data_5WBY
# 
_entry.id   5WBY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WBY         
WWPDB D_1000228756 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WBY 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Pavletich, N.P.' 1 ? 
'Yang, H.'        2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            552 
_citation.language                  ? 
_citation.page_first                368 
_citation.page_last                 373 
_citation.title                     'Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature25023 
_citation.pdbx_database_id_PubMed   29236692 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, H.'        1 
primary 'Jiang, X.'       2 
primary 'Li, B.'          3 
primary 'Yang, H.J.'      4 
primary 'Miller, M.'      5 
primary 'Yang, A.'        6 
primary 'Dhar, A.'        7 
primary 'Pavletich, N.P.' 8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5WBY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     138.926 
_cell.length_a_esd                 ? 
_cell.length_b                     163.044 
_cell.length_b_esd                 ? 
_cell.length_c                     206.666 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5WBY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 2 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Serine/threonine-protein kinase mTOR'     134865.453 2 2.7.11.1 ? 'residues 1376-2549' ? 
2 polymer man 'Target of rapamycin complex subunit LST8' 36054.219  2 ?        ? ?                    ? 
3 polymer man 'Proline-rich AKT1 substrate 1'            10336.045  2 ?        ? 'residues 114-207'   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;FK506-binding protein 12-rapamycin complex-associated protein 1,FKBP12-rapamycin complex-associated protein,Mammalian target of rapamycin,mTOR,Mechanistic target of rapamycin,Rapamycin and FKBP12 target 1,Rapamycin target protein 1
;
2 'TORC subunit LST8,G protein beta subunit-like,Protein GbetaL,Mammalian lethal with SEC13 protein 8,mLST8' 
3 '40 kDa proline-rich AKT substrate' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GTGDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEK
LHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEY
TCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERR
EIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTV
HPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKV
LQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESE
AESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQI
DTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMV
SEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSG
NVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKL
TLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRD
YREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGY
ILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKD
SVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEA
LNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
;
;GTGDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEK
LHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEY
TCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERR
EIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTV
HPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKV
LQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESE
AESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQI
DTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMV
SEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSG
NVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKL
TLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRD
YREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGY
ILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKD
SVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEA
LNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
;
B,A ? 
2 'polypeptide(L)' no no 
;GSMNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPI
ISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLK
TDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATC
SADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCL
AFNDSVLG
;
;GSMNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPI
ISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLK
TDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATC
SADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCL
AFNDSVLG
;
D,C ? 
3 'polypeptide(L)' no no 
;GSGRETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVP
VWGFKEKRTEARSSDEEN
;
;GSGRETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVP
VWGFKEKRTEARSSDEEN
;
P,O ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    THR n 
1 3    GLY n 
1 4    ASP n 
1 5    ASP n 
1 6    ASN n 
1 7    GLY n 
1 8    ILE n 
1 9    VAL n 
1 10   LEU n 
1 11   LEU n 
1 12   GLY n 
1 13   GLU n 
1 14   ARG n 
1 15   ALA n 
1 16   ALA n 
1 17   LYS n 
1 18   CYS n 
1 19   ARG n 
1 20   ALA n 
1 21   TYR n 
1 22   ALA n 
1 23   LYS n 
1 24   ALA n 
1 25   LEU n 
1 26   HIS n 
1 27   TYR n 
1 28   LYS n 
1 29   GLU n 
1 30   LEU n 
1 31   GLU n 
1 32   PHE n 
1 33   GLN n 
1 34   LYS n 
1 35   GLY n 
1 36   PRO n 
1 37   THR n 
1 38   PRO n 
1 39   ALA n 
1 40   ILE n 
1 41   LEU n 
1 42   GLU n 
1 43   SER n 
1 44   LEU n 
1 45   ILE n 
1 46   SER n 
1 47   ILE n 
1 48   ASN n 
1 49   ASN n 
1 50   LYS n 
1 51   LEU n 
1 52   GLN n 
1 53   GLN n 
1 54   PRO n 
1 55   GLU n 
1 56   ALA n 
1 57   ALA n 
1 58   ALA n 
1 59   GLY n 
1 60   VAL n 
1 61   LEU n 
1 62   GLU n 
1 63   TYR n 
1 64   ALA n 
1 65   MET n 
1 66   LYS n 
1 67   HIS n 
1 68   PHE n 
1 69   GLY n 
1 70   GLU n 
1 71   LEU n 
1 72   GLU n 
1 73   ILE n 
1 74   GLN n 
1 75   ALA n 
1 76   THR n 
1 77   TRP n 
1 78   TYR n 
1 79   GLU n 
1 80   LYS n 
1 81   LEU n 
1 82   HIS n 
1 83   GLU n 
1 84   TRP n 
1 85   GLU n 
1 86   ASP n 
1 87   ALA n 
1 88   LEU n 
1 89   VAL n 
1 90   ALA n 
1 91   TYR n 
1 92   ASP n 
1 93   LYS n 
1 94   LYS n 
1 95   MET n 
1 96   ASP n 
1 97   THR n 
1 98   ASN n 
1 99   LYS n 
1 100  ASP n 
1 101  ASP n 
1 102  PRO n 
1 103  GLU n 
1 104  LEU n 
1 105  MET n 
1 106  LEU n 
1 107  GLY n 
1 108  ARG n 
1 109  MET n 
1 110  ARG n 
1 111  CYS n 
1 112  LEU n 
1 113  GLU n 
1 114  ALA n 
1 115  LEU n 
1 116  GLY n 
1 117  GLU n 
1 118  TRP n 
1 119  GLY n 
1 120  GLN n 
1 121  LEU n 
1 122  HIS n 
1 123  GLN n 
1 124  GLN n 
1 125  CYS n 
1 126  CYS n 
1 127  GLU n 
1 128  LYS n 
1 129  TRP n 
1 130  THR n 
1 131  LEU n 
1 132  VAL n 
1 133  ASN n 
1 134  ASP n 
1 135  GLU n 
1 136  THR n 
1 137  GLN n 
1 138  ALA n 
1 139  LYS n 
1 140  MET n 
1 141  ALA n 
1 142  ARG n 
1 143  MET n 
1 144  ALA n 
1 145  ALA n 
1 146  ALA n 
1 147  ALA n 
1 148  ALA n 
1 149  TRP n 
1 150  GLY n 
1 151  LEU n 
1 152  GLY n 
1 153  GLN n 
1 154  TRP n 
1 155  ASP n 
1 156  SER n 
1 157  MET n 
1 158  GLU n 
1 159  GLU n 
1 160  TYR n 
1 161  THR n 
1 162  CYS n 
1 163  MET n 
1 164  ILE n 
1 165  PRO n 
1 166  ARG n 
1 167  ASP n 
1 168  THR n 
1 169  HIS n 
1 170  ASP n 
1 171  GLY n 
1 172  ALA n 
1 173  PHE n 
1 174  TYR n 
1 175  ARG n 
1 176  ALA n 
1 177  VAL n 
1 178  LEU n 
1 179  ALA n 
1 180  LEU n 
1 181  HIS n 
1 182  GLN n 
1 183  ASP n 
1 184  LEU n 
1 185  PHE n 
1 186  SER n 
1 187  LEU n 
1 188  ALA n 
1 189  GLN n 
1 190  GLN n 
1 191  CYS n 
1 192  ILE n 
1 193  ASP n 
1 194  LYS n 
1 195  ALA n 
1 196  ARG n 
1 197  ASP n 
1 198  LEU n 
1 199  LEU n 
1 200  ASP n 
1 201  ALA n 
1 202  GLU n 
1 203  LEU n 
1 204  THR n 
1 205  ALA n 
1 206  MET n 
1 207  ALA n 
1 208  GLY n 
1 209  GLU n 
1 210  SER n 
1 211  TYR n 
1 212  SER n 
1 213  ARG n 
1 214  ALA n 
1 215  TYR n 
1 216  GLY n 
1 217  ALA n 
1 218  MET n 
1 219  VAL n 
1 220  SER n 
1 221  CYS n 
1 222  HIS n 
1 223  MET n 
1 224  LEU n 
1 225  SER n 
1 226  GLU n 
1 227  LEU n 
1 228  GLU n 
1 229  GLU n 
1 230  VAL n 
1 231  ILE n 
1 232  GLN n 
1 233  TYR n 
1 234  LYS n 
1 235  LEU n 
1 236  VAL n 
1 237  PRO n 
1 238  GLU n 
1 239  ARG n 
1 240  ARG n 
1 241  GLU n 
1 242  ILE n 
1 243  ILE n 
1 244  ARG n 
1 245  GLN n 
1 246  ILE n 
1 247  TRP n 
1 248  TRP n 
1 249  GLU n 
1 250  ARG n 
1 251  LEU n 
1 252  GLN n 
1 253  GLY n 
1 254  CYS n 
1 255  GLN n 
1 256  ARG n 
1 257  ILE n 
1 258  VAL n 
1 259  GLU n 
1 260  ASP n 
1 261  TRP n 
1 262  GLN n 
1 263  LYS n 
1 264  ILE n 
1 265  LEU n 
1 266  MET n 
1 267  VAL n 
1 268  ARG n 
1 269  SER n 
1 270  LEU n 
1 271  VAL n 
1 272  VAL n 
1 273  SER n 
1 274  PRO n 
1 275  HIS n 
1 276  GLU n 
1 277  ASP n 
1 278  MET n 
1 279  ARG n 
1 280  THR n 
1 281  TRP n 
1 282  LEU n 
1 283  LYS n 
1 284  TYR n 
1 285  ALA n 
1 286  SER n 
1 287  LEU n 
1 288  CYS n 
1 289  GLY n 
1 290  LYS n 
1 291  SER n 
1 292  GLY n 
1 293  ARG n 
1 294  LEU n 
1 295  ALA n 
1 296  LEU n 
1 297  ALA n 
1 298  HIS n 
1 299  LYS n 
1 300  THR n 
1 301  LEU n 
1 302  VAL n 
1 303  LEU n 
1 304  LEU n 
1 305  LEU n 
1 306  GLY n 
1 307  VAL n 
1 308  ASP n 
1 309  PRO n 
1 310  SER n 
1 311  ARG n 
1 312  GLN n 
1 313  LEU n 
1 314  ASP n 
1 315  HIS n 
1 316  PRO n 
1 317  LEU n 
1 318  PRO n 
1 319  THR n 
1 320  VAL n 
1 321  HIS n 
1 322  PRO n 
1 323  GLN n 
1 324  VAL n 
1 325  THR n 
1 326  TYR n 
1 327  ALA n 
1 328  TYR n 
1 329  MET n 
1 330  LYS n 
1 331  ASN n 
1 332  MET n 
1 333  TRP n 
1 334  LYS n 
1 335  SER n 
1 336  ALA n 
1 337  ARG n 
1 338  LYS n 
1 339  ILE n 
1 340  ASP n 
1 341  ALA n 
1 342  PHE n 
1 343  GLN n 
1 344  HIS n 
1 345  MET n 
1 346  GLN n 
1 347  HIS n 
1 348  PHE n 
1 349  VAL n 
1 350  GLN n 
1 351  THR n 
1 352  MET n 
1 353  GLN n 
1 354  GLN n 
1 355  GLN n 
1 356  ALA n 
1 357  GLN n 
1 358  HIS n 
1 359  ALA n 
1 360  ILE n 
1 361  ALA n 
1 362  THR n 
1 363  GLU n 
1 364  ASP n 
1 365  GLN n 
1 366  GLN n 
1 367  HIS n 
1 368  LYS n 
1 369  GLN n 
1 370  GLU n 
1 371  LEU n 
1 372  HIS n 
1 373  LYS n 
1 374  LEU n 
1 375  MET n 
1 376  ALA n 
1 377  ARG n 
1 378  CYS n 
1 379  PHE n 
1 380  LEU n 
1 381  LYS n 
1 382  LEU n 
1 383  GLY n 
1 384  GLU n 
1 385  TRP n 
1 386  GLN n 
1 387  LEU n 
1 388  ASN n 
1 389  LEU n 
1 390  GLN n 
1 391  GLY n 
1 392  ILE n 
1 393  ASN n 
1 394  GLU n 
1 395  SER n 
1 396  THR n 
1 397  ILE n 
1 398  PRO n 
1 399  LYS n 
1 400  VAL n 
1 401  LEU n 
1 402  GLN n 
1 403  TYR n 
1 404  TYR n 
1 405  SER n 
1 406  ALA n 
1 407  ALA n 
1 408  THR n 
1 409  GLU n 
1 410  HIS n 
1 411  ASP n 
1 412  ARG n 
1 413  SER n 
1 414  TRP n 
1 415  TYR n 
1 416  LYS n 
1 417  ALA n 
1 418  TRP n 
1 419  HIS n 
1 420  ALA n 
1 421  TRP n 
1 422  ALA n 
1 423  VAL n 
1 424  MET n 
1 425  ASN n 
1 426  PHE n 
1 427  GLU n 
1 428  ALA n 
1 429  VAL n 
1 430  LEU n 
1 431  HIS n 
1 432  TYR n 
1 433  LYS n 
1 434  HIS n 
1 435  GLN n 
1 436  ASN n 
1 437  GLN n 
1 438  ALA n 
1 439  ARG n 
1 440  ASP n 
1 441  GLU n 
1 442  LYS n 
1 443  LYS n 
1 444  LYS n 
1 445  LEU n 
1 446  ARG n 
1 447  HIS n 
1 448  ALA n 
1 449  SER n 
1 450  GLY n 
1 451  ALA n 
1 452  ASN n 
1 453  ILE n 
1 454  THR n 
1 455  ASN n 
1 456  ALA n 
1 457  THR n 
1 458  THR n 
1 459  ALA n 
1 460  ALA n 
1 461  THR n 
1 462  THR n 
1 463  ALA n 
1 464  ALA n 
1 465  THR n 
1 466  ALA n 
1 467  THR n 
1 468  THR n 
1 469  THR n 
1 470  ALA n 
1 471  SER n 
1 472  THR n 
1 473  GLU n 
1 474  GLY n 
1 475  SER n 
1 476  ASN n 
1 477  SER n 
1 478  GLU n 
1 479  SER n 
1 480  GLU n 
1 481  ALA n 
1 482  GLU n 
1 483  SER n 
1 484  THR n 
1 485  GLU n 
1 486  ASN n 
1 487  SER n 
1 488  PRO n 
1 489  THR n 
1 490  PRO n 
1 491  SER n 
1 492  PRO n 
1 493  LEU n 
1 494  GLN n 
1 495  LYS n 
1 496  LYS n 
1 497  VAL n 
1 498  THR n 
1 499  GLU n 
1 500  ASP n 
1 501  LEU n 
1 502  SER n 
1 503  LYS n 
1 504  THR n 
1 505  LEU n 
1 506  LEU n 
1 507  MET n 
1 508  TYR n 
1 509  THR n 
1 510  VAL n 
1 511  PRO n 
1 512  ALA n 
1 513  VAL n 
1 514  GLN n 
1 515  GLY n 
1 516  PHE n 
1 517  PHE n 
1 518  ARG n 
1 519  SER n 
1 520  ILE n 
1 521  SER n 
1 522  LEU n 
1 523  SER n 
1 524  ARG n 
1 525  GLY n 
1 526  ASN n 
1 527  ASN n 
1 528  LEU n 
1 529  GLN n 
1 530  ASP n 
1 531  THR n 
1 532  LEU n 
1 533  ARG n 
1 534  VAL n 
1 535  LEU n 
1 536  THR n 
1 537  LEU n 
1 538  TRP n 
1 539  PHE n 
1 540  ASP n 
1 541  TYR n 
1 542  GLY n 
1 543  HIS n 
1 544  TRP n 
1 545  PRO n 
1 546  ASP n 
1 547  VAL n 
1 548  ASN n 
1 549  GLU n 
1 550  ALA n 
1 551  LEU n 
1 552  VAL n 
1 553  GLU n 
1 554  GLY n 
1 555  VAL n 
1 556  LYS n 
1 557  ALA n 
1 558  ILE n 
1 559  GLN n 
1 560  ILE n 
1 561  ASP n 
1 562  THR n 
1 563  TRP n 
1 564  LEU n 
1 565  GLN n 
1 566  VAL n 
1 567  ILE n 
1 568  PRO n 
1 569  GLN n 
1 570  LEU n 
1 571  ILE n 
1 572  ALA n 
1 573  ARG n 
1 574  ILE n 
1 575  ASP n 
1 576  THR n 
1 577  PRO n 
1 578  ARG n 
1 579  PRO n 
1 580  LEU n 
1 581  VAL n 
1 582  GLY n 
1 583  ARG n 
1 584  LEU n 
1 585  ILE n 
1 586  HIS n 
1 587  GLN n 
1 588  LEU n 
1 589  LEU n 
1 590  THR n 
1 591  ASP n 
1 592  ILE n 
1 593  GLY n 
1 594  ARG n 
1 595  TYR n 
1 596  HIS n 
1 597  PRO n 
1 598  GLN n 
1 599  ALA n 
1 600  LEU n 
1 601  ILE n 
1 602  TYR n 
1 603  PRO n 
1 604  LEU n 
1 605  THR n 
1 606  VAL n 
1 607  ALA n 
1 608  SER n 
1 609  LYS n 
1 610  SER n 
1 611  THR n 
1 612  THR n 
1 613  THR n 
1 614  ALA n 
1 615  ARG n 
1 616  HIS n 
1 617  ASN n 
1 618  ALA n 
1 619  ALA n 
1 620  ASN n 
1 621  LYS n 
1 622  ILE n 
1 623  LEU n 
1 624  LYS n 
1 625  ASN n 
1 626  MET n 
1 627  CYS n 
1 628  GLU n 
1 629  HIS n 
1 630  SER n 
1 631  ASN n 
1 632  THR n 
1 633  LEU n 
1 634  VAL n 
1 635  GLN n 
1 636  GLN n 
1 637  ALA n 
1 638  MET n 
1 639  MET n 
1 640  VAL n 
1 641  SER n 
1 642  GLU n 
1 643  GLU n 
1 644  LEU n 
1 645  ILE n 
1 646  ARG n 
1 647  VAL n 
1 648  ALA n 
1 649  ILE n 
1 650  LEU n 
1 651  TRP n 
1 652  HIS n 
1 653  GLU n 
1 654  MET n 
1 655  TRP n 
1 656  HIS n 
1 657  GLU n 
1 658  GLY n 
1 659  LEU n 
1 660  GLU n 
1 661  GLU n 
1 662  ALA n 
1 663  SER n 
1 664  ARG n 
1 665  LEU n 
1 666  TYR n 
1 667  PHE n 
1 668  GLY n 
1 669  GLU n 
1 670  ARG n 
1 671  ASN n 
1 672  VAL n 
1 673  LYS n 
1 674  GLY n 
1 675  MET n 
1 676  PHE n 
1 677  GLU n 
1 678  VAL n 
1 679  LEU n 
1 680  GLU n 
1 681  PRO n 
1 682  LEU n 
1 683  HIS n 
1 684  ALA n 
1 685  MET n 
1 686  MET n 
1 687  GLU n 
1 688  ARG n 
1 689  GLY n 
1 690  PRO n 
1 691  GLN n 
1 692  THR n 
1 693  LEU n 
1 694  LYS n 
1 695  GLU n 
1 696  THR n 
1 697  SER n 
1 698  PHE n 
1 699  ASN n 
1 700  GLN n 
1 701  ALA n 
1 702  TYR n 
1 703  GLY n 
1 704  ARG n 
1 705  ASP n 
1 706  LEU n 
1 707  MET n 
1 708  GLU n 
1 709  ALA n 
1 710  GLN n 
1 711  GLU n 
1 712  TRP n 
1 713  CYS n 
1 714  ARG n 
1 715  LYS n 
1 716  TYR n 
1 717  MET n 
1 718  LYS n 
1 719  SER n 
1 720  GLY n 
1 721  ASN n 
1 722  VAL n 
1 723  LYS n 
1 724  ASP n 
1 725  LEU n 
1 726  THR n 
1 727  GLN n 
1 728  ALA n 
1 729  TRP n 
1 730  ASP n 
1 731  LEU n 
1 732  TYR n 
1 733  TYR n 
1 734  HIS n 
1 735  VAL n 
1 736  PHE n 
1 737  ARG n 
1 738  ARG n 
1 739  ILE n 
1 740  SER n 
1 741  LYS n 
1 742  GLN n 
1 743  LEU n 
1 744  PRO n 
1 745  GLN n 
1 746  LEU n 
1 747  THR n 
1 748  SER n 
1 749  LEU n 
1 750  GLU n 
1 751  LEU n 
1 752  GLN n 
1 753  TYR n 
1 754  VAL n 
1 755  SER n 
1 756  PRO n 
1 757  LYS n 
1 758  LEU n 
1 759  LEU n 
1 760  MET n 
1 761  CYS n 
1 762  ARG n 
1 763  ASP n 
1 764  LEU n 
1 765  GLU n 
1 766  LEU n 
1 767  ALA n 
1 768  VAL n 
1 769  PRO n 
1 770  GLY n 
1 771  THR n 
1 772  TYR n 
1 773  ASP n 
1 774  PRO n 
1 775  ASN n 
1 776  GLN n 
1 777  PRO n 
1 778  ILE n 
1 779  ILE n 
1 780  ARG n 
1 781  ILE n 
1 782  GLN n 
1 783  SER n 
1 784  ILE n 
1 785  ALA n 
1 786  PRO n 
1 787  SER n 
1 788  LEU n 
1 789  GLN n 
1 790  VAL n 
1 791  ILE n 
1 792  THR n 
1 793  SER n 
1 794  LYS n 
1 795  GLN n 
1 796  ARG n 
1 797  PRO n 
1 798  ARG n 
1 799  LYS n 
1 800  LEU n 
1 801  THR n 
1 802  LEU n 
1 803  MET n 
1 804  GLY n 
1 805  SER n 
1 806  ASN n 
1 807  GLY n 
1 808  HIS n 
1 809  GLU n 
1 810  PHE n 
1 811  VAL n 
1 812  PHE n 
1 813  LEU n 
1 814  LEU n 
1 815  LYS n 
1 816  GLY n 
1 817  HIS n 
1 818  GLU n 
1 819  ASP n 
1 820  LEU n 
1 821  ARG n 
1 822  GLN n 
1 823  ASP n 
1 824  GLU n 
1 825  ARG n 
1 826  VAL n 
1 827  MET n 
1 828  GLN n 
1 829  LEU n 
1 830  PHE n 
1 831  GLY n 
1 832  LEU n 
1 833  VAL n 
1 834  ASN n 
1 835  THR n 
1 836  LEU n 
1 837  LEU n 
1 838  ALA n 
1 839  ASN n 
1 840  ASP n 
1 841  PRO n 
1 842  THR n 
1 843  SER n 
1 844  LEU n 
1 845  ARG n 
1 846  LYS n 
1 847  ASN n 
1 848  LEU n 
1 849  SER n 
1 850  ILE n 
1 851  GLN n 
1 852  ARG n 
1 853  TYR n 
1 854  ALA n 
1 855  VAL n 
1 856  ILE n 
1 857  PRO n 
1 858  LEU n 
1 859  SER n 
1 860  THR n 
1 861  ASN n 
1 862  SER n 
1 863  GLY n 
1 864  LEU n 
1 865  ILE n 
1 866  GLY n 
1 867  TRP n 
1 868  VAL n 
1 869  PRO n 
1 870  HIS n 
1 871  CYS n 
1 872  ASP n 
1 873  THR n 
1 874  LEU n 
1 875  HIS n 
1 876  ALA n 
1 877  LEU n 
1 878  ILE n 
1 879  ARG n 
1 880  ASP n 
1 881  TYR n 
1 882  ARG n 
1 883  GLU n 
1 884  LYS n 
1 885  LYS n 
1 886  LYS n 
1 887  ILE n 
1 888  LEU n 
1 889  LEU n 
1 890  ASN n 
1 891  ILE n 
1 892  GLU n 
1 893  HIS n 
1 894  ARG n 
1 895  ILE n 
1 896  MET n 
1 897  LEU n 
1 898  ARG n 
1 899  MET n 
1 900  ALA n 
1 901  PRO n 
1 902  ASP n 
1 903  TYR n 
1 904  ASP n 
1 905  HIS n 
1 906  LEU n 
1 907  THR n 
1 908  LEU n 
1 909  MET n 
1 910  GLN n 
1 911  LYS n 
1 912  VAL n 
1 913  GLU n 
1 914  VAL n 
1 915  PHE n 
1 916  GLU n 
1 917  HIS n 
1 918  ALA n 
1 919  VAL n 
1 920  ASN n 
1 921  ASN n 
1 922  THR n 
1 923  ALA n 
1 924  GLY n 
1 925  ASP n 
1 926  ASP n 
1 927  LEU n 
1 928  ALA n 
1 929  LYS n 
1 930  LEU n 
1 931  LEU n 
1 932  TRP n 
1 933  LEU n 
1 934  LYS n 
1 935  SER n 
1 936  PRO n 
1 937  SER n 
1 938  SER n 
1 939  GLU n 
1 940  VAL n 
1 941  TRP n 
1 942  PHE n 
1 943  ASP n 
1 944  ARG n 
1 945  ARG n 
1 946  THR n 
1 947  ASN n 
1 948  TYR n 
1 949  THR n 
1 950  ARG n 
1 951  SER n 
1 952  LEU n 
1 953  ALA n 
1 954  VAL n 
1 955  MET n 
1 956  SER n 
1 957  MET n 
1 958  VAL n 
1 959  GLY n 
1 960  TYR n 
1 961  ILE n 
1 962  LEU n 
1 963  GLY n 
1 964  LEU n 
1 965  GLY n 
1 966  ASP n 
1 967  ARG n 
1 968  HIS n 
1 969  PRO n 
1 970  SER n 
1 971  ASN n 
1 972  LEU n 
1 973  MET n 
1 974  LEU n 
1 975  ASP n 
1 976  ARG n 
1 977  LEU n 
1 978  SER n 
1 979  GLY n 
1 980  LYS n 
1 981  ILE n 
1 982  LEU n 
1 983  HIS n 
1 984  ILE n 
1 985  ASP n 
1 986  PHE n 
1 987  GLY n 
1 988  ASP n 
1 989  CYS n 
1 990  PHE n 
1 991  GLU n 
1 992  VAL n 
1 993  ALA n 
1 994  MET n 
1 995  THR n 
1 996  ARG n 
1 997  GLU n 
1 998  LYS n 
1 999  PHE n 
1 1000 PRO n 
1 1001 GLU n 
1 1002 LYS n 
1 1003 ILE n 
1 1004 PRO n 
1 1005 PHE n 
1 1006 ARG n 
1 1007 LEU n 
1 1008 THR n 
1 1009 ARG n 
1 1010 MET n 
1 1011 LEU n 
1 1012 THR n 
1 1013 ASN n 
1 1014 ALA n 
1 1015 MET n 
1 1016 GLU n 
1 1017 VAL n 
1 1018 THR n 
1 1019 GLY n 
1 1020 LEU n 
1 1021 ASP n 
1 1022 GLY n 
1 1023 ASN n 
1 1024 TYR n 
1 1025 ARG n 
1 1026 ILE n 
1 1027 THR n 
1 1028 CYS n 
1 1029 HIS n 
1 1030 THR n 
1 1031 VAL n 
1 1032 MET n 
1 1033 GLU n 
1 1034 VAL n 
1 1035 LEU n 
1 1036 ARG n 
1 1037 GLU n 
1 1038 HIS n 
1 1039 LYS n 
1 1040 ASP n 
1 1041 SER n 
1 1042 VAL n 
1 1043 MET n 
1 1044 ALA n 
1 1045 VAL n 
1 1046 LEU n 
1 1047 GLU n 
1 1048 ALA n 
1 1049 PHE n 
1 1050 VAL n 
1 1051 TYR n 
1 1052 ASP n 
1 1053 PRO n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASN n 
1 1057 TRP n 
1 1058 ARG n 
1 1059 LEU n 
1 1060 MET n 
1 1061 ASP n 
1 1062 THR n 
1 1063 ASN n 
1 1064 THR n 
1 1065 LYS n 
1 1066 GLY n 
1 1067 ASN n 
1 1068 LYS n 
1 1069 ARG n 
1 1070 SER n 
1 1071 ARG n 
1 1072 THR n 
1 1073 ARG n 
1 1074 THR n 
1 1075 ASP n 
1 1076 SER n 
1 1077 TYR n 
1 1078 SER n 
1 1079 ALA n 
1 1080 GLY n 
1 1081 GLN n 
1 1082 SER n 
1 1083 VAL n 
1 1084 GLU n 
1 1085 ILE n 
1 1086 LEU n 
1 1087 ASP n 
1 1088 GLY n 
1 1089 VAL n 
1 1090 GLU n 
1 1091 LEU n 
1 1092 GLY n 
1 1093 GLU n 
1 1094 PRO n 
1 1095 ALA n 
1 1096 HIS n 
1 1097 LYS n 
1 1098 LYS n 
1 1099 THR n 
1 1100 GLY n 
1 1101 THR n 
1 1102 THR n 
1 1103 VAL n 
1 1104 PRO n 
1 1105 GLU n 
1 1106 SER n 
1 1107 ILE n 
1 1108 HIS n 
1 1109 SER n 
1 1110 PHE n 
1 1111 ILE n 
1 1112 GLY n 
1 1113 ASP n 
1 1114 GLY n 
1 1115 LEU n 
1 1116 VAL n 
1 1117 LYS n 
1 1118 PRO n 
1 1119 GLU n 
1 1120 ALA n 
1 1121 LEU n 
1 1122 ASN n 
1 1123 LYS n 
1 1124 LYS n 
1 1125 ALA n 
1 1126 ILE n 
1 1127 GLN n 
1 1128 ILE n 
1 1129 ILE n 
1 1130 ASN n 
1 1131 ARG n 
1 1132 VAL n 
1 1133 ARG n 
1 1134 ASP n 
1 1135 LYS n 
1 1136 LEU n 
1 1137 THR n 
1 1138 GLY n 
1 1139 ARG n 
1 1140 ASP n 
1 1141 PHE n 
1 1142 SER n 
1 1143 HIS n 
1 1144 ASP n 
1 1145 ASP n 
1 1146 THR n 
1 1147 LEU n 
1 1148 ASP n 
1 1149 VAL n 
1 1150 PRO n 
1 1151 THR n 
1 1152 GLN n 
1 1153 VAL n 
1 1154 GLU n 
1 1155 LEU n 
1 1156 LEU n 
1 1157 ILE n 
1 1158 LYS n 
1 1159 GLN n 
1 1160 ALA n 
1 1161 THR n 
1 1162 SER n 
1 1163 HIS n 
1 1164 GLU n 
1 1165 ASN n 
1 1166 LEU n 
1 1167 CYS n 
1 1168 GLN n 
1 1169 CYS n 
1 1170 TYR n 
1 1171 ILE n 
1 1172 GLY n 
1 1173 TRP n 
1 1174 CYS n 
1 1175 PRO n 
1 1176 PHE n 
1 1177 TRP n 
2 1    GLY n 
2 2    SER n 
2 3    MET n 
2 4    ASN n 
2 5    THR n 
2 6    SER n 
2 7    PRO n 
2 8    GLY n 
2 9    THR n 
2 10   VAL n 
2 11   GLY n 
2 12   SER n 
2 13   ASP n 
2 14   PRO n 
2 15   VAL n 
2 16   ILE n 
2 17   LEU n 
2 18   ALA n 
2 19   THR n 
2 20   ALA n 
2 21   GLY n 
2 22   TYR n 
2 23   ASP n 
2 24   HIS n 
2 25   THR n 
2 26   VAL n 
2 27   ARG n 
2 28   PHE n 
2 29   TRP n 
2 30   GLN n 
2 31   ALA n 
2 32   HIS n 
2 33   SER n 
2 34   GLY n 
2 35   ILE n 
2 36   CYS n 
2 37   THR n 
2 38   ARG n 
2 39   THR n 
2 40   VAL n 
2 41   GLN n 
2 42   HIS n 
2 43   GLN n 
2 44   ASP n 
2 45   SER n 
2 46   GLN n 
2 47   VAL n 
2 48   ASN n 
2 49   ALA n 
2 50   LEU n 
2 51   GLU n 
2 52   VAL n 
2 53   THR n 
2 54   PRO n 
2 55   ASP n 
2 56   ARG n 
2 57   SER n 
2 58   MET n 
2 59   ILE n 
2 60   ALA n 
2 61   ALA n 
2 62   ALA n 
2 63   GLY n 
2 64   TYR n 
2 65   GLN n 
2 66   HIS n 
2 67   ILE n 
2 68   ARG n 
2 69   MET n 
2 70   TYR n 
2 71   ASP n 
2 72   LEU n 
2 73   ASN n 
2 74   SER n 
2 75   ASN n 
2 76   ASN n 
2 77   PRO n 
2 78   ASN n 
2 79   PRO n 
2 80   ILE n 
2 81   ILE n 
2 82   SER n 
2 83   TYR n 
2 84   ASP n 
2 85   GLY n 
2 86   VAL n 
2 87   ASN n 
2 88   LYS n 
2 89   ASN n 
2 90   ILE n 
2 91   ALA n 
2 92   SER n 
2 93   VAL n 
2 94   GLY n 
2 95   PHE n 
2 96   HIS n 
2 97   GLU n 
2 98   ASP n 
2 99   GLY n 
2 100  ARG n 
2 101  TRP n 
2 102  MET n 
2 103  TYR n 
2 104  THR n 
2 105  GLY n 
2 106  GLY n 
2 107  GLU n 
2 108  ASP n 
2 109  CYS n 
2 110  THR n 
2 111  ALA n 
2 112  ARG n 
2 113  ILE n 
2 114  TRP n 
2 115  ASP n 
2 116  LEU n 
2 117  ARG n 
2 118  SER n 
2 119  ARG n 
2 120  ASN n 
2 121  LEU n 
2 122  GLN n 
2 123  CYS n 
2 124  GLN n 
2 125  ARG n 
2 126  ILE n 
2 127  PHE n 
2 128  GLN n 
2 129  VAL n 
2 130  ASN n 
2 131  ALA n 
2 132  PRO n 
2 133  ILE n 
2 134  ASN n 
2 135  CYS n 
2 136  VAL n 
2 137  CYS n 
2 138  LEU n 
2 139  HIS n 
2 140  PRO n 
2 141  ASN n 
2 142  GLN n 
2 143  ALA n 
2 144  GLU n 
2 145  LEU n 
2 146  ILE n 
2 147  VAL n 
2 148  GLY n 
2 149  ASP n 
2 150  GLN n 
2 151  SER n 
2 152  GLY n 
2 153  ALA n 
2 154  ILE n 
2 155  HIS n 
2 156  ILE n 
2 157  TRP n 
2 158  ASP n 
2 159  LEU n 
2 160  LYS n 
2 161  THR n 
2 162  ASP n 
2 163  HIS n 
2 164  ASN n 
2 165  GLU n 
2 166  GLN n 
2 167  LEU n 
2 168  ILE n 
2 169  PRO n 
2 170  GLU n 
2 171  PRO n 
2 172  GLU n 
2 173  VAL n 
2 174  SER n 
2 175  ILE n 
2 176  THR n 
2 177  SER n 
2 178  ALA n 
2 179  HIS n 
2 180  ILE n 
2 181  ASP n 
2 182  PRO n 
2 183  ASP n 
2 184  ALA n 
2 185  SER n 
2 186  TYR n 
2 187  MET n 
2 188  ALA n 
2 189  ALA n 
2 190  VAL n 
2 191  ASN n 
2 192  SER n 
2 193  THR n 
2 194  GLY n 
2 195  ASN n 
2 196  CYS n 
2 197  TYR n 
2 198  VAL n 
2 199  TRP n 
2 200  ASN n 
2 201  LEU n 
2 202  THR n 
2 203  GLY n 
2 204  GLY n 
2 205  ILE n 
2 206  GLY n 
2 207  ASP n 
2 208  GLU n 
2 209  VAL n 
2 210  THR n 
2 211  GLN n 
2 212  LEU n 
2 213  ILE n 
2 214  PRO n 
2 215  LYS n 
2 216  THR n 
2 217  LYS n 
2 218  ILE n 
2 219  PRO n 
2 220  ALA n 
2 221  HIS n 
2 222  THR n 
2 223  ARG n 
2 224  TYR n 
2 225  ALA n 
2 226  LEU n 
2 227  GLN n 
2 228  CYS n 
2 229  ARG n 
2 230  PHE n 
2 231  SER n 
2 232  PRO n 
2 233  ASP n 
2 234  SER n 
2 235  THR n 
2 236  LEU n 
2 237  LEU n 
2 238  ALA n 
2 239  THR n 
2 240  CYS n 
2 241  SER n 
2 242  ALA n 
2 243  ASP n 
2 244  GLN n 
2 245  THR n 
2 246  CYS n 
2 247  LYS n 
2 248  ILE n 
2 249  TRP n 
2 250  ARG n 
2 251  THR n 
2 252  SER n 
2 253  ASN n 
2 254  PHE n 
2 255  SER n 
2 256  LEU n 
2 257  MET n 
2 258  THR n 
2 259  GLU n 
2 260  LEU n 
2 261  SER n 
2 262  ILE n 
2 263  LYS n 
2 264  SER n 
2 265  GLY n 
2 266  ASN n 
2 267  PRO n 
2 268  GLY n 
2 269  GLU n 
2 270  SER n 
2 271  SER n 
2 272  ARG n 
2 273  GLY n 
2 274  TRP n 
2 275  MET n 
2 276  TRP n 
2 277  GLY n 
2 278  CYS n 
2 279  ALA n 
2 280  PHE n 
2 281  SER n 
2 282  GLY n 
2 283  ASP n 
2 284  SER n 
2 285  GLN n 
2 286  TYR n 
2 287  ILE n 
2 288  VAL n 
2 289  THR n 
2 290  ALA n 
2 291  SER n 
2 292  SER n 
2 293  ASP n 
2 294  ASN n 
2 295  LEU n 
2 296  ALA n 
2 297  ARG n 
2 298  LEU n 
2 299  TRP n 
2 300  CYS n 
2 301  VAL n 
2 302  GLU n 
2 303  THR n 
2 304  GLY n 
2 305  GLU n 
2 306  ILE n 
2 307  LYS n 
2 308  ARG n 
2 309  GLU n 
2 310  TYR n 
2 311  GLY n 
2 312  GLY n 
2 313  HIS n 
2 314  GLN n 
2 315  LYS n 
2 316  ALA n 
2 317  VAL n 
2 318  VAL n 
2 319  CYS n 
2 320  LEU n 
2 321  ALA n 
2 322  PHE n 
2 323  ASN n 
2 324  ASP n 
2 325  SER n 
2 326  VAL n 
2 327  LEU n 
2 328  GLY n 
3 1    GLY n 
3 2    SER n 
3 3    GLY n 
3 4    ARG n 
3 5    GLU n 
3 6    THR n 
3 7    SER n 
3 8    GLY n 
3 9    GLU n 
3 10   GLN n 
3 11   LEU n 
3 12   GLY n 
3 13   ILE n 
3 14   SER n 
3 15   ASP n 
3 16   ASN n 
3 17   GLY n 
3 18   GLY n 
3 19   LEU n 
3 20   PHE n 
3 21   VAL n 
3 22   MET n 
3 23   ASP n 
3 24   GLU n 
3 25   ASP n 
3 26   ALA n 
3 27   THR n 
3 28   LEU n 
3 29   GLN n 
3 30   ASP n 
3 31   LEU n 
3 32   PRO n 
3 33   PRO n 
3 34   PHE n 
3 35   CYS n 
3 36   GLU n 
3 37   SER n 
3 38   ASP n 
3 39   PRO n 
3 40   GLU n 
3 41   SER n 
3 42   THR n 
3 43   ASP n 
3 44   ASP n 
3 45   GLY n 
3 46   SER n 
3 47   LEU n 
3 48   SER n 
3 49   GLU n 
3 50   GLU n 
3 51   THR n 
3 52   PRO n 
3 53   ALA n 
3 54   GLY n 
3 55   PRO n 
3 56   PRO n 
3 57   THR n 
3 58   CYS n 
3 59   SER n 
3 60   VAL n 
3 61   PRO n 
3 62   PRO n 
3 63   ALA n 
3 64   SER n 
3 65   ALA n 
3 66   LEU n 
3 67   PRO n 
3 68   THR n 
3 69   GLN n 
3 70   GLN n 
3 71   TYR n 
3 72   ALA n 
3 73   LYS n 
3 74   SER n 
3 75   LEU n 
3 76   PRO n 
3 77   VAL n 
3 78   SER n 
3 79   VAL n 
3 80   PRO n 
3 81   VAL n 
3 82   TRP n 
3 83   GLY n 
3 84   PHE n 
3 85   LYS n 
3 86   GLU n 
3 87   LYS n 
3 88   ARG n 
3 89   THR n 
3 90   GLU n 
3 91   ALA n 
3 92   ARG n 
3 93   SER n 
3 94   SER n 
3 95   ASP n 
3 96   GLU n 
3 97   GLU n 
3 98   ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 1177 Human ? 'MTOR, FRAP, FRAP1, FRAP2, RAFT1, RAPT1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? HEK293 ? ? ? ? ? ? ? ? ? ?    ? ? 
2 1 sample 'Biological sequence' 1 328  Human ? 'MLST8, GBL, LST8'                       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? HEK293 ? ? ? ? ? ? ? ? ? ?    ? ? 
3 1 sample 'Biological sequence' 1 98   Human ? 'AKT1S1, PRAS40'                         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? ? ?      ? ? ? ? ? ? ? ? ? pET2 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MTOR_HUMAN  P42345 ? 1 
;DDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHE
WEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCM
IPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREII
RQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQ
VTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQY
YSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAES
TENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTW
LQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEE
LIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVK
DLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLM
GSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYRE
KKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILG
LGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVM
AVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNK
KAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
;
1376 
2 UNP LST8_HUMAN  Q9BVC4 ? 2 
;MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIIS
YDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTD
HNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAF
NDSVLG
;
1    
3 UNP AKTS1_HUMAN Q96B36 ? 3 
;ETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGF
KEKRTEARSSDEEN
;
114  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WBY B 4 ? 1177 ? P42345 1376 ? 2549 ? 1376 2549 
2 2 5WBY D 3 ? 328  ? Q9BVC4 1    ? 326  ? 1    326  
3 1 5WBY A 4 ? 1177 ? P42345 1376 ? 2549 ? 1376 2549 
4 2 5WBY C 3 ? 328  ? Q9BVC4 1    ? 326  ? 1    326  
5 3 5WBY P 5 ? 98   ? Q96B36 114  ? 207  ? 114  207  
6 3 5WBY O 5 ? 98   ? Q96B36 114  ? 207  ? 114  207  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WBY GLY B 1 ? UNP P42345 ? ? 'expression tag' 1373 1  
1 5WBY THR B 2 ? UNP P42345 ? ? 'expression tag' 1374 2  
1 5WBY GLY B 3 ? UNP P42345 ? ? 'expression tag' 1375 3  
2 5WBY GLY D 1 ? UNP Q9BVC4 ? ? 'expression tag' -1   4  
2 5WBY SER D 2 ? UNP Q9BVC4 ? ? 'expression tag' 0    5  
3 5WBY GLY A 1 ? UNP P42345 ? ? 'expression tag' 1373 6  
3 5WBY THR A 2 ? UNP P42345 ? ? 'expression tag' 1374 7  
3 5WBY GLY A 3 ? UNP P42345 ? ? 'expression tag' 1375 8  
4 5WBY GLY C 1 ? UNP Q9BVC4 ? ? 'expression tag' -1   9  
4 5WBY SER C 2 ? UNP Q9BVC4 ? ? 'expression tag' 0    10 
5 5WBY GLY P 1 ? UNP Q96B36 ? ? 'expression tag' 110  11 
5 5WBY SER P 2 ? UNP Q96B36 ? ? 'expression tag' 111  12 
5 5WBY GLY P 3 ? UNP Q96B36 ? ? 'expression tag' 112  13 
5 5WBY ARG P 4 ? UNP Q96B36 ? ? 'expression tag' 113  14 
6 5WBY GLY O 1 ? UNP Q96B36 ? ? 'expression tag' 110  15 
6 5WBY SER O 2 ? UNP Q96B36 ? ? 'expression tag' 111  16 
6 5WBY GLY O 3 ? UNP Q96B36 ? ? 'expression tag' 112  17 
6 5WBY ARG O 4 ? UNP Q96B36 ? ? 'expression tag' 113  18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WBY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.23 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.91 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.304 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    tacsimate 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97920 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97920 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5WBY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.1 
_reflns.d_resolution_low                 80.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       71263 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.200 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.900 
_reflns.pdbx_Rmerge_I_obs                0.113 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.556 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.131 
_reflns.pdbx_Rpim_I_all                  0.064 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         278987 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.1   3.110  ? ? ? ? ? ? 7126 98.500 ? ? ? ? 0.692 ? ? ? ? ? ? ? ? 4.000 ? 0.555 ? ? 0.798 0.386 ? 1  1 0.826 ? 
3.110 3.230  ? ? ? ? ? ? ?    98.300 ? ? ? ? 0.475 ? ? ? ? ? ? ? ? 3.900 ? 0.565 ? ? 0.550 0.269 ? 2  1 0.895 ? 
3.230 3.380  ? ? ? ? ? ? ?    96.900 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 3.700 ? 0.568 ? ? 0.395 0.199 ? 3  1 0.938 ? 
3.380 3.560  ? ? ? ? ? ? ?    97.500 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 3.900 ? 0.558 ? ? 0.288 0.141 ? 4  1 0.964 ? 
3.560 3.780  ? ? ? ? ? ? ?    98.100 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 4.000 ? 0.554 ? ? 0.193 0.093 ? 5  1 0.982 ? 
3.780 4.070  ? ? ? ? ? ? ?    97.900 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 4.000 ? 0.556 ? ? 0.128 0.062 ? 6  1 0.990 ? 
4.070 4.480  ? ? ? ? ? ? ?    96.300 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 3.800 ? 0.560 ? ? 0.094 0.047 ? 7  1 0.994 ? 
4.480 5.130  ? ? ? ? ? ? ?    97.200 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 4.100 ? 0.555 ? ? 0.091 0.044 ? 8  1 0.995 ? 
5.130 6.460  ? ? ? ? ? ? ?    97.300 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 3.900 ? 0.551 ? ? 0.081 0.040 ? 9  1 0.996 ? 
6.460 80.000 ? ? ? ? ? ? ?    94.500 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 3.900 ? 0.541 ? ? 0.038 0.019 ? 10 1 0.998 ? 
# 
_refine.aniso_B[1][1]                            -0.89 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -4.64 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            5.54 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               98.723 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.928 
_refine.correlation_coeff_Fo_to_Fc_free          0.903 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5WBY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.10 
_refine.ls_d_res_low                             50.01 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     69072 
_refine.ls_number_reflns_R_free                  1707 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    82.54 
_refine.ls_percent_reflns_R_free                 2.4 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.23390 
_refine.ls_R_factor_R_free                       0.27587 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.23287 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4JSN 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.522 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             0.90 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             54.095 
_refine.overall_SU_ML                            0.436 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        22243 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               22243 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        50.01 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  0.019  22757 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  20893 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.148  1.941  30849 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.901  3.000  48454 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.290  5.000  2753  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 37.153 23.963 1090  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.330 15.000 4008  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 11.396 15.000 157   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.064  0.200  3386  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  25139 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  4662  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.869  2.326  11045 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.869  2.326  11044 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 4.892  4.647  13787 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.892  4.648  13788 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.913  2.413  11712 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.913  2.413  11713 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.030  4.772  17063 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 7.811  51.858 25048 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 7.811  51.863 25049 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 10 10 1  ? 0.01  0.05  ? ? A 419  'tight positional'  
'X-RAY DIFFRACTION' 11 11 2  ? 0.01  0.05  ? ? A 120  'tight positional'  
'X-RAY DIFFRACTION' 12 12 3  ? 0.01  0.05  ? ? A 556  'tight positional'  
'X-RAY DIFFRACTION' 13 13 4  ? 0.01  0.05  ? ? A 439  'tight positional'  
'X-RAY DIFFRACTION' 14 14 5  ? 0.01  0.05  ? ? A 131  'tight positional'  
'X-RAY DIFFRACTION' 15 15 6  ? 0.01  0.05  ? ? A 169  'tight positional'  
'X-RAY DIFFRACTION' 16 16 7  ? 0.01  0.05  ? ? A 1500 'tight positional'  
'X-RAY DIFFRACTION' 17 17 8  ? 0.01  0.05  ? ? C 1866 'tight positional'  
'X-RAY DIFFRACTION' 18 18 9  ? 0.00  0.05  ? ? O 58   'tight positional'  
'X-RAY DIFFRACTION' 1  1  10 ? 0.01  0.50  ? ? A 556  'medium positional' 
'X-RAY DIFFRACTION' 2  2  11 ? 0.01  0.50  ? ? A 627  'medium positional' 
'X-RAY DIFFRACTION' 3  3  12 ? 0.01  0.50  ? ? A 280  'medium positional' 
'X-RAY DIFFRACTION' 4  4  13 ? 0.01  0.50  ? ? A 387  'medium positional' 
'X-RAY DIFFRACTION' 5  5  14 ? 0.01  0.50  ? ? A 226  'medium positional' 
'X-RAY DIFFRACTION' 6  6  15 ? 0.01  0.50  ? ? A 727  'medium positional' 
'X-RAY DIFFRACTION' 7  7  16 ? 0.01  0.50  ? ? A 545  'medium positional' 
'X-RAY DIFFRACTION' 8  8  17 ? 0.01  0.50  ? ? A 816  'medium positional' 
'X-RAY DIFFRACTION' 9  9  18 ? 0.01  0.50  ? ? A 634  'medium positional' 
'X-RAY DIFFRACTION' 10 10 19 ? 0.01  0.50  ? ? A 710  'medium positional' 
'X-RAY DIFFRACTION' 11 11 20 ? 0.01  0.50  ? ? A 187  'medium positional' 
'X-RAY DIFFRACTION' 12 12 21 ? 0.01  0.50  ? ? A 980  'medium positional' 
'X-RAY DIFFRACTION' 13 13 22 ? 0.01  0.50  ? ? A 744  'medium positional' 
'X-RAY DIFFRACTION' 14 14 23 ? 0.01  0.50  ? ? A 216  'medium positional' 
'X-RAY DIFFRACTION' 15 15 24 ? 0.01  0.50  ? ? A 281  'medium positional' 
'X-RAY DIFFRACTION' 16 16 25 ? 0.01  0.50  ? ? A 2552 'medium positional' 
'X-RAY DIFFRACTION' 17 17 26 ? 0.01  0.50  ? ? C 2783 'medium positional' 
'X-RAY DIFFRACTION' 18 18 27 ? 0.01  0.50  ? ? O 110  'medium positional' 
'X-RAY DIFFRACTION' 1  1  28 ? 3.13  99.00 ? ? A 342  'tight thermal'     
'X-RAY DIFFRACTION' 2  2  29 ? 11.12 99.00 ? ? A 368  'tight thermal'     
'X-RAY DIFFRACTION' 3  3  30 ? 12.02 99.00 ? ? A 195  'tight thermal'     
'X-RAY DIFFRACTION' 4  4  31 ? 9.90  99.00 ? ? A 256  'tight thermal'     
'X-RAY DIFFRACTION' 5  5  32 ? 8.32  99.00 ? ? A 149  'tight thermal'     
'X-RAY DIFFRACTION' 6  6  33 ? 6.71  99.00 ? ? A 397  'tight thermal'     
'X-RAY DIFFRACTION' 7  7  34 ? 3.43  99.00 ? ? A 332  'tight thermal'     
'X-RAY DIFFRACTION' 8  8  35 ? 3.50  99.00 ? ? A 477  'tight thermal'     
'X-RAY DIFFRACTION' 9  9  36 ? 2.47  99.00 ? ? A 378  'tight thermal'     
'X-RAY DIFFRACTION' 10 10 37 ? 2.72  99.00 ? ? A 419  'tight thermal'     
'X-RAY DIFFRACTION' 11 11 38 ? 2.91  99.00 ? ? A 120  'tight thermal'     
'X-RAY DIFFRACTION' 12 12 39 ? 12.55 99.00 ? ? A 556  'tight thermal'     
'X-RAY DIFFRACTION' 13 13 40 ? 4.09  99.00 ? ? A 439  'tight thermal'     
'X-RAY DIFFRACTION' 14 14 41 ? 2.90  99.00 ? ? A 131  'tight thermal'     
'X-RAY DIFFRACTION' 15 15 42 ? 2.93  99.00 ? ? A 169  'tight thermal'     
'X-RAY DIFFRACTION' 16 16 43 ? 3.98  99.00 ? ? A 1500 'tight thermal'     
'X-RAY DIFFRACTION' 17 17 44 ? 4.40  99.00 ? ? C 1866 'tight thermal'     
'X-RAY DIFFRACTION' 18 18 45 ? 7.56  99.00 ? ? O 58   'tight thermal'     
'X-RAY DIFFRACTION' 1  1  46 ? 4.00  99.00 ? ? A 556  'medium thermal'    
'X-RAY DIFFRACTION' 2  2  47 ? 10.98 99.00 ? ? A 627  'medium thermal'    
'X-RAY DIFFRACTION' 3  3  48 ? 11.04 99.00 ? ? A 280  'medium thermal'    
'X-RAY DIFFRACTION' 4  4  49 ? 8.32  99.00 ? ? A 387  'medium thermal'    
'X-RAY DIFFRACTION' 5  5  50 ? 10.03 99.00 ? ? A 226  'medium thermal'    
'X-RAY DIFFRACTION' 6  6  51 ? 7.89  99.00 ? ? A 727  'medium thermal'    
'X-RAY DIFFRACTION' 7  7  52 ? 3.86  99.00 ? ? A 545  'medium thermal'    
'X-RAY DIFFRACTION' 8  8  53 ? 4.09  99.00 ? ? A 816  'medium thermal'    
'X-RAY DIFFRACTION' 9  9  54 ? 2.94  99.00 ? ? A 634  'medium thermal'    
'X-RAY DIFFRACTION' 10 10 55 ? 3.85  99.00 ? ? A 710  'medium thermal'    
'X-RAY DIFFRACTION' 11 11 56 ? 3.19  99.00 ? ? A 187  'medium thermal'    
'X-RAY DIFFRACTION' 12 12 57 ? 11.39 99.00 ? ? A 980  'medium thermal'    
'X-RAY DIFFRACTION' 13 13 58 ? 3.77  99.00 ? ? A 744  'medium thermal'    
'X-RAY DIFFRACTION' 14 14 59 ? 4.17  99.00 ? ? A 216  'medium thermal'    
'X-RAY DIFFRACTION' 15 15 60 ? 3.27  99.00 ? ? A 281  'medium thermal'    
'X-RAY DIFFRACTION' 16 16 61 ? 4.65  99.00 ? ? A 2552 'medium thermal'    
'X-RAY DIFFRACTION' 17 17 62 ? 4.81  99.00 ? ? C 2783 'medium thermal'    
'X-RAY DIFFRACTION' 18 18 63 ? 7.80  99.00 ? ? O 110  'medium thermal'    
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.100 
_refine_ls_shell.d_res_low                        3.180 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             54 
_refine_ls_shell.number_reflns_R_work             2082 
_refine_ls_shell.percent_reflns_obs               34.31 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.412 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.355 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_oper.code 
_struct_ncs_oper.id 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
_struct_ncs_oper.details 
given 1  1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 2  0.999973 -0.007384 0.000186  -0.007386 -0.999823 0.017318  0.000058  -0.017319 -0.999850 -69.721687 -31.597900 
-102.920921 ? 
given 3  1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 4  0.999676 -0.012174 -0.022333 -0.011942 -0.999873 0.010510  -0.022458 -0.010240 -0.999695 -71.616333 -31.806530 
-100.876343 ? 
given 5  1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 6  0.999834 -0.006294 -0.017069 -0.006308 -0.999980 -0.000781 -0.017064 0.000889  -0.999854 -70.896301 -33.261791 
-100.962967 ? 
given 7  1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 8  0.999633 -0.020611 -0.017579 -0.020801 -0.999726 -0.010739 -0.017353 0.011101  -0.999788 -71.454193 -33.158482 
-100.762711 ? 
given 9  1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 10 0.999792 0.004595  -0.019854 0.004865  -0.999896 0.013548  -0.019790 -0.013642 -0.999711 -71.016693 -32.980350 
-101.174683 ? 
given 11 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 12 0.999847 0.007430  -0.015861 0.007578  -0.999928 0.009288  -0.015791 -0.009407 -0.999831 -70.589417 -33.776451 
-101.101448 ? 
given 13 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 14 0.999770 0.020708  -0.005645 0.020927  -0.998899 0.041993  -0.004769 -0.042101 -0.999102 -69.571709 -32.411030 
-102.542084 ? 
given 15 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 16 0.999949 0.005613  -0.008454 0.005913  -0.999340 0.035846  -0.008247 -0.035894 -0.999322 -69.747383 -31.278950 
-102.332062 ? 
given 17 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 18 0.999991 0.003362  -0.002580 0.003420  -0.999736 0.022699  -0.002503 -0.022708 -0.999739 -69.431091 -31.621099 
-103.195023 ? 
given 19 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 20 0.999986 0.004790  -0.002046 0.004825  -0.999835 0.017532  -0.001962 -0.017542 -0.999844 -69.400627 -31.935209 
-103.386292 ? 
given 21 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 22 0.999960 0.008668  0.002178  0.008613  -0.999672 0.024131  0.002386  -0.024111 -0.999706 -69.312927 -31.887529 
-103.477966 ? 
given 23 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 24 0.999829 0.013438  -0.012708 0.013793  -0.999505 0.028265  -0.012322 -0.028436 -0.999520 -69.912338 -31.873739 
-102.915489 ? 
given 25 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 26 0.999966 0.008156  0.001065  0.008131  -0.999718 0.022324  0.001247  -0.022315 -0.999750 -69.340233 -31.894831 
-103.455849 ? 
given 27 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 28 0.999999 0.001063  0.000381  0.001052  -0.999588 0.028693  0.000411  -0.028693 -0.999588 -69.293953 -31.253920 
-103.345261 ? 
given 29 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 30 0.999959 0.007712  -0.004753 0.007873  -0.999364 0.034765  -0.004482 -0.034801 -0.999384 -69.590233 -31.381359 
-102.991798 ? 
given 31 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 32 0.999949 0.010037  -0.000649 0.010048  -0.999736 0.020651  -0.000442 -0.020657 -0.999786 -69.316872 -32.359402 
-103.135262 ? 
given 33 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 34 0.999955 0.004915  0.008095  0.004914  -0.999988 0.000132  0.008095  -0.000092 -0.999967 -69.155327 -32.978680 
-103.127113 ? 
given 35 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 ? 
given 36 0.998327 -0.034430 0.046460  -0.034160 -0.999395 -0.006587 0.046659  0.004989  -0.998898 -69.001007 -29.431280 
-106.350609 ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 B 1  
2 A 1  
1 B 2  
2 A 2  
1 B 3  
2 A 3  
1 B 4  
2 A 4  
1 B 5  
2 A 5  
1 B 6  
2 A 6  
1 B 7  
2 A 7  
1 B 8  
2 A 8  
1 B 9  
2 A 9  
1 B 10 
2 A 10 
1 B 11 
2 A 11 
1 B 12 
2 A 12 
1 B 13 
2 A 13 
1 B 14 
2 A 14 
1 B 15 
2 A 15 
1 B 16 
2 A 16 
1 D 17 
2 C 17 
1 P 18 
2 O 18 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 B 1385 B 1442 1 2 ? ? ? ? ? ? ? ? 1  ? 
2 A 1385 A 1442 1 2 ? ? ? ? ? ? ? ? 1  ? 
1 B 1443 B 1504 1 2 ? ? ? ? ? ? ? ? 2  ? 
2 A 1443 A 1504 1 2 ? ? ? ? ? ? ? ? 2  ? 
1 B 1505 B 1537 1 2 ? ? ? ? ? ? ? ? 3  ? 
2 A 1505 A 1537 1 2 ? ? ? ? ? ? ? ? 3  ? 
1 B 1538 B 1580 1 2 ? ? ? ? ? ? ? ? 4  ? 
2 A 1538 A 1580 1 2 ? ? ? ? ? ? ? ? 4  ? 
1 B 1581 B 1605 1 2 ? ? ? ? ? ? ? ? 5  ? 
2 A 1581 A 1605 1 2 ? ? ? ? ? ? ? ? 5  ? 
1 B 1612 B 1678 1 2 ? ? ? ? ? ? ? ? 6  ? 
2 A 1612 A 1678 1 2 ? ? ? ? ? ? ? ? 6  ? 
1 B 1679 B 1734 1 2 ? ? ? ? ? ? ? ? 7  ? 
2 A 1679 A 1734 1 2 ? ? ? ? ? ? ? ? 7  ? 
1 B 1735 B 1814 1 2 ? ? ? ? ? ? ? ? 8  ? 
2 A 1735 A 1814 1 2 ? ? ? ? ? ? ? ? 8  ? 
1 B 1867 B 1930 1 2 ? ? ? ? ? ? ? ? 9  ? 
2 A 1867 A 1930 1 2 ? ? ? ? ? ? ? ? 9  ? 
1 B 1931 B 2001 1 2 ? ? ? ? ? ? ? ? 10 ? 
2 A 1931 A 2001 1 2 ? ? ? ? ? ? ? ? 10 ? 
1 B 2002 B 2021 1 2 ? ? ? ? ? ? ? ? 11 ? 
2 A 2002 A 2021 1 2 ? ? ? ? ? ? ? ? 11 ? 
1 B 2022 B 2115 1 2 ? ? ? ? ? ? ? ? 12 ? 
2 A 2022 A 2115 1 2 ? ? ? ? ? ? ? ? 12 ? 
1 B 2116 B 2190 1 2 ? ? ? ? ? ? ? ? 13 ? 
2 A 2116 A 2190 1 2 ? ? ? ? ? ? ? ? 13 ? 
1 B 2191 B 2212 1 2 ? ? ? ? ? ? ? ? 14 ? 
2 A 2191 A 2212 1 2 ? ? ? ? ? ? ? ? 14 ? 
1 B 2213 B 2241 1 2 ? ? ? ? ? ? ? ? 15 ? 
2 A 2213 A 2241 1 2 ? ? ? ? ? ? ? ? 15 ? 
1 B 2242 B 2549 1 2 ? ? ? ? ? ? ? ? 16 ? 
2 A 2242 A 2549 1 2 ? ? ? ? ? ? ? ? 16 ? 
1 D 8    D 324  1 2 ? ? ? ? ? ? ? ? 17 ? 
2 C 8    C 324  1 2 ? ? ? ? ? ? ? ? 17 ? 
1 P 187  P 196  1 2 ? ? ? ? ? ? ? ? 18 ? 
2 O 187  O 196  1 2 ? ? ? ? ? ? ? ? 18 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
16 ? 
