1.140   9.900   20.779  1.00 65.27  ? 582  LEU A C   1 
ATOM   3714 O O   . LEU A 1 566  ? 0.723   9.549   19.667  1.00 65.38  ? 582  LEU A O   1 
ATOM   3715 C CB  . LEU A 1 566  ? -1.026  10.958  21.488  1.00 60.95  ? 582  LEU A CB  1 
ATOM   3716 C CG  . LEU A 1 566  ? -2.098  11.224  22.545  1.00 67.01  ? 582  LEU A CG  1 
ATOM   3717 C CD1 . LEU A 1 566  ? -2.835  12.502  22.269  1.00 67.31  ? 582  LEU A CD1 1 
ATOM   3718 C CD2 . LEU A 1 566  ? -3.039  10.044  22.710  1.00 70.81  ? 582  LEU A CD2 1 
ATOM   3719 N N   . LEU A 1 567  ? 2.435   10.114  21.047  1.00 62.91  ? 583  LEU A N   1 
ATOM   3720 C CA  . LEU A 1 567  ? 3.518   9.967   20.078  1.00 62.94  ? 583  LEU A CA  1 
ATOM   3721 C C   . LEU A 1 567  ? 4.043   8.534   20.065  1.00 70.30  ? 583  LEU A C   1 
ATOM   3722 O O   . LEU A 1 567  ? 4.617   8.101   19.063  1.00 70.74  ? 583  LEU A O   1 
ATOM   3723 C CB  . LEU A 1 567  ? 4.663   10.936  20.389  1.00 62.30  ? 583  LEU A CB  1 
ATOM   3724 C CG  . LEU A 1 567  ? 4.368   12.426  20.229  1.00 65.62  ? 583  LEU A CG  1 
ATOM   3725 C CD1 . LEU A 1 567  ? 5.541   13.232  20.668  1.00 65.42  ? 583  LEU A CD1 1 
ATOM   3726 C CD2 . LEU A 1 567  ? 4.035   12.787  18.813  1.00 64.55  ? 583  LEU A CD2 1 
ATOM   3727 N N   . ASP A 1 568  ? 3.811   7.804   21.170  1.00 68.27  ? 584  ASP A N   1 
ATOM   3728 C CA  . ASP A 1 568  ? 4.230   6.424   21.414  1.00 69.12  ? 584  ASP A CA  1 
ATOM   3729 C C   . ASP A 1 568  ? 3.589   5.424   20.440  1.00 73.74  ? 584  ASP A C   1 
ATOM   3730 O O   . ASP A 1 568  ? 2.456   5.650   20.026  1.00 72.73  ? 584  ASP A O   1 
ATOM   3731 C CB  . ASP A 1 568  ? 3.891   6.051   22.870  1.00 71.55  ? 584  ASP A CB  1 
ATOM   3732 C CG  . ASP A 1 568  ? 4.973   5.322   23.639  1.00 82.89  ? 584  ASP A CG  1 
ATOM   3733 O OD1 . ASP A 1 568  ? 6.024   4.982   23.026  1.00 82.20  ? 584  ASP A OD1 1 
ATOM   3734 O OD2 . ASP A 1 568  ? 4.768   5.072   24.848  1.00 91.34  ? 584  ASP A OD2 1 
ATOM   3735 N N   . PHE A 1 569  ? 4.318   4.306   20.117  1.00 72.03  ? 585  PHE A N   1 
ATOM   3736 C CA  . PHE A 1 569  ? 3.989   3.197   19.190  1.00 72.30  ? 585  PHE A CA  1 
ATOM   3737 C C   . PHE A 1 569  ? 2.577   2.600   19.325  1.00 76.08  ? 585  PHE A C   1 
ATOM   3738 O O   . PHE A 1 569  ? 2.077   2.039   18.353  1.00 76.05  ? 585  PHE A O   1 
ATOM   3739 C CB  . PHE A 1 569  ? 5.027   2.057   19.277  1.00 74.71  ? 585  PHE A CB  1 
ATOM   3740 C CG  . PHE A 1 569  ? 5.019   1.227   20.556  1.00 78.43  ? 585  PHE A CG  1 
ATOM   3741 C CD1 . PHE A 1 569  ? 4.132   0.160   20.715  1.00 83.35  ? 585  PHE A CD1 1 
ATOM   3742 C CD2 . PHE A 1 569  ? 5.943   1.465   21.570  1.00 81.13  ? 585  PHE A CD2 1 
ATOM   3743 C CE1 . PHE A 1 569  ? 4.128   -0.603  21.893  1.00 84.03  ? 585  PHE A CE1 1 
ATOM   3744 C CE2 . PHE A 1 569  ? 5.967   0.670   22.724  1.00 84.17  ? 585  PHE A CE2 1 
ATOM   3745 C CZ  . PHE A 1 569  ? 5.059   -0.355  22.877  1.00 82.59  ? 585  PHE A CZ  1 
ATOM   3746 N N   . SER A 1 570  ? 1.969   2.660   20.531  1.00 72.46  ? 586  SER A N   1 
ATOM   3747 C CA  . SER A 1 570  ? 0.633   2.107   20.800  1.00 71.77  ? 586  SER A CA  1 
ATOM   3748 C C   . SER A 1 570  ? -0.510  2.939   20.179  1.00 74.88  ? 586  SER A C   1 
ATOM   3749 O O   . SER A 1 570  ? -1.658  2.471   20.167  1.00 76.19  ? 586  SER A O   1 
ATOM   3750 C CB  . SER A 1 570  ? 0.412   1.867   22.298  1.00 73.72  ? 586  SER A CB  1 
ATOM   3751 O OG  . SER A 1 570  ? 0.743   2.982   23.106  1.00 80.84  ? 586  SER A OG  1 
ATOM   3752 N N   . PHE A 1 571  ? -0.183  4.141   19.613  1.00 67.79  ? 587  PHE A N   1 
ATOM   3753 C CA  . PHE A 1 571  ? -1.107  5.064   18.926  1.00 65.45  ? 587  PHE A CA  1 
ATOM   3754 C C   . PHE A 1 571  ? -0.642  5.218   17.463  1.00 72.80  ? 587  PHE A C   1 
ATOM   3755 O O   . PHE A 1 571  ? -0.152  6.291   17.086  1.00 72.67  ? 587  PHE A O   1 
ATOM   3756 C CB  . PHE A 1 571  ? -1.172  6.420   19.649  1.00 65.28  ? 587  PHE A CB  1 
ATOM   3757 C CG  . PHE A 1 571  ? -1.450  6.311   21.133  1.00 65.42  ? 587  PHE A CG  1 
ATOM   3758 C CD1 . PHE A 1 571  ? -2.752  6.224   21.608  1.00 66.90  ? 587  PHE A CD1 1 
ATOM   3759 C CD2 . PHE A 1 571  ? -0.411  6.298   22.053  1.00 66.53  ? 587  PHE A CD2 1 
ATOM   3760 C CE1 . PHE A 1 571  ? -3.009  6.102   22.968  1.00 67.16  ? 587  PHE A CE1 1 
ATOM   3761 C CE2 . PHE A 1 571  ? -0.673  6.206   23.417  1.00 69.12  ? 587  PHE A CE2 1 
ATOM   3762 C CZ  . PHE A 1 571  ? -1.970  6.102   23.863  1.00 67.04  ? 587  PHE A CZ  1 
ATOM   3763 N N   . PRO A 1 572  ? -0.734  4.134   16.630  1.00 71.29  ? 588  PRO A N   1 
ATOM   3764 C CA  . PRO A 1 572  ? -0.227  4.229   15.248  1.00 71.22  ? 588  PRO A CA  1 
ATOM   3765 C C   . PRO A 1 572  ? -1.075  5.027   14.270  1.00 77.09  ? 588  PRO A C   1 
ATOM   3766 O O   . PRO A 1 572  ? -0.563  5.348   13.194  1.00 78.56  ? 588  PRO A O   1 
ATOM   3767 C CB  . PRO A 1 572  ? -0.171  2.775   14.805  1.00 72.87  ? 588  PRO A CB  1 
ATOM   3768 C CG  . PRO A 1 572  ? -1.267  2.126   15.568  1.00 76.74  ? 588  PRO A CG  1 
ATOM   3769 C CD  . PRO A 1 572  ? -1.266  2.777   16.906  1.00 72.11  ? 588  PRO A CD  1 
ATOM   3770 N N   . ASP A 1 573  ? -2.353  5.325   14.598  1.00 72.29  ? 589  ASP A N   1 
ATOM   3771 C CA  . ASP A 1 573  ? -3.190  6.060   13.663  1.00 71.60  ? 589  ASP A CA  1 
ATOM   3772 C C   . ASP A 1 573  ? -2.632  7.433   13.312  1.00 78.00  ? 589  ASP A C   1 
ATOM   3773 O O   . ASP A 1 573  ? -2.272  8.200   14.193  1.00 78.81  ? 589  ASP A O   1 
ATOM   3774 C CB  . ASP A 1 573  ? -4.638  6.147   14.126  1.00 72.36  ? 589  ASP A CB  1 
ATOM   3775 C CG  . ASP A 1 573  ? -5.553  6.227   12.928  1.00 74.46  ? 589  ASP A CG  1 
ATOM   3776 O OD1 . ASP A 1 573  ? -5.818  7.363   12.457  1.00 71.75  ? 589  ASP A OD1 1 
ATOM   3777 O OD2 . ASP A 1 573  ? -5.891  5.154   12.371  1.00 79.57  ? 589  ASP A OD2 1 
ATOM   3778 N N   . CYS A 1 574  ? -2.530  7.721   12.023  1.00 76.31  ? 590  CYS A N   1 
ATOM   3779 C CA  . CYS A 1 574  ? -2.001  8.980   11.515  1.00 78.40  ? 590  CYS A CA  1 
ATOM   3780 C C   . CYS A 1 574  ? -2.824  10.191  11.935  1.00 82.07  ? 590  CYS A C   1 
ATOM   3781 O O   . CYS A 1 574  ? -2.296  11.310  11.985  1.00 81.83  ? 590  CYS A O   1 
ATOM   3782 C CB  . CYS A 1 574  ? -1.841  8.912   10.004  1.00 80.46  ? 590  CYS A CB  1 
ATOM   3783 S SG  . CYS A 1 574  ? -3.338  8.376   9.142   1.00 85.55  ? 590  CYS A SG  1 
ATOM   3784 N N   . HIS A 1 575  ? -4.116  9.974   12.228  1.00 78.32  ? 591  HIS A N   1 
ATOM   3785 C CA  . HIS A 1 575  ? -4.998  11.047  12.696  1.00 77.78  ? 591  HIS A CA  1 
ATOM   3786 C C   . HIS A 1 575  ? -4.614  11.384  14.146  1.00 77.64  ? 591  HIS A C   1 
ATOM   3787 O O   . HIS A 1 575  ? -4.683  12.550  14.548  1.00 76.71  ? 591  HIS A O   1 
ATOM   3788 C CB  . HIS A 1 575  ? -6.486  10.653  12.542  1.00 78.97  ? 591  HIS A CB  1 
ATOM   3789 C CG  . HIS A 1 575  ? -6.930  10.545  11.108  1.00 83.20  ? 591  HIS A CG  1 
ATOM   3790 N ND1 . HIS A 1 575  ? -6.992  9.315   10.455  1.00 85.41  ? 591  HIS A ND1 1 
ATOM   3791 C CD2 . HIS A 1 575  ? -7.261  11.523  10.224  1.00 85.27  ? 591  HIS A CD2 1 
ATOM   3792 C CE1 . HIS A 1 575  ? -7.381  9.583   9.213   1.00 84.71  ? 591  HIS A CE1 1 
ATOM   3793 N NE2 . HIS A 1 575  ? -7.547  10.897  9.023   1.00 85.08  ? 591  HIS A NE2 1 
ATOM   3794 N N   . VAL A 1 576  ? -4.135  10.357  14.898  1.00 70.87  ? 592  VAL A N   1 
ATOM   3795 C CA  . VAL A 1 576  ? -3.695  10.514  16.277  1.00 69.64  ? 592  VAL A CA  1 
ATOM   3796 C C   . VAL A 1 576  ? -2.427  11.344  16.332  1.00 73.51  ? 592  VAL A C   1 
ATOM   3797 O O   . VAL A 1 576  ? -2.371  12.309  17.098  1.00 72.29  ? 592  VAL A O   1 
ATOM   3798 C CB  . VAL A 1 576  ? -3.594  9.179   17.052  1.00 72.71  ? 592  VAL A CB  1 
ATOM   3799 C CG1 . VAL A 1 576  ? -3.086  9.410   18.478  1.00 73.00  ? 592  VAL A CG1 1 
ATOM   3800 C CG2 . VAL A 1 576  ? -4.944  8.474   17.089  1.00 71.99  ? 592  VAL A CG2 1 
ATOM   3801 N N   . GLY A 1 577  ? -1.465  10.998  15.469  1.00 71.26  ? 593  GLY A N   1 
ATOM   3802 C CA  . GLY A 1 577  ? -0.185  11.689  15.324  1.00 71.15  ? 593  GLY A CA  1 
ATOM   3803 C C   . GLY A 1 577  ? -0.357  13.149  14.950  1.00 73.50  ? 593  GLY A C   1 
ATOM   3804 O O   . GLY A 1 577  ? 0.333   14.034  15.473  1.00 72.31  ? 593  GLY A O   1 
ATOM   3805 N N   . SER A 1 578  ? -1.344  13.397  14.098  1.00 69.58  ? 594  SER A N   1 
ATOM   3806 C CA  . SER A 1 578  ? -1.701  14.721  13.636  1.00 69.34  ? 594  SER A CA  1 
ATOM   3807 C C   . SER A 1 578  ? -2.190  15.559  14.789  1.00 70.59  ? 594  SER A C   1 
ATOM   3808 O O   . SER A 1 578  ? -1.775  16.712  14.889  1.00 71.99  ? 594  SER A O   1 
ATOM   3809 C CB  . SER A 1 578  ? -2.756  14.632  12.539  1.00 75.01  ? 594  SER A CB  1 
ATOM   3810 O OG  . SER A 1 578  ? -2.653  15.730  11.649  1.00 87.91  ? 594  SER A OG  1 
ATOM   3811 N N   . PHE A 1 579  ? -3.019  14.976  15.692  1.00 63.73  ? 595  PHE A N   1 
ATOM   3812 C CA  . PHE A 1 579  ? -3.548  15.663  16.880  1.00 61.68  ? 595  PHE A CA  1 
ATOM   3813 C C   . PHE A 1 579  ? -2.392  15.938  17.862  1.00 63.38  ? 595  PHE A C   1 
ATOM   3814 O O   . PHE A 1 579  ? -2.251  17.043  18.380  1.00 61.42  ? 595  PHE A O   1 
ATOM   3815 C CB  . PHE A 1 579  ? -4.677  14.821  17.530  1.00 63.07  ? 595  PHE A CB  1 
ATOM   3816 C CG  . PHE A 1 579  ? -5.322  15.455  18.743  1.00 64.38  ? 595  PHE A CG  1 
ATOM   3817 C CD1 . PHE A 1 579  ? -4.800  15.247  20.019  1.00 67.72  ? 595  PHE A CD1 1 
ATOM   3818 C CD2 . PHE A 1 579  ? -6.418  16.291  18.608  1.00 66.60  ? 595  PHE A CD2 1 
ATOM   3819 C CE1 . PHE A 1 579  ? -5.337  15.903  21.133  1.00 69.25  ? 595  PHE A CE1 1 
ATOM   3820 C CE2 . PHE A 1 579  ? -6.972  16.929  19.724  1.00 70.37  ? 595  PHE A CE2 1 
ATOM   3821 C CZ  . PHE A 1 579  ? -6.432  16.727  20.982  1.00 68.81  ? 595  PHE A CZ  1 
ATOM   3822 N N   . ALA A 1 580  ? -1.549  14.929  18.081  1.00 61.21  ? 596  ALA A N   1 
ATOM   3823 C CA  . ALA A 1 580  ? -0.388  15.024  18.958  1.00 61.47  ? 596  ALA A CA  1 
ATOM   3824 C C   . ALA A 1 580  ? 0.542   16.213  18.580  1.00 64.84  ? 596  ALA A C   1 
ATOM   3825 O O   . ALA A 1 580  ? 0.895   16.985  19.481  1.00 65.05  ? 596  ALA A O   1 
ATOM   3826 C CB  . ALA A 1 580  ? 0.376   13.710  18.952  1.00 62.05  ? 596  ALA A CB  1 
ATOM   3827 N N   . ILE A 1 581  ? 0.908   16.371  17.261  1.00 58.50  ? 597  ILE A N   1 
ATOM   3828 C CA  . ILE A 1 581  ? 1.760   17.479  16.756  1.00 56.54  ? 597  ILE A CA  1 
ATOM   3829 C C   . ILE A 1 581  ? 1.037   18.829  16.933  1.00 61.27  ? 597  ILE A C   1 
ATOM   3830 O O   . ILE A 1 581  ? 1.653   19.789  17.395  1.00 61.57  ? 597  ILE A O   1 
ATOM   3831 C CB  . ILE A 1 581  ? 2.257   17.287  15.280  1.00 58.16  ? 597  ILE A CB  1 
ATOM   3832 C CG1 . ILE A 1 581  ? 3.044   15.956  15.040  1.00 57.31  ? 597  ILE A CG1 1 
ATOM   3833 C CG2 . ILE A 1 581  ? 3.051   18.485  14.787  1.00 57.26  ? 597  ILE A CG2 1 
ATOM   3834 C CD1 . ILE A 1 581  ? 4.073   15.522  16.060  1.00 52.06  ? 597  ILE A CD1 1 
ATOM   3835 N N   . LYS A 1 582  ? -0.266  18.889  16.578  1.00 57.68  ? 598  LYS A N   1 
ATOM   3836 C CA  . LYS A 1 582  ? -1.143  20.064  16.665  1.00 57.14  ? 598  LYS A CA  1 
ATOM   3837 C C   . LYS A 1 582  ? -1.052  20.664  18.057  1.00 63.55  ? 598  LYS A C   1 
ATOM   3838 O O   . LYS A 1 582  ? -0.781  21.856  18.180  1.00 65.86  ? 598  LYS A O   1 
ATOM   3839 C CB  . LYS A 1 582  ? -2.571  19.637  16.326  1.00 59.08  ? 598  LYS A CB  1 
ATOM   3840 C CG  . LYS A 1 582  ? -3.482  20.725  15.828  1.00 71.66  ? 598  LYS A CG  1 
ATOM   3841 C CD  . LYS A 1 582  ? -4.783  20.121  15.286  1.00 84.67  ? 598  LYS A CD  1 
ATOM   3842 C CE  . LYS A 1 582  ? -5.795  19.774  16.364  1.00 98.90  ? 598  LYS A CE  1 
ATOM   3843 N NZ  . LYS A 1 582  ? -6.957  19.029  15.814  1.00 111.74 ? 598  LYS A NZ  1 
ATOM   3844 N N   . SER A 1 583  ? -1.142  19.819  19.103  1.00 60.37  ? 599  SER A N   1 
ATOM   3845 C CA  . SER A 1 583  ? -0.991  20.227  20.510  1.00 60.28  ? 599  SER A CA  1 
ATOM   3846 C C   . SER A 1 583  ? 0.470   20.531  20.914  1.00 63.46  ? 599  SER A C   1 
ATOM   3847 O O   . SER A 1 583  ? 0.694   21.277  21.863  1.00 66.24  ? 599  SER A O   1 
ATOM   3848 C CB  . SER A 1 583  ? -1.596  19.181  21.437  1.00 63.09  ? 599  SER A CB  1 
ATOM   3849 O OG  . SER A 1 583  ? -3.012  19.177  21.338  1.00 72.77  ? 599  SER A OG  1 
ATOM   3850 N N   . LEU A 1 584  ? 1.451   19.975  20.196  1.00 56.30  ? 600  LEU A N   1 
ATOM   3851 C CA  . LEU A 1 584  ? 2.864   20.216  20.454  1.00 55.78  ? 600  LEU A CA  1 
ATOM   3852 C C   . LEU A 1 584  ? 3.366   21.485  19.797  1.00 58.57  ? 600  LEU A C   1 
ATOM   3853 O O   . LEU A 1 584  ? 4.499   21.882  20.037  1.00 58.06  ? 600  LEU A O   1 
ATOM   3854 C CB  . LEU A 1 584  ? 3.709   19.017  19.980  1.00 56.38  ? 600  LEU A CB  1 
ATOM   3855 C CG  . LEU A 1 584  ? 3.888   17.813  20.932  1.00 60.72  ? 600  LEU A CG  1 
ATOM   3856 C CD1 . LEU A 1 584  ? 5.091   17.047  20.528  1.00 61.31  ? 600  LEU A CD1 1 
ATOM   3857 C CD2 . LEU A 1 584  ? 4.023   18.228  22.424  1.00 58.77  ? 600  LEU A CD2 1 
ATOM   3858 N N   . ARG A 1 585  ? 2.540   22.122  18.955  1.00 55.63  ? 601  ARG A N   1 
ATOM   3859 C CA  . ARG A 1 585  ? 2.871   23.363  18.244  1.00 53.89  ? 601  ARG A CA  1 
ATOM   3860 C C   . ARG A 1 585  ? 2.925   24.628  19.163  1.00 55.08  ? 601  ARG A C   1 
ATOM   3861 O O   . ARG A 1 585  ? 3.375   25.695  18.729  1.00 54.67  ? 601  ARG A O   1 
ATOM   3862 C CB  . ARG A 1 585  ? 1.918   23.558  17.067  1.00 49.57  ? 601  ARG A CB  1 
ATOM   3863 C CG  . ARG A 1 585  ? 2.297   22.746  15.876  1.00 52.76  ? 601  ARG A CG  1 
ATOM   3864 C CD  . ARG A 1 585  ? 1.711   23.305  14.597  1.00 66.58  ? 601  ARG A CD  1 
ATOM   3865 N NE  . ARG A 1 585  ? 1.358   22.239  13.660  1.00 81.83  ? 601  ARG A NE  1 
ATOM   3866 C CZ  . ARG A 1 585  ? 2.181   21.736  12.740  1.00 103.91 ? 601  ARG A CZ  1 
ATOM   3867 N NH1 . ARG A 1 585  ? 3.421   22.217  12.605  1.00 75.14  ? 601  ARG A NH1 1 
ATOM   3868 N NH2 . ARG A 1 585  ? 1.769   20.761  11.937  1.00 102.05 ? 601  ARG A NH2 1 
ATOM   3869 N N   . LYS A 1 586  ? 2.485   24.491  20.421  1.00 49.12  ? 602  LYS A N   1 
ATOM   3870 C CA  . LYS A 1 586  ? 2.492   25.556  21.436  1.00 48.01  ? 602  LYS A CA  1 
ATOM   3871 C C   . LYS A 1 586  ? 3.877   25.659  22.085  1.00 53.54  ? 602  LYS A C   1 
ATOM   3872 O O   . LYS A 1 586  ? 4.158   26.638  22.758  1.00 54.08  ? 602  LYS A O   1 
ATOM   3873 C CB  . LYS A 1 586  ? 1.486   25.246  22.552  1.00 48.87  ? 602  LYS A CB  1 
ATOM   3874 C CG  . LYS A 1 586  ? 0.200   24.531  22.124  1.00 67.81  ? 602  LYS A CG  1 
ATOM   3875 C CD  . LYS A 1 586  ? -0.879  24.585  23.226  1.00 73.59  ? 602  LYS A CD  1 
ATOM   3876 C CE  . LYS A 1 586  ? -0.780  23.536  24.299  1.00 72.03  ? 602  LYS A CE  1 
ATOM   3877 N NZ  . LYS A 1 586  ? -1.123  22.194  23.776  1.00 80.93  ? 602  LYS A NZ  1 
ATOM   3878 N N   . LEU A 1 587  ? 4.716   24.632  21.922  1.00 51.65  ? 603  LEU A N   1 
ATOM   3879 C CA  . LEU A 1 587  ? 6.035   24.513  22.526  1.00 52.78  ? 603  LEU A CA  1 
ATOM   3880 C C   . LEU A 1 587  ? 6.963   25.686  22.191  1.00 58.06  ? 603  LEU A C   1 
ATOM   3881 O O   . LEU A 1 587  ? 7.174   25.993  21.020  1.00 58.96  ? 603  LEU A O   1 
ATOM   3882 C CB  . LEU A 1 587  ? 6.708   23.169  22.102  1.00 53.26  ? 603  LEU A CB  1 
ATOM   3883 C CG  . LEU A 1 587  ? 6.267   21.830  22.788  1.00 57.95  ? 603  LEU A CG  1 
ATOM   3884 C CD1 . LEU A 1 587  ? 6.845   20.625  22.067  1.00 57.97  ? 603  LEU A CD1 1 
ATOM   3885 C CD2 . LEU A 1 587  ? 6.736   21.733  24.202  1.00 59.04  ? 603  LEU A CD2 1 
ATOM   3886 N N   . THR A 1 588  ? 7.538   26.332  23.215  1.00 52.95  ? 604  THR A N   1 
ATOM   3887 C CA  . THR A 1 588  ? 8.539   27.374  22.979  1.00 51.37  ? 604  THR A CA  1 
ATOM   3888 C C   . THR A 1 588  ? 9.798   26.629  22.597  1.00 56.94  ? 604  THR A C   1 
ATOM   3889 O O   . THR A 1 588  ? 10.024  25.517  23.078  1.00 56.83  ? 604  THR A O   1 
ATOM   3890 C CB  . THR A 1 588  ? 8.823   28.181  24.244  1.00 52.60  ? 604  THR A CB  1 
ATOM   3891 O OG1 . THR A 1 588  ? 9.034   27.296  25.335  1.00 56.76  ? 604  THR A OG1 1 
ATOM   3892 C CG2 . THR A 1 588  ? 7.710   29.099  24.605  1.00 47.15  ? 604  THR A CG2 1 
ATOM   3893 N N   . ASP A 1 589  ? 10.633  27.223  21.752  1.00 55.56  ? 605  ASP A N   1 
ATOM   3894 C CA  . ASP A 1 589  ? 11.914  26.624  21.360  1.00 54.79  ? 605  ASP A CA  1 
ATOM   3895 C C   . ASP A 1 589  ? 12.645  26.045  22.569  1.00 58.74  ? 605  ASP A C   1 
ATOM   3896 O O   . ASP A 1 589  ? 13.172  24.946  22.482  1.00 57.77  ? 605  ASP A O   1 
ATOM   3897 C CB  . ASP A 1 589  ? 12.788  27.657  20.645  1.00 55.96  ? 605  ASP A CB  1 
ATOM   3898 C CG  . ASP A 1 589  ? 12.385  27.971  19.217  1.00 61.67  ? 605  ASP A CG  1 
ATOM   3899 O OD1 . ASP A 1 589  ? 11.475  27.267  18.676  1.00 61.74  ? 605  ASP A OD1 1 
ATOM   3900 O OD2 . ASP A 1 589  ? 12.971  28.921  18.633  1.00 60.63  ? 605  ASP A OD2 1 
ATOM   3901 N N   . ASP A 1 590  ? 12.578  26.731  23.720  1.00 57.67  ? 606  ASP A N   1 
ATOM   3902 C CA  . ASP A 1 590  ? 13.211  26.282  24.954  1.00 58.79  ? 606  ASP A CA  1 
ATOM   3903 C C   . ASP A 1 590  ? 12.730  24.907  25.480  1.00 64.26  ? 606  ASP A C   1 
ATOM   3904 O O   . ASP A 1 590  ? 13.584  24.034  25.741  1.00 64.76  ? 606  ASP A O   1 
ATOM   3905 C CB  . ASP A 1 590  ? 13.107  27.355  26.024  1.00 60.92  ? 606  ASP A CB  1 
ATOM   3906 C CG  . ASP A 1 590  ? 14.203  28.388  25.824  1.00 77.16  ? 606  ASP A CG  1 
ATOM   3907 O OD1 . ASP A 1 590  ? 15.085  28.156  24.965  1.00 76.02  ? 606  ASP A OD1 1 
ATOM   3908 O OD2 . ASP A 1 590  ? 14.199  29.417  26.551  1.00 87.90  ? 606  ASP A OD2 1 
ATOM   3909 N N   . GLU A 1 591  ? 11.390  24.702  25.591  1.00 58.11  ? 607  GLU A N   1 
ATOM   3910 C CA  . GLU A 1 591  ? 10.807  23.449  26.079  1.00 56.30  ? 607  GLU A CA  1 
ATOM   3911 C C   . GLU A 1 591  ? 10.975  22.344  25.050  1.00 62.13  ? 607  GLU A C   1 
ATOM   3912 O O   . GLU A 1 591  ? 11.114  21.183  25.412  1.00 62.53  ? 607  GLU A O   1 
ATOM   3913 C CB  . GLU A 1 591  ? 9.337   23.667  26.394  1.00 57.25  ? 607  GLU A CB  1 
ATOM   3914 C CG  . GLU A 1 591  ? 8.657   22.562  27.183  1.00 64.59  ? 607  GLU A CG  1 
ATOM   3915 C CD  . GLU A 1 591  ? 7.216   22.866  27.549  1.00 84.11  ? 607  GLU A CD  1 
ATOM   3916 O OE1 . GLU A 1 591  ? 6.713   23.957  27.183  1.00 65.24  ? 607  GLU A OE1 1 
ATOM   3917 O OE2 . GLU A 1 591  ? 6.580   21.994  28.182  1.00 84.54  ? 607  GLU A OE2 1 
ATOM   3918 N N   . LEU A 1 592  ? 10.944  22.707  23.756  1.00 59.48  ? 608  LEU A N   1 
ATOM   3919 C CA  . LEU A 1 592  ? 11.114  21.788  22.633  1.00 57.76  ? 608  LEU A CA  1 
ATOM   3920 C C   . LEU A 1 592  ? 12.495  21.150  22.694  1.00 61.79  ? 608  LEU A C   1 
ATOM   3921 O O   . LEU A 1 592  ? 12.607  19.931  22.626  1.00 62.59  ? 608  LEU A O   1 
ATOM   3922 C CB  . LEU A 1 592  ? 10.897  22.539  21.308  1.00 56.71  ? 608  LEU A CB  1 
ATOM   3923 C CG  . LEU A 1 592  ? 11.240  21.770  20.063  1.00 59.46  ? 608  LEU A CG  1 
ATOM   3924 C CD1 . LEU A 1 592  ? 10.277  20.634  19.839  1.00 58.94  ? 608  LEU A CD1 1 
ATOM   3925 C CD2 . LEU A 1 592  ? 11.220  22.662  18.905  1.00 60.38  ? 608  LEU A CD2 1 
ATOM   3926 N N   . PHE A 1 593  ? 13.535  21.968  22.899  1.00 58.43  ? 609  PHE A N   1 
ATOM   3927 C CA  . PHE A 1 593  ? 14.913  21.506  23.033  1.00 58.01  ? 609  PHE A CA  1 
ATOM   3928 C C   . PHE A 1 593  ? 15.047  20.436  24.124  1.00 59.52  ? 609  PHE A C   1 
ATOM   3929 O O   . PHE A 1 593  ? 15.854  19.537  23.988  1.00 61.05  ? 609  PHE A O   1 
ATOM   3930 C CB  . PHE A 1 593  ? 15.846  22.686  23.319  1.00 60.02  ? 609  PHE A CB  1 
ATOM   3931 C CG  . PHE A 1 593  ? 17.289  22.258  23.423  1.00 62.51  ? 609  PHE A CG  1 
ATOM   3932 C CD1 . PHE A 1 593  ? 18.019  21.932  22.283  1.00 66.48  ? 609  PHE A CD1 1 
ATOM   3933 C CD2 . PHE A 1 593  ? 17.909  22.142  24.663  1.00 65.35  ? 609  PHE A CD2 1 
ATOM   3934 C CE1 . PHE A 1 593  ? 19.350  21.508  22.383  1.00 67.78  ? 609  PHE A CE1 1 
ATOM   3935 C CE2 . PHE A 1 593  ? 19.241  21.722  24.764  1.00 68.62  ? 609  PHE A CE2 1 
ATOM   3936 C CZ  . PHE A 1 593  ? 19.955  21.405  23.624  1.00 66.91  ? 609  PHE A CZ  1 
ATOM   3937 N N   . GLN A 1 594  ? 14.264  20.548  25.201  1.00 53.51  ? 610  GLN A N   1 
ATOM   3938 C CA  . GLN A 1 594  ? 14.245  19.617  26.318  1.00 51.62  ? 610  GLN A CA  1 
ATOM   3939 C C   . GLN A 1 594  ? 13.714  18.229  25.933  1.00 56.27  ? 610  GLN A C   1 
ATOM   3940 O O   . GLN A 1 594  ? 14.131  17.247  26.547  1.00 56.71  ? 610  GLN A O   1 
ATOM   3941 C CB  . GLN A 1 594  ? 13.489  20.217  27.505  1.00 52.00  ? 610  GLN A CB  1 
ATOM   3942 C CG  . GLN A 1 594  ? 14.313  20.199  28.802  1.00 67.64  ? 610  GLN A CG  1 
ATOM   3943 C CD  . GLN A 1 594  ? 15.209  21.399  29.020  1.00 94.63  ? 610  GLN A CD  1 
ATOM   3944 O OE1 . GLN A 1 594  ? 14.773  22.556  28.935  1.00 97.85  ? 610  GLN A OE1 1 
ATOM   3945 N NE2 . GLN A 1 594  ? 16.464  21.152  29.407  1.00 82.18  ? 610  GLN A NE2 1 
ATOM   3946 N N   . TYR A 1 595  ? 12.872  18.132  24.876  1.00 52.15  ? 611  TYR A N   1 
ATOM   3947 C CA  . TYR A 1 595  ? 12.279  16.867  24.428  1.00 51.46  ? 611  TYR A CA  1 
ATOM   3948 C C   . TYR A 1 595  ? 12.801  16.386  23.107  1.00 54.37  ? 611  TYR A C   1 
ATOM   3949 O O   . TYR A 1 595  ? 12.424  15.283  22.679  1.00 53.61  ? 611  TYR A O   1 
ATOM   3950 C CB  . TYR A 1 595  ? 10.744  16.976  24.343  1.00 53.38  ? 611  TYR A CB  1 
ATOM   3951 C CG  . TYR A 1 595  ? 10.105  17.650  25.536  1.00 56.09  ? 611  TYR A CG  1 
ATOM   3952 C CD1 . TYR A 1 595  ? 10.587  17.436  26.831  1.00 57.24  ? 611  TYR A CD1 1 
ATOM   3953 C CD2 . TYR A 1 595  ? 8.986   18.457  25.383  1.00 57.53  ? 611  TYR A CD2 1 
ATOM   3954 C CE1 . TYR A 1 595  ? 10.025  18.074  27.926  1.00 56.46  ? 611  TYR A CE1 1 
ATOM   3955 C CE2 . TYR A 1 595  ? 8.414   19.102  26.475  1.00 59.33  ? 611  TYR A CE2 1 
ATOM   3956 C CZ  . TYR A 1 595  ? 8.943   18.910  27.742  1.00 63.77  ? 611  TYR A CZ  1 
ATOM   3957 O OH  . TYR A 1 595  ? 8.404   19.563  28.804  1.00 65.04  ? 611  TYR A OH  1 
ATOM   3958 N N   . LEU A 1 596  ? 13.656  17.213  22.444  1.00 50.02  ? 612  LEU A N   1 
ATOM   3959 C CA  . LEU A 1 596  ? 14.223  16.930  21.122  1.00 49.30  ? 612  LEU A CA  1 
ATOM   3960 C C   . LEU A 1 596  ? 14.707  15.446  20.940  1.00 55.71  ? 612  LEU A C   1 
ATOM   3961 O O   . LEU A 1 596  ? 14.278  14.759  19.981  1.00 54.74  ? 612  LEU A O   1 
ATOM   3962 C CB  . LEU A 1 596  ? 15.333  17.945  20.795  1.00 48.24  ? 612  LEU A CB  1 
ATOM   3963 C CG  . LEU A 1 596  ? 15.692  18.142  19.296  1.00 50.02  ? 612  LEU A CG  1 
ATOM   3964 C CD1 . LEU A 1 596  ? 14.457  18.339  18.436  1.00 47.63  ? 612  LEU A CD1 1 
ATOM   3965 C CD2 . LEU A 1 596  ? 16.619  19.325  19.131  1.00 50.92  ? 612  LEU A CD2 1 
ATOM   3966 N N   . LEU A 1 597  ? 15.531  14.947  21.904  1.00 51.00  ? 613  LEU A N   1 
ATOM   3967 C CA  . LEU A 1 597  ? 16.014  13.578  21.849  1.00 50.49  ? 613  LEU A CA  1 
ATOM   3968 C C   . LEU A 1 597  ? 14.871  12.577  21.799  1.00 55.52  ? 613  LEU A C   1 
ATOM   3969 O O   . LEU A 1 597  ? 14.955  11.647  21.011  1.00 56.64  ? 613  LEU A O   1 
ATOM   3970 C CB  . LEU A 1 597  ? 16.991  13.275  22.998  1.00 50.41  ? 613  LEU A CB  1 
ATOM   3971 C CG  . LEU A 1 597  ? 17.351  11.817  23.265  1.00 54.43  ? 613  LEU A CG  1 
ATOM   3972 C CD1 . LEU A 1 597  ? 17.977  11.162  22.032  1.00 55.49  ? 613  LEU A CD1 1 
ATOM   3973 C CD2 . LEU A 1 597  ? 18.257  11.712  24.454  1.00 54.42  ? 613  LEU A CD2 1 
ATOM   3974 N N   . GLN A 1 598  ? 13.803  12.762  22.596  1.00 51.41  ? 614  GLN A N   1 
ATOM   3975 C CA  . GLN A 1 598  ? 12.676  11.832  22.539  1.00 51.25  ? 614  GLN A CA  1 
ATOM   3976 C C   . GLN A 1 598  ? 11.949  11.917  21.225  1.00 54.93  ? 614  GLN A C   1 
ATOM   3977 O O   . GLN A 1 598  ? 11.752  10.888  20.588  1.00 55.62  ? 614  GLN A O   1 
ATOM   3978 C CB  . GLN A 1 598  ? 11.729  11.979  23.733  1.00 52.93  ? 614  GLN A CB  1 
ATOM   3979 C CG  . GLN A 1 598  ? 12.338  11.437  25.042  1.00 63.56  ? 614  GLN A CG  1 
ATOM   3980 C CD  . GLN A 1 598  ? 13.388  12.344  25.631  1.00 69.90  ? 614  GLN A CD  1 
ATOM   3981 O OE1 . GLN A 1 598  ? 13.330  13.558  25.521  1.00 63.67  ? 614  GLN A OE1 1 
ATOM   3982 N NE2 . GLN A 1 598  ? 14.387  11.776  26.237  1.00 70.06  ? 614  GLN A NE2 1 
ATOM   3983 N N   . LEU A 1 599  ? 11.662  13.139  20.762  1.00 51.23  ? 615  LEU A N   1 
ATOM   3984 C CA  . LEU A 1 599  ? 11.009  13.376  19.483  1.00 51.90  ? 615  LEU A CA  1 
ATOM   3985 C C   . LEU A 1 599  ? 11.746  12.737  18.295  1.00 54.74  ? 615  LEU A C   1 
ATOM   3986 O O   . LEU A 1 599  ? 11.109  12.072  17.505  1.00 54.43  ? 615  LEU A O   1 
ATOM   3987 C CB  . LEU A 1 599  ? 10.745  14.879  19.270  1.00 53.00  ? 615  LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 599  ? 9.771   15.509  20.284  1.00 59.04  ? 615  LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 599  ? 9.865   17.016  20.297  1.00 59.91  ? 615  LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 599  ? 8.357   15.025  20.094  1.00 58.97  ? 615  LEU A CD2 1 
ATOM   3991 N N   . VAL A 1 600  ? 13.068  12.860  18.200  1.00 53.30  ? 616  VAL A N   1 
ATOM   3992 C CA  . VAL A 1 600  ? 13.862  12.174  17.152  1.00 53.44  ? 616  VAL A CA  1 
ATOM   3993 C C   . VAL A 1 600  ? 13.666  10.638  17.229  1.00 59.07  ? 616  VAL A C   1 
ATOM   3994 O O   . VAL A 1 600  ? 13.388  9.992   16.201  1.00 58.67  ? 616  VAL A O   1 
ATOM   3995 C CB  . VAL A 1 600  ? 15.354  12.562  17.237  1.00 56.10  ? 616  VAL A CB  1 
ATOM   3996 C CG1 . VAL A 1 600  ? 16.224  11.634  16.407  1.00 54.85  ? 616  VAL A CG1 1 
ATOM   3997 C CG2 . VAL A 1 600  ? 15.553  14.017  16.818  1.00 56.07  ? 616  VAL A CG2 1 
ATOM   3998 N N   . GLN A 1 601  ? 13.744  10.080  18.465  1.00 55.66  ? 617  GLN A N   1 
ATOM   3999 C CA  . GLN A 1 601  ? 13.591  8.645   18.744  1.00 55.37  ? 617  GLN A CA  1 
ATOM   4000 C C   . GLN A 1 601  ? 12.280  8.054   18.256  1.00 59.70  ? 617  GLN A C   1 
ATOM   4001 O O   . GLN A 1 601  ? 12.274  6.960   17.688  1.00 58.72  ? 617  GLN A O   1 
ATOM   4002 C CB  . GLN A 1 601  ? 13.812  8.336   20.234  1.00 56.42  ? 617  GLN A CB  1 
ATOM   4003 C CG  . GLN A 1 601  ? 15.289  8.428   20.684  1.00 53.80  ? 617  GLN A CG  1 
ATOM   4004 C CD  . GLN A 1 601  ? 16.263  7.699   19.781  1.00 68.56  ? 617  GLN A CD  1 
ATOM   4005 O OE1 . GLN A 1 601  ? 16.099  6.519   19.469  1.00 64.85  ? 617  GLN A OE1 1 
ATOM   4006 N NE2 . GLN A 1 601  ? 17.300  8.389   19.331  1.00 58.23  ? 617  GLN A NE2 1 
ATOM   4007 N N   . VAL A 1 602  ? 11.188  8.810   18.425  1.00 57.60  ? 618  VAL A N   1 
ATOM   4008 C CA  . VAL A 1 602  ? 9.819   8.470   18.025  1.00 57.50  ? 618  VAL A CA  1 
ATOM   4009 C C   . VAL A 1 602  ? 9.683   8.355   16.472  1.00 63.24  ? 618  VAL A C   1 
ATOM   4010 O O   . VAL A 1 602  ? 8.788   7.649   15.988  1.00 61.76  ? 618  VAL A O   1 
ATOM   4011 C CB  . VAL A 1 602  ? 8.857   9.479   18.700  1.00 61.03  ? 618  VAL A CB  1 
ATOM   4012 C CG1 . VAL A 1 602  ? 7.471   9.491   18.074  1.00 61.69  ? 618  VAL A CG1 1 
ATOM   4013 C CG2 . VAL A 1 602  ? 8.753   9.182   20.176  1.00 60.34  ? 618  VAL A CG2 1 
ATOM   4014 N N   . LEU A 1 603  ? 10.617  8.962   15.699  1.00 61.44  ? 619  LEU A N   1 
ATOM   4015 C CA  . LEU A 1 603  ? 10.607  8.813   14.233  1.00 61.92  ? 619  LEU A CA  1 
ATOM   4016 C C   . LEU A 1 603  ? 10.793  7.331   13.853  1.00 66.32  ? 619  LEU A C   1 
ATOM   4017 O O   . LEU A 1 603  ? 10.412  6.930   12.763  1.00 67.72  ? 619  LEU A O   1 
ATOM   4018 C CB  . LEU A 1 603  ? 11.717  9.656   13.543  1.00 62.06  ? 619  LEU A CB  1 
ATOM   4019 C CG  . LEU A 1 603  ? 11.590  11.199  13.523  1.00 65.55  ? 619  LEU A CG  1 
ATOM   4020 C CD1 . LEU A 1 603  ? 12.928  11.839  13.285  1.00 64.95  ? 619  LEU A CD1 1 
ATOM   4021 C CD2 . LEU A 1 603  ? 10.651  11.668  12.435  1.00 66.64  ? 619  LEU A CD2 1 
ATOM   4022 N N   . LYS A 1 604  ? 11.368  6.527   14.750  1.00 62.41  ? 620  LYS A N   1 
ATOM   4023 C CA  . LYS A 1 604  ? 11.621  5.105   14.527  1.00 62.00  ? 620  LYS A CA  1 
ATOM   4024 C C   . LYS A 1 604  ? 10.339  4.272   14.591  1.00 66.53  ? 620  LYS A C   1 
ATOM   4025 O O   . LYS A 1 604  ? 10.369  3.102   14.230  1.00 67.91  ? 620  LYS A O   1 
ATOM   4026 C CB  . LYS A 1 604  ? 12.643  4.561   15.533  1.00 63.51  ? 620  LYS A CB  1 
ATOM   4027 C CG  . LYS A 1 604  ? 14.040  5.156   15.405  1.00 62.43  ? 620  LYS A CG  1 
ATOM   4028 C CD  . LYS A 1 604  ? 14.933  4.613   16.507  1.00 65.68  ? 620  LYS A CD  1 
ATOM   4029 C CE  . LYS A 1 604  ? 16.359  5.079   16.420  1.00 68.92  ? 620  LYS A CE  1 
ATOM   4030 N NZ  . LYS A 1 604  ? 17.243  4.262   17.302  1.00 75.48  ? 620  LYS A NZ  1 
ATOM   4031 N N   . TYR A 1 605  ? 9.243   4.850   15.086  1.00 60.81  ? 621  TYR A N   1 
ATOM   4032 C CA  . TYR A 1 605  ? 7.950   4.197   15.212  1.00 59.84  ? 621  TYR A CA  1 
ATOM   4033 C C   . TYR A 1 605  ? 7.060   4.597   14.022  1.00 63.21  ? 621  TYR A C   1 
ATOM   4034 O O   . TYR A 1 605  ? 5.904   4.193   13.962  1.00 61.74  ? 621  TYR A O   1 
ATOM   4035 C CB  . TYR A 1 605  ? 7.248   4.675   16.496  1.00 61.71  ? 621  TYR A CB  1 
ATOM   4036 C CG  . TYR A 1 605  ? 7.760   4.186   17.835  1.00 64.41  ? 621  TYR A CG  1 
ATOM   4037 C CD1 . TYR A 1 605  ? 8.412   2.961   17.952  1.00 66.89  ? 621  TYR A CD1 1 
ATOM   4038 C CD2 . TYR A 1 605  ? 7.472   4.883   19.005  1.00 65.41  ? 621  TYR A CD2 1 
ATOM   4039 C CE1 . TYR A 1 605  ? 8.820   2.472   19.199  1.00 68.53  ? 621  TYR A CE1 1 
ATOM   4040 C CE2 . TYR A 1 605  ? 7.881   4.411   20.253  1.00 66.93  ? 621  TYR A CE2 1 
ATOM   4041 C CZ  . TYR A 1 605  ? 8.555   3.205   20.347  1.00 76.40  ? 621  TYR A CZ  1 
ATOM   4042 O OH  . TYR A 1 605  ? 8.960   2.746   21.582  1.00 79.33  ? 621  TYR A OH  1 
ATOM   4043 N N   . GLU A 1 606  ? 7.552   5.444   13.124  1.00 62.47  ? 622  GLU A N   1 
ATOM   4044 C CA  . GLU A 1 606  ? 6.739   5.889   11.993  1.00 63.69  ? 622  GLU A CA  1 
ATOM   4045 C C   . GLU A 1 606  ? 6.639   4.802   10.933  1.00 73.19  ? 622  GLU A C   1 
ATOM   4046 O O   . GLU A 1 606  ? 7.553   3.988   10.766  1.00 75.07  ? 622  GLU A O   1 
ATOM   4047 C CB  . GLU A 1 606  ? 7.239   7.206   11.373  1.00 64.72  ? 622  GLU A CB  1 
ATOM   4048 C CG  . GLU A 1 606  ? 7.327   8.399   12.312  1.00 73.93  ? 622  GLU A CG  1 
ATOM   4049 C CD  . GLU A 1 606  ? 6.055   8.961   12.916  1.00 87.63  ? 622  GLU A CD  1 
ATOM   4050 O OE1 . GLU A 1 606  ? 5.825   8.710   14.120  1.00 99.76  ? 622  GLU A OE1 1 
ATOM   4051 O OE2 . GLU A 1 606  ? 5.372   9.765   12.243  1.00 71.07  ? 622  GLU A OE2 1 
ATOM   4052 N N   . SER A 1 607  ? 5.495   4.767   10.254  1.00 70.75  ? 623  SER A N   1 
ATOM   4053 C CA  . SER A 1 607  ? 5.213   3.823   9.193   1.00 70.08  ? 623  SER A CA  1 
ATOM   4054 C C   . SER A 1 607  ? 5.791   4.349   7.831   1.00 72.23  ? 623  SER A C   1 
ATOM   4055 O O   . SER A 1 607  ? 6.511   3.627   7.145   1.00 71.86  ? 623  SER A O   1 
ATOM   4056 C CB  . SER A 1 607  ? 3.706   3.595   9.123   1.00 73.27  ? 623  SER A CB  1 
ATOM   4057 N N   . TYR A 1 608  ? 5.517   5.620   7.488   1.00 66.80  ? 624  TYR A N   1 
ATOM   4058 C CA  . TYR A 1 608  ? 5.930   6.263   6.240   1.00 65.21  ? 624  TYR A CA  1 
ATOM   4059 C C   . TYR A 1 608  ? 6.986   7.366   6.418   1.00 67.79  ? 624  TYR A C   1 
ATOM   4060 O O   . TYR A 1 608  ? 7.087   7.952   7.503   1.00 66.59  ? 624  TYR A O   1 
ATOM   4061 C CB  . TYR A 1 608  ? 4.678   6.793   5.516   1.00 66.13  ? 624  TYR A CB  1 
ATOM   4062 C CG  . TYR A 1 608  ? 3.577   5.754   5.438   1.00 68.93  ? 624  TYR A CG  1 
ATOM   4063 C CD1 . TYR A 1 608  ? 3.684   4.653   4.582   1.00 70.85  ? 624  TYR A CD1 1 
ATOM   4064 C CD2 . TYR A 1 608  ? 2.447   5.843   6.248   1.00 70.25  ? 624  TYR A CD2 1 
ATOM   4065 C CE1 . TYR A 1 608  ? 2.705   3.655   4.556   1.00 71.07  ? 624  TYR A CE1 1 
ATOM   4066 C CE2 . TYR A 1 608  ? 1.454   4.859   6.218   1.00 71.70  ? 624  TYR A CE2 1 
ATOM   4067 C CZ  . TYR A 1 608  ? 1.593   3.764   5.377   1.00 78.69  ? 624  TYR A CZ  1 
ATOM   4068 O OH  . TYR A 1 608  ? 0.613   2.808   5.341   1.00 79.40  ? 624  TYR A OH  1 
ATOM   4069 N N   . LEU A 1 609  ? 7.762   7.656   5.346   1.00 64.37  ? 625  LEU A N   1 
ATOM   4070 C CA  . LEU A 1 609  ? 8.808   8.686   5.357   1.00 64.55  ? 625  LEU A CA  1 
ATOM   4071 C C   . LEU A 1 609  ? 8.264   10.095  5.572   1.00 69.24  ? 625  LEU A C   1 
ATOM   4072 O O   . LEU A 1 609  ? 8.745   10.821  6.444   1.00 68.77  ? 625  LEU A O   1 
ATOM   4073 C CB  . LEU A 1 609  ? 9.687   8.630   4.104   1.00 64.77  ? 625  LEU A CB  1 
ATOM   4074 C CG  . LEU A 1 609  ? 10.261  7.291   3.704   1.00 69.56  ? 625  LEU A CG  1 
ATOM   4075 C CD1 . LEU A 1 609  ? 10.877  7.393   2.359   1.00 69.81  ? 625  LEU A CD1 1 
ATOM   4076 C CD2 . LEU A 1 609  ? 11.281  6.762   4.733   1.00 71.14  ? 625  LEU A CD2 1 
ATOM   4077 N N   . ASP A 1 610  ? 7.260   10.478  4.793   1.00 68.47  ? 626  ASP A N   1 
ATOM   4078 C CA  . ASP A 1 610  ? 6.597   11.767  4.967   1.00 68.96  ? 626  ASP A CA  1 
ATOM   4079 C C   . ASP A 1 610  ? 5.595   11.535  6.077   1.00 72.78  ? 626  ASP A C   1 
ATOM   4080 O O   . ASP A 1 610  ? 4.763   10.633  5.988   1.00 72.63  ? 626  ASP A O   1 
ATOM   4081 C CB  . ASP A 1 610  ? 5.878   12.209  3.677   1.00 70.94  ? 626  ASP A CB  1 
ATOM   4082 C CG  . ASP A 1 610  ? 5.330   13.632  3.638   1.00 87.09  ? 626  ASP A CG  1 
ATOM   4083 O OD1 . ASP A 1 610  ? 5.188   14.258  4.726   1.00 91.06  ? 626  ASP A OD1 1 
ATOM   4084 O OD2 . ASP A 1 610  ? 4.972   14.098  2.531   1.00 89.97  ? 626  ASP A OD2 1 
ATOM   4085 N N   . CYS A 1 611  ? 5.744   12.285  7.158   1.00 69.83  ? 627  CYS A N   1 
ATOM   4086 C CA  . CYS A 1 611  ? 4.855   12.243  8.320   1.00 69.40  ? 627  CYS A CA  1 
ATOM   4087 C C   . CYS A 1 611  ? 4.782   13.624  8.968   1.00 70.41  ? 627  CYS A C   1 
ATOM   4088 O O   . CYS A 1 611  ? 5.568   14.523  8.630   1.00 69.20  ? 627  CYS A O   1 
ATOM   4089 C CB  . CYS A 1 611  ? 5.258   11.151  9.314   1.00 70.08  ? 627  CYS A CB  1 
ATOM   4090 S SG  . CYS A 1 611  ? 6.941   11.307  9.980   1.00 74.27  ? 627  CYS A SG  1 
ATOM   4091 N N   . GLU A 1 612  ? 3.792   13.810  9.840   1.00 66.61  ? 628  GLU A N   1 
ATOM   4092 C CA  . GLU A 1 612  ? 3.576   15.069  10.545  1.00 66.80  ? 628  GLU A CA  1 
ATOM   4093 C C   . GLU A 1 612  ? 4.781   15.445  11.465  1.00 68.78  ? 628  GLU A C   1 
ATOM   4094 O O   . GLU A 1 612  ? 5.186   16.620  11.501  1.00 70.16  ? 628  GLU A O   1 
ATOM   4095 C CB  . GLU A 1 612  ? 2.229   15.028  11.310  1.00 68.37  ? 628  GLU A CB  1 
ATOM   4096 C CG  . GLU A 1 612  ? 1.035   15.523  10.505  1.00 76.60  ? 628  GLU A CG  1 
ATOM   4097 C CD  . GLU A 1 612  ? 0.782   17.011  10.660  1.00 103.62 ? 628  GLU A CD  1 
ATOM   4098 O OE1 . GLU A 1 612  ? -0.125  17.379  11.443  1.00 106.97 ? 628  GLU A OE1 1 
ATOM   4099 O OE2 . GLU A 1 612  ? 1.528   17.810  10.046  1.00 95.86  ? 628  GLU A OE2 1 
ATOM   4100 N N   . LEU A 1 613  ? 5.358   14.442  12.168  1.00 59.94  ? 629  LEU A N   1 
ATOM   4101 C CA  . LEU A 1 613  ? 6.494   14.639  13.050  1.00 57.91  ? 629  LEU A CA  1 
ATOM   4102 C C   . LEU A 1 613  ? 7.718   15.092  12.279  1.00 61.77  ? 629  LEU A C   1 
ATOM   4103 O O   . LEU A 1 613  ? 8.343   16.066  12.714  1.00 61.86  ? 629  LEU A O   1 
ATOM   4104 C CB  . LEU A 1 613  ? 6.771   13.380  13.888  1.00 57.54  ? 629  LEU A CB  1 
ATOM   4105 C CG  . LEU A 1 613  ? 7.951   13.413  14.856  1.00 61.08  ? 629  LEU A CG  1 
ATOM   4106 C CD1 . LEU A 1 613  ? 7.752   14.417  15.970  1.00 59.93  ? 629  LEU A CD1 1 
ATOM   4107 C CD2 . LEU A 1 613  ? 8.228   12.035  15.398  1.00 63.91  ? 629  LEU A CD2 1 
ATOM   4108 N N   . THR A 1 614  ? 8.060   14.425  11.128  1.00 57.93  ? 630  THR A N   1 
ATOM   4109 C CA  . THR A 1 614  ? 9.199   14.865  10.305  1.00 58.02  ? 630  THR A CA  1 
ATOM   4110 C C   . THR A 1 614  ? 9.040   16.356  9.962   1.00 63.80  ? 630  THR A C   1 
ATOM   4111 O O   . THR A 1 614  ? 9.906   17.139  10.330  1.00 66.21  ? 630  THR A O   1 
ATOM   4112 C CB  . THR A 1 614  ? 9.424   13.994  9.064   1.00 69.38  ? 630  THR A CB  1 
ATOM   4113 O OG1 . THR A 1 614  ? 9.683   12.643  9.446   1.00 76.52  ? 630  THR A OG1 1 
ATOM   4114 C CG2 . THR A 1 614  ? 10.576  14.488  8.214   1.00 64.21  ? 630  THR A CG2 1 
ATOM   4115 N N   . LYS A 1 615  ? 7.902   16.754  9.353   1.00 59.67  ? 631  LYS A N   1 
ATOM   4116 C CA  . LYS A 1 615  ? 7.577   18.135  8.961   1.00 58.63  ? 631  LYS A CA  1 
ATOM   4117 C C   . LYS A 1 615  ? 7.683   19.119  10.126  1.00 60.71  ? 631  LYS A C   1 
ATOM   4118 O O   . LYS A 1 615  ? 8.233   20.209  9.947   1.00 61.17  ? 631  LYS A O   1 
ATOM   4119 C CB  . LYS A 1 615  ? 6.184   18.200  8.301   1.00 61.67  ? 631  LYS A CB  1 
ATOM   4120 C CG  . LYS A 1 615  ? 5.944   19.466  7.465   1.00 75.16  ? 631  LYS A CG  1 
ATOM   4121 N N   . PHE A 1 616  ? 7.191   18.718  11.325  1.00 54.72  ? 632  PHE A N   1 
ATOM   4122 C CA  . PHE A 1 616  ? 7.216   19.531  12.545  1.00 51.52  ? 632  PHE A CA  1 
ATOM   4123 C C   . PHE A 1 616  ? 8.637   19.792  12.931  1.00 52.83  ? 632  PHE A C   1 
ATOM   4124 O O   . PHE A 1 616  ? 9.014   20.952  13.107  1.00 51.07  ? 632  PHE A O   1 
ATOM   4125 C CB  . PHE A 1 616  ? 6.478   18.815  13.693  1.00 52.54  ? 632  PHE A CB  1 
ATOM   4126 C CG  . PHE A 1 616  ? 6.626   19.506  15.035  1.00 53.72  ? 632  PHE A CG  1 
ATOM   4127 C CD1 . PHE A 1 616  ? 6.181   20.821  15.220  1.00 55.97  ? 632  PHE A CD1 1 
ATOM   4128 C CD2 . PHE A 1 616  ? 7.237   18.862  16.104  1.00 54.02  ? 632  PHE A CD2 1 
ATOM   4129 C CE1 . PHE A 1 616  ? 6.346   21.466  16.454  1.00 55.96  ? 632  PHE A CE1 1 
ATOM   4130 C CE2 . PHE A 1 616  ? 7.400   19.519  17.338  1.00 56.03  ? 632  PHE A CE2 1 
ATOM   4131 C CZ  . PHE A 1 616  ? 6.948   20.808  17.504  1.00 53.65  ? 632  PHE A CZ  1 
ATOM   4132 N N   . LEU A 1 617  ? 9.444   18.694  13.042  1.00 50.01  ? 633  LEU A N   1 
ATOM   4133 C CA  . LEU A 1 617  ? 10.872  18.721  13.395  1.00 49.15  ? 633  LEU A CA  1 
ATOM   4134 C C   . LEU A 1 617  ? 11.688  19.581  12.424  1.00 53.33  ? 633  LEU A C   1 
ATOM   4135 O O   . LEU A 1 617  ? 12.540  20.350  12.873  1.00 51.49  ? 633  LEU A O   1 
ATOM   4136 C CB  . LEU A 1 617  ? 11.437  17.295  13.498  1.00 48.55  ? 633  LEU A CB  1 
ATOM   4137 C CG  . LEU A 1 617  ? 11.131  16.518  14.792  1.00 50.58  ? 633  LEU A CG  1 
ATOM   4138 C CD1 . LEU A 1 617  ? 11.744  15.159  14.747  1.00 50.23  ? 633  LEU A CD1 1 
ATOM   4139 C CD2 . LEU A 1 617  ? 11.665  17.229  16.019  1.00 48.01  ? 633  LEU A CD2 1 
ATOM   4140 N N   . LEU A 1 618  ? 11.354  19.518  11.105  1.00 51.88  ? 634  LEU A N   1 
ATOM   4141 C CA  . LEU A 1 618  ? 11.992  20.343  10.072  1.00 52.76  ? 634  LEU A CA  1 
ATOM   4142 C C   . LEU A 1 618  ? 11.556  21.817  10.171  1.00 57.40  ? 634  LEU A C   1 
ATOM   4143 O O   . LEU A 1 618  ? 12.431  22.694  10.159  1.00 55.02  ? 634  LEU A O   1 
ATOM   4144 C CB  . LEU A 1 618  ? 11.837  19.765  8.643   1.00 52.62  ? 634  LEU A CB  1 
ATOM   4145 C CG  . LEU A 1 618  ? 12.739  18.519  8.338   1.00 56.37  ? 634  LEU A CG  1 
ATOM   4146 C CD1 . LEU A 1 618  ? 12.244  17.755  7.152   1.00 55.86  ? 634  LEU A CD1 1 
ATOM   4147 C CD2 . LEU A 1 618  ? 14.238  18.870  8.223   1.00 54.02  ? 634  LEU A CD2 1 
ATOM   4148 N N   . ASP A 1 619  ? 10.240  22.093  10.387  1.00 55.99  ? 635  ASP A N   1 
ATOM   4149 C CA  . ASP A 1 619  ? 9.775   23.484  10.563  1.00 57.05  ? 635  ASP A CA  1 
ATOM   4150 C C   . ASP A 1 619  ? 10.591  24.178  11.659  1.00 62.06  ? 635  ASP A C   1 
ATOM   4151 O O   . ASP A 1 619  ? 11.137  25.255  11.448  1.00 63.19  ? 635  ASP A O   1 
ATOM   4152 C CB  . ASP A 1 619  ? 8.277   23.575  10.945  1.00 59.62  ? 635  ASP A CB  1 
ATOM   4153 C CG  . ASP A 1 619  ? 7.216   23.309  9.880   1.00 73.23  ? 635  ASP A CG  1 
ATOM   4154 O OD1 . ASP A 1 619  ? 7.319   23.893  8.774   1.00 73.93  ? 635  ASP A OD1 1 
ATOM   4155 O OD2 . ASP A 1 619  ? 6.194   22.647  10.213  1.00 79.88  ? 635  ASP A OD2 1 
ATOM   4156 N N   . ARG A 1 620  ? 10.712  23.516  12.805  1.00 58.52  ? 636  ARG A N   1 
ATOM   4157 C CA  . ARG A 1 620  ? 11.384  24.026  13.988  1.00 57.95  ? 636  ARG A CA  1 
ATOM   4158 C C   . ARG A 1 620  ? 12.842  24.276  13.817  1.00 61.99  ? 636  ARG A C   1 
ATOM   4159 O O   . ARG A 1 620  ? 13.324  25.313  14.279  1.00 62.80  ? 636  ARG A O   1 
ATOM   4160 C CB  . ARG A 1 620  ? 11.127  23.092  15.158  1.00 56.66  ? 636  ARG A CB  1 
ATOM   4161 C CG  . ARG A 1 620  ? 9.681   23.115  15.563  1.00 59.17  ? 636  ARG A CG  1 
ATOM   4162 C CD  . ARG A 1 620  ? 9.302   24.475  16.109  1.00 56.27  ? 636  ARG A CD  1 
ATOM   4163 N NE  . ARG A 1 620  ? 8.107   24.317  16.908  1.00 62.27  ? 636  ARG A NE  1 
ATOM   4164 C CZ  . ARG A 1 620  ? 7.979   24.753  18.147  1.00 73.36  ? 636  ARG A CZ  1 
ATOM   4165 N NH1 . ARG A 1 620  ? 8.950   25.472  18.711  1.00 38.95  ? 636  ARG A NH1 1 
ATOM   4166 N NH2 . ARG A 1 620  ? 6.866   24.509  18.827  1.00 71.25  ? 636  ARG A NH2 1 
ATOM   4167 N N   . ALA A 1 621  ? 13.549  23.322  13.174  1.00 57.52  ? 637  ALA A N   1 
ATOM   4168 C CA  . ALA A 1 621  ? 14.977  23.365  12.863  1.00 56.75  ? 637  ALA A CA  1 
ATOM   4169 C C   . ALA A 1 621  ? 15.325  24.554  11.904  1.00 60.35  ? 637  ALA A C   1 
ATOM   4170 O O   . ALA A 1 621  ? 16.402  25.131  11.999  1.00 59.83  ? 637  ALA A O   1 
ATOM   4171 C CB  . ALA A 1 621  ? 15.370  22.050  12.212  1.00 57.33  ? 637  ALA A CB  1 
ATOM   4172 N N   . LEU A 1 622  ? 14.433  24.863  10.948  1.00 55.84  ? 638  LEU A N   1 
ATOM   4173 C CA  . LEU A 1 622  ? 14.644  25.939  10.011  1.00 55.62  ? 638  LEU A CA  1 
ATOM   4174 C C   . LEU A 1 622  ? 14.311  27.285  10.672  1.00 60.58  ? 638  LEU A C   1 
ATOM   4175 O O   . LEU A 1 622  ? 14.847  28.318  10.265  1.00 62.14  ? 638  LEU A O   1 
ATOM   4176 C CB  . LEU A 1 622  ? 13.796  25.712  8.748   1.00 55.98  ? 638  LEU A CB  1 
ATOM   4177 C CG  . LEU A 1 622  ? 14.095  24.456  7.911   1.00 60.60  ? 638  LEU A CG  1 
ATOM   4178 C CD1 . LEU A 1 622  ? 13.007  24.198  6.932   1.00 60.38  ? 638  LEU A CD1 1 
ATOM   4179 C CD2 . LEU A 1 622  ? 15.386  24.573  7.161   1.00 64.34  ? 638  LEU A CD2 1 
ATOM   4180 N N   . ALA A 1 623  ? 13.434  27.276  11.692  1.00 55.44  ? 639  ALA A N   1 
ATOM   4181 C CA  . ALA A 1 623  ? 13.043  28.475  12.431  1.00 54.64  ? 639  ALA A CA  1 
ATOM   4182 C C   . ALA A 1 623  ? 14.073  28.864  13.520  1.00 63.42  ? 639  ALA A C   1 
ATOM   4183 O O   . ALA A 1 623  ? 14.234  30.056  13.795  1.00 64.83  ? 639  ALA A O   1 
ATOM   4184 C CB  . ALA A 1 623  ? 11.664  28.292  13.031  1.00 54.39  ? 639  ALA A CB  1 
ATOM   4185 N N   . ASN A 1 624  ? 14.755  27.865  14.142  1.00 61.15  ? 640  ASN A N   1 
ATOM   4186 C CA  . ASN A 1 624  ? 15.796  28.069  15.163  1.00 61.82  ? 640  ASN A CA  1 
ATOM   4187 C C   . ASN A 1 624  ? 17.109  27.344  14.764  1.00 67.83  ? 640  ASN A C   1 
ATOM   4188 O O   . ASN A 1 624  ? 17.079  26.154  14.458  1.00 68.76  ? 640  ASN A O   1 
ATOM   4189 C CB  . ASN A 1 624  ? 15.302  27.576  16.520  1.00 63.35  ? 640  ASN A CB  1 
ATOM   4190 C CG  . ASN A 1 624  ? 16.199  27.973  17.662  1.00 82.64  ? 640  ASN A CG  1 
ATOM   4191 O OD1 . ASN A 1 624  ? 17.303  27.469  17.818  1.00 75.76  ? 640  ASN A OD1 1 
ATOM   4192 N ND2 . ASN A 1 624  ? 15.739  28.880  18.494  1.00 78.35  ? 640  ASN A ND2 1 
ATOM   4193 N N   . ARG A 1 625  ? 18.255  28.028  14.810  1.00 64.98  ? 641  ARG A N   1 
ATOM   4194 C CA  . ARG A 1 625  ? 19.537  27.408  14.409  1.00 64.74  ? 641  ARG A CA  1 
ATOM   4195 C C   . ARG A 1 625  ? 20.096  26.383  15.431  1.00 67.77  ? 641  ARG A C   1 
ATOM   4196 O O   . ARG A 1 625  ? 20.618  25.347  15.009  1.00 68.45  ? 641  ARG A O   1 
ATOM   4197 C CB  . ARG A 1 625  ? 20.592  28.464  14.049  1.00 61.24  ? 641  ARG A CB  1 
ATOM   4198 C CG  . ARG A 1 625  ? 21.320  28.150  12.760  1.00 62.14  ? 641  ARG A CG  1 
ATOM   4199 C CD  . ARG A 1 625  ? 22.526  29.032  12.540  1.00 76.57  ? 641  ARG A CD  1 
ATOM   4200 N NE  . ARG A 1 625  ? 23.417  29.005  13.701  1.00 95.32  ? 641  ARG A NE  1 
ATOM   4201 C CZ  . ARG A 1 625  ? 24.740  29.106  13.644  1.00 112.77 ? 641  ARG A CZ  1 
ATOM   4202 N NH1 . ARG A 1 625  ? 25.354  29.249  12.470  1.00 102.85 ? 641  ARG A NH1 1 
ATOM   4203 N NH2 . ARG A 1 625  ? 25.462  29.056  14.757  1.00 90.21  ? 641  ARG A NH2 1 
ATOM   4204 N N   . LYS A 1 626  ? 19.981  26.669  16.749  1.00 62.00  ? 642  LYS A N   1 
ATOM   4205 C CA  . LYS A 1 626  ? 20.403  25.775  17.844  1.00 60.96  ? 642  LYS A CA  1 
ATOM   4206 C C   . LYS A 1 626  ? 19.647  24.441  17.735  1.00 64.14  ? 642  LYS A C   1 
ATOM   4207 O O   . LYS A 1 626  ? 20.272  23.382  17.786  1.00 64.38  ? 642  LYS A O   1 
ATOM   4208 C CB  . LYS A 1 626  ? 20.196  26.453  19.226  1.00 62.00  ? 642  LYS A CB  1 
ATOM   4209 C CG  . LYS A 1 626  ? 20.071  25.519  20.435  1.00 66.57  ? 642  LYS A CG  1 
ATOM   4210 N N   . ILE A 1 627  ? 18.317  24.503  17.535  1.00 58.34  ? 643  ILE A N   1 
ATOM   4211 C CA  . ILE A 1 627  ? 17.481  23.322  17.370  1.00 56.65  ? 643  ILE A CA  1 
ATOM   4212 C C   . ILE A 1 627  ? 17.984  22.545  16.164  1.00 60.67  ? 643  ILE A C   1 
ATOM   4213 O O   . ILE A 1 627  ? 18.277  21.363  16.316  1.00 61.75  ? 643  ILE A O   1 
ATOM   4214 C CB  . ILE A 1 627  ? 15.955  23.666  17.327  1.00 59.10  ? 643  ILE A CB  1 
ATOM   4215 C CG1 . ILE A 1 627  ? 15.415  23.866  18.747  1.00 59.32  ? 643  ILE A CG1 1 
ATOM   4216 C CG2 . ILE A 1 627  ? 15.131  22.579  16.614  1.00 59.86  ? 643  ILE A CG2 1 
ATOM   4217 C CD1 . ILE A 1 627  ? 14.204  24.679  18.820  1.00 66.00  ? 643  ILE A CD1 1 
ATOM   4218 N N   . GLY A 1 628  ? 18.130  23.225  15.013  1.00 55.02  ? 644  GLY A N   1 
ATOM   4219 C CA  . GLY A 1 628  ? 18.613  22.646  13.761  1.00 53.57  ? 644  GLY A CA  1 
ATOM   4220 C C   . GLY A 1 628  ? 19.927  21.923  13.935  1.00 58.42  ? 644  GLY A C   1 
ATOM   4221 O O   . GLY A 1 628  ? 20.054  20.784  13.505  1.00 59.35  ? 644  GLY A O   1 
ATOM   4222 N N   . HIS A 1 629  ? 20.879  22.549  14.652  1.00 55.37  ? 645  HIS A N   1 
ATOM   4223 C CA  . HIS A 1 629  ? 22.190  21.993  14.983  1.00 55.72  ? 645  HIS A CA  1 
ATOM   4224 C C   . HIS A 1 629  ? 22.097  20.638  15.721  1.00 61.10  ? 645  HIS A C   1 
ATOM   4225 O O   . HIS A 1 629  ? 22.741  19.663  15.304  1.00 63.28  ? 645  HIS A O   1 
ATOM   4226 C CB  . HIS A 1 629  ? 22.981  22.991  15.831  1.00 56.59  ? 645  HIS A CB  1 
ATOM   4227 C CG  . HIS A 1 629  ? 24.180  22.400  16.502  1.00 60.74  ? 645  HIS A CG  1 
ATOM   4228 N ND1 . HIS A 1 629  ? 25.395  22.270  15.842  1.00 63.20  ? 645  HIS A ND1 1 
ATOM   4229 C CD2 . HIS A 1 629  ? 24.318  21.929  17.762  1.00 62.96  ? 645  HIS A CD2 1 
ATOM   4230 C CE1 . HIS A 1 629  ? 26.226  21.734  16.723  1.00 62.53  ? 645  HIS A CE1 1 
ATOM   4231 N NE2 . HIS A 1 629  ? 25.625  21.517  17.893  1.00 62.67  ? 645  HIS A NE2 1 
ATOM   4232 N N   . PHE A 1 630  ? 21.345  20.599  16.843  1.00 53.54  ? 646  PHE A N   1 
ATOM   4233 C CA  . PHE A 1 630  ? 21.199  19.390  17.645  1.00 50.68  ? 646  PHE A CA  1 
ATOM   4234 C C   . PHE A 1 630  ? 20.301  18.371  16.946  1.00 55.72  ? 646  PHE A C   1 
ATOM   4235 O O   . PHE A 1 630  ? 20.553  17.168  17.085  1.00 57.45  ? 646  PHE A O   1 
ATOM   4236 C CB  . PHE A 1 630  ? 20.776  19.701  19.078  1.00 50.47  ? 646  PHE A CB  1 
ATOM   4237 C CG  . PHE A 1 630  ? 21.809  20.484  19.854  1.00 50.00  ? 646  PHE A CG  1 
ATOM   4238 C CD1 . PHE A 1 630  ? 22.956  19.866  20.337  1.00 51.43  ? 646  PHE A CD1 1 
ATOM   4239 C CD2 . PHE A 1 630  ? 21.622  21.842  20.124  1.00 51.82  ? 646  PHE A CD2 1 
ATOM   4240 C CE1 . PHE A 1 630  ? 23.905  20.589  21.072  1.00 52.75  ? 646  PHE A CE1 1 
ATOM   4241 C CE2 . PHE A 1 630  ? 22.555  22.565  20.880  1.00 54.35  ? 646  PHE A CE2 1 
ATOM   4242 C CZ  . PHE A 1 630  ? 23.686  21.932  21.360  1.00 52.91  ? 646  PHE A CZ  1 
ATOM   4243 N N   . LEU A 1 631  ? 19.357  18.828  16.086  1.00 49.84  ? 647  LEU A N   1 
ATOM   4244 C CA  . LEU A 1 631  ? 18.566  17.899  15.275  1.00 48.44  ? 647  LEU A CA  1 
ATOM   4245 C C   . LEU A 1 631  ? 19.552  17.176  14.294  1.00 53.98  ? 647  LEU A C   1 
ATOM   4246 O O   . LEU A 1 631  ? 19.505  15.944  14.167  1.00 55.54  ? 647  LEU A O   1 
ATOM   4247 C CB  . LEU A 1 631  ? 17.427  18.612  14.507  1.00 47.10  ? 647  LEU A CB  1 
ATOM   4248 C CG  . LEU A 1 631  ? 16.676  17.743  13.455  1.00 48.63  ? 647  LEU A CG  1 
ATOM   4249 C CD1 . LEU A 1 631  ? 16.041  16.498  14.084  1.00 47.74  ? 647  LEU A CD1 1 
ATOM   4250 C CD2 . LEU A 1 631  ? 15.702  18.537  12.660  1.00 43.59  ? 647  LEU A CD2 1 
ATOM   4251 N N   . PHE A 1 632  ? 20.480  17.935  13.688  1.00 47.98  ? 648  PHE A N   1 
ATOM   4252 C CA  . PHE A 1 632  ? 21.496  17.375  12.815  1.00 49.08  ? 648  PHE A CA  1 
ATOM   4253 C C   . PHE A 1 632  ? 22.330  16.278  13.519  1.00 56.36  ? 648  PHE A C   1 
ATOM   4254 O O   . PHE A 1 632  ? 22.517  15.194  12.957  1.00 54.70  ? 648  PHE A O   1 
ATOM   4255 C CB  . PHE A 1 632  ? 22.442  18.473  12.286  1.00 50.68  ? 648  PHE A CB  1 
ATOM   4256 C CG  . PHE A 1 632  ? 23.535  17.903  11.417  1.00 52.01  ? 648  PHE A CG  1 
ATOM   4257 C CD1 . PHE A 1 632  ? 24.713  17.407  11.982  1.00 54.23  ? 648  PHE A CD1 1 
ATOM   4258 C CD2 . PHE A 1 632  ? 23.382  17.835  10.033  1.00 54.14  ? 648  PHE A CD2 1 
ATOM   4259 C CE1 . PHE A 1 632  ? 25.701  16.829  11.184  1.00 54.26  ? 648  PHE A CE1 1 
ATOM   4260 C CE2 . PHE A 1 632  ? 24.396  17.299  9.230   1.00 56.71  ? 648  PHE A CE2 1 
ATOM   4261 C CZ  . PHE A 1 632  ? 25.537  16.784  9.817   1.00 54.55  ? 648  PHE A CZ  1 
ATOM   4262 N N   . TRP A 1 633  ? 22.875  16.580  14.710  1.00 55.68  ? 649  TRP A N   1 
ATOM   4263 C CA  . TRP A 1 633  ? 23.688  15.594  15.413  1.00 56.73  ? 649  TRP A CA  1 
ATOM   4264 C C   . TRP A 1 633  ? 22.873  14.425  15.912  1.00 61.32  ? 649  TRP A C   1 
ATOM   4265 O O   . TRP A 1 633  ? 23.356  13.293  15.829  1.00 61.23  ? 649  TRP A O   1 
ATOM   4266 C CB  . TRP A 1 633  ? 24.538  16.224  16.517  1.00 55.92  ? 649  TRP A CB  1 
ATOM   4267 C CG  . TRP A 1 633  ? 25.688  16.991  15.946  1.00 56.93  ? 649  TRP A CG  1 
ATOM   4268 C CD1 . TRP A 1 633  ? 25.886  18.339  16.012  1.00 59.98  ? 649  TRP A CD1 1 
ATOM   4269 C CD2 . TRP A 1 633  ? 26.684  16.482  15.047  1.00 56.31  ? 649  TRP A CD2 1 
ATOM   4270 N NE1 . TRP A 1 633  ? 26.978  18.697  15.249  1.00 59.14  ? 649  TRP A NE1 1 
ATOM   4271 C CE2 . TRP A 1 633  ? 27.496  17.574  14.659  1.00 59.88  ? 649  TRP A CE2 1 
ATOM   4272 C CE3 . TRP A 1 633  ? 27.002  15.195  14.571  1.00 56.89  ? 649  TRP A CE3 1 
ATOM   4273 C CZ2 . TRP A 1 633  ? 28.608  17.420  13.833  1.00 58.68  ? 649  TRP A CZ2 1 
ATOM   4274 C CZ3 . TRP A 1 633  ? 28.101  15.048  13.752  1.00 57.85  ? 649  TRP A CZ3 1 
ATOM   4275 C CH2 . TRP A 1 633  ? 28.881  16.154  13.378  1.00 58.51  ? 649  TRP A CH2 1 
ATOM   4276 N N   . HIS A 1 634  ? 21.609  14.668  16.326  1.00 57.06  ? 650  HIS A N   1 
ATOM   4277 C CA  . HIS A 1 634  ? 20.754  13.567  16.771  1.00 56.31  ? 650  HIS A CA  1 
ATOM   4278 C C   . HIS A 1 634  ? 20.587  12.535  15.650  1.00 58.17  ? 650  HIS A C   1 
ATOM   4279 O O   . HIS A 1 634  ? 20.796  11.351  15.890  1.00 57.11  ? 650  HIS A O   1 
ATOM   4280 C CB  . HIS A 1 634  ? 19.398  14.069  17.300  1.00 56.92  ? 650  HIS A CB  1 
ATOM   4281 C CG  . HIS A 1 634  ? 19.430  14.611  18.697  1.00 60.43  ? 650  HIS A CG  1 
ATOM   4282 N ND1 . HIS A 1 634  ? 19.716  13.804  19.773  1.00 63.15  ? 650  HIS A ND1 1 
ATOM   4283 C CD2 . HIS A 1 634  ? 19.103  15.840  19.156  1.00 62.41  ? 650  HIS A CD2 1 
ATOM   4284 C CE1 . HIS A 1 634  ? 19.608  14.577  20.847  1.00 62.52  ? 650  HIS A CE1 1 
ATOM   4285 N NE2 . HIS A 1 634  ? 19.248  15.814  20.518  1.00 62.56  ? 650  HIS A NE2 1 
ATOM   4286 N N   . LEU A 1 635  ? 20.271  12.986  14.421  1.00 54.68  ? 651  LEU A N   1 
ATOM   4287 C CA  . LEU A 1 635  ? 20.121  12.097  13.258  1.00 54.66  ? 651  LEU A CA  1 
ATOM   4288 C C   . LEU A 1 635  ? 21.467  11.551  12.743  1.00 58.64  ? 651  LEU A C   1 
ATOM   4289 O O   . LEU A 1 635  ? 21.563  10.360  12.462  1.00 58.27  ? 651  LEU A O   1 
ATOM   4290 C CB  . LEU A 1 635  ? 19.341  12.789  12.128  1.00 54.74  ? 651  LEU A CB  1 
ATOM   4291 C CG  . LEU A 1 635  ? 17.992  13.454  12.516  1.00 57.98  ? 651  LEU A CG  1 
ATOM   4292 C CD1 . LEU A 1 635  ? 17.590  14.482  11.520  1.00 56.28  ? 651  LEU A CD1 1 
ATOM   4293 C CD2 . LEU A 1 635  ? 16.890  12.426  12.713  1.00 60.01  ? 651  LEU A CD2 1 
ATOM   4294 N N   . ARG A 1 636  ? 22.512  12.404  12.677  1.00 55.42  ? 652  ARG A N   1 
ATOM   4295 C CA  . ARG A 1 636  ? 23.857  12.036  12.225  1.00 54.70  ? 652  ARG A CA  1 
ATOM   4296 C C   . ARG A 1 636  ? 24.470  10.879  12.980  1.00 58.48  ? 652  ARG A C   1 
ATOM   4297 O O   . ARG A 1 636  ? 25.000  9.952   12.357  1.00 59.74  ? 652  ARG A O   1 
ATOM   4298 C CB  . ARG A 1 636  ? 24.810  13.234  12.300  1.00 54.06  ? 652  ARG A CB  1 
ATOM   4299 C CG  . ARG A 1 636  ? 26.129  13.038  11.571  1.00 54.13  ? 652  ARG A CG  1 
ATOM   4300 C CD  . ARG A 1 636  ? 25.878  12.605  10.151  1.00 60.45  ? 652  ARG A CD  1 
ATOM   4301 N NE  . ARG A 1 636  ? 27.097  12.411  9.368   1.00 69.95  ? 652  ARG A NE  1 
ATOM   4302 C CZ  . ARG A 1 636  ? 27.838  11.312  9.383   1.00 69.93  ? 652  ARG A CZ  1 
ATOM   4303 N NH1 . ARG A 1 636  ? 27.541  10.319  10.200  1.00 46.85  ? 652  ARG A NH1 1 
ATOM   4304 N NH2 . ARG A 1 636  ? 28.909  11.219  8.609   1.00 59.02  ? 652  ARG A NH2 1 
ATOM   4305 N N   . SER A 1 637  ? 24.428  10.947  14.320  1.00 52.96  ? 653  SER A N   1 
ATOM   4306 C CA  . SER A 1 637  ? 24.997  9.951   15.219  1.00 51.26  ? 653  SER A CA  1 
ATOM   4307 C C   . SER A 1 637  ? 24.362  8.540   15.116  1.00 59.47  ? 653  SER A C   1 
ATOM   4308 O O   . SER A 1 637  ? 24.800  7.619   15.818  1.00 62.11  ? 653  SER A O   1 
ATOM   4309 C CB  . SER A 1 637  ? 24.921  10.454  16.639  1.00 49.77  ? 653  SER A CB  1 
ATOM   4310 O OG  . SER A 1 637  ? 23.621  10.221  17.141  1.00 55.00  ? 653  SER A OG  1 
ATOM   4311 N N   . GLU A 1 638  ? 23.348  8.372   14.262  1.00 55.67  ? 654  GLU A N   1 
ATOM   4312 C CA  . GLU A 1 638  ? 22.693  7.087   14.017  1.00 55.53  ? 654  GLU A CA  1 
ATOM   4313 C C   . GLU A 1 638  ? 22.706  6.738   12.518  1.00 60.66  ? 654  GLU A C   1 
ATOM   4314 O O   . GLU A 1 638  ? 21.971  5.845   12.083  1.00 59.68  ? 654  GLU A O   1 
ATOM   4315 C CB  . GLU A 1 638  ? 21.256  7.065   14.592  1.00 56.17  ? 654  GLU A CB  1 
ATOM   4316 C CG  . GLU A 1 638  ? 21.200  7.152   16.096  1.00 56.70  ? 654  GLU A CG  1 
ATOM   4317 C CD  . GLU A 1 638  ? 20.140  6.264   16.702  1.00 82.82  ? 654  GLU A CD  1 
ATOM   4318 O OE1 . GLU A 1 638  ? 19.044  6.781   17.015  1.00 93.98  ? 654  GLU A OE1 1 
ATOM   4319 O OE2 . GLU A 1 638  ? 20.418  5.060   16.902  1.00 82.90  ? 654  GLU A OE2 1 
ATOM   4320 N N   . MET A 1 639  ? 23.553  7.434   11.730  1.00 59.76  ? 655  MET A N   1 
ATOM   4321 C CA  . MET A 1 639  ? 23.660  7.180   10.287  1.00 60.71  ? 655  MET A CA  1 
ATOM   4322 C C   . MET A 1 639  ? 24.292  5.775   9.989   1.00 68.24  ? 655  MET A C   1 
ATOM   4323 O O   . MET A 1 639  ? 24.185  5.263   8.862   1.00 69.03  ? 655  MET A O   1 
ATOM   4324 C CB  . MET A 1 639  ? 24.353  8.336   9.540   1.00 62.47  ? 655  MET A CB  1 
ATOM   4325 C CG  . MET A 1 639  ? 23.405  9.498   9.183   1.00 65.76  ? 655  MET A CG  1 
ATOM   4326 S SD  . MET A 1 639  ? 21.857  9.113   8.279   1.00 70.33  ? 655  MET A SD  1 
ATOM   4327 C CE  . MET A 1 639  ? 22.498  8.649   6.662   1.00 66.67  ? 655  MET A CE  1 
ATOM   4328 N N   . HIS A 1 640  ? 24.862  5.131   11.038  1.00 63.34  ? 656  HIS A N   1 
ATOM   4329 C CA  . HIS A 1 640  ? 25.392  3.782   10.982  1.00 62.10  ? 656  HIS A CA  1 
ATOM   4330 C C   . HIS A 1 640  ? 24.318  2.698   11.197  1.00 68.81  ? 656  HIS A C   1 
ATOM   4331 O O   . HIS A 1 640  ? 24.534  1.571   10.768  1.00 72.40  ? 656  HIS A O   1 
ATOM   4332 C CB  . HIS A 1 640  ? 26.560  3.591   11.957  1.00 61.78  ? 656  HIS A CB  1 
ATOM   4333 C CG  . HIS A 1 640  ? 26.266  4.020   13.357  1.00 64.95  ? 656  HIS A CG  1 
ATOM   4334 N ND1 . HIS A 1 640  ? 25.864  3.116   14.321  1.00 66.11  ? 656  HIS A ND1 1 
ATOM   4335 C CD2 . HIS A 1 640  ? 26.345  5.250   13.917  1.00 66.30  ? 656  HIS A CD2 1 
ATOM   4336 C CE1 . HIS A 1 640  ? 25.694  3.817   15.421  1.00 65.08  ? 656  HIS A CE1 1 
ATOM   4337 N NE2 . HIS A 1 640  ? 25.966  5.107   15.225  1.00 65.66  ? 656  HIS A NE2 1 
ATOM   4338 N N   . VAL A 1 641  ? 23.194  3.006   11.855  1.00 63.41  ? 657  VAL A N   1 
ATOM   4339 C CA  . VAL A 1 641  ? 22.169  2.009   12.178  1.00 61.92  ? 657  VAL A CA  1 
ATOM   4340 C C   . VAL A 1 641  ? 21.319  1.685   10.943  1.00 65.22  ? 657  VAL A C   1 
ATOM   4341 O O   . VAL A 1 641  ? 20.603  2.531   10.410  1.00 64.71  ? 657  VAL A O   1 
ATOM   4342 C CB  . VAL A 1 641  ? 21.340  2.387   13.440  1.00 64.49  ? 657  VAL A CB  1 
ATOM   4343 N N   . PRO A 1 642  ? 21.407  0.451   10.439  1.00 63.52  ? 658  PRO A N   1 
ATOM   4344 C CA  . PRO A 1 642  ? 20.695  0.118   9.185   1.00 63.61  ? 658  PRO A CA  1 
ATOM   4345 C C   . PRO A 1 642  ? 19.216  0.476   9.137   1.00 67.85  ? 658  PRO A C   1 
ATOM   4346 O O   . PRO A 1 642  ? 18.712  0.874   8.084   1.00 68.19  ? 658  PRO A O   1 
ATOM   4347 C CB  . PRO A 1 642  ? 20.924  -1.389  9.051   1.00 64.84  ? 658  PRO A CB  1 
ATOM   4348 C CG  . PRO A 1 642  ? 22.259  -1.598  9.689   1.00 68.95  ? 658  PRO A CG  1 
ATOM   4349 C CD  . PRO A 1 642  ? 22.236  -0.686  10.894  1.00 64.97  ? 658  PRO A CD  1 
ATOM   4350 N N   . SER A 1 643  ? 18.539  0.361   10.281  1.00 63.94  ? 659  SER A N   1 
ATOM   4351 C CA  . SER A 1 643  ? 17.097  0.583   10.445  1.00 62.91  ? 659  SER A CA  1 
ATOM   4352 C C   . SER A 1 643  ? 16.670  1.995   10.119  1.00 65.54  ? 659  SER A C   1 
ATOM   4353 O O   . SER A 1 643  ? 15.568  2.168   9.577   1.00 66.23  ? 659  SER A O   1 
ATOM   4354 C CB  . SER A 1 643  ? 16.656  0.259   11.874  1.00 64.79  ? 659  SER A CB  1 
ATOM   4355 O OG  . SER A 1 643  ? 17.385  -0.815  12.448  1.00 76.38  ? 659  SER A OG  1 
ATOM   4356 N N   . VAL A 1 644  ? 17.543  2.998   10.455  1.00 58.56  ? 660  VAL A N   1 
ATOM   4357 C CA  . VAL A 1 644  ? 17.254  4.430   10.363  1.00 56.53  ? 660  VAL A CA  1 
ATOM   4358 C C   . VAL A 1 644  ? 18.036  5.177   9.294   1.00 62.12  ? 660  VAL A C   1 
ATOM   4359 O O   . VAL A 1 644  ? 17.609  6.264   8.909   1.00 61.17  ? 660  VAL A O   1 
ATOM   4360 C CB  . VAL A 1 644  ? 17.389  5.139   11.746  1.00 58.39  ? 660  VAL A CB  1 
ATOM   4361 C CG1 . VAL A 1 644  ? 16.295  4.682   12.684  1.00 57.83  ? 660  VAL A CG1 1 
ATOM   4362 C CG2 . VAL A 1 644  ? 18.768  4.940   12.388  1.00 57.34  ? 660  VAL A CG2 1 
ATOM   4363 N N   . ALA A 1 645  ? 19.162  4.619   8.811   1.00 61.98  ? 661  ALA A N   1 
ATOM   4364 C CA  . ALA A 1 645  ? 20.028  5.253   7.792   1.00 62.54  ? 661  ALA A CA  1 
ATOM   4365 C C   . ALA A 1 645  ? 19.274  6.016   6.672   1.00 68.31  ? 661  ALA A C   1 
ATOM   4366 O O   . ALA A 1 645  ? 19.565  7.201   6.433   1.00 69.67  ? 661  ALA A O   1 
ATOM   4367 C CB  . ALA A 1 645  ? 20.971  4.234   7.190   1.00 62.79  ? 661  ALA A CB  1 
ATOM   4368 N N   . LEU A 1 646  ? 18.275  5.358   6.049   1.00 62.72  ? 662  LEU A N   1 
ATOM   4369 C CA  . LEU A 1 646  ? 17.491  5.931   4.966   1.00 62.17  ? 662  LEU A CA  1 
ATOM   4370 C C   . LEU A 1 646  ? 16.661  7.092   5.454   1.00 69.71  ? 662  LEU A C   1 
ATOM   4371 O O   . LEU A 1 646  ? 16.884  8.212   4.989   1.00 71.38  ? 662  LEU A O   1 
ATOM   4372 C CB  . LEU A 1 646  ? 16.609  4.860   4.275   1.00 61.56  ? 662  LEU A CB  1 
ATOM   4373 C CG  . LEU A 1 646  ? 15.661  5.354   3.180   1.00 64.87  ? 662  LEU A CG  1 
ATOM   4374 C CD1 . LEU A 1 646  ? 16.431  5.759   1.946   1.00 65.16  ? 662  LEU A CD1 1 
ATOM   4375 C CD2 . LEU A 1 646  ? 14.584  4.322   2.854   1.00 63.74  ? 662  LEU A CD2 1 
ATOM   4376 N N   . ARG A 1 647  ? 15.706  6.830   6.396   1.00 65.69  ? 663  ARG A N   1 
ATOM   4377 C CA  . ARG A 1 647  ? 14.794  7.833   6.959   1.00 62.41  ? 663  ARG A CA  1 
ATOM   4378 C C   . ARG A 1 647  ? 15.558  9.042   7.438   1.00 64.42  ? 663  ARG A C   1 
ATOM   4379 O O   . ARG A 1 647  ? 15.289  10.145  6.979   1.00 66.92  ? 663  ARG A O   1 
ATOM   4380 C CB  . ARG A 1 647  ? 13.927  7.263   8.086   1.00 55.62  ? 663  ARG A CB  1 
ATOM   4381 C CG  . ARG A 1 647  ? 13.152  8.376   8.790   1.00 65.47  ? 663  ARG A CG  1 
ATOM   4382 C CD  . ARG A 1 647  ? 12.346  7.932   9.990   1.00 71.27  ? 663  ARG A CD  1 
ATOM   4383 N NE  . ARG A 1 647  ? 11.235  7.044   9.634   1.00 68.87  ? 663  ARG A NE  1 
ATOM   4384 C CZ  . ARG A 1 647  ? 10.112  7.434   9.046   1.00 74.67  ? 663  ARG A CZ  1 
ATOM   4385 N NH1 . ARG A 1 647  ? 9.942   8.710   8.694   1.00 58.00  ? 663  ARG A NH1 1 
ATOM   4386 N NH2 . ARG A 1 647  ? 9.159   6.555   8.786   1.00 61.65  ? 663  ARG A NH2 1 
ATOM   4387 N N   . PHE A 1 648  ? 16.534  8.834   8.307   1.00 57.21  ? 664  PHE A N   1 
ATOM   4388 C CA  . PHE A 1 648  ? 17.337  9.905   8.871   1.00 56.00  ? 664  PHE A CA  1 
ATOM   4389 C C   . PHE A 1 648  ? 18.094  10.652  7.821   1.00 61.41  ? 664  PHE A C   1 
ATOM   4390 O O   . PHE A 1 648  ? 18.192  11.866  7.917   1.00 61.32  ? 664  PHE A O   1 
ATOM   4391 C CB  . PHE A 1 648  ? 18.278  9.358   9.961   1.00 56.59  ? 664  PHE A CB  1 
ATOM   4392 C CG  . PHE A 1 648  ? 17.612  9.106   11.295  1.00 56.16  ? 664  PHE A CG  1 
ATOM   4393 C CD1 . PHE A 1 648  ? 16.224  9.076   11.408  1.00 56.27  ? 664  PHE A CD1 1 
ATOM   4394 C CD2 . PHE A 1 648  ? 18.370  8.912   12.441  1.00 58.30  ? 664  PHE A CD2 1 
ATOM   4395 C CE1 . PHE A 1 648  ? 15.609  8.882   12.643  1.00 57.01  ? 664  PHE A CE1 1 
ATOM   4396 C CE2 . PHE A 1 648  ? 17.750  8.689   13.679  1.00 60.86  ? 664  PHE A CE2 1 
ATOM   4397 C CZ  . PHE A 1 648  ? 16.373  8.670   13.771  1.00 57.61  ? 664  PHE A CZ  1 
ATOM   4398 N N   . GLY A 1 649  ? 18.597  9.926   6.820   1.00 59.50  ? 665  GLY A N   1 
ATOM   4399 C CA  . GLY A 1 649  ? 19.338  10.485  5.696   1.00 59.39  ? 665  GLY A CA  1 
ATOM   4400 C C   . GLY A 1 649  ? 18.508  11.447  4.879   1.00 63.33  ? 665  GLY A C   1 
ATOM   4401 O O   . GLY A 1 649  ? 18.974  12.527  4.521   1.00 65.18  ? 665  GLY A O   1 
ATOM   4402 N N   . LEU A 1 650  ? 17.265  11.081  4.612   1.00 57.96  ? 666  LEU A N   1 
ATOM   4403 C CA  . LEU A 1 650  ? 16.363  11.930  3.859   1.00 58.17  ? 666  LEU A CA  1 
ATOM   4404 C C   . LEU A 1 650  ? 16.003  13.197  4.640   1.00 63.73  ? 666  LEU A C   1 
ATOM   4405 O O   . LEU A 1 650  ? 15.751  14.222  4.005   1.00 67.01  ? 666  LEU A O   1 
ATOM   4406 C CB  . LEU A 1 650  ? 15.102  11.152  3.432   1.00 58.41  ? 666  LEU A CB  1 
ATOM   4407 C CG  . LEU A 1 650  ? 15.329  9.866   2.609   1.00 63.21  ? 666  LEU A CG  1 
ATOM   4408 C CD1 . LEU A 1 650  ? 14.106  8.974   2.638   1.00 63.27  ? 666  LEU A CD1 1 
ATOM   4409 C CD2 . LEU A 1 650  ? 15.757  10.174  1.181   1.00 63.57  ? 666  LEU A CD2 1 
ATOM   4410 N N   . ILE A 1 651  ? 15.976  13.142  6.003   1.00 56.76  ? 667  ILE A N   1 
ATOM   4411 C CA  . ILE A 1 651  ? 15.688  14.315  6.854   1.00 54.89  ? 667  ILE A CA  1 
ATOM   4412 C C   . ILE A 1 651  ? 16.909  15.269  6.844   1.00 59.34  ? 667  ILE A C   1 
ATOM   4413 O O   . ILE A 1 651  ? 16.778  16.471  6.598   1.00 60.51  ? 667  ILE A O   1 
ATOM   4414 C CB  . ILE A 1 651  ? 15.216  13.937  8.290   1.00 56.12  ? 667  ILE A CB  1 
ATOM   4415 C CG1 . ILE A 1 651  ? 13.938  13.077  8.253   1.00 54.90  ? 667  ILE A CG1 1 
ATOM   4416 C CG2 . ILE A 1 651  ? 15.016  15.182  9.172   1.00 55.25  ? 667  ILE A CG2 1 
ATOM   4417 C CD1 . ILE A 1 651  ? 13.561  12.525  9.611   1.00 53.10  ? 667  ILE A CD1 1 
ATOM   4418 N N   . LEU A 1 652  ? 18.089  14.714  7.033   1.00 54.39  ? 668  LEU A N   1 