17 ? 
18 ? 
# 
_struct.entry_id                     5WBY 
_struct.title                        'Crystal structure of mTOR(deltaN)-mLST8-PRAS40(beta-strand) complex' 
_struct.pdbx_descriptor              
'Serine/threonine-protein kinase mTOR (E.C.2.7.11.1), Target of rapamycin complex subunit LST8, Proline-rich AKT1 substrate 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WBY 
_struct_keywords.text            'WD40, PRAS40 beta, complex, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLU A 13   ? GLY A 35   ? GLU B 1385 GLY B 1407 1 ? 23 
HELX_P HELX_P2   AA2 THR A 37   ? LYS A 50   ? THR B 1409 LYS B 1422 1 ? 14 
HELX_P HELX_P3   AA3 GLN A 53   ? PHE A 68   ? GLN B 1425 PHE B 1440 1 ? 16 
HELX_P HELX_P4   AA4 ILE A 73   ? LEU A 81   ? ILE B 1445 LEU B 1453 1 ? 9  
HELX_P HELX_P5   AA5 GLU A 83   ? ASN A 98   ? GLU B 1455 ASN B 1470 1 ? 16 
HELX_P HELX_P6   AA6 ASP A 101  ? GLY A 116  ? ASP B 1473 GLY B 1488 1 ? 16 
HELX_P HELX_P7   AA7 GLU A 117  ? GLU A 127  ? GLU B 1489 GLU B 1499 1 ? 11 
HELX_P HELX_P8   AA8 ASN A 133  ? GLY A 152  ? ASN B 1505 GLY B 1524 1 ? 20 
HELX_P HELX_P9   AA9 GLN A 153  ? ILE A 164  ? GLN B 1525 ILE B 1536 1 ? 12 
HELX_P HELX_P10  AB1 THR A 168  ? GLN A 182  ? THR B 1540 GLN B 1554 1 ? 15 
HELX_P HELX_P11  AB2 LEU A 184  ? MET A 206  ? LEU B 1556 MET B 1578 1 ? 23 
HELX_P HELX_P12  AB3 ALA A 214  ? LYS A 234  ? ALA B 1586 LYS B 1606 1 ? 21 
HELX_P HELX_P13  AB4 ARG A 240  ? GLY A 253  ? ARG B 1612 GLY B 1625 1 ? 14 
HELX_P HELX_P14  AB5 ILE A 257  ? SER A 269  ? ILE B 1629 SER B 1641 1 ? 13 
HELX_P HELX_P15  AB6 ASP A 277  ? GLY A 292  ? ASP B 1649 GLY B 1664 1 ? 16 
HELX_P HELX_P16  AB7 ARG A 293  ? GLY A 306  ? ARG B 1665 GLY B 1678 1 ? 14 
HELX_P HELX_P17  AB8 HIS A 321  ? SER A 335  ? HIS B 1693 SER B 1707 1 ? 15 
HELX_P HELX_P18  AB9 ARG A 337  ? HIS A 358  ? ARG B 1709 HIS B 1730 1 ? 22 
HELX_P HELX_P19  AC1 GLN A 365  ? GLN A 390  ? GLN B 1737 GLN B 1762 1 ? 26 
HELX_P HELX_P20  AC2 SER A 395  ? ASP A 411  ? SER B 1767 ASP B 1783 1 ? 17 
HELX_P HELX_P21  AC3 TRP A 414  ? LYS A 442  ? TRP B 1786 LYS B 1814 1 ? 29 
HELX_P HELX_P22  AC4 LYS A 496  ? LEU A 522  ? LYS B 1868 LEU B 1894 1 ? 27 
HELX_P HELX_P23  AC5 ASN A 527  ? GLY A 542  ? ASN B 1899 GLY B 1914 1 ? 16 
HELX_P HELX_P24  AC6 TRP A 544  ? ILE A 558  ? TRP B 1916 ILE B 1930 1 ? 15 
HELX_P HELX_P25  AC7 GLN A 559  ? GLN A 565  ? GLN B 1931 GLN B 1937 5 ? 7  
HELX_P HELX_P26  AC8 VAL A 566  ? ALA A 572  ? VAL B 1938 ALA B 1944 1 ? 7  
HELX_P HELX_P27  AC9 ARG A 578  ? TYR A 595  ? ARG B 1950 TYR B 1967 1 ? 18 
HELX_P HELX_P28  AD1 HIS A 596  ? ALA A 599  ? HIS B 1968 ALA B 1971 5 ? 4  
HELX_P HELX_P29  AD2 LEU A 600  ? LYS A 609  ? LEU B 1972 LYS B 1981 1 ? 10 
HELX_P HELX_P30  AD3 THR A 612  ? ILE A 649  ? THR B 1984 ILE B 2021 1 ? 38 
HELX_P HELX_P31  AD4 LEU A 650  ? PHE A 667  ? LEU B 2022 PHE B 2039 1 ? 18 
HELX_P HELX_P32  AD5 ASN A 671  ? ARG A 688  ? ASN B 2043 ARG B 2060 1 ? 18 
HELX_P HELX_P33  AD6 THR A 692  ? TYR A 702  ? THR B 2064 TYR B 2074 1 ? 11 
HELX_P HELX_P34  AD7 TYR A 702  ? GLY A 720  ? TYR B 2074 GLY B 2092 1 ? 19 
HELX_P HELX_P35  AD8 ASN A 721  ? LEU A 743  ? ASN B 2093 LEU B 2115 1 ? 23 
HELX_P HELX_P36  AD9 LEU A 751  ? SER A 755  ? LEU B 2123 SER B 2127 1 ? 5  
HELX_P HELX_P37  AE1 SER A 755  ? CYS A 761  ? SER B 2127 CYS B 2133 1 ? 7  
HELX_P HELX_P38  AE2 LEU A 820  ? ASP A 840  ? LEU B 2192 ASP B 2212 1 ? 21 
HELX_P HELX_P39  AE3 ASP A 840  ? LYS A 846  ? ASP B 2212 LYS B 2218 1 ? 7  
HELX_P HELX_P40  AE4 LEU A 874  ? LYS A 885  ? LEU B 2246 LYS B 2257 1 ? 12 
HELX_P HELX_P41  AE5 ASN A 890  ? ALA A 900  ? ASN B 2262 ALA B 2272 1 ? 11 
HELX_P HELX_P42  AE6 ASP A 902  ? LEU A 906  ? ASP B 2274 LEU B 2278 5 ? 5  
HELX_P HELX_P43  AE7 THR A 907  ? ASN A 921  ? THR B 2279 ASN B 2293 1 ? 15 
HELX_P HELX_P44  AE8 ASP A 925  ? SER A 935  ? ASP B 2297 SER B 2307 1 ? 11 
HELX_P HELX_P45  AE9 SER A 937  ? GLY A 963  ? SER B 2309 GLY B 2335 1 ? 27 
HELX_P HELX_P46  AF1 GLU A 991  ? ARG A 996  ? GLU B 2363 ARG B 2368 1 ? 6  
HELX_P HELX_P47  AF2 THR A 1008 ? MET A 1015 ? THR B 2380 MET B 2387 1 ? 8  
HELX_P HELX_P48  AF3 GLY A 1022 ? HIS A 1038 ? GLY B 2394 HIS B 2410 1 ? 17 
HELX_P HELX_P49  AF4 HIS A 1038 ? TYR A 1051 ? HIS B 2410 TYR B 2423 1 ? 14 
HELX_P HELX_P50  AF5 ASN A 1056 ? ASP A 1061 ? ASN B 2428 ASP B 2433 1 ? 6  
HELX_P HELX_P51  AF6 THR A 1062 ? THR A 1064 ? THR B 2434 THR B 2436 5 ? 3  
HELX_P HELX_P52  AF7 LEU A 1121 ? GLY A 1138 ? LEU B 2493 GLY B 2510 1 ? 18 
HELX_P HELX_P53  AF8 ASP A 1148 ? SER A 1162 ? ASP B 2520 SER B 2534 1 ? 15 
HELX_P HELX_P54  AF9 SER A 1162 ? CYS A 1169 ? SER B 2534 CYS B 2541 1 ? 8  
HELX_P HELX_P55  AG1 TYR A 1170 ? CYS A 1174 ? TYR B 2542 CYS B 2546 5 ? 5  
HELX_P HELX_P56  AG2 ARG C 14   ? GLY C 35   ? ARG A 1386 GLY A 1407 1 ? 22 
HELX_P HELX_P57  AG3 THR C 37   ? LYS C 50   ? THR A 1409 LYS A 1422 1 ? 14 
HELX_P HELX_P58  AG4 GLN C 53   ? PHE C 68   ? GLN A 1425 PHE A 1440 1 ? 16 
HELX_P HELX_P59  AG5 ILE C 73   ? LEU C 81   ? ILE A 1445 LEU A 1453 1 ? 9  
HELX_P HELX_P60  AG6 GLU C 83   ? ASN C 98   ? GLU A 1455 ASN A 1470 1 ? 16 
HELX_P HELX_P61  AG7 ASP C 101  ? GLY C 116  ? ASP A 1473 GLY A 1488 1 ? 16 
HELX_P HELX_P62  AG8 GLU C 117  ? GLU C 127  ? GLU A 1489 GLU A 1499 1 ? 11 
HELX_P HELX_P63  AG9 ASN C 133  ? GLY C 152  ? ASN A 1505 GLY A 1524 1 ? 20 
HELX_P HELX_P64  AH1 GLN C 153  ? ILE C 164  ? GLN A 1525 ILE A 1536 1 ? 12 
HELX_P HELX_P65  AH2 THR C 168  ? GLN C 182  ? THR A 1540 GLN A 1554 1 ? 15 
HELX_P HELX_P66  AH3 LEU C 184  ? MET C 206  ? LEU A 1556 MET A 1578 1 ? 23 
HELX_P HELX_P67  AH4 ALA C 214  ? ILE C 231  ? ALA A 1586 ILE A 1603 1 ? 18 
HELX_P HELX_P68  AH5 GLU C 241  ? GLY C 253  ? GLU A 1613 GLY A 1625 1 ? 13 
HELX_P HELX_P69  AH6 ILE C 257  ? SER C 269  ? ILE A 1629 SER A 1641 1 ? 13 
HELX_P HELX_P70  AH7 ASP C 277  ? GLY C 292  ? ASP A 1649 GLY A 1664 1 ? 16 
HELX_P HELX_P71  AH8 ARG C 293  ? GLY C 306  ? ARG A 1665 GLY A 1678 1 ? 14 
HELX_P HELX_P72  AH9 HIS C 321  ? SER C 335  ? HIS A 1693 SER A 1707 1 ? 15 
HELX_P HELX_P73  AI1 ARG C 337  ? HIS C 358  ? ARG A 1709 HIS A 1730 1 ? 22 
HELX_P HELX_P74  AI2 GLN C 365  ? GLN C 390  ? GLN A 1737 GLN A 1762 1 ? 26 
HELX_P HELX_P75  AI3 SER C 395  ? ASP C 411  ? SER A 1767 ASP A 1783 1 ? 17 
HELX_P HELX_P76  AI4 TRP C 414  ? LYS C 442  ? TRP A 1786 LYS A 1814 1 ? 29 
HELX_P HELX_P77  AI5 LYS C 496  ? LEU C 522  ? LYS A 1868 LEU A 1894 1 ? 27 
HELX_P HELX_P78  AI6 ASN C 527  ? GLY C 542  ? ASN A 1899 GLY A 1914 1 ? 16 
HELX_P HELX_P79  AI7 TRP C 544  ? ILE C 558  ? TRP A 1916 ILE A 1930 1 ? 15 
HELX_P HELX_P80  AI8 GLN C 559  ? GLN C 565  ? GLN A 1931 GLN A 1937 5 ? 7  
HELX_P HELX_P81  AI9 VAL C 566  ? ALA C 572  ? VAL A 1938 ALA A 1944 1 ? 7  
HELX_P HELX_P82  AJ1 ARG C 578  ? TYR C 595  ? ARG A 1950 TYR A 1967 1 ? 18 
HELX_P HELX_P83  AJ2 LEU C 600  ? SER C 608  ? LEU A 1972 SER A 1980 1 ? 9  
HELX_P HELX_P84  AJ3 THR C 612  ? ILE C 649  ? THR A 1984 ILE A 2021 1 ? 38 
HELX_P HELX_P85  AJ4 LEU C 650  ? PHE C 667  ? LEU A 2022 PHE A 2039 1 ? 18 
HELX_P HELX_P86  AJ5 ASN C 671  ? ARG C 688  ? ASN A 2043 ARG A 2060 1 ? 18 
HELX_P HELX_P87  AJ6 THR C 692  ? TYR C 702  ? THR A 2064 TYR A 2074 1 ? 11 
HELX_P HELX_P88  AJ7 TYR C 702  ? GLY C 720  ? TYR A 2074 GLY A 2092 1 ? 19 
HELX_P HELX_P89  AJ8 ASN C 721  ? LEU C 743  ? ASN A 2093 LEU A 2115 1 ? 23 
HELX_P HELX_P90  AJ9 LEU C 751  ? SER C 755  ? LEU A 2123 SER A 2127 1 ? 5  
HELX_P HELX_P91  AK1 SER C 755  ? CYS C 761  ? SER A 2127 CYS A 2133 1 ? 7  
HELX_P HELX_P92  AK2 LEU C 820  ? ASP C 840  ? LEU A 2192 ASP A 2212 1 ? 21 
HELX_P HELX_P93  AK3 ASP C 840  ? LYS C 846  ? ASP A 2212 LYS A 2218 1 ? 7  
HELX_P HELX_P94  AK4 LEU C 874  ? LYS C 885  ? LEU A 2246 LYS A 2257 1 ? 12 
HELX_P HELX_P95  AK5 ASN C 890  ? ALA C 900  ? ASN A 2262 ALA A 2272 1 ? 11 
HELX_P HELX_P96  AK6 ASP C 902  ? LEU C 906  ? ASP A 2274 LEU A 2278 5 ? 5  
HELX_P HELX_P97  AK7 THR C 907  ? ASN C 921  ? THR A 2279 ASN A 2293 1 ? 15 
HELX_P HELX_P98  AK8 ASP C 925  ? SER C 935  ? ASP A 2297 SER A 2307 1 ? 11 
HELX_P HELX_P99  AK9 SER C 937  ? GLY C 963  ? SER A 2309 GLY A 2335 1 ? 27 
HELX_P HELX_P100 AL1 GLU C 991  ? ARG C 996  ? GLU A 2363 ARG A 2368 1 ? 6  
HELX_P HELX_P101 AL2 THR C 1008 ? MET C 1015 ? THR A 2380 MET A 2387 1 ? 8  
HELX_P HELX_P102 AL3 GLY C 1022 ? HIS C 1038 ? GLY A 2394 HIS A 2410 1 ? 17 
HELX_P HELX_P103 AL4 HIS C 1038 ? TYR C 1051 ? HIS A 2410 TYR A 2423 1 ? 14 
HELX_P HELX_P104 AL5 ASN C 1056 ? ASP C 1061 ? ASN A 2428 ASP A 2433 1 ? 6  
HELX_P HELX_P105 AL6 THR C 1062 ? THR C 1064 ? THR A 2434 THR A 2436 5 ? 3  
HELX_P HELX_P106 AL7 LEU C 1121 ? GLY C 1138 ? LEU A 2493 GLY A 2510 1 ? 18 
HELX_P HELX_P107 AL8 ASP C 1148 ? SER C 1162 ? ASP A 2520 SER A 2534 1 ? 15 
HELX_P HELX_P108 AL9 SER C 1162 ? CYS C 1169 ? SER A 2534 CYS A 2541 1 ? 8  
HELX_P HELX_P109 AM1 TYR C 1170 ? CYS C 1174 ? TYR A 2542 CYS A 2546 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 3 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 5 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 6 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 5 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? parallel      
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 748 ? GLU A 750 ? SER B 2120 GLU B 2122 
AA1 2 SER A 787 ? VAL A 790 ? SER B 2159 VAL B 2162 
AA1 3 ARG A 798 ? GLY A 804 ? ARG B 2170 GLY B 2176 
AA1 4 ILE A 781 ? ILE A 784 ? ILE B 2153 ILE B 2156 
AA2 1 SER A 748 ? GLU A 750 ? SER B 2120 GLU B 2122 
AA2 2 SER A 787 ? VAL A 790 ? SER B 2159 VAL B 2162 
AA2 3 ARG A 798 ? GLY A 804 ? ARG B 2170 GLY B 2176 
AA2 4 GLU A 809 ? LYS A 815 ? GLU B 2181 LYS B 2187 
AA2 5 GLY A 863 ? GLY A 866 ? GLY B 2235 GLY B 2238 
AA2 6 VAL A 855 ? PRO A 857 ? VAL B 2227 PRO B 2229 
AA3 1 CYS A 871 ? THR A 873 ? CYS B 2243 THR B 2245 
AA3 2 LEU A 972 ? ASP A 975 ? LEU B 2344 ASP B 2347 
AA3 3 ILE A 981 ? HIS A 983 ? ILE B 2353 HIS B 2355 
AA4 1 CYS B 36  ? GLN B 41  ? CYS D 34   GLN D 39   
AA4 2 THR B 25  ? TRP B 29  ? THR D 23   TRP D 27   
AA4 3 VAL B 15  ? GLY B 21  ? VAL D 13   GLY D 19   
AA4 4 VAL B 317 ? ASP B 324 ? VAL D 315  ASP D 322  
AA5 1 ALA B 49  ? VAL B 52  ? ALA D 47   VAL D 50   
AA5 2 MET B 58  ? ALA B 62  ? MET D 56   ALA D 60   
AA5 3 ILE B 67  ? ASP B 71  ? ILE D 65   ASP D 69   
AA5 4 PRO B 79  ? SER B 82  ? PRO D 77   SER D 80   
AA6 1 ILE B 90  ? PHE B 95  ? ILE D 88   PHE D 93   
AA6 2 TRP B 101 ? GLY B 106 ? TRP D 99   GLY D 104  
AA6 3 THR B 110 ? ASP B 115 ? THR D 108  ASP D 113  
AA6 4 ARG B 125 ? GLN B 128 ? ARG D 123  GLN D 126  
AA7 1 ILE B 133 ? LEU B 138 ? ILE D 131  LEU D 136  
AA7 2 GLU B 144 ? ASP B 149 ? GLU D 142  ASP D 147  
AA7 3 ILE B 154 ? ASP B 158 ? ILE D 152  ASP D 156  
AA7 4 ASN B 164 ? ILE B 168 ? ASN D 162  ILE D 166  
AA7 5 VAL E 81  ? TRP E 82  ? VAL P 190  TRP P 191  
AA8 1 ILE B 175 ? ILE B 180 ? ILE D 173  ILE D 178  
AA8 2 TYR B 186 ? ASN B 191 ? TYR D 184  ASN D 189  
AA8 3 CYS B 196 ? LEU B 201 ? CYS D 194  LEU D 199  
AA8 4 LEU B 212 ? ILE B 218 ? LEU D 210  ILE D 216  
AA9 1 ALA B 225 ? PHE B 230 ? ALA D 223  PHE D 228  
AA9 2 LEU B 236 ? SER B 241 ? LEU D 234  SER D 239  
AA9 3 THR B 245 ? ARG B 250 ? THR D 243  ARG D 248  
AA9 4 LEU B 256 ? SER B 261 ? LEU D 254  SER D 259  
AB1 1 MET B 275 ? PHE B 280 ? MET D 273  PHE D 278  
AB1 2 TYR B 286 ? SER B 291 ? TYR D 284  SER D 289  
AB1 3 LEU B 295 ? CYS B 300 ? LEU D 293  CYS D 298  
AB1 4 ILE B 306 ? GLY B 311 ? ILE D 304  GLY D 309  
AB2 1 SER C 748 ? GLU C 750 ? SER A 2120 GLU A 2122 
AB2 2 SER C 787 ? VAL C 790 ? SER A 2159 VAL A 2162 
AB2 3 ARG C 798 ? GLY C 804 ? ARG A 2170 GLY A 2176 
AB2 4 ILE C 781 ? ILE C 784 ? ILE A 2153 ILE A 2156 
AB3 1 SER C 748 ? GLU C 750 ? SER A 2120 GLU A 2122 
AB3 2 SER C 787 ? VAL C 790 ? SER A 2159 VAL A 2162 
AB3 3 ARG C 798 ? GLY C 804 ? ARG A 2170 GLY A 2176 
AB3 4 GLU C 809 ? LYS C 815 ? GLU A 2181 LYS A 2187 
AB3 5 GLY C 863 ? GLY C 866 ? GLY A 2235 GLY A 2238 
AB3 6 VAL C 855 ? PRO C 857 ? VAL A 2227 PRO A 2229 
AB4 1 CYS C 871 ? THR C 873 ? CYS A 2243 THR A 2245 
AB4 2 LEU C 972 ? ASP C 975 ? LEU A 2344 ASP A 2347 
AB4 3 ILE C 981 ? HIS C 983 ? ILE A 2353 HIS A 2355 
AB5 1 CYS D 36  ? GLN D 41  ? CYS C 34   GLN C 39   
AB5 2 THR D 25  ? TRP D 29  ? THR C 23   TRP C 27   
AB5 3 VAL D 15  ? GLY D 21  ? VAL C 13   GLY C 19   
AB5 4 VAL D 317 ? ASP D 324 ? VAL C 315  ASP C 322  
AB6 1 ALA D 49  ? VAL D 52  ? ALA C 47   VAL C 50   
AB6 2 MET D 58  ? ALA D 62  ? MET C 56   ALA C 60   
AB6 3 ILE D 67  ? ASP D 71  ? ILE C 65   ASP C 69   
AB6 4 PRO D 79  ? SER D 82  ? PRO C 77   SER C 80   
AB7 1 ILE D 90  ? PHE D 95  ? ILE C 88   PHE C 93   
AB7 2 TRP D 101 ? GLY D 106 ? TRP C 99   GLY C 104  
AB7 3 THR D 110 ? ASP D 115 ? THR C 108  ASP C 113  
AB7 4 ARG D 125 ? GLN D 128 ? ARG C 123  GLN C 126  
AB8 1 ILE D 133 ? LEU D 138 ? ILE C 131  LEU C 136  
AB8 2 GLU D 144 ? ASP D 149 ? GLU C 142  ASP C 147  
AB8 3 ILE D 154 ? ASP D 158 ? ILE C 152  ASP C 156  
AB8 4 ASN D 164 ? ILE D 168 ? ASN C 162  ILE C 166  
AB8 5 VAL F 81  ? TRP F 82  ? VAL O 190  TRP O 191  
AB9 1 ILE D 175 ? ILE D 180 ? ILE C 173  ILE C 178  
AB9 2 TYR D 186 ? ASN D 191 ? TYR C 184  ASN C 189  
AB9 3 CYS D 196 ? LEU D 201 ? CYS C 194  LEU C 199  
AB9 4 LEU D 212 ? ILE D 218 ? LEU C 210  ILE C 216  
AC1 1 ALA D 225 ? PHE D 230 ? ALA C 223  PHE C 228  
AC1 2 LEU D 236 ? SER D 241 ? LEU C 234  SER C 239  
AC1 3 THR D 245 ? ARG D 250 ? THR C 243  ARG C 248  
AC1 4 LEU D 256 ? SER D 261 ? LEU C 254  SER C 259  
AC2 1 MET D 275 ? PHE D 280 ? MET C 273  PHE C 278  
AC2 2 TYR D 286 ? SER D 291 ? TYR C 284  SER C 289  
AC2 3 LEU D 295 ? CYS D 300 ? LEU C 293  CYS C 298  
AC2 4 ILE D 306 ? GLY D 311 ? ILE C 304  GLY C 309  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 749 ? N LEU B 2121 O LEU A 788 ? O LEU B 2160 
AA1 2 3 N GLN A 789 ? N GLN B 2161 O LYS A 799 ? O LYS B 2171 
AA1 3 4 O MET A 803 ? O MET B 2175 N SER A 783 ? N SER B 2155 
AA2 1 2 N LEU A 749 ? N LEU B 2121 O LEU A 788 ? O LEU B 2160 
AA2 2 3 N GLN A 789 ? N GLN B 2161 O LYS A 799 ? O LYS B 2171 
AA2 3 4 N LEU A 800 ? N LEU B 2172 O PHE A 812 ? O PHE B 2184 
AA2 4 5 N LEU A 813 ? N LEU B 2185 O ILE A 865 ? O ILE B 2237 
AA2 5 6 O LEU A 864 ? O LEU B 2236 N ILE A 856 ? N ILE B 2228 
AA3 1 2 N ASP A 872 ? N ASP B 2244 O LEU A 974 ? O LEU B 2346 
AA3 2 3 N MET A 973 ? N MET B 2345 O LEU A 982 ? O LEU B 2354 
AA4 1 2 O ARG B 38  ? O ARG D 36   N PHE B 28  ? N PHE D 26   
AA4 2 3 O ARG B 27  ? O ARG D 25   N THR B 19  ? N THR D 17   
AA4 3 4 N ALA B 18  ? N ALA D 16   O ALA B 321 ? O ALA D 319  
AA5 1 2 N GLU B 51  ? N GLU D 49   O ALA B 60  ? O ALA D 58   
AA5 2 3 N ALA B 61  ? N ALA D 59   O ARG B 68  ? O ARG D 66   
AA5 3 4 N MET B 69  ? N MET D 67   O ILE B 80  ? O ILE D 78   
AA6 1 2 N GLY B 94  ? N GLY D 92   O TYR B 103 ? O TYR D 101  
AA6 2 3 N MET B 102 ? N MET D 100  O TRP B 114 ? O TRP D 112  
AA6 3 4 N ALA B 111 ? N ALA D 109  O PHE B 127 ? O PHE D 125  
AA7 1 2 N CYS B 137 ? N CYS D 135  O ILE B 146 ? O ILE D 144  
AA7 2 3 N VAL B 147 ? N VAL D 145  O HIS B 155 ? O HIS D 153  
AA7 3 4 N ILE B 156 ? N ILE D 154  O GLU B 165 ? O GLU D 163  
AA7 4 5 N ILE B 168 ? N ILE D 166  O VAL E 81  ? O VAL P 190  
AA8 1 2 N HIS B 179 ? N HIS D 177  O ALA B 188 ? O ALA D 186  
AA8 2 3 N MET B 187 ? N MET D 185  O TRP B 199 ? O TRP D 197  
AA8 3 4 N ASN B 200 ? N ASN D 198  O ILE B 213 ? O ILE D 211  
AA9 1 2 N ARG B 229 ? N ARG D 227  O ALA B 238 ? O ALA D 236  
AA9 2 3 N THR B 239 ? N THR D 237  O LYS B 247 ? O LYS D 245  
AA9 3 4 N CYS B 246 ? N CYS D 244  O LEU B 260 ? O LEU D 258  
AB1 1 2 N GLY B 277 ? N GLY D 275  O ALA B 290 ? O ALA D 288  
AB1 2 3 N ILE B 287 ? N ILE D 285  O TRP B 299 ? O TRP D 297  
AB1 3 4 N ALA B 296 ? N ALA D 294  O TYR B 310 ? O TYR D 308  
AB2 1 2 N LEU C 749 ? N LEU A 2121 O LEU C 788 ? O LEU A 2160 
AB2 2 3 N GLN C 789 ? N GLN A 2161 O LYS C 799 ? O LYS A 2171 
AB2 3 4 O MET C 803 ? O MET A 2175 N SER C 783 ? N SER A 2155 
AB3 1 2 N LEU C 749 ? N LEU A 2121 O LEU C 788 ? O LEU A 2160 
AB3 2 3 N GLN C 789 ? N GLN A 2161 O LYS C 799 ? O LYS A 2171 
AB3 3 4 N LEU C 800 ? N LEU A 2172 O PHE C 812 ? O PHE A 2184 
AB3 4 5 N LEU C 813 ? N LEU A 2185 O ILE C 865 ? O ILE A 2237 
AB3 5 6 O LEU C 864 ? O LEU A 2236 N ILE C 856 ? N ILE A 2228 
AB4 1 2 N ASP C 872 ? N ASP A 2244 O LEU C 974 ? O LEU A 2346 
AB4 2 3 N MET C 973 ? N MET A 2345 O LEU C 982 ? O LEU A 2354 
AB5 1 2 O ARG D 38  ? O ARG C 36   N PHE D 28  ? N PHE C 26   
AB5 2 3 O ARG D 27  ? O ARG C 25   N THR D 19  ? N THR C 17   
AB5 3 4 N ALA D 18  ? N ALA C 16   O ALA D 321 ? O ALA C 319  
AB6 1 2 N GLU D 51  ? N GLU C 49   O ALA D 60  ? O ALA C 58   
AB6 2 3 N ALA D 61  ? N ALA C 59   O ARG D 68  ? O ARG C 66   
AB6 3 4 N MET D 69  ? N MET C 67   O ILE D 80  ? O ILE C 78   
AB7 1 2 N GLY D 94  ? N GLY C 92   O TYR D 103 ? O TYR C 101  
AB7 2 3 N MET D 102 ? N MET C 100  O TRP D 114 ? O TRP C 112  
AB7 3 4 N ALA D 111 ? N ALA C 109  O PHE D 127 ? O PHE C 125  
AB8 1 2 N CYS D 137 ? N CYS C 135  O ILE D 146 ? O ILE C 144  
AB8 2 3 N VAL D 147 ? N VAL C 145  O HIS D 155 ? O HIS C 153  
AB8 3 4 N ILE D 156 ? N ILE C 154  O GLU D 165 ? O GLU C 163  
AB8 4 5 N ILE D 168 ? N ILE C 166  O VAL F 81  ? O VAL O 190  
AB9 1 2 N HIS D 179 ? N HIS C 177  O ALA D 188 ? O ALA C 186  
AB9 2 3 N MET D 187 ? N MET C 185  O TRP D 199 ? O TRP C 197  
AB9 3 4 N ASN D 200 ? N ASN C 198  O ILE D 213 ? O ILE C 211  
AC1 1 2 N ARG D 229 ? N ARG C 227  O ALA D 238 ? O ALA C 236  
AC1 2 3 N THR D 239 ? N THR C 237  O LYS D 247 ? O LYS C 245  
AC1 3 4 N CYS D 246 ? N CYS C 244  O LEU D 260 ? O LEU C 258  
AC2 1 2 N GLY D 277 ? N GLY C 275  O ALA D 290 ? O ALA C 288  
AC2 2 3 N ILE D 287 ? N ILE C 285  O TRP D 299 ? O TRP C 297  
AC2 3 4 N ALA D 296 ? N ALA C 294  O TYR D 310 ? O TYR C 308  
# 
_atom_sites.entry_id                    5WBY 
_atom_sites.fract_transf_matrix[1][1]   0.007198 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006133 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004839 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . GLU A 1 13   ? -19.995 -20.065 -16.202  1.00 141.08 ? 1385 GLU B N   1 
ATOM 2     C CA  . GLU A 1 13   ? -19.636 -18.607 -16.199  1.00 141.21 ? 1385 GLU B CA  1 
ATOM 3     C C   . GLU A 1 13   ? -18.584 -18.240 -17.250  1.00 142.31 ? 1385 GLU B C   1 
ATOM 4     O O   . GLU A 1 13   ? -18.814 -17.354 -18.074  1.00 142.78 ? 1385 GLU B O   1 
ATOM 5     C CB  . GLU A 1 13   ? -19.151 -18.157 -14.815  1.00 144.53 ? 1385 GLU B CB  1 
ATOM 6     C CG  . GLU A 1 13   ? -20.254 -18.051 -13.772  1.00 148.45 ? 1385 GLU B CG  1 
ATOM 7     C CD  . GLU A 1 13   ? -19.757 -17.533 -12.431  1.00 153.24 ? 1385 GLU B CD  1 
ATOM 8     O OE1 . GLU A 1 13   ? -18.884 -16.636 -12.411  1.00 152.46 ? 1385 GLU B OE1 1 
ATOM 9     O OE2 . GLU A 1 13   ? -20.246 -18.019 -11.389  1.00 156.63 ? 1385 GLU B OE2 1 
ATOM 10    N N   . ARG A 1 14   ? -17.437 -18.920 -17.208  1.00 146.80 ? 1386 ARG B N   1 
ATOM 11    C CA  . ARG A 1 14   ? -16.285 -18.592 -18.072  1.00 145.75 ? 1386 ARG B CA  1 
ATOM 12    C C   . ARG A 1 14   ? -16.502 -18.817 -19.581  1.00 140.29 ? 1386 ARG B C   1 
ATOM 13    O O   . ARG A 1 14   ? -15.862 -18.152 -20.402  1.00 133.13 ? 1386 ARG B O   1 
ATOM 14    C CB  . ARG A 1 14   ? -15.029 -19.342 -17.606  1.00 150.35 ? 1386 ARG B CB  1 
ATOM 15    C CG  . ARG A 1 14   ? -14.503 -18.878 -16.254  1.00 155.63 ? 1386 ARG B CG  1 
ATOM 16    C CD  . ARG A 1 14   ? -13.070 -19.334 -16.018  1.00 158.91 ? 1386 ARG B CD  1 
ATOM 17    N NE  . ARG A 1 14   ? -12.506 -18.785 -14.784  1.00 163.79 ? 1386 ARG B NE  1 
ATOM 18    C CZ  . ARG A 1 14   ? -11.248 -18.958 -14.368  1.00 166.63 ? 1386 ARG B CZ  1 
ATOM 19    N NH1 . ARG A 1 14   ? -10.379 -19.675 -15.082  1.00 165.72 ? 1386 ARG B NH1 1 
ATOM 20    N NH2 . ARG A 1 14   ? -10.850 -18.407 -13.222  1.00 170.25 ? 1386 ARG B NH2 1 
ATOM 21    N N   . ALA A 1 15   ? -17.389 -19.746 -19.937  1.00 140.08 ? 1387 ALA B N   1 
ATOM 22    C CA  . ALA A 1 15   ? -17.798 -19.946 -21.333  1.00 135.23 ? 1387 ALA B CA  1 
ATOM 23    C C   . ALA A 1 15   ? -18.589 -18.744 -21.874  1.00 131.57 ? 1387 ALA B C   1 
ATOM 24    O O   . ALA A 1 15   ? -18.420 -18.357 -23.031  1.00 126.17 ? 1387 ALA B O   1 
ATOM 25    C CB  . ALA A 1 15   ? -18.620 -21.222 -21.467  1.00 136.20 ? 1387 ALA B CB  1 
ATOM 26    N N   . ALA A 1 16   ? -19.450 -18.171 -21.030  1.00 132.80 ? 1388 ALA B N   1 
ATOM 27    C CA  . ALA A 1 16   ? -20.240 -16.980 -21.378  1.00 129.43 ? 1388 ALA B CA  1 
ATOM 28    C C   . ALA A 1 16   ? -19.431 -15.674 -21.378  1.00 128.88 ? 1388 ALA B C   1 
ATOM 29    O O   . ALA A 1 16   ? -19.885 -14.676 -21.939  1.00 126.96 ? 1388 ALA B O   1 
ATOM 30    C CB  . ALA A 1 16   ? -21.435 -16.848 -20.441  1.00 130.67 ? 1388 ALA B CB  1 
ATOM 31    N N   . LYS A 1 17   ? -18.260 -15.673 -20.736  1.00 132.62 ? 1389 LYS B N   1 
ATOM 32    C CA  . LYS A 1 17   ? -17.390 -14.487 -20.695  1.00 134.90 ? 1389 LYS B CA  1 
ATOM 33    C C   . LYS A 1 17   ? -16.731 -14.197 -22.048  1.00 130.66 ? 1389 LYS B C   1 
ATOM 34    O O   . LYS A 1 17   ? -16.693 -13.043 -22.480  1.00 129.56 ? 1389 LYS B O   1 
ATOM 35    C CB  . LYS A 1 17   ? -16.334 -14.610 -19.585  1.00 139.51 ? 1389 LYS B CB  1 
ATOM 36    C CG  . LYS A 1 17   ? -16.904 -14.382 -18.192  1.00 143.76 ? 1389 LYS B CG  1 
ATOM 37    C CD  . LYS A 1 17   ? -15.886 -14.634 -17.090  1.00 148.60 ? 1389 LYS B CD  1 
ATOM 38    C CE  . LYS A 1 17   ? -16.528 -14.504 -15.715  1.00 154.29 ? 1389 LYS B CE  1 
ATOM 39    N NZ  . LYS A 1 17   ? -15.649 -15.001 -14.621  1.00 159.03 ? 1389 LYS B NZ  1 
ATOM 40    N N   . CYS A 1 18   ? -16.225 -15.239 -22.709  1.00 128.61 ? 1390 CYS B N   1 
ATOM 41    C CA  . CYS A 1 18   ? -15.651 -15.100 -24.057  1.00 124.84 ? 1390 CYS B CA  1 
ATOM 42    C C   . CYS A 1 18   ? -16.704 -14.764 -25.128  1.00 124.55 ? 1390 CYS B C   1 
ATOM 43    O O   . CYS A 1 18   ? -16.376 -14.143 -26.140  1.00 129.23 ? 1390 CYS B O   1 
ATOM 44    C CB  . CYS A 1 18   ? -14.864 -16.358 -24.453  1.00 122.15 ? 1390 CYS B CB  1 
ATOM 45    S SG  . CYS A 1 18   ? -15.862 -17.824 -24.811  1.00 118.88 ? 1390 CYS B SG  1 
ATOM 46    N N   . ARG A 1 19   ? -17.953 -15.177 -24.898  1.00 124.03 ? 1391 ARG B N   1 
ATOM 47    C CA  . ARG A 1 19   ? -19.093 -14.840 -25.771  1.00 121.06 ? 1391 ARG B CA  1 
ATOM 48    C C   . ARG A 1 19   ? -19.353 -13.330 -25.831  1.00 116.35 ? 1391 ARG B C   1 
ATOM 49    O O   . ARG A 1 19   ? -19.587 -12.780 -26.909  1.00 110.99 ? 1391 ARG B O   1 
ATOM 50    C CB  . ARG A 1 19   ? -20.352 -15.560 -25.272  1.00 125.35 ? 1391 ARG B CB  1 
ATOM 51    C CG  . ARG A 1 19   ? -21.608 -15.412 -26.124  1.00 125.55 ? 1391 ARG B CG  1 
ATOM 52    C CD  . ARG A 1 19   ? -22.795 -16.060 -25.417  1.00 131.14 ? 1391 ARG B CD  1 
ATOM 53    N NE  . ARG A 1 19   ? -23.612 -16.913 -26.282  1.00 131.21 ? 1391 ARG B NE  1 
ATOM 54    C CZ  . ARG A 1 19   ? -24.621 -17.680 -25.860  1.00 135.73 ? 1391 ARG B CZ  1 
ATOM 55    N NH1 . ARG A 1 19   ? -24.971 -17.717 -24.572  1.00 141.36 ? 1391 ARG B NH1 1 
ATOM 56    N NH2 . ARG A 1 19   ? -25.295 -18.423 -26.733  1.00 136.39 ? 1391 ARG B NH2 1 
ATOM 57    N N   . ALA A 1 20   ? -19.324 -12.677 -24.670  1.00 116.53 ? 1392 ALA B N   1 
ATOM 58    C CA  . ALA A 1 20   ? -19.515 -11.225 -24.573  1.00 116.88 ? 1392 ALA B CA  1 
ATOM 59    C C   . ALA A 1 20   ? -18.469 -10.449 -25.376  1.00 117.49 ? 1392 ALA B C   1 
ATOM 60    O O   . ALA A 1 20   ? -18.802 -9.475  -26.055  1.00 118.70 ? 1392 ALA B O   1 
ATOM 61    C CB  . ALA A 1 20   ? -19.487 -10.786 -23.116  1.00 119.61 ? 1392 ALA B CB  1 
ATOM 62    N N   . TYR A 1 21   ? -17.214 -10.890 -25.291  1.00 117.87 ? 1393 TYR B N   1 
ATOM 63    C CA  . TYR A 1 21   ? -16.106 -10.283 -26.042  1.00 114.83 ? 1393 TYR B CA  1 
ATOM 64    C C   . TYR A 1 21   ? -16.191 -10.546 -27.553  1.00 106.17 ? 1393 TYR B C   1 
ATOM 65    O O   . TYR A 1 21   ? -15.856 -9.672  -28.355  1.00 102.31 ? 1393 TYR B O   1 
ATOM 66    C CB  . TYR A 1 21   ? -14.753 -10.787 -25.519  1.00 121.15 ? 1393 TYR B CB  1 
ATOM 67    C CG  . TYR A 1 21   ? -14.425 -10.393 -24.086  1.00 128.88 ? 1393 TYR B CG  1 
ATOM 68    C CD1 . TYR A 1 21   ? -14.137 -11.364 -23.121  1.00 131.35 ? 1393 TYR B CD1 1 
ATOM 69    C CD2 . TYR A 1 21   ? -14.383 -9.050  -23.695  1.00 131.49 ? 1393 TYR B CD2 1 
ATOM 70    C CE1 . TYR A 1 21   ? -13.829 -11.011 -21.813  1.00 136.10 ? 1393 TYR B CE1 1 
ATOM 71    C CE2 . TYR A 1 21   ? -14.075 -8.689  -22.388  1.00 135.51 ? 1393 TYR B CE2 1 
ATOM 72    C CZ  . TYR A 1 21   ? -13.799 -9.672  -21.450  1.00 138.28 ? 1393 TYR B CZ  1 
ATOM 73    O OH  . TYR A 1 21   ? -13.493 -9.325  -20.153  1.00 141.54 ? 1393 TYR B OH  1 
ATOM 74    N N   . ALA A 1 22   ? -16.627 -11.748 -27.930  1.00 101.50 ? 1394 ALA B N   1 
ATOM 75    C CA  . ALA A 1 22   ? -16.750 -12.134 -29.341  1.00 96.48  ? 1394 ALA B CA  1 
ATOM 76    C C   . ALA A 1 22   ? -17.818 -11.329 -30.083  1.00 96.60  ? 1394 ALA B C   1 
ATOM 77    O O   . ALA A 1 22   ? -17.611 -10.953 -31.238  1.00 95.08  ? 1394 ALA B O   1 
ATOM 78    C CB  . ALA A 1 22   ? -17.038 -13.623 -29.464  1.00 95.23  ? 1394 ALA B CB  1 
ATOM 79    N N   . LYS A 1 23   ? -18.955 -11.081 -29.428  1.00 100.07 ? 1395 LYS B N   1 
ATOM 80    C CA  . LYS A 1 23   ? -20.017 -10.229 -29.992  1.00 101.51 ? 1395 LYS B CA  1 
ATOM 81    C C   . LYS A 1 23   ? -19.567 -8.769  -30.076  1.00 102.83 ? 1395 LYS B C   1 
ATOM 82    O O   . LYS A 1 23   ? -19.882 -8.072  -31.044  1.00 103.57 ? 1395 LYS B O   1 
ATOM 83    C CB  . LYS A 1 23   ? -21.316 -10.329 -29.176  1.00 101.60 ? 1395 LYS B CB  1 
ATOM 84    C CG  . LYS A 1 23   ? -22.475 -9.521  -29.752  1.00 101.68 ? 1395 LYS B CG  1 
ATOM 85    C CD  . LYS A 1 23   ? -23.821 -9.947  -29.188  1.00 105.87 ? 1395 LYS B CD  1 
ATOM 86    C CE  . LYS A 1 23   ? -24.960 -9.179  -29.842  1.00 108.64 ? 1395 LYS B CE  1 
ATOM 87    N NZ  . LYS A 1 23   ? -26.298 -9.677  -29.418  1.00 112.64 ? 1395 LYS B NZ  1 
ATOM 88    N N   . ALA A 1 24   ? -18.846 -8.315  -29.052  1.00 103.91 ? 1396 ALA B N   1 
ATOM 89    C CA  . ALA A 1 24   ? -18.283 -6.965  -29.032  1.00 103.32 ? 1396 ALA B CA  1 
ATOM 90    C C   . ALA A 1 24   ? -17.200 -6.771  -30.099  1.00 98.52  ? 1396 ALA B C   1 
ATOM 91    O O   . ALA A 1 24   ? -17.062 -5.672  -30.641  1.00 100.16 ? 1396 ALA B O   1 
ATOM 92    C CB  . ALA A 1 24   ? -17.739 -6.638  -27.648  1.00 105.34 ? 1396 ALA B CB  1 
ATOM 93    N N   . LEU A 1 25   ? -16.444 -7.832  -30.393  1.00 93.02  ? 1397 LEU B N   1 
ATOM 94    C CA  . LEU A 1 25   ? -15.471 -7.823  -31.496  1.00 89.64  ? 1397 LEU B CA  1 
ATOM 95    C C   . LEU A 1 25   ? -16.147 -7.584  -32.853  1.00 87.86  ? 1397 LEU B C   1 
ATOM 96    O O   . LEU A 1 25   ? -15.670 -6.762  -33.636  1.00 85.31  ? 1397 LEU B O   1 
ATOM 97    C CB  . LEU A 1 25   ? -14.660 -9.132  -31.528  1.00 87.67  ? 1397 LEU B CB  1 
ATOM 98    C CG  . LEU A 1 25   ? -13.696 -9.386  -32.698  1.00 84.70  ? 1397 LEU B CG  1 
ATOM 99    C CD1 . LEU A 1 25   ? -12.664 -8.278  -32.821  1.00 84.37  ? 1397 LEU B CD1 1 
ATOM 100   C CD2 . LEU A 1 25   ? -13.009 -10.735 -32.549  1.00 83.97  ? 1397 LEU B CD2 1 
ATOM 101   N N   . HIS A 1 26   ? -17.249 -8.294  -33.116  1.00 87.29  ? 1398 HIS B N   1 
ATOM 102   C CA  . HIS A 1 26   ? -17.989 -8.171  -34.385  1.00 87.23  ? 1398 HIS B CA  1 
ATOM 103   C C   . HIS A 1 26   ? -18.375 -6.725  -34.694  1.00 90.22  ? 1398 HIS B C   1 
ATOM 104   O O   . HIS A 1 26   ? -18.154 -6.242  -35.805  1.00 90.96  ? 1398 HIS B O   1 
ATOM 105   C CB  . HIS A 1 26   ? -19.247 -9.053  -34.383  1.00 86.83  ? 1398 HIS B CB  1 
ATOM 106   C CG  . HIS A 1 26   ? -20.099 -8.894  -35.605  1.00 88.32  ? 1398 HIS B CG  1 
ATOM 107   N ND1 . HIS A 1 26   ? -19.752 -9.424  -36.830  1.00 90.10  ? 1398 HIS B ND1 1 
ATOM 108   C CD2 . HIS A 1 26   ? -21.277 -8.254  -35.794  1.00 90.08  ? 1398 HIS B CD2 1 
ATOM 109   C CE1 . HIS A 1 26   ? -20.679 -9.118  -37.720  1.00 91.35  ? 1398 HIS B CE1 1 
ATOM 110   N NE2 . HIS A 1 26   ? -21.617 -8.410  -37.116  1.00 92.00  ? 1398 HIS B NE2 1 
ATOM 111   N N   . TYR A 1 27   ? -18.944 -6.044  -33.703  1.00 95.58  ? 1399 TYR B N   1 
ATOM 112   C CA  . TYR A 1 27   ? -19.339 -4.641  -33.854  1.00 97.90  ? 1399 TYR B CA  1 
ATOM 113   C C   . TYR A 1 27   ? -18.129 -3.700  -33.898  1.00 95.96  ? 1399 TYR B C   1 
ATOM 114   O O   . TYR A 1 27   ? -18.130 -2.736  -34.665  1.00 95.11  ? 1399 TYR B O   1 
ATOM 115   C CB  . TYR A 1 27   ? -20.328 -4.233  -32.752  1.00 101.54 ? 1399 TYR B CB  1 
ATOM 116   C CG  . TYR A 1 27   ? -21.665 -4.946  -32.864  1.00 104.37 ? 1399 TYR B CG  1 
ATOM 117   C CD1 . TYR A 1 27   ? -22.079 -5.865  -31.896  1.00 104.35 ? 1399 TYR B CD1 1 
ATOM 118   C CD2 . TYR A 1 27   ? -22.514 -4.714  -33.953  1.00 106.27 ? 1399 TYR B CD2 1 
ATOM 119   C CE1 . TYR A 1 27   ? -23.300 -6.522  -32.004  1.00 106.07 ? 1399 TYR B CE1 1 
ATOM 120   C CE2 . TYR A 1 27   ? -23.736 -5.367  -34.069  1.00 106.84 ? 1399 TYR B CE2 1 
ATOM 121   C CZ  . TYR A 1 27   ? -24.125 -6.268  -33.094  1.00 106.64 ? 1399 TYR B CZ  1 
ATOM 122   O OH  . TYR A 1 27   ? -25.334 -6.915  -33.207  1.00 107.17 ? 1399 TYR B OH  1 
ATOM 123   N N   . LYS A 1 28   ? -17.101 -3.990  -33.098  1.00 96.11  ? 1400 LYS B N   1 
ATOM 124   C CA  . LYS A 1 28   ? -15.845 -3.220  -33.120  1.00 96.87  ? 1400 LYS B CA  1 
ATOM 125   C C   . LYS A 1 28   ? -15.125 -3.329  -34.473  1.00 96.92  ? 1400 LYS B C   1 
ATOM 126   O O   . LYS A 1 28   ? -14.513 -2.361  -34.930  1.00 100.29 ? 1400 LYS B O   1 
ATOM 127   C CB  . LYS A 1 28   ? -14.915 -3.668  -31.979  1.00 97.14  ? 1400 LYS B CB  1 
ATOM 128   C CG  . LYS A 1 28   ? -13.656 -2.824  -31.774  1.00 98.51  ? 1400 LYS B CG  1 
ATOM 129   C CD  . LYS A 1 28   ? -13.939 -1.419  -31.253  1.00 102.05 ? 1400 LYS B CD  1 
ATOM 130   C CE  . LYS A 1 28   ? -14.289 -1.411  -29.772  1.00 105.84 ? 1400 LYS B CE  1 
ATOM 131   N NZ  . LYS A 1 28   ? -14.560 -0.035  -29.273  1.00 109.25 ? 1400 LYS B NZ  1 
ATOM 132   N N   . GLU A 1 29   ? -15.199 -4.504  -35.099  1.00 93.90  ? 1401 GLU B N   1 
ATOM 133   C CA  . GLU A 1 29   ? -14.695 -4.696  -36.467  1.00 90.49  ? 1401 GLU B CA  1 
ATOM 134   C C   . GLU A 1 29   ? -15.538 -3.955  -37.505  1.00 90.58  ? 1401 GLU B C   1 
ATOM 135   O O   . GLU A 1 29   ? -14.997 -3.347  -38.429  1.00 90.04  ? 1401 GLU B O   1 
ATOM 136   C CB  . GLU A 1 29   ? -14.646 -6.182  -36.832  1.00 87.30  ? 1401 GLU B CB  1 
ATOM 137   C CG  . GLU A 1 29   ? -13.541 -6.956  -36.134  1.00 84.73  ? 1401 GLU B CG  1 
ATOM 138   C CD  . GLU A 1 29   ? -13.309 -8.317  -36.748  1.00 81.27  ? 1401 GLU B CD  1 
ATOM 139   O OE1 . GLU A 1 29   ? -14.265 -8.881  -37.321  1.00 78.95  ? 1401 GLU B OE1 1 
ATOM 140   O OE2 . GLU A 1 29   ? -12.172 -8.824  -36.655  1.00 80.90  ? 1401 GLU B OE2 1 
ATOM 141   N N   . LEU A 1 30   ? -16.860 -4.015  -37.352  1.00 92.15  ? 1402 LEU B N   1 
ATOM 142   C CA  . LEU A 1 30   ? -17.775 -3.322  -38.268  1.00 95.84  ? 1402 LEU B CA  1 
ATOM 143   C C   . LEU A 1 30   ? -17.688 -1.793  -38.095  1.00 98.43  ? 1402 LEU B C   1 
ATOM 144   O O   . LEU A 1 30   ? -18.045 -1.041  -39.006  1.00 101.71 ? 1402 LEU B O   1 
ATOM 145   C CB  . LEU A 1 30   ? -19.217 -3.837  -38.094  1.00 97.50  ? 1402 LEU B CB  1 
ATOM 146   C CG  . LEU A 1 30   ? -20.187 -3.771  -39.284  1.00 101.34 ? 1402 LEU B CG  1 
ATOM 147   C CD1 . LEU A 1 30   ? -19.676 -4.491  -40.529  1.00 100.37 ? 1402 LEU B CD1 1 
ATOM 148   C CD2 . LEU A 1 30   ? -21.525 -4.363  -38.868  1.00 104.66 ? 1402 LEU B CD2 1 
ATOM 149   N N   . GLU A 1 31   ? -17.209 -1.349  -36.930  1.00 98.70  ? 1403 GLU B N   1 
ATOM 150   C CA  . GLU A 1 31   ? -16.831 0.051   -36.705  1.00 100.17 ? 1403 GLU B CA  1 
ATOM 151   C C   . GLU A 1 31   ? -15.571 0.394   -37.506  1.00 97.81  ? 1403 GLU B C   1 
ATOM 152   O O   . GLU A 1 31   ? -15.535 1.406   -38.207  1.00 99.33  ? 1403 GLU B O   1 
ATOM 153   C CB  . GLU A 1 31   ? -16.601 0.315   -35.210  1.00 102.91 ? 1403 GLU B CB  1 
ATOM 154   C CG  . GLU A 1 31   ? -16.667 1.783   -34.808  1.00 109.21 ? 1403 GLU B CG  1 
ATOM 155   C CD  . GLU A 1 31   ? -16.585 2.006   -33.299  1.00 113.83 ? 1403 GLU B CD  1 
ATOM 156   O OE1 . GLU A 1 31   ? -16.050 1.136   -32.572  1.00 112.93 ? 1403 GLU B OE1 1 
ATOM 157   O OE2 . GLU A 1 31   ? -17.056 3.067   -32.833  1.00 115.90 ? 1403 GLU B OE2 1 
ATOM 158   N N   . PHE A 1 32   ? -14.551 -0.459  -37.389  1.00 94.22  ? 1404 PHE B N   1 
ATOM 159   C CA  . PHE A 1 32   ? -13.299 -0.350  -38.163  1.00 93.78  ? 1404 PHE B CA  1 
ATOM 160   C C   . PHE A 1 32   ? -13.552 -0.268  -39.675  1.00 95.13  ? 1404 PHE B C   1 
ATOM 161   O O   . PHE A 1 32   ? -12.859 0.469   -40.378  1.00 93.47  ? 1404 PHE B O   1 
ATOM 162   C CB  . PHE A 1 32   ? -12.375 -1.537  -37.816  1.00 91.33  ? 1404 PHE B CB  1 
ATOM 163   C CG  . PHE A 1 32   ? -11.110 -1.615  -38.633  1.00 91.10  ? 1404 PHE B CG  1 
ATOM 164   C CD1 . PHE A 1 32   ? -9.905  -1.140  -38.125  1.00 92.56  ? 1404 PHE B CD1 1 
ATOM 165   C CD2 . PHE A 1 32   ? -11.111 -2.208  -39.896  1.00 90.39  ? 1404 PHE B CD2 1 
ATOM 166   C CE1 . PHE A 1 32   ? -8.735  -1.230  -38.868  1.00 93.08  ? 1404 PHE B CE1 1 
ATOM 167   C CE2 . PHE A 1 32   ? -9.947  -2.294  -40.644  1.00 91.19  ? 1404 PHE B CE2 1 
ATOM 168   C CZ  . PHE A 1 32   ? -8.756  -1.807  -40.129  1.00 91.93  ? 1404 PHE B CZ  1 