ATOM   4419 C CA  . LEU A 1 652  ? 19.312  15.479  7.008   1.00 54.25  ? 668  LEU A CA  1 
ATOM   4420 C C   . LEU A 1 652  ? 19.551  16.226  5.668   1.00 59.87  ? 668  LEU A C   1 
ATOM   4421 O O   . LEU A 1 652  ? 20.120  17.315  5.691   1.00 60.06  ? 668  LEU A O   1 
ATOM   4422 C CB  . LEU A 1 652  ? 20.494  14.558  7.304   1.00 53.95  ? 668  LEU A CB  1 
ATOM   4423 C CG  . LEU A 1 652  ? 20.693  14.021  8.702   1.00 56.80  ? 668  LEU A CG  1 
ATOM   4424 C CD1 . LEU A 1 652  ? 21.685  12.906  8.654   1.00 57.43  ? 668  LEU A CD1 1 
ATOM   4425 C CD2 . LEU A 1 652  ? 21.179  15.104  9.660   1.00 54.42  ? 668  LEU A CD2 1 
ATOM   4426 N N   . GLU A 1 653  ? 19.151  15.644  4.517   1.00 56.24  ? 669  GLU A N   1 
ATOM   4427 C CA  . GLU A 1 653  ? 19.362  16.289  3.213   1.00 56.27  ? 669  GLU A CA  1 
ATOM   4428 C C   . GLU A 1 653  ? 18.458  17.531  3.151   1.00 60.55  ? 669  GLU A C   1 
ATOM   4429 O O   . GLU A 1 653  ? 18.958  18.633  2.903   1.00 61.49  ? 669  GLU A O   1 
ATOM   4430 C CB  . GLU A 1 653  ? 19.081  15.305  2.061   1.00 57.86  ? 669  GLU A CB  1 
ATOM   4431 C CG  . GLU A 1 653  ? 19.193  15.906  0.664   1.00 69.64  ? 669  GLU A CG  1 
ATOM   4432 C CD  . GLU A 1 653  ? 18.461  15.207  -0.473  1.00 84.81  ? 669  GLU A CD  1 
ATOM   4433 O OE1 . GLU A 1 653  ? 18.105  14.013  -0.337  1.00 66.67  ? 669  GLU A OE1 1 
ATOM   4434 O OE2 . GLU A 1 653  ? 18.257  15.866  -1.519  1.00 81.87  ? 669  GLU A OE2 1 
ATOM   4435 N N   . ALA A 1 654  ? 17.148  17.347  3.454   1.00 55.17  ? 670  ALA A N   1 
ATOM   4436 C CA  . ALA A 1 654  ? 16.136  18.386  3.529   1.00 54.20  ? 670  ALA A CA  1 
ATOM   4437 C C   . ALA A 1 654  ? 16.618  19.487  4.486   1.00 61.27  ? 670  ALA A C   1 
ATOM   4438 O O   . ALA A 1 654  ? 16.692  20.644  4.067   1.00 61.97  ? 670  ALA A O   1 
ATOM   4439 C CB  . ALA A 1 654  ? 14.840  17.790  4.028   1.00 54.35  ? 670  ALA A CB  1 
ATOM   4440 N N   . TYR A 1 655  ? 17.042  19.128  5.730   1.00 58.67  ? 671  TYR A N   1 
ATOM   4441 C CA  . TYR A 1 655  ? 17.541  20.118  6.678   1.00 59.01  ? 671  TYR A CA  1 
ATOM   4442 C C   . TYR A 1 655  ? 18.681  20.919  6.056   1.00 64.93  ? 671  TYR A C   1 
ATOM   4443 O O   . TYR A 1 655  ? 18.676  22.133  6.167   1.00 66.09  ? 671  TYR A O   1 
ATOM   4444 C CB  . TYR A 1 655  ? 17.971  19.491  8.025   1.00 60.27  ? 671  TYR A CB  1 
ATOM   4445 C CG  . TYR A 1 655  ? 18.950  20.361  8.798   1.00 62.98  ? 671  TYR A CG  1 
ATOM   4446 C CD1 . TYR A 1 655  ? 18.513  21.472  9.518   1.00 64.00  ? 671  TYR A CD1 1 
ATOM   4447 C CD2 . TYR A 1 655  ? 20.324  20.134  8.727   1.00 65.01  ? 671  TYR A CD2 1 
ATOM   4448 C CE1 . TYR A 1 655  ? 19.411  22.298  10.191  1.00 63.23  ? 671  TYR A CE1 1 
ATOM   4449 C CE2 . TYR A 1 655  ? 21.235  20.977  9.372   1.00 65.97  ? 671  TYR A CE2 1 
ATOM   4450 C CZ  . TYR A 1 655  ? 20.771  22.047  10.114  1.00 70.32  ? 671  TYR A CZ  1 
ATOM   4451 O OH  . TYR A 1 655  ? 21.667  22.870  10.748  1.00 71.43  ? 671  TYR A OH  1 
ATOM   4452 N N   . CYS A 1 656  ? 19.650  20.242  5.429   1.00 62.11  ? 672  CYS A N   1 
ATOM   4453 C CA  . CYS A 1 656  ? 20.821  20.850  4.800   1.00 62.72  ? 672  CYS A CA  1 
ATOM   4454 C C   . CYS A 1 656  ? 20.454  21.819  3.707   1.00 69.96  ? 672  CYS A C   1 
ATOM   4455 O O   . CYS A 1 656  ? 20.950  22.958  3.711   1.00 71.40  ? 672  CYS A O   1 
ATOM   4456 C CB  . CYS A 1 656  ? 21.762  19.775  4.285   1.00 62.74  ? 672  CYS A CB  1 
ATOM   4457 S SG  . CYS A 1 656  ? 22.677  18.940  5.591   1.00 66.57  ? 672  CYS A SG  1 
ATOM   4458 N N   . ARG A 1 657  ? 19.548  21.383  2.800   1.00 65.49  ? 673  ARG A N   1 
ATOM   4459 C CA  . ARG A 1 657  ? 19.029  22.181  1.691   1.00 65.51  ? 673  ARG A CA  1 
ATOM   4460 C C   . ARG A 1 657  ? 18.439  23.538  2.146   1.00 70.72  ? 673  ARG A C   1 
ATOM   4461 O O   . ARG A 1 657  ? 18.454  24.508  1.357   1.00 70.46  ? 673  ARG A O   1 
ATOM   4462 C CB  . ARG A 1 657  ? 17.971  21.391  0.902   1.00 63.33  ? 673  ARG A CB  1 
ATOM   4463 C CG  . ARG A 1 657  ? 18.550  20.192  0.221   1.00 68.69  ? 673  ARG A CG  1 
ATOM   4464 C CD  . ARG A 1 657  ? 18.086  20.076  -1.199  1.00 75.55  ? 673  ARG A CD  1 
ATOM   4465 N NE  . ARG A 1 657  ? 18.546  18.823  -1.790  1.00 76.17  ? 673  ARG A NE  1 
ATOM   4466 C CZ  . ARG A 1 657  ? 19.694  18.691  -2.441  1.00 97.13  ? 673  ARG A CZ  1 
ATOM   4467 N NH1 . ARG A 1 657  ? 20.499  19.734  -2.597  1.00 87.50  ? 673  ARG A NH1 1 
ATOM   4468 N NH2 . ARG A 1 657  ? 20.047  17.514  -2.942  1.00 88.90  ? 673  ARG A NH2 1 
ATOM   4469 N N   . GLY A 1 658  ? 17.910  23.568  3.386   1.00 65.93  ? 674  GLY A N   1 
ATOM   4470 C CA  . GLY A 1 658  ? 17.307  24.751  3.988   1.00 65.66  ? 674  GLY A CA  1 
ATOM   4471 C C   . GLY A 1 658  ? 18.216  25.467  4.968   1.00 71.10  ? 674  GLY A C   1 
ATOM   4472 O O   . GLY A 1 658  ? 17.877  26.546  5.457   1.00 69.31  ? 674  GLY A O   1 
ATOM   4473 N N   . SER A 1 659  ? 19.394  24.888  5.244   1.00 70.53  ? 675  SER A N   1 
ATOM   4474 C CA  . SER A 1 659  ? 20.341  25.453  6.199   1.00 71.30  ? 675  SER A CA  1 
ATOM   4475 C C   . SER A 1 659  ? 21.763  25.454  5.682   1.00 75.65  ? 675  SER A C   1 
ATOM   4476 O O   . SER A 1 659  ? 22.686  25.125  6.433   1.00 76.41  ? 675  SER A O   1 
ATOM   4477 C CB  . SER A 1 659  ? 20.252  24.720  7.539   1.00 76.40  ? 675  SER A CB  1 
ATOM   4478 O OG  . SER A 1 659  ? 18.934  24.715  8.066   1.00 88.93  ? 675  SER A OG  1 
ATOM   4479 N N   . THR A 1 660  ? 21.945  25.879  4.417   1.00 71.42  ? 676  THR A N   1 
ATOM   4480 C CA  . THR A 1 660  ? 23.239  26.014  3.729   1.00 71.14  ? 676  THR A CA  1 
ATOM   4481 C C   . THR A 1 660  ? 24.289  26.769  4.547   1.00 78.99  ? 676  THR A C   1 
ATOM   4482 O O   . THR A 1 660  ? 25.460  26.436  4.451   1.00 79.55  ? 676  THR A O   1 
ATOM   4483 C CB  . THR A 1 660  ? 23.062  26.685  2.377   1.00 68.29  ? 676  THR A CB  1 
ATOM   4484 O OG1 . THR A 1 660  ? 22.176  27.799  2.534   1.00 74.85  ? 676  THR A OG1 1 
ATOM   4485 C CG2 . THR A 1 660  ? 22.552  25.731  1.309   1.00 55.61  ? 676  THR A CG2 1 
ATOM   4486 N N   . HIS A 1 661  ? 23.892  27.774  5.336   1.00 78.96  ? 677  HIS A N   1 
ATOM   4487 C CA  . HIS A 1 661  ? 24.842  28.489  6.186   1.00 81.60  ? 677  HIS A CA  1 
ATOM   4488 C C   . HIS A 1 661  ? 25.379  27.465  7.217   1.00 84.61  ? 677  HIS A C   1 
ATOM   4489 O O   . HIS A 1 661  ? 26.590  27.201  7.255   1.00 85.28  ? 677  HIS A O   1 
ATOM   4490 C CB  . HIS A 1 661  ? 24.161  29.646  6.969   1.00 84.44  ? 677  HIS A CB  1 
ATOM   4491 C CG  . HIS A 1 661  ? 23.934  30.933  6.225   1.00 89.75  ? 677  HIS A CG  1 
ATOM   4492 N ND1 . HIS A 1 661  ? 24.485  32.134  6.675   1.00 92.39  ? 677  HIS A ND1 1 
ATOM   4493 C CD2 . HIS A 1 661  ? 23.126  31.196  5.163   1.00 92.66  ? 677  HIS A CD2 1 
ATOM   4494 C CE1 . HIS A 1 661  ? 24.042  33.069  5.844   1.00 92.21  ? 677  HIS A CE1 1 
ATOM   4495 N NE2 . HIS A 1 661  ? 23.214  32.558  4.923   1.00 92.60  ? 677  HIS A NE2 1 
ATOM   4496 N N   . HIS A 1 662  ? 24.457  26.863  8.030   1.00 76.75  ? 678  HIS A N   1 
ATOM   4497 C CA  . HIS A 1 662  ? 24.836  25.915  9.071   1.00 73.44  ? 678  HIS A CA  1 
ATOM   4498 C C   . HIS A 1 662  ? 25.588  24.698  8.499   1.00 72.59  ? 678  HIS A C   1 
ATOM   4499 O O   . HIS A 1 662  ? 26.463  24.172  9.183   1.00 71.67  ? 678  HIS A O   1 
ATOM   4500 C CB  . HIS A 1 662  ? 23.656  25.521  9.981   1.00 73.12  ? 678  HIS A CB  1 
ATOM   4501 C CG  . HIS A 1 662  ? 24.122  25.211  11.365  1.00 75.74  ? 678  HIS A CG  1 
ATOM   4502 N ND1 . HIS A 1 662  ? 24.741  26.175  12.149  1.00 77.39  ? 678  HIS A ND1 1 
ATOM   4503 C CD2 . HIS A 1 662  ? 24.164  24.031  12.020  1.00 76.73  ? 678  HIS A CD2 1 
ATOM   4504 C CE1 . HIS A 1 662  ? 25.118  25.554  13.256  1.00 76.33  ? 678  HIS A CE1 1 
ATOM   4505 N NE2 . HIS A 1 662  ? 24.794  24.262  13.224  1.00 76.49  ? 678  HIS A NE2 1 
ATOM   4506 N N   . MET A 1 663  ? 25.319  24.332  7.223   1.00 65.99  ? 679  MET A N   1 
ATOM   4507 C CA  . MET A 1 663  ? 26.013  23.276  6.481   1.00 65.27  ? 679  MET A CA  1 
ATOM   4508 C C   . MET A 1 663  ? 27.503  23.530  6.494   1.00 69.96  ? 679  MET A C   1 
ATOM   4509 O O   . MET A 1 663  ? 28.267  22.574  6.513   1.00 71.35  ? 679  MET A O   1 
ATOM   4510 C CB  . MET A 1 663  ? 25.590  23.267  5.011   1.00 67.35  ? 679  MET A CB  1 
ATOM   4511 C CG  . MET A 1 663  ? 24.680  22.160  4.651   1.00 70.85  ? 679  MET A CG  1 
ATOM   4512 S SD  . MET A 1 663  ? 24.626  21.970  2.849   1.00 74.77  ? 679  MET A SD  1 
ATOM   4513 C CE  . MET A 1 663  ? 25.761  20.659  2.667   1.00 71.83  ? 679  MET A CE  1 
ATOM   4514 N N   . LYS A 1 664  ? 27.919  24.805  6.464   1.00 66.01  ? 680  LYS A N   1 
ATOM   4515 C CA  . LYS A 1 664  ? 29.331  25.187  6.471   1.00 66.18  ? 680  LYS A CA  1 
ATOM   4516 C C   . LYS A 1 664  ? 29.964  24.934  7.824   1.00 68.96  ? 680  LYS A C   1 
ATOM   4517 O O   . LYS A 1 664  ? 31.100  24.464  7.902   1.00 67.32  ? 680  LYS A O   1 
ATOM   4518 C CB  . LYS A 1 664  ? 29.511  26.647  6.027   1.00 69.68  ? 680  LYS A CB  1 
ATOM   4519 C CG  . LYS A 1 664  ? 29.335  26.853  4.515   1.00 82.10  ? 680  LYS A CG  1 
ATOM   4520 N N   . VAL A 1 665  ? 29.195  25.167  8.883   1.00 67.17  ? 681  VAL A N   1 
ATOM   4521 C CA  . VAL A 1 665  ? 29.622  24.937  10.261  1.00 67.47  ? 681  VAL A CA  1 
ATOM   4522 C C   . VAL A 1 665  ? 29.785  23.430  10.534  1.00 72.62  ? 681  VAL A C   1 
ATOM   4523 O O   . VAL A 1 665  ? 30.865  22.978  10.928  1.00 73.07  ? 681  VAL A O   1 
ATOM   4524 C CB  . VAL A 1 665  ? 28.655  25.603  11.253  1.00 71.26  ? 681  VAL A CB  1 
ATOM   4525 C CG1 . VAL A 1 665  ? 29.056  25.303  12.688  1.00 71.51  ? 681  VAL A CG1 1 
ATOM   4526 C CG2 . VAL A 1 665  ? 28.571  27.109  11.015  1.00 70.99  ? 681  VAL A CG2 1 
ATOM   4527 N N   . LEU A 1 666  ? 28.716  22.665  10.302  1.00 68.57  ? 682  LEU A N   1 
ATOM   4528 C CA  . LEU A 1 666  ? 28.660  21.222  10.514  1.00 68.28  ? 682  LEU A CA  1 
ATOM   4529 C C   . LEU A 1 666  ? 29.714  20.486  9.703   1.00 74.42  ? 682  LEU A C   1 
ATOM   4530 O O   . LEU A 1 666  ? 30.145  19.413  10.120  1.00 74.06  ? 682  LEU A O   1 
ATOM   4531 C CB  . LEU A 1 666  ? 27.250  20.706  10.192  1.00 68.08  ? 682  LEU A CB  1 
ATOM   4532 C CG  . LEU A 1 666  ? 26.109  21.321  11.003  1.00 71.23  ? 682  LEU A CG  1 
ATOM   4533 C CD1 . LEU A 1 666  ? 24.794  21.085  10.332  1.00 70.71  ? 682  LEU A CD1 1 
ATOM   4534 C CD2 . LEU A 1 666  ? 26.121  20.847  12.450  1.00 72.43  ? 682  LEU A CD2 1 
ATOM   4535 N N   . MET A 1 667  ? 30.128  21.071  8.545   1.00 71.85  ? 683  MET A N   1 
ATOM   4536 C CA  . MET A 1 667  ? 31.193  20.573  7.677   1.00 71.17  ? 683  MET A CA  1 
ATOM   4537 C C   . MET A 1 667  ? 32.516  20.720  8.433   1.00 70.26  ? 683  MET A C   1 
ATOM   4538 O O   . MET A 1 667  ? 33.240  19.744  8.537   1.00 70.75  ? 683  MET A O   1 
ATOM   4539 C CB  . MET A 1 667  ? 31.255  21.370  6.363   1.00 74.41  ? 683  MET A CB  1 
ATOM   4540 C CG  . MET A 1 667  ? 30.685  20.644  5.157   1.00 79.61  ? 683  MET A CG  1 
ATOM   4541 S SD  . MET A 1 667  ? 30.338  21.778  3.764   1.00 85.82  ? 683  MET A SD  1 
ATOM   4542 C CE  . MET A 1 667  ? 32.028  21.981  3.073   1.00 83.11  ? 683  MET A CE  1 
ATOM   4543 N N   . LYS A 1 668  ? 32.811  21.915  8.993   1.00 63.29  ? 684  LYS A N   1 
ATOM   4544 C CA  . LYS A 1 668  ? 34.033  22.176  9.770   1.00 62.16  ? 684  LYS A CA  1 
ATOM   4545 C C   . LYS A 1 668  ? 34.154  21.197  10.951  1.00 67.86  ? 684  LYS A C   1 
ATOM   4546 O O   . LYS A 1 668  ? 35.251  20.689  11.200  1.00 68.70  ? 684  LYS A O   1 
ATOM   4547 C CB  . LYS A 1 668  ? 34.033  23.611  10.328  1.00 62.53  ? 684  LYS A CB  1 
ATOM   4548 C CG  . LYS A 1 668  ? 35.178  24.467  9.852   1.00 66.46  ? 684  LYS A CG  1 
ATOM   4549 C CD  . LYS A 1 668  ? 34.674  25.689  9.095   1.00 74.02  ? 684  LYS A CD  1 
ATOM   4550 N N   . GLN A 1 669  ? 33.010  20.934  11.654  1.00 62.77  ? 685  GLN A N   1 
ATOM   4551 C CA  . GLN A 1 669  ? 32.877  20.085  12.837  1.00 61.38  ? 685  GLN A CA  1 
ATOM   4552 C C   . GLN A 1 669  ? 33.115  18.635  12.546  1.00 67.42  ? 685  GLN A C   1 
ATOM   4553 O O   . GLN A 1 669  ? 33.896  18.013  13.252  1.00 68.40  ? 685  GLN A O   1 
ATOM   4554 C CB  . GLN A 1 669  ? 31.508  20.265  13.507  1.00 61.86  ? 685  GLN A CB  1 
ATOM   4555 C CG  . GLN A 1 669  ? 31.259  21.672  14.050  1.00 61.76  ? 685  GLN A CG  1 
ATOM   4556 C CD  . GLN A 1 669  ? 29.909  21.838  14.727  1.00 75.00  ? 685  GLN A CD  1 
ATOM   4557 O OE1 . GLN A 1 669  ? 29.036  20.955  14.693  1.00 63.80  ? 685  GLN A OE1 1 
ATOM   4558 N NE2 . GLN A 1 669  ? 29.709  22.991  15.372  1.00 70.77  ? 685  GLN A NE2 1 
ATOM   4559 N N   . GLY A 1 670  ? 32.452  18.103  11.523  1.00 65.59  ? 686  GLY A N   1 
ATOM   4560 C CA  . GLY A 1 670  ? 32.567  16.705  11.110  1.00 66.36  ? 686  GLY A CA  1 
ATOM   4561 C C   . GLY A 1 670  ? 33.967  16.336  10.660  1.00 72.99  ? 686  GLY A C   1 
ATOM   4562 O O   . GLY A 1 670  ? 34.375  15.167  10.767  1.00 73.22  ? 686  GLY A O   1 
ATOM   4563 N N   . GLU A 1 671  ? 34.701  17.356  10.146  1.00 70.08  ? 687  GLU A N   1 
ATOM   4564 C CA  . GLU A 1 671  ? 36.069  17.283  9.652   1.00 70.95  ? 687  GLU A CA  1 
ATOM   4565 C C   . GLU A 1 671  ? 37.033  17.088  10.794  1.00 75.42  ? 687  GLU A C   1 
ATOM   4566 O O   . GLU A 1 671  ? 37.833  16.151  10.743  1.00 75.53  ? 687  GLU A O   1 
ATOM   4567 C CB  . GLU A 1 671  ? 36.415  18.568  8.917   1.00 73.08  ? 687  GLU A CB  1 
ATOM   4568 C CG  . GLU A 1 671  ? 37.346  18.343  7.745   1.00 87.55  ? 687  GLU A CG  1 
ATOM   4569 C CD  . GLU A 1 671  ? 36.934  19.199  6.572   1.00 109.43 ? 687  GLU A CD  1 
ATOM   4570 O OE1 . GLU A 1 671  ? 36.984  20.447  6.693   1.00 116.63 ? 687  GLU A OE1 1 
ATOM   4571 O OE2 . GLU A 1 671  ? 36.486  18.619  5.559   1.00 93.76  ? 687  GLU A OE2 1 
ATOM   4572 N N   . ALA A 1 672  ? 36.965  17.989  11.820  1.00 71.64  ? 688  ALA A N   1 
ATOM   4573 C CA  . ALA A 1 672  ? 37.734  17.928  13.066  1.00 70.61  ? 688  ALA A CA  1 
ATOM   4574 C C   . ALA A 1 672  ? 37.430  16.591  13.719  1.00 75.36  ? 688  ALA A C   1 
ATOM   4575 O O   . ALA A 1 672  ? 38.341  15.932  14.215  1.00 77.07  ? 688  ALA A O   1 
ATOM   4576 C CB  . ALA A 1 672  ? 37.317  19.044  14.001  1.00 70.81  ? 688  ALA A CB  1 
ATOM   4577 N N   . LEU A 1 673  ? 36.162  16.151  13.655  1.00 70.33  ? 689  LEU A N   1 
ATOM   4578 C CA  . LEU A 1 673  ? 35.752  14.874  14.239  1.00 69.94  ? 689  LEU A CA  1 
ATOM   4579 C C   . LEU A 1 673  ? 36.429  13.688  13.590  1.00 73.47  ? 689  LEU A C   1 
ATOM   4580 O O   . LEU A 1 673  ? 36.772  12.733  14.291  1.00 72.37  ? 689  LEU A O   1 
ATOM   4581 C CB  . LEU A 1 673  ? 34.221  14.705  14.235  1.00 69.25  ? 689  LEU A CB  1 
ATOM   4582 C CG  . LEU A 1 673  ? 33.470  15.557  15.231  1.00 71.47  ? 689  LEU A CG  1 
ATOM   4583 C CD1 . LEU A 1 673  ? 32.032  15.629  14.854  1.00 71.12  ? 689  LEU A CD1 1 
ATOM   4584 C CD2 . LEU A 1 673  ? 33.671  15.065  16.628  1.00 69.00  ? 689  LEU A CD2 1 
ATOM   4585 N N   . SER A 1 674  ? 36.627  13.772  12.257  1.00 70.71  ? 690  SER A N   1 
ATOM   4586 C CA  . SER A 1 674  ? 37.269  12.752  11.421  1.00 70.50  ? 690  SER A CA  1 
ATOM   4587 C C   . SER A 1 674  ? 38.741  12.634  11.764  1.00 72.30  ? 690  SER A C   1 
ATOM   4588 O O   . SER A 1 674  ? 39.253  11.517  11.870  1.00 69.93  ? 690  SER A O   1 
ATOM   4589 C CB  . SER A 1 674  ? 37.109  13.081  9.941   1.00 74.63  ? 690  SER A CB  1 
ATOM   4590 O OG  . SER A 1 674  ? 37.308  11.905  9.173   1.00 87.78  ? 690  SER A OG  1 
ATOM   4591 N N   . LYS A 1 675  ? 39.402  13.797  11.973  1.00 69.33  ? 691  LYS A N   1 
ATOM   4592 C CA  . LYS A 1 675  ? 40.813  13.879  12.353  1.00 69.18  ? 691  LYS A CA  1 
ATOM   4593 C C   . LYS A 1 675  ? 41.030  13.267  13.729  1.00 73.60  ? 691  LYS A C   1 
ATOM   4594 O O   . LYS A 1 675  ? 41.903  12.408  13.865  1.00 72.26  ? 691  LYS A O   1 
ATOM   4595 C CB  . LYS A 1 675  ? 41.360  15.323  12.269  1.00 70.77  ? 691  LYS A CB  1 
ATOM   4596 C CG  . LYS A 1 675  ? 41.380  15.912  10.846  1.00 76.04  ? 691  LYS A CG  1 
ATOM   4597 C CD  . LYS A 1 675  ? 42.390  15.290  9.876   1.00 74.73  ? 691  LYS A CD  1 
ATOM   4598 N N   . LEU A 1 676  ? 40.188  13.665  14.726  1.00 71.13  ? 692  LEU A N   1 
ATOM   4599 C CA  . LEU A 1 676  ? 40.207  13.151  16.099  1.00 70.34  ? 692  LEU A CA  1 
ATOM   4600 C C   . LEU A 1 676  ? 40.022  11.609  16.136  1.00 74.71  ? 692  LEU A C   1 
ATOM   4601 O O   . LEU A 1 676  ? 40.711  10.956  16.910  1.00 74.22  ? 692  LEU A O   1 
ATOM   4602 C CB  . LEU A 1 676  ? 39.153  13.857  16.976  1.00 69.99  ? 692  LEU A CB  1 
ATOM   4603 C CG  . LEU A 1 676  ? 39.377  15.340  17.338  1.00 73.41  ? 692  LEU A CG  1 
ATOM   4604 C CD1 . LEU A 1 676  ? 38.126  15.965  17.923  1.00 71.99  ? 692  LEU A CD1 1 
ATOM   4605 C CD2 . LEU A 1 676  ? 40.528  15.523  18.315  1.00 75.81  ? 692  LEU A CD2 1 
ATOM   4606 N N   . LYS A 1 677  ? 39.153  11.019  15.278  1.00 71.65  ? 693  LYS A N   1 
ATOM   4607 C CA  . LYS A 1 677  ? 38.992  9.553   15.261  1.00 71.96  ? 693  LYS A CA  1 
ATOM   4608 C C   . LYS A 1 677  ? 40.300  8.897   14.833  1.00 80.86  ? 693  LYS A C   1 
ATOM   4609 O O   . LYS A 1 677  ? 40.726  7.930   15.457  1.00 82.31  ? 693  LYS A O   1 
ATOM   4610 C CB  . LYS A 1 677  ? 37.803  9.091   14.383  1.00 72.30  ? 693  LYS A CB  1 
ATOM   4611 C CG  . LYS A 1 677  ? 37.755  7.587   14.005  1.00 63.12  ? 693  LYS A CG  1 
ATOM   4612 C CD  . LYS A 1 677  ? 37.557  6.620   15.172  1.00 64.78  ? 693  LYS A CD  1 
ATOM   4613 C CE  . LYS A 1 677  ? 36.905  5.298   14.817  1.00 75.59  ? 693  LYS A CE  1 
ATOM   4614 N NZ  . LYS A 1 677  ? 37.807  4.372   14.055  1.00 84.24  ? 693  LYS A NZ  1 
ATOM   4615 N N   . ALA A 1 678  ? 40.949  9.451   13.793  1.00 78.58  ? 694  ALA A N   1 
ATOM   4616 C CA  . ALA A 1 678  ? 42.222  8.971   13.275  1.00 77.82  ? 694  ALA A CA  1 
ATOM   4617 C C   . ALA A 1 678  ? 43.348  9.206   14.320  1.00 82.25  ? 694  ALA A C   1 
ATOM   4618 O O   . ALA A 1 678  ? 44.155  8.305   14.564  1.00 81.30  ? 694  ALA A O   1 
ATOM   4619 C CB  . ALA A 1 678  ? 42.530  9.666   11.961  1.00 78.09  ? 694  ALA A CB  1 
ATOM   4620 N N   . LEU A 1 679  ? 43.337  10.374  14.985  1.00 79.46  ? 695  LEU A N   1 
ATOM   4621 C CA  . LEU A 1 679  ? 44.294  10.736  16.022  1.00 80.34  ? 695  LEU A CA  1 
ATOM   4622 C C   . LEU A 1 679  ? 44.143  9.847   17.253  1.00 88.13  ? 695  LEU A C   1 
ATOM   4623 O O   . LEU A 1 679  ? 45.144  9.379   17.786  1.00 87.89  ? 695  LEU A O   1 
ATOM   4624 C CB  . LEU A 1 679  ? 44.139  12.217  16.391  1.00 80.29  ? 695  LEU A CB  1 
ATOM   4625 C CG  . LEU A 1 679  ? 45.023  12.726  17.518  1.00 84.96  ? 695  LEU A CG  1 
ATOM   4626 C CD1 . LEU A 1 679  ? 46.478  12.818  17.081  1.00 85.42  ? 695  LEU A CD1 1 
ATOM   4627 C CD2 . LEU A 1 679  ? 44.555  14.063  17.979  1.00 86.61  ? 695  LEU A CD2 1 
ATOM   4628 N N   . ASN A 1 680  ? 42.893  9.600   17.684  1.00 87.82  ? 696  ASN A N   1 
ATOM   4629 C CA  . ASN A 1 680  ? 42.567  8.745   18.824  1.00 88.89  ? 696  ASN A CA  1 
ATOM   4630 C C   . ASN A 1 680  ? 42.984  7.320   18.537  1.00 93.72  ? 696  ASN A C   1 
ATOM   4631 O O   . ASN A 1 680  ? 43.536  6.671   19.421  1.00 94.05  ? 696  ASN A O   1 
ATOM   4632 C CB  . ASN A 1 680  ? 41.065  8.793   19.155  1.00 90.65  ? 696  ASN A CB  1 
ATOM   4633 C CG  . ASN A 1 680  ? 40.593  7.620   19.976  1.00 115.12 ? 696  ASN A CG  1 
ATOM   4634 O OD1 . ASN A 1 680  ? 40.987  7.447   21.139  1.00 104.84 ? 696  ASN A OD1 1 
ATOM   4635 N ND2 . ASN A 1 680  ? 39.843  6.724   19.332  1.00 108.35 ? 696  ASN A ND2 1 
ATOM   4636 N N   . ASP A 1 681  ? 42.684  6.830   17.316  1.00 90.05  ? 697  ASP A N   1 
ATOM   4637 C CA  . ASP A 1 681  ? 43.009  5.481   16.858  1.00 90.27  ? 697  ASP A CA  1 
ATOM   4638 C C   . ASP A 1 681  ? 44.515  5.189   17.002  1.00 96.19  ? 697  ASP A C   1 
ATOM   4639 O O   . ASP A 1 681  ? 44.893  4.114   17.495  1.00 95.91  ? 697  ASP A O   1 
ATOM   4640 C CB  . ASP A 1 681  ? 42.513  5.264   15.416  1.00 91.31  ? 697  ASP A CB  1 
ATOM   4641 C CG  . ASP A 1 681  ? 41.072  4.788   15.297  1.00 95.21  ? 697  ASP A CG  1 
ATOM   4642 O OD1 . ASP A 1 681  ? 40.341  4.826   16.319  1.00 96.51  ? 697  ASP A OD1 1 
ATOM   4643 O OD2 . ASP A 1 681  ? 40.675  4.377   14.190  1.00 96.18  ? 697  ASP A OD2 1 
ATOM   4644 N N   . PHE A 1 682  ? 45.356  6.192   16.645  1.00 92.96  ? 698  PHE A N   1 
ATOM   4645 C CA  . PHE A 1 682  ? 46.805  6.146   16.763  1.00 92.32  ? 698  PHE A CA  1 
ATOM   4646 C C   . PHE A 1 682  ? 47.184  6.023   18.231  1.00 93.80  ? 698  PHE A C   1 
ATOM   4647 O O   . PHE A 1 682  ? 47.848  5.059   18.589  1.00 92.79  ? 698  PHE A O   1 
ATOM   4648 C CB  . PHE A 1 682  ? 47.468  7.381   16.116  1.00 94.52  ? 698  PHE A CB  1 
ATOM   4649 C CG  . PHE A 1 682  ? 48.954  7.470   16.385  1.00 97.01  ? 698  PHE A CG  1 
ATOM   4650 C CD1 . PHE A 1 682  ? 49.843  6.571   15.792  1.00 100.36 ? 698  PHE A CD1 1 
ATOM   4651 C CD2 . PHE A 1 682  ? 49.465  8.426   17.259  1.00 99.91  ? 698  PHE A CD2 1 
ATOM   4652 C CE1 . PHE A 1 682  ? 51.214  6.634   16.065  1.00 101.59 ? 698  PHE A CE1 1 
ATOM   4653 C CE2 . PHE A 1 682  ? 50.839  8.487   17.534  1.00 103.03 ? 698  PHE A CE2 1 
ATOM   4654 C CZ  . PHE A 1 682  ? 51.704  7.592   16.934  1.00 101.17 ? 698  PHE A CZ  1 
ATOM   4655 N N   . VAL A 1 683  ? 46.728  6.975   19.075  1.00 89.63  ? 699  VAL A N   1 
ATOM   4656 C CA  . VAL A 1 683  ? 46.972  7.018   20.528  1.00 89.10  ? 699  VAL A CA  1 
ATOM   4657 C C   . VAL A 1 683  ? 46.570  5.705   21.205  1.00 94.14  ? 699  VAL A C   1 
ATOM   4658 O O   . VAL A 1 683  ? 47.344  5.180   21.994  1.00 93.49  ? 699  VAL A O   1 
ATOM   4659 C CB  . VAL A 1 683  ? 46.323  8.262   21.189  1.00 92.18  ? 699  VAL A CB  1 
ATOM   4660 C CG1 . VAL A 1 683  ? 46.393  8.196   22.714  1.00 91.78  ? 699  VAL A CG1 1 
ATOM   4661 C CG2 . VAL A 1 683  ? 46.965  9.546   20.678  1.00 91.64  ? 699  VAL A CG2 1 
ATOM   4662 N N   . LYS A 1 684  ? 45.395  5.151   20.845  1.00 93.29  ? 700  LYS A N   1 
ATOM   4663 C CA  . LYS A 1 684  ? 44.876  3.871   21.345  1.00 94.16  ? 700  LYS A CA  1 
ATOM   4664 C C   . LYS A 1 684  ? 45.936  2.773   21.145  1.00 100.32 ? 700  LYS A C   1 
ATOM   4665 O O   . LYS A 1 684  ? 46.272  2.064   22.100  1.00 99.13  ? 700  LYS A O   1 
ATOM   4666 C CB  . LYS A 1 684  ? 43.568  3.493   20.611  1.00 96.46  ? 700  LYS A CB  1 
ATOM   4667 C CG  . LYS A 1 684  ? 42.292  4.087   21.211  1.00 105.78 ? 700  LYS A CG  1 
ATOM   4668 C CD  . LYS A 1 684  ? 41.059  3.752   20.354  1.00 108.71 ? 700  LYS A CD  1 
ATOM   4669 C CE  . LYS A 1 684  ? 40.131  2.745   20.987  1.00 106.06 ? 700  LYS A CE  1 
ATOM   4670 N NZ  . LYS A 1 684  ? 38.959  2.454   20.120  1.00 105.31 ? 700  LYS A NZ  1 
ATOM   4671 N N   . LEU A 1 685  ? 46.492  2.695   19.907  1.00 99.33  ? 701  LEU A N   1 
ATOM   4672 C CA  . LEU A 1 685  ? 47.528  1.756   19.470  1.00 100.14 ? 701  LEU A CA  1 
ATOM   4673 C C   . LEU A 1 685  ? 48.870  2.053   20.172  1.00 107.46 ? 701  LEU A C   1 
ATOM   4674 O O   . LEU A 1 685  ? 49.437  1.162   20.817  1.00 107.58 ? 701  LEU A O   1 
ATOM   4675 C CB  . LEU A 1 685  ? 47.672  1.813   17.935  1.00 99.99  ? 701  LEU A CB  1 
ATOM   4676 N N   . SER A 1 686  ? 49.332  3.329   20.101  1.00 105.47 ? 702  SER A N   1 
ATOM   4677 C CA  . SER A 1 686  ? 50.562  3.865   20.704  1.00 105.40 ? 702  SER A CA  1 
ATOM   4678 C C   . SER A 1 686  ? 50.600  3.734   22.242  1.00 111.04 ? 702  SER A C   1 
ATOM   4679 O O   . SER A 1 686  ? 51.641  4.016   22.849  1.00 111.04 ? 702  SER A O   1 
ATOM   4680 C CB  . SER A 1 686  ? 50.767  5.314   20.273  1.00 108.05 ? 702  SER A CB  1 
ATOM   4681 O OG  . SER A 1 686  ? 51.880  5.922   20.905  1.00 115.77 ? 702  SER A OG  1 
ATOM   4682 N N   . SER A 1 687  ? 49.467  3.315   22.864  1.00 108.14 ? 703  SER A N   1 
ATOM   4683 C CA  . SER A 1 687  ? 49.339  3.075   24.303  1.00 107.98 ? 703  SER A CA  1 
ATOM   4684 C C   . SER A 1 687  ? 49.825  1.672   24.589  1.00 112.68 ? 703  SER A C   1 
ATOM   4685 O O   . SER A 1 687  ? 50.395  1.414   25.650  1.00 111.97 ? 703  SER A O   1 
ATOM   4686 C CB  . SER A 1 687  ? 47.889  3.205   24.742  1.00 110.90 ? 703  SER A CB  1 
ATOM   4687 O OG  . SER A 1 687  ? 47.467  4.552   24.638  1.00 119.42 ? 703  SER A OG  1 
ATOM   4688 N N   . GLN A 1 688  ? 49.616  0.772   23.617  1.00 110.53 ? 704  GLN A N   1 
ATOM   4689 C CA  . GLN A 1 688  ? 50.037  -0.620  23.686  1.00 111.28 ? 704  GLN A CA  1 
ATOM   4690 C C   . GLN A 1 688  ? 51.461  -0.773  23.079  1.00 118.76 ? 704  GLN A C   1 
ATOM   4691 O O   . GLN A 1 688  ? 51.788  -1.820  22.508  1.00 119.40 ? 704  GLN A O   1 
ATOM   4692 C CB  . GLN A 1 688  ? 48.988  -1.532  23.014  1.00 112.13 ? 704  GLN A CB  1 
ATOM   4693 C CG  . GLN A 1 688  ? 47.703  -1.684  23.820  1.00 116.50 ? 704  GLN A CG  1 
ATOM   4694 N N   . LYS A 1 689  ? 52.307  0.284   23.234  1.00 116.25 ? 705  LYS A N   1 
ATOM   4695 C CA  . LYS A 1 689  ? 53.697  0.380   22.762  1.00 116.06 ? 705  LYS A CA  1 
ATOM   4696 C C   . LYS A 1 689  ? 54.524  1.240   23.746  1.00 121.29 ? 705  LYS A C   1 
ATOM   4697 O O   . LYS A 1 689  ? 54.918  0.765   24.814  1.00 121.12 ? 705  LYS A O   1 
ATOM   4698 C CB  . LYS A 1 689  ? 53.763  0.966   21.325  1.00 117.64 ? 705  LYS A CB  1 
ATOM   4699 C CG  . LYS A 1 689  ? 53.566  -0.048  20.208  1.00 126.84 ? 705  LYS A CG  1 
ATOM   4700 N N   . THR A 1 690  ? 54.754  2.509   23.386  1.00 118.57 ? 706  THR A N   1 
ATOM   4701 C CA  . THR A 1 690  ? 55.519  3.488   24.150  1.00 118.60 ? 706  THR A CA  1 
ATOM   4702 C C   . THR A 1 690  ? 54.788  3.926   25.442  1.00 122.42 ? 706  THR A C   1 
ATOM   4703 O O   . THR A 1 690  ? 53.567  3.782   25.500  1.00 122.19 ? 706  THR A O   1 
ATOM   4704 C CB  . THR A 1 690  ? 55.807  4.689   23.231  1.00 125.74 ? 706  THR A CB  1 
ATOM   4705 N N   . PRO A 1 691  ? 55.484  4.492   26.471  1.00 118.51 ? 707  PRO A N   1 
ATOM   4706 C CA  . PRO A 1 691  ? 54.762  4.977   27.659  1.00 117.73 ? 707  PRO A CA  1 
ATOM   4707 C C   . PRO A 1 691  ? 53.972  6.256   27.352  1.00 119.00 ? 707  PRO A C   1 
ATOM   4708 O O   . PRO A 1 691  ? 54.192  6.877   26.310  1.00 118.11 ? 707  PRO A O   1 
ATOM   4709 C CB  . PRO A 1 691  ? 55.887  5.243   28.664  1.00 119.78 ? 707  PRO A CB  1 
ATOM   4710 C CG  . PRO A 1 691  ? 57.049  5.607   27.829  1.00 124.53 ? 707  PRO A CG  1 
ATOM   4711 C CD  . PRO A 1 691  ? 56.938  4.752   26.594  1.00 120.26 ? 707  PRO A CD  1 
ATOM   4712 N N   . LYS A 1 692  ? 53.077  6.659   28.279  1.00 114.00 ? 708  LYS A N   1 
ATOM   4713 C CA  . LYS A 1 692  ? 52.202  7.828   28.144  1.00 112.67 ? 708  LYS A CA  1 
ATOM   4714 C C   . LYS A 1 692  ? 52.924  9.131   27.714  1.00 114.63 ? 708  LYS A C   1 
ATOM   4715 O O   . LYS A 1 692  ? 52.393  9.759   26.798  1.00 114.40 ? 708  LYS A O   1 
ATOM   4716 C CB  . LYS A 1 692  ? 51.346  8.062   29.413  1.00 114.34 ? 708  LYS A CB  1 
ATOM   4717 C CG  . LYS A 1 692  ? 50.235  9.115   29.239  1.00 116.72 ? 708  LYS A CG  1 
ATOM   4718 C CD  . LYS A 1 692  ? 49.096  8.949   30.240  1.00 117.86 ? 708  LYS A CD  1 
ATOM   4719 C CE  . LYS A 1 692  ? 48.128  10.110  30.237  1.00 114.65 ? 708  LYS A CE  1 
ATOM   4720 N NZ  . LYS A 1 692  ? 48.678  11.307  30.940  1.00 116.69 ? 708  LYS A NZ  1 
ATOM   4721 N N   . PRO A 1 693  ? 54.083  9.580   28.289  1.00 109.41 ? 709  PRO A N   1 
ATOM   4722 C CA  . PRO A 1 693  ? 54.664  10.867  27.834  1.00 108.23 ? 709  PRO A CA  1 
ATOM   4723 C C   . PRO A 1 693  ? 55.230  10.843  26.422  1.00 109.32 ? 709  PRO A C   1 
ATOM   4724 O O   . PRO A 1 693  ? 55.307  11.897  25.782  1.00 107.38 ? 709  PRO A O   1 
ATOM   4725 C CB  . PRO A 1 693  ? 55.736  11.184  28.879  1.00 110.12 ? 709  PRO A CB  1 
ATOM   4726 C CG  . PRO A 1 693  ? 55.536  10.190  29.989  1.00 114.82 ? 709  PRO A CG  1 
ATOM   4727 C CD  . PRO A 1 693  ? 54.891  8.997   29.379  1.00 110.54 ? 709  PRO A CD  1 
ATOM   4728 N N   . GLN A 1 694  ? 55.610  9.634   25.942  1.00 105.84 ? 710  GLN A N   1 
ATOM   4729 C CA  . GLN A 1 694  ? 56.125  9.387   24.594  1.00 105.71 ? 710  GLN A CA  1 
ATOM   4730 C C   . GLN A 1 694  ? 54.972  9.522   23.606  1.00 109.52 ? 710  GLN A C   1 
ATOM   4731 O O   . GLN A 1 694  ? 55.098  10.257  22.618  1.00 109.33 ? 710  GLN A O   1 
ATOM   4732 C CB  . GLN A 1 694  ? 56.766  7.997   24.496  1.00 107.06 ? 710  GLN A CB  1 
ATOM   4733 N N   . THR A 1 695  ? 53.827  8.849   23.910  1.00 105.06 ? 711  THR A N   1 
ATOM   4734 C CA  . THR A 1 695  ? 52.577  8.895   23.137  1.00 103.69 ? 711  THR A CA  1 
ATOM   4735 C C   . THR A 1 695  ? 52.076  10.353  23.081  1.00 103.81 ? 711  THR A C   1 
ATOM   4736 O O   . THR A 1 695  ? 51.780  10.841  21.996  1.00 102.78 ? 711  THR A O   1 
ATOM   4737 C CB  . THR A 1 695  ? 51.539  7.898   23.702  1.00 111.75 ? 711  THR A CB  1 
ATOM   4738 O OG1 . THR A 1 695  ? 52.076  6.569   23.673  1.00 110.23 ? 711  THR A OG1 1 
ATOM   4739 C CG2 . THR A 1 695  ? 50.221  7.930   22.940  1.00 110.36 ? 711  THR A CG2 1 
ATOM   4740 N N   . LYS A 1 696  ? 52.054  11.050  24.240  1.00 98.10  ? 712  LYS A N   1 
ATOM   4741 C CA  . LYS A 1 696  ? 51.666  12.461  24.391  1.00 96.69  ? 712  LYS A CA  1 
ATOM   4742 C C   . LYS A 1 696  ? 52.384  13.324  23.344  1.00 102.35 ? 712  LYS A C   1 
ATOM   4743 O O   . LYS A 1 696  ? 51.724  14.073  22.618  1.00 101.85 ? 712  LYS A O   1 
ATOM   4744 C CB  . LYS A 1 696  ? 51.968  12.947  25.840  1.00 96.45  ? 712  LYS A CB  1 
ATOM   4745 C CG  . LYS A 1 696  ? 51.682  14.424  26.128  1.00 84.73  ? 712  LYS A CG  1 
ATOM   4746 C CD  . LYS A 1 696  ? 51.445  14.719  27.625  1.00 79.32  ? 712  LYS A CD  1 
ATOM   4747 N N   . GLU A 1 697  ? 53.730  13.162  23.242  1.00 100.02 ? 713  GLU A N   1 
ATOM   4748 C CA  . GLU A 1 697  ? 54.597  13.902  22.327  1.00 99.79  ? 713  GLU A CA  1 
ATOM   4749 C C   . GLU A 1 697  ? 54.465  13.398  20.893  1.00 103.34 ? 713  GLU A C   1 
ATOM   4750 O O   . GLU A 1 697  ? 54.550  14.203  19.960  1.00 102.57 ? 713  GLU A O   1 
ATOM   4751 C CB  . GLU A 1 697  ? 56.048  13.875  22.812  1.00 101.26 ? 713  GLU A CB  1 
ATOM   4752 C CG  . GLU A 1 697  ? 56.253  14.601  24.132  1.00 112.52 ? 713  GLU A CG  1 
ATOM   4753 N N   . LEU A 1 698  ? 54.209  12.080  20.722  1.00 99.52  ? 714  LEU A N   1 
ATOM   4754 C CA  . LEU A 1 698  ? 53.983  11.458  19.412  1.00 99.78  ? 714  LEU A CA  1 
ATOM   4755 C C   . LEU A 1 698  ? 52.538  11.770  18.896  1.00 105.38 ? 714  LEU A C   1 
ATOM   4756 O O   . LEU A 1 698  ? 52.177  11.441  17.752  1.00 104.29 ? 714  LEU A O   1 
ATOM   4757 C CB  . LEU A 1 698  ? 54.255  9.945   19.465  1.00 99.72  ? 714  LEU A CB  1 
ATOM   4758 N N   . MET A 1 699  ? 51.732  12.432  19.758  1.00 102.82 ? 715  MET A N   1 
ATOM   4759 C CA  . MET A 1 699  ? 50.380  12.885  19.469  1.00 102.82 ? 715  MET A CA  1 
ATOM   4760 C C   . MET A 1 699  ? 50.494  14.339  19.053  1.00 107.27 ? 715  MET A C   1 
ATOM   4761 O O   . MET A 1 699  ? 49.810  14.740  18.116  1.00 107.99 ? 715  MET A O   1 
ATOM   4762 C CB  . MET A 1 699  ? 49.480  12.753  20.711  1.00 105.14 ? 715  MET A CB  1 
ATOM   4763 C CG  . MET A 1 699  ? 48.017  13.091  20.479  1.00 108.41 ? 715  MET A CG  1 
ATOM   4764 S SD  . MET A 1 699  ? 47.077  13.000  22.023  1.00 112.28 ? 715  MET A SD  1 
ATOM   4765 C CE  . MET A 1 699  ? 47.135  14.711  22.537  1.00 109.06 ? 715  MET A CE  1 
ATOM   4766 N N   . HIS A 1 700  ? 51.384  15.110  19.704  1.00 102.96 ? 716  HIS A N   1 
ATOM   4767 C CA  . HIS A 1 700  ? 51.563  16.532  19.409  1.00 103.08 ? 716  HIS A CA  1 
ATOM   4768 C C   . HIS A 1 700  ? 52.172  16.837  18.029  1.00 107.79 ? 716  HIS A C   1 
ATOM   4769 O O   . HIS A 1 700  ? 51.906  17.913  17.484  1.00 107.11 ? 716  HIS A O   1 
ATOM   4770 C CB  . HIS A 1 700  ? 52.350  17.216  20.520  1.00 103.81 ? 716  HIS A CB  1 
ATOM   4771 C CG  . HIS A 1 700  ? 51.652  17.177  21.842  1.00 107.25 ? 716  HIS A CG  1 
ATOM   4772 N ND1 . HIS A 1 700  ? 52.341  17.377  23.023  1.00 109.17 ? 716  HIS A ND1 1 
ATOM   4773 C CD2 . HIS A 1 700  ? 50.355  16.924  22.132  1.00 108.95 ? 716  HIS A CD2 1 
ATOM   4774 C CE1 . HIS A 1 700  ? 51.443  17.270  23.986  1.00 108.48 ? 716  HIS A CE1 1 
ATOM   4775 N NE2 . HIS A 1 700  ? 50.236  16.991  23.496  1.00 108.80 ? 716  HIS A NE2 1 
ATOM   4776 N N   . LEU A 1 701  ? 52.966  15.903  17.464  1.00 105.03 ? 717  LEU A N   1 
ATOM   4777 C CA  . LEU A 1 701  ? 53.577  16.049  16.135  1.00 104.94 ? 717  LEU A CA  1 
ATOM   4778 C C   . LEU A 1 701  ? 52.528  15.722  15.075  1.00 107.99 ? 717  LEU A C   1 
ATOM   4779 O O   . LEU A 1 701  ? 52.401  16.465  14.094  1.00 108.23 ? 717  LEU A O   1 
ATOM   4780 C CB  . LEU A 1 701  ? 54.814  15.142  15.977  1.00 105.13 ? 717  LEU A CB  1 
ATOM   4781 N N   . CYS A 1 702  ? 51.745  14.629  15.305  1.00 102.57 ? 718  CYS A N   1 
ATOM   4782 C CA  . CYS A 1 702  ? 50.643  14.166  14.449  1.00 101.06 ? 718  CYS A CA  1 
ATOM   4783 C C   . CYS A 1 702  ? 49.531  15.226  14.389  1.00 101.28 ? 718  CYS A C   1 
ATOM   4784 O O   . CYS A 1 702  ? 48.792  15.272  13.406  1.00 101.15 ? 718  CYS A O   1 
ATOM   4785 C CB  . CYS A 1 702  ? 50.108  12.817  14.933  1.00 101.61 ? 718  CYS A CB  1 
ATOM   4786 S SG  . CYS A 1 702  ? 48.806  12.098  13.885  1.00 105.73 ? 718  CYS A SG  1 
ATOM   4787 N N   . MET A 1 703  ? 49.428  16.074  15.437  1.00 94.60  ? 719  MET A N   1 
ATOM   4788 C CA  . MET A 1 703  ? 48.444  17.147  15.567  1.00 93.06  ? 719  MET A CA  1 
ATOM   4789 C C   . MET A 1 703  ? 48.893  18.405  14.853  1.00 95.51  ? 719  MET A C   1 
ATOM   4790 O O   . MET A 1 703  ? 48.047  19.123  14.315  1.00 95.82  ? 719  MET A O   1 
ATOM   4791 C CB  . MET A 1 703  ? 48.212  17.489  17.049  1.00 95.28  ? 719  MET A CB  1 
ATOM   4792 C CG  . MET A 1 703  ? 47.182  16.615  17.745  1.00 98.56  ? 719  MET A CG  1 
ATOM   4793 S SD  . MET A 1 703  ? 46.978  17.055  19.499  1.00 102.25 ? 719  MET A SD  1 
ATOM   4794 C CE  . MET A 1 703  ? 45.844  18.408  19.361  1.00 98.70  ? 719  MET A CE  1 
ATOM   4795 N N   . ARG A 1 704  ? 50.214  18.702  14.887  1.00 90.49  ? 720  ARG A N   1 
ATOM   4796 C CA  . ARG A 1 704  ? 50.801  19.918  14.307  1.00 88.96  ? 720  ARG A CA  1 
ATOM   4797 C C   . ARG A 1 704  ? 51.018  19.831  12.788  1.00 90.81  ? 720  ARG A C   1 
ATOM   4798 O O   . ARG A 1 704  ? 51.456  20.811  12.169  1.00 88.68  ? 720  ARG A O   1 
ATOM   4799 C CB  . ARG A 1 704  ? 52.067  20.342  15.055  1.00 86.60  ? 720  ARG A CB  1 
ATOM   4800 C CG  . ARG A 1 704  ? 51.712  21.115  16.332  1.00 93.39  ? 720  ARG A CG  1 
ATOM   4801 C CD  . ARG A 1 704  ? 52.898  21.740  17.047  1.00 91.65  ? 720  ARG A CD  1 
ATOM   4802 N NE  . ARG A 1 704  ? 53.662  20.751  17.808  1.00 98.51  ? 720  ARG A NE  1 
ATOM   4803 C CZ  . ARG A 1 704  ? 53.824  20.781  19.127  1.00 116.21 ? 720  ARG A CZ  1 
ATOM   4804 N NH1 . ARG A 1 704  ? 53.282  21.759  19.850  1.00 98.00  ? 720  ARG A NH1 1 
ATOM   4805 N NH2 . ARG A 1 704  ? 54.535  19.839  19.736  1.00 105.83 ? 720  ARG A NH2 1 
ATOM   4806 N N   . GLN A 1 705  ? 50.621  18.691  12.180  1.00 87.77  ? 721  GLN A N   1 
ATOM   4807 C CA  . GLN A 1 705  ? 50.640  18.505  10.728  1.00 88.26  ? 721  GLN A CA  1 
ATOM   4808 C C   . GLN A 1 705  ? 49.655  19.535  10.149  1.00 96.61  ? 721  GLN A C   1 
ATOM   4809 O O   . GLN A 1 705  ? 48.555  19.685  10.690  1.00 95.92  ? 721  GLN A O   1 
ATOM   4810 C CB  . GLN A 1 705  ? 50.216  17.073  10.346  1.00 88.59  ? 721  GLN A CB  1 
ATOM   4811 C CG  . GLN A 1 705  ? 51.339  16.043  10.432  1.00 81.98  ? 721  GLN A CG  1 
ATOM   4812 C CD  . GLN A 1 705  ? 50.840  14.650  10.167  1.00 99.64  ? 721  GLN A CD  1 
ATOM   4813 O OE1 . GLN A 1 705  ? 49.977  14.139  10.873  1.00 97.92  ? 721  GLN A OE1 1 
ATOM   4814 N NE2 . GLN A 1 705  ? 51.375  13.986  9.151   1.00 97.14  ? 721  GLN A NE2 1 
ATOM   4815 N N   . GLU A 1 706  ? 50.090  20.308  9.118   1.00 96.51  ? 722  GLU A N   1 
ATOM   4816 C CA  . GLU A 1 706  ? 49.322  21.388  8.466   1.00 96.91  ? 722  GLU A CA  1 
ATOM   4817 C C   . GLU A 1 706  ? 47.794  21.142  8.493   1.00 100.62 ? 722  GLU A C   1 
ATOM   4818 O O   . GLU A 1 706  ? 47.060  21.861  9.180   1.00 99.06  ? 722  GLU A O   1 
ATOM   4819 C CB  . GLU A 1 706  ? 49.823  21.593  7.026   1.00 98.48  ? 722  GLU A CB  1 
ATOM   4820 C CG  . GLU A 1 706  ? 50.582  22.892  6.801   1.00 112.47 ? 722  GLU A CG  1 
ATOM   4821 C CD  . GLU A 1 706  ? 50.769  23.246  5.334   1.00 126.86 ? 722  GLU A CD  1 
ATOM   4822 O OE1 . GLU A 1 706  ? 50.024  24.122  4.834   1.00 109.01 ? 722  GLU A OE1 1 
ATOM   4823 O OE2 . GLU A 1 706  ? 51.633  22.619  4.676   1.00 111.03 ? 722  GLU A OE2 1 
ATOM   4824 N N   . ALA A 1 707  ? 47.362  20.059  7.804   1.00 97.71  ? 723  ALA A N   1 
ATOM   4825 C CA  . ALA A 1 707  ? 45.991  19.586  7.652   1.00 97.16  ? 723  ALA A CA  1 
ATOM   4826 C C   . ALA A 1 707  ? 45.310  19.271  8.996   1.00 100.51 ? 723  ALA A C   1 
ATOM   4827 O O   . ALA A 1 707  ? 44.163  19.678  9.184   1.00 100.55 ? 723  ALA A O   1 
ATOM   4828 C CB  . ALA A 1 707  ? 45.965  18.371  6.733   1.00 97.80  ? 723  ALA A CB  1 
ATOM   4829 N N   . TYR A 1 708  ? 46.018  18.574  9.930   1.00 95.18  ? 724  TYR A N   1 
ATOM   4830 C CA  . TYR A 1 708  ? 45.526  18.205  11.265  1.00 93.34  ? 724  TYR A CA  1 
ATOM   4831 C C   . TYR A 1 708  ? 45.213  19.416  12.091  1.00 94.33  ? 724  TYR A C   1 
ATOM   4832 O O   . TYR A 1 708  ? 44.118  19.528  12.625  1.00 95.32  ? 724  TYR A O   1 
ATOM   4833 C CB  . TYR A 1 708  ? 46.533  17.322  12.007  1.00 94.53  ? 724  TYR A CB  1 
ATOM   4834 C CG  . TYR A 1 708  ? 46.079  15.888  12.095  1.00 97.75  ? 724  TYR A CG  1 
ATOM   4835 C CD1 . TYR A 1 708  ? 45.305  15.445  13.163  1.00 100.19 ? 724  TYR A CD1 1 
ATOM   4836 C CD2 . TYR A 1 708  ? 46.392  14.974  11.091  1.00 98.89  ? 724  TYR A CD2 1 
ATOM   4837 C CE1 . TYR A 1 708  ? 44.862  14.125  13.237  1.00 101.77 ? 724  TYR A CE1 1 
ATOM   4838 C CE2 . TYR A 1 708  ? 45.942  13.654  11.146  1.00 99.74  ? 724  TYR A CE2 1 
ATOM   4839 C CZ  . TYR A 1 708  ? 45.184  13.234  12.225  1.00 107.36 ? 724  TYR A CZ  1 
ATOM   4840 O OH  . TYR A 1 708  ? 44.764  11.934  12.298  1.00 107.70 ? 724  TYR A OH  1 
ATOM   4841 N N   . LEU A 1 709  ? 46.152  20.341  12.149  1.00 88.18  ? 725  LEU A N   1 
ATOM   4842 C CA  . LEU A 1 709  ? 46.044  21.589  12.877  1.00 86.96  ? 725  LEU A CA  1 
ATOM   4843 C C   . LEU A 1 709  ? 44.964  22.507  12.277  1.00 90.89  ? 725  LEU A C   1 
ATOM   4844 O O   . LEU A 1 709  ? 44.289  23.201  13.030  1.00 90.69  ? 725  LEU A O   1 
ATOM   4845 C CB  . LEU A 1 709  ? 47.412  22.275  12.853  1.00 86.47  ? 725  LEU A CB  1 
ATOM   4846 C CG  . LEU A 1 709  ? 47.615  23.391  13.842  1.00 90.56  ? 725  LEU A CG  1 
ATOM   4847 C CD1 . LEU A 1 709  ? 48.821  23.124  14.711  1.00 90.69  ? 725  LEU A CD1 1 
ATOM   4848 C CD2 . LEU A 1 709  ? 47.692  24.738  13.130  1.00 92.52  ? 725  LEU A CD2 1 
ATOM   4849 N N   . GLU A 1 710  ? 44.814  22.532  10.939  1.00 87.55  ? 726  GLU A N   1 
ATOM   4850 C CA  . GLU A 1 710  ? 43.825  23.395  10.277  1.00 86.95  ? 726  GLU A CA  1 
ATOM   4851 C C   . GLU A 1 710  ? 42.409  22.903  10.561  1.00 91.13  ? 726  GLU A C   1 
ATOM   4852 O O   . GLU A 1 710  ? 41.526  23.701  10.885  1.00 90.28  ? 726  GLU A O   1 
ATOM   4853 C CB  . GLU A 1 710  ? 44.088  23.486  8.762   1.00 87.95  ? 726  GLU A CB  1 
ATOM   4854 N N   . ALA A 1 711  ? 42.223  21.569  10.477  1.00 88.48  ? 727  ALA A N   1 
ATOM   4855 C CA  . ALA A 1 711  ? 40.965  20.855  10.688  1.00 87.92  ? 727  ALA A CA  1 
ATOM   4856 C C   . ALA A 1 711  ? 40.480  20.949  12.129  1.00 90.48  ? 727  ALA A C   1 
ATOM   4857 O O   . ALA A 1 711  ? 39.265  21.045  12.360  1.00 89.39  ? 727  ALA A O   1 
ATOM   4858 C CB  . ALA A 1 711  ? 41.124  19.400  10.285  1.00 88.45  ? 727  ALA A CB  1 
ATOM   4859 N N   . LEU A 1 712  ? 41.431  20.915  13.086  1.00 85.64  ? 728  LEU A N   1 
ATOM   4860 C CA  . LEU A 1 712  ? 41.141  20.982  14.513  1.00 84.94  ? 728  LEU A CA  1 
ATOM   4861 C C   . LEU A 1 712  ? 41.039  22.402  15.045  1.00 88.77  ? 728  LEU A C   1 
ATOM   4862 O O   . LEU A 1 712  ? 40.676  22.583  16.212  1.00 89.01  ? 728  LEU A O   1 
ATOM   4863 C CB  . LEU A 1 712  ? 42.156  20.162  15.329  1.00 84.69  ? 728  LEU A CB  1 
ATOM   4864 C CG  . LEU A 1 712  ? 42.161  18.653  15.088  1.00 88.97  ? 728  LEU A CG  1 
ATOM   4865 C CD1 . LEU A 1 712  ? 43.218  17.991  15.909  1.00 88.48  ? 728  LEU A CD1 1 
ATOM   4866 C CD2 . LEU A 1 712  ? 40.828  18.044  15.410  1.00 92.84  ? 728  LEU A CD2 1 
ATOM   4867 N N   . SER A 1 713  ? 41.326  23.409  14.202  1.00 84.25  ? 729  SER A N   1 
ATOM   4868 C CA  . SER A 1 713  ? 41.276  24.802  14.640  1.00 83.93  ? 729  SER A CA  1 
ATOM   4869 C C   . SER A 1 713  ? 40.083  25.561  14.086  1.00 87.63  ? 729  SER A C   1 
ATOM   4870 O O   . SER A 1 713  ? 39.492  25.171  13.076  1.00 86.36  ? 729  SER A O   1 
ATOM   4871 C CB  . SER A 1 713  ? 42.577  25.534  14.305  1.00 87.38  ? 729  SER A CB  1 
ATOM   4872 O OG  . SER A 1 713  ? 43.629  25.278  15.224  1.00 94.44  ? 729  SER A OG  1 
ATOM   4873 N N   . HIS A 1 714  ? 39.749  26.663  14.773  1.00 85.12  ? 730  HIS A N   1 
ATOM   4874 C CA  . HIS A 1 714  ? 38.699  27.621  14.464  1.00 85.45  ? 730  HIS A CA  1 
ATOM   4875 C C   . HIS A 1 714  ? 37.445  26.942  13.967  1.00 85.92  ? 730  HIS A C   1 
ATOM   4876 O O   . HIS A 1 714  ? 37.279  26.666  12.771  1.00 84.78  ? 730  HIS A O   1 
ATOM   4877 C CB  . HIS A 1 714  ? 39.220  28.715  13.517  1.00 87.32  ? 730  HIS A CB  1 
ATOM   4878 C CG  . HIS A 1 714  ? 40.453  29.361  14.055  1.00 91.55  ? 730  HIS A CG  1 
ATOM   4879 N ND1 . HIS A 1 714  ? 40.391  30.269  15.103  1.00 93.71  ? 730  HIS A ND1 1 
ATOM   4880 C CD2 . HIS A 1 714  ? 41.751  29.123  13.754  1.00 93.58  ? 730  HIS A CD2 1 
ATOM   4881 C CE1 . HIS A 1 714  ? 41.647  30.594  15.365  1.00 93.29  ? 730  HIS A CE1 1 
ATOM   4882 N NE2 . HIS A 1 714  ? 42.501  29.928  14.579  1.00 93.60  ? 730  HIS A NE2 1 
ATOM   4883 N N   . LEU A 1 715  ? 36.605  26.582  14.928  1.00 80.49  ? 731  LEU A N   1 
ATOM   4884 C CA  . LEU A 1 715  ? 35.344  25.909  14.660  1.00 79.31  ? 731  LEU A CA  1 
ATOM   4885 C C   . LEU A 1 715  ? 34.348  26.202  15.759  1.00 81.61  ? 731  LEU A C   1 
ATOM   4886 O O   . LEU A 1 715  ? 34.747  26.569  16.869  1.00 83.37  ? 731  LEU A O   1 
ATOM   4887 C CB  . LEU A 1 715  ? 35.517  24.380  14.418  1.00 78.77  ? 731  LEU A CB  1 
ATOM   4888 C CG  . LEU A 1 715  ? 35.934  23.487  15.584  1.00 82.67  ? 731  LEU A CG  1 
ATOM   4889 C CD1 . LEU A 1 715  ? 35.341  22.104  15.436  1.00 82.91  ? 731  LEU A CD1 1 
ATOM   4890 C CD2 . LEU A 1 715  ? 37.420  23.336  15.649  1.00 84.61  ? 731  LEU A CD2 1 
ATOM   4891 N N   . GLN A 1 716  ? 33.056  26.110  15.439  1.00 73.50  ? 732  GLN A N   1 
ATOM   4892 C CA  . GLN A 1 716  ? 32.031  26.275  16.447  1.00 71.67  ? 732  GLN A CA  1 
ATOM   4893 C C   . GLN A 1 716  ? 31.979  24.905  17.144  1.00 71.75  ? 732  GLN A C   1 
ATOM   4894 O O   . GLN A 1 716  ? 32.136  23.877  16.482  1.00 71.29  ? 732  GLN A O   1 
ATOM   4895 C CB  . GLN A 1 716  ? 30.686  26.627  15.804  1.00 72.83  ? 732  GLN A CB  1 
ATOM   4896 C CG  . GLN A 1 716  ? 30.592  28.055  15.284  1.00 83.41  ? 732  GLN A CG  1 
ATOM   4897 C CD  . GLN A 1 716  ? 29.242  28.354  14.653  1.00 111.90 ? 732  GLN A CD  1 
ATOM   4898 O OE1 . GLN A 1 716  ? 28.212  27.735  14.983  1.00 110.27 ? 732  GLN A OE1 1 
ATOM   4899 N NE2 . GLN A 1 716  ? 29.204  29.335  13.740  1.00 101.48 ? 732  GLN A NE2 1 
ATOM   4900 N N   . SER A 1 717  ? 31.864  24.893  18.471  1.00 65.31  ? 733  SER A N   1 
ATOM   4901 C CA  . SER A 1 717  ? 31.816  23.664  19.268  1.00 63.53  ? 733  SER A CA  1 
ATOM   4902 C C   . SER A 1 717  ? 30.577  22.847  18.936  1.00 65.91  ? 733  SER A C   1 
ATOM   4903 O O   . SER A 1 717  ? 29.483  23.415  18.983  1.00 65.96  ? 733  SER A O   1 
ATOM   4904 C CB  . SER A 1 717  ? 31.814  24.006  20.754  1.00 64.59  ? 733  SER A CB  1 
ATOM   4905 O OG  . SER A 1 717  ? 31.489  22.884  21.549  1.00 67.12  ? 733  SER A OG  1 
ATOM   4906 N N   . PRO A 1 718  ? 30.696  21.531  18.602  1.00 60.17  ? 734  PRO A N   1 
ATOM   4907 C CA  . PRO A 1 718  ? 29.480  20.722  18.360  1.00 59.16  ? 734  PRO A CA  1 
ATOM   4908 C C   . PRO A 1 718  ? 28.630  20.620  19.632  1.00 62.25  ? 734  PRO A C   1 
ATOM   4909 O O   . PRO A 1 718  ? 27.417  20.480  19.544  1.00 62.72  ? 734  PRO A O   1 
ATOM   4910 C CB  . PRO A 1 718  ? 30.032  19.345  17.968  1.00 60.47  ? 734  PRO A CB  1 
ATOM   4911 C CG  . PRO A 1 718  ? 31.460  19.591  17.619  1.00 64.79  ? 734  PRO A CG  1 
ATOM   4912 C CD  . PRO A 1 718  ? 31.908  20.700  18.491  1.00 60.68  ? 734  PRO A CD  1 
ATOM   4913 N N   . LEU A 1 719  ? 29.262  20.734  20.814  1.00 56.98  ? 735  LEU A N   1 
ATOM   4914 C CA  . LEU A 1 719  ? 28.564  20.644  22.097  1.00 56.52  ? 735  LEU A CA  1 
ATOM   4915 C C   . LEU A 1 719  ? 27.649  21.830  22.386  1.00 64.08  ? 735  LEU A C   1 
ATOM   4916 O O   . LEU A 1 719  ? 26.604  21.649  23.018  1.00 65.94  ? 735  LEU A O   1 
ATOM   4917 C CB  . LEU A 1 719  ? 29.542  20.412  23.262  1.00 55.37  ? 735  LEU A CB  1 
ATOM   4918 C CG  . LEU A 1 719  ? 30.163  19.039  23.364  1.00 57.69  ? 735  LEU A CG  1 
ATOM   4919 C CD1 . LEU A 1 719  ? 31.366  19.074  24.227  1.00 58.19  ? 735  LEU A CD1 1 
ATOM   4920 C CD2 . LEU A 1 719  ? 29.204  18.040  23.951  1.00 56.28  ? 735  LEU A CD2 1 
ATOM   4921 N N   . ASP A 1 720  ? 28.057  23.031  21.962  1.00 61.06  ? 736  ASP A N   1 
ATOM   4922 C CA  . ASP A 1 720  ? 27.323  24.290  22.109  1.00 61.66  ? 736  ASP A CA  1 
ATOM   4923 C C   . ASP A 1 720  ? 27.762  25.113  20.915  1.00 69.25  ? 736  ASP A C   1 
ATOM   4924 O O   . ASP A 1 720  ? 28.910  25.562  20.902  1.00 71.34  ? 736  ASP A O   1 
ATOM   4925 C CB  . ASP A 1 720  ? 27.677  24.994  23.432  1.00 63.07  ? 736  ASP A CB  1 
ATOM   4926 C CG  . ASP A 1 720  ? 27.169  26.421  23.618  1.00 74.52  ? 736  ASP A CG  1 
ATOM   4927 O OD1 . ASP A 1 720  ? 26.527  26.957  22.690  1.00 73.90  ? 736  ASP A OD1 1 
ATOM   4928 O OD2 . ASP A 1 720  ? 27.395  26.993  24.705  1.00 85.52  ? 736  ASP A OD2 1 
ATOM   4929 N N   . PRO A 1 721  ? 26.907  25.311  19.889  1.00 65.60  ? 737  PRO A N   1 
ATOM   4930 C CA  . PRO A 1 721  ? 27.384  26.011  18.684  1.00 66.27  ? 737  PRO A CA  1 
ATOM   4931 C C   . PRO A 1 721  ? 27.654  27.506  18.866  1.00 73.19  ? 737  PRO A C   1 
ATOM   4932 O O   . PRO A 1 721  ? 28.222  28.115  17.955  1.00 74.20  ? 737  PRO A O   1 
ATOM   4933 C CB  . PRO A 1 721  ? 26.318  25.698  17.617  1.00 67.77  ? 737  PRO A CB  1 
ATOM   4934 C CG  . PRO A 1 721  ? 25.099  25.382  18.381  1.00 71.71  ? 737  PRO A CG  1 
ATOM   4935 C CD  . PRO A 1 721  ? 25.522  24.829  19.730  1.00 66.81  ? 737  PRO A CD  1 
ATOM   4936 N N   . SER A 1 722  ? 27.325  28.087  20.031  1.00 71.58  ? 738  SER A N   1 
ATOM   4937 C CA  . SER A 1 722  ? 27.641  29.499  20.278  1.00 73.15  ? 738  SER A CA  1 
ATOM   4938 C C   . SER A 1 722  ? 29.039  29.664  20.955  1.00 81.04  ? 738  SER A C   1 
ATOM   4939 O O   . SER A 1 722  ? 29.473  30.788  21.244  1.00 80.37  ? 738  SER A O   1 
ATOM   4940 C CB  . SER A 1 722  ? 26.522  30.203  21.040  1.00 75.64  ? 738  SER A CB  1 
ATOM   4941 O OG  . SER A 1 722  ? 26.325  29.607  22.307  1.00 84.21  ? 738  SER A OG  1 
ATOM   4942 N N   . THR A 1 723  ? 29.751  28.526  21.164  1.00 79.70  ? 739  THR A N   1 
ATOM   4943 C CA  . THR A 1 723  ? 31.100  28.483  21.733  1.00 79.98  ? 739  THR A CA  1 
ATOM   4944 C C   . THR A 1 723  ? 32.080  28.349  20.581  1.00 85.55  ? 739  THR A C   1 
ATOM   4945 O O   . THR A 1 723  ? 31.904  27.472  19.729  1.00 85.46  ? 739  THR A O   1 
ATOM   4946 C CB  . THR A 1 723  ? 31.214  27.394  22.812  1.00 83.94  ? 739  THR A CB  1 
ATOM   4947 O OG1 . THR A 1 723  ? 30.669  27.916  24.022  1.00 81.16  ? 739  THR A OG1 1 
ATOM   4948 C CG2 . THR A 1 723  ? 32.656  26.952  23.073  1.00 81.42  ? 739  THR A CG2 1 
ATOM   4949 N N   . LEU A 1 724  ? 33.086  29.242  20.533  1.00 82.67  ? 740  LEU A N   1 
ATOM   4950 C CA  . LEU A 1 724  ? 34.072  29.233  19.463  1.00 82.67  ? 740  LEU A CA  1 
ATOM   4951 C C   . LEU A 1 724  ? 35.395  28.577  19.889  1.00 86.89  ? 740  LEU A C   1 
ATOM   4952 O O   . LEU A 1 724  ? 36.221  29.189  20.569  1.00 87.90  ? 740  LEU A O   1 
ATOM   4953 C CB  . LEU A 1 724  ? 34.284  30.645  18.861  1.00 82.55  ? 740  LEU A CB  1 
ATOM   4954 C CG  . LEU A 1 724  ? 34.954  30.673  17.477  1.00 86.80  ? 740  LEU A CG  1 
ATOM   4955 N N   . LEU A 1 725  ? 35.584  27.318  19.487  1.00 81.78  ? 741  LEU A N   1 
ATOM   4956 C CA  . LEU A 1 725  ? 36.827  26.607  19.736  1.00 80.78  ? 741  LEU A CA  1 
ATOM   4957 C C   . LEU A 1 725  ? 37.785  27.185  18.669  1.00 86.37  ? 741  LEU A C   1 
ATOM   4958 O O   . LEU A 1 725  ? 37.649  26.876  17.479  1.00 84.60  ? 741  LEU A O   1 
ATOM   4959 C CB  . LEU A 1 725  ? 36.643  25.081  19.555  1.00 79.93  ? 741  LEU A CB  1 
ATOM   4960 C CG  . LEU A 1 725  ? 35.463  24.386  20.226  1.00 82.54  ? 741  LEU A CG  1 
ATOM   4961 C CD1 . LEU A 1 725  ? 35.442  22.901  19.862  1.00 81.84  ? 741  LEU A CD1 1 
ATOM   4962 C CD2 . LEU A 1 725  ? 35.472  24.583  21.741  1.00 82.43  ? 741  LEU A CD2 1 
ATOM   4963 N N   . ALA A 1 726  ? 38.663  28.116  19.093  1.00 85.86  ? 742  ALA A N   1 
ATOM   4964 C CA  . ALA A 1 726  ? 39.595  28.840  18.228  1.00 86.96  ? 742  ALA A CA  1 
ATOM   4965 C C   . ALA A 1 726  ? 40.958  28.142  18.014  1.00 94.38  ? 742  ALA A C   1 
ATOM   4966 O O   . ALA A 1 726  ? 41.090  27.324  17.098  1.00 93.68  ? 742  ALA A O   1 
ATOM   4967 C CB  . ALA A 1 726  ? 39.788  30.265  18.743  1.00 87.44  ? 742  ALA A CB  1 
ATOM   4968 N N   . GLU A 1 727  ? 41.966  28.482  18.840  1.00 93.63  ? 743  GLU A N   1 
ATOM   4969 C CA  . GLU A 1 727  ? 43.335  27.972  18.725  1.00 94.76  ? 743  GLU A CA  1 
ATOM   4970 C C   . GLU A 1 727  ? 43.582  26.798  19.654  1.00 97.49  ? 743  GLU A C   1 
ATOM   4971 O O   . GLU A 1 727  ? 43.508  26.965  20.878  1.00 97.64  ? 743  GLU A O   1 
ATOM   4972 C CB  . GLU A 1 727  ? 44.356  29.103  19.026  1.00 96.85  ? 743  GLU A CB  1 
ATOM   4973 C CG  . GLU A 1 727  ? 44.635  30.061  17.872  1.00 110.27 ? 743  GLU A CG  1 
ATOM   4974 C CD  . GLU A 1 727  ? 45.855  29.738  17.025  1.00 135.97 ? 743  GLU A CD  1 
ATOM   4975 O OE1 . GLU A 1 727  ? 45.783  29.944  15.791  1.00 132.66 ? 743  GLU A OE1 1 
ATOM   4976 O OE2 . GLU A 1 727  ? 46.884  29.295  17.588  1.00 127.62 ? 743  GLU A OE2 1 
ATOM   4977 N N   . VAL A 1 728  ? 43.915  25.628  19.084  1.00 92.36  ? 744  VAL A N   1 
ATOM   4978 C CA  . VAL A 1 728  ? 44.223  24.429  19.873  1.00 92.35  ? 744  VAL A CA  1 
ATOM   4979 C C   . VAL A 1 728  ? 45.516  24.694  20.658  1.00 98.24  ? 744  VAL A C   1 
ATOM   4980 O O   . VAL A 1 728  ? 46.444  25.305  20.116  1.00 99.54  ? 744  VAL A O   1 
ATOM   4981 C CB  . VAL A 1 728  ? 44.369  23.139  19.015  1.00 96.10  ? 744  VAL A CB  1 
ATOM   4982 C CG1 . VAL A 1 728  ? 44.188  21.884  19.861  1.00 95.77  ? 744  VAL A CG1 1 
ATOM   4983 C CG2 . VAL A 1 728  ? 43.402  23.120  17.842  1.00 96.09  ? 744  VAL A CG2 1 
ATOM   4984 N N   . CYS A 1 729  ? 45.565  24.270  21.931  1.00 93.34  ? 745  CYS A N   1 
ATOM   4985 C CA  . CYS A 1 729  ? 46.755  24.408  22.753  1.00 92.39  ? 745  CYS A CA  1 
ATOM   4986 C C   . CYS A 1 729  ? 47.297  23.022  22.889  1.00 96.51  ? 745  CYS A C   1 
ATOM   4987 O O   . CYS A 1 729  ? 46.985  22.306  23.844  1.00 96.04  ? 745  CYS A O   1 
ATOM   4988 C CB  . CYS A 1 729  ? 46.428  25.039  24.095  1.00 92.75  ? 745  CYS A CB  1 
ATOM   4989 S SG  . CYS A 1 729  ? 45.573  26.627  23.953  1.00 97.09  ? 745  CYS A SG  1 
ATOM   4990 N N   . VAL A 1 730  ? 48.046  22.617  21.841  1.00 93.87  ? 746  VAL A N   1 
ATOM   4991 C CA  . VAL A 1 730  ? 48.681  21.310  21.637  1.00 93.98  ? 746  VAL A CA  1 
ATOM   4992 C C   . VAL A 1 730  ? 49.553  20.911  22.851  1.00 100.89 ? 746  VAL A C   1 
ATOM   4993 O O   . VAL A 1 730  ? 49.658  19.723  23.160  1.00 101.21 ? 746  VAL A O   1 
ATOM   4994 C CB  . VAL A 1 730  ? 49.436  21.219  20.277  1.00 96.98  ? 746  VAL A CB  1 
ATOM   4995 C CG1 . VAL A 1 730  ? 49.743  19.772  19.909  1.00 96.77  ? 746  VAL A CG1 1 
ATOM   4996 C CG2 . VAL A 1 730  ? 48.631  21.866  19.151  1.00 96.52  ? 746  VAL A CG2 1 
ATOM   4997 N N   . GLU A 1 731  ? 50.118  21.901  23.573  1.00 98.73  ? 747  GLU A N   1 
ATOM   4998 C CA  . GLU A 1 731  ? 50.897  21.652  24.791  1.00 98.63  ? 747  GLU A CA  1 
ATOM   4999 C C   . GLU A 1 731  ? 49.995  21.033  25.891  1.00 102.61 ? 747  GLU A C   1 
ATOM   5000 O O   . GLU A 1 731  ? 50.386  20.035  26.508  1.00 102.49 ? 747  GLU A O   1 
ATOM   5001 C CB  . GLU A 1 731  ? 51.640  22.926  25.275  1.00 99.89  ? 747  GLU A CB  1 
ATOM   5002 C CG  . GLU A 1 731  ? 50.819  24.208  25.341  1.00 110.34 ? 747  GLU A CG  1 
ATOM   5003 N N   . GLN A 1 732  ? 48.759  21.587  26.050  1.00 98.36  ? 748  GLN A N   1 
ATOM   5004 C CA  . GLN A 1 732  ? 47.716  21.196  27.013  1.00 97.63  ? 748  GLN A CA  1 
ATOM   5005 C C   . GLN A 1 732  ? 46.896  19.961  26.591  1.00 100.29 ? 748  GLN A C   1 
ATOM   5006 O O   . GLN A 1 732  ? 46.239  19.351  27.434  1.00 99.62  ? 748  GLN A O   1 
ATOM   5007 C CB  . GLN A 1 732  ? 46.790  22.381  27.311  1.00 98.73  ? 748  GLN A CB  1 
ATOM   5008 C CG  . GLN A 1 732  ? 47.458  23.493  28.109  1.00 112.93 ? 748  GLN A CG  1 
ATOM   5009 C CD  . GLN A 1 732  ? 47.123  24.862  27.571  1.00 133.33 ? 748  GLN A CD  1 
ATOM   5010 O OE1 . GLN A 1 732  ? 45.960  25.283  27.542  1.00 128.67 ? 748  GLN A OE1 1 
ATOM   5011 N NE2 . GLN A 1 732  ? 48.141  25.596  27.132  1.00 126.73 ? 748  GLN A NE2 1 
ATOM   5012 N N   . CYS A 1 733  ? 46.949  19.590  25.309  1.00 96.34  ? 749  CYS A N   1 
ATOM   5013 C CA  . CYS A 1 733  ? 46.258  18.417  24.788  1.00 96.68  ? 749  CYS A CA  1 
ATOM   5014 C C   . CYS A 1 733  ? 46.914  17.133  25.295  1.00 101.22 ? 749  CYS A C   1 
ATOM   5015 O O   . CYS A 1 733  ? 48.133  17.011  25.228  1.00 100.70 ? 749  CYS A O   1 
ATOM   5016 C CB  . CYS A 1 733  ? 46.193  18.449  23.263  1.00 97.33  ? 749  CYS A CB  1 
ATOM   5017 S SG  . CYS A 1 733  ? 45.169  19.788  22.596  1.00 101.54 ? 749  CYS A SG  1 
ATOM   5018 N N   . THR A 1 734  ? 46.103  16.194  25.829  1.00 98.22  ? 750  THR A N   1 
ATOM   5019 C CA  . THR A 1 734  ? 46.540  14.892  26.375  1.00 97.86  ? 750  THR A CA  1 
ATOM   5020 C C   . THR A 1 734  ? 45.487  13.826  26.050  1.00 99.71  ? 750  THR A C   1 
ATOM   5021 O O   . THR A 1 734  ? 44.688  14.007  25.122  1.00 98.17  ? 750  THR A O   1 
ATOM   5022 C CB  . THR A 1 734  ? 46.742  14.974  27.919  1.00 110.18 ? 750  THR A CB  1 
ATOM   5023 O OG1 . THR A 1 734  ? 45.676  15.710  28.518  1.00 111.68 ? 750  THR A OG1 1 
ATOM   5024 C CG2 . THR A 1 734  ? 48.054  15.601  28.318  1.00 112.37 ? 750  THR A CG2 1 
ATOM   5025 N N   . PHE A 1 735  ? 45.500  12.718  26.817  1.00 95.42  ? 751  PHE A N   1 
ATOM   5026 C CA  . PHE A 1 735  ? 44.524  11.640  26.754  1.00 95.57  ? 751  PHE A CA  1 
ATOM   5027 C C   . PHE A 1 735  ? 44.316  11.021  28.151  1.00 100.08 ? 751  PHE A C   1 
ATOM   5028 O O   . PHE A 1 735  ? 45.076  11.339  29.073  1.00 100.88 ? 751  PHE A O   1 
ATOM   5029 C CB  . PHE A 1 735  ? 44.847  10.619  25.662  1.00 97.73  ? 751  PHE A CB  1 
ATOM   5030 C CG  . PHE A 1 735  ? 46.028  9.726   25.929  1.00 100.40 ? 751  PHE A CG  1 
ATOM   5031 C CD1 . PHE A 1 735  ? 47.322  10.153  25.644  1.00 104.83 ? 751  PHE A CD1 1 
ATOM   5032 C CD2 . PHE A 1 735  ? 45.848  8.432   26.399  1.00 102.67 ? 751  PHE A CD2 1 
ATOM   5033 C CE1 . PHE A 1 735  ? 48.417  9.309   25.851  1.00 105.56 ? 751  PHE A CE1 1 
ATOM   5034 C CE2 . PHE A 1 735  ? 46.943  7.594   26.618  1.00 105.75 ? 751  PHE A CE2 1 
ATOM   5035 C CZ  . PHE A 1 735  ? 48.218  8.034   26.334  1.00 104.24 ? 751  PHE A CZ  1 
ATOM   5036 N N   . MET A 1 736  ? 43.263  10.194  28.328  1.00 94.72  ? 752  MET A N   1 
ATOM   5037 C CA  . MET A 1 736  ? 42.929  9.603   29.630  1.00 93.54  ? 752  MET A CA  1 
ATOM   5038 C C   . MET A 1 736  ? 43.286  8.130   29.698  1.00 98.70  ? 752  MET A C   1 
ATOM   5039 O O   . MET A 1 736  ? 43.048  7.389   28.736  1.00 98.23  ? 752  MET A O   1 
ATOM   5040 C CB  . MET A 1 736  ? 41.442  9.790   29.985  1.00 95.17  ? 752  MET A CB  1 
ATOM   5041 C CG  . MET A 1 736  ? 40.905  11.192  29.766  1.00 97.96  ? 752  MET A CG  1 
ATOM   5042 S SD  . MET A 1 736  ? 39.686  11.757  30.980  1.00 101.60 ? 752  MET A SD  1 
ATOM   5043 C CE  . MET A 1 736  ? 38.602  10.338  31.104  1.00 97.81  ? 752  MET A CE  1 
ATOM   5044 N N   . ASP A 1 737  ? 43.798  7.688   30.867  1.00 96.20  ? 753  ASP A N   1 
ATOM   5045 C CA  . ASP A 1 737  ? 44.218  6.300   31.105  1.00 95.97  ? 753  ASP A CA  1 
ATOM   5046 C C   . ASP A 1 737  ? 43.036  5.309   31.178  1.00 98.35  ? 753  ASP A C   1 
ATOM   5047 O O   . ASP A 1 737  ? 43.240  4.137   31.510  1.00 98.31  ? 753  ASP A O   1 
ATOM   5048 C CB  . ASP A 1 737  ? 45.125  6.206   32.343  1.00 98.00  ? 753  ASP A CB  1 
ATOM   5049 N N   . SER A 1 738  ? 41.816  5.779   30.796  1.00 92.64  ? 754  SER A N   1 
ATOM   5050 C CA  . SER A 1 738  ? 40.557  5.035   30.732  1.00 91.24  ? 754  SER A CA  1 
ATOM   5051 C C   . SER A 1 738  ? 40.619  3.967   29.632  1.00 93.77  ? 754  SER A C   1 
ATOM   5052 O O   . SER A 1 738  ? 41.559  3.969   28.838  1.00 92.53  ? 754  SER A O   1 
ATOM   5053 C CB  . SER A 1 738  ? 39.403  6.005   30.498  1.00 95.24  ? 754  SER A CB  1 
ATOM   5054 O OG  . SER A 1 738  ? 38.156  5.343   30.388  1.00 108.31 ? 754  SER A OG  1 
ATOM   5055 N N   . LYS A 1 739  ? 39.634  3.047   29.594  1.00 91.79  ? 755  LYS A N   1 
ATOM   5056 C CA  . LYS A 1 739  ? 39.577  1.933   28.620  1.00 92.27  ? 755  LYS A CA  1 
ATOM   5057 C C   . LYS A 1 739  ? 39.698  2.364   27.171  1.00 96.14  ? 755  LYS A C   1 
ATOM   5058 O O   . LYS A 1 739  ? 40.572  1.863   26.465  1.00 95.94  ? 755  LYS A O   1 
ATOM   5059 C CB  . LYS A 1 739  ? 38.309  1.056   28.786  1.00 95.46  ? 755  LYS A CB  1 
ATOM   5060 C CG  . LYS A 1 739  ? 38.217  0.320   30.118  1.00 115.78 ? 755  LYS A CG  1 
ATOM   5061 N N   . MET A 1 740  ? 38.829  3.302   26.727  1.00 92.16  ? 756  MET A N   1 
ATOM   5062 C CA  . MET A 1 740  ? 38.766  3.759   25.333  1.00 90.13  ? 756  MET A CA  1 
ATOM   5063 C C   . MET A 1 740  ? 39.761  4.874   24.981  1.00 91.91  ? 756  MET A C   1 
ATOM   5064 O O   . MET A 1 740  ? 39.809  5.288   23.824  1.00 92.01  ? 756  MET A O   1 
ATOM   5065 C CB  . MET A 1 740  ? 37.326  4.146   24.973  1.00 91.89  ? 756  MET A CB  1 
ATOM   5066 C CG  . MET A 1 740  ? 36.358  2.970   25.029  1.00 94.81  ? 756  MET A CG  1 
ATOM   5067 S SD  . MET A 1 740  ? 36.904  1.543   24.041  1.00 98.63  ? 756  MET A SD  1 
ATOM   5068 C CE  . MET A 1 740  ? 35.577  0.424   24.350  1.00 95.37  ? 756  MET A CE  1 
ATOM   5069 N N   . LYS A 1 741  ? 40.609  5.279   25.947  1.00 87.34  ? 757  LYS A N   1 
ATOM   5070 C CA  . LYS A 1 741  ? 41.659  6.309   25.839  1.00 87.20  ? 757  LYS A CA  1 
ATOM   5071 C C   . LYS A 1 741  ? 41.097  7.617   25.269  1.00 89.69  ? 757  LYS A C   1 
ATOM   5072 O O   . LYS A 1 741  ? 41.504  8.021   24.171  1.00 88.95  ? 757  LYS A O   1 
ATOM   5073 C CB  . LYS A 1 741  ? 42.904  5.817   25.031  1.00 89.54  ? 757  LYS A CB  1 
ATOM   5074 C CG  . LYS A 1 741  ? 43.607  4.565   25.569  1.00 86.74  ? 757  LYS A CG  1 
ATOM   5075 C CD  . LYS A 1 741  ? 44.490  4.863   26.760  1.00 87.80  ? 757  LYS A CD  1 
ATOM   5076 C CE  . LYS A 1 741  ? 45.162  3.610   27.260  1.00 95.73  ? 757  LYS A CE  1 
ATOM   5077 N N   . PRO A 1 742  ? 40.131  8.270   25.974  1.00 84.92  ? 758  PRO A N   1 
ATOM   5078 C CA  . PRO A 1 742  ? 39.522  9.496   25.413  1.00 83.30  ? 758  PRO A CA  1 
ATOM   5079 C C   . PRO A 1 742  ? 40.481  10.671  25.337  1.00 80.64  ? 758  PRO A C   1 
ATOM   5080 O O   . PRO A 1 742  ? 41.209  10.894  26.293  1.00 77.93  ? 758  PRO A O   1 
ATOM   5081 C CB  . PRO A 1 742  ? 38.317  9.757   26.325  1.00 85.55  ? 758  PRO A CB  1 
ATOM   5082 C CG  . PRO A 1 742  ? 38.620  9.050   27.592  1.00 90.36  ? 758  PRO A CG  1 
ATOM   5083 C CD  . PRO A 1 742  ? 39.532  7.909   27.281  1.00 86.13  ? 758  PRO A CD  1 
ATOM   5084 N N   . LEU A 1 743  ? 40.509  11.384  24.189  1.00 75.60  ? 759  LEU A N   1 
ATOM   5085 C CA  . LEU A 1 743  ? 41.427  12.515  23.968  1.00 75.22  ? 759  LEU A CA  1 
ATOM   5086 C C   . LEU A 1 743  ? 41.019  13.814  24.653  1.00 78.29  ? 759  LEU A C   1 
ATOM   5087 O O   . LEU A 1 743  ? 39.879  14.251  24.526  1.00 79.39  ? 759  LEU A O   1 
ATOM   5088 C CB  . LEU A 1 743  ? 41.677  12.776  22.482  1.00 75.16  ? 759  LEU A CB  1 
ATOM   5089 C CG  . LEU A 1 743  ? 42.006  11.612  21.571  1.00 79.67  ? 759  LEU A CG  1 
ATOM   5090 C CD1 . LEU A 1 743  ? 42.138  12.105  20.159  1.00 80.37  ? 759  LEU A CD1 1 
ATOM   5091 C CD2 . LEU A 1 743  ? 43.289  10.907  21.985  1.00 79.79  ? 759  LEU A CD2 1 
ATOM   5092 N N   . TRP A 1 744  ? 41.954  14.436  25.362  1.00 73.36  ? 760  TRP A N   1 
ATOM   5093 C CA  . TRP A 1 744  ? 41.741  15.687  26.106  1.00 72.92  ? 760  TRP A CA  1 
ATOM   5094 C C   . TRP A 1 744  ? 42.244  16.805  25.199  1.00 77.00  ? 760  TRP A C   1 
ATOM   5095 O O   . TRP A 1 744  ? 43.445  16.857  24.947  1.00 77.96  ? 760  TRP A O   1 
ATOM   5096 C CB  . TRP A 1 744  ? 42.551  15.625  27.414  1.00 70.96  ? 760  TRP A CB  1 
ATOM   5097 C CG  . TRP A 1 744  ? 42.294  16.740  28.368  1.00 71.23  ? 760  TRP A CG  1 
ATOM   5098 C CD1 . TRP A 1 744  ? 42.889  17.967  28.376  1.00 74.10  ? 760  TRP A CD1 1 
ATOM   5099 C CD2 . TRP A 1 744  ? 41.454  16.691  29.525  1.00 71.03  ? 760  TRP A CD2 1 
ATOM   5100 N NE1 . TRP A 1 744  ? 42.420  18.713  29.431  1.00 73.55  ? 760  TRP A NE1 1 
ATOM   5101 C CE2 . TRP A 1 744  ? 41.552  17.946  30.168  1.00 74.62  ? 760  TRP A CE2 1 
ATOM   5102 C CE3 . TRP A 1 744  ? 40.602  15.709  30.073  1.00 72.25  ? 760  TRP A CE3 1 
ATOM   5103 C CZ2 . TRP A 1 744  ? 40.804  18.265  31.308  1.00 73.22  ? 760  TRP A CZ2 1 
ATOM   5104 C CZ3 . TRP A 1 744  ? 39.864  16.028  31.204  1.00 73.57  ? 760  TRP A CZ3 1 
ATOM   5105 C CH2 . TRP A 1 744  ? 39.958  17.300  31.797  1.00 73.94  ? 760  TRP A CH2 1 
ATOM   5106 N N   . ILE A 1 745  ? 41.336  17.630  24.637  1.00 71.29  ? 761  ILE A N   1 
ATOM   5107 C CA  . ILE A 1 745  ? 41.691  18.649  23.640  1.00 70.55  ? 761  ILE A CA  1 
ATOM   5108 C C   . ILE A 1 745  ? 41.379  20.019  24.168  1.00 77.96  ? 761  ILE A C   1 
ATOM   5109 O O   . ILE A 1 745  ? 40.200  20.318  24.346  1.00 78.13  ? 761  ILE A O   1 
ATOM   5110 C CB  . ILE A 1 745  ? 41.002  18.374  22.237  1.00 71.63  ? 761  ILE A CB  1 
ATOM   5111 C CG1 . ILE A 1 745  ? 41.112  16.897  21.782  1.00 71.50  ? 761  ILE A CG1 1 
ATOM   5112 C CG2 . ILE A 1 745  ? 41.473  19.313  21.134  1.00 69.05  ? 761  ILE A CG2 1 
ATOM   5113 C CD1 . ILE A 1 745  ? 42.531  16.234  21.660  1.00 75.62  ? 761  ILE A CD1 1 
ATOM   5114 N N   . MET A 1 746  ? 42.421  20.873  24.352  1.00 76.89  ? 762  MET A N   1 
ATOM   5115 C CA  . MET A 1 746  ? 42.286  22.237  24.895  1.00 78.07  ? 762  MET A CA  1 
ATOM   5116 C C   . MET A 1 746  ? 42.387  23.351  23.867  1.00 85.19  ? 762  MET A C   1 
ATOM   5117 O O   . MET A 1 746  ? 43.121  23.217  22.889  1.00 84.84  ? 762  MET A O   1 
ATOM   5118 C CB  . MET A 1 746  ? 43.290  22.487  26.026  1.00 80.60  ? 762  MET A CB  1 
ATOM   5119 C CG  . MET A 1 746  ? 43.073  21.626  27.269  1.00 84.17  ? 762  MET A CG  1 
ATOM   5120 S SD  . MET A 1 746  ? 41.435  21.753  28.027  1.00 88.10  ? 762  MET A SD  1 
ATOM   5121 C CE  . MET A 1 746  ? 41.270  23.549  28.233  1.00 84.30  ? 762  MET A CE  1 
ATOM   5122 N N   . TYR A 1 747  ? 41.661  24.464  24.113  1.00 85.06  ? 763  TYR A N   1 
ATOM   5123 C CA  . TYR A 1 747  ? 41.582  25.645  23.244  1.00 87.08  ? 763  TYR A CA  1 
ATOM   5124 C C   . TYR A 1 747  ? 41.715  26.946  24.027  1.00 99.90  ? 763  TYR A C   1 
ATOM   5125 O O   . TYR A 1 747  ? 41.341  27.009  25.204  1.00 99.80  ? 763  TYR A O   1 