ATOM 169   N N   . GLN A 1 33   ? -14.534 -1.030  -40.160  1.00 99.19  ? 1405 GLN B N   1 
ATOM 170   C CA  . GLN A 1 33   ? -14.948 -0.994  -41.572  1.00 104.66 ? 1405 GLN B CA  1 
ATOM 171   C C   . GLN A 1 33   ? -15.383 0.406   -42.013  1.00 107.51 ? 1405 GLN B C   1 
ATOM 172   O O   . GLN A 1 33   ? -14.950 0.886   -43.062  1.00 105.72 ? 1405 GLN B O   1 
ATOM 173   C CB  . GLN A 1 33   ? -16.094 -1.984  -41.830  1.00 107.76 ? 1405 GLN B CB  1 
ATOM 174   C CG  . GLN A 1 33   ? -15.699 -3.451  -41.761  1.00 107.58 ? 1405 GLN B CG  1 
ATOM 175   C CD  . GLN A 1 33   ? -15.099 -3.955  -43.057  1.00 114.31 ? 1405 GLN B CD  1 
ATOM 176   O OE1 . GLN A 1 33   ? -14.001 -3.554  -43.445  1.00 119.81 ? 1405 GLN B OE1 1 
ATOM 177   N NE2 . GLN A 1 33   ? -15.816 -4.844  -43.733  1.00 118.24 ? 1405 GLN B NE2 1 
ATOM 178   N N   . LYS A 1 34   ? -16.236 1.042   -41.206  1.00 109.73 ? 1406 LYS B N   1 
ATOM 179   C CA  . LYS A 1 34   ? -16.744 2.396   -41.489  1.00 112.95 ? 1406 LYS B CA  1 
ATOM 180   C C   . LYS A 1 34   ? -15.667 3.495   -41.455  1.00 115.36 ? 1406 LYS B C   1 
ATOM 181   O O   . LYS A 1 34   ? -15.812 4.520   -42.123  1.00 116.49 ? 1406 LYS B O   1 
ATOM 182   C CB  . LYS A 1 34   ? -17.883 2.765   -40.523  1.00 114.87 ? 1406 LYS B CB  1 
ATOM 183   C CG  . LYS A 1 34   ? -19.167 1.971   -40.730  1.00 115.74 ? 1406 LYS B CG  1 
ATOM 184   C CD  . LYS A 1 34   ? -20.354 2.635   -40.044  1.00 118.77 ? 1406 LYS B CD  1 
ATOM 185   C CE  . LYS A 1 34   ? -21.654 1.894   -40.319  1.00 119.77 ? 1406 LYS B CE  1 
ATOM 186   N NZ  . LYS A 1 34   ? -22.844 2.664   -39.859  1.00 125.07 ? 1406 LYS B NZ  1 
ATOM 187   N N   . GLY A 1 35   ? -14.604 3.291   -40.676  1.00 115.78 ? 1407 GLY B N   1 
ATOM 188   C CA  . GLY A 1 35   ? -13.509 4.264   -40.596  1.00 116.18 ? 1407 GLY B CA  1 
ATOM 189   C C   . GLY A 1 35   ? -12.412 3.840   -39.627  1.00 114.23 ? 1407 GLY B C   1 
ATOM 190   O O   . GLY A 1 35   ? -12.573 4.007   -38.418  1.00 112.84 ? 1407 GLY B O   1 
ATOM 191   N N   . PRO A 1 36   ? -11.287 3.298   -40.143  1.00 115.10 ? 1408 PRO B N   1 
ATOM 192   C CA  . PRO A 1 36   ? -10.243 2.761   -39.262  1.00 113.74 ? 1408 PRO B CA  1 
ATOM 193   C C   . PRO A 1 36   ? -9.410  3.854   -38.579  1.00 118.23 ? 1408 PRO B C   1 
ATOM 194   O O   . PRO A 1 36   ? -8.612  4.524   -39.238  1.00 121.79 ? 1408 PRO B O   1 
ATOM 195   C CB  . PRO A 1 36   ? -9.383  1.925   -40.215  1.00 111.61 ? 1408 PRO B CB  1 
ATOM 196   C CG  . PRO A 1 36   ? -9.527  2.593   -41.537  1.00 114.16 ? 1408 PRO B CG  1 
ATOM 197   C CD  . PRO A 1 36   ? -10.902 3.206   -41.566  1.00 116.61 ? 1408 PRO B CD  1 
ATOM 198   N N   . THR A 1 37   ? -9.608  4.021   -37.269  1.00 118.83 ? 1409 THR B N   1 
ATOM 199   C CA  . THR A 1 37   ? -8.907  5.038   -36.473  1.00 121.96 ? 1409 THR B CA  1 
ATOM 200   C C   . THR A 1 37   ? -7.974  4.388   -35.440  1.00 126.60 ? 1409 THR B C   1 
ATOM 201   O O   . THR A 1 37   ? -8.078  3.182   -35.190  1.00 125.71 ? 1409 THR B O   1 
ATOM 202   C CB  . THR A 1 37   ? -9.903  5.947   -35.720  1.00 121.39 ? 1409 THR B CB  1 
ATOM 203   O OG1 . THR A 1 37   ? -10.712 5.160   -34.836  1.00 118.96 ? 1409 THR B OG1 1 
ATOM 204   C CG2 . THR A 1 37   ? -10.799 6.695   -36.696  1.00 122.07 ? 1409 THR B CG2 1 
ATOM 205   N N   . PRO A 1 38   ? -7.054  5.181   -34.840  1.00 132.31 ? 1410 PRO B N   1 
ATOM 206   C CA  . PRO A 1 38   ? -6.274  4.705   -33.682  1.00 127.74 ? 1410 PRO B CA  1 
ATOM 207   C C   . PRO A 1 38   ? -7.122  4.370   -32.448  1.00 121.54 ? 1410 PRO B C   1 
ATOM 208   O O   . PRO A 1 38   ? -6.744  3.495   -31.666  1.00 116.58 ? 1410 PRO B O   1 
ATOM 209   C CB  . PRO A 1 38   ? -5.341  5.884   -33.373  1.00 133.61 ? 1410 PRO B CB  1 
ATOM 210   C CG  . PRO A 1 38   ? -5.229  6.631   -34.654  1.00 136.20 ? 1410 PRO B CG  1 
ATOM 211   C CD  . PRO A 1 38   ? -6.572  6.497   -35.307  1.00 136.28 ? 1410 PRO B CD  1 
ATOM 212   N N   . ALA A 1 39   ? -8.240  5.077   -32.279  1.00 121.08 ? 1411 ALA B N   1 
ATOM 213   C CA  . ALA A 1 39   ? -9.185  4.826   -31.188  1.00 121.36 ? 1411 ALA B CA  1 
ATOM 214   C C   . ALA A 1 39   ? -9.786  3.419   -31.251  1.00 116.66 ? 1411 ALA B C   1 
ATOM 215   O O   . ALA A 1 39   ? -9.899  2.741   -30.225  1.00 116.58 ? 1411 ALA B O   1 
ATOM 216   C CB  . ALA A 1 39   ? -10.290 5.873   -31.203  1.00 124.22 ? 1411 ALA B CB  1 
ATOM 217   N N   . ILE A 1 40   ? -10.164 2.990   -32.455  1.00 112.74 ? 1412 ILE B N   1 
ATOM 218   C CA  . ILE A 1 40   ? -10.688 1.637   -32.682  1.00 108.57 ? 1412 ILE B CA  1 
ATOM 219   C C   . ILE A 1 40   ? -9.548  0.613   -32.626  1.00 108.34 ? 1412 ILE B C   1 
ATOM 220   O O   . ILE A 1 40   ? -9.669  -0.402  -31.940  1.00 106.25 ? 1412 ILE B O   1 
ATOM 221   C CB  . ILE A 1 40   ? -11.450 1.534   -34.027  1.00 104.71 ? 1412 ILE B CB  1 
ATOM 222   C CG1 . ILE A 1 40   ? -12.672 2.460   -34.019  1.00 106.69 ? 1412 ILE B CG1 1 
ATOM 223   C CG2 . ILE A 1 40   ? -11.913 0.103   -34.301  1.00 101.73 ? 1412 ILE B CG2 1 
ATOM 224   C CD1 . ILE A 1 40   ? -13.154 2.850   -35.399  1.00 107.37 ? 1412 ILE B CD1 1 
ATOM 225   N N   . LEU A 1 41   ? -8.455  0.889   -33.346  1.00 110.58 ? 1413 LEU B N   1 
ATOM 226   C CA  . LEU A 1 41   ? -7.282  -0.009  -33.405  1.00 111.42 ? 1413 LEU B CA  1 
ATOM 227   C C   . LEU A 1 41   ? -6.681  -0.350  -32.038  1.00 113.84 ? 1413 LEU B C   1 
ATOM 228   O O   . LEU A 1 41   ? -6.221  -1.474  -31.832  1.00 110.70 ? 1413 LEU B O   1 
ATOM 229   C CB  . LEU A 1 41   ? -6.176  0.573   -34.305  1.00 113.46 ? 1413 LEU B CB  1 
ATOM 230   C CG  . LEU A 1 41   ? -6.283  0.364   -35.819  1.00 114.18 ? 1413 LEU B CG  1 
ATOM 231   C CD1 . LEU A 1 41   ? -5.276  1.246   -36.546  1.00 116.45 ? 1413 LEU B CD1 1 
ATOM 232   C CD2 . LEU A 1 41   ? -6.070  -1.098  -36.193  1.00 112.01 ? 1413 LEU B CD2 1 
ATOM 233   N N   . GLU A 1 42   ? -6.678  0.618   -31.121  1.00 119.38 ? 1414 GLU B N   1 
ATOM 234   C CA  . GLU A 1 42   ? -6.209  0.393   -29.747  1.00 123.85 ? 1414 GLU B CA  1 
ATOM 235   C C   . GLU A 1 42   ? -7.164  -0.532  -28.980  1.00 122.60 ? 1414 GLU B C   1 
ATOM 236   O O   . GLU A 1 42   ? -6.713  -1.413  -28.247  1.00 121.47 ? 1414 GLU B O   1 
ATOM 237   C CB  . GLU A 1 42   ? -6.034  1.729   -29.007  1.00 127.96 ? 1414 GLU B CB  1 
ATOM 238   C CG  . GLU A 1 42   ? -5.283  1.652   -27.677  1.00 131.12 ? 1414 GLU B CG  1 
ATOM 239   C CD  . GLU A 1 42   ? -3.815  1.264   -27.817  1.00 133.33 ? 1414 GLU B CD  1 
ATOM 240   O OE1 . GLU A 1 42   ? -3.142  1.735   -28.761  1.00 132.99 ? 1414 GLU B OE1 1 
ATOM 241   O OE2 . GLU A 1 42   ? -3.325  0.489   -26.967  1.00 134.10 ? 1414 GLU B OE2 1 
ATOM 242   N N   . SER A 1 43   ? -8.473  -0.338  -29.172  1.00 121.10 ? 1415 SER B N   1 
ATOM 243   C CA  . SER A 1 43   ? -9.506  -1.193  -28.556  1.00 117.10 ? 1415 SER B CA  1 
ATOM 244   C C   . SER A 1 43   ? -9.827  -2.475  -29.354  1.00 106.98 ? 1415 SER B C   1 
ATOM 245   O O   . SER A 1 43   ? -10.745 -3.212  -28.988  1.00 98.80  ? 1415 SER B O   1 
ATOM 246   C CB  . SER A 1 43   ? -10.790 -0.382  -28.319  1.00 117.99 ? 1415 SER B CB  1 
ATOM 247   O OG  . SER A 1 43   ? -11.380 0.029   -29.539  1.00 117.34 ? 1415 SER B OG  1 
ATOM 248   N N   . LEU A 1 44   ? -9.077  -2.725  -30.430  1.00 105.50 ? 1416 LEU B N   1 
ATOM 249   C CA  . LEU A 1 44   ? -9.218  -3.921  -31.265  1.00 103.90 ? 1416 LEU B CA  1 
ATOM 250   C C   . LEU A 1 44   ? -8.166  -4.982  -30.912  1.00 105.26 ? 1416 LEU B C   1 
ATOM 251   O O   . LEU A 1 44   ? -8.479  -6.168  -30.894  1.00 102.34 ? 1416 LEU B O   1 
ATOM 252   C CB  . LEU A 1 44   ? -9.116  -3.541  -32.748  1.00 100.93 ? 1416 LEU B CB  1 
ATOM 253   C CG  . LEU A 1 44   ? -9.610  -4.531  -33.805  1.00 96.64  ? 1416 LEU B CG  1 
ATOM 254   C CD1 . LEU A 1 44   ? -11.117 -4.730  -33.732  1.00 93.89  ? 1416 LEU B CD1 1 
ATOM 255   C CD2 . LEU A 1 44   ? -9.219  -4.036  -35.190  1.00 97.80  ? 1416 LEU B CD2 1 
ATOM 256   N N   . ILE A 1 45   ? -6.921  -4.560  -30.672  1.00 110.93 ? 1417 ILE B N   1 
ATOM 257   C CA  . ILE A 1 45   ? -5.876  -5.468  -30.142  1.00 113.32 ? 1417 ILE B CA  1 
ATOM 258   C C   . ILE A 1 45   ? -6.217  -6.008  -28.750  1.00 116.68 ? 1417 ILE B C   1 
ATOM 259   O O   . ILE A 1 45   ? -5.921  -7.167  -28.451  1.00 117.13 ? 1417 ILE B O   1 
ATOM 260   C CB  . ILE A 1 45   ? -4.439  -4.849  -30.089  1.00 114.97 ? 1417 ILE B CB  1 
ATOM 261   C CG1 . ILE A 1 45   ? -4.442  -3.403  -29.573  1.00 117.67 ? 1417 ILE B CG1 1 
ATOM 262   C CG2 . ILE A 1 45   ? -3.761  -4.925  -31.448  1.00 112.49 ? 1417 ILE B CG2 1 
ATOM 263   C CD1 . ILE A 1 45   ? -3.117  -2.949  -29.003  1.00 122.27 ? 1417 ILE B CD1 1 
ATOM 264   N N   . SER A 1 46   ? -6.836  -5.173  -27.913  1.00 119.58 ? 1418 SER B N   1 
ATOM 265   C CA  . SER A 1 46   ? -7.133  -5.536  -26.523  1.00 123.10 ? 1418 SER B CA  1 
ATOM 266   C C   . SER A 1 46   ? -8.258  -6.562  -26.441  1.00 118.95 ? 1418 SER B C   1 
ATOM 267   O O   . SER A 1 46   ? -8.105  -7.606  -25.805  1.00 120.12 ? 1418 SER B O   1 
ATOM 268   C CB  . SER A 1 46   ? -7.499  -4.292  -25.706  1.00 127.38 ? 1418 SER B CB  1 
ATOM 269   O OG  . SER A 1 46   ? -8.650  -3.654  -26.232  1.00 127.15 ? 1418 SER B OG  1 
ATOM 270   N N   . ILE A 1 47   ? -9.380  -6.247  -27.087  1.00 112.86 ? 1419 ILE B N   1 
ATOM 271   C CA  . ILE A 1 47   ? -10.530 -7.167  -27.202  1.00 108.79 ? 1419 ILE B CA  1 
ATOM 272   C C   . ILE A 1 47   ? -10.165 -8.533  -27.815  1.00 103.35 ? 1419 ILE B C   1 
ATOM 273   O O   . ILE A 1 47   ? -10.743 -9.557  -27.449  1.00 102.06 ? 1419 ILE B O   1 
ATOM 274   C CB  . ILE A 1 47   ? -11.704 -6.513  -27.988  1.00 108.46 ? 1419 ILE B CB  1 
ATOM 275   C CG1 . ILE A 1 47   ? -12.964 -7.383  -27.936  1.00 110.28 ? 1419 ILE B CG1 1 
ATOM 276   C CG2 . ILE A 1 47   ? -11.331 -6.245  -29.438  1.00 108.42 ? 1419 ILE B CG2 1 
ATOM 277   C CD1 . ILE A 1 47   ? -14.227 -6.634  -28.298  1.00 112.29 ? 1419 ILE B CD1 1 
ATOM 278   N N   . ASN A 1 48   ? -9.210  -8.534  -28.741  1.00 101.79 ? 1420 ASN B N   1 
ATOM 279   C CA  . ASN A 1 48   ? -8.733  -9.765  -29.376  1.00 99.66  ? 1420 ASN B CA  1 
ATOM 280   C C   . ASN A 1 48   ? -7.738  -10.513 -28.465  1.00 101.53 ? 1420 ASN B C   1 
ATOM 281   O O   . ASN A 1 48   ? -7.698  -11.747 -28.474  1.00 98.96  ? 1420 ASN B O   1 
ATOM 282   C CB  . ASN A 1 48   ? -8.104  -9.443  -30.744  1.00 95.67  ? 1420 ASN B CB  1 
ATOM 283   C CG  . ASN A 1 48   ? -8.383  -10.506 -31.785  1.00 93.55  ? 1420 ASN B CG  1 
ATOM 284   O OD1 . ASN A 1 48   ? -7.476  -11.201 -32.229  1.00 94.00  ? 1420 ASN B OD1 1 
ATOM 285   N ND2 . ASN A 1 48   ? -9.646  -10.632 -32.184  1.00 91.19  ? 1420 ASN B ND2 1 
ATOM 286   N N   . ASN A 1 49   ? -6.946  -9.765  -27.689  1.00 105.51 ? 1421 ASN B N   1 
ATOM 287   C CA  . ASN A 1 49   ? -6.035  -10.345 -26.681  1.00 112.11 ? 1421 ASN B CA  1 
ATOM 288   C C   . ASN A 1 49   ? -6.775  -10.994 -25.506  1.00 118.97 ? 1421 ASN B C   1 
ATOM 289   O O   . ASN A 1 49   ? -6.399  -12.085 -25.066  1.00 120.70 ? 1421 ASN B O   1 
ATOM 290   C CB  . ASN A 1 49   ? -5.044  -9.293  -26.144  1.00 112.27 ? 1421 ASN B CB  1 
ATOM 291   C CG  . ASN A 1 49   ? -3.770  -9.209  -26.965  1.00 111.02 ? 1421 ASN B CG  1 
ATOM 292   O OD1 . ASN A 1 49   ? -3.125  -10.223 -27.242  1.00 110.19 ? 1421 ASN B OD1 1 
ATOM 293   N ND2 . ASN A 1 49   ? -3.388  -7.992  -27.339  1.00 110.28 ? 1421 ASN B ND2 1 
ATOM 294   N N   . LYS A 1 50   ? -7.816  -10.321 -25.006  1.00 124.55 ? 1422 LYS B N   1 
ATOM 295   C CA  . LYS A 1 50   ? -8.699  -10.876 -23.955  1.00 128.04 ? 1422 LYS B CA  1 
ATOM 296   C C   . LYS A 1 50   ? -9.462  -12.131 -24.405  1.00 122.70 ? 1422 LYS B C   1 
ATOM 297   O O   . LYS A 1 50   ? -9.921  -12.913 -23.570  1.00 121.85 ? 1422 LYS B O   1 
ATOM 298   C CB  . LYS A 1 50   ? -9.713  -9.829  -23.476  1.00 131.76 ? 1422 LYS B CB  1 
ATOM 299   C CG  . LYS A 1 50   ? -9.111  -8.663  -22.707  1.00 138.95 ? 1422 LYS B CG  1 
ATOM 300   C CD  . LYS A 1 50   ? -10.173 -7.621  -22.380  1.00 140.87 ? 1422 LYS B CD  1 
ATOM 301   C CE  . LYS A 1 50   ? -9.573  -6.243  -22.150  1.00 145.64 ? 1422 LYS B CE  1 
ATOM 302   N NZ  . LYS A 1 50   ? -10.629 -5.193  -22.153  1.00 146.80 ? 1422 LYS B NZ  1 
ATOM 303   N N   . LEU A 1 51   ? -9.602  -12.301 -25.721  1.00 117.65 ? 1423 LEU B N   1 
ATOM 304   C CA  . LEU A 1 51   ? -10.196 -13.497 -26.323  1.00 112.40 ? 1423 LEU B CA  1 
ATOM 305   C C   . LEU A 1 51   ? -9.171  -14.624 -26.594  1.00 111.36 ? 1423 LEU B C   1 
ATOM 306   O O   . LEU A 1 51   ? -9.511  -15.612 -27.247  1.00 108.80 ? 1423 LEU B O   1 
ATOM 307   C CB  . LEU A 1 51   ? -10.917 -13.085 -27.620  1.00 107.09 ? 1423 LEU B CB  1 
ATOM 308   C CG  . LEU A 1 51   ? -12.104 -13.887 -28.162  1.00 106.00 ? 1423 LEU B CG  1 
ATOM 309   C CD1 . LEU A 1 51   ? -13.144 -14.218 -27.102  1.00 106.40 ? 1423 LEU B CD1 1 
ATOM 310   C CD2 . LEU A 1 51   ? -12.753 -13.099 -29.292  1.00 105.67 ? 1423 LEU B CD2 1 
ATOM 311   N N   . GLN A 1 52   ? -7.942  -14.476 -26.077  1.00 113.94 ? 1424 GLN B N   1 
ATOM 312   C CA  . GLN A 1 52   ? -6.849  -15.459 -26.206  1.00 116.27 ? 1424 GLN B CA  1 
ATOM 313   C C   . GLN A 1 52   ? -6.574  -15.885 -27.654  1.00 115.30 ? 1424 GLN B C   1 
ATOM 314   O O   . GLN A 1 52   ? -6.502  -17.076 -27.974  1.00 114.86 ? 1424 GLN B O   1 
ATOM 315   C CB  . GLN A 1 52   ? -7.083  -16.663 -25.278  1.00 118.13 ? 1424 GLN B CB  1 
ATOM 316   C CG  . GLN A 1 52   ? -7.003  -16.308 -23.799  1.00 119.33 ? 1424 GLN B CG  1 
ATOM 317   C CD  . GLN A 1 52   ? -6.862  -17.524 -22.903  1.00 123.24 ? 1424 GLN B CD  1 
ATOM 318   O OE1 . GLN A 1 52   ? -7.583  -18.511 -23.056  1.00 123.50 ? 1424 GLN B OE1 1 
ATOM 319   N NE2 . GLN A 1 52   ? -5.935  -17.455 -21.955  1.00 126.82 ? 1424 GLN B NE2 1 
ATOM 320   N N   . GLN A 1 53   ? -6.428  -14.878 -28.513  1.00 114.93 ? 1425 GLN B N   1 
ATOM 321   C CA  . GLN A 1 53   ? -6.101  -15.059 -29.925  1.00 112.12 ? 1425 GLN B CA  1 
ATOM 322   C C   . GLN A 1 53   ? -4.996  -14.050 -30.280  1.00 110.66 ? 1425 GLN B C   1 
ATOM 323   O O   . GLN A 1 53   ? -5.286  -12.939 -30.732  1.00 103.10 ? 1425 GLN B O   1 
ATOM 324   C CB  . GLN A 1 53   ? -7.352  -14.856 -30.787  1.00 107.68 ? 1425 GLN B CB  1 
ATOM 325   C CG  . GLN A 1 53   ? -7.163  -15.219 -32.253  1.00 109.13 ? 1425 GLN B CG  1 
ATOM 326   C CD  . GLN A 1 53   ? -7.037  -16.711 -32.486  1.00 111.56 ? 1425 GLN B CD  1 
ATOM 327   O OE1 . GLN A 1 53   ? -6.052  -17.176 -33.062  1.00 116.49 ? 1425 GLN B OE1 1 
ATOM 328   N NE2 . GLN A 1 53   ? -8.031  -17.471 -32.035  1.00 107.53 ? 1425 GLN B NE2 1 
ATOM 329   N N   . PRO A 1 54   ? -3.721  -14.432 -30.059  1.00 116.39 ? 1426 PRO B N   1 
ATOM 330   C CA  . PRO A 1 54   ? -2.601  -13.493 -30.194  1.00 118.02 ? 1426 PRO B CA  1 
ATOM 331   C C   . PRO A 1 54   ? -2.158  -13.212 -31.631  1.00 114.14 ? 1426 PRO B C   1 
ATOM 332   O O   . PRO A 1 54   ? -1.820  -12.069 -31.952  1.00 109.69 ? 1426 PRO B O   1 
ATOM 333   C CB  . PRO A 1 54   ? -1.474  -14.184 -29.422  1.00 125.79 ? 1426 PRO B CB  1 
ATOM 334   C CG  . PRO A 1 54   ? -1.766  -15.638 -29.549  1.00 127.56 ? 1426 PRO B CG  1 
ATOM 335   C CD  . PRO A 1 54   ? -3.259  -15.781 -29.675  1.00 122.72 ? 1426 PRO B CD  1 
ATOM 336   N N   . GLU A 1 55   ? -2.144  -14.244 -32.474  1.00 113.27 ? 1427 GLU B N   1 
ATOM 337   C CA  . GLU A 1 55   ? -1.662  -14.115 -33.854  1.00 112.37 ? 1427 GLU B CA  1 
ATOM 338   C C   . GLU A 1 55   ? -2.609  -13.314 -34.766  1.00 106.46 ? 1427 GLU B C   1 
ATOM 339   O O   . GLU A 1 55   ? -2.161  -12.691 -35.730  1.00 103.45 ? 1427 GLU B O   1 
ATOM 340   C CB  . GLU A 1 55   ? -1.327  -15.488 -34.448  1.00 115.87 ? 1427 GLU B CB  1 
ATOM 341   C CG  . GLU A 1 55   ? -2.491  -16.443 -34.661  1.00 116.15 ? 1427 GLU B CG  1 
ATOM 342   C CD  . GLU A 1 55   ? -2.018  -17.782 -35.192  1.00 121.10 ? 1427 GLU B CD  1 
ATOM 343   O OE1 . GLU A 1 55   ? -1.144  -18.399 -34.544  1.00 121.35 ? 1427 GLU B OE1 1 
ATOM 344   O OE2 . GLU A 1 55   ? -2.509  -18.215 -36.258  1.00 123.00 ? 1427 GLU B OE2 1 
ATOM 345   N N   . ALA A 1 56   ? -3.906  -13.340 -34.461  1.00 103.77 ? 1428 ALA B N   1 
ATOM 346   C CA  . ALA A 1 56   ? -4.880  -12.442 -35.097  1.00 100.10 ? 1428 ALA B CA  1 
ATOM 347   C C   . ALA A 1 56   ? -4.649  -10.987 -34.683  1.00 98.09  ? 1428 ALA B C   1 
ATOM 348   O O   . ALA A 1 56   ? -4.753  -10.075 -35.508  1.00 96.78  ? 1428 ALA B O   1 
ATOM 349   C CB  . ALA A 1 56   ? -6.296  -12.860 -34.738  1.00 99.19  ? 1428 ALA B CB  1 
ATOM 350   N N   . ALA A 1 57   ? -4.354  -10.788 -33.397  1.00 99.42  ? 1429 ALA B N   1 
ATOM 351   C CA  . ALA A 1 57   ? -4.048  -9.463  -32.838  1.00 98.29  ? 1429 ALA B CA  1 
ATOM 352   C C   . ALA A 1 57   ? -2.727  -8.898  -33.350  1.00 96.14  ? 1429 ALA B C   1 
ATOM 353   O O   . ALA A 1 57   ? -2.591  -7.683  -33.500  1.00 93.41  ? 1429 ALA B O   1 
ATOM 354   C CB  . ALA A 1 57   ? -4.031  -9.520  -31.316  1.00 101.10 ? 1429 ALA B CB  1 
ATOM 355   N N   . ALA A 1 58   ? -1.758  -9.777  -33.607  1.00 96.82  ? 1430 ALA B N   1 
ATOM 356   C CA  . ALA A 1 58   ? -0.485  -9.383  -34.223  1.00 98.61  ? 1430 ALA B CA  1 
ATOM 357   C C   . ALA A 1 58   ? -0.698  -8.704  -35.579  1.00 95.20  ? 1430 ALA B C   1 
ATOM 358   O O   . ALA A 1 58   ? 0.002   -7.745  -35.915  1.00 95.32  ? 1430 ALA B O   1 
ATOM 359   C CB  . ALA A 1 58   ? 0.428   -10.591 -34.376  1.00 101.65 ? 1430 ALA B CB  1 
ATOM 360   N N   . GLY A 1 59   ? -1.666  -9.210  -36.342  1.00 92.00  ? 1431 GLY B N   1 
ATOM 361   C CA  . GLY A 1 59   ? -2.071  -8.607  -37.610  1.00 89.83  ? 1431 GLY B CA  1 
ATOM 362   C C   . GLY A 1 59   ? -2.654  -7.210  -37.487  1.00 86.81  ? 1431 GLY B C   1 
ATOM 363   O O   . GLY A 1 59   ? -2.471  -6.384  -38.382  1.00 87.25  ? 1431 GLY B O   1 
ATOM 364   N N   . VAL A 1 60   ? -3.352  -6.943  -36.383  1.00 84.92  ? 1432 VAL B N   1 
ATOM 365   C CA  . VAL A 1 60   ? -3.904  -5.607  -36.115  1.00 84.36  ? 1432 VAL B CA  1 
ATOM 366   C C   . VAL A 1 60   ? -2.764  -4.602  -35.964  1.00 85.54  ? 1432 VAL B C   1 
ATOM 367   O O   . VAL A 1 60   ? -2.866  -3.470  -36.441  1.00 84.32  ? 1432 VAL B O   1 
ATOM 368   C CB  . VAL A 1 60   ? -4.793  -5.557  -34.841  1.00 84.65  ? 1432 VAL B CB  1 
ATOM 369   C CG1 . VAL A 1 60   ? -5.389  -4.163  -34.641  1.00 84.70  ? 1432 VAL B CG1 1 
ATOM 370   C CG2 . VAL A 1 60   ? -5.925  -6.577  -34.895  1.00 83.16  ? 1432 VAL B CG2 1 
ATOM 371   N N   . LEU A 1 61   ? -1.689  -5.024  -35.298  1.00 88.62  ? 1433 LEU B N   1 
ATOM 372   C CA  . LEU A 1 61   ? -0.514  -4.173  -35.097  1.00 92.40  ? 1433 LEU B CA  1 
ATOM 373   C C   . LEU A 1 61   ? 0.243   -3.922  -36.406  1.00 91.91  ? 1433 LEU B C   1 
ATOM 374   O O   . LEU A 1 61   ? 0.764   -2.825  -36.616  1.00 91.40  ? 1433 LEU B O   1 
ATOM 375   C CB  . LEU A 1 61   ? 0.428   -4.775  -34.047  1.00 96.31  ? 1433 LEU B CB  1 
ATOM 376   C CG  . LEU A 1 61   ? 1.314   -3.743  -33.337  1.00 100.00 ? 1433 LEU B CG  1 
ATOM 377   C CD1 . LEU A 1 61   ? 0.548   -3.044  -32.221  1.00 99.95  ? 1433 LEU B CD1 1 
ATOM 378   C CD2 . LEU A 1 61   ? 2.577   -4.387  -32.786  1.00 103.96 ? 1433 LEU B CD2 1 
ATOM 379   N N   . GLU A 1 62   ? 0.298   -4.931  -37.275  1.00 91.85  ? 1434 GLU B N   1 
ATOM 380   C CA  . GLU A 1 62   ? 0.891   -4.771  -38.609  1.00 93.93  ? 1434 GLU B CA  1 
ATOM 381   C C   . GLU A 1 62   ? 0.153   -3.709  -39.435  1.00 93.72  ? 1434 GLU B C   1 
ATOM 382   O O   . GLU A 1 62   ? 0.788   -2.945  -40.158  1.00 94.35  ? 1434 GLU B O   1 
ATOM 383   C CB  . GLU A 1 62   ? 0.927   -6.108  -39.364  1.00 94.94  ? 1434 GLU B CB  1 
ATOM 384   C CG  . GLU A 1 62   ? 1.888   -7.147  -38.786  1.00 98.10  ? 1434 GLU B CG  1 
ATOM 385   C CD  . GLU A 1 62   ? 3.360   -6.766  -38.894  1.00 100.96 ? 1434 GLU B CD  1 
ATOM 386   O OE1 . GLU A 1 62   ? 3.739   -6.018  -39.821  1.00 100.73 ? 1434 GLU B OE1 1 
ATOM 387   O OE2 . GLU A 1 62   ? 4.150   -7.229  -38.043  1.00 103.25 ? 1434 GLU B OE2 1 
ATOM 388   N N   . TYR A 1 63   ? -1.177  -3.663  -39.314  1.00 94.39  ? 1435 TYR B N   1 
ATOM 389   C CA  . TYR A 1 63   ? -1.990  -2.589  -39.909  1.00 94.81  ? 1435 TYR B CA  1 
ATOM 390   C C   . TYR A 1 63   ? -1.715  -1.238  -39.243  1.00 97.41  ? 1435 TYR B C   1 
ATOM 391   O O   . TYR A 1 63   ? -1.631  -0.217  -39.925  1.00 99.21  ? 1435 TYR B O   1 
ATOM 392   C CB  . TYR A 1 63   ? -3.484  -2.917  -39.808  1.00 92.33  ? 1435 TYR B CB  1 
ATOM 393   C CG  . TYR A 1 63   ? -4.398  -1.948  -40.533  1.00 92.82  ? 1435 TYR B CG  1 
ATOM 394   C CD1 . TYR A 1 63   ? -4.780  -2.177  -41.856  1.00 93.85  ? 1435 TYR B CD1 1 
ATOM 395   C CD2 . TYR A 1 63   ? -4.889  -0.806  -39.896  1.00 92.33  ? 1435 TYR B CD2 1 
ATOM 396   C CE1 . TYR A 1 63   ? -5.620  -1.296  -42.525  1.00 94.40  ? 1435 TYR B CE1 1 
ATOM 397   C CE2 . TYR A 1 63   ? -5.725  0.084   -40.559  1.00 93.62  ? 1435 TYR B CE2 1 
ATOM 398   C CZ  . TYR A 1 63   ? -6.087  -0.163  -41.873  1.00 94.69  ? 1435 TYR B CZ  1 
ATOM 399   O OH  . TYR A 1 63   ? -6.921  0.715   -42.532  1.00 97.31  ? 1435 TYR B OH  1 
ATOM 400   N N   . ALA A 1 64   ? -1.599  -1.241  -37.916  1.00 99.90  ? 1436 ALA B N   1 
ATOM 401   C CA  . ALA A 1 64   ? -1.261  -0.035  -37.152  1.00 105.20 ? 1436 ALA B CA  1 
ATOM 402   C C   . ALA A 1 64   ? 0.121   0.536   -37.503  1.00 112.00 ? 1436 ALA B C   1 
ATOM 403   O O   . ALA A 1 64   ? 0.301   1.754   -37.501  1.00 115.45 ? 1436 ALA B O   1 
ATOM 404   C CB  . ALA A 1 64   ? -1.350  -0.311  -35.659  1.00 104.89 ? 1436 ALA B CB  1 
ATOM 405   N N   . MET A 1 65   ? 1.087   -0.337  -37.793  1.00 115.11 ? 1437 MET B N   1 
ATOM 406   C CA  . MET A 1 65   ? 2.403   0.094   -38.290  1.00 122.77 ? 1437 MET B CA  1 
ATOM 407   C C   . MET A 1 65   ? 2.298   0.717   -39.678  1.00 125.06 ? 1437 MET B C   1 
ATOM 408   O O   . MET A 1 65   ? 2.708   1.858   -39.890  1.00 132.10 ? 1437 MET B O   1 
ATOM 409   C CB  . MET A 1 65   ? 3.394   -1.082  -38.364  1.00 128.09 ? 1437 MET B CB  1 
ATOM 410   C CG  . MET A 1 65   ? 4.176   -1.361  -37.089  1.00 130.49 ? 1437 MET B CG  1 
ATOM 411   S SD  . MET A 1 65   ? 5.650   -2.361  -37.397  1.00 131.26 ? 1437 MET B SD  1 
ATOM 412   C CE  . MET A 1 65   ? 6.771   -1.142  -38.084  1.00 131.77 ? 1437 MET B CE  1 
ATOM 413   N N   . LYS A 1 66   ? 1.740   -0.048  -40.612  1.00 123.91 ? 1438 LYS B N   1 
ATOM 414   C CA  . LYS A 1 66   ? 1.774   0.292   -42.040  1.00 126.08 ? 1438 LYS B CA  1 
ATOM 415   C C   . LYS A 1 66   ? 0.906   1.492   -42.448  1.00 121.83 ? 1438 LYS B C   1 
ATOM 416   O O   . LYS A 1 66   ? 1.123   2.059   -43.518  1.00 121.70 ? 1438 LYS B O   1 
ATOM 417   C CB  . LYS A 1 66   ? 1.413   -0.940  -42.882  1.00 131.41 ? 1438 LYS B CB  1 
ATOM 418   C CG  . LYS A 1 66   ? 2.441   -2.064  -42.777  1.00 139.88 ? 1438 LYS B CG  1 
ATOM 419   C CD  . LYS A 1 66   ? 1.892   -3.410  -43.235  1.00 142.56 ? 1438 LYS B CD  1 
ATOM 420   C CE  . LYS A 1 66   ? 2.845   -4.547  -42.883  1.00 144.18 ? 1438 LYS B CE  1 
ATOM 421   N NZ  . LYS A 1 66   ? 2.268   -5.891  -43.170  1.00 140.78 ? 1438 LYS B NZ  1 
ATOM 422   N N   . HIS A 1 67   ? -0.060  1.869   -41.607  1.00 119.76 ? 1439 HIS B N   1 
ATOM 423   C CA  . HIS A 1 67   ? -0.922  3.032   -41.857  1.00 120.30 ? 1439 HIS B CA  1 
ATOM 424   C C   . HIS A 1 67   ? -0.593  4.215   -40.945  1.00 122.68 ? 1439 HIS B C   1 
ATOM 425   O O   . HIS A 1 67   ? -0.318  5.315   -41.432  1.00 127.90 ? 1439 HIS B O   1 
ATOM 426   C CB  . HIS A 1 67   ? -2.390  2.635   -41.696  1.00 118.20 ? 1439 HIS B CB  1 
ATOM 427   C CG  . HIS A 1 67   ? -2.877  1.712   -42.769  1.00 119.59 ? 1439 HIS B CG  1 
ATOM 428   N ND1 . HIS A 1 67   ? -3.799  2.097   -43.718  1.00 123.69 ? 1439 HIS B ND1 1 
ATOM 429   C CD2 . HIS A 1 67   ? -2.552  0.430   -43.058  1.00 118.94 ? 1439 HIS B CD2 1 
ATOM 430   C CE1 . HIS A 1 67   ? -4.030  1.087   -44.539  1.00 122.09 ? 1439 HIS B CE1 1 
ATOM 431   N NE2 . HIS A 1 67   ? -3.284  0.064   -44.161  1.00 118.56 ? 1439 HIS B NE2 1 
ATOM 432   N N   . PHE A 1 68   ? -0.619  3.980   -39.633  1.00 120.69 ? 1440 PHE B N   1 
ATOM 433   C CA  . PHE A 1 68   ? -0.447  5.035   -38.629  1.00 121.55 ? 1440 PHE B CA  1 
ATOM 434   C C   . PHE A 1 68   ? 0.912   4.966   -37.938  1.00 121.18 ? 1440 PHE B C   1 
ATOM 435   O O   . PHE A 1 68   ? 1.028   4.486   -36.809  1.00 117.45 ? 1440 PHE B O   1 
ATOM 436   C CB  . PHE A 1 68   ? -1.570  4.958   -37.589  1.00 122.47 ? 1440 PHE B CB  1 
ATOM 437   C CG  . PHE A 1 68   ? -2.932  5.218   -38.157  1.00 123.86 ? 1440 PHE B CG  1 
ATOM 438   C CD1 . PHE A 1 68   ? -3.707  4.171   -38.646  1.00 123.20 ? 1440 PHE B CD1 1 
ATOM 439   C CD2 . PHE A 1 68   ? -3.438  6.513   -38.216  1.00 126.86 ? 1440 PHE B CD2 1 
ATOM 440   C CE1 . PHE A 1 68   ? -4.965  4.410   -39.180  1.00 124.61 ? 1440 PHE B CE1 1 
ATOM 441   C CE2 . PHE A 1 68   ? -4.695  6.760   -38.746  1.00 127.79 ? 1440 PHE B CE2 1 
ATOM 442   C CZ  . PHE A 1 68   ? -5.460  5.707   -39.229  1.00 127.65 ? 1440 PHE B CZ  1 
ATOM 443   N N   . GLY A 1 69   ? 1.938   5.471   -38.616  1.00 126.32 ? 1441 GLY B N   1 
ATOM 444   C CA  . GLY A 1 69   ? 3.268   5.616   -38.023  1.00 129.78 ? 1441 GLY B CA  1 
ATOM 445   C C   . GLY A 1 69   ? 3.292   6.821   -37.101  1.00 133.95 ? 1441 GLY B C   1 
ATOM 446   O O   . GLY A 1 69   ? 3.967   7.815   -37.386  1.00 136.01 ? 1441 GLY B O   1 
ATOM 447   N N   . GLU A 1 70   ? 2.561   6.716   -35.989  1.00 135.17 ? 1442 GLU B N   1 
ATOM 448   C CA  . GLU A 1 70   ? 2.222   7.867   -35.141  1.00 140.60 ? 1442 GLU B CA  1 
ATOM 449   C C   . GLU A 1 70   ? 2.437   7.641   -33.628  1.00 140.50 ? 1442 GLU B C   1 
ATOM 450   O O   . GLU A 1 70   ? 2.890   8.569   -32.957  1.00 149.50 ? 1442 GLU B O   1 
ATOM 451   C CB  . GLU A 1 70   ? 0.793   8.340   -35.441  1.00 142.70 ? 1442 GLU B CB  1 
ATOM 452   C CG  . GLU A 1 70   ? 0.618   8.836   -36.877  1.00 143.37 ? 1442 GLU B CG  1 
ATOM 453   C CD  . GLU A 1 70   ? -0.708  9.534   -37.136  1.00 143.29 ? 1442 GLU B CD  1 
ATOM 454   O OE1 . GLU A 1 70   ? -1.132  10.363  -36.303  1.00 147.02 ? 1442 GLU B OE1 1 
ATOM 455   O OE2 . GLU A 1 70   ? -1.320  9.271   -38.194  1.00 140.24 ? 1442 GLU B OE2 1 
ATOM 456   N N   . LEU A 1 71   ? 2.113   6.453   -33.085  1.00 145.94 ? 1443 LEU B N   1 
ATOM 457   C CA  . LEU A 1 71   ? 2.698   5.996   -31.800  1.00 144.63 ? 1443 LEU B CA  1 
ATOM 458   C C   . LEU A 1 71   ? 4.004   5.295   -32.172  1.00 146.02 ? 1443 LEU B C   1 
ATOM 459   O O   . LEU A 1 71   ? 4.173   4.087   -31.963  1.00 143.05 ? 1443 LEU B O   1 
ATOM 460   C CB  . LEU A 1 71   ? 1.750   5.069   -31.003  1.00 141.17 ? 1443 LEU B CB  1 
ATOM 461   C CG  . LEU A 1 71   ? 2.177   4.516   -29.620  1.00 137.38 ? 1443 LEU B CG  1 
ATOM 462   C CD1 . LEU A 1 71   ? 2.837   5.559   -28.725  1.00 137.92 ? 1443 LEU B CD1 1 
ATOM 463   C CD2 . LEU A 1 71   ? 0.983   3.901   -28.900  1.00 134.85 ? 1443 LEU B CD2 1 
ATOM 464   N N   . GLU A 1 72   ? 4.925   6.088   -32.725  1.00 150.89 ? 1444 GLU B N   1 
ATOM 465   C CA  . GLU A 1 72   ? 6.072   5.581   -33.472  1.00 153.58 ? 1444 GLU B CA  1 
ATOM 466   C C   . GLU A 1 72   ? 7.398   6.199   -33.042  1.00 152.65 ? 1444 GLU B C   1 
ATOM 467   O O   . GLU A 1 72   ? 7.779   7.285   -33.486  1.00 157.40 ? 1444 GLU B O   1 
ATOM 468   C CB  . GLU A 1 72   ? 5.877   5.794   -34.986  1.00 158.79 ? 1444 GLU B CB  1 
ATOM 469   C CG  . GLU A 1 72   ? 6.982   5.166   -35.838  1.00 160.71 ? 1444 GLU B CG  1 
ATOM 470   C CD  . GLU A 1 72   ? 6.643   5.078   -37.314  1.00 163.41 ? 1444 GLU B CD  1 
ATOM 471   O OE1 . GLU A 1 72   ? 6.309   6.122   -37.910  1.00 165.42 ? 1444 GLU B OE1 1 
ATOM 472   O OE2 . GLU A 1 72   ? 6.741   3.971   -37.888  1.00 163.81 ? 1444 GLU B OE2 1 
ATOM 473   N N   . ILE A 1 73   ? 8.070   5.499   -32.141  1.00 147.99 ? 1445 ILE B N   1 
ATOM 474   C CA  . ILE A 1 73   ? 9.517   5.405   -32.167  1.00 148.39 ? 1445 ILE B CA  1 
ATOM 475   C C   . ILE A 1 73   ? 9.661   4.014   -32.769  1.00 149.59 ? 1445 ILE B C   1 
ATOM 476   O O   . ILE A 1 73   ? 9.085   3.066   -32.234  1.00 149.56 ? 1445 ILE B O   1 
ATOM 477   C CB  . ILE A 1 73   ? 10.153  5.471   -30.760  1.00 147.09 ? 1445 ILE B CB  1 
ATOM 478   C CG1 . ILE A 1 73   ? 9.734   6.757   -30.030  1.00 147.75 ? 1445 ILE B CG1 1 
ATOM 479   C CG2 . ILE A 1 73   ? 11.674  5.403   -30.857  1.00 147.15 ? 1445 ILE B CG2 1 
ATOM 480   C CD1 . ILE A 1 73   ? 9.942   6.714   -28.530  1.00 146.36 ? 1445 ILE B CD1 1 
ATOM 481   N N   . GLN A 1 74   ? 10.387  3.877   -33.881  1.00 153.94 ? 1446 GLN B N   1 
ATOM 482   C CA  . GLN A 1 74   ? 10.459  2.586   -34.602  1.00 155.24 ? 1446 GLN B CA  1 
ATOM 483   C C   . GLN A 1 74   ? 10.870  1.389   -33.720  1.00 155.38 ? 1446 GLN B C   1 
ATOM 484   O O   . GLN A 1 74   ? 10.477  0.257   -34.002  1.00 155.22 ? 1446 GLN B O   1 
ATOM 485   C CB  . GLN A 1 74   ? 11.365  2.679   -35.843  1.00 156.28 ? 1446 GLN B CB  1 
ATOM 486   C CG  . GLN A 1 74   ? 10.745  3.447   -37.008  1.00 158.62 ? 1446 GLN B CG  1 
ATOM 487   C CD  . GLN A 1 74   ? 11.371  3.112   -38.355  1.00 160.86 ? 1446 GLN B CD  1 
ATOM 488   O OE1 . GLN A 1 74   ? 11.507  1.941   -38.716  1.00 160.76 ? 1446 GLN B OE1 1 
ATOM 489   N NE2 . GLN A 1 74   ? 11.737  4.142   -39.113  1.00 161.97 ? 1446 GLN B NE2 1 
ATOM 490   N N   . ALA A 1 75   ? 11.642  1.650   -32.663  1.00 156.22 ? 1447 ALA B N   1 
ATOM 491   C CA  . ALA A 1 75   ? 11.961  0.642   -31.640  1.00 152.48 ? 1447 ALA B CA  1 
ATOM 492   C C   . ALA A 1 75   ? 10.755  0.218   -30.774  1.00 148.64 ? 1447 ALA B C   1 
ATOM 493   O O   . ALA A 1 75   ? 10.693  -0.931  -30.333  1.00 145.47 ? 1447 ALA B O   1 
ATOM 494   C CB  . ALA A 1 75   ? 13.097  1.137   -30.754  1.00 152.36 ? 1447 ALA B CB  1 
ATOM 495   N N   . THR A 1 76   ? 9.827   1.145   -30.517  1.00 148.74 ? 1448 THR B N   1 
ATOM 496   C CA  . THR A 1 76   ? 8.571   0.849   -29.792  1.00 147.03 ? 1448 THR B CA  1 
ATOM 497   C C   . THR A 1 76   ? 7.629   -0.086  -30.573  1.00 149.86 ? 1448 THR B C   1 
ATOM 498   O O   . THR A 1 76   ? 6.923   -0.893  -29.960  1.00 149.73 ? 1448 THR B O   1 
ATOM 499   C CB  . THR A 1 76   ? 7.815   2.148   -29.399  1.00 142.88 ? 1448 THR B CB  1 
ATOM 500   O OG1 . THR A 1 76   ? 8.700   3.018   -28.685  1.00 140.51 ? 1448 THR B OG1 1 
ATOM 501   C CG2 . THR A 1 76   ? 6.597   1.863   -28.510  1.00 140.17 ? 1448 THR B CG2 1 
ATOM 502   N N   . TRP A 1 77   ? 7.609   0.023   -31.905  1.00 152.90 ? 1449 TRP B N   1 
ATOM 503   C CA  . TRP A 1 77   ? 6.855   -0.928  -32.741  1.00 153.60 ? 1449 TRP B CA  1 
ATOM 504   C C   . TRP A 1 77   ? 7.514   -2.312  -32.751  1.00 150.96 ? 1449 TRP B C   1 
ATOM 505   O O   . TRP A 1 77   ? 6.818   -3.324  -32.636  1.00 148.34 ? 1449 TRP B O   1 
ATOM 506   C CB  . TRP A 1 77   ? 6.682   -0.435  -34.188  1.00 158.84 ? 1449 TRP B CB  1 
ATOM 507   C CG  . TRP A 1 77   ? 5.655   0.660   -34.413  1.00 160.53 ? 1449 TRP B CG  1 
ATOM 508   C CD1 . TRP A 1 77   ? 5.830   1.783   -35.164  1.00 163.05 ? 1449 TRP B CD1 1 
ATOM 509   C CD2 . TRP A 1 77   ? 4.300   0.718   -33.921  1.00 159.35 ? 1449 TRP B CD2 1 
ATOM 510   N NE1 . TRP A 1 77   ? 4.688   2.544   -35.164  1.00 164.30 ? 1449 TRP B NE1 1 
ATOM 511   C CE2 . TRP A 1 77   ? 3.733   1.917   -34.410  1.00 160.38 ? 1449 TRP B CE2 1 
ATOM 512   C CE3 . TRP A 1 77   ? 3.515   -0.117  -33.111  1.00 157.79 ? 1449 TRP B CE3 1 
ATOM 513   C CZ2 . TRP A 1 77   ? 2.420   2.303   -34.117  1.00 158.73 ? 1449 TRP B CZ2 1 
ATOM 514   C CZ3 . TRP A 1 77   ? 2.205   0.270   -32.820  1.00 156.88 ? 1449 TRP B CZ3 1 
ATOM 515   C CH2 . TRP A 1 77   ? 1.674   1.469   -33.324  1.00 156.99 ? 1449 TRP B CH2 1 
ATOM 516   N N   . TYR A 1 78   ? 8.841   -2.352  -32.898  1.00 150.42 ? 1450 TYR B N   1 
ATOM 517   C CA  . TYR A 1 78   ? 9.604   -3.610  -32.794  1.00 149.35 ? 1450 TYR B CA  1 
ATOM 518   C C   . TYR A 1 78   ? 9.523   -4.238  -31.386  1.00 148.88 ? 1450 TYR B C   1 
ATOM 519   O O   . TYR A 1 78   ? 9.653   -5.457  -31.245  1.00 152.71 ? 1450 TYR B O   1 
ATOM 520   C CB  . TYR A 1 78   ? 11.081  -3.413  -33.193  1.00 149.23 ? 1450 TYR B CB  1 
ATOM 521   C CG  . TYR A 1 78   ? 11.334  -3.062  -34.658  1.00 151.09 ? 1450 TYR B CG  1 
ATOM 522   C CD1 . TYR A 1 78   ? 10.727  -3.780  -35.697  1.00 153.55 ? 1450 TYR B CD1 1 
ATOM 523   C CD2 . TYR A 1 78   ? 12.218  -2.035  -35.007  1.00 149.44 ? 1450 TYR B CD2 1 
ATOM 524   C CE1 . TYR A 1 78   ? 10.970  -3.464  -37.030  1.00 151.53 ? 1450 TYR B CE1 1 
ATOM 525   C CE2 . TYR A 1 78   ? 12.464  -1.714  -36.337  1.00 148.14 ? 1450 TYR B CE2 1 
ATOM 526   C CZ  . TYR A 1 78   ? 11.841  -2.431  -37.344  1.00 148.46 ? 1450 TYR B CZ  1 
ATOM 527   O OH  . TYR A 1 78   ? 12.084  -2.118  -38.660  1.00 146.00 ? 1450 TYR B OH  1 
ATOM 528   N N   . GLU A 1 79   ? 9.321   -3.405  -30.361  1.00 145.50 ? 1451 GLU B N   1 
ATOM 529   C CA  . GLU A 1 79   ? 9.088   -3.868  -28.981  1.00 138.72 ? 1451 GLU B CA  1 
ATOM 530   C C   . GLU A 1 79   ? 7.713   -4.535  -28.798  1.00 132.15 ? 1451 GLU B C   1 
ATOM 531   O O   . GLU A 1 79   ? 7.614   -5.597  -28.176  1.00 128.79 ? 1451 GLU B O   1 
ATOM 532   C CB  . GLU A 1 79   ? 9.257   -2.701  -27.988  1.00 138.56 ? 1451 GLU B CB  1 
ATOM 533   C CG  . GLU A 1 79   ? 8.834   -3.009  -26.553  1.00 137.32 ? 1451 GLU B CG  1 
ATOM 534   C CD  . GLU A 1 79   ? 9.453   -2.084  -25.517  1.00 135.20 ? 1451 GLU B CD  1 
ATOM 535   O OE1 . GLU A 1 79   ? 9.803   -0.930  -25.848  1.00 134.33 ? 1451 GLU B OE1 1 
ATOM 536   O OE2 . GLU A 1 79   ? 9.576   -2.516  -24.352  1.00 131.64 ? 1451 GLU B OE2 1 
ATOM 537   N N   . LYS A 1 80   ? 6.664   -3.903  -29.323  1.00 128.31 ? 1452 LYS B N   1 
ATOM 538   C CA  . LYS A 1 80   ? 5.299   -4.452  -29.249  1.00 124.58 ? 1452 LYS B CA  1 
ATOM 539   C C   . LYS A 1 80   ? 5.097   -5.713  -30.106  1.00 126.11 ? 1452 LYS B C   1 
ATOM 540   O O   . LYS A 1 80   ? 4.203   -6.509  -29.815  1.00 124.75 ? 1452 LYS B O   1 
ATOM 541   C CB  . LYS A 1 80   ? 4.264   -3.382  -29.614  1.00 121.78 ? 1452 LYS B CB  1 
ATOM 542   C CG  . LYS A 1 80   ? 4.101   -2.322  -28.539  1.00 120.56 ? 1452 LYS B CG  1 
ATOM 543   C CD  . LYS A 1 80   ? 3.387   -1.087  -29.058  1.00 121.10 ? 1452 LYS B CD  1 
ATOM 544   C CE  . LYS A 1 80   ? 3.245   -0.044  -27.964  1.00 122.27 ? 1452 LYS B CE  1 
ATOM 545   N NZ  . LYS A 1 80   ? 2.867   1.291   -28.502  1.00 124.22 ? 1452 LYS B NZ  1 
ATOM 546   N N   . LEU A 1 81   ? 5.926   -5.888  -31.143  1.00 130.08 ? 1453 LEU B N   1 
ATOM 547   C CA  . LEU A 1 81   ? 5.938   -7.113  -31.979  1.00 132.67 ? 1453 LEU B CA  1 
ATOM 548   C C   . LEU A 1 81   ? 6.739   -8.297  -31.382  1.00 132.11 ? 1453 LEU B C   1 
ATOM 549   O O   . LEU A 1 81   ? 6.804   -9.366  -32.001  1.00 133.90 ? 1453 LEU B O   1 
ATOM 550   C CB  . LEU A 1 81   ? 6.490   -6.802  -33.390  1.00 134.17 ? 1453 LEU B CB  1 
ATOM 551   C CG  . LEU A 1 81   ? 5.651   -5.978  -34.376  1.00 133.43 ? 1453 LEU B CG  1 
ATOM 552   C CD1 . LEU A 1 81   ? 6.500   -5.586  -35.577  1.00 133.41 ? 1453 LEU B CD1 1 
ATOM 553   C CD2 . LEU A 1 81   ? 4.416   -6.738  -34.837  1.00 132.80 ? 1453 LEU B CD2 1 
ATOM 554   N N   . HIS A 1 82   ? 7.344   -8.106  -30.204  1.00 128.35 ? 1454 HIS B N   1 
ATOM 555   C CA  . HIS A 1 82   ? 8.255   -9.084  -29.582  1.00 123.91 ? 1454 HIS B CA  1 
ATOM 556   C C   . HIS A 1 82   ? 9.508   -9.380  -30.436  1.00 123.75 ? 1454 HIS B C   1 
ATOM 557   O O   . HIS A 1 82   ? 10.068  -10.476 -30.368  1.00 124.88 ? 1454 HIS B O   1 
ATOM 558   C CB  . HIS A 1 82   ? 7.506   -10.373 -29.183  1.00 120.90 ? 1454 HIS B CB  1 
ATOM 559   C CG  . HIS A 1 82   ? 6.346   -10.135 -28.264  1.00 118.87 ? 1454 HIS B CG  1 
ATOM 560   N ND1 . HIS A 1 82   ? 6.458   -10.207 -26.892  1.00 118.58 ? 1454 HIS B ND1 1 
ATOM 561   C CD2 . HIS A 1 82   ? 5.055   -9.816  -28.519  1.00 117.44 ? 1454 HIS B CD2 1 
ATOM 562   C CE1 . HIS A 1 82   ? 5.286   -9.946  -26.342  1.00 117.54 ? 1454 HIS B CE1 1 
ATOM 563   N NE2 . HIS A 1 82   ? 4.417   -9.704  -27.307  1.00 117.23 ? 1454 HIS B NE2 1 
ATOM 564   N N   . GLU A 1 83   ? 9.941   -8.386  -31.220  1.00 123.95 ? 1455 GLU B N   1 
ATOM 565   C CA  . GLU A 1 83   ? 11.199  -8.438  -31.966  1.00 125.04 ? 1455 GLU B CA  1 
ATOM 566   C C   . GLU A 1 83   ? 12.224  -7.634  -31.177  1.00 125.25 ? 1455 GLU B C   1 
ATOM 567   O O   . GLU A 1 83   ? 12.492  -6.466  -31.472  1.00 124.16 ? 1455 GLU B O   1 
ATOM 568   C CB  . GLU A 1 83   ? 11.030  -7.876  -33.380  1.00 125.42 ? 1455 GLU B CB  1 
ATOM 569   C CG  . GLU A 1 83   ? 10.117  -8.715  -34.264  1.00 126.08 ? 1455 GLU B CG  1 
ATOM 570   C CD  . GLU A 1 83   ? 10.316  -8.466  -35.751  1.00 127.14 ? 1455 GLU B CD  1 
ATOM 571   O OE1 . GLU A 1 83   ? 10.768  -7.362  -36.132  1.00 127.27 ? 1455 GLU B OE1 1 
ATOM 572   O OE2 . GLU A 1 83   ? 10.011  -9.381  -36.545  1.00 126.50 ? 1455 GLU B OE2 1 
ATOM 573   N N   . TRP A 1 84   ? 12.790  -8.285  -30.167  1.00 127.59 ? 1456 TRP B N   1 
ATOM 574   C CA  . TRP A 1 84   ? 13.640  -7.622  -29.178  1.00 130.91 ? 1456 TRP B CA  1 
ATOM 575   C C   . TRP A 1 84   ? 15.042  -7.332  -29.722  1.00 134.15 ? 1456 TRP B C   1 
ATOM 576   O O   . TRP A 1 84   ? 15.612  -6.280  -29.424  1.00 137.04 ? 1456 TRP B O   1 
ATOM 577   C CB  . TRP A 1 84   ? 13.740  -8.466  -27.901  1.00 133.68 ? 1456 TRP B CB  1 
ATOM 578   C CG  . TRP A 1 84   ? 12.409  -8.898  -27.329  1.00 135.96 ? 1456 TRP B CG  1 
ATOM 579   C CD1 . TRP A 1 84   ? 11.846  -10.139 -27.417  1.00 137.35 ? 1456 TRP B CD1 1 
ATOM 580   C CD2 . TRP A 1 84   ? 11.485  -8.091  -26.588  1.00 137.83 ? 1456 TRP B CD2 1 
ATOM 581   N NE1 . TRP A 1 84   ? 10.631  -10.157 -26.774  1.00 137.61 ? 1456 TRP B NE1 1 
ATOM 582   C CE2 . TRP A 1 84   ? 10.384  -8.914  -26.256  1.00 137.72 ? 1456 TRP B CE2 1 
ATOM 583   C CE3 . TRP A 1 84   ? 11.480  -6.753  -26.169  1.00 140.42 ? 1456 TRP B CE3 1 
ATOM 584   C CZ2 . TRP A 1 84   ? 9.286   -8.442  -25.524  1.00 139.35 ? 1456 TRP B CZ2 1 
ATOM 585   C CZ3 . TRP A 1 84   ? 10.387  -6.282  -25.440  1.00 141.15 ? 1456 TRP B CZ3 1 
ATOM 586   C CH2 . TRP A 1 84   ? 9.305   -7.128  -25.127  1.00 140.63 ? 1456 TRP B CH2 1 
ATOM 587   N N   . GLU A 1 85   ? 15.594  -8.271  -30.497  1.00 136.01 ? 1457 GLU B N   1 
ATOM 588   C CA  . GLU A 1 85   ? 16.896  -8.082  -31.174  1.00 135.81 ? 1457 GLU B CA  1 
ATOM 589   C C   . GLU A 1 85   ? 16.872  -6.890  -32.141  1.00 135.02 ? 1457 GLU B C   1 
ATOM 590   O O   . GLU A 1 85   ? 17.831  -6.115  -32.196  1.00 135.99 ? 1457 GLU B O   1 
ATOM 591   C CB  . GLU A 1 85   ? 17.350  -9.362  -31.911  1.00 136.48 ? 1457 GLU B CB  1 
ATOM 592   C CG  . GLU A 1 85   ? 18.489  -10.122 -31.236  1.00 137.85 ? 1457 GLU B CG  1 
ATOM 593   C CD  . GLU A 1 85   ? 19.847  -9.468  -31.410  1.00 141.67 ? 1457 GLU B CD  1 
ATOM 594   O OE1 . GLU A 1 85   ? 20.572  -9.339  -30.400  1.00 140.52 ? 1457 GLU B OE1 1 
ATOM 595   O OE2 . GLU A 1 85   ? 20.196  -9.092  -32.550  1.00 147.85 ? 1457 GLU B OE2 1 
ATOM 596   N N   . ASP A 1 86   ? 15.777  -6.758  -32.893  1.00 132.43 ? 1458 ASP B N   1 
ATOM 597   C CA  . ASP A 1 86   ? 15.564  -5.607  -33.785  1.00 130.52 ? 1458 ASP B CA  1 
ATOM 598   C C   . ASP A 1 86   ? 15.363  -4.304  -33.003  1.00 130.17 ? 1458 ASP B C   1 
ATOM 599   O O   . ASP A 1 86   ? 15.934  -3.273  -33.360  1.00 131.13 ? 1458 ASP B O   1 
ATOM 600   C CB  . ASP A 1 86   ? 14.358  -5.840  -34.711  1.00 127.95 ? 1458 ASP B CB  1 
ATOM 601   C CG  . ASP A 1 86   ? 14.607  -6.929  -35.743  1.00 126.37 ? 1458 ASP B CG  1 
ATOM 602   O OD1 . ASP A 1 86   ? 15.658  -6.896  -36.418  1.00 125.64 ? 1458 ASP B OD1 1 
ATOM 603   O OD2 . ASP A 1 86   ? 13.739  -7.813  -35.891  1.00 125.36 ? 1458 ASP B OD2 1 
ATOM 604   N N   . ALA A 1 87   ? 14.554  -4.361  -31.946  1.00 130.60 ? 1459 ALA B N   1 
ATOM 605   C CA  . ALA A 1 87   ? 14.270  -3.193  -31.096  1.00 130.93 ? 1459 ALA B CA  1 
ATOM 606   C C   . ALA A 1 87   ? 15.490  -2.687  -30.312  1.00 133.23 ? 1459 ALA B C   1 
ATOM 607   O O   . ALA A 1 87   ? 15.616  -1.483  -30.084  1.00 132.13 ? 1459 ALA B O   1 
ATOM 608   C CB  . ALA A 1 87   ? 13.129  -3.507  -30.137  1.00 128.96 ? 1459 ALA B CB  1 
ATOM 609   N N   . LEU A 1 88   ? 16.370  -3.607  -29.905  1.00 136.76 ? 1460 LEU B N   1 
ATOM 610   C CA  . LEU A 1 88   ? 17.597  -3.281  -29.156  1.00 139.34 ? 1460 LEU B CA  1 
ATOM 611   C C   . LEU A 1 88   ? 18.518  -2.328  -29.921  1.00 143.20 ? 1460 LEU B C   1 
ATOM 612   O O   . LEU A 1 88   ? 18.884  -1.267  -29.409  1.00 142.44 ? 1460 LEU B O   1 
ATOM 613   C CB  . LEU A 1 88   ? 18.367  -4.567  -28.810  1.00 140.03 ? 1460 LEU B CB  1 
ATOM 614   C CG  . LEU A 1 88   ? 19.714  -4.449  -28.082  1.00 141.61 ? 1460 LEU B CG  1 
ATOM 615   C CD1 . LEU A 1 88   ? 19.545  -3.822  -26.707  1.00 141.03 ? 1460 LEU B CD1 1 
ATOM 616   C CD2 . LEU A 1 88   ? 20.383  -5.811  -27.971  1.00 142.34 ? 1460 LEU B CD2 1 
ATOM 617   N N   . VAL A 1 89   ? 18.884  -2.724  -31.141  1.00 148.13 ? 1461 VAL B N   1 
ATOM 618   C CA  . VAL A 1 89   ? 19.790  -1.938  -31.998  1.00 150.84 ? 1461 VAL B CA  1 
ATOM 619   C C   . VAL A 1 89   ? 19.051  -0.705  -32.560  1.00 151.09 ? 1461 VAL B C   1 
ATOM 620   O O   . VAL A 1 89   ? 19.683  0.311   -32.864  1.00 155.32 ? 1461 VAL B O   1 
ATOM 621   C CB  . VAL A 1 89   ? 20.423  -2.804  -33.131  1.00 150.85 ? 1461 VAL B CB  1 
ATOM 622   C CG1 . VAL A 1 89   ? 21.435  -2.010  -33.955  1.00 150.29 ? 1461 VAL B CG1 1 
ATOM 623   C CG2 . VAL A 1 89   ? 21.120  -4.035  -32.556  1.00 150.12 ? 1461 VAL B CG2 1 
ATOM 624   N N   . ALA A 1 90   ? 17.723  -0.796  -32.687  1.00 147.44 ? 1462 ALA B N   1 
ATOM 625   C CA  . ALA A 1 90   ? 16.878  0.354   -33.049  1.00 144.71 ? 1462 ALA B CA  1 
ATOM 626   C C   . ALA A 1 90   ? 16.858  1.443   -31.968  1.00 142.85 ? 1462 ALA B C   1 
ATOM 627   O O   . ALA A 1 90   ? 16.829  2.633   -32.291  1.00 143.76 ? 1462 ALA B O   1 
ATOM 628   C CB  . ALA A 1 90   ? 15.458  -0.104  -33.354  1.00 142.40 ? 1462 ALA B CB  1 
ATOM 629   N N   . TYR A 1 91   ? 16.856  1.033   -30.698  1.00 139.44 ? 1463 TYR B N   1 
ATOM 630   C CA  . TYR A 1 91   ? 16.965  1.976   -29.569  1.00 138.07 ? 1463 TYR B CA  1 
ATOM 631   C C   . TYR A 1 91   ? 18.335  2.657   -29.473  1.00 140.14 ? 1463 TYR B C   1 
ATOM 632   O O   . TYR A 1 91   ? 18.415  3.808   -29.050  1.00 139.67 ? 1463 TYR B O   1 
ATOM 633   C CB  . TYR A 1 91   ? 16.647  1.292   -28.227  1.00 134.99 ? 1463 TYR B CB  1 
ATOM 634   C CG  . TYR A 1 91   ? 15.177  1.260   -27.868  1.00 133.24 ? 1463 TYR B CG  1 
ATOM 635   C CD1 . TYR A 1 91   ? 14.526  0.053   -27.599  1.00 131.13 ? 1463 TYR B CD1 1 
ATOM 636   C CD2 . TYR A 1 91   ? 14.434  2.439   -27.780  1.00 134.38 ? 1463 TYR B CD2 1 
ATOM 637   C CE1 . TYR A 1 91   ? 13.178  0.023   -27.265  1.00 130.55 ? 1463 TYR B CE1 1 
ATOM 638   C CE2 . TYR A 1 91   ? 13.087  2.418   -27.449  1.00 133.68 ? 1463 TYR B CE2 1 
ATOM 639   C CZ  . TYR A 1 91   ? 12.463  1.208   -27.190  1.00 131.40 ? 1463 TYR B CZ  1 
ATOM 640   O OH  . TYR A 1 91   ? 11.129  1.181   -26.859  1.00 130.33 ? 1463 TYR B OH  1 
ATOM 641   N N   . ASP A 1 92   ? 19.400  1.944   -29.845  1.00 142.48 ? 1464 ASP B N   1 
ATOM 642   C CA  . ASP A 1 92   ? 20.758  2.516   -29.886  1.00 145.26 ? 1464 ASP B CA  1 
ATOM 643   C C   . ASP A 1 92   ? 20.885  3.627   -30.936  1.00 150.12 ? 1464 ASP B C   1 
ATOM 644   O O   . ASP A 1 92   ? 21.500  4.664   -30.673  1.00 149.88 ? 1464 ASP B O   1 
ATOM 645   C CB  . ASP A 1 92   ? 21.806  1.424   -30.157  1.00 142.61 ? 1464 ASP B CB  1 
ATOM 646   C CG  . ASP A 1 92   ? 21.976  0.464   -28.989  1.00 139.26 ? 1464 ASP B CG  1 
ATOM 647   O OD1 . ASP A 1 92   ? 21.085  0.395   -28.115  1.00 135.50 ? 1464 ASP B OD1 1 
ATOM 648   O OD2 . ASP A 1 92   ? 23.012  -0.231  -28.952  1.00 140.14 ? 1464 ASP B OD2 1 
ATOM 649   N N   . LYS A 1 93   ? 20.309  3.389   -32.118  1.00 154.01 ? 1465 LYS B N   1 
ATOM 650   C CA  . LYS A 1 93   ? 20.195  4.401   -33.185  1.00 157.59 ? 1465 LYS B CA  1 
ATOM 651   C C   . LYS A 1 93   ? 19.483  5.661   -32.671  1.00 163.23 ? 1465 LYS B C   1 
ATOM 652   O O   . LYS A 1 93   ? 19.911  6.783   -32.950  1.00 164.34 ? 1465 LYS B O   1 
ATOM 653   C CB  . LYS A 1 93   ? 19.433  3.819   -34.392  1.00 155.06 ? 1465 LYS B CB  1 
ATOM 654   C CG  . LYS A 1 93   ? 19.450  4.663   -35.666  1.00 155.97 ? 1465 LYS B CG  1 
ATOM 655   C CD  . LYS A 1 93   ? 20.628  4.334   -36.573  1.00 157.22 ? 1465 LYS B CD  1 
ATOM 656   C CE  . LYS A 1 93   ? 20.555  5.114   -37.878  1.00 159.28 ? 1465 LYS B CE  1 
ATOM 657   N NZ  . LYS A 1 93   ? 21.636  4.735   -38.830  1.00 160.63 ? 1465 LYS B NZ  1 
ATOM 658   N N   . LYS A 1 94   ? 18.404  5.455   -31.915  1.00 168.21 ? 1466 LYS B N   1 
ATOM 659   C CA  . LYS A 1 94   ? 17.621  6.542   -31.313  1.00 169.21 ? 1466 LYS B CA  1 
ATOM 660   C C   . LYS A 1 94   ? 18.332  7.216   -30.125  1.00 172.79 ? 1466 LYS B C   1 
ATOM 661   O O   . LYS A 1 94   ? 18.250  8.436   -29.978  1.00 176.27 ? 1466 LYS B O   1 
ATOM 662   C CB  . LYS A 1 94   ? 16.246  6.006   -30.877  1.00 163.73 ? 1466 LYS B CB  1 
ATOM 663   C CG  . LYS A 1 94   ? 15.271  7.037   -30.322  1.00 160.88 ? 1466 LYS B CG  1 
ATOM 664   C CD  . LYS A 1 94   ? 14.775  8.007   -31.380  1.00 159.30 ? 1466 LYS B CD  1 
ATOM 665   C CE  . LYS A 1 94   ? 13.797  9.001   -30.775  1.00 158.46 ? 1466 LYS B CE  1 
ATOM 666   N NZ  . LYS A 1 94   ? 13.235  9.936   -31.786  1.00 158.51 ? 1466 LYS B NZ  1 
ATOM 667   N N   . MET A 1 95   ? 19.009  6.427   -29.285  1.00 170.86 ? 1467 MET B N   1 
ATOM 668   C CA  . MET A 1 95   ? 19.641  6.940   -28.051  1.00 169.12 ? 1467 MET B CA  1 
ATOM 669   C C   . MET A 1 95   ? 20.909  7.770   -28.285  1.00 168.25 ? 1467 MET B C   1 
ATOM 670   O O   . MET A 1 95   ? 21.131  8.759   -27.584  1.00 168.37 ? 1467 MET B O   1 
ATOM 671   C CB  . MET A 1 95   ? 19.960  5.798   -27.068  1.00 165.70 ? 1467 MET B CB  1 
ATOM 672   C CG  . MET A 1 95   ? 18.789  5.371   -26.192  1.00 163.29 ? 1467 MET B CG  1 
ATOM 673   S SD  . MET A 1 95   ? 19.281  4.259   -24.857  1.00 158.61 ? 1467 MET B SD  1 
ATOM 674   C CE  . MET A 1 95   ? 20.080  5.400   -23.727  1.00 159.22 ? 1467 MET B CE  1 
ATOM 675   N N   . ASP A 1 96   ? 21.741  7.356   -29.240  1.00 164.66 ? 1468 ASP B N   1 
ATOM 676   C CA  . ASP A 1 96   ? 22.982  8.080   -29.566  1.00 163.66 ? 1468 ASP B CA  1 
ATOM 677   C C   . ASP A 1 96   ? 22.746  9.386   -30.343  1.00 168.18 ? 1468 ASP B C   1 
ATOM 678   O O   . ASP A 1 96   ? 23.533  10.326  -30.215  1.00 167.30 ? 1468 ASP B O   1 
ATOM 679   C CB  . ASP A 1 96   ? 23.956  7.174   -30.332  1.00 159.07 ? 1468 ASP B CB  1 
ATOM 680   C CG  . ASP A 1 96   ? 24.529  6.062   -29.463  1.00 156.11 ? 1468 ASP B CG  1 
ATOM 681   O OD1 . ASP A 1 96   ? 25.060  6.362   -28.372  1.00 154.57 ? 1468 ASP B OD1 1 
ATOM 682   O OD2 . ASP A 1 96   ? 24.460  4.885   -29.875  1.00 154.39 ? 1468 ASP B OD2 1 
ATOM 683   N N   . THR A 1 97   ? 21.680  9.437   -31.147  1.00 174.56 ? 1469 THR B N   1 
ATOM 684   C CA  . THR A 1 97   ? 21.293  10.657  -31.878  1.00 179.11 ? 1469 THR B CA  1 
ATOM 685   C C   . THR A 1 97   ? 20.681  11.692  -30.922  1.00 183.96 ? 1469 THR B C   1 
ATOM 686   O O   . THR A 1 97   ? 21.122  12.842  -30.883  1.00 189.39 ? 1469 THR B O   1 
ATOM 687   C CB  . THR A 1 97   ? 20.293  10.351  -33.021  1.00 176.65 ? 1469 THR B CB  1 
ATOM 688   O OG1 . THR A 1 97   ? 20.759  9.234   -33.789  1.00 174.78 ? 1469 THR B OG1 1 
ATOM 689   C CG2 . THR A 1 97   ? 20.124  11.554  -33.953  1.00 177.23 ? 1469 THR B CG2 1 
ATOM 690   N N   . ASN A 1 98   ? 19.666  11.271  -30.164  1.00 182.84 ? 1470 ASN B N   1 
ATOM 691   C CA  . ASN A 1 98   ? 19.021  12.120  -29.143  1.00 180.43 ? 1470 ASN B CA  1 
ATOM 692   C C   . ASN A 1 98   ? 19.885  12.221  -27.875  1.00 181.40 ? 1470 ASN B C   1 
ATOM 693   O O   . ASN A 1 98   ? 20.965  11.629  -27.796  1.00 183.24 ? 1470 ASN B O   1 
ATOM 694   C CB  . ASN A 1 98   ? 17.615  11.582  -28.794  1.00 174.06 ? 1470 ASN B CB  1 
ATOM 695   C CG  . ASN A 1 98   ? 16.569  11.934  -29.838  1.00 171.05 ? 1470 ASN B CG  1 
ATOM 696   O OD1 . ASN A 1 98   ? 16.884  12.176  -31.003  1.00 172.85 ? 1470 ASN B OD1 1 
ATOM 697   N ND2 . ASN A 1 98   ? 15.310  11.962  -29.419  1.00 167.14 ? 1470 ASN B ND2 1 
ATOM 698   N N   . LYS A 1 99   ? 19.400  12.971  -26.885  1.00 179.45 ? 1471 LYS B N   1 
ATOM 699   C CA  . LYS A 1 99   ? 20.065  13.078  -25.579  1.00 176.57 ? 1471 LYS B CA  1 
ATOM 700   C C   . LYS A 1 99   ? 19.809  11.795  -24.768  1.00 172.26 ? 1471 LYS B C   1 
ATOM 701   O O   . LYS A 1 99   ? 19.247  10.824  -25.287  1.00 166.23 ? 1471 LYS B O   1 
ATOM 702   C CB  . LYS A 1 99   ? 19.552  14.299  -24.789  1.00 177.00 ? 1471 LYS B CB  1 
ATOM 703   C CG  . LYS A 1 99   ? 19.420  15.613  -25.554  1.00 176.02 ? 1471 LYS B CG  1 
ATOM 704   C CD  . LYS A 1 99   ? 20.711  16.056  -26.218  1.00 174.11 ? 1471 LYS B CD  1 
ATOM 705   C CE  . LYS A 1 99   ? 20.493  17.358  -26.969  1.00 174.84 ? 1471 LYS B CE  1 
ATOM 706   N NZ  . LYS A 1 99   ? 21.760  17.932  -27.495  1.00 175.20 ? 1471 LYS B NZ  1 
ATOM 707   N N   . ASP A 1 100  ? 20.227  11.788  -23.502  1.00 173.84 ? 1472 ASP B N   1 
ATOM 708   C CA  . ASP A 1 100  ? 19.770  10.770  -22.555  1.00 172.32 ? 1472 ASP B CA  1 
ATOM 709   C C   . ASP A 1 100  ? 18.323  11.073  -22.160  1.00 173.44 ? 1472 ASP B C   1 
ATOM 710   O O   . ASP A 1 100  ? 18.047  12.113  -21.558  1.00 174.96 ? 1472 ASP B O   1 
ATOM 711   C CB  . ASP A 1 100  ? 20.640  10.733  -21.300  1.00 173.47 ? 1472 ASP B CB  1 
ATOM 712   C CG  . ASP A 1 100  ? 20.159  9.697   -20.299  1.00 171.11 ? 1472 ASP B CG  1 
ATOM 713   O OD1 . ASP A 1 100  ? 19.529  10.082  -19.291  1.00 172.48 ? 1472 ASP B OD1 1 
ATOM 714   O OD2 . ASP A 1 100  ? 20.383  8.493   -20.541  1.00 166.59 ? 1472 ASP B OD2 1 
ATOM 715   N N   . ASP A 1 101  ? 17.417  10.156  -22.499  1.00 171.49 ? 1473 ASP B N   1 
ATOM 716   C CA  . ASP A 1 101  ? 15.986  10.286  -22.213  1.00 169.57 ? 1473 ASP B CA  1 
ATOM 717   C C   . ASP A 1 101  ? 15.545  9.100   -21.335  1.00 168.60 ? 1473 ASP B C   1 
ATOM 718   O O   . ASP A 1 101  ? 15.773  7.952   -21.716  1.00 175.94 ? 1473 ASP B O   1 
ATOM 719   C CB  . ASP A 1 101  ? 15.192  10.297  -23.526  1.00 165.95 ? 1473 ASP B CB  1 
ATOM 720   C CG  . ASP A 1 101  ? 15.614  11.427  -24.466  1.00 166.34 ? 1473 ASP B CG  1 
ATOM 721   O OD1 . ASP A 1 101  ? 15.734  12.582  -24.004  1.00 168.20 ? 1473 ASP B OD1 1 
ATOM 722   O OD2 . ASP A 1 101  ? 15.821  11.161  -25.671  1.00 164.00 ? 1473 ASP B OD2 1 
ATOM 723   N N   . PRO A 1 102  ? 14.932  9.362   -20.154  1.00 163.90 ? 1474 PRO B N   1 
ATOM 724   C CA  . PRO A 1 102  ? 14.419  8.278   -19.286  1.00 159.38 ? 1474 PRO B CA  1 
ATOM 725   C C   . PRO A 1 102  ? 13.366  7.324   -19.887  1.00 154.84 ? 1474 PRO B C   1 
ATOM 726   O O   . PRO A 1 102  ? 13.192  6.218   -19.370  1.00 152.01 ? 1474 PRO B O   1 
ATOM 727   C CB  . PRO A 1 102  ? 13.811  9.040   -18.105  1.00 162.14 ? 1474 PRO B CB  1 
ATOM 728   C CG  . PRO A 1 102  ? 14.604  10.293  -18.030  1.00 165.98 ? 1474 PRO B CG  1 
ATOM 729   C CD  . PRO A 1 102  ? 14.917  10.660  -19.451  1.00 166.10 ? 1474 PRO B CD  1 
ATOM 730   N N   . GLU A 1 103  ? 12.667  7.751   -20.940  1.00 154.37 ? 1475 GLU B N   1 
ATOM 731   C CA  . GLU A 1 103  ? 11.724  6.887   -21.668  1.00 150.95 ? 1475 GLU B CA  1 
ATOM 732   C C   . GLU A 1 103  ? 12.466  5.818   -22.474  1.00 147.72 ? 1475 GLU B C   1 
ATOM 733   O O   . GLU A 1 103  ? 12.195  4.625   -22.327  1.00 141.09 ? 1475 GLU B O   1 
ATOM 734   C CB  . GLU A 1 103  ? 10.851  7.722   -22.612  1.00 152.15 ? 1475 GLU B CB  1 
ATOM 735   C CG  . GLU A 1 103  ? 9.931   8.718   -21.913  1.00 154.62 ? 1475 GLU B CG  1 
ATOM 736   C CD  . GLU A 1 103  ? 9.532   9.892   -22.798  1.00 156.26 ? 1475 GLU B CD  1 
ATOM 737   O OE1 . GLU A 1 103  ? 9.433   9.724   -24.033  1.00 155.27 ? 1475 GLU B OE1 1 
ATOM 738   O OE2 . GLU A 1 103  ? 9.310   10.994  -22.253  1.00 158.78 ? 1475 GLU B OE2 1 
ATOM 739   N N   . LEU A 1 104  ? 13.401  6.265   -23.318  1.00 152.21 ? 1476 LEU B N   1 
ATOM 740   C CA  . LEU A 1 104  ? 14.232  5.379   -24.161  1.00 152.58 ? 1476 LEU B CA  1 
ATOM 741   C C   . LEU A 1 104  ? 15.164  4.478   -23.341  1.00 151.52 ? 1476 LEU B C   1 
ATOM 742   O O   . LEU A 1 104  ? 15.501  3.373   -23.769  1.00 149.66 ? 1476 LEU B O   1 
ATOM 743   C CB  . LEU A 1 104  ? 15.091  6.200   -25.139  1.00 155.28 ? 1476 LEU B CB  1 
ATOM 744   C CG  . LEU A 1 104  ? 14.422  7.142   -26.148  1.00 158.11 ? 1476 LEU B CG  1 
ATOM 745   C CD1 . LEU A 1 104  ? 15.474  7.997   -26.842  1.00 159.96 ? 1476 LEU B CD1 1 
ATOM 746   C CD2 . LEU A 1 104  ? 13.600  6.369   -27.167  1.00 157.06 ? 1476 LEU B CD2 1 
ATOM 747   N N   . MET A 1 105  ? 15.591  4.974   -22.180  1.00 154.87 ? 1477 MET B N   1 
ATOM 748   C CA  . MET A 1 105  ? 16.496  4.254   -21.276  1.00 156.15 ? 1477 MET B CA  1 
ATOM 749   C C   . MET A 1 105  ? 15.846  3.005   -20.678  1.00 151.41 ? 1477 MET B C   1 
ATOM 750   O O   . MET A 1 105  ? 16.504  1.979   -20.514  1.00 147.98 ? 1477 MET B O   1 
ATOM 751   C CB  . MET A 1 105  ? 16.954  5.191   -20.154  1.00 162.77 ? 1477 MET B CB  1 
ATOM 752   C CG  . MET A 1 105  ? 18.125  4.687   -19.332  1.00 165.26 ? 1477 MET B CG  1 
ATOM 753   S SD  . MET A 1 105  ? 18.858  6.021   -18.363  1.00 172.58 ? 1477 MET B SD  1 
ATOM 754   C CE  . MET A 1 105  ? 17.552  6.349   -17.183  1.00 174.83 ? 1477 MET B CE  1 
ATOM 755   N N   . LEU A 1 106  ? 14.561  3.109   -20.344  1.00 150.32 ? 1478 LEU B N   1 
ATOM 756   C CA  . LEU A 1 106  ? 13.766  1.955   -19.912  1.00 147.83 ? 1478 LEU B CA  1 
ATOM 757   C C   . LEU A 1 106  ? 13.505  0.994   -21.070  1.00 147.13 ? 1478 LEU B C   1 
ATOM 758   O O   . LEU A 1 106  ? 13.672  -0.215  -20.922  1.00 144.42 ? 1478 LEU B O   1 
ATOM 759   C CB  . LEU A 1 106  ? 12.430  2.407   -19.319  1.00 146.79 ? 1478 LEU B CB  1 
ATOM 760   C CG  . LEU A 1 106  ? 12.509  3.108   -17.963  1.00 146.89 ? 1478 LEU B CG  1 
ATOM 761   C CD1 . LEU A 1 106  ? 11.241  3.907   -17.698  1.00 147.98 ? 1478 LEU B CD1 1 
ATOM 762   C CD2 . LEU A 1 106  ? 12.756  2.099   -16.851  1.00 145.01 ? 1478 LEU B CD2 1 
ATOM 763   N N   . GLY A 1 107  ? 13.091  1.544   -22.211  1.00 150.14 ? 1479 GLY B N   1 
ATOM 764   C CA  . GLY A 1 107  ? 12.788  0.759   -23.410  1.00 150.22 ? 1479 GLY B CA  1 
ATOM 765   C C   . GLY A 1 107  ? 13.934  -0.085  -23.935  1.00 150.61 ? 1479 GLY B C   1 
ATOM 766   O O   . GLY A 1 107  ? 13.719  -1.218  -24.371  1.00 152.51 ? 1479 GLY B O   1 
ATOM 767   N N   . ARG A 1 108  ? 15.148  0.465   -23.898  1.00 150.96 ? 1480 ARG B N   1 
ATOM 768   C CA  . ARG A 1 108  ? 16.348  -0.274  -24.307  1.00 147.57 ? 1480 ARG B CA  1 
ATOM 769   C C   . ARG A 1 108  ? 16.665  -1.414  -23.335  1.00 141.07 ? 1480 ARG B C   1 
ATOM 770   O O   . ARG A 1 108  ? 17.147  -2.468  -23.751  1.00 140.13 ? 1480 ARG B O   1 
ATOM 771   C CB  . ARG A 1 108  ? 17.564  0.653   -24.424  1.00 152.07 ? 1480 ARG B CB  1 
ATOM 772   C CG  . ARG A 1 108  ? 18.676  0.073   -25.292  1.00 153.56 ? 1480 ARG B CG  1 
ATOM 773   C CD  . ARG A 1 108  ? 20.068  0.297   -24.721  1.00 153.82 ? 1480 ARG B CD  1 
ATOM 774   N NE  . ARG A 1 108  ? 21.057  -0.566  -25.371  1.00 153.52 ? 1480 ARG B NE  1 
ATOM 775   C CZ  . ARG A 1 108  ? 22.381  -0.456  -25.247  1.00 155.29 ? 1480 ARG B CZ  1 
ATOM 776   N NH1 . ARG A 1 108  ? 22.931  0.498   -24.495  1.00 157.34 ? 1480 ARG B NH1 1 
ATOM 777   N NH2 . ARG A 1 108  ? 23.171  -1.311  -25.893  1.00 155.85 ? 1480 ARG B NH2 1 
ATOM 778   N N   . MET A 1 109  ? 16.403  -1.189  -22.049  1.00 137.23 ? 1481 MET B N   1 
ATOM 779   C CA  . MET A 1 109  ? 16.594  -2.217  -21.018  1.00 134.72 ? 1481 MET B CA  1 
ATOM 780   C C   . MET A 1 109  ? 15.577  -3.361  -21.094  1.00 131.76 ? 1481 MET B C   1 
ATOM 781   O O   . MET A 1 109  ? 15.915  -4.503  -20.774  1.00 129.64 ? 1481 MET B O   1 
ATOM 782   C CB  . MET A 1 109  ? 16.557  -1.596  -19.618  1.00 134.39 ? 1481 MET B CB  1 
ATOM 783   C CG  . MET A 1 109  ? 17.792  -0.785  -19.267  1.00 133.56 ? 1481 MET B CG  1 
ATOM 784   S SD  . MET A 1 109  ? 17.623  0.049   -17.682  1.00 132.54 ? 1481 MET B SD  1 
ATOM 785   C CE  . MET A 1 109  ? 17.647  -1.356  -16.565  1.00 132.70 ? 1481 MET B CE  1 
ATOM 786   N N   . ARG A 1 110  ? 14.337  -3.058  -21.484  1.00 131.12 ? 1482 ARG B N   1 
ATOM 787   C CA  . ARG A 1 110  ? 13.295  -4.090  -21.626  1.00 130.24 ? 1482 ARG B CA  1 
ATOM 788   C C   . ARG A 1 110  ? 13.635  -5.094  -22.731  1.00 131.00 ? 1482 ARG B C   1 
ATOM 789   O O   . ARG A 1 110  ? 13.306  -6.280  -22.615  1.00 127.50 ? 1482 ARG B O   1 
ATOM 790   C CB  . ARG A 1 110  ? 11.915  -3.463  -21.872  1.00 128.51 ? 1482 ARG B CB  1 
ATOM 791   C CG  . ARG A 1 110  ? 11.359  -2.723  -20.665  1.00 127.85 ? 1482 ARG B CG  1 
ATOM 792   C CD  . ARG A 1 110  ? 9.892   -2.356  -20.825  1.00 126.60 ? 1482 ARG B CD  1 
ATOM 793   N NE  . ARG A 1 110  ? 9.639   -0.970  -20.419  1.00 128.05 ? 1482 ARG B NE  1 
ATOM 794   C CZ  . ARG A 1 110  ? 9.530   0.083   -21.237  1.00 127.91 ? 1482 ARG B CZ  1 
ATOM 795   N NH1 . ARG A 1 110  ? 9.626   -0.038  -22.563  1.00 126.15 ? 1482 ARG B NH1 1 
ATOM 796   N NH2 . ARG A 1 110  ? 9.304   1.289   -20.717  1.00 130.03 ? 1482 ARG B NH2 1 
ATOM 797   N N   . CYS A 1 111  ? 14.291  -4.610  -23.789  1.00 134.95 ? 1483 CYS B N   1 
ATOM 798   C CA  . CYS A 1 111  ? 14.862  -5.471  -24.830  1.00 136.91 ? 1483 CYS B CA  1 
ATOM 799   C C   . CYS A 1 111  ? 15.967  -6.379  -24.268  1.00 140.59 ? 1483 CYS B C   1 
ATOM 800   O O   . CYS A 1 111  ? 16.036  -7.560  -24.616  1.00 141.48 ? 1483 CYS B O   1 
ATOM 801   C CB  . CYS A 1 111  ? 15.416  -4.630  -25.992  1.00 135.27 ? 1483 CYS B CB  1 
ATOM 802   S SG  . CYS A 1 111  ? 14.198  -3.584  -26.832  1.00 132.55 ? 1483 CYS B SG  1 
ATOM 803   N N   . LEU A 1 112  ? 16.820  -5.821  -23.408  1.00 141.63 ? 1484 LEU B N   1 
ATOM 804   C CA  . LEU A 1 112  ? 17.895  -6.583  -22.757  1.00 139.58 ? 1484 LEU B CA  1 
ATOM 805   C C   . LEU A 1 112  ? 17.395  -7.664  -21.787  1.00 139.05 ? 1484 LEU B C   1 
ATOM 806   O O   . LEU A 1 112  ? 17.991  -8.739  -21.721  1.00 138.50 ? 1484 LEU B O   1 
ATOM 807   C CB  . LEU A 1 112  ? 18.884  -5.640  -22.046  1.00 140.35 ? 1484 LEU B CB  1 
ATOM 808   C CG  . LEU A 1 112  ? 19.773  -4.807  -22.979  1.00 141.88 ? 1484 LEU B CG  1 
ATOM 809   C CD1 . LEU A 1 112  ? 20.328  -3.571  -22.286  1.00 142.99 ? 1484 LEU B CD1 1 
ATOM 810   C CD2 . LEU A 1 112  ? 20.911  -5.645  -23.543  1.00 143.00 ? 1484 LEU B CD2 1 
ATOM 811   N N   . GLU A 1 113  ? 16.313  -7.393  -21.051  1.00 141.26 ? 1485 GLU B N   1 
ATOM 812   C CA  . GLU A 1 113  ? 15.777  -8.373  -20.084  1.00 143.02 ? 1485 GLU B CA  1 
ATOM 813   C C   . GLU A 1 113  ? 15.015  -9.522  -20.755  1.00 139.79 ? 1485 GLU B C   1 
ATOM 814   O O   . GLU A 1 113  ? 15.060  -10.656 -20.274  1.00 138.79 ? 1485 GLU B O   1 
ATOM 815   C CB  . GLU A 1 113  ? 14.919  -7.698  -18.993  1.00 146.29 ? 1485 GLU B CB  1 
ATOM 816   C CG  . GLU A 1 113  ? 13.435  -7.489  -19.304  1.00 146.56 ? 1485 GLU B CG  1 
ATOM 817   C CD  . GLU A 1 113  ? 12.619  -7.121  -18.075  1.00 148.85 ? 1485 GLU B CD  1 
ATOM 818   O OE1 . GLU A 1 113  ? 12.819  -7.737  -17.005  1.00 148.63 ? 1485 GLU B OE1 1 
ATOM 819   O OE2 . GLU A 1 113  ? 11.758  -6.223  -18.185  1.00 151.31 ? 1485 GLU B OE2 1 
ATOM 820   N N   . ALA A 1 114  ? 14.309  -9.223  -21.845  1.00 137.19 ? 1486 ALA B N   1 
ATOM 821   C CA  . ALA A 1 114  ? 13.611  -10.249 -22.629  1.00 136.90 ? 1486 ALA B CA  1 
ATOM 822   C C   . ALA A 1 114  ? 14.601  -11.167 -23.356  1.00 136.66 ? 1486 ALA B C   1 
ATOM 823   O O   . ALA A 1 114  ? 14.423  -12.387 -23.368  1.00 135.43 ? 1486 ALA B O   1 
ATOM 824   C CB  . ALA A 1 114  ? 12.655  -9.604  -23.622  1.00 136.70 ? 1486 ALA B CB  1 
ATOM 825   N N   . LEU A 1 115  ? 15.632  -10.567 -23.959  1.00 136.32 ? 1487 LEU B N   1 
ATOM 826   C CA  . LEU A 1 115  ? 16.733  -11.310 -24.606  1.00 134.18 ? 1487 LEU B CA  1 
ATOM 827   C C   . LEU A 1 115  ? 17.529  -12.197 -23.642  1.00 130.80 ? 1487 LEU B C   1 
ATOM 828   O O   . LEU A 1 115  ? 18.007  -13.264 -24.031  1.00 129.40 ? 1487 LEU B O   1 
ATOM 829   C CB  . LEU A 1 115  ? 17.709  -10.350 -25.315  1.00 135.60 ? 1487 LEU B CB  1 
ATOM 830   C CG  . LEU A 1 115  ? 17.320  -9.866  -26.715  1.00 134.28 ? 1487 LEU B CG  1 
ATOM 831   C CD1 . LEU A 1 115  ? 18.128  -8.640  -27.115  1.00 134.12 ? 1487 LEU B CD1 1 
ATOM 832   C CD2 . LEU A 1 115  ? 17.503  -10.978 -27.735  1.00 134.21 ? 1487 LEU B CD2 1 
ATOM 833   N N   . GLY A 1 116  ? 17.669  -11.740 -22.398  1.00 128.75 ? 1488 GLY B N   1 
ATOM 834   C CA  . GLY A 1 116  ? 18.499  -12.400 -21.396  1.00 129.08 ? 1488 GLY B CA  1 
ATOM 835   C C   . GLY A 1 116  ? 19.930  -11.892 -21.384  1.00 130.61 ? 1488 GLY B C   1 
ATOM 836   O O   . GLY A 1 116  ? 20.849  -12.647 -21.070  1.00 132.22 ? 1488 GLY B O   1 
ATOM 837   N N   . GLU A 1 117  ? 20.115  -10.612 -21.717  1.00 131.94 ? 1489 GLU B N   1 
ATOM 838   C CA  . GLU A 1 117  ? 21.430  -9.958  -21.685  1.00 134.02 ? 1489 GLU B CA  1 
ATOM 839   C C   . GLU A 1 117  ? 21.643  -9.368  -20.294  1.00 135.17 ? 1489 GLU B C   1 
ATOM 840   O O   . GLU A 1 117  ? 21.544  -8.153  -20.085  1.00 134.74 ? 1489 GLU B O   1 
ATOM 841   C CB  . GLU A 1 117  ? 21.536  -8.881  -22.778  1.00 134.09 ? 1489 GLU B CB  1 
ATOM 842   C CG  . GLU A 1 117  ? 21.905  -9.430  -24.149  1.00 134.20 ? 1489 GLU B CG  1 
ATOM 843   C CD  . GLU A 1 117  ? 23.392  -9.705  -24.292  1.00 135.37 ? 1489 GLU B CD  1 
ATOM 844   O OE1 . GLU A 1 117  ? 24.198  -8.780  -24.054  1.00 136.45 ? 1489 GLU B OE1 1 
ATOM 845   O OE2 . GLU A 1 117  ? 23.758  -10.844 -24.650  1.00 135.30 ? 1489 GLU B OE2 1 
ATOM 846   N N   . TRP A 1 118  ? 21.940  -10.254 -19.347  1.00 137.52 ? 1490 TRP B N   1 
ATOM 847   C CA  . TRP A 1 118  ? 22.032  -9.889  -17.929  1.00 140.51 ? 1490 TRP B CA  1 
ATOM 848   C C   . TRP A 1 118  ? 23.258  -9.019  -17.662  1.00 143.59 ? 1490 TRP B C   1 
ATOM 849   O O   . TRP A 1 118  ? 23.195  -8.085  -16.858  1.00 145.35 ? 1490 TRP B O   1 
ATOM 850   C CB  . TRP A 1 118  ? 22.083  -11.132 -17.026  1.00 141.90 ? 1490 TRP B CB  1 
ATOM 851   C CG  . TRP A 1 118  ? 21.052  -12.193 -17.324  1.00 140.75 ? 1490 TRP B CG  1 
ATOM 852   C CD1 . TRP A 1 118  ? 21.294  -13.510 -17.584  1.00 141.21 ? 1490 TRP B CD1 1 
ATOM 853   C CD2 . TRP A 1 118  ? 19.630  -12.023 -17.402  1.00 140.35 ? 1490 TRP B CD2 1 
ATOM 854   N NE1 . TRP A 1 118  ? 20.114  -14.175 -17.813  1.00 140.55 ? 1490 TRP B NE1 1 
ATOM 855   C CE2 . TRP A 1 118  ? 19.076  -13.287 -17.709  1.00 139.60 ? 1490 TRP B CE2 1 
ATOM 856   C CE3 . TRP A 1 118  ? 18.768  -10.928 -17.241  1.00 140.92 ? 1490 TRP B CE3 1 
ATOM 857   C CZ2 . TRP A 1 118  ? 17.698  -13.489 -17.858  1.00 139.33 ? 1490 TRP B CZ2 1 
ATOM 858   C CZ3 . TRP A 1 118  ? 17.394  -11.128 -17.390  1.00 140.18 ? 1490 TRP B CZ3 1 
ATOM 859   C CH2 . TRP A 1 118  ? 16.876  -12.402 -17.695  1.00 139.69 ? 1490 TRP B CH2 1 
ATOM 860   N N   . GLY A 1 119  ? 24.364  -9.342  -18.335  1.00 144.91 ? 1491 GLY B N   1 
ATOM 861   C CA  . GLY A 1 119  ? 25.606  -8.578  -18.240  1.00 146.97 ? 1491 GLY B CA  1 
ATOM 862   C C   . GLY A 1 119  ? 25.444  -7.110  -18.589  1.00 148.78 ? 1491 GLY B C   1 
ATOM 863   O O   . GLY A 1 119  ? 25.933  -6.244  -17.862  1.00 153.35 ? 1491 GLY B O   1 
ATOM 864   N N   . GLN A 1 120  ? 24.746  -6.831  -19.690  1.00 147.04 ? 1492 GLN B N   1 
ATOM 865   C CA  . GLN A 1 120  ? 24.481  -5.446  -20.115  1.00 146.81 ? 1492 GLN B CA  1 
ATOM 866   C C   . GLN A 1 120  ? 23.353  -4.775  -19.321  1.00 145.21 ? 1492 GLN B C   1 
ATOM 867   O O   . GLN A 1 120  ? 23.417  -3.570  -19.065  1.00 147.58 ? 1492 GLN B O   1 
ATOM 868   C CB  . GLN A 1 120  ? 24.194  -5.364  -21.625  1.00 147.03 ? 1492 GLN B CB  1 
ATOM 869   C CG  . GLN A 1 120  ? 25.452  -5.282  -22.486  1.00 148.17 ? 1492 GLN B CG  1 
ATOM 870   C CD  . GLN A 1 120  ? 25.180  -4.942  -23.944  1.00 147.87 ? 1492 GLN B CD  1 
ATOM 871   O OE1 . GLN A 1 120  ? 24.041  -4.711  -24.349  1.00 147.56 ? 1492 GLN B OE1 1 
ATOM 872   N NE2 . GLN A 1 120  ? 26.241  -4.904  -24.743  1.00 149.11 ? 1492 GLN B NE2 1 
ATOM 873   N N   . LEU A 1 121  ? 22.330  -5.542  -18.943  1.00 141.28 ? 1493 LEU B N   1 
ATOM 874   C CA  . LEU A 1 121  ? 21.196  -5.007  -18.175  1.00 140.00 ? 1493 LEU B CA  1 
ATOM 875   C C   . LEU A 1 121  ? 21.612  -4.513  -16.785  1.00 140.55 ? 1493 LEU B C   1 
ATOM 876   O O   . LEU A 1 121  ? 21.138  -3.471  -16.326  1.00 140.81 ? 1493 LEU B O   1 
ATOM 877   C CB  . LEU A 1 121  ? 20.087  -6.061  -18.050  1.00 139.82 ? 1493 LEU B CB  1 
ATOM 878   C CG  . LEU A 1 121  ? 18.762  -5.665  -17.383  1.00 139.76 ? 1493 LEU B CG  1 
ATOM 879   C CD1 . LEU A 1 121  ? 18.097  -4.494  -18.091  1.00 138.63 ? 1493 LEU B CD1 1 
ATOM 880   C CD2 . LEU A 1 121  ? 17.819  -6.859  -17.356  1.00 138.95 ? 1493 LEU B CD2 1 
ATOM 881   N N   . HIS A 1 122  ? 22.492  -5.266  -16.127  1.00 140.85 ? 1494 HIS B N   1 
ATOM 882   C CA  . HIS A 1 122  ? 23.047  -4.870  -14.831  1.00 144.19 ? 1494 HIS B CA  1 
ATOM 883   C C   . HIS A 1 122  ? 24.028  -3.700  -14.970  1.00 148.70 ? 1494 HIS B C   1 
ATOM 884   O O   . HIS A 1 122  ? 24.014  -2.782  -14.147  1.00 150.33 ? 1494 HIS B O   1 
ATOM 885   C CB  . HIS A 1 122  ? 23.741  -6.058  -14.157  1.00 143.78 ? 1494 HIS B CB  1 
ATOM 886   C CG  . HIS A 1 122  ? 24.020  -5.847  -12.703  1.00 145.13 ? 1494 HIS B CG  1 
ATOM 887   N ND1 . HIS A 1 122  ? 25.258  -5.470  -12.230  1.00 146.03 ? 1494 HIS B ND1 1 
ATOM 888   C CD2 . HIS A 1 122  ? 23.218  -5.953  -11.618  1.00 146.02 ? 1494 HIS B CD2 1 
ATOM 889   C CE1 . HIS A 1 122  ? 25.207  -5.356  -10.915  1.00 148.57 ? 1494 HIS B CE1 1 
ATOM 890   N NE2 . HIS A 1 122  ? 23.981  -5.644  -10.518  1.00 148.67 ? 1494 HIS B NE2 1 
ATOM 891   N N   . GLN A 1 123  ? 24.879  -3.754  -16.001  1.00 152.17 ? 1495 GLN B N   1 
ATOM 892   C CA  . GLN A 1 123  ? 25.827  -2.668  -16.326  1.00 155.99 ? 1495 GLN B CA  1 
ATOM 893   C C   . GLN A 1 123  ? 25.125  -1.340  -16.582  1.00 159.50 ? 1495 GLN B C   1 
ATOM 894   O O   . GLN A 1 123  ? 25.420  -0.340  -15.928  1.00 165.67 ? 1495 GLN B O   1 
ATOM 895   C CB  . GLN A 1 123  ? 26.676  -3.009  -17.565  1.00 153.91 ? 1495 GLN B CB  1 
ATOM 896   C CG  . GLN A 1 123  ? 27.997  -3.701  -17.268  1.00 154.09 ? 1495 GLN B CG  1 
ATOM 897   C CD  . GLN A 1 123  ? 28.876  -3.841  -18.501  1.00 151.42 ? 1495 GLN B CD  1 
ATOM 898   O OE1 . GLN A 1 123  ? 28.389  -3.866  -19.634  1.00 146.49 ? 1495 GLN B OE1 1 