ATOM   5126 C CB  . TYR A 1 747  ? 40.244  25.683  22.474  1.00 86.79  ? 763  TYR A CB  1 
ATOM   5127 C CG  . TYR A 1 747  ? 40.037  24.555  21.487  1.00 86.40  ? 763  TYR A CG  1 
ATOM   5128 C CD1 . TYR A 1 747  ? 39.555  23.316  21.904  1.00 87.48  ? 763  TYR A CD1 1 
ATOM   5129 C CD2 . TYR A 1 747  ? 40.232  24.752  20.125  1.00 86.87  ? 763  TYR A CD2 1 
ATOM   5130 C CE1 . TYR A 1 747  ? 39.342  22.278  20.999  1.00 86.89  ? 763  TYR A CE1 1 
ATOM   5131 C CE2 . TYR A 1 747  ? 40.006  23.726  19.205  1.00 87.68  ? 763  TYR A CE2 1 
ATOM   5132 C CZ  . TYR A 1 747  ? 39.557  22.491  19.647  1.00 93.44  ? 763  TYR A CZ  1 
ATOM   5133 O OH  . TYR A 1 747  ? 39.328  21.478  18.745  1.00 91.81  ? 763  TYR A OH  1 
ATOM   5134 N N   . SER A 1 748  ? 42.201  28.000  23.344  1.00 102.81 ? 764  SER A N   1 
ATOM   5135 C CA  . SER A 1 748  ? 42.367  29.339  23.908  1.00 105.77 ? 764  SER A CA  1 
ATOM   5136 C C   . SER A 1 748  ? 41.578  30.368  23.103  1.00 115.22 ? 764  SER A C   1 
ATOM   5137 O O   . SER A 1 748  ? 41.419  30.224  21.883  1.00 114.05 ? 764  SER A O   1 
ATOM   5138 C CB  . SER A 1 748  ? 43.840  29.727  23.985  1.00 111.32 ? 764  SER A CB  1 
ATOM   5139 O OG  . SER A 1 748  ? 44.490  29.582  22.730  1.00 124.88 ? 764  SER A OG  1 
ATOM   5140 N N   . ASN A 1 749  ? 41.085  31.409  23.813  1.00 116.95 ? 765  ASN A N   1 
ATOM   5141 C CA  . ASN A 1 749  ? 40.251  32.515  23.311  1.00 118.59 ? 765  ASN A CA  1 
ATOM   5142 C C   . ASN A 1 749  ? 41.032  33.666  22.681  1.00 125.66 ? 765  ASN A C   1 
ATOM   5143 O O   . ASN A 1 749  ? 41.938  34.237  23.303  1.00 125.58 ? 765  ASN A O   1 
ATOM   5144 C CB  . ASN A 1 749  ? 39.308  33.053  24.401  1.00 120.20 ? 765  ASN A CB  1 
ATOM   5145 C CG  . ASN A 1 749  ? 39.522  32.465  25.784  1.00 149.17 ? 765  ASN A CG  1 
ATOM   5146 O OD1 . ASN A 1 749  ? 40.486  32.795  26.493  1.00 145.80 ? 765  ASN A OD1 1 
ATOM   5147 N ND2 . ASN A 1 749  ? 38.636  31.561  26.185  1.00 138.37 ? 765  ASN A ND2 1 
ATOM   5148 N N   . GLU A 1 750  ? 40.648  34.013  21.442  1.00 123.94 ? 766  GLU A N   1 
ATOM   5149 C CA  . GLU A 1 750  ? 41.240  35.104  20.667  1.00 124.14 ? 766  GLU A CA  1 
ATOM   5150 C C   . GLU A 1 750  ? 40.675  36.463  21.144  1.00 128.48 ? 766  GLU A C   1 
ATOM   5151 O O   . GLU A 1 750  ? 41.421  37.449  21.217  1.00 127.73 ? 766  GLU A O   1 
ATOM   5152 C CB  . GLU A 1 750  ? 41.014  34.885  19.153  1.00 125.36 ? 766  GLU A CB  1 
ATOM   5153 C CG  . GLU A 1 750  ? 41.749  33.680  18.578  1.00 131.73 ? 766  GLU A CG  1 
ATOM   5154 N N   . GLU A 1 751  ? 39.370  36.481  21.526  1.00 125.36 ? 767  GLU A N   1 
ATOM   5155 C CA  . GLU A 1 751  ? 38.654  37.671  22.007  1.00 125.02 ? 767  GLU A CA  1 
ATOM   5156 C C   . GLU A 1 751  ? 38.047  37.534  23.421  1.00 127.76 ? 767  GLU A C   1 
ATOM   5157 O O   . GLU A 1 751  ? 37.967  38.541  24.130  1.00 127.06 ? 767  GLU A O   1 
ATOM   5158 C CB  . GLU A 1 751  ? 37.572  38.100  21.000  1.00 126.35 ? 767  GLU A CB  1 
ATOM   5159 N N   . ALA A 1 752  ? 37.617  36.310  23.821  1.00 123.69 ? 768  ALA A N   1 
ATOM   5160 C CA  . ALA A 1 752  ? 36.983  36.050  25.125  1.00 149.12 ? 768  ALA A CA  1 
ATOM   5161 C C   . ALA A 1 752  ? 37.944  36.108  26.310  1.00 160.15 ? 768  ALA A C   1 
ATOM   5162 O O   . ALA A 1 752  ? 37.501  36.173  27.458  1.00 112.32 ? 768  ALA A O   1 
ATOM   5163 C CB  . ALA A 1 752  ? 36.247  34.718  25.106  1.00 149.85 ? 768  ALA A CB  1 
ATOM   5164 N N   . SER A 1 757  ? 39.360  29.975  28.629  1.00 82.39  ? 773  SER A N   1 
ATOM   5165 C CA  . SER A 1 757  ? 39.753  28.623  28.204  1.00 81.33  ? 773  SER A CA  1 
ATOM   5166 C C   . SER A 1 757  ? 38.524  27.688  28.040  1.00 83.85  ? 773  SER A C   1 
ATOM   5167 O O   . SER A 1 757  ? 37.487  27.899  28.680  1.00 83.93  ? 773  SER A O   1 
ATOM   5168 C CB  . SER A 1 757  ? 40.773  28.031  29.177  1.00 82.47  ? 773  SER A CB  1 
ATOM   5169 O OG  . SER A 1 757  ? 41.336  26.822  28.698  1.00 84.89  ? 773  SER A OG  1 
ATOM   5170 N N   . VAL A 1 758  ? 38.641  26.697  27.132  1.00 78.13  ? 774  VAL A N   1 
ATOM   5171 C CA  . VAL A 1 758  ? 37.623  25.699  26.773  1.00 76.25  ? 774  VAL A CA  1 
ATOM   5172 C C   . VAL A 1 758  ? 38.302  24.433  26.290  1.00 76.87  ? 774  VAL A C   1 
ATOM   5173 O O   . VAL A 1 758  ? 39.267  24.500  25.534  1.00 76.63  ? 774  VAL A O   1 
ATOM   5174 C CB  . VAL A 1 758  ? 36.614  26.182  25.696  1.00 79.82  ? 774  VAL A CB  1 
ATOM   5175 C CG1 . VAL A 1 758  ? 35.447  26.940  26.309  1.00 79.65  ? 774  VAL A CG1 1 
ATOM   5176 C CG2 . VAL A 1 758  ? 37.292  26.987  24.590  1.00 79.76  ? 774  VAL A CG2 1 
ATOM   5177 N N   . GLY A 1 759  ? 37.767  23.294  26.691  1.00 70.76  ? 775  GLY A N   1 
ATOM   5178 C CA  . GLY A 1 759  ? 38.290  22.002  26.285  1.00 69.19  ? 775  GLY A CA  1 
ATOM   5179 C C   . GLY A 1 759  ? 37.184  21.036  25.948  1.00 72.43  ? 775  GLY A C   1 
ATOM   5180 O O   . GLY A 1 759  ? 36.043  21.213  26.400  1.00 72.68  ? 775  GLY A O   1 
ATOM   5181 N N   . ILE A 1 760  ? 37.516  20.023  25.124  1.00 66.71  ? 776  ILE A N   1 
ATOM   5182 C CA  . ILE A 1 760  ? 36.584  18.985  24.682  1.00 65.19  ? 776  ILE A CA  1 
ATOM   5183 C C   . ILE A 1 760  ? 37.187  17.601  24.924  1.00 69.08  ? 776  ILE A C   1 
ATOM   5184 O O   . ILE A 1 760  ? 38.409  17.450  24.851  1.00 69.93  ? 776  ILE A O   1 
ATOM   5185 C CB  . ILE A 1 760  ? 36.069  19.180  23.200  1.00 67.16  ? 776  ILE A CB  1 
ATOM   5186 C CG1 . ILE A 1 760  ? 37.135  18.922  22.097  1.00 65.88  ? 776  ILE A CG1 1 
ATOM   5187 C CG2 . ILE A 1 760  ? 35.326  20.503  22.995  1.00 67.09  ? 776  ILE A CG2 1 
ATOM   5188 N N   . ILE A 1 761  ? 36.345  16.591  25.193  1.00 63.93  ? 777  ILE A N   1 
ATOM   5189 C CA  . ILE A 1 761  ? 36.851  15.228  25.373  1.00 63.43  ? 777  ILE A CA  1 
ATOM   5190 C C   . ILE A 1 761  ? 36.328  14.373  24.218  1.00 67.66  ? 777  ILE A C   1 
ATOM   5191 O O   . ILE A 1 761  ? 35.119  14.268  24.047  1.00 67.28  ? 777  ILE A O   1 
ATOM   5192 C CB  . ILE A 1 761  ? 36.596  14.595  26.784  1.00 65.91  ? 777  ILE A CB  1 
ATOM   5193 C CG1 . ILE A 1 761  ? 37.119  15.500  27.933  1.00 65.27  ? 777  ILE A CG1 1 
ATOM   5194 C CG2 . ILE A 1 761  ? 37.246  13.209  26.854  1.00 66.59  ? 777  ILE A CG2 1 
ATOM   5195 C CD1 . ILE A 1 761  ? 36.546  15.250  29.339  1.00 63.86  ? 777  ILE A CD1 1 
ATOM   5196 N N   . PHE A 1 762  ? 37.233  13.809  23.399  1.00 63.52  ? 778  PHE A N   1 
ATOM   5197 C CA  . PHE A 1 762  ? 36.826  12.979  22.277  1.00 62.86  ? 778  PHE A CA  1 
ATOM   5198 C C   . PHE A 1 762  ? 36.859  11.522  22.690  1.00 71.20  ? 778  PHE A C   1 
ATOM   5199 O O   . PHE A 1 762  ? 37.941  10.955  22.837  1.00 74.68  ? 778  PHE A O   1 
ATOM   5200 C CB  . PHE A 1 762  ? 37.697  13.229  21.034  1.00 63.52  ? 778  PHE A CB  1 
ATOM   5201 C CG  . PHE A 1 762  ? 37.261  12.390  19.856  1.00 63.93  ? 778  PHE A CG  1 
ATOM   5202 C CD1 . PHE A 1 762  ? 36.255  12.831  19.005  1.00 66.59  ? 778  PHE A CD1 1 
ATOM   5203 C CD2 . PHE A 1 762  ? 37.811  11.128  19.637  1.00 64.92  ? 778  PHE A CD2 1 
ATOM   5204 C CE1 . PHE A 1 762  ? 35.822  12.033  17.951  1.00 68.09  ? 778  PHE A CE1 1 
ATOM   5205 C CE2 . PHE A 1 762  ? 37.372  10.322  18.584  1.00 67.41  ? 778  PHE A CE2 1 
ATOM   5206 C CZ  . PHE A 1 762  ? 36.400  10.782  17.738  1.00 66.67  ? 778  PHE A CZ  1 
ATOM   5207 N N   . LYS A 1 763  ? 35.693  10.910  22.885  1.00 67.18  ? 779  LYS A N   1 
ATOM   5208 C CA  . LYS A 1 763  ? 35.628  9.511   23.290  1.00 66.59  ? 779  LYS A CA  1 
ATOM   5209 C C   . LYS A 1 763  ? 35.053  8.723   22.150  1.00 71.46  ? 779  LYS A C   1 
ATOM   5210 O O   . LYS A 1 763  ? 34.063  9.134   21.550  1.00 71.35  ? 779  LYS A O   1 
ATOM   5211 C CB  . LYS A 1 763  ? 34.830  9.320   24.602  1.00 67.97  ? 779  LYS A CB  1 
ATOM   5212 C CG  . LYS A 1 763  ? 34.824  7.874   25.142  1.00 64.52  ? 779  LYS A CG  1 
ATOM   5213 C CD  . LYS A 1 763  ? 34.925  7.750   26.675  1.00 61.40  ? 779  LYS A CD  1 
ATOM   5214 C CE  . LYS A 1 763  ? 33.612  7.926   27.419  1.00 67.86  ? 779  LYS A CE  1 
ATOM   5215 N NZ  . LYS A 1 763  ? 33.775  7.700   28.880  1.00 79.40  ? 779  LYS A NZ  1 
ATOM   5216 N N   . ASN A 1 764  ? 35.707  7.608   21.844  1.00 68.66  ? 780  ASN A N   1 
ATOM   5217 C CA  . ASN A 1 764  ? 35.401  6.665   20.796  1.00 69.01  ? 780  ASN A CA  1 
ATOM   5218 C C   . ASN A 1 764  ? 35.634  5.255   21.341  1.00 77.76  ? 780  ASN A C   1 
ATOM   5219 O O   . ASN A 1 764  ? 36.724  4.957   21.838  1.00 79.24  ? 780  ASN A O   1 
ATOM   5220 C CB  . ASN A 1 764  ? 36.264  6.960   19.562  1.00 65.51  ? 780  ASN A CB  1 
ATOM   5221 C CG  . ASN A 1 764  ? 36.330  5.866   18.520  1.00 85.83  ? 780  ASN A CG  1 
ATOM   5222 O OD1 . ASN A 1 764  ? 37.401  5.286   18.285  1.00 87.98  ? 780  ASN A OD1 1 
ATOM   5223 N ND2 . ASN A 1 764  ? 35.209  5.587   17.840  1.00 66.40  ? 780  ASN A ND2 1 
ATOM   5224 N N   . GLY A 1 765  ? 34.595  4.426   21.262  1.00 75.19  ? 781  GLY A N   1 
ATOM   5225 C CA  . GLY A 1 765  ? 34.585  3.041   21.714  1.00 75.62  ? 781  GLY A CA  1 
ATOM   5226 C C   . GLY A 1 765  ? 33.338  2.692   22.504  1.00 82.66  ? 781  GLY A C   1 
ATOM   5227 O O   . GLY A 1 765  ? 32.787  1.597   22.350  1.00 82.64  ? 781  GLY A O   1 
ATOM   5228 N N   . ASP A 1 766  ? 32.889  3.631   23.367  1.00 80.50  ? 782  ASP A N   1 
ATOM   5229 C CA  . ASP A 1 766  ? 31.707  3.481   24.214  1.00 80.67  ? 782  ASP A CA  1 
ATOM   5230 C C   . ASP A 1 766  ? 30.518  4.155   23.583  1.00 83.85  ? 782  ASP A C   1 
ATOM   5231 O O   . ASP A 1 766  ? 30.669  5.200   22.952  1.00 84.10  ? 782  ASP A O   1 
ATOM   5232 C CB  . ASP A 1 766  ? 31.916  4.158   25.584  1.00 83.16  ? 782  ASP A CB  1 
ATOM   5233 C CG  . ASP A 1 766  ? 33.103  3.692   26.393  1.00 93.05  ? 782  ASP A CG  1 
ATOM   5234 O OD1 . ASP A 1 766  ? 33.290  2.461   26.516  1.00 94.56  ? 782  ASP A OD1 1 
ATOM   5235 O OD2 . ASP A 1 766  ? 33.817  4.560   26.944  1.00 93.43  ? 782  ASP A OD2 1 
ATOM   5236 N N   . ASP A 1 767  ? 29.323  3.601   23.840  1.00 78.99  ? 783  ASP A N   1 
ATOM   5237 C CA  . ASP A 1 767  ? 28.034  4.141   23.431  1.00 77.94  ? 783  ASP A CA  1 
ATOM   5238 C C   . ASP A 1 767  ? 27.736  5.276   24.429  1.00 80.26  ? 783  ASP A C   1 
ATOM   5239 O O   . ASP A 1 767  ? 27.792  5.049   25.640  1.00 80.82  ? 783  ASP A O   1 
ATOM   5240 C CB  . ASP A 1 767  ? 26.961  3.031   23.503  1.00 79.67  ? 783  ASP A CB  1 
ATOM   5241 C CG  . ASP A 1 767  ? 25.548  3.498   23.263  1.00 93.18  ? 783  ASP A CG  1 
ATOM   5242 O OD1 . ASP A 1 767  ? 25.271  3.989   22.153  1.00 94.07  ? 783  ASP A OD1 1 
ATOM   5243 O OD2 . ASP A 1 767  ? 24.713  3.378   24.196  1.00 103.50 ? 783  ASP A OD2 1 
ATOM   5244 N N   . LEU A 1 768  ? 27.474  6.496   23.935  1.00 74.42  ? 784  LEU A N   1 
ATOM   5245 C CA  . LEU A 1 768  ? 27.235  7.628   24.822  1.00 73.04  ? 784  LEU A CA  1 
ATOM   5246 C C   . LEU A 1 768  ? 25.750  7.989   25.045  1.00 73.24  ? 784  LEU A C   1 
ATOM   5247 O O   . LEU A 1 768  ? 25.444  8.728   25.978  1.00 70.85  ? 784  LEU A O   1 
ATOM   5248 C CB  . LEU A 1 768  ? 28.042  8.834   24.351  1.00 73.26  ? 784  LEU A CB  1 
ATOM   5249 C CG  . LEU A 1 768  ? 29.481  8.803   24.860  1.00 78.55  ? 784  LEU A CG  1 
ATOM   5250 C CD1 . LEU A 1 768  ? 30.346  9.731   24.090  1.00 78.85  ? 784  LEU A CD1 1 
ATOM   5251 C CD2 . LEU A 1 768  ? 29.556  9.116   26.351  1.00 82.03  ? 784  LEU A CD2 1 
ATOM   5252 N N   . ARG A 1 769  ? 24.841  7.416   24.243  1.00 70.02  ? 785  ARG A N   1 
ATOM   5253 C CA  . ARG A 1 769  ? 23.382  7.609   24.294  1.00 69.83  ? 785  ARG A CA  1 
ATOM   5254 C C   . ARG A 1 769  ? 22.828  7.569   25.724  1.00 73.25  ? 785  ARG A C   1 
ATOM   5255 O O   . ARG A 1 769  ? 22.158  8.508   26.163  1.00 72.04  ? 785  ARG A O   1 
ATOM   5256 C CB  . ARG A 1 769  ? 22.687  6.554   23.417  1.00 69.78  ? 785  ARG A CB  1 
ATOM   5257 C CG  . ARG A 1 769  ? 23.143  6.572   21.960  1.00 68.95  ? 785  ARG A CG  1 
ATOM   5258 C CD  . ARG A 1 769  ? 22.386  5.586   21.105  1.00 71.91  ? 785  ARG A CD  1 
ATOM   5259 N NE  . ARG A 1 769  ? 22.543  4.200   21.555  1.00 72.57  ? 785  ARG A NE  1 
ATOM   5260 C CZ  . ARG A 1 769  ? 21.662  3.231   21.308  1.00 102.54 ? 785  ARG A CZ  1 
ATOM   5261 N NH1 . ARG A 1 769  ? 20.555  3.488   20.607  1.00 91.72  ? 785  ARG A NH1 1 
ATOM   5262 N NH2 . ARG A 1 769  ? 21.868  2.004   21.773  1.00 95.00  ? 785  ARG A NH2 1 
ATOM   5263 N N   . GLN A 1 770  ? 23.172  6.490   26.451  1.00 70.59  ? 786  GLN A N   1 
ATOM   5264 C CA  . GLN A 1 770  ? 22.846  6.225   27.850  1.00 70.33  ? 786  GLN A CA  1 
ATOM   5265 C C   . GLN A 1 770  ? 23.227  7.434   28.740  1.00 73.07  ? 786  GLN A C   1 
ATOM   5266 O O   . GLN A 1 770  ? 22.369  7.953   29.448  1.00 72.95  ? 786  GLN A O   1 
ATOM   5267 C CB  . GLN A 1 770  ? 23.578  4.933   28.284  1.00 72.09  ? 786  GLN A CB  1 
ATOM   5268 C CG  . GLN A 1 770  ? 23.438  4.537   29.766  1.00 87.54  ? 786  GLN A CG  1 
ATOM   5269 C CD  . GLN A 1 770  ? 22.083  4.002   30.186  1.00 98.16  ? 786  GLN A CD  1 
ATOM   5270 O OE1 . GLN A 1 770  ? 21.126  3.859   29.398  1.00 83.74  ? 786  GLN A OE1 1 
ATOM   5271 N NE2 . GLN A 1 770  ? 21.988  3.686   31.468  1.00 95.12  ? 786  GLN A NE2 1 
ATOM   5272 N N   . ASP A 1 771  ? 24.495  7.902   28.658  1.00 68.70  ? 787  ASP A N   1 
ATOM   5273 C CA  . ASP A 1 771  ? 25.010  9.060   29.401  1.00 67.94  ? 787  ASP A CA  1 
ATOM   5274 C C   . ASP A 1 771  ? 24.315  10.346  28.994  1.00 69.01  ? 787  ASP A C   1 
ATOM   5275 O O   . ASP A 1 771  ? 24.048  11.169  29.856  1.00 68.30  ? 787  ASP A O   1 
ATOM   5276 C CB  . ASP A 1 771  ? 26.517  9.222   29.183  1.00 70.59  ? 787  ASP A CB  1 
ATOM   5277 C CG  . ASP A 1 771  ? 27.373  8.538   30.219  1.00 83.05  ? 787  ASP A CG  1 
ATOM   5278 O OD1 . ASP A 1 771  ? 27.733  7.348   30.004  1.00 82.27  ? 787  ASP A OD1 1 
ATOM   5279 O OD2 . ASP A 1 771  ? 27.726  9.204   31.228  1.00 89.77  ? 787  ASP A OD2 1 
ATOM   5280 N N   . MET A 1 772  ? 24.013  10.526  27.698  1.00 65.02  ? 788  MET A N   1 
ATOM   5281 C CA  . MET A 1 772  ? 23.321  11.730  27.266  1.00 64.74  ? 788  MET A CA  1 
ATOM   5282 C C   . MET A 1 772  ? 21.888  11.783  27.769  1.00 65.53  ? 788  MET A C   1 
ATOM   5283 O O   . MET A 1 772  ? 21.404  12.861  28.085  1.00 64.24  ? 788  MET A O   1 
ATOM   5284 C CB  . MET A 1 772  ? 23.358  11.936  25.760  1.00 67.74  ? 788  MET A CB  1 
ATOM   5285 C CG  . MET A 1 772  ? 22.824  13.310  25.406  1.00 72.49  ? 788  MET A CG  1 
ATOM   5286 S SD  . MET A 1 772  ? 22.514  13.690  23.687  1.00 77.57  ? 788  MET A SD  1 
ATOM   5287 C CE  . MET A 1 772  ? 21.612  12.244  23.184  1.00 74.58  ? 788  MET A CE  1 
ATOM   5288 N N   . LEU A 1 773  ? 21.212  10.641  27.849  1.00 61.14  ? 789  LEU A N   1 
ATOM   5289 C CA  . LEU A 1 773  ? 19.851  10.640  28.356  1.00 60.80  ? 789  LEU A CA  1 
ATOM   5290 C C   . LEU A 1 773  ? 19.871  10.965  29.837  1.00 64.76  ? 789  LEU A C   1 
ATOM   5291 O O   . LEU A 1 773  ? 19.097  11.812  30.278  1.00 64.03  ? 789  LEU A O   1 
ATOM   5292 C CB  . LEU A 1 773  ? 19.156  9.292   28.079  1.00 60.58  ? 789  LEU A CB  1 
ATOM   5293 C CG  . LEU A 1 773  ? 17.816  9.018   28.769  1.00 63.18  ? 789  LEU A CG  1 
ATOM   5294 C CD1 . LEU A 1 773  ? 16.761  10.052  28.385  1.00 62.51  ? 789  LEU A CD1 1 
ATOM   5295 C CD2 . LEU A 1 773  ? 17.340  7.633   28.428  1.00 63.33  ? 789  LEU A CD2 1 
ATOM   5296 N N   . THR A 1 774  ? 20.783  10.318  30.599  1.00 61.93  ? 790  THR A N   1 
ATOM   5297 C CA  . THR A 1 774  ? 20.913  10.540  32.040  1.00 61.22  ? 790  THR A CA  1 
ATOM   5298 C C   . THR A 1 774  ? 21.142  12.045  32.285  1.00 64.27  ? 790  THR A C   1 
ATOM   5299 O O   . THR A 1 774  ? 20.304  12.678  32.929  1.00 64.41  ? 790  THR A O   1 
ATOM   5300 C CB  . THR A 1 774  ? 21.947  9.571   32.658  1.00 66.61  ? 790  THR A CB  1 
ATOM   5301 O OG1 . THR A 1 774  ? 21.520  8.210   32.459  1.00 60.77  ? 790  THR A OG1 1 
ATOM   5302 C CG2 . THR A 1 774  ? 22.167  9.824   34.156  1.00 64.91  ? 790  THR A CG2 1 
ATOM   5303 N N   . LEU A 1 775  ? 22.184  12.626  31.644  1.00 59.21  ? 791  LEU A N   1 
ATOM   5304 C CA  . LEU A 1 775  ? 22.532  14.052  31.730  1.00 58.28  ? 791  LEU A CA  1 
ATOM   5305 C C   . LEU A 1 775  ? 21.368  15.000  31.348  1.00 63.69  ? 791  LEU A C   1 
ATOM   5306 O O   . LEU A 1 775  ? 21.120  15.983  32.072  1.00 63.86  ? 791  LEU A O   1 
ATOM   5307 C CB  . LEU A 1 775  ? 23.796  14.349  30.914  1.00 57.16  ? 791  LEU A CB  1 
ATOM   5308 C CG  . LEU A 1 775  ? 25.092  13.899  31.585  1.00 59.78  ? 791  LEU A CG  1 
ATOM   5309 C CD1 . LEU A 1 775  ? 26.166  13.664  30.579  1.00 59.99  ? 791  LEU A CD1 1 
ATOM   5310 C CD2 . LEU A 1 775  ? 25.558  14.896  32.587  1.00 57.46  ? 791  LEU A CD2 1 
ATOM   5311 N N   . GLN A 1 776  ? 20.625  14.667  30.246  1.00 58.91  ? 792  GLN A N   1 
ATOM   5312 C CA  . GLN A 1 776  ? 19.431  15.409  29.781  1.00 57.54  ? 792  GLN A CA  1 
ATOM   5313 C C   . GLN A 1 776  ? 18.380  15.450  30.904  1.00 57.57  ? 792  GLN A C   1 
ATOM   5314 O O   . GLN A 1 776  ? 17.821  16.498  31.166  1.00 55.46  ? 792  GLN A O   1 
ATOM   5315 C CB  . GLN A 1 776  ? 18.826  14.758  28.504  1.00 58.71  ? 792  GLN A CB  1 
ATOM   5316 C CG  . GLN A 1 776  ? 17.597  15.465  27.933  1.00 79.63  ? 792  GLN A CG  1 
ATOM   5317 C CD  . GLN A 1 776  ? 16.533  14.531  27.381  1.00 106.19 ? 792  GLN A CD  1 
ATOM   5318 O OE1 . GLN A 1 776  ? 16.568  14.127  26.218  1.00 103.76 ? 792  GLN A OE1 1 
ATOM   5319 N NE2 . GLN A 1 776  ? 15.506  14.245  28.171  1.00 101.42 ? 792  GLN A NE2 1 
ATOM   5320 N N   . MET A 1 777  ? 18.130  14.310  31.566  1.00 54.14  ? 793  MET A N   1 
ATOM   5321 C CA  . MET A 1 777  ? 17.142  14.219  32.631  1.00 54.09  ? 793  MET A CA  1 
ATOM   5322 C C   . MET A 1 777  ? 17.504  15.061  33.838  1.00 60.93  ? 793  MET A C   1 
ATOM   5323 O O   . MET A 1 777  ? 16.653  15.820  34.306  1.00 62.08  ? 793  MET A O   1 
ATOM   5324 C CB  . MET A 1 777  ? 16.856  12.772  32.991  1.00 55.65  ? 793  MET A CB  1 
ATOM   5325 C CG  . MET A 1 777  ? 16.158  12.045  31.863  1.00 58.21  ? 793  MET A CG  1 
ATOM   5326 S SD  . MET A 1 777  ? 14.573  12.810  31.517  1.00 61.46  ? 793  MET A SD  1 
ATOM   5327 C CE  . MET A 1 777  ? 14.001  11.791  30.233  1.00 59.26  ? 793  MET A CE  1 
ATOM   5328 N N   . ILE A 1 778  ? 18.785  15.016  34.273  1.00 56.95  ? 794  ILE A N   1 
ATOM   5329 C CA  . ILE A 1 778  ? 19.314  15.833  35.373  1.00 55.91  ? 794  ILE A CA  1 
ATOM   5330 C C   . ILE A 1 778  ? 19.107  17.331  35.030  1.00 60.13  ? 794  ILE A C   1 
ATOM   5331 O O   . ILE A 1 778  ? 18.616  18.092  35.855  1.00 61.47  ? 794  ILE A O   1 
ATOM   5332 C CB  . ILE A 1 778  ? 20.795  15.424  35.676  1.00 58.39  ? 794  ILE A CB  1 
ATOM   5333 C CG1 . ILE A 1 778  ? 20.847  14.029  36.368  1.00 58.23  ? 794  ILE A CG1 1 
ATOM   5334 C CG2 . ILE A 1 778  ? 21.515  16.466  36.523  1.00 58.11  ? 794  ILE A CG2 1 
ATOM   5335 C CD1 . ILE A 1 778  ? 21.992  13.175  35.971  1.00 64.23  ? 794  ILE A CD1 1 
ATOM   5336 N N   . GLN A 1 779  ? 19.410  17.720  33.789  1.00 55.83  ? 795  GLN A N   1 
ATOM   5337 C CA  . GLN A 1 779  ? 19.206  19.065  33.259  1.00 54.74  ? 795  GLN A CA  1 
ATOM   5338 C C   . GLN A 1 779  ? 17.685  19.423  33.293  1.00 60.50  ? 795  GLN A C   1 
ATOM   5339 O O   . GLN A 1 779  ? 17.324  20.550  33.642  1.00 60.40  ? 795  GLN A O   1 
ATOM   5340 C CB  . GLN A 1 779  ? 19.812  19.144  31.845  1.00 55.08  ? 795  GLN A CB  1 
ATOM   5341 C CG  . GLN A 1 779  ? 19.393  20.358  31.037  1.00 80.28  ? 795  GLN A CG  1 
ATOM   5342 C CD  . GLN A 1 779  ? 20.563  21.036  30.381  1.00 119.71 ? 795  GLN A CD  1 
ATOM   5343 O OE1 . GLN A 1 779  ? 20.741  22.257  30.506  1.00 120.52 ? 795  GLN A OE1 1 
ATOM   5344 N NE2 . GLN A 1 779  ? 21.386  20.268  29.659  1.00 114.00 ? 795  GLN A NE2 1 
ATOM   5345 N N   . LEU A 1 780  ? 16.801  18.451  32.978  1.00 57.32  ? 796  LEU A N   1 
ATOM   5346 C CA  . LEU A 1 780  ? 15.373  18.690  33.049  1.00 56.89  ? 796  LEU A CA  1 
ATOM   5347 C C   . LEU A 1 780  ? 14.986  18.986  34.494  1.00 62.33  ? 796  LEU A C   1 
ATOM   5348 O O   . LEU A 1 780  ? 14.322  19.990  34.736  1.00 62.15  ? 796  LEU A O   1 
ATOM   5349 C CB  . LEU A 1 780  ? 14.569  17.528  32.470  1.00 56.59  ? 796  LEU A CB  1 
ATOM   5350 C CG  . LEU A 1 780  ? 13.037  17.722  32.448  1.00 60.56  ? 796  LEU A CG  1 
ATOM   5351 C CD1 . LEU A 1 780  ? 12.624  19.044  31.798  1.00 59.14  ? 796  LEU A CD1 1 
ATOM   5352 C CD2 . LEU A 1 780  ? 12.351  16.552  31.780  1.00 62.54  ? 796  LEU A CD2 1 
ATOM   5353 N N   . MET A 1 781  ? 15.472  18.153  35.452  1.00 60.18  ? 797  MET A N   1 
ATOM   5354 C CA  . MET A 1 781  ? 15.262  18.301  36.903  1.00 59.63  ? 797  MET A CA  1 
ATOM   5355 C C   . MET A 1 781  ? 15.711  19.676  37.321  1.00 67.14  ? 797  MET A C   1 
ATOM   5356 O O   . MET A 1 781  ? 14.914  20.392  37.908  1.00 68.65  ? 797  MET A O   1 
ATOM   5357 C CB  . MET A 1 781  ? 16.047  17.261  37.699  1.00 60.83  ? 797  MET A CB  1 
ATOM   5358 C CG  . MET A 1 781  ? 15.654  15.871  37.404  1.00 63.31  ? 797  MET A CG  1 
ATOM   5359 S SD  . MET A 1 781  ? 16.620  14.734  38.396  1.00 66.62  ? 797  MET A SD  1 
ATOM   5360 C CE  . MET A 1 781  ? 15.888  13.179  37.878  1.00 63.24  ? 797  MET A CE  1 
ATOM   5361 N N   . ASP A 1 782  ? 16.955  20.073  36.945  1.00 64.02  ? 798  ASP A N   1 
ATOM   5362 C CA  . ASP A 1 782  ? 17.532  21.395  37.194  1.00 63.93  ? 798  ASP A CA  1 
ATOM   5363 C C   . ASP A 1 782  ? 16.610  22.509  36.705  1.00 70.49  ? 798  ASP A C   1 
ATOM   5364 O O   . ASP A 1 782  ? 16.424  23.471  37.424  1.00 71.75  ? 798  ASP A O   1 
ATOM   5365 C CB  . ASP A 1 782  ? 18.914  21.532  36.529  1.00 65.02  ? 798  ASP A CB  1 
ATOM   5366 C CG  . ASP A 1 782  ? 19.676  22.797  36.899  1.00 73.74  ? 798  ASP A CG  1 
ATOM   5367 O OD1 . ASP A 1 782  ? 19.681  23.165  38.103  1.00 75.44  ? 798  ASP A OD1 1 
ATOM   5368 O OD2 . ASP A 1 782  ? 20.339  23.368  36.011  1.00 78.34  ? 798  ASP A OD2 1 
ATOM   5369 N N   . VAL A 1 783  ? 16.020  22.375  35.509  1.00 67.59  ? 799  VAL A N   1 
ATOM   5370 C CA  . VAL A 1 783  ? 15.122  23.387  34.930  1.00 66.74  ? 799  VAL A CA  1 
ATOM   5371 C C   . VAL A 1 783  ? 13.819  23.442  35.720  1.00 69.25  ? 799  VAL A C   1 
ATOM   5372 O O   . VAL A 1 783  ? 13.420  24.526  36.135  1.00 69.42  ? 799  VAL A O   1 
ATOM   5373 C CB  . VAL A 1 783  ? 14.937  23.184  33.407  1.00 69.69  ? 799  VAL A CB  1 
ATOM   5374 C CG1 . VAL A 1 783  ? 13.854  24.087  32.849  1.00 69.04  ? 799  VAL A CG1 1 
ATOM   5375 C CG2 . VAL A 1 783  ? 16.252  23.427  32.678  1.00 69.39  ? 799  VAL A CG2 1 
ATOM   5376 N N   . LEU A 1 784  ? 13.217  22.275  35.999  1.00 64.26  ? 800  LEU A N   1 
ATOM   5377 C CA  . LEU A 1 784  ? 12.021  22.153  36.831  1.00 63.89  ? 800  LEU A CA  1 
ATOM   5378 C C   . LEU A 1 784  ? 12.244  22.765  38.240  1.00 69.46  ? 800  LEU A C   1 
ATOM   5379 O O   . LEU A 1 784  ? 11.355  23.471  38.735  1.00 70.66  ? 800  LEU A O   1 
ATOM   5380 C CB  . LEU A 1 784  ? 11.594  20.680  36.960  1.00 63.49  ? 800  LEU A CB  1 
ATOM   5381 C CG  . LEU A 1 784  ? 11.058  20.037  35.687  1.00 67.34  ? 800  LEU A CG  1 
ATOM   5382 C CD1 . LEU A 1 784  ? 10.934  18.528  35.816  1.00 65.38  ? 800  LEU A CD1 1 
ATOM   5383 C CD2 . LEU A 1 784  ? 9.778   20.703  35.232  1.00 69.56  ? 800  LEU A CD2 1 
ATOM   5384 N N   . TRP A 1 785  ? 13.429  22.523  38.865  1.00 64.99  ? 801  TRP A N   1 
ATOM   5385 C CA  . TRP A 1 785  ? 13.763  23.084  40.175  1.00 64.32  ? 801  TRP A CA  1 
ATOM   5386 C C   . TRP A 1 785  ? 13.971  24.592  40.023  1.00 73.09  ? 801  TRP A C   1 
ATOM   5387 O O   . TRP A 1 785  ? 13.265  25.355  40.684  1.00 74.37  ? 801  TRP A O   1 
ATOM   5388 C CB  . TRP A 1 785  ? 15.002  22.435  40.816  1.00 61.33  ? 801  TRP A CB  1 
ATOM   5389 C CG  . TRP A 1 785  ? 14.931  20.961  41.118  1.00 61.37  ? 801  TRP A CG  1 
ATOM   5390 C CD1 . TRP A 1 785  ? 13.866  20.259  41.624  1.00 64.10  ? 801  TRP A CD1 1 
ATOM   5391 C CD2 . TRP A 1 785  ? 16.034  20.038  41.077  1.00 60.36  ? 801  TRP A CD2 1 
ATOM   5392 N NE1 . TRP A 1 785  ? 14.222  18.940  41.833  1.00 62.47  ? 801  TRP A NE1 1 
ATOM   5393 C CE2 . TRP A 1 785  ? 15.552  18.784  41.517  1.00 63.74  ? 801  TRP A CE2 1 
ATOM   5394 C CE3 . TRP A 1 785  ? 17.377  20.146  40.685  1.00 60.82  ? 801  TRP A CE3 1 
ATOM   5395 C CZ2 . TRP A 1 785  ? 16.370  17.652  41.568  1.00 62.89  ? 801  TRP A CZ2 1 
ATOM   5396 C CZ3 . TRP A 1 785  ? 18.188  19.031  40.754  1.00 61.86  ? 801  TRP A CZ3 1 
ATOM   5397 C CH2 . TRP A 1 785  ? 17.685  17.800  41.182  1.00 62.58  ? 801  TRP A CH2 1 
ATOM   5398 N N   . LYS A 1 786  ? 14.881  25.022  39.119  1.00 71.01  ? 802  LYS A N   1 
ATOM   5399 C CA  . LYS A 1 786  ? 15.181  26.440  38.840  1.00 71.96  ? 802  LYS A CA  1 
ATOM   5400 C C   . LYS A 1 786  ? 13.919  27.275  38.561  1.00 81.00  ? 802  LYS A C   1 
ATOM   5401 O O   . LYS A 1 786  ? 13.858  28.444  38.961  1.00 81.79  ? 802  LYS A O   1 
ATOM   5402 C CB  . LYS A 1 786  ? 16.178  26.594  37.678  1.00 72.39  ? 802  LYS A CB  1 
ATOM   5403 C CG  . LYS A 1 786  ? 17.630  26.579  38.109  1.00 72.04  ? 802  LYS A CG  1 
ATOM   5404 C CD  . LYS A 1 786  ? 18.530  26.543  36.897  1.00 79.66  ? 802  LYS A CD  1 
ATOM   5405 C CE  . LYS A 1 786  ? 19.871  27.187  37.143  1.00 96.31  ? 802  LYS A CE  1 
ATOM   5406 N NZ  . LYS A 1 786  ? 20.751  27.097  35.944  1.00 111.01 ? 802  LYS A NZ  1 
ATOM   5407 N N   . GLN A 1 787  ? 12.922  26.673  37.884  1.00 79.37  ? 803  GLN A N   1 
ATOM   5408 C CA  . GLN A 1 787  ? 11.657  27.327  37.578  1.00 80.74  ? 803  GLN A CA  1 
ATOM   5409 C C   . GLN A 1 787  ? 10.902  27.738  38.853  1.00 88.11  ? 803  GLN A C   1 
ATOM   5410 O O   . GLN A 1 787  ? 10.351  28.843  38.895  1.00 89.01  ? 803  GLN A O   1 
ATOM   5411 C CB  . GLN A 1 787  ? 10.785  26.415  36.719  1.00 82.33  ? 803  GLN A CB  1 
ATOM   5412 C CG  . GLN A 1 787  ? 11.052  26.590  35.231  1.00 95.99  ? 803  GLN A CG  1 
ATOM   5413 C CD  . GLN A 1 787  ? 10.132  25.770  34.368  1.00 109.47 ? 803  GLN A CD  1 
ATOM   5414 O OE1 . GLN A 1 787  ? 9.146   25.166  34.835  1.00 105.22 ? 803  GLN A OE1 1 
ATOM   5415 N NE2 . GLN A 1 787  ? 10.436  25.746  33.077  1.00 95.70  ? 803  GLN A NE2 1 
ATOM   5416 N N   . GLU A 1 788  ? 10.917  26.862  39.896  1.00 84.62  ? 804  GLU A N   1 
ATOM   5417 C CA  . GLU A 1 788  ? 10.264  27.078  41.195  1.00 83.77  ? 804  GLU A CA  1 
ATOM   5418 C C   . GLU A 1 788  ? 11.212  27.644  42.281  1.00 84.75  ? 804  GLU A C   1 
ATOM   5419 O O   . GLU A 1 788  ? 11.148  27.239  43.453  1.00 83.61  ? 804  GLU A O   1 
ATOM   5420 C CB  . GLU A 1 788  ? 9.562   25.798  41.664  1.00 85.26  ? 804  GLU A CB  1 
ATOM   5421 C CG  . GLU A 1 788  ? 8.189   25.632  41.042  1.00 94.21  ? 804  GLU A CG  1 
ATOM   5422 C CD  . GLU A 1 788  ? 7.128   25.243  42.046  1.00 112.23 ? 804  GLU A CD  1 
ATOM   5423 O OE1 . GLU A 1 788  ? 6.225   26.073  42.309  1.00 112.66 ? 804  GLU A OE1 1 
ATOM   5424 O OE2 . GLU A 1 788  ? 7.234   24.131  42.614  1.00 100.04 ? 804  GLU A OE2 1 
ATOM   5425 N N   . GLY A 1 789  ? 12.076  28.573  41.851  1.00 79.27  ? 805  GLY A N   1 
ATOM   5426 C CA  . GLY A 1 789  ? 13.024  29.312  42.680  1.00 78.11  ? 805  GLY A CA  1 
ATOM   5427 C C   . GLY A 1 789  ? 14.101  28.550  43.427  1.00 79.94  ? 805  GLY A C   1 
ATOM   5428 O O   . GLY A 1 789  ? 14.772  29.135  44.286  1.00 80.51  ? 805  GLY A O   1 
ATOM   5429 N N   . LEU A 1 790  ? 14.309  27.266  43.103  1.00 73.51  ? 806  LEU A N   1 
ATOM   5430 C CA  . LEU A 1 790  ? 15.338  26.481  43.768  1.00 72.26  ? 806  LEU A CA  1 
ATOM   5431 C C   . LEU A 1 790  ? 16.531  26.178  42.827  1.00 75.41  ? 806  LEU A C   1 
ATOM   5432 O O   . LEU A 1 790  ? 16.406  25.394  41.879  1.00 75.73  ? 806  LEU A O   1 
ATOM   5433 C CB  . LEU A 1 790  ? 14.712  25.236  44.398  1.00 72.15  ? 806  LEU A CB  1 
ATOM   5434 C CG  . LEU A 1 790  ? 15.598  24.054  44.751  1.00 77.12  ? 806  LEU A CG  1 
ATOM   5435 C CD1 . LEU A 1 790  ? 16.055  24.127  46.159  1.00 77.69  ? 806  LEU A CD1 1 
ATOM   5436 C CD2 . LEU A 1 790  ? 14.831  22.791  44.605  1.00 81.26  ? 806  LEU A CD2 1 
ATOM   5437 N N   . ASP A 1 791  ? 17.675  26.863  43.072  1.00 69.78  ? 807  ASP A N   1 
ATOM   5438 C CA  . ASP A 1 791  ? 18.892  26.676  42.302  1.00 68.70  ? 807  ASP A CA  1 
ATOM   5439 C C   . ASP A 1 791  ? 19.778  25.776  43.111  1.00 73.20  ? 807  ASP A C   1 
ATOM   5440 O O   . ASP A 1 791  ? 20.236  26.160  44.193  1.00 75.07  ? 807  ASP A O   1 
ATOM   5441 C CB  . ASP A 1 791  ? 19.589  28.005  42.011  1.00 70.60  ? 807  ASP A CB  1 
ATOM   5442 C CG  . ASP A 1 791  ? 20.626  27.940  40.901  1.00 86.82  ? 807  ASP A CG  1 
ATOM   5443 O OD1 . ASP A 1 791  ? 21.379  26.938  40.844  1.00 88.49  ? 807  ASP A OD1 1 
ATOM   5444 O OD2 . ASP A 1 791  ? 20.728  28.919  40.124  1.00 95.37  ? 807  ASP A OD2 1 
ATOM   5445 N N   . LEU A 1 792  ? 19.984  24.550  42.619  1.00 67.05  ? 808  LEU A N   1 
ATOM   5446 C CA  . LEU A 1 792  ? 20.790  23.570  43.323  1.00 64.97  ? 808  LEU A CA  1 
ATOM   5447 C C   . LEU A 1 792  ? 22.176  23.452  42.736  1.00 67.91  ? 808  LEU A C   1 
ATOM   5448 O O   . LEU A 1 792  ? 22.820  22.409  42.874  1.00 69.13  ? 808  LEU A O   1 
ATOM   5449 C CB  . LEU A 1 792  ? 20.065  22.211  43.434  1.00 64.70  ? 808  LEU A CB  1 
ATOM   5450 C CG  . LEU A 1 792  ? 18.821  22.198  44.358  1.00 68.71  ? 808  LEU A CG  1 
ATOM   5451 C CD1 . LEU A 1 792  ? 17.916  21.073  44.014  1.00 68.34  ? 808  LEU A CD1 1 
ATOM   5452 C CD2 . LEU A 1 792  ? 19.204  22.158  45.853  1.00 70.29  ? 808  LEU A CD2 1 
ATOM   5453 N N   . ARG A 1 793  ? 22.661  24.550  42.122  1.00 62.40  ? 809  ARG A N   1 
ATOM   5454 C CA  . ARG A 1 793  ? 24.009  24.712  41.574  1.00 61.72  ? 809  ARG A CA  1 
ATOM   5455 C C   . ARG A 1 793  ? 24.559  23.438  40.925  1.00 68.77  ? 809  ARG A C   1 
ATOM   5456 O O   . ARG A 1 793  ? 25.610  22.937  41.324  1.00 69.71  ? 809  ARG A O   1 
ATOM   5457 C CB  . ARG A 1 793  ? 24.950  25.255  42.662  1.00 60.94  ? 809  ARG A CB  1 
ATOM   5458 C CG  . ARG A 1 793  ? 24.317  26.322  43.588  1.00 73.10  ? 809  ARG A CG  1 
ATOM   5459 C CD  . ARG A 1 793  ? 24.004  27.638  42.890  1.00 86.18  ? 809  ARG A CD  1 
ATOM   5460 N NE  . ARG A 1 793  ? 25.122  28.051  42.040  1.00 101.78 ? 809  ARG A NE  1 
ATOM   5461 C CZ  . ARG A 1 793  ? 24.998  28.724  40.903  1.00 121.14 ? 809  ARG A CZ  1 
ATOM   5462 N NH1 . ARG A 1 793  ? 23.800  29.104  40.475  1.00 109.00 ? 809  ARG A NH1 1 
ATOM   5463 N NH2 . ARG A 1 793  ? 26.074  29.043  40.194  1.00 111.38 ? 809  ARG A NH2 1 
ATOM   5464 N N   . MET A 1 794  ? 23.804  22.884  39.945  1.00 66.01  ? 810  MET A N   1 
ATOM   5465 C CA  . MET A 1 794  ? 24.185  21.658  39.228  1.00 64.65  ? 810  MET A CA  1 
ATOM   5466 C C   . MET A 1 794  ? 25.134  22.030  38.086  1.00 69.72  ? 810  MET A C   1 
ATOM   5467 O O   . MET A 1 794  ? 25.186  23.202  37.686  1.00 69.46  ? 810  MET A O   1 
ATOM   5468 C CB  . MET A 1 794  ? 22.951  20.927  38.671  1.00 66.14  ? 810  MET A CB  1 
ATOM   5469 C CG  . MET A 1 794  ? 21.798  20.816  39.648  1.00 68.76  ? 810  MET A CG  1 
ATOM   5470 S SD  . MET A 1 794  ? 22.063  19.578  40.916  1.00 71.94  ? 810  MET A SD  1 
ATOM   5471 C CE  . MET A 1 794  ? 21.704  18.113  40.005  1.00 69.19  ? 810  MET A CE  1 
ATOM   5472 N N   . THR A 1 795  ? 25.873  21.030  37.560  1.00 66.06  ? 811  THR A N   1 
ATOM   5473 C CA  . THR A 1 795  ? 26.827  21.195  36.461  1.00 65.27  ? 811  THR A CA  1 
ATOM   5474 C C   . THR A 1 795  ? 26.302  20.464  35.207  1.00 69.57  ? 811  THR A C   1 
ATOM   5475 O O   . THR A 1 795  ? 26.660  19.306  34.952  1.00 68.71  ? 811  THR A O   1 
ATOM   5476 C CB  . THR A 1 795  ? 28.249  20.803  36.931  1.00 63.90  ? 811  THR A CB  1 
ATOM   5477 O OG1 . THR A 1 795  ? 28.579  21.647  38.027  1.00 56.10  ? 811  THR A OG1 1 
ATOM   5478 C CG2 . THR A 1 795  ? 29.324  20.917  35.819  1.00 56.80  ? 811  THR A CG2 1 
ATOM   5479 N N   . PRO A 1 796  ? 25.424  21.124  34.425  1.00 67.65  ? 812  PRO A N   1 
ATOM   5480 C CA  . PRO A 1 796  ? 24.907  20.483  33.203  1.00 67.69  ? 812  PRO A CA  1 
ATOM   5481 C C   . PRO A 1 796  ? 25.968  20.576  32.103  1.00 68.29  ? 812  PRO A C   1 
ATOM   5482 O O   . PRO A 1 796  ? 25.950  21.482  31.244  1.00 67.01  ? 812  PRO A O   1 
ATOM   5483 C CB  . PRO A 1 796  ? 23.618  21.280  32.885  1.00 69.64  ? 812  PRO A CB  1 
ATOM   5484 C CG  . PRO A 1 796  ? 23.544  22.384  33.907  1.00 74.22  ? 812  PRO A CG  1 
ATOM   5485 C CD  . PRO A 1 796  ? 24.893  22.494  34.558  1.00 69.81  ? 812  PRO A CD  1 
ATOM   5486 N N   . TYR A 1 797  ? 26.964  19.684  32.214  1.00 61.64  ? 813  TYR A N   1 
ATOM   5487 C CA  . TYR A 1 797  ? 28.057  19.655  31.260  1.00 60.37  ? 813  TYR A CA  1 
ATOM   5488 C C   . TYR A 1 797  ? 27.517  18.922  30.057  1.00 63.18  ? 813  TYR A C   1 
ATOM   5489 O O   . TYR A 1 797  ? 26.670  18.040  30.230  1.00 63.34  ? 813  TYR A O   1 
ATOM   5490 C CB  . TYR A 1 797  ? 29.345  19.007  31.841  1.00 60.16  ? 813  TYR A CB  1 
ATOM   5491 C CG  . TYR A 1 797  ? 29.221  17.542  32.220  1.00 59.13  ? 813  TYR A CG  1 
ATOM   5492 C CD1 . TYR A 1 797  ? 29.426  16.537  31.276  1.00 61.44  ? 813  TYR A CD1 1 
ATOM   5493 C CD2 . TYR A 1 797  ? 28.940  17.158  33.536  1.00 57.43  ? 813  TYR A CD2 1 
ATOM   5494 C CE1 . TYR A 1 797  ? 29.310  15.187  31.620  1.00 64.06  ? 813  TYR A CE1 1 
ATOM   5495 C CE2 . TYR A 1 797  ? 28.851  15.814  33.896  1.00 56.77  ? 813  TYR A CE2 1 
ATOM   5496 C CZ  . TYR A 1 797  ? 29.036  14.831  32.935  1.00 67.09  ? 813  TYR A CZ  1 
ATOM   5497 O OH  . TYR A 1 797  ? 28.918  13.499  33.264  1.00 67.44  ? 813  TYR A OH  1 
ATOM   5498 N N   . GLY A 1 798  ? 27.952  19.344  28.874  1.00 57.65  ? 814  GLY A N   1 
ATOM   5499 C CA  . GLY A 1 798  ? 27.513  18.786  27.611  1.00 57.52  ? 814  GLY A CA  1 
ATOM   5500 C C   . GLY A 1 798  ? 28.150  17.470  27.277  1.00 63.61  ? 814  GLY A C   1 
ATOM   5501 O O   . GLY A 1 798  ? 29.311  17.236  27.604  1.00 64.30  ? 814  GLY A O   1 
ATOM   5502 N N   . CYS A 1 799  ? 27.374  16.596  26.635  1.00 62.57  ? 815  CYS A N   1 
ATOM   5503 C CA  . CYS A 1 799  ? 27.759  15.260  26.165  1.00 63.39  ? 815  CYS A CA  1 
ATOM   5504 C C   . CYS A 1 799  ? 26.958  15.058  24.915  1.00 66.97  ? 815  CYS A C   1 
ATOM   5505 O O   . CYS A 1 799  ? 25.726  15.162  24.941  1.00 66.87  ? 815  CYS A O   1 
ATOM   5506 C CB  . CYS A 1 799  ? 27.469  14.183  27.209  1.00 64.59  ? 815  CYS A CB  1 
ATOM   5507 S SG  . CYS A 1 799  ? 27.497  12.478  26.571  1.00 68.94  ? 815  CYS A SG  1 
ATOM   5508 N N   . LEU A 1 800  ? 27.657  14.836  23.802  1.00 63.56  ? 816  LEU A N   1 
ATOM   5509 C CA  . LEU A 1 800  ? 26.993  14.709  22.523  1.00 62.99  ? 816  LEU A CA  1 
ATOM   5510 C C   . LEU A 1 800  ? 27.464  13.527  21.655  1.00 60.99  ? 816  LEU A C   1 
ATOM   5511 O O   . LEU A 1 800  ? 28.505  13.629  21.009  1.00 59.57  ? 816  LEU A O   1 
ATOM   5512 C CB  . LEU A 1 800  ? 27.112  16.061  21.758  1.00 63.69  ? 816  LEU A CB  1 
ATOM   5513 C CG  . LEU A 1 800  ? 26.603  16.152  20.312  1.00 68.90  ? 816  LEU A CG  1 
ATOM   5514 C CD1 . LEU A 1 800  ? 25.257  16.797  20.246  1.00 68.55  ? 816  LEU A CD1 1 
ATOM   5515 C CD2 . LEU A 1 800  ? 27.545  16.953  19.484  1.00 74.11  ? 816  LEU A CD2 1 
ATOM   5516 N N   . PRO A 1 801  ? 26.628  12.470  21.497  1.00 54.43  ? 817  PRO A N   1 
ATOM   5517 C CA  . PRO A 1 801  ? 26.941  11.431  20.497  1.00 54.11  ? 817  PRO A CA  1 
ATOM   5518 C C   . PRO A 1 801  ? 26.986  12.050  19.083  1.00 58.90  ? 817  PRO A C   1 
ATOM   5519 O O   . PRO A 1 801  ? 26.048  12.724  18.649  1.00 58.59  ? 817  PRO A O   1 
ATOM   5520 C CB  . PRO A 1 801  ? 25.772  10.436  20.641  1.00 55.02  ? 817  PRO A CB  1 
ATOM   5521 C CG  . PRO A 1 801  ? 25.216  10.693  21.996  1.00 58.45  ? 817  PRO A CG  1 
ATOM   5522 C CD  . PRO A 1 801  ? 25.343  12.182  22.158  1.00 54.22  ? 817  PRO A CD  1 
ATOM   5523 N N   . THR A 1 802  ? 28.110  11.870  18.400  1.00 56.65  ? 818  THR A N   1 
ATOM   5524 C CA  . THR A 1 802  ? 28.357  12.399  17.058  1.00 57.06  ? 818  THR A CA  1 
ATOM   5525 C C   . THR A 1 802  ? 28.346  11.303  15.990  1.00 64.24  ? 818  THR A C   1 
ATOM   5526 O O   . THR A 1 802  ? 28.054  11.594  14.822  1.00 65.04  ? 818  THR A O   1 
ATOM   5527 C CB  . THR A 1 802  ? 29.676  13.150  17.041  1.00 59.64  ? 818  THR A CB  1 
ATOM   5528 O OG1 . THR A 1 802  ? 30.688  12.264  17.488  1.00 56.63  ? 818  THR A OG1 1 
ATOM   5529 C CG2 . THR A 1 802  ? 29.660  14.370  17.927  1.00 57.27  ? 818  THR A CG2 1 
ATOM   5530 N N   . GLY A 1 803  ? 28.667  10.064  16.387  1.00 60.85  ? 819  GLY A N   1 
ATOM   5531 C CA  . GLY A 1 803  ? 28.690  8.941   15.464  1.00 60.64  ? 819  GLY A CA  1 
ATOM   5532 C C   . GLY A 1 803  ? 28.647  7.606   16.147  1.00 67.34  ? 819  GLY A C   1 
ATOM   5533 O O   . GLY A 1 803  ? 28.226  7.510   17.297  1.00 66.15  ? 819  GLY A O   1 
ATOM   5534 N N   . ASP A 1 804  ? 29.075  6.556   15.415  1.00 68.47  ? 820  ASP A N   1 
ATOM   5535 C CA  . ASP A 1 804  ? 29.159  5.161   15.888  1.00 68.72  ? 820  ASP A CA  1 
ATOM   5536 C C   . ASP A 1 804  ? 30.137  5.045   17.058  1.00 71.60  ? 820  ASP A C   1 
ATOM   5537 O O   . ASP A 1 804  ? 31.357  5.223   16.884  1.00 70.69  ? 820  ASP A O   1 
ATOM   5538 C CB  . ASP A 1 804  ? 29.560  4.230   14.731  1.00 70.76  ? 820  ASP A CB  1 
ATOM   5539 C CG  . ASP A 1 804  ? 29.461  2.745   15.000  1.00 82.05  ? 820  ASP A CG  1 
ATOM   5540 O OD1 . ASP A 1 804  ? 29.033  2.366   16.120  1.00 81.64  ? 820  ASP A OD1 1 
ATOM   5541 O OD2 . ASP A 1 804  ? 29.825  1.955   14.092  1.00 88.39  ? 820  ASP A OD2 1 
ATOM   5542 N N   . ARG A 1 805  ? 29.575  4.811   18.273  1.00 67.04  ? 821  ARG A N   1 
ATOM   5543 C CA  . ARG A 1 805  ? 30.318  4.694   19.543  1.00 65.36  ? 821  ARG A CA  1 
ATOM   5544 C C   . ARG A 1 805  ? 31.294  5.857   19.725  1.00 66.16  ? 821  ARG A C   1 
ATOM   5545 O O   . ARG A 1 805  ? 32.272  5.735   20.446  1.00 66.19  ? 821  ARG A O   1 
ATOM   5546 C CB  . ARG A 1 805  ? 31.011  3.319   19.700  1.00 64.10  ? 821  ARG A CB  1 
ATOM   5547 C CG  . ARG A 1 805  ? 30.055  2.158   19.912  1.00 75.61  ? 821  ARG A CG  1 
ATOM   5548 C CD  . ARG A 1 805  ? 30.757  0.817   19.838  1.00 97.12  ? 821  ARG A CD  1 
ATOM   5549 N NE  . ARG A 1 805  ? 31.069  0.426   18.462  1.00 117.02 ? 821  ARG A NE  1 
ATOM   5550 C CZ  . ARG A 1 805  ? 30.253  -0.272  17.676  1.00 138.22 ? 821  ARG A CZ  1 
ATOM   5551 N NH1 . ARG A 1 805  ? 29.066  -0.669  18.123  1.00 130.28 ? 821  ARG A NH1 1 
ATOM   5552 N NH2 . ARG A 1 805  ? 30.617  -0.578  16.437  1.00 123.80 ? 821  ARG A NH2 1 
ATOM   5553 N N   . THR A 1 806  ? 30.989  6.997   19.094  1.00 61.02  ? 822  THR A N   1 
ATOM   5554 C CA  . THR A 1 806  ? 31.767  8.237   19.158  1.00 59.93  ? 822  THR A CA  1 
ATOM   5555 C C   . THR A 1 806  ? 30.909  9.379   19.681  1.00 62.83  ? 822  THR A C   1 
ATOM   5556 O O   . THR A 1 806  ? 29.725  9.469   19.326  1.00 63.82  ? 822  THR A O   1 
ATOM   5557 C CB  . THR A 1 806  ? 32.232  8.641   17.755  1.00 61.69  ? 822  THR A CB  1 
ATOM   5558 O OG1 . THR A 1 806  ? 32.765  7.516   17.046  1.00 61.31  ? 822  THR A OG1 1 
ATOM   5559 C CG2 . THR A 1 806  ? 33.198  9.800   17.783  1.00 53.25  ? 822  THR A CG2 1 
ATOM   5560 N N   . GLY A 1 807  ? 31.536  10.262  20.457  1.00 56.49  ? 823  GLY A N   1 
ATOM   5561 C CA  . GLY A 1 807  ? 30.935  11.487  20.964  1.00 55.03  ? 823  GLY A CA  1 
ATOM   5562 C C   . GLY A 1 807  ? 31.946  12.455  21.559  1.00 57.34  ? 823  GLY A C   1 
ATOM   5563 O O   . GLY A 1 807  ? 33.150  12.187  21.587  1.00 56.33  ? 823  GLY A O   1 
ATOM   5564 N N   . LEU A 1 808  ? 31.439  13.567  22.088  1.00 53.01  ? 824  LEU A N   1 
ATOM   5565 C CA  . LEU A 1 808  ? 32.190  14.602  22.779  1.00 51.58  ? 824  LEU A CA  1 
ATOM   5566 C C   . LEU A 1 808  ? 31.572  14.791  24.145  1.00 58.94  ? 824  LEU A C   1 
ATOM   5567 O O   . LEU A 1 808  ? 30.388  14.544  24.309  1.00 58.42  ? 824  LEU A O   1 
ATOM   5568 C CB  . LEU A 1 808  ? 32.179  15.936  22.011  1.00 50.35  ? 824  LEU A CB  1 
ATOM   5569 C CG  . LEU A 1 808  ? 32.837  15.953  20.629  1.00 53.59  ? 824  LEU A CG  1 
ATOM   5570 C CD1 . LEU A 1 808  ? 32.583  17.242  19.944  1.00 52.48  ? 824  LEU A CD1 1 
ATOM   5571 C CD2 . LEU A 1 808  ? 34.360  15.716  20.704  1.00 55.75  ? 824  LEU A CD2 1 
ATOM   5572 N N   . ILE A 1 809  ? 32.395  15.147  25.138  1.00 59.67  ? 825  ILE A N   1 
ATOM   5573 C CA  . ILE A 1 809  ? 32.023  15.423  26.525  1.00 60.50  ? 825  ILE A CA  1 
ATOM   5574 C C   . ILE A 1 809  ? 32.770  16.713  26.858  1.00 67.94  ? 825  ILE A C   1 
ATOM   5575 O O   . ILE A 1 809  ? 33.970  16.793  26.599  1.00 67.87  ? 825  ILE A O   1 
ATOM   5576 C CB  . ILE A 1 809  ? 32.402  14.267  27.512  1.00 63.22  ? 825  ILE A CB  1 
ATOM   5577 C CG1 . ILE A 1 809  ? 31.732  12.913  27.145  1.00 63.24  ? 825  ILE A CG1 1 
ATOM   5578 C CG2 . ILE A 1 809  ? 32.007  14.652  28.958  1.00 63.65  ? 825  ILE A CG2 1 
ATOM   5579 C CD1 . ILE A 1 809  ? 32.560  11.905  26.349  1.00 66.65  ? 825  ILE A CD1 1 
ATOM   5580 N N   . GLU A 1 810  ? 32.062  17.719  27.394  1.00 66.90  ? 826  GLU A N   1 
ATOM   5581 C CA  . GLU A 1 810  ? 32.597  19.033  27.799  1.00 67.78  ? 826  GLU A CA  1 
ATOM   5582 C C   . GLU A 1 810  ? 33.631  18.905  28.928  1.00 77.95  ? 826  GLU A C   1 
ATOM   5583 O O   . GLU A 1 810  ? 33.497  18.035  29.793  1.00 79.86  ? 826  GLU A O   1 
ATOM   5584 C CB  . GLU A 1 810  ? 31.456  19.949  28.279  1.00 68.25  ? 826  GLU A CB  1 
ATOM   5585 C CG  . GLU A 1 810  ? 31.881  21.385  28.509  1.00 73.18  ? 826  GLU A CG  1 
ATOM   5586 C CD  . GLU A 1 810  ? 30.806  22.366  28.929  1.00 85.46  ? 826  GLU A CD  1 
ATOM   5587 O OE1 . GLU A 1 810  ? 29.642  21.951  29.139  1.00 70.78  ? 826  GLU A OE1 1 
ATOM   5588 O OE2 . GLU A 1 810  ? 31.137  23.569  29.031  1.00 67.26  ? 826  GLU A OE2 1 
ATOM   5589 N N   . VAL A 1 811  ? 34.644  19.784  28.928  1.00 76.26  ? 827  VAL A N   1 
ATOM   5590 C CA  . VAL A 1 811  ? 35.640  19.821  29.980  1.00 76.88  ? 827  VAL A CA  1 
ATOM   5591 C C   . VAL A 1 811  ? 35.145  20.801  31.020  1.00 81.82  ? 827  VAL A C   1 
ATOM   5592 O O   . VAL A 1 811  ? 34.844  21.952  30.697  1.00 82.80  ? 827  VAL A O   1 
ATOM   5593 C CB  . VAL A 1 811  ? 37.074  20.153  29.479  1.00 81.86  ? 827  VAL A CB  1 
ATOM   5594 C CG1 . VAL A 1 811  ? 37.986  20.601  30.628  1.00 82.00  ? 827  VAL A CG1 1 
ATOM   5595 C CG2 . VAL A 1 811  ? 37.692  18.954  28.761  1.00 81.99  ? 827  VAL A CG2 1 
ATOM   5596 N N   . VAL A 1 812  ? 35.009  20.322  32.254  1.00 78.14  ? 828  VAL A N   1 
ATOM   5597 C CA  . VAL A 1 812  ? 34.644  21.132  33.411  1.00 77.50  ? 828  VAL A CA  1 
ATOM   5598 C C   . VAL A 1 812  ? 36.011  21.442  34.014  1.00 83.48  ? 828  VAL A C   1 
ATOM   5599 O O   . VAL A 1 812  ? 36.673  20.536  34.553  1.00 84.02  ? 828  VAL A O   1 
ATOM   5600 C CB  . VAL A 1 812  ? 33.704  20.392  34.413  1.00 79.49  ? 828  VAL A CB  1 
ATOM   5601 C CG1 . VAL A 1 812  ? 33.538  21.177  35.703  1.00 78.21  ? 828  VAL A CG1 1 
ATOM   5602 C CG2 . VAL A 1 812  ? 32.345  20.097  33.790  1.00 79.14  ? 828  VAL A CG2 1 
ATOM   5603 N N   . LEU A 1 813  ? 36.481  22.688  33.825  1.00 79.87  ? 829  LEU A N   1 
ATOM   5604 C CA  . LEU A 1 813  ? 37.793  23.093  34.349  1.00 79.30  ? 829  LEU A CA  1 
ATOM   5605 C C   . LEU A 1 813  ? 37.677  23.359  35.819  1.00 85.75  ? 829  LEU A C   1 
ATOM   5606 O O   . LEU A 1 813  ? 36.592  23.715  36.313  1.00 86.78  ? 829  LEU A O   1 
ATOM   5607 C CB  . LEU A 1 813  ? 38.364  24.351  33.667  1.00 78.48  ? 829  LEU A CB  1 
ATOM   5608 C CG  . LEU A 1 813  ? 38.473  24.343  32.150  1.00 81.51  ? 829  LEU A CG  1 
ATOM   5609 C CD1 . LEU A 1 813  ? 38.070  25.697  31.576  1.00 80.66  ? 829  LEU A CD1 1 
ATOM   5610 C CD2 . LEU A 1 813  ? 39.831  23.829  31.684  1.00 81.82  ? 829  LEU A CD2 1 
ATOM   5611 N N   . ARG A 1 814  ? 38.821  23.216  36.516  1.00 81.64  ? 830  ARG A N   1 
ATOM   5612 C CA  . ARG A 1 814  ? 38.969  23.465  37.942  1.00 80.07  ? 830  ARG A CA  1 
ATOM   5613 C C   . ARG A 1 814  ? 38.193  22.412  38.716  1.00 80.01  ? 830  ARG A C   1 
ATOM   5614 O O   . ARG A 1 814  ? 37.663  22.690  39.787  1.00 80.00  ? 830  ARG A O   1 
ATOM   5615 C CB  . ARG A 1 814  ? 38.543  24.923  38.292  1.00 81.37  ? 830  ARG A CB  1 
ATOM   5616 C CG  . ARG A 1 814  ? 39.355  26.013  37.581  1.00 89.80  ? 830  ARG A CG  1 
ATOM   5617 C CD  . ARG A 1 814  ? 38.618  27.338  37.555  1.00 105.84 ? 830  ARG A CD  1 
ATOM   5618 N NE  . ARG A 1 814  ? 37.857  27.531  36.319  1.00 113.79 ? 830  ARG A NE  1 
ATOM   5619 N N   . SER A 1 815  ? 38.121  21.198  38.174  1.00 74.87  ? 831  SER A N   1 
ATOM   5620 C CA  . SER A 1 815  ? 37.409  20.111  38.852  1.00 74.48  ? 831  SER A CA  1 
ATOM   5621 C C   . SER A 1 815  ? 38.257  18.837  38.984  1.00 78.91  ? 831  SER A C   1 
ATOM   5622 O O   . SER A 1 815  ? 39.110  18.581  38.121  1.00 78.27  ? 831  SER A O   1 
ATOM   5623 C CB  . SER A 1 815  ? 36.081  19.811  38.159  1.00 75.15  ? 831  SER A CB  1 
ATOM   5624 O OG  . SER A 1 815  ? 36.251  18.912  37.076  1.00 81.27  ? 831  SER A OG  1 
ATOM   5625 N N   . ASP A 1 816  ? 38.000  18.030  40.048  1.00 75.30  ? 832  ASP A N   1 
ATOM   5626 C CA  . ASP A 1 816  ? 38.701  16.757  40.282  1.00 75.06  ? 832  ASP A CA  1 
ATOM   5627 C C   . ASP A 1 816  ? 37.774  15.708  40.900  1.00 76.74  ? 832  ASP A C   1 
ATOM   5628 O O   . ASP A 1 816  ? 36.772  16.090  41.507  1.00 74.87  ? 832  ASP A O   1 
ATOM   5629 C CB  . ASP A 1 816  ? 39.961  16.964  41.152  1.00 77.37  ? 832  ASP A CB  1 
ATOM   5630 C CG  . ASP A 1 816  ? 41.039  15.896  40.978  1.00 91.56  ? 832  ASP A CG  1 
ATOM   5631 O OD1 . ASP A 1 816  ? 41.171  15.354  39.850  1.00 90.74  ? 832  ASP A OD1 1 
ATOM   5632 O OD2 . ASP A 1 816  ? 41.787  15.642  41.956  1.00 101.50 ? 832  ASP A OD2 1 
ATOM   5633 N N   . THR A 1 817  ? 38.094  14.394  40.719  1.00 73.55  ? 833  THR A N   1 
ATOM   5634 C CA  . THR A 1 817  ? 37.321  13.273  41.280  1.00 74.39  ? 833  THR A CA  1 
ATOM   5635 C C   . THR A 1 817  ? 37.651  13.141  42.759  1.00 81.73  ? 833  THR A C   1 
ATOM   5636 O O   . THR A 1 817  ? 38.831  13.191  43.114  1.00 80.63  ? 833  THR A O   1 
ATOM   5637 C CB  . THR A 1 817  ? 37.602  11.929  40.570  1.00 83.61  ? 833  THR A CB  1 
ATOM   5638 O OG1 . THR A 1 817  ? 38.978  11.588  40.679  1.00 87.20  ? 833  THR A OG1 1 
ATOM   5639 C CG2 . THR A 1 817  ? 37.178  11.908  39.126  1.00 81.52  ? 833  THR A CG2 1 
ATOM   5640 N N   . ILE A 1 818  ? 36.620  12.917  43.616  1.00 81.86  ? 834  ILE A N   1 
ATOM   5641 C CA  . ILE A 1 818  ? 36.756  12.799  45.079  1.00 83.29  ? 834  ILE A CA  1 
ATOM   5642 C C   . ILE A 1 818  ? 37.855  11.772  45.476  1.00 90.67  ? 834  ILE A C   1 
ATOM   5643 O O   . ILE A 1 818  ? 38.529  12.008  46.475  1.00 91.92  ? 834  ILE A O   1 
ATOM   5644 C CB  . ILE A 1 818  ? 35.382  12.573  45.805  1.00 86.34  ? 834  ILE A CB  1 
ATOM   5645 C CG1 . ILE A 1 818  ? 34.675  13.923  46.087  1.00 86.56  ? 834  ILE A CG1 1 
ATOM   5646 C CG2 . ILE A 1 818  ? 35.513  11.792  47.126  1.00 85.99  ? 834  ILE A CG2 1 
ATOM   5647 C CD1 . ILE A 1 818  ? 33.974  14.519  44.961  1.00 93.68  ? 834  ILE A CD1 1 
ATOM   5648 N N   . ALA A 1 819  ? 38.100  10.714  44.673  1.00 87.76  ? 835  ALA A N   1 
ATOM   5649 C CA  . ALA A 1 819  ? 39.176  9.763   44.960  1.00 88.01  ? 835  ALA A CA  1 
ATOM   5650 C C   . ALA A 1 819  ? 40.541  10.482  44.905  1.00 94.33  ? 835  ALA A C   1 
ATOM   5651 O O   . ALA A 1 819  ? 41.288  10.425  45.887  1.00 94.87  ? 835  ALA A O   1 
ATOM   5652 C CB  . ALA A 1 819  ? 39.139  8.594   43.982  1.00 88.66  ? 835  ALA A CB  1 
ATOM   5653 N N   . ASN A 1 820  ? 40.816  11.226  43.809  1.00 91.57  ? 836  ASN A N   1 
ATOM   5654 C CA  . ASN A 1 820  ? 42.060  11.983  43.615  1.00 92.12  ? 836  ASN A CA  1 
ATOM   5655 C C   . ASN A 1 820  ? 42.280  13.087  44.655  1.00 99.16  ? 836  ASN A C   1 
ATOM   5656 O O   . ASN A 1 820  ? 43.431  13.360  45.010  1.00 100.05 ? 836  ASN A O   1 
ATOM   5657 C CB  . ASN A 1 820  ? 42.131  12.578  42.206  1.00 90.32  ? 836  ASN A CB  1 
ATOM   5658 C CG  . ASN A 1 820  ? 42.425  11.606  41.087  1.00 99.14  ? 836  ASN A CG  1 
ATOM   5659 O OD1 . ASN A 1 820  ? 42.836  10.449  41.305  1.00 89.44  ? 836  ASN A OD1 1 
ATOM   5660 N ND2 . ASN A 1 820  ? 42.240  12.081  39.848  1.00 82.91  ? 836  ASN A ND2 1 
ATOM   5661 N N   . ILE A 1 821  ? 41.191  13.739  45.110  1.00 96.44  ? 837  ILE A N   1 
ATOM   5662 C CA  . ILE A 1 821  ? 41.215  14.805  46.118  1.00 96.76  ? 837  ILE A CA  1 
ATOM   5663 C C   . ILE A 1 821  ? 41.629  14.206  47.473  1.00 103.47 ? 837  ILE A C   1 
ATOM   5664 O O   . ILE A 1 821  ? 42.471  14.777  48.169  1.00 103.58 ? 837  ILE A O   1 
ATOM   5665 C CB  . ILE A 1 821  ? 39.838  15.545  46.156  1.00 99.65  ? 837  ILE A CB  1 
ATOM   5666 C CG1 . ILE A 1 821  ? 39.667  16.482  44.939  1.00 99.90  ? 837  ILE A CG1 1 
ATOM   5667 C CG2 . ILE A 1 821  ? 39.585  16.301  47.465  1.00 99.57  ? 837  ILE A CG2 1 
ATOM   5668 N N   . GLN A 1 822  ? 41.088  13.022  47.797  1.00 102.00 ? 838  GLN A N   1 
ATOM   5669 C CA  . GLN A 1 822  ? 41.334  12.292  49.043  1.00 102.62 ? 838  GLN A CA  1 
ATOM   5670 C C   . GLN A 1 822  ? 42.750  11.679  49.156  1.00 109.56 ? 838  GLN A C   1 
ATOM   5671 O O   . GLN A 1 822  ? 43.123  11.227  50.242  1.00 110.20 ? 838  GLN A O   1 
ATOM   5672 C CB  . GLN A 1 822  ? 40.241  11.231  49.275  1.00 103.53 ? 838  GLN A CB  1 
ATOM   5673 C CG  . GLN A 1 822  ? 38.907  11.844  49.727  1.00 104.74 ? 838  GLN A CG  1 
ATOM   5674 C CD  . GLN A 1 822  ? 37.836  10.841  50.103  1.00 110.93 ? 838  GLN A CD  1 
ATOM   5675 O OE1 . GLN A 1 822  ? 37.638  9.802   49.453  1.00 100.97 ? 838  GLN A OE1 1 
ATOM   5676 N NE2 . GLN A 1 822  ? 37.084  11.164  51.148  1.00 98.13  ? 838  GLN A NE2 1 
ATOM   5677 N N   . LEU A 1 823  ? 43.538  11.680  48.068  1.00 107.52 ? 839  LEU A N   1 
ATOM   5678 C CA  . LEU A 1 823  ? 44.911  11.170  48.089  1.00 108.19 ? 839  LEU A CA  1 
ATOM   5679 C C   . LEU A 1 823  ? 45.923  12.201  47.535  1.00 113.60 ? 839  LEU A C   1 
ATOM   5680 O O   . LEU A 1 823  ? 46.264  12.181  46.346  1.00 113.77 ? 839  LEU A O   1 
ATOM   5681 C CB  . LEU A 1 823  ? 45.034  9.792   47.404  1.00 108.43 ? 839  LEU A CB  1 
ATOM   5682 C CG  . LEU A 1 823  ? 45.064  8.575   48.355  1.00 113.90 ? 839  LEU A CG  1 
ATOM   5683 C CD1 . LEU A 1 823  ? 44.802  7.274   47.599  1.00 114.24 ? 839  LEU A CD1 1 
ATOM   5684 C CD2 . LEU A 1 823  ? 46.398  8.474   49.134  1.00 116.67 ? 839  LEU A CD2 1 
ATOM   5685 N N   . ASN A 1 824  ? 46.369  13.126  48.416  1.00 110.24 ? 840  ASN A N   1 
ATOM   5686 C CA  . ASN A 1 824  ? 47.324  14.199  48.118  1.00 136.43 ? 840  ASN A CA  1 
ATOM   5687 C C   . ASN A 1 824  ? 47.987  14.668  49.408  1.00 155.71 ? 840  ASN A C   1 
ATOM   5688 O O   . ASN A 1 824  ? 49.081  15.223  49.375  1.00 114.68 ? 840  ASN A O   1 
ATOM   5689 C CB  . ASN A 1 824  ? 46.627  15.377  47.426  1.00 137.22 ? 840  ASN A CB  1 
ATOM   5690 N N   . PHE A 1 834  ? 42.662  16.841  59.026  1.00 120.73 ? 850  PHE A N   1 
ATOM   5691 C CA  . PHE A 1 834  ? 42.861  15.391  58.955  1.00 120.71 ? 850  PHE A CA  1 
ATOM   5692 C C   . PHE A 1 834  ? 42.508  14.783  57.560  1.00 124.56 ? 850  PHE A C   1 
ATOM   5693 O O   . PHE A 1 834  ? 42.408  15.521  56.574  1.00 123.61 ? 850  PHE A O   1 
ATOM   5694 C CB  . PHE A 1 834  ? 42.091  14.696  60.097  1.00 122.38 ? 850  PHE A CB  1 
ATOM   5695 N N   . ASN A 1 835  ? 42.373  13.433  57.485  1.00 121.45 ? 851  ASN A N   1 
ATOM   5696 C CA  . ASN A 1 835  ? 42.002  12.687  56.271  1.00 121.23 ? 851  ASN A CA  1 
ATOM   5697 C C   . ASN A 1 835  ? 40.469  12.646  56.119  1.00 124.19 ? 851  ASN A C   1 
ATOM   5698 O O   . ASN A 1 835  ? 39.962  12.402  55.018  1.00 123.91 ? 851  ASN A O   1 
ATOM   5699 C CB  . ASN A 1 835  ? 42.594  11.272  56.281  1.00 122.68 ? 851  ASN A CB  1 
ATOM   5700 N N   . LYS A 1 836  ? 39.735  12.873  57.240  1.00 119.30 ? 852  LYS A N   1 
ATOM   5701 C CA  . LYS A 1 836  ? 38.276  12.991  57.264  1.00 118.26 ? 852  LYS A CA  1 
ATOM   5702 C C   . LYS A 1 836  ? 37.978  14.413  56.736  1.00 119.79 ? 852  LYS A C   1 
ATOM   5703 O O   . LYS A 1 836  ? 36.965  14.631  56.064  1.00 119.75 ? 852  LYS A O   1 
ATOM   5704 C CB  . LYS A 1 836  ? 37.740  12.810  58.694  1.00 120.83 ? 852  LYS A CB  1 
ATOM   5705 N N   . ASP A 1 837  ? 38.916  15.360  57.007  1.00 113.11 ? 853  ASP A N   1 
ATOM   5706 C CA  . ASP A 1 837  ? 38.896  16.756  56.572  1.00 111.02 ? 853  ASP A CA  1 
ATOM   5707 C C   . ASP A 1 837  ? 39.588  16.932  55.191  1.00 111.12 ? 853  ASP A C   1 
ATOM   5708 O O   . ASP A 1 837  ? 39.682  18.066  54.718  1.00 110.63 ? 853  ASP A O   1 
ATOM   5709 C CB  . ASP A 1 837  ? 39.579  17.662  57.625  1.00 112.58 ? 853  ASP A CB  1 
ATOM   5710 C CG  . ASP A 1 837  ? 38.909  17.744  58.990  1.00 121.43 ? 853  ASP A CG  1 
ATOM   5711 O OD1 . ASP A 1 837  ? 37.744  18.187  59.054  1.00 120.94 ? 853  ASP A OD1 1 
ATOM   5712 O OD2 . ASP A 1 837  ? 39.596  17.481  60.004  1.00 127.97 ? 853  ASP A OD2 1 
ATOM   5713 N N   . ALA A 1 838  ? 40.050  15.821  54.544  1.00 104.33 ? 854  ALA A N   1 
ATOM   5714 C CA  . ALA A 1 838  ? 40.734  15.817  53.234  1.00 102.64 ? 854  ALA A CA  1 
ATOM   5715 C C   . ALA A 1 838  ? 40.035  16.647  52.145  1.00 104.58 ? 854  ALA A C   1 
ATOM   5716 O O   . ALA A 1 838  ? 40.709  17.364  51.400  1.00 104.41 ? 854  ALA A O   1 
ATOM   5717 C CB  . ALA A 1 838  ? 40.956  14.394  52.745  1.00 103.07 ? 854  ALA A CB  1 
ATOM   5718 N N   . LEU A 1 839  ? 38.690  16.556  52.062  1.00 98.80  ? 855  LEU A N   1 
ATOM   5719 C CA  . LEU A 1 839  ? 37.889  17.315  51.107  1.00 97.15  ? 855  LEU A CA  1 
ATOM   5720 C C   . LEU A 1 839  ? 37.743  18.774  51.581  1.00 98.73  ? 855  LEU A C   1 
ATOM   5721 O O   . LEU A 1 839  ? 37.814  19.693  50.756  1.00 97.10  ? 855  LEU A O   1 
ATOM   5722 C CB  . LEU A 1 839  ? 36.517  16.655  50.901  1.00 96.97  ? 855  LEU A CB  1 
ATOM   5723 N N   . LEU A 1 840  ? 37.561  18.983  52.915  1.00 94.21  ? 856  LEU A N   1 
ATOM   5724 C CA  . LEU A 1 840  ? 37.416  20.313  53.516  1.00 93.19  ? 856  LEU A CA  1 
ATOM   5725 C C   . LEU A 1 840  ? 38.700  21.149  53.377  1.00 97.54  ? 856  LEU A C   1 
ATOM   5726 O O   . LEU A 1 840  ? 38.627  22.364  53.164  1.00 95.64  ? 856  LEU A O   1 
ATOM   5727 C CB  . LEU A 1 840  ? 36.968  20.208  54.968  1.00 92.77  ? 856  LEU A CB  1 
ATOM   5728 C CG  . LEU A 1 840  ? 35.836  21.152  55.337  1.00 97.07  ? 856  LEU A CG  1 
ATOM   5729 N N   . ASN A 1 841  ? 39.871  20.478  53.430  1.00 95.60  ? 857  ASN A N   1 
ATOM   5730 C CA  . ASN A 1 841  ? 41.180  21.099  53.251  1.00 95.89  ? 857  ASN A CA  1 
ATOM   5731 C C   . ASN A 1 841  ? 41.310  21.518  51.807  1.00 100.74 ? 857  ASN A C   1 
ATOM   5732 O O   . ASN A 1 841  ? 41.772  22.627  51.540  1.00 100.34 ? 857  ASN A O   1 
ATOM   5733 C CB  . ASN A 1 841  ? 42.318  20.129  53.614  1.00 98.13  ? 857  ASN A CB  1 
ATOM   5734 C CG  . ASN A 1 841  ? 42.403  19.716  55.071  1.00 122.28 ? 857  ASN A CG  1 
ATOM   5735 O OD1 . ASN A 1 841  ? 41.871  20.375  55.982  1.00 118.54 ? 857  ASN A OD1 1 
ATOM   5736 N ND2 . ASN A 1 841  ? 43.096  18.606  55.320  1.00 110.23 ? 857  ASN A ND2 1 
ATOM   5737 N N   . TRP A 1 842  ? 40.886  20.635  50.871  1.00 98.63  ? 858  TRP A N   1 
ATOM   5738 C CA  . TRP A 1 842  ? 40.919  20.906  49.434  1.00 98.87  ? 858  TRP A CA  1 
ATOM   5739 C C   . TRP A 1 842  ? 40.056  22.110  49.154  1.00 102.21 ? 858  TRP A C   1 
ATOM   5740 O O   . TRP A 1 842  ? 40.532  23.046  48.526  1.00 102.07 ? 858  TRP A O   1 
ATOM   5741 C CB  . TRP A 1 842  ? 40.447  19.697  48.612  1.00 98.31  ? 858  TRP A CB  1 
ATOM   5742 C CG  . TRP A 1 842  ? 40.575  19.897  47.126  1.00 99.93  ? 858  TRP A CG  1 
ATOM   5743 C CD1 . TRP A 1 842  ? 41.670  19.637  46.353  1.00 102.81 ? 858  TRP A CD1 1 
ATOM   5744 C CD2 . TRP A 1 842  ? 39.572  20.423  46.239  1.00 100.12 ? 858  TRP A CD2 1 
ATOM   5745 N NE1 . TRP A 1 842  ? 41.418  19.972  45.044  1.00 102.35 ? 858  TRP A NE1 1 
ATOM   5746 C CE2 . TRP A 1 842  ? 40.141  20.470  44.946  1.00 104.00 ? 858  TRP A CE2 1 
ATOM   5747 C CE3 . TRP A 1 842  ? 38.250  20.878  46.416  1.00 101.46 ? 858  TRP A CE3 1 
ATOM   5748 C CZ2 . TRP A 1 842  ? 39.428  20.935  43.832  1.00 103.27 ? 858  TRP A CZ2 1 
ATOM   5749 C CZ3 . TRP A 1 842  ? 37.549  21.336  45.311  1.00 102.96 ? 858  TRP A CZ3 1 
ATOM   5750 C CH2 . TRP A 1 842  ? 38.132  21.348  44.036  1.00 103.51 ? 858  TRP A CH2 1 
ATOM   5751 N N   . LEU A 1 843  ? 38.816  22.115  49.676  1.00 98.94  ? 859  LEU A N   1 
ATOM   5752 C CA  . LEU A 1 843  ? 37.875  23.222  49.516  1.00 98.95  ? 859  LEU A CA  1 
ATOM   5753 C C   . LEU A 1 843  ? 38.460  24.500  50.126  1.00 102.68 ? 859  LEU A C   1 
ATOM   5754 O O   . LEU A 1 843  ? 38.304  25.563  49.532  1.00 102.06 ? 859  LEU A O   1 
ATOM   5755 C CB  . LEU A 1 843  ? 36.496  22.879  50.126  1.00 98.99  ? 859  LEU A CB  1 
ATOM   5756 C CG  . LEU A 1 843  ? 35.266  23.229  49.281  1.00 103.20 ? 859  LEU A CG  1 
ATOM   5757 N N   . LYS A 1 844  ? 39.190  24.387  51.269  1.00 99.44  ? 860  LYS A N   1 
ATOM   5758 C CA  . LYS A 1 844  ? 39.836  25.529  51.934  1.00 98.57  ? 860  LYS A CA  1 
ATOM   5759 C C   . LYS A 1 844  ? 40.950  26.105  51.063  1.00 101.56 ? 860  LYS A C   1 
ATOM   5760 O O   . LYS A 1 844  ? 40.988  27.315  50.868  1.00 101.21 ? 860  LYS A O   1 
ATOM   5761 C CB  . LYS A 1 844  ? 40.354  25.149  53.332  1.00 100.64 ? 860  LYS A CB  1 
ATOM   5762 C CG  . LYS A 1 844  ? 39.321  25.330  54.435  1.00 112.92 ? 860  LYS A CG  1 
ATOM   5763 N N   . SER A 1 845  ? 41.807  25.230  50.488  1.00 98.37  ? 861  SER A N   1 
ATOM   5764 C CA  . SER A 1 845  ? 42.919  25.581  49.591  1.00 98.67  ? 861  SER A CA  1 
ATOM   5765 C C   . SER A 1 845  ? 42.461  26.208  48.243  1.00 103.18 ? 861  SER A C   1 
ATOM   5766 O O   . SER A 1 845  ? 43.299  26.749  47.507  1.00 102.13 ? 861  SER A O   1 
ATOM   5767 C CB  . SER A 1 845  ? 43.831  24.372  49.358  1.00 102.46 ? 861  SER A CB  1 
ATOM   5768 O OG  . SER A 1 845  ? 43.631  23.740  48.100  1.00 111.70 ? 861  SER A OG  1 
ATOM   5769 N N   . LYS A 1 846  ? 41.143  26.112  47.922  1.00 100.52 ? 862  LYS A N   1 
ATOM   5770 C CA  . LYS A 1 846  ? 40.535  26.672  46.704  1.00 100.39 ? 862  LYS A CA  1 
ATOM   5771 C C   . LYS A 1 846  ? 39.527  27.800  47.046  1.00 107.13 ? 862  LYS A C   1 
ATOM   5772 O O   . LYS A 1 846  ? 39.105  28.543  46.156  1.00 106.35 ? 862  LYS A O   1 
ATOM   5773 C CB  . LYS A 1 846  ? 39.900  25.577  45.805  1.00 100.52 ? 862  LYS A CB  1 
ATOM   5774 C CG  . LYS A 1 846  ? 40.700  24.274  45.644  1.00 93.41  ? 862  LYS A CG  1 
ATOM   5775 C CD  . LYS A 1 846  ? 41.940  24.338  44.734  1.00 93.55  ? 862  LYS A CD  1 
ATOM   5776 C CE  . LYS A 1 846  ? 42.754  23.061  44.831  1.00 81.74  ? 862  LYS A CE  1 
ATOM   5777 N NZ  . LYS A 1 846  ? 43.885  23.032  43.872  1.00 69.95  ? 862  LYS A NZ  1 
ATOM   5778 N N   . ASN A 1 847  ? 39.175  27.934  48.337  1.00 106.92 ? 863  ASN A N   1 
ATOM   5779 C CA  . ASN A 1 847  ? 38.261  28.955  48.868  1.00 108.87 ? 863  ASN A CA  1 
ATOM   5780 C C   . ASN A 1 847  ? 38.768  29.465  50.239  1.00 117.27 ? 863  ASN A C   1 
ATOM   5781 O O   . ASN A 1 847  ? 38.480  28.857  51.279  1.00 117.03 ? 863  ASN A O   1 
ATOM   5782 C CB  . ASN A 1 847  ? 36.801  28.451  48.963  1.00 108.24 ? 863  ASN A CB  1 
ATOM   5783 C CG  . ASN A 1 847  ? 36.031  28.476  47.665  1.00 112.59 ? 863  ASN A CG  1 
ATOM   5784 O OD1 . ASN A 1 847  ? 35.294  29.429  47.354  1.00 97.12  ? 863  ASN A OD1 1 
ATOM   5785 N ND2 . ASN A 1 847  ? 36.112  27.381  46.932  1.00 98.27  ? 863  ASN A ND2 1 
ATOM   5786 N N   . PRO A 1 848  ? 39.550  30.564  50.263  1.00 116.49 ? 864  PRO A N   1 
ATOM   5787 C CA  . PRO A 1 848  ? 40.077  31.048  51.544  1.00 116.70 ? 864  PRO A CA  1 
ATOM   5788 C C   . PRO A 1 848  ? 39.220  32.110  52.252  1.00 120.55 ? 864  PRO A C   1 
ATOM   5789 O O   . PRO A 1 848  ? 38.692  33.029  51.615  1.00 119.63 ? 864  PRO A O   1 
ATOM   5790 C CB  . PRO A 1 848  ? 41.455  31.584  51.157  1.00 118.68 ? 864  PRO A CB  1 
ATOM   5791 C CG  . PRO A 1 848  ? 41.324  31.980  49.683  1.00 123.24 ? 864  PRO A CG  1 
ATOM   5792 C CD  . PRO A 1 848  ? 40.052  31.383  49.136  1.00 118.65 ? 864  PRO A CD  1 
ATOM   5793 N N   . GLY A 1 849  ? 39.126  31.976  53.577  1.00 117.29 ? 865  GLY A N   1 
ATOM   5794 C CA  . GLY A 1 849  ? 38.433  32.904  54.465  1.00 117.12 ? 865  GLY A CA  1 
ATOM   5795 C C   . GLY A 1 849  ? 36.935  32.992  54.296  1.00 121.42 ? 865  GLY A C   1 
ATOM   5796 O O   . GLY A 1 849  ? 36.211  32.092  54.732  1.00 121.06 ? 865  GLY A O   1 
ATOM   5797 N N   . GLU A 1 850  ? 36.465  34.105  53.693  1.00 118.64 ? 866  GLU A N   1 
ATOM   5798 C CA  . GLU A 1 850  ? 35.041  34.387  53.442  1.00 119.00 ? 866  GLU A CA  1 
ATOM   5799 C C   . GLU A 1 850  ? 34.454  33.457  52.370  1.00 122.39 ? 866  GLU A C   1 
ATOM   5800 O O   . GLU A 1 850  ? 33.258  33.131  52.412  1.00 121.55 ? 866  GLU A O   1 
ATOM   5801 C CB  . GLU A 1 850  ? 34.835  35.863  53.037  1.00 120.58 ? 866  GLU A CB  1 
ATOM   5802 C CG  . GLU A 1 850  ? 34.725  36.837  54.205  1.00 130.15 ? 866  GLU A CG  1 
ATOM   5803 C CD  . GLU A 1 850  ? 36.001  37.224  54.933  1.00 148.05 ? 866  GLU A CD  1 
ATOM   5804 O OE1 . GLU A 1 850  ? 37.105  37.074  54.357  1.00 142.94 ? 866  GLU A OE1 1 
ATOM   5805 O OE2 . GLU A 1 850  ? 35.889  37.712  56.080  1.00 138.55 ? 866  GLU A OE2 1 
ATOM   5806 N N   . ALA A 1 851  ? 35.317  33.041  51.412  1.00 118.28 ? 867  ALA A N   1 
ATOM   5807 C CA  . ALA A 1 851  ? 35.007  32.145  50.296  1.00 117.21 ? 867  ALA A CA  1 
ATOM   5808 C C   . ALA A 1 851  ? 34.653  30.717  50.738  1.00 118.79 ? 867  ALA A C   1 
ATOM   5809 O O   . ALA A 1 851  ? 33.951  30.024  49.999  1.00 119.25 ? 867  ALA A O   1 
ATOM   5810 C CB  . ALA A 1 851  ? 36.170  32.116  49.318  1.00 117.82 ? 867  ALA A CB  1 
ATOM   5811 N N   . LEU A 1 852  ? 35.137  30.277  51.925  1.00 112.24 ? 868  LEU A N   1 
ATOM   5812 C CA  . LEU A 1 852  ? 34.888  28.940  52.477  1.00 110.60 ? 868  LEU A CA  1 
ATOM   5813 C C   . LEU A 1 852  ? 33.400  28.687  52.710  1.00 112.47 ? 868  LEU A C   1 
ATOM   5814 O O   . LEU A 1 852  ? 32.908  27.604  52.392  1.00 112.24 ? 868  LEU A O   1 
ATOM   5815 C CB  . LEU A 1 852  ? 35.684  28.715  53.777  1.00 110.32 ? 868  LEU A CB  1 
ATOM   5816 C CG  . LEU A 1 852  ? 35.924  27.255  54.175  1.00 114.32 ? 868  LEU A CG  1 
ATOM   5817 N N   . ASP A 1 853  ? 32.685  29.688  53.235  1.00 107.26 ? 869  ASP A N   1 
ATOM   5818 C CA  . ASP A 1 853  ? 31.256  29.583  53.528  1.00 106.29 ? 869  ASP A CA  1 
ATOM   5819 C C   . ASP A 1 853  ? 30.397  29.562  52.257  1.00 108.62 ? 869  ASP A C   1 
ATOM   5820 O O   . ASP A 1 853  ? 29.289  29.018  52.270  1.00 108.05 ? 869  ASP A O   1 
ATOM   5821 C CB  . ASP A 1 853  ? 30.827  30.687  54.504  1.00 108.00 ? 869  ASP A CB  1 
ATOM   5822 C CG  . ASP A 1 853  ? 31.527  30.586  55.847  1.00 115.78 ? 869  ASP A CG  1 
ATOM   5823 O OD1 . ASP A 1 853  ? 31.058  29.805  56.701  1.00 115.56 ? 869  ASP A OD1 1 
ATOM   5824 O OD2 . ASP A 1 853  ? 32.572  31.256  56.026  1.00 121.47 ? 869  ASP A OD2 1 
ATOM   5825 N N   . ARG A 1 854  ? 30.930  30.124  51.153  1.00 103.72 ? 870  ARG A N   1 
ATOM   5826 C CA  . ARG A 1 854  ? 30.268  30.159  49.848  1.00 102.39 ? 870  ARG A CA  1 
ATOM   5827 C C   . ARG A 1 854  ? 30.310  28.749  49.261  1.00 101.64 ? 870  ARG A C   1 
ATOM   5828 O O   . ARG A 1 854  ? 29.259  28.187  48.952  1.00 100.97 ? 870  ARG A O   1 
ATOM   5829 C CB  . ARG A 1 854  ? 30.961  31.160  48.899  1.00 105.18 ? 870  ARG A CB  1 
ATOM   5830 C CG  . ARG A 1 854  ? 31.261  32.534  49.512  1.00 122.34 ? 870  ARG A CG  1 
ATOM   5831 C CD  . ARG A 1 854  ? 31.958  33.454  48.524  1.00 135.27 ? 870  ARG A CD  1 
ATOM   5832 N N   . ALA A 1 855  ? 31.523  28.163  49.178  1.00 94.94  ? 871  ALA A N   1 
ATOM   5833 C CA  . ALA A 1 855  ? 31.777  26.818  48.665  1.00 93.80  ? 871  ALA A CA  1 
ATOM   5834 C C   . ALA A 1 855  ? 30.960  25.720  49.352  1.00 97.54  ? 871  ALA A C   1 
ATOM   5835 O O   . ALA A 1 855  ? 30.539  24.790  48.663  1.00 97.73  ? 871  ALA A O   1 
ATOM   5836 C CB  . ALA A 1 855  ? 33.258  26.492  48.748  1.00 94.19  ? 871  ALA A CB  1 
ATOM   5837 N N   . ILE A 1 856  ? 30.745  25.811  50.701  1.00 92.47  ? 872  ILE A N   1 
ATOM   5838 C CA  . ILE A 1 856  ? 29.971  24.813  51.462  1.00 90.69  ? 872  ILE A CA  1 
ATOM   5839 C C   . ILE A 1 856  ? 28.490  24.918  51.089  1.00 91.18  ? 872  ILE A C   1 
ATOM   5840 O O   . ILE A 1 856  ? 27.799  23.904  51.048  1.00 89.65  ? 872  ILE A O   1 
ATOM   5841 C CB  . ILE A 1 856  ? 30.223  24.770  53.015  1.00 93.59  ? 872  ILE A CB  1 
ATOM   5842 C CG1 . ILE A 1 856  ? 29.806  26.065  53.753  1.00 94.04  ? 872  ILE A CG1 1 
ATOM   5843 C CG2 . ILE A 1 856  ? 31.645  24.310  53.377  1.00 92.78  ? 872  ILE A CG2 1 
ATOM   5844 N N   . GLU A 1 857  ? 28.021  26.132  50.762  1.00 87.08  ? 873  GLU A N   1 
ATOM   5845 C CA  . GLU A 1 857  ? 26.645  26.327  50.320  1.00 86.45  ? 873  GLU A CA  1 
ATOM   5846 C C   . GLU A 1 857  ? 26.503  25.762  48.877  1.00 90.23  ? 873  GLU A C   1 
ATOM   5847 O O   . GLU A 1 857  ? 25.448  25.252  48.510  1.00 89.11  ? 873  GLU A O   1 
ATOM   5848 C CB  . GLU A 1 857  ? 26.234  27.804  50.442  1.00 87.33  ? 873  GLU A CB  1 
ATOM   5849 C CG  . GLU A 1 857  ? 24.757  28.084  50.185  1.00 97.32  ? 873  GLU A CG  1 
ATOM   5850 C CD  . GLU A 1 857  ? 23.699  27.512  51.121  1.00 110.93 ? 873  GLU A CD  1 
ATOM   5851 O OE1 . GLU A 1 857  ? 24.021  26.613  51.934  1.00 104.55 ? 873  GLU A OE1 1 
ATOM   5852 O OE2 . GLU A 1 857  ? 22.528  27.948  51.011  1.00 88.78  ? 873  GLU A OE2 1 
ATOM   5853 N N   . GLU A 1 858  ? 27.605  25.785  48.107  1.00 86.10  ? 874  GLU A N   1 
ATOM   5854 C CA  . GLU A 1 858  ? 27.679  25.238  46.755  1.00 85.33  ? 874  GLU A CA  1 
ATOM   5855 C C   . GLU A 1 858  ? 27.655  23.703  46.832  1.00 87.51  ? 874  GLU A C   1 
ATOM   5856 O O   . GLU A 1 858  ? 27.014  23.043  46.001  1.00 88.21  ? 874  GLU A O   1 
ATOM   5857 C CB  . GLU A 1 858  ? 28.972  25.702  46.068  1.00 86.70  ? 874  GLU A CB  1 
ATOM   5858 C CG  . GLU A 1 858  ? 28.982  27.173  45.714  1.00 95.62  ? 874  GLU A CG  1 
ATOM   5859 C CD  . GLU A 1 858  ? 28.199  27.472  44.458  1.00 107.65 ? 874  GLU A CD  1 
ATOM   5860 O OE1 . GLU A 1 858  ? 28.715  27.176  43.357  1.00 100.56 ? 874  GLU A OE1 1 
ATOM   5861 O OE2 . GLU A 1 858  ? 27.055  27.963  44.574  1.00 98.40  ? 874  GLU A OE2 1 
ATOM   5862 N N   . PHE A 1 859  ? 28.340  23.144  47.852  1.00 79.93  ? 875  PHE A N   1 
ATOM   5863 C CA  . PHE A 1 859  ? 28.429  21.702  48.085  1.00 77.02  ? 875  PHE A CA  1 
ATOM   5864 C C   . PHE A 1 859  ? 27.113  21.145  48.580  1.00 82.84  ? 875  PHE A C   1 
ATOM   5865 O O   . PHE A 1 859  ? 26.730  20.043  48.192  1.00 82.61  ? 875  PHE A O   1 
ATOM   5866 C CB  . PHE A 1 859  ? 29.522  21.411  49.099  1.00 76.08  ? 875  PHE A CB  1 
ATOM   5867 C CG  . PHE A 1 859  ? 29.861  19.959  49.230  1.00 74.96  ? 875  PHE A CG  1 
ATOM   5868 C CD1 . PHE A 1 859  ? 30.868  19.393  48.457  1.00 76.45  ? 875  PHE A CD1 1 
ATOM   5869 C CD2 . PHE A 1 859  ? 29.224  19.165  50.172  1.00 75.52  ? 875  PHE A CD2 1 
ATOM   5870 C CE1 . PHE A 1 859  ? 31.228  18.050  48.613  1.00 76.66  ? 875  PHE A CE1 1 
ATOM   5871 C CE2 . PHE A 1 859  ? 29.563  17.817  50.316  1.00 78.31  ? 875  PHE A CE2 1 
ATOM   5872 C CZ  . PHE A 1 859  ? 30.569  17.267  49.539  1.00 76.17  ? 875  PHE A CZ  1 
ATOM   5873 N N   . THR A 1 860  ? 26.454  21.897  49.472  1.00 79.38  ? 876  THR A N   1 
ATOM   5874 C CA  . THR A 1 860  ? 25.199  21.538  50.106  1.00 78.56  ? 876  THR A CA  1 
ATOM   5875 C C   . THR A 1 860  ? 24.105  21.527  49.067  1.00 81.92  ? 876  THR A C   1 
ATOM   5876 O O   . THR A 1 860  ? 23.343  20.562  48.978  1.00 81.86  ? 876  THR A O   1 
ATOM   5877 C CB  . THR A 1 860  ? 24.985  22.458  51.321  1.00 82.43  ? 876  THR A CB  1 
ATOM   5878 O OG1 . THR A 1 860  ? 25.857  22.007  52.359  1.00 77.25  ? 876  THR A OG1 1 
ATOM   5879 C CG2 . THR A 1 860  ? 23.550  22.485  51.820  1.00 79.57  ? 876  THR A CG2 1 
ATOM   5880 N N   . LEU A 1 861  ? 24.073  22.576  48.247  1.00 77.87  ? 877  LEU A N   1 
ATOM   5881 C CA  . LEU A 1 861  ? 23.093  22.729  47.184  1.00 76.57  ? 877  LEU A CA  1 
ATOM   5882 C C   . LEU A 1 861  ? 23.269  21.669  46.077  1.00 78.04  ? 877  LEU A C   1 
ATOM   5883 O O   . LEU A 1 861  ? 22.291  20.996  45.744  1.00 76.17  ? 877  LEU A O   1 
ATOM   5884 C CB  . LEU A 1 861  ? 23.102  24.173  46.654  1.00 76.28  ? 877  LEU A CB  1 
ATOM   5885 C CG  . LEU A 1 861  ? 22.514  25.244  47.615  1.00 80.22  ? 877  LEU A CG  1 
ATOM   5886 C CD1 . LEU A 1 861  ? 22.807  26.647  47.122  1.00 80.69  ? 877  LEU A CD1 1 
ATOM   5887 C CD2 . LEU A 1 861  ? 21.002  25.085  47.809  1.00 81.56  ? 877  LEU A CD2 1 
ATOM   5888 N N   . SER A 1 862  ? 24.509  21.460  45.578  1.00 74.60  ? 878  SER A N   1 
ATOM   5889 C CA  . SER A 1 862  ? 24.756  20.422  44.561  1.00 74.87  ? 878  SER A CA  1 
ATOM   5890 C C   . SER A 1 862  ? 24.610  18.982  45.114  1.00 79.58  ? 878  SER A C   1 
ATOM   5891 O O   . SER A 1 862  ? 24.143  18.101  44.397  1.00 78.41  ? 878  SER A O   1 
ATOM   5892 C CB  . SER A 1 862  ? 26.100  20.621  43.865  1.00 77.50  ? 878  SER A CB  1 
ATOM   5893 O OG  . SER A 1 862  ? 27.166  20.672  44.796  1.00 84.14  ? 878  SER A OG  1 
ATOM   5894 N N   . CYS A 1 863  ? 24.964  18.759  46.394  1.00 77.31  ? 879  CYS A N   1 
ATOM   5895 C CA  . CYS A 1 863  ? 24.838  17.449  47.028  1.00 77.26  ? 879  CYS A CA  1 
ATOM   5896 C C   . CYS A 1 863  ? 23.367  16.997  46.993  1.00 74.95  ? 879  CYS A C   1 
ATOM   5897 O O   . CYS A 1 863  ? 23.077  15.944  46.429  1.00 74.64  ? 879  CYS A O   1 
ATOM   5898 C CB  . CYS A 1 863  ? 25.392  17.467  48.453  1.00 78.86  ? 879  CYS A CB  1 
ATOM   5899 S SG  . CYS A 1 863  ? 25.658  15.823  49.172  1.00 83.41  ? 879  CYS A SG  1 
ATOM   5900 N N   . ALA A 1 864  ? 22.451  17.833  47.516  1.00 65.46  ? 880  ALA A N   1 
ATOM   5901 C CA  . ALA A 1 864  ? 21.016  17.585  47.541  1.00 63.29  ? 880  ALA A CA  1 
ATOM   5902 C C   . ALA A 1 864  ? 20.477  17.131  46.199  1.00 68.43  ? 880  ALA A C   1 
ATOM   5903 O O   . ALA A 1 864  ? 19.887  16.042  46.120  1.00 67.96  ? 880  ALA A O   1 
ATOM   5904 C CB  . ALA A 1 864  ? 20.287  18.836  47.974  1.00 63.50  ? 880  ALA A CB  1 
ATOM   5905 N N   . GLY A 1 865  ? 20.708  17.971  45.170  1.00 65.35  ? 881  GLY A N   1 
ATOM   5906 C CA  . GLY A 1 865  ? 20.284  17.801  43.782  1.00 64.40  ? 881  GLY A CA  1 
ATOM   5907 C C   . GLY A 1 865  ? 20.715  16.502  43.147  1.00 67.62  ? 881  GLY A C   1 
ATOM   5908 O O   . GLY A 1 865  ? 19.901  15.834  42.518  1.00 66.91  ? 881  GLY A O   1 
ATOM   5909 N N   . TYR A 1 866  ? 21.989  16.132  43.326  1.00 65.32  ? 882  TYR A N   1 
ATOM   5910 C CA  . TYR A 1 866  ? 22.558  14.892  42.805  1.00 65.93  ? 882  TYR A CA  1 
ATOM   5911 C C   . TYR A 1 866  ? 22.201  13.695  43.701  1.00 73.46  ? 882  TYR A C   1 
ATOM   5912 O O   . TYR A 1 866  ? 22.263  12.562  43.255  1.00 74.00  ? 882  TYR A O   1 
ATOM   5913 C CB  . TYR A 1 866  ? 24.080  15.019  42.594  1.00 67.36  ? 882  TYR A CB  1 
ATOM   5914 C CG  . TYR A 1 866  ? 24.460  15.848  41.380  1.00 71.16  ? 882  TYR A CG  1 
ATOM   5915 C CD1 . TYR A 1 866  ? 24.376  15.320  40.093  1.00 73.03  ? 882  TYR A CD1 1 
ATOM   5916 C CD2 . TYR A 1 866  ? 24.907  17.159  41.516  1.00 72.00  ? 882  TYR A CD2 1 
ATOM   5917 C CE1 . TYR A 1 866  ? 24.694  16.088  38.976  1.00 73.39  ? 882  TYR A CE1 1 
ATOM   5918 C CE2 . TYR A 1 866  ? 25.234  17.933  40.405  1.00 72.73  ? 882  TYR A CE2 1 
ATOM   5919 C CZ  . TYR A 1 866  ? 25.124  17.397  39.135  1.00 78.74  ? 882  TYR A CZ  1 
ATOM   5920 O OH  . TYR A 1 866  ? 25.437  18.172  38.033  1.00 76.41  ? 882  TYR A OH  1 
ATOM   5921 N N   . CYS A 1 867  ? 21.819  13.932  44.950  1.00 71.70  ? 883  CYS A N   1 
ATOM   5922 C CA  . CYS A 1 867  ? 21.407  12.835  45.815  1.00 72.09  ? 883  CYS A CA  1 
ATOM   5923 C C   . CYS A 1 867  ? 20.015  12.397  45.390  1.00 72.89  ? 883  CYS A C   1 
ATOM   5924 O O   . CYS A 1 867  ? 19.774  11.206  45.237  1.00 71.51  ? 883  CYS A O   1 
ATOM   5925 C CB  . CYS A 1 867  ? 21.459  13.240  47.287  1.00 73.06  ? 883  CYS A CB  1 
ATOM   5926 S SG  . CYS A 1 867  ? 23.116  13.121  48.015  1.00 77.51  ? 883  CYS A SG  1 
ATOM   5927 N N   . VAL A 1 868  ? 19.140  13.383  45.133  1.00 68.62  ? 884  VAL A N   1 
ATOM   5928 C CA  . VAL A 1 868  ? 17.756  13.237  44.688  1.00 68.44  ? 884  VAL A CA  1 
ATOM   5929 C C   . VAL A 1 868  ? 17.717  12.694  43.225  1.00 71.96  ? 884  VAL A C   1 
ATOM   5930 O O   . VAL A 1 868  ? 17.010  11.719  42.943  1.00 72.94  ? 884  VAL A O   1 
ATOM   5931 C CB  . VAL A 1 868  ? 17.017  14.597  44.876  1.00 71.99  ? 884  VAL A CB  1 
ATOM   5932 C CG1 . VAL A 1 868  ? 15.738  14.686  44.034  1.00 72.07  ? 884  VAL A CG1 1 
ATOM   5933 C CG2 . VAL A 1 868  ? 16.723  14.870  46.353  1.00 70.89  ? 884  VAL A CG2 1 
ATOM   5934 N N   . ALA A 1 869  ? 18.515  13.298  42.330  1.00 65.17  ? 885  ALA A N   1 
ATOM   5935 C CA  . ALA A 1 869  ? 18.629  12.906  40.933  1.00 63.67  ? 885  ALA A CA  1 
ATOM   5936 C C   . ALA A 1 869  ? 19.008  11.448  40.785  1.00 66.91  ? 885  ALA A C   1 
ATOM   5937 O O   . ALA A 1 869  ? 18.280  10.682  40.143  1.00 65.71  ? 885  ALA A O   1 
ATOM   5938 C CB  . ALA A 1 869  ? 19.662  13.779  40.222  1.00 64.03  ? 885  ALA A CB  1 
ATOM   5939 N N   . THR A 1 870  ? 20.139  11.057  41.395  1.00 64.33  ? 886  THR A N   1 
ATOM   5940 C CA  . THR A 1 870  ? 20.667  9.698   41.273  1.00 64.99  ? 886  THR A CA  1 
ATOM   5941 C C   . THR A 1 870  ? 19.751  8.646   41.955  1.00 68.20  ? 886  THR A C   1 
ATOM   5942 O O   . THR A 1 870  ? 19.762  7.477   41.532  1.00 67.72  ? 886  THR A O   1 
ATOM   5943 C CB  . THR A 1 870  ? 22.151  9.611   41.703  1.00 76.36  ? 886  THR A CB  1 
ATOM   5944 O OG1 . THR A 1 870  ? 22.311  9.993   43.068  1.00 77.21  ? 886  THR A OG1 1 
ATOM   5945 C CG2 . THR A 1 870  ? 23.068  10.458  40.825  1.00 76.09  ? 886  THR A CG2 1 
ATOM   5946 N N   . TYR A 1 871  ? 18.943  9.063   42.955  1.00 63.84  ? 887  TYR A N   1 
ATOM   5947 C CA  . TYR A 1 871  ? 18.025  8.154   43.635  1.00 64.40  ? 887  TYR A CA  1 
ATOM   5948 C C   . TYR A 1 871  ? 16.776  7.913   42.754  1.00 70.05  ? 887  TYR A C   1 
ATOM   5949 O O   . TYR A 1 871  ? 16.311  6.767   42.608  1.00 68.86  ? 887  TYR A O   1 
ATOM   5950 C CB  . TYR A 1 871  ? 17.677  8.663   45.053  1.00 65.22  ? 887  TYR A CB  1 
ATOM   5951 C CG  . TYR A 1 871  ? 16.358  8.161   45.617  1.00 66.37  ? 887  TYR A CG  1 
ATOM   5952 C CD1 . TYR A 1 871  ? 16.215  6.840   46.056  1.00 68.00  ? 887  TYR A CD1 1 
ATOM   5953 C CD2 . TYR A 1 871  ? 15.249  9.004   45.708  1.00 66.44  ? 887  TYR A CD2 1 
ATOM   5954 C CE1 . TYR A 1 871  ? 14.991  6.365   46.534  1.00 66.99  ? 887  TYR A CE1 1 
ATOM   5955 C CE2 . TYR A 1 871  ? 14.028  8.543   46.195  1.00 66.71  ? 887  TYR A CE2 1 
ATOM   5956 C CZ  . TYR A 1 871  ? 13.907  7.227   46.613  1.00 74.29  ? 887  TYR A CZ  1 
ATOM   5957 O OH  . TYR A 1 871  ? 12.705  6.800   47.109  1.00 79.15  ? 887  TYR A OH  1 
ATOM   5958 N N   . VAL A 1 872  ? 16.237  9.011   42.191  1.00 66.92  ? 888  VAL A N   1 
ATOM   5959 C CA  . VAL A 1 872  ? 15.076  9.001   41.317  1.00 65.65  ? 888  VAL A CA  1 
ATOM   5960 C C   . VAL A 1 872  ? 15.374  8.226   40.023  1.00 69.95  ? 888  VAL A C   1 
ATOM   5961 O O   . VAL A 1 872  ? 14.525  7.471   39.562  1.00 70.38  ? 888  VAL A O   1 
ATOM   5962 C CB  . VAL A 1 872  ? 14.590  10.443  41.077  1.00 68.42  ? 888  VAL A CB  1 
ATOM   5963 C CG1 . VAL A 1 872  ? 13.795  10.574  39.775  1.00 68.45  ? 888  VAL A CG1 1 
ATOM   5964 C CG2 . VAL A 1 872  ? 13.781  10.942  42.270  1.00 67.58  ? 888  VAL A CG2 1 
ATOM   5965 N N   . LEU A 1 873  ? 16.575  8.374   39.470  1.00 66.46  ? 889  LEU A N   1 
ATOM   5966 C CA  . LEU A 1 873  ? 16.914  7.676   38.231  1.00 67.00  ? 889  LEU A CA  1 
ATOM   5967 C C   . LEU A 1 873  ? 17.449  6.275   38.464  1.00 74.39  ? 889  LEU A C   1 
ATOM   5968 O O   . LEU A 1 873  ? 17.617  5.528   37.508  1.00 74.92  ? 889  LEU A O   1 
ATOM   5969 C CB  . LEU A 1 873  ? 17.869  8.496   37.325  1.00 66.79  ? 889  LEU A CB  1 
ATOM   5970 C CG  . LEU A 1 873  ? 17.351  9.867   36.843  1.00 70.68  ? 889  LEU A CG  1 
ATOM   5971 C CD1 . LEU A 1 873  ? 18.467  10.736  36.357  1.00 70.05  ? 889  LEU A CD1 1 
ATOM   5972 C CD2 . LEU A 1 873  ? 16.221  9.738   35.806  1.00 71.59  ? 889  LEU A CD2 1 
ATOM   5973 N N   . GLY A 1 874  ? 17.684  5.920   39.720  1.00 72.56  ? 890  GLY A N   1 
ATOM   5974 C CA  . GLY A 1 874  ? 18.204  4.612   40.090  1.00 72.67  ? 890  GLY A CA  1 
ATOM   5975 C C   . GLY A 1 874  ? 19.631  4.405   39.652  1.00 78.97  ? 890  GLY A C   1 
ATOM   5976 O O   . GLY A 1 874  ? 19.995  3.305   39.219  1.00 80.60  ? 890  GLY A O   1 
ATOM   5977 N N   . ILE A 1 875  ? 20.441  5.460   39.726  1.00 75.56  ? 891  ILE A N   1 
ATOM   5978 C CA  . ILE A 1 875  ? 21.835  5.333   39.313  1.00 76.54  ? 891  ILE A CA  1 
ATOM   5979 C C   . ILE A 1 875  ? 22.633  4.945   40.553  1.00 84.25  ? 891  ILE A C   1 
ATOM   5980 O O   . ILE A 1 875  ? 22.816  5.768   41.468  1.00 85.01  ? 891  ILE A O   1 
ATOM   5981 C CB  . ILE A 1 875  ? 22.428  6.593   38.577  1.00 78.92  ? 891  ILE A CB  1 
ATOM   5982 C CG1 . ILE A 1 875  ? 21.434  7.261   37.633  1.00 79.40  ? 891  ILE A CG1 1 
ATOM   5983 C CG2 . ILE A 1 875  ? 23.723  6.282   37.851  1.00 77.94  ? 891  ILE A CG2 1 
ATOM   5984 C CD1 . ILE A 1 875  ? 21.566  8.773   37.671  1.00 88.40  ? 891  ILE A CD1 1 
ATOM   5985 N N   . GLY A 1 876  ? 23.049  3.681   40.587  1.00 81.59  ? 892  GLY A N   1 
ATOM   5986 C CA  . GLY A 1 876  ? 23.869  3.147   41.665  1.00 82.03  ? 892  GLY A CA  1 
ATOM   5987 C C   . GLY A 1 876  ? 25.343  3.193   41.299  1.00 88.87  ? 892  GLY A C   1 
ATOM   5988 O O   . GLY A 1 876  ? 25.731  3.840   40.311  1.00 88.76  ? 892  GLY A O   1 
ATOM   5989 N N   . ASP A 1 877  ? 26.179  2.481   42.088  1.00 86.81  ? 893  ASP A N   1 
ATOM   5990 C CA  . ASP A 1 877  ? 27.637  2.391   41.907  1.00 86.81  ? 893  ASP A CA  1 
ATOM   5991 C C   . ASP A 1 877  ? 28.278  3.787   42.008  1.00 88.75  ? 893  ASP A C   1 
ATOM   5992 O O   . ASP A 1 877  ? 29.252  4.084   41.305  1.00 87.84  ? 893  ASP A O   1 
ATOM   5993 C CB  . ASP A 1 877  ? 27.992  1.647   40.590  1.00 89.34  ? 893  ASP A CB  1 
ATOM   5994 C CG  . ASP A 1 877  ? 29.410  1.102   40.503  1.00 106.77 ? 893  ASP A CG  1 
ATOM   5995 O OD1 . ASP A 1 877  ? 29.777  0.252   41.354  1.00 108.66 ? 893  ASP A OD1 1 
ATOM   5996 O OD2 . ASP A 1 877  ? 30.134  1.480   39.550  1.00 113.03 ? 893  ASP A OD2 1 
ATOM   5997 N N   . ARG A 1 878  ? 27.710  4.639   42.895  1.00 84.29  ? 894  ARG A N   1 
ATOM   5998 C CA  . ARG A 1 878  ? 28.167  6.012   43.134  1.00 84.02  ? 894  ARG A CA  1 
ATOM   5999 C C   . ARG A 1 878  ? 29.319  6.049   44.141  1.00 88.53  ? 894  ARG A C   1 
ATOM   6000 O O   . ARG A 1 878  ? 29.106  6.198   45.355  1.00 89.21  ? 894  ARG A O   1 
ATOM   6001 C CB  . ARG A 1 878  ? 27.015  6.972   43.560  1.00 82.47  ? 894  ARG A CB  1 
ATOM   6002 C CG  . ARG A 1 878  ? 25.812  7.142   42.616  1.00 81.79  ? 894  ARG A CG  1 
ATOM   6003 C CD  . ARG A 1 878  ? 26.099  6.953   41.134  1.00 78.37  ? 894  ARG A CD  1 
ATOM   6004 N NE  . ARG A 1 878  ? 26.966  7.985   40.581  1.00 71.38  ? 894  ARG A NE  1 
ATOM   6005 C CZ  . ARG A 1 878  ? 27.696  7.834   39.483  1.00 82.97  ? 894  ARG A CZ  1 
ATOM   6006 N NH1 . ARG A 1 878  ? 27.697  6.676   38.829  1.00 58.35  ? 894  ARG A NH1 1 
ATOM   6007 N NH2 . ARG A 1 878  ? 28.457  8.829   39.045  1.00 80.76  ? 894  ARG A NH2 1 
ATOM   6008 N N   . HIS A 1 879  ? 30.543  5.900   43.620  1.00 84.55  ? 895  HIS A N   1 
ATOM   6009 C CA  . HIS A 1 879  ? 31.780  5.924   44.395  1.00 83.78  ? 895  HIS A CA  1 
ATOM   6010 C C   . HIS A 1 879  ? 32.571  7.216   44.154  1.00 88.74  ? 895  HIS A C   1 
ATOM   6011 O O   . HIS A 1 879  ? 32.037  8.141   43.541  1.00 88.37  ? 895  HIS A O   1 
ATOM   6012 C CB  . HIS A 1 879  ? 32.615  4.651   44.173  1.00 84.00  ? 895  HIS A CB  1 
ATOM   6013 C CG  . HIS A 1 879  ? 32.853  4.299   42.746  1.00 87.11  ? 895  HIS A CG  1 
ATOM   6014 N ND1 . HIS A 1 879  ? 33.657  5.077   41.935  1.00 88.83  ? 895  HIS A ND1 1 
ATOM   6015 C CD2 . HIS A 1 879  ? 32.416  3.235   42.037  1.00 89.02  ? 895  HIS A CD2 1 
ATOM   6016 C CE1 . HIS A 1 879  ? 33.664  4.480   40.753  1.00 88.26  ? 895  HIS A CE1 1 
ATOM   6017 N NE2 . HIS A 1 879  ? 32.937  3.367   40.764  1.00 88.78  ? 895  HIS A NE2 1 
ATOM   6018 N N   . SER A 1 880  ? 33.815  7.296   44.679  1.00 86.23  ? 896  SER A N   1 
ATOM   6019 C CA  . SER A 1 880  ? 34.699  8.465   44.616  1.00 85.52  ? 896  SER A CA  1 
ATOM   6020 C C   . SER A 1 880  ? 35.416  8.631   43.272  1.00 89.09  ? 896  SER A C   1 
ATOM   6021 O O   . SER A 1 880  ? 35.897  9.726   42.968  1.00 89.91  ? 896  SER A O   1 
ATOM   6022 C CB  . SER A 1 880  ? 35.689  8.443   45.776  1.00 88.97  ? 896  SER A CB  1 
ATOM   6023 O OG  . SER A 1 880  ? 36.492  7.274   45.751  1.00 98.51  ? 896  SER A OG  1 
ATOM   6024 N N   . ASP A 1 881  ? 35.477  7.565   42.460  1.00 84.14  ? 897  ASP A N   1 
ATOM   6025 C CA  . ASP A 1 881  ? 36.079  7.638   41.128  1.00 83.26  ? 897  ASP A CA  1 
ATOM   6026 C C   . ASP A 1 881  ? 35.053  8.207   40.132  1.00 85.28  ? 897  ASP A C   1 
ATOM   6027 O O   . ASP A 1 881  ? 35.440  8.683   39.062  1.00 84.99  ? 897  ASP A O   1 
ATOM   6028 C CB  . ASP A 1 881  ? 36.555  6.253   40.648  1.00 85.06  ? 897  ASP A CB  1 
ATOM   6029 C CG  . ASP A 1 881  ? 37.708  5.666   41.429  1.00 95.43  ? 897  ASP A CG  1 
ATOM   6030 O OD1 . ASP A 1 881  ? 38.866  5.919   41.045  1.00 95.14  ? 897  ASP A OD1 1 
ATOM   6031 O OD2 . ASP A 1 881  ? 37.450  4.911   42.403  1.00 103.04 ? 897  ASP A OD2 1 
ATOM   6032 N N   . ASN A 1 882  ? 33.747  8.136   40.460  1.00 80.58  ? 898  ASN A N   1 
ATOM   6033 C CA  . ASN A 1 882  ? 32.746  8.659   39.537  1.00 79.60  ? 898  ASN A CA  1 
ATOM   6034 C C   . ASN A 1 882  ? 31.968  9.855   40.111  1.00 81.13  ? 898  ASN A C   1 
ATOM   6035 O O   . ASN A 1 882  ? 31.008  10.299  39.479  1.00 82.19  ? 898  ASN A O   1 
ATOM   6036 C CB  . ASN A 1 882  ? 31.829  7.580   38.946  1.00 77.25  ? 898  ASN A CB  1 
ATOM   6037 C CG  . ASN A 1 882  ? 31.076  6.743   39.922  1.00 86.36  ? 898  ASN A CG  1 
ATOM   6038 O OD1 . ASN A 1 882  ? 30.628  7.213   40.965  1.00 73.31  ? 898  ASN A OD1 1 
ATOM   6039 N ND2 . ASN A 1 882  ? 30.839  5.497   39.548  1.00 79.39  ? 898  ASN A ND2 1 
ATOM   6040 N N   . ILE A 1 883  ? 32.441  10.438  41.237  1.00 73.86  ? 899  ILE A N   1 
ATOM   6041 C CA  . ILE A 1 883  ? 31.905  11.696  41.768  1.00 72.89  ? 899  ILE A CA  1 
ATOM   6042 C C   . ILE A 1 883  ? 33.027  12.752  41.662  1.00 79.32  ? 899  ILE A C   1 
ATOM   6043 O O   . ILE A 1 883  ? 34.188  12.437  41.951  1.00 79.42  ? 899  ILE A O   1 
ATOM   6044 C CB  . ILE A 1 883  ? 31.230  11.631  43.159  1.00 75.14  ? 899  ILE A CB  1 
ATOM   6045 C CG1 . ILE A 1 883  ? 29.978  10.721  43.112  1.00 75.38  ? 899  ILE A CG1 1 
ATOM   6046 C CG2 . ILE A 1 883  ? 30.853  13.044  43.642  1.00 74.18  ? 899  ILE A CG2 1 
ATOM   6047 C CD1 . ILE A 1 883  ? 29.279  10.433  44.488  1.00 79.82  ? 899  ILE A CD1 1 
ATOM   6048 N N   . MET A 1 884  ? 32.692  13.965  41.158  1.00 75.90  ? 900  MET A N   1 
ATOM   6049 C CA  . MET A 1 884  ? 33.649  15.051  40.959  1.00 75.17  ? 900  MET A CA  1 
ATOM   6050 C C   . MET A 1 884  ? 33.259  16.306  41.701  1.00 78.08  ? 900  MET A C   1 
ATOM   6051 O O   . MET A 1 884  ? 32.075  16.617  41.840  1.00 77.42  ? 900  MET A O   1 
ATOM   6052 C CB  . MET A 1 884  ? 33.850  15.371  39.473  1.00 77.53  ? 900  MET A CB  1 
ATOM   6053 C CG  . MET A 1 884  ? 34.636  14.341  38.719  1.00 81.31  ? 900  MET A CG  1 
ATOM   6054 S SD  . MET A 1 884  ? 35.156  14.988  37.116  1.00 86.26  ? 900  MET A SD  1 
ATOM   6055 C CE  . MET A 1 884  ? 36.857  15.239  37.390  1.00 82.84  ? 900  MET A CE  1 
ATOM   6056 N N   . ILE A 1 885  ? 34.270  17.030  42.175  1.00 74.46  ? 901  ILE A N   1 
ATOM   6057 C CA  . ILE A 1 885  ? 34.110  18.278  42.913  1.00 74.18  ? 901  ILE A CA  1 
ATOM   6058 C C   . ILE A 1 885  ? 34.786  19.376  42.114  1.00 78.46  ? 901  ILE A C   1 
ATOM   6059 O O   . ILE A 1 885  ? 35.825  19.129  41.493  1.00 77.84  ? 901  ILE A O   1 
ATOM   6060 C CB  . ILE A 1 885  ? 34.596  18.171  44.418  1.00 76.91  ? 901  ILE A CB  1 
ATOM   6061 C CG1 . ILE A 1 885  ? 34.327  19.436  45.239  1.00 76.82  ? 901  ILE A CG1 1 
ATOM   6062 C CG2 . ILE A 1 885  ? 36.066  17.764  44.558  1.00 78.49  ? 901  ILE A CG2 1 
ATOM   6063 C CD1 . ILE A 1 885  ? 32.912  19.762  45.446  1.00 85.44  ? 901  ILE A CD1 1 
ATOM   6064 N N   . ARG A 1 886  ? 34.147  20.552  42.073  1.00 75.85  ? 902  ARG A N   1 
ATOM   6065 C CA  . ARG A 1 886  ? 34.616  21.757  41.406  1.00 76.68  ? 902  ARG A CA  1 
ATOM   6066 C C   . ARG A 1 886  ? 35.186  22.702  42.457  1.00 85.96  ? 902  ARG A C   1 
ATOM   6067 O O   . ARG A 1 886  ? 34.666  22.764  43.577  1.00 86.70  ? 902  ARG A O   1 
ATOM   6068 C CB  . ARG A 1 886  ? 33.458  22.457  40.684  1.00 73.84  ? 902  ARG A CB  1 
ATOM   6069 C CG  . ARG A 1 886  ? 33.285  22.020  39.247  1.00 74.24  ? 902  ARG A CG  1 
ATOM   6070 C CD  . ARG A 1 886  ? 31.982  22.506  38.632  1.00 79.75  ? 902  ARG A CD  1 
ATOM   6071 N NE  . ARG A 1 886  ? 31.954  23.953  38.409  1.00 89.07  ? 902  ARG A NE  1 
ATOM   6072 C CZ  . ARG A 1 886  ? 31.001  24.605  37.744  1.00 104.78 ? 902  ARG A CZ  1 
ATOM   6073 N NH1 . ARG A 1 886  ? 29.977  23.945  37.219  1.00 85.34  ? 902  ARG A NH1 1 
ATOM   6074 N NH2 . ARG A 1 886  ? 31.056  25.926  37.617  1.00 97.19  ? 902  ARG A NH2 1 
ATOM   6075 N N   . GLU A 1 887  ? 36.225  23.478  42.073  1.00 84.49  ? 903  GLU A N   1 
ATOM   6076 C CA  . GLU A 1 887  ? 36.905  24.488  42.903  1.00 83.98  ? 903  GLU A CA  1 
ATOM   6077 C C   . GLU A 1 887  ? 35.960  25.503  43.538  1.00 87.02  ? 903  GLU A C   1 
ATOM   6078 O O   . GLU A 1 887  ? 36.381  26.190  44.462  1.00 87.56  ? 903  GLU A O   1 
ATOM   6079 C CB  . GLU A 1 887  ? 37.963  25.244  42.087  1.00 85.14  ? 903  GLU A CB  1 
ATOM   6080 C CG  . GLU A 1 887  ? 39.327  24.583  42.052  1.00 91.78  ? 903  GLU A CG  1 
ATOM   6081 C CD  . GLU A 1 887  ? 40.379  25.382  41.304  1.00 102.52 ? 903  GLU A CD  1 
ATOM   6082 O OE1 . GLU A 1 887  ? 40.309  26.636  41.317  1.00 78.02  ? 903  GLU A OE1 1 
ATOM   6083 O OE2 . GLU A 1 887  ? 41.262  24.745  40.682  1.00 91.44  ? 903  GLU A OE2 1 
ATOM   6084 N N   . SER A 1 888  ? 34.710  25.623  43.038  1.00 82.02  ? 904  SER A N   1 
ATOM   6085 C CA  . SER A 1 888  ? 33.725  26.561  43.578  1.00 81.48  ? 904  SER A CA  1 
ATOM   6086 C C   . SER A 1 888  ? 32.948  25.951  44.743  1.00 84.28  ? 904  SER A C   1 
ATOM   6087 O O   . SER A 1 888  ? 32.310  26.684  45.498  1.00 83.08  ? 904  SER A O   1 
ATOM   6088 C CB  . SER A 1 888  ? 32.763  27.024  42.486  1.00 84.61  ? 904  SER A CB  1 
ATOM   6089 O OG  . SER A 1 888  ? 31.777  26.041  42.212  1.00 93.78  ? 904  SER A OG  1 
ATOM   6090 N N   . GLY A 1 889  ? 32.996  24.625  44.848  1.00 81.30  ? 905  GLY A N   1 
ATOM   6091 C CA  . GLY A 1 889  ? 32.281  23.854  45.858  1.00 82.01  ? 905  GLY A CA  1 
ATOM   6092 C C   . GLY A 1 889  ? 31.220  22.907  45.304  1.00 87.85  ? 905  GLY A C   1 
ATOM   6093 O O   . GLY A 1 889  ? 30.751  22.027  46.032  1.00 89.25  ? 905  GLY A O   1 
ATOM   6094 N N   . GLN A 1 890  ? 30.852  23.051  44.006  1.00 81.94  ? 906  GLN A N   1 
ATOM   6095 C CA  . GLN A 1 890  ? 29.854  22.212  43.332  1.00 79.81  ? 906  GLN A CA  1 
ATOM   6096 C C   . GLN A 1 890  ? 30.318  20.771  43.086  1.00 81.76  ? 906  GLN A C   1 
ATOM   6097 O O   . GLN A 1 890  ? 31.374  20.528  42.508  1.00 81.00  ? 906  GLN A O   1 
ATOM   6098 C CB  . GLN A 1 890  ? 29.379  22.853  42.017  1.00 80.42  ? 906  GLN A CB  1 
ATOM   6099 C CG  . GLN A 1 890  ? 28.537  24.104  42.198  1.00 77.16  ? 906  GLN A CG  1 
ATOM   6100 C CD  . GLN A 1 890  ? 28.685  25.083  41.055  1.00 90.98  ? 906  GLN A CD  1 
ATOM   6101 O OE1 . GLN A 1 890  ? 29.740  25.219  40.440  1.00 78.79  ? 906  GLN A OE1 1 
ATOM   6102 N NE2 . GLN A 1 890  ? 27.660  25.879  40.816  1.00 93.73  ? 906  GLN A NE2 1 
ATOM   6103 N N   . LEU A 1 891  ? 29.489  19.822  43.518  1.00 77.81  ? 907  LEU A N   1 
ATOM   6104 C CA  . LEU A 1 891  ? 29.638  18.370  43.374  1.00 76.77  ? 907  LEU A CA  1 
ATOM   6105 C C   . LEU A 1 891  ? 28.908  17.997  42.066  1.00 77.54  ? 907  LEU A C   1 
ATOM   6106 O O   . LEU A 1 891  ? 27.933  18.658  41.725  1.00 78.33  ? 907  LEU A O   1 
ATOM   6107 C CB  . LEU A 1 891  ? 28.902  17.733  44.580  1.00 77.00  ? 907  LEU A CB  1 
ATOM   6108 C CG  . LEU A 1 891  ? 29.062  16.232  44.874  1.00 82.44  ? 907  LEU A CG  1 
ATOM   6109 C CD1 . LEU A 1 891  ? 28.966  15.967  46.377  1.00 82.10  ? 907  LEU A CD1 1 
ATOM   6110 C CD2 . LEU A 1 891  ? 27.971  15.394  44.167  1.00 85.70  ? 907  LEU A CD2 1 
ATOM   6111 N N   . PHE A 1 892  ? 29.357  16.963  41.341  1.00 69.84  ? 908  PHE A N   1 
ATOM   6112 C CA  . PHE A 1 892  ? 28.667  16.486  40.134  1.00 68.33  ? 908  PHE A CA  1 
ATOM   6113 C C   . PHE A 1 892  ? 29.089  15.067  39.783  1.00 72.57  ? 908  PHE A C   1 
ATOM   6114 O O   . PHE A 1 892  ? 30.182  14.619  40.152  1.00 70.38  ? 908  PHE A O   1 
ATOM   6115 C CB  . PHE A 1 892  ? 28.751  17.448  38.914  1.00 69.20  ? 908  PHE A CB  1 
ATOM   6116 C CG  . PHE A 1 892  ? 30.093  17.561  38.251  1.00 68.84  ? 908  PHE A CG  1 
ATOM   6117 C CD1 . PHE A 1 892  ? 31.034  18.476  38.706  1.00 70.14  ? 908  PHE A CD1 1 
ATOM   6118 C CD2 . PHE A 1 892  ? 30.426  16.739  37.182  1.00 70.05  ? 908  PHE A CD2 1 
ATOM   6119 C CE1 . PHE A 1 892  ? 32.295  18.544  38.130  1.00 70.96  ? 908  PHE A CE1 1 
ATOM   6120 C CE2 . PHE A 1 892  ? 31.688  16.820  36.586  1.00 72.78  ? 908  PHE A CE2 1 
ATOM   6121 C CZ  . PHE A 1 892  ? 32.611  17.724  37.061  1.00 70.99  ? 908  PHE A CZ  1 
ATOM   6122 N N   . HIS A 1 893  ? 28.208  14.354  39.070  1.00 71.07  ? 909  HIS A N   1 
ATOM   6123 C CA  . HIS A 1 893  ? 28.460  12.953  38.742  1.00 70.82  ? 909  HIS A CA  1 
ATOM   6124 C C   . HIS A 1 893  ? 28.892  12.735  37.307  1.00 73.85  ? 909  HIS A C   1 
ATOM   6125 O O   . HIS A 1 893  ? 28.485  13.467  36.400  1.00 73.85  ? 909  HIS A O   1 
ATOM   6126 C CB  . HIS A 1 893  ? 27.254  12.085  39.109  1.00 71.08  ? 909  HIS A CB  1 
ATOM   6127 C CG  . HIS A 1 893  ? 26.928  12.084  40.571  1.00 73.83  ? 909  HIS A CG  1 
ATOM   6128 N ND1 . HIS A 1 893  ? 26.763  10.907  41.265  1.00 75.21  ? 909  HIS A ND1 1 
ATOM   6129 C CD2 . HIS A 1 893  ? 26.766  13.120  41.423  1.00 74.89  ? 909  HIS A CD2 1 
ATOM   6130 C CE1 . HIS A 1 893  ? 26.474  11.264  42.500  1.00 74.39  ? 909  HIS A CE1 1 
ATOM   6131 N NE2 . HIS A 1 893  ? 26.492  12.584  42.645  1.00 74.69  ? 909  HIS A NE2 1 
ATOM   6132 N N   . ILE A 1 894  ? 29.774  11.746  37.135  1.00 68.60  ? 910  ILE A N   1 
ATOM   6133 C CA  . ILE A 1 894  ? 30.374  11.341  35.872  1.00 67.47  ? 910  ILE A CA  1 
ATOM   6134 C C   . ILE A 1 894  ? 30.208  9.822   35.643  1.00 74.86  ? 910  ILE A C   1 
ATOM   6135 O O   . ILE A 1 894  ? 29.918  9.062   36.582  1.00 73.36  ? 910  ILE A O   1 
ATOM   6136 C CB  . ILE A 1 894  ? 31.859  11.790  35.789  1.00 69.18  ? 910  ILE A CB  1 
ATOM   6137 C CG1 . ILE A 1 894  ? 32.795  10.983  36.723  1.00 68.73  ? 910  ILE A CG1 1 
ATOM   6138 C CG2 . ILE A 1 894  ? 31.997  13.282  36.032  1.00 69.14  ? 910  ILE A CG2 1 
ATOM   6139 C CD1 . ILE A 1 894  ? 33.781  10.065  36.010  1.00 66.05  ? 910  ILE A CD1 1 
ATOM   6140 N N   . ASP A 1 895  ? 30.407  9.401   34.379  1.00 74.47  ? 911  ASP A N   1 
ATOM   6141 C CA  . ASP A 1 895  ? 30.345  8.027   33.893  1.00 75.44  ? 911  ASP A CA  1 
ATOM   6142 C C   . ASP A 1 895  ? 29.186  7.225   34.504  1.00 81.42  ? 911  ASP A C   1 
ATOM   6143 O O   . ASP A 1 895  ? 29.381  6.371   35.374  1.00 82.65  ? 911  ASP A O   1 
ATOM   6144 C CB  . ASP A 1 895  ? 31.711  7.333   34.058  1.00 77.58  ? 911  ASP A CB  1 
ATOM   6145 C CG  . ASP A 1 895  ? 32.768  7.840   33.082  1.00 93.22  ? 911  ASP A CG  1 
ATOM   6146 O OD1 . ASP A 1 895  ? 32.397  8.193   31.923  1.00 95.48  ? 911  ASP A OD1 1 
ATOM   6147 O OD2 . ASP A 1 895  ? 33.974  7.862   33.462  1.00 96.42  ? 911  ASP A OD2 1 
ATOM   6148 N N   . PHE A 1 896  ? 27.966  7.564   34.074  1.00 77.75  ? 912  PHE A N   1 
ATOM   6149 C CA  . PHE A 1 896  ? 26.744  6.893   34.501  1.00 77.39  ? 912  PHE A CA  1 
ATOM   6150 C C   . PHE A 1 896  ? 26.686  5.709   33.566  1.00 86.17  ? 912  PHE A C   1 
ATOM   6151 O O   . PHE A 1 896  ? 26.320  5.860   32.384  1.00 86.69  ? 912  PHE A O   1 
ATOM   6152 C CB  . PHE A 1 896  ? 25.494  7.789   34.306  1.00 77.61  ? 912  PHE A CB  1 
ATOM   6153 C CG  . PHE A 1 896  ? 25.631  9.226   34.729  1.00 77.22  ? 912  PHE A CG  1 
ATOM   6154 C CD1 . PHE A 1 896  ? 25.433  9.598   36.049  1.00 79.35  ? 912  PHE A CD1 1 
ATOM   6155 C CD2 . PHE A 1 896  ? 25.938  10.213  33.800  1.00 77.62  ? 912  PHE A CD2 1 
ATOM   6156 C CE1 . PHE A 1 896  ? 25.540  10.935  36.431  1.00 79.90  ? 912  PHE A CE1 1 
ATOM   6157 C CE2 . PHE A 1 896  ? 26.086  11.541  34.192  1.00 79.48  ? 912  PHE A CE2 1 
ATOM   6158 C CZ  . PHE A 1 896  ? 25.879  11.895  35.501  1.00 77.87  ? 912  PHE A CZ  1 
ATOM   6159 N N   . GLY A 1 897  ? 27.150  4.567   34.056  1.00 84.40  ? 913  GLY A N   1 
ATOM   6160 C CA  . GLY A 1 897  ? 27.202  3.353   33.235  1.00 85.01  ? 913  GLY A CA  1 
ATOM   6161 C C   . GLY A 1 897  ? 25.875  2.638   33.072  1.00 87.63  ? 913  GLY A C   1 
ATOM   6162 O O   . GLY A 1 897  ? 25.585  2.065   32.014  1.00 86.96  ? 913  GLY A O   1 
ATOM   6163 N N   . HIS A 1 898  ? 25.079  2.672   34.146  1.00 83.31  ? 914  HIS A N   1 
ATOM   6164 C CA  . HIS A 1 898  ? 23.791  2.023   34.286  1.00 82.32  ? 914  HIS A CA  1 
ATOM   6165 C C   . HIS A 1 898  ? 22.833  2.910   35.107  1.00 82.65  ? 914  HIS A C   1 
ATOM   6166 O O   . HIS A 1 898  ? 23.288  3.738   35.894  1.00 81.54  ? 914  HIS A O   1 
ATOM   6167 C CB  . HIS A 1 898  ? 24.004  0.664   34.988  1.00 83.28  ? 914  HIS A CB  1 
ATOM   6168 N N   . PHE A 1 899  ? 21.512  2.741   34.904  1.00 77.22  ? 915  PHE A N   1 
ATOM   6169 C CA  . PHE A 1 899  ? 20.454  3.445   35.631  1.00 75.82  ? 915  PHE A CA  1 
ATOM   6170 C C   . PHE A 1 899  ? 19.217  2.555   35.803  1.00 78.20  ? 915  PHE A C   1 
ATOM   6171 O O   . PHE A 1 899  ? 19.254  1.380   35.442  1.00 77.13  ? 915  PHE A O   1 
ATOM   6172 C CB  . PHE A 1 899  ? 20.140  4.832   35.018  1.00 77.60  ? 915  PHE A CB  1 
ATOM   6173 C CG  . PHE A 1 899  ? 19.408  4.994   33.697  1.00 79.42  ? 915  PHE A CG  1 
ATOM   6174 C CD1 . PHE A 1 899  ? 19.042  3.888   32.935  1.00 82.64  ? 915  PHE A CD1 1 
ATOM   6175 C CD2 . PHE A 1 899  ? 19.076  6.258   33.219  1.00 81.92  ? 915  PHE A CD2 1 
ATOM   6176 C CE1 . PHE A 1 899  ? 18.364  4.046   31.716  1.00 83.49  ? 915  PHE A CE1 1 
ATOM   6177 C CE2 . PHE A 1 899  ? 18.389  6.413   32.006  1.00 84.37  ? 915  PHE A CE2 1 
ATOM   6178 C CZ  . PHE A 1 899  ? 18.035  5.306   31.266  1.00 82.27  ? 915  PHE A CZ  1 
ATOM   6179 N N   . LEU A 1 900  ? 18.140  3.110   36.371  1.00 75.27  ? 916  LEU A N   1 
ATOM   6180 C CA  . LEU A 1 900  ? 16.856  2.455   36.646  1.00 75.87  ? 916  LEU A CA  1 
ATOM   6181 C C   . LEU A 1 900  ? 17.009  1.163   37.477  1.00 85.22  ? 916  LEU A C   1 
ATOM   6182 O O   . LEU A 1 900  ? 16.333  0.164   37.221  1.00 85.00  ? 916  LEU A O   1 
ATOM   6183 C CB  . LEU A 1 900  ? 16.021  2.240   35.368  1.00 75.00  ? 916  LEU A CB  1 
ATOM   6184 C CG  . LEU A 1 900  ? 15.522  3.522   34.693  1.00 77.66  ? 916  LEU A CG  1 
ATOM   6185 C CD1 . LEU A 1 900  ? 15.097  3.250   33.278  1.00 76.93  ? 916  LEU A CD1 1 
ATOM   6186 C CD2 . LEU A 1 900  ? 14.429  4.238   35.521  1.00 75.76  ? 916  LEU A CD2 1 
ATOM   6187 N N   . GLY A 1 901  ? 17.888  1.233   38.481  1.00 85.70  ? 917  GLY A N   1 
ATOM   6188 C CA  . GLY A 1 901  ? 18.155  0.150   39.415  1.00 87.53  ? 917  GLY A CA  1 
ATOM   6189 C C   . GLY A 1 901  ? 19.198  -0.855  38.987  1.00 96.32  ? 917  GLY A C   1 
ATOM   6190 O O   . GLY A 1 901  ? 19.693  -1.618  39.826  1.00 96.57  ? 917  GLY A O   1 
ATOM   6191 N N   . ASN A 1 902  ? 19.522  -0.889  37.680  1.00 95.20  ? 918  ASN A N   1 
ATOM   6192 C CA  . ASN A 1 902  ? 20.516  -1.807  37.130  1.00 95.67  ? 918  ASN A CA  1 
ATOM   6193 C C   . ASN A 1 902  ? 21.911  -1.551  37.709  1.00 102.48 ? 918  ASN A C   1 
ATOM   6194 O O   . ASN A 1 902  ? 22.348  -0.396  37.794  1.00 103.02 ? 918  ASN A O   1 
ATOM   6195 C CB  . ASN A 1 902  ? 20.512  -1.783  35.607  1.00 94.62  ? 918  ASN A CB  1 
ATOM   6196 C CG  . ASN A 1 902  ? 19.253  -2.367  34.990  1.00 116.99 ? 918  ASN A CG  1 
ATOM   6197 O OD1 . ASN A 1 902  ? 18.195  -1.715  34.889  1.00 100.96 ? 918  ASN A OD1 1 
ATOM   6198 N ND2 . ASN A 1 902  ? 19.355  -3.610  34.530  1.00 111.89 ? 918  ASN A ND2 1 
ATOM   6199 N N   . PHE A 1 903  ? 22.560  -2.639  38.182  1.00 99.98  ? 919  PHE A N   1 
ATOM   6200 C CA  . PHE A 1 903  ? 23.900  -2.658  38.779  1.00 129.99 ? 919  PHE A CA  1 
ATOM   6201 C C   . PHE A 1 903  ? 24.885  -3.451  37.905  1.00 139.82 ? 919  PHE A C   1 
ATOM   6202 O O   . PHE A 1 903  ? 24.497  -4.031  36.887  1.00 81.05  ? 919  PHE A O   1 
ATOM   6203 C CB  . PHE A 1 903  ? 23.847  -3.257  40.192  1.00 131.76 ? 919  PHE A CB  1 
ATOM   6204 N N   . ILE A 1 909  ? 22.851  -4.727  34.597  1.00 125.59 ? 925  ILE A N   1 
ATOM   6205 C CA  . ILE A 1 909  ? 22.856  -6.191  34.519  1.00 125.31 ? 925  ILE A CA  1 
ATOM   6206 C C   . ILE A 1 909  ? 21.680  -6.793  35.319  1.00 127.71 ? 925  ILE A C   1 
ATOM   6207 O O   . ILE A 1 909  ? 20.898  -7.562  34.747  1.00 127.48 ? 925  ILE A O   1 
ATOM   6208 C CB  . ILE A 1 909  ? 24.255  -6.796  34.901  1.00 128.62 ? 925  ILE A CB  1 
ATOM   6209 C CG1 . ILE A 1 909  ? 25.319  -6.493  33.821  1.00 128.99 ? 925  ILE A CG1 1 
ATOM   6210 C CG2 . ILE A 1 909  ? 24.197  -8.308  35.187  1.00 129.38 ? 925  ILE A CG2 1 
ATOM   6211 N N   . ASN A 1 910  ? 21.570  -6.444  36.634  1.00 122.51 ? 926  ASN A N   1 
ATOM   6212 C CA  . ASN A 1 910  ? 20.533  -6.934  37.562  1.00 121.19 ? 926  ASN A CA  1 
ATOM   6213 C C   . ASN A 1 910  ? 19.850  -5.802  38.365  1.00 120.94 ? 926  ASN A C   1 
ATOM   6214 O O   . ASN A 1 910  ? 20.353  -5.358  39.408  1.00 120.23 ? 926  ASN A O   1 
ATOM   6215 C CB  . ASN A 1 910  ? 21.081  -8.041  38.488  1.00 122.76 ? 926  ASN A CB  1 
ATOM   6216 N N   . ARG A 1 911  ? 18.683  -5.363  37.855  1.00 114.34 ? 927  ARG A N   1 
ATOM   6217 C CA  . ARG A 1 911  ? 17.831  -4.297  38.395  1.00 112.45 ? 927  ARG A CA  1 
ATOM   6218 C C   . ARG A 1 911  ? 17.221  -4.627  39.782  1.00 111.33 ? 927  ARG A C   1 
ATOM   6219 O O   . ARG A 1 911  ? 16.510  -5.630  39.942  1.00 110.88 ? 927  ARG A O   1 
ATOM   6220 C CB  . ARG A 1 911  ? 16.743  -3.885  37.373  1.00 113.02 ? 927  ARG A CB  1 
ATOM   6221 C CG  . ARG A 1 911  ? 16.081  -5.045  36.618  1.00 121.72 ? 927  ARG A CG  1 
ATOM   6222 N N   . GLU A 1 912  ? 17.544  -3.765  40.782  1.00 103.03 ? 928  GLU A N   1 
ATOM   6223 C CA  . GLU A 1 912  ? 17.130  -3.808  42.196  1.00 99.55  ? 928  GLU A CA  1 
ATOM   6224 C C   . GLU A 1 912  ? 17.031  -2.369  42.703  1.00 96.79  ? 928  GLU A C   1 
ATOM   6225 O O   . GLU A 1 912  ? 17.827  -1.525  42.279  1.00 95.80  ? 928  GLU A O   1 
ATOM   6226 C CB  . GLU A 1 912  ? 18.153  -4.584  43.047  1.00 100.53 ? 928  GLU A CB  1 
ATOM   6227 C CG  . GLU A 1 912  ? 17.971  -6.090  43.016  1.00 108.99 ? 928  GLU A CG  1 
ATOM   6228 N N   . ARG A 1 913  ? 16.070  -2.087  43.610  1.00 88.78  ? 929  ARG A N   1 
ATOM   6229 C CA  . ARG A 1 913  ? 15.837  -0.738  44.155  1.00 86.22  ? 929  ARG A CA  1 
ATOM   6230 C C   . ARG A 1 913  ? 17.075  -0.109  44.870  1.00 86.41  ? 929  ARG A C   1 
ATOM   6231 O O   . ARG A 1 913  ? 17.448  -0.508  45.980  1.00 87.57  ? 929  ARG A O   1 
ATOM   6232 C CB  . ARG A 1 913  ? 14.592  -0.697  45.058  1.00 84.05  ? 929  ARG A CB  1 
ATOM   6233 C CG  . ARG A 1 913  ? 13.271  -0.869  44.321  1.00 92.97  ? 929  ARG A CG  1 
ATOM   6234 C CD  . ARG A 1 913  ? 12.090  -0.842  45.276  1.00 100.54 ? 929  ARG A CD  1 
ATOM   6235 N N   . VAL A 1 914  ? 17.709  0.868   44.194  1.00 78.20  ? 930  VAL A N   1 
ATOM   6236 C CA  . VAL A 1 914  ? 18.853  1.656   44.678  1.00 75.58  ? 930  VAL A CA  1 
ATOM   6237 C C   . VAL A 1 914  ? 18.329  2.593   45.799  1.00 76.48  ? 930  VAL A C   1 
ATOM   6238 O O   . VAL A 1 914  ? 17.380  3.362   45.572  1.00 75.94  ? 930  VAL A O   1 
ATOM   6239 C CB  . VAL A 1 914  ? 19.529  2.469   43.516  1.00 78.12  ? 930  VAL A CB  1 
ATOM   6240 C CG1 . VAL A 1 914  ? 20.739  3.267   44.003  1.00 77.26  ? 930  VAL A CG1 1 
ATOM   6241 C CG2 . VAL A 1 914  ? 19.924  1.563   42.350  1.00 77.76  ? 930  VAL A CG2 1 
ATOM   6242 N N   . PRO A 1 915  ? 18.892  2.544   47.018  1.00 71.72  ? 931  PRO A N   1 
ATOM   6243 C CA  . PRO A 1 915  ? 18.381  3.441   48.068  1.00 71.75  ? 931  PRO A CA  1 
ATOM   6244 C C   . PRO A 1 915  ? 18.993  4.822   47.960  1.00 76.92  ? 931  PRO A C   1 
ATOM   6245 O O   . PRO A 1 915  ? 19.981  5.002   47.244  1.00 77.68  ? 931  PRO A O   1 
ATOM   6246 C CB  . PRO A 1 915  ? 18.801  2.747   49.369  1.00 72.70  ? 931  PRO A CB  1 
ATOM   6247 C CG  . PRO A 1 915  ? 19.984  1.925   49.004  1.00 76.44  ? 931  PRO A CG  1 
ATOM   6248 C CD  . PRO A 1 915  ? 19.998  1.700   47.516  1.00 72.55  ? 931  PRO A CD  1 
ATOM   6249 N N   . PHE A 1 916  ? 18.432  5.789   48.700  1.00 73.27  ? 932  PHE A N   1 
ATOM   6250 C CA  . PHE A 1 916  ? 18.997  7.135   48.797  1.00 72.86  ? 932  PHE A CA  1 
ATOM   6251 C C   . PHE A 1 916  ? 20.355  6.957   49.490  1.00 77.09  ? 932  PHE A C   1 
ATOM   6252 O O   . PHE A 1 916  ? 20.474  6.130   50.419  1.00 77.99  ? 932  PHE A O   1 
ATOM   6253 C CB  . PHE A 1 916  ? 18.101  8.016   49.661  1.00 74.21  ? 932  PHE A CB  1 
ATOM   6254 C CG  . PHE A 1 916  ? 18.343  9.497   49.535  1.00 75.35  ? 932  PHE A CG  1 
ATOM   6255 C CD1 . PHE A 1 916  ? 17.653  10.252  48.595  1.00 78.19  ? 932  PHE A CD1 1 
ATOM   6256 C CD2 . PHE A 1 916  ? 19.177  10.158  50.427  1.00 77.38  ? 932  PHE A CD2 1 
ATOM   6257 C CE1 . PHE A 1 916  ? 17.826  11.635  48.523  1.00 79.30  ? 932  PHE A CE1 1 
ATOM   6258 C CE2 . PHE A 1 916  ? 19.357  11.543  50.349  1.00 80.24  ? 932  PHE A CE2 1 
ATOM   6259 C CZ  . PHE A 1 916  ? 18.681  12.272  49.396  1.00 78.40  ? 932  PHE A CZ  1 
ATOM   6260 N N   . ILE A 1 917  ? 21.386  7.650   48.997  1.00 71.20  ? 933  ILE A N   1 
ATOM   6261 C CA  . ILE A 1 917  ? 22.699  7.462   49.572  1.00 70.77  ? 933  ILE A CA  1 
ATOM   6262 C C   . ILE A 1 917  ? 23.284  8.777   50.100  1.00 80.06  ? 933  ILE A C   1 
ATOM   6263 O O   . ILE A 1 917  ? 23.542  9.719   49.342  1.00 80.59  ? 933  ILE A O   1 
ATOM   6264 C CB  . ILE A 1 917  ? 23.646  6.689   48.588  1.00 72.40  ? 933  ILE A CB  1 
ATOM   6265 C CG1 . ILE A 1 917  ? 23.198  5.228   48.451  1.00 72.14  ? 933  ILE A CG1 1 
ATOM   6266 C CG2 . ILE A 1 917  ? 25.113  6.729   49.037  1.00 72.07  ? 933  ILE A CG2 1 
ATOM   6267 C CD1 . ILE A 1 917  ? 23.366  4.627   47.116  1.00 80.24  ? 933  ILE A CD1 1 
ATOM   6268 N N   . LEU A 1 918  ? 23.507  8.814   51.426  1.00 80.05  ? 934  LEU A N   1 
ATOM   6269 C CA  . LEU A 1 918  ? 24.171  9.926   52.114  1.00 80.79  ? 934  LEU A CA  1 
ATOM   6270 C C   . LEU A 1 918  ? 25.564  9.433   52.424  1.00 89.92  ? 934  LEU A C   1 
ATOM   6271 O O   . LEU A 1 918  ? 25.711  8.341   52.980  1.00 91.58  ? 934  LEU A O   1 
ATOM   6272 C CB  . LEU A 1 918  ? 23.443  10.361  53.397  1.00 79.68  ? 934  LEU A CB  1 
ATOM   6273 C CG  . LEU A 1 918  ? 22.224  11.213  53.174  1.00 82.63  ? 934  LEU A CG  1 
ATOM   6274 C CD1 . LEU A 1 918  ? 21.457  11.383  54.433  1.00 82.52  ? 934  LEU A CD1 1 
ATOM   6275 C CD2 . LEU A 1 918  ? 22.592  12.543  52.592  1.00 83.80  ? 934  LEU A CD2 1 
ATOM   6276 N N   . THR A 1 919  ? 26.581  10.172  51.977  1.00 87.92  ? 935  THR A N   1 
ATOM   6277 C CA  . THR A 1 919  ? 27.977  9.783   52.171  1.00 88.28  ? 935  THR A CA  1 
ATOM   6278 C C   . THR A 1 919  ? 28.522  10.614  53.316  1.00 93.85  ? 935  THR A C   1 
ATOM   6279 O O   . THR A 1 919  ? 28.459  11.847  53.250  1.00 93.72  ? 935  THR A O   1 
ATOM   6280 C CB  . THR A 1 919  ? 28.784  9.962   50.871  1.00 93.43  ? 935  THR A CB  1 
ATOM   6281 O OG1 . THR A 1 919  ? 28.028  9.490   49.749  1.00 93.66  ? 935  THR A OG1 1 
ATOM   6282 C CG2 . THR A 1 919  ? 30.133  9.279   50.926  1.00 89.72  ? 935  THR A CG2 1 
ATOM   6283 N N   . TYR A 1 920  ? 29.047  9.927   54.368  1.00 90.17  ? 936  TYR A N   1 
ATOM   6284 C CA  . TYR A 1 920  ? 29.602  10.525  55.585  1.00 89.73  ? 936  TYR A CA  1 
ATOM   6285 C C   . TYR A 1 920  ? 30.513  11.705  55.261  1.00 93.10  ? 936  TYR A C   1 
ATOM   6286 O O   . TYR A 1 920  ? 30.284  12.820  55.755  1.00 92.36  ? 936  TYR A O   1 
ATOM   6287 C CB  . TYR A 1 920  ? 30.336  9.458   56.414  1.00 90.96  ? 936  TYR A CB  1 
ATOM   6288 N N   . ASP A 1 921  ? 31.478  11.470  54.341  1.00 89.00  ? 937  ASP A N   1 
ATOM   6289 C CA  . ASP A 1 921  ? 32.429  12.455  53.830  1.00 88.95  ? 937  ASP A CA  1 
ATOM   6290 C C   . ASP A 1 921  ? 31.725  13.758  53.417  1.00 90.25  ? 937  ASP A C   1 
ATOM   6291 O O   . ASP A 1 921  ? 32.207  14.844  53.750  1.00 89.71  ? 937  ASP A O   1 
ATOM   6292 C CB  . ASP A 1 921  ? 33.195  11.870  52.636  1.00 91.73  ? 937  ASP A CB  1 
ATOM   6293 C CG  . ASP A 1 921  ? 33.715  10.460  52.860  1.00 111.77 ? 937  ASP A CG  1 
ATOM   6294 O OD1 . ASP A 1 921  ? 34.563  10.272  53.772  1.00 113.60 ? 937  ASP A OD1 1 
ATOM   6295 O OD2 . ASP A 1 921  ? 33.299  9.548   52.107  1.00 120.33 ? 937  ASP A OD2 1 
ATOM   6296 N N   . PHE A 1 922  ? 30.559  13.637  52.748  1.00 84.56  ? 938  PHE A N   1 
ATOM   6297 C CA  . PHE A 1 922  ? 29.772  14.774  52.292  1.00 83.94  ? 938  PHE A CA  1 
ATOM   6298 C C   . PHE A 1 922  ? 29.024  15.422  53.446  1.00 87.03  ? 938  PHE A C   1 
ATOM   6299 O O   . PHE A 1 922  ? 29.084  16.643  53.593  1.00 84.21  ? 938  PHE A O   1 
ATOM   6300 C CB  . PHE A 1 922  ? 28.810  14.382  51.147  1.00 85.84  ? 938  PHE A CB  1 
ATOM   6301 C CG  . PHE A 1 922  ? 29.365  13.651  49.935  1.00 87.48  ? 938  PHE A CG  1 
ATOM   6302 C CD1 . PHE A 1 922  ? 30.741  13.566  49.712  1.00 90.15  ? 938  PHE A CD1 1 
ATOM   6303 C CD2 . PHE A 1 922  ? 28.511  13.067  49.005  1.00 89.73  ? 938  PHE A CD2 1 
ATOM   6304 C CE1 . PHE A 1 922  ? 31.249  12.869  48.609  1.00 90.85  ? 938  PHE A CE1 1 
ATOM   6305 C CE2 . PHE A 1 922  ? 29.021  12.377  47.894  1.00 92.39  ? 938  PHE A CE2 1 
ATOM   6306 C CZ  . PHE A 1 922  ? 30.385  12.284  47.703  1.00 90.29  ? 938  PHE A CZ  1 
ATOM   6307 N N   . VAL A 1 923  ? 28.354  14.591  54.288  1.00 86.76  ? 939  VAL A N   1 
ATOM   6308 C CA  . VAL A 1 923  ? 27.563  14.971  55.487  1.00 87.71  ? 939  VAL A CA  1 
ATOM   6309 C C   . VAL A 1 923  ? 28.409  15.842  56.446  1.00 92.59  ? 939  VAL A C   1 
ATOM   6310 O O   . VAL A 1 923  ? 27.888  16.768  57.083  1.00 91.88  ? 939  VAL A O   1 
ATOM   6311 C CB  . VAL A 1 923  ? 26.961  13.726  56.211  1.00 92.02  ? 939  VAL A CB  1 
ATOM   6312 C CG1 . VAL A 1 923  ? 26.077  14.135  57.392  1.00 92.04  ? 939  VAL A CG1 1 
ATOM   6313 C CG2 . VAL A 1 923  ? 26.170  12.843  55.248  1.00 91.86  ? 939  VAL A CG2 1 
ATOM   6314 N N   . HIS A 1 924  ? 29.722  15.540  56.493  1.00 89.44  ? 940  HIS A N   1 
ATOM   6315 C CA  . HIS A 1 924  ? 30.763  16.218  57.250  1.00 89.41  ? 940  HIS A CA  1 
ATOM   6316 C C   . HIS A 1 924  ? 30.922  17.683  56.773  1.00 90.41  ? 940  HIS A C   1 
ATOM   6317 O O   . HIS A 1 924  ? 30.731  18.597  57.571  1.00 89.94  ? 940  HIS A O   1 
ATOM   6318 C CB  . HIS A 1 924  ? 32.067  15.409  57.087  1.00 91.25  ? 940  HIS A CB  1 
ATOM   6319 C CG  . HIS A 1 924  ? 33.264  15.990  57.776  1.00 95.63  ? 940  HIS A CG  1 
ATOM   6320 N ND1 . HIS A 1 924  ? 33.254  16.282  59.131  1.00 97.91  ? 940  HIS A ND1 1 
ATOM   6321 C CD2 . HIS A 1 924  ? 34.495  16.255  57.280  1.00 97.84  ? 940  HIS A CD2 1 
ATOM   6322 C CE1 . HIS A 1 924  ? 34.461  16.749  59.401  1.00 97.56  ? 940  HIS A CE1 1 
ATOM   6323 N NE2 . HIS A 1 924  ? 35.242  16.752  58.318  1.00 97.78  ? 940  HIS A NE2 1 
ATOM   6324 N N   . VAL A 1 925  ? 31.225  17.887  55.457  1.00 84.83  ? 941  VAL A N   1 
ATOM   6325 C CA  . VAL A 1 925  ? 31.416  19.170  54.752  1.00 82.77  ? 941  VAL A CA  1 
ATOM   6326 C C   . VAL A 1 925  ? 30.161  20.002  54.922  1.00 85.56  ? 941  VAL A C   1 
ATOM   6327 O O   . VAL A 1 925  ? 30.247  21.218  55.082  1.00 85.14  ? 941  VAL A O   1 
ATOM   6328 C CB  . VAL A 1 925  ? 31.718  18.971  53.230  1.00 85.60  ? 941  VAL A CB  1 
ATOM   6329 C CG1 . VAL A 1 925  ? 32.088  20.290  52.551  1.00 85.17  ? 941  VAL A CG1 1 
ATOM   6330 C CG2 . VAL A 1 925  ? 32.789  17.911  52.979  1.00 84.97  ? 941  VAL A CG2 1 
ATOM   6331 N N   . ILE A 1 926  ? 28.995  19.342  54.857  1.00 81.90  ? 942  ILE A N   1 
ATOM   6332 C CA  . ILE A 1 926  ? 27.698  20.002  55.017  1.00 82.17  ? 942  ILE A CA  1 
ATOM   6333 C C   . ILE A 1 926  ? 27.610  20.574  56.426  1.00 86.66  ? 942  ILE A C   1 
ATOM   6334 O O   . ILE A 1 926  ? 27.182  21.718  56.580  1.00 86.85  ? 942  ILE A O   1 
ATOM   6335 C CB  . ILE A 1 926  ? 26.480  19.083  54.635  1.00 84.94  ? 942  ILE A CB  1 
ATOM   6336 C CG1 . ILE A 1 926  ? 26.583  18.623  53.160  1.00 84.63  ? 942  ILE A CG1 1 
ATOM   6337 C CG2 . ILE A 1 926  ? 25.122  19.795  54.891  1.00 85.24  ? 942  ILE A CG2 1 
ATOM   6338 C CD1 . ILE A 1 926  ? 25.980  17.319  52.867  1.00 88.03  ? 942  ILE A CD1 1 
ATOM   6339 N N   . GLN A 1 927  ? 28.082  19.808  57.437  1.00 83.15  ? 943  GLN A N   1 
ATOM   6340 C CA  . GLN A 1 927  ? 28.075  20.233  58.844  1.00 83.10  ? 943  GLN A CA  1 
ATOM   6341 C C   . GLN A 1 927  ? 29.265  21.184  59.190  1.00 88.94  ? 943  GLN A C   1 
ATOM   6342 O O   . GLN A 1 927  ? 29.414  21.596  60.346  1.00 87.98  ? 943  GLN A O   1 
ATOM   6343 C CB  . GLN A 1 927  ? 27.973  19.024  59.792  1.00 83.55  ? 943  GLN A CB  1 
ATOM   6344 C CG  . GLN A 1 927  ? 26.555  18.443  59.792  1.00 83.18  ? 943  GLN A CG  1 
ATOM   6345 C CD  . GLN A 1 927  ? 26.322  17.231  60.664  1.00 83.11  ? 943  GLN A CD  1 
ATOM   6346 O OE1 . GLN A 1 927  ? 27.179  16.352  60.825  1.00 70.68  ? 943  GLN A OE1 1 
ATOM   6347 N NE2 . GLN A 1 927  ? 25.123  17.145  61.213  1.00 75.51  ? 943  GLN A NE2 1 
ATOM   6348 N N   . GLN A 1 928  ? 30.051  21.589  58.152  1.00 86.46  ? 944  GLN A N   1 
ATOM   6349 C CA  . GLN A 1 928  ? 31.177  22.530  58.212  1.00 86.73  ? 944  GLN A CA  1 
ATOM   6350 C C   . GLN A 1 928  ? 32.370  22.022  59.035  1.00 91.35  ? 944  GLN A C   1 
ATOM   6351 O O   . GLN A 1 928  ? 33.269  22.811  59.355  1.00 90.30  ? 944  GLN A O   1 
ATOM   6352 C CB  . GLN A 1 928  ? 30.719  23.928  58.698  1.00 88.11  ? 944  GLN A CB  1 
ATOM   6353 C CG  . GLN A 1 928  ? 30.121  24.810  57.607  1.00 100.13 ? 944  GLN A CG  1 
ATOM   6354 C CD  . GLN A 1 928  ? 29.414  26.013  58.186  1.00 116.02 ? 944  GLN A CD  1 
ATOM   6355 O OE1 . GLN A 1 928  ? 28.433  25.894  58.933  1.00 107.70 ? 944  GLN A OE1 1 
ATOM   6356 N NE2 . GLN A 1 928  ? 29.880  27.203  57.831  1.00 110.19 ? 944  GLN A NE2 1 
ATOM   6357 N N   . GLY A 1 929  ? 32.385  20.719  59.325  1.00 88.79  ? 945  GLY A N   1 
ATOM   6358 C CA  . GLY A 1 929  ? 33.448  20.080  60.086  1.00 89.53  ? 945  GLY A CA  1 
ATOM   6359 C C   . GLY A 1 929  ? 32.997  19.498  61.408  1.00 96.58  ? 945  GLY A C   1 
ATOM   6360 O O   . GLY A 1 929  ? 33.620  18.553  61.895  1.00 97.16  ? 945  GLY A O   1 
ATOM   6361 N N   . LYS A 1 930  ? 31.924  20.063  62.005  1.00 94.84  ? 946  LYS A N   1 
ATOM   6362 C CA  . LYS A 1 930  ? 31.324  19.631  63.281  1.00 95.96  ? 946  LYS A CA  1 
ATOM   6363 C C   . LYS A 1 930  ? 30.795  18.172  63.266  1.00 104.64 ? 946  LYS A C   1 
ATOM   6364 O O   . LYS A 1 930  ? 30.534  17.597  62.191  1.00 104.07 ? 946  LYS A O   1 
ATOM   6365 C CB  . LYS A 1 930  ? 30.174  20.587  63.704  1.00 97.59  ? 946  LYS A CB  1 
ATOM   6366 C CG  . LYS A 1 930  ? 30.630  21.968  64.164  1.00 102.82 ? 946  LYS A CG  1 
ATOM   6367 C CD  . LYS A 1 930  ? 29.858  23.097  63.490  1.00 106.59 ? 946  LYS A CD  1 
ATOM   6368 C CE  . LYS A 1 930  ? 30.607  24.414  63.551  1.00 110.49 ? 946  LYS A CE  1 
ATOM   6369 N NZ  . LYS A 1 930  ? 29.827  25.549  62.981  1.00 113.47 ? 946  LYS A NZ  1 
ATOM   6370 N N   . THR A 1 931  ? 30.643  17.584  64.483  1.00 104.45 ? 947  THR A N   1 
ATOM   6371 C CA  . THR A 1 931  ? 30.079  16.242  64.706  1.00 105.05 ? 947  THR A CA  1 
ATOM   6372 C C   . THR A 1 931  ? 28.549  16.399  64.630  1.00 108.25 ? 947  THR A C   1 
ATOM   6373 O O   . THR A 1 931  ? 27.877  15.591  63.979  1.00 108.78 ? 947  THR A O   1 
ATOM   6374 C CB  . THR A 1 931  ? 30.553  15.658  66.065  1.00 117.55 ? 947  THR A CB  1 
ATOM   6375 O OG1 . THR A 1 931  ? 31.982  15.615  66.086  1.00 121.60 ? 947  THR A OG1 1 
ATOM   6376 C CG2 . THR A 1 931  ? 30.001  14.254  66.341  1.00 115.39 ? 947  THR A CG2 1 
ATOM   6377 N N   . ASN A 1 932  ? 28.022  17.465  65.266  1.00 102.31 ? 948  ASN A N   1 
ATOM   6378 C CA  . ASN A 1 932  ? 26.601  17.782  65.286  1.00 101.03 ? 948  ASN A CA  1 
ATOM   6379 C C   . ASN A 1 932  ? 26.393  19.258  64.960  1.00 102.24 ? 948  ASN A C   1 
ATOM   6380 O O   . ASN A 1 932  ? 27.024  20.129  65.554  1.00 100.78 ? 948  ASN A O   1 
ATOM   6381 C CB  . ASN A 1 932  ? 25.964  17.380  66.620  1.00 101.08 ? 948  ASN A CB  1 
ATOM   6382 N N   . ASN A 1 933  ? 25.553  19.515  63.955  1.00 98.20  ? 949  ASN A N   1 
ATOM   6383 C CA  . ASN A 1 933  ? 25.216  20.830  63.416  1.00 97.48  ? 949  ASN A CA  1 
ATOM   6384 C C   . ASN A 1 933  ? 23.903  20.652  62.674  1.00 103.57 ? 949  ASN A C   1 
ATOM   6385 O O   . ASN A 1 933  ? 23.892  20.583  61.443  1.00 104.28 ? 949  ASN A O   1 
ATOM   6386 C CB  . ASN A 1 933  ? 26.320  21.316  62.443  1.00 90.54  ? 949  ASN A CB  1 
ATOM   6387 C CG  . ASN A 1 933  ? 26.165  22.739  61.964  1.00 87.11  ? 949  ASN A CG  1 
ATOM   6388 O OD1 . ASN A 1 933  ? 25.227  23.455  62.318  1.00 79.26  ? 949  ASN A OD1 1 
ATOM   6389 N ND2 . ASN A 1 933  ? 27.101  23.193  61.160  1.00 74.80  ? 949  ASN A ND2 1 
ATOM   6390 N N   . SER A 1 934  ? 22.798  20.514  63.420  1.00 100.19 ? 950  SER A N   1 
ATOM   6391 C CA  . SER A 1 934  ? 21.480  20.307  62.813  1.00 99.38  ? 950  SER A CA  1 
ATOM   6392 C C   . SER A 1 934  ? 20.973  21.578  62.132  1.00 103.11 ? 950  SER A C   1 
ATOM   6393 O O   . SER A 1 934  ? 20.103  21.501  61.265  1.00 103.72 ? 950  SER A O   1 
ATOM   6394 C CB  . SER A 1 934  ? 20.477  19.813  63.847  1.00 101.25 ? 950  SER A CB  1 
ATOM   6395 O OG  . SER A 1 934  ? 20.271  20.790  64.850  1.00 106.57 ? 950  SER A OG  1 
ATOM   6396 N N   . GLU A 1 935  ? 21.537  22.739  62.509  1.00 97.65  ? 951  GLU A N   1 
ATOM   6397 C CA  . GLU A 1 935  ? 21.182  24.050  61.963  1.00 96.35  ? 951  GLU A CA  1 
ATOM   6398 C C   . GLU A 1 935  ? 21.347  24.003  60.441  1.00 95.55  ? 951  GLU A C   1 
ATOM   6399 O O   . GLU A 1 935  ? 20.430  24.376  59.697  1.00 94.83  ? 951  GLU A O   1 
ATOM   6400 C CB  . GLU A 1 935  ? 22.091  25.145  62.572  1.00 98.16  ? 951  GLU A CB  1 
ATOM   6401 C CG  . GLU A 1 935  ? 22.637  24.846  63.967  1.00 108.34 ? 951  GLU A CG  1 
ATOM   6402 N N   . LYS A 1 936  ? 22.500  23.462  60.002  1.00 88.76  ? 952  LYS A N   1 
ATOM   6403 C CA  . LYS A 1 936  ? 22.877  23.295  58.610  1.00 87.26  ? 952  LYS A CA  1 
ATOM   6404 C C   . LYS A 1 936  ? 22.242  22.043  58.048  1.00 91.94  ? 952  LYS A C   1 
ATOM   6405 O O   . LYS A 1 936  ? 21.460  22.146  57.102  1.00 92.49  ? 952  LYS A O   1 
ATOM   6406 C CB  . LYS A 1 936  ? 24.408  23.255  58.439  1.00 88.10  ? 952  LYS A CB  1 
ATOM   6407 C CG  . LYS A 1 936  ? 25.117  24.595  58.647  1.00 93.86  ? 952  LYS A CG  1 
ATOM   6408 C CD  . LYS A 1 936  ? 24.491  25.755  57.863  1.00 98.42  ? 952  LYS A CD  1 
ATOM   6409 C CE  . LYS A 1 936  ? 25.436  26.915  57.685  1.00 107.91 ? 952  LYS A CE  1 
ATOM   6410 N N   . PHE A 1 937  ? 22.536  20.866  58.647  1.00 87.10  ? 953  PHE A N   1 
ATOM   6411 C CA  . PHE A 1 937  ? 22.014  19.566  58.215  1.00 85.92  ? 953  PHE A CA  1 
ATOM   6412 C C   . PHE A 1 937  ? 20.506  19.562  57.903  1.00 89.20  ? 953  PHE A C   1 
ATOM   6413 O O   . PHE A 1 937  ? 20.108  18.957  56.914  1.00 89.53  ? 953  PHE A O   1 
ATOM   6414 C CB  . PHE A 1 937  ? 22.374  18.455  59.212  1.00 87.19  ? 953  PHE A CB  1 
ATOM   6415 C CG  . PHE A 1 937  ? 22.041  17.087  58.676  1.00 88.08  ? 953  PHE A CG  1 
ATOM   6416 C CD1 . PHE A 1 937  ? 22.869  16.467  57.748  1.00 90.69  ? 953  PHE A CD1 1 
ATOM   6417 C CD2 . PHE A 1 937  ? 20.869  16.442  59.054  1.00 89.41  ? 953  PHE A CD2 1 
ATOM   6418 C CE1 . PHE A 1 937  ? 22.534  15.226  57.213  1.00 91.25  ? 953  PHE A CE1 1 
ATOM   6419 C CE2 . PHE A 1 937  ? 20.532  15.204  58.518  1.00 91.87  ? 953  PHE A CE2 1 
ATOM   6420 C CZ  . PHE A 1 937  ? 21.362  14.608  57.594  1.00 90.20  ? 953  PHE A CZ  1 
ATOM   6421 N N   . GLU A 1 938  ? 19.683  20.232  58.720  1.00 85.37  ? 954  GLU A N   1 
ATOM   6422 C CA  . GLU A 1 938  ? 18.234  20.298  58.495  1.00 85.20  ? 954  GLU A CA  1 
ATOM   6423 C C   . GLU A 1 938  ? 17.851  21.169  57.283  1.00 90.06  ? 954  GLU A C   1 
ATOM   6424 O O   . GLU A 1 938  ? 16.809  20.929  56.667  1.00 89.55  ? 954  GLU A O   1 
ATOM   6425 C CB  . GLU A 1 938  ? 17.488  20.730  59.761  1.00 86.03  ? 954  GLU A CB  1 
ATOM   6426 C CG  . GLU A 1 938  ? 17.367  19.616  60.783  1.00 93.55  ? 954  GLU A CG  1 
ATOM   6427 C CD  . GLU A 1 938  ? 16.116  18.761  60.721  1.00 125.52 ? 954  GLU A CD  1 
ATOM   6428 O OE1 . GLU A 1 938  ? 15.237  19.037  59.870  1.00 129.52 ? 954  GLU A OE1 1 
ATOM   6429 O OE2 . GLU A 1 938  ? 16.009  17.813  61.535  1.00 123.03 ? 954  GLU A OE2 1 
ATOM   6430 N N   . ARG A 1 939  ? 18.686  22.179  56.949  1.00 86.53  ? 955  ARG A N   1 
ATOM   6431 C CA  . ARG A 1 939  ? 18.468  23.054  55.797  1.00 85.84  ? 955  ARG A CA  1 
ATOM   6432 C C   . ARG A 1 939  ? 18.687  22.209  54.546  1.00 90.63  ? 955  ARG A C   1 
ATOM   6433 O O   . ARG A 1 939  ? 17.894  22.304  53.604  1.00 91.48  ? 955  ARG A O   1 
ATOM   6434 C CB  . ARG A 1 939  ? 19.444  24.239  55.809  1.00 83.70  ? 955  ARG A CB  1 
ATOM   6435 C CG  . ARG A 1 939  ? 18.922  25.476  56.512  1.00 84.28  ? 955  ARG A CG  1 
ATOM   6436 C CD  . ARG A 1 939  ? 19.749  26.694  56.148  1.00 85.71  ? 955  ARG A CD  1 
ATOM   6437 N NE  . ARG A 1 939  ? 19.399  27.237  54.836  1.00 87.51  ? 955  ARG A NE  1 
ATOM   6438 N N   . PHE A 1 940  ? 19.742  21.342  54.578  1.00 85.76  ? 956  PHE A N   1 
ATOM   6439 C CA  . PHE A 1 940  ? 20.143  20.379  53.544  1.00 84.30  ? 956  PHE A CA  1 
ATOM   6440 C C   . PHE A 1 940  ? 19.038  19.351  53.337  1.00 87.34  ? 956  PHE A C   1 
ATOM   6441 O O   . PHE A 1 940  ? 18.778  18.957  52.202  1.00 87.47  ? 956  PHE A O   1 
ATOM   6442 C CB  . PHE A 1 940  ? 21.449  19.681  53.953  1.00 85.54  ? 956  PHE A CB  1 
ATOM   6443 C CG  . PHE A 1 940  ? 21.865  18.511  53.095  1.00 86.97  ? 956  PHE A CG  1 
ATOM   6444 C CD1 . PHE A 1 940  ? 22.402  18.712  51.829  1.00 89.94  ? 956  PHE A CD1 1 
ATOM   6445 C CD2 . PHE A 1 940  ? 21.765  17.210  53.571  1.00 89.04  ? 956  PHE A CD2 1 
ATOM   6446 C CE1 . PHE A 1 940  ? 22.807  17.624  51.042  1.00 91.01  ? 956  PHE A CE1 1 
ATOM   6447 C CE2 . PHE A 1 940  ? 22.172  16.125  52.787  1.00 91.71  ? 956  PHE A CE2 1 
ATOM   6448 C CZ  . PHE A 1 940  ? 22.689  16.338  51.526  1.00 89.79  ? 956  PHE A CZ  1 
ATOM   6449 N N   . ARG A 1 941  ? 18.382  18.935  54.440  1.00 82.42  ? 957  ARG A N   1 
ATOM   6450 C CA  . ARG A 1 941  ? 17.253  18.010  54.453  1.00 81.40  ? 957  ARG A CA  1 
ATOM   6451 C C   . ARG A 1 941  ? 16.099  18.650  53.691  1.00 83.28  ? 957  ARG A C   1 
ATOM   6452 O O   . ARG A 1 941  ? 15.441  17.970  52.917  1.00 84.38  ? 957  ARG A O   1 
ATOM   6453 C CB  . ARG A 1 941  ? 16.831  17.697  55.897  1.00 82.13  ? 957  ARG A CB  1 
ATOM   6454 C CG  . ARG A 1 941  ? 15.719  16.667  56.014  1.00 92.73  ? 957  ARG A CG  1 
ATOM   6455 C CD  . ARG A 1 941  ? 14.942  16.782  57.318  1.00 100.44 ? 957  ARG A CD  1 
ATOM   6456 N NE  . ARG A 1 941  ? 15.761  16.410  58.473  1.00 108.37 ? 957  ARG A NE  1 
ATOM   6457 C CZ  . ARG A 1 941  ? 15.950  15.164  58.899  1.00 122.32 ? 957  ARG A CZ  1 
ATOM   6458 N NH1 . ARG A 1 941  ? 15.373  14.145  58.272  1.00 114.95 ? 957  ARG A NH1 1 
ATOM   6459 N NH2 . ARG A 1 941  ? 16.724  14.927  59.949  1.00 104.68 ? 957  ARG A NH2 1 
ATOM   6460 N N   . GLY A 1 942  ? 15.905  19.949  53.876  1.00 77.09  ? 958  GLY A N   1 
ATOM   6461 C CA  . GLY A 1 942  ? 14.870  20.714  53.194  1.00 76.27  ? 958  GLY A CA  1 
ATOM   6462 C C   . GLY A 1 942  ? 15.088  20.798  51.699  1.00 79.40  ? 958  GLY A C   1 
ATOM   6463 O O   . GLY A 1 942  ? 14.121  20.682  50.935  1.00 78.90  ? 958  GLY A O   1 
ATOM   6464 N N   . TYR A 1 943  ? 16.372  20.971  51.269  1.00 74.79  ? 959  TYR A N   1 
ATOM   6465 C CA  . TYR A 1 943  ? 16.746  21.026  49.845  1.00 73.74  ? 959  TYR A CA  1 
ATOM   6466 C C   . TYR A 1 943  ? 16.411  19.702  49.169  1.00 75.00  ? 959  TYR A C   1 
ATOM   6467 O O   . TYR A 1 943  ? 15.742  19.716  48.140  1.00 75.02  ? 959  TYR A O   1 
ATOM   6468 C CB  . TYR A 1 943  ? 18.233  21.367  49.626  1.00 74.66  ? 959  TYR A CB  1 
ATOM   6469 C CG  . TYR A 1 943  ? 18.716  22.684  50.193  1.00 75.87  ? 959  TYR A CG  1 
ATOM   6470 C CD1 . TYR A 1 943  ? 17.919  23.827  50.145  1.00 78.24  ? 959  TYR A CD1 1 
ATOM   6471 C CD2 . TYR A 1 943  ? 19.999  22.808  50.712  1.00 76.30  ? 959  TYR A CD2 1 
ATOM   6472 C CE1 . TYR A 1 943  ? 18.362  25.041  50.678  1.00 79.90  ? 959  TYR A CE1 1 
ATOM   6473 C CE2 . TYR A 1 943  ? 20.462  24.021  51.220  1.00 77.10  ? 959  TYR A CE2 1 
ATOM   6474 C CZ  . TYR A 1 943  ? 19.643  25.135  51.198  1.00 82.93  ? 959  TYR A CZ  1 
ATOM   6475 O OH  . TYR A 1 943  ? 20.124  26.318  51.693  1.00 83.30  ? 959  TYR A OH  1 
ATOM   6476 N N   . CYS A 1 944  ? 16.830  18.563  49.782  1.00 68.79  ? 960  CYS A N   1 
ATOM   6477 C CA  . CYS A 1 944  ? 16.530  17.201  49.329  1.00 66.91  ? 960  CYS A CA  1 
ATOM   6478 C C   . CYS A 1 944  ? 15.032  16.990  49.241  1.00 72.27  ? 960  CYS A C   1 
ATOM   6479 O O   . CYS A 1 944  ? 14.526  16.515  48.218  1.00 73.50  ? 960  CYS A O   1 
ATOM   6480 C CB  . CYS A 1 944  ? 17.176  16.166  50.243  1.00 65.64  ? 960  CYS A CB  1 
ATOM   6481 S SG  . CYS A 1 944  ? 18.984  16.126  50.153  1.00 68.63  ? 960  CYS A SG  1 
ATOM   6482 N N   . GLU A 1 945  ? 14.321  17.380  50.300  1.00 68.67  ? 961  GLU A N   1 
ATOM   6483 C CA  . GLU A 1 945  ? 12.872  17.238  50.382  1.00 68.35  ? 961  GLU A CA  1 
ATOM   6484 C C   . GLU A 1 945  ? 12.114  18.071  49.368  1.00 70.46  ? 961  GLU A C   1 
ATOM   6485 O O   . GLU A 1 945  ? 11.193  17.546  48.760  1.00 68.17  ? 961  GLU A O   1 
ATOM   6486 C CB  . GLU A 1 945  ? 12.366  17.500  51.795  1.00 69.51  ? 961  GLU A CB  1 
ATOM   6487 C CG  . GLU A 1 945  ? 12.670  16.342  52.723  1.00 77.27  ? 961  GLU A CG  1 
ATOM   6488 C CD  . GLU A 1 945  ? 12.155  16.516  54.132  1.00 89.82  ? 961  GLU A CD  1 
ATOM   6489 O OE1 . GLU A 1 945  ? 11.187  17.289  54.320  1.00 80.24  ? 961  GLU A OE1 1 
ATOM   6490 O OE2 . GLU A 1 945  ? 12.697  15.849  55.043  1.00 79.81  ? 961  GLU A OE2 1 
ATOM   6491 N N   . ARG A 1 946  ? 12.502  19.336  49.148  1.00 68.31  ? 962  ARG A N   1 
ATOM   6492 C CA  . ARG A 1 946  ? 11.754  20.113  48.171  1.00 69.07  ? 962  ARG A CA  1 
ATOM   6493 C C   . ARG A 1 946  ? 12.131  19.673  46.736  1.00 72.73  ? 962  ARG A C   1 
ATOM   6494 O O   . ARG A 1 946  ? 11.226  19.472  45.922  1.00 73.15  ? 962  ARG A O   1 
ATOM   6495 C CB  . ARG A 1 946  ? 11.795  21.638  48.430  1.00 70.75  ? 962  ARG A CB  1 
ATOM   6496 C CG  . ARG A 1 946  ? 12.996  22.411  47.930  1.00 86.53  ? 962  ARG A CG  1 
ATOM   6497 C CD  . ARG A 1 946  ? 12.768  23.920  48.080  1.00 99.25  ? 962  ARG A CD  1 
ATOM   6498 N NE  . ARG A 1 946  ? 11.589  24.405  47.349  1.00 102.06 ? 962  ARG A NE  1 
ATOM   6499 C CZ  . ARG A 1 946  ? 11.406  25.662  46.950  1.00 107.55 ? 962  ARG A CZ  1 
ATOM   6500 N NH1 . ARG A 1 946  ? 12.335  26.586  47.187  1.00 89.08  ? 962  ARG A NH1 1 
ATOM   6501 N NH2 . ARG A 1 946  ? 10.301  26.001  46.297  1.00 85.58  ? 962  ARG A NH2 1 
ATOM   6502 N N   . ALA A 1 947  ? 13.411  19.379  46.481  1.00 68.71  ? 963  ALA A N   1 
ATOM   6503 C CA  . ALA A 1 947  ? 13.858  18.851  45.187  1.00 69.43  ? 963  ALA A CA  1 
ATOM   6504 C C   . ALA A 1 947  ? 13.009  17.627  44.764  1.00 74.47  ? 963  ALA A C   1 
ATOM   6505 O O   . ALA A 1 947  ? 12.458  17.623  43.661  1.00 74.04  ? 963  ALA A O   1 
ATOM   6506 C CB  . ALA A 1 947  ? 15.339  18.476  45.242  1.00 70.03  ? 963  ALA A CB  1 
ATOM   6507 N N   . TYR A 1 948  ? 12.846  16.642  45.675  1.00 71.58  ? 964  TYR A N   1 
ATOM   6508 C CA  . TYR A 1 948  ? 12.040  15.435  45.453  1.00 71.64  ? 964  TYR A CA  1 
ATOM   6509 C C   . TYR A 1 948  ? 10.555  15.755  45.217  1.00 75.99  ? 964  TYR A C   1 
ATOM   6510 O O   . TYR A 1 948  ? 9.923   15.118  44.373  1.00 76.57  ? 964  TYR A O   1 
ATOM   6511 C CB  . TYR A 1 948  ? 12.201  14.442  46.622  1.00 72.53  ? 964  TYR A CB  1 
ATOM   6512 C CG  . TYR A 1 948  ? 11.470  13.125  46.434  1.00 74.23  ? 964  TYR A CG  1 
ATOM   6513 C CD1 . TYR A 1 948  ? 12.084  12.047  45.799  1.00 74.95  ? 964  TYR A CD1 1 
ATOM   6514 C CD2 . TYR A 1 948  ? 10.191  12.930  46.957  1.00 75.81  ? 964  TYR A CD2 1 
ATOM   6515 C CE1 . TYR A 1 948  ? 11.429  10.825  45.648  1.00 74.26  ? 964  TYR A CE1 1 
ATOM   6516 C CE2 . TYR A 1 948  ? 9.525   11.712  46.811  1.00 76.74  ? 964  TYR A CE2 1 
ATOM   6517 C CZ  . TYR A 1 948  ? 10.146  10.663  46.150  1.00 82.25  ? 964  TYR A CZ  1 
ATOM   6518 O OH  . TYR A 1 948  ? 9.492   9.462   46.005  1.00 82.48  ? 964  TYR A OH  1 
ATOM   6519 N N   . THR A 1 949  ? 10.011  16.733  45.962  1.00 71.28  ? 965  THR A N   1 
ATOM   6520 C CA  . THR A 1 949  ? 8.609   17.148  45.914  1.00 69.82  ? 965  THR A CA  1 
ATOM   6521 C C   . THR A 1 949  ? 8.243   17.724  44.585  1.00 72.32  ? 965  THR A C   1 
ATOM   6522 O O   . THR A 1 949  ? 7.175   17.386  44.075  1.00 73.33  ? 965  THR A O   1 
ATOM   6523 C CB  . THR A 1 949  ? 8.301   18.074  47.074  1.00 77.99  ? 965  THR A CB  1 
ATOM   6524 O OG1 . THR A 1 949  ? 8.561   17.335  48.270  1.00 81.71  ? 965  THR A OG1 1 
ATOM   6525 C CG2 . THR A 1 949  ? 6.847   18.545  47.083  1.00 75.44  ? 965  THR A CG2 1 
ATOM   6526 N N   . ILE A 1 950  ? 9.124   18.590  44.022  1.00 66.13  ? 966  ILE A N   1 
ATOM   6527 C CA  . ILE A 1 950  ? 8.985   19.239  42.714  1.00 63.64  ? 966  ILE A CA  1 
ATOM   6528 C C   . ILE A 1 950  ? 9.033   18.160  41.614  1.00 67.35  ? 966  ILE A C   1 
ATOM   6529 O O   . ILE A 1 950  ? 8.213   18.176  40.696  1.00 66.41  ? 966  ILE A O   1 
ATOM   6530 C CB  . ILE A 1 950  ? 10.100  20.312  42.569  1.00 65.69  ? 966  ILE A CB  1 
ATOM   6531 C CG1 . ILE A 1 950  ? 9.804   21.527  43.467  1.00 66.24  ? 966  ILE A CG1 1 
ATOM   6532 C CG2 . ILE A 1 950  ? 10.328  20.743  41.129  1.00 64.60  ? 966  ILE A CG2 1 
ATOM   6533 C CD1 . ILE A 1 950  ? 11.069  22.291  44.027  1.00 74.31  ? 966  ILE A CD1 1 
ATOM   6534 N N   . LEU A 1 951  ? 9.951   17.187  41.742  1.00 64.74  ? 967  LEU A N   1 
ATOM   6535 C CA  . LEU A 1 951  ? 10.082  16.125  40.747  1.00 64.77  ? 967  LEU A CA  1 
ATOM   6536 C C   . LEU A 1 951  ? 8.798   15.329  40.576  1.00 73.41  ? 967  LEU A C   1 
ATOM   6537 O O   . LEU A 1 951  ? 8.446   14.966  39.446  1.00 73.88  ? 967  LEU A O   1 