ATOM 899   N NE2 . GLN A 1 123  ? 30.182  -3.932  -18.283  1.00 152.76 ? 1495 GLN B NE2 1 
ATOM 900   N N   . GLN A 1 124  ? 24.195  -1.350  -17.534  1.00 159.16 ? 1496 GLN B N   1 
ATOM 901   C CA  . GLN A 1 124  ? 23.470  -0.140  -17.944  1.00 159.43 ? 1496 GLN B CA  1 
ATOM 902   C C   . GLN A 1 124  ? 22.509  0.406   -16.876  1.00 161.20 ? 1496 GLN B C   1 
ATOM 903   O O   . GLN A 1 124  ? 22.070  1.552   -16.977  1.00 161.25 ? 1496 GLN B O   1 
ATOM 904   C CB  . GLN A 1 124  ? 22.724  -0.385  -19.260  1.00 157.63 ? 1496 GLN B CB  1 
ATOM 905   C CG  . GLN A 1 124  ? 23.655  -0.607  -20.445  1.00 158.91 ? 1496 GLN B CG  1 
ATOM 906   C CD  . GLN A 1 124  ? 22.932  -1.058  -21.702  1.00 159.60 ? 1496 GLN B CD  1 
ATOM 907   O OE1 . GLN A 1 124  ? 21.765  -0.728  -21.921  1.00 159.42 ? 1496 GLN B OE1 1 
ATOM 908   N NE2 . GLN A 1 124  ? 23.632  -1.811  -22.545  1.00 158.43 ? 1496 GLN B NE2 1 
ATOM 909   N N   . CYS A 1 125  ? 22.182  -0.410  -15.871  1.00 163.36 ? 1497 CYS B N   1 
ATOM 910   C CA  . CYS A 1 125  ? 21.450  0.055   -14.688  1.00 167.32 ? 1497 CYS B CA  1 
ATOM 911   C C   . CYS A 1 125  ? 22.333  0.901   -13.761  1.00 168.99 ? 1497 CYS B C   1 
ATOM 912   O O   . CYS A 1 125  ? 21.955  2.011   -13.371  1.00 170.07 ? 1497 CYS B O   1 
ATOM 913   C CB  . CYS A 1 125  ? 20.887  -1.137  -13.911  1.00 168.66 ? 1497 CYS B CB  1 
ATOM 914   S SG  . CYS A 1 125  ? 19.899  -0.664  -12.476  1.00 175.53 ? 1497 CYS B SG  1 
ATOM 915   N N   . CYS A 1 126  ? 23.499  0.362   -13.406  1.00 166.92 ? 1498 CYS B N   1 
ATOM 916   C CA  . CYS A 1 126  ? 24.464  1.059   -12.543  1.00 165.90 ? 1498 CYS B CA  1 
ATOM 917   C C   . CYS A 1 126  ? 25.176  2.220   -13.249  1.00 164.81 ? 1498 CYS B C   1 
ATOM 918   O O   . CYS A 1 126  ? 25.516  3.214   -12.605  1.00 163.98 ? 1498 CYS B O   1 
ATOM 919   C CB  . CYS A 1 126  ? 25.500  0.074   -11.995  1.00 165.25 ? 1498 CYS B CB  1 
ATOM 920   S SG  . CYS A 1 126  ? 24.797  -1.232  -10.959  1.00 163.56 ? 1498 CYS B SG  1 
ATOM 921   N N   . GLU A 1 127  ? 25.401  2.089   -14.560  1.00 165.56 ? 1499 GLU B N   1 
ATOM 922   C CA  . GLU A 1 127  ? 26.039  3.148   -15.372  1.00 166.56 ? 1499 GLU B CA  1 
ATOM 923   C C   . GLU A 1 127  ? 25.224  4.448   -15.495  1.00 167.87 ? 1499 GLU B C   1 
ATOM 924   O O   . GLU A 1 127  ? 25.781  5.476   -15.889  1.00 167.18 ? 1499 GLU B O   1 
ATOM 925   C CB  . GLU A 1 127  ? 26.397  2.634   -16.782  1.00 163.87 ? 1499 GLU B CB  1 
ATOM 926   C CG  . GLU A 1 127  ? 27.685  1.824   -16.849  1.00 162.67 ? 1499 GLU B CG  1 
ATOM 927   C CD  . GLU A 1 127  ? 27.989  1.310   -18.247  1.00 158.50 ? 1499 GLU B CD  1 
ATOM 928   O OE1 . GLU A 1 127  ? 28.009  2.124   -19.194  1.00 155.07 ? 1499 GLU B OE1 1 
ATOM 929   O OE2 . GLU A 1 127  ? 28.220  0.093   -18.400  1.00 157.76 ? 1499 GLU B OE2 1 
ATOM 930   N N   . LYS A 1 128  ? 23.921  4.396   -15.196  1.00 170.02 ? 1500 LYS B N   1 
ATOM 931   C CA  . LYS A 1 128  ? 23.074  5.596   -15.119  1.00 173.95 ? 1500 LYS B CA  1 
ATOM 932   C C   . LYS A 1 128  ? 22.117  5.528   -13.911  1.00 175.27 ? 1500 LYS B C   1 
ATOM 933   O O   . LYS A 1 128  ? 21.070  4.877   -13.973  1.00 172.44 ? 1500 LYS B O   1 
ATOM 934   C CB  . LYS A 1 128  ? 22.303  5.793   -16.435  1.00 171.93 ? 1500 LYS B CB  1 
ATOM 935   C CG  . LYS A 1 128  ? 23.184  6.212   -17.610  1.00 169.52 ? 1500 LYS B CG  1 
ATOM 936   C CD  . LYS A 1 128  ? 22.380  6.500   -18.870  1.00 166.66 ? 1500 LYS B CD  1 
ATOM 937   C CE  . LYS A 1 128  ? 23.269  7.041   -19.983  1.00 165.52 ? 1500 LYS B CE  1 
ATOM 938   N NZ  . LYS A 1 128  ? 22.595  7.058   -21.313  1.00 163.27 ? 1500 LYS B NZ  1 
ATOM 939   N N   . TRP A 1 129  ? 22.507  6.190   -12.815  1.00 179.21 ? 1501 TRP B N   1 
ATOM 940   C CA  . TRP A 1 129  ? 21.714  6.248   -11.569  1.00 179.25 ? 1501 TRP B CA  1 
ATOM 941   C C   . TRP A 1 129  ? 21.388  7.666   -11.044  1.00 184.68 ? 1501 TRP B C   1 
ATOM 942   O O   . TRP A 1 129  ? 20.411  7.832   -10.314  1.00 183.37 ? 1501 TRP B O   1 
ATOM 943   C CB  . TRP A 1 129  ? 22.415  5.441   -10.471  1.00 176.80 ? 1501 TRP B CB  1 
ATOM 944   C CG  . TRP A 1 129  ? 21.540  5.175   -9.286   1.00 175.43 ? 1501 TRP B CG  1 
ATOM 945   C CD1 . TRP A 1 129  ? 21.568  5.824   -8.085   1.00 177.55 ? 1501 TRP B CD1 1 
ATOM 946   C CD2 . TRP A 1 129  ? 20.487  4.208   -9.196   1.00 170.17 ? 1501 TRP B CD2 1 
ATOM 947   N NE1 . TRP A 1 129  ? 20.606  5.313   -7.247   1.00 177.00 ? 1501 TRP B NE1 1 
ATOM 948   C CE2 . TRP A 1 129  ? 19.927  4.319   -7.903   1.00 171.99 ? 1501 TRP B CE2 1 
ATOM 949   C CE3 . TRP A 1 129  ? 19.966  3.251   -10.079  1.00 163.29 ? 1501 TRP B CE3 1 
ATOM 950   C CZ2 . TRP A 1 129  ? 18.870  3.508   -7.469   1.00 167.61 ? 1501 TRP B CZ2 1 
ATOM 951   C CZ3 . TRP A 1 129  ? 18.913  2.445   -9.647   1.00 160.53 ? 1501 TRP B CZ3 1 
ATOM 952   C CH2 . TRP A 1 129  ? 18.379  2.580   -8.352   1.00 161.98 ? 1501 TRP B CH2 1 
ATOM 953   N N   . THR A 1 130  ? 22.205  8.670   -11.371  1.00 190.51 ? 1502 THR B N   1 
ATOM 954   C CA  . THR A 1 130  ? 21.856  10.078  -11.099  1.00 197.01 ? 1502 THR B CA  1 
ATOM 955   C C   . THR A 1 130  ? 20.678  10.523  -11.974  1.00 201.11 ? 1502 THR B C   1 
ATOM 956   O O   . THR A 1 130  ? 19.810  11.274  -11.523  1.00 205.73 ? 1502 THR B O   1 
ATOM 957   C CB  . THR A 1 130  ? 23.050  11.031  -11.350  1.00 196.07 ? 1502 THR B CB  1 
ATOM 958   O OG1 . THR A 1 130  ? 24.222  10.521  -10.703  1.00 197.35 ? 1502 THR B OG1 1 
ATOM 959   C CG2 . THR A 1 130  ? 22.763  12.441  -10.819  1.00 197.15 ? 1502 THR B CG2 1 
ATOM 960   N N   . LEU A 1 131  ? 20.660  10.046  -13.219  1.00 201.99 ? 1503 LEU B N   1 
ATOM 961   C CA  . LEU A 1 131  ? 19.636  10.412  -14.206  1.00 203.31 ? 1503 LEU B CA  1 
ATOM 962   C C   . LEU A 1 131  ? 18.239  9.808   -13.955  1.00 205.45 ? 1503 LEU B C   1 
ATOM 963   O O   . LEU A 1 131  ? 17.264  10.264  -14.561  1.00 205.36 ? 1503 LEU B O   1 
ATOM 964   C CB  . LEU A 1 131  ? 20.118  10.037  -15.620  1.00 197.92 ? 1503 LEU B CB  1 
ATOM 965   C CG  . LEU A 1 131  ? 21.378  10.772  -16.111  1.00 196.10 ? 1503 LEU B CG  1 
ATOM 966   C CD1 . LEU A 1 131  ? 22.179  9.935   -17.102  1.00 191.00 ? 1503 LEU B CD1 1 
ATOM 967   C CD2 . LEU A 1 131  ? 21.026  12.128  -16.708  1.00 196.45 ? 1503 LEU B CD2 1 
ATOM 968   N N   . VAL A 1 132  ? 18.134  8.802   -13.080  1.00 204.77 ? 1504 VAL B N   1 
ATOM 969   C CA  . VAL A 1 132  ? 16.842  8.144   -12.813  1.00 199.91 ? 1504 VAL B CA  1 
ATOM 970   C C   . VAL A 1 132  ? 15.959  8.993   -11.886  1.00 200.04 ? 1504 VAL B C   1 
ATOM 971   O O   . VAL A 1 132  ? 16.427  9.490   -10.857  1.00 205.19 ? 1504 VAL B O   1 
ATOM 972   C CB  . VAL A 1 132  ? 16.992  6.686   -12.269  1.00 197.15 ? 1504 VAL B CB  1 
ATOM 973   C CG1 . VAL A 1 132  ? 17.895  5.859   -13.178  1.00 194.46 ? 1504 VAL B CG1 1 
ATOM 974   C CG2 . VAL A 1 132  ? 17.493  6.625   -10.827  1.00 197.17 ? 1504 VAL B CG2 1 
ATOM 975   N N   . ASN A 1 133  ? 14.696  9.174   -12.285  1.00 205.51 ? 1505 ASN B N   1 
ATOM 976   C CA  . ASN A 1 133  ? 13.675  9.840   -11.461  1.00 204.36 ? 1505 ASN B CA  1 
ATOM 977   C C   . ASN A 1 133  ? 12.942  8.809   -10.591  1.00 200.52 ? 1505 ASN B C   1 
ATOM 978   O O   . ASN A 1 133  ? 13.184  7.610   -10.720  1.00 195.68 ? 1505 ASN B O   1 
ATOM 979   C CB  . ASN A 1 133  ? 12.670  10.580  -12.353  1.00 204.18 ? 1505 ASN B CB  1 
ATOM 980   C CG  . ASN A 1 133  ? 13.330  11.618  -13.245  1.00 204.51 ? 1505 ASN B CG  1 
ATOM 981   O OD1 . ASN A 1 133  ? 14.032  12.508  -12.765  1.00 206.15 ? 1505 ASN B OD1 1 
ATOM 982   N ND2 . ASN A 1 133  ? 13.102  11.510  -14.549  1.00 202.11 ? 1505 ASN B ND2 1 
ATOM 983   N N   . ASP A 1 134  ? 12.059  9.284   -9.708   1.00 202.27 ? 1506 ASP B N   1 
ATOM 984   C CA  . ASP A 1 134  ? 11.227  8.406   -8.855   1.00 202.02 ? 1506 ASP B CA  1 
ATOM 985   C C   . ASP A 1 134  ? 10.401  7.402   -9.658   1.00 206.57 ? 1506 ASP B C   1 
ATOM 986   O O   . ASP A 1 134  ? 10.311  6.226   -9.292   1.00 204.24 ? 1506 ASP B O   1 
ATOM 987   C CB  . ASP A 1 134  ? 10.265  9.228   -7.977   1.00 201.22 ? 1506 ASP B CB  1 
ATOM 988   C CG  . ASP A 1 134  ? 10.910  9.728   -6.698   1.00 201.95 ? 1506 ASP B CG  1 
ATOM 989   O OD1 . ASP A 1 134  ? 11.536  8.918   -5.981   1.00 200.39 ? 1506 ASP B OD1 1 
ATOM 990   O OD2 . ASP A 1 134  ? 10.763  10.930  -6.392   1.00 203.70 ? 1506 ASP B OD2 1 
ATOM 991   N N   . GLU A 1 135  ? 9.794   7.886   -10.740  1.00 213.57 ? 1507 GLU B N   1 
ATOM 992   C CA  . GLU A 1 135  ? 8.995   7.050   -11.643  1.00 212.88 ? 1507 GLU B CA  1 
ATOM 993   C C   . GLU A 1 135  ? 9.857   6.055   -12.429  1.00 212.06 ? 1507 GLU B C   1 
ATOM 994   O O   . GLU A 1 135  ? 9.438   4.917   -12.656  1.00 212.29 ? 1507 GLU B O   1 
ATOM 995   C CB  . GLU A 1 135  ? 8.188   7.924   -12.609  1.00 211.66 ? 1507 GLU B CB  1 
ATOM 996   C CG  . GLU A 1 135  ? 7.124   8.772   -11.925  1.00 210.71 ? 1507 GLU B CG  1 
ATOM 997   C CD  . GLU A 1 135  ? 6.441   9.749   -12.864  1.00 210.48 ? 1507 GLU B CD  1 
ATOM 998   O OE1 . GLU A 1 135  ? 6.258   9.418   -14.055  1.00 208.57 ? 1507 GLU B OE1 1 
ATOM 999   O OE2 . GLU A 1 135  ? 6.077   10.851  -12.402  1.00 210.97 ? 1507 GLU B OE2 1 
ATOM 1000  N N   . THR A 1 136  ? 11.048  6.492   -12.841  1.00 210.74 ? 1508 THR B N   1 
ATOM 1001  C CA  . THR A 1 136  ? 12.017  5.625   -13.524  1.00 205.88 ? 1508 THR B CA  1 
ATOM 1002  C C   . THR A 1 136  ? 12.615  4.576   -12.573  1.00 200.60 ? 1508 THR B C   1 
ATOM 1003  O O   . THR A 1 136  ? 12.767  3.416   -12.954  1.00 204.53 ? 1508 THR B O   1 
ATOM 1004  C CB  . THR A 1 136  ? 13.172  6.440   -14.158  1.00 207.79 ? 1508 THR B CB  1 
ATOM 1005  O OG1 . THR A 1 136  ? 12.665  7.658   -14.720  1.00 212.22 ? 1508 THR B OG1 1 
ATOM 1006  C CG2 . THR A 1 136  ? 13.875  5.639   -15.252  1.00 205.10 ? 1508 THR B CG2 1 
ATOM 1007  N N   . GLN A 1 137  ? 12.938  4.992   -11.346  1.00 194.73 ? 1509 GLN B N   1 
ATOM 1008  C CA  . GLN A 1 137  ? 13.615  4.136   -10.351  1.00 186.45 ? 1509 GLN B CA  1 
ATOM 1009  C C   . GLN A 1 137  ? 12.781  2.934   -9.874   1.00 177.64 ? 1509 GLN B C   1 
ATOM 1010  O O   . GLN A 1 137  ? 13.341  1.878   -9.567   1.00 170.33 ? 1509 GLN B O   1 
ATOM 1011  C CB  . GLN A 1 137  ? 14.052  4.980   -9.142   1.00 189.27 ? 1509 GLN B CB  1 
ATOM 1012  C CG  . GLN A 1 137  ? 15.034  4.302   -8.191   1.00 186.93 ? 1509 GLN B CG  1 
ATOM 1013  C CD  . GLN A 1 137  ? 15.424  5.182   -7.011   1.00 186.30 ? 1509 GLN B CD  1 
ATOM 1014  O OE1 . GLN A 1 137  ? 15.126  6.377   -6.978   1.00 186.62 ? 1509 GLN B OE1 1 
ATOM 1015  N NE2 . GLN A 1 137  ? 16.097  4.588   -6.033   1.00 183.19 ? 1509 GLN B NE2 1 
ATOM 1016  N N   . ALA A 1 138  ? 11.459  3.103   -9.800   1.00 175.39 ? 1510 ALA B N   1 
ATOM 1017  C CA  . ALA A 1 138  ? 10.543  2.016   -9.417   1.00 171.23 ? 1510 ALA B CA  1 
ATOM 1018  C C   . ALA A 1 138  ? 10.603  0.837   -10.393  1.00 167.07 ? 1510 ALA B C   1 
ATOM 1019  O O   . ALA A 1 138  ? 10.657  -0.323  -9.977   1.00 161.11 ? 1510 ALA B O   1 
ATOM 1020  C CB  . ALA A 1 138  ? 9.117   2.540   -9.316   1.00 171.97 ? 1510 ALA B CB  1 
ATOM 1021  N N   . LYS A 1 139  ? 10.598  1.156   -11.686  1.00 169.86 ? 1511 LYS B N   1 
ATOM 1022  C CA  . LYS A 1 139  ? 10.765  0.164   -12.755  1.00 169.69 ? 1511 LYS B CA  1 
ATOM 1023  C C   . LYS A 1 139  ? 12.209  -0.346  -12.824  1.00 169.24 ? 1511 LYS B C   1 
ATOM 1024  O O   . LYS A 1 139  ? 12.437  -1.532  -13.060  1.00 165.47 ? 1511 LYS B O   1 
ATOM 1025  C CB  . LYS A 1 139  ? 10.371  0.761   -14.115  1.00 171.02 ? 1511 LYS B CB  1 
ATOM 1026  C CG  . LYS A 1 139  ? 8.919   1.213   -14.221  1.00 172.47 ? 1511 LYS B CG  1 
ATOM 1027  C CD  . LYS A 1 139  ? 8.660   1.962   -15.521  1.00 173.31 ? 1511 LYS B CD  1 
ATOM 1028  C CE  . LYS A 1 139  ? 7.328   2.693   -15.490  1.00 175.51 ? 1511 LYS B CE  1 
ATOM 1029  N NZ  . LYS A 1 139  ? 7.127   3.522   -16.711  1.00 177.56 ? 1511 LYS B NZ  1 
ATOM 1030  N N   . MET A 1 140  ? 13.167  0.565   -12.625  1.00 174.24 ? 1512 MET B N   1 
ATOM 1031  C CA  . MET A 1 140  ? 14.616  0.274   -12.671  1.00 174.02 ? 1512 MET B CA  1 
ATOM 1032  C C   . MET A 1 140  ? 15.033  -0.887  -11.763  1.00 173.89 ? 1512 MET B C   1 
ATOM 1033  O O   . MET A 1 140  ? 15.843  -1.730  -12.156  1.00 169.88 ? 1512 MET B O   1 
ATOM 1034  C CB  . MET A 1 140  ? 15.414  1.533   -12.276  1.00 175.71 ? 1512 MET B CB  1 
ATOM 1035  C CG  . MET A 1 140  ? 16.896  1.529   -12.625  1.00 173.38 ? 1512 MET B CG  1 
ATOM 1036  S SD  . MET A 1 140  ? 17.274  1.488   -14.388  1.00 172.55 ? 1512 MET B SD  1 
ATOM 1037  C CE  . MET A 1 140  ? 16.394  2.907   -15.040  1.00 173.81 ? 1512 MET B CE  1 
ATOM 1038  N N   . ALA A 1 141  ? 14.478  -0.910  -10.552  1.00 177.47 ? 1513 ALA B N   1 
ATOM 1039  C CA  . ALA A 1 141  ? 14.782  -1.943  -9.555   1.00 177.44 ? 1513 ALA B CA  1 
ATOM 1040  C C   . ALA A 1 141  ? 14.276  -3.339  -9.943   1.00 175.71 ? 1513 ALA B C   1 
ATOM 1041  O O   . ALA A 1 141  ? 14.955  -4.339  -9.699   1.00 175.89 ? 1513 ALA B O   1 
ATOM 1042  C CB  . ALA A 1 141  ? 14.206  -1.541  -8.205   1.00 179.23 ? 1513 ALA B CB  1 
ATOM 1043  N N   . ARG A 1 142  ? 13.086  -3.392  -10.537  1.00 174.54 ? 1514 ARG B N   1 
ATOM 1044  C CA  . ARG A 1 142  ? 12.439  -4.653  -10.934  1.00 172.66 ? 1514 ARG B CA  1 
ATOM 1045  C C   . ARG A 1 142  ? 13.252  -5.480  -11.939  1.00 168.75 ? 1514 ARG B C   1 
ATOM 1046  O O   . ARG A 1 142  ? 13.290  -6.709  -11.851  1.00 162.37 ? 1514 ARG B O   1 
ATOM 1047  C CB  . ARG A 1 142  ? 11.055  -4.353  -11.513  1.00 175.87 ? 1514 ARG B CB  1 
ATOM 1048  C CG  . ARG A 1 142  ? 10.142  -5.559  -11.665  1.00 175.03 ? 1514 ARG B CG  1 
ATOM 1049  C CD  . ARG A 1 142  ? 8.694   -5.143  -11.891  1.00 176.90 ? 1514 ARG B CD  1 
ATOM 1050  N NE  . ARG A 1 142  ? 8.084   -4.561  -10.687  1.00 179.96 ? 1514 ARG B NE  1 
ATOM 1051  C CZ  . ARG A 1 142  ? 7.979   -3.259  -10.397  1.00 185.00 ? 1514 ARG B CZ  1 
ATOM 1052  N NH1 . ARG A 1 142  ? 8.440   -2.309  -11.216  1.00 188.30 ? 1514 ARG B NH1 1 
ATOM 1053  N NH2 . ARG A 1 142  ? 7.401   -2.895  -9.253   1.00 186.32 ? 1514 ARG B NH2 1 
ATOM 1054  N N   . MET A 1 143  ? 13.900  -4.791  -12.877  1.00 170.89 ? 1515 MET B N   1 
ATOM 1055  C CA  . MET A 1 143  ? 14.656  -5.425  -13.964  1.00 168.04 ? 1515 MET B CA  1 
ATOM 1056  C C   . MET A 1 143  ? 16.074  -5.800  -13.528  1.00 168.45 ? 1515 MET B C   1 
ATOM 1057  O O   . MET A 1 143  ? 16.567  -6.874  -13.878  1.00 166.74 ? 1515 MET B O   1 
ATOM 1058  C CB  . MET A 1 143  ? 14.716  -4.490  -15.178  1.00 166.42 ? 1515 MET B CB  1 
ATOM 1059  C CG  . MET A 1 143  ? 13.351  -4.077  -15.713  1.00 164.73 ? 1515 MET B CG  1 
ATOM 1060  S SD  . MET A 1 143  ? 13.414  -2.604  -16.745  1.00 163.50 ? 1515 MET B SD  1 
ATOM 1061  C CE  . MET A 1 143  ? 13.900  -3.327  -18.297  1.00 159.64 ? 1515 MET B CE  1 
ATOM 1062  N N   . ALA A 1 144  ? 16.721  -4.911  -12.772  1.00 169.82 ? 1516 ALA B N   1 
ATOM 1063  C CA  . ALA A 1 144  ? 18.080  -5.145  -12.255  1.00 167.23 ? 1516 ALA B CA  1 
ATOM 1064  C C   . ALA A 1 144  ? 18.165  -6.247  -11.186  1.00 165.57 ? 1516 ALA B C   1 
ATOM 1065  O O   . ALA A 1 144  ? 19.256  -6.746  -10.901  1.00 165.54 ? 1516 ALA B O   1 
ATOM 1066  C CB  . ALA A 1 144  ? 18.668  -3.850  -11.719  1.00 166.95 ? 1516 ALA B CB  1 
ATOM 1067  N N   . ALA A 1 145  ? 17.027  -6.600  -10.585  1.00 164.16 ? 1517 ALA B N   1 
ATOM 1068  C CA  . ALA A 1 145  ? 16.929  -7.776  -9.712   1.00 160.99 ? 1517 ALA B CA  1 
ATOM 1069  C C   . ALA A 1 145  ? 17.074  -9.081  -10.501  1.00 158.22 ? 1517 ALA B C   1 
ATOM 1070  O O   . ALA A 1 145  ? 17.735  -10.015 -10.044  1.00 154.29 ? 1517 ALA B O   1 
ATOM 1071  C CB  . ALA A 1 145  ? 15.607  -7.764  -8.959   1.00 161.47 ? 1517 ALA B CB  1 
ATOM 1072  N N   . ALA A 1 146  ? 16.444  -9.138  -11.676  1.00 159.75 ? 1518 ALA B N   1 
ATOM 1073  C CA  . ALA A 1 146  ? 16.545  -10.297 -12.576  1.00 159.61 ? 1518 ALA B CA  1 
ATOM 1074  C C   . ALA A 1 146  ? 17.952  -10.471 -13.152  1.00 156.66 ? 1518 ALA B C   1 
ATOM 1075  O O   . ALA A 1 146  ? 18.439  -11.596 -13.270  1.00 151.05 ? 1518 ALA B O   1 
ATOM 1076  C CB  . ALA A 1 146  ? 15.537  -10.179 -13.711  1.00 162.72 ? 1518 ALA B CB  1 
ATOM 1077  N N   . ALA A 1 147  ? 18.585  -9.356  -13.521  1.00 159.43 ? 1519 ALA B N   1 
ATOM 1078  C CA  . ALA A 1 147  ? 19.960  -9.357  -14.043  1.00 159.56 ? 1519 ALA B CA  1 
ATOM 1079  C C   . ALA A 1 147  ? 20.960  -9.895  -13.020  1.00 157.37 ? 1519 ALA B C   1 
ATOM 1080  O O   . ALA A 1 147  ? 21.813  -10.723 -13.351  1.00 156.33 ? 1519 ALA B O   1 
ATOM 1081  C CB  . ALA A 1 147  ? 20.363  -7.954  -14.477  1.00 162.78 ? 1519 ALA B CB  1 
ATOM 1082  N N   . ALA A 1 148  ? 20.844  -9.413  -11.784  1.00 155.74 ? 1520 ALA B N   1 
ATOM 1083  C CA  . ALA A 1 148  ? 21.677  -9.875  -10.669  1.00 150.34 ? 1520 ALA B CA  1 
ATOM 1084  C C   . ALA A 1 148  ? 21.466  -11.362 -10.344  1.00 142.08 ? 1520 ALA B C   1 
ATOM 1085  O O   . ALA A 1 148  ? 22.409  -12.053 -9.956   1.00 141.53 ? 1520 ALA B O   1 
ATOM 1086  C CB  . ALA A 1 148  ? 21.418  -9.019  -9.435   1.00 153.49 ? 1520 ALA B CB  1 
ATOM 1087  N N   . TRP A 1 149  ? 20.232  -11.840 -10.507  1.00 135.01 ? 1521 TRP B N   1 
ATOM 1088  C CA  . TRP A 1 149  ? 19.892  -13.252 -10.295  1.00 129.32 ? 1521 TRP B CA  1 
ATOM 1089  C C   . TRP A 1 149  ? 20.547  -14.175 -11.330  1.00 125.77 ? 1521 TRP B C   1 
ATOM 1090  O O   . TRP A 1 149  ? 21.104  -15.214 -10.969  1.00 123.39 ? 1521 TRP B O   1 
ATOM 1091  C CB  . TRP A 1 149  ? 18.367  -13.425 -10.310  1.00 127.10 ? 1521 TRP B CB  1 
ATOM 1092  C CG  . TRP A 1 149  ? 17.864  -14.826 -10.075  1.00 123.56 ? 1521 TRP B CG  1 
ATOM 1093  C CD1 . TRP A 1 149  ? 18.503  -15.842 -9.420   1.00 121.27 ? 1521 TRP B CD1 1 
ATOM 1094  C CD2 . TRP A 1 149  ? 16.591  -15.343 -10.469  1.00 122.35 ? 1521 TRP B CD2 1 
ATOM 1095  N NE1 . TRP A 1 149  ? 17.714  -16.966 -9.404   1.00 119.98 ? 1521 TRP B NE1 1 
ATOM 1096  C CE2 . TRP A 1 149  ? 16.532  -16.687 -10.036  1.00 120.58 ? 1521 TRP B CE2 1 
ATOM 1097  C CE3 . TRP A 1 149  ? 15.491  -14.801 -11.151  1.00 123.34 ? 1521 TRP B CE3 1 
ATOM 1098  C CZ2 . TRP A 1 149  ? 15.417  -17.500 -10.266  1.00 120.87 ? 1521 TRP B CZ2 1 
ATOM 1099  C CZ3 . TRP A 1 149  ? 14.383  -15.611 -11.384  1.00 123.09 ? 1521 TRP B CZ3 1 
ATOM 1100  C CH2 . TRP A 1 149  ? 14.356  -16.947 -10.940  1.00 122.13 ? 1521 TRP B CH2 1 
ATOM 1101  N N   . GLY A 1 150  ? 20.474  -13.791 -12.604  1.00 125.21 ? 1522 GLY B N   1 
ATOM 1102  C CA  . GLY A 1 150  ? 21.043  -14.582 -13.703  1.00 122.89 ? 1522 GLY B CA  1 
ATOM 1103  C C   . GLY A 1 150  ? 22.553  -14.745 -13.638  1.00 120.37 ? 1522 GLY B C   1 
ATOM 1104  O O   . GLY A 1 150  ? 23.077  -15.843 -13.839  1.00 116.86 ? 1522 GLY B O   1 
ATOM 1105  N N   . LEU A 1 151  ? 23.246  -13.647 -13.352  1.00 121.71 ? 1523 LEU B N   1 
ATOM 1106  C CA  . LEU A 1 151  ? 24.702  -13.653 -13.206  1.00 122.59 ? 1523 LEU B CA  1 
ATOM 1107  C C   . LEU A 1 151  ? 25.163  -14.389 -11.940  1.00 123.03 ? 1523 LEU B C   1 
ATOM 1108  O O   . LEU A 1 151  ? 26.244  -14.978 -11.923  1.00 121.50 ? 1523 LEU B O   1 
ATOM 1109  C CB  . LEU A 1 151  ? 25.241  -12.215 -13.195  1.00 125.04 ? 1523 LEU B CB  1 
ATOM 1110  C CG  . LEU A 1 151  ? 24.999  -11.364 -14.450  1.00 125.30 ? 1523 LEU B CG  1 
ATOM 1111  C CD1 . LEU A 1 151  ? 25.336  -9.903  -14.176  1.00 126.80 ? 1523 LEU B CD1 1 
ATOM 1112  C CD2 . LEU A 1 151  ? 25.796  -11.886 -15.639  1.00 123.58 ? 1523 LEU B CD2 1 
ATOM 1113  N N   . GLY A 1 152  ? 24.336  -14.354 -10.895  1.00 125.25 ? 1524 GLY B N   1 
ATOM 1114  C CA  . GLY A 1 152  ? 24.670  -14.938 -9.596   1.00 126.64 ? 1524 GLY B CA  1 
ATOM 1115  C C   . GLY A 1 152  ? 25.308  -13.951 -8.631   1.00 130.29 ? 1524 GLY B C   1 
ATOM 1116  O O   . GLY A 1 152  ? 26.113  -14.351 -7.792   1.00 133.79 ? 1524 GLY B O   1 
ATOM 1117  N N   . GLN A 1 153  ? 24.948  -12.669 -8.748   1.00 131.63 ? 1525 GLN B N   1 
ATOM 1118  C CA  . GLN A 1 153  ? 25.387  -11.623 -7.816   1.00 133.61 ? 1525 GLN B CA  1 
ATOM 1119  C C   . GLN A 1 153  ? 24.305  -11.430 -6.749   1.00 135.47 ? 1525 GLN B C   1 
ATOM 1120  O O   . GLN A 1 153  ? 23.338  -10.693 -6.956   1.00 137.51 ? 1525 GLN B O   1 
ATOM 1121  C CB  . GLN A 1 153  ? 25.651  -10.309 -8.560   1.00 133.92 ? 1525 GLN B CB  1 
ATOM 1122  C CG  . GLN A 1 153  ? 26.825  -10.358 -9.524   1.00 132.44 ? 1525 GLN B CG  1 
ATOM 1123  C CD  . GLN A 1 153  ? 27.057  -9.030  -10.228  1.00 134.33 ? 1525 GLN B CD  1 
ATOM 1124  O OE1 . GLN A 1 153  ? 26.141  -8.458  -10.821  1.00 136.53 ? 1525 GLN B OE1 1 
ATOM 1125  N NE2 . GLN A 1 153  ? 28.287  -8.535  -10.167  1.00 134.62 ? 1525 GLN B NE2 1 
ATOM 1126  N N   . TRP A 1 154  ? 24.482  -12.085 -5.604   1.00 135.19 ? 1526 TRP B N   1 
ATOM 1127  C CA  . TRP A 1 154  ? 23.425  -12.191 -4.587   1.00 136.87 ? 1526 TRP B CA  1 
ATOM 1128  C C   . TRP A 1 154  ? 23.330  -10.965 -3.675   1.00 139.91 ? 1526 TRP B C   1 
ATOM 1129  O O   . TRP A 1 154  ? 22.252  -10.651 -3.162   1.00 140.51 ? 1526 TRP B O   1 
ATOM 1130  C CB  . TRP A 1 154  ? 23.616  -13.467 -3.764   1.00 136.53 ? 1526 TRP B CB  1 
ATOM 1131  C CG  . TRP A 1 154  ? 23.682  -14.696 -4.627   1.00 133.59 ? 1526 TRP B CG  1 
ATOM 1132  C CD1 . TRP A 1 154  ? 24.808  -15.319 -5.077   1.00 131.92 ? 1526 TRP B CD1 1 
ATOM 1133  C CD2 . TRP A 1 154  ? 22.574  -15.426 -5.172   1.00 132.12 ? 1526 TRP B CD2 1 
ATOM 1134  N NE1 . TRP A 1 154  ? 24.473  -16.400 -5.859   1.00 130.20 ? 1526 TRP B NE1 1 
ATOM 1135  C CE2 . TRP A 1 154  ? 23.108  -16.490 -5.932   1.00 129.62 ? 1526 TRP B CE2 1 
ATOM 1136  C CE3 . TRP A 1 154  ? 21.181  -15.291 -5.084   1.00 132.39 ? 1526 TRP B CE3 1 
ATOM 1137  C CZ2 . TRP A 1 154  ? 22.298  -17.417 -6.601   1.00 127.19 ? 1526 TRP B CZ2 1 
ATOM 1138  C CZ3 . TRP A 1 154  ? 20.373  -16.214 -5.751   1.00 130.00 ? 1526 TRP B CZ3 1 
ATOM 1139  C CH2 . TRP A 1 154  ? 20.937  -17.262 -6.499   1.00 127.71 ? 1526 TRP B CH2 1 
ATOM 1140  N N   . ASP A 1 155  ? 24.456  -10.283 -3.476   1.00 142.09 ? 1527 ASP B N   1 
ATOM 1141  C CA  . ASP A 1 155  ? 24.476  -8.995  -2.779   1.00 147.48 ? 1527 ASP B CA  1 
ATOM 1142  C C   . ASP A 1 155  ? 23.820  -7.904  -3.627   1.00 151.45 ? 1527 ASP B C   1 
ATOM 1143  O O   . ASP A 1 155  ? 23.063  -7.082  -3.106   1.00 155.67 ? 1527 ASP B O   1 
ATOM 1144  C CB  . ASP A 1 155  ? 25.913  -8.590  -2.426   1.00 147.72 ? 1527 ASP B CB  1 
ATOM 1145  C CG  . ASP A 1 155  ? 26.582  -9.559  -1.455   1.00 147.98 ? 1527 ASP B CG  1 
ATOM 1146  O OD1 . ASP A 1 155  ? 25.920  -10.508 -0.982   1.00 147.42 ? 1527 ASP B OD1 1 
ATOM 1147  O OD2 . ASP A 1 155  ? 27.782  -9.368  -1.168   1.00 148.80 ? 1527 ASP B OD2 1 
ATOM 1148  N N   . SER A 1 156  ? 24.114  -7.906  -4.929   1.00 151.65 ? 1528 SER B N   1 
ATOM 1149  C CA  . SER A 1 156  ? 23.527  -6.950  -5.878   1.00 153.00 ? 1528 SER B CA  1 
ATOM 1150  C C   . SER A 1 156  ? 22.010  -7.106  -6.038   1.00 154.34 ? 1528 SER B C   1 
ATOM 1151  O O   . SER A 1 156  ? 21.313  -6.113  -6.262   1.00 155.91 ? 1528 SER B O   1 
ATOM 1152  C CB  . SER A 1 156  ? 24.198  -7.076  -7.250   1.00 151.33 ? 1528 SER B CB  1 
ATOM 1153  O OG  . SER A 1 156  ? 25.601  -6.896  -7.154   1.00 152.58 ? 1528 SER B OG  1 
ATOM 1154  N N   . MET A 1 157  ? 21.511  -8.341  -5.935   1.00 154.48 ? 1529 MET B N   1 
ATOM 1155  C CA  . MET A 1 157  ? 20.063  -8.608  -5.971   1.00 154.88 ? 1529 MET B CA  1 
ATOM 1156  C C   . MET A 1 157  ? 19.363  -8.070  -4.722   1.00 157.40 ? 1529 MET B C   1 
ATOM 1157  O O   . MET A 1 157  ? 18.324  -7.417  -4.831   1.00 156.54 ? 1529 MET B O   1 
ATOM 1158  C CB  . MET A 1 157  ? 19.763  -10.112 -6.131   1.00 151.57 ? 1529 MET B CB  1 
ATOM 1159  C CG  . MET A 1 157  ? 18.279  -10.464 -6.022   1.00 151.11 ? 1529 MET B CG  1 
ATOM 1160  S SD  . MET A 1 157  ? 17.765  -12.001 -6.814   1.00 146.21 ? 1529 MET B SD  1 
ATOM 1161  C CE  . MET A 1 157  ? 18.844  -13.199 -6.052   1.00 142.41 ? 1529 MET B CE  1 
ATOM 1162  N N   . GLU A 1 158  ? 19.930  -8.351  -3.550   1.00 158.36 ? 1530 GLU B N   1 
ATOM 1163  C CA  . GLU A 1 158  ? 19.327  -7.937  -2.275   1.00 161.57 ? 1530 GLU B CA  1 
ATOM 1164  C C   . GLU A 1 158  ? 19.252  -6.413  -2.111   1.00 167.26 ? 1530 GLU B C   1 
ATOM 1165  O O   . GLU A 1 158  ? 18.354  -5.915  -1.429   1.00 168.92 ? 1530 GLU B O   1 
ATOM 1166  C CB  . GLU A 1 158  ? 20.066  -8.569  -1.089   1.00 160.06 ? 1530 GLU B CB  1 
ATOM 1167  C CG  . GLU A 1 158  ? 19.252  -8.585  0.199    1.00 160.28 ? 1530 GLU B CG  1 
ATOM 1168  C CD  . GLU A 1 158  ? 19.943  -9.301  1.347    1.00 159.85 ? 1530 GLU B CD  1 
ATOM 1169  O OE1 . GLU A 1 158  ? 20.998  -9.937  1.133    1.00 156.87 ? 1530 GLU B OE1 1 
ATOM 1170  O OE2 . GLU A 1 158  ? 19.422  -9.226  2.479    1.00 161.61 ? 1530 GLU B OE2 1 
ATOM 1171  N N   . GLU A 1 159  ? 20.185  -5.685  -2.730   1.00 170.34 ? 1531 GLU B N   1 
ATOM 1172  C CA  . GLU A 1 159  ? 20.117  -4.218  -2.804   1.00 174.57 ? 1531 GLU B CA  1 
ATOM 1173  C C   . GLU A 1 159  ? 18.912  -3.768  -3.632   1.00 178.20 ? 1531 GLU B C   1 
ATOM 1174  O O   . GLU A 1 159  ? 18.092  -2.973  -3.163   1.00 181.84 ? 1531 GLU B O   1 
ATOM 1175  C CB  . GLU A 1 159  ? 21.401  -3.632  -3.408   1.00 172.59 ? 1531 GLU B CB  1 
ATOM 1176  C CG  . GLU A 1 159  ? 22.620  -3.712  -2.501   1.00 172.30 ? 1531 GLU B CG  1 
ATOM 1177  C CD  . GLU A 1 159  ? 23.902  -3.300  -3.204   1.00 170.90 ? 1531 GLU B CD  1 
ATOM 1178  O OE1 . GLU A 1 159  ? 23.902  -2.252  -3.884   1.00 171.51 ? 1531 GLU B OE1 1 
ATOM 1179  O OE2 . GLU A 1 159  ? 24.914  -4.019  -3.071   1.00 168.86 ? 1531 GLU B OE2 1 
ATOM 1180  N N   . TYR A 1 160  ? 18.817  -4.287  -4.858   1.00 176.25 ? 1532 TYR B N   1 
ATOM 1181  C CA  . TYR A 1 160  ? 17.722  -3.939  -5.778   1.00 174.44 ? 1532 TYR B CA  1 
ATOM 1182  C C   . TYR A 1 160  ? 16.371  -4.591  -5.431   1.00 171.27 ? 1532 TYR B C   1 
ATOM 1183  O O   . TYR A 1 160  ? 15.333  -4.107  -5.880   1.00 176.00 ? 1532 TYR B O   1 
ATOM 1184  C CB  . TYR A 1 160  ? 18.105  -4.244  -7.240   1.00 172.26 ? 1532 TYR B CB  1 
ATOM 1185  C CG  . TYR A 1 160  ? 19.093  -3.260  -7.851   1.00 172.81 ? 1532 TYR B CG  1 
ATOM 1186  C CD1 . TYR A 1 160  ? 20.324  -3.693  -8.359   1.00 170.15 ? 1532 TYR B CD1 1 
ATOM 1187  C CD2 . TYR A 1 160  ? 18.796  -1.893  -7.928   1.00 175.06 ? 1532 TYR B CD2 1 
ATOM 1188  C CE1 . TYR A 1 160  ? 21.226  -2.796  -8.921   1.00 171.36 ? 1532 TYR B CE1 1 
ATOM 1189  C CE2 . TYR A 1 160  ? 19.693  -0.989  -8.484   1.00 176.03 ? 1532 TYR B CE2 1 
ATOM 1190  C CZ  . TYR A 1 160  ? 20.905  -1.443  -8.981   1.00 174.64 ? 1532 TYR B CZ  1 
ATOM 1191  O OH  . TYR A 1 160  ? 21.793  -0.547  -9.535   1.00 173.50 ? 1532 TYR B OH  1 
ATOM 1192  N N   . THR A 1 161  ? 16.375  -5.671  -4.647   1.00 163.79 ? 1533 THR B N   1 
ATOM 1193  C CA  . THR A 1 161  ? 15.127  -6.283  -4.165   1.00 160.44 ? 1533 THR B CA  1 
ATOM 1194  C C   . THR A 1 161  ? 14.470  -5.423  -3.080   1.00 162.79 ? 1533 THR B C   1 
ATOM 1195  O O   . THR A 1 161  ? 13.243  -5.291  -3.050   1.00 162.76 ? 1533 THR B O   1 
ATOM 1196  C CB  . THR A 1 161  ? 15.356  -7.712  -3.634   1.00 156.99 ? 1533 THR B CB  1 
ATOM 1197  O OG1 . THR A 1 161  ? 15.954  -8.505  -4.665   1.00 151.18 ? 1533 THR B OG1 1 
ATOM 1198  C CG2 . THR A 1 161  ? 14.033  -8.364  -3.212   1.00 158.26 ? 1533 THR B CG2 1 
ATOM 1199  N N   . CYS A 1 162  ? 15.290  -4.856  -2.194   1.00 163.74 ? 1534 CYS B N   1 
ATOM 1200  C CA  . CYS A 1 162  ? 14.825  -3.883  -1.194   1.00 166.44 ? 1534 CYS B CA  1 
ATOM 1201  C C   . CYS A 1 162  ? 14.175  -2.640  -1.816   1.00 169.45 ? 1534 CYS B C   1 
ATOM 1202  O O   . CYS A 1 162  ? 13.277  -2.048  -1.216   1.00 173.68 ? 1534 CYS B O   1 
ATOM 1203  C CB  . CYS A 1 162  ? 15.979  -3.454  -0.281   1.00 167.00 ? 1534 CYS B CB  1 
ATOM 1204  S SG  . CYS A 1 162  ? 16.513  -4.734  0.878    1.00 166.01 ? 1534 CYS B SG  1 
ATOM 1205  N N   . MET A 1 163  ? 14.639  -2.250  -3.003   1.00 169.30 ? 1535 MET B N   1 
ATOM 1206  C CA  . MET A 1 163  ? 14.052  -1.134  -3.755   1.00 171.40 ? 1535 MET B CA  1 
ATOM 1207  C C   . MET A 1 163  ? 12.646  -1.449  -4.306   1.00 170.10 ? 1535 MET B C   1 
ATOM 1208  O O   . MET A 1 163  ? 11.812  -0.546  -4.401   1.00 171.48 ? 1535 MET B O   1 
ATOM 1209  C CB  . MET A 1 163  ? 14.985  -0.707  -4.902   1.00 172.41 ? 1535 MET B CB  1 
ATOM 1210  C CG  . MET A 1 163  ? 16.348  -0.167  -4.469   1.00 173.66 ? 1535 MET B CG  1 
ATOM 1211  S SD  . MET A 1 163  ? 16.499  1.633   -4.499   1.00 177.59 ? 1535 MET B SD  1 
ATOM 1212  C CE  . MET A 1 163  ? 15.505  2.104   -3.086   1.00 178.53 ? 1535 MET B CE  1 
ATOM 1213  N N   . ILE A 1 164  ? 12.386  -2.713  -4.662   1.00 167.15 ? 1536 ILE B N   1 
ATOM 1214  C CA  . ILE A 1 164  ? 11.069  -3.130  -5.185   1.00 165.79 ? 1536 ILE B CA  1 
ATOM 1215  C C   . ILE A 1 164  ? 10.075  -3.253  -4.023   1.00 165.89 ? 1536 ILE B C   1 
ATOM 1216  O O   . ILE A 1 164  ? 10.406  -3.870  -3.006   1.00 163.21 ? 1536 ILE B O   1 
ATOM 1217  C CB  . ILE A 1 164  ? 11.108  -4.493  -5.925   1.00 163.68 ? 1536 ILE B CB  1 
ATOM 1218  C CG1 . ILE A 1 164  ? 12.129  -4.490  -7.070   1.00 161.78 ? 1536 ILE B CG1 1 
ATOM 1219  C CG2 . ILE A 1 164  ? 9.737   -4.832  -6.511   1.00 163.42 ? 1536 ILE B CG2 1 
ATOM 1220  C CD1 . ILE A 1 164  ? 12.621  -5.874  -7.440   1.00 157.70 ? 1536 ILE B CD1 1 
ATOM 1221  N N   . PRO A 1 165  ? 8.852   -2.688  -4.171   1.00 168.88 ? 1537 PRO B N   1 
ATOM 1222  C CA  . PRO A 1 165  ? 7.852   -2.834  -3.102   1.00 170.62 ? 1537 PRO B CA  1 
ATOM 1223  C C   . PRO A 1 165  ? 7.306   -4.251  -2.940   1.00 166.88 ? 1537 PRO B C   1 
ATOM 1224  O O   . PRO A 1 165  ? 7.254   -5.018  -3.899   1.00 165.29 ? 1537 PRO B O   1 
ATOM 1225  C CB  . PRO A 1 165  ? 6.711   -1.901  -3.539   1.00 173.65 ? 1537 PRO B CB  1 
ATOM 1226  C CG  . PRO A 1 165  ? 7.304   -0.990  -4.550   1.00 173.56 ? 1537 PRO B CG  1 
ATOM 1227  C CD  . PRO A 1 165  ? 8.369   -1.788  -5.235   1.00 170.13 ? 1537 PRO B CD  1 
ATOM 1228  N N   . ARG A 1 166  ? 6.872   -4.563  -1.728   1.00 164.35 ? 1538 ARG B N   1 
ATOM 1229  C CA  . ARG A 1 166  ? 6.272   -5.858  -1.408   1.00 161.71 ? 1538 ARG B CA  1 
ATOM 1230  C C   . ARG A 1 166  ? 4.791   -5.956  -1.801   1.00 165.03 ? 1538 ARG B C   1 
ATOM 1231  O O   . ARG A 1 166  ? 4.257   -7.062  -1.901   1.00 162.81 ? 1538 ARG B O   1 
ATOM 1232  C CB  . ARG A 1 166  ? 6.447   -6.146  0.081    1.00 160.44 ? 1538 ARG B CB  1 
ATOM 1233  C CG  . ARG A 1 166  ? 7.904   -6.285  0.492    1.00 158.09 ? 1538 ARG B CG  1 
ATOM 1234  C CD  . ARG A 1 166  ? 8.086   -6.233  2.001    1.00 159.02 ? 1538 ARG B CD  1 
ATOM 1235  N NE  . ARG A 1 166  ? 9.492   -6.055  2.371    1.00 157.71 ? 1538 ARG B NE  1 
ATOM 1236  C CZ  . ARG A 1 166  ? 9.951   -5.910  3.616    1.00 157.87 ? 1538 ARG B CZ  1 
ATOM 1237  N NH1 . ARG A 1 166  ? 9.124   -5.921  4.660    1.00 159.76 ? 1538 ARG B NH1 1 
ATOM 1238  N NH2 . ARG A 1 166  ? 11.257  -5.752  3.819    1.00 157.11 ? 1538 ARG B NH2 1 
ATOM 1239  N N   . ASP A 1 167  ? 4.133   -4.808  -2.004   1.00 170.92 ? 1539 ASP B N   1 
ATOM 1240  C CA  . ASP A 1 167  ? 2.765   -4.760  -2.558   1.00 173.61 ? 1539 ASP B CA  1 
ATOM 1241  C C   . ASP A 1 167  ? 2.671   -5.359  -3.966   1.00 174.65 ? 1539 ASP B C   1 
ATOM 1242  O O   . ASP A 1 167  ? 1.646   -5.940  -4.317   1.00 174.49 ? 1539 ASP B O   1 
ATOM 1243  C CB  . ASP A 1 167  ? 2.220   -3.317  -2.591   1.00 174.12 ? 1539 ASP B CB  1 
ATOM 1244  C CG  . ASP A 1 167  ? 1.652   -2.865  -1.255   1.00 175.03 ? 1539 ASP B CG  1 
ATOM 1245  O OD1 . ASP A 1 167  ? 0.773   -3.564  -0.708   1.00 174.83 ? 1539 ASP B OD1 1 
ATOM 1246  O OD2 . ASP A 1 167  ? 2.067   -1.795  -0.763   1.00 175.71 ? 1539 ASP B OD2 1 
ATOM 1247  N N   . THR A 1 168  ? 3.725   -5.197  -4.769   1.00 176.04 ? 1540 THR B N   1 
ATOM 1248  C CA  . THR A 1 168  ? 3.780   -5.789  -6.111   1.00 175.60 ? 1540 THR B CA  1 
ATOM 1249  C C   . THR A 1 168  ? 4.075   -7.291  -6.010   1.00 175.29 ? 1540 THR B C   1 
ATOM 1250  O O   . THR A 1 168  ? 4.767   -7.732  -5.086   1.00 174.01 ? 1540 THR B O   1 
ATOM 1251  C CB  . THR A 1 168  ? 4.852   -5.113  -7.006   1.00 173.12 ? 1540 THR B CB  1 
ATOM 1252  O OG1 . THR A 1 168  ? 4.956   -3.719  -6.691   1.00 175.24 ? 1540 THR B OG1 1 
ATOM 1253  C CG2 . THR A 1 168  ? 4.499   -5.267  -8.485   1.00 171.25 ? 1540 THR B CG2 1 
ATOM 1254  N N   . HIS A 1 169  ? 3.536   -8.063  -6.956   1.00 176.23 ? 1541 HIS B N   1 
ATOM 1255  C CA  . HIS A 1 169  ? 3.814   -9.510  -7.061   1.00 174.26 ? 1541 HIS B CA  1 
ATOM 1256  C C   . HIS A 1 169  ? 5.293   -9.795  -7.348   1.00 172.35 ? 1541 HIS B C   1 
ATOM 1257  O O   . HIS A 1 169  ? 5.879   -10.706 -6.754   1.00 171.02 ? 1541 HIS B O   1 
ATOM 1258  C CB  . HIS A 1 169  ? 2.931   -10.177 -8.139   1.00 174.08 ? 1541 HIS B CB  1 
ATOM 1259  C CG  . HIS A 1 169  ? 3.641   -11.223 -8.946   1.00 173.23 ? 1541 HIS B CG  1 
ATOM 1260  N ND1 . HIS A 1 169  ? 3.938   -12.475 -8.453   1.00 171.14 ? 1541 HIS B ND1 1 
ATOM 1261  C CD2 . HIS A 1 169  ? 4.136   -11.189 -10.206  1.00 173.36 ? 1541 HIS B CD2 1 
ATOM 1262  C CE1 . HIS A 1 169  ? 4.576   -13.171 -9.378   1.00 169.55 ? 1541 HIS B CE1 1 
ATOM 1263  N NE2 . HIS A 1 169  ? 4.709   -12.413 -10.451  1.00 170.87 ? 1541 HIS B NE2 1 