ATOM   6538 C CB  . LEU A 1 951  ? 11.275  15.219  41.050  1.00 63.83  ? 967  LEU A CB  1 
ATOM   6539 C CG  . LEU A 1 951  ? 12.650  15.826  40.819  1.00 67.34  ? 967  LEU A CG  1 
ATOM   6540 C CD1 . LEU A 1 951  ? 13.723  14.753  40.795  1.00 66.97  ? 967  LEU A CD1 1 
ATOM   6541 C CD2 . LEU A 1 951  ? 12.686  16.665  39.547  1.00 67.90  ? 967  LEU A CD2 1 
ATOM   6542 N N   . ARG A 1 952  ? 8.074   15.116  41.705  1.00 71.09  ? 968  ARG A N   1 
ATOM   6543 C CA  . ARG A 1 952  ? 6.793   14.413  41.791  1.00 70.00  ? 968  ARG A CA  1 
ATOM   6544 C C   . ARG A 1 952  ? 5.734   15.169  41.011  1.00 72.86  ? 968  ARG A C   1 
ATOM   6545 O O   . ARG A 1 952  ? 4.986   14.552  40.248  1.00 71.25  ? 968  ARG A O   1 
ATOM   6546 C CB  . ARG A 1 952  ? 6.365   14.240  43.257  1.00 69.02  ? 968  ARG A CB  1 
ATOM   6547 C CG  . ARG A 1 952  ? 7.177   13.188  44.016  1.00 82.38  ? 968  ARG A CG  1 
ATOM   6548 C CD  . ARG A 1 952  ? 6.466   12.670  45.256  1.00 95.89  ? 968  ARG A CD  1 
ATOM   6549 N NE  . ARG A 1 952  ? 5.336   11.797  44.921  1.00 102.91 ? 968  ARG A NE  1 
ATOM   6550 C CZ  . ARG A 1 952  ? 4.064   12.179  44.941  1.00 113.94 ? 968  ARG A CZ  1 
ATOM   6551 N NH1 . ARG A 1 952  ? 3.742   13.417  45.285  1.00 109.51 ? 968  ARG A NH1 1 
ATOM   6552 N NH2 . ARG A 1 952  ? 3.107   11.330  44.602  1.00 92.54  ? 968  ARG A NH2 1 
ATOM   6553 N N   . ARG A 1 953  ? 5.700   16.510  41.157  1.00 70.66  ? 969  ARG A N   1 
ATOM   6554 C CA  . ARG A 1 953  ? 4.740   17.359  40.444  1.00 71.68  ? 969  ARG A CA  1 
ATOM   6555 C C   . ARG A 1 953  ? 4.778   17.134  38.919  1.00 76.16  ? 969  ARG A C   1 
ATOM   6556 O O   . ARG A 1 953  ? 3.729   17.180  38.263  1.00 76.94  ? 969  ARG A O   1 
ATOM   6557 C CB  . ARG A 1 953  ? 4.920   18.841  40.821  1.00 73.66  ? 969  ARG A CB  1 
ATOM   6558 C CG  . ARG A 1 953  ? 4.409   19.136  42.229  1.00 91.30  ? 969  ARG A CG  1 
ATOM   6559 C CD  . ARG A 1 953  ? 5.253   20.144  42.982  1.00 107.52 ? 969  ARG A CD  1 
ATOM   6560 N NE  . ARG A 1 953  ? 4.733   20.341  44.337  1.00 120.66 ? 969  ARG A NE  1 
ATOM   6561 C CZ  . ARG A 1 953  ? 5.274   21.142  45.254  1.00 136.72 ? 969  ARG A CZ  1 
ATOM   6562 N NH1 . ARG A 1 953  ? 6.384   21.823  44.983  1.00 118.13 ? 969  ARG A NH1 1 
ATOM   6563 N NH2 . ARG A 1 953  ? 4.721   21.252  46.456  1.00 124.90 ? 969  ARG A NH2 1 
ATOM   6564 N N   . HIS A 1 954  ? 5.980   16.811  38.387  1.00 71.28  ? 970  HIS A N   1 
ATOM   6565 C CA  . HIS A 1 954  ? 6.251   16.535  36.985  1.00 70.47  ? 970  HIS A CA  1 
ATOM   6566 C C   . HIS A 1 954  ? 6.557   15.057  36.724  1.00 75.29  ? 970  HIS A C   1 
ATOM   6567 O O   . HIS A 1 954  ? 7.255   14.740  35.764  1.00 77.53  ? 970  HIS A O   1 
ATOM   6568 C CB  . HIS A 1 954  ? 7.402   17.414  36.513  1.00 71.31  ? 970  HIS A CB  1 
ATOM   6569 C CG  . HIS A 1 954  ? 7.101   18.871  36.624  1.00 75.20  ? 970  HIS A CG  1 
ATOM   6570 N ND1 . HIS A 1 954  ? 7.546   19.623  37.707  1.00 77.16  ? 970  HIS A ND1 1 
ATOM   6571 C CD2 . HIS A 1 954  ? 6.374   19.667  35.804  1.00 77.08  ? 970  HIS A CD2 1 
ATOM   6572 C CE1 . HIS A 1 954  ? 7.098   20.850  37.499  1.00 76.62  ? 970  HIS A CE1 1 
ATOM   6573 N NE2 . HIS A 1 954  ? 6.385   20.926  36.367  1.00 76.97  ? 970  HIS A NE2 1 
ATOM   6574 N N   . GLY A 1 955  ? 5.995   14.171  37.544  1.00 69.32  ? 971  GLY A N   1 
ATOM   6575 C CA  . GLY A 1 955  ? 6.181   12.727  37.457  1.00 67.46  ? 971  GLY A CA  1 
ATOM   6576 C C   . GLY A 1 955  ? 5.719   12.118  36.150  1.00 69.86  ? 971  GLY A C   1 
ATOM   6577 O O   . GLY A 1 955  ? 6.395   11.237  35.601  1.00 70.27  ? 971  GLY A O   1 
ATOM   6578 N N   . LEU A 1 956  ? 4.564   12.582  35.638  1.00 63.97  ? 972  LEU A N   1 
ATOM   6579 C CA  . LEU A 1 956  ? 4.015   12.093  34.373  1.00 62.29  ? 972  LEU A CA  1 
ATOM   6580 C C   . LEU A 1 956  ? 4.887   12.476  33.181  1.00 65.17  ? 972  LEU A C   1 
ATOM   6581 O O   . LEU A 1 956  ? 4.962   11.710  32.222  1.00 64.67  ? 972  LEU A O   1 
ATOM   6582 C CB  . LEU A 1 956  ? 2.587   12.585  34.158  1.00 61.57  ? 972  LEU A CB  1 
ATOM   6583 C CG  . LEU A 1 956  ? 1.514   11.773  34.829  1.00 64.65  ? 972  LEU A CG  1 
ATOM   6584 C CD1 . LEU A 1 956  ? 0.197   12.471  34.727  1.00 64.48  ? 972  LEU A CD1 1 
ATOM   6585 C CD2 . LEU A 1 956  ? 1.391   10.413  34.192  1.00 66.49  ? 972  LEU A CD2 1 
ATOM   6586 N N   . LEU A 1 957  ? 5.566   13.645  33.263  1.00 59.88  ? 973  LEU A N   1 
ATOM   6587 C CA  . LEU A 1 957  ? 6.478   14.140  32.235  1.00 58.00  ? 973  LEU A CA  1 
ATOM   6588 C C   . LEU A 1 957  ? 7.611   13.156  32.025  1.00 60.82  ? 973  LEU A C   1 
ATOM   6589 O O   . LEU A 1 957  ? 7.865   12.746  30.897  1.00 60.25  ? 973  LEU A O   1 
ATOM   6590 C CB  . LEU A 1 957  ? 7.005   15.544  32.626  1.00 56.88  ? 973  LEU A CB  1 
ATOM   6591 C CG  . LEU A 1 957  ? 7.878   16.286  31.605  1.00 57.98  ? 973  LEU A CG  1 
ATOM   6592 C CD1 . LEU A 1 957  ? 7.193   16.422  30.255  1.00 55.90  ? 973  LEU A CD1 1 
ATOM   6593 C CD2 . LEU A 1 957  ? 8.314   17.615  32.146  1.00 55.30  ? 973  LEU A CD2 1 
ATOM   6594 N N   . PHE A 1 958  ? 8.257   12.751  33.128  1.00 57.00  ? 974  PHE A N   1 
ATOM   6595 C CA  . PHE A 1 958  ? 9.356   11.795  33.138  1.00 55.87  ? 974  PHE A CA  1 
ATOM   6596 C C   . PHE A 1 958  ? 8.890   10.432  32.693  1.00 59.79  ? 974  PHE A C   1 
ATOM   6597 O O   . PHE A 1 958  ? 9.657   9.747   32.049  1.00 60.96  ? 974  PHE A O   1 
ATOM   6598 C CB  . PHE A 1 958  ? 9.994   11.714  34.528  1.00 57.60  ? 974  PHE A CB  1 
ATOM   6599 C CG  . PHE A 1 958  ? 10.772  12.940  34.967  1.00 58.84  ? 974  PHE A CG  1 
ATOM   6600 C CD1 . PHE A 1 958  ? 12.123  13.069  34.672  1.00 62.21  ? 974  PHE A CD1 1 
ATOM   6601 C CD2 . PHE A 1 958  ? 10.180  13.911  35.755  1.00 60.56  ? 974  PHE A CD2 1 
ATOM   6602 C CE1 . PHE A 1 958  ? 12.851  14.181  35.110  1.00 63.36  ? 974  PHE A CE1 1 
ATOM   6603 C CE2 . PHE A 1 958  ? 10.900  15.026  36.181  1.00 63.83  ? 974  PHE A CE2 1 
ATOM   6604 C CZ  . PHE A 1 958  ? 12.235  15.156  35.855  1.00 62.20  ? 974  PHE A CZ  1 
ATOM   6605 N N   . LEU A 1 959  ? 7.653   10.034  32.996  1.00 56.90  ? 975  LEU A N   1 
ATOM   6606 C CA  . LEU A 1 959  ? 7.145   8.734   32.571  1.00 58.83  ? 975  LEU A CA  1 
ATOM   6607 C C   . LEU A 1 959  ? 6.905   8.729   31.063  1.00 64.75  ? 975  LEU A C   1 
ATOM   6608 O O   . LEU A 1 959  ? 7.371   7.824   30.374  1.00 65.80  ? 975  LEU A O   1 
ATOM   6609 C CB  . LEU A 1 959  ? 5.872   8.345   33.346  1.00 60.36  ? 975  LEU A CB  1 
ATOM   6610 C CG  . LEU A 1 959  ? 6.058   8.017   34.847  1.00 67.39  ? 975  LEU A CG  1 
ATOM   6611 C CD1 . LEU A 1 959  ? 4.739   7.919   35.550  1.00 67.53  ? 975  LEU A CD1 1 
ATOM   6612 C CD2 . LEU A 1 959  ? 6.830   6.721   35.046  1.00 72.59  ? 975  LEU A CD2 1 
ATOM   6613 N N   . HIS A 1 960  ? 6.249   9.793   30.551  1.00 59.80  ? 976  HIS A N   1 
ATOM   6614 C CA  . HIS A 1 960  ? 5.962   10.034  29.144  1.00 57.59  ? 976  HIS A CA  1 
ATOM   6615 C C   . HIS A 1 960  ? 7.260   10.080  28.356  1.00 59.25  ? 976  HIS A C   1 
ATOM   6616 O O   . HIS A 1 960  ? 7.375   9.362   27.357  1.00 59.91  ? 976  HIS A O   1 
ATOM   6617 C CB  . HIS A 1 960  ? 5.135   11.333  28.966  1.00 58.02  ? 976  HIS A CB  1 
ATOM   6618 C CG  . HIS A 1 960  ? 3.691   11.243  29.413  1.00 61.65  ? 976  HIS A CG  1 
ATOM   6619 N ND1 . HIS A 1 960  ? 3.091   10.034  29.748  1.00 63.51  ? 976  HIS A ND1 1 
ATOM   6620 C CD2 . HIS A 1 960  ? 2.768   12.220  29.539  1.00 63.39  ? 976  HIS A CD2 1 
ATOM   6621 C CE1 . HIS A 1 960  ? 1.840   10.322  30.059  1.00 62.53  ? 976  HIS A CE1 1 
ATOM   6622 N NE2 . HIS A 1 960  ? 1.603   11.622  29.965  1.00 62.90  ? 976  HIS A NE2 1 
ATOM   6623 N N   . LEU A 1 961  ? 8.253   10.880  28.828  1.00 53.35  ? 977  LEU A N   1 
ATOM   6624 C CA  . LEU A 1 961  ? 9.574   11.015  28.185  1.00 52.01  ? 977  LEU A CA  1 
ATOM   6625 C C   . LEU A 1 961  ? 10.325  9.683   28.111  1.00 56.93  ? 977  LEU A C   1 
ATOM   6626 O O   . LEU A 1 961  ? 10.737  9.263   27.023  1.00 55.88  ? 977  LEU A O   1 
ATOM   6627 C CB  . LEU A 1 961  ? 10.437  12.131  28.830  1.00 50.91  ? 977  LEU A CB  1 
ATOM   6628 C CG  . LEU A 1 961  ? 9.957   13.600  28.614  1.00 53.29  ? 977  LEU A CG  1 
ATOM   6629 C CD1 . LEU A 1 961  ? 10.958  14.582  29.151  1.00 51.61  ? 977  LEU A CD1 1 
ATOM   6630 C CD2 . LEU A 1 961  ? 9.705   13.925  27.126  1.00 51.94  ? 977  LEU A CD2 1 
ATOM   6631 N N   . PHE A 1 962  ? 10.417  8.985   29.256  1.00 54.79  ? 978  PHE A N   1 
ATOM   6632 C CA  . PHE A 1 962  ? 11.063  7.685   29.369  1.00 54.86  ? 978  PHE A CA  1 
ATOM   6633 C C   . PHE A 1 962  ? 10.358  6.643   28.502  1.00 58.09  ? 978  PHE A C   1 
ATOM   6634 O O   . PHE A 1 962  ? 11.033  5.883   27.819  1.00 57.47  ? 978  PHE A O   1 
ATOM   6635 C CB  . PHE A 1 962  ? 11.173  7.259   30.847  1.00 57.03  ? 978  PHE A CB  1 
ATOM   6636 C CG  . PHE A 1 962  ? 12.504  7.609   31.485  1.00 58.63  ? 978  PHE A CG  1 
ATOM   6637 C CD1 . PHE A 1 962  ? 12.719  8.857   32.046  1.00 61.29  ? 978  PHE A CD1 1 
ATOM   6638 C CD2 . PHE A 1 962  ? 13.565  6.705   31.463  1.00 60.61  ? 978  PHE A CD2 1 
ATOM   6639 C CE1 . PHE A 1 962  ? 13.961  9.179   32.616  1.00 62.41  ? 978  PHE A CE1 1 
ATOM   6640 C CE2 . PHE A 1 962  ? 14.818  7.048   31.987  1.00 62.55  ? 978  PHE A CE2 1 
ATOM   6641 C CZ  . PHE A 1 962  ? 15.007  8.279   32.566  1.00 60.18  ? 978  PHE A CZ  1 
ATOM   6642 N N   . ALA A 1 963  ? 9.004   6.660   28.465  1.00 53.94  ? 979  ALA A N   1 
ATOM   6643 C CA  . ALA A 1 963  ? 8.218   5.759   27.627  1.00 52.74  ? 979  ALA A CA  1 
ATOM   6644 C C   . ALA A 1 963  ? 8.566   5.947   26.163  1.00 58.42  ? 979  ALA A C   1 
ATOM   6645 O O   . ALA A 1 963  ? 8.680   4.953   25.477  1.00 60.25  ? 979  ALA A O   1 
ATOM   6646 C CB  . ALA A 1 963  ? 6.735   5.969   27.849  1.00 52.90  ? 979  ALA A CB  1 
ATOM   6647 N N   . LEU A 1 964  ? 8.795   7.186   25.686  1.00 55.27  ? 980  LEU A N   1 
ATOM   6648 C CA  . LEU A 1 964  ? 9.218   7.411   24.294  1.00 55.35  ? 980  LEU A CA  1 
ATOM   6649 C C   . LEU A 1 964  ? 10.647  6.919   24.065  1.00 60.81  ? 980  LEU A C   1 
ATOM   6650 O O   . LEU A 1 964  ? 10.917  6.391   22.991  1.00 61.12  ? 980  LEU A O   1 
ATOM   6651 C CB  . LEU A 1 964  ? 9.110   8.875   23.843  1.00 55.43  ? 980  LEU A CB  1 
ATOM   6652 C CG  . LEU A 1 964  ? 7.744   9.600   23.914  1.00 59.88  ? 980  LEU A CG  1 
ATOM   6653 C CD1 . LEU A 1 964  ? 7.822   10.956  23.231  1.00 59.78  ? 980  LEU A CD1 1 
ATOM   6654 C CD2 . LEU A 1 964  ? 6.603   8.782   23.339  1.00 59.96  ? 980  LEU A CD2 1 
ATOM   6655 N N   . MET A 1 965  ? 11.552  7.037   25.073  1.00 57.97  ? 981  MET A N   1 
ATOM   6656 C CA  . MET A 1 965  ? 12.947  6.564   24.952  1.00 57.39  ? 981  MET A CA  1 
ATOM   6657 C C   . MET A 1 965  ? 13.073  5.085   24.702  1.00 61.86  ? 981  MET A C   1 
ATOM   6658 O O   . MET A 1 965  ? 14.129  4.633   24.283  1.00 61.45  ? 981  MET A O   1 
ATOM   6659 C CB  . MET A 1 965  ? 13.823  6.959   26.142  1.00 59.30  ? 981  MET A CB  1 
ATOM   6660 C CG  . MET A 1 965  ? 14.457  8.289   25.997  1.00 63.06  ? 981  MET A CG  1 
ATOM   6661 S SD  . MET A 1 965  ? 15.253  8.596   24.410  1.00 67.46  ? 981  MET A SD  1 
ATOM   6662 C CE  . MET A 1 965  ? 16.811  7.911   24.671  1.00 63.57  ? 981  MET A CE  1 
ATOM   6663 N N   . ARG A 1 966  ? 11.995  4.334   24.908  1.00 59.71  ? 982  ARG A N   1 
ATOM   6664 C CA  . ARG A 1 966  ? 11.971  2.906   24.633  1.00 60.69  ? 982  ARG A CA  1 
ATOM   6665 C C   . ARG A 1 966  ? 12.247  2.613   23.130  1.00 66.74  ? 982  ARG A C   1 
ATOM   6666 O O   . ARG A 1 966  ? 12.716  1.522   22.800  1.00 67.54  ? 982  ARG A O   1 
ATOM   6667 C CB  . ARG A 1 966  ? 10.650  2.295   25.098  1.00 60.98  ? 982  ARG A CB  1 
ATOM   6668 C CG  . ARG A 1 966  ? 10.569  2.100   26.603  1.00 68.17  ? 982  ARG A CG  1 
ATOM   6669 C CD  . ARG A 1 966  ? 9.168   1.728   27.018  1.00 84.36  ? 982  ARG A CD  1 
ATOM   6670 N NE  . ARG A 1 966  ? 8.741   0.456   26.432  1.00 101.45 ? 982  ARG A NE  1 
ATOM   6671 C CZ  . ARG A 1 966  ? 7.582   -0.136  26.698  1.00 120.85 ? 982  ARG A CZ  1 
ATOM   6672 N NH1 . ARG A 1 966  ? 6.724   0.419   27.550  1.00 107.66 ? 982  ARG A NH1 1 
ATOM   6673 N NH2 . ARG A 1 966  ? 7.267   -1.286  26.113  1.00 106.41 ? 982  ARG A NH2 1 
ATOM   6674 N N   . ALA A 1 967  ? 12.037  3.615   22.249  1.00 63.30  ? 983  ALA A N   1 
ATOM   6675 C CA  . ALA A 1 967  ? 12.316  3.536   20.814  1.00 62.96  ? 983  ALA A CA  1 
ATOM   6676 C C   . ALA A 1 967  ? 13.836  3.469   20.515  1.00 69.98  ? 983  ALA A C   1 
ATOM   6677 O O   . ALA A 1 967  ? 14.211  2.902   19.484  1.00 71.66  ? 983  ALA A O   1 
ATOM   6678 C CB  . ALA A 1 967  ? 11.678  4.714   20.098  1.00 63.13  ? 983  ALA A CB  1 
ATOM   6679 N N   . ALA A 1 968  ? 14.700  4.006   21.429  1.00 66.27  ? 984  ALA A N   1 
ATOM   6680 C CA  . ALA A 1 968  ? 16.169  4.005   21.348  1.00 66.76  ? 984  ALA A CA  1 
ATOM   6681 C C   . ALA A 1 968  ? 16.837  2.618   21.465  1.00 75.80  ? 984  ALA A C   1 
ATOM   6682 O O   . ALA A 1 968  ? 18.006  2.455   21.087  1.00 74.95  ? 984  ALA A O   1 
ATOM   6683 C CB  . ALA A 1 968  ? 16.749  4.931   22.394  1.00 67.16  ? 984  ALA A CB  1 
ATOM   6684 N N   . GLY A 1 969  ? 16.107  1.658   22.026  1.00 76.51  ? 985  GLY A N   1 
ATOM   6685 C CA  . GLY A 1 969  ? 16.563  0.286   22.193  1.00 78.04  ? 985  GLY A CA  1 
ATOM   6686 C C   . GLY A 1 969  ? 17.726  0.098   23.146  1.00 86.59  ? 985  GLY A C   1 
ATOM   6687 O O   . GLY A 1 969  ? 18.558  -0.794  22.938  1.00 88.68  ? 985  GLY A O   1 
ATOM   6688 N N   . LEU A 1 970  ? 17.802  0.927   24.197  1.00 82.55  ? 986  LEU A N   1 
ATOM   6689 C CA  . LEU A 1 970  ? 18.840  0.785   25.214  1.00 81.70  ? 986  LEU A CA  1 
ATOM   6690 C C   . LEU A 1 970  ? 18.390  -0.396  26.092  1.00 89.39  ? 986  LEU A C   1 
ATOM   6691 O O   . LEU A 1 970  ? 17.202  -0.472  26.414  1.00 89.71  ? 986  LEU A O   1 
ATOM   6692 C CB  . LEU A 1 970  ? 18.942  2.046   26.086  1.00 80.54  ? 986  LEU A CB  1 
ATOM   6693 C CG  . LEU A 1 970  ? 18.992  3.387   25.393  1.00 82.84  ? 986  LEU A CG  1 
ATOM   6694 C CD1 . LEU A 1 970  ? 18.391  4.458   26.263  1.00 81.17  ? 986  LEU A CD1 1 
ATOM   6695 C CD2 . LEU A 1 970  ? 20.403  3.736   24.994  1.00 86.01  ? 986  LEU A CD2 1 
ATOM   6696 N N   . PRO A 1 971  ? 19.289  -1.342  26.459  1.00 87.82  ? 987  PRO A N   1 
ATOM   6697 C CA  . PRO A 1 971  ? 18.865  -2.493  27.297  1.00 87.26  ? 987  PRO A CA  1 
ATOM   6698 C C   . PRO A 1 971  ? 18.214  -2.111  28.633  1.00 89.47  ? 987  PRO A C   1 
ATOM   6699 O O   . PRO A 1 971  ? 17.208  -2.725  29.045  1.00 88.53  ? 987  PRO A O   1 
ATOM   6700 C CB  . PRO A 1 971  ? 20.174  -3.255  27.526  1.00 89.28  ? 987  PRO A CB  1 
ATOM   6701 C CG  . PRO A 1 971  ? 21.278  -2.236  27.251  1.00 94.04  ? 987  PRO A CG  1 
ATOM   6702 C CD  . PRO A 1 971  ? 20.731  -1.416  26.135  1.00 89.63  ? 987  PRO A CD  1 
ATOM   6703 N N   . GLU A 1 972  ? 18.779  -1.058  29.283  1.00 84.19  ? 988  GLU A N   1 
ATOM   6704 C CA  . GLU A 1 972  ? 18.336  -0.501  30.572  1.00 82.63  ? 988  GLU A CA  1 
ATOM   6705 C C   . GLU A 1 972  ? 16.950  0.181   30.500  1.00 83.58  ? 988  GLU A C   1 
ATOM   6706 O O   . GLU A 1 972  ? 16.291  0.370   31.530  1.00 82.07  ? 988  GLU A O   1 
ATOM   6707 C CB  . GLU A 1 972  ? 19.389  0.462   31.107  1.00 83.69  ? 988  GLU A CB  1 
ATOM   6708 C CG  . GLU A 1 972  ? 20.789  -0.126  31.081  1.00 94.87  ? 988  GLU A CG  1 
ATOM   6709 C CD  . GLU A 1 972  ? 21.396  -0.331  32.451  1.00 111.89 ? 988  GLU A CD  1 
ATOM   6710 O OE1 . GLU A 1 972  ? 21.109  0.506   33.333  1.00 96.28  ? 988  GLU A OE1 1 
ATOM   6711 O OE2 . GLU A 1 972  ? 22.146  -1.317  32.649  1.00 107.58 ? 988  GLU A OE2 1 
ATOM   6712 N N   . LEU A 1 973  ? 16.510  0.517   29.275  1.00 78.79  ? 989  LEU A N   1 
ATOM   6713 C CA  . LEU A 1 973  ? 15.225  1.144   29.011  1.00 77.94  ? 989  LEU A CA  1 
ATOM   6714 C C   . LEU A 1 973  ? 14.559  0.456   27.806  1.00 80.35  ? 989  LEU A C   1 
ATOM   6715 O O   . LEU A 1 973  ? 14.485  0.999   26.706  1.00 78.79  ? 989  LEU A O   1 
ATOM   6716 C CB  . LEU A 1 973  ? 15.419  2.667   28.840  1.00 77.65  ? 989  LEU A CB  1 
ATOM   6717 C CG  . LEU A 1 973  ? 14.201  3.562   28.618  1.00 82.05  ? 989  LEU A CG  1 
ATOM   6718 C CD1 . LEU A 1 973  ? 13.024  3.230   29.568  1.00 81.63  ? 989  LEU A CD1 1 
ATOM   6719 C CD2 . LEU A 1 973  ? 14.609  4.983   28.741  1.00 85.35  ? 989  LEU A CD2 1 
ATOM   6720 N N   . SER A 1 974  ? 14.101  -0.771  28.037  1.00 78.34  ? 990  SER A N   1 
ATOM   6721 C CA  . SER A 1 974  ? 13.475  -1.624  27.026  1.00 79.26  ? 990  SER A CA  1 
ATOM   6722 C C   . SER A 1 974  ? 12.029  -2.057  27.340  1.00 84.87  ? 990  SER A C   1 
ATOM   6723 O O   . SER A 1 974  ? 11.349  -2.590  26.452  1.00 83.82  ? 990  SER A O   1 
ATOM   6724 C CB  . SER A 1 974  ? 14.345  -2.855  26.775  1.00 82.97  ? 990  SER A CB  1 
ATOM   6725 O OG  . SER A 1 974  ? 14.563  -3.584  27.974  1.00 95.29  ? 990  SER A OG  1 
ATOM   6726 N N   . CYS A 1 975  ? 11.546  -1.838  28.579  1.00 83.73  ? 991  CYS A N   1 
ATOM   6727 C CA  . CYS A 1 975  ? 10.211  -2.328  28.914  1.00 85.00  ? 991  CYS A CA  1 
ATOM   6728 C C   . CYS A 1 975  ? 9.455   -1.520  29.939  1.00 89.53  ? 991  CYS A C   1 
ATOM   6729 O O   . CYS A 1 975  ? 9.981   -0.572  30.520  1.00 90.17  ? 991  CYS A O   1 
ATOM   6730 C CB  . CYS A 1 975  ? 10.320  -3.779  29.368  1.00 86.07  ? 991  CYS A CB  1 
ATOM   6731 S SG  . CYS A 1 975  ? 11.213  -3.986  30.927  1.00 90.33  ? 991  CYS A SG  1 
ATOM   6732 N N   . SER A 1 976  ? 8.222   -1.994  30.209  1.00 85.30  ? 992  SER A N   1 
ATOM   6733 C CA  . SER A 1 976  ? 7.233   -1.576  31.212  1.00 84.32  ? 992  SER A CA  1 
ATOM   6734 C C   . SER A 1 976  ? 7.816   -1.470  32.676  1.00 85.16  ? 992  SER A C   1 
ATOM   6735 O O   . SER A 1 976  ? 7.529   -0.495  33.386  1.00 82.10  ? 992  SER A O   1 
ATOM   6736 C CB  . SER A 1 976  ? 6.102   -2.601  31.211  1.00 86.74  ? 992  SER A CB  1 
ATOM   6737 O OG  . SER A 1 976  ? 6.641   -3.918  31.183  1.00 90.69  ? 992  SER A OG  1 
ATOM   6738 N N   . LYS A 1 977  ? 8.604   -2.489  33.110  1.00 81.33  ? 993  LYS A N   1 
ATOM   6739 C CA  . LYS A 1 977  ? 9.177   -2.518  34.451  1.00 81.89  ? 993  LYS A CA  1 
ATOM   6740 C C   . LYS A 1 977  ? 10.316  -1.490  34.630  1.00 87.79  ? 993  LYS A C   1 
ATOM   6741 O O   . LYS A 1 977  ? 10.584  -1.098  35.776  1.00 89.64  ? 993  LYS A O   1 
ATOM   6742 C CB  . LYS A 1 977  ? 9.586   -3.943  34.900  1.00 84.51  ? 993  LYS A CB  1 
ATOM   6743 C CG  . LYS A 1 977  ? 11.030  -4.379  34.588  1.00 97.04  ? 993  LYS A CG  1 
ATOM   6744 C CD  . LYS A 1 977  ? 11.339  -5.771  35.135  1.00 102.32 ? 993  LYS A CD  1 
ATOM   6745 N N   . ASP A 1 978  ? 10.955  -1.034  33.520  1.00 82.25  ? 994  ASP A N   1 
ATOM   6746 C CA  . ASP A 1 978  ? 12.009  -0.018  33.572  1.00 81.64  ? 994  ASP A CA  1 
ATOM   6747 C C   . ASP A 1 978  ? 11.358  1.337   33.868  1.00 84.94  ? 994  ASP A C   1 
ATOM   6748 O O   . ASP A 1 978  ? 11.816  2.053   34.754  1.00 84.51  ? 994  ASP A O   1 
ATOM   6749 C CB  . ASP A 1 978  ? 12.812  0.040   32.259  1.00 84.19  ? 994  ASP A CB  1 
ATOM   6750 C CG  . ASP A 1 978  ? 13.482  -1.253  31.821  1.00 102.70 ? 994  ASP A CG  1 
ATOM   6751 O OD1 . ASP A 1 978  ? 14.105  -1.923  32.673  1.00 105.42 ? 994  ASP A OD1 1 
ATOM   6752 O OD2 . ASP A 1 978  ? 13.435  -1.563  30.615  1.00 111.07 ? 994  ASP A OD2 1 
ATOM   6753 N N   . ILE A 1 979  ? 10.254  1.658   33.159  1.00 81.68  ? 995  ILE A N   1 
ATOM   6754 C CA  . ILE A 1 979  ? 9.448   2.876   33.336  1.00 81.41  ? 995  ILE A CA  1 
ATOM   6755 C C   . ILE A 1 979  ? 8.780   2.804   34.714  1.00 85.55  ? 995  ILE A C   1 
ATOM   6756 O O   . ILE A 1 979  ? 8.651   3.824   35.395  1.00 86.25  ? 995  ILE A O   1 
ATOM   6757 C CB  . ILE A 1 979  ? 8.419   3.035   32.168  1.00 84.42  ? 995  ILE A CB  1 
ATOM   6758 C CG1 . ILE A 1 979  ? 9.101   3.494   30.873  1.00 84.27  ? 995  ILE A CG1 1 
ATOM   6759 C CG2 . ILE A 1 979  ? 7.264   3.973   32.510  1.00 85.64  ? 995  ILE A CG2 1 
ATOM   6760 N N   . GLN A 1 980  ? 8.397   1.583   35.138  1.00 81.23  ? 996  GLN A N   1 
ATOM   6761 C CA  . GLN A 1 980  ? 7.782   1.333   36.445  1.00 79.70  ? 996  GLN A CA  1 
ATOM   6762 C C   . GLN A 1 980  ? 8.731   1.787   37.548  1.00 79.88  ? 996  GLN A C   1 
ATOM   6763 O O   . GLN A 1 980  ? 8.272   2.377   38.536  1.00 77.21  ? 996  GLN A O   1 
ATOM   6764 C CB  . GLN A 1 980  ? 7.398   -0.155  36.592  1.00 80.76  ? 996  GLN A CB  1 
ATOM   6765 C CG  . GLN A 1 980  ? 6.756   -0.551  37.930  1.00 92.62  ? 996  GLN A CG  1 
ATOM   6766 C CD  . GLN A 1 980  ? 5.410   0.083   38.189  1.00 101.32 ? 996  GLN A CD  1 
ATOM   6767 O OE1 . GLN A 1 980  ? 4.438   -0.127  37.454  1.00 100.15 ? 996  GLN A OE1 1 
ATOM   6768 N NE2 . GLN A 1 980  ? 5.314   0.841   39.272  1.00 81.40  ? 996  GLN A NE2 1 
ATOM   6769 N N   . TYR A 1 981  ? 10.064  1.579   37.345  1.00 75.78  ? 997  TYR A N   1 
ATOM   6770 C CA  . TYR A 1 981  ? 11.065  2.016   38.323  1.00 75.50  ? 997  TYR A CA  1 
ATOM   6771 C C   . TYR A 1 981  ? 10.763  3.452   38.771  1.00 77.99  ? 997  TYR A C   1 
ATOM   6772 O O   . TYR A 1 981  ? 10.612  3.696   39.964  1.00 78.91  ? 997  TYR A O   1 
ATOM   6773 C CB  . TYR A 1 981  ? 12.498  1.900   37.780  1.00 77.03  ? 997  TYR A CB  1 
ATOM   6774 C CG  . TYR A 1 981  ? 13.532  2.131   38.853  1.00 79.79  ? 997  TYR A CG  1 
ATOM   6775 C CD1 . TYR A 1 981  ? 13.859  3.419   39.270  1.00 81.67  ? 997  TYR A CD1 1 
ATOM   6776 C CD2 . TYR A 1 981  ? 14.137  1.062   39.502  1.00 81.64  ? 997  TYR A CD2 1 
ATOM   6777 C CE1 . TYR A 1 981  ? 14.741  3.636   40.325  1.00 83.52  ? 997  TYR A CE1 1 
ATOM   6778 C CE2 . TYR A 1 981  ? 15.041  1.267   40.545  1.00 83.43  ? 997  TYR A CE2 1 
ATOM   6779 C CZ  . TYR A 1 981  ? 15.346  2.557   40.951  1.00 92.30  ? 997  TYR A CZ  1 
ATOM   6780 O OH  . TYR A 1 981  ? 16.240  2.757   41.977  1.00 93.90  ? 997  TYR A OH  1 
ATOM   6781 N N   . LEU A 1 982  ? 10.603  4.365   37.803  1.00 71.51  ? 998  LEU A N   1 
ATOM   6782 C CA  . LEU A 1 982  ? 10.281  5.761   37.998  1.00 70.06  ? 998  LEU A CA  1 
ATOM   6783 C C   . LEU A 1 982  ? 9.019   6.017   38.798  1.00 74.62  ? 998  LEU A C   1 
ATOM   6784 O O   . LEU A 1 982  ? 8.997   6.961   39.590  1.00 73.70  ? 998  LEU A O   1 
ATOM   6785 C CB  . LEU A 1 982  ? 10.161  6.437   36.654  1.00 69.75  ? 998  LEU A CB  1 
ATOM   6786 C CG  . LEU A 1 982  ? 11.434  6.907   36.020  1.00 74.53  ? 998  LEU A CG  1 
ATOM   6787 C CD1 . LEU A 1 982  ? 11.107  7.679   34.775  1.00 75.36  ? 998  LEU A CD1 1 
ATOM   6788 C CD2 . LEU A 1 982  ? 12.255  7.786   36.968  1.00 74.21  ? 998  LEU A CD2 1 
ATOM   6789 N N   . LYS A 1 983  ? 7.957   5.215   38.576  1.00 72.65  ? 999  LYS A N   1 
ATOM   6790 C CA  . LYS A 1 983  ? 6.683   5.356   39.307  1.00 72.74  ? 999  LYS A CA  1 
ATOM   6791 C C   . LYS A 1 983  ? 6.952   5.139   40.808  1.00 77.13  ? 999  LYS A C   1 
ATOM   6792 O O   . LYS A 1 983  ? 6.563   5.958   41.649  1.00 76.20  ? 999  LYS A O   1 
ATOM   6793 C CB  . LYS A 1 983  ? 5.657   4.326   38.790  1.00 74.63  ? 999  LYS A CB  1 
ATOM   6794 C CG  . LYS A 1 983  ? 4.504   4.903   37.998  1.00 73.17  ? 999  LYS A CG  1 
ATOM   6795 C CD  . LYS A 1 983  ? 3.862   3.843   37.129  1.00 82.98  ? 999  LYS A CD  1 
ATOM   6796 C CE  . LYS A 1 983  ? 4.375   3.843   35.702  1.00 89.56  ? 999  LYS A CE  1 
ATOM   6797 N NZ  . LYS A 1 983  ? 3.370   3.275   34.763  1.00 96.40  ? 999  LYS A NZ  1 
ATOM   6798 N N   . ASP A 1 984  ? 7.698   4.063   41.117  1.00 74.20  ? 1000 ASP A N   1 
ATOM   6799 C CA  . ASP A 1 984  ? 8.083   3.713   42.477  1.00 74.16  ? 1000 ASP A CA  1 
ATOM   6800 C C   . ASP A 1 984  ? 9.082   4.726   43.074  1.00 77.66  ? 1000 ASP A C   1 
ATOM   6801 O O   . ASP A 1 984  ? 8.776   5.303   44.124  1.00 77.15  ? 1000 ASP A O   1 
ATOM   6802 C CB  . ASP A 1 984  ? 8.563   2.258   42.548  1.00 75.54  ? 1000 ASP A CB  1 
ATOM   6803 C CG  . ASP A 1 984  ? 7.493   1.284   42.062  1.00 89.99  ? 1000 ASP A CG  1 
ATOM   6804 O OD1 . ASP A 1 984  ? 6.291   1.664   42.058  1.00 88.95  ? 1000 ASP A OD1 1 
ATOM   6805 O OD2 . ASP A 1 984  ? 7.858   0.164   41.642  1.00 102.71 ? 1000 ASP A OD2 1 
ATOM   6806 N N   . SER A 1 985  ? 10.214  5.003   42.379  1.00 73.15  ? 1001 SER A N   1 
ATOM   6807 C CA  . SER A 1 985  ? 11.210  5.992   42.826  1.00 73.01  ? 1001 SER A CA  1 
ATOM   6808 C C   . SER A 1 985  ? 10.566  7.353   43.186  1.00 77.15  ? 1001 SER A C   1 
ATOM   6809 O O   . SER A 1 985  ? 10.875  7.907   44.232  1.00 76.50  ? 1001 SER A O   1 
ATOM   6810 C CB  . SER A 1 985  ? 12.327  6.162   41.793  1.00 75.07  ? 1001 SER A CB  1 
ATOM   6811 O OG  . SER A 1 985  ? 12.199  7.316   40.973  1.00 76.31  ? 1001 SER A OG  1 
ATOM   6812 N N   . LEU A 1 986  ? 9.638   7.842   42.344  1.00 74.31  ? 1002 LEU A N   1 
ATOM   6813 C CA  . LEU A 1 986  ? 8.947   9.109   42.543  1.00 74.50  ? 1002 LEU A CA  1 
ATOM   6814 C C   . LEU A 1 986  ? 7.661   8.970   43.343  1.00 80.99  ? 1002 LEU A C   1 
ATOM   6815 O O   . LEU A 1 986  ? 6.877   9.923   43.365  1.00 81.50  ? 1002 LEU A O   1 
ATOM   6816 C CB  . LEU A 1 986  ? 8.620   9.747   41.185  1.00 74.22  ? 1002 LEU A CB  1 
ATOM   6817 C CG  . LEU A 1 986  ? 9.626   10.732  40.633  1.00 78.31  ? 1002 LEU A CG  1 
ATOM   6818 C CD1 . LEU A 1 986  ? 9.227   11.163  39.241  1.00 77.91  ? 1002 LEU A CD1 1 
ATOM   6819 C CD2 . LEU A 1 986  ? 9.782   11.938  41.548  1.00 79.65  ? 1002 LEU A CD2 1 
ATOM   6820 N N   . ALA A 1 987  ? 7.401   7.779   43.943  1.00 77.45  ? 1003 ALA A N   1 
ATOM   6821 C CA  . ALA A 1 987  ? 6.197   7.479   44.741  1.00 77.20  ? 1003 ALA A CA  1 
ATOM   6822 C C   . ALA A 1 987  ? 4.943   8.079   44.086  1.00 82.36  ? 1003 ALA A C   1 
ATOM   6823 O O   . ALA A 1 987  ? 4.069   8.655   44.755  1.00 82.16  ? 1003 ALA A O   1 
ATOM   6824 C CB  . ALA A 1 987  ? 6.371   7.971   46.179  1.00 77.60  ? 1003 ALA A CB  1 
ATOM   6825 N N   . LEU A 1 988  ? 4.902   7.952   42.735  1.00 79.56  ? 1004 LEU A N   1 
ATOM   6826 C CA  . LEU A 1 988  ? 3.886   8.463   41.812  1.00 79.36  ? 1004 LEU A CA  1 
ATOM   6827 C C   . LEU A 1 988  ? 2.445   8.109   42.231  1.00 85.33  ? 1004 LEU A C   1 
ATOM   6828 O O   . LEU A 1 988  ? 1.569   8.980   42.177  1.00 84.76  ? 1004 LEU A O   1 
ATOM   6829 C CB  . LEU A 1 988  ? 4.201   8.023   40.363  1.00 78.80  ? 1004 LEU A CB  1 
ATOM   6830 C CG  . LEU A 1 988  ? 4.976   9.033   39.490  1.00 82.08  ? 1004 LEU A CG  1 
ATOM   6831 N N   . GLY A 1 989  ? 2.245   6.872   42.707  1.00 83.69  ? 1005 GLY A N   1 
ATOM   6832 C CA  . GLY A 1 989  ? 0.955   6.384   43.181  1.00 84.65  ? 1005 GLY A CA  1 
ATOM   6833 C C   . GLY A 1 989  ? 0.490   7.137   44.413  1.00 92.48  ? 1005 GLY A C   1 
ATOM   6834 O O   . GLY A 1 989  ? -0.474  7.917   44.338  1.00 93.98  ? 1005 GLY A O   1 
ATOM   6835 N N   . LYS A 1 990  ? 1.246   6.956   45.536  1.00 88.05  ? 1006 LYS A N   1 
ATOM   6836 C CA  . LYS A 1 990  ? 1.067   7.529   46.882  1.00 86.54  ? 1006 LYS A CA  1 
ATOM   6837 C C   . LYS A 1 990  ? 0.808   9.016   46.849  1.00 90.41  ? 1006 LYS A C   1 
ATOM   6838 O O   . LYS A 1 990  ? 1.413   9.714   46.055  1.00 90.76  ? 1006 LYS A O   1 
ATOM   6839 C CB  . LYS A 1 990  ? 2.326   7.288   47.762  1.00 87.40  ? 1006 LYS A CB  1 
ATOM   6840 C CG  . LYS A 1 990  ? 2.689   5.832   48.090  1.00 77.18  ? 1006 LYS A CG  1 
ATOM   6841 C CD  . LYS A 1 990  ? 4.091   5.764   48.714  1.00 76.99  ? 1006 LYS A CD  1 
ATOM   6842 C CE  . LYS A 1 990  ? 4.643   4.372   48.939  1.00 73.83  ? 1006 LYS A CE  1 
ATOM   6843 N N   . THR A 1 991  ? -0.036  9.505   47.757  1.00 88.08  ? 1007 THR A N   1 
ATOM   6844 C CA  . THR A 1 991  ? -0.362  10.926  47.939  1.00 88.77  ? 1007 THR A CA  1 
ATOM   6845 C C   . THR A 1 991  ? 0.929   11.711  48.300  1.00 94.14  ? 1007 THR A C   1 
ATOM   6846 O O   . THR A 1 991  ? 1.888   11.104  48.796  1.00 92.36  ? 1007 THR A O   1 
ATOM   6847 C CB  . THR A 1 991  ? -1.451  11.087  49.047  1.00 94.90  ? 1007 THR A CB  1 
ATOM   6848 O OG1 . THR A 1 991  ? -0.882  10.926  50.357  1.00 91.55  ? 1007 THR A OG1 1 
ATOM   6849 C CG2 . THR A 1 991  ? -2.635  10.127  48.869  1.00 90.12  ? 1007 THR A CG2 1 
ATOM   6850 N N   . GLU A 1 992  ? 0.938   13.051  48.078  1.00 92.87  ? 1008 GLU A N   1 
ATOM   6851 C CA  . GLU A 1 992  ? 2.097   13.914  48.366  1.00 93.24  ? 1008 GLU A CA  1 
ATOM   6852 C C   . GLU A 1 992  ? 2.604   13.749  49.815  1.00 99.18  ? 1008 GLU A C   1 
ATOM   6853 O O   . GLU A 1 992  ? 3.821   13.672  50.028  1.00 99.11  ? 1008 GLU A O   1 
ATOM   6854 C CB  . GLU A 1 992  ? 1.815   15.387  48.001  1.00 94.52  ? 1008 GLU A CB  1 
ATOM   6855 C CG  . GLU A 1 992  ? 3.083   16.196  47.755  1.00 110.17 ? 1008 GLU A CG  1 
ATOM   6856 C CD  . GLU A 1 992  ? 2.973   17.388  46.818  1.00 146.15 ? 1008 GLU A CD  1 
ATOM   6857 O OE1 . GLU A 1 992  ? 2.748   18.516  47.316  1.00 149.98 ? 1008 GLU A OE1 1 
ATOM   6858 O OE2 . GLU A 1 992  ? 3.177   17.208  45.594  1.00 142.91 ? 1008 GLU A OE2 1 
ATOM   6859 N N   . GLU A 1 993  ? 1.666   13.632  50.789  1.00 96.40  ? 1009 GLU A N   1 
ATOM   6860 C CA  . GLU A 1 993  ? 1.967   13.419  52.205  1.00 96.51  ? 1009 GLU A CA  1 
ATOM   6861 C C   . GLU A 1 993  ? 2.582   12.020  52.430  1.00 99.83  ? 1009 GLU A C   1 
ATOM   6862 O O   . GLU A 1 993  ? 3.637   11.926  53.071  1.00 99.49  ? 1009 GLU A O   1 
ATOM   6863 C CB  . GLU A 1 993  ? 0.703   13.611  53.061  1.00 98.36  ? 1009 GLU A CB  1 
ATOM   6864 C CG  . GLU A 1 993  ? 0.628   14.945  53.791  1.00 112.83 ? 1009 GLU A CG  1 
ATOM   6865 C CD  . GLU A 1 993  ? 1.466   15.055  55.055  1.00 132.95 ? 1009 GLU A CD  1 
ATOM   6866 O OE1 . GLU A 1 993  ? 1.119   14.399  56.066  1.00 123.99 ? 1009 GLU A OE1 1 
ATOM   6867 O OE2 . GLU A 1 993  ? 2.453   15.826  55.041  1.00 122.34 ? 1009 GLU A OE2 1 
ATOM   6868 N N   . GLU A 1 994  ? 1.941   10.946  51.866  1.00 95.06  ? 1010 GLU A N   1 
ATOM   6869 C CA  . GLU A 1 994  ? 2.375   9.540   51.938  1.00 93.77  ? 1010 GLU A CA  1 
ATOM   6870 C C   . GLU A 1 994  ? 3.765   9.328   51.320  1.00 97.82  ? 1010 GLU A C   1 
ATOM   6871 O O   . GLU A 1 994  ? 4.548   8.515   51.821  1.00 96.86  ? 1010 GLU A O   1 
ATOM   6872 C CB  . GLU A 1 994  ? 1.344   8.615   51.279  1.00 94.74  ? 1010 GLU A CB  1 
ATOM   6873 C CG  . GLU A 1 994  ? 0.179   8.256   52.177  1.00 102.78 ? 1010 GLU A CG  1 
ATOM   6874 N N   . ALA A 1 995  ? 4.065   10.078  50.238  1.00 95.12  ? 1011 ALA A N   1 
ATOM   6875 C CA  . ALA A 1 995  ? 5.337   10.081  49.510  1.00 95.03  ? 1011 ALA A CA  1 
ATOM   6876 C C   . ALA A 1 995  ? 6.448   10.728  50.350  1.00 99.06  ? 1011 ALA A C   1 
ATOM   6877 O O   . ALA A 1 995  ? 7.564   10.187  50.441  1.00 98.42  ? 1011 ALA A O   1 
ATOM   6878 C CB  . ALA A 1 995  ? 5.174   10.855  48.213  1.00 95.72  ? 1011 ALA A CB  1 
ATOM   6879 N N   . LEU A 1 996  ? 6.135   11.909  50.940  1.00 95.06  ? 1012 LEU A N   1 
ATOM   6880 C CA  . LEU A 1 996  ? 7.056   12.685  51.763  1.00 94.16  ? 1012 LEU A CA  1 
ATOM   6881 C C   . LEU A 1 996  ? 7.476   11.963  53.032  1.00 95.73  ? 1012 LEU A C   1 
ATOM   6882 O O   . LEU A 1 996  ? 8.629   12.094  53.439  1.00 95.07  ? 1012 LEU A O   1 
ATOM   6883 C CB  . LEU A 1 996  ? 6.485   14.068  52.065  1.00 94.27  ? 1012 LEU A CB  1 
ATOM   6884 C CG  . LEU A 1 996  ? 7.509   15.188  52.255  1.00 98.99  ? 1012 LEU A CG  1 
ATOM   6885 C CD1 . LEU A 1 996  ? 8.526   15.232  51.117  1.00 98.39  ? 1012 LEU A CD1 1 
ATOM   6886 C CD2 . LEU A 1 996  ? 6.809   16.542  52.434  1.00 101.85 ? 1012 LEU A CD2 1 
ATOM   6887 N N   . LYS A 1 997  ? 6.571   11.164  53.629  1.00 90.63  ? 1013 LYS A N   1 
ATOM   6888 C CA  . LYS A 1 997  ? 6.908   10.401  54.830  1.00 89.43  ? 1013 LYS A CA  1 
ATOM   6889 C C   . LYS A 1 997  ? 7.768   9.179   54.476  1.00 92.48  ? 1013 LYS A C   1 
ATOM   6890 O O   . LYS A 1 997  ? 8.639   8.820   55.276  1.00 91.86  ? 1013 LYS A O   1 
ATOM   6891 C CB  . LYS A 1 997  ? 5.687   10.067  55.726  1.00 91.15  ? 1013 LYS A CB  1 
ATOM   6892 C CG  . LYS A 1 997  ? 4.517   9.331   55.076  1.00 107.74 ? 1013 LYS A CG  1 
ATOM   6893 C CD  . LYS A 1 997  ? 3.188   9.700   55.765  1.00 118.80 ? 1013 LYS A CD  1 
ATOM   6894 C CE  . LYS A 1 997  ? 2.060   8.720   55.503  1.00 121.59 ? 1013 LYS A CE  1 
ATOM   6895 N NZ  . LYS A 1 997  ? 0.733   9.400   55.443  1.00 120.01 ? 1013 LYS A NZ  1 
ATOM   6896 N N   . HIS A 1 998  ? 7.588   8.583   53.266  1.00 89.30  ? 1014 HIS A N   1 
ATOM   6897 C CA  . HIS A 1 998  ? 8.450   7.463   52.855  1.00 89.34  ? 1014 HIS A CA  1 
ATOM   6898 C C   . HIS A 1 998  ? 9.827   7.970   52.398  1.00 88.20  ? 1014 HIS A C   1 
ATOM   6899 O O   . HIS A 1 998  ? 10.825  7.283   52.649  1.00 87.03  ? 1014 HIS A O   1 
ATOM   6900 C CB  . HIS A 1 998  ? 7.818   6.507   51.819  1.00 91.40  ? 1014 HIS A CB  1 
ATOM   6901 C CG  . HIS A 1 998  ? 8.368   5.103   51.912  1.00 95.80  ? 1014 HIS A CG  1 
ATOM   6902 N ND1 . HIS A 1 998  ? 9.711   4.826   51.662  1.00 97.85  ? 1014 HIS A ND1 1 
ATOM   6903 C CD2 . HIS A 1 998  ? 7.748   3.947   52.257  1.00 97.99  ? 1014 HIS A CD2 1 
ATOM   6904 C CE1 . HIS A 1 998  ? 9.857   3.525   51.855  1.00 97.30  ? 1014 HIS A CE1 1 
ATOM   6905 N NE2 . HIS A 1 998  ? 8.706   2.951   52.211  1.00 97.68  ? 1014 HIS A NE2 1 
ATOM   6906 N N   . PHE A 1 999  ? 9.889   9.187   51.775  1.00 80.87  ? 1015 PHE A N   1 
ATOM   6907 C CA  . PHE A 1 999  ? 11.160  9.800   51.374  1.00 78.79  ? 1015 PHE A CA  1 
ATOM   6908 C C   . PHE A 1 999  ? 12.002  10.038  52.619  1.00 80.34  ? 1015 PHE A C   1 
ATOM   6909 O O   . PHE A 1 999  ? 13.183  9.691   52.645  1.00 77.26  ? 1015 PHE A O   1 
ATOM   6910 C CB  . PHE A 1 999  ? 10.951  11.113  50.584  1.00 79.83  ? 1015 PHE A CB  1 
ATOM   6911 C CG  . PHE A 1 999  ? 12.241  11.770  50.119  1.00 80.02  ? 1015 PHE A CG  1 
ATOM   6912 C CD1 . PHE A 1 999  ? 13.115  11.103  49.267  1.00 81.27  ? 1015 PHE A CD1 1 
ATOM   6913 C CD2 . PHE A 1 999  ? 12.578  13.054  50.536  1.00 81.28  ? 1015 PHE A CD2 1 
ATOM   6914 C CE1 . PHE A 1 999  ? 14.306  11.703  48.848  1.00 81.70  ? 1015 PHE A CE1 1 
ATOM   6915 C CE2 . PHE A 1 999  ? 13.758  13.661  50.098  1.00 83.52  ? 1015 PHE A CE2 1 
ATOM   6916 C CZ  . PHE A 1 999  ? 14.613  12.980  49.256  1.00 81.26  ? 1015 PHE A CZ  1 
ATOM   6917 N N   . ARG A 1 1000 ? 11.342  10.556  53.674  1.00 78.82  ? 1016 ARG A N   1 
ATOM   6918 C CA  . ARG A 1 1000 ? 11.906  10.825  54.995  1.00 78.96  ? 1016 ARG A CA  1 
ATOM   6919 C C   . ARG A 1 1000 ? 12.507  9.556   55.633  1.00 82.94  ? 1016 ARG A C   1 
ATOM   6920 O O   . ARG A 1 1000 ? 13.681  9.572   56.004  1.00 82.00  ? 1016 ARG A O   1 
ATOM   6921 C CB  . ARG A 1 1000 ? 10.861  11.508  55.890  1.00 78.94  ? 1016 ARG A CB  1 
ATOM   6922 C CG  . ARG A 1 1000 ? 10.677  12.988  55.535  1.00 90.29  ? 1016 ARG A CG  1 
ATOM   6923 C CD  . ARG A 1 1000 ? 9.556   13.667  56.306  1.00 98.18  ? 1016 ARG A CD  1 
ATOM   6924 N NE  . ARG A 1 1000 ? 9.490   15.104  56.014  1.00 103.04 ? 1016 ARG A NE  1 
ATOM   6925 C CZ  . ARG A 1 1000 ? 8.367   15.776  55.765  1.00 111.74 ? 1016 ARG A CZ  1 
ATOM   6926 N NH1 . ARG A 1 1000 ? 7.196   15.152  55.771  1.00 107.64 ? 1016 ARG A NH1 1 
ATOM   6927 N NH2 . ARG A 1 1000 ? 8.408   17.077  55.502  1.00 81.50  ? 1016 ARG A NH2 1 
ATOM   6928 N N   . VAL A 1 1001 ? 11.744  8.442   55.664  1.00 80.09  ? 1017 VAL A N   1 
ATOM   6929 C CA  . VAL A 1 1001 ? 12.196  7.144   56.211  1.00 80.63  ? 1017 VAL A CA  1 
ATOM   6930 C C   . VAL A 1 1001 ? 13.479  6.654   55.509  1.00 86.10  ? 1017 VAL A C   1 
ATOM   6931 O O   . VAL A 1 1001 ? 14.431  6.208   56.169  1.00 84.42  ? 1017 VAL A O   1 
ATOM   6932 C CB  . VAL A 1 1001 ? 11.040  6.096   56.201  1.00 84.29  ? 1017 VAL A CB  1 
ATOM   6933 C CG1 . VAL A 1 1001 ? 11.547  4.656   56.363  1.00 83.06  ? 1017 VAL A CG1 1 
ATOM   6934 C CG2 . VAL A 1 1001 ? 9.997   6.437   57.272  1.00 84.50  ? 1017 VAL A CG2 1 
ATOM   6935 N N   . LYS A 1 1002 ? 13.497  6.792   54.165  1.00 84.92  ? 1018 LYS A N   1 
ATOM   6936 C CA  . LYS A 1 1002 ? 14.606  6.426   53.280  1.00 84.52  ? 1018 LYS A CA  1 
ATOM   6937 C C   . LYS A 1 1002 ? 15.785  7.382   53.488  1.00 88.63  ? 1018 LYS A C   1 
ATOM   6938 O O   . LYS A 1 1002 ? 16.931  6.921   53.511  1.00 88.74  ? 1018 LYS A O   1 
ATOM   6939 C CB  . LYS A 1 1002 ? 14.144  6.401   51.813  1.00 86.40  ? 1018 LYS A CB  1 
ATOM   6940 C CG  . LYS A 1 1002 ? 13.129  5.296   51.500  1.00 93.50  ? 1018 LYS A CG  1 
ATOM   6941 C CD  . LYS A 1 1002 ? 12.619  5.382   50.074  1.00 99.70  ? 1018 LYS A CD  1 
ATOM   6942 N N   . PHE A 1 1003 ? 15.502  8.691   53.706  1.00 84.52  ? 1019 PHE A N   1 
ATOM   6943 C CA  . PHE A 1 1003 ? 16.524  9.700   53.973  1.00 85.02  ? 1019 PHE A CA  1 
ATOM   6944 C C   . PHE A 1 1003 ? 17.239  9.370   55.284  1.00 92.88  ? 1019 PHE A C   1 
ATOM   6945 O O   . PHE A 1 1003 ? 18.468  9.229   55.287  1.00 92.94  ? 1019 PHE A O   1 
ATOM   6946 C CB  . PHE A 1 1003 ? 15.902  11.107  54.043  1.00 86.56  ? 1019 PHE A CB  1 
ATOM   6947 C CG  . PHE A 1 1003 ? 16.859  12.276  54.177  1.00 88.06  ? 1019 PHE A CG  1 
ATOM   6948 C CD1 . PHE A 1 1003 ? 17.515  12.531  55.382  1.00 90.89  ? 1019 PHE A CD1 1 
ATOM   6949 C CD2 . PHE A 1 1003 ? 17.036  13.174  53.132  1.00 89.96  ? 1019 PHE A CD2 1 
ATOM   6950 C CE1 . PHE A 1 1003 ? 18.373  13.627  55.516  1.00 91.37  ? 1019 PHE A CE1 1 
ATOM   6951 C CE2 . PHE A 1 1003 ? 17.893  14.273  53.271  1.00 92.59  ? 1019 PHE A CE2 1 
ATOM   6952 C CZ  . PHE A 1 1003 ? 18.551  14.493  54.462  1.00 90.59  ? 1019 PHE A CZ  1 
ATOM   6953 N N   . ASN A 1 1004 ? 16.461  9.238   56.392  1.00 91.31  ? 1020 ASN A N   1 
ATOM   6954 C CA  . ASN A 1 1004 ? 16.947  8.958   57.747  1.00 91.56  ? 1020 ASN A CA  1 
ATOM   6955 C C   . ASN A 1 1004 ? 17.777  7.707   57.819  1.00 98.34  ? 1020 ASN A C   1 
ATOM   6956 O O   . ASN A 1 1004 ? 18.826  7.718   58.463  1.00 98.48  ? 1020 ASN A O   1 
ATOM   6957 C CB  . ASN A 1 1004 ? 15.794  8.894   58.741  1.00 90.91  ? 1020 ASN A CB  1 
ATOM   6958 C CG  . ASN A 1 1004 ? 14.971  10.160  58.817  1.00 105.62 ? 1020 ASN A CG  1 
ATOM   6959 O OD1 . ASN A 1 1004 ? 15.386  11.242  58.358  1.00 97.65  ? 1020 ASN A OD1 1 
ATOM   6960 N ND2 . ASN A 1 1004 ? 13.770  10.042  59.382  1.00 90.34  ? 1020 ASN A ND2 1 
ATOM   6961 N N   . GLU A 1 1005 ? 17.349  6.644   57.124  1.00 96.96  ? 1021 GLU A N   1 
ATOM   6962 C CA  . GLU A 1 1005 ? 18.108  5.398   57.113  1.00 97.89  ? 1021 GLU A CA  1 
ATOM   6963 C C   . GLU A 1 1005 ? 19.384  5.491   56.258  1.00 103.11 ? 1021 GLU A C   1 
ATOM   6964 O O   . GLU A 1 1005 ? 20.341  4.769   56.554  1.00 103.05 ? 1021 GLU A O   1 
ATOM   6965 C CB  . GLU A 1 1005 ? 17.237  4.185   56.751  1.00 99.44  ? 1021 GLU A CB  1 
ATOM   6966 C CG  . GLU A 1 1005 ? 16.312  3.750   57.888  1.00 110.09 ? 1021 GLU A CG  1 
ATOM   6967 C CD  . GLU A 1 1005 ? 16.847  3.779   59.315  1.00 122.50 ? 1021 GLU A CD  1 
ATOM   6968 O OE1 . GLU A 1 1005 ? 17.889  3.135   59.579  1.00 115.20 ? 1021 GLU A OE1 1 
ATOM   6969 O OE2 . GLU A 1 1005 ? 16.192  4.408   60.180  1.00 104.49 ? 1021 GLU A OE2 1 
ATOM   6970 N N   . ALA A 1 1006 ? 19.429  6.424   55.263  1.00 100.08 ? 1022 ALA A N   1 
ATOM   6971 C CA  . ALA A 1 1006 ? 20.625  6.701   54.449  1.00 99.88  ? 1022 ALA A CA  1 
ATOM   6972 C C   . ALA A 1 1006 ? 21.678  7.395   55.342  1.00 103.39 ? 1022 ALA A C   1 
ATOM   6973 O O   . ALA A 1 1006 ? 22.874  7.192   55.155  1.00 102.73 ? 1022 ALA A O   1 
ATOM   6974 C CB  . ALA A 1 1006 ? 20.270  7.601   53.279  1.00 100.59 ? 1022 ALA A CB  1 
ATOM   6975 N N   . LEU A 1 1007 ? 21.212  8.197   56.319  1.00 99.56  ? 1023 LEU A N   1 
ATOM   6976 C CA  . LEU A 1 1007 ? 22.035  8.891   57.304  1.00 99.34  ? 1023 LEU A CA  1 
ATOM   6977 C C   . LEU A 1 1007 ? 22.553  7.885   58.368  1.00 104.38 ? 1023 LEU A C   1 
ATOM   6978 O O   . LEU A 1 1007 ? 23.692  8.004   58.827  1.00 103.41 ? 1023 LEU A O   1 
ATOM   6979 C CB  . LEU A 1 1007 ? 21.200  10.025  57.940  1.00 99.04  ? 1023 LEU A CB  1 
ATOM   6980 C CG  . LEU A 1 1007 ? 21.804  10.802  59.109  1.00 102.98 ? 1023 LEU A CG  1 
ATOM   6981 C CD1 . LEU A 1 1007 ? 23.021  11.599  58.679  1.00 103.32 ? 1023 LEU A CD1 1 
ATOM   6982 C CD2 . LEU A 1 1007 ? 20.774  11.686  59.756  1.00 103.31 ? 1023 LEU A CD2 1 
ATOM   6983 N N   . ARG A 1 1008 ? 21.708  6.900   58.745  1.00 102.34 ? 1024 ARG A N   1 
ATOM   6984 C CA  . ARG A 1 1008 ? 22.033  5.834   59.702  1.00 102.64 ? 1024 ARG A CA  1 
ATOM   6985 C C   . ARG A 1 1008 ? 23.064  4.883   59.100  1.00 107.06 ? 1024 ARG A C   1 
ATOM   6986 O O   . ARG A 1 1008 ? 24.084  4.610   59.736  1.00 106.66 ? 1024 ARG A O   1 
ATOM   6987 C CB  . ARG A 1 1008 ? 20.764  5.066   60.132  1.00 103.76 ? 1024 ARG A CB  1 
ATOM   6988 C CG  . ARG A 1 1008 ? 20.937  4.236   61.405  1.00 115.48 ? 1024 ARG A CG  1 
ATOM   6989 C CD  . ARG A 1 1008 ? 19.671  4.205   62.248  1.00 126.72 ? 1024 ARG A CD  1 
ATOM   6990 N N   . GLU A 1 1009 ? 22.809  4.405   57.865  1.00 104.54 ? 1025 GLU A N   1 
ATOM   6991 C CA  . GLU A 1 1009 ? 23.705  3.504   57.142  1.00 104.88 ? 1025 GLU A CA  1 
ATOM   6992 C C   . GLU A 1 1009 ? 24.994  4.221   56.697  1.00 110.95 ? 1025 GLU A C   1 
ATOM   6993 O O   . GLU A 1 1009 ? 25.996  3.562   56.409  1.00 109.58 ? 1025 GLU A O   1 
ATOM   6994 C CB  . GLU A 1 1009 ? 22.964  2.820   55.976  1.00 106.02 ? 1025 GLU A CB  1 
ATOM   6995 C CG  . GLU A 1 1009 ? 23.638  1.582   55.396  1.00 117.09 ? 1025 GLU A CG  1 
ATOM   6996 C CD  . GLU A 1 1009 ? 24.305  0.626   56.368  1.00 141.24 ? 1025 GLU A CD  1 
ATOM   6997 O OE1 . GLU A 1 1009 ? 23.639  0.185   57.334  1.00 138.12 ? 1025 GLU A OE1 1 
ATOM   6998 O OE2 . GLU A 1 1009 ? 25.501  0.317   56.159  1.00 133.42 ? 1025 GLU A OE2 1 
ATOM   6999 N N   . SER A 1 1010 ? 24.971  5.578   56.698  1.00 110.73 ? 1026 SER A N   1 
ATOM   7000 C CA  . SER A 1 1010 ? 26.102  6.449   56.341  1.00 111.67 ? 1026 SER A CA  1 
ATOM   7001 C C   . SER A 1 1010 ? 27.215  6.266   57.357  1.00 118.50 ? 1026 SER A C   1 
ATOM   7002 O O   . SER A 1 1010 ? 28.383  6.135   56.977  1.00 117.80 ? 1026 SER A O   1 
ATOM   7003 C CB  . SER A 1 1010 ? 25.661  7.912   56.306  1.00 113.96 ? 1026 SER A CB  1 
ATOM   7004 O OG  . SER A 1 1010 ? 26.736  8.797   56.053  1.00 119.98 ? 1026 SER A OG  1 
ATOM   7005 N N   . TRP A 1 1011 ? 26.828  6.231   58.650  1.00 117.82 ? 1027 TRP A N   1 
ATOM   7006 C CA  . TRP A 1 1011 ? 27.709  6.058   59.803  1.00 119.15 ? 1027 TRP A CA  1 
ATOM   7007 C C   . TRP A 1 1011 ? 28.459  4.712   59.769  1.00 125.11 ? 1027 TRP A C   1 
ATOM   7008 O O   . TRP A 1 1011 ? 29.674  4.691   59.995  1.00 124.64 ? 1027 TRP A O   1 
ATOM   7009 C CB  . TRP A 1 1011 ? 26.913  6.226   61.112  1.00 117.98 ? 1027 TRP A CB  1 
ATOM   7010 N N   . LYS A 1 1012 ? 27.734  3.608   59.454  1.00 122.94 ? 1028 LYS A N   1 
ATOM   7011 C CA  . LYS A 1 1012 ? 28.249  2.235   59.371  1.00 123.39 ? 1028 LYS A CA  1 
ATOM   7012 C C   . LYS A 1 1012 ? 29.388  2.079   58.349  1.00 129.97 ? 1028 LYS A C   1 
ATOM   7013 O O   . LYS A 1 1012 ? 30.383  1.409   58.653  1.00 130.62 ? 1028 LYS A O   1 
ATOM   7014 C CB  . LYS A 1 1012 ? 27.115  1.234   59.070  1.00 125.34 ? 1028 LYS A CB  1 
ATOM   7015 C CG  . LYS A 1 1012 ? 26.191  0.951   60.248  1.00 136.12 ? 1028 LYS A CG  1 
ATOM   7016 N N   . THR A 1 1013 ? 29.242  2.705   57.153  1.00 126.67 ? 1029 THR A N   1 
ATOM   7017 C CA  . THR A 1 1013 ? 30.209  2.657   56.049  1.00 151.40 ? 1029 THR A CA  1 
ATOM   7018 C C   . THR A 1 1013 ? 31.567  3.286   56.403  1.00 165.79 ? 1029 THR A C   1 
ATOM   7019 O O   . THR A 1 1013 ? 31.631  4.323   57.062  1.00 120.43 ? 1029 THR A O   1 
ATOM   7020 C CB  . THR A 1 1013 ? 29.599  3.275   54.786  1.00 159.13 ? 1029 THR A CB  1 
ATOM   7021 N N   . TYR B 2 1    ? -5.641  -34.045 41.126  1.00 100.54 ? 431  TYR B N   1 
ATOM   7022 C CA  . TYR B 2 1    ? -5.306  -33.493 39.818  1.00 100.58 ? 431  TYR B CA  1 
ATOM   7023 C C   . TYR B 2 1    ? -4.494  -32.196 39.904  1.00 109.59 ? 431  TYR B C   1 
ATOM   7024 O O   . TYR B 2 1    ? -3.649  -32.046 40.801  1.00 109.05 ? 431  TYR B O   1 
ATOM   7025 C CB  . TYR B 2 1    ? -6.553  -33.317 38.915  1.00 100.01 ? 431  TYR B CB  1 
ATOM   7026 C CG  . TYR B 2 1    ? -7.728  -32.584 39.529  1.00 99.84  ? 431  TYR B CG  1 
ATOM   7027 C CD1 . TYR B 2 1    ? -7.670  -31.217 39.783  1.00 101.63 ? 431  TYR B CD1 1 
ATOM   7028 C CD2 . TYR B 2 1    ? -8.936  -33.234 39.758  1.00 99.99  ? 431  TYR B CD2 1 
ATOM   7029 C CE1 . TYR B 2 1    ? -8.754  -30.538 40.334  1.00 101.80 ? 431  TYR B CE1 1 
ATOM   7030 C CE2 . TYR B 2 1    ? -10.023 -32.568 40.315  1.00 100.26 ? 431  TYR B CE2 1 
ATOM   7031 C CZ  . TYR B 2 1    ? -9.936  -31.215 40.576  1.00 106.76 ? 431  TYR B CZ  1 
ATOM   7032 O OH  . TYR B 2 1    ? -11.020 -30.561 41.094  1.00 110.39 ? 431  TYR B OH  1 
ATOM   7033 N N   . GLN B 2 2    ? -4.750  -31.273 38.932  1.00 109.51 ? 432  GLN B N   1 
ATOM   7034 C CA  . GLN B 2 2    ? -4.122  -29.966 38.727  1.00 110.98 ? 432  GLN B CA  1 
ATOM   7035 C C   . GLN B 2 2    ? -2.593  -30.093 38.505  1.00 118.64 ? 432  GLN B C   1 
ATOM   7036 O O   . GLN B 2 2    ? -1.873  -29.089 38.576  1.00 118.73 ? 432  GLN B O   1 
ATOM   7037 C CB  . GLN B 2 2    ? -4.496  -28.969 39.852  1.00 112.39 ? 432  GLN B CB  1 
ATOM   7038 N N   . GLN B 2 3    ? -2.117  -31.329 38.192  1.00 117.38 ? 433  GLN B N   1 
ATOM   7039 C CA  . GLN B 2 3    ? -0.711  -31.656 37.959  1.00 118.54 ? 433  GLN B CA  1 
ATOM   7040 C C   . GLN B 2 3    ? -0.196  -31.013 36.669  1.00 125.94 ? 433  GLN B C   1 
ATOM   7041 O O   . GLN B 2 3    ? -0.780  -31.227 35.601  1.00 126.09 ? 433  GLN B O   1 
ATOM   7042 C CB  . GLN B 2 3    ? -0.502  -33.179 37.951  1.00 119.83 ? 433  GLN B CB  1 
ATOM   7043 N N   . ASP B 2 4    ? 0.873   -30.195 36.781  1.00 124.51 ? 434  ASP B N   1 
ATOM   7044 C CA  . ASP B 2 4    ? 1.497   -29.484 35.655  1.00 125.57 ? 434  ASP B CA  1 
ATOM   7045 C C   . ASP B 2 4    ? 2.801   -30.177 35.155  1.00 131.60 ? 434  ASP B C   1 
ATOM   7046 O O   . ASP B 2 4    ? 3.034   -31.346 35.487  1.00 131.56 ? 434  ASP B O   1 
ATOM   7047 C CB  . ASP B 2 4    ? 1.718   -27.996 36.009  1.00 127.45 ? 434  ASP B CB  1 
ATOM   7048 N N   . GLN B 2 5    ? 3.633   -29.468 34.348  1.00 128.96 ? 435  GLN B N   1 
ATOM   7049 C CA  . GLN B 2 5    ? 4.892   -30.002 33.803  1.00 129.05 ? 435  GLN B CA  1 
ATOM   7050 C C   . GLN B 2 5    ? 6.102   -29.842 34.775  1.00 133.21 ? 435  GLN B C   1 
ATOM   7051 O O   . GLN B 2 5    ? 7.256   -29.966 34.345  1.00 132.41 ? 435  GLN B O   1 
ATOM   7052 C CB  . GLN B 2 5    ? 5.176   -29.396 32.413  1.00 130.27 ? 435  GLN B CB  1 
ATOM   7053 N N   . VAL B 2 6    ? 5.808   -29.627 36.092  1.00 130.01 ? 436  VAL B N   1 
ATOM   7054 C CA  . VAL B 2 6    ? 6.719   -29.414 37.236  1.00 129.77 ? 436  VAL B CA  1 
ATOM   7055 C C   . VAL B 2 6    ? 8.036   -30.217 37.180  1.00 133.54 ? 436  VAL B C   1 
ATOM   7056 O O   . VAL B 2 6    ? 8.008   -31.429 36.932  1.00 133.04 ? 436  VAL B O   1 
ATOM   7057 C CB  . VAL B 2 6    ? 5.990   -29.660 38.579  1.00 133.43 ? 436  VAL B CB  1 
ATOM   7058 N N   . VAL B 2 7    ? 9.183   -29.518 37.435  1.00 129.55 ? 437  VAL B N   1 
ATOM   7059 C CA  . VAL B 2 7    ? 10.559  -30.061 37.440  1.00 128.79 ? 437  VAL B CA  1 
ATOM   7060 C C   . VAL B 2 7    ? 10.817  -31.048 38.619  1.00 129.85 ? 437  VAL B C   1 
ATOM   7061 O O   . VAL B 2 7    ? 9.965   -31.214 39.508  1.00 128.89 ? 437  VAL B O   1 
ATOM   7062 C CB  . VAL B 2 7    ? 11.684  -28.977 37.343  1.00 132.78 ? 437  VAL B CB  1 
ATOM   7063 C CG1 . VAL B 2 7    ? 11.815  -28.432 35.920  1.00 132.63 ? 437  VAL B CG1 1 
ATOM   7064 C CG2 . VAL B 2 7    ? 11.505  -27.849 38.366  1.00 132.40 ? 437  VAL B CG2 1 
ATOM   7065 N N   . LYS B 2 8    ? 12.004  -31.711 38.587  1.00 123.97 ? 438  LYS B N   1 
ATOM   7066 C CA  . LYS B 2 8    ? 12.452  -32.722 39.555  1.00 122.28 ? 438  LYS B CA  1 
ATOM   7067 C C   . LYS B 2 8    ? 12.343  -32.280 41.031  1.00 120.33 ? 438  LYS B C   1 
ATOM   7068 O O   . LYS B 2 8    ? 13.191  -31.526 41.530  1.00 119.51 ? 438  LYS B O   1 
ATOM   7069 C CB  . LYS B 2 8    ? 13.877  -33.216 39.223  1.00 125.13 ? 438  LYS B CB  1 
ATOM   7070 C CG  . LYS B 2 8    ? 13.910  -34.606 38.589  1.00 138.03 ? 438  LYS B CG  1 
ATOM   7071 N N   . GLU B 2 9    ? 11.273  -32.765 41.709  1.00 112.31 ? 439  GLU B N   1 
ATOM   7072 C CA  . GLU B 2 9    ? 10.982  -32.523 43.127  1.00 110.12 ? 439  GLU B CA  1 
ATOM   7073 C C   . GLU B 2 9    ? 12.199  -32.971 43.943  1.00 110.87 ? 439  GLU B C   1 
ATOM   7074 O O   . GLU B 2 9    ? 12.591  -34.136 43.869  1.00 110.57 ? 439  GLU B O   1 
ATOM   7075 C CB  . GLU B 2 9    ? 9.729   -33.305 43.577  1.00 110.99 ? 439  GLU B CB  1 
ATOM   7076 C CG  . GLU B 2 9    ? 8.477   -33.046 42.753  1.00 118.34 ? 439  GLU B CG  1 
ATOM   7077 C CD  . GLU B 2 9    ? 7.661   -31.821 43.125  1.00 125.52 ? 439  GLU B CD  1 
ATOM   7078 O OE1 . GLU B 2 9    ? 8.201   -30.691 43.053  1.00 121.85 ? 439  GLU B OE1 1 
ATOM   7079 O OE2 . GLU B 2 9    ? 6.456   -31.990 43.422  1.00 99.30  ? 439  GLU B OE2 1 
ATOM   7080 N N   . ASP B 2 10   ? 12.856  -32.029 44.632  1.00 104.13 ? 440  ASP B N   1 
ATOM   7081 C CA  . ASP B 2 10   ? 14.063  -32.326 45.408  1.00 102.57 ? 440  ASP B CA  1 
ATOM   7082 C C   . ASP B 2 10   ? 14.177  -31.414 46.610  1.00 101.59 ? 440  ASP B C   1 
ATOM   7083 O O   . ASP B 2 10   ? 13.325  -30.549 46.844  1.00 101.62 ? 440  ASP B O   1 
ATOM   7084 C CB  . ASP B 2 10   ? 15.335  -32.153 44.545  1.00 105.16 ? 440  ASP B CB  1 
ATOM   7085 C CG  . ASP B 2 10   ? 15.665  -33.293 43.611  1.00 121.59 ? 440  ASP B CG  1 
ATOM   7086 O OD1 . ASP B 2 10   ? 16.104  -34.355 44.106  1.00 124.02 ? 440  ASP B OD1 1 
ATOM   7087 O OD2 . ASP B 2 10   ? 15.559  -33.097 42.377  1.00 126.66 ? 440  ASP B OD2 1 
ATOM   7088 N N   . ASN B 2 11   ? 15.262  -31.609 47.365  1.00 93.78  ? 441  ASN B N   1 
ATOM   7089 C CA  . ASN B 2 11   ? 15.642  -30.812 48.516  1.00 91.41  ? 441  ASN B CA  1 
ATOM   7090 C C   . ASN B 2 11   ? 15.961  -29.380 47.999  1.00 89.61  ? 441  ASN B C   1 
ATOM   7091 O O   . ASN B 2 11   ? 16.356  -29.217 46.842  1.00 87.90  ? 441  ASN B O   1 
ATOM   7092 C CB  . ASN B 2 11   ? 16.838  -31.502 49.203  1.00 92.48  ? 441  ASN B CB  1 
ATOM   7093 C CG  . ASN B 2 11   ? 17.800  -30.616 49.959  1.00 124.15 ? 441  ASN B CG  1 
ATOM   7094 O OD1 . ASN B 2 11   ? 18.908  -30.335 49.488  1.00 122.52 ? 441  ASN B OD1 1 
ATOM   7095 N ND2 . ASN B 2 11   ? 17.436  -30.224 51.176  1.00 113.96 ? 441  ASN B ND2 1 
ATOM   7096 N N   . ILE B 2 12   ? 15.717  -28.358 48.829  1.00 82.88  ? 442  ILE B N   1 
ATOM   7097 C CA  . ILE B 2 12   ? 15.955  -26.960 48.492  1.00 81.53  ? 442  ILE B CA  1 
ATOM   7098 C C   . ILE B 2 12   ? 17.428  -26.728 48.062  1.00 84.57  ? 442  ILE B C   1 
ATOM   7099 O O   . ILE B 2 12   ? 17.659  -26.069 47.048  1.00 84.49  ? 442  ILE B O   1 
ATOM   7100 C CB  . ILE B 2 12   ? 15.459  -26.047 49.650  1.00 84.54  ? 442  ILE B CB  1 
ATOM   7101 C CG1 . ILE B 2 12   ? 13.925  -25.929 49.631  1.00 84.68  ? 442  ILE B CG1 1 
ATOM   7102 C CG2 . ILE B 2 12   ? 16.108  -24.662 49.667  1.00 85.08  ? 442  ILE B CG2 1 
ATOM   7103 N N   . GLU B 2 13   ? 18.403  -27.327 48.771  1.00 80.20  ? 443  GLU B N   1 
ATOM   7104 C CA  . GLU B 2 13   ? 19.819  -27.188 48.439  1.00 78.98  ? 443  GLU B CA  1 
ATOM   7105 C C   . GLU B 2 13   ? 20.169  -27.818 47.097  1.00 81.38  ? 443  GLU B C   1 
ATOM   7106 O O   . GLU B 2 13   ? 20.963  -27.249 46.356  1.00 80.37  ? 443  GLU B O   1 
ATOM   7107 C CB  . GLU B 2 13   ? 20.705  -27.729 49.566  1.00 80.51  ? 443  GLU B CB  1 
ATOM   7108 C CG  . GLU B 2 13   ? 22.138  -27.208 49.544  1.00 97.28  ? 443  GLU B CG  1 
ATOM   7109 C CD  . GLU B 2 13   ? 22.334  -25.698 49.516  1.00 128.90 ? 443  GLU B CD  1 
ATOM   7110 O OE1 . GLU B 2 13   ? 21.711  -24.993 50.346  1.00 108.75 ? 443  GLU B OE1 1 
ATOM   7111 O OE2 . GLU B 2 13   ? 23.134  -25.225 48.673  1.00 133.85 ? 443  GLU B OE2 1 
ATOM   7112 N N   . ALA B 2 14   ? 19.550  -28.960 46.769  1.00 78.96  ? 444  ALA B N   1 
ATOM   7113 C CA  . ALA B 2 14   ? 19.741  -29.692 45.510  1.00 79.00  ? 444  ALA B CA  1 
ATOM   7114 C C   . ALA B 2 14   ? 19.249  -28.928 44.268  1.00 84.99  ? 444  ALA B C   1 
ATOM   7115 O O   . ALA B 2 14   ? 19.906  -28.997 43.234  1.00 85.31  ? 444  ALA B O   1 
ATOM   7116 C CB  . ALA B 2 14   ? 19.062  -31.048 45.590  1.00 79.59  ? 444  ALA B CB  1 
ATOM   7117 N N   . VAL B 2 15   ? 18.092  -28.220 44.366  1.00 83.32  ? 445  VAL B N   1 
ATOM   7118 C CA  . VAL B 2 15   ? 17.477  -27.405 43.292  1.00 83.40  ? 445  VAL B CA  1 
ATOM   7119 C C   . VAL B 2 15   ? 18.213  -26.045 43.137  1.00 87.33  ? 445  VAL B C   1 
ATOM   7120 O O   . VAL B 2 15   ? 18.279  -25.513 42.024  1.00 87.81  ? 445  VAL B O   1 
ATOM   7121 C CB  . VAL B 2 15   ? 15.935  -27.234 43.448  1.00 87.02  ? 445  VAL B CB  1 
ATOM   7122 C CG1 . VAL B 2 15   ? 15.315  -26.612 42.201  1.00 86.95  ? 445  VAL B CG1 1 
ATOM   7123 C CG2 . VAL B 2 15   ? 15.263  -28.567 43.734  1.00 86.70  ? 445  VAL B CG2 1 
ATOM   7124 N N   . GLY B 2 16   ? 18.780  -25.537 44.233  1.00 82.26  ? 446  GLY B N   1 
ATOM   7125 C CA  . GLY B 2 16   ? 19.546  -24.295 44.266  1.00 81.82  ? 446  GLY B CA  1 
ATOM   7126 C C   . GLY B 2 16   ? 20.913  -24.385 43.615  1.00 85.47  ? 446  GLY B C   1 
ATOM   7127 O O   . GLY B 2 16   ? 21.485  -23.364 43.223  1.00 84.23  ? 446  GLY B O   1 
ATOM   7128 N N   . LYS B 2 17   ? 21.450  -25.608 43.511  1.00 82.85  ? 447  LYS B N   1 
ATOM   7129 C CA  . LYS B 2 17   ? 22.752  -25.896 42.895  1.00 83.17  ? 447  LYS B CA  1 
ATOM   7130 C C   . LYS B 2 17   ? 22.568  -26.017 41.385  1.00 84.95  ? 447  LYS B C   1 
ATOM   7131 O O   . LYS B 2 17   ? 23.439  -25.595 40.612  1.00 84.64  ? 447  LYS B O   1 
ATOM   7132 C CB  . LYS B 2 17   ? 23.378  -27.180 43.486  1.00 87.06  ? 447  LYS B CB  1 
ATOM   7133 C CG  . LYS B 2 17   ? 23.912  -27.005 44.917  1.00 107.26 ? 447  LYS B CG  1 
ATOM   7134 N N   . LYS B 2 18   ? 21.416  -26.581 40.968  1.00 79.01  ? 448  LYS B N   1 
ATOM   7135 C CA  . LYS B 2 18   ? 21.068  -26.678 39.562  1.00 78.07  ? 448  LYS B CA  1 
ATOM   7136 C C   . LYS B 2 18   ? 20.747  -25.253 39.068  1.00 81.73  ? 448  LYS B C   1 
ATOM   7137 O O   . LYS B 2 18   ? 21.071  -24.944 37.931  1.00 82.99  ? 448  LYS B O   1 
ATOM   7138 C CB  . LYS B 2 18   ? 19.893  -27.630 39.316  1.00 80.03  ? 448  LYS B CB  1 
ATOM   7139 C CG  . LYS B 2 18   ? 20.121  -29.090 39.681  1.00 98.28  ? 448  LYS B CG  1 
ATOM   7140 C CD  . LYS B 2 18   ? 18.918  -29.965 39.270  1.00 110.82 ? 448  LYS B CD  1 
ATOM   7141 C CE  . LYS B 2 18   ? 17.845  -30.079 40.343  1.00 125.61 ? 448  LYS B CE  1 
ATOM   7142 N NZ  . LYS B 2 18   ? 16.528  -30.501 39.785  1.00 131.72 ? 448  LYS B NZ  1 
ATOM   7143 N N   . LEU B 2 19   ? 20.168  -24.373 39.927  1.00 75.80  ? 449  LEU B N   1 
ATOM   7144 C CA  . LEU B 2 19   ? 19.936  -22.974 39.571  1.00 75.13  ? 449  LEU B CA  1 
ATOM   7145 C C   . LEU B 2 19   ? 21.304  -22.299 39.400  1.00 81.96  ? 449  LEU B C   1 
ATOM   7146 O O   . LEU B 2 19   ? 21.458  -21.465 38.523  1.00 80.35  ? 449  LEU B O   1 
ATOM   7147 C CB  . LEU B 2 19   ? 19.087  -22.221 40.622  1.00 74.77  ? 449  LEU B CB  1 
ATOM   7148 C CG  . LEU B 2 19   ? 18.907  -20.694 40.407  1.00 78.82  ? 449  LEU B CG  1 
ATOM   7149 C CD1 . LEU B 2 19   ? 17.779  -20.380 39.443  1.00 78.29  ? 449  LEU B CD1 1 
ATOM   7150 C CD2 . LEU B 2 19   ? 18.676  -19.974 41.711  1.00 81.16  ? 449  LEU B CD2 1 
ATOM   7151 N N   . HIS B 2 20   ? 22.303  -22.666 40.208  1.00 82.88  ? 450  HIS B N   1 
ATOM   7152 C CA  . HIS B 2 20   ? 23.626  -22.063 40.033  1.00 84.71  ? 450  HIS B CA  1 
ATOM   7153 C C   . HIS B 2 20   ? 24.253  -22.559 38.721  1.00 89.20  ? 450  HIS B C   1 
ATOM   7154 O O   . HIS B 2 20   ? 24.741  -21.741 37.943  1.00 88.47  ? 450  HIS B O   1 
ATOM   7155 C CB  . HIS B 2 20   ? 24.545  -22.334 41.237  1.00 86.24  ? 450  HIS B CB  1 
ATOM   7156 C CG  . HIS B 2 20   ? 25.805  -21.524 41.220  1.00 90.15  ? 450  HIS B CG  1 
ATOM   7157 N ND1 . HIS B 2 20   ? 25.892  -20.311 41.882  1.00 92.12  ? 450  HIS B ND1 1 
ATOM   7158 C CD2 . HIS B 2 20   ? 26.989  -21.778 40.616  1.00 92.30  ? 450  HIS B CD2 1 
ATOM   7159 C CE1 . HIS B 2 20   ? 27.112  -19.861 41.651  1.00 91.70  ? 450  HIS B CE1 1 
ATOM   7160 N NE2 . HIS B 2 20   ? 27.816  -20.718 40.911  1.00 92.15  ? 450  HIS B NE2 1 
ATOM   7161 N N   . GLU B 2 21   ? 24.188  -23.890 38.471  1.00 85.65  ? 451  GLU B N   1 
ATOM   7162 C CA  . GLU B 2 21   ? 24.712  -24.534 37.272  1.00 85.22  ? 451  GLU B CA  1 
ATOM   7163 C C   . GLU B 2 21   ? 24.133  -23.903 36.011  1.00 88.57  ? 451  GLU B C   1 
ATOM   7164 O O   . GLU B 2 21   ? 24.906  -23.378 35.208  1.00 89.58  ? 451  GLU B O   1 
ATOM   7165 C CB  . GLU B 2 21   ? 24.456  -26.047 37.300  1.00 86.67  ? 451  GLU B CB  1 
ATOM   7166 C CG  . GLU B 2 21   ? 25.706  -26.862 37.590  1.00 100.13 ? 451  GLU B CG  1 
ATOM   7167 C CD  . GLU B 2 21   ? 25.749  -27.659 38.886  1.00 117.47 ? 451  GLU B CD  1 
ATOM   7168 O OE1 . GLU B 2 21   ? 24.678  -28.113 39.353  1.00 121.50 ? 451  GLU B OE1 1 
ATOM   7169 O OE2 . GLU B 2 21   ? 26.872  -27.887 39.398  1.00 94.26  ? 451  GLU B OE2 1 
ATOM   7170 N N   . TYR B 2 22   ? 22.781  -23.909 35.870  1.00 82.93  ? 452  TYR B N   1 
ATOM   7171 C CA  . TYR B 2 22   ? 22.024  -23.370 34.738  1.00 81.42  ? 452  TYR B CA  1 
ATOM   7172 C C   . TYR B 2 22   ? 22.290  -21.917 34.452  1.00 83.19  ? 452  TYR B C   1 
ATOM   7173 O O   . TYR B 2 22   ? 22.389  -21.550 33.284  1.00 83.45  ? 452  TYR B O   1 
ATOM   7174 C CB  . TYR B 2 22   ? 20.516  -23.598 34.898  1.00 83.01  ? 452  TYR B CB  1 
ATOM   7175 C CG  . TYR B 2 22   ? 20.098  -25.010 34.560  1.00 85.92  ? 452  TYR B CG  1 
ATOM   7176 C CD1 . TYR B 2 22   ? 20.272  -25.521 33.276  1.00 87.52  ? 452  TYR B CD1 1 
ATOM   7177 C CD2 . TYR B 2 22   ? 19.519  -25.836 35.521  1.00 87.22  ? 452  TYR B CD2 1 
ATOM   7178 C CE1 . TYR B 2 22   ? 19.923  -26.835 32.969  1.00 89.50  ? 452  TYR B CE1 1 
ATOM   7179 C CE2 . TYR B 2 22   ? 19.164  -27.152 35.226  1.00 88.47  ? 452  TYR B CE2 1 
ATOM   7180 C CZ  . TYR B 2 22   ? 19.371  -27.649 33.948  1.00 96.58  ? 452  TYR B CZ  1 
ATOM   7181 O OH  . TYR B 2 22   ? 19.025  -28.946 33.647  1.00 97.59  ? 452  TYR B OH  1 
ATOM   7182 N N   . ASN B 2 23   ? 22.378  -21.084 35.496  1.00 77.38  ? 453  ASN B N   1 
ATOM   7183 C CA  . ASN B 2 23   ? 22.641  -19.654 35.368  1.00 76.48  ? 453  ASN B CA  1 
ATOM   7184 C C   . ASN B 2 23   ? 24.048  -19.409 34.783  1.00 82.50  ? 453  ASN B C   1 
ATOM   7185 O O   . ASN B 2 23   ? 24.206  -18.610 33.855  1.00 82.75  ? 453  ASN B O   1 
ATOM   7186 C CB  . ASN B 2 23   ? 22.477  -18.990 36.711  1.00 71.14  ? 453  ASN B CB  1 
ATOM   7187 C CG  . ASN B 2 23   ? 22.658  -17.519 36.705  1.00 89.44  ? 453  ASN B CG  1 
ATOM   7188 O OD1 . ASN B 2 23   ? 21.813  -16.755 36.229  1.00 89.03  ? 453  ASN B OD1 1 
ATOM   7189 N ND2 . ASN B 2 23   ? 23.739  -17.098 37.300  1.00 84.26  ? 453  ASN B ND2 1 
ATOM   7190 N N   . THR B 2 24   ? 25.045  -20.138 35.306  1.00 79.85  ? 454  THR B N   1 
ATOM   7191 C CA  . THR B 2 24   ? 26.438  -20.112 34.884  1.00 79.73  ? 454  THR B CA  1 
ATOM   7192 C C   . THR B 2 24   ? 26.499  -20.477 33.401  1.00 86.71  ? 454  THR B C   1 
ATOM   7193 O O   . THR B 2 24   ? 27.047  -19.709 32.608  1.00 88.42  ? 454  THR B O   1 
ATOM   7194 C CB  . THR B 2 24   ? 27.249  -20.984 35.849  1.00 82.96  ? 454  THR B CB  1 
ATOM   7195 O OG1 . THR B 2 24   ? 27.561  -20.205 37.008  1.00 76.11  ? 454  THR B OG1 1 
ATOM   7196 C CG2 . THR B 2 24   ? 28.513  -21.546 35.239  1.00 84.67  ? 454  THR B CG2 1 
ATOM   7197 N N   . GLN B 2 25   ? 25.842  -21.588 33.022  1.00 82.99  ? 455  GLN B N   1 
ATOM   7198 C CA  . GLN B 2 25   ? 25.729  -22.069 31.647  1.00 82.44  ? 455  GLN B CA  1 
ATOM   7199 C C   . GLN B 2 25   ? 24.979  -21.067 30.759  1.00 87.30  ? 455  GLN B C   1 
ATOM   7200 O O   . GLN B 2 25   ? 25.246  -21.009 29.560  1.00 88.34  ? 455  GLN B O   1 
ATOM   7201 C CB  . GLN B 2 25   ? 24.972  -23.401 31.621  1.00 83.76  ? 455  GLN B CB  1 
ATOM   7202 C CG  . GLN B 2 25   ? 25.730  -24.608 32.170  1.00 100.51 ? 455  GLN B CG  1 
ATOM   7203 C CD  . GLN B 2 25   ? 24.944  -25.889 31.965  1.00 118.89 ? 455  GLN B CD  1 
ATOM   7204 O OE1 . GLN B 2 25   ? 24.351  -26.135 30.902  1.00 111.01 ? 455  GLN B OE1 1 
ATOM   7205 N NE2 . GLN B 2 25   ? 24.931  -26.747 32.977  1.00 114.30 ? 455  GLN B NE2 1 
ATOM   7206 N N   . PHE B 2 26   ? 24.008  -20.317 31.332  1.00 83.95  ? 456  PHE B N   1 
ATOM   7207 C CA  . PHE B 2 26   ? 23.199  -19.335 30.593  1.00 83.09  ? 456  PHE B CA  1 
ATOM   7208 C C   . PHE B 2 26   ? 24.008  -18.136 30.248  1.00 87.52  ? 456  PHE B C   1 
ATOM   7209 O O   . PHE B 2 26   ? 24.050  -17.775 29.085  1.00 87.78  ? 456  PHE B O   1 
ATOM   7210 C CB  . PHE B 2 26   ? 21.940  -18.892 31.358  1.00 84.31  ? 456  PHE B CB  1 
ATOM   7211 C CG  . PHE B 2 26   ? 21.250  -17.706 30.721  1.00 85.42  ? 456  PHE B CG  1 
ATOM   7212 C CD1 . PHE B 2 26   ? 20.555  -17.844 29.523  1.00 87.41  ? 456  PHE B CD1 1 
ATOM   7213 C CD2 . PHE B 2 26   ? 21.287  -16.452 31.325  1.00 87.55  ? 456  PHE B CD2 1 
ATOM   7214 C CE1 . PHE B 2 26   ? 19.922  -16.750 28.936  1.00 88.15  ? 456  PHE B CE1 1 
ATOM   7215 C CE2 . PHE B 2 26   ? 20.649  -15.359 30.738  1.00 89.92  ? 456  PHE B CE2 1 
ATOM   7216 C CZ  . PHE B 2 26   ? 19.963  -15.517 29.551  1.00 87.83  ? 456  PHE B CZ  1 
ATOM   7217 N N   . GLN B 2 27   ? 24.611  -17.490 31.264  1.00 84.23  ? 457  GLN B N   1 
ATOM   7218 C CA  . GLN B 2 27   ? 25.457  -16.310 31.126  1.00 83.30  ? 457  GLN B CA  1 
ATOM   7219 C C   . GLN B 2 27   ? 26.620  -16.564 30.142  1.00 87.75  ? 457  GLN B C   1 
ATOM   7220 O O   . GLN B 2 27   ? 26.922  -15.674 29.345  1.00 87.06  ? 457  GLN B O   1 
ATOM   7221 C CB  . GLN B 2 27   ? 25.935  -15.835 32.499  1.00 83.84  ? 457  GLN B CB  1 
ATOM   7222 C CG  . GLN B 2 27   ? 24.794  -15.309 33.366  1.00 86.93  ? 457  GLN B CG  1 
ATOM   7223 N N   . GLU B 2 28   ? 27.196  -17.802 30.131  1.00 84.46  ? 458  GLU B N   1 
ATOM   7224 C CA  . GLU B 2 28   ? 28.262  -18.200 29.200  1.00 84.33  ? 458  GLU B CA  1 
ATOM   7225 C C   . GLU B 2 28   ? 27.744  -18.266 27.747  1.00 89.85  ? 458  GLU B C   1 
ATOM   7226 O O   . GLU B 2 28   ? 28.293  -17.580 26.879  1.00 90.41  ? 458  GLU B O   1 
ATOM   7227 C CB  . GLU B 2 28   ? 28.903  -19.525 29.617  1.00 85.53  ? 458  GLU B CB  1 
ATOM   7228 C CG  . GLU B 2 28   ? 29.884  -19.374 30.765  1.00 98.94  ? 458  GLU B CG  1 
ATOM   7229 N N   . LYS B 2 29   ? 26.669  -19.057 27.493  1.00 85.59  ? 459  LYS B N   1 
ATOM   7230 C CA  . LYS B 2 29   ? 26.031  -19.193 26.177  1.00 84.76  ? 459  LYS B CA  1 
ATOM   7231 C C   . LYS B 2 29   ? 25.554  -17.824 25.679  1.00 87.74  ? 459  LYS B C   1 
ATOM   7232 O O   . LYS B 2 29   ? 25.681  -17.531 24.488  1.00 87.68  ? 459  LYS B O   1 
ATOM   7233 C CB  . LYS B 2 29   ? 24.870  -20.207 26.221  1.00 86.92  ? 459  LYS B CB  1 
ATOM   7234 C CG  . LYS B 2 29   ? 24.552  -20.859 24.865  1.00 94.54  ? 459  LYS B CG  1 
ATOM   7235 N N   . SER B 2 30   ? 25.055  -16.974 26.606  1.00 82.93  ? 460  SER B N   1 
ATOM   7236 C CA  . SER B 2 30   ? 24.630  -15.593 26.361  1.00 81.49  ? 460  SER B CA  1 
ATOM   7237 C C   . SER B 2 30   ? 25.851  -14.733 25.926  1.00 85.13  ? 460  SER B C   1 
ATOM   7238 O O   . SER B 2 30   ? 25.713  -13.922 25.009  1.00 84.59  ? 460  SER B O   1 
ATOM   7239 C CB  . SER B 2 30   ? 23.968  -15.024 27.608  1.00 82.93  ? 460  SER B CB  1 
ATOM   7240 O OG  . SER B 2 30   ? 23.544  -13.688 27.428  1.00 93.60  ? 460  SER B OG  1 
ATOM   7241 N N   . ARG B 2 31   ? 27.051  -14.968 26.541  1.00 80.74  ? 461  ARG B N   1 
ATOM   7242 C CA  . ARG B 2 31   ? 28.313  -14.284 26.218  1.00 79.67  ? 461  ARG B CA  1 
ATOM   7243 C C   . ARG B 2 31   ? 28.789  -14.678 24.822  1.00 83.20  ? 461  ARG B C   1 
ATOM   7244 O O   . ARG B 2 31   ? 29.218  -13.809 24.059  1.00 82.68  ? 461  ARG B O   1 
ATOM   7245 C CB  . ARG B 2 31   ? 29.403  -14.583 27.267  1.00 77.17  ? 461  ARG B CB  1 
ATOM   7246 C CG  . ARG B 2 31   ? 29.513  -13.512 28.347  1.00 82.64  ? 461  ARG B CG  1 
ATOM   7247 C CD  . ARG B 2 31   ? 30.530  -13.889 29.411  1.00 95.60  ? 461  ARG B CD  1 
ATOM   7248 N N   . GLU B 2 32   ? 28.698  -15.990 24.500  1.00 79.10  ? 462  GLU B N   1 
ATOM   7249 C CA  . GLU B 2 32   ? 29.019  -16.592 23.202  1.00 78.55  ? 462  GLU B CA  1 
ATOM   7250 C C   . GLU B 2 32   ? 28.154  -15.891 22.101  1.00 83.95  ? 462  GLU B C   1 
ATOM   7251 O O   . GLU B 2 32   ? 28.710  -15.402 21.109  1.00 83.85  ? 462  GLU B O   1 
ATOM   7252 C CB  . GLU B 2 32   ? 28.777  -18.134 23.262  1.00 79.24  ? 462  GLU B CB  1 
ATOM   7253 C CG  . GLU B 2 32   ? 29.048  -18.942 21.998  1.00 81.42  ? 462  GLU B CG  1 
ATOM   7254 N N   . TYR B 2 33   ? 26.821  -15.784 22.311  1.00 80.65  ? 463  TYR B N   1 
ATOM   7255 C CA  . TYR B 2 33   ? 25.937  -15.125 21.347  1.00 80.87  ? 463  TYR B CA  1 
ATOM   7256 C C   . TYR B 2 33   ? 26.247  -13.625 21.170  1.00 89.12  ? 463  TYR B C   1 
ATOM   7257 O O   . TYR B 2 33   ? 26.305  -13.160 20.034  1.00 89.69  ? 463  TYR B O   1 
ATOM   7258 C CB  . TYR B 2 33   ? 24.452  -15.360 21.669  1.00 80.30  ? 463  TYR B CB  1 
ATOM   7259 C CG  . TYR B 2 33   ? 23.507  -14.566 20.793  1.00 80.23  ? 463  TYR B CG  1 
ATOM   7260 C CD1 . TYR B 2 33   ? 23.102  -15.048 19.553  1.00 81.38  ? 463  TYR B CD1 1 
ATOM   7261 C CD2 . TYR B 2 33   ? 23.015  -13.331 21.206  1.00 81.29  ? 463  TYR B CD2 1 
ATOM   7262 C CE1 . TYR B 2 33   ? 22.231  -14.323 18.743  1.00 81.79  ? 463  TYR B CE1 1 
ATOM   7263 C CE2 . TYR B 2 33   ? 22.128  -12.602 20.411  1.00 82.53  ? 463  TYR B CE2 1 
ATOM   7264 C CZ  . TYR B 2 33   ? 21.751  -13.095 19.173  1.00 91.52  ? 463  TYR B CZ  1 
ATOM   7265 O OH  . TYR B 2 33   ? 20.885  -12.373 18.386  1.00 96.39  ? 463  TYR B OH  1 
ATOM   7266 N N   . ASP B 2 34   ? 26.429  -12.881 22.278  1.00 87.47  ? 464  ASP B N   1 
ATOM   7267 C CA  . ASP B 2 34   ? 26.736  -11.441 22.276  1.00 87.46  ? 464  ASP B CA  1 
ATOM   7268 C C   . ASP B 2 34   ? 27.984  -11.119 21.441  1.00 90.77  ? 464  ASP B C   1 
ATOM   7269 O O   . ASP B 2 34   ? 27.986  -10.128 20.700  1.00 89.25  ? 464  ASP B O   1 
ATOM   7270 C CB  . ASP B 2 34   ? 26.866  -10.914 23.715  1.00 89.14  ? 464  ASP B CB  1 
ATOM   7271 C CG  . ASP B 2 34   ? 25.547  -10.473 24.322  1.00 104.08 ? 464  ASP B CG  1 
ATOM   7272 O OD1 . ASP B 2 34   ? 24.560  -11.250 24.246  1.00 104.82 ? 464  ASP B OD1 1 
ATOM   7273 O OD2 . ASP B 2 34   ? 25.498  -9.353  24.884  1.00 113.68 ? 464  ASP B OD2 1 
ATOM   7274 N N   . ARG B 2 35   ? 29.005  -12.010 21.517  1.00 87.60  ? 465  ARG B N   1 
ATOM   7275 C CA  . ARG B 2 35   ? 30.260  -11.923 20.766  1.00 87.70  ? 465  ARG B CA  1 
ATOM   7276 C C   . ARG B 2 35   ? 30.060  -12.239 19.278  1.00 92.78  ? 465  ARG B C   1 
ATOM   7277 O O   . ARG B 2 35   ? 30.661  -11.572 18.439  1.00 93.03  ? 465  ARG B O   1 
ATOM   7278 C CB  . ARG B 2 35   ? 31.355  -12.806 21.393  1.00 87.43  ? 465  ARG B CB  1 
ATOM   7279 C CG  . ARG B 2 35   ? 31.938  -12.224 22.683  1.00 97.62  ? 465  ARG B CG  1 
ATOM   7280 N N   . LEU B 2 36   ? 29.191  -13.222 18.952  1.00 89.83  ? 466  LEU B N   1 
ATOM   7281 C CA  . LEU B 2 36   ? 28.852  -13.613 17.574  1.00 89.78  ? 466  LEU B CA  1 
ATOM   7282 C C   . LEU B 2 36   ? 27.943  -12.589 16.894  1.00 93.70  ? 466  LEU B C   1 
ATOM   7283 O O   . LEU B 2 36   ? 27.741  -12.673 15.677  1.00 93.90  ? 466  LEU B O   1 
ATOM   7284 C CB  . LEU B 2 36   ? 28.182  -15.008 17.519  1.00 90.05  ? 466  LEU B CB  1 
ATOM   7285 C CG  . LEU B 2 36   ? 28.957  -16.152 16.821  1.00 94.71  ? 466  LEU B CG  1 
ATOM   7286 C CD1 . LEU B 2 36   ? 28.185  -17.457 16.911  1.00 94.86  ? 466  LEU B CD1 1 
ATOM   7287 C CD2 . LEU B 2 36   ? 29.235  -15.850 15.360  1.00 96.65  ? 466  LEU B CD2 1 
ATOM   7288 N N   . TYR B 2 37   ? 27.347  -11.662 17.677  1.00 89.72  ? 467  TYR B N   1 
ATOM   7289 C CA  . TYR B 2 37   ? 26.483  -10.600 17.156  1.00 88.72  ? 467  TYR B CA  1 
ATOM   7290 C C   . TYR B 2 37   ? 27.349  -9.364  16.963  1.00 91.62  ? 467  TYR B C   1 
ATOM   7291 O O   . TYR B 2 37   ? 26.994  -8.496  16.171  1.00 91.69  ? 467  TYR B O   1 
ATOM   7292 C CB  . TYR B 2 37   ? 25.294  -10.329 18.086  1.00 89.32  ? 467  TYR B CB  1 
ATOM   7293 C CG  . TYR B 2 37   ? 24.236  -9.410  17.512  1.00 90.67  ? 467  TYR B CG  1 
ATOM   7294 C CD1 . TYR B 2 37   ? 24.346  -8.026  17.629  1.00 92.34  ? 467  TYR B CD1 1 
ATOM   7295 C CD2 . TYR B 2 37   ? 23.074  -9.923  16.946  1.00 91.77  ? 467  TYR B CD2 1 
ATOM   7296 C CE1 . TYR B 2 37   ? 23.359  -7.176  17.133  1.00 92.69  ? 467  TYR B CE1 1 
ATOM   7297 C CE2 . TYR B 2 37   ? 22.070  -9.081  16.459  1.00 92.49  ? 467  TYR B CE2 1 
ATOM   7298 C CZ  . TYR B 2 37   ? 22.213  -7.707  16.564  1.00 99.12  ? 467  TYR B CZ  1 
ATOM   7299 O OH  . TYR B 2 37   ? 21.223  -6.870  16.099  1.00 99.44  ? 467  TYR B OH  1 
ATOM   7300 N N   . GLU B 2 38   ? 28.500  -9.299  17.659  1.00 87.15  ? 468  GLU B N   1 
ATOM   7301 C CA  . GLU B 2 38   ? 29.461  -8.214  17.494  1.00 86.80  ? 468  GLU B CA  1 
ATOM   7302 C C   . GLU B 2 38   ? 30.027  -8.385  16.080  1.00 88.14  ? 468  GLU B C   1 
ATOM   7303 O O   . GLU B 2 38   ? 30.003  -7.428  15.299  1.00 87.51  ? 468  GLU B O   1 
ATOM   7304 C CB  . GLU B 2 38   ? 30.570  -8.284  18.566  1.00 88.65  ? 468  GLU B CB  1 
ATOM   7305 C CG  . GLU B 2 38   ? 31.048  -6.925  19.065  1.00 104.85 ? 468  GLU B CG  1 
ATOM   7306 C CD  . GLU B 2 38   ? 31.979  -6.959  20.269  1.00 138.96 ? 468  GLU B CD  1 
ATOM   7307 O OE1 . GLU B 2 38   ? 31.471  -6.954  21.415  1.00 131.48 ? 468  GLU B OE1 1 
ATOM   7308 O OE2 . GLU B 2 38   ? 33.216  -6.959  20.069  1.00 139.12 ? 468  GLU B OE2 1 
ATOM   7309 N N   . ASP B 2 39   ? 30.418  -9.635  15.720  1.00 83.13  ? 469  ASP B N   1 
ATOM   7310 C CA  . ASP B 2 39   ? 30.926  -9.999  14.388  1.00 82.60  ? 469  ASP B CA  1 
ATOM   7311 C C   . ASP B 2 39   ? 29.841  -9.861  13.328  1.00 86.33  ? 469  ASP B C   1 
ATOM   7312 O O   . ASP B 2 39   ? 30.134  -9.359  12.256  1.00 85.71  ? 469  ASP B O   1 
ATOM   7313 C CB  . ASP B 2 39   ? 31.531  -11.411 14.371  1.00 84.15  ? 469  ASP B CB  1 
ATOM   7314 C CG  . ASP B 2 39   ? 32.621  -11.623 15.398  1.00 96.39  ? 469  ASP B CG  1 
ATOM   7315 O OD1 . ASP B 2 39   ? 33.562  -10.797 15.448  1.00 97.23  ? 469  ASP B OD1 1 
ATOM   7316 O OD2 . ASP B 2 39   ? 32.533  -12.608 16.158  1.00 103.83 ? 469  ASP B OD2 1 
ATOM   7317 N N   . TYR B 2 40   ? 28.589  -10.274 13.628  1.00 83.36  ? 470  TYR B N   1 
ATOM   7318 C CA  . TYR B 2 40   ? 27.453  -10.111 12.717  1.00 83.65  ? 470  TYR B CA  1 
ATOM   7319 C C   . TYR B 2 40   ? 27.378  -8.622  12.336  1.00 89.08  ? 470  TYR B C   1 
ATOM   7320 O O   . TYR B 2 40   ? 27.443  -8.309  11.154  1.00 89.86  ? 470  TYR B O   1 
ATOM   7321 C CB  . TYR B 2 40   ? 26.130  -10.609 13.355  1.00 84.62  ? 470  TYR B CB  1 
ATOM   7322 C CG  . TYR B 2 40   ? 24.896  -10.339 12.512  1.00 85.89  ? 470  TYR B CG  1 
ATOM   7323 C CD1 . TYR B 2 40   ? 24.512  -11.217 11.502  1.00 87.46  ? 470  TYR B CD1 1 
ATOM   7324 C CD2 . TYR B 2 40   ? 24.097  -9.217  12.744  1.00 86.72  ? 470  TYR B CD2 1 
ATOM   7325 C CE1 . TYR B 2 40   ? 23.378  -10.975 10.724  1.00 88.20  ? 470  TYR B CE1 1 
ATOM   7326 C CE2 . TYR B 2 40   ? 22.976  -8.948  11.954  1.00 87.42  ? 470  TYR B CE2 1 
ATOM   7327 C CZ  . TYR B 2 40   ? 22.624  -9.829  10.941  1.00 96.40  ? 470  TYR B CZ  1 
ATOM   7328 O OH  . TYR B 2 40   ? 21.530  -9.577  10.147  1.00 98.02  ? 470  TYR B OH  1 
ATOM   7329 N N   . THR B 2 41   ? 27.337  -7.715  13.340  1.00 85.46  ? 471  THR B N   1 
ATOM   7330 C CA  . THR B 2 41   ? 27.341  -6.258  13.170  1.00 85.24  ? 471  THR B CA  1 
ATOM   7331 C C   . THR B 2 41   ? 28.590  -5.792  12.369  1.00 90.68  ? 471  THR B C   1 
ATOM   7332 O O   . THR B 2 41   ? 28.438  -5.068  11.386  1.00 90.19  ? 471  THR B O   1 
ATOM   7333 C CB  . THR B 2 41   ? 27.197  -5.587  14.545  1.00 86.70  ? 471  THR B CB  1 
ATOM   7334 O OG1 . THR B 2 41   ? 25.895  -5.878  15.058  1.00 85.79  ? 471  THR B OG1 1 
ATOM   7335 C CG2 . THR B 2 41   ? 27.417  -4.085  14.506  1.00 81.88  ? 471  THR B CG2 1 
ATOM   7336 N N   . ARG B 2 42   ? 29.799  -6.243  12.772  1.00 88.06  ? 472  ARG B N   1 
ATOM   7337 C CA  . ARG B 2 42   ? 31.077  -5.926  12.123  1.00 88.49  ? 472  ARG B CA  1 
ATOM   7338 C C   . ARG B 2 42   ? 31.063  -6.333  10.629  1.00 93.42  ? 472  ARG B C   1 
ATOM   7339 O O   . ARG B 2 42   ? 31.297  -5.485  9.769   1.00 94.83  ? 472  ARG B O   1 
ATOM   7340 C CB  . ARG B 2 42   ? 32.238  -6.595  12.902  1.00 90.33  ? 472  ARG B CB  1 
ATOM   7341 C CG  . ARG B 2 42   ? 33.603  -6.634  12.211  1.00 101.70 ? 472  ARG B CG  1 
ATOM   7342 C CD  . ARG B 2 42   ? 34.495  -7.739  12.770  1.00 111.14 ? 472  ARG B CD  1 
ATOM   7343 N NE  . ARG B 2 42   ? 34.205  -9.064  12.204  1.00 124.01 ? 472  ARG B NE  1 
ATOM   7344 C CZ  . ARG B 2 42   ? 34.897  -9.642  11.220  1.00 142.99 ? 472  ARG B CZ  1 
ATOM   7345 N NH1 . ARG B 2 42   ? 35.926  -9.013  10.661  1.00 131.69 ? 472  ARG B NH1 1 
ATOM   7346 N NH2 . ARG B 2 42   ? 34.564  -10.853 10.788  1.00 130.14 ? 472  ARG B NH2 1 
ATOM   7347 N N   . THR B 2 43   ? 30.751  -7.602  10.324  1.00 87.95  ? 473  THR B N   1 
ATOM   7348 C CA  . THR B 2 43   ? 30.714  -8.116  8.959   1.00 86.99  ? 473  THR B CA  1 
ATOM   7349 C C   . THR B 2 43   ? 29.617  -7.420  8.149   1.00 90.19  ? 473  THR B C   1 
ATOM   7350 O O   . THR B 2 43   ? 29.827  -7.134  6.970   1.00 89.73  ? 473  THR B O   1 
ATOM   7351 C CB  . THR B 2 43   ? 30.631  -9.653  8.963   1.00 89.69  ? 473  THR B CB  1 
ATOM   7352 O OG1 . THR B 2 43   ? 31.777  -10.157 9.640   1.00 83.80  ? 473  THR B OG1 1 
ATOM   7353 C CG2 . THR B 2 43   ? 30.578  -10.257 7.558   1.00 88.20  ? 473  THR B CG2 1 
ATOM   7354 N N   . SER B 2 44   ? 28.470  -7.124  8.788   1.00 85.92  ? 474  SER B N   1 
ATOM   7355 C CA  . SER B 2 44   ? 27.350  -6.465  8.126   1.00 85.46  ? 474  SER B CA  1 
ATOM   7356 C C   . SER B 2 44   ? 27.774  -5.122  7.563   1.00 88.45  ? 474  SER B C   1 
ATOM   7357 O O   . SER B 2 44   ? 27.447  -4.837  6.411   1.00 88.74  ? 474  SER B O   1 
ATOM   7358 C CB  . SER B 2 44   ? 26.172  -6.282  9.081   1.00 89.39  ? 474  SER B CB  1 
ATOM   7359 O OG  . SER B 2 44   ? 25.300  -7.400  9.076   1.00 97.58  ? 474  SER B OG  1 
ATOM   7360 N N   . GLN B 2 45   ? 28.520  -4.316  8.351   1.00 83.59  ? 475  GLN B N   1 
ATOM   7361 C CA  . GLN B 2 45   ? 28.949  -2.994  7.909   1.00 83.44  ? 475  GLN B CA  1 
ATOM   7362 C C   . GLN B 2 45   ? 30.130  -3.074  6.930   1.00 85.97  ? 475  GLN B C   1 
ATOM   7363 O O   . GLN B 2 45   ? 30.083  -2.370  5.911   1.00 84.41  ? 475  GLN B O   1 
ATOM   7364 C CB  . GLN B 2 45   ? 29.192  -1.996  9.070   1.00 85.02  ? 475  GLN B CB  1 
ATOM   7365 C CG  . GLN B 2 45   ? 30.198  -2.405  10.139  1.00 109.61 ? 475  GLN B CG  1 
ATOM   7366 C CD  . GLN B 2 45   ? 30.268  -1.386  11.258  1.00 131.53 ? 475  GLN B CD  1 
ATOM   7367 O OE1 . GLN B 2 45   ? 29.392  -1.317  12.141  1.00 121.18 ? 475  GLN B OE1 1 
ATOM   7368 N NE2 . GLN B 2 45   ? 31.326  -0.577  11.243  1.00 127.51 ? 475  GLN B NE2 1 
ATOM   7369 N N   . GLU B 2 46   ? 31.134  -3.981  7.190   1.00 80.92  ? 476  GLU B N   1 
ATOM   7370 C CA  . GLU B 2 46   ? 32.306  -4.212  6.317   1.00 79.23  ? 476  GLU B CA  1 
ATOM   7371 C C   . GLU B 2 46   ? 31.900  -4.582  4.885   1.00 82.58  ? 476  GLU B C   1 
ATOM   7372 O O   . GLU B 2 46   ? 32.583  -4.188  3.936   1.00 82.51  ? 476  GLU B O   1 
ATOM   7373 C CB  . GLU B 2 46   ? 33.245  -5.281  6.892   1.00 79.96  ? 476  GLU B CB  1 
ATOM   7374 C CG  . GLU B 2 46   ? 34.085  -4.793  8.062   1.00 89.34  ? 476  GLU B CG  1 
ATOM   7375 C CD  . GLU B 2 46   ? 35.266  -5.640  8.504   1.00 106.19 ? 476  GLU B CD  1 
ATOM   7376 O OE1 . GLU B 2 46   ? 35.659  -6.569  7.760   1.00 96.64  ? 476  GLU B OE1 1 
ATOM   7377 O OE2 . GLU B 2 46   ? 35.829  -5.343  9.584   1.00 94.42  ? 476  GLU B OE2 1 
ATOM   7378 N N   . ILE B 2 47   ? 30.776  -5.312  4.750   1.00 78.86  ? 477  ILE B N   1 
ATOM   7379 C CA  . ILE B 2 47   ? 30.174  -5.762  3.497   1.00 79.38  ? 477  ILE B CA  1 
ATOM   7380 C C   . ILE B 2 47   ? 29.546  -4.601  2.745   1.00 83.96  ? 477  ILE B C   1 
ATOM   7381 O O   . ILE B 2 47   ? 29.690  -4.543  1.530   1.00 82.89  ? 477  ILE B O   1 
ATOM   7382 C CB  . ILE B 2 47   ? 29.190  -6.954  3.748   1.00 82.84  ? 477  ILE B CB  1 
ATOM   7383 C CG1 . ILE B 2 47   ? 29.945  -8.296  3.696   1.00 83.52  ? 477  ILE B CG1 1 
ATOM   7384 C CG2 . ILE B 2 47   ? 27.927  -6.949  2.828   1.00 82.71  ? 477  ILE B CG2 1 
ATOM   7385 C CD1 . ILE B 2 47   ? 29.150  -9.495  4.193   1.00 93.72  ? 477  ILE B CD1 1 
ATOM   7386 N N   . GLN B 2 48   ? 28.839  -3.691  3.449   1.00 83.42  ? 478  GLN B N   1 
ATOM   7387 C CA  . GLN B 2 48   ? 28.197  -2.523  2.818   1.00 84.35  ? 478  GLN B CA  1 
ATOM   7388 C C   . GLN B 2 48   ? 29.235  -1.462  2.428   1.00 88.08  ? 478  GLN B C   1 
ATOM   7389 O O   . GLN B 2 48   ? 28.972  -0.637  1.552   1.00 87.62  ? 478  GLN B O   1 
ATOM   7390 C CB  . GLN B 2 48   ? 27.033  -1.943  3.654   1.00 86.20  ? 478  GLN B CB  1 
ATOM   7391 C CG  . GLN B 2 48   ? 25.835  -2.908  3.863   1.00 112.02 ? 478  GLN B CG  1 
ATOM   7392 C CD  . GLN B 2 48   ? 25.094  -3.336  2.604   1.00 130.16 ? 478  GLN B CD  1 
ATOM   7393 O OE1 . GLN B 2 48   ? 25.386  -4.381  2.011   1.00 126.71 ? 478  GLN B OE1 1 
ATOM   7394 N NE2 . GLN B 2 48   ? 24.070  -2.583  2.213   1.00 118.53 ? 478  GLN B NE2 1 
ATOM   7395 N N   . MET B 2 49   ? 30.437  -1.538  3.040   1.00 84.78  ? 479  MET B N   1 
ATOM   7396 C CA  . MET B 2 49   ? 31.592  -0.712  2.722   1.00 84.51  ? 479  MET B CA  1 
ATOM   7397 C C   . MET B 2 49   ? 32.141  -1.232  1.390   1.00 85.36  ? 479  MET B C   1 
ATOM   7398 O O   . MET B 2 49   ? 32.328  -0.436  0.475   1.00 85.39  ? 479  MET B O   1 
ATOM   7399 C CB  . MET B 2 49   ? 32.670  -0.845  3.792   1.00 87.59  ? 479  MET B CB  1 
ATOM   7400 C CG  . MET B 2 49   ? 32.440  0.000   4.986   1.00 92.97  ? 479  MET B CG  1 
ATOM   7401 S SD  . MET B 2 49   ? 33.804  -0.323  6.132   1.00 99.50  ? 479  MET B SD  1 
ATOM   7402 N N   . LYS B 2 50   ? 32.378  -2.568  1.285   1.00 78.72  ? 480  LYS B N   1 
ATOM   7403 C CA  . LYS B 2 50   ? 32.861  -3.245  0.080   1.00 77.39  ? 480  LYS B CA  1 
ATOM   7404 C C   . LYS B 2 50   ? 31.906  -2.993  -1.077  1.00 83.39  ? 480  LYS B C   1 
ATOM   7405 O O   . LYS B 2 50   ? 32.367  -2.771  -2.190  1.00 84.38  ? 480  LYS B O   1 
ATOM   7406 C CB  . LYS B 2 50   ? 32.989  -4.757  0.295   1.00 77.76  ? 480  LYS B CB  1 
ATOM   7407 C CG  . LYS B 2 50   ? 34.196  -5.163  1.092   1.00 77.37  ? 480  LYS B CG  1 
ATOM   7408 C CD  . LYS B 2 50   ? 34.347  -6.672  1.149   1.00 79.26  ? 480  LYS B CD  1 
ATOM   7409 C CE  . LYS B 2 50   ? 35.727  -7.091  1.600   1.00 88.98  ? 480  LYS B CE  1 
ATOM   7410 N NZ  . LYS B 2 50   ? 36.020  -6.677  3.005   1.00 97.91  ? 480  LYS B NZ  1 
ATOM   7411 N N   . ARG B 2 51   ? 30.585  -3.015  -0.822  1.00 79.85  ? 481  ARG B N   1 
ATOM   7412 C CA  . ARG B 2 51   ? 29.584  -2.757  -1.854  1.00 79.75  ? 481  ARG B CA  1 
ATOM   7413 C C   . ARG B 2 51   ? 29.609  -1.277  -2.339  1.00 83.77  ? 481  ARG B C   1 
ATOM   7414 O O   . ARG B 2 51   ? 29.415  -1.035  -3.537  1.00 84.07  ? 481  ARG B O   1 
ATOM   7415 C CB  . ARG B 2 51   ? 28.186  -3.208  -1.412  1.00 80.67  ? 481  ARG B CB  1 
ATOM   7416 C CG  . ARG B 2 51   ? 28.033  -4.722  -1.306  1.00 90.65  ? 481  ARG B CG  1 
ATOM   7417 N N   . THR B 2 52   ? 29.903  -0.297  -1.447  1.00 78.84  ? 482  THR B N   1 
ATOM   7418 C CA  . THR B 2 52   ? 29.999  1.090   -1.929  1.00 78.33  ? 482  THR B CA  1 
ATOM   7419 C C   . THR B 2 52   ? 31.389  1.325   -2.591  1.00 80.84  ? 482  THR B C   1 
ATOM   7420 O O   . THR B 2 52   ? 31.518  2.229   -3.418  1.00 80.62  ? 482  THR B O   1 
ATOM   7421 C CB  . THR B 2 52   ? 29.596  2.147   -0.879  1.00 85.25  ? 482  THR B CB  1 
ATOM   7422 O OG1 . THR B 2 52   ? 30.499  2.129   0.218   1.00 85.60  ? 482  THR B OG1 1 
ATOM   7423 C CG2 . THR B 2 52   ? 28.163  1.985   -0.397  1.00 81.58  ? 482  THR B CG2 1 
ATOM   7424 N N   . ALA B 2 53   ? 32.395  0.466   -2.274  1.00 75.45  ? 483  ALA B N   1 
ATOM   7425 C CA  . ALA B 2 53   ? 33.742  0.493   -2.852  1.00 74.25  ? 483  ALA B CA  1 
ATOM   7426 C C   . ALA B 2 53   ? 33.678  -0.036  -4.289  1.00 79.79  ? 483  ALA B C   1 
ATOM   7427 O O   . ALA B 2 53   ? 34.452  0.406   -5.141  1.00 80.08  ? 483  ALA B O   1 
ATOM   7428 C CB  . ALA B 2 53   ? 34.699  -0.359  -2.025  1.00 74.24  ? 483  ALA B CB  1 
ATOM   7429 N N   . ILE B 2 54   ? 32.754  -0.980  -4.550  1.00 76.11  ? 484  ILE B N   1 
ATOM   7430 C CA  . ILE B 2 54   ? 32.545  -1.573  -5.864  1.00 75.68  ? 484  ILE B CA  1 
ATOM   7431 C C   . ILE B 2 54   ? 31.803  -0.560  -6.728  1.00 81.17  ? 484  ILE B C   1 
ATOM   7432 O O   . ILE B 2 54   ? 32.149  -0.417  -7.910  1.00 82.04  ? 484  ILE B O   1 
ATOM   7433 C CB  . ILE B 2 54   ? 31.872  -2.971  -5.770  1.00 78.27  ? 484  ILE B CB  1 
ATOM   7434 C CG1 . ILE B 2 54   ? 32.869  -4.001  -5.228  1.00 78.20  ? 484  ILE B CG1 1 
ATOM   7435 C CG2 . ILE B 2 54   ? 31.303  -3.440  -7.118  1.00 79.36  ? 484  ILE B CG2 1 
ATOM   7436 C CD1 . ILE B 2 54   ? 32.243  -5.205  -4.602  1.00 83.54  ? 484  ILE B CD1 1 
ATOM   7437 N N   . GLU B 2 55   ? 30.828  0.182   -6.141  1.00 77.04  ? 485  GLU B N   1 
ATOM   7438 C CA  . GLU B 2 55   ? 30.123  1.243   -6.884  1.00 76.97  ? 485  GLU B CA  1 
ATOM   7439 C C   . GLU B 2 55   ? 31.162  2.355   -7.270  1.00 78.83  ? 485  GLU B C   1 
ATOM   7440 O O   . GLU B 2 55   ? 31.159  2.854   -8.398  1.00 77.30  ? 485  GLU B O   1 
ATOM   7441 C CB  . GLU B 2 55   ? 28.948  1.821   -6.070  1.00 78.71  ? 485  GLU B CB  1 
ATOM   7442 C CG  . GLU B 2 55   ? 27.789  0.862   -5.810  1.00 93.56  ? 485  GLU B CG  1 
ATOM   7443 C CD  . GLU B 2 55   ? 27.057  1.003   -4.477  1.00 123.29 ? 485  GLU B CD  1 
ATOM   7444 O OE1 . GLU B 2 55   ? 26.910  2.141   -3.970  1.00 109.45 ? 485  GLU B OE1 1 
ATOM   7445 O OE2 . GLU B 2 55   ? 26.602  -0.040  -3.950  1.00 121.94 ? 485  GLU B OE2 1 
ATOM   7446 N N   . ALA B 2 56   ? 32.093  2.660   -6.343  1.00 74.47  ? 486  ALA B N   1 
ATOM   7447 C CA  . ALA B 2 56   ? 33.179  3.614   -6.541  1.00 73.23  ? 486  ALA B CA  1 
ATOM   7448 C C   . ALA B 2 56   ? 34.122  3.205   -7.698  1.00 74.75  ? 486  ALA B C   1 
ATOM   7449 O O   . ALA B 2 56   ? 34.550  4.088   -8.445  1.00 75.37  ? 486  ALA B O   1 
ATOM   7450 C CB  . ALA B 2 56   ? 33.954  3.799   -5.251  1.00 73.68  ? 486  ALA B CB  1 
ATOM   7451 N N   . PHE B 2 57   ? 34.405  1.885   -7.872  1.00 67.78  ? 487  PHE B N   1 
ATOM   7452 C CA  . PHE B 2 57   ? 35.244  1.350   -8.962  1.00 66.59  ? 487  PHE B CA  1 
ATOM   7453 C C   . PHE B 2 57   ? 34.518  1.439   -10.312 1.00 71.10  ? 487  PHE B C   1 
ATOM   7454 O O   . PHE B 2 57   ? 35.105  1.756   -11.336 1.00 69.94  ? 487  PHE B O   1 
ATOM   7455 C CB  . PHE B 2 57   ? 35.569  -0.101  -8.700  1.00 68.01  ? 487  PHE B CB  1 
ATOM   7456 C CG  . PHE B 2 57   ? 36.865  -0.348  -7.992  1.00 70.16  ? 487  PHE B CG  1 
ATOM   7457 C CD1 . PHE B 2 57   ? 38.076  -0.219  -8.663  1.00 74.52  ? 487  PHE B CD1 1 
ATOM   7458 C CD2 . PHE B 2 57   ? 36.880  -0.848  -6.698  1.00 72.58  ? 487  PHE B CD2 1 
ATOM   7459 C CE1 . PHE B 2 57   ? 39.285  -0.506  -8.021  1.00 75.35  ? 487  PHE B CE1 1 
ATOM   7460 C CE2 . PHE B 2 57   ? 38.088  -1.135  -6.056  1.00 75.79  ? 487  PHE B CE2 1 
ATOM   7461 C CZ  . PHE B 2 57   ? 39.283  -0.952  -6.719  1.00 74.21  ? 487  PHE B CZ  1 
ATOM   7462 N N   . ASN B 2 58   ? 33.229  1.128   -10.290 1.00 68.61  ? 488  ASN B N   1 
ATOM   7463 C CA  . ASN B 2 58   ? 32.318  1.155   -11.409 1.00 67.19  ? 488  ASN B CA  1 
ATOM   7464 C C   . ASN B 2 58   ? 32.205  2.569   -11.903 1.00 69.88  ? 488  ASN B C   1 
ATOM   7465 O O   . ASN B 2 58   ? 32.199  2.762   -13.111 1.00 71.46  ? 488  ASN B O   1 
ATOM   7466 C CB  . ASN B 2 58   ? 30.972  0.621   -10.971 1.00 67.28  ? 488  ASN B CB  1 
ATOM   7467 N N   . GLU B 2 59   ? 32.169  3.566   -10.993 1.00 64.35  ? 489  GLU B N   1 
ATOM   7468 C CA  . GLU B 2 59   ? 32.120  4.984   -11.392 1.00 63.24  ? 489  GLU B CA  1 
ATOM   7469 C C   . GLU B 2 59   ? 33.456  5.443   -11.912 1.00 69.26  ? 489  GLU B C   1 
ATOM   7470 O O   . GLU B 2 59   ? 33.483  6.232   -12.851 1.00 67.74  ? 489  GLU B O   1 
ATOM   7471 C CB  . GLU B 2 59   ? 31.603  5.909   -10.286 1.00 63.71  ? 489  GLU B CB  1 
ATOM   7472 C CG  . GLU B 2 59   ? 30.135  5.711   -9.977  1.00 69.78  ? 489  GLU B CG  1 
ATOM   7473 C CD  . GLU B 2 59   ? 29.239  5.730   -11.199 1.00 93.20  ? 489  GLU B CD  1 
ATOM   7474 O OE1 . GLU B 2 59   ? 28.925  4.634   -11.724 1.00 89.54  ? 489  GLU B OE1 1 
ATOM   7475 O OE2 . GLU B 2 59   ? 28.902  6.844   -11.666 1.00 80.32  ? 489  GLU B OE2 1 
ATOM   7476 N N   . THR B 2 60   ? 34.569  4.892   -11.345 1.00 68.93  ? 490  THR B N   1 
ATOM   7477 C CA  . THR B 2 60   ? 35.945  5.162   -11.777 1.00 69.82  ? 490  THR B CA  1 
ATOM   7478 C C   . THR B 2 60   ? 36.100  4.655   -13.210 1.00 74.11  ? 490  THR B C   1 
ATOM   7479 O O   . THR B 2 60   ? 36.385  5.451   -14.101 1.00 74.09  ? 490  THR B O   1 
ATOM   7480 C CB  . THR B 2 60   ? 36.958  4.586   -10.766 1.00 87.34  ? 490  THR B CB  1 
ATOM   7481 O OG1 . THR B 2 60   ? 36.778  5.259   -9.515  1.00 95.33  ? 490  THR B OG1 1 
ATOM   7482 C CG2 . THR B 2 60   ? 38.406  4.741   -11.213 1.00 86.61  ? 490  THR B CG2 1 
ATOM   7483 N N   . ILE B 2 61   ? 35.811  3.360   -13.441 1.00 71.30  ? 491  ILE B N   1 
ATOM   7484 C CA  . ILE B 2 61   ? 35.885  2.718   -14.752 1.00 71.12  ? 491  ILE B CA  1 
ATOM   7485 C C   . ILE B 2 61   ? 34.973  3.435   -15.751 1.00 75.80  ? 491  ILE B C   1 
ATOM   7486 O O   . ILE B 2 61   ? 35.402  3.653   -16.888 1.00 75.41  ? 491  ILE B O   1 
ATOM   7487 C CB  . ILE B 2 61   ? 35.656  1.178   -14.669 1.00 73.42  ? 491  ILE B CB  1 
ATOM   7488 C CG1 . ILE B 2 61   ? 36.748  0.543   -13.790 1.00 73.90  ? 491  ILE B CG1 1 
ATOM   7489 C CG2 . ILE B 2 61   ? 35.662  0.532   -16.062 1.00 72.11  ? 491  ILE B CG2 1 
ATOM   7490 C CD1 . ILE B 2 61   ? 36.445  -0.818  -13.250 1.00 85.24  ? 491  ILE B CD1 1 
ATOM   7491 N N   . LYS B 2 62   ? 33.756  3.863   -15.315 1.00 72.48  ? 492  LYS B N   1 
ATOM   7492 C CA  . LYS B 2 62   ? 32.824  4.587   -16.200 1.00 72.35  ? 492  LYS B CA  1 
ATOM   7493 C C   . LYS B 2 62   ? 33.523  5.813   -16.835 1.00 76.82  ? 492  LYS B C   1 
ATOM   7494 O O   . LYS B 2 62   ? 33.567  5.942   -18.068 1.00 76.20  ? 492  LYS B O   1 
ATOM   7495 C CB  . LYS B 2 62   ? 31.535  4.995   -15.465 1.00 73.68  ? 492  LYS B CB  1 
ATOM   7496 C CG  . LYS B 2 62   ? 30.420  3.968   -15.582 1.00 80.95  ? 492  LYS B CG  1 
ATOM   7497 C CD  . LYS B 2 62   ? 29.088  4.519   -15.076 1.00 91.15  ? 492  LYS B CD  1 
ATOM   7498 N N   . ILE B 2 63   ? 34.149  6.637   -15.957 1.00 71.76  ? 493  ILE B N   1 
ATOM   7499 C CA  . ILE B 2 63   ? 34.919  7.849   -16.217 1.00 69.71  ? 493  ILE B CA  1 
ATOM   7500 C C   . ILE B 2 63   ? 36.152  7.540   -17.136 1.00 71.12  ? 493  ILE B C   1 
ATOM   7501 O O   . ILE B 2 63   ? 36.501  8.361   -17.994 1.00 70.24  ? 493  ILE B O   1 
ATOM   7502 C CB  . ILE B 2 63   ? 35.244  8.472   -14.814 1.00 71.97  ? 493  ILE B CB  1 
ATOM   7503 C CG1 . ILE B 2 63   ? 34.316  9.639   -14.451 1.00 71.10  ? 493  ILE B CG1 1 
ATOM   7504 C CG2 . ILE B 2 63   ? 36.715  8.796   -14.574 1.00 73.32  ? 493  ILE B CG2 1 
ATOM   7505 N N   . PHE B 2 64   ? 36.762  6.342   -16.993 1.00 65.38  ? 494  PHE B N   1 
ATOM   7506 C CA  . PHE B 2 64   ? 37.898  5.939   -17.825 1.00 64.59  ? 494  PHE B CA  1 
ATOM   7507 C C   . PHE B 2 64   ? 37.445  5.515   -19.187 1.00 69.61  ? 494  PHE B C   1 
ATOM   7508 O O   . PHE B 2 64   ? 38.167  5.689   -20.173 1.00 70.11  ? 494  PHE B O   1 
ATOM   7509 C CB  . PHE B 2 64   ? 38.672  4.808   -17.167 1.00 66.25  ? 494  PHE B CB  1 
ATOM   7510 C CG  . PHE B 2 64   ? 39.833  5.314   -16.350 1.00 67.66  ? 494  PHE B CG  1 
ATOM   7511 C CD1 . PHE B 2 64   ? 39.626  5.907   -15.111 1.00 70.06  ? 494  PHE B CD1 1 
ATOM   7512 C CD2 . PHE B 2 64   ? 41.135  5.203   -16.823 1.00 69.64  ? 494  PHE B CD2 1 
ATOM   7513 C CE1 . PHE B 2 64   ? 40.697  6.380   -14.365 1.00 71.98  ? 494  PHE B CE1 1 
ATOM   7514 C CE2 . PHE B 2 64   ? 42.213  5.662   -16.065 1.00 72.92  ? 494  PHE B CE2 1 
ATOM   7515 C CZ  . PHE B 2 64   ? 41.988  6.270   -14.854 1.00 71.74  ? 494  PHE B CZ  1 
ATOM   7516 N N   . GLU B 2 65   ? 36.241  4.948   -19.250 1.00 65.70  ? 495  GLU B N   1 
ATOM   7517 C CA  . GLU B 2 65   ? 35.676  4.504   -20.497 1.00 64.95  ? 495  GLU B CA  1 
ATOM   7518 C C   . GLU B 2 65   ? 35.148  5.698   -21.295 1.00 66.78  ? 495  GLU B C   1 
ATOM   7519 O O   . GLU B 2 65   ? 35.249  5.689   -22.521 1.00 66.86  ? 495  GLU B O   1 
ATOM   7520 C CB  . GLU B 2 65   ? 34.662  3.381   -20.267 1.00 66.68  ? 495  GLU B CB  1 
ATOM   7521 C CG  . GLU B 2 65   ? 35.336  2.031   -20.034 1.00 78.36  ? 495  GLU B CG  1 
ATOM   7522 C CD  . GLU B 2 65   ? 34.475  0.887   -19.520 1.00 108.48 ? 495  GLU B CD  1 
ATOM   7523 O OE1 . GLU B 2 65   ? 33.278  1.106   -19.217 1.00 99.71  ? 495  GLU B OE1 1 
ATOM   7524 O OE2 . GLU B 2 65   ? 35.015  -0.236  -19.400 1.00 108.72 ? 495  GLU B OE2 1 
ATOM   7525 N N   . GLU B 2 66   ? 34.685  6.765   -20.599 1.00 62.18  ? 496  GLU B N   1 
ATOM   7526 C CA  . GLU B 2 66   ? 34.253  8.042   -21.212 1.00 60.71  ? 496  GLU B CA  1 
ATOM   7527 C C   . GLU B 2 66   ? 35.495  8.669   -21.857 1.00 64.33  ? 496  GLU B C   1 
ATOM   7528 O O   . GLU B 2 66   ? 35.426  9.097   -22.997 1.00 64.15  ? 496  GLU B O   1 
ATOM   7529 C CB  . GLU B 2 66   ? 33.702  9.027   -20.167 1.00 61.34  ? 496  GLU B CB  1 
ATOM   7530 C CG  . GLU B 2 66   ? 32.367  8.679   -19.539 1.00 65.14  ? 496  GLU B CG  1 
ATOM   7531 C CD  . GLU B 2 66   ? 31.828  9.771   -18.639 1.00 81.23  ? 496  GLU B CD  1 
ATOM   7532 O OE1 . GLU B 2 66   ? 31.953  10.954  -19.023 1.00 67.49  ? 496  GLU B OE1 1 
ATOM   7533 O OE2 . GLU B 2 66   ? 31.282  9.456   -17.556 1.00 80.85  ? 496  GLU B OE2 1 
ATOM   7534 N N   . GLN B 2 67   ? 36.637  8.681   -21.137 1.00 61.22  ? 497  GLN B N   1 
ATOM   7535 C CA  . GLN B 2 67   ? 37.910  9.163   -21.653 1.00 61.68  ? 497  GLN B CA  1 
ATOM   7536 C C   . GLN B 2 67   ? 38.273  8.433   -22.958 1.00 67.20  ? 497  GLN B C   1 
ATOM   7537 O O   . GLN B 2 67   ? 38.673  9.089   -23.927 1.00 67.04  ? 497  GLN B O   1 
ATOM   7538 C CB  . GLN B 2 67   ? 39.029  9.017   -20.602 1.00 62.88  ? 497  GLN B CB  1 
ATOM   7539 C CG  . GLN B 2 67   ? 40.374  9.644   -21.009 1.00 63.20  ? 497  GLN B CG  1 
ATOM   7540 C CD  . GLN B 2 67   ? 40.438  11.145  -20.858 1.00 75.22  ? 497  GLN B CD  1 
ATOM   7541 O OE1 . GLN B 2 67   ? 39.428  11.838  -20.648 1.00 69.66  ? 497  GLN B OE1 1 
ATOM   7542 N NE2 . GLN B 2 67   ? 41.641  11.677  -20.925 1.00 62.18  ? 497  GLN B NE2 1 
ATOM   7543 N N   . CYS B 2 68   ? 38.074  7.102   -23.007 1.00 64.98  ? 498  CYS B N   1 
ATOM   7544 C CA  . CYS B 2 68   ? 38.364  6.327   -24.215 1.00 66.23  ? 498  CYS B CA  1 
ATOM   7545 C C   . CYS B 2 68   ? 37.504  6.734   -25.404 1.00 73.34  ? 498  CYS B C   1 
ATOM   7546 O O   . CYS B 2 68   ? 37.987  6.763   -26.533 1.00 73.50  ? 498  CYS B O   1 
ATOM   7547 C CB  . CYS B 2 68   ? 38.253  4.841   -23.934 1.00 67.01  ? 498  CYS B CB  1 
ATOM   7548 S SG  . CYS B 2 68   ? 39.621  4.184   -22.957 1.00 71.31  ? 498  CYS B SG  1 
ATOM   7549 N N   . GLN B 2 69   ? 36.230  7.056   -25.147 1.00 71.19  ? 499  GLN B N   1 
ATOM   7550 C CA  . GLN B 2 69   ? 35.311  7.512   -26.171 1.00 70.89  ? 499  GLN B CA  1 
ATOM   7551 C C   . GLN B 2 69   ? 35.760  8.890   -26.635 1.00 74.08  ? 499  GLN B C   1 
ATOM   7552 O O   . GLN B 2 69   ? 35.891  9.079   -27.844 1.00 74.21  ? 499  GLN B O   1 
ATOM   7553 C CB  . GLN B 2 69   ? 33.843  7.472   -25.678 1.00 72.70  ? 499  GLN B CB  1 
ATOM   7554 C CG  . GLN B 2 69   ? 32.760  7.682   -26.759 1.00 105.49 ? 499  GLN B CG  1 
ATOM   7555 C CD  . GLN B 2 69   ? 32.966  6.899   -28.054 1.00 134.95 ? 499  GLN B CD  1 
ATOM   7556 O OE1 . GLN B 2 69   ? 33.200  5.674   -28.057 1.00 129.27 ? 499  GLN B OE1 1 
ATOM   7557 N NE2 . GLN B 2 69   ? 32.880  7.602   -29.191 1.00 126.51 ? 499  GLN B NE2 1 
ATOM   7558 N N   . THR B 2 70   ? 36.110  9.807   -25.690 1.00 70.57  ? 500  THR B N   1 
ATOM   7559 C CA  . THR B 2 70   ? 36.614  11.164  -26.005 1.00 70.22  ? 500  THR B CA  1 
ATOM   7560 C C   . THR B 2 70   ? 37.860  11.089  -26.869 1.00 75.09  ? 500  THR B C   1 
ATOM   7561 O O   . THR B 2 70   ? 37.896  11.725  -27.919 1.00 74.72  ? 500  THR B O   1 
ATOM   7562 C CB  . THR B 2 70   ? 36.819  12.004  -24.747 1.00 66.85  ? 500  THR B CB  1 
ATOM   7563 O OG1 . THR B 2 70   ? 35.541  12.175  -24.155 1.00 63.35  ? 500  THR B OG1 1 
ATOM   7564 C CG2 . THR B 2 70   ? 37.458  13.381  -25.049 1.00 57.30  ? 500  THR B CG2 1 
ATOM   7565 N N   . GLN B 2 71   ? 38.850  10.281  -26.447 1.00 72.09  ? 501  GLN B N   1 
ATOM   7566 C CA  . GLN B 2 71   ? 40.066  10.017  -27.205 1.00 72.37  ? 501  GLN B CA  1 
ATOM   7567 C C   . GLN B 2 71   ? 39.725  9.627   -28.676 1.00 77.81  ? 501  GLN B C   1 
ATOM   7568 O O   . GLN B 2 71   ? 40.230  10.275  -29.581 1.00 77.41  ? 501  GLN B O   1 
ATOM   7569 C CB  . GLN B 2 71   ? 40.886  8.907   -26.516 1.00 73.25  ? 501  GLN B CB  1 
ATOM   7570 C CG  . GLN B 2 71   ? 42.342  8.855   -26.949 1.00 83.66  ? 501  GLN B CG  1 
ATOM   7571 C CD  . GLN B 2 71   ? 42.581  8.197   -28.295 1.00 100.79 ? 501  GLN B CD  1 
ATOM   7572 O OE1 . GLN B 2 71   ? 41.752  7.431   -28.830 1.00 97.83  ? 501  GLN B OE1 1 
ATOM   7573 N NE2 . GLN B 2 71   ? 43.761  8.446   -28.842 1.00 86.72  ? 501  GLN B NE2 1 
ATOM   7574 N N   . GLU B 2 72   ? 38.866  8.598   -28.891 1.00 75.59  ? 502  GLU B N   1 
ATOM   7575 C CA  . GLU B 2 72   ? 38.433  8.065   -30.193 1.00 76.67  ? 502  GLU B CA  1 
ATOM   7576 C C   . GLU B 2 72   ? 37.643  9.028   -31.122 1.00 83.82  ? 502  GLU B C   1 
ATOM   7577 O O   . GLU B 2 72   ? 37.458  8.732   -32.308 1.00 83.89  ? 502  GLU B O   1 
ATOM   7578 C CB  . GLU B 2 72   ? 37.572  6.842   -29.965 1.00 78.26  ? 502  GLU B CB  1 
ATOM   7579 C CG  . GLU B 2 72   ? 38.339  5.574   -29.691 1.00 92.15  ? 502  GLU B CG  1 
ATOM   7580 C CD  . GLU B 2 72   ? 37.443  4.465   -29.184 1.00 118.38 ? 502  GLU B CD  1 
ATOM   7581 O OE1 . GLU B 2 72   ? 37.999  3.471   -28.665 1.00 118.18 ? 502  GLU B OE1 1 
ATOM   7582 O OE2 . GLU B 2 72   ? 36.197  4.592   -29.278 1.00 109.86 ? 502  GLU B OE2 1 
ATOM   7583 N N   . ARG B 2 73   ? 37.093  10.102  -30.577 1.00 81.47  ? 503  ARG B N   1 
ATOM   7584 C CA  . ARG B 2 73   ? 36.340  11.057  -31.375 1.00 81.36  ? 503  ARG B CA  1 
ATOM   7585 C C   . ARG B 2 73   ? 37.287  12.207  -31.636 1.00 86.45  ? 503  ARG B C   1 
ATOM   7586 O O   . ARG B 2 73   ? 37.750  12.359  -32.757 1.00 86.85  ? 503  ARG B O   1 
ATOM   7587 C CB  . ARG B 2 73   ? 35.050  11.493  -30.651 1.00 79.55  ? 503  ARG B CB  1 
ATOM   7588 C CG  . ARG B 2 73   ? 34.073  12.261  -31.536 1.00 86.43  ? 503  ARG B CG  1 
ATOM   7589 C CD  . ARG B 2 73   ? 32.771  12.583  -30.839 1.00 88.64  ? 503  ARG B CD  1 
ATOM   7590 N NE  . ARG B 2 73   ? 32.920  13.664  -29.863 1.00 88.25  ? 503  ARG B NE  1 
ATOM   7591 C CZ  . ARG B 2 73   ? 33.027  13.484  -28.548 1.00 87.65  ? 503  ARG B CZ  1 
ATOM   7592 N NH1 . ARG B 2 73   ? 33.005  12.258  -28.031 1.00 60.38  ? 503  ARG B NH1 1 
ATOM   7593 N NH2 . ARG B 2 73   ? 33.159  14.523  -27.741 1.00 64.90  ? 503  ARG B NH2 1 
ATOM   7594 N N   . TYR B 2 74   ? 37.659  12.939  -30.573 1.00 83.61  ? 504  TYR B N   1 
ATOM   7595 C CA  . TYR B 2 74   ? 38.606  14.060  -30.563 1.00 82.96  ? 504  TYR B CA  1 
ATOM   7596 C C   . TYR B 2 74   ? 39.892  13.865  -31.412 1.00 87.48  ? 504  TYR B C   1 
ATOM   7597 O O   . TYR B 2 74   ? 40.424  14.842  -31.938 1.00 85.61  ? 504  TYR B O   1 
ATOM   7598 C CB  . TYR B 2 74   ? 38.990  14.427  -29.105 1.00 82.32  ? 504  TYR B CB  1 
ATOM   7599 C CG  . TYR B 2 74   ? 39.572  15.813  -29.036 1.00 81.91  ? 504  TYR B CG  1 
ATOM   7600 C CD1 . TYR B 2 74   ? 38.748  16.933  -29.095 1.00 83.60  ? 504  TYR B CD1 1 
ATOM   7601 C CD2 . TYR B 2 74   ? 40.952  16.013  -29.068 1.00 81.83  ? 504  TYR B CD2 1 
ATOM   7602 C CE1 . TYR B 2 74   ? 39.276  18.216  -29.142 1.00 84.35  ? 504  TYR B CE1 1 
ATOM   7603 C CE2 . TYR B 2 74   ? 41.492  17.293  -29.111 1.00 82.36  ? 504  TYR B CE2 1 
ATOM   7604 C CZ  . TYR B 2 74   ? 40.647  18.391  -29.133 1.00 88.73  ? 504  TYR B CZ  1 
ATOM   7605 O OH  . TYR B 2 74   ? 41.138  19.660  -29.184 1.00 86.08  ? 504  TYR B OH  1 
ATOM   7606 N N   . SER B 2 75   ? 40.397  12.622  -31.502 1.00 86.92  ? 505  SER B N   1 
ATOM   7607 C CA  . SER B 2 75   ? 41.612  12.290  -32.240 1.00 88.16  ? 505  SER B CA  1 
ATOM   7608 C C   . SER B 2 75   ? 41.438  12.400  -33.748 1.00 93.74  ? 505  SER B C   1 
ATOM   7609 O O   . SER B 2 75   ? 42.275  13.025  -34.383 1.00 92.31  ? 505  SER B O   1 
ATOM   7610 C CB  . SER B 2 75   ? 42.131  10.907  -31.852 1.00 93.62  ? 505  SER B CB  1 
ATOM   7611 O OG  . SER B 2 75   ? 41.241  9.858   -32.215 1.00 104.76 ? 505  SER B OG  1 
ATOM   7612 N N   . LYS B 2 76   ? 40.362  11.803  -34.311 1.00 94.19  ? 506  LYS B N   1 
ATOM   7613 C CA  . LYS B 2 76   ? 40.013  11.770  -35.749 1.00 96.15  ? 506  LYS B CA  1 
ATOM   7614 C C   . LYS B 2 76   ? 40.510  13.013  -36.568 1.00 105.13 ? 506  LYS B C   1 
ATOM   7615 O O   . LYS B 2 76   ? 41.309  12.856  -37.500 1.00 105.19 ? 506  LYS B O   1 
ATOM   7616 C CB  . LYS B 2 76   ? 38.485  11.552  -35.929 1.00 97.96  ? 506  LYS B CB  1 
ATOM   7617 C CG  . LYS B 2 76   ? 38.021  11.357  -37.377 1.00 107.10 ? 506  LYS B CG  1 
ATOM   7618 C CD  . LYS B 2 76   ? 36.520  11.584  -37.559 1.00 112.09 ? 506  LYS B CD  1 
ATOM   7619 N N   . GLU B 2 77   ? 40.073  14.228  -36.173 1.00 103.85 ? 507  GLU B N   1 
ATOM   7620 C CA  . GLU B 2 77   ? 40.378  15.509  -36.828 1.00 104.75 ? 507  GLU B CA  1 
ATOM   7621 C C   . GLU B 2 77   ? 41.856  15.936  -36.763 1.00 109.63 ? 507  GLU B C   1 
ATOM   7622 O O   . GLU B 2 77   ? 42.273  16.799  -37.547 1.00 109.43 ? 507  GLU B O   1 
ATOM   7623 C CB  . GLU B 2 77   ? 39.472  16.630  -36.270 1.00 106.52 ? 507  GLU B CB  1 
ATOM   7624 C CG  . GLU B 2 77   ? 37.986  16.491  -36.606 1.00 119.55 ? 507  GLU B CG  1 
ATOM   7625 C CD  . GLU B 2 77   ? 37.113  15.581  -35.751 1.00 135.54 ? 507  GLU B CD  1 
ATOM   7626 O OE1 . GLU B 2 77   ? 37.653  14.825  -34.910 1.00 115.62 ? 507  GLU B OE1 1 
ATOM   7627 O OE2 . GLU B 2 77   ? 35.876  15.611  -35.947 1.00 130.86 ? 507  GLU B OE2 1 
ATOM   7628 N N   . TYR B 2 78   ? 42.631  15.354  -35.826 1.00 106.67 ? 508  TYR B N   1 
ATOM   7629 C CA  . TYR B 2 78   ? 44.057  15.652  -35.619 1.00 106.81 ? 508  TYR B CA  1 
ATOM   7630 C C   . TYR B 2 78   ? 44.975  14.615  -36.257 1.00 110.91 ? 508  TYR B C   1 
ATOM   7631 O O   . TYR B 2 78   ? 45.960  14.999  -36.896 1.00 111.07 ? 508  TYR B O   1 
ATOM   7632 C CB  . TYR B 2 78   ? 44.383  15.862  -34.128 1.00 107.67 ? 508  TYR B CB  1 
ATOM   7633 C CG  . TYR B 2 78   ? 43.761  17.123  -33.580 1.00 109.03 ? 508  TYR B CG  1 
ATOM   7634 C CD1 . TYR B 2 78   ? 42.457  17.125  -33.095 1.00 110.80 ? 508  TYR B CD1 1 
ATOM   7635 C CD2 . TYR B 2 78   ? 44.450  18.332  -33.606 1.00 109.73 ? 508  TYR B CD2 1 
ATOM   7636 C CE1 . TYR B 2 78   ? 41.862  18.293  -32.628 1.00 111.88 ? 508  TYR B CE1 1 
ATOM   7637 C CE2 . TYR B 2 78   ? 43.871  19.505  -33.123 1.00 110.51 ? 508  TYR B CE2 1 
ATOM   7638 C CZ  . TYR B 2 78   ? 42.574  19.481  -32.638 1.00 119.25 ? 508  TYR B CZ  1 
ATOM   7639 O OH  . TYR B 2 78   ? 41.981  20.630  -32.170 1.00 123.86 ? 508  TYR B OH  1 
ATOM   7640 N N   . ILE B 2 79   ? 44.635  13.308  -36.120 1.00 106.06 ? 509  ILE B N   1 
ATOM   7641 C CA  . ILE B 2 79   ? 45.383  12.209  -36.733 1.00 105.23 ? 509  ILE B CA  1 
ATOM   7642 C C   . ILE B 2 79   ? 45.297  12.378  -38.287 1.00 111.21 ? 509  ILE B C   1 
ATOM   7643 O O   . ILE B 2 79   ? 46.281  12.121  -38.992 1.00 110.38 ? 509  ILE B O   1 
ATOM   7644 C CB  . ILE B 2 79   ? 44.913  10.830  -36.182 1.00 107.35 ? 509  ILE B CB  1 
ATOM   7645 C CG1 . ILE B 2 79   ? 45.146  10.720  -34.663 1.00 106.91 ? 509  ILE B CG1 1 
ATOM   7646 C CG2 . ILE B 2 79   ? 45.598  9.662   -36.884 1.00 108.04 ? 509  ILE B CG2 1 
ATOM   7647 N N   . GLU B 2 80   ? 44.155  12.923  -38.787 1.00 109.31 ? 510  GLU B N   1 
ATOM   7648 C CA  . GLU B 2 80   ? 43.950  13.228  -40.205 1.00 109.93 ? 510  GLU B CA  1 
ATOM   7649 C C   . GLU B 2 80   ? 44.827  14.423  -40.631 1.00 116.21 ? 510  GLU B C   1 
ATOM   7650 O O   . GLU B 2 80   ? 45.590  14.298  -41.591 1.00 115.98 ? 510  GLU B O   1 
ATOM   7651 C CB  . GLU B 2 80   ? 42.465  13.490  -40.513 1.00 111.17 ? 510  GLU B CB  1 
ATOM   7652 N N   . LYS B 2 81   ? 44.743  15.555  -39.881 1.00 114.34 ? 511  LYS B N   1 
ATOM   7653 C CA  . LYS B 2 81   ? 45.485  16.816  -40.085 1.00 114.46 ? 511  LYS B CA  1 
ATOM   7654 C C   . LYS B 2 81   ? 47.020  16.637  -40.027 1.00 118.59 ? 511  LYS B C   1 
ATOM   7655 O O   . LYS B 2 81   ? 47.727  17.245  -40.835 1.00 118.56 ? 511  LYS B O   1 
ATOM   7656 C CB  . LYS B 2 81   ? 45.011  17.884  -39.072 1.00 116.88 ? 511  LYS B CB  1 
ATOM   7657 C CG  . LYS B 2 81   ? 45.477  19.307  -39.358 1.00 129.52 ? 511  LYS B CG  1 
ATOM   7658 N N   . PHE B 2 82   ? 47.523  15.813  -39.078 1.00 114.32 ? 512  PHE B N   1 
ATOM   7659 C CA  . PHE B 2 82   ? 48.953  15.536  -38.914 1.00 113.60 ? 512  PHE B CA  1 
ATOM   7660 C C   . PHE B 2 82   ? 49.532  14.695  -40.054 1.00 116.81 ? 512  PHE B C   1 
ATOM   7661 O O   . PHE B 2 82   ? 50.678  14.923  -40.440 1.00 116.09 ? 512  PHE B O   1 
ATOM   7662 C CB  . PHE B 2 82   ? 49.225  14.835  -37.580 1.00 115.30 ? 512  PHE B CB  1 
ATOM   7663 C CG  . PHE B 2 82   ? 49.122  15.676  -36.332 1.00 116.80 ? 512  PHE B CG  1 
ATOM   7664 C CD1 . PHE B 2 82   ? 49.680  16.949  -36.281 1.00 119.92 ? 512  PHE B CD1 1 
ATOM   7665 C CD2 . PHE B 2 82   ? 48.554  15.161  -35.174 1.00 118.59 ? 512  PHE B CD2 1 
ATOM   7666 C CE1 . PHE B 2 82   ? 49.610  17.713  -35.114 1.00 120.60 ? 512  PHE B CE1 1 
ATOM   7667 C CE2 . PHE B 2 82   ? 48.483  15.926  -34.009 1.00 121.26 ? 512  PHE B CE2 1 
ATOM   7668 C CZ  . PHE B 2 82   ? 49.020  17.194  -33.983 1.00 119.26 ? 512  PHE B CZ  1 
ATOM   7669 N N   . LYS B 2 83   ? 48.754  13.704  -40.561 1.00 112.92 ? 513  LYS B N   1 
ATOM   7670 C CA  . LYS B 2 83   ? 49.145  12.799  -41.648 1.00 112.39 ? 513  LYS B CA  1 
ATOM   7671 C C   . LYS B 2 83   ? 49.443  13.570  -42.941 1.00 116.91 ? 513  LYS B C   1 
ATOM   7672 O O   . LYS B 2 83   ? 50.460  13.304  -43.590 1.00 116.81 ? 513  LYS B O   1 
ATOM   7673 C CB  . LYS B 2 83   ? 48.072  11.719  -41.875 1.00 114.13 ? 513  LYS B CB  1 
ATOM   7674 C CG  . LYS B 2 83   ? 48.649  10.325  -42.109 1.00 119.34 ? 513  LYS B CG  1 
ATOM   7675 N N   . ARG B 2 84   ? 48.585  14.567  -43.270 1.00 113.27 ? 514  ARG B N   1 
ATOM   7676 C CA  . ARG B 2 84   ? 48.697  15.475  -44.428 1.00 112.61 ? 514  ARG B CA  1 
ATOM   7677 C C   . ARG B 2 84   ? 49.994  16.313  -44.357 1.00 115.25 ? 514  ARG B C   1 
ATOM   7678 O O   . ARG B 2 84   ? 50.497  16.754  -45.393 1.00 114.36 ? 514  ARG B O   1 
ATOM   7679 C CB  . ARG B 2 84   ? 47.498  16.448  -44.452 1.00 112.58 ? 514  ARG B CB  1 
ATOM   7680 C CG  . ARG B 2 84   ? 46.132  15.787  -44.558 1.00 121.75 ? 514  ARG B CG  1 
ATOM   7681 C CD  . ARG B 2 84   ? 45.048  16.716  -44.058 1.00 130.41 ? 514  ARG B CD  1 
ATOM   7682 N N   . GLU B 2 85   ? 50.503  16.543  -43.120 1.00 110.92 ? 515  GLU B N   1 
ATOM   7683 C CA  . GLU B 2 85   ? 51.697  17.327  -42.783 1.00 109.81 ? 515  GLU B CA  1 
ATOM   7684 C C   . GLU B 2 85   ? 52.935  16.450  -42.457 1.00 111.63 ? 515  GLU B C   1 
ATOM   7685 O O   . GLU B 2 85   ? 53.984  16.979  -42.059 1.00 110.52 ? 515  GLU B O   1 
ATOM   7686 C CB  . GLU B 2 85   ? 51.384  18.291  -41.616 1.00 111.11 ? 515  GLU B CB  1 
ATOM   7687 C CG  . GLU B 2 85   ? 50.295  19.307  -41.915 1.00 119.80 ? 515  GLU B CG  1 
ATOM   7688 N N   . GLY B 2 86   ? 52.798  15.129  -42.627 1.00 107.49 ? 516  GLY B N   1 
ATOM   7689 C CA  . GLY B 2 86   ? 53.865  14.160  -42.368 1.00 107.20 ? 516  GLY B CA  1 
ATOM   7690 C C   . GLY B 2 86   ? 54.267  13.997  -40.909 1.00 111.03 ? 516  GLY B C   1 
ATOM   7691 O O   . GLY B 2 86   ? 55.296  13.372  -40.617 1.00 108.80 ? 516  GLY B O   1 
ATOM   7692 N N   . ASN B 2 87   ? 53.435  14.557  -39.977 1.00 108.85 ? 517  ASN B N   1 
ATOM   7693 C CA  . ASN B 2 87   ? 53.607  14.501  -38.523 1.00 108.41 ? 517  ASN B CA  1 
ATOM   7694 C C   . ASN B 2 87   ? 53.154  13.129  -38.044 1.00 112.31 ? 517  ASN B C   1 
ATOM   7695 O O   . ASN B 2 87   ? 52.163  12.999  -37.324 1.00 111.73 ? 517  ASN B O   1 
ATOM   7696 C CB  . ASN B 2 87   ? 52.841  15.634  -37.820 1.00 107.47 ? 517  ASN B CB  1 
ATOM   7697 N N   . GLU B 2 88   ? 53.886  12.090  -38.494 1.00 108.77 ? 518  GLU B N   1 
ATOM   7698 C CA  . GLU B 2 88   ? 53.675  10.683  -38.140 1.00 108.06 ? 518  GLU B CA  1 
ATOM   7699 C C   . GLU B 2 88   ? 54.126  10.557  -36.687 1.00 109.76 ? 518  GLU B C   1 
ATOM   7700 O O   . GLU B 2 88   ? 53.734  9.640   -35.966 1.00 109.73 ? 518  GLU B O   1 
ATOM   7701 C CB  . GLU B 2 88   ? 54.540  9.767   -39.035 1.00 109.47 ? 518  GLU B CB  1 
ATOM   7702 C CG  . GLU B 2 88   ? 54.209  9.812   -40.521 1.00 120.00 ? 518  GLU B CG  1 
ATOM   7703 C CD  . GLU B 2 88   ? 53.379  8.658   -41.051 1.00 136.07 ? 518  GLU B CD  1 
ATOM   7704 O OE1 . GLU B 2 88   ? 53.926  7.538   -41.171 1.00 130.08 ? 518  GLU B OE1 1 
ATOM   7705 O OE2 . GLU B 2 88   ? 52.195  8.882   -41.393 1.00 124.52 ? 518  GLU B OE2 1 
ATOM   7706 N N   . THR B 2 89   ? 54.952  11.517  -36.276 1.00 103.86 ? 519  THR B N   1 
ATOM   7707 C CA  . THR B 2 89   ? 55.528  11.650  -34.950 1.00 102.64 ? 519  THR B CA  1 
ATOM   7708 C C   . THR B 2 89   ? 54.476  12.110  -33.950 1.00 102.25 ? 519  THR B C   1 
ATOM   7709 O O   . THR B 2 89   ? 54.431  11.570  -32.843 1.00 101.25 ? 519  THR B O   1 
ATOM   7710 C CB  . THR B 2 89   ? 56.774  12.529  -35.023 1.00 111.97 ? 519  THR B CB  1 
ATOM   7711 O OG1 . THR B 2 89   ? 56.501  13.624  -35.907 1.00 113.55 ? 519  THR B OG1 1 
ATOM   7712 C CG2 . THR B 2 89   ? 57.977  11.756  -35.540 1.00 110.19 ? 519  THR B CG2 1 
ATOM   7713 N N   . GLU B 2 90   ? 53.611  13.074  -34.345 1.00 95.90  ? 520  GLU B N   1 
ATOM   7714 C CA  . GLU B 2 90   ? 52.527  13.545  -33.482 1.00 94.45  ? 520  GLU B CA  1 
ATOM   7715 C C   . GLU B 2 90   ? 51.441  12.474  -33.320 1.00 95.62  ? 520  GLU B C   1 
ATOM   7716 O O   . GLU B 2 90   ? 50.950  12.269  -32.205 1.00 96.20  ? 520  GLU B O   1 
ATOM   7717 C CB  . GLU B 2 90   ? 51.951  14.881  -33.955 1.00 95.81  ? 520  GLU B CB  1 
ATOM   7718 C CG  . GLU B 2 90   ? 52.573  16.101  -33.284 1.00 106.24 ? 520  GLU B CG  1 
ATOM   7719 C CD  . GLU B 2 90   ? 52.674  16.078  -31.769 1.00 122.23 ? 520  GLU B CD  1 
ATOM   7720 O OE1 . GLU B 2 90   ? 51.622  16.129  -31.089 1.00 124.06 ? 520  GLU B OE1 1 
ATOM   7721 O OE2 . GLU B 2 90   ? 53.817  16.017  -31.262 1.00 107.51 ? 520  GLU B OE2 1 
ATOM   7722 N N   . ILE B 2 91   ? 51.134  11.739  -34.413 1.00 88.35  ? 521  ILE B N   1 
ATOM   7723 C CA  . ILE B 2 91   ? 50.194  10.615  -34.428 1.00 85.96  ? 521  ILE B CA  1 
ATOM   7724 C C   . ILE B 2 91   ? 50.760  9.533   -33.501 1.00 87.18  ? 521  ILE B C   1 
ATOM   7725 O O   . ILE B 2 91   ? 50.018  8.964   -32.714 1.00 85.60  ? 521  ILE B O   1 
ATOM   7726 C CB  . ILE B 2 91   ? 49.942  10.115  -35.887 1.00 88.47  ? 521  ILE B CB  1 
ATOM   7727 C CG1 . ILE B 2 91   ? 49.073  11.114  -36.666 1.00 88.64  ? 521  ILE B CG1 1 
ATOM   7728 C CG2 . ILE B 2 91   ? 49.306  8.715   -35.933 1.00 89.12  ? 521  ILE B CG2 1 
ATOM   7729 C CD1 . ILE B 2 91   ? 49.366  11.180  -38.158 1.00 96.57  ? 521  ILE B CD1 1 
ATOM   7730 N N   . GLN B 2 92   ? 52.080  9.308   -33.546 1.00 84.22  ? 522  GLN B N   1 
ATOM   7731 C CA  . GLN B 2 92   ? 52.761  8.317   -32.713 1.00 84.58  ? 522  GLN B CA  1 
ATOM   7732 C C   . GLN B 2 92   ? 52.651  8.648   -31.222 1.00 86.87  ? 522  GLN B C   1 
ATOM   7733 O O   . GLN B 2 92   ? 52.581  7.729   -30.400 1.00 87.70  ? 522  GLN B O   1 
ATOM   7734 C CB  . GLN B 2 92   ? 54.236  8.166   -33.140 1.00 86.52  ? 522  GLN B CB  1 
ATOM   7735 C CG  . GLN B 2 92   ? 54.745  6.720   -33.111 1.00 108.19 ? 522  GLN B CG  1 
ATOM   7736 C CD  . GLN B 2 92   ? 56.054  6.517   -33.852 1.00 131.82 ? 522  GLN B CD  1 
ATOM   7737 O OE1 . GLN B 2 92   ? 56.862  7.441   -34.038 1.00 129.72 ? 522  GLN B OE1 1 
ATOM   7738 N NE2 . GLN B 2 92   ? 56.310  5.281   -34.266 1.00 120.11 ? 522  GLN B NE2 1 
ATOM   7739 N N   . ARG B 2 93   ? 52.606  9.955   -30.885 1.00 80.44  ? 523  ARG B N   1 
ATOM   7740 C CA  . ARG B 2 93   ? 52.493  10.449  -29.509 1.00 79.28  ? 523  ARG B CA  1 
ATOM   7741 C C   . ARG B 2 93   ? 51.091  10.316  -28.973 1.00 81.77  ? 523  ARG B C   1 
ATOM   7742 O O   . ARG B 2 93   ? 50.932  9.955   -27.805 1.00 82.29  ? 523  ARG B O   1 
ATOM   7743 C CB  . ARG B 2 93   ? 52.915  11.907  -29.413 1.00 78.12  ? 523  ARG B CB  1 
ATOM   7744 C CG  . ARG B 2 93   ? 54.400  12.092  -29.475 1.00 76.64  ? 523  ARG B CG  1 
ATOM   7745 C CD  . ARG B 2 93   ? 54.686  13.553  -29.430 1.00 72.80  ? 523  ARG B CD  1 
ATOM   7746 N NE  . ARG B 2 93   ? 54.793  13.993  -28.046 1.00 64.98  ? 523  ARG B NE  1 
ATOM   7747 C CZ  . ARG B 2 93   ? 54.534  15.224  -27.633 1.00 71.03  ? 523  ARG B CZ  1 
ATOM   7748 N NH1 . ARG B 2 93   ? 54.128  16.151  -28.497 1.00 47.99  ? 523  ARG B NH1 1 
ATOM   7749 N NH2 . ARG B 2 93   ? 54.654  15.535  -26.349 1.00 60.44  ? 523  ARG B NH2 1 
ATOM   7750 N N   . ILE B 2 94   ? 50.079  10.663  -29.806 1.00 75.45  ? 524  ILE B N   1 
ATOM   7751 C CA  . ILE B 2 94   ? 48.665  10.554  -29.476 1.00 73.86  ? 524  ILE B CA  1 
ATOM   7752 C C   . ILE B 2 94   ? 48.323  9.076   -29.213 1.00 82.09  ? 524  ILE B C   1 
ATOM   7753 O O   . ILE B 2 94   ? 47.736  8.775   -28.180 1.00 83.58  ? 524  ILE B O   1 
ATOM   7754 C CB  . ILE B 2 94   ? 47.770  11.164  -30.584 1.00 75.00  ? 524  ILE B CB  1 
ATOM   7755 C CG1 . ILE B 2 94   ? 47.994  12.667  -30.764 1.00 74.61  ? 524  ILE B CG1 1 
ATOM   7756 C CG2 . ILE B 2 94   ? 46.316  10.886  -30.318 1.00 74.37  ? 524  ILE B CG2 1 
ATOM   7757 N N   . MET B 2 95   ? 48.722  8.166   -30.123 1.00 80.59  ? 525  MET B N   1 
ATOM   7758 C CA  . MET B 2 95   ? 48.429  6.732   -30.064 1.00 81.22  ? 525  MET B CA  1 
ATOM   7759 C C   . MET B 2 95   ? 49.027  6.038   -28.880 1.00 83.73  ? 525  MET B C   1 
ATOM   7760 O O   . MET B 2 95   ? 48.339  5.228   -28.260 1.00 82.98  ? 525  MET B O   1 
ATOM   7761 C CB  . MET B 2 95   ? 48.820  5.993   -31.359 1.00 84.50  ? 525  MET B CB  1 
ATOM   7762 C CG  . MET B 2 95   ? 48.169  6.538   -32.629 1.00 89.79  ? 525  MET B CG  1 
ATOM   7763 S SD  . MET B 2 95   ? 46.364  6.790   -32.633 1.00 95.84  ? 525  MET B SD  1 
ATOM   7764 C CE  . MET B 2 95   ? 46.038  6.686   -34.463 1.00 93.03  ? 525  MET B CE  1 
ATOM   7765 N N   . HIS B 2 96   ? 50.303  6.308   -28.575 1.00 80.89  ? 526  HIS B N   1 
ATOM   7766 C CA  . HIS B 2 96   ? 50.942  5.662   -27.426 1.00 81.67  ? 526  HIS B CA  1 
ATOM   7767 C C   . HIS B 2 96   ? 50.351  6.191   -26.109 1.00 81.12  ? 526  HIS B C   1 
ATOM   7768 O O   . HIS B 2 96   ? 50.234  5.434   -25.141 1.00 81.06  ? 526  HIS B O   1 
ATOM   7769 C CB  . HIS B 2 96   ? 52.477  5.783   -27.464 1.00 84.21  ? 526  HIS B CB  1 
ATOM   7770 C CG  . HIS B 2 96   ? 53.134  5.193   -26.248 1.00 89.43  ? 526  HIS B CG  1 
ATOM   7771 N ND1 . HIS B 2 96   ? 53.408  5.967   -25.122 1.00 91.96  ? 526  HIS B ND1 1 
ATOM   7772 C CD2 . HIS B 2 96   ? 53.461  3.906   -25.980 1.00 92.66  ? 526  HIS B CD2 1 
ATOM   7773 C CE1 . HIS B 2 96   ? 53.937  5.141   -24.235 1.00 92.00  ? 526  HIS B CE1 1 
ATOM   7774 N NE2 . HIS B 2 96   ? 53.988  3.889   -24.701 1.00 92.66  ? 526  HIS B NE2 1 
ATOM   7775 N N   . ASN B 2 97   ? 49.945  7.475   -26.089 1.00 73.89  ? 527  ASN B N   1 
ATOM   7776 C CA  . ASN B 2 97   ? 49.311  8.069   -24.923 1.00 72.53  ? 527  ASN B CA  1 
ATOM   7777 C C   . ASN B 2 97   ? 48.022  7.305   -24.630 1.00 77.12  ? 527  ASN B C   1 
ATOM   7778 O O   . ASN B 2 97   ? 47.714  7.053   -23.469 1.00 77.51  ? 527  ASN B O   1 
ATOM   7779 C CB  . ASN B 2 97   ? 49.041  9.550   -25.132 1.00 67.69  ? 527  ASN B CB  1 
ATOM   7780 C CG  . ASN B 2 97   ? 48.578  10.228  -23.864 1.00 84.65  ? 527  ASN B CG  1 
ATOM   7781 O OD1 . ASN B 2 97   ? 47.373  10.270  -23.549 1.00 74.86  ? 527  ASN B OD1 1 
ATOM   7782 N ND2 . ASN B 2 97   ? 49.537  10.694  -23.076 1.00 70.75  ? 527  ASN B ND2 1 
ATOM   7783 N N   . TYR B 2 98   ? 47.311  6.889   -25.694 1.00 72.63  ? 528  TYR B N   1 
ATOM   7784 C CA  . TYR B 2 98   ? 46.108  6.091   -25.597 1.00 72.10  ? 528  TYR B CA  1 
ATOM   7785 C C   . TYR B 2 98   ? 46.456  4.724   -25.054 1.00 74.39  ? 528  TYR B C   1 
ATOM   7786 O O   . TYR B 2 98   ? 45.783  4.251   -24.156 1.00 73.99  ? 528  TYR B O   1 
ATOM   7787 C CB  . TYR B 2 98   ? 45.425  5.979   -26.956 1.00 74.14  ? 528  TYR B CB  1 
ATOM   7788 C CG  . TYR B 2 98   ? 44.013  5.423   -26.933 1.00 77.98  ? 528  TYR B CG  1 
ATOM   7789 C CD1 . TYR B 2 98   ? 43.135  5.732   -25.896 1.00 80.37  ? 528  TYR B CD1 1 
ATOM   7790 C CD2 . TYR B 2 98   ? 43.514  4.692   -28.008 1.00 79.15  ? 528  TYR B CD2 1 
ATOM   7791 C CE1 . TYR B 2 98   ? 41.808  5.310   -25.922 1.00 82.15  ? 528  TYR B CE1 1 
ATOM   7792 C CE2 . TYR B 2 98   ? 42.197  4.242   -28.031 1.00 80.11  ? 528  TYR B CE2 1 
ATOM   7793 C CZ  . TYR B 2 98   ? 41.341  4.558   -26.990 1.00 86.64  ? 528  TYR B CZ  1 
ATOM   7794 O OH  . TYR B 2 98   ? 40.031  4.121   -27.011 1.00 84.34  ? 528  TYR B OH  1 
ATOM   7795 N N   . GLU B 2 99   ? 47.540  4.117   -25.530 1.00 71.51  ? 529  GLU B N   1 
ATOM   7796 C CA  . GLU B 2 99   ? 47.965  2.803   -25.034 1.00 71.45  ? 529  GLU B CA  1 
ATOM   7797 C C   . GLU B 2 99   ? 48.289  2.853   -23.557 1.00 76.78  ? 529  GLU B C   1 
ATOM   7798 O O   . GLU B 2 99   ? 48.031  1.874   -22.847 1.00 78.43  ? 529  GLU B O   1 
ATOM   7799 C CB  . GLU B 2 99   ? 49.139  2.216   -25.844 1.00 72.55  ? 529  GLU B CB  1 
ATOM   7800 C CG  . GLU B 2 99   ? 48.840  1.979   -27.317 1.00 84.63  ? 529  GLU B CG  1 
ATOM   7801 C CD  . GLU B 2 99   ? 47.457  1.451   -27.666 1.00 102.66 ? 529  GLU B CD  1 
ATOM   7802 O OE1 . GLU B 2 99   ? 47.133  0.302   -27.272 1.00 74.90  ? 529  GLU B OE1 1 
ATOM   7803 O OE2 . GLU B 2 99   ? 46.694  2.202   -28.322 1.00 91.43  ? 529  GLU B OE2 1 
ATOM   7804 N N   . LYS B 2 100  ? 48.823  4.004   -23.086 1.00 71.36  ? 530  LYS B N   1 
ATOM   7805 C CA  . LYS B 2 100  ? 49.135  4.227   -21.673 1.00 69.89  ? 530  LYS B CA  1 
ATOM   7806 C C   . LYS B 2 100  ? 47.825  4.271   -20.855 1.00 71.56  ? 530  LYS B C   1 
ATOM   7807 O O   . LYS B 2 100  ? 47.789  3.707   -19.769 1.00 71.97  ? 530  LYS B O   1 
ATOM   7808 C CB  . LYS B 2 100  ? 49.929  5.528   -21.492 1.00 71.71  ? 530  LYS B CB  1 
ATOM   7809 C CG  . LYS B 2 100  ? 51.400  5.389   -21.768 1.00 84.90  ? 530  LYS B CG  1 
ATOM   7810 C CD  . LYS B 2 100  ? 52.122  6.687   -21.462 1.00 100.15 ? 530  LYS B CD  1 
ATOM   7811 N N   . LEU B 2 101  ? 46.752  4.914   -21.408 1.00 64.97  ? 531  LEU B N   1 
ATOM   7812 C CA  . LEU B 2 101  ? 45.419  5.065   -20.824 1.00 62.64  ? 531  LEU B CA  1 
ATOM   7813 C C   . LEU B 2 101  ? 44.738  3.713   -20.651 1.00 68.07  ? 531  LEU B C   1 
ATOM   7814 O O   . LEU B 2 101  ? 44.340  3.364   -19.529 1.00 68.58  ? 531  LEU B O   1 
ATOM   7815 C CB  . LEU B 2 101  ? 44.550  6.031   -21.680 1.00 61.03  ? 531  LEU B CB  1 
ATOM   7816 C CG  . LEU B 2 101  ? 43.050  6.204   -21.325 1.00 62.29  ? 531  LEU B CG  1 
ATOM   7817 C CD1 . LEU B 2 101  ? 42.868  6.997   -20.051 1.00 62.00  ? 531  LEU B CD1 1 
ATOM   7818 C CD2 . LEU B 2 101  ? 42.321  6.907   -22.420 1.00 58.84  ? 531  LEU B CD2 1 
ATOM   7819 N N   . LYS B 2 102  ? 44.625  2.962   -21.766 1.00 63.94  ? 532  LYS B N   1 
ATOM   7820 C CA  . LYS B 2 102  ? 43.997  1.640   -21.881 1.00 63.20  ? 532  LYS B CA  1 
ATOM   7821 C C   . LYS B 2 102  ? 44.554  0.617   -20.917 1.00 67.23  ? 532  LYS B C   1 
ATOM   7822 O O   . LYS B 2 102  ? 43.782  -0.201  -20.420 1.00 67.07  ? 532  LYS B O   1 
ATOM   7823 C CB  . LYS B 2 102  ? 44.065  1.115   -23.326 1.00 64.88  ? 532  LYS B CB  1 
ATOM   7824 C CG  . LYS B 2 102  ? 43.156  1.877   -24.296 1.00 66.93  ? 532  LYS B CG  1 
ATOM   7825 C CD  . LYS B 2 102  ? 43.573  1.672   -25.754 1.00 78.61  ? 532  LYS B CD  1 
ATOM   7826 N N   . SER B 2 103  ? 45.874  0.666   -20.639 1.00 64.92  ? 533  SER B N   1 
ATOM   7827 C CA  . SER B 2 103  ? 46.556  -0.266  -19.721 1.00 66.02  ? 533  SER B CA  1 
ATOM   7828 C C   . SER B 2 103  ? 46.320  0.051   -18.244 1.00 70.26  ? 533  SER B C   1 
ATOM   7829 O O   . SER B 2 103  ? 46.266  -0.853  -17.406 1.00 69.20  ? 533  SER B O   1 
ATOM   7830 C CB  . SER B 2 103  ? 48.049  -0.364  -20.029 1.00 70.96  ? 533  SER B CB  1 
ATOM   7831 O OG  . SER B 2 103  ? 48.592  0.897   -20.373 1.00 86.75  ? 533  SER B OG  1 
ATOM   7832 N N   . ARG B 2 104  ? 46.165  1.332   -17.932 1.00 68.25  ? 534  ARG B N   1 
ATOM   7833 C CA  . ARG B 2 104  ? 45.847  1.790   -16.585 1.00 68.45  ? 534  ARG B CA  1 
ATOM   7834 C C   . ARG B 2 104  ? 44.441  1.296   -16.202 1.00 74.66  ? 534  ARG B C   1 
ATOM   7835 O O   . ARG B 2 104  ? 44.189  1.057   -15.020 1.00 75.87  ? 534  ARG B O   1 
ATOM   7836 C CB  . ARG B 2 104  ? 45.908  3.324   -16.519 1.00 65.02  ? 534  ARG B CB  1 
ATOM   7837 C CG  . ARG B 2 104  ? 45.409  3.891   -15.217 1.00 62.98  ? 534  ARG B CG  1 
ATOM   7838 C CD  . ARG B 2 104  ? 46.327  3.530   -14.085 1.00 65.54  ? 534  ARG B CD  1 
ATOM   7839 N NE  . ARG B 2 104  ? 45.779  4.028   -12.834 1.00 70.00  ? 534  ARG B NE  1 
ATOM   7840 C CZ  . ARG B 2 104  ? 45.482  3.263   -11.800 1.00 75.50  ? 534  ARG B CZ  1 
ATOM   7841 N NH1 . ARG B 2 104  ? 45.725  1.962   -11.840 1.00 64.78  ? 534  ARG B NH1 1 
ATOM   7842 N NH2 . ARG B 2 104  ? 44.964  3.795   -10.705 1.00 64.23  ? 534  ARG B NH2 1 
ATOM   7843 N N   . ILE B 2 105  ? 43.536  1.162   -17.198 1.00 70.77  ? 535  ILE B N   1 
ATOM   7844 C CA  . ILE B 2 105  ? 42.176  0.671   -16.983 1.00 71.28  ? 535  ILE B CA  1 
ATOM   7845 C C   . ILE B 2 105  ? 42.217  -0.796  -16.499 1.00 75.79  ? 535  ILE B C   1 
ATOM   7846 O O   . ILE B 2 105  ? 41.597  -1.121  -15.489 1.00 75.95  ? 535  ILE B O   1 
ATOM   7847 C CB  . ILE B 2 105  ? 41.268  0.877   -18.235 1.00 74.44  ? 535  ILE B CB  1 
ATOM   7848 C CG1 . ILE B 2 105  ? 41.079  2.380   -18.525 1.00 74.15  ? 535  ILE B CG1 1 
ATOM   7849 C CG2 . ILE B 2 105  ? 39.906  0.162   -18.049 1.00 75.83  ? 535  ILE B CG2 1 
ATOM   7850 C CD1 . ILE B 2 105  ? 40.323  2.738   -19.757 1.00 76.09  ? 535  ILE B CD1 1 
ATOM   7851 N N   . SER B 2 106  ? 42.988  -1.650  -17.195 1.00 71.36  ? 536  SER B N   1 
ATOM   7852 C CA  . SER B 2 106  ? 43.170  -3.065  -16.883 1.00 70.51  ? 536  SER B CA  1 
ATOM   7853 C C   . SER B 2 106  ? 43.702  -3.228  -15.481 1.00 73.66  ? 536  SER B C   1 
ATOM   7854 O O   . SER B 2 106  ? 43.495  -4.288  -14.881 1.00 74.81  ? 536  SER B O   1 
ATOM   7855 C CB  . SER B 2 106  ? 44.137  -3.704  -17.867 1.00 74.37  ? 536  SER B CB  1 
ATOM   7856 O OG  . SER B 2 106  ? 43.743  -3.423  -19.199 1.00 86.48  ? 536  SER B OG  1 
ATOM   7857 N N   . GLU B 2 107  ? 44.365  -2.173  -14.949 1.00 67.26  ? 537  GLU B N   1 
ATOM   7858 C CA  . GLU B 2 107  ? 44.874  -2.163  -13.588 1.00 66.21  ? 537  GLU B CA  1 
ATOM   7859 C C   . GLU B 2 107  ? 43.692  -1.943  -12.668 1.00 69.61  ? 537  GLU B C   1 
ATOM   7860 O O   . GLU B 2 107  ? 43.496  -2.718  -11.741 1.00 68.62  ? 537  GLU B O   1 
ATOM   7861 C CB  . GLU B 2 107  ? 45.926  -1.063  -13.368 1.00 67.53  ? 537  GLU B CB  1 
ATOM   7862 C CG  . GLU B 2 107  ? 47.213  -1.215  -14.161 1.00 78.92  ? 537  GLU B CG  1 
ATOM   7863 C CD  . GLU B 2 107  ? 48.319  -0.221  -13.846 1.00 106.52 ? 537  GLU B CD  1 
ATOM   7864 O OE1 . GLU B 2 107  ? 48.056  0.792   -13.155 1.00 92.49  ? 537  GLU B OE1 1 
ATOM   7865 O OE2 . GLU B 2 107  ? 49.459  -0.454  -14.310 1.00 109.28 ? 537  GLU B OE2 1 
ATOM   7866 N N   . ILE B 2 108  ? 42.882  -0.913  -12.951 1.00 67.68  ? 538  ILE B N   1 
ATOM   7867 C CA  . ILE B 2 108  ? 41.696  -0.545  -12.161 1.00 68.49  ? 538  ILE B CA  1 
ATOM   7868 C C   . ILE B 2 108  ? 40.611  -1.651  -12.208 1.00 76.21  ? 538  ILE B C   1 
ATOM   7869 O O   . ILE B 2 108  ? 39.857  -1.804  -11.237 1.00 78.74  ? 538  ILE B O   1 
ATOM   7870 C CB  . ILE B 2 108  ? 41.153  0.851   -12.584 1.00 70.54  ? 538  ILE B CB  1 
ATOM   7871 C CG1 . ILE B 2 108  ? 42.189  1.942   -12.314 1.00 69.65  ? 538  ILE B CG1 1 
ATOM   7872 C CG2 . ILE B 2 108  ? 39.813  1.186   -11.914 1.00 71.57  ? 538  ILE B CG2 1 
ATOM   7873 C CD1 . ILE B 2 108  ? 42.062  3.091   -13.176 1.00 74.84  ? 538  ILE B CD1 1 
ATOM   7874 N N   . VAL B 2 109  ? 40.545  -2.408  -13.317 1.00 70.70  ? 539  VAL B N   1 
ATOM   7875 C CA  . VAL B 2 109  ? 39.594  -3.498  -13.507 1.00 69.92  ? 539  VAL B CA  1 
ATOM   7876 C C   . VAL B 2 109  ? 40.053  -4.685  -12.645 1.00 75.48  ? 539  VAL B C   1 
ATOM   7877 O O   . VAL B 2 109  ? 39.224  -5.324  -11.974 1.00 75.66  ? 539  VAL B O   1 
ATOM   7878 C CB  . VAL B 2 109  ? 39.419  -3.838  -15.015 1.00 72.46  ? 539  VAL B CB  1 
ATOM   7879 C CG1 . VAL B 2 109  ? 38.810  -5.214  -15.232 1.00 71.63  ? 539  VAL B CG1 1 
ATOM   7880 C CG2 . VAL B 2 109  ? 38.579  -2.779  -15.715 1.00 72.37  ? 539  VAL B CG2 1 
ATOM   7881 N N   . ASP B 2 110  ? 41.375  -4.947  -12.640 1.00 71.55  ? 540  ASP B N   1 
ATOM   7882 C CA  . ASP B 2 110  ? 41.943  -6.042  -11.870 1.00 71.51  ? 540  ASP B CA  1 
ATOM   7883 C C   . ASP B 2 110  ? 41.749  -5.802  -10.381 1.00 77.59  ? 540  ASP B C   1 
ATOM   7884 O O   . ASP B 2 110  ? 41.403  -6.732  -9.663  1.00 78.11  ? 540  ASP B O   1 
ATOM   7885 C CB  . ASP B 2 110  ? 43.415  -6.259  -12.211 1.00 72.81  ? 540  ASP B CB  1 
ATOM   7886 C CG  . ASP B 2 110  ? 43.949  -7.521  -11.592 1.00 84.48  ? 540  ASP B CG  1 
ATOM   7887 O OD1 . ASP B 2 110  ? 43.705  -8.603  -12.158 1.00 85.28  ? 540  ASP B OD1 1 
ATOM   7888 O OD2 . ASP B 2 110  ? 44.546  -7.437  -10.491 1.00 92.81  ? 540  ASP B OD2 1 
ATOM   7889 N N   . SER B 2 111  ? 41.916  -4.545  -9.931  1.00 74.55  ? 541  SER B N   1 
ATOM   7890 C CA  . SER B 2 111  ? 41.715  -4.129  -8.542  1.00 73.77  ? 541  SER B CA  1 
ATOM   7891 C C   . SER B 2 111  ? 40.251  -4.307  -8.136  1.00 77.81  ? 541  SER B C   1 
ATOM   7892 O O   . SER B 2 111  ? 39.986  -4.722  -7.009  1.00 77.44  ? 541  SER B O   1 
ATOM   7893 C CB  . SER B 2 111  ? 42.145  -2.680  -8.349  1.00 75.90  ? 541  SER B CB  1 
ATOM   7894 O OG  . SER B 2 111  ? 43.556  -2.583  -8.382  1.00 84.16  ? 541  SER B OG  1 
ATOM   7895 N N   . ARG B 2 112  ? 39.309  -4.003  -9.064  1.00 74.28  ? 542  ARG B N   1 
ATOM   7896 C CA  . ARG B 2 112  ? 37.866  -4.144  -8.873  1.00 73.82  ? 542  ARG B CA  1 
ATOM   7897 C C   . ARG B 2 112  ? 37.515  -5.615  -8.702  1.00 79.63  ? 542  ARG B C   1 
ATOM   7898 O O   . ARG B 2 112  ? 36.703  -5.939  -7.834  1.00 80.47  ? 542  ARG B O   1 
ATOM   7899 C CB  . ARG B 2 112  ? 37.102  -3.574  -10.064 1.00 71.75  ? 542  ARG B CB  1 
ATOM   7900 C CG  . ARG B 2 112  ? 35.607  -3.597  -9.875  1.00 75.93  ? 542  ARG B CG  1 
ATOM   7901 C CD  . ARG B 2 112  ? 34.902  -3.787  -11.182 1.00 86.34  ? 542  ARG B CD  1 
ATOM   7902 N NE  . ARG B 2 112  ? 33.480  -3.568  -10.984 1.00 97.90  ? 542  ARG B NE  1 
ATOM   7903 C CZ  . ARG B 2 112  ? 32.737  -2.735  -11.699 1.00 117.47 ? 542  ARG B CZ  1 
ATOM   7904 N NH1 . ARG B 2 112  ? 33.265  -2.069  -12.720 1.00 100.01 ? 542  ARG B NH1 1 
ATOM   7905 N NH2 . ARG B 2 112  ? 31.451  -2.584  -11.421 1.00 111.20 ? 542  ARG B NH2 1 
ATOM   7906 N N   . ARG B 2 113  ? 38.131  -6.498  -9.522  1.00 75.17  ? 543  ARG B N   1 
ATOM   7907 C CA  . ARG B 2 113  ? 37.941  -7.948  -9.480  1.00 73.80  ? 543  ARG B CA  1 
ATOM   7908 C C   . ARG B 2 113  ? 38.335  -8.500  -8.081  1.00 78.12  ? 543  ARG B C   1 
ATOM   7909 O O   . ARG B 2 113  ? 37.648  -9.386  -7.574  1.00 77.70  ? 543  ARG B O   1 
ATOM   7910 C CB  . ARG B 2 113  ? 38.744  -8.601  -10.624 1.00 71.59  ? 543  ARG B CB  1 
ATOM   7911 C CG  . ARG B 2 113  ? 38.856  -10.122 -10.562 1.00 88.46  ? 543  ARG B CG  1 
ATOM   7912 C CD  . ARG B 2 113  ? 40.083  -10.707 -11.269 1.00 108.13 ? 543  ARG B CD  1 
ATOM   7913 N NE  . ARG B 2 113  ? 41.381  -10.141 -10.859 1.00 121.32 ? 543  ARG B NE  1 
ATOM   7914 C CZ  . ARG B 2 113  ? 42.109  -10.555 -9.821  1.00 136.23 ? 543  ARG B CZ  1 
ATOM   7915 N NH1 . ARG B 2 113  ? 41.659  -11.514 -9.023  1.00 126.35 ? 543  ARG B NH1 1 
ATOM   7916 N NH2 . ARG B 2 113  ? 43.287  -9.999  -9.565  1.00 122.28 ? 543  ARG B NH2 1 
ATOM   7917 N N   . ARG B 2 114  ? 39.403  -7.951  -7.455  1.00 75.05  ? 544  ARG B N   1 
ATOM   7918 C CA  . ARG B 2 114  ? 39.879  -8.384  -6.135  1.00 75.64  ? 544  ARG B CA  1 
ATOM   7919 C C   . ARG B 2 114  ? 38.892  -8.055  -5.012  1.00 80.65  ? 544  ARG B C   1 
ATOM   7920 O O   . ARG B 2 114  ? 38.676  -8.894  -4.135  1.00 81.01  ? 544  ARG B O   1 
ATOM   7921 C CB  . ARG B 2 114  ? 41.292  -7.854  -5.830  1.00 75.81  ? 544  ARG B CB  1 
ATOM   7922 C CG  . ARG B 2 114  ? 42.371  -8.606  -6.600  1.00 83.76  ? 544  ARG B CG  1 
ATOM   7923 C CD  . ARG B 2 114  ? 43.781  -8.124  -6.322  1.00 94.81  ? 544  ARG B CD  1 
ATOM   7924 N NE  . ARG B 2 114  ? 44.314  -7.315  -7.419  1.00 104.86 ? 544  ARG B NE  1 
ATOM   7925 C CZ  . ARG B 2 114  ? 44.593  -6.015  -7.336  1.00 122.50 ? 544  ARG B CZ  1 
ATOM   7926 N NH1 . ARG B 2 114  ? 44.399  -5.355  -6.195  1.00 94.89  ? 544  ARG B NH1 1 
ATOM   7927 N NH2 . ARG B 2 114  ? 45.065  -5.365  -8.393  1.00 120.82 ? 544  ARG B NH2 1 
ATOM   7928 N N   . LEU B 2 115  ? 38.264  -6.869  -5.058  1.00 77.43  ? 545  LEU B N   1 
ATOM   7929 C CA  . LEU B 2 115  ? 37.247  -6.470  -4.081  1.00 78.33  ? 545  LEU B CA  1 
ATOM   7930 C C   . LEU B 2 115  ? 36.017  -7.367  -4.262  1.00 84.70  ? 545  LEU B C   1 
ATOM   7931 O O   . LEU B 2 115  ? 35.484  -7.820  -3.265  1.00 85.36  ? 545  LEU B O   1 
ATOM   7932 C CB  . LEU B 2 115  ? 36.876  -4.975  -4.207  1.00 78.36  ? 545  LEU B CB  1 
ATOM   7933 C CG  . LEU B 2 115  ? 36.277  -4.307  -2.967  1.00 82.06  ? 545  LEU B CG  1 
ATOM   7934 N N   . GLU B 2 116  ? 35.627  -7.687  -5.529  1.00 82.08  ? 546  GLU B N   1 
ATOM   7935 C CA  . GLU B 2 116  ? 34.528  -8.593  -5.897  1.00 81.88  ? 546  GLU B CA  1 
ATOM   7936 C C   . GLU B 2 116  ? 34.798  -9.992  -5.343  1.00 87.88  ? 546  GLU B C   1 
ATOM   7937 O O   . GLU B 2 116  ? 33.860  -10.694 -4.943  1.00 87.66  ? 546  GLU B O   1 
ATOM   7938 C CB  . GLU B 2 116  ? 34.360  -8.669  -7.423  1.00 83.18  ? 546  GLU B CB  1 
ATOM   7939 C CG  . GLU B 2 116  ? 33.638  -7.468  -8.029  1.00 96.12  ? 546  GLU B CG  1 
ATOM   7940 C CD  . GLU B 2 116  ? 33.599  -7.336  -9.546  1.00 116.75 ? 546  GLU B CD  1 
ATOM   7941 O OE1 . GLU B 2 116  ? 34.140  -8.220  -10.253 1.00 114.81 ? 546  GLU B OE1 1 
ATOM   7942 O OE2 . GLU B 2 116  ? 33.023  -6.332  -10.027 1.00 104.12 ? 546  GLU B OE2 1 
ATOM   7943 N N   . GLU B 2 117  ? 36.083  -10.385 -5.295  1.00 85.59  ? 547  GLU B N   1 
ATOM   7944 C CA  . GLU B 2 117  ? 36.501  -11.666 -4.745  1.00 85.75  ? 547  GLU B CA  1 
ATOM   7945 C C   . GLU B 2 117  ? 36.397  -11.593 -3.237  1.00 91.45  ? 547  GLU B C   1 
ATOM   7946 O O   . GLU B 2 117  ? 35.740  -12.440 -2.625  1.00 91.94  ? 547  GLU B O   1 
ATOM   7947 C CB  . GLU B 2 117  ? 37.930  -12.021 -5.168  1.00 87.02  ? 547  GLU B CB  1 
ATOM   7948 C CG  . GLU B 2 117  ? 38.042  -12.491 -6.611  1.00 101.89 ? 547  GLU B CG  1 
ATOM   7949 C CD  . GLU B 2 117  ? 39.438  -12.832 -7.109  1.00 132.29 ? 547  GLU B CD  1 
ATOM   7950 O OE1 . GLU B 2 117  ? 40.426  -12.261 -6.587  1.00 141.07 ? 547  GLU B OE1 1 