ATOM 1264  N N   . ASP A 1 170  ? 5.867   -9.025  -8.275   1.00 170.39 ? 1542 ASP B N   1 
ATOM 1265  C CA  . ASP A 1 170  ? 7.276   -9.157  -8.672   1.00 163.24 ? 1542 ASP B CA  1 
ATOM 1266  C C   . ASP A 1 170  ? 8.223   -8.999  -7.481   1.00 162.75 ? 1542 ASP B C   1 
ATOM 1267  O O   . ASP A 1 170  ? 9.187   -9.752  -7.351   1.00 162.62 ? 1542 ASP B O   1 
ATOM 1268  C CB  . ASP A 1 170  ? 7.639   -8.129  -9.750   1.00 160.00 ? 1542 ASP B CB  1 
ATOM 1269  C CG  . ASP A 1 170  ? 6.905   -8.365  -11.060  1.00 157.59 ? 1542 ASP B CG  1 
ATOM 1270  O OD1 . ASP A 1 170  ? 5.656   -8.322  -11.059  1.00 158.61 ? 1542 ASP B OD1 1 
ATOM 1271  O OD2 . ASP A 1 170  ? 7.575   -8.581  -12.091  1.00 154.08 ? 1542 ASP B OD2 1 
ATOM 1272  N N   . GLY A 1 171  ? 7.936   -8.023  -6.619   1.00 162.41 ? 1543 GLY B N   1 
ATOM 1273  C CA  . GLY A 1 171  ? 8.674   -7.834  -5.371   1.00 159.18 ? 1543 GLY B CA  1 
ATOM 1274  C C   . GLY A 1 171  ? 8.500   -8.978  -4.385   1.00 155.52 ? 1543 GLY B C   1 
ATOM 1275  O O   . GLY A 1 171  ? 9.462   -9.394  -3.745   1.00 153.40 ? 1543 GLY B O   1 
ATOM 1276  N N   . ALA A 1 172  ? 7.273   -9.483  -4.263   1.00 153.84 ? 1544 ALA B N   1 
ATOM 1277  C CA  . ALA A 1 172  ? 6.980   -10.641 -3.406   1.00 152.54 ? 1544 ALA B CA  1 
ATOM 1278  C C   . ALA A 1 172  ? 7.656   -11.935 -3.879   1.00 149.55 ? 1544 ALA B C   1 
ATOM 1279  O O   . ALA A 1 172  ? 7.932   -12.817 -3.068   1.00 146.28 ? 1544 ALA B O   1 
ATOM 1280  C CB  . ALA A 1 172  ? 5.476   -10.848 -3.295   1.00 153.90 ? 1544 ALA B CB  1 
ATOM 1281  N N   . PHE A 1 173  ? 7.909   -12.043 -5.184   1.00 151.31 ? 1545 PHE B N   1 
ATOM 1282  C CA  . PHE A 1 173  ? 8.589   -13.210 -5.763   1.00 151.45 ? 1545 PHE B CA  1 
ATOM 1283  C C   . PHE A 1 173  ? 10.095  -13.248 -5.469   1.00 151.75 ? 1545 PHE B C   1 
ATOM 1284  O O   . PHE A 1 173  ? 10.624  -14.298 -5.101   1.00 146.84 ? 1545 PHE B O   1 
ATOM 1285  C CB  . PHE A 1 173  ? 8.360   -13.273 -7.280   1.00 149.47 ? 1545 PHE B CB  1 
ATOM 1286  C CG  . PHE A 1 173  ? 9.100   -14.396 -7.955   1.00 145.58 ? 1545 PHE B CG  1 
ATOM 1287  C CD1 . PHE A 1 173  ? 8.720   -15.716 -7.743   1.00 143.72 ? 1545 PHE B CD1 1 
ATOM 1288  C CD2 . PHE A 1 173  ? 10.188  -14.138 -8.785   1.00 142.78 ? 1545 PHE B CD2 1 
ATOM 1289  C CE1 . PHE A 1 173  ? 9.400   -16.760 -8.350   1.00 140.11 ? 1545 PHE B CE1 1 
ATOM 1290  C CE2 . PHE A 1 173  ? 10.873  -15.177 -9.396   1.00 139.56 ? 1545 PHE B CE2 1 
ATOM 1291  C CZ  . PHE A 1 173  ? 10.478  -16.490 -9.177   1.00 138.63 ? 1545 PHE B CZ  1 
ATOM 1292  N N   . TYR A 1 174  ? 10.779  -12.117 -5.650   1.00 157.28 ? 1546 TYR B N   1 
ATOM 1293  C CA  . TYR A 1 174  ? 12.240  -12.049 -5.463   1.00 161.32 ? 1546 TYR B CA  1 
ATOM 1294  C C   . TYR A 1 174  ? 12.697  -12.239 -4.009   1.00 164.77 ? 1546 TYR B C   1 
ATOM 1295  O O   . TYR A 1 174  ? 13.834  -12.661 -3.783   1.00 167.21 ? 1546 TYR B O   1 
ATOM 1296  C CB  . TYR A 1 174  ? 12.821  -10.739 -6.024   1.00 166.13 ? 1546 TYR B CB  1 
ATOM 1297  C CG  . TYR A 1 174  ? 12.793  -10.630 -7.540   1.00 168.10 ? 1546 TYR B CG  1 
ATOM 1298  C CD1 . TYR A 1 174  ? 12.192  -9.536  -8.171   1.00 171.97 ? 1546 TYR B CD1 1 
ATOM 1299  C CD2 . TYR A 1 174  ? 13.375  -11.615 -8.349   1.00 164.46 ? 1546 TYR B CD2 1 
ATOM 1300  C CE1 . TYR A 1 174  ? 12.166  -9.429  -9.555   1.00 171.36 ? 1546 TYR B CE1 1 
ATOM 1301  C CE2 . TYR A 1 174  ? 13.351  -11.516 -9.734   1.00 162.98 ? 1546 TYR B CE2 1 
ATOM 1302  C CZ  . TYR A 1 174  ? 12.747  -10.422 -10.332  1.00 167.00 ? 1546 TYR B CZ  1 
ATOM 1303  O OH  . TYR A 1 174  ? 12.720  -10.319 -11.702  1.00 165.78 ? 1546 TYR B OH  1 
ATOM 1304  N N   . ARG A 1 175  ? 11.834  -11.922 -3.038   1.00 165.44 ? 1547 ARG B N   1 
ATOM 1305  C CA  . ARG A 1 175  ? 12.092  -12.268 -1.625   1.00 162.24 ? 1547 ARG B CA  1 
ATOM 1306  C C   . ARG A 1 175  ? 12.112  -13.793 -1.398   1.00 160.56 ? 1547 ARG B C   1 
ATOM 1307  O O   . ARG A 1 175  ? 12.849  -14.277 -0.536   1.00 160.99 ? 1547 ARG B O   1 
ATOM 1308  C CB  . ARG A 1 175  ? 11.085  -11.596 -0.665   1.00 161.21 ? 1547 ARG B CB  1 
ATOM 1309  C CG  . ARG A 1 175  ? 11.484  -10.207 -0.166   1.00 160.34 ? 1547 ARG B CG  1 
ATOM 1310  C CD  . ARG A 1 175  ? 10.961  -9.101  -1.066   1.00 159.23 ? 1547 ARG B CD  1 
ATOM 1311  N NE  . ARG A 1 175  ? 11.393  -7.767  -0.644   1.00 160.19 ? 1547 ARG B NE  1 
ATOM 1312  C CZ  . ARG A 1 175  ? 10.941  -6.614  -1.146   1.00 161.29 ? 1547 ARG B CZ  1 
ATOM 1313  N NH1 . ARG A 1 175  ? 10.013  -6.587  -2.104   1.00 160.19 ? 1547 ARG B NH1 1 
ATOM 1314  N NH2 . ARG A 1 175  ? 11.419  -5.463  -0.681   1.00 164.25 ? 1547 ARG B NH2 1 
ATOM 1315  N N   . ALA A 1 176  ? 11.307  -14.536 -2.163   1.00 157.24 ? 1548 ALA B N   1 
ATOM 1316  C CA  . ALA A 1 176  ? 11.327  -16.008 -2.135   1.00 152.81 ? 1548 ALA B CA  1 
ATOM 1317  C C   . ALA A 1 176  ? 12.604  -16.607 -2.748   1.00 148.61 ? 1548 ALA B C   1 
ATOM 1318  O O   . ALA A 1 176  ? 13.071  -17.653 -2.296   1.00 146.93 ? 1548 ALA B O   1 
ATOM 1319  C CB  . ALA A 1 176  ? 10.090  -16.576 -2.824   1.00 151.22 ? 1548 ALA B CB  1 
ATOM 1320  N N   . VAL A 1 177  ? 13.158  -15.944 -3.764   1.00 146.42 ? 1549 VAL B N   1 
ATOM 1321  C CA  . VAL A 1 177  ? 14.393  -16.390 -4.432   1.00 144.05 ? 1549 VAL B CA  1 
ATOM 1322  C C   . VAL A 1 177  ? 15.618  -16.160 -3.538   1.00 146.11 ? 1549 VAL B C   1 
ATOM 1323  O O   . VAL A 1 177  ? 16.428  -17.071 -3.349   1.00 143.46 ? 1549 VAL B O   1 
ATOM 1324  C CB  . VAL A 1 177  ? 14.590  -15.675 -5.795   1.00 141.86 ? 1549 VAL B CB  1 
ATOM 1325  C CG1 . VAL A 1 177  ? 15.913  -16.063 -6.449   1.00 139.71 ? 1549 VAL B CG1 1 
ATOM 1326  C CG2 . VAL A 1 177  ? 13.439  -15.999 -6.740   1.00 141.33 ? 1549 VAL B CG2 1 
ATOM 1327  N N   . LEU A 1 178  ? 15.750  -14.936 -3.020   1.00 151.05 ? 1550 LEU B N   1 
ATOM 1328  C CA  . LEU A 1 178  ? 16.835  -14.558 -2.088   1.00 153.03 ? 1550 LEU B CA  1 
ATOM 1329  C C   . LEU A 1 178  ? 16.853  -15.396 -0.807   1.00 152.19 ? 1550 LEU B C   1 
ATOM 1330  O O   . LEU A 1 178  ? 17.923  -15.726 -0.290   1.00 151.35 ? 1550 LEU B O   1 
ATOM 1331  C CB  . LEU A 1 178  ? 16.730  -13.075 -1.698   1.00 158.06 ? 1550 LEU B CB  1 
ATOM 1332  C CG  . LEU A 1 178  ? 17.287  -12.042 -2.682   1.00 160.41 ? 1550 LEU B CG  1 
ATOM 1333  C CD1 . LEU A 1 178  ? 16.675  -10.679 -2.411   1.00 163.73 ? 1550 LEU B CD1 1 
ATOM 1334  C CD2 . LEU A 1 178  ? 18.806  -11.965 -2.599   1.00 160.20 ? 1550 LEU B CD2 1 
ATOM 1335  N N   . ALA A 1 179  ? 15.664  -15.703 -0.293   1.00 151.53 ? 1551 ALA B N   1 
ATOM 1336  C CA  . ALA A 1 179  ? 15.510  -16.546 0.893    1.00 151.33 ? 1551 ALA B CA  1 
ATOM 1337  C C   . ALA A 1 179  ? 16.001  -17.977 0.658    1.00 148.77 ? 1551 ALA B C   1 
ATOM 1338  O O   . ALA A 1 179  ? 16.620  -18.570 1.542    1.00 150.64 ? 1551 ALA B O   1 
ATOM 1339  C CB  . ALA A 1 179  ? 14.057  -16.555 1.347    1.00 152.85 ? 1551 ALA B CB  1 
ATOM 1340  N N   . LEU A 1 180  ? 15.728  -18.522 -0.527   1.00 145.61 ? 1552 LEU B N   1 
ATOM 1341  C CA  . LEU A 1 180  ? 16.166  -19.881 -0.875   1.00 143.95 ? 1552 LEU B CA  1 
ATOM 1342  C C   . LEU A 1 180  ? 17.676  -20.007 -1.103   1.00 143.57 ? 1552 LEU B C   1 
ATOM 1343  O O   . LEU A 1 180  ? 18.232  -21.078 -0.883   1.00 142.27 ? 1552 LEU B O   1 
ATOM 1344  C CB  . LEU A 1 180  ? 15.396  -20.413 -2.088   1.00 141.71 ? 1552 LEU B CB  1 
ATOM 1345  C CG  . LEU A 1 180  ? 13.939  -20.770 -1.787   1.00 142.69 ? 1552 LEU B CG  1 
ATOM 1346  C CD1 . LEU A 1 180  ? 13.127  -20.868 -3.068   1.00 141.81 ? 1552 LEU B CD1 1 
ATOM 1347  C CD2 . LEU A 1 180  ? 13.834  -22.067 -1.000   1.00 142.99 ? 1552 LEU B CD2 1 
ATOM 1348  N N   . HIS A 1 181  ? 18.335  -18.934 -1.539   1.00 145.29 ? 1553 HIS B N   1 
ATOM 1349  C CA  . HIS A 1 181  ? 19.806  -18.904 -1.579   1.00 146.40 ? 1553 HIS B CA  1 
ATOM 1350  C C   . HIS A 1 181  ? 20.390  -18.968 -0.161   1.00 150.13 ? 1553 HIS B C   1 
ATOM 1351  O O   . HIS A 1 181  ? 21.327  -19.727 0.095    1.00 150.77 ? 1553 HIS B O   1 
ATOM 1352  C CB  . HIS A 1 181  ? 20.320  -17.657 -2.306   1.00 146.72 ? 1553 HIS B CB  1 
ATOM 1353  C CG  . HIS A 1 181  ? 21.808  -17.489 -2.235   1.00 148.74 ? 1553 HIS B CG  1 
ATOM 1354  N ND1 . HIS A 1 181  ? 22.412  -16.556 -1.419   1.00 154.33 ? 1553 HIS B ND1 1 
ATOM 1355  C CD2 . HIS A 1 181  ? 22.812  -18.149 -2.858   1.00 146.69 ? 1553 HIS B CD2 1 
ATOM 1356  C CE1 . HIS A 1 181  ? 23.724  -16.640 -1.553   1.00 153.68 ? 1553 HIS B CE1 1 
ATOM 1357  N NE2 . HIS A 1 181  ? 23.992  -17.599 -2.420   1.00 150.40 ? 1553 HIS B NE2 1 
ATOM 1358  N N   . GLN A 1 182  ? 19.813  -18.181 0.750    1.00 153.11 ? 1554 GLN B N   1 
ATOM 1359  C CA  . GLN A 1 182  ? 20.250  -18.121 2.154    1.00 155.70 ? 1554 GLN B CA  1 
ATOM 1360  C C   . GLN A 1 182  ? 19.699  -19.246 3.062    1.00 156.01 ? 1554 GLN B C   1 
ATOM 1361  O O   . GLN A 1 182  ? 19.931  -19.216 4.274    1.00 161.30 ? 1554 GLN B O   1 
ATOM 1362  C CB  . GLN A 1 182  ? 19.878  -16.753 2.752    1.00 159.55 ? 1554 GLN B CB  1 
ATOM 1363  C CG  . GLN A 1 182  ? 20.530  -15.563 2.061    1.00 160.70 ? 1554 GLN B CG  1 
ATOM 1364  C CD  . GLN A 1 182  ? 20.111  -14.235 2.666    1.00 165.40 ? 1554 GLN B CD  1 
ATOM 1365  O OE1 . GLN A 1 182  ? 18.922  -13.971 2.848    1.00 168.03 ? 1554 GLN B OE1 1 
ATOM 1366  N NE2 . GLN A 1 182  ? 21.087  -13.387 2.975    1.00 167.90 ? 1554 GLN B NE2 1 
ATOM 1367  N N   . ASP A 1 183  ? 18.985  -20.223 2.486    1.00 150.28 ? 1555 ASP B N   1 
ATOM 1368  C CA  . ASP A 1 183  ? 18.384  -21.354 3.224    1.00 147.94 ? 1555 ASP B CA  1 
ATOM 1369  C C   . ASP A 1 183  ? 17.361  -20.931 4.297    1.00 148.47 ? 1555 ASP B C   1 
ATOM 1370  O O   . ASP A 1 183  ? 17.348  -21.455 5.412    1.00 148.47 ? 1555 ASP B O   1 
ATOM 1371  C CB  . ASP A 1 183  ? 19.469  -22.283 3.805    1.00 146.93 ? 1555 ASP B CB  1 
ATOM 1372  C CG  . ASP A 1 183  ? 20.244  -23.018 2.730    1.00 143.18 ? 1555 ASP B CG  1 
ATOM 1373  O OD1 . ASP A 1 183  ? 19.616  -23.776 1.965    1.00 141.35 ? 1555 ASP B OD1 1 
ATOM 1374  O OD2 . ASP A 1 183  ? 21.478  -22.850 2.654    1.00 142.50 ? 1555 ASP B OD2 1 
ATOM 1375  N N   . LEU A 1 184  ? 16.511  -19.973 3.929    1.00 147.60 ? 1556 LEU B N   1 
ATOM 1376  C CA  . LEU A 1 184  ? 15.363  -19.555 4.733    1.00 148.85 ? 1556 LEU B CA  1 
ATOM 1377  C C   . LEU A 1 184  ? 14.124  -20.142 4.058    1.00 148.53 ? 1556 LEU B C   1 
ATOM 1378  O O   . LEU A 1 184  ? 13.721  -19.680 2.988    1.00 149.63 ? 1556 LEU B O   1 
ATOM 1379  C CB  . LEU A 1 184  ? 15.282  -18.027 4.800    1.00 148.72 ? 1556 LEU B CB  1 
ATOM 1380  C CG  . LEU A 1 184  ? 16.378  -17.339 5.628    1.00 149.77 ? 1556 LEU B CG  1 
ATOM 1381  C CD1 . LEU A 1 184  ? 16.701  -15.947 5.098    1.00 148.97 ? 1556 LEU B CD1 1 
ATOM 1382  C CD2 . LEU A 1 184  ? 15.993  -17.273 7.100    1.00 153.38 ? 1556 LEU B CD2 1 
ATOM 1383  N N   . PHE A 1 185  ? 13.527  -21.154 4.685    1.00 148.51 ? 1557 PHE B N   1 
ATOM 1384  C CA  . PHE A 1 185  ? 12.514  -22.002 4.040    1.00 147.29 ? 1557 PHE B CA  1 
ATOM 1385  C C   . PHE A 1 185  ? 11.091  -21.522 4.307    1.00 148.18 ? 1557 PHE B C   1 
ATOM 1386  O O   . PHE A 1 185  ? 10.304  -21.349 3.372    1.00 147.80 ? 1557 PHE B O   1 
ATOM 1387  C CB  . PHE A 1 185  ? 12.684  -23.449 4.501    1.00 148.00 ? 1557 PHE B CB  1 
ATOM 1388  C CG  . PHE A 1 185  ? 14.082  -23.969 4.326    1.00 147.05 ? 1557 PHE B CG  1 
ATOM 1389  C CD1 . PHE A 1 185  ? 14.977  -23.964 5.390    1.00 148.88 ? 1557 PHE B CD1 1 
ATOM 1390  C CD2 . PHE A 1 185  ? 14.518  -24.433 3.088    1.00 144.31 ? 1557 PHE B CD2 1 
ATOM 1391  C CE1 . PHE A 1 185  ? 16.273  -24.431 5.230    1.00 148.36 ? 1557 PHE B CE1 1 
ATOM 1392  C CE2 . PHE A 1 185  ? 15.813  -24.899 2.921    1.00 143.01 ? 1557 PHE B CE2 1 
ATOM 1393  C CZ  . PHE A 1 185  ? 16.693  -24.899 3.993    1.00 145.30 ? 1557 PHE B CZ  1 
ATOM 1394  N N   . SER A 1 186  ? 10.768  -21.316 5.582    1.00 149.47 ? 1558 SER B N   1 
ATOM 1395  C CA  . SER A 1 186  ? 9.473   -20.749 5.977    1.00 150.45 ? 1558 SER B CA  1 
ATOM 1396  C C   . SER A 1 186  ? 9.320   -19.284 5.537    1.00 148.81 ? 1558 SER B C   1 
ATOM 1397  O O   . SER A 1 186  ? 8.198   -18.824 5.315    1.00 149.29 ? 1558 SER B O   1 
ATOM 1398  C CB  . SER A 1 186  ? 9.256   -20.882 7.489    1.00 154.00 ? 1558 SER B CB  1 
ATOM 1399  O OG  . SER A 1 186  ? 10.312  -20.281 8.216    1.00 155.46 ? 1558 SER B OG  1 
ATOM 1400  N N   . LEU A 1 187  ? 10.440  -18.563 5.417    1.00 146.88 ? 1559 LEU B N   1 
ATOM 1401  C CA  . LEU A 1 187  ? 10.449  -17.206 4.840    1.00 145.78 ? 1559 LEU B CA  1 
ATOM 1402  C C   . LEU A 1 187  ? 10.131  -17.284 3.342    1.00 143.30 ? 1559 LEU B C   1 
ATOM 1403  O O   . LEU A 1 187  ? 9.324   -16.506 2.831    1.00 143.92 ? 1559 LEU B O   1 
ATOM 1404  C CB  . LEU A 1 187  ? 11.804  -16.501 5.068    1.00 145.27 ? 1559 LEU B CB  1 
ATOM 1405  C CG  . LEU A 1 187  ? 11.808  -14.977 5.290    1.00 146.47 ? 1559 LEU B CG  1 
ATOM 1406  C CD1 . LEU A 1 187  ? 13.230  -14.484 5.514    1.00 146.19 ? 1559 LEU B CD1 1 
ATOM 1407  C CD2 . LEU A 1 187  ? 11.167  -14.198 4.151    1.00 145.16 ? 1559 LEU B CD2 1 
ATOM 1408  N N   . ALA A 1 188  ? 10.768  -18.231 2.653    1.00 141.07 ? 1560 ALA B N   1 
ATOM 1409  C CA  . ALA A 1 188  ? 10.520  -18.468 1.226    1.00 138.42 ? 1560 ALA B CA  1 
ATOM 1410  C C   . ALA A 1 188  ? 9.110   -18.994 0.939    1.00 138.65 ? 1560 ALA B C   1 
ATOM 1411  O O   . ALA A 1 188  ? 8.512   -18.632 -0.073   1.00 138.51 ? 1560 ALA B O   1 
ATOM 1412  C CB  . ALA A 1 188  ? 11.560  -19.424 0.659    1.00 136.17 ? 1560 ALA B CB  1 
ATOM 1413  N N   . GLN A 1 189  ? 8.588   -19.839 1.828    1.00 139.54 ? 1561 GLN B N   1 
ATOM 1414  C CA  . GLN A 1 189  ? 7.260   -20.437 1.654    1.00 140.31 ? 1561 GLN B CA  1 
ATOM 1415  C C   . GLN A 1 189  ? 6.120   -19.414 1.770    1.00 142.60 ? 1561 GLN B C   1 
ATOM 1416  O O   . GLN A 1 189  ? 5.160   -19.470 0.995    1.00 141.99 ? 1561 GLN B O   1 
ATOM 1417  C CB  . GLN A 1 189  ? 7.058   -21.581 2.661    1.00 141.33 ? 1561 GLN B CB  1 
ATOM 1418  C CG  . GLN A 1 189  ? 5.752   -22.355 2.517    1.00 141.72 ? 1561 GLN B CG  1 
ATOM 1419  C CD  . GLN A 1 189  ? 5.516   -22.854 1.105    1.00 139.18 ? 1561 GLN B CD  1 
ATOM 1420  O OE1 . GLN A 1 189  ? 6.418   -23.396 0.468    1.00 136.59 ? 1561 GLN B OE1 1 
ATOM 1421  N NE2 . GLN A 1 189  ? 4.304   -22.661 0.605    1.00 140.05 ? 1561 GLN B NE2 1 
ATOM 1422  N N   . GLN A 1 190  ? 6.227   -18.503 2.741    1.00 145.21 ? 1562 GLN B N   1 
ATOM 1423  C CA  . GLN A 1 190  ? 5.250   -17.411 2.927    1.00 147.31 ? 1562 GLN B CA  1 
ATOM 1424  C C   . GLN A 1 190  ? 5.212   -16.454 1.731    1.00 147.36 ? 1562 GLN B C   1 
ATOM 1425  O O   . GLN A 1 190  ? 4.133   -16.087 1.255    1.00 148.17 ? 1562 GLN B O   1 
ATOM 1426  C CB  . GLN A 1 190  ? 5.557   -16.606 4.200    1.00 148.14 ? 1562 GLN B CB  1 
ATOM 1427  C CG  . GLN A 1 190  ? 5.188   -17.302 5.503    1.00 150.32 ? 1562 GLN B CG  1 
ATOM 1428  C CD  . GLN A 1 190  ? 5.563   -16.496 6.740    1.00 152.34 ? 1562 GLN B CD  1 
ATOM 1429  O OE1 . GLN A 1 190  ? 6.055   -15.369 6.645    1.00 151.60 ? 1562 GLN B OE1 1 
ATOM 1430  N NE2 . GLN A 1 190  ? 5.328   -17.075 7.912    1.00 155.02 ? 1562 GLN B NE2 1 
ATOM 1431  N N   . CYS A 1 191  ? 6.396   -16.055 1.267    1.00 146.63 ? 1563 CYS B N   1 
ATOM 1432  C CA  . CYS A 1 191  ? 6.544   -15.142 0.124    1.00 145.73 ? 1563 CYS B CA  1 
ATOM 1433  C C   . CYS A 1 191  ? 5.995   -15.696 -1.199   1.00 144.32 ? 1563 CYS B C   1 
ATOM 1434  O O   . CYS A 1 191  ? 5.604   -14.920 -2.073   1.00 144.75 ? 1563 CYS B O   1 
ATOM 1435  C CB  . CYS A 1 191  ? 8.017   -14.746 -0.058   1.00 144.69 ? 1563 CYS B CB  1 
ATOM 1436  S SG  . CYS A 1 191  ? 8.673   -13.679 1.245    1.00 147.74 ? 1563 CYS B SG  1 
ATOM 1437  N N   . ILE A 1 192  ? 5.984   -17.023 -1.343   1.00 142.42 ? 1564 ILE B N   1 
ATOM 1438  C CA  . ILE A 1 192  ? 5.392   -17.693 -2.511   1.00 140.50 ? 1564 ILE B CA  1 
ATOM 1439  C C   . ILE A 1 192  ? 3.873   -17.518 -2.538   1.00 141.63 ? 1564 ILE B C   1 
ATOM 1440  O O   . ILE A 1 192  ? 3.310   -17.078 -3.545   1.00 141.52 ? 1564 ILE B O   1 
ATOM 1441  C CB  . ILE A 1 192  ? 5.749   -19.205 -2.539   1.00 139.52 ? 1564 ILE B CB  1 
ATOM 1442  C CG1 . ILE A 1 192  ? 7.222   -19.388 -2.924   1.00 136.94 ? 1564 ILE B CG1 1 
ATOM 1443  C CG2 . ILE A 1 192  ? 4.878   -19.979 -3.528   1.00 139.31 ? 1564 ILE B CG2 1 
ATOM 1444  C CD1 . ILE A 1 192  ? 7.821   -20.704 -2.477   1.00 136.24 ? 1564 ILE B CD1 1 
ATOM 1445  N N   . ASP A 1 193  ? 3.226   -17.875 -1.431   1.00 142.24 ? 1565 ASP B N   1 
ATOM 1446  C CA  . ASP A 1 193  ? 1.761   -17.859 -1.337   1.00 142.85 ? 1565 ASP B CA  1 
ATOM 1447  C C   . ASP A 1 193  ? 1.154   -16.453 -1.349   1.00 144.01 ? 1565 ASP B C   1 
ATOM 1448  O O   . ASP A 1 193  ? 0.020   -16.281 -1.796   1.00 145.75 ? 1565 ASP B O   1 
ATOM 1449  C CB  . ASP A 1 193  ? 1.295   -18.641 -0.107   1.00 143.63 ? 1565 ASP B CB  1 
ATOM 1450  C CG  . ASP A 1 193  ? 1.601   -20.124 -0.216   1.00 142.13 ? 1565 ASP B CG  1 
ATOM 1451  O OD1 . ASP A 1 193  ? 1.049   -20.779 -1.127   1.00 140.76 ? 1565 ASP B OD1 1 
ATOM 1452  O OD2 . ASP A 1 193  ? 2.395   -20.632 0.602    1.00 141.59 ? 1565 ASP B OD2 1 
ATOM 1453  N N   . LYS A 1 194  ? 1.901   -15.463 -0.860   1.00 143.29 ? 1566 LYS B N   1 
ATOM 1454  C CA  . LYS A 1 194  ? 1.511   -14.051 -0.997   1.00 143.81 ? 1566 LYS B CA  1 
ATOM 1455  C C   . LYS A 1 194  ? 1.780   -13.513 -2.408   1.00 142.87 ? 1566 LYS B C   1 
ATOM 1456  O O   . LYS A 1 194  ? 1.020   -12.679 -2.900   1.00 143.27 ? 1566 LYS B O   1 
ATOM 1457  C CB  . LYS A 1 194  ? 2.189   -13.183 0.072    1.00 143.56 ? 1566 LYS B CB  1 
ATOM 1458  C CG  . LYS A 1 194  ? 1.492   -13.271 1.423    1.00 145.70 ? 1566 LYS B CG  1 
ATOM 1459  C CD  . LYS A 1 194  ? 2.421   -12.982 2.589    1.00 145.83 ? 1566 LYS B CD  1 
ATOM 1460  C CE  . LYS A 1 194  ? 1.711   -13.217 3.913    1.00 148.38 ? 1566 LYS B CE  1 
ATOM 1461  N NZ  . LYS A 1 194  ? 2.648   -13.173 5.067    1.00 149.25 ? 1566 LYS B NZ  1 
ATOM 1462  N N   . ALA A 1 195  ? 2.847   -13.989 -3.054   1.00 142.23 ? 1567 ALA B N   1 
ATOM 1463  C CA  . ALA A 1 195  ? 3.119   -13.662 -4.466   1.00 142.21 ? 1567 ALA B CA  1 
ATOM 1464  C C   . ALA A 1 195  ? 2.096   -14.276 -5.437   1.00 144.41 ? 1567 ALA B C   1 
ATOM 1465  O O   . ALA A 1 195  ? 1.876   -13.734 -6.523   1.00 145.63 ? 1567 ALA B O   1 
ATOM 1466  C CB  . ALA A 1 195  ? 4.530   -14.083 -4.857   1.00 139.45 ? 1567 ALA B CB  1 
ATOM 1467  N N   . ARG A 1 196  ? 1.501   -15.410 -5.056   1.00 146.00 ? 1568 ARG B N   1 
ATOM 1468  C CA  . ARG A 1 196  ? 0.353   -15.986 -5.780   1.00 147.03 ? 1568 ARG B CA  1 
ATOM 1469  C C   . ARG A 1 196  ? -0.868  -15.075 -5.719   1.00 150.13 ? 1568 ARG B C   1 
ATOM 1470  O O   . ARG A 1 196  ? -1.511  -14.813 -6.739   1.00 151.08 ? 1568 ARG B O   1 
ATOM 1471  C CB  . ARG A 1 196  ? -0.048  -17.340 -5.190   1.00 147.25 ? 1568 ARG B CB  1 
ATOM 1472  C CG  . ARG A 1 196  ? 0.844   -18.499 -5.580   1.00 145.28 ? 1568 ARG B CG  1 
ATOM 1473  C CD  . ARG A 1 196  ? 0.496   -19.724 -4.750   1.00 146.88 ? 1568 ARG B CD  1 
ATOM 1474  N NE  . ARG A 1 196  ? 0.993   -20.970 -5.331   1.00 145.91 ? 1568 ARG B NE  1 
ATOM 1475  C CZ  . ARG A 1 196  ? 0.943   -22.164 -4.736   1.00 146.91 ? 1568 ARG B CZ  1 
ATOM 1476  N NH1 . ARG A 1 196  ? 0.420   -22.305 -3.514   1.00 149.62 ? 1568 ARG B NH1 1 
ATOM 1477  N NH2 . ARG A 1 196  ? 1.426   -23.231 -5.367   1.00 144.88 ? 1568 ARG B NH2 1 
ATOM 1478  N N   . ASP A 1 197  ? -1.174  -14.607 -4.511   1.00 151.65 ? 1569 ASP B N   1 
ATOM 1479  C CA  . ASP A 1 197  ? -2.368  -13.799 -4.252   1.00 154.63 ? 1569 ASP B CA  1 
ATOM 1480  C C   . ASP A 1 197  ? -2.260  -12.387 -4.835   1.00 156.97 ? 1569 ASP B C   1 
ATOM 1481  O O   . ASP A 1 197  ? -3.256  -11.846 -5.328   1.00 158.91 ? 1569 ASP B O   1 
ATOM 1482  C CB  . ASP A 1 197  ? -2.649  -13.728 -2.744   1.00 154.87 ? 1569 ASP B CB  1 
ATOM 1483  C CG  . ASP A 1 197  ? -2.865  -15.102 -2.114   1.00 153.81 ? 1569 ASP B CG  1 
ATOM 1484  O OD1 . ASP A 1 197  ? -2.809  -16.122 -2.837   1.00 151.55 ? 1569 ASP B OD1 1 
ATOM 1485  O OD2 . ASP A 1 197  ? -3.074  -15.161 -0.884   1.00 154.59 ? 1569 ASP B OD2 1 
ATOM 1486  N N   . LEU A 1 198  ? -1.063  -11.798 -4.775   1.00 157.14 ? 1570 LEU B N   1 
ATOM 1487  C CA  . LEU A 1 198  ? -0.801  -10.485 -5.389   1.00 159.14 ? 1570 LEU B CA  1 
ATOM 1488  C C   . LEU A 1 198  ? -0.788  -10.516 -6.930   1.00 160.00 ? 1570 LEU B C   1 
ATOM 1489  O O   . LEU A 1 198  ? -0.927  -9.466  -7.559   1.00 161.60 ? 1570 LEU B O   1 
ATOM 1490  C CB  . LEU A 1 198  ? 0.509   -9.874  -4.860   1.00 157.94 ? 1570 LEU B CB  1 
ATOM 1491  C CG  . LEU A 1 198  ? 0.545   -9.458  -3.382   1.00 159.97 ? 1570 LEU B CG  1 
ATOM 1492  C CD1 . LEU A 1 198  ? 1.966   -9.106  -2.962   1.00 158.39 ? 1570 LEU B CD1 1 
ATOM 1493  C CD2 . LEU A 1 198  ? -0.405  -8.304  -3.081   1.00 163.01 ? 1570 LEU B CD2 1 
ATOM 1494  N N   . LEU A 1 199  ? -0.607  -11.700 -7.524   1.00 159.60 ? 1571 LEU B N   1 
ATOM 1495  C CA  . LEU A 1 199  ? -0.757  -11.899 -8.976   1.00 158.74 ? 1571 LEU B CA  1 
ATOM 1496  C C   . LEU A 1 199  ? -2.185  -12.308 -9.381   1.00 162.24 ? 1571 LEU B C   1 
ATOM 1497  O O   . LEU A 1 199  ? -2.591  -12.066 -10.518  1.00 161.21 ? 1571 LEU B O   1 
ATOM 1498  C CB  . LEU A 1 199  ? 0.252   -12.937 -9.483   1.00 155.27 ? 1571 LEU B CB  1 
ATOM 1499  C CG  . LEU A 1 199  ? 0.375   -13.152 -10.998  1.00 154.01 ? 1571 LEU B CG  1 
ATOM 1500  C CD1 . LEU A 1 199  ? 0.737   -11.876 -11.752  1.00 153.82 ? 1571 LEU B CD1 1 
ATOM 1501  C CD2 . LEU A 1 199  ? 1.406   -14.235 -11.270  1.00 151.17 ? 1571 LEU B CD2 1 
ATOM 1502  N N   . ASP A 1 200  ? -2.929  -12.943 -8.469   1.00 166.52 ? 1572 ASP B N   1 
ATOM 1503  C CA  . ASP A 1 200  ? -4.372  -13.197 -8.664   1.00 170.64 ? 1572 ASP B CA  1 
ATOM 1504  C C   . ASP A 1 200  ? -5.164  -11.890 -8.774   1.00 175.77 ? 1572 ASP B C   1 
ATOM 1505  O O   . ASP A 1 200  ? -5.957  -11.714 -9.704   1.00 177.64 ? 1572 ASP B O   1 
ATOM 1506  C CB  . ASP A 1 200  ? -4.959  -14.045 -7.518   1.00 170.03 ? 1572 ASP B CB  1 
ATOM 1507  C CG  . ASP A 1 200  ? -4.853  -15.539 -7.772   1.00 167.03 ? 1572 ASP B CG  1 
ATOM 1508  O OD1 . ASP A 1 200  ? -5.439  -16.023 -8.765   1.00 164.34 ? 1572 ASP B OD1 1 
ATOM 1509  O OD2 . ASP A 1 200  ? -4.205  -16.234 -6.961   1.00 166.71 ? 1572 ASP B OD2 1 
ATOM 1510  N N   . ALA A 1 201  ? -4.945  -10.992 -7.813   1.00 178.18 ? 1573 ALA B N   1 
ATOM 1511  C CA  . ALA A 1 201  ? -5.579  -9.665  -7.802   1.00 182.35 ? 1573 ALA B CA  1 
ATOM 1512  C C   . ALA A 1 201  ? -5.095  -8.754  -8.942   1.00 184.82 ? 1573 ALA B C   1 
ATOM 1513  O O   . ALA A 1 201  ? -5.843  -7.884  -9.391   1.00 187.06 ? 1573 ALA B O   1 
ATOM 1514  C CB  . ALA A 1 201  ? -5.361  -8.984  -6.456   1.00 182.06 ? 1573 ALA B CB  1 
ATOM 1515  N N   . GLU A 1 202  ? -3.851  -8.951  -9.389   1.00 185.91 ? 1574 GLU B N   1 
ATOM 1516  C CA  . GLU A 1 202  ? -3.286  -8.238  -10.552  1.00 185.97 ? 1574 GLU B CA  1 
ATOM 1517  C C   . GLU A 1 202  ? -4.077  -8.520  -11.837  1.00 189.76 ? 1574 GLU B C   1 
ATOM 1518  O O   . GLU A 1 202  ? -4.367  -7.597  -12.602  1.00 194.37 ? 1574 GLU B O   1 
ATOM 1519  C CB  . GLU A 1 202  ? -1.811  -8.630  -10.755  1.00 180.36 ? 1574 GLU B CB  1 
ATOM 1520  C CG  . GLU A 1 202  ? -1.048  -7.855  -11.829  1.00 177.17 ? 1574 GLU B CG  1 
ATOM 1521  C CD  . GLU A 1 202  ? -0.454  -6.554  -11.320  1.00 175.86 ? 1574 GLU B CD  1 
ATOM 1522  O OE1 . GLU A 1 202  ? -1.227  -5.652  -10.935  1.00 178.19 ? 1574 GLU B OE1 1 
ATOM 1523  O OE2 . GLU A 1 202  ? 0.790   -6.432  -11.316  1.00 170.93 ? 1574 GLU B OE2 1 
ATOM 1524  N N   . LEU A 1 203  ? -4.417  -9.790  -12.063  1.00 187.63 ? 1575 LEU B N   1 
ATOM 1525  C CA  . LEU A 1 203  ? -5.157  -10.207 -13.264  1.00 184.80 ? 1575 LEU B CA  1 
ATOM 1526  C C   . LEU A 1 203  ? -6.657  -9.836  -13.261  1.00 189.29 ? 1575 LEU B C   1 
ATOM 1527  O O   . LEU A 1 203  ? -7.304  -9.922  -14.308  1.00 192.25 ? 1575 LEU B O   1 
ATOM 1528  C CB  . LEU A 1 203  ? -4.990  -11.717 -13.496  1.00 178.91 ? 1575 LEU B CB  1 
ATOM 1529  C CG  . LEU A 1 203  ? -3.561  -12.231 -13.726  1.00 171.54 ? 1575 LEU B CG  1 
ATOM 1530  C CD1 . LEU A 1 203  ? -3.530  -13.748 -13.641  1.00 168.82 ? 1575 LEU B CD1 1 
ATOM 1531  C CD2 . LEU A 1 203  ? -2.985  -11.759 -15.054  1.00 168.59 ? 1575 LEU B CD2 1 
ATOM 1532  N N   . THR A 1 204  ? -7.204  -9.439  -12.108  1.00 189.86 ? 1576 THR B N   1 
ATOM 1533  C CA  . THR A 1 204  ? -8.600  -8.970  -12.010  1.00 192.32 ? 1576 THR B CA  1 
ATOM 1534  C C   . THR A 1 204  ? -8.820  -7.604  -12.692  1.00 199.06 ? 1576 THR B C   1 
ATOM 1535  O O   . THR A 1 204  ? -9.888  -7.364  -13.264  1.00 202.33 ? 1576 THR B O   1 
ATOM 1536  C CB  . THR A 1 204  ? -9.072  -8.884  -10.537  1.00 188.32 ? 1576 THR B CB  1 
ATOM 1537  O OG1 . THR A 1 204  ? -8.658  -10.056 -9.824   1.00 183.28 ? 1576 THR B OG1 1 
ATOM 1538  C CG2 . THR A 1 204  ? -10.594 -8.764  -10.447  1.00 190.43 ? 1576 THR B CG2 1 
ATOM 1539  N N   . ALA A 1 205  ? -7.821  -6.720  -12.618  1.00 202.22 ? 1577 ALA B N   1 
ATOM 1540  C CA  . ALA A 1 205  ? -7.887  -5.381  -13.237  1.00 205.54 ? 1577 ALA B CA  1 
ATOM 1541  C C   . ALA A 1 205  ? -7.858  -5.395  -14.777  1.00 209.09 ? 1577 ALA B C   1 
ATOM 1542  O O   . ALA A 1 205  ? -8.393  -4.480  -15.408  1.00 211.35 ? 1577 ALA B O   1 
ATOM 1543  C CB  . ALA A 1 205  ? -6.764  -4.498  -12.703  1.00 202.85 ? 1577 ALA B CB  1 
ATOM 1544  N N   . MET A 1 206  ? -7.196  -6.406  -15.354  1.00 207.12 ? 1578 MET B N   1 
ATOM 1545  C CA  . MET A 1 206  ? -7.133  -6.679  -16.815  1.00 203.13 ? 1578 MET B CA  1 
ATOM 1546  C C   . MET A 1 206  ? -6.729  -5.514  -17.747  1.00 205.61 ? 1578 MET B C   1 
ATOM 1547  O O   . MET A 1 206  ? -7.010  -5.557  -18.952  1.00 202.94 ? 1578 MET B O   1 
ATOM 1548  C CB  . MET A 1 206  ? -8.433  -7.370  -17.302  1.00 201.01 ? 1578 MET B CB  1 
ATOM 1549  C CG  . MET A 1 206  ? -9.669  -6.490  -17.486  1.00 201.82 ? 1578 MET B CG  1 
ATOM 1550  S SD  . MET A 1 206  ? -11.136 -7.428  -17.961  1.00 199.50 ? 1578 MET B SD  1 
ATOM 1551  C CE  . MET A 1 206  ? -11.638 -8.103  -16.382  1.00 197.68 ? 1578 MET B CE  1 
ATOM 1552  N N   . ALA A 1 207  ? -6.028  -4.515  -17.196  1.00 208.61 ? 1579 ALA B N   1 
ATOM 1553  C CA  . ALA A 1 207  ? -5.687  -3.268  -17.907  1.00 209.20 ? 1579 ALA B CA  1 
ATOM 1554  C C   . ALA A 1 207  ? -4.183  -3.055  -18.177  1.00 203.74 ? 1579 ALA B C   1 
ATOM 1555  O O   . ALA A 1 207  ? -3.830  -2.312  -19.096  1.00 202.98 ? 1579 ALA B O   1 
ATOM 1556  C CB  . ALA A 1 207  ? -6.252  -2.075  -17.146  1.00 211.28 ? 1579 ALA B CB  1 
ATOM 1557  N N   . GLY A 1 208  ? -3.308  -3.677  -17.382  1.00 199.07 ? 1580 GLY B N   1 
ATOM 1558  C CA  . GLY A 1 208  ? -1.858  -3.568  -17.577  1.00 196.75 ? 1580 GLY B CA  1 
ATOM 1559  C C   . GLY A 1 208  ? -1.395  -4.263  -18.846  1.00 198.11 ? 1580 GLY B C   1 
ATOM 1560  O O   . GLY A 1 208  ? -1.078  -3.600  -19.836  1.00 198.42 ? 1580 GLY B O   1 
ATOM 1561  N N   . GLU A 1 209  ? -1.338  -5.596  -18.799  1.00 200.70 ? 1581 GLU B N   1 
ATOM 1562  C CA  . GLU A 1 209  ? -1.129  -6.444  -19.987  1.00 199.35 ? 1581 GLU B CA  1 
ATOM 1563  C C   . GLU A 1 209  ? -2.149  -7.600  -19.957  1.00 201.29 ? 1581 GLU B C   1 
ATOM 1564  O O   . GLU A 1 209  ? -2.135  -8.413  -19.028  1.00 206.27 ? 1581 GLU B O   1 
ATOM 1565  C CB  . GLU A 1 209  ? 0.301   -7.008  -20.049  1.00 192.94 ? 1581 GLU B CB  1 
ATOM 1566  C CG  . GLU A 1 209  ? 1.430   -6.058  -19.656  1.00 190.72 ? 1581 GLU B CG  1 
ATOM 1567  C CD  . GLU A 1 209  ? 1.812   -6.146  -18.184  1.00 189.74 ? 1581 GLU B CD  1 
ATOM 1568  O OE1 . GLU A 1 209  ? 0.907   -6.238  -17.327  1.00 193.26 ? 1581 GLU B OE1 1 
ATOM 1569  O OE2 . GLU A 1 209  ? 3.024   -6.119  -17.882  1.00 183.75 ? 1581 GLU B OE2 1 
ATOM 1570  N N   . SER A 1 210  ? -3.020  -7.671  -20.968  1.00 197.41 ? 1582 SER B N   1 
ATOM 1571  C CA  . SER A 1 210  ? -4.184  -8.578  -20.946  1.00 192.13 ? 1582 SER B CA  1 
ATOM 1572  C C   . SER A 1 210  ? -3.941  -9.999  -21.490  1.00 188.88 ? 1582 SER B C   1 
ATOM 1573  O O   . SER A 1 210  ? -4.682  -10.912 -21.120  1.00 187.66 ? 1582 SER B O   1 
ATOM 1574  C CB  . SER A 1 210  ? -5.382  -7.932  -21.656  1.00 192.22 ? 1582 SER B CB  1 
ATOM 1575  O OG  . SER A 1 210  ? -5.052  -7.525  -22.969  1.00 193.26 ? 1582 SER B OG  1 
ATOM 1576  N N   . TYR A 1 211  ? -2.946  -10.188 -22.366  1.00 187.34 ? 1583 TYR B N   1 
ATOM 1577  C CA  . TYR A 1 211  ? -2.531  -11.547 -22.801  1.00 188.18 ? 1583 TYR B CA  1 
ATOM 1578  C C   . TYR A 1 211  ? -1.041  -11.887 -22.611  1.00 191.82 ? 1583 TYR B C   1 
ATOM 1579  O O   . TYR A 1 211  ? -0.721  -13.031 -22.273  1.00 195.36 ? 1583 TYR B O   1 
ATOM 1580  C CB  . TYR A 1 211  ? -2.945  -11.850 -24.249  1.00 186.12 ? 1583 TYR B CB  1 
ATOM 1581  C CG  . TYR A 1 211  ? -2.767  -13.318 -24.602  1.00 182.85 ? 1583 TYR B CG  1 
ATOM 1582  C CD1 . TYR A 1 211  ? -3.656  -14.283 -24.122  1.00 184.06 ? 1583 TYR B CD1 1 
ATOM 1583  C CD2 . TYR A 1 211  ? -1.684  -13.749 -25.373  1.00 178.85 ? 1583 TYR B CD2 1 
ATOM 1584  C CE1 . TYR A 1 211  ? -3.485  -15.629 -24.421  1.00 182.92 ? 1583 TYR B CE1 1 
ATOM 1585  C CE2 . TYR A 1 211  ? -1.507  -15.094 -25.675  1.00 177.85 ? 1583 TYR B CE2 1 
ATOM 1586  C CZ  . TYR A 1 211  ? -2.410  -16.028 -25.197  1.00 180.39 ? 1583 TYR B CZ  1 
ATOM 1587  O OH  . TYR A 1 211  ? -2.241  -17.361 -25.493  1.00 180.82 ? 1583 TYR B OH  1 
ATOM 1588  N N   . SER A 1 212  ? -0.138  -10.928 -22.833  1.00 194.36 ? 1584 SER B N   1 
ATOM 1589  C CA  . SER A 1 212  ? 1.304   -11.158 -22.615  1.00 192.55 ? 1584 SER B CA  1 
ATOM 1590  C C   . SER A 1 212  ? 1.670   -11.429 -21.140  1.00 195.90 ? 1584 SER B C   1 
ATOM 1591  O O   . SER A 1 212  ? 2.706   -12.043 -20.870  1.00 192.97 ? 1584 SER B O   1 
ATOM 1592  C CB  . SER A 1 212  ? 2.146   -10.002 -23.175  1.00 190.15 ? 1584 SER B CB  1 
ATOM 1593  O OG  . SER A 1 212  ? 1.895   -8.788  -22.493  1.00 191.62 ? 1584 SER B OG  1 
ATOM 1594  N N   . ARG A 1 213  ? 0.829   -10.966 -20.206  1.00 200.16 ? 1585 ARG B N   1 
ATOM 1595  C CA  . ARG A 1 213  ? 0.926   -11.322 -18.776  1.00 195.79 ? 1585 ARG B CA  1 
ATOM 1596  C C   . ARG A 1 213  ? -0.108  -12.382 -18.331  1.00 195.14 ? 1585 ARG B C   1 
ATOM 1597  O O   . ARG A 1 213  ? 0.059   -12.977 -17.271  1.00 196.02 ? 1585 ARG B O   1 
ATOM 1598  C CB  . ARG A 1 213  ? 0.796   -10.064 -17.908  1.00 194.11 ? 1585 ARG B CB  1 
ATOM 1599  C CG  . ARG A 1 213  ? 1.259   -10.207 -16.458  1.00 189.47 ? 1585 ARG B CG  1 
ATOM 1600  C CD  . ARG A 1 213  ? 2.585   -9.512  -16.183  1.00 184.74 ? 1585 ARG B CD  1 
ATOM 1601  N NE  . ARG A 1 213  ? 2.837   -9.388  -14.746  1.00 182.97 ? 1585 ARG B NE  1 
ATOM 1602  C CZ  . ARG A 1 213  ? 2.244   -8.513  -13.928  1.00 182.92 ? 1585 ARG B CZ  1 
ATOM 1603  N NH1 . ARG A 1 213  ? 1.331   -7.649  -14.379  1.00 183.94 ? 1585 ARG B NH1 1 
ATOM 1604  N NH2 . ARG A 1 213  ? 2.563   -8.505  -12.636  1.00 180.84 ? 1585 ARG B NH2 1 
ATOM 1605  N N   . ALA A 1 214  ? -1.169  -12.610 -19.112  1.00 192.58 ? 1586 ALA B N   1 
ATOM 1606  C CA  . ALA A 1 214  ? -2.082  -13.749 -18.879  1.00 188.55 ? 1586 ALA B CA  1 
ATOM 1607  C C   . ALA A 1 214  ? -1.402  -15.079 -19.215  1.00 182.75 ? 1586 ALA B C   1 
ATOM 1608  O O   . ALA A 1 214  ? -1.477  -16.035 -18.440  1.00 179.33 ? 1586 ALA B O   1 
ATOM 1609  C CB  . ALA A 1 214  ? -3.360  -13.596 -19.687  1.00 190.31 ? 1586 ALA B CB  1 
ATOM 1610  N N   . TYR A 1 215  ? -0.754  -15.127 -20.378  1.00 180.48 ? 1587 TYR B N   1 
ATOM 1611  C CA  . TYR A 1 215  ? 0.171   -16.215 -20.726  1.00 177.51 ? 1587 TYR B CA  1 
ATOM 1612  C C   . TYR A 1 215  ? 1.421   -16.158 -19.831  1.00 172.21 ? 1587 TYR B C   1 
ATOM 1613  O O   . TYR A 1 215  ? 1.944   -17.195 -19.423  1.00 166.63 ? 1587 TYR B O   1 
ATOM 1614  C CB  . TYR A 1 215  ? 0.554   -16.138 -22.213  1.00 177.70 ? 1587 TYR B CB  1 
ATOM 1615  C CG  . TYR A 1 215  ? 1.579   -17.165 -22.663  1.00 175.59 ? 1587 TYR B CG  1 
ATOM 1616  C CD1 . TYR A 1 215  ? 1.265   -18.524 -22.699  1.00 175.75 ? 1587 TYR B CD1 1 
ATOM 1617  C CD2 . TYR A 1 215  ? 2.861   -16.775 -23.064  1.00 173.23 ? 1587 TYR B CD2 1 
ATOM 1618  C CE1 . TYR A 1 215  ? 2.200   -19.466 -23.112  1.00 173.47 ? 1587 TYR B CE1 1 
ATOM 1619  C CE2 . TYR A 1 215  ? 3.801   -17.709 -23.479  1.00 170.09 ? 1587 TYR B CE2 1 
ATOM 1620  C CZ  . TYR A 1 215  ? 3.468   -19.053 -23.501  1.00 169.90 ? 1587 TYR B CZ  1 
ATOM 1621  O OH  . TYR A 1 215  ? 4.396   -19.983 -23.910  1.00 165.19 ? 1587 TYR B OH  1 
ATOM 1622  N N   . GLY A 1 216  ? 1.885   -14.942 -19.536  1.00 171.69 ? 1588 GLY B N   1 
ATOM 1623  C CA  . GLY A 1 216  ? 2.983   -14.706 -18.591  1.00 170.12 ? 1588 GLY B CA  1 
ATOM 1624  C C   . GLY A 1 216  ? 2.683   -14.962 -17.116  1.00 173.04 ? 1588 GLY B C   1 
ATOM 1625  O O   . GLY A 1 216  ? 3.607   -15.005 -16.302  1.00 174.56 ? 1588 GLY B O   1 
ATOM 1626  N N   . ALA A 1 217  ? 1.405   -15.108 -16.761  1.00 176.08 ? 1589 ALA B N   1 
ATOM 1627  C CA  . ALA A 1 217  ? 0.999   -15.572 -15.428  1.00 176.57 ? 1589 ALA B CA  1 
ATOM 1628  C C   . ALA A 1 217  ? 1.160   -17.086 -15.346  1.00 177.49 ? 1589 ALA B C   1 