ATOM   7951 O OE2 . GLU B 2 117  ? 39.541  -13.650 -8.055  1.00 116.96 ? 547  GLU B OE2 1 
ATOM   7952 N N   . ASP B 2 118  ? 36.987  -10.544 -2.638  1.00 88.47  ? 548  ASP B N   1 
ATOM   7953 C CA  . ASP B 2 118  ? 36.994  -10.347 -1.184  1.00 88.50  ? 548  ASP B CA  1 
ATOM   7954 C C   . ASP B 2 118  ? 35.581  -10.194 -0.596  1.00 89.77  ? 548  ASP B C   1 
ATOM   7955 O O   . ASP B 2 118  ? 35.383  -10.479 0.583   1.00 90.48  ? 548  ASP B O   1 
ATOM   7956 C CB  . ASP B 2 118  ? 37.928  -9.178  -0.781  1.00 91.18  ? 548  ASP B CB  1 
ATOM   7957 C CG  . ASP B 2 118  ? 39.401  -9.546  -0.589  1.00 109.28 ? 548  ASP B CG  1 
ATOM   7958 O OD1 . ASP B 2 118  ? 39.948  -10.307 -1.431  1.00 111.72 ? 548  ASP B OD1 1 
ATOM   7959 O OD2 . ASP B 2 118  ? 40.019  -9.041  0.375   1.00 117.06 ? 548  ASP B OD2 1 
ATOM   7960 N N   . LEU B 2 119  ? 34.605  -9.798  -1.422  1.00 83.38  ? 549  LEU B N   1 
ATOM   7961 C CA  . LEU B 2 119  ? 33.228  -9.636  -0.979  1.00 82.67  ? 549  LEU B CA  1 
ATOM   7962 C C   . LEU B 2 119  ? 32.551  -10.997 -0.892  1.00 87.42  ? 549  LEU B C   1 
ATOM   7963 O O   . LEU B 2 119  ? 31.892  -11.259 0.102   1.00 88.04  ? 549  LEU B O   1 
ATOM   7964 C CB  . LEU B 2 119  ? 32.441  -8.644  -1.873  1.00 82.22  ? 549  LEU B CB  1 
ATOM   7965 C CG  . LEU B 2 119  ? 30.935  -8.493  -1.613  1.00 86.67  ? 549  LEU B CG  1 
ATOM   7966 C CD1 . LEU B 2 119  ? 30.649  -7.695  -0.357  1.00 86.99  ? 549  LEU B CD1 1 
ATOM   7967 C CD2 . LEU B 2 119  ? 30.245  -7.865  -2.791  1.00 89.17  ? 549  LEU B CD2 1 
ATOM   7968 N N   . LYS B 2 120  ? 32.739  -11.865 -1.905  1.00 83.09  ? 550  LYS B N   1 
ATOM   7969 C CA  . LYS B 2 120  ? 32.178  -13.219 -1.983  1.00 82.36  ? 550  LYS B CA  1 
ATOM   7970 C C   . LYS B 2 120  ? 32.615  -14.033 -0.774  1.00 87.58  ? 550  LYS B C   1 
ATOM   7971 O O   . LYS B 2 120  ? 31.804  -14.760 -0.203  1.00 87.98  ? 550  LYS B O   1 
ATOM   7972 C CB  . LYS B 2 120  ? 32.661  -13.925 -3.261  1.00 83.64  ? 550  LYS B CB  1 
ATOM   7973 C CG  . LYS B 2 120  ? 31.581  -14.721 -3.972  1.00 84.93  ? 550  LYS B CG  1 
ATOM   7974 C CD  . LYS B 2 120  ? 32.181  -15.772 -4.907  1.00 85.20  ? 550  LYS B CD  1 
ATOM   7975 C CE  . LYS B 2 120  ? 31.130  -16.451 -5.741  1.00 82.05  ? 550  LYS B CE  1 
ATOM   7976 N N   . LYS B 2 121  ? 33.887  -13.881 -0.371  1.00 83.96  ? 551  LYS B N   1 
ATOM   7977 C CA  . LYS B 2 121  ? 34.462  -14.578 0.772   1.00 83.80  ? 551  LYS B CA  1 
ATOM   7978 C C   . LYS B 2 121  ? 33.844  -14.101 2.077   1.00 89.49  ? 551  LYS B C   1 
ATOM   7979 O O   . LYS B 2 121  ? 33.641  -14.910 2.986   1.00 90.56  ? 551  LYS B O   1 
ATOM   7980 C CB  . LYS B 2 121  ? 35.992  -14.402 0.814   1.00 85.22  ? 551  LYS B CB  1 
ATOM   7981 C CG  . LYS B 2 121  ? 36.742  -15.132 -0.295  1.00 90.38  ? 551  LYS B CG  1 
ATOM   7982 C CD  . LYS B 2 121  ? 36.806  -16.641 -0.101  1.00 97.42  ? 551  LYS B CD  1 
ATOM   7983 N N   . GLN B 2 122  ? 33.561  -12.791 2.170   1.00 84.87  ? 552  GLN B N   1 
ATOM   7984 C CA  . GLN B 2 122  ? 32.975  -12.174 3.353   1.00 83.57  ? 552  GLN B CA  1 
ATOM   7985 C C   . GLN B 2 122  ? 31.453  -12.382 3.399   1.00 86.48  ? 552  GLN B C   1 
ATOM   7986 O O   . GLN B 2 122  ? 30.876  -12.374 4.487   1.00 85.73  ? 552  GLN B O   1 
ATOM   7987 C CB  . GLN B 2 122  ? 33.347  -10.687 3.413   1.00 84.48  ? 552  GLN B CB  1 
ATOM   7988 C CG  . GLN B 2 122  ? 33.165  -10.075 4.797   1.00 93.12  ? 552  GLN B CG  1 
ATOM   7989 C CD  . GLN B 2 122  ? 33.525  -8.614  4.910   1.00 100.49 ? 552  GLN B CD  1 
ATOM   7990 O OE1 . GLN B 2 122  ? 33.099  -7.753  4.115   1.00 92.24  ? 552  GLN B OE1 1 
ATOM   7991 N NE2 . GLN B 2 122  ? 34.250  -8.298  5.973   1.00 85.82  ? 552  GLN B NE2 1 
ATOM   7992 N N   . ALA B 2 123  ? 30.809  -12.590 2.225   1.00 82.75  ? 553  ALA B N   1 
ATOM   7993 C CA  . ALA B 2 123  ? 29.356  -12.816 2.106   1.00 82.12  ? 553  ALA B CA  1 
ATOM   7994 C C   . ALA B 2 123  ? 29.026  -14.200 2.640   1.00 85.77  ? 553  ALA B C   1 
ATOM   7995 O O   . ALA B 2 123  ? 27.893  -14.429 3.075   1.00 84.68  ? 553  ALA B O   1 
ATOM   7996 C CB  . ALA B 2 123  ? 28.905  -12.692 0.655   1.00 82.39  ? 553  ALA B CB  1 
ATOM   7997 N N   . ALA B 2 124  ? 30.036  -15.117 2.592   1.00 81.71  ? 554  ALA B N   1 
ATOM   7998 C CA  . ALA B 2 124  ? 30.002  -16.484 3.096   1.00 81.01  ? 554  ALA B CA  1 
ATOM   7999 C C   . ALA B 2 124  ? 30.129  -16.439 4.618   1.00 86.34  ? 554  ALA B C   1 
ATOM   8000 O O   . ALA B 2 124  ? 29.358  -17.122 5.301   1.00 87.07  ? 554  ALA B O   1 
ATOM   8001 C CB  . ALA B 2 124  ? 31.136  -17.297 2.495   1.00 81.32  ? 554  ALA B CB  1 
ATOM   8002 N N   . GLU B 2 125  ? 31.067  -15.606 5.149   1.00 82.61  ? 555  GLU B N   1 
ATOM   8003 C CA  . GLU B 2 125  ? 31.270  -15.410 6.588   1.00 82.86  ? 555  GLU B CA  1 
ATOM   8004 C C   . GLU B 2 125  ? 29.946  -14.968 7.178   1.00 88.96  ? 555  GLU B C   1 
ATOM   8005 O O   . GLU B 2 125  ? 29.485  -15.593 8.127   1.00 89.23  ? 555  GLU B O   1 
ATOM   8006 C CB  . GLU B 2 125  ? 32.314  -14.320 6.885   1.00 84.25  ? 555  GLU B CB  1 
ATOM   8007 C CG  . GLU B 2 125  ? 33.757  -14.639 6.548   1.00 97.99  ? 555  GLU B CG  1 
ATOM   8008 C CD  . GLU B 2 125  ? 34.677  -13.440 6.713   1.00 127.87 ? 555  GLU B CD  1 
ATOM   8009 O OE1 . GLU B 2 125  ? 34.792  -12.922 7.850   1.00 123.05 ? 555  GLU B OE1 1 
ATOM   8010 O OE2 . GLU B 2 125  ? 35.268  -13.006 5.696   1.00 123.03 ? 555  GLU B OE2 1 
ATOM   8011 N N   . TYR B 2 126  ? 29.309  -13.923 6.580   1.00 86.77  ? 556  TYR B N   1 
ATOM   8012 C CA  . TYR B 2 126  ? 28.012  -13.407 7.013   1.00 87.63  ? 556  TYR B CA  1 
ATOM   8013 C C   . TYR B 2 126  ? 27.012  -14.548 7.171   1.00 92.03  ? 556  TYR B C   1 
ATOM   8014 O O   . TYR B 2 126  ? 26.389  -14.671 8.228   1.00 92.98  ? 556  TYR B O   1 
ATOM   8015 C CB  . TYR B 2 126  ? 27.458  -12.345 6.037   1.00 89.71  ? 556  TYR B CB  1 
ATOM   8016 C CG  . TYR B 2 126  ? 26.026  -11.926 6.331   1.00 93.15  ? 556  TYR B CG  1 
ATOM   8017 C CD1 . TYR B 2 126  ? 24.948  -12.684 5.879   1.00 95.78  ? 556  TYR B CD1 1 
ATOM   8018 C CD2 . TYR B 2 126  ? 25.749  -10.765 7.047   1.00 94.06  ? 556  TYR B CD2 1 
ATOM   8019 C CE1 . TYR B 2 126  ? 23.633  -12.329 6.181   1.00 97.52  ? 556  TYR B CE1 1 
ATOM   8020 C CE2 . TYR B 2 126  ? 24.434  -10.369 7.305   1.00 95.24  ? 556  TYR B CE2 1 
ATOM   8021 C CZ  . TYR B 2 126  ? 23.378  -11.163 6.880   1.00 103.87 ? 556  TYR B CZ  1 
ATOM   8022 O OH  . TYR B 2 126  ? 22.074  -10.804 7.135   1.00 104.89 ? 556  TYR B OH  1 
ATOM   8023 N N   . ARG B 2 127  ? 26.871  -15.373 6.125   1.00 87.12  ? 557  ARG B N   1 
ATOM   8024 C CA  . ARG B 2 127  ? 25.938  -16.484 6.086   1.00 86.33  ? 557  ARG B CA  1 
ATOM   8025 C C   . ARG B 2 127  ? 26.262  -17.560 7.131   1.00 90.67  ? 557  ARG B C   1 
ATOM   8026 O O   . ARG B 2 127  ? 25.332  -18.048 7.779   1.00 91.78  ? 557  ARG B O   1 
ATOM   8027 C CB  . ARG B 2 127  ? 25.816  -17.041 4.668   1.00 85.02  ? 557  ARG B CB  1 
ATOM   8028 C CG  . ARG B 2 127  ? 24.981  -16.123 3.770   1.00 95.10  ? 557  ARG B CG  1 
ATOM   8029 C CD  . ARG B 2 127  ? 24.370  -16.851 2.587   1.00 107.91 ? 557  ARG B CD  1 
ATOM   8030 N NE  . ARG B 2 127  ? 23.270  -17.716 3.008   1.00 116.90 ? 557  ARG B NE  1 
ATOM   8031 C CZ  . ARG B 2 127  ? 22.687  -18.633 2.244   1.00 126.05 ? 557  ARG B CZ  1 
ATOM   8032 N NH1 . ARG B 2 127  ? 23.082  -18.813 0.991   1.00 104.48 ? 557  ARG B NH1 1 
ATOM   8033 N NH2 . ARG B 2 127  ? 21.708  -19.380 2.729   1.00 116.78 ? 557  ARG B NH2 1 
ATOM   8034 N N   . GLU B 2 128  ? 27.556  -17.870 7.353   1.00 85.49  ? 558  GLU B N   1 
ATOM   8035 C CA  . GLU B 2 128  ? 27.975  -18.833 8.375   1.00 85.44  ? 558  GLU B CA  1 
ATOM   8036 C C   . GLU B 2 128  ? 27.683  -18.280 9.804   1.00 92.00  ? 558  GLU B C   1 
ATOM   8037 O O   . GLU B 2 128  ? 27.178  -19.025 10.647  1.00 92.84  ? 558  GLU B O   1 
ATOM   8038 C CB  . GLU B 2 128  ? 29.457  -19.194 8.201   1.00 86.61  ? 558  GLU B CB  1 
ATOM   8039 C CG  . GLU B 2 128  ? 30.088  -19.939 9.365   1.00 98.41  ? 558  GLU B CG  1 
ATOM   8040 C CD  . GLU B 2 128  ? 29.713  -21.401 9.518   1.00 126.46 ? 558  GLU B CD  1 
ATOM   8041 O OE1 . GLU B 2 128  ? 29.814  -22.154 8.520   1.00 129.65 ? 558  GLU B OE1 1 
ATOM   8042 O OE2 . GLU B 2 128  ? 29.389  -21.809 10.658  1.00 115.76 ? 558  GLU B OE2 1 
ATOM   8043 N N   . ILE B 2 129  ? 27.994  -16.981 10.065  1.00 87.61  ? 559  ILE B N   1 
ATOM   8044 C CA  . ILE B 2 129  ? 27.739  -16.313 11.348  1.00 86.31  ? 559  ILE B CA  1 
ATOM   8045 C C   . ILE B 2 129  ? 26.256  -16.469 11.695  1.00 88.14  ? 559  ILE B C   1 
ATOM   8046 O O   . ILE B 2 129  ? 25.951  -16.913 12.799  1.00 88.05  ? 559  ILE B O   1 
ATOM   8047 C CB  . ILE B 2 129  ? 28.213  -14.822 11.329  1.00 89.50  ? 559  ILE B CB  1 
ATOM   8048 C CG1 . ILE B 2 129  ? 29.755  -14.737 11.425  1.00 89.88  ? 559  ILE B CG1 1 
ATOM   8049 C CG2 . ILE B 2 129  ? 27.525  -13.963 12.429  1.00 90.30  ? 559  ILE B CG2 1 
ATOM   8050 C CD1 . ILE B 2 129  ? 30.348  -13.327 11.417  1.00 96.59  ? 559  ILE B CD1 1 
ATOM   8051 N N   . ASP B 2 130  ? 25.346  -16.169 10.724  1.00 82.42  ? 560  ASP B N   1 
ATOM   8052 C CA  . ASP B 2 130  ? 23.894  -16.289 10.880  1.00 80.94  ? 560  ASP B CA  1 
ATOM   8053 C C   . ASP B 2 130  ? 23.466  -17.717 11.192  1.00 86.80  ? 560  ASP B C   1 
ATOM   8054 O O   . ASP B 2 130  ? 22.569  -17.899 12.009  1.00 86.30  ? 560  ASP B O   1 
ATOM   8055 C CB  . ASP B 2 130  ? 23.154  -15.781 9.645   1.00 81.64  ? 560  ASP B CB  1 
ATOM   8056 C CG  . ASP B 2 130  ? 21.705  -15.425 9.914   1.00 89.36  ? 560  ASP B CG  1 
ATOM   8057 O OD1 . ASP B 2 130  ? 21.433  -14.784 10.956  1.00 90.00  ? 560  ASP B OD1 1 
ATOM   8058 O OD2 . ASP B 2 130  ? 20.845  -15.744 9.062   1.00 95.67  ? 560  ASP B OD2 1 
ATOM   8059 N N   . LYS B 2 131  ? 24.116  -18.728 10.552  1.00 84.50  ? 561  LYS B N   1 
ATOM   8060 C CA  . LYS B 2 131  ? 23.857  -20.165 10.762  1.00 83.86  ? 561  LYS B CA  1 
ATOM   8061 C C   . LYS B 2 131  ? 24.325  -20.563 12.167  1.00 86.39  ? 561  LYS B C   1 
ATOM   8062 O O   . LYS B 2 131  ? 23.598  -21.261 12.874  1.00 85.49  ? 561  LYS B O   1 
ATOM   8063 C CB  . LYS B 2 131  ? 24.567  -21.020 9.686   1.00 85.97  ? 561  LYS B CB  1 
ATOM   8064 C CG  . LYS B 2 131  ? 23.792  -22.270 9.265   1.00 93.66  ? 561  LYS B CG  1 
ATOM   8065 C CD  . LYS B 2 131  ? 24.720  -23.469 9.049   1.00 101.15 ? 561  LYS B CD  1 
ATOM   8066 C CE  . LYS B 2 131  ? 23.999  -24.721 8.597   1.00 107.53 ? 561  LYS B CE  1 
ATOM   8067 N NZ  . LYS B 2 131  ? 24.839  -25.939 8.782   1.00 113.46 ? 561  LYS B NZ  1 
ATOM   8068 N N   . ARG B 2 132  ? 25.521  -20.077 12.573  1.00 82.57  ? 562  ARG B N   1 
ATOM   8069 C CA  . ARG B 2 132  ? 26.129  -20.304 13.884  1.00 82.43  ? 562  ARG B CA  1 
ATOM   8070 C C   . ARG B 2 132  ? 25.304  -19.669 15.009  1.00 87.91  ? 562  ARG B C   1 
ATOM   8071 O O   . ARG B 2 132  ? 25.232  -20.247 16.094  1.00 88.43  ? 562  ARG B O   1 
ATOM   8072 C CB  . ARG B 2 132  ? 27.565  -19.781 13.915  1.00 80.59  ? 562  ARG B CB  1 
ATOM   8073 C CG  . ARG B 2 132  ? 28.595  -20.865 14.108  1.00 88.90  ? 562  ARG B CG  1 
ATOM   8074 C CD  . ARG B 2 132  ? 29.968  -20.260 14.271  1.00 102.95 ? 562  ARG B CD  1 
ATOM   8075 N NE  . ARG B 2 132  ? 30.946  -21.254 14.709  1.00 122.73 ? 562  ARG B NE  1 
ATOM   8076 C CZ  . ARG B 2 132  ? 32.139  -20.961 15.220  1.00 144.33 ? 562  ARG B CZ  1 
ATOM   8077 N NH1 . ARG B 2 132  ? 32.519  -19.695 15.360  1.00 136.13 ? 562  ARG B NH1 1 
ATOM   8078 N NH2 . ARG B 2 132  ? 32.961  -21.933 15.601  1.00 130.46 ? 562  ARG B NH2 1 
ATOM   8079 N N   . MET B 2 133  ? 24.685  -18.495 14.752  1.00 84.37  ? 563  MET B N   1 
ATOM   8080 C CA  . MET B 2 133  ? 23.832  -17.808 15.728  1.00 84.54  ? 563  MET B CA  1 
ATOM   8081 C C   . MET B 2 133  ? 22.484  -18.516 15.793  1.00 87.03  ? 563  MET B C   1 
ATOM   8082 O O   . MET B 2 133  ? 21.955  -18.690 16.887  1.00 87.55  ? 563  MET B O   1 
ATOM   8083 C CB  . MET B 2 133  ? 23.571  -16.339 15.348  1.00 87.13  ? 563  MET B CB  1 
ATOM   8084 C CG  . MET B 2 133  ? 24.744  -15.412 15.541  1.00 91.05  ? 563  MET B CG  1 
ATOM   8085 S SD  . MET B 2 133  ? 24.306  -13.650 15.356  1.00 95.20  ? 563  MET B SD  1 
ATOM   8086 C CE  . MET B 2 133  ? 23.271  -13.665 13.846  1.00 91.48  ? 563  MET B CE  1 
ATOM   8087 N N   . ASN B 2 134  ? 21.912  -18.905 14.630  1.00 80.73  ? 564  ASN B N   1 
ATOM   8088 C CA  . ASN B 2 134  ? 20.621  -19.588 14.587  1.00 79.68  ? 564  ASN B CA  1 
ATOM   8089 C C   . ASN B 2 134  ? 20.734  -21.009 15.123  1.00 84.81  ? 564  ASN B C   1 
ATOM   8090 O O   . ASN B 2 134  ? 19.742  -21.730 15.213  1.00 84.43  ? 564  ASN B O   1 
ATOM   8091 C CB  . ASN B 2 134  ? 20.061  -19.596 13.182  1.00 77.12  ? 564  ASN B CB  1 
ATOM   8092 C CG  . ASN B 2 134  ? 19.519  -18.279 12.707  1.00 91.09  ? 564  ASN B CG  1 
ATOM   8093 O OD1 . ASN B 2 134  ? 19.120  -17.406 13.489  1.00 88.70  ? 564  ASN B OD1 1 
ATOM   8094 N ND2 . ASN B 2 134  ? 19.483  -18.118 11.393  1.00 79.56  ? 564  ASN B ND2 1 
ATOM   8095 N N   . SER B 2 135  ? 21.948  -21.410 15.473  1.00 82.17  ? 565  SER B N   1 
ATOM   8096 C CA  . SER B 2 135  ? 22.195  -22.715 16.021  1.00 82.37  ? 565  SER B CA  1 
ATOM   8097 C C   . SER B 2 135  ? 22.176  -22.626 17.541  1.00 86.82  ? 565  SER B C   1 
ATOM   8098 O O   . SER B 2 135  ? 21.633  -23.528 18.178  1.00 88.92  ? 565  SER B O   1 
ATOM   8099 C CB  . SER B 2 135  ? 23.533  -23.249 15.524  1.00 86.86  ? 565  SER B CB  1 
ATOM   8100 O OG  . SER B 2 135  ? 23.634  -24.641 15.767  1.00 99.36  ? 565  SER B OG  1 
ATOM   8101 N N   . ILE B 2 136  ? 22.727  -21.538 18.125  1.00 80.79  ? 566  ILE B N   1 
ATOM   8102 C CA  . ILE B 2 136  ? 22.818  -21.381 19.584  1.00 79.81  ? 566  ILE B CA  1 
ATOM   8103 C C   . ILE B 2 136  ? 21.642  -20.597 20.213  1.00 81.14  ? 566  ILE B C   1 
ATOM   8104 O O   . ILE B 2 136  ? 21.612  -20.452 21.430  1.00 80.84  ? 566  ILE B O   1 
ATOM   8105 C CB  . ILE B 2 136  ? 24.192  -20.823 20.022  1.00 83.18  ? 566  ILE B CB  1 
ATOM   8106 C CG1 . ILE B 2 136  ? 24.348  -19.322 19.697  1.00 83.17  ? 566  ILE B CG1 1 
ATOM   8107 C CG2 . ILE B 2 136  ? 25.330  -21.686 19.416  1.00 85.65  ? 566  ILE B CG2 1 
ATOM   8108 C CD1 . ILE B 2 136  ? 25.513  -18.673 20.368  1.00 90.66  ? 566  ILE B CD1 1 
ATOM   8109 N N   . LYS B 2 137  ? 20.670  -20.144 19.412  1.00 76.44  ? 567  LYS B N   1 
ATOM   8110 C CA  . LYS B 2 137  ? 19.476  -19.460 19.912  1.00 75.97  ? 567  LYS B CA  1 
ATOM   8111 C C   . LYS B 2 137  ? 18.524  -20.430 20.647  1.00 82.43  ? 567  LYS B C   1 
ATOM   8112 O O   . LYS B 2 137  ? 18.127  -20.098 21.768  1.00 81.24  ? 567  LYS B O   1 
ATOM   8113 C CB  . LYS B 2 137  ? 18.747  -18.698 18.806  1.00 76.57  ? 567  LYS B CB  1 
ATOM   8114 C CG  . LYS B 2 137  ? 19.333  -17.331 18.541  1.00 73.86  ? 567  LYS B CG  1 
ATOM   8115 C CD  . LYS B 2 137  ? 18.416  -16.595 17.601  1.00 82.70  ? 567  LYS B CD  1 
ATOM   8116 C CE  . LYS B 2 137  ? 19.136  -15.648 16.691  1.00 91.82  ? 567  LYS B CE  1 
ATOM   8117 N NZ  . LYS B 2 137  ? 18.308  -15.353 15.498  1.00 100.19 ? 567  LYS B NZ  1 
ATOM   8118 N N   . PRO B 2 138  ? 18.194  -21.647 20.108  1.00 82.04  ? 568  PRO B N   1 
ATOM   8119 C CA  . PRO B 2 138  ? 17.324  -22.576 20.868  1.00 82.36  ? 568  PRO B CA  1 
ATOM   8120 C C   . PRO B 2 138  ? 17.914  -23.003 22.209  1.00 87.32  ? 568  PRO B C   1 
ATOM   8121 O O   . PRO B 2 138  ? 17.155  -23.224 23.146  1.00 87.81  ? 568  PRO B O   1 
ATOM   8122 C CB  . PRO B 2 138  ? 17.187  -23.785 19.930  1.00 83.76  ? 568  PRO B CB  1 
ATOM   8123 C CG  . PRO B 2 138  ? 18.359  -23.700 19.024  1.00 87.67  ? 568  PRO B CG  1 
ATOM   8124 C CD  . PRO B 2 138  ? 18.574  -22.245 18.807  1.00 83.20  ? 568  PRO B CD  1 
ATOM   8125 N N   . ASP B 2 139  ? 19.259  -23.116 22.297  1.00 83.99  ? 569  ASP B N   1 
ATOM   8126 C CA  . ASP B 2 139  ? 19.984  -23.480 23.519  1.00 83.96  ? 569  ASP B CA  1 
ATOM   8127 C C   . ASP B 2 139  ? 19.912  -22.334 24.520  1.00 86.92  ? 569  ASP B C   1 
ATOM   8128 O O   . ASP B 2 139  ? 19.665  -22.566 25.705  1.00 86.66  ? 569  ASP B O   1 
ATOM   8129 C CB  . ASP B 2 139  ? 21.468  -23.797 23.214  1.00 86.28  ? 569  ASP B CB  1 
ATOM   8130 C CG  . ASP B 2 139  ? 21.772  -24.951 22.261  1.00 101.79 ? 569  ASP B CG  1 
ATOM   8131 O OD1 . ASP B 2 139  ? 20.845  -25.380 21.509  1.00 103.30 ? 569  ASP B OD1 1 
ATOM   8132 O OD2 . ASP B 2 139  ? 22.946  -25.386 22.217  1.00 108.17 ? 569  ASP B OD2 1 
ATOM   8133 N N   . LEU B 2 140  ? 20.135  -21.093 24.025  1.00 83.05  ? 570  LEU B N   1 
ATOM   8134 C CA  . LEU B 2 140  ? 20.127  -19.831 24.776  1.00 81.94  ? 570  LEU B CA  1 
ATOM   8135 C C   . LEU B 2 140  ? 18.790  -19.584 25.452  1.00 83.44  ? 570  LEU B C   1 
ATOM   8136 O O   . LEU B 2 140  ? 18.754  -19.300 26.656  1.00 82.81  ? 570  LEU B O   1 
ATOM   8137 C CB  . LEU B 2 140  ? 20.453  -18.664 23.829  1.00 81.62  ? 570  LEU B CB  1 
ATOM   8138 C CG  . LEU B 2 140  ? 20.713  -17.321 24.475  1.00 85.52  ? 570  LEU B CG  1 
ATOM   8139 C CD1 . LEU B 2 140  ? 21.767  -17.426 25.550  1.00 85.75  ? 570  LEU B CD1 1 
ATOM   8140 C CD2 . LEU B 2 140  ? 21.144  -16.334 23.448  1.00 87.60  ? 570  LEU B CD2 1 
ATOM   8141 N N   . ILE B 2 141  ? 17.698  -19.683 24.662  1.00 77.70  ? 571  ILE B N   1 
ATOM   8142 C CA  . ILE B 2 141  ? 16.318  -19.519 25.110  1.00 77.04  ? 571  ILE B CA  1 
ATOM   8143 C C   . ILE B 2 141  ? 15.960  -20.639 26.130  1.00 82.66  ? 571  ILE B C   1 
ATOM   8144 O O   . ILE B 2 141  ? 15.297  -20.363 27.146  1.00 82.64  ? 571  ILE B O   1 
ATOM   8145 C CB  . ILE B 2 141  ? 15.382  -19.458 23.868  1.00 79.46  ? 571  ILE B CB  1 
ATOM   8146 C CG1 . ILE B 2 141  ? 15.622  -18.163 23.072  1.00 79.37  ? 571  ILE B CG1 1 
ATOM   8147 C CG2 . ILE B 2 141  ? 13.904  -19.600 24.227  1.00 80.03  ? 571  ILE B CG2 1 
ATOM   8148 C CD1 . ILE B 2 141  ? 15.391  -18.288 21.610  1.00 84.40  ? 571  ILE B CD1 1 
ATOM   8149 N N   . GLN B 2 142  ? 16.451  -21.882 25.883  1.00 78.63  ? 572  GLN B N   1 
ATOM   8150 C CA  . GLN B 2 142  ? 16.189  -23.012 26.770  1.00 77.56  ? 572  GLN B CA  1 
ATOM   8151 C C   . GLN B 2 142  ? 16.843  -22.846 28.127  1.00 77.93  ? 572  GLN B C   1 
ATOM   8152 O O   . GLN B 2 142  ? 16.201  -23.135 29.136  1.00 78.98  ? 572  GLN B O   1 
ATOM   8153 C CB  . GLN B 2 142  ? 16.539  -24.366 26.128  1.00 79.19  ? 572  GLN B CB  1 
ATOM   8154 C CG  . GLN B 2 142  ? 15.776  -25.549 26.748  1.00 97.61  ? 572  GLN B CG  1 
ATOM   8155 C CD  . GLN B 2 142  ? 14.309  -25.247 27.033  1.00 116.05 ? 572  GLN B CD  1 
ATOM   8156 O OE1 . GLN B 2 142  ? 13.476  -25.137 26.119  1.00 109.18 ? 572  GLN B OE1 1 
ATOM   8157 N NE2 . GLN B 2 142  ? 13.968  -25.071 28.316  1.00 106.44 ? 572  GLN B NE2 1 
ATOM   8158 N N   . LEU B 2 143  ? 18.086  -22.348 28.158  1.00 70.16  ? 573  LEU B N   1 
ATOM   8159 C CA  . LEU B 2 143  ? 18.808  -22.096 29.402  1.00 68.65  ? 573  LEU B CA  1 
ATOM   8160 C C   . LEU B 2 143  ? 18.211  -20.979 30.222  1.00 71.99  ? 573  LEU B C   1 
ATOM   8161 O O   . LEU B 2 143  ? 18.409  -20.983 31.425  1.00 72.65  ? 573  LEU B O   1 
ATOM   8162 C CB  . LEU B 2 143  ? 20.275  -21.788 29.149  1.00 68.49  ? 573  LEU B CB  1 
ATOM   8163 C CG  . LEU B 2 143  ? 21.167  -22.967 28.887  1.00 72.55  ? 573  LEU B CG  1 
ATOM   8164 C CD1 . LEU B 2 143  ? 22.401  -22.515 28.195  1.00 72.38  ? 573  LEU B CD1 1 
ATOM   8165 C CD2 . LEU B 2 143  ? 21.514  -23.690 30.184  1.00 73.23  ? 573  LEU B CD2 1 
ATOM   8166 N N   . ARG B 2 144  ? 17.537  -20.002 29.586  1.00 67.84  ? 574  ARG B N   1 
ATOM   8167 C CA  . ARG B 2 144  ? 16.876  -18.891 30.271  1.00 67.19  ? 574  ARG B CA  1 
ATOM   8168 C C   . ARG B 2 144  ? 15.557  -19.366 30.897  1.00 68.21  ? 574  ARG B C   1 
ATOM   8169 O O   . ARG B 2 144  ? 15.247  -18.953 32.010  1.00 66.68  ? 574  ARG B O   1 
ATOM   8170 C CB  . ARG B 2 144  ? 16.600  -17.724 29.300  1.00 69.80  ? 574  ARG B CB  1 
ATOM   8171 C CG  . ARG B 2 144  ? 16.063  -16.457 29.977  1.00 80.11  ? 574  ARG B CG  1 
ATOM   8172 C CD  . ARG B 2 144  ? 15.088  -15.703 29.093  1.00 95.22  ? 574  ARG B CD  1 
ATOM   8173 N NE  . ARG B 2 144  ? 15.761  -14.851 28.105  1.00 114.36 ? 574  ARG B NE  1 
ATOM   8174 C CZ  . ARG B 2 144  ? 16.173  -13.604 28.334  1.00 130.03 ? 574  ARG B CZ  1 
ATOM   8175 N NH1 . ARG B 2 144  ? 16.001  -13.049 29.528  1.00 113.19 ? 574  ARG B NH1 1 
ATOM   8176 N NH2 . ARG B 2 144  ? 16.770  -12.909 27.374  1.00 118.13 ? 574  ARG B NH2 1 
ATOM   8177 N N   . LYS B 2 145  ? 14.763  -20.193 30.171  1.00 64.06  ? 575  LYS B N   1 
ATOM   8178 C CA  . LYS B 2 145  ? 13.471  -20.692 30.673  1.00 63.67  ? 575  LYS B CA  1 
ATOM   8179 C C   . LYS B 2 145  ? 13.654  -21.597 31.898  1.00 66.73  ? 575  LYS B C   1 
ATOM   8180 O O   . LYS B 2 145  ? 12.936  -21.436 32.897  1.00 65.25  ? 575  LYS B O   1 
ATOM   8181 C CB  . LYS B 2 145  ? 12.672  -21.394 29.567  1.00 66.20  ? 575  LYS B CB  1 
ATOM   8182 C CG  . LYS B 2 145  ? 12.242  -20.450 28.441  1.00 82.83  ? 575  LYS B CG  1 
ATOM   8183 C CD  . LYS B 2 145  ? 11.283  -21.131 27.486  1.00 96.07  ? 575  LYS B CD  1 
ATOM   8184 N N   . THR B 2 146  ? 14.671  -22.494 31.831  1.00 62.47  ? 576  THR B N   1 
ATOM   8185 C CA  . THR B 2 146  ? 15.056  -23.431 32.880  1.00 62.01  ? 576  THR B CA  1 
ATOM   8186 C C   . THR B 2 146  ? 15.434  -22.669 34.138  1.00 68.41  ? 576  THR B C   1 
ATOM   8187 O O   . THR B 2 146  ? 14.823  -22.868 35.184  1.00 69.98  ? 576  THR B O   1 
ATOM   8188 C CB  . THR B 2 146  ? 16.169  -24.342 32.380  1.00 66.96  ? 576  THR B CB  1 
ATOM   8189 O OG1 . THR B 2 146  ? 15.740  -24.968 31.180  1.00 70.30  ? 576  THR B OG1 1 
ATOM   8190 C CG2 . THR B 2 146  ? 16.534  -25.402 33.377  1.00 65.09  ? 576  THR B CG2 1 
ATOM   8191 N N   . ARG B 2 147  ? 16.408  -21.768 34.020  1.00 65.47  ? 577  ARG B N   1 
ATOM   8192 C CA  . ARG B 2 147  ? 16.920  -20.902 35.077  1.00 64.86  ? 577  ARG B CA  1 
ATOM   8193 C C   . ARG B 2 147  ? 15.742  -20.152 35.698  1.00 69.41  ? 577  ARG B C   1 
ATOM   8194 O O   . ARG B 2 147  ? 15.598  -20.166 36.917  1.00 69.35  ? 577  ARG B O   1 
ATOM   8195 C CB  . ARG B 2 147  ? 17.933  -19.913 34.462  1.00 62.06  ? 577  ARG B CB  1 
ATOM   8196 C CG  . ARG B 2 147  ? 18.815  -19.148 35.437  1.00 68.04  ? 577  ARG B CG  1 
ATOM   8197 C CD  . ARG B 2 147  ? 18.120  -17.954 36.083  1.00 70.84  ? 577  ARG B CD  1 
ATOM   8198 N NE  . ARG B 2 147  ? 17.453  -17.076 35.121  1.00 63.62  ? 577  ARG B NE  1 
ATOM   8199 C CZ  . ARG B 2 147  ? 18.052  -16.081 34.476  1.00 79.17  ? 577  ARG B CZ  1 
ATOM   8200 N NH1 . ARG B 2 147  ? 19.345  -15.838 34.666  1.00 82.32  ? 577  ARG B NH1 1 
ATOM   8201 N NH2 . ARG B 2 147  ? 17.372  -15.339 33.614  1.00 53.11  ? 577  ARG B NH2 1 
ATOM   8202 N N   . ASP B 2 148  ? 14.882  -19.545 34.855  1.00 66.03  ? 578  ASP B N   1 
ATOM   8203 C CA  . ASP B 2 148  ? 13.720  -18.792 35.307  1.00 65.65  ? 578  ASP B CA  1 
ATOM   8204 C C   . ASP B 2 148  ? 12.728  -19.648 36.104  1.00 71.31  ? 578  ASP B C   1 
ATOM   8205 O O   . ASP B 2 148  ? 12.217  -19.177 37.121  1.00 70.66  ? 578  ASP B O   1 
ATOM   8206 C CB  . ASP B 2 148  ? 13.025  -18.098 34.133  1.00 66.78  ? 578  ASP B CB  1 
ATOM   8207 C CG  . ASP B 2 148  ? 13.734  -16.864 33.601  1.00 80.41  ? 578  ASP B CG  1 
ATOM   8208 O OD1 . ASP B 2 148  ? 14.917  -16.664 33.941  1.00 79.26  ? 578  ASP B OD1 1 
ATOM   8209 O OD2 . ASP B 2 148  ? 13.119  -16.124 32.797  1.00 92.78  ? 578  ASP B OD2 1 
ATOM   8210 N N   . GLN B 2 149  ? 12.481  -20.903 35.672  1.00 68.32  ? 579  GLN B N   1 
ATOM   8211 C CA  . GLN B 2 149  ? 11.508  -21.728 36.362  1.00 68.49  ? 579  GLN B CA  1 
ATOM   8212 C C   . GLN B 2 149  ? 12.098  -22.408 37.582  1.00 73.45  ? 579  GLN B C   1 
ATOM   8213 O O   . GLN B 2 149  ? 11.336  -22.780 38.472  1.00 74.42  ? 579  GLN B O   1 
ATOM   8214 C CB  . GLN B 2 149  ? 10.762  -22.704 35.422  1.00 70.11  ? 579  GLN B CB  1 
ATOM   8215 C CG  . GLN B 2 149  ? 11.586  -23.755 34.719  1.00 93.01  ? 579  GLN B CG  1 
ATOM   8216 C CD  . GLN B 2 149  ? 10.693  -24.618 33.865  1.00 121.78 ? 579  GLN B CD  1 
ATOM   8217 O OE1 . GLN B 2 149  ? 10.312  -24.250 32.746  1.00 112.56 ? 579  GLN B OE1 1 
ATOM   8218 N NE2 . GLN B 2 149  ? 10.313  -25.777 34.391  1.00 124.62 ? 579  GLN B NE2 1 
ATOM   8219 N N   . TYR B 2 150  ? 13.436  -22.525 37.669  1.00 69.90  ? 580  TYR B N   1 
ATOM   8220 C CA  . TYR B 2 150  ? 14.098  -23.075 38.864  1.00 69.93  ? 580  TYR B CA  1 
ATOM   8221 C C   . TYR B 2 150  ? 14.060  -21.986 39.932  1.00 72.71  ? 580  TYR B C   1 
ATOM   8222 O O   . TYR B 2 150  ? 13.907  -22.259 41.124  1.00 72.31  ? 580  TYR B O   1 
ATOM   8223 C CB  . TYR B 2 150  ? 15.551  -23.441 38.549  1.00 71.61  ? 580  TYR B CB  1 
ATOM   8224 C CG  . TYR B 2 150  ? 15.768  -24.897 38.202  1.00 74.34  ? 580  TYR B CG  1 
ATOM   8225 C CD1 . TYR B 2 150  ? 15.217  -25.451 37.051  1.00 76.90  ? 580  TYR B CD1 1 
ATOM   8226 C CD2 . TYR B 2 150  ? 16.572  -25.705 38.988  1.00 75.68  ? 580  TYR B CD2 1 
ATOM   8227 C CE1 . TYR B 2 150  ? 15.407  -26.795 36.731  1.00 78.42  ? 580  TYR B CE1 1 
ATOM   8228 C CE2 . TYR B 2 150  ? 16.769  -27.048 38.679  1.00 77.00  ? 580  TYR B CE2 1 
ATOM   8229 C CZ  . TYR B 2 150  ? 16.204  -27.586 37.538  1.00 84.71  ? 580  TYR B CZ  1 
ATOM   8230 O OH  . TYR B 2 150  ? 16.434  -28.904 37.224  1.00 87.72  ? 580  TYR B OH  1 
ATOM   8231 N N   . LEU B 2 151  ? 14.154  -20.743 39.471  1.00 68.77  ? 581  LEU B N   1 
ATOM   8232 C CA  . LEU B 2 151  ? 14.089  -19.545 40.282  1.00 69.45  ? 581  LEU B CA  1 
ATOM   8233 C C   . LEU B 2 151  ? 12.690  -19.346 40.888  1.00 75.11  ? 581  LEU B C   1 
ATOM   8234 O O   . LEU B 2 151  ? 12.575  -18.915 42.035  1.00 74.38  ? 581  LEU B O   1 
ATOM   8235 C CB  . LEU B 2 151  ? 14.482  -18.368 39.394  1.00 69.42  ? 581  LEU B CB  1 
ATOM   8236 C CG  . LEU B 2 151  ? 14.796  -17.058 40.041  1.00 73.81  ? 581  LEU B CG  1 
ATOM   8237 C CD1 . LEU B 2 151  ? 15.598  -17.249 41.305  1.00 75.04  ? 581  LEU B CD1 1 
ATOM   8238 C CD2 . LEU B 2 151  ? 15.547  -16.208 39.075  1.00 74.86  ? 581  LEU B CD2 1 
ATOM   8239 N N   . MET B 2 152  ? 11.643  -19.687 40.123  1.00 73.29  ? 582  MET B N   1 
ATOM   8240 C CA  . MET B 2 152  ? 10.251  -19.598 40.538  1.00 73.80  ? 582  MET B CA  1 
ATOM   8241 C C   . MET B 2 152  ? 9.950   -20.688 41.511  1.00 75.08  ? 582  MET B C   1 
ATOM   8242 O O   . MET B 2 152  ? 9.239   -20.441 42.476  1.00 75.33  ? 582  MET B O   1 
ATOM   8243 C CB  . MET B 2 152  ? 9.316   -19.720 39.344  1.00 77.66  ? 582  MET B CB  1 
ATOM   8244 C CG  . MET B 2 152  ? 9.429   -18.571 38.390  1.00 84.33  ? 582  MET B CG  1 
ATOM   8245 S SD  . MET B 2 152  ? 8.666   -17.054 38.984  1.00 91.81  ? 582  MET B SD  1 
ATOM   8246 C CE  . MET B 2 152  ? 6.955   -17.461 38.681  1.00 88.70  ? 582  MET B CE  1 
ATOM   8247 N N   . TRP B 2 153  ? 10.503  -21.889 41.279  1.00 70.09  ? 583  TRP B N   1 
ATOM   8248 C CA  . TRP B 2 153  ? 10.328  -23.062 42.133  1.00 69.41  ? 583  TRP B CA  1 
ATOM   8249 C C   . TRP B 2 153  ? 10.776  -22.771 43.572  1.00 70.08  ? 583  TRP B C   1 
ATOM   8250 O O   . TRP B 2 153  ? 10.075  -23.132 44.510  1.00 69.35  ? 583  TRP B O   1 
ATOM   8251 C CB  . TRP B 2 153  ? 11.085  -24.268 41.561  1.00 68.61  ? 583  TRP B CB  1 
ATOM   8252 C CG  . TRP B 2 153  ? 10.745  -25.579 42.214  1.00 70.34  ? 583  TRP B CG  1 
ATOM   8253 C CD1 . TRP B 2 153  ? 9.827   -26.494 41.783  1.00 73.45  ? 583  TRP B CD1 1 
ATOM   8254 C CD2 . TRP B 2 153  ? 11.368  -26.155 43.375  1.00 70.31  ? 583  TRP B CD2 1 
ATOM   8255 N NE1 . TRP B 2 153  ? 9.832   -27.600 42.608  1.00 72.98  ? 583  TRP B NE1 1 
ATOM   8256 C CE2 . TRP B 2 153  ? 10.760  -27.414 43.599  1.00 74.12  ? 583  TRP B CE2 1 
ATOM   8257 C CE3 . TRP B 2 153  ? 12.364  -25.718 44.266  1.00 71.94  ? 583  TRP B CE3 1 
ATOM   8258 C CZ2 . TRP B 2 153  ? 11.112  -28.238 44.675  1.00 73.52  ? 583  TRP B CZ2 1 
ATOM   8259 C CZ3 . TRP B 2 153  ? 12.701  -26.532 45.347  1.00 73.52  ? 583  TRP B CZ3 1 
ATOM   8260 C CH2 . TRP B 2 153  ? 12.075  -27.772 45.546  1.00 74.00  ? 583  TRP B CH2 1 
ATOM   8261 N N   . LEU B 2 154  ? 11.905  -22.086 43.736  1.00 64.41  ? 584  LEU B N   1 
ATOM   8262 C CA  . LEU B 2 154  ? 12.421  -21.763 45.063  1.00 63.46  ? 584  LEU B CA  1 
ATOM   8263 C C   . LEU B 2 154  ? 11.687  -20.563 45.703  1.00 64.62  ? 584  LEU B C   1 
ATOM   8264 O O   . LEU B 2 154  ? 11.516  -20.524 46.921  1.00 62.29  ? 584  LEU B O   1 
ATOM   8265 C CB  . LEU B 2 154  ? 13.950  -21.579 45.018  1.00 63.22  ? 584  LEU B CB  1 
ATOM   8266 C CG  . LEU B 2 154  ? 14.757  -22.772 44.492  1.00 66.00  ? 584  LEU B CG  1 
ATOM   8267 C CD1 . LEU B 2 154  ? 16.005  -22.298 43.808  1.00 65.61  ? 584  LEU B CD1 1 
ATOM   8268 C CD2 . LEU B 2 154  ? 15.087  -23.749 45.614  1.00 66.17  ? 584  LEU B CD2 1 
ATOM   8269 N N   . THR B 2 155  ? 11.213  -19.614 44.879  1.00 61.14  ? 585  THR B N   1 
ATOM   8270 C CA  . THR B 2 155  ? 10.418  -18.482 45.373  1.00 60.61  ? 585  THR B CA  1 
ATOM   8271 C C   . THR B 2 155  ? 9.127   -19.032 45.997  1.00 64.90  ? 585  THR B C   1 
ATOM   8272 O O   . THR B 2 155  ? 8.919   -18.856 47.183  1.00 63.24  ? 585  THR B O   1 
ATOM   8273 C CB  . THR B 2 155  ? 10.172  -17.444 44.262  1.00 58.10  ? 585  THR B CB  1 
ATOM   8274 O OG1 . THR B 2 155  ? 11.427  -16.972 43.843  1.00 55.54  ? 585  THR B OG1 1 
ATOM   8275 C CG2 . THR B 2 155  ? 9.386   -16.256 44.729  1.00 53.52  ? 585  THR B CG2 1 
ATOM   8276 N N   . GLN B 2 156  ? 8.305   -19.757 45.219  1.00 63.57  ? 586  GLN B N   1 
ATOM   8277 C CA  . GLN B 2 156  ? 7.067   -20.340 45.739  1.00 63.21  ? 586  GLN B CA  1 
ATOM   8278 C C   . GLN B 2 156  ? 7.349   -21.279 46.920  1.00 68.49  ? 586  GLN B C   1 
ATOM   8279 O O   . GLN B 2 156  ? 6.521   -21.361 47.822  1.00 69.90  ? 586  GLN B O   1 
ATOM   8280 C CB  . GLN B 2 156  ? 6.231   -21.005 44.634  1.00 63.66  ? 586  GLN B CB  1 
ATOM   8281 C CG  . GLN B 2 156  ? 7.000   -22.049 43.827  1.00 69.95  ? 586  GLN B CG  1 
ATOM   8282 C CD  . GLN B 2 156  ? 6.268   -22.636 42.640  1.00 77.20  ? 586  GLN B CD  1 
ATOM   8283 O OE1 . GLN B 2 156  ? 6.225   -23.855 42.479  1.00 70.27  ? 586  GLN B OE1 1 
ATOM   8284 N NE2 . GLN B 2 156  ? 5.759   -21.806 41.726  1.00 61.53  ? 586  GLN B NE2 1 
ATOM   8285 N N   . LYS B 2 157  ? 8.542   -21.922 46.957  1.00 62.95  ? 587  LYS B N   1 
ATOM   8286 C CA  . LYS B 2 157  ? 8.924   -22.805 48.059  1.00 61.42  ? 587  LYS B CA  1 
ATOM   8287 C C   . LYS B 2 157  ? 9.336   -22.031 49.336  1.00 65.58  ? 587  LYS B C   1 
ATOM   8288 O O   . LYS B 2 157  ? 9.518   -22.634 50.382  1.00 65.72  ? 587  LYS B O   1 
ATOM   8289 C CB  . LYS B 2 157  ? 9.999   -23.818 47.626  1.00 63.33  ? 587  LYS B CB  1 
ATOM   8290 C CG  . LYS B 2 157  ? 9.427   -25.116 47.063  1.00 71.34  ? 587  LYS B CG  1 
ATOM   8291 C CD  . LYS B 2 157  ? 9.805   -26.316 47.938  1.00 75.53  ? 587  LYS B CD  1 
ATOM   8292 C CE  . LYS B 2 157  ? 8.810   -27.446 47.861  1.00 72.45  ? 587  LYS B CE  1 
ATOM   8293 N N   . GLY B 2 158  ? 9.448   -20.717 49.251  1.00 62.66  ? 588  GLY B N   1 
ATOM   8294 C CA  . GLY B 2 158  ? 9.753   -19.883 50.404  1.00 63.12  ? 588  GLY B CA  1 
ATOM   8295 C C   . GLY B 2 158  ? 11.191  -19.465 50.614  1.00 70.36  ? 588  GLY B C   1 
ATOM   8296 O O   . GLY B 2 158  ? 11.470  -18.780 51.602  1.00 69.77  ? 588  GLY B O   1 
ATOM   8297 N N   . VAL B 2 159  ? 12.112  -19.870 49.699  1.00 69.52  ? 589  VAL B N   1 
ATOM   8298 C CA  . VAL B 2 159  ? 13.552  -19.534 49.739  1.00 69.68  ? 589  VAL B CA  1 
ATOM   8299 C C   . VAL B 2 159  ? 13.737  -18.001 49.656  1.00 77.22  ? 589  VAL B C   1 
ATOM   8300 O O   . VAL B 2 159  ? 13.075  -17.326 48.849  1.00 74.30  ? 589  VAL B O   1 
ATOM   8301 C CB  . VAL B 2 159  ? 14.425  -20.312 48.701  1.00 71.54  ? 589  VAL B CB  1 
ATOM   8302 C CG1 . VAL B 2 159  ? 15.911  -19.992 48.866  1.00 70.41  ? 589  VAL B CG1 1 
ATOM   8303 C CG2 . VAL B 2 159  ? 14.195  -21.814 48.808  1.00 71.12  ? 589  VAL B CG2 1 
ATOM   8304 N N   . ARG B 2 160  ? 14.592  -17.468 50.563  1.00 78.83  ? 590  ARG B N   1 
ATOM   8305 C CA  . ARG B 2 160  ? 14.853  -16.040 50.702  1.00 80.45  ? 590  ARG B CA  1 
ATOM   8306 C C   . ARG B 2 160  ? 15.698  -15.511 49.574  1.00 86.38  ? 590  ARG B C   1 
ATOM   8307 O O   . ARG B 2 160  ? 16.601  -16.206 49.104  1.00 86.29  ? 590  ARG B O   1 
ATOM   8308 C CB  . ARG B 2 160  ? 15.522  -15.738 52.053  1.00 83.26  ? 590  ARG B CB  1 
ATOM   8309 C CG  . ARG B 2 160  ? 15.219  -14.328 52.577  1.00 94.25  ? 590  ARG B CG  1 
ATOM   8310 N N   . GLN B 2 161  ? 15.431  -14.247 49.182  1.00 83.90  ? 591  GLN B N   1 
ATOM   8311 C CA  . GLN B 2 161  ? 16.136  -13.512 48.136  1.00 83.63  ? 591  GLN B CA  1 
ATOM   8312 C C   . GLN B 2 161  ? 17.668  -13.583 48.274  1.00 87.53  ? 591  GLN B C   1 
ATOM   8313 O O   . GLN B 2 161  ? 18.340  -13.785 47.269  1.00 86.23  ? 591  GLN B O   1 
ATOM   8314 C CB  . GLN B 2 161  ? 15.640  -12.056 48.086  1.00 84.84  ? 591  GLN B CB  1 
ATOM   8315 C CG  . GLN B 2 161  ? 16.047  -11.283 46.825  1.00 102.08 ? 591  GLN B CG  1 
ATOM   8316 C CD  . GLN B 2 161  ? 15.698  -12.002 45.543  1.00 119.51 ? 591  GLN B CD  1 
ATOM   8317 O OE1 . GLN B 2 161  ? 14.533  -12.079 45.150  1.00 116.37 ? 591  GLN B OE1 1 
ATOM   8318 N NE2 . GLN B 2 161  ? 16.705  -12.550 44.868  1.00 108.23 ? 591  GLN B NE2 1 
ATOM   8319 N N   . LYS B 2 162  ? 18.199  -13.468 49.518  1.00 85.35  ? 592  LYS B N   1 
ATOM   8320 C CA  . LYS B 2 162  ? 19.634  -13.513 49.852  1.00 85.75  ? 592  LYS B CA  1 
ATOM   8321 C C   . LYS B 2 162  ? 20.289  -14.817 49.436  1.00 90.09  ? 592  LYS B C   1 
ATOM   8322 O O   . LYS B 2 162  ? 21.429  -14.798 48.952  1.00 92.05  ? 592  LYS B O   1 
ATOM   8323 C CB  . LYS B 2 162  ? 19.877  -13.252 51.351  1.00 88.85  ? 592  LYS B CB  1 
ATOM   8324 C CG  . LYS B 2 162  ? 20.979  -12.230 51.626  1.00 104.83 ? 592  LYS B CG  1 
ATOM   8325 N N   . LYS B 2 163  ? 19.572  -15.945 49.614  1.00 83.70  ? 593  LYS B N   1 
ATOM   8326 C CA  . LYS B 2 163  ? 20.051  -17.271 49.225  1.00 81.85  ? 593  LYS B CA  1 
ATOM   8327 C C   . LYS B 2 163  ? 19.971  -17.372 47.709  1.00 81.84  ? 593  LYS B C   1 
ATOM   8328 O O   . LYS B 2 163  ? 20.887  -17.923 47.114  1.00 82.33  ? 593  LYS B O   1 
ATOM   8329 C CB  . LYS B 2 163  ? 19.243  -18.392 49.914  1.00 84.82  ? 593  LYS B CB  1 
ATOM   8330 C CG  . LYS B 2 163  ? 20.030  -19.700 50.093  1.00 107.39 ? 593  LYS B CG  1 
ATOM   8331 C CD  . LYS B 2 163  ? 19.274  -20.694 50.989  1.00 124.29 ? 593  LYS B CD  1 
ATOM   8332 C CE  . LYS B 2 163  ? 20.013  -21.994 51.253  1.00 139.53 ? 593  LYS B CE  1 
ATOM   8333 N NZ  . LYS B 2 163  ? 21.107  -21.854 52.258  1.00 151.44 ? 593  LYS B NZ  1 
ATOM   8334 N N   . LEU B 2 164  ? 18.906  -16.801 47.078  1.00 75.69  ? 594  LEU B N   1 
ATOM   8335 C CA  . LEU B 2 164  ? 18.732  -16.789 45.616  1.00 74.50  ? 594  LEU B CA  1 
ATOM   8336 C C   . LEU B 2 164  ? 19.858  -15.988 44.946  1.00 79.14  ? 594  LEU B C   1 
ATOM   8337 O O   . LEU B 2 164  ? 20.410  -16.448 43.952  1.00 77.31  ? 594  LEU B O   1 
ATOM   8338 C CB  . LEU B 2 164  ? 17.336  -16.283 45.183  1.00 73.65  ? 594  LEU B CB  1 
ATOM   8339 C CG  . LEU B 2 164  ? 16.104  -17.096 45.650  1.00 76.01  ? 594  LEU B CG  1 
ATOM   8340 C CD1 . LEU B 2 164  ? 14.804  -16.404 45.257  1.00 74.86  ? 594  LEU B CD1 1 
ATOM   8341 C CD2 . LEU B 2 164  ? 16.126  -18.506 45.102  1.00 76.54  ? 594  LEU B CD2 1 
ATOM   8342 N N   . ASN B 2 165  ? 20.255  -14.839 45.555  1.00 77.96  ? 595  ASN B N   1 
ATOM   8343 C CA  . ASN B 2 165  ? 21.370  -13.986 45.126  1.00 77.80  ? 595  ASN B CA  1 
ATOM   8344 C C   . ASN B 2 165  ? 22.628  -14.820 45.080  1.00 85.19  ? 595  ASN B C   1 
ATOM   8345 O O   . ASN B 2 165  ? 23.244  -14.905 44.012  1.00 85.76  ? 595  ASN B O   1 
ATOM   8346 C CB  . ASN B 2 165  ? 21.557  -12.834 46.084  1.00 73.97  ? 595  ASN B CB  1 
ATOM   8347 C CG  . ASN B 2 165  ? 20.419  -11.862 46.066  1.00 104.25 ? 595  ASN B CG  1 
ATOM   8348 O OD1 . ASN B 2 165  ? 19.726  -11.686 45.052  1.00 94.60  ? 595  ASN B OD1 1 
ATOM   8349 N ND2 . ASN B 2 165  ? 20.189  -11.223 47.205  1.00 103.20 ? 595  ASN B ND2 1 
ATOM   8350 N N   . GLU B 2 166  ? 22.951  -15.521 46.210  1.00 82.85  ? 596  GLU B N   1 
ATOM   8351 C CA  . GLU B 2 166  ? 24.093  -16.436 46.335  1.00 83.34  ? 596  GLU B CA  1 
ATOM   8352 C C   . GLU B 2 166  ? 24.146  -17.444 45.184  1.00 91.08  ? 596  GLU B C   1 
ATOM   8353 O O   . GLU B 2 166  ? 25.237  -17.696 44.671  1.00 92.49  ? 596  GLU B O   1 
ATOM   8354 C CB  . GLU B 2 166  ? 24.091  -17.182 47.684  1.00 84.57  ? 596  GLU B CB  1 
ATOM   8355 C CG  . GLU B 2 166  ? 24.376  -16.312 48.898  1.00 93.99  ? 596  GLU B CG  1 
ATOM   8356 N N   . TRP B 2 167  ? 22.983  -17.993 44.753  1.00 88.54  ? 597  TRP B N   1 
ATOM   8357 C CA  . TRP B 2 167  ? 22.938  -18.971 43.663  1.00 89.07  ? 597  TRP B CA  1 
ATOM   8358 C C   . TRP B 2 167  ? 22.981  -18.345 42.284  1.00 92.55  ? 597  TRP B C   1 
ATOM   8359 O O   . TRP B 2 167  ? 23.623  -18.894 41.397  1.00 92.88  ? 597  TRP B O   1 
ATOM   8360 C CB  . TRP B 2 167  ? 21.742  -19.923 43.799  1.00 88.75  ? 597  TRP B CB  1 
ATOM   8361 C CG  . TRP B 2 167  ? 21.814  -20.844 44.991  1.00 90.46  ? 597  TRP B CG  1 
ATOM   8362 C CD1 . TRP B 2 167  ? 22.918  -21.500 45.463  1.00 93.61  ? 597  TRP B CD1 1 
ATOM   8363 C CD2 . TRP B 2 167  ? 20.713  -21.277 45.805  1.00 90.24  ? 597  TRP B CD2 1 
ATOM   8364 N NE1 . TRP B 2 167  ? 22.585  -22.264 46.558  1.00 93.35  ? 597  TRP B NE1 1 
ATOM   8365 C CE2 . TRP B 2 167  ? 21.234  -22.158 46.782  1.00 94.52  ? 597  TRP B CE2 1 
ATOM   8366 C CE3 . TRP B 2 167  ? 19.339  -20.980 45.826  1.00 91.03  ? 597  TRP B CE3 1 
ATOM   8367 C CZ2 . TRP B 2 167  ? 20.427  -22.755 47.758  1.00 93.17  ? 597  TRP B CZ2 1 
ATOM   8368 C CZ3 . TRP B 2 167  ? 18.544  -21.582 46.789  1.00 92.23  ? 597  TRP B CZ3 1 
ATOM   8369 C CH2 . TRP B 2 167  ? 19.090  -22.447 47.746  1.00 92.75  ? 597  TRP B CH2 1 
ATOM   8370 N N   . LEU B 2 168  ? 22.315  -17.200 42.090  1.00 88.71  ? 598  LEU B N   1 
ATOM   8371 C CA  . LEU B 2 168  ? 22.296  -16.498 40.805  1.00 88.18  ? 598  LEU B CA  1 
ATOM   8372 C C   . LEU B 2 168  ? 23.648  -15.806 40.532  1.00 96.79  ? 598  LEU B C   1 
ATOM   8373 O O   . LEU B 2 168  ? 23.884  -15.315 39.426  1.00 96.20  ? 598  LEU B O   1 
ATOM   8374 C CB  . LEU B 2 168  ? 21.151  -15.473 40.781  1.00 87.02  ? 598  LEU B CB  1 
ATOM   8375 C CG  . LEU B 2 168  ? 19.763  -16.004 40.435  1.00 90.05  ? 598  LEU B CG  1 
ATOM   8376 C CD1 . LEU B 2 168  ? 18.683  -15.041 40.891  1.00 89.27  ? 598  LEU B CD1 1 
ATOM   8377 C CD2 . LEU B 2 168  ? 19.619  -16.250 38.940  1.00 91.37  ? 598  LEU B CD2 1 
ATOM   8378 N N   . GLY B 2 169  ? 24.517  -15.797 41.544  1.00 96.17  ? 599  GLY B N   1 
ATOM   8379 C CA  . GLY B 2 169  ? 25.823  -15.163 41.486  1.00 96.90  ? 599  GLY B CA  1 
ATOM   8380 C C   . GLY B 2 169  ? 25.688  -13.708 41.876  1.00 102.81 ? 599  GLY B C   1 
ATOM   8381 O O   . GLY B 2 169  ? 25.119  -12.913 41.119  1.00 102.21 ? 599  GLY B O   1 
ATOM   8382 N N   . ASN B 2 170  ? 26.168  -13.363 43.090  1.00 100.53 ? 600  ASN B N   1 
ATOM   8383 C CA  . ASN B 2 170  ? 26.137  -12.000 43.621  1.00 131.62 ? 600  ASN B CA  1 
ATOM   8384 C C   . ASN B 2 170  ? 27.342  -11.215 43.099  1.00 165.52 ? 600  ASN B C   1 
ATOM   8385 O O   . ASN B 2 170  ? 27.923  -11.569 42.069  1.00 123.28 ? 600  ASN B O   1 
ATOM   8386 C CB  . ASN B 2 170  ? 26.122  -12.015 45.151  1.00 131.88 ? 600  ASN B CB  1 
HETATM 8387 C C15 . 9EM C 3 .    ? 44.221  13.603  31.319  1.00 84.59  ? 4001 9EM A C15 1 
HETATM 8388 C C19 . 9EM C 3 .    ? 45.548  13.347  33.389  1.00 88.47  ? 4001 9EM A C19 1 
HETATM 8389 C C23 . 9EM C 3 .    ? 43.072  13.385  33.474  1.00 87.45  ? 4001 9EM A C23 1 
HETATM 8390 C C11 . 9EM C 3 .    ? 42.161  15.669  33.930  1.00 85.81  ? 4001 9EM A C11 1 
HETATM 8391 C C34 . 9EM C 3 .    ? 38.596  12.788  35.854  1.00 94.17  ? 4001 9EM A C34 1 
HETATM 8392 C C27 . 9EM C 3 .    ? 40.996  13.021  35.844  1.00 91.92  ? 4001 9EM A C27 1 
HETATM 8393 C C33 . 9EM C 3 .    ? 38.510  13.481  34.649  1.00 93.69  ? 4001 9EM A C33 1 
HETATM 8394 O O1  . 9EM C 3 .    ? 45.895  15.864  31.227  1.00 92.23  ? 4001 9EM A O1  1 
HETATM 8395 C C2  . 9EM C 3 .    ? 45.195  16.318  32.116  1.00 89.71  ? 4001 9EM A C2  1 
HETATM 8396 C C3  . 9EM C 3 .    ? 45.173  17.796  32.373  1.00 89.61  ? 4001 9EM A C3  1 
HETATM 8397 N N7  . 9EM C 3 .    ? 44.406  15.501  32.927  1.00 87.02  ? 4001 9EM A N7  1 
HETATM 8398 C C8  . 9EM C 3 .    ? 43.598  16.091  34.005  1.00 86.43  ? 4001 9EM A C8  1 
HETATM 8399 C C14 . 9EM C 3 .    ? 44.308  14.010  32.790  1.00 86.65  ? 4001 9EM A C14 1 
HETATM 8400 O O24 . 9EM C 3 .    ? 42.971  12.166  33.544  1.00 85.73  ? 4001 9EM A O24 1 
HETATM 8401 N N25 . 9EM C 3 .    ? 42.096  14.203  33.992  1.00 88.06  ? 4001 9EM A N25 1 
HETATM 8402 C C26 . 9EM C 3 .    ? 40.920  13.714  34.634  1.00 91.39  ? 4001 9EM A C26 1 
HETATM 8403 C C29 . 9EM C 3 .    ? 39.832  12.560  36.448  1.00 92.80  ? 4001 9EM A C29 1 
HETATM 8404 C C31 . 9EM C 3 .    ? 39.675  13.941  34.040  1.00 94.05  ? 4001 9EM A C31 1 
HETATM 8405 C C36 . 9EM C 3 .    ? 37.209  13.760  34.002  1.00 88.47  ? 4001 9EM A C36 1 
HETATM 8406 C C37 . 9EM C 3 .    ? 36.209  12.888  33.645  1.00 85.85  ? 4001 9EM A C37 1 
HETATM 8407 C C39 . 9EM C 3 .    ? 35.144  13.622  33.056  1.00 83.50  ? 4001 9EM A C39 1 
HETATM 8408 C C40 . 9EM C 3 .    ? 35.513  14.983  33.056  1.00 83.63  ? 4001 9EM A C40 1 
HETATM 8409 C C41 . 9EM C 3 .    ? 34.970  16.244  32.647  1.00 81.25  ? 4001 9EM A C41 1 
HETATM 8410 N N42 . 9EM C 3 .    ? 33.761  16.335  32.058  1.00 79.97  ? 4001 9EM A N42 1 
HETATM 8411 N N45 . 9EM C 3 .    ? 35.660  17.362  32.840  1.00 80.23  ? 4001 9EM A N45 1 
HETATM 8412 C C46 . 9EM C 3 .    ? 36.862  17.279  33.414  1.00 80.52  ? 4001 9EM A C46 1 
HETATM 8413 N N48 . 9EM C 3 .    ? 37.481  16.216  33.828  1.00 81.61  ? 4001 9EM A N48 1 
HETATM 8414 N N49 . 9EM C 3 .    ? 36.762  15.044  33.632  1.00 84.59  ? 4001 9EM A N49 1 
HETATM 8415 C C50 . 9EM C 3 .    ? 33.894  13.054  32.559  1.00 78.73  ? 4001 9EM A C50 1 
HETATM 8416 C C51 . 9EM C 3 .    ? 32.621  13.589  32.763  1.00 75.18  ? 4001 9EM A C51 1 
HETATM 8417 C C53 . 9EM C 3 .    ? 31.759  12.706  32.120  1.00 75.00  ? 4001 9EM A C53 1 
HETATM 8418 N N55 . 9EM C 3 .    ? 32.398  11.692  31.550  1.00 76.23  ? 4001 9EM A N55 1 
HETATM 8419 N N56 . 9EM C 3 .    ? 33.721  11.920  31.828  1.00 77.66  ? 4001 9EM A N56 1 
HETATM 8420 C C57 . 9EM C 3 .    ? 34.725  10.996  31.326  1.00 78.65  ? 4001 9EM A C57 1 
HETATM 8421 C C60 . 9EM C 3 .    ? 34.807  11.054  29.828  1.00 79.44  ? 4001 9EM A C60 1 
HETATM 8422 F F61 . 9EM C 3 .    ? 35.053  12.291  29.409  1.00 77.05  ? 4001 9EM A F61 1 
HETATM 8423 F F62 . 9EM C 3 .    ? 33.662  10.687  29.258  1.00 83.16  ? 4001 9EM A F62 1 
HETATM 8424 F F63 . 9EM C 3 .    ? 35.751  10.263  29.321  1.00 78.01  ? 4001 9EM A F63 1 
HETATM 8425 O O   . HOH D 4 .    ? 27.043  20.596  40.173  1.00 56.08  ? 4101 HOH A O   1 
HETATM 8426 O O   . HOH D 4 .    ? 7.699   3.017   23.962  1.00 84.20  ? 4102 HOH A O   1 
HETATM 8427 O O   . HOH D 4 .    ? 15.773  2.663   25.088  1.00 67.36  ? 4103 HOH A O   1 
HETATM 8428 O O   . HOH D 4 .    ? 38.274  7.471   22.560  1.00 56.60  ? 4104 HOH A O   1 
HETATM 8429 O O   . HOH D 4 .    ? 17.433  30.564  36.790  1.00 76.36  ? 4105 HOH A O   1 
HETATM 8430 O O   . HOH D 4 .    ? 45.415  10.534  40.446  1.00 71.64  ? 4106 HOH A O   1 
HETATM 8431 O O   . HOH D 4 .    ? 42.722  20.284  6.957   1.00 52.87  ? 4107 HOH A O   1 
HETATM 8432 O O   . HOH D 4 .    ? -19.299 0.754   18.097  1.00 71.92  ? 4108 HOH A O   1 
HETATM 8433 O O   . HOH D 4 .    ? 14.950  -32.060 13.569  1.00 72.22  ? 4109 HOH A O   1 
HETATM 8434 O O   . HOH D 4 .    ? -2.368  23.825  17.122  1.00 49.51  ? 4110 HOH A O   1 
HETATM 8435 O O   . HOH D 4 .    ? 38.311  19.775  3.238   1.00 63.87  ? 4111 HOH A O   1 
HETATM 8436 O O   . HOH D 4 .    ? 4.796   13.951  55.161  1.00 81.32  ? 4112 HOH A O   1 
HETATM 8437 O O   . HOH D 4 .    ? 21.582  27.883  32.255  1.00 62.76  ? 4113 HOH A O   1 
HETATM 8438 O O   . HOH D 4 .    ? 53.112  17.955  -4.302  1.00 62.79  ? 4114 HOH A O   1 
HETATM 8439 O O   . HOH D 4 .    ? 54.712  7.428   -15.164 1.00 72.84  ? 4115 HOH A O   1 
HETATM 8440 O O   . HOH D 4 .    ? 19.159  25.340  10.919  1.00 59.93  ? 4116 HOH A O   1 
HETATM 8441 O O   . HOH D 4 .    ? 18.109  28.893  45.164  1.00 64.91  ? 4117 HOH A O   1 
HETATM 8442 O O   . HOH D 4 .    ? 4.916   -32.694 19.397  1.00 64.29  ? 4118 HOH A O   1 
HETATM 8443 O O   . HOH D 4 .    ? 27.570  6.383   0.142   1.00 65.74  ? 4119 HOH A O   1 
HETATM 8444 O O   . HOH D 4 .    ? -15.484 19.035  14.738  1.00 69.48  ? 4120 HOH A O   1 
HETATM 8445 O O   . HOH D 4 .    ? 39.913  1.511   17.302  1.00 60.32  ? 4121 HOH A O   1 
HETATM 8446 O O   . HOH D 4 .    ? 23.291  1.407   1.924   1.00 61.47  ? 4122 HOH A O   1 
HETATM 8447 O O   . HOH D 4 .    ? 4.648   5.330   52.585  1.00 53.32  ? 4123 HOH A O   1 
HETATM 8448 O O   . HOH E 4 .    ? 32.087  -14.724 18.729  1.00 70.21  ? 701  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    ASN 1    17   17   ASN ASN A . n 
A 1 2    GLN 2    18   18   GLN GLN A . n 
A 1 3    SER 3    19   19   SER SER A . n 
A 1 4    VAL 4    20   20   VAL VAL A . n 
A 1 5    VAL 5    21   21   VAL VAL A . n 
A 1 6    VAL 6    22   22   VAL VAL A . n 
A 1 7    ASP 7    23   23   ASP ASP A . n 
A 1 8    PHE 8    24   24   PHE PHE A . n 
A 1 9    LEU 9    25   25   LEU LEU A . n 
A 1 10   LEU 10   26   26   LEU LEU A . n 
A 1 11   PRO 11   27   27   PRO PRO A . n 
A 1 12   THR 12   28   28   THR THR A . n 
A 1 13   GLY 13   29   29   GLY GLY A . n 
A 1 14   VAL 14   30   30   VAL VAL A . n 
A 1 15   TYR 15   31   31   TYR TYR A . n 
A 1 16   LEU 16   32   32   LEU LEU A . n 
A 1 17   ASN 17   33   33   ASN ASN A . n 
A 1 18   PHE 18   34   34   PHE PHE A . n 
A 1 19   PRO 19   35   35   PRO PRO A . n 
A 1 20   VAL 20   36   36   VAL VAL A . n 
A 1 21   SER 21   37   37   SER SER A . n 
A 1 22   ARG 22   38   38   ARG ARG A . n 
A 1 23   ASN 23   39   39   ASN ASN A . n 
A 1 24   ALA 24   40   40   ALA ALA A . n 
A 1 25   ASN 25   41   41   ASN ASN A . n 
A 1 26   LEU 26   42   42   LEU LEU A . n 
A 1 27   SER 27   43   43   SER SER A . n 
A 1 28   THR 28   44   44   THR THR A . n 
A 1 29   ILE 29   45   45   ILE ILE A . n 
A 1 30   LYS 30   46   46   LYS LYS A . n 
A 1 31   GLN 31   47   47   GLN GLN A . n 
A 1 32   LEU 32   48   48   LEU LEU A . n 
A 1 33   LEU 33   49   49   LEU LEU A . n 
A 1 34   TRP 34   50   50   TRP TRP A . n 
A 1 35   HIS 35   51   51   HIS HIS A . n 
A 1 36   ARG 36   52   52   ARG ARG A . n 
A 1 37   ALA 37   53   53   ALA ALA A . n 
A 1 38   GLN 38   54   54   GLN GLN A . n 
A 1 39   TYR 39   55   55   TYR TYR A . n 
A 1 40   GLU 40   56   56   GLU GLU A . n 
A 1 41   PRO 41   57   57   PRO PRO A . n 
A 1 42   LEU 42   58   58   LEU LEU A . n 
A 1 43   PHE 43   59   59   PHE PHE A . n 
A 1 44   HIS 44   60   60   HIS HIS A . n 
A 1 45   MET 45   61   61   MET MET A . n 
A 1 46   LEU 46   62   62   LEU LEU A . n 
A 1 47   SER 47   63   63   SER SER A . n 
A 1 48   GLY 48   64   64   GLY GLY A . n 
A 1 49   PRO 49   65   65   PRO PRO A . n 
A 1 50   GLU 50   66   66   GLU GLU A . n 
A 1 51   ALA 51   67   67   ALA ALA A . n 
A 1 52   TYR 52   68   68   TYR TYR A . n 
A 1 53   VAL 53   69   69   VAL VAL A . n 
A 1 54   PHE 54   70   70   PHE PHE A . n 
A 1 55   THR 55   71   71   THR THR A . n 
A 1 56   CYS 56   72   72   CYS CYS A . n 
A 1 57   ILE 57   73   73   ILE ILE A . n 
A 1 58   ASN 58   74   74   ASN ASN A . n 
A 1 59   GLN 59   75   75   GLN GLN A . n 
A 1 60   THR 60   76   76   THR THR A . n 
A 1 61   ALA 61   77   77   ALA ALA A . n 
A 1 62   GLU 62   78   78   GLU GLU A . n 
A 1 63   GLN 63   79   79   GLN GLN A . n 
A 1 64   GLN 64   80   80   GLN GLN A . n 
A 1 65   GLU 65   81   81   GLU GLU A . n 
A 1 66   LEU 66   82   82   LEU LEU A . n 
A 1 67   GLU 67   83   83   GLU GLU A . n 
A 1 68   ASP 68   84   84   ASP ASP A . n 
A 1 69   GLU 69   85   85   GLU GLU A . n 
A 1 70   GLN 70   86   86   GLN GLN A . n 
A 1 71   ARG 71   87   87   ARG ARG A . n 
A 1 72   ARG 72   88   88   ARG ARG A . n 
A 1 73   LEU 73   89   89   LEU LEU A . n 
A 1 74   CYS 74   90   90   CYS CYS A . n 
A 1 75   ASP 75   91   91   ASP ASP A . n 
A 1 76   VAL 76   92   92   VAL VAL A . n 
A 1 77   GLN 77   93   93   GLN GLN A . n 
A 1 78   PRO 78   94   94   PRO PRO A . n 
A 1 79   PHE 79   95   95   PHE PHE A . n 
A 1 80   LEU 80   96   96   LEU LEU A . n 
A 1 81   PRO 81   97   97   PRO PRO A . n 
A 1 82   VAL 82   98   98   VAL VAL A . n 
A 1 83   LEU 83   99   99   LEU LEU A . n 
A 1 84   ARG 84   100  100  ARG ARG A . n 
A 1 85   LEU 85   101  101  LEU LEU A . n 
A 1 86   VAL 86   102  102  VAL VAL A . n 
A 1 87   ALA 87   103  103  ALA ALA A . n 
A 1 88   ARG 88   104  104  ARG ARG A . n 
A 1 89   GLU 89   105  105  GLU GLU A . n 
A 1 90   GLY 90   106  106  GLY GLY A . n 
A 1 91   ASP 91   107  107  ASP ASP A . n 
A 1 92   ARG 92   108  108  ARG ARG A . n 
A 1 93   VAL 93   109  109  VAL VAL A . n 
A 1 94   LYS 94   110  110  LYS LYS A . n 
A 1 95   LYS 95   111  111  LYS LYS A . n 
A 1 96   LEU 96   112  112  LEU LEU A . n 
A 1 97   ILE 97   113  113  ILE ILE A . n 
A 1 98   ASN 98   114  114  ASN ASN A . n 
A 1 99   SER 99   115  115  SER SER A . n 
A 1 100  GLN 100  116  116  GLN GLN A . n 
A 1 101  ILE 101  117  117  ILE ILE A . n 
A 1 102  SER 102  118  118  SER SER A . n 
A 1 103  LEU 103  119  119  LEU LEU A . n 
A 1 104  LEU 104  120  120  LEU LEU A . n 
A 1 105  ILE 105  121  121  ILE ILE A . n 
A 1 106  GLY 106  122  122  GLY GLY A . n 
A 1 107  LYS 107  123  123  LYS LYS A . n 
A 1 108  GLY 108  124  124  GLY GLY A . n 
A 1 109  LEU 109  125  125  LEU LEU A . n 
A 1 110  HIS 110  126  126  HIS HIS A . n 
A 1 111  GLU 111  127  127  GLU GLU A . n 
A 1 112  PHE 112  128  128  PHE PHE A . n 
A 1 113  ASP 113  129  129  ASP ASP A . n 
A 1 114  SER 114  130  130  SER SER A . n 
A 1 115  LEU 115  131  131  LEU LEU A . n 
A 1 116  CYS 116  132  132  CYS CYS A . n 
A 1 117  ASP 117  133  133  ASP ASP A . n 
A 1 118  PRO 118  134  134  PRO PRO A . n 
A 1 119  GLU 119  135  135  GLU GLU A . n 
A 1 120  VAL 120  136  136  VAL VAL A . n 
A 1 121  ASN 121  137  137  ASN ASN A . n 
A 1 122  ASP 122  138  138  ASP ASP A . n 
A 1 123  PHE 123  139  139  PHE PHE A . n 
A 1 124  ARG 124  140  140  ARG ARG A . n 
A 1 125  ALA 125  141  141  ALA ALA A . n 
A 1 126  LYS 126  142  142  LYS LYS A . n 
A 1 127  MET 127  143  143  MET MET A . n 
A 1 128  CYS 128  144  144  CYS CYS A . n 
A 1 129  GLN 129  145  145  GLN GLN A . n 
A 1 130  PHE 130  146  146  PHE PHE A . n 
A 1 131  CYS 131  147  147  CYS CYS A . n 
A 1 132  GLU 132  148  148  GLU GLU A . n 
A 1 133  GLU 133  149  149  GLU GLU A . n 
A 1 134  ALA 134  150  150  ALA ALA A . n 
A 1 135  ALA 135  151  151  ALA ALA A . n 
A 1 136  ALA 136  152  152  ALA ALA A . n 
A 1 137  ARG 137  153  153  ARG ARG A . n 
A 1 138  ARG 138  154  154  ARG ARG A . n 
A 1 139  GLN 139  155  155  GLN GLN A . n 
A 1 140  GLN 140  156  156  GLN GLN A . n 
A 1 141  LEU 141  157  157  LEU LEU A . n 
A 1 142  GLY 142  158  158  GLY GLY A . n 
A 1 143  TRP 143  159  159  TRP TRP A . n 
A 1 144  GLU 144  160  160  GLU GLU A . n 
A 1 145  ALA 145  161  161  ALA ALA A . n 
A 1 146  TRP 146  162  162  TRP TRP A . n 
A 1 147  LEU 147  163  163  LEU LEU A . n 
A 1 148  GLN 148  164  164  GLN GLN A . n 
A 1 149  TYR 149  165  165  TYR TYR A . n 
A 1 150  SER 150  166  166  SER SER A . n 
A 1 151  PHE 151  167  167  PHE PHE A . n 
A 1 152  PRO 152  168  168  PRO PRO A . n 
A 1 153  LEU 153  169  169  LEU LEU A . n 
A 1 154  GLN 154  170  170  GLN GLN A . n 
A 1 155  LEU 155  171  171  LEU LEU A . n 
A 1 156  GLU 156  172  172  GLU GLU A . n 
A 1 157  PRO 157  173  173  PRO PRO A . n 
A 1 158  SER 158  174  174  SER SER A . n 
A 1 159  ALA 159  175  ?    ?   ?   A . n 
A 1 160  GLN 160  176  ?    ?   ?   A . n 
A 1 161  THR 161  177  ?    ?   ?   A . n 
A 1 162  TRP 162  178  ?    ?   ?   A . n 
A 1 163  GLY 163  179  ?    ?   ?   A . n 
A 1 164  PRO 164  180  ?    ?   ?   A . n 
A 1 165  GLY 165  181  ?    ?   ?   A . n 
A 1 166  THR 166  182  ?    ?   ?   A . n 
A 1 167  LEU 167  183  ?    ?   ?   A . n 
A 1 168  ARG 168  184  ?    ?   ?   A . n 
A 1 169  LEU 169  185  185  LEU LEU A . n 
A 1 170  PRO 170  186  186  PRO PRO A . n 
A 1 171  ASN 171  187  187  ASN ASN A . n 
A 1 172  ARG 172  188  188  ARG ARG A . n 
A 1 173  ALA 173  189  189  ALA ALA A . n 
A 1 174  LEU 174  190  190  LEU LEU A . n 
A 1 175  LEU 175  191  191  LEU LEU A . n 
A 1 176  VAL 176  192  192  VAL VAL A . n 
A 1 177  ASN 177  193  193  ASN ASN A . n 
A 1 178  VAL 178  194  194  VAL VAL A . n 
A 1 179  LYS 179  195  195  LYS LYS A . n 
A 1 180  PHE 180  196  196  PHE PHE A . n 
A 1 181  GLU 181  197  197  GLU GLU A . n 
A 1 182  GLY 182  198  198  GLY GLY A . n 
A 1 183  SER 183  199  199  SER SER A . n 
A 1 184  GLU 184  200  200  GLU GLU A . n 
A 1 185  GLU 185  201  201  GLU GLU A . n 
A 1 186  SER 186  202  202  SER SER A . n 
A 1 187  PHE 187  203  203  PHE PHE A . n 
A 1 188  THR 188  204  204  THR THR A . n 
A 1 189  PHE 189  205  205  PHE PHE A . n 
A 1 190  GLN 190  206  206  GLN GLN A . n 
A 1 191  VAL 191  207  207  VAL VAL A . n 
A 1 192  SER 192  208  208  SER SER A . n 
A 1 193  THR 193  209  209  THR THR A . n 
A 1 194  LYS 194  210  210  LYS LYS A . n 
A 1 195  ASP 195  211  211  ASP ASP A . n 
A 1 196  VAL 196  212  212  VAL VAL A . n 
A 1 197  PRO 197  213  213  PRO PRO A . n 
A 1 198  LEU 198  214  214  LEU LEU A . n 
A 1 199  ALA 199  215  215  ALA ALA A . n 
A 1 200  LEU 200  216  216  LEU LEU A . n 
A 1 201  MET 201  217  217  MET MET A . n 
A 1 202  ALA 202  218  218  ALA ALA A . n 
A 1 203  CYS 203  219  219  CYS CYS A . n 
A 1 204  ALA 204  220  220  ALA ALA A . n 
A 1 205  LEU 205  221  221  LEU LEU A . n 
A 1 206  ARG 206  222  222  ARG ARG A . n 
A 1 207  LYS 207  223  223  LYS LYS A . n 
A 1 208  LYS 208  224  224  LYS LYS A . n 
A 1 209  ALA 209  225  225  ALA ALA A . n 
A 1 210  THR 210  226  226  THR THR A . n 
A 1 211  VAL 211  227  ?    ?   ?   A . n 
A 1 212  PHE 212  228  ?    ?   ?   A . n 
A 1 213  ARG 213  229  ?    ?   ?   A . n 
A 1 214  GLN 214  230  ?    ?   ?   A . n 
A 1 215  PRO 215  231  ?    ?   ?   A . n 
A 1 216  LEU 216  232  ?    ?   ?   A . n 
A 1 217  VAL 217  233  ?    ?   ?   A . n 
A 1 218  GLU 218  234  ?    ?   ?   A . n 
A 1 219  GLN 219  235  ?    ?   ?   A . n 
A 1 220  PRO 220  236  ?    ?   ?   A . n 
A 1 221  GLU 221  237  237  GLU GLU A . n 
A 1 222  ASP 222  238  238  ASP ASP A . n 
A 1 223  TYR 223  239  239  TYR TYR A . n 
A 1 224  THR 224  240  240  THR THR A . n 
A 1 225  LEU 225  241  241  LEU LEU A . n 
A 1 226  GLN 226  242  242  GLN GLN A . n 
A 1 227  VAL 227  243  243  VAL VAL A . n 
A 1 228  ASN 228  244  244  ASN ASN A . n 
A 1 229  GLY 229  245  245  GLY GLY A . n 
A 1 230  ARG 230  246  246  ARG ARG A . n 
A 1 231  HIS 231  247  247  HIS HIS A . n 
A 1 232  GLU 232  248  248  GLU GLU A . n 
A 1 233  TYR 233  249  249  TYR TYR A . n 
A 1 234  LEU 234  250  250  LEU LEU A . n 
A 1 235  TYR 235  251  251  TYR TYR A . n 
A 1 236  GLY 236  252  252  GLY GLY A . n 
A 1 237  SER 237  253  253  SER SER A . n 
A 1 238  TYR 238  254  254  TYR TYR A . n 
A 1 239  PRO 239  255  255  PRO PRO A . n 
A 1 240  LEU 240  256  256  LEU LEU A . n 
A 1 241  CYS 241  257  257  CYS CYS A . n 
A 1 242  GLN 242  258  258  GLN GLN A . n 
A 1 243  PHE 243  259  259  PHE PHE A . n 
A 1 244  GLN 244  260  260  GLN GLN A . n 
A 1 245  TYR 245  261  261  TYR TYR A . n 
A 1 246  ILE 246  262  262  ILE ILE A . n 
A 1 247  CYS 247  263  263  CYS CYS A . n 
A 1 248  SER 248  264  264  SER SER A . n 
A 1 249  CYS 249  265  265  CYS CYS A . n 
A 1 250  LEU 250  266  266  LEU LEU A . n 
A 1 251  HIS 251  267  267  HIS HIS A . n 
A 1 252  SER 252  268  268  SER SER A . n 
A 1 253  GLY 253  269  269  GLY GLY A . n 
A 1 254  LEU 254  270  270  LEU LEU A . n 
A 1 255  THR 255  271  271  THR THR A . n 
A 1 256  PRO 256  272  272  PRO PRO A . n 
A 1 257  HIS 257  273  273  HIS HIS A . n 
A 1 258  LEU 258  274  274  LEU LEU A . n 
A 1 259  THR 259  275  275  THR THR A . n 
A 1 260  MET 260  276  276  MET MET A . n 
A 1 261  VAL 261  277  277  VAL VAL A . n 
A 1 262  HIS 262  278  278  HIS HIS A . n 
A 1 263  SER 263  279  279  SER SER A . n 
A 1 264  SER 264  280  280  SER SER A . n 
A 1 265  SER 265  281  281  SER SER A . n 
A 1 266  ILE 266  282  282  ILE ILE A . n 
A 1 267  LEU 267  283  283  LEU LEU A . n 
A 1 268  ALA 268  284  284  ALA ALA A . n 
A 1 269  MET 269  285  285  MET MET A . n 
A 1 270  ARG 270  286  286  ARG ARG A . n 
A 1 271  ASP 271  287  287  ASP ASP A . n 
A 1 272  GLU 272  288  ?    ?   ?   A . n 
A 1 273  GLN 273  289  ?    ?   ?   A . n 
A 1 274  SER 274  290  ?    ?   ?   A . n 
A 1 275  ASN 275  291  ?    ?   ?   A . n 
A 1 276  PRO 276  292  ?    ?   ?   A . n 
A 1 277  ALA 277  293  ?    ?   ?   A . n 
A 1 278  PRO 278  294  ?    ?   ?   A . n 
A 1 279  GLN 279  295  ?    ?   ?   A . n 
A 1 280  VAL 280  296  ?    ?   ?   A . n 
A 1 281  GLN 281  297  ?    ?   ?   A . n 
A 1 282  LYS 282  298  ?    ?   ?   A . n 
A 1 283  PRO 283  299  ?    ?   ?   A . n 
A 1 284  ARG 284  300  ?    ?   ?   A . n 
A 1 285  ALA 285  301  ?    ?   ?   A . n 
A 1 286  LYS 286  302  ?    ?   ?   A . n 
A 1 287  PRO 287  303  ?    ?   ?   A . n 
A 1 288  PRO 288  304  ?    ?   ?   A . n 
A 1 289  PRO 289  305  ?    ?   ?   A . n 
A 1 290  ILE 290  306  ?    ?   ?   A . n 
A 1 291  PRO 291  307  ?    ?   ?   A . n 
A 1 292  ALA 292  308  ?    ?   ?   A . n 
A 1 293  LYS 293  309  ?    ?   ?   A . n 
A 1 294  LYS 294  310  ?    ?   ?   A . n 
A 1 295  PRO 295  311  ?    ?   ?   A . n 
A 1 296  SER 296  312  ?    ?   ?   A . n 
A 1 297  SER 297  313  ?    ?   ?   A . n 
A 1 298  VAL 298  314  ?    ?   ?   A . n 
A 1 299  SER 299  315  ?    ?   ?   A . n 
A 1 300  LEU 300  316  316  LEU LEU A . n 
A 1 301  TRP 301  317  317  TRP TRP A . n 
A 1 302  SER 302  318  318  SER SER A . n 
A 1 303  LEU 303  319  319  LEU LEU A . n 
A 1 304  GLU 304  320  320  GLU GLU A . n 
A 1 305  GLN 305  321  321  GLN GLN A . n 
A 1 306  PRO 306  322  322  PRO PRO A . n 
A 1 307  PHE 307  323  323  PHE PHE A . n 
A 1 308  ARG 308  324  324  ARG ARG A . n 
A 1 309  ILE 309  325  325  ILE ILE A . n 
A 1 310  GLU 310  326  326  GLU GLU A . n 
A 1 311  LEU 311  327  327  LEU LEU A . n 
A 1 312  ILE 312  328  328  ILE ILE A . n 
A 1 313  GLN 313  329  329  GLN GLN A . n 
A 1 314  GLY 314  330  330  GLY GLY A . n 
A 1 315  SER 315  331  331  SER SER A . n 
A 1 316  LYS 316  332  332  LYS LYS A . n 
A 1 317  VAL 317  333  333  VAL VAL A . n 
A 1 318  ASN 318  334  334  ASN ASN A . n 
A 1 319  ALA 319  335  335  ALA ALA A . n 
A 1 320  ASP 320  336  336  ASP ASP A . n 
A 1 321  GLU 321  337  337  GLU GLU A . n 
A 1 322  ARG 322  338  338  ARG ARG A . n 
A 1 323  MET 323  339  339  MET MET A . n 
A 1 324  LYS 324  340  340  LYS LYS A . n 
A 1 325  LEU 325  341  341  LEU LEU A . n 
A 1 326  VAL 326  342  342  VAL VAL A . n 
A 1 327  VAL 327  343  343  VAL VAL A . n 
A 1 328  GLN 328  344  344  GLN GLN A . n 
A 1 329  ALA 329  345  345  ALA ALA A . n 
A 1 330  GLY 330  346  346  GLY GLY A . n 
A 1 331  LEU 331  347  347  LEU LEU A . n 
A 1 332  PHE 332  348  348  PHE PHE A . n 
A 1 333  HIS 333  349  349  HIS HIS A . n 
A 1 334  GLY 334  350  350  GLY GLY A . n 
A 1 335  ASN 335  351  351  ASN ASN A . n 
A 1 336  GLU 336  352  352  GLU GLU A . n 
A 1 337  MET 337  353  353  MET MET A . n 
A 1 338  LEU 338  354  354  LEU LEU A . n 
A 1 339  CYS 339  355  355  CYS CYS A . n 
A 1 340  LYS 340  356  356  LYS LYS A . n 
A 1 341  THR 341  357  357  THR THR A . n 
A 1 342  VAL 342  358  358  VAL VAL A . n 
A 1 343  SER 343  359  359  SER SER A . n 
A 1 344  SER 344  360  360  SER SER A . n 
A 1 345  SER 345  361  361  SER SER A . n 
A 1 346  GLU 346  362  362  GLU GLU A . n 
A 1 347  VAL 347  363  363  VAL VAL A . n 
A 1 348  SER 348  364  364  SER SER A . n 
A 1 349  VAL 349  365  365  VAL VAL A . n 
A 1 350  CYS 350  366  366  CYS CYS A . n 
A 1 351  SER 351  367  367  SER SER A . n 
A 1 352  GLU 352  368  368  GLU GLU A . n 
A 1 353  PRO 353  369  369  PRO PRO A . n 
A 1 354  VAL 354  370  370  VAL VAL A . n 
A 1 355  TRP 355  371  371  TRP TRP A . n 
A 1 356  LYS 356  372  372  LYS LYS A . n 
A 1 357  GLN 357  373  373  GLN GLN A . n 
A 1 358  ARG 358  374  374  ARG ARG A . n 
A 1 359  LEU 359  375  375  LEU LEU A . n 
A 1 360  GLU 360  376  376  GLU GLU A . n 
A 1 361  PHE 361  377  377  PHE PHE A . n 
A 1 362  ASP 362  378  378  ASP ASP A . n 
A 1 363  ILE 363  379  379  ILE ILE A . n 
A 1 364  ASN 364  380  380  ASN ASN A . n 
A 1 365  ILE 365  381  381  ILE ILE A . n 
A 1 366  CYS 366  382  382  CYS CYS A . n 
A 1 367  ASP 367  383  383  ASP ASP A . n 
A 1 368  LEU 368  384  384  LEU LEU A . n 
A 1 369  PRO 369  385  385  PRO PRO A . n 
A 1 370  ARG 370  386  386  ARG ARG A . n 
A 1 371  MET 371  387  387  MET MET A . n 
A 1 372  ALA 372  388  388  ALA ALA A . n 
A 1 373  ARG 373  389  389  ARG ARG A . n 
A 1 374  LEU 374  390  390  LEU LEU A . n 
A 1 375  CYS 375  391  391  CYS CYS A . n 
A 1 376  PHE 376  392  392  PHE PHE A . n 
A 1 377  ALA 377  393  393  ALA ALA A . n 
A 1 378  LEU 378  394  394  LEU LEU A . n 
A 1 379  TYR 379  395  395  TYR TYR A . n 
A 1 380  ALA 380  396  396  ALA ALA A . n 
A 1 381  VAL 381  397  397  VAL VAL A . n 
A 1 382  ILE 382  398  398  ILE ILE A . n 
A 1 383  GLU 383  399  399  GLU GLU A . n 
A 1 384  LYS 384  400  400  LYS LYS A . n 
A 1 385  ALA 385  401  401  ALA ALA A . n 
A 1 386  LYS 386  402  ?    ?   ?   A . n 
A 1 387  LYS 387  403  ?    ?   ?   A . n 
A 1 388  ALA 388  404  ?    ?   ?   A . n 
A 1 389  ARG 389  405  ?    ?   ?   A . n 
A 1 390  SER 390  406  ?    ?   ?   A . n 
A 1 391  THR 391  407  ?    ?   ?   A . n 
A 1 392  LYS 392  408  ?    ?   ?   A . n 
A 1 393  LYS 393  409  ?    ?   ?   A . n 
A 1 394  LYS 394  410  ?    ?   ?   A . n 
A 1 395  SER 395  411  ?    ?   ?   A . n 
A 1 396  LYS 396  412  ?    ?   ?   A . n 
A 1 397  LYS 397  413  413  LYS LYS A . n 
A 1 398  ALA 398  414  414  ALA ALA A . n 
A 1 399  ASP 399  415  415  ASP ASP A . n 
A 1 400  CYS 400  416  416  CYS CYS A . n 
A 1 401  PRO 401  417  417  PRO PRO A . n 
A 1 402  ILE 402  418  418  ILE ILE A . n 
A 1 403  ALA 403  419  419  ALA ALA A . n 
A 1 404  TRP 404  420  420  TRP TRP A . n 
A 1 405  ALA 405  421  421  ALA ALA A . n 
A 1 406  ASN 406  422  422  ASN ASN A . n 
A 1 407  LEU 407  423  423  LEU LEU A . n 
A 1 408  MET 408  424  424  MET MET A . n 
A 1 409  LEU 409  425  425  LEU LEU A . n 
A 1 410  PHE 410  426  426  PHE PHE A . n 
A 1 411  ASP 411  427  427  ASP ASP A . n 
A 1 412  TYR 412  428  428  TYR TYR A . n 
A 1 413  LYS 413  429  429  LYS LYS A . n 
A 1 414  ASP 414  430  430  ASP ASP A . n 
A 1 415  GLN 415  431  431  GLN GLN A . n 
A 1 416  LEU 416  432  432  LEU LEU A . n 
A 1 417  LYS 417  433  433  LYS LYS A . n 
A 1 418  THR 418  434  434  THR THR A . n 
A 1 419  GLY 419  435  435  GLY GLY A . n 
A 1 420  GLU 420  436  436  GLU GLU A . n 
A 1 421  ARG 421  437  437  ARG ARG A . n 
A 1 422  CYS 422  438  438  CYS CYS A . n 
A 1 423  LEU 423  439  439  LEU LEU A . n 
A 1 424  TYR 424  440  440  TYR TYR A . n 
A 1 425  MET 425  441  441  MET MET A . n 
A 1 426  TRP 426  442  442  TRP TRP A . n 
A 1 427  PRO 427  443  443  PRO PRO A . n 
A 1 428  SER 428  444  444  SER SER A . n 
A 1 429  VAL 429  445  445  VAL VAL A . n 
A 1 430  PRO 430  446  446  PRO PRO A . n 
A 1 431  ASP 431  447  447  ASP ASP A . n 
A 1 432  GLU 432  448  448  GLU GLU A . n 
A 1 433  LYS 433  449  449  LYS LYS A . n 
A 1 434  GLY 434  450  450  GLY GLY A . n 
A 1 435  GLU 435  451  451  GLU GLU A . n 
A 1 436  LEU 436  452  452  LEU LEU A . n 
A 1 437  LEU 437  453  453  LEU LEU A . n 
A 1 438  ASN 438  454  454  ASN ASN A . n 
A 1 439  PRO 439  455  455  PRO PRO A . n 
A 1 440  THR 440  456  456  THR THR A . n 