ATOM 1629  O O   . ALA A 1 217  ? 1.576   -17.612 -14.313  1.00 176.13 ? 1589 ALA B O   1 
ATOM 1630  C CB  . ALA A 1 217  ? -0.440  -15.182 -15.126  1.00 178.11 ? 1589 ALA B CB  1 
ATOM 1631  N N   . MET A 1 218  ? 0.812   -17.776 -16.433  1.00 181.06 ? 1590 MET B N   1 
ATOM 1632  C CA  . MET A 1 218  ? 1.106   -19.210 -16.591  1.00 183.01 ? 1590 MET B CA  1 
ATOM 1633  C C   . MET A 1 218  ? 2.611   -19.513 -16.604  1.00 176.94 ? 1590 MET B C   1 
ATOM 1634  O O   . MET A 1 218  ? 3.009   -20.626 -16.276  1.00 172.62 ? 1590 MET B O   1 
ATOM 1635  C CB  . MET A 1 218  ? 0.436   -19.776 -17.856  1.00 190.15 ? 1590 MET B CB  1 
ATOM 1636  C CG  . MET A 1 218  ? -1.010  -20.220 -17.661  1.00 199.93 ? 1590 MET B CG  1 
ATOM 1637  S SD  . MET A 1 218  ? -1.242  -22.013 -17.677  1.00 209.26 ? 1590 MET B SD  1 
ATOM 1638  C CE  . MET A 1 218  ? -0.164  -22.554 -16.352  1.00 205.54 ? 1590 MET B CE  1 
ATOM 1639  N N   . VAL A 1 219  ? 3.429   -18.535 -16.998  1.00 174.73 ? 1591 VAL B N   1 
ATOM 1640  C CA  . VAL A 1 219  ? 4.888   -18.602 -16.823  1.00 170.17 ? 1591 VAL B CA  1 
ATOM 1641  C C   . VAL A 1 219  ? 5.248   -18.449 -15.339  1.00 166.73 ? 1591 VAL B C   1 
ATOM 1642  O O   . VAL A 1 219  ? 6.022   -19.244 -14.806  1.00 165.54 ? 1591 VAL B O   1 
ATOM 1643  C CB  . VAL A 1 219  ? 5.624   -17.522 -17.664  1.00 171.09 ? 1591 VAL B CB  1 
ATOM 1644  C CG1 . VAL A 1 219  ? 7.124   -17.497 -17.377  1.00 169.07 ? 1591 VAL B CG1 1 
ATOM 1645  C CG2 . VAL A 1 219  ? 5.398   -17.749 -19.153  1.00 171.55 ? 1591 VAL B CG2 1 
ATOM 1646  N N   . SER A 1 220  ? 4.695   -17.423 -14.688  1.00 164.21 ? 1592 SER B N   1 
ATOM 1647  C CA  . SER A 1 220  ? 4.994   -17.129 -13.275  1.00 159.82 ? 1592 SER B CA  1 
ATOM 1648  C C   . SER A 1 220  ? 4.467   -18.182 -12.294  1.00 160.48 ? 1592 SER B C   1 
ATOM 1649  O O   . SER A 1 220  ? 5.150   -18.505 -11.323  1.00 161.91 ? 1592 SER B O   1 
ATOM 1650  C CB  . SER A 1 220  ? 4.476   -15.739 -12.875  1.00 158.08 ? 1592 SER B CB  1 
ATOM 1651  O OG  . SER A 1 220  ? 5.283   -14.714 -13.430  1.00 153.22 ? 1592 SER B OG  1 
ATOM 1652  N N   . CYS A 1 221  ? 3.268   -18.711 -12.542  1.00 161.93 ? 1593 CYS B N   1 
ATOM 1653  C CA  . CYS A 1 221  ? 2.679   -19.748 -11.675  1.00 162.76 ? 1593 CYS B CA  1 
ATOM 1654  C C   . CYS A 1 221  ? 3.342   -21.117 -11.883  1.00 158.23 ? 1593 CYS B C   1 
ATOM 1655  O O   . CYS A 1 221  ? 3.386   -21.932 -10.959  1.00 156.13 ? 1593 CYS B O   1 
ATOM 1656  C CB  . CYS A 1 221  ? 1.161   -19.848 -11.875  1.00 166.98 ? 1593 CYS B CB  1 
ATOM 1657  S SG  . CYS A 1 221  ? 0.632   -20.936 -13.215  1.00 172.63 ? 1593 CYS B SG  1 
ATOM 1658  N N   . HIS A 1 222  ? 3.826   -21.369 -13.102  1.00 156.52 ? 1594 HIS B N   1 
ATOM 1659  C CA  . HIS A 1 222  ? 4.693   -22.518 -13.392  1.00 154.69 ? 1594 HIS B CA  1 
ATOM 1660  C C   . HIS A 1 222  ? 5.987   -22.390 -12.590  1.00 148.54 ? 1594 HIS B C   1 
ATOM 1661  O O   . HIS A 1 222  ? 6.405   -23.339 -11.929  1.00 145.97 ? 1594 HIS B O   1 
ATOM 1662  C CB  . HIS A 1 222  ? 4.995   -22.587 -14.895  1.00 158.17 ? 1594 HIS B CB  1 
ATOM 1663  C CG  . HIS A 1 222  ? 5.775   -23.794 -15.320  1.00 163.81 ? 1594 HIS B CG  1 
ATOM 1664  N ND1 . HIS A 1 222  ? 5.170   -24.936 -15.799  1.00 170.65 ? 1594 HIS B ND1 1 
ATOM 1665  C CD2 . HIS A 1 222  ? 7.109   -24.023 -15.378  1.00 163.96 ? 1594 HIS B CD2 1 
ATOM 1666  C CE1 . HIS A 1 222  ? 6.096   -25.823 -16.117  1.00 170.81 ? 1594 HIS B CE1 1 
ATOM 1667  N NE2 . HIS A 1 222  ? 7.282   -25.294 -15.870  1.00 166.21 ? 1594 HIS B NE2 1 
ATOM 1668  N N   . MET A 1 223  ? 6.599   -21.206 -12.647  1.00 145.29 ? 1595 MET B N   1 
ATOM 1669  C CA  . MET A 1 223  ? 7.809   -20.895 -11.868  1.00 141.25 ? 1595 MET B CA  1 
ATOM 1670  C C   . MET A 1 223  ? 7.590   -20.971 -10.356  1.00 140.86 ? 1595 MET B C   1 
ATOM 1671  O O   . MET A 1 223  ? 8.446   -21.487 -9.643   1.00 141.05 ? 1595 MET B O   1 
ATOM 1672  C CB  . MET A 1 223  ? 8.356   -19.507 -12.229  1.00 140.05 ? 1595 MET B CB  1 
ATOM 1673  C CG  . MET A 1 223  ? 9.083   -19.453 -13.560  1.00 138.18 ? 1595 MET B CG  1 
ATOM 1674  S SD  . MET A 1 223  ? 9.407   -17.761 -14.084  1.00 138.34 ? 1595 MET B SD  1 
ATOM 1675  C CE  . MET A 1 223  ? 10.649  -17.262 -12.896  1.00 136.51 ? 1595 MET B CE  1 
ATOM 1676  N N   . LEU A 1 224  ? 6.457   -20.455 -9.878   1.00 140.70 ? 1596 LEU B N   1 
ATOM 1677  C CA  . LEU A 1 224  ? 6.126   -20.482 -8.441   1.00 139.69 ? 1596 LEU B CA  1 
ATOM 1678  C C   . LEU A 1 224  ? 5.902   -21.906 -7.923   1.00 139.43 ? 1596 LEU B C   1 
ATOM 1679  O O   . LEU A 1 224  ? 6.340   -22.237 -6.822   1.00 139.77 ? 1596 LEU B O   1 
ATOM 1680  C CB  . LEU A 1 224  ? 4.906   -19.597 -8.132   1.00 140.29 ? 1596 LEU B CB  1 
ATOM 1681  C CG  . LEU A 1 224  ? 5.174   -18.086 -8.111   1.00 139.27 ? 1596 LEU B CG  1 
ATOM 1682  C CD1 . LEU A 1 224  ? 3.896   -17.288 -8.329   1.00 140.66 ? 1596 LEU B CD1 1 
ATOM 1683  C CD2 . LEU A 1 224  ? 5.843   -17.666 -6.812   1.00 139.43 ? 1596 LEU B CD2 1 
ATOM 1684  N N   . SER A 1 225  ? 5.230   -22.738 -8.717   1.00 139.25 ? 1597 SER B N   1 
ATOM 1685  C CA  . SER A 1 225  ? 5.074   -24.163 -8.398   1.00 139.56 ? 1597 SER B CA  1 
ATOM 1686  C C   . SER A 1 225  ? 6.396   -24.929 -8.559   1.00 136.93 ? 1597 SER B C   1 
ATOM 1687  O O   . SER A 1 225  ? 6.655   -25.872 -7.809   1.00 137.28 ? 1597 SER B O   1 
ATOM 1688  C CB  . SER A 1 225  ? 3.973   -24.798 -9.257   1.00 141.00 ? 1597 SER B CB  1 
ATOM 1689  O OG  . SER A 1 225  ? 4.175   -24.527 -10.631  1.00 140.95 ? 1597 SER B OG  1 
ATOM 1690  N N   . GLU A 1 226  ? 7.216   -24.526 -9.535   1.00 134.39 ? 1598 GLU B N   1 
ATOM 1691  C CA  . GLU A 1 226  ? 8.586   -25.054 -9.694   1.00 132.08 ? 1598 GLU B CA  1 
ATOM 1692  C C   . GLU A 1 226  ? 9.496   -24.654 -8.525   1.00 132.53 ? 1598 GLU B C   1 
ATOM 1693  O O   . GLU A 1 226  ? 10.335  -25.448 -8.101   1.00 131.14 ? 1598 GLU B O   1 
ATOM 1694  C CB  . GLU A 1 226  ? 9.219   -24.591 -11.020  1.00 129.59 ? 1598 GLU B CB  1 
ATOM 1695  C CG  . GLU A 1 226  ? 8.757   -25.353 -12.266  1.00 127.99 ? 1598 GLU B CG  1 
ATOM 1696  C CD  . GLU A 1 226  ? 9.744   -26.411 -12.753  1.00 124.07 ? 1598 GLU B CD  1 
ATOM 1697  O OE1 . GLU A 1 226  ? 10.952  -26.114 -12.865  1.00 120.76 ? 1598 GLU B OE1 1 
ATOM 1698  O OE2 . GLU A 1 226  ? 9.306   -27.541 -13.054  1.00 123.38 ? 1598 GLU B OE2 1 
ATOM 1699  N N   . LEU A 1 227  ? 9.321   -23.434 -8.012   1.00 134.48 ? 1599 LEU B N   1 
ATOM 1700  C CA  . LEU A 1 227  ? 10.073  -22.945 -6.843   1.00 134.89 ? 1599 LEU B CA  1 
ATOM 1701  C C   . LEU A 1 227  ? 9.648   -23.659 -5.551   1.00 137.17 ? 1599 LEU B C   1 
ATOM 1702  O O   . LEU A 1 227  ? 10.444  -23.778 -4.618   1.00 135.54 ? 1599 LEU B O   1 
ATOM 1703  C CB  . LEU A 1 227  ? 9.913   -21.421 -6.692   1.00 134.91 ? 1599 LEU B CB  1 
ATOM 1704  C CG  . LEU A 1 227  ? 10.941  -20.653 -5.854   1.00 134.50 ? 1599 LEU B CG  1 
ATOM 1705  C CD1 . LEU A 1 227  ? 12.305  -20.641 -6.528   1.00 132.03 ? 1599 LEU B CD1 1 
ATOM 1706  C CD2 . LEU A 1 227  ? 10.475  -19.223 -5.618   1.00 136.16 ? 1599 LEU B CD2 1 
ATOM 1707  N N   . GLU A 1 228  ? 8.397   -24.120 -5.504   1.00 141.52 ? 1600 GLU B N   1 
ATOM 1708  C CA  . GLU A 1 228  ? 7.918   -25.007 -4.430   1.00 147.08 ? 1600 GLU B CA  1 
ATOM 1709  C C   . GLU A 1 228  ? 8.453   -26.446 -4.541   1.00 146.93 ? 1600 GLU B C   1 
ATOM 1710  O O   . GLU A 1 228  ? 8.382   -27.204 -3.573   1.00 149.53 ? 1600 GLU B O   1 
ATOM 1711  C CB  . GLU A 1 228  ? 6.381   -25.016 -4.365   1.00 151.69 ? 1600 GLU B CB  1 
ATOM 1712  C CG  . GLU A 1 228  ? 5.794   -23.762 -3.725   1.00 154.26 ? 1600 GLU B CG  1 
ATOM 1713  C CD  . GLU A 1 228  ? 4.286   -23.821 -3.536   1.00 156.12 ? 1600 GLU B CD  1 
ATOM 1714  O OE1 . GLU A 1 228  ? 3.620   -24.666 -4.174   1.00 156.67 ? 1600 GLU B OE1 1 
ATOM 1715  O OE2 . GLU A 1 228  ? 3.763   -23.007 -2.745   1.00 157.08 ? 1600 GLU B OE2 1 
ATOM 1716  N N   . GLU A 1 229  ? 8.952   -26.825 -5.718   1.00 145.37 ? 1601 GLU B N   1 
ATOM 1717  C CA  . GLU A 1 229  ? 9.675   -28.091 -5.911   1.00 144.35 ? 1601 GLU B CA  1 
ATOM 1718  C C   . GLU A 1 229  ? 11.185  -27.955 -5.658   1.00 143.97 ? 1601 GLU B C   1 
ATOM 1719  O O   . GLU A 1 229  ? 11.844  -28.943 -5.328   1.00 142.67 ? 1601 GLU B O   1 
ATOM 1720  C CB  . GLU A 1 229  ? 9.417   -28.647 -7.316   1.00 141.69 ? 1601 GLU B CB  1 
ATOM 1721  C CG  . GLU A 1 229  ? 7.983   -29.111 -7.530   1.00 142.90 ? 1601 GLU B CG  1 
ATOM 1722  C CD  . GLU A 1 229  ? 7.641   -29.347 -8.990   1.00 141.11 ? 1601 GLU B CD  1 
ATOM 1723  O OE1 . GLU A 1 229  ? 8.542   -29.713 -9.774   1.00 138.18 ? 1601 GLU B OE1 1 
ATOM 1724  O OE2 . GLU A 1 229  ? 6.460   -29.170 -9.351   1.00 142.99 ? 1601 GLU B OE2 1 
ATOM 1725  N N   . VAL A 1 230  ? 11.732  -26.749 -5.834   1.00 145.50 ? 1602 VAL B N   1 
ATOM 1726  C CA  . VAL A 1 230  ? 13.134  -26.460 -5.480   1.00 146.90 ? 1602 VAL B CA  1 
ATOM 1727  C C   . VAL A 1 230  ? 13.338  -26.510 -3.960   1.00 150.03 ? 1602 VAL B C   1 
ATOM 1728  O O   . VAL A 1 230  ? 14.332  -27.068 -3.490   1.00 151.30 ? 1602 VAL B O   1 
ATOM 1729  C CB  . VAL A 1 230  ? 13.609  -25.103 -6.069   1.00 146.01 ? 1602 VAL B CB  1 
ATOM 1730  C CG1 . VAL A 1 230  ? 14.956  -24.659 -5.498   1.00 145.11 ? 1602 VAL B CG1 1 
ATOM 1731  C CG2 . VAL A 1 230  ? 13.719  -25.204 -7.580   1.00 144.72 ? 1602 VAL B CG2 1 
ATOM 1732  N N   . ILE A 1 231  ? 12.407  -25.925 -3.205   1.00 151.51 ? 1603 ILE B N   1 
ATOM 1733  C CA  . ILE A 1 231  ? 12.447  -25.978 -1.731   1.00 152.89 ? 1603 ILE B CA  1 
ATOM 1734  C C   . ILE A 1 231  ? 12.304  -27.413 -1.188   1.00 150.10 ? 1603 ILE B C   1 
ATOM 1735  O O   . ILE A 1 231  ? 12.878  -27.740 -0.148   1.00 149.74 ? 1603 ILE B O   1 
ATOM 1736  C CB  . ILE A 1 231  ? 11.410  -25.008 -1.083   1.00 156.73 ? 1603 ILE B CB  1 
ATOM 1737  C CG1 . ILE A 1 231  ? 11.718  -24.787 0.404    1.00 158.18 ? 1603 ILE B CG1 1 
ATOM 1738  C CG2 . ILE A 1 231  ? 9.977   -25.495 -1.276   1.00 158.25 ? 1603 ILE B CG2 1 
ATOM 1739  C CD1 . ILE A 1 231  ? 10.972  -23.622 1.026    1.00 159.39 ? 1603 ILE B CD1 1 
ATOM 1740  N N   . GLN A 1 232  ? 11.538  -28.251 -1.893   1.00 148.03 ? 1604 GLN B N   1 
ATOM 1741  C CA  . GLN A 1 232  ? 11.460  -29.699 -1.613   1.00 149.20 ? 1604 GLN B CA  1 
ATOM 1742  C C   . GLN A 1 232  ? 12.820  -30.387 -1.761   1.00 147.36 ? 1604 GLN B C   1 
ATOM 1743  O O   . GLN A 1 232  ? 13.211  -31.205 -0.925   1.00 146.65 ? 1604 GLN B O   1 
ATOM 1744  C CB  . GLN A 1 232  ? 10.466  -30.386 -2.564   1.00 149.68 ? 1604 GLN B CB  1 
ATOM 1745  C CG  . GLN A 1 232  ? 8.993   -30.072 -2.318   1.00 151.89 ? 1604 GLN B CG  1 
ATOM 1746  C CD  . GLN A 1 232  ? 8.239   -31.180 -1.591   1.00 154.09 ? 1604 GLN B CD  1 
ATOM 1747  O OE1 . GLN A 1 232  ? 8.374   -32.362 -1.915   1.00 154.15 ? 1604 GLN B OE1 1 
ATOM 1748  N NE2 . GLN A 1 232  ? 7.417   -30.797 -0.619   1.00 155.31 ? 1604 GLN B NE2 1 
ATOM 1749  N N   . TYR A 1 233  ? 13.518  -30.047 -2.842   1.00 146.19 ? 1605 TYR B N   1 
ATOM 1750  C CA  . TYR A 1 233  ? 14.808  -30.652 -3.199   1.00 146.13 ? 1605 TYR B CA  1 
ATOM 1751  C C   . TYR A 1 233  ? 15.884  -30.392 -2.140   1.00 146.71 ? 1605 TYR B C   1 
ATOM 1752  O O   . TYR A 1 233  ? 16.596  -31.310 -1.725   1.00 143.73 ? 1605 TYR B O   1 
ATOM 1753  C CB  . TYR A 1 233  ? 15.274  -30.106 -4.561   1.00 143.90 ? 1605 TYR B CB  1 
ATOM 1754  C CG  . TYR A 1 233  ? 16.174  -31.027 -5.357   1.00 141.19 ? 1605 TYR B CG  1 
ATOM 1755  C CD1 . TYR A 1 233  ? 15.651  -31.843 -6.360   1.00 141.11 ? 1605 TYR B CD1 1 
ATOM 1756  C CD2 . TYR A 1 233  ? 17.549  -31.066 -5.130   1.00 139.29 ? 1605 TYR B CD2 1 
ATOM 1757  C CE1 . TYR A 1 233  ? 16.468  -32.681 -7.103   1.00 139.60 ? 1605 TYR B CE1 1 
ATOM 1758  C CE2 . TYR A 1 233  ? 18.376  -31.900 -5.868   1.00 137.86 ? 1605 TYR B CE2 1 
ATOM 1759  C CZ  . TYR A 1 233  ? 17.830  -32.705 -6.852   1.00 138.35 ? 1605 TYR B CZ  1 
ATOM 1760  O OH  . TYR A 1 233  ? 18.643  -33.535 -7.586   1.00 138.03 ? 1605 TYR B OH  1 
ATOM 1761  N N   . LYS A 1 234  ? 15.959  -29.144 -1.683   1.00 149.46 ? 1606 LYS B N   1 
ATOM 1762  C CA  . LYS A 1 234  ? 17.058  -28.672 -0.830   1.00 153.34 ? 1606 LYS B CA  1 
ATOM 1763  C C   . LYS A 1 234  ? 16.759  -28.752 0.677    1.00 159.48 ? 1606 LYS B C   1 
ATOM 1764  O O   . LYS A 1 234  ? 17.108  -27.844 1.436    1.00 168.05 ? 1606 LYS B O   1 
ATOM 1765  C CB  . LYS A 1 234  ? 17.472  -27.244 -1.245   1.00 153.48 ? 1606 LYS B CB  1 
ATOM 1766  C CG  . LYS A 1 234  ? 16.435  -26.144 -1.015   1.00 156.69 ? 1606 LYS B CG  1 
ATOM 1767  C CD  . LYS A 1 234  ? 16.700  -24.912 -1.870   1.00 156.04 ? 1606 LYS B CD  1 
ATOM 1768  C CE  . LYS A 1 234  ? 17.879  -24.100 -1.358   1.00 156.89 ? 1606 LYS B CE  1 
ATOM 1769  N NZ  . LYS A 1 234  ? 17.558  -23.342 -0.114   1.00 160.48 ? 1606 LYS B NZ  1 
ATOM 1770  N N   . LEU A 1 235  ? 16.132  -29.846 1.112    1.00 159.42 ? 1607 LEU B N   1 
ATOM 1771  C CA  . LEU A 1 235  ? 15.909  -30.098 2.546    1.00 160.75 ? 1607 LEU B CA  1 
ATOM 1772  C C   . LEU A 1 235  ? 15.705  -31.591 2.824    1.00 160.06 ? 1607 LEU B C   1 
ATOM 1773  O O   . LEU A 1 235  ? 16.451  -32.179 3.612    1.00 162.62 ? 1607 LEU B O   1 
ATOM 1774  C CB  . LEU A 1 235  ? 14.736  -29.254 3.087    1.00 161.23 ? 1607 LEU B CB  1 
ATOM 1775  C CG  . LEU A 1 235  ? 14.622  -29.025 4.605    1.00 163.30 ? 1607 LEU B CG  1 
ATOM 1776  C CD1 . LEU A 1 235  ? 15.881  -28.419 5.217    1.00 163.00 ? 1607 LEU B CD1 1 
ATOM 1777  C CD2 . LEU A 1 235  ? 13.425  -28.132 4.897    1.00 163.92 ? 1607 LEU B CD2 1 
ATOM 1778  N N   . VAL A 1 236  ? 14.711  -32.197 2.171    1.00 156.74 ? 1608 VAL B N   1 
ATOM 1779  C CA  . VAL A 1 236  ? 14.515  -33.658 2.220    1.00 156.02 ? 1608 VAL B CA  1 
ATOM 1780  C C   . VAL A 1 236  ? 15.225  -34.302 1.016    1.00 152.36 ? 1608 VAL B C   1 
ATOM 1781  O O   . VAL A 1 236  ? 15.052  -33.822 -0.110   1.00 149.82 ? 1608 VAL B O   1 
ATOM 1782  C CB  . VAL A 1 236  ? 13.020  -34.090 2.290    1.00 157.55 ? 1608 VAL B CB  1 
ATOM 1783  C CG1 . VAL A 1 236  ? 12.465  -33.855 3.690    1.00 161.07 ? 1608 VAL B CG1 1 
ATOM 1784  C CG2 . VAL A 1 236  ? 12.148  -33.399 1.243    1.00 155.46 ? 1608 VAL B CG2 1 
ATOM 1785  N N   . PRO A 1 237  ? 16.038  -35.372 1.240    1.00 151.04 ? 1609 PRO B N   1 
ATOM 1786  C CA  . PRO A 1 237  ? 16.781  -35.983 0.120    1.00 146.64 ? 1609 PRO B CA  1 
ATOM 1787  C C   . PRO A 1 237  ? 16.098  -37.162 -0.608   1.00 145.18 ? 1609 PRO B C   1 
ATOM 1788  O O   . PRO A 1 237  ? 16.767  -37.880 -1.359   1.00 141.79 ? 1609 PRO B O   1 
ATOM 1789  C CB  . PRO A 1 237  ? 18.095  -36.452 0.787    1.00 147.37 ? 1609 PRO B CB  1 
ATOM 1790  C CG  . PRO A 1 237  ? 17.878  -36.356 2.267    1.00 151.39 ? 1609 PRO B CG  1 
ATOM 1791  C CD  . PRO A 1 237  ? 16.444  -35.993 2.514    1.00 153.16 ? 1609 PRO B CD  1 
ATOM 1792  N N   . GLU A 1 238  ? 14.791  -37.347 -0.411   1.00 146.83 ? 1610 GLU B N   1 
ATOM 1793  C CA  . GLU A 1 238  ? 14.063  -38.484 -0.988   1.00 146.87 ? 1610 GLU B CA  1 
ATOM 1794  C C   . GLU A 1 238  ? 13.859  -38.293 -2.487   1.00 142.71 ? 1610 GLU B C   1 
ATOM 1795  O O   . GLU A 1 238  ? 14.346  -39.092 -3.285   1.00 139.24 ? 1610 GLU B O   1 
ATOM 1796  C CB  . GLU A 1 238  ? 12.707  -38.667 -0.282   1.00 149.86 ? 1610 GLU B CB  1 
ATOM 1797  C CG  . GLU A 1 238  ? 11.923  -39.926 -0.664   1.00 150.67 ? 1610 GLU B CG  1 
ATOM 1798  C CD  . GLU A 1 238  ? 12.247  -41.139 0.195    1.00 152.01 ? 1610 GLU B CD  1 
ATOM 1799  O OE1 . GLU A 1 238  ? 12.143  -41.052 1.438    1.00 152.74 ? 1610 GLU B OE1 1 
ATOM 1800  O OE2 . GLU A 1 238  ? 12.581  -42.196 -0.380   1.00 151.51 ? 1610 GLU B OE2 1 
ATOM 1801  N N   . ARG A 1 239  ? 13.154  -37.224 -2.855   1.00 143.35 ? 1611 ARG B N   1 
ATOM 1802  C CA  . ARG A 1 239  ? 12.782  -36.963 -4.247   1.00 143.70 ? 1611 ARG B CA  1 
ATOM 1803  C C   . ARG A 1 239  ? 13.905  -36.251 -5.021   1.00 143.31 ? 1611 ARG B C   1 
ATOM 1804  O O   . ARG A 1 239  ? 13.777  -35.091 -5.407   1.00 142.97 ? 1611 ARG B O   1 
ATOM 1805  C CB  . ARG A 1 239  ? 11.483  -36.141 -4.321   1.00 143.52 ? 1611 ARG B CB  1 
ATOM 1806  C CG  . ARG A 1 239  ? 10.208  -36.854 -3.879   1.00 144.89 ? 1611 ARG B CG  1 
ATOM 1807  C CD  . ARG A 1 239  ? 9.019   -36.364 -4.702   1.00 144.25 ? 1611 ARG B CD  1 
ATOM 1808  N NE  . ARG A 1 239  ? 7.768   -37.066 -4.413   1.00 146.86 ? 1611 ARG B NE  1 
ATOM 1809  C CZ  . ARG A 1 239  ? 6.655   -36.998 -5.153   1.00 147.04 ? 1611 ARG B CZ  1 
ATOM 1810  N NH1 . ARG A 1 239  ? 6.597   -36.259 -6.265   1.00 144.24 ? 1611 ARG B NH1 1 
ATOM 1811  N NH2 . ARG A 1 239  ? 5.579   -37.686 -4.780   1.00 150.07 ? 1611 ARG B NH2 1 
ATOM 1812  N N   . ARG A 1 240  ? 14.995  -36.970 -5.267   1.00 144.54 ? 1612 ARG B N   1 
ATOM 1813  C CA  . ARG A 1 240  ? 16.132  -36.445 -6.027   1.00 143.44 ? 1612 ARG B CA  1 
ATOM 1814  C C   . ARG A 1 240  ? 15.884  -36.778 -7.489   1.00 144.75 ? 1612 ARG B C   1 
ATOM 1815  O O   . ARG A 1 240  ? 15.810  -35.888 -8.337   1.00 145.66 ? 1612 ARG B O   1 
ATOM 1816  C CB  . ARG A 1 240  ? 17.448  -37.071 -5.554   1.00 142.88 ? 1612 ARG B CB  1 
ATOM 1817  C CG  . ARG A 1 240  ? 17.881  -36.643 -4.162   1.00 144.02 ? 1612 ARG B CG  1 
ATOM 1818  C CD  . ARG A 1 240  ? 18.629  -35.318 -4.180   1.00 142.67 ? 1612 ARG B CD  1 
ATOM 1819  N NE  . ARG A 1 240  ? 18.869  -34.811 -2.827   1.00 144.43 ? 1612 ARG B NE  1 
ATOM 1820  C CZ  . ARG A 1 240  ? 19.730  -33.845 -2.498   1.00 143.61 ? 1612 ARG B CZ  1 
ATOM 1821  N NH1 . ARG A 1 240  ? 20.483  -33.235 -3.416   1.00 142.08 ? 1612 ARG B NH1 1 
ATOM 1822  N NH2 . ARG A 1 240  ? 19.847  -33.484 -1.222   1.00 144.53 ? 1612 ARG B NH2 1 
ATOM 1823  N N   . GLU A 1 241  ? 15.735  -38.071 -7.762   1.00 146.92 ? 1613 GLU B N   1 
ATOM 1824  C CA  . GLU A 1 241  ? 15.450  -38.572 -9.103   1.00 146.90 ? 1613 GLU B CA  1 
ATOM 1825  C C   . GLU A 1 241  ? 13.988  -38.369 -9.511   1.00 146.68 ? 1613 GLU B C   1 
ATOM 1826  O O   . GLU A 1 241  ? 13.691  -38.283 -10.703  1.00 149.66 ? 1613 GLU B O   1 
ATOM 1827  C CB  . GLU A 1 241  ? 15.813  -40.056 -9.199   1.00 149.73 ? 1613 GLU B CB  1 
ATOM 1828  C CG  . GLU A 1 241  ? 17.293  -40.342 -8.989   1.00 150.30 ? 1613 GLU B CG  1 
ATOM 1829  C CD  . GLU A 1 241  ? 17.615  -41.824 -9.027   1.00 153.14 ? 1613 GLU B CD  1 
ATOM 1830  O OE1 . GLU A 1 241  ? 16.996  -42.591 -8.258   1.00 153.85 ? 1613 GLU B OE1 1 
ATOM 1831  O OE2 . GLU A 1 241  ? 18.496  -42.222 -9.820   1.00 154.61 ? 1613 GLU B OE2 1 
ATOM 1832  N N   . ILE A 1 242  ? 13.083  -38.291 -8.534   1.00 145.40 ? 1614 ILE B N   1 
ATOM 1833  C CA  . ILE A 1 242  ? 11.652  -38.117 -8.813   1.00 146.23 ? 1614 ILE B CA  1 
ATOM 1834  C C   . ILE A 1 242  ? 11.383  -36.688 -9.293   1.00 142.34 ? 1614 ILE B C   1 
ATOM 1835  O O   . ILE A 1 242  ? 10.654  -36.492 -10.269  1.00 142.56 ? 1614 ILE B O   1 
ATOM 1836  C CB  . ILE A 1 242  ? 10.769  -38.463 -7.585   1.00 151.22 ? 1614 ILE B CB  1 
ATOM 1837  C CG1 . ILE A 1 242  ? 10.984  -39.924 -7.159   1.00 154.46 ? 1614 ILE B CG1 1 
ATOM 1838  C CG2 . ILE A 1 242  ? 9.285   -38.258 -7.895   1.00 152.80 ? 1614 ILE B CG2 1 
ATOM 1839  C CD1 . ILE A 1 242  ? 10.553  -40.232 -5.739   1.00 158.00 ? 1614 ILE B CD1 1 
ATOM 1840  N N   . ILE A 1 243  ? 11.966  -35.704 -8.607   1.00 138.85 ? 1615 ILE B N   1 
ATOM 1841  C CA  . ILE A 1 243  ? 11.864  -34.296 -9.024   1.00 137.52 ? 1615 ILE B CA  1 
ATOM 1842  C C   . ILE A 1 243  ? 12.572  -34.062 -10.373  1.00 136.99 ? 1615 ILE B C   1 
ATOM 1843  O O   . ILE A 1 243  ? 12.090  -33.279 -11.197  1.00 136.90 ? 1615 ILE B O   1 
ATOM 1844  C CB  . ILE A 1 243  ? 12.370  -33.327 -7.914   1.00 135.60 ? 1615 ILE B CB  1 
ATOM 1845  C CG1 . ILE A 1 243  ? 11.378  -33.331 -6.743   1.00 137.77 ? 1615 ILE B CG1 1 
ATOM 1846  C CG2 . ILE A 1 243  ? 12.510  -31.895 -8.433   1.00 134.20 ? 1615 ILE B CG2 1 
ATOM 1847  C CD1 . ILE A 1 243  ? 11.841  -32.638 -5.473   1.00 138.10 ? 1615 ILE B CD1 1 
ATOM 1848  N N   . ARG A 1 244  ? 13.696  -34.744 -10.595  1.00 136.79 ? 1616 ARG B N   1 
ATOM 1849  C CA  . ARG A 1 244  ? 14.432  -34.652 -11.867  1.00 134.50 ? 1616 ARG B CA  1 
ATOM 1850  C C   . ARG A 1 244  ? 13.658  -35.188 -13.074  1.00 133.71 ? 1616 ARG B C   1 
ATOM 1851  O O   . ARG A 1 244  ? 13.748  -34.621 -14.164  1.00 130.25 ? 1616 ARG B O   1 
ATOM 1852  C CB  . ARG A 1 244  ? 15.783  -35.367 -11.768  1.00 135.00 ? 1616 ARG B CB  1 
ATOM 1853  C CG  . ARG A 1 244  ? 16.851  -34.543 -11.080  1.00 136.08 ? 1616 ARG B CG  1 
ATOM 1854  C CD  . ARG A 1 244  ? 18.074  -35.385 -10.774  1.00 138.91 ? 1616 ARG B CD  1 
ATOM 1855  N NE  . ARG A 1 244  ? 19.208  -34.564 -10.361  1.00 142.58 ? 1616 ARG B NE  1 
ATOM 1856  C CZ  . ARG A 1 244  ? 20.391  -35.035 -9.968   1.00 147.82 ? 1616 ARG B CZ  1 
ATOM 1857  N NH1 . ARG A 1 244  ? 20.627  -36.347 -9.916   1.00 149.97 ? 1616 ARG B NH1 1 
ATOM 1858  N NH2 . ARG A 1 244  ? 21.353  -34.183 -9.618   1.00 150.54 ? 1616 ARG B NH2 1 
ATOM 1859  N N   . GLN A 1 245  ? 12.921  -36.281 -12.879  1.00 136.91 ? 1617 GLN B N   1 
ATOM 1860  C CA  . GLN A 1 245  ? 12.102  -36.872 -13.950  1.00 138.11 ? 1617 GLN B CA  1 
ATOM 1861  C C   . GLN A 1 245  ? 10.917  -35.992 -14.346  1.00 137.24 ? 1617 GLN B C   1 
ATOM 1862  O O   . GLN A 1 245  ? 10.597  -35.893 -15.531  1.00 137.57 ? 1617 GLN B O   1 
ATOM 1863  C CB  . GLN A 1 245  ? 11.596  -38.274 -13.576  1.00 141.80 ? 1617 GLN B CB  1 
ATOM 1864  C CG  . GLN A 1 245  ? 12.528  -39.407 -13.979  1.00 141.17 ? 1617 GLN B CG  1 
ATOM 1865  C CD  . GLN A 1 245  ? 11.814  -40.743 -14.044  1.00 144.02 ? 1617 GLN B CD  1 
ATOM 1866  O OE1 . GLN A 1 245  ? 11.094  -41.121 -13.118  1.00 146.73 ? 1617 GLN B OE1 1 
ATOM 1867  N NE2 . GLN A 1 245  ? 12.006  -41.465 -15.143  1.00 143.71 ? 1617 GLN B NE2 1 
ATOM 1868  N N   . ILE A 1 246  ? 10.269  -35.367 -13.362  1.00 136.11 ? 1618 ILE B N   1 
ATOM 1869  C CA  . ILE A 1 246  ? 9.152   -34.451 -13.628  1.00 136.59 ? 1618 ILE B CA  1 
ATOM 1870  C C   . ILE A 1 246  ? 9.687   -33.171 -14.296  1.00 134.64 ? 1618 ILE B C   1 
ATOM 1871  O O   . ILE A 1 246  ? 9.053   -32.641 -15.211  1.00 136.64 ? 1618 ILE B O   1 
ATOM 1872  C CB  . ILE A 1 246  ? 8.339   -34.128 -12.346  1.00 138.02 ? 1618 ILE B CB  1 
ATOM 1873  C CG1 . ILE A 1 246  ? 7.745   -35.411 -11.744  1.00 141.18 ? 1618 ILE B CG1 1 
ATOM 1874  C CG2 . ILE A 1 246  ? 7.198   -33.158 -12.645  1.00 138.11 ? 1618 ILE B CG2 1 
ATOM 1875  C CD1 . ILE A 1 246  ? 7.346   -35.287 -10.287  1.00 143.48 ? 1618 ILE B CD1 1 
ATOM 1876  N N   . TRP A 1 247  ? 10.843  -32.688 -13.830  1.00 130.91 ? 1619 TRP B N   1 
ATOM 1877  C CA  . TRP A 1 247  ? 11.575  -31.588 -14.488  1.00 126.24 ? 1619 TRP B CA  1 
ATOM 1878  C C   . TRP A 1 247  ? 11.951  -31.932 -15.937  1.00 125.27 ? 1619 TRP B C   1 
ATOM 1879  O O   . TRP A 1 247  ? 11.819  -31.095 -16.829  1.00 124.58 ? 1619 TRP B O   1 
ATOM 1880  C CB  . TRP A 1 247  ? 12.846  -31.229 -13.695  1.00 122.84 ? 1619 TRP B CB  1 
ATOM 1881  C CG  . TRP A 1 247  ? 12.631  -30.377 -12.454  1.00 122.62 ? 1619 TRP B CG  1 
ATOM 1882  C CD1 . TRP A 1 247  ? 11.437  -30.003 -11.896  1.00 123.97 ? 1619 TRP B CD1 1 
ATOM 1883  C CD2 . TRP A 1 247  ? 13.653  -29.827 -11.606  1.00 121.53 ? 1619 TRP B CD2 1 
ATOM 1884  N NE1 . TRP A 1 247  ? 11.655  -29.241 -10.771  1.00 124.06 ? 1619 TRP B NE1 1 
ATOM 1885  C CE2 . TRP A 1 247  ? 13.004  -29.120 -10.568  1.00 122.34 ? 1619 TRP B CE2 1 
ATOM 1886  C CE3 . TRP A 1 247  ? 15.056  -29.858 -11.628  1.00 119.98 ? 1619 TRP B CE3 1 
ATOM 1887  C CZ2 . TRP A 1 247  ? 13.712  -28.447 -9.559   1.00 121.71 ? 1619 TRP B CZ2 1 
ATOM 1888  C CZ3 . TRP A 1 247  ? 15.760  -29.186 -10.620  1.00 119.19 ? 1619 TRP B CZ3 1 
ATOM 1889  C CH2 . TRP A 1 247  ? 15.084  -28.492 -9.603   1.00 119.98 ? 1619 TRP B CH2 1 
ATOM 1890  N N   . TRP A 1 248  ? 12.415  -33.162 -16.154  1.00 126.50 ? 1620 TRP B N   1 
ATOM 1891  C CA  . TRP A 1 248  ? 12.791  -33.661 -17.490  1.00 126.37 ? 1620 TRP B CA  1 
ATOM 1892  C C   . TRP A 1 248  ? 11.582  -33.923 -18.401  1.00 129.86 ? 1620 TRP B C   1 
ATOM 1893  O O   . TRP A 1 248  ? 11.648  -33.671 -19.607  1.00 128.27 ? 1620 TRP B O   1 
ATOM 1894  C CB  . TRP A 1 248  ? 13.646  -34.933 -17.347  1.00 125.29 ? 1620 TRP B CB  1 
ATOM 1895  C CG  . TRP A 1 248  ? 14.088  -35.575 -18.640  1.00 123.24 ? 1620 TRP B CG  1 
ATOM 1896  C CD1 . TRP A 1 248  ? 13.815  -36.847 -19.051  1.00 124.40 ? 1620 TRP B CD1 1 
ATOM 1897  C CD2 . TRP A 1 248  ? 14.880  -34.981 -19.678  1.00 120.95 ? 1620 TRP B CD2 1 
ATOM 1898  N NE1 . TRP A 1 248  ? 14.385  -37.084 -20.278  1.00 122.79 ? 1620 TRP B NE1 1 
ATOM 1899  C CE2 . TRP A 1 248  ? 15.045  -35.956 -20.688  1.00 120.09 ? 1620 TRP B CE2 1 
ATOM 1900  C CE3 . TRP A 1 248  ? 15.467  -33.721 -19.854  1.00 120.39 ? 1620 TRP B CE3 1 
ATOM 1901  C CZ2 . TRP A 1 248  ? 15.772  -35.712 -21.859  1.00 117.68 ? 1620 TRP B CZ2 1 
ATOM 1902  C CZ3 . TRP A 1 248  ? 16.191  -33.478 -21.025  1.00 118.61 ? 1620 TRP B CZ3 1 
ATOM 1903  C CH2 . TRP A 1 248  ? 16.335  -34.471 -22.010  1.00 116.90 ? 1620 TRP B CH2 1 
ATOM 1904  N N   . GLU A 1 249  ? 10.493  -34.436 -17.826  1.00 135.61 ? 1621 GLU B N   1 
ATOM 1905  C CA  . GLU A 1 249  ? 9.259   -34.711 -18.578  1.00 139.82 ? 1621 GLU B CA  1 
ATOM 1906  C C   . GLU A 1 249  ? 8.578   -33.422 -19.036  1.00 141.51 ? 1621 GLU B C   1 
ATOM 1907  O O   . GLU A 1 249  ? 8.186   -33.314 -20.199  1.00 141.17 ? 1621 GLU B O   1 
ATOM 1908  C CB  . GLU A 1 249  ? 8.290   -35.574 -17.756  1.00 143.81 ? 1621 GLU B CB  1 
ATOM 1909  C CG  . GLU A 1 249  ? 8.661   -37.053 -17.744  1.00 144.67 ? 1621 GLU B CG  1 
ATOM 1910  C CD  . GLU A 1 249  ? 8.121   -37.810 -16.542  1.00 147.98 ? 1621 GLU B CD  1 
ATOM 1911  O OE1 . GLU A 1 249  ? 7.086   -37.400 -15.970  1.00 150.04 ? 1621 GLU B OE1 1 
ATOM 1912  O OE2 . GLU A 1 249  ? 8.739   -38.830 -16.172  1.00 148.80 ? 1621 GLU B OE2 1 
ATOM 1913  N N   . ARG A 1 250  ? 8.458   -32.446 -18.134  1.00 144.69 ? 1622 ARG B N   1 
ATOM 1914  C CA  . ARG A 1 250  ? 7.937   -31.112 -18.481  1.00 147.85 ? 1622 ARG B CA  1 
ATOM 1915  C C   . ARG A 1 250  ? 9.044   -30.260 -19.121  1.00 145.82 ? 1622 ARG B C   1 
ATOM 1916  O O   . ARG A 1 250  ? 9.489   -29.251 -18.565  1.00 149.26 ? 1622 ARG B O   1 
ATOM 1917  C CB  . ARG A 1 250  ? 7.324   -30.417 -17.254  1.00 151.45 ? 1622 ARG B CB  1 
ATOM 1918  C CG  . ARG A 1 250  ? 6.006   -31.030 -16.785  1.00 155.33 ? 1622 ARG B CG  1 
ATOM 1919  C CD  . ARG A 1 250  ? 5.214   -30.112 -15.856  1.00 155.25 ? 1622 ARG B CD  1 
ATOM 1920  N NE  . ARG A 1 250  ? 5.603   -30.249 -14.448  1.00 153.81 ? 1622 ARG B NE  1 
ATOM 1921  C CZ  . ARG A 1 250  ? 6.589   -29.585 -13.834  1.00 151.58 ? 1622 ARG B CZ  1 
ATOM 1922  N NH1 . ARG A 1 250  ? 7.350   -28.696 -14.478  1.00 151.53 ? 1622 ARG B NH1 1 
ATOM 1923  N NH2 . ARG A 1 250  ? 6.823   -29.817 -12.544  1.00 149.58 ? 1622 ARG B NH2 1 
ATOM 1924  N N   . LEU A 1 251  ? 9.462   -30.684 -20.310  1.00 143.97 ? 1623 LEU B N   1 
ATOM 1925  C CA  . LEU A 1 251  ? 10.575  -30.077 -21.050  1.00 141.75 ? 1623 LEU B CA  1 
ATOM 1926  C C   . LEU A 1 251  ? 10.517  -30.584 -22.494  1.00 138.65 ? 1623 LEU B C   1 
ATOM 1927  O O   . LEU A 1 251  ? 10.392  -29.801 -23.433  1.00 138.02 ? 1623 LEU B O   1 
ATOM 1928  C CB  . LEU A 1 251  ? 11.926  -30.423 -20.403  1.00 142.74 ? 1623 LEU B CB  1 
ATOM 1929  C CG  . LEU A 1 251  ? 13.123  -29.537 -20.770  1.00 142.81 ? 1623 LEU B CG  1 
ATOM 1930  C CD1 . LEU A 1 251  ? 13.097  -28.242 -19.966  1.00 143.98 ? 1623 LEU B CD1 1 
ATOM 1931  C CD2 . LEU A 1 251  ? 14.440  -30.266 -20.547  1.00 141.83 ? 1623 LEU B CD2 1 
ATOM 1932  N N   . GLN A 1 252  ? 10.579  -31.904 -22.655  1.00 136.40 ? 1624 GLN B N   1 
ATOM 1933  C CA  . GLN A 1 252  ? 10.296  -32.545 -23.935  1.00 135.18 ? 1624 GLN B CA  1 
ATOM 1934  C C   . GLN A 1 252  ? 8.828   -32.321 -24.283  1.00 138.11 ? 1624 GLN B C   1 
ATOM 1935  O O   . GLN A 1 252  ? 8.505   -31.904 -25.396  1.00 137.93 ? 1624 GLN B O   1 
ATOM 1936  C CB  . GLN A 1 252  ? 10.599  -34.043 -23.864  1.00 134.11 ? 1624 GLN B CB  1 
ATOM 1937  C CG  . GLN A 1 252  ? 12.081  -34.358 -23.703  1.00 131.72 ? 1624 GLN B CG  1 
ATOM 1938  C CD  . GLN A 1 252  ? 12.340  -35.687 -23.019  1.00 131.80 ? 1624 GLN B CD  1 
ATOM 1939  O OE1 . GLN A 1 252  ? 11.799  -35.966 -21.951  1.00 132.45 ? 1624 GLN B OE1 1 
ATOM 1940  N NE2 . GLN A 1 252  ? 13.187  -36.507 -23.626  1.00 132.24 ? 1624 GLN B NE2 1 
ATOM 1941  N N   . GLY A 1 253  ? 7.954   -32.580 -23.309  1.00 142.93 ? 1625 GLY B N   1 
ATOM 1942  C CA  . GLY A 1 253  ? 6.513   -32.363 -23.451  1.00 147.82 ? 1625 GLY B CA  1 
ATOM 1943  C C   . GLY A 1 253  ? 6.110   -30.899 -23.488  1.00 149.87 ? 1625 GLY B C   1 
ATOM 1944  O O   . GLY A 1 253  ? 5.459   -30.458 -24.437  1.00 151.24 ? 1625 GLY B O   1 
ATOM 1945  N N   . CYS A 1 254  ? 6.494   -30.148 -22.454  1.00 151.59 ? 1626 CYS B N   1 
ATOM 1946  C CA  . CYS A 1 254  ? 6.166   -28.714 -22.361  1.00 153.06 ? 1626 CYS B CA  1 
ATOM 1947  C C   . CYS A 1 254  ? 6.810   -27.903 -23.486  1.00 152.90 ? 1626 CYS B C   1 
ATOM 1948  O O   . CYS A 1 254  ? 7.898   -28.237 -23.960  1.00 154.46 ? 1626 CYS B O   1 
ATOM 1949  C CB  . CYS A 1 254  ? 6.584   -28.125 -21.005  1.00 151.54 ? 1626 CYS B CB  1 
ATOM 1950  S SG  . CYS A 1 254  ? 5.422   -28.442 -19.660  1.00 152.47 ? 1626 CYS B SG  1 
ATOM 1951  N N   . GLN A 1 255  ? 6.119   -26.844 -23.904  1.00 152.13 ? 1627 GLN B N   1 
ATOM 1952  C CA  . GLN A 1 255  ? 6.597   -25.958 -24.964  1.00 149.80 ? 1627 GLN B CA  1 
ATOM 1953  C C   . GLN A 1 255  ? 6.268   -24.499 -24.641  1.00 151.91 ? 1627 GLN B C   1 
ATOM 1954  O O   . GLN A 1 255  ? 5.179   -24.012 -24.953  1.00 154.10 ? 1627 GLN B O   1 
ATOM 1955  C CB  . GLN A 1 255  ? 5.998   -26.367 -26.313  1.00 149.30 ? 1627 GLN B CB  1 
ATOM 1956  C CG  . GLN A 1 255  ? 6.538   -27.684 -26.854  1.00 147.90 ? 1627 GLN B CG  1 
ATOM 1957  C CD  . GLN A 1 255  ? 6.081   -27.984 -28.271  1.00 149.21 ? 1627 GLN B CD  1 
ATOM 1958  O OE1 . GLN A 1 255  ? 5.083   -27.443 -28.748  1.00 150.50 ? 1627 GLN B OE1 1 
ATOM 1959  N NE2 . GLN A 1 255  ? 6.813   -28.860 -28.951  1.00 147.95 ? 1627 GLN B NE2 1 
ATOM 1960  N N   . ARG A 1 256  ? 7.215   -23.829 -23.984  1.00 153.00 ? 1628 ARG B N   1 
ATOM 1961  C CA  . ARG A 1 256  ? 7.180   -22.378 -23.769  1.00 155.25 ? 1628 ARG B CA  1 
ATOM 1962  C C   . ARG A 1 256  ? 8.411   -21.773 -24.445  1.00 152.55 ? 1628 ARG B C   1 
ATOM 1963  O O   . ARG A 1 256  ? 9.413   -22.465 -24.648  1.00 148.32 ? 1628 ARG B O   1 
ATOM 1964  C CB  . ARG A 1 256  ? 7.163   -22.044 -22.274  1.00 157.51 ? 1628 ARG B CB  1 
ATOM 1965  C CG  . ARG A 1 256  ? 6.003   -22.658 -21.499  1.00 162.13 ? 1628 ARG B CG  1 
ATOM 1966  C CD  . ARG A 1 256  ? 6.393   -23.027 -20.075  1.00 164.66 ? 1628 ARG B CD  1 
ATOM 1967  N NE  . ARG A 1 256  ? 5.342   -23.800 -19.409  1.00 172.04 ? 1628 ARG B NE  1 
ATOM 1968  C CZ  . ARG A 1 256  ? 4.222   -23.297 -18.880  1.00 179.62 ? 1628 ARG B CZ  1 
ATOM 1969  N NH1 . ARG A 1 256  ? 3.958   -21.990 -18.918  1.00 183.81 ? 1628 ARG B NH1 1 
ATOM 1970  N NH2 . ARG A 1 256  ? 3.346   -24.118 -18.302  1.00 181.18 ? 1628 ARG B NH2 1 
ATOM 1971  N N   . ILE A 1 257  ? 8.340   -20.481 -24.770  1.00 154.87 ? 1629 ILE B N   1 
ATOM 1972  C CA  . ILE A 1 257  ? 9.334   -19.839 -25.653  1.00 156.89 ? 1629 ILE B CA  1 
ATOM 1973  C C   . ILE A 1 257  ? 10.677  -19.669 -24.923  1.00 156.71 ? 1629 ILE B C   1 
ATOM 1974  O O   . ILE A 1 257  ? 10.711  -19.538 -23.697  1.00 161.36 ? 1629 ILE B O   1 
ATOM 1975  C CB  . ILE A 1 257  ? 8.848   -18.464 -26.213  1.00 158.99 ? 1629 ILE B CB  1 
ATOM 1976  C CG1 . ILE A 1 257  ? 7.457   -18.569 -26.865  1.00 162.94 ? 1629 ILE B CG1 1 
ATOM 1977  C CG2 . ILE A 1 257  ? 9.816   -17.923 -27.269  1.00 157.48 ? 1629 ILE B CG2 1 
ATOM 1978  C CD1 . ILE A 1 257  ? 6.725   -17.246 -26.977  1.00 164.34 ? 1629 ILE B CD1 1 
ATOM 1979  N N   . VAL A 1 258  ? 11.767  -19.727 -25.695  1.00 153.81 ? 1630 VAL B N   1 
ATOM 1980  C CA  . VAL A 1 258  ? 13.150  -19.407 -25.253  1.00 151.44 ? 1630 VAL B CA  1 
ATOM 1981  C C   . VAL A 1 258  ? 13.229  -18.525 -23.999  1.00 149.72 ? 1630 VAL B C   1 
ATOM 1982  O O   . VAL A 1 258  ? 13.828  -18.910 -22.992  1.00 145.16 ? 1630 VAL B O   1 
ATOM 1983  C CB  . VAL A 1 258  ? 13.989  -18.674 -26.355  1.00 155.31 ? 1630 VAL B CB  1 
ATOM 1984  C CG1 . VAL A 1 258  ? 15.481  -18.793 -26.054  1.00 155.35 ? 1630 VAL B CG1 1 
ATOM 1985  C CG2 . VAL A 1 258  ? 13.714  -19.191 -27.766  1.00 155.78 ? 1630 VAL B CG2 1 
ATOM 1986  N N   . GLU A 1 259  ? 12.598  -17.354 -24.089  1.00 151.73 ? 1631 GLU B N   1 
ATOM 1987  C CA  . GLU A 1 259  ? 12.710  -16.277 -23.095  1.00 150.33 ? 1631 GLU B CA  1 
ATOM 1988  C C   . GLU A 1 259  ? 12.186  -16.696 -21.720  1.00 148.28 ? 1631 GLU B C   1 
ATOM 1989  O O   . GLU A 1 259  ? 12.792  -16.378 -20.694  1.00 144.25 ? 1631 GLU B O   1 
ATOM 1990  C CB  . GLU A 1 259  ? 11.949  -15.024 -23.569  1.00 153.80 ? 1631 GLU B CB  1 
ATOM 1991  C CG  . GLU A 1 259  ? 12.426  -14.423 -24.895  1.00 152.54 ? 1631 GLU B CG  1 
ATOM 1992  C CD  . GLU A 1 259  ? 11.691  -14.946 -26.128  1.00 150.90 ? 1631 GLU B CD  1 
ATOM 1993  O OE1 . GLU A 1 259  ? 10.442  -14.979 -26.126  1.00 152.13 ? 1631 GLU B OE1 1 