A 1 441  GLY 441  457  457  GLY GLY A . n 
A 1 442  THR 442  458  458  THR THR A . n 
A 1 443  VAL 443  459  459  VAL VAL A . n 
A 1 444  ARG 444  460  460  ARG ARG A . n 
A 1 445  SER 445  461  461  SER SER A . n 
A 1 446  ASN 446  462  462  ASN ASN A . n 
A 1 447  PRO 447  463  463  PRO PRO A . n 
A 1 448  ASN 448  464  464  ASN ASN A . n 
A 1 449  THR 449  465  465  THR THR A . n 
A 1 450  ASP 450  466  466  ASP ASP A . n 
A 1 451  SER 451  467  467  SER SER A . n 
A 1 452  ALA 452  468  468  ALA ALA A . n 
A 1 453  ALA 453  469  469  ALA ALA A . n 
A 1 454  ALA 454  470  470  ALA ALA A . n 
A 1 455  LEU 455  471  471  LEU LEU A . n 
A 1 456  LEU 456  472  472  LEU LEU A . n 
A 1 457  ILE 457  473  473  ILE ILE A . n 
A 1 458  CYS 458  474  474  CYS CYS A . n 
A 1 459  LEU 459  475  475  LEU LEU A . n 
A 1 460  PRO 460  476  476  PRO PRO A . n 
A 1 461  GLU 461  477  477  GLU GLU A . n 
A 1 462  VAL 462  478  478  VAL VAL A . n 
A 1 463  ALA 463  479  479  ALA ALA A . n 
A 1 464  PRO 464  480  480  PRO PRO A . n 
A 1 465  HIS 465  481  481  HIS HIS A . n 
A 1 466  PRO 466  482  482  PRO PRO A . n 
A 1 467  VAL 467  483  483  VAL VAL A . n 
A 1 468  TYR 468  484  484  TYR TYR A . n 
A 1 469  TYR 469  485  485  TYR TYR A . n 
A 1 470  PRO 470  486  486  PRO PRO A . n 
A 1 471  ALA 471  487  487  ALA ALA A . n 
A 1 472  LEU 472  488  488  LEU LEU A . n 
A 1 473  GLU 473  489  489  GLU GLU A . n 
A 1 474  LYS 474  490  490  LYS LYS A . n 
A 1 475  ILE 475  491  491  ILE ILE A . n 
A 1 476  LEU 476  492  492  LEU LEU A . n 
A 1 477  GLU 477  493  493  GLU GLU A . n 
A 1 478  LEU 478  494  494  LEU LEU A . n 
A 1 479  GLY 479  495  495  GLY GLY A . n 
A 1 480  ARG 480  496  496  ARG ARG A . n 
A 1 481  HIS 481  497  497  HIS HIS A . n 
A 1 482  SER 482  498  ?    ?   ?   A . n 
A 1 483  GLU 483  499  ?    ?   ?   A . n 
A 1 484  CYS 484  500  ?    ?   ?   A . n 
A 1 485  VAL 485  501  ?    ?   ?   A . n 
A 1 486  HIS 486  502  ?    ?   ?   A . n 
A 1 487  VAL 487  503  ?    ?   ?   A . n 
A 1 488  THR 488  504  504  THR THR A . n 
A 1 489  GLU 489  505  505  GLU GLU A . n 
A 1 490  GLU 490  506  506  GLU GLU A . n 
A 1 491  GLU 491  507  507  GLU GLU A . n 
A 1 492  GLN 492  508  508  GLN GLN A . n 
A 1 493  LEU 493  509  509  LEU LEU A . n 
A 1 494  GLN 494  510  510  GLN GLN A . n 
A 1 495  LEU 495  511  511  LEU LEU A . n 
A 1 496  ARG 496  512  512  ARG ARG A . n 
A 1 497  GLU 497  513  513  GLU GLU A . n 
A 1 498  ILE 498  514  514  ILE ILE A . n 
A 1 499  LEU 499  515  515  LEU LEU A . n 
A 1 500  GLU 500  516  516  GLU GLU A . n 
A 1 501  ARG 501  517  ?    ?   ?   A . n 
A 1 502  ARG 502  518  ?    ?   ?   A . n 
A 1 503  GLY 503  519  ?    ?   ?   A . n 
A 1 504  SER 504  520  ?    ?   ?   A . n 
A 1 505  GLY 505  521  521  GLY GLY A . n 
A 1 506  GLU 506  522  522  GLU GLU A . n 
A 1 507  LEU 507  523  523  LEU LEU A . n 
A 1 508  TYR 508  524  524  TYR TYR A . n 
A 1 509  GLU 509  525  525  GLU GLU A . n 
A 1 510  HIS 510  526  526  HIS HIS A . n 
A 1 511  GLU 511  527  527  GLU GLU A . n 
A 1 512  LYS 512  528  528  LYS LYS A . n 
A 1 513  ASP 513  529  529  ASP ASP A . n 
A 1 514  LEU 514  530  530  LEU LEU A . n 
A 1 515  VAL 515  531  531  VAL VAL A . n 
A 1 516  TRP 516  532  532  TRP TRP A . n 
A 1 517  LYS 517  533  533  LYS LYS A . n 
A 1 518  LEU 518  534  534  LEU LEU A . n 
A 1 519  ARG 519  535  535  ARG ARG A . n 
A 1 520  HIS 520  536  536  HIS HIS A . n 
A 1 521  GLU 521  537  537  GLU GLU A . n 
A 1 522  VAL 522  538  538  VAL VAL A . n 
A 1 523  GLN 523  539  539  GLN GLN A . n 
A 1 524  GLU 524  540  540  GLU GLU A . n 
A 1 525  HIS 525  541  541  HIS HIS A . n 
A 1 526  PHE 526  542  542  PHE PHE A . n 
A 1 527  PRO 527  543  543  PRO PRO A . n 
A 1 528  GLU 528  544  544  GLU GLU A . n 
A 1 529  ALA 529  545  545  ALA ALA A . n 
A 1 530  LEU 530  546  546  LEU LEU A . n 
A 1 531  ALA 531  547  547  ALA ALA A . n 
A 1 532  ARG 532  548  548  ARG ARG A . n 
A 1 533  LEU 533  549  549  LEU LEU A . n 
A 1 534  LEU 534  550  550  LEU LEU A . n 
A 1 535  LEU 535  551  551  LEU LEU A . n 
A 1 536  VAL 536  552  552  VAL VAL A . n 
A 1 537  THR 537  553  553  THR THR A . n 
A 1 538  LYS 538  554  554  LYS LYS A . n 
A 1 539  TRP 539  555  555  TRP TRP A . n 
A 1 540  ASN 540  556  556  ASN ASN A . n 
A 1 541  LYS 541  557  557  LYS LYS A . n 
A 1 542  HIS 542  558  558  HIS HIS A . n 
A 1 543  GLU 543  559  559  GLU GLU A . n 
A 1 544  ASP 544  560  560  ASP ASP A . n 
A 1 545  VAL 545  561  561  VAL VAL A . n 
A 1 546  ALA 546  562  562  ALA ALA A . n 
A 1 547  GLN 547  563  563  GLN GLN A . n 
A 1 548  MET 548  564  564  MET MET A . n 
A 1 549  LEU 549  565  565  LEU LEU A . n 
A 1 550  TYR 550  566  566  TYR TYR A . n 
A 1 551  LEU 551  567  567  LEU LEU A . n 
A 1 552  LEU 552  568  568  LEU LEU A . n 
A 1 553  CYS 553  569  569  CYS CYS A . n 
A 1 554  SER 554  570  570  SER SER A . n 
A 1 555  TRP 555  571  571  TRP TRP A . n 
A 1 556  PRO 556  572  572  PRO PRO A . n 
A 1 557  GLU 557  573  573  GLU GLU A . n 
A 1 558  LEU 558  574  574  LEU LEU A . n 
A 1 559  PRO 559  575  575  PRO PRO A . n 
A 1 560  VAL 560  576  576  VAL VAL A . n 
A 1 561  LEU 561  577  577  LEU LEU A . n 
A 1 562  SER 562  578  578  SER SER A . n 
A 1 563  ALA 563  579  579  ALA ALA A . n 
A 1 564  LEU 564  580  580  LEU LEU A . n 
A 1 565  GLU 565  581  581  GLU GLU A . n 
A 1 566  LEU 566  582  582  LEU LEU A . n 
A 1 567  LEU 567  583  583  LEU LEU A . n 
A 1 568  ASP 568  584  584  ASP ASP A . n 
A 1 569  PHE 569  585  585  PHE PHE A . n 
A 1 570  SER 570  586  586  SER SER A . n 
A 1 571  PHE 571  587  587  PHE PHE A . n 
A 1 572  PRO 572  588  588  PRO PRO A . n 
A 1 573  ASP 573  589  589  ASP ASP A . n 
A 1 574  CYS 574  590  590  CYS CYS A . n 
A 1 575  HIS 575  591  591  HIS HIS A . n 
A 1 576  VAL 576  592  592  VAL VAL A . n 
A 1 577  GLY 577  593  593  GLY GLY A . n 
A 1 578  SER 578  594  594  SER SER A . n 
A 1 579  PHE 579  595  595  PHE PHE A . n 
A 1 580  ALA 580  596  596  ALA ALA A . n 
A 1 581  ILE 581  597  597  ILE ILE A . n 
A 1 582  LYS 582  598  598  LYS LYS A . n 
A 1 583  SER 583  599  599  SER SER A . n 
A 1 584  LEU 584  600  600  LEU LEU A . n 
A 1 585  ARG 585  601  601  ARG ARG A . n 
A 1 586  LYS 586  602  602  LYS LYS A . n 
A 1 587  LEU 587  603  603  LEU LEU A . n 
A 1 588  THR 588  604  604  THR THR A . n 
A 1 589  ASP 589  605  605  ASP ASP A . n 
A 1 590  ASP 590  606  606  ASP ASP A . n 
A 1 591  GLU 591  607  607  GLU GLU A . n 
A 1 592  LEU 592  608  608  LEU LEU A . n 
A 1 593  PHE 593  609  609  PHE PHE A . n 
A 1 594  GLN 594  610  610  GLN GLN A . n 
A 1 595  TYR 595  611  611  TYR TYR A . n 
A 1 596  LEU 596  612  612  LEU LEU A . n 
A 1 597  LEU 597  613  613  LEU LEU A . n 
A 1 598  GLN 598  614  614  GLN GLN A . n 
A 1 599  LEU 599  615  615  LEU LEU A . n 
A 1 600  VAL 600  616  616  VAL VAL A . n 
A 1 601  GLN 601  617  617  GLN GLN A . n 
A 1 602  VAL 602  618  618  VAL VAL A . n 
A 1 603  LEU 603  619  619  LEU LEU A . n 
A 1 604  LYS 604  620  620  LYS LYS A . n 
A 1 605  TYR 605  621  621  TYR TYR A . n 
A 1 606  GLU 606  622  622  GLU GLU A . n 
A 1 607  SER 607  623  623  SER SER A . n 
A 1 608  TYR 608  624  624  TYR TYR A . n 
A 1 609  LEU 609  625  625  LEU LEU A . n 
A 1 610  ASP 610  626  626  ASP ASP A . n 
A 1 611  CYS 611  627  627  CYS CYS A . n 
A 1 612  GLU 612  628  628  GLU GLU A . n 
A 1 613  LEU 613  629  629  LEU LEU A . n 
A 1 614  THR 614  630  630  THR THR A . n 
A 1 615  LYS 615  631  631  LYS LYS A . n 
A 1 616  PHE 616  632  632  PHE PHE A . n 
A 1 617  LEU 617  633  633  LEU LEU A . n 
A 1 618  LEU 618  634  634  LEU LEU A . n 
A 1 619  ASP 619  635  635  ASP ASP A . n 
A 1 620  ARG 620  636  636  ARG ARG A . n 
A 1 621  ALA 621  637  637  ALA ALA A . n 
A 1 622  LEU 622  638  638  LEU LEU A . n 
A 1 623  ALA 623  639  639  ALA ALA A . n 
A 1 624  ASN 624  640  640  ASN ASN A . n 
A 1 625  ARG 625  641  641  ARG ARG A . n 
A 1 626  LYS 626  642  642  LYS LYS A . n 
A 1 627  ILE 627  643  643  ILE ILE A . n 
A 1 628  GLY 628  644  644  GLY GLY A . n 
A 1 629  HIS 629  645  645  HIS HIS A . n 
A 1 630  PHE 630  646  646  PHE PHE A . n 
A 1 631  LEU 631  647  647  LEU LEU A . n 
A 1 632  PHE 632  648  648  PHE PHE A . n 
A 1 633  TRP 633  649  649  TRP TRP A . n 
A 1 634  HIS 634  650  650  HIS HIS A . n 
A 1 635  LEU 635  651  651  LEU LEU A . n 
A 1 636  ARG 636  652  652  ARG ARG A . n 
A 1 637  SER 637  653  653  SER SER A . n 
A 1 638  GLU 638  654  654  GLU GLU A . n 
A 1 639  MET 639  655  655  MET MET A . n 
A 1 640  HIS 640  656  656  HIS HIS A . n 
A 1 641  VAL 641  657  657  VAL VAL A . n 
A 1 642  PRO 642  658  658  PRO PRO A . n 
A 1 643  SER 643  659  659  SER SER A . n 
A 1 644  VAL 644  660  660  VAL VAL A . n 
A 1 645  ALA 645  661  661  ALA ALA A . n 
A 1 646  LEU 646  662  662  LEU LEU A . n 
A 1 647  ARG 647  663  663  ARG ARG A . n 
A 1 648  PHE 648  664  664  PHE PHE A . n 
A 1 649  GLY 649  665  665  GLY GLY A . n 
A 1 650  LEU 650  666  666  LEU LEU A . n 
A 1 651  ILE 651  667  667  ILE ILE A . n 
A 1 652  LEU 652  668  668  LEU LEU A . n 
A 1 653  GLU 653  669  669  GLU GLU A . n 
A 1 654  ALA 654  670  670  ALA ALA A . n 
A 1 655  TYR 655  671  671  TYR TYR A . n 
A 1 656  CYS 656  672  672  CYS CYS A . n 
A 1 657  ARG 657  673  673  ARG ARG A . n 
A 1 658  GLY 658  674  674  GLY GLY A . n 
A 1 659  SER 659  675  675  SER SER A . n 
A 1 660  THR 660  676  676  THR THR A . n 
A 1 661  HIS 661  677  677  HIS HIS A . n 
A 1 662  HIS 662  678  678  HIS HIS A . n 
A 1 663  MET 663  679  679  MET MET A . n 
A 1 664  LYS 664  680  680  LYS LYS A . n 
A 1 665  VAL 665  681  681  VAL VAL A . n 
A 1 666  LEU 666  682  682  LEU LEU A . n 
A 1 667  MET 667  683  683  MET MET A . n 
A 1 668  LYS 668  684  684  LYS LYS A . n 
A 1 669  GLN 669  685  685  GLN GLN A . n 
A 1 670  GLY 670  686  686  GLY GLY A . n 
A 1 671  GLU 671  687  687  GLU GLU A . n 
A 1 672  ALA 672  688  688  ALA ALA A . n 
A 1 673  LEU 673  689  689  LEU LEU A . n 
A 1 674  SER 674  690  690  SER SER A . n 
A 1 675  LYS 675  691  691  LYS LYS A . n 
A 1 676  LEU 676  692  692  LEU LEU A . n 
A 1 677  LYS 677  693  693  LYS LYS A . n 
A 1 678  ALA 678  694  694  ALA ALA A . n 
A 1 679  LEU 679  695  695  LEU LEU A . n 
A 1 680  ASN 680  696  696  ASN ASN A . n 
A 1 681  ASP 681  697  697  ASP ASP A . n 
A 1 682  PHE 682  698  698  PHE PHE A . n 
A 1 683  VAL 683  699  699  VAL VAL A . n 
A 1 684  LYS 684  700  700  LYS LYS A . n 
A 1 685  LEU 685  701  701  LEU LEU A . n 
A 1 686  SER 686  702  702  SER SER A . n 
A 1 687  SER 687  703  703  SER SER A . n 
A 1 688  GLN 688  704  704  GLN GLN A . n 
A 1 689  LYS 689  705  705  LYS LYS A . n 
A 1 690  THR 690  706  706  THR THR A . n 
A 1 691  PRO 691  707  707  PRO PRO A . n 
A 1 692  LYS 692  708  708  LYS LYS A . n 
A 1 693  PRO 693  709  709  PRO PRO A . n 
A 1 694  GLN 694  710  710  GLN GLN A . n 
A 1 695  THR 695  711  711  THR THR A . n 
A 1 696  LYS 696  712  712  LYS LYS A . n 
A 1 697  GLU 697  713  713  GLU GLU A . n 
A 1 698  LEU 698  714  714  LEU LEU A . n 
A 1 699  MET 699  715  715  MET MET A . n 
A 1 700  HIS 700  716  716  HIS HIS A . n 
A 1 701  LEU 701  717  717  LEU LEU A . n 
A 1 702  CYS 702  718  718  CYS CYS A . n 
A 1 703  MET 703  719  719  MET MET A . n 
A 1 704  ARG 704  720  720  ARG ARG A . n 
A 1 705  GLN 705  721  721  GLN GLN A . n 
A 1 706  GLU 706  722  722  GLU GLU A . n 
A 1 707  ALA 707  723  723  ALA ALA A . n 
A 1 708  TYR 708  724  724  TYR TYR A . n 
A 1 709  LEU 709  725  725  LEU LEU A . n 
A 1 710  GLU 710  726  726  GLU GLU A . n 
A 1 711  ALA 711  727  727  ALA ALA A . n 
A 1 712  LEU 712  728  728  LEU LEU A . n 
A 1 713  SER 713  729  729  SER SER A . n 
A 1 714  HIS 714  730  730  HIS HIS A . n 
A 1 715  LEU 715  731  731  LEU LEU A . n 
A 1 716  GLN 716  732  732  GLN GLN A . n 
A 1 717  SER 717  733  733  SER SER A . n 
A 1 718  PRO 718  734  734  PRO PRO A . n 
A 1 719  LEU 719  735  735  LEU LEU A . n 
A 1 720  ASP 720  736  736  ASP ASP A . n 
A 1 721  PRO 721  737  737  PRO PRO A . n 
A 1 722  SER 722  738  738  SER SER A . n 
A 1 723  THR 723  739  739  THR THR A . n 
A 1 724  LEU 724  740  740  LEU LEU A . n 
A 1 725  LEU 725  741  741  LEU LEU A . n 
A 1 726  ALA 726  742  742  ALA ALA A . n 
A 1 727  GLU 727  743  743  GLU GLU A . n 
A 1 728  VAL 728  744  744  VAL VAL A . n 
A 1 729  CYS 729  745  745  CYS CYS A . n 
A 1 730  VAL 730  746  746  VAL VAL A . n 
A 1 731  GLU 731  747  747  GLU GLU A . n 
A 1 732  GLN 732  748  748  GLN GLN A . n 
A 1 733  CYS 733  749  749  CYS CYS A . n 
A 1 734  THR 734  750  750  THR THR A . n 
A 1 735  PHE 735  751  751  PHE PHE A . n 
A 1 736  MET 736  752  752  MET MET A . n 
A 1 737  ASP 737  753  753  ASP ASP A . n 
A 1 738  SER 738  754  754  SER SER A . n 
A 1 739  LYS 739  755  755  LYS LYS A . n 
A 1 740  MET 740  756  756  MET MET A . n 
A 1 741  LYS 741  757  757  LYS LYS A . n 
A 1 742  PRO 742  758  758  PRO PRO A . n 
A 1 743  LEU 743  759  759  LEU LEU A . n 
A 1 744  TRP 744  760  760  TRP TRP A . n 
A 1 745  ILE 745  761  761  ILE ILE A . n 
A 1 746  MET 746  762  762  MET MET A . n 
A 1 747  TYR 747  763  763  TYR TYR A . n 
A 1 748  SER 748  764  764  SER SER A . n 
A 1 749  ASN 749  765  765  ASN ASN A . n 
A 1 750  GLU 750  766  766  GLU GLU A . n 
A 1 751  GLU 751  767  767  GLU GLU A . n 
A 1 752  ALA 752  768  768  ALA ALA A . n 
A 1 753  GLY 753  769  ?    ?   ?   A . n 
A 1 754  SER 754  770  ?    ?   ?   A . n 
A 1 755  GLY 755  771  ?    ?   ?   A . n 
A 1 756  GLY 756  772  ?    ?   ?   A . n 
A 1 757  SER 757  773  773  SER SER A . n 
A 1 758  VAL 758  774  774  VAL VAL A . n 
A 1 759  GLY 759  775  775  GLY GLY A . n 
A 1 760  ILE 760  776  776  ILE ILE A . n 
A 1 761  ILE 761  777  777  ILE ILE A . n 
A 1 762  PHE 762  778  778  PHE PHE A . n 
A 1 763  LYS 763  779  779  LYS LYS A . n 
A 1 764  ASN 764  780  780  ASN ASN A . n 
A 1 765  GLY 765  781  781  GLY GLY A . n 
A 1 766  ASP 766  782  782  ASP ASP A . n 
A 1 767  ASP 767  783  783  ASP ASP A . n 
A 1 768  LEU 768  784  784  LEU LEU A . n 
A 1 769  ARG 769  785  785  ARG ARG A . n 
A 1 770  GLN 770  786  786  GLN GLN A . n 
A 1 771  ASP 771  787  787  ASP ASP A . n 
A 1 772  MET 772  788  788  MET MET A . n 
A 1 773  LEU 773  789  789  LEU LEU A . n 
A 1 774  THR 774  790  790  THR THR A . n 
A 1 775  LEU 775  791  791  LEU LEU A . n 
A 1 776  GLN 776  792  792  GLN GLN A . n 
A 1 777  MET 777  793  793  MET MET A . n 
A 1 778  ILE 778  794  794  ILE ILE A . n 
A 1 779  GLN 779  795  795  GLN GLN A . n 
A 1 780  LEU 780  796  796  LEU LEU A . n 
A 1 781  MET 781  797  797  MET MET A . n 
A 1 782  ASP 782  798  798  ASP ASP A . n 
A 1 783  VAL 783  799  799  VAL VAL A . n 
A 1 784  LEU 784  800  800  LEU LEU A . n 
A 1 785  TRP 785  801  801  TRP TRP A . n 
A 1 786  LYS 786  802  802  LYS LYS A . n 
A 1 787  GLN 787  803  803  GLN GLN A . n 
A 1 788  GLU 788  804  804  GLU GLU A . n 
A 1 789  GLY 789  805  805  GLY GLY A . n 
A 1 790  LEU 790  806  806  LEU LEU A . n 
A 1 791  ASP 791  807  807  ASP ASP A . n 
A 1 792  LEU 792  808  808  LEU LEU A . n 
A 1 793  ARG 793  809  809  ARG ARG A . n 
A 1 794  MET 794  810  810  MET MET A . n 
A 1 795  THR 795  811  811  THR THR A . n 
A 1 796  PRO 796  812  812  PRO PRO A . n 
A 1 797  TYR 797  813  813  TYR TYR A . n 
A 1 798  GLY 798  814  814  GLY GLY A . n 
A 1 799  CYS 799  815  815  CYS CYS A . n 
A 1 800  LEU 800  816  816  LEU LEU A . n 
A 1 801  PRO 801  817  817  PRO PRO A . n 
A 1 802  THR 802  818  818  THR THR A . n 
A 1 803  GLY 803  819  819  GLY GLY A . n 
A 1 804  ASP 804  820  820  ASP ASP A . n 
A 1 805  ARG 805  821  821  ARG ARG A . n 
A 1 806  THR 806  822  822  THR THR A . n 
A 1 807  GLY 807  823  823  GLY GLY A . n 
A 1 808  LEU 808  824  824  LEU LEU A . n 
A 1 809  ILE 809  825  825  ILE ILE A . n 
A 1 810  GLU 810  826  826  GLU GLU A . n 
A 1 811  VAL 811  827  827  VAL VAL A . n 
A 1 812  VAL 812  828  828  VAL VAL A . n 
A 1 813  LEU 813  829  829  LEU LEU A . n 
A 1 814  ARG 814  830  830  ARG ARG A . n 
A 1 815  SER 815  831  831  SER SER A . n 
A 1 816  ASP 816  832  832  ASP ASP A . n 
A 1 817  THR 817  833  833  THR THR A . n 
A 1 818  ILE 818  834  834  ILE ILE A . n 
A 1 819  ALA 819  835  835  ALA ALA A . n 
A 1 820  ASN 820  836  836  ASN ASN A . n 
A 1 821  ILE 821  837  837  ILE ILE A . n 
A 1 822  GLN 822  838  838  GLN GLN A . n 
A 1 823  LEU 823  839  839  LEU LEU A . n 
A 1 824  ASN 824  840  840  ASN ASN A . n 
A 1 825  LYS 825  841  ?    ?   ?   A . n 
A 1 826  SER 826  842  ?    ?   ?   A . n 
A 1 827  ASN 827  843  ?    ?   ?   A . n 
A 1 828  MET 828  844  ?    ?   ?   A . n 
A 1 829  ALA 829  845  ?    ?   ?   A . n 
A 1 830  ALA 830  846  ?    ?   ?   A . n 
A 1 831  THR 831  847  ?    ?   ?   A . n 
A 1 832  ALA 832  848  ?    ?   ?   A . n 
A 1 833  ALA 833  849  ?    ?   ?   A . n 
A 1 834  PHE 834  850  850  PHE PHE A . n 
A 1 835  ASN 835  851  851  ASN ASN A . n 
A 1 836  LYS 836  852  852  LYS LYS A . n 
A 1 837  ASP 837  853  853  ASP ASP A . n 
A 1 838  ALA 838  854  854  ALA ALA A . n 
A 1 839  LEU 839  855  855  LEU LEU A . n 
A 1 840  LEU 840  856  856  LEU LEU A . n 
A 1 841  ASN 841  857  857  ASN ASN A . n 
A 1 842  TRP 842  858  858  TRP TRP A . n 
A 1 843  LEU 843  859  859  LEU LEU A . n 
A 1 844  LYS 844  860  860  LYS LYS A . n 
A 1 845  SER 845  861  861  SER SER A . n 
A 1 846  LYS 846  862  862  LYS LYS A . n 
A 1 847  ASN 847  863  863  ASN ASN A . n 
A 1 848  PRO 848  864  864  PRO PRO A . n 
A 1 849  GLY 849  865  865  GLY GLY A . n 
A 1 850  GLU 850  866  866  GLU GLU A . n 
A 1 851  ALA 851  867  867  ALA ALA A . n 
A 1 852  LEU 852  868  868  LEU LEU A . n 
A 1 853  ASP 853  869  869  ASP ASP A . n 
A 1 854  ARG 854  870  870  ARG ARG A . n 
A 1 855  ALA 855  871  871  ALA ALA A . n 
A 1 856  ILE 856  872  872  ILE ILE A . n 
A 1 857  GLU 857  873  873  GLU GLU A . n 
A 1 858  GLU 858  874  874  GLU GLU A . n 
A 1 859  PHE 859  875  875  PHE PHE A . n 
A 1 860  THR 860  876  876  THR THR A . n 
A 1 861  LEU 861  877  877  LEU LEU A . n 
A 1 862  SER 862  878  878  SER SER A . n 
A 1 863  CYS 863  879  879  CYS CYS A . n 
A 1 864  ALA 864  880  880  ALA ALA A . n 
A 1 865  GLY 865  881  881  GLY GLY A . n 
A 1 866  TYR 866  882  882  TYR TYR A . n 
A 1 867  CYS 867  883  883  CYS CYS A . n 
A 1 868  VAL 868  884  884  VAL VAL A . n 
A 1 869  ALA 869  885  885  ALA ALA A . n 
A 1 870  THR 870  886  886  THR THR A . n 
A 1 871  TYR 871  887  887  TYR TYR A . n 
A 1 872  VAL 872  888  888  VAL VAL A . n 
A 1 873  LEU 873  889  889  LEU LEU A . n 
A 1 874  GLY 874  890  890  GLY GLY A . n 
A 1 875  ILE 875  891  891  ILE ILE A . n 
A 1 876  GLY 876  892  892  GLY GLY A . n 
A 1 877  ASP 877  893  893  ASP ASP A . n 
A 1 878  ARG 878  894  894  ARG ARG A . n 
A 1 879  HIS 879  895  895  HIS HIS A . n 
A 1 880  SER 880  896  896  SER SER A . n 
A 1 881  ASP 881  897  897  ASP ASP A . n 
A 1 882  ASN 882  898  898  ASN ASN A . n 
A 1 883  ILE 883  899  899  ILE ILE A . n 
A 1 884  MET 884  900  900  MET MET A . n 
A 1 885  ILE 885  901  901  ILE ILE A . n 
A 1 886  ARG 886  902  902  ARG ARG A . n 
A 1 887  GLU 887  903  903  GLU GLU A . n 
A 1 888  SER 888  904  904  SER SER A . n 
A 1 889  GLY 889  905  905  GLY GLY A . n 
A 1 890  GLN 890  906  906  GLN GLN A . n 
A 1 891  LEU 891  907  907  LEU LEU A . n 
A 1 892  PHE 892  908  908  PHE PHE A . n 
A 1 893  HIS 893  909  909  HIS HIS A . n 
A 1 894  ILE 894  910  910  ILE ILE A . n 
A 1 895  ASP 895  911  911  ASP ASP A . n 
A 1 896  PHE 896  912  912  PHE PHE A . n 
A 1 897  GLY 897  913  913  GLY GLY A . n 
A 1 898  HIS 898  914  914  HIS HIS A . n 
A 1 899  PHE 899  915  915  PHE PHE A . n 
A 1 900  LEU 900  916  916  LEU LEU A . n 
A 1 901  GLY 901  917  917  GLY GLY A . n 
A 1 902  ASN 902  918  918  ASN ASN A . n 
A 1 903  PHE 903  919  919  PHE PHE A . n 
A 1 904  LYS 904  920  ?    ?   ?   A . n 
A 1 905  THR 905  921  ?    ?   ?   A . n 
A 1 906  LYS 906  922  ?    ?   ?   A . n 
A 1 907  PHE 907  923  ?    ?   ?   A . n 
A 1 908  GLY 908  924  ?    ?   ?   A . n 
A 1 909  ILE 909  925  925  ILE ILE A . n 
A 1 910  ASN 910  926  926  ASN ASN A . n 
A 1 911  ARG 911  927  927  ARG ARG A . n 
A 1 912  GLU 912  928  928  GLU GLU A . n 
A 1 913  ARG 913  929  929  ARG ARG A . n 
A 1 914  VAL 914  930  930  VAL VAL A . n 
A 1 915  PRO 915  931  931  PRO PRO A . n 
A 1 916  PHE 916  932  932  PHE PHE A . n 
A 1 917  ILE 917  933  933  ILE ILE A . n 
A 1 918  LEU 918  934  934  LEU LEU A . n 
A 1 919  THR 919  935  935  THR THR A . n 
A 1 920  TYR 920  936  936  TYR TYR A . n 
A 1 921  ASP 921  937  937  ASP ASP A . n 
A 1 922  PHE 922  938  938  PHE PHE A . n 
A 1 923  VAL 923  939  939  VAL VAL A . n 
A 1 924  HIS 924  940  940  HIS HIS A . n 
A 1 925  VAL 925  941  941  VAL VAL A . n 
A 1 926  ILE 926  942  942  ILE ILE A . n 
A 1 927  GLN 927  943  943  GLN GLN A . n 
A 1 928  GLN 928  944  944  GLN GLN A . n 
A 1 929  GLY 929  945  945  GLY GLY A . n 
A 1 930  LYS 930  946  946  LYS LYS A . n 
A 1 931  THR 931  947  947  THR THR A . n 
A 1 932  ASN 932  948  948  ASN ASN A . n 
A 1 933  ASN 933  949  949  ASN ASN A . n 
A 1 934  SER 934  950  950  SER SER A . n 
A 1 935  GLU 935  951  951  GLU GLU A . n 
A 1 936  LYS 936  952  952  LYS LYS A . n 
A 1 937  PHE 937  953  953  PHE PHE A . n 
A 1 938  GLU 938  954  954  GLU GLU A . n 
A 1 939  ARG 939  955  955  ARG ARG A . n 
A 1 940  PHE 940  956  956  PHE PHE A . n 
A 1 941  ARG 941  957  957  ARG ARG A . n 
A 1 942  GLY 942  958  958  GLY GLY A . n 
A 1 943  TYR 943  959  959  TYR TYR A . n 
A 1 944  CYS 944  960  960  CYS CYS A . n 
A 1 945  GLU 945  961  961  GLU GLU A . n 
A 1 946  ARG 946  962  962  ARG ARG A . n 
A 1 947  ALA 947  963  963  ALA ALA A . n 
A 1 948  TYR 948  964  964  TYR TYR A . n 
A 1 949  THR 949  965  965  THR THR A . n 
A 1 950  ILE 950  966  966  ILE ILE A . n 
A 1 951  LEU 951  967  967  LEU LEU A . n 
A 1 952  ARG 952  968  968  ARG ARG A . n 
A 1 953  ARG 953  969  969  ARG ARG A . n 
A 1 954  HIS 954  970  970  HIS HIS A . n 
A 1 955  GLY 955  971  971  GLY GLY A . n 
A 1 956  LEU 956  972  972  LEU LEU A . n 
A 1 957  LEU 957  973  973  LEU LEU A . n 
A 1 958  PHE 958  974  974  PHE PHE A . n 
A 1 959  LEU 959  975  975  LEU LEU A . n 
A 1 960  HIS 960  976  976  HIS HIS A . n 
A 1 961  LEU 961  977  977  LEU LEU A . n 
A 1 962  PHE 962  978  978  PHE PHE A . n 
A 1 963  ALA 963  979  979  ALA ALA A . n 
A 1 964  LEU 964  980  980  LEU LEU A . n 
A 1 965  MET 965  981  981  MET MET A . n 
A 1 966  ARG 966  982  982  ARG ARG A . n 
A 1 967  ALA 967  983  983  ALA ALA A . n 
A 1 968  ALA 968  984  984  ALA ALA A . n 
A 1 969  GLY 969  985  985  GLY GLY A . n 
A 1 970  LEU 970  986  986  LEU LEU A . n 
A 1 971  PRO 971  987  987  PRO PRO A . n 
A 1 972  GLU 972  988  988  GLU GLU A . n 
A 1 973  LEU 973  989  989  LEU LEU A . n 
A 1 974  SER 974  990  990  SER SER A . n 
A 1 975  CYS 975  991  991  CYS CYS A . n 
A 1 976  SER 976  992  992  SER SER A . n 
A 1 977  LYS 977  993  993  LYS LYS A . n 
A 1 978  ASP 978  994  994  ASP ASP A . n 
A 1 979  ILE 979  995  995  ILE ILE A . n 
A 1 980  GLN 980  996  996  GLN GLN A . n 
A 1 981  TYR 981  997  997  TYR TYR A . n 
A 1 982  LEU 982  998  998  LEU LEU A . n 
A 1 983  LYS 983  999  999  LYS LYS A . n 
A 1 984  ASP 984  1000 1000 ASP ASP A . n 
A 1 985  SER 985  1001 1001 SER SER A . n 
A 1 986  LEU 986  1002 1002 LEU LEU A . n 
A 1 987  ALA 987  1003 1003 ALA ALA A . n 
A 1 988  LEU 988  1004 1004 LEU LEU A . n 
A 1 989  GLY 989  1005 1005 GLY GLY A . n 
A 1 990  LYS 990  1006 1006 LYS LYS A . n 
A 1 991  THR 991  1007 1007 THR THR A . n 
A 1 992  GLU 992  1008 1008 GLU GLU A . n 
A 1 993  GLU 993  1009 1009 GLU GLU A . n 
A 1 994  GLU 994  1010 1010 GLU GLU A . n 
A 1 995  ALA 995  1011 1011 ALA ALA A . n 
A 1 996  LEU 996  1012 1012 LEU LEU A . n 
A 1 997  LYS 997  1013 1013 LYS LYS A . n 
A 1 998  HIS 998  1014 1014 HIS HIS A . n 
A 1 999  PHE 999  1015 1015 PHE PHE A . n 
A 1 1000 ARG 1000 1016 1016 ARG ARG A . n 
A 1 1001 VAL 1001 1017 1017 VAL VAL A . n 
A 1 1002 LYS 1002 1018 1018 LYS LYS A . n 
A 1 1003 PHE 1003 1019 1019 PHE PHE A . n 
A 1 1004 ASN 1004 1020 1020 ASN ASN A . n 
A 1 1005 GLU 1005 1021 1021 GLU GLU A . n 
A 1 1006 ALA 1006 1022 1022 ALA ALA A . n 
A 1 1007 LEU 1007 1023 1023 LEU LEU A . n 
A 1 1008 ARG 1008 1024 1024 ARG ARG A . n 
A 1 1009 GLU 1009 1025 1025 GLU GLU A . n 
A 1 1010 SER 1010 1026 1026 SER SER A . n 
A 1 1011 TRP 1011 1027 1027 TRP TRP A . n 
A 1 1012 LYS 1012 1028 1028 LYS LYS A . n 
A 1 1013 THR 1013 1029 1029 THR THR A . n 
B 2 1    TYR 1    431  431  TYR TYR B . n 
B 2 2    GLN 2    432  432  GLN GLN B . n 
B 2 3    GLN 3    433  433  GLN GLN B . n 
B 2 4    ASP 4    434  434  ASP ASP B . n 
B 2 5    GLN 5    435  435  GLN GLN B . n 
B 2 6    VAL 6    436  436  VAL VAL B . n 
B 2 7    VAL 7    437  437  VAL VAL B . n 
B 2 8    LYS 8    438  438  LYS LYS B . n 
B 2 9    GLU 9    439  439  GLU GLU B . n 
B 2 10   ASP 10   440  440  ASP ASP B . n 
B 2 11   ASN 11   441  441  ASN ASN B . n 
B 2 12   ILE 12   442  442  ILE ILE B . n 
B 2 13   GLU 13   443  443  GLU GLU B . n 
B 2 14   ALA 14   444  444  ALA ALA B . n 
B 2 15   VAL 15   445  445  VAL VAL B . n 
B 2 16   GLY 16   446  446  GLY GLY B . n 
B 2 17   LYS 17   447  447  LYS LYS B . n 
B 2 18   LYS 18   448  448  LYS LYS B . n 
B 2 19   LEU 19   449  449  LEU LEU B . n 
B 2 20   HIS 20   450  450  HIS HIS B . n 
B 2 21   GLU 21   451  451  GLU GLU B . n 
B 2 22   TYR 22   452  452  TYR TYR B . n 
B 2 23   ASN 23   453  453  ASN ASN B . n 
B 2 24   THR 24   454  454  THR THR B . n 
B 2 25   GLN 25   455  455  GLN GLN B . n 
B 2 26   PHE 26   456  456  PHE PHE B . n 
B 2 27   GLN 27   457  457  GLN GLN B . n 
B 2 28   GLU 28   458  458  GLU GLU B . n 
B 2 29   LYS 29   459  459  LYS LYS B . n 
B 2 30   SER 30   460  460  SER SER B . n 
B 2 31   ARG 31   461  461  ARG ARG B . n 
B 2 32   GLU 32   462  462  GLU GLU B . n 
B 2 33   TYR 33   463  463  TYR TYR B . n 
B 2 34   ASP 34   464  464  ASP ASP B . n 
B 2 35   ARG 35   465  465  ARG ARG B . n 
B 2 36   LEU 36   466  466  LEU LEU B . n 
B 2 37   TYR 37   467  467  TYR TYR B . n 
B 2 38   GLU 38   468  468  GLU GLU B . n 
B 2 39   ASP 39   469  469  ASP ASP B . n 
B 2 40   TYR 40   470  470  TYR TYR B . n 
B 2 41   THR 41   471  471  THR THR B . n 
B 2 42   ARG 42   472  472  ARG ARG B . n 
B 2 43   THR 43   473  473  THR THR B . n 
B 2 44   SER 44   474  474  SER SER B . n 
B 2 45   GLN 45   475  475  GLN GLN B . n 
B 2 46   GLU 46   476  476  GLU GLU B . n 
B 2 47   ILE 47   477  477  ILE ILE B . n 
B 2 48   GLN 48   478  478  GLN GLN B . n 
B 2 49   MET 49   479  479  MET MET B . n 
B 2 50   LYS 50   480  480  LYS LYS B . n 
B 2 51   ARG 51   481  481  ARG ARG B . n 
B 2 52   THR 52   482  482  THR THR B . n 
B 2 53   ALA 53   483  483  ALA ALA B . n 
B 2 54   ILE 54   484  484  ILE ILE B . n 
B 2 55   GLU 55   485  485  GLU GLU B . n 
B 2 56   ALA 56   486  486  ALA ALA B . n 
B 2 57   PHE 57   487  487  PHE PHE B . n 
B 2 58   ASN 58   488  488  ASN ASN B . n 
B 2 59   GLU 59   489  489  GLU GLU B . n 
B 2 60   THR 60   490  490  THR THR B . n 
B 2 61   ILE 61   491  491  ILE ILE B . n 
B 2 62   LYS 62   492  492  LYS LYS B . n 
B 2 63   ILE 63   493  493  ILE ILE B . n 
B 2 64   PHE 64   494  494  PHE PHE B . n 
B 2 65   GLU 65   495  495  GLU GLU B . n 
B 2 66   GLU 66   496  496  GLU GLU B . n 
B 2 67   GLN 67   497  497  GLN GLN B . n 
B 2 68   CYS 68   498  498  CYS CYS B . n 
B 2 69   GLN 69   499  499  GLN GLN B . n 
B 2 70   THR 70   500  500  THR THR B . n 
B 2 71   GLN 71   501  501  GLN GLN B . n 
B 2 72   GLU 72   502  502  GLU GLU B . n 
B 2 73   ARG 73   503  503  ARG ARG B . n 
B 2 74   TYR 74   504  504  TYR TYR B . n 
B 2 75   SER 75   505  505  SER SER B . n 
B 2 76   LYS 76   506  506  LYS LYS B . n 
B 2 77   GLU 77   507  507  GLU GLU B . n 
B 2 78   TYR 78   508  508  TYR TYR B . n 
B 2 79   ILE 79   509  509  ILE ILE B . n 
B 2 80   GLU 80   510  510  GLU GLU B . n 
B 2 81   LYS 81   511  511  LYS LYS B . n 
B 2 82   PHE 82   512  512  PHE PHE B . n 
B 2 83   LYS 83   513  513  LYS LYS B . n 
B 2 84   ARG 84   514  514  ARG ARG B . n 
B 2 85   GLU 85   515  515  GLU GLU B . n 
B 2 86   GLY 86   516  516  GLY GLY B . n 
B 2 87   ASN 87   517  517  ASN ASN B . n 
B 2 88   GLU 88   518  518  GLU GLU B . n 
B 2 89   THR 89   519  519  THR THR B . n 
B 2 90   GLU 90   520  520  GLU GLU B . n 
B 2 91   ILE 91   521  521  ILE ILE B . n 
B 2 92   GLN 92   522  522  GLN GLN B . n 
B 2 93   ARG 93   523  523  ARG ARG B . n 
B 2 94   ILE 94   524  524  ILE ILE B . n 
B 2 95   MET 95   525  525  MET MET B . n 
B 2 96   HIS 96   526  526  HIS HIS B . n 
B 2 97   ASN 97   527  527  ASN ASN B . n 
B 2 98   TYR 98   528  528  TYR TYR B . n 
B 2 99   GLU 99   529  529  GLU GLU B . n 
B 2 100  LYS 100  530  530  LYS LYS B . n 
B 2 101  LEU 101  531  531  LEU LEU B . n 
B 2 102  LYS 102  532  532  LYS LYS B . n 
B 2 103  SER 103  533  533  SER SER B . n 
B 2 104  ARG 104  534  534  ARG ARG B . n 
B 2 105  ILE 105  535  535  ILE ILE B . n 
B 2 106  SER 106  536  536  SER SER B . n 
B 2 107  GLU 107  537  537  GLU GLU B . n 
B 2 108  ILE 108  538  538  ILE ILE B . n 
B 2 109  VAL 109  539  539  VAL VAL B . n 
B 2 110  ASP 110  540  540  ASP ASP B . n 
B 2 111  SER 111  541  541  SER SER B . n 
B 2 112  ARG 112  542  542  ARG ARG B . n 
B 2 113  ARG 113  543  543  ARG ARG B . n 
B 2 114  ARG 114  544  544  ARG ARG B . n 
B 2 115  LEU 115  545  545  LEU LEU B . n 
B 2 116  GLU 116  546  546  GLU GLU B . n 
B 2 117  GLU 117  547  547  GLU GLU B . n 
B 2 118  ASP 118  548  548  ASP ASP B . n 
B 2 119  LEU 119  549  549  LEU LEU B . n 
B 2 120  LYS 120  550  550  LYS LYS B . n 
B 2 121  LYS 121  551  551  LYS LYS B . n 
B 2 122  GLN 122  552  552  GLN GLN B . n 
B 2 123  ALA 123  553  553  ALA ALA B . n 
B 2 124  ALA 124  554  554  ALA ALA B . n 
B 2 125  GLU 125  555  555  GLU GLU B . n 
B 2 126  TYR 126  556  556  TYR TYR B . n 
B 2 127  ARG 127  557  557  ARG ARG B . n 
B 2 128  GLU 128  558  558  GLU GLU B . n 
B 2 129  ILE 129  559  559  ILE ILE B . n 
B 2 130  ASP 130  560  560  ASP ASP B . n 
B 2 131  LYS 131  561  561  LYS LYS B . n 
B 2 132  ARG 132  562  562  ARG ARG B . n 
B 2 133  MET 133  563  563  MET MET B . n 
B 2 134  ASN 134  564  564  ASN ASN B . n 
B 2 135  SER 135  565  565  SER SER B . n 
B 2 136  ILE 136  566  566  ILE ILE B . n 
B 2 137  LYS 137  567  567  LYS LYS B . n 
B 2 138  PRO 138  568  568  PRO PRO B . n 
B 2 139  ASP 139  569  569  ASP ASP B . n 
B 2 140  LEU 140  570  570  LEU LEU B . n 
B 2 141  ILE 141  571  571  ILE ILE B . n 
B 2 142  GLN 142  572  572  GLN GLN B . n 
B 2 143  LEU 143  573  573  LEU LEU B . n 
B 2 144  ARG 144  574  574  ARG ARG B . n 
B 2 145  LYS 145  575  575  LYS LYS B . n 
B 2 146  THR 146  576  576  THR THR B . n 
B 2 147  ARG 147  577  577  ARG ARG B . n 
B 2 148  ASP 148  578  578  ASP ASP B . n 
B 2 149  GLN 149  579  579  GLN GLN B . n 
B 2 150  TYR 150  580  580  TYR TYR B . n 
B 2 151  LEU 151  581  581  LEU LEU B . n 
B 2 152  MET 152  582  582  MET MET B . n 
B 2 153  TRP 153  583  583  TRP TRP B . n 
B 2 154  LEU 154  584  584  LEU LEU B . n 
B 2 155  THR 155  585  585  THR THR B . n 
B 2 156  GLN 156  586  586  GLN GLN B . n 
B 2 157  LYS 157  587  587  LYS LYS B . n 
B 2 158  GLY 158  588  588  GLY GLY B . n 
B 2 159  VAL 159  589  589  VAL VAL B . n 
B 2 160  ARG 160  590  590  ARG ARG B . n 
B 2 161  GLN 161  591  591  GLN GLN B . n 
B 2 162  LYS 162  592  592  LYS LYS B . n 
B 2 163  LYS 163  593  593  LYS LYS B . n 
B 2 164  LEU 164  594  594  LEU LEU B . n 
B 2 165  ASN 165  595  595  ASN ASN B . n 
B 2 166  GLU 166  596  596  GLU GLU B . n 
B 2 167  TRP 167  597  597  TRP TRP B . n 
B 2 168  LEU 168  598  598  LEU LEU B . n 
B 2 169  GLY 169  599  599  GLY GLY B . n 
B 2 170  ASN 170  600  600  ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 9EM 1  4001 4001 9EM LG1 A . 
D 4 HOH 1  4101 21   HOH HOH A . 
D 4 HOH 2  4102 24   HOH HOH A . 
D 4 HOH 3  4103 23   HOH HOH A . 
D 4 HOH 4  4104 2    HOH HOH A . 
D 4 HOH 5  4105 15   HOH HOH A . 
D 4 HOH 6  4106 13   HOH HOH A . 
D 4 HOH 7  4107 12   HOH HOH A . 
D 4 HOH 8  4108 18   HOH HOH A . 
D 4 HOH 9  4109 19   HOH HOH A . 
D 4 HOH 10 4110 22   HOH HOH A . 
D 4 HOH 11 4111 5    HOH HOH A . 
D 4 HOH 12 4112 6    HOH HOH A . 
D 4 HOH 13 4113 16   HOH HOH A . 
D 4 HOH 14 4114 11   HOH HOH A . 
D 4 HOH 15 4115 3    HOH HOH A . 
D 4 HOH 16 4116 20   HOH HOH A . 
D 4 HOH 17 4117 4    HOH HOH A . 
D 4 HOH 18 4118 7    HOH HOH A . 
D 4 HOH 19 4119 17   HOH HOH A . 
D 4 HOH 20 4120 9    HOH HOH A . 
D 4 HOH 21 4121 8    HOH HOH A . 
D 4 HOH 22 4122 10   HOH HOH A . 
D 4 HOH 23 4123 1    HOH HOH A . 
E 4 HOH 1  701  14   HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D     
2 1 B,E       
3 1 A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 4100  ? 
3 MORE         -20   ? 
3 'SSA (A^2)'  49380 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-06-07 
2 'Structure model' 1 1 2017-07-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.country'         
2 2 'Structure model' '_citation.journal_id_ASTM' 
3 2 'Structure model' '_citation.journal_id_CSD'  
4 2 'Structure model' '_citation.journal_volume'  
5 2 'Structure model' '_citation.page_first'      
6 2 'Structure model' '_citation.page_last'       
7 2 'Structure model' '_citation.title'           
8 2 'Structure model' '_citation_author.name'     
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .      1 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .      2 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.7 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 93  ? ? 46.87   71.32   
2  1 ARG A 108 ? ? -74.69  35.38   
3  1 VAL A 109 ? ? -122.92 -55.82  
4  1 TRP A 159 ? ? -22.24  -43.25  
5  1 THR A 204 ? ? -64.26  86.56   
6  1 LYS A 210 ? ? -92.52  33.28   
7  1 MET A 217 ? ? -90.68  -94.93  
8  1 TYR A 239 ? ? 66.09   171.09  
9  1 HIS A 247 ? ? -105.65 50.21   
10 1 SER A 253 ? ? -65.83  38.40   
11 1 LEU A 270 ? ? -33.45  143.49  
12 1 TRP A 317 ? ? 57.09   -79.39  
13 1 SER A 318 ? ? 26.33   -67.01  
14 1 LEU A 319 ? ? -36.30  85.24   
15 1 ILE A 328 ? ? -79.71  -78.85  
16 1 LYS A 332 ? ? 35.99   42.22   
17 1 GLU A 368 ? ? -113.98 78.50   
18 1 LYS A 372 ? ? 34.66   47.82   
19 1 ILE A 381 ? ? -8.80   -47.12  
20 1 LYS A 400 ? ? -28.59  129.27  
21 1 ILE A 418 ? ? -82.09  -70.82  
22 1 ASP A 430 ? ? 75.53   -2.51   
23 1 GLU A 451 ? ? 31.87   122.97  
24 1 ASP A 466 ? ? -55.44  -82.60  
25 1 LEU A 534 ? ? -87.99  30.49   
26 1 PHE A 587 ? ? -118.54 67.42   
27 1 GLN A 704 ? ? -91.10  32.52   
28 1 LYS A 705 ? ? -147.26 -100.91 
29 1 HIS A 730 ? ? 40.26   88.08   
30 1 ALA A 742 ? ? -88.40  -93.24  
31 1 THR A 750 ? ? -143.77 -159.21 
32 1 GLU A 804 ? ? -95.90  39.73   
33 1 ARG A 809 ? ? 37.09   55.55   
34 1 ARG A 821 ? ? 49.28   25.87   
35 1 ASP A 911 ? ? 40.84   71.76   
36 1 ARG A 929 ? ? -58.21  105.88  
37 1 ASN A 949 ? ? -160.11 74.29   
38 1 GLN B 432 ? ? 59.50   16.22   
39 1 ASP B 434 ? ? -101.23 -164.74 
40 1 VAL B 436 ? ? -35.47  132.41  
41 1 LYS B 438 ? ? -51.05  101.04  
42 1 ARG B 503 ? ? -100.16 -66.59  
43 1 LYS B 506 ? ? -29.35  -58.92  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ASN 17   ? CG  ? A ASN 1    CG  
2   1 Y 1 A ASN 17   ? OD1 ? A ASN 1    OD1 
3   1 Y 1 A ASN 17   ? ND2 ? A ASN 1    ND2 
4   1 Y 1 A GLN 18   ? CG  ? A GLN 2    CG  
5   1 Y 1 A GLN 18   ? CD  ? A GLN 2    CD  
6   1 Y 1 A GLN 18   ? OE1 ? A GLN 2    OE1 
7   1 Y 1 A GLN 18   ? NE2 ? A GLN 2    NE2 
8   1 Y 1 A ARG 38   ? CG  ? A ARG 22   CG  
9   1 Y 1 A ARG 38   ? CD  ? A ARG 22   CD  
10  1 Y 1 A ARG 38   ? NE  ? A ARG 22   NE  
11  1 Y 1 A ARG 38   ? CZ  ? A ARG 22   CZ  
12  1 Y 1 A ARG 38   ? NH1 ? A ARG 22   NH1 
13  1 Y 1 A ARG 38   ? NH2 ? A ARG 22   NH2 
14  1 Y 1 A LEU 42   ? CD1 ? A LEU 26   CD1 
15  1 Y 1 A LEU 42   ? CD2 ? A LEU 26   CD2 
16  1 Y 1 A ILE 45   ? CD1 ? A ILE 29   CD1 
17  1 Y 1 A GLN 47   ? CD  ? A GLN 31   CD  
18  1 Y 1 A GLN 47   ? OE1 ? A GLN 31   OE1 
19  1 Y 1 A GLN 47   ? NE2 ? A GLN 31   NE2 
20  1 Y 1 A LEU 48   ? CD1 ? A LEU 32   CD1 
21  1 Y 1 A LEU 48   ? CD2 ? A LEU 32   CD2 
22  1 Y 1 A HIS 60   ? CG  ? A HIS 44   CG  
23  1 Y 1 A HIS 60   ? ND1 ? A HIS 44   ND1 
24  1 Y 1 A HIS 60   ? CD2 ? A HIS 44   CD2 
25  1 Y 1 A HIS 60   ? CE1 ? A HIS 44   CE1 
26  1 Y 1 A HIS 60   ? NE2 ? A HIS 44   NE2 
27  1 Y 1 A MET 61   ? SD  ? A MET 45   SD  
28  1 Y 1 A MET 61   ? CE  ? A MET 45   CE  
29  1 Y 1 A ILE 73   ? CD1 ? A ILE 57   CD1 
30  1 Y 1 A GLU 83   ? CD  ? A GLU 67   CD  
31  1 Y 1 A GLU 83   ? OE1 ? A GLU 67   OE1 
32  1 Y 1 A GLU 83   ? OE2 ? A GLU 67   OE2 
33  1 Y 1 A ARG 87   ? CZ  ? A ARG 71   CZ  
34  1 Y 1 A ARG 87   ? NH1 ? A ARG 71   NH1 
35  1 Y 1 A ARG 87   ? NH2 ? A ARG 71   NH2 
36  1 Y 1 A LEU 89   ? CD1 ? A LEU 73   CD1 
37  1 Y 1 A LEU 89   ? CD2 ? A LEU 73   CD2 
38  1 Y 1 A ARG 100  ? CD  ? A ARG 84   CD  
39  1 Y 1 A ARG 100  ? NE  ? A ARG 84   NE  
40  1 Y 1 A ARG 100  ? CZ  ? A ARG 84   CZ  
41  1 Y 1 A ARG 100  ? NH1 ? A ARG 84   NH1 
42  1 Y 1 A ARG 100  ? NH2 ? A ARG 84   NH2 
43  1 Y 1 A GLU 105  ? CG  ? A GLU 89   CG  
44  1 Y 1 A GLU 105  ? CD  ? A GLU 89   CD  
45  1 Y 1 A GLU 105  ? OE1 ? A GLU 89   OE1 
46  1 Y 1 A GLU 105  ? OE2 ? A GLU 89   OE2 
47  1 Y 1 A LYS 110  ? CD  ? A LYS 94   CD  
48  1 Y 1 A LYS 110  ? CE  ? A LYS 94   CE  
49  1 Y 1 A LYS 110  ? NZ  ? A LYS 94   NZ  
50  1 Y 1 A LYS 111  ? CG  ? A LYS 95   CG  
51  1 Y 1 A LYS 111  ? CD  ? A LYS 95   CD  
52  1 Y 1 A LYS 111  ? CE  ? A LYS 95   CE  
53  1 Y 1 A LYS 111  ? NZ  ? A LYS 95   NZ  
54  1 Y 1 A LEU 112  ? CD1 ? A LEU 96   CD1 
55  1 Y 1 A LEU 112  ? CD2 ? A LEU 96   CD2 
56  1 Y 1 A LEU 119  ? CG  ? A LEU 103  CG  
57  1 Y 1 A LEU 119  ? CD1 ? A LEU 103  CD1 
58  1 Y 1 A LEU 119  ? CD2 ? A LEU 103  CD2 
59  1 Y 1 A PHE 146  ? CG  ? A PHE 130  CG  
60  1 Y 1 A PHE 146  ? CD1 ? A PHE 130  CD1 
61  1 Y 1 A PHE 146  ? CD2 ? A PHE 130  CD2 
62  1 Y 1 A PHE 146  ? CE1 ? A PHE 130  CE1 
63  1 Y 1 A PHE 146  ? CE2 ? A PHE 130  CE2 
64  1 Y 1 A PHE 146  ? CZ  ? A PHE 130  CZ  
65  1 Y 1 A GLN 156  ? CD  ? A GLN 140  CD  
66  1 Y 1 A GLN 156  ? OE1 ? A GLN 140  OE1 
67  1 Y 1 A GLN 156  ? NE2 ? A GLN 140  NE2 
68  1 Y 1 A LEU 157  ? CD1 ? A LEU 141  CD1 
69  1 Y 1 A LEU 157  ? CD2 ? A LEU 141  CD2 
70  1 Y 1 A LEU 163  ? CD1 ? A LEU 147  CD1 
71  1 Y 1 A LEU 163  ? CD2 ? A LEU 147  CD2 
72  1 Y 1 A LEU 185  ? CG  ? A LEU 169  CG  
73  1 Y 1 A LEU 185  ? CD1 ? A LEU 169  CD1 
74  1 Y 1 A LEU 185  ? CD2 ? A LEU 169  CD2 
75  1 Y 1 A ARG 188  ? CD  ? A ARG 172  CD  
76  1 Y 1 A ARG 188  ? NE  ? A ARG 172  NE  
77  1 Y 1 A ARG 188  ? CZ  ? A ARG 172  CZ  
78  1 Y 1 A ARG 188  ? NH1 ? A ARG 172  NH1 
79  1 Y 1 A ARG 188  ? NH2 ? A ARG 172  NH2 
80  1 Y 1 A LEU 190  ? CG  ? A LEU 174  CG  
81  1 Y 1 A LEU 190  ? CD1 ? A LEU 174  CD1 
82  1 Y 1 A LEU 190  ? CD2 ? A LEU 174  CD2 
83  1 Y 1 A LEU 191  ? CG  ? A LEU 175  CG  
84  1 Y 1 A LEU 191  ? CD1 ? A LEU 175  CD1 
85  1 Y 1 A LEU 191  ? CD2 ? A LEU 175  CD2 
86  1 Y 1 A GLU 197  ? CD  ? A GLU 181  CD  
87  1 Y 1 A GLU 197  ? OE1 ? A GLU 181  OE1 
88  1 Y 1 A GLU 197  ? OE2 ? A GLU 181  OE2 
89  1 Y 1 A GLU 200  ? CD  ? A GLU 184  CD  
90  1 Y 1 A GLU 200  ? OE1 ? A GLU 184  OE1 
91  1 Y 1 A GLU 200  ? OE2 ? A GLU 184  OE2 
92  1 Y 1 A GLU 201  ? CG  ? A GLU 185  CG  
93  1 Y 1 A GLU 201  ? CD  ? A GLU 185  CD  
94  1 Y 1 A GLU 201  ? OE1 ? A GLU 185  OE1 
95  1 Y 1 A GLU 201  ? OE2 ? A GLU 185  OE2 
96  1 Y 1 A PHE 205  ? CG  ? A PHE 189  CG  
97  1 Y 1 A PHE 205  ? CD1 ? A PHE 189  CD1 
98  1 Y 1 A PHE 205  ? CD2 ? A PHE 189  CD2 
99  1 Y 1 A PHE 205  ? CE1 ? A PHE 189  CE1 
100 1 Y 1 A PHE 205  ? CE2 ? A PHE 189  CE2 
101 1 Y 1 A PHE 205  ? CZ  ? A PHE 189  CZ  
102 1 Y 1 A GLN 206  ? CG  ? A GLN 190  CG  
103 1 Y 1 A GLN 206  ? CD  ? A GLN 190  CD  
104 1 Y 1 A GLN 206  ? OE1 ? A GLN 190  OE1 
105 1 Y 1 A GLN 206  ? NE2 ? A GLN 190  NE2 
106 1 Y 1 A VAL 207  ? CG1 ? A VAL 191  CG1 
107 1 Y 1 A VAL 207  ? CG2 ? A VAL 191  CG2 
108 1 Y 1 A SER 208  ? OG  ? A SER 192  OG  
109 1 Y 1 A LYS 210  ? CD  ? A LYS 194  CD  
110 1 Y 1 A LYS 210  ? CE  ? A LYS 194  CE  
111 1 Y 1 A LYS 210  ? NZ  ? A LYS 194  NZ  
112 1 Y 1 A VAL 212  ? CG1 ? A VAL 196  CG1 
113 1 Y 1 A VAL 212  ? CG2 ? A VAL 196  CG2 
114 1 Y 1 A LEU 214  ? CG  ? A LEU 198  CG  
115 1 Y 1 A LEU 214  ? CD1 ? A LEU 198  CD1 
116 1 Y 1 A LEU 214  ? CD2 ? A LEU 198  CD2 
117 1 Y 1 A LEU 216  ? CG  ? A LEU 200  CG  
118 1 Y 1 A LEU 216  ? CD1 ? A LEU 200  CD1 
119 1 Y 1 A LEU 216  ? CD2 ? A LEU 200  CD2 
120 1 Y 1 A LEU 221  ? CG  ? A LEU 205  CG  
121 1 Y 1 A LEU 221  ? CD1 ? A LEU 205  CD1 
122 1 Y 1 A LEU 221  ? CD2 ? A LEU 205  CD2 
123 1 Y 1 A LYS 223  ? CG  ? A LYS 207  CG  
124 1 Y 1 A LYS 223  ? CD  ? A LYS 207  CD  
125 1 Y 1 A LYS 223  ? CE  ? A LYS 207  CE  
126 1 Y 1 A LYS 223  ? NZ  ? A LYS 207  NZ  
127 1 Y 1 A LYS 224  ? CG  ? A LYS 208  CG  
128 1 Y 1 A LYS 224  ? CD  ? A LYS 208  CD  
129 1 Y 1 A LYS 224  ? CE  ? A LYS 208  CE  
130 1 Y 1 A LYS 224  ? NZ  ? A LYS 208  NZ  
131 1 Y 1 A THR 226  ? OG1 ? A THR 210  OG1 
132 1 Y 1 A THR 226  ? CG2 ? A THR 210  CG2 
133 1 Y 1 A GLU 237  ? CD  ? A GLU 221  CD  
134 1 Y 1 A GLU 237  ? OE1 ? A GLU 221  OE1 
135 1 Y 1 A GLU 237  ? OE2 ? A GLU 221  OE2 
136 1 Y 1 A TYR 239  ? CG  ? A TYR 223  CG  
137 1 Y 1 A TYR 239  ? CD1 ? A TYR 223  CD1 
138 1 Y 1 A TYR 239  ? CD2 ? A TYR 223  CD2 
139 1 Y 1 A TYR 239  ? CE1 ? A TYR 223  CE1 
140 1 Y 1 A TYR 239  ? CE2 ? A TYR 223  CE2 
141 1 Y 1 A TYR 239  ? CZ  ? A TYR 223  CZ  
142 1 Y 1 A TYR 239  ? OH  ? A TYR 223  OH  
143 1 Y 1 A LEU 241  ? CG  ? A LEU 225  CG  
144 1 Y 1 A LEU 241  ? CD1 ? A LEU 225  CD1 
145 1 Y 1 A LEU 241  ? CD2 ? A LEU 225  CD2 
146 1 Y 1 A LEU 250  ? CD1 ? A LEU 234  CD1 
147 1 Y 1 A LEU 250  ? CD2 ? A LEU 234  CD2 
148 1 Y 1 A LEU 256  ? CD1 ? A LEU 240  CD1 
149 1 Y 1 A LEU 256  ? CD2 ? A LEU 240  CD2 
150 1 Y 1 A ILE 262  ? CD1 ? A ILE 246  CD1 
151 1 Y 1 A LEU 266  ? CD1 ? A LEU 250  CD1 
152 1 Y 1 A LEU 266  ? CD2 ? A LEU 250  CD2 
153 1 Y 1 A LEU 270  ? CD1 ? A LEU 254  CD1 
154 1 Y 1 A LEU 270  ? CD2 ? A LEU 254  CD2 
155 1 Y 1 A LEU 274  ? CD1 ? A LEU 258  CD1 
156 1 Y 1 A LEU 274  ? CD2 ? A LEU 258  CD2 
157 1 Y 1 A VAL 277  ? CG1 ? A VAL 261  CG1 
158 1 Y 1 A VAL 277  ? CG2 ? A VAL 261  CG2 
159 1 Y 1 A ILE 282  ? CG1 ? A ILE 266  CG1 
160 1 Y 1 A ILE 282  ? CG2 ? A ILE 266  CG2 
161 1 Y 1 A ILE 282  ? CD1 ? A ILE 266  CD1 
162 1 Y 1 A MET 285  ? CE  ? A MET 269  CE  
163 1 Y 1 A LEU 316  ? CG  ? A LEU 300  CG  
164 1 Y 1 A LEU 316  ? CD1 ? A LEU 300  CD1 
165 1 Y 1 A LEU 316  ? CD2 ? A LEU 300  CD2 
166 1 Y 1 A LEU 319  ? CD1 ? A LEU 303  CD1 
167 1 Y 1 A LEU 319  ? CD2 ? A LEU 303  CD2 
168 1 Y 1 A GLN 321  ? CD  ? A GLN 305  CD  
169 1 Y 1 A GLN 321  ? OE1 ? A GLN 305  OE1 
170 1 Y 1 A GLN 321  ? NE2 ? A GLN 305  NE2 
171 1 Y 1 A ILE 325  ? CD1 ? A ILE 309  CD1 
172 1 Y 1 A GLU 326  ? CD  ? A GLU 310  CD  
173 1 Y 1 A GLU 326  ? OE1 ? A GLU 310  OE1 
174 1 Y 1 A GLU 326  ? OE2 ? A GLU 310  OE2 
175 1 Y 1 A ILE 328  ? CD1 ? A ILE 312  CD1 
176 1 Y 1 A GLU 337  ? CD  ? A GLU 321  CD  
177 1 Y 1 A GLU 337  ? OE1 ? A GLU 321  OE1 
178 1 Y 1 A GLU 337  ? OE2 ? A GLU 321  OE2 
179 1 Y 1 A LYS 340  ? CE  ? A LYS 324  CE  
180 1 Y 1 A LYS 340  ? NZ  ? A LYS 324  NZ  
181 1 Y 1 A LEU 341  ? CD1 ? A LEU 325  CD1 
182 1 Y 1 A LEU 341  ? CD2 ? A LEU 325  CD2 
183 1 Y 1 A VAL 342  ? CG1 ? A VAL 326  CG1 
184 1 Y 1 A VAL 342  ? CG2 ? A VAL 326  CG2 
185 1 Y 1 A VAL 343  ? CG1 ? A VAL 327  CG1 
186 1 Y 1 A VAL 343  ? CG2 ? A VAL 327  CG2 
187 1 Y 1 A GLN 344  ? CD  ? A GLN 328  CD  
188 1 Y 1 A GLN 344  ? OE1 ? A GLN 328  OE1 
189 1 Y 1 A GLN 344  ? NE2 ? A GLN 328  NE2 
190 1 Y 1 A LEU 347  ? CD1 ? A LEU 331  CD1 
191 1 Y 1 A LEU 347  ? CD2 ? A LEU 331  CD2 
192 1 Y 1 A LYS 356  ? CD  ? A LYS 340  CD  
193 1 Y 1 A LYS 356  ? CE  ? A LYS 340  CE  
194 1 Y 1 A LYS 356  ? NZ  ? A LYS 340  NZ  
195 1 Y 1 A VAL 358  ? CG1 ? A VAL 342  CG1 
196 1 Y 1 A VAL 358  ? CG2 ? A VAL 342  CG2 
197 1 Y 1 A LYS 372  ? CE  ? A LYS 356  CE  
198 1 Y 1 A LYS 372  ? NZ  ? A LYS 356  NZ  
199 1 Y 1 A ARG 374  ? CG  ? A ARG 358  CG  
200 1 Y 1 A ARG 374  ? CD  ? A ARG 358  CD  
201 1 Y 1 A ARG 374  ? NE  ? A ARG 358  NE  
202 1 Y 1 A ARG 374  ? CZ  ? A ARG 358  CZ  
203 1 Y 1 A ARG 374  ? NH1 ? A ARG 358  NH1 
204 1 Y 1 A ARG 374  ? NH2 ? A ARG 358  NH2 
205 1 Y 1 A ILE 379  ? CD1 ? A ILE 363  CD1 
206 1 Y 1 A ILE 381  ? CG1 ? A ILE 365  CG1 
207 1 Y 1 A ILE 381  ? CG2 ? A ILE 365  CG2 
208 1 Y 1 A ILE 381  ? CD1 ? A ILE 365  CD1 
209 1 Y 1 A LEU 394  ? CD1 ? A LEU 378  CD1 
210 1 Y 1 A LEU 394  ? CD2 ? A LEU 378  CD2 
211 1 Y 1 A LYS 400  ? CE  ? A LYS 384  CE  
212 1 Y 1 A LYS 400  ? NZ  ? A LYS 384  NZ  
213 1 Y 1 A LYS 413  ? CG  ? A LYS 397  CG  
214 1 Y 1 A LYS 413  ? CD  ? A LYS 397  CD  
215 1 Y 1 A LYS 413  ? CE  ? A LYS 397  CE  
216 1 Y 1 A LYS 413  ? NZ  ? A LYS 397  NZ  
217 1 Y 1 A ILE 418  ? CD1 ? A ILE 402  CD1 
218 1 Y 1 A LEU 425  ? CD1 ? A LEU 409  CD1 
219 1 Y 1 A LEU 425  ? CD2 ? A LEU 409  CD2 
220 1 Y 1 A LYS 429  ? CG  ? A LYS 413  CG  
221 1 Y 1 A LYS 429  ? CD  ? A LYS 413  CD  
222 1 Y 1 A LYS 429  ? CE  ? A LYS 413  CE  
223 1 Y 1 A LYS 429  ? NZ  ? A LYS 413  NZ  
224 1 Y 1 A GLU 448  ? CD  ? A GLU 432  CD  
225 1 Y 1 A GLU 448  ? OE1 ? A GLU 432  OE1 
226 1 Y 1 A GLU 448  ? OE2 ? A GLU 432  OE2 
227 1 Y 1 A LYS 449  ? CG  ? A LYS 433  CG  
228 1 Y 1 A LYS 449  ? CD  ? A LYS 433  CD  
229 1 Y 1 A LYS 449  ? CE  ? A LYS 433  CE  
230 1 Y 1 A LYS 449  ? NZ  ? A LYS 433  NZ  
231 1 Y 1 A LEU 452  ? CG  ? A LEU 436  CG  
232 1 Y 1 A LEU 452  ? CD1 ? A LEU 436  CD1 
233 1 Y 1 A LEU 452  ? CD2 ? A LEU 436  CD2 
234 1 Y 1 A LEU 471  ? CD1 ? A LEU 455  CD1 
235 1 Y 1 A LEU 471  ? CD2 ? A LEU 455  CD2 
236 1 Y 1 A ILE 473  ? CD1 ? A ILE 457  CD1 
237 1 Y 1 A LEU 475  ? CD1 ? A LEU 459  CD1 
238 1 Y 1 A LEU 475  ? CD2 ? A LEU 459  CD2 
239 1 Y 1 A GLU 477  ? CD  ? A GLU 461  CD  
240 1 Y 1 A GLU 477  ? OE1 ? A GLU 461  OE1 
241 1 Y 1 A GLU 477  ? OE2 ? A GLU 461  OE2 
242 1 Y 1 A HIS 481  ? CG  ? A HIS 465  CG  
243 1 Y 1 A HIS 481  ? ND1 ? A HIS 465  ND1 
244 1 Y 1 A HIS 481  ? CD2 ? A HIS 465  CD2 
245 1 Y 1 A HIS 481  ? CE1 ? A HIS 465  CE1 
246 1 Y 1 A HIS 481  ? NE2 ? A HIS 465  NE2 
247 1 Y 1 A LEU 488  ? CD1 ? A LEU 472  CD1 
248 1 Y 1 A LEU 488  ? CD2 ? A LEU 472  CD2 
249 1 Y 1 A GLU 489  ? CD  ? A GLU 473  CD  
250 1 Y 1 A GLU 489  ? OE1 ? A GLU 473  OE1 
251 1 Y 1 A GLU 489  ? OE2 ? A GLU 473  OE2 
252 1 Y 1 A LYS 490  ? CG  ? A LYS 474  CG  
253 1 Y 1 A LYS 490  ? CD  ? A LYS 474  CD  
254 1 Y 1 A LYS 490  ? CE  ? A LYS 474  CE  
255 1 Y 1 A LYS 490  ? NZ  ? A LYS 474  NZ  
256 1 Y 1 A ILE 491  ? CD1 ? A ILE 475  CD1 
257 1 Y 1 A LEU 492  ? CD1 ? A LEU 476  CD1 
258 1 Y 1 A LEU 492  ? CD2 ? A LEU 476  CD2 
259 1 Y 1 A GLU 493  ? CD  ? A GLU 477  CD  
260 1 Y 1 A GLU 493  ? OE1 ? A GLU 477  OE1 
261 1 Y 1 A GLU 493  ? OE2 ? A GLU 477  OE2 
262 1 Y 1 A GLU 506  ? CD  ? A GLU 490  CD  
263 1 Y 1 A GLU 506  ? OE1 ? A GLU 490  OE1 
264 1 Y 1 A GLU 506  ? OE2 ? A GLU 490  OE2 
265 1 Y 1 A LEU 509  ? CD1 ? A LEU 493  CD1 
266 1 Y 1 A LEU 509  ? CD2 ? A LEU 493  CD2 
267 1 Y 1 A GLU 513  ? CD  ? A GLU 497  CD  
268 1 Y 1 A GLU 513  ? OE1 ? A GLU 497  OE1 
269 1 Y 1 A GLU 513  ? OE2 ? A GLU 497  OE2 
270 1 Y 1 A ILE 514  ? CD1 ? A ILE 498  CD1 
271 1 Y 1 A LEU 523  ? CD1 ? A LEU 507  CD1 
272 1 Y 1 A LEU 523  ? CD2 ? A LEU 507  CD2 
273 1 Y 1 A LEU 530  ? CD1 ? A LEU 514  CD1 
274 1 Y 1 A LEU 530  ? CD2 ? A LEU 514  CD2 
275 1 Y 1 A LYS 533  ? CD  ? A LYS 517  CD  
276 1 Y 1 A LYS 533  ? CE  ? A LYS 517  CE  
277 1 Y 1 A LYS 533  ? NZ  ? A LYS 517  NZ  
278 1 Y 1 A GLU 537  ? CD  ? A GLU 521  CD  
279 1 Y 1 A GLU 537  ? OE1 ? A GLU 521  OE1 
280 1 Y 1 A GLU 537  ? OE2 ? A GLU 521  OE2 
281 1 Y 1 A GLU 540  ? CG  ? A GLU 524  CG  
282 1 Y 1 A GLU 540  ? CD  ? A GLU 524  CD  
283 1 Y 1 A GLU 540  ? OE1 ? A GLU 524  OE1 
284 1 Y 1 A GLU 540  ? OE2 ? A GLU 524  OE2 
285 1 Y 1 A ARG 548  ? CZ  ? A ARG 532  CZ  
286 1 Y 1 A ARG 548  ? NH1 ? A ARG 532  NH1 
287 1 Y 1 A ARG 548  ? NH2 ? A ARG 532  NH2 
288 1 Y 1 A LYS 554  ? CE  ? A LYS 538  CE  
289 1 Y 1 A LYS 554  ? NZ  ? A LYS 538  NZ  
290 1 Y 1 A LYS 557  ? CE  ? A LYS 541  CE  
291 1 Y 1 A LYS 557  ? NZ  ? A LYS 541  NZ  
292 1 Y 1 A SER 623  ? OG  ? A SER 607  OG  
293 1 Y 1 A LYS 631  ? CD  ? A LYS 615  CD  
294 1 Y 1 A LYS 631  ? CE  ? A LYS 615  CE  
295 1 Y 1 A LYS 631  ? NZ  ? A LYS 615  NZ  
296 1 Y 1 A LYS 642  ? CD  ? A LYS 626  CD  
297 1 Y 1 A LYS 642  ? CE  ? A LYS 626  CE  
298 1 Y 1 A LYS 642  ? NZ  ? A LYS 626  NZ  
299 1 Y 1 A VAL 657  ? CG1 ? A VAL 641  CG1 
300 1 Y 1 A VAL 657  ? CG2 ? A VAL 641  CG2 
301 1 Y 1 A LYS 680  ? CD  ? A LYS 664  CD  
302 1 Y 1 A LYS 680  ? CE  ? A LYS 664  CE  
303 1 Y 1 A LYS 680  ? NZ  ? A LYS 664  NZ  
304 1 Y 1 A LYS 684  ? CE  ? A LYS 668  CE  
305 1 Y 1 A LYS 684  ? NZ  ? A LYS 668  NZ  
306 1 Y 1 A LYS 691  ? CE  ? A LYS 675  CE  
307 1 Y 1 A LYS 691  ? NZ  ? A LYS 675  NZ  
308 1 Y 1 A LEU 701  ? CG  ? A LEU 685  CG  
309 1 Y 1 A LEU 701  ? CD1 ? A LEU 685  CD1 
310 1 Y 1 A LEU 701  ? CD2 ? A LEU 685  CD2 
311 1 Y 1 A GLN 704  ? CD  ? A GLN 688  CD  
312 1 Y 1 A GLN 704  ? OE1 ? A GLN 688  OE1 
313 1 Y 1 A GLN 704  ? NE2 ? A GLN 688  NE2 
314 1 Y 1 A LYS 705  ? CD  ? A LYS 689  CD  
315 1 Y 1 A LYS 705  ? CE  ? A LYS 689  CE  
316 1 Y 1 A LYS 705  ? NZ  ? A LYS 689  NZ  
317 1 Y 1 A THR 706  ? OG1 ? A THR 690  OG1 
318 1 Y 1 A THR 706  ? CG2 ? A THR 690  CG2 
319 1 Y 1 A GLN 710  ? CG  ? A GLN 694  CG  
320 1 Y 1 A GLN 710  ? CD  ? A GLN 694  CD  
321 1 Y 1 A GLN 710  ? OE1 ? A GLN 694  OE1 
322 1 Y 1 A GLN 710  ? NE2 ? A GLN 694  NE2 
323 1 Y 1 A LYS 712  ? CE  ? A LYS 696  CE  
324 1 Y 1 A LYS 712  ? NZ  ? A LYS 696  NZ  
325 1 Y 1 A GLU 713  ? CD  ? A GLU 697  CD  
326 1 Y 1 A GLU 713  ? OE1 ? A GLU 697  OE1 
327 1 Y 1 A GLU 713  ? OE2 ? A GLU 697  OE2 
328 1 Y 1 A LEU 714  ? CG  ? A LEU 698  CG  
329 1 Y 1 A LEU 714  ? CD1 ? A LEU 698  CD1 
330 1 Y 1 A LEU 714  ? CD2 ? A LEU 698  CD2 
331 1 Y 1 A LEU 717  ? CG  ? A LEU 701  CG  
332 1 Y 1 A LEU 717  ? CD1 ? A LEU 701  CD1 
333 1 Y 1 A LEU 717  ? CD2 ? A LEU 701  CD2 
334 1 Y 1 A GLU 726  ? CG  ? A GLU 710  CG  
335 1 Y 1 A GLU 726  ? CD  ? A GLU 710  CD  
336 1 Y 1 A GLU 726  ? OE1 ? A GLU 710  OE1 
337 1 Y 1 A GLU 726  ? OE2 ? A GLU 710  OE2 
338 1 Y 1 A LEU 740  ? CD1 ? A LEU 724  CD1 
339 1 Y 1 A LEU 740  ? CD2 ? A LEU 724  CD2 
340 1 Y 1 A GLU 747  ? CD  ? A GLU 731  CD  
341 1 Y 1 A GLU 747  ? OE1 ? A GLU 731  OE1 
342 1 Y 1 A GLU 747  ? OE2 ? A GLU 731  OE2 
343 1 Y 1 A ASP 753  ? CG  ? A ASP 737  CG  
344 1 Y 1 A ASP 753  ? OD1 ? A ASP 737  OD1 
345 1 Y 1 A ASP 753  ? OD2 ? A ASP 737  OD2 
346 1 Y 1 A LYS 755  ? CD  ? A LYS 739  CD  
347 1 Y 1 A LYS 755  ? CE  ? A LYS 739  CE  
348 1 Y 1 A LYS 755  ? NZ  ? A LYS 739  NZ  
349 1 Y 1 A LYS 757  ? NZ  ? A LYS 741  NZ  
350 1 Y 1 A GLU 766  ? CD  ? A GLU 750  CD  
351 1 Y 1 A GLU 766  ? OE1 ? A GLU 750  OE1 
352 1 Y 1 A GLU 766  ? OE2 ? A GLU 750  OE2 
353 1 Y 1 A GLU 767  ? CG  ? A GLU 751  CG  
354 1 Y 1 A GLU 767  ? CD  ? A GLU 751  CD  
355 1 Y 1 A GLU 767  ? OE1 ? A GLU 751  OE1 
356 1 Y 1 A GLU 767  ? OE2 ? A GLU 751  OE2 
357 1 Y 1 A ILE 776  ? CD1 ? A ILE 760  CD1 
358 1 Y 1 A ARG 830  ? CZ  ? A ARG 814  CZ  
359 1 Y 1 A ARG 830  ? NH1 ? A ARG 814  NH1 
360 1 Y 1 A ARG 830  ? NH2 ? A ARG 814  NH2 
361 1 Y 1 A ILE 837  ? CD1 ? A ILE 821  CD1 
362 1 Y 1 A ASN 840  ? CG  ? A ASN 824  CG  
363 1 Y 1 A ASN 840  ? OD1 ? A ASN 824  OD1 
364 1 Y 1 A ASN 840  ? ND2 ? A ASN 824  ND2 
365 1 Y 1 A PHE 850  ? CG  ? A PHE 834  CG  
366 1 Y 1 A PHE 850  ? CD1 ? A PHE 834  CD1 
367 1 Y 1 A PHE 850  ? CD2 ? A PHE 834  CD2 
368 1 Y 1 A PHE 850  ? CE1 ? A PHE 834  CE1 
369 1 Y 1 A PHE 850  ? CE2 ? A PHE 834  CE2 
370 1 Y 1 A PHE 850  ? CZ  ? A PHE 834  CZ  
371 1 Y 1 A ASN 851  ? CG  ? A ASN 835  CG  
372 1 Y 1 A ASN 851  ? OD1 ? A ASN 835  OD1 
373 1 Y 1 A ASN 851  ? ND2 ? A ASN 835  ND2 
374 1 Y 1 A LYS 852  ? CG  ? A LYS 836  CG  
375 1 Y 1 A LYS 852  ? CD  ? A LYS 836  CD  
376 1 Y 1 A LYS 852  ? CE  ? A LYS 836  CE  
377 1 Y 1 A LYS 852  ? NZ  ? A LYS 836  NZ  
378 1 Y 1 A LEU 855  ? CG  ? A LEU 839  CG  
379 1 Y 1 A LEU 855  ? CD1 ? A LEU 839  CD1 
380 1 Y 1 A LEU 855  ? CD2 ? A LEU 839  CD2 
381 1 Y 1 A LEU 856  ? CD1 ? A LEU 840  CD1 
382 1 Y 1 A LEU 856  ? CD2 ? A LEU 840  CD2 
383 1 Y 1 A LEU 859  ? CD1 ? A LEU 843  CD1 
384 1 Y 1 A LEU 859  ? CD2 ? A LEU 843  CD2 
385 1 Y 1 A LYS 860  ? CD  ? A LYS 844  CD  
386 1 Y 1 A LYS 860  ? CE  ? A LYS 844  CE  
387 1 Y 1 A LYS 860  ? NZ  ? A LYS 844  NZ  
388 1 Y 1 A LEU 868  ? CD1 ? A LEU 852  CD1 
389 1 Y 1 A LEU 868  ? CD2 ? A LEU 852  CD2 
390 1 Y 1 A ARG 870  ? NE  ? A ARG 854  NE  
391 1 Y 1 A ARG 870  ? CZ  ? A ARG 854  CZ  
392 1 Y 1 A ARG 870  ? NH1 ? A ARG 854  NH1 
393 1 Y 1 A ARG 870  ? NH2 ? A ARG 854  NH2 
394 1 Y 1 A ILE 872  ? CD1 ? A ILE 856  CD1 
395 1 Y 1 A HIS 914  ? CG  ? A HIS 898  CG  
396 1 Y 1 A HIS 914  ? ND1 ? A HIS 898  ND1 
397 1 Y 1 A HIS 914  ? CD2 ? A HIS 898  CD2 
398 1 Y 1 A HIS 914  ? CE1 ? A HIS 898  CE1 
399 1 Y 1 A HIS 914  ? NE2 ? A HIS 898  NE2 
400 1 Y 1 A PHE 919  ? CG  ? A PHE 903  CG  
401 1 Y 1 A PHE 919  ? CD1 ? A PHE 903  CD1 
402 1 Y 1 A PHE 919  ? CD2 ? A PHE 903  CD2 
403 1 Y 1 A PHE 919  ? CE1 ? A PHE 903  CE1 
404 1 Y 1 A PHE 919  ? CE2 ? A PHE 903  CE2 
405 1 Y 1 A PHE 919  ? CZ  ? A PHE 903  CZ  
406 1 Y 1 A ILE 925  ? CD1 ? A ILE 909  CD1 
407 1 Y 1 A ASN 926  ? CG  ? A ASN 910  CG  
408 1 Y 1 A ASN 926  ? OD1 ? A ASN 910  OD1 
409 1 Y 1 A ASN 926  ? ND2 ? A ASN 910  ND2 
410 1 Y 1 A ARG 927  ? CD  ? A ARG 911  CD  
411 1 Y 1 A ARG 927  ? NE  ? A ARG 911  NE  
412 1 Y 1 A ARG 927  ? CZ  ? A ARG 911  CZ  
413 1 Y 1 A ARG 927  ? NH1 ? A ARG 911  NH1 
414 1 Y 1 A ARG 927  ? NH2 ? A ARG 911  NH2 
415 1 Y 1 A GLU 928  ? CD  ? A GLU 912  CD  
416 1 Y 1 A GLU 928  ? OE1 ? A GLU 912  OE1 
417 1 Y 1 A GLU 928  ? OE2 ? A GLU 912  OE2 
418 1 Y 1 A ARG 929  ? NE  ? A ARG 913  NE  
419 1 Y 1 A ARG 929  ? CZ  ? A ARG 913  CZ  
420 1 Y 1 A ARG 929  ? NH1 ? A ARG 913  NH1 
421 1 Y 1 A ARG 929  ? NH2 ? A ARG 913  NH2 
422 1 Y 1 A TYR 936  ? CG  ? A TYR 920  CG  
423 1 Y 1 A TYR 936  ? CD1 ? A TYR 920  CD1 
424 1 Y 1 A TYR 936  ? CD2 ? A TYR 920  CD2 
425 1 Y 1 A TYR 936  ? CE1 ? A TYR 920  CE1 
426 1 Y 1 A TYR 936  ? CE2 ? A TYR 920  CE2 
427 1 Y 1 A TYR 936  ? CZ  ? A TYR 920  CZ  
428 1 Y 1 A TYR 936  ? OH  ? A TYR 920  OH  
429 1 Y 1 A ASN 948  ? CG  ? A ASN 932  CG  
430 1 Y 1 A ASN 948  ? OD1 ? A ASN 932  OD1 
431 1 Y 1 A ASN 948  ? ND2 ? A ASN 932  ND2 
432 1 Y 1 A GLU 951  ? CD  ? A GLU 935  CD  
433 1 Y 1 A GLU 951  ? OE1 ? A GLU 935  OE1 
434 1 Y 1 A GLU 951  ? OE2 ? A GLU 935  OE2 
435 1 Y 1 A LYS 952  ? NZ  ? A LYS 936  NZ  
436 1 Y 1 A ARG 955  ? CZ  ? A ARG 939  CZ  
437 1 Y 1 A ARG 955  ? NH1 ? A ARG 939  NH1 
438 1 Y 1 A ARG 955  ? NH2 ? A ARG 939  NH2 
439 1 Y 1 A LYS 993  ? CE  ? A LYS 977  CE  
440 1 Y 1 A LYS 993  ? NZ  ? A LYS 977  NZ  
441 1 Y 1 A ILE 995  ? CD1 ? A ILE 979  CD1 
442 1 Y 1 A LEU 1004 ? CD1 ? A LEU 988  CD1 
443 1 Y 1 A LEU 1004 ? CD2 ? A LEU 988  CD2 
444 1 Y 1 A LYS 1006 ? NZ  ? A LYS 990  NZ  
445 1 Y 1 A GLU 1010 ? CD  ? A GLU 994  CD  
446 1 Y 1 A GLU 1010 ? OE1 ? A GLU 994  OE1 
447 1 Y 1 A GLU 1010 ? OE2 ? A GLU 994  OE2 
448 1 Y 1 A LYS 1018 ? CE  ? A LYS 1002 CE  
449 1 Y 1 A LYS 1018 ? NZ  ? A LYS 1002 NZ  
450 1 Y 1 A ARG 1024 ? NE  ? A ARG 1008 NE  
451 1 Y 1 A ARG 1024 ? CZ  ? A ARG 1008 CZ  
452 1 Y 1 A ARG 1024 ? NH1 ? A ARG 1008 NH1 
453 1 Y 1 A ARG 1024 ? NH2 ? A ARG 1008 NH2 
454 1 Y 1 A TRP 1027 ? CG  ? A TRP 1011 CG  
455 1 Y 1 A TRP 1027 ? CD1 ? A TRP 1011 CD1 
456 1 Y 1 A TRP 1027 ? CD2 ? A TRP 1011 CD2 
457 1 Y 1 A TRP 1027 ? NE1 ? A TRP 1011 NE1 
458 1 Y 1 A TRP 1027 ? CE2 ? A TRP 1011 CE2 
459 1 Y 1 A TRP 1027 ? CE3 ? A TRP 1011 CE3 
460 1 Y 1 A TRP 1027 ? CZ2 ? A TRP 1011 CZ2 
461 1 Y 1 A TRP 1027 ? CZ3 ? A TRP 1011 CZ3 
462 1 Y 1 A TRP 1027 ? CH2 ? A TRP 1011 CH2 
463 1 Y 1 A LYS 1028 ? CD  ? A LYS 1012 CD  
464 1 Y 1 A LYS 1028 ? CE  ? A LYS 1012 CE  
465 1 Y 1 A LYS 1028 ? NZ  ? A LYS 1012 NZ  
466 1 Y 1 A THR 1029 ? OG1 ? A THR 1013 OG1 
467 1 Y 1 A THR 1029 ? CG2 ? A THR 1013 CG2 
468 1 Y 1 B GLN 432  ? CG  ? B GLN 2    CG  
469 1 Y 1 B GLN 432  ? CD  ? B GLN 2    CD  
470 1 Y 1 B GLN 432  ? OE1 ? B GLN 2    OE1 
471 1 Y 1 B GLN 432  ? NE2 ? B GLN 2    NE2 
472 1 Y 1 B GLN 433  ? CG  ? B GLN 3    CG  
473 1 Y 1 B GLN 433  ? CD  ? B GLN 3    CD  
474 1 Y 1 B GLN 433  ? OE1 ? B GLN 3    OE1 
475 1 Y 1 B GLN 433  ? NE2 ? B GLN 3    NE2 
476 1 Y 1 B ASP 434  ? CG  ? B ASP 4    CG  
477 1 Y 1 B ASP 434  ? OD1 ? B ASP 4    OD1 
478 1 Y 1 B ASP 434  ? OD2 ? B ASP 4    OD2 
479 1 Y 1 B GLN 435  ? CG  ? B GLN 5    CG  
480 1 Y 1 B GLN 435  ? CD  ? B GLN 5    CD  
481 1 Y 1 B GLN 435  ? OE1 ? B GLN 5    OE1 
482 1 Y 1 B GLN 435  ? NE2 ? B GLN 5    NE2 
483 1 Y 1 B VAL 436  ? CG1 ? B VAL 6    CG1 
484 1 Y 1 B VAL 436  ? CG2 ? B VAL 6    CG2 
485 1 Y 1 B LYS 438  ? CD  ? B LYS 8    CD  
486 1 Y 1 B LYS 438  ? CE  ? B LYS 8    CE  
487 1 Y 1 B LYS 438  ? NZ  ? B LYS 8    NZ  
488 1 Y 1 B ILE 442  ? CD1 ? B ILE 12   CD1 
489 1 Y 1 B LYS 447  ? CD  ? B LYS 17   CD  
490 1 Y 1 B LYS 447  ? CE  ? B LYS 17   CE  
491 1 Y 1 B LYS 447  ? NZ  ? B LYS 17   NZ  
492 1 Y 1 B GLN 457  ? CD  ? B GLN 27   CD  
493 1 Y 1 B GLN 457  ? OE1 ? B GLN 27   OE1 
494 1 Y 1 B GLN 457  ? NE2 ? B GLN 27   NE2 
495 1 Y 1 B GLU 458  ? CD  ? B GLU 28   CD  
496 1 Y 1 B GLU 458  ? OE1 ? B GLU 28   OE1 
497 1 Y 1 B GLU 458  ? OE2 ? B GLU 28   OE2 
498 1 Y 1 B LYS 459  ? CD  ? B LYS 29   CD  
499 1 Y 1 B LYS 459  ? CE  ? B LYS 29   CE  
500 1 Y 1 B LYS 459  ? NZ  ? B LYS 29   NZ  
501 1 Y 1 B ARG 461  ? NE  ? B ARG 31   NE  
502 1 Y 1 B ARG 461  ? CZ  ? B ARG 31   CZ  
503 1 Y 1 B ARG 461  ? NH1 ? B ARG 31   NH1 
504 1 Y 1 B ARG 461  ? NH2 ? B ARG 31   NH2 
505 1 Y 1 B GLU 462  ? CD  ? B GLU 32   CD  
506 1 Y 1 B GLU 462  ? OE1 ? B GLU 32   OE1 
507 1 Y 1 B GLU 462  ? OE2 ? B GLU 32   OE2 
508 1 Y 1 B ARG 465  ? CD  ? B ARG 35   CD  
509 1 Y 1 B ARG 465  ? NE  ? B ARG 35   NE  
510 1 Y 1 B ARG 465  ? CZ  ? B ARG 35   CZ  
511 1 Y 1 B ARG 465  ? NH1 ? B ARG 35   NH1 
512 1 Y 1 B ARG 465  ? NH2 ? B ARG 35   NH2 
513 1 Y 1 B MET 479  ? CE  ? B MET 49   CE  
514 1 Y 1 B ARG 481  ? CD  ? B ARG 51   CD  
515 1 Y 1 B ARG 481  ? NE  ? B ARG 51   NE  
516 1 Y 1 B ARG 481  ? CZ  ? B ARG 51   CZ  
517 1 Y 1 B ARG 481  ? NH1 ? B ARG 51   NH1 
518 1 Y 1 B ARG 481  ? NH2 ? B ARG 51   NH2 
519 1 Y 1 B ASN 488  ? CG  ? B ASN 58   CG  
520 1 Y 1 B ASN 488  ? OD1 ? B ASN 58   OD1 
521 1 Y 1 B ASN 488  ? ND2 ? B ASN 58   ND2 
522 1 Y 1 B LYS 492  ? CE  ? B LYS 62   CE  
523 1 Y 1 B LYS 492  ? NZ  ? B LYS 62   NZ  
524 1 Y 1 B ILE 493  ? CD1 ? B ILE 63   CD1 
525 1 Y 1 B LYS 506  ? CE  ? B LYS 76   CE  
526 1 Y 1 B LYS 506  ? NZ  ? B LYS 76   NZ  
527 1 Y 1 B ILE 509  ? CD1 ? B ILE 79   CD1 
528 1 Y 1 B GLU 510  ? CG  ? B GLU 80   CG  
529 1 Y 1 B GLU 510  ? CD  ? B GLU 80   CD  
530 1 Y 1 B GLU 510  ? OE1 ? B GLU 80   OE1 
531 1 Y 1 B GLU 510  ? OE2 ? B GLU 80   OE2 
532 1 Y 1 B LYS 511  ? CD  ? B LYS 81   CD  
533 1 Y 1 B LYS 511  ? CE  ? B LYS 81   CE  
534 1 Y 1 B LYS 511  ? NZ  ? B LYS 81   NZ  
535 1 Y 1 B LYS 513  ? CD  ? B LYS 83   CD  
536 1 Y 1 B LYS 513  ? CE  ? B LYS 83   CE  
537 1 Y 1 B LYS 513  ? NZ  ? B LYS 83   NZ  
538 1 Y 1 B ARG 514  ? NE  ? B ARG 84   NE  
539 1 Y 1 B ARG 514  ? CZ  ? B ARG 84   CZ  
540 1 Y 1 B ARG 514  ? NH1 ? B ARG 84   NH1 
541 1 Y 1 B ARG 514  ? NH2 ? B ARG 84   NH2 
542 1 Y 1 B GLU 515  ? CD  ? B GLU 85   CD  
543 1 Y 1 B GLU 515  ? OE1 ? B GLU 85   OE1 
544 1 Y 1 B GLU 515  ? OE2 ? B GLU 85   OE2 
545 1 Y 1 B ASN 517  ? CG  ? B ASN 87   CG  
546 1 Y 1 B ASN 517  ? OD1 ? B ASN 87   OD1 
547 1 Y 1 B ASN 517  ? ND2 ? B ASN 87   ND2 
548 1 Y 1 B ILE 524  ? CD1 ? B ILE 94   CD1 
549 1 Y 1 B LYS 530  ? CE  ? B LYS 100  CE  
550 1 Y 1 B LYS 530  ? NZ  ? B LYS 100  NZ  
551 1 Y 1 B LYS 532  ? CE  ? B LYS 102  CE  
552 1 Y 1 B LYS 532  ? NZ  ? B LYS 102  NZ  
553 1 Y 1 B LEU 545  ? CD1 ? B LEU 115  CD1 
554 1 Y 1 B LEU 545  ? CD2 ? B LEU 115  CD2 
555 1 Y 1 B LYS 550  ? NZ  ? B LYS 120  NZ  
556 1 Y 1 B LYS 551  ? CE  ? B LYS 121  CE  
557 1 Y 1 B LYS 551  ? NZ  ? B LYS 121  NZ  
558 1 Y 1 B LYS 575  ? CE  ? B LYS 145  CE  
559 1 Y 1 B LYS 575  ? NZ  ? B LYS 145  NZ  
560 1 Y 1 B LYS 587  ? NZ  ? B LYS 157  NZ  
561 1 Y 1 B ARG 590  ? CD  ? B ARG 160  CD  
562 1 Y 1 B ARG 590  ? NE  ? B ARG 160  NE  
563 1 Y 1 B ARG 590  ? CZ  ? B ARG 160  CZ  
564 1 Y 1 B ARG 590  ? NH1 ? B ARG 160  NH1 
565 1 Y 1 B ARG 590  ? NH2 ? B ARG 160  NH2 
566 1 Y 1 B LYS 592  ? CD  ? B LYS 162  CD  
567 1 Y 1 B LYS 592  ? CE  ? B LYS 162  CE  
568 1 Y 1 B LYS 592  ? NZ  ? B LYS 162  NZ  
569 1 Y 1 B GLU 596  ? CD  ? B GLU 166  CD  
570 1 Y 1 B GLU 596  ? OE1 ? B GLU 166  OE1 
571 1 Y 1 B GLU 596  ? OE2 ? B GLU 166  OE2 
572 1 Y 1 B ASN 600  ? CG  ? B ASN 170  CG  
573 1 Y 1 B ASN 600  ? OD1 ? B ASN 170  OD1 
574 1 Y 1 B ASN 600  ? ND2 ? B ASN 170  ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 175 ? A ALA 159 
2  1 Y 1 A GLN 176 ? A GLN 160 
3  1 Y 1 A THR 177 ? A THR 161 
4  1 Y 1 A TRP 178 ? A TRP 162 
5  1 Y 1 A GLY 179 ? A GLY 163 
6  1 Y 1 A PRO 180 ? A PRO 164 
7  1 Y 1 A GLY 181 ? A GLY 165 
8  1 Y 1 A THR 182 ? A THR 166 
9  1 Y 1 A LEU 183 ? A LEU 167 
10 1 Y 1 A ARG 184 ? A ARG 168 
11 1 Y 1 A VAL 227 ? A VAL 211 
12 1 Y 1 A PHE 228 ? A PHE 212 
13 1 Y 1 A ARG 229 ? A ARG 213 
14 1 Y 1 A GLN 230 ? A GLN 214 
15 1 Y 1 A PRO 231 ? A PRO 215 
16 1 Y 1 A LEU 232 ? A LEU 216 
17 1 Y 1 A VAL 233 ? A VAL 217 
18 1 Y 1 A GLU 234 ? A GLU 218 
19 1 Y 1 A GLN 235 ? A GLN 219 
20 1 Y 1 A PRO 236 ? A PRO 220 
21 1 Y 1 A GLU 288 ? A GLU 272 
22 1 Y 1 A GLN 289 ? A GLN 273 
23 1 Y 1 A SER 290 ? A SER 274 
24 1 Y 1 A ASN 291 ? A ASN 275 
25 1 Y 1 A PRO 292 ? A PRO 276 
26 1 Y 1 A ALA 293 ? A ALA 277 
27 1 Y 1 A PRO 294 ? A PRO 278 
28 1 Y 1 A GLN 295 ? A GLN 279 
29 1 Y 1 A VAL 296 ? A VAL 280 
30 1 Y 1 A GLN 297 ? A GLN 281 
31 1 Y 1 A LYS 298 ? A LYS 282 
32 1 Y 1 A PRO 299 ? A PRO 283 
33 1 Y 1 A ARG 300 ? A ARG 284 
34 1 Y 1 A ALA 301 ? A ALA 285 
35 1 Y 1 A LYS 302 ? A LYS 286 
36 1 Y 1 A PRO 303 ? A PRO 287 
37 1 Y 1 A PRO 304 ? A PRO 288 
38 1 Y 1 A PRO 305 ? A PRO 289 
39 1 Y 1 A ILE 306 ? A ILE 290 
40 1 Y 1 A PRO 307 ? A PRO 291 
41 1 Y 1 A ALA 308 ? A ALA 292 
42 1 Y 1 A LYS 309 ? A LYS 293 
43 1 Y 1 A LYS 310 ? A LYS 294 
44 1 Y 1 A PRO 311 ? A PRO 295 
45 1 Y 1 A SER 312 ? A SER 296 
46 1 Y 1 A SER 313 ? A SER 297 
47 1 Y 1 A VAL 314 ? A VAL 298 
48 1 Y 1 A SER 315 ? A SER 299 
49 1 Y 1 A LYS 402 ? A LYS 386 
50 1 Y 1 A LYS 403 ? A LYS 387 
51 1 Y 1 A ALA 404 ? A ALA 388 
52 1 Y 1 A ARG 405 ? A ARG 389 
53 1 Y 1 A SER 406 ? A SER 390 
54 1 Y 1 A THR 407 ? A THR 391 
55 1 Y 1 A LYS 408 ? A LYS 392 
56 1 Y 1 A LYS 409 ? A LYS 393 
57 1 Y 1 A LYS 410 ? A LYS 394 
58 1 Y 1 A SER 411 ? A SER 395 
59 1 Y 1 A LYS 412 ? A LYS 396 
60 1 Y 1 A SER 498 ? A SER 482 
61 1 Y 1 A GLU 499 ? A GLU 483 
62 1 Y 1 A CYS 500 ? A CYS 484 
63 1 Y 1 A VAL 501 ? A VAL 485 
64 1 Y 1 A HIS 502 ? A HIS 486 
65 1 Y 1 A VAL 503 ? A VAL 487 
66 1 Y 1 A ARG 517 ? A ARG 501 
67 1 Y 1 A ARG 518 ? A ARG 502 
68 1 Y 1 A GLY 519 ? A GLY 503 
69 1 Y 1 A SER 520 ? A SER 504 
70 1 Y 1 A GLY 769 ? A GLY 753 
71 1 Y 1 A SER 770 ? A SER 754 
72 1 Y 1 A GLY 771 ? A GLY 755 
73 1 Y 1 A GLY 772 ? A GLY 756 
74 1 Y 1 A LYS 841 ? A LYS 825 
75 1 Y 1 A SER 842 ? A SER 826 
76 1 Y 1 A ASN 843 ? A ASN 827 
77 1 Y 1 A MET 844 ? A MET 828 
78 1 Y 1 A ALA 845 ? A ALA 829 
79 1 Y 1 A ALA 846 ? A ALA 830 
80 1 Y 1 A THR 847 ? A THR 831 
81 1 Y 1 A ALA 848 ? A ALA 832 
82 1 Y 1 A ALA 849 ? A ALA 833 
83 1 Y 1 A LYS 920 ? A LYS 904 
84 1 Y 1 A THR 921 ? A THR 905 
85 1 Y 1 A LYS 922 ? A LYS 906 
86 1 Y 1 A PHE 923 ? A PHE 907 
87 1 Y 1 A GLY 924 ? A GLY 908 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;4-acetyl-1-(3-{4-amino-5-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]pyrrolo[2,1-f][1,2,4]triazin-7-yl}phenyl)-3,3-dimethylpiperazin-2-one
;
9EM 
4 water HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#