ATOM 1994  O OE2 . GLU A 1 259  ? 12.366  -15.322 -27.112  1.00 147.16 ? 1631 GLU B OE2 1 
ATOM 1995  N N   . ASP A 1 260  ? 11.058  -17.406 -21.719  1.00 149.93 ? 1632 ASP B N   1 
ATOM 1996  C CA  . ASP A 1 260  ? 10.445  -17.929 -20.493  1.00 149.73 ? 1632 ASP B CA  1 
ATOM 1997  C C   . ASP A 1 260  ? 11.271  -19.073 -19.897  1.00 146.68 ? 1632 ASP B C   1 
ATOM 1998  O O   . ASP A 1 260  ? 11.390  -19.185 -18.677  1.00 148.39 ? 1632 ASP B O   1 
ATOM 1999  C CB  . ASP A 1 260  ? 9.013   -18.419 -20.763  1.00 151.68 ? 1632 ASP B CB  1 
ATOM 2000  C CG  . ASP A 1 260  ? 8.086   -17.314 -21.271  1.00 153.55 ? 1632 ASP B CG  1 
ATOM 2001  O OD1 . ASP A 1 260  ? 8.219   -16.151 -20.831  1.00 152.62 ? 1632 ASP B OD1 1 
ATOM 2002  O OD2 . ASP A 1 260  ? 7.207   -17.620 -22.108  1.00 153.24 ? 1632 ASP B OD2 1 
ATOM 2003  N N   . TRP A 1 261  ? 11.831  -19.915 -20.765  1.00 143.30 ? 1633 TRP B N   1 
ATOM 2004  C CA  . TRP A 1 261  ? 12.681  -21.039 -20.339  1.00 141.35 ? 1633 TRP B CA  1 
ATOM 2005  C C   . TRP A 1 261  ? 14.013  -20.637 -19.703  1.00 135.89 ? 1633 TRP B C   1 
ATOM 2006  O O   . TRP A 1 261  ? 14.615  -21.444 -18.992  1.00 131.03 ? 1633 TRP B O   1 
ATOM 2007  C CB  . TRP A 1 261  ? 12.934  -21.998 -21.509  1.00 143.84 ? 1633 TRP B CB  1 
ATOM 2008  C CG  . TRP A 1 261  ? 11.909  -23.070 -21.624  1.00 148.75 ? 1633 TRP B CG  1 
ATOM 2009  C CD1 . TRP A 1 261  ? 10.578  -22.970 -21.354  1.00 154.27 ? 1633 TRP B CD1 1 
ATOM 2010  C CD2 . TRP A 1 261  ? 12.131  -24.410 -22.050  1.00 151.97 ? 1633 TRP B CD2 1 
ATOM 2011  N NE1 . TRP A 1 261  ? 9.954   -24.172 -21.578  1.00 156.94 ? 1633 TRP B NE1 1 
ATOM 2012  C CE2 . TRP A 1 261  ? 10.887  -25.074 -22.010  1.00 155.20 ? 1633 TRP B CE2 1 
ATOM 2013  C CE3 . TRP A 1 261  ? 13.265  -25.118 -22.465  1.00 155.06 ? 1633 TRP B CE3 1 
ATOM 2014  C CZ2 . TRP A 1 261  ? 10.743  -26.413 -22.369  1.00 158.99 ? 1633 TRP B CZ2 1 
ATOM 2015  C CZ3 . TRP A 1 261  ? 13.124  -26.448 -22.820  1.00 157.75 ? 1633 TRP B CZ3 1 
ATOM 2016  C CH2 . TRP A 1 261  ? 11.870  -27.079 -22.777  1.00 160.56 ? 1633 TRP B CH2 1 
ATOM 2017  N N   . GLN A 1 262  ? 14.478  -19.414 -19.969  1.00 135.17 ? 1634 GLN B N   1 
ATOM 2018  C CA  . GLN A 1 262  ? 15.613  -18.843 -19.236  1.00 133.74 ? 1634 GLN B CA  1 
ATOM 2019  C C   . GLN A 1 262  ? 15.273  -18.786 -17.754  1.00 133.05 ? 1634 GLN B C   1 
ATOM 2020  O O   . GLN A 1 262  ? 16.017  -19.291 -16.914  1.00 131.90 ? 1634 GLN B O   1 
ATOM 2021  C CB  . GLN A 1 262  ? 15.941  -17.424 -19.709  1.00 135.42 ? 1634 GLN B CB  1 
ATOM 2022  C CG  . GLN A 1 262  ? 16.375  -17.310 -21.157  1.00 137.15 ? 1634 GLN B CG  1 
ATOM 2023  C CD  . GLN A 1 262  ? 17.193  -16.060 -21.417  1.00 139.93 ? 1634 GLN B CD  1 
ATOM 2024  O OE1 . GLN A 1 262  ? 18.298  -15.911 -20.895  1.00 139.66 ? 1634 GLN B OE1 1 
ATOM 2025  N NE2 . GLN A 1 262  ? 16.657  -15.155 -22.230  1.00 143.81 ? 1634 GLN B NE2 1 
ATOM 2026  N N   . LYS A 1 263  ? 14.126  -18.175 -17.461  1.00 132.74 ? 1635 LYS B N   1 
ATOM 2027  C CA  . LYS A 1 263  ? 13.652  -17.984 -16.091  1.00 130.79 ? 1635 LYS B CA  1 
ATOM 2028  C C   . LYS A 1 263  ? 13.289  -19.302 -15.391  1.00 128.10 ? 1635 LYS B C   1 
ATOM 2029  O O   . LYS A 1 263  ? 13.497  -19.432 -14.186  1.00 128.47 ? 1635 LYS B O   1 
ATOM 2030  C CB  . LYS A 1 263  ? 12.454  -17.021 -16.071  1.00 132.68 ? 1635 LYS B CB  1 
ATOM 2031  C CG  . LYS A 1 263  ? 12.779  -15.601 -16.521  1.00 132.27 ? 1635 LYS B CG  1 
ATOM 2032  C CD  . LYS A 1 263  ? 11.601  -14.661 -16.315  1.00 133.09 ? 1635 LYS B CD  1 
ATOM 2033  C CE  . LYS A 1 263  ? 11.998  -13.209 -16.528  1.00 132.28 ? 1635 LYS B CE  1 
ATOM 2034  N NZ  . LYS A 1 263  ? 10.893  -12.277 -16.170  1.00 134.22 ? 1635 LYS B NZ  1 
ATOM 2035  N N   . ILE A 1 264  ? 12.762  -20.270 -16.145  1.00 125.32 ? 1636 ILE B N   1 
ATOM 2036  C CA  . ILE A 1 264  ? 12.380  -21.582 -15.596  1.00 123.60 ? 1636 ILE B CA  1 
ATOM 2037  C C   . ILE A 1 264  ? 13.605  -22.377 -15.145  1.00 117.87 ? 1636 ILE B C   1 
ATOM 2038  O O   . ILE A 1 264  ? 13.597  -22.967 -14.065  1.00 116.01 ? 1636 ILE B O   1 
ATOM 2039  C CB  . ILE A 1 264  ? 11.535  -22.399 -16.609  1.00 126.58 ? 1636 ILE B CB  1 
ATOM 2040  C CG1 . ILE A 1 264  ? 10.163  -21.734 -16.790  1.00 131.18 ? 1636 ILE B CG1 1 
ATOM 2041  C CG2 . ILE A 1 264  ? 11.340  -23.847 -16.153  1.00 127.01 ? 1636 ILE B CG2 1 
ATOM 2042  C CD1 . ILE A 1 264  ? 9.436   -22.120 -18.059  1.00 133.91 ? 1636 ILE B CD1 1 
ATOM 2043  N N   . LEU A 1 265  ? 14.641  -22.398 -15.980  1.00 114.76 ? 1637 LEU B N   1 
ATOM 2044  C CA  . LEU A 1 265  ? 15.905  -23.049 -15.627  1.00 112.96 ? 1637 LEU B CA  1 
ATOM 2045  C C   . LEU A 1 265  ? 16.668  -22.294 -14.531  1.00 113.21 ? 1637 LEU B C   1 
ATOM 2046  O O   . LEU A 1 265  ? 17.391  -22.917 -13.753  1.00 113.44 ? 1637 LEU B O   1 
ATOM 2047  C CB  . LEU A 1 265  ? 16.800  -23.230 -16.861  1.00 110.17 ? 1637 LEU B CB  1 
ATOM 2048  C CG  . LEU A 1 265  ? 16.336  -24.191 -17.962  1.00 108.93 ? 1637 LEU B CG  1 
ATOM 2049  C CD1 . LEU A 1 265  ? 17.331  -24.142 -19.107  1.00 107.99 ? 1637 LEU B CD1 1 
ATOM 2050  C CD2 . LEU A 1 265  ? 16.185  -25.624 -17.476  1.00 108.42 ? 1637 LEU B CD2 1 
ATOM 2051  N N   . MET A 1 266  ? 16.510  -20.969 -14.472  1.00 113.24 ? 1638 MET B N   1 
ATOM 2052  C CA  . MET A 1 266  ? 17.110  -20.149 -13.397  1.00 113.17 ? 1638 MET B CA  1 
ATOM 2053  C C   . MET A 1 266  ? 16.577  -20.503 -11.996  1.00 113.58 ? 1638 MET B C   1 
ATOM 2054  O O   . MET A 1 266  ? 17.286  -20.324 -10.999  1.00 114.53 ? 1638 MET B O   1 
ATOM 2055  C CB  . MET A 1 266  ? 16.924  -18.647 -13.680  1.00 114.35 ? 1638 MET B CB  1 
ATOM 2056  C CG  . MET A 1 266  ? 17.936  -18.072 -14.664  1.00 113.62 ? 1638 MET B CG  1 
ATOM 2057  S SD  . MET A 1 266  ? 17.385  -16.568 -15.497  1.00 115.98 ? 1638 MET B SD  1 
ATOM 2058  C CE  . MET A 1 266  ? 17.149  -15.458 -14.113  1.00 117.88 ? 1638 MET B CE  1 
ATOM 2059  N N   . VAL A 1 267  ? 15.338  -20.994 -11.930  1.00 112.80 ? 1639 VAL B N   1 
ATOM 2060  C CA  . VAL A 1 267  ? 14.771  -21.560 -10.696  1.00 112.73 ? 1639 VAL B CA  1 
ATOM 2061  C C   . VAL A 1 267  ? 15.439  -22.904 -10.383  1.00 111.09 ? 1639 VAL B C   1 
ATOM 2062  O O   . VAL A 1 267  ? 15.782  -23.177 -9.236   1.00 111.74 ? 1639 VAL B O   1 
ATOM 2063  C CB  . VAL A 1 267  ? 13.235  -21.735 -10.806  1.00 113.82 ? 1639 VAL B CB  1 
ATOM 2064  C CG1 . VAL A 1 267  ? 12.664  -22.493 -9.616   1.00 115.24 ? 1639 VAL B CG1 1 
ATOM 2065  C CG2 . VAL A 1 267  ? 12.554  -20.379 -10.924  1.00 114.70 ? 1639 VAL B CG2 1 
ATOM 2066  N N   . ARG A 1 268  ? 15.616  -23.729 -11.412  1.00 109.02 ? 1640 ARG B N   1 
ATOM 2067  C CA  . ARG A 1 268  ? 16.277  -25.035 -11.279  1.00 107.92 ? 1640 ARG B CA  1 
ATOM 2068  C C   . ARG A 1 268  ? 17.786  -24.926 -11.022  1.00 105.94 ? 1640 ARG B C   1 
ATOM 2069  O O   . ARG A 1 268  ? 18.379  -25.835 -10.441  1.00 104.75 ? 1640 ARG B O   1 
ATOM 2070  C CB  . ARG A 1 268  ? 16.031  -25.881 -12.531  1.00 107.46 ? 1640 ARG B CB  1 
ATOM 2071  C CG  . ARG A 1 268  ? 14.559  -26.159 -12.807  1.00 109.37 ? 1640 ARG B CG  1 
ATOM 2072  C CD  . ARG A 1 268  ? 14.364  -26.973 -14.076  1.00 108.70 ? 1640 ARG B CD  1 
ATOM 2073  N NE  . ARG A 1 268  ? 12.996  -26.877 -14.589  1.00 110.09 ? 1640 ARG B NE  1 
ATOM 2074  C CZ  . ARG A 1 268  ? 12.489  -27.625 -15.570  1.00 110.55 ? 1640 ARG B CZ  1 
ATOM 2075  N NH1 . ARG A 1 268  ? 13.220  -28.562 -16.175  1.00 109.22 ? 1640 ARG B NH1 1 
ATOM 2076  N NH2 . ARG A 1 268  ? 11.227  -27.437 -15.950  1.00 112.72 ? 1640 ARG B NH2 1 
ATOM 2077  N N   . SER A 1 269  ? 18.394  -23.822 -11.466  1.00 105.45 ? 1641 SER B N   1 
ATOM 2078  C CA  . SER A 1 269  ? 19.819  -23.537 -11.238  1.00 104.85 ? 1641 SER B CA  1 
ATOM 2079  C C   . SER A 1 269  ? 20.186  -23.419 -9.760   1.00 106.59 ? 1641 SER B C   1 
ATOM 2080  O O   . SER A 1 269  ? 21.318  -23.727 -9.385   1.00 106.34 ? 1641 SER B O   1 
ATOM 2081  C CB  . SER A 1 269  ? 20.236  -22.242 -11.949  1.00 104.10 ? 1641 SER B CB  1 
ATOM 2082  O OG  . SER A 1 269  ? 20.109  -22.354 -13.355  1.00 102.64 ? 1641 SER B OG  1 
ATOM 2083  N N   . LEU A 1 270  ? 19.237  -22.953 -8.941   1.00 108.96 ? 1642 LEU B N   1 
ATOM 2084  C CA  . LEU A 1 270  ? 19.415  -22.827 -7.482   1.00 111.00 ? 1642 LEU B CA  1 
ATOM 2085  C C   . LEU A 1 270  ? 19.975  -24.090 -6.819   1.00 111.83 ? 1642 LEU B C   1 
ATOM 2086  O O   . LEU A 1 270  ? 20.883  -23.998 -5.988   1.00 113.08 ? 1642 LEU B O   1 
ATOM 2087  C CB  . LEU A 1 270  ? 18.087  -22.447 -6.795   1.00 112.08 ? 1642 LEU B CB  1 
ATOM 2088  C CG  . LEU A 1 270  ? 17.593  -21.000 -6.940   1.00 111.94 ? 1642 LEU B CG  1 
ATOM 2089  C CD1 . LEU A 1 270  ? 16.108  -20.887 -6.631   1.00 112.95 ? 1642 LEU B CD1 1 
ATOM 2090  C CD2 . LEU A 1 270  ? 18.383  -20.061 -6.039   1.00 113.04 ? 1642 LEU B CD2 1 
ATOM 2091  N N   . VAL A 1 271  ? 19.436  -25.252 -7.197   1.00 111.36 ? 1643 VAL B N   1 
ATOM 2092  C CA  . VAL A 1 271  ? 19.762  -26.526 -6.536   1.00 112.08 ? 1643 VAL B CA  1 
ATOM 2093  C C   . VAL A 1 271  ? 20.469  -27.588 -7.414   1.00 110.35 ? 1643 VAL B C   1 
ATOM 2094  O O   . VAL A 1 271  ? 21.087  -28.507 -6.870   1.00 110.15 ? 1643 VAL B O   1 
ATOM 2095  C CB  . VAL A 1 271  ? 18.491  -27.095 -5.845   1.00 114.12 ? 1643 VAL B CB  1 
ATOM 2096  C CG1 . VAL A 1 271  ? 17.598  -27.865 -6.813   1.00 113.54 ? 1643 VAL B CG1 1 
ATOM 2097  C CG2 . VAL A 1 271  ? 18.860  -27.946 -4.639   1.00 116.02 ? 1643 VAL B CG2 1 
ATOM 2098  N N   . VAL A 1 272  ? 20.384  -27.473 -8.743   1.00 109.49 ? 1644 VAL B N   1 
ATOM 2099  C CA  . VAL A 1 272  ? 21.099  -28.376 -9.667   1.00 108.71 ? 1644 VAL B CA  1 
ATOM 2100  C C   . VAL A 1 272  ? 21.904  -27.555 -10.677  1.00 108.12 ? 1644 VAL B C   1 
ATOM 2101  O O   . VAL A 1 272  ? 21.337  -26.742 -11.408  1.00 107.34 ? 1644 VAL B O   1 
ATOM 2102  C CB  . VAL A 1 272  ? 20.138  -29.312 -10.442  1.00 108.03 ? 1644 VAL B CB  1 
ATOM 2103  C CG1 . VAL A 1 272  ? 20.916  -30.347 -11.249  1.00 106.18 ? 1644 VAL B CG1 1 
ATOM 2104  C CG2 . VAL A 1 272  ? 19.184  -30.021 -9.493   1.00 110.48 ? 1644 VAL B CG2 1 
ATOM 2105  N N   . SER A 1 273  ? 23.218  -27.787 -10.719  1.00 109.36 ? 1645 SER B N   1 
ATOM 2106  C CA  . SER A 1 273  ? 24.114  -27.096 -11.655  1.00 109.01 ? 1645 SER B CA  1 
ATOM 2107  C C   . SER A 1 273  ? 23.997  -27.688 -13.068  1.00 108.16 ? 1645 SER B C   1 
ATOM 2108  O O   . SER A 1 273  ? 23.515  -28.815 -13.229  1.00 107.95 ? 1645 SER B O   1 
ATOM 2109  C CB  . SER A 1 273  ? 25.568  -27.176 -11.164  1.00 109.73 ? 1645 SER B CB  1 
ATOM 2110  O OG  . SER A 1 273  ? 26.061  -28.505 -11.193  1.00 110.96 ? 1645 SER B OG  1 
ATOM 2111  N N   . PRO A 1 274  ? 24.430  -26.928 -14.097  1.00 107.66 ? 1646 PRO B N   1 
ATOM 2112  C CA  . PRO A 1 274  ? 24.413  -27.461 -15.466  1.00 107.17 ? 1646 PRO B CA  1 
ATOM 2113  C C   . PRO A 1 274  ? 25.369  -28.635 -15.711  1.00 107.72 ? 1646 PRO B C   1 
ATOM 2114  O O   . PRO A 1 274  ? 25.067  -29.500 -16.532  1.00 105.66 ? 1646 PRO B O   1 
ATOM 2115  C CB  . PRO A 1 274  ? 24.819  -26.251 -16.323  1.00 105.78 ? 1646 PRO B CB  1 
ATOM 2116  C CG  . PRO A 1 274  ? 25.529  -25.335 -15.390  1.00 106.16 ? 1646 PRO B CG  1 
ATOM 2117  C CD  . PRO A 1 274  ? 24.838  -25.510 -14.076  1.00 107.61 ? 1646 PRO B CD  1 
ATOM 2118  N N   . HIS A 1 275  ? 26.499  -28.658 -15.004  1.00 110.81 ? 1647 HIS B N   1 
ATOM 2119  C CA  . HIS A 1 275  ? 27.521  -29.696 -15.187  1.00 112.53 ? 1647 HIS B CA  1 
ATOM 2120  C C   . HIS A 1 275  ? 27.015  -31.071 -14.761  1.00 111.33 ? 1647 HIS B C   1 
ATOM 2121  O O   . HIS A 1 275  ? 27.337  -32.074 -15.397  1.00 109.48 ? 1647 HIS B O   1 
ATOM 2122  C CB  . HIS A 1 275  ? 28.797  -29.358 -14.404  1.00 118.76 ? 1647 HIS B CB  1 
ATOM 2123  C CG  . HIS A 1 275  ? 29.390  -28.026 -14.750  1.00 123.81 ? 1647 HIS B CG  1 
ATOM 2124  N ND1 . HIS A 1 275  ? 30.111  -27.807 -15.905  1.00 125.71 ? 1647 HIS B ND1 1 
ATOM 2125  C CD2 . HIS A 1 275  ? 29.369  -26.844 -14.089  1.00 126.17 ? 1647 HIS B CD2 1 
ATOM 2126  C CE1 . HIS A 1 275  ? 30.507  -26.547 -15.941  1.00 126.46 ? 1647 HIS B CE1 1 
ATOM 2127  N NE2 . HIS A 1 275  ? 30.070  -25.941 -14.851  1.00 127.12 ? 1647 HIS B NE2 1 
ATOM 2128  N N   . GLU A 1 276  ? 26.234  -31.108 -13.682  1.00 113.21 ? 1648 GLU B N   1 
ATOM 2129  C CA  . GLU A 1 276  ? 25.627  -32.349 -13.188  1.00 115.57 ? 1648 GLU B CA  1 
ATOM 2130  C C   . GLU A 1 276  ? 24.517  -32.864 -14.110  1.00 114.72 ? 1648 GLU B C   1 
ATOM 2131  O O   . GLU A 1 276  ? 24.430  -34.068 -14.359  1.00 115.18 ? 1648 GLU B O   1 
ATOM 2132  C CB  . GLU A 1 276  ? 25.081  -32.156 -11.768  1.00 118.67 ? 1648 GLU B CB  1 
ATOM 2133  C CG  . GLU A 1 276  ? 26.164  -31.935 -10.719  1.00 120.66 ? 1648 GLU B CG  1 
ATOM 2134  C CD  . GLU A 1 276  ? 25.609  -31.616 -9.337   1.00 123.76 ? 1648 GLU B CD  1 
ATOM 2135  O OE1 . GLU A 1 276  ? 26.075  -32.230 -8.355   1.00 125.81 ? 1648 GLU B OE1 1 
ATOM 2136  O OE2 . GLU A 1 276  ? 24.713  -30.752 -9.225   1.00 123.93 ? 1648 GLU B OE2 1 
ATOM 2137  N N   . ASP A 1 277  ? 23.682  -31.952 -14.608  1.00 114.08 ? 1649 ASP B N   1 
ATOM 2138  C CA  . ASP A 1 277  ? 22.559  -32.293 -15.488  1.00 114.32 ? 1649 ASP B CA  1 
ATOM 2139  C C   . ASP A 1 277  ? 22.752  -31.663 -16.875  1.00 112.32 ? 1649 ASP B C   1 
ATOM 2140  O O   . ASP A 1 277  ? 22.118  -30.663 -17.213  1.00 111.81 ? 1649 ASP B O   1 
ATOM 2141  C CB  . ASP A 1 277  ? 21.244  -31.834 -14.835  1.00 116.14 ? 1649 ASP B CB  1 
ATOM 2142  C CG  . ASP A 1 277  ? 20.001  -32.240 -15.629  1.00 116.28 ? 1649 ASP B CG  1 
ATOM 2143  O OD1 . ASP A 1 277  ? 20.025  -33.259 -16.349  1.00 115.93 ? 1649 ASP B OD1 1 
ATOM 2144  O OD2 . ASP A 1 277  ? 18.982  -31.530 -15.519  1.00 116.89 ? 1649 ASP B OD2 1 
ATOM 2145  N N   . MET A 1 278  ? 23.634  -32.263 -17.673  1.00 110.53 ? 1650 MET B N   1 
ATOM 2146  C CA  . MET A 1 278  ? 23.952  -31.741 -19.011  1.00 108.34 ? 1650 MET B CA  1 
ATOM 2147  C C   . MET A 1 278  ? 22.854  -31.986 -20.045  1.00 107.45 ? 1650 MET B C   1 
ATOM 2148  O O   . MET A 1 278  ? 22.693  -31.182 -20.966  1.00 107.21 ? 1650 MET B O   1 
ATOM 2149  C CB  . MET A 1 278  ? 25.282  -32.307 -19.526  1.00 107.07 ? 1650 MET B CB  1 
ATOM 2150  C CG  . MET A 1 278  ? 26.501  -31.790 -18.778  1.00 107.84 ? 1650 MET B CG  1 
ATOM 2151  S SD  . MET A 1 278  ? 27.980  -31.675 -19.803  1.00 106.36 ? 1650 MET B SD  1 
ATOM 2152  C CE  . MET A 1 278  ? 29.086  -30.807 -18.685  1.00 107.43 ? 1650 MET B CE  1 
ATOM 2153  N N   . ARG A 1 279  ? 22.117  -33.090 -19.904  1.00 107.26 ? 1651 ARG B N   1 
ATOM 2154  C CA  . ARG A 1 279  ? 21.031  -33.438 -20.839  1.00 108.29 ? 1651 ARG B CA  1 
ATOM 2155  C C   . ARG A 1 279  ? 19.954  -32.351 -20.967  1.00 107.63 ? 1651 ARG B C   1 
ATOM 2156  O O   . ARG A 1 279  ? 19.414  -32.131 -22.055  1.00 106.83 ? 1651 ARG B O   1 
ATOM 2157  C CB  . ARG A 1 279  ? 20.381  -34.782 -20.463  1.00 111.64 ? 1651 ARG B CB  1 
ATOM 2158  C CG  . ARG A 1 279  ? 19.669  -34.819 -19.113  1.00 115.55 ? 1651 ARG B CG  1 
ATOM 2159  C CD  . ARG A 1 279  ? 18.946  -36.139 -18.895  1.00 119.32 ? 1651 ARG B CD  1 
ATOM 2160  N NE  . ARG A 1 279  ? 17.992  -36.077 -17.786  1.00 122.84 ? 1651 ARG B NE  1 
ATOM 2161  C CZ  . ARG A 1 279  ? 17.203  -37.083 -17.398  1.00 127.06 ? 1651 ARG B CZ  1 
ATOM 2162  N NH1 . ARG A 1 279  ? 17.236  -38.262 -18.021  1.00 128.59 ? 1651 ARG B NH1 1 
ATOM 2163  N NH2 . ARG A 1 279  ? 16.369  -36.912 -16.373  1.00 129.29 ? 1651 ARG B NH2 1 
ATOM 2164  N N   . THR A 1 280  ? 19.661  -31.681 -19.853  1.00 107.23 ? 1652 THR B N   1 
ATOM 2165  C CA  . THR A 1 280  ? 18.645  -30.628 -19.801  1.00 106.33 ? 1652 THR B CA  1 
ATOM 2166  C C   . THR A 1 280  ? 19.130  -29.355 -20.504  1.00 103.63 ? 1652 THR B C   1 
ATOM 2167  O O   . THR A 1 280  ? 18.431  -28.815 -21.362  1.00 102.85 ? 1652 THR B O   1 
ATOM 2168  C CB  . THR A 1 280  ? 18.246  -30.338 -18.334  1.00 106.84 ? 1652 THR B CB  1 
ATOM 2169  O OG1 . THR A 1 280  ? 17.718  -31.536 -17.747  1.00 106.01 ? 1652 THR B OG1 1 
ATOM 2170  C CG2 . THR A 1 280  ? 17.194  -29.229 -18.227  1.00 108.18 ? 1652 THR B CG2 1 
ATOM 2171  N N   . TRP A 1 281  ? 20.324  -28.893 -20.140  1.00 101.78 ? 1653 TRP B N   1 
ATOM 2172  C CA  . TRP A 1 281  ? 20.891  -27.664 -20.712  1.00 100.46 ? 1653 TRP B CA  1 
ATOM 2173  C C   . TRP A 1 281  ? 21.305  -27.812 -22.187  1.00 98.61  ? 1653 TRP B C   1 
ATOM 2174  O O   . TRP A 1 281  ? 21.363  -26.814 -22.911  1.00 97.83  ? 1653 TRP B O   1 
ATOM 2175  C CB  . TRP A 1 281  ? 22.071  -27.165 -19.870  1.00 100.00 ? 1653 TRP B CB  1 
ATOM 2176  C CG  . TRP A 1 281  ? 21.676  -26.664 -18.503  1.00 102.37 ? 1653 TRP B CG  1 
ATOM 2177  C CD1 . TRP A 1 281  ? 21.380  -27.422 -17.409  1.00 104.14 ? 1653 TRP B CD1 1 
ATOM 2178  C CD2 . TRP A 1 281  ? 21.543  -25.296 -18.087  1.00 104.31 ? 1653 TRP B CD2 1 
ATOM 2179  N NE1 . TRP A 1 281  ? 21.073  -26.618 -16.337  1.00 105.63 ? 1653 TRP B NE1 1 
ATOM 2180  C CE2 . TRP A 1 281  ? 21.163  -25.308 -16.725  1.00 105.74 ? 1653 TRP B CE2 1 
ATOM 2181  C CE3 . TRP A 1 281  ? 21.707  -24.060 -18.732  1.00 105.12 ? 1653 TRP B CE3 1 
ATOM 2182  C CZ2 . TRP A 1 281  ? 20.944  -24.134 -15.993  1.00 107.44 ? 1653 TRP B CZ2 1 
ATOM 2183  C CZ3 . TRP A 1 281  ? 21.488  -22.884 -18.001  1.00 106.38 ? 1653 TRP B CZ3 1 
ATOM 2184  C CH2 . TRP A 1 281  ? 21.111  -22.935 -16.645  1.00 107.55 ? 1653 TRP B CH2 1 
ATOM 2185  N N   . LEU A 1 282  ? 21.596  -29.041 -22.620  1.00 97.66  ? 1654 LEU B N   1 
ATOM 2186  C CA  . LEU A 1 282  ? 21.806  -29.343 -24.050  1.00 96.55  ? 1654 LEU B CA  1 
ATOM 2187  C C   . LEU A 1 282  ? 20.498  -29.306 -24.845  1.00 97.54  ? 1654 LEU B C   1 
ATOM 2188  O O   . LEU A 1 282  ? 20.477  -28.846 -25.992  1.00 96.55  ? 1654 LEU B O   1 
ATOM 2189  C CB  . LEU A 1 282  ? 22.483  -30.709 -24.241  1.00 95.40  ? 1654 LEU B CB  1 
ATOM 2190  C CG  . LEU A 1 282  ? 24.000  -30.751 -24.032  1.00 93.56  ? 1654 LEU B CG  1 
ATOM 2191  C CD1 . LEU A 1 282  ? 24.485  -32.181 -23.843  1.00 93.24  ? 1654 LEU B CD1 1 
ATOM 2192  C CD2 . LEU A 1 282  ? 24.725  -30.094 -25.198  1.00 91.85  ? 1654 LEU B CD2 1 
ATOM 2193  N N   . LYS A 1 283  ? 19.425  -29.813 -24.238  1.00 98.93  ? 1655 LYS B N   1 
ATOM 2194  C CA  . LYS A 1 283  ? 18.080  -29.742 -24.820  1.00 99.89  ? 1655 LYS B CA  1 
ATOM 2195  C C   . LYS A 1 283  ? 17.580  -28.288 -24.903  1.00 98.81  ? 1655 LYS B C   1 
ATOM 2196  O O   . LYS A 1 283  ? 16.933  -27.906 -25.880  1.00 99.52  ? 1655 LYS B O   1 
ATOM 2197  C CB  . LYS A 1 283  ? 17.104  -30.623 -24.014  1.00 102.45 ? 1655 LYS B CB  1 
ATOM 2198  C CG  . LYS A 1 283  ? 15.642  -30.601 -24.458  1.00 105.16 ? 1655 LYS B CG  1 
ATOM 2199  C CD  . LYS A 1 283  ? 15.457  -31.011 -25.912  1.00 105.91 ? 1655 LYS B CD  1 
ATOM 2200  C CE  . LYS A 1 283  ? 14.000  -30.916 -26.336  1.00 108.62 ? 1655 LYS B CE  1 
ATOM 2201  N NZ  . LYS A 1 283  ? 13.855  -30.926 -27.819  1.00 109.22 ? 1655 LYS B NZ  1 
ATOM 2202  N N   . TYR A 1 284  ? 17.875  -27.495 -23.874  1.00 96.90  ? 1656 TYR B N   1 
ATOM 2203  C CA  . TYR A 1 284  ? 17.571  -26.056 -23.880  1.00 96.03  ? 1656 TYR B CA  1 
ATOM 2204  C C   . TYR A 1 284  ? 18.394  -25.334 -24.949  1.00 94.95  ? 1656 TYR B C   1 
ATOM 2205  O O   . TYR A 1 284  ? 17.846  -24.566 -25.744  1.00 95.38  ? 1656 TYR B O   1 
ATOM 2206  C CB  . TYR A 1 284  ? 17.804  -25.447 -22.486  1.00 95.27  ? 1656 TYR B CB  1 
ATOM 2207  C CG  . TYR A 1 284  ? 17.991  -23.939 -22.447  1.00 94.35  ? 1656 TYR B CG  1 
ATOM 2208  C CD1 . TYR A 1 284  ? 16.967  -23.072 -22.826  1.00 94.71  ? 1656 TYR B CD1 1 
ATOM 2209  C CD2 . TYR A 1 284  ? 19.197  -23.379 -22.004  1.00 93.42  ? 1656 TYR B CD2 1 
ATOM 2210  C CE1 . TYR A 1 284  ? 17.142  -21.694 -22.781  1.00 94.79  ? 1656 TYR B CE1 1 
ATOM 2211  C CE2 . TYR A 1 284  ? 19.379  -22.004 -21.953  1.00 93.25  ? 1656 TYR B CE2 1 
ATOM 2212  C CZ  . TYR A 1 284  ? 18.352  -21.166 -22.343  1.00 93.93  ? 1656 TYR B CZ  1 
ATOM 2213  O OH  . TYR A 1 284  ? 18.546  -19.808 -22.291  1.00 94.06  ? 1656 TYR B OH  1 
ATOM 2214  N N   . ALA A 1 285  ? 19.701  -25.599 -24.965  1.00 93.75  ? 1657 ALA B N   1 
ATOM 2215  C CA  . ALA A 1 285  ? 20.606  -25.050 -25.985  1.00 93.04  ? 1657 ALA B CA  1 
ATOM 2216  C C   . ALA A 1 285  ? 20.184  -25.443 -27.400  1.00 93.65  ? 1657 ALA B C   1 
ATOM 2217  O O   . ALA A 1 285  ? 20.294  -24.637 -28.323  1.00 93.36  ? 1657 ALA B O   1 
ATOM 2218  C CB  . ALA A 1 285  ? 22.037  -25.497 -25.726  1.00 91.42  ? 1657 ALA B CB  1 
ATOM 2219  N N   . SER A 1 286  ? 19.703  -26.678 -27.554  1.00 95.02  ? 1658 SER B N   1 
ATOM 2220  C CA  . SER A 1 286  ? 19.174  -27.170 -28.830  1.00 96.69  ? 1658 SER B CA  1 
ATOM 2221  C C   . SER A 1 286  ? 17.980  -26.341 -29.309  1.00 99.71  ? 1658 SER B C   1 
ATOM 2222  O O   . SER A 1 286  ? 17.930  -25.944 -30.475  1.00 101.96 ? 1658 SER B O   1 
ATOM 2223  C CB  . SER A 1 286  ? 18.772  -28.648 -28.714  1.00 97.01  ? 1658 SER B CB  1 
ATOM 2224  O OG  . SER A 1 286  ? 18.191  -29.131 -29.915  1.00 97.50  ? 1658 SER B OG  1 
ATOM 2225  N N   . LEU A 1 287  ? 17.036  -26.081 -28.407  1.00 100.85 ? 1659 LEU B N   1 
ATOM 2226  C CA  . LEU A 1 287  ? 15.841  -25.292 -28.733  1.00 103.00 ? 1659 LEU B CA  1 
ATOM 2227  C C   . LEU A 1 287  ? 16.151  -23.825 -29.035  1.00 103.03 ? 1659 LEU B C   1 
ATOM 2228  O O   . LEU A 1 287  ? 15.465  -23.210 -29.856  1.00 104.13 ? 1659 LEU B O   1 
ATOM 2229  C CB  . LEU A 1 287  ? 14.799  -25.391 -27.613  1.00 104.55 ? 1659 LEU B CB  1 
ATOM 2230  C CG  . LEU A 1 287  ? 14.108  -26.753 -27.491  1.00 105.76 ? 1659 LEU B CG  1 
ATOM 2231  C CD1 . LEU A 1 287  ? 13.481  -26.921 -26.116  1.00 105.96 ? 1659 LEU B CD1 1 
ATOM 2232  C CD2 . LEU A 1 287  ? 13.064  -26.943 -28.586  1.00 108.22 ? 1659 LEU B CD2 1 
ATOM 2233  N N   . CYS A 1 288  ? 17.169  -23.272 -28.372  1.00 102.35 ? 1660 CYS B N   1 
ATOM 2234  C CA  . CYS A 1 288  ? 17.654  -21.919 -28.677  1.00 104.11 ? 1660 CYS B CA  1 
ATOM 2235  C C   . CYS A 1 288  ? 18.145  -21.809 -30.124  1.00 107.22 ? 1660 CYS B C   1 
ATOM 2236  O O   . CYS A 1 288  ? 17.913  -20.796 -30.789  1.00 110.80 ? 1660 CYS B O   1 
ATOM 2237  C CB  . CYS A 1 288  ? 18.778  -21.504 -27.722  1.00 101.50 ? 1660 CYS B CB  1 
ATOM 2238  S SG  . CYS A 1 288  ? 18.273  -21.248 -26.008  1.00 101.13 ? 1660 CYS B SG  1 
ATOM 2239  N N   . GLY A 1 289  ? 18.825  -22.855 -30.594  1.00 108.36 ? 1661 GLY B N   1 
ATOM 2240  C CA  . GLY A 1 289  ? 19.283  -22.947 -31.983  1.00 109.43 ? 1661 GLY B CA  1 
ATOM 2241  C C   . GLY A 1 289  ? 18.170  -23.173 -32.995  1.00 111.34 ? 1661 GLY B C   1 
ATOM 2242  O O   . GLY A 1 289  ? 18.207  -22.608 -34.090  1.00 112.62 ? 1661 GLY B O   1 
ATOM 2243  N N   . LYS A 1 290  ? 17.191  -24.003 -32.637  1.00 112.56 ? 1662 LYS B N   1 
ATOM 2244  C CA  . LYS A 1 290  ? 16.025  -24.259 -33.496  1.00 116.38 ? 1662 LYS B CA  1 
ATOM 2245  C C   . LYS A 1 290  ? 15.202  -22.993 -33.748  1.00 117.51 ? 1662 LYS B C   1 
ATOM 2246  O O   . LYS A 1 290  ? 14.840  -22.702 -34.893  1.00 119.43 ? 1662 LYS B O   1 
ATOM 2247  C CB  . LYS A 1 290  ? 15.125  -25.347 -32.893  1.00 119.89 ? 1662 LYS B CB  1 
ATOM 2248  C CG  . LYS A 1 290  ? 15.699  -26.751 -33.000  1.00 121.31 ? 1662 LYS B CG  1 
ATOM 2249  C CD  . LYS A 1 290  ? 14.672  -27.809 -32.629  1.00 123.83 ? 1662 LYS B CD  1 
ATOM 2250  C CE  . LYS A 1 290  ? 15.263  -29.206 -32.730  1.00 123.44 ? 1662 LYS B CE  1 
ATOM 2251  N NZ  . LYS A 1 290  ? 14.209  -30.256 -32.703  1.00 126.67 ? 1662 LYS B NZ  1 
ATOM 2252  N N   . SER A 1 291  ? 14.913  -22.256 -32.676  1.00 115.67 ? 1663 SER B N   1 
ATOM 2253  C CA  . SER A 1 291  ? 14.198  -20.976 -32.763  1.00 115.31 ? 1663 SER B CA  1 
ATOM 2254  C C   . SER A 1 291  ? 15.043  -19.850 -33.380  1.00 113.90 ? 1663 SER B C   1 
ATOM 2255  O O   . SER A 1 291  ? 14.488  -18.882 -33.901  1.00 116.58 ? 1663 SER B O   1 
ATOM 2256  C CB  . SER A 1 291  ? 13.708  -20.549 -31.382  1.00 115.01 ? 1663 SER B CB  1 
ATOM 2257  O OG  . SER A 1 291  ? 14.790  -20.462 -30.478  1.00 114.60 ? 1663 SER B OG  1 
ATOM 2258  N N   . GLY A 1 292  ? 16.369  -19.966 -33.296  1.00 109.93 ? 1664 GLY B N   1 
ATOM 2259  C CA  . GLY A 1 292  ? 17.291  -19.071 -34.003  1.00 109.13 ? 1664 GLY B CA  1 
ATOM 2260  C C   . GLY A 1 292  ? 17.885  -17.946 -33.172  1.00 108.62 ? 1664 GLY B C   1 
ATOM 2261  O O   . GLY A 1 292  ? 18.040  -16.828 -33.663  1.00 109.32 ? 1664 GLY B O   1 
ATOM 2262  N N   . ARG A 1 293  ? 18.214  -18.241 -31.916  1.00 108.12 ? 1665 ARG B N   1 
ATOM 2263  C CA  . ARG A 1 293  ? 18.991  -17.340 -31.070  1.00 108.76 ? 1665 ARG B CA  1 
ATOM 2264  C C   . ARG A 1 293  ? 20.351  -17.981 -30.871  1.00 104.95 ? 1665 ARG B C   1 
ATOM 2265  O O   . ARG A 1 293  ? 20.611  -18.609 -29.841  1.00 104.19 ? 1665 ARG B O   1 
ATOM 2266  C CB  . ARG A 1 293  ? 18.309  -17.123 -29.724  1.00 113.18 ? 1665 ARG B CB  1 
ATOM 2267  C CG  . ARG A 1 293  ? 17.160  -16.136 -29.751  1.00 119.63 ? 1665 ARG B CG  1 
ATOM 2268  C CD  . ARG A 1 293  ? 16.862  -15.678 -28.336  1.00 124.86 ? 1665 ARG B CD  1 
ATOM 2269  N NE  . ARG A 1 293  ? 15.802  -14.680 -28.268  1.00 133.41 ? 1665 ARG B NE  1 
ATOM 2270  C CZ  . ARG A 1 293  ? 15.371  -14.112 -27.141  1.00 141.26 ? 1665 ARG B CZ  1 
ATOM 2271  N NH1 . ARG A 1 293  ? 15.905  -14.437 -25.960  1.00 140.09 ? 1665 ARG B NH1 1 
ATOM 2272  N NH2 . ARG A 1 293  ? 14.394  -13.207 -27.193  1.00 148.55 ? 1665 ARG B NH2 1 
ATOM 2273  N N   . LEU A 1 294  ? 21.211  -17.823 -31.874  1.00 102.52 ? 1666 LEU B N   1 
ATOM 2274  C CA  . LEU A 1 294  ? 22.501  -18.517 -31.914  1.00 97.77  ? 1666 LEU B CA  1 
ATOM 2275  C C   . LEU A 1 294  ? 23.484  -18.001 -30.862  1.00 95.63  ? 1666 LEU B C   1 
ATOM 2276  O O   . LEU A 1 294  ? 24.173  -18.800 -30.226  1.00 93.99  ? 1666 LEU B O   1 
ATOM 2277  C CB  . LEU A 1 294  ? 23.116  -18.440 -33.318  1.00 96.31  ? 1666 LEU B CB  1 
ATOM 2278  C CG  . LEU A 1 294  ? 22.318  -19.114 -34.442  1.00 96.72  ? 1666 LEU B CG  1 
ATOM 2279  C CD1 . LEU A 1 294  ? 22.873  -18.726 -35.806  1.00 97.01  ? 1666 LEU B CD1 1 
ATOM 2280  C CD2 . LEU A 1 294  ? 22.300  -20.628 -34.293  1.00 95.50  ? 1666 LEU B CD2 1 
ATOM 2281  N N   . ALA A 1 295  ? 23.539  -16.681 -30.673  1.00 95.75  ? 1667 ALA B N   1 
ATOM 2282  C CA  . ALA A 1 295  ? 24.425  -16.071 -29.667  1.00 95.43  ? 1667 ALA B CA  1 
ATOM 2283  C C   . ALA A 1 295  ? 24.053  -16.460 -28.226  1.00 94.97  ? 1667 ALA B C   1 
ATOM 2284  O O   . ALA A 1 295  ? 24.917  -16.511 -27.347  1.00 93.06  ? 1667 ALA B O   1 
ATOM 2285  C CB  . ALA A 1 295  ? 24.447  -14.555 -29.821  1.00 96.89  ? 1667 ALA B CB  1 
ATOM 2286  N N   . LEU A 1 296  ? 22.767  -16.722 -27.996  1.00 96.35  ? 1668 LEU B N   1 
ATOM 2287  C CA  . LEU A 1 296  ? 22.287  -17.245 -26.712  1.00 96.85  ? 1668 LEU B CA  1 
ATOM 2288  C C   . LEU A 1 296  ? 22.616  -18.730 -26.583  1.00 95.49  ? 1668 LEU B C   1 
ATOM 2289  O O   . LEU A 1 296  ? 23.127  -19.171 -25.553  1.00 94.10  ? 1668 LEU B O   1 
ATOM 2290  C CB  . LEU A 1 296  ? 20.773  -17.031 -26.580  1.00 98.52  ? 1668 LEU B CB  1 
ATOM 2291  C CG  . LEU A 1 296  ? 20.058  -17.548 -25.325  1.00 98.81  ? 1668 LEU B CG  1 
ATOM 2292  C CD1 . LEU A 1 296  ? 20.725  -17.078 -24.038  1.00 98.31  ? 1668 LEU B CD1 1 
ATOM 2293  C CD2 . LEU A 1 296  ? 18.600  -17.112 -25.364  1.00 100.81 ? 1668 LEU B CD2 1 
ATOM 2294  N N   . ALA A 1 297  ? 22.301  -19.485 -27.637  1.00 95.82  ? 1669 ALA B N   1 
ATOM 2295  C CA  . ALA A 1 297  ? 22.608  -20.919 -27.725  1.00 94.16  ? 1669 ALA B CA  1 
ATOM 2296  C C   . ALA A 1 297  ? 24.096  -21.201 -27.549  1.00 92.12  ? 1669 ALA B C   1 
ATOM 2297  O O   . ALA A 1 297  ? 24.470  -22.167 -26.883  1.00 90.84  ? 1669 ALA B O   1 
ATOM 2298  C CB  . ALA A 1 297  ? 22.133  -21.478 -29.059  1.00 93.98  ? 1669 ALA B CB  1 
ATOM 2299  N N   . HIS A 1 298  ? 24.929  -20.356 -28.158  1.00 91.65  ? 1670 HIS B N   1 
ATOM 2300  C CA  . HIS A 1 298  ? 26.384  -20.446 -28.038  1.00 90.86  ? 1670 HIS B CA  1 
ATOM 2301  C C   . HIS A 1 298  ? 26.805  -20.346 -26.576  1.00 92.03  ? 1670 HIS B C   1 
ATOM 2302  O O   . HIS A 1 298  ? 27.438  -21.261 -26.055  1.00 91.21  ? 1670 HIS B O   1 
ATOM 2303  C CB  . HIS A 1 298  ? 27.064  -19.352 -28.880  1.00 90.25  ? 1670 HIS B CB  1 
ATOM 2304  C CG  . HIS A 1 298  ? 28.553  -19.278 -28.706  1.00 88.23  ? 1670 HIS B CG  1 
ATOM 2305  N ND1 . HIS A 1 298  ? 29.158  -18.346 -27.891  1.00 88.01  ? 1670 HIS B ND1 1 
ATOM 2306  C CD2 . HIS A 1 298  ? 29.555  -20.013 -29.244  1.00 85.95  ? 1670 HIS B CD2 1 
ATOM 2307  C CE1 . HIS A 1 298  ? 30.467  -18.508 -27.933  1.00 86.50  ? 1670 HIS B CE1 1 
ATOM 2308  N NE2 . HIS A 1 298  ? 30.734  -19.517 -28.743  1.00 85.26  ? 1670 HIS B NE2 1 
ATOM 2309  N N   . LYS A 1 299  ? 26.412  -19.254 -25.921  1.00 95.80  ? 1671 LYS B N   1 
ATOM 2310  C CA  . LYS A 1 299  ? 26.794  -18.983 -24.518  1.00 98.19  ? 1671 LYS B CA  1 
ATOM 2311  C C   . LYS A 1 299  ? 26.315  -20.045 -23.516  1.00 95.30  ? 1671 LYS B C   1 
ATOM 2312  O O   . LYS A 1 299  ? 26.929  -20.221 -22.459  1.00 93.39  ? 1671 LYS B O   1 
ATOM 2313  C CB  . LYS A 1 299  ? 26.336  -17.573 -24.093  1.00 103.16 ? 1671 LYS B CB  1 
ATOM 2314  C CG  . LYS A 1 299  ? 27.158  -16.468 -24.746  1.00 106.06 ? 1671 LYS B CG  1 
ATOM 2315  C CD  . LYS A 1 299  ? 26.537  -15.086 -24.615  1.00 109.27 ? 1671 LYS B CD  1 
ATOM 2316  C CE  . LYS A 1 299  ? 27.313  -14.076 -25.451  1.00 110.09 ? 1671 LYS B CE  1 
ATOM 2317  N NZ  . LYS A 1 299  ? 26.829  -12.679 -25.280  1.00 112.46 ? 1671 LYS B NZ  1 
ATOM 2318  N N   . THR A 1 300  ? 25.233  -20.747 -23.860  1.00 93.87  ? 1672 THR B N   1 
ATOM 2319  C CA  . THR A 1 300  ? 24.789  -21.935 -23.120  1.00 92.65  ? 1672 THR B CA  1 
ATOM 2320  C C   . THR A 1 300  ? 25.849  -23.046 -23.190  1.00 90.04  ? 1672 THR B C   1 
ATOM 2321  O O   . THR A 1 300  ? 26.253  -23.597 -22.165  1.00 89.44  ? 1672 THR B O   1 
ATOM 2322  C CB  . THR A 1 300  ? 23.447  -22.483 -23.672  1.00 93.40  ? 1672 THR B CB  1 
ATOM 2323  O OG1 . THR A 1 300  ? 22.561  -21.399 -23.985  1.00 95.13  ? 1672 THR B OG1 1 
ATOM 2324  C CG2 . THR A 1 300  ? 22.775  -23.409 -22.664  1.00 93.52  ? 1672 THR B CG2 1 
ATOM 2325  N N   . LEU A 1 301  ? 26.297  -23.349 -24.408  1.00 88.02  ? 1673 LEU B N   1 
ATOM 2326  C CA  . LEU A 1 301  ? 27.281  -24.414 -24.653  1.00 85.01  ? 1673 LEU B CA  1 
ATOM 2327  C C   . LEU A 1 301  ? 28.689  -24.098 -24.129  1.00 84.44  ? 1673 LEU B C   1 
ATOM 2328  O O   . LEU A 1 301  ? 29.429  -25.020 -23.781  1.00 83.54  ? 1673 LEU B O   1 
ATOM 2329  C CB  . LEU A 1 301  ? 27.345  -24.747 -26.149  1.00 82.55  ? 1673 LEU B CB  1 
ATOM 2330  C CG  . LEU A 1 301  ? 26.061  -25.285 -26.788  1.00 82.33  ? 1673 LEU B CG  1 
ATOM 2331  C CD1 . LEU A 1 301  ? 26.190  -25.303 -28.301  1.00 81.41  ? 1673 LEU B CD1 1 
ATOM 2332  C CD2 . LEU A 1 301  ? 25.720  -26.673 -26.274  1.00 82.47  ? 1673 LEU B CD2 1 
ATOM 2333  N N   . VAL A 1 302  ? 29.049  -22.812 -24.070  1.00 84.94  ? 1674 VAL B N   1 
ATOM 2334  C CA  . VAL A 1 302  ? 30.355  -22.381 -23.547  1.00 85.04  ? 1674 VAL B CA  1 
ATOM 2335  C C   . VAL A 1 302  ? 30.470  -22.808 -22.083  1.00 87.54  ? 1674 VAL B C   1 
ATOM 2336  O O   . VAL A 1 302  ? 31.486  -23.372 -21.671  1.00 87.35  ? 1674 VAL B O   1 
ATOM 2337  C CB  . VAL A 1 302  ? 30.561  -20.846 -23.660  1.00 84.86  ? 1674 VAL B CB  1 
ATOM 2338  C CG1 . VAL A 1 302  ? 31.884  -20.412 -23.032  1.00 84.79  ? 1674 VAL B CG1 1 
ATOM 2339  C CG2 . VAL A 1 302  ? 30.521  -20.389 -25.114  1.00 84.13  ? 1674 VAL B CG2 1 
ATOM 2340  N N   . LEU A 1 303  ? 29.416  -22.529 -21.316  1.00 90.79  ? 1675 LEU B N   1 
ATOM 2341  C CA  . LEU A 1 303  ? 29.327  -22.912 -19.901  1.00 93.49  ? 1675 LEU B CA  1 
ATOM 2342  C C   . LEU A 1 303  ? 29.454  -24.426 -19.698  1.00 94.08  ? 1675 LEU B C   1 
ATOM 2343  O O   . LEU A 1 303  ? 30.144  -24.880 -18.780  1.00 93.91  ? 1675 LEU B O   1 
ATOM 2344  C CB  . LEU A 1 303  ? 28.001  -22.410 -19.305  1.00 94.60  ? 1675 LEU B CB  1 
ATOM 2345  C CG  . LEU A 1 303  ? 27.684  -22.682 -17.831  1.00 95.96  ? 1675 LEU B CG  1 
ATOM 2346  C CD1 . LEU A 1 303  ? 28.746  -22.106 -16.901  1.00 96.97  ? 1675 LEU B CD1 1 
ATOM 2347  C CD2 . LEU A 1 303  ? 26.314  -22.111 -17.495  1.00 96.99  ? 1675 LEU B CD2 1 
ATOM 2348  N N   . LEU A 1 304  ? 28.789  -25.190 -20.564  1.00 94.93  ? 1676 LEU B N   1 
ATOM 2349  C CA  . LEU A 1 304  ? 28.813  -26.656 -20.503  1.00 95.81  ? 1676 LEU B CA  1 
ATOM 2350  C C   . LEU A 1 304  ? 30.204  -27.238 -20.774  1.00 95.24  ? 1676 LEU B C   1 
ATOM 2351  O O   . LEU A 1 304  ? 30.636  -28.157 -20.073  1.00 95.41  ? 1676 LEU B O   1 
ATOM 2352  C CB  . LEU A 1 304  ? 27.783  -27.252 -21.472  1.00 95.56  ? 1676 LEU B CB  1 
ATOM 2353  C CG  . LEU A 1 304  ? 26.331  -27.112 -20.999  1.00 96.71  ? 1676 LEU B CG  1 
ATOM 2354  C CD1 . LEU A 1 304  ? 25.350  -27.109 -22.163  1.00 96.88  ? 1676 LEU B CD1 1 
ATOM 2355  C CD2 . LEU A 1 304  ? 25.983  -28.211 -20.005  1.00 97.61  ? 1676 LEU B CD2 1 
ATOM 2356  N N   . LEU A 1 305  ? 30.892  -26.701 -21.783  1.00 94.38  ? 1677 LEU B N   1 
ATOM 2357  C CA  . LEU A 1 305  ? 32.275  -27.096 -22.086  1.00 94.24  ? 1677 LEU B CA  1 
ATOM 2358  C C   . LEU A 1 305  ? 33.252  -26.716 -20.977  1.00 98.72  ? 1677 LEU B C   1 
ATOM 2359  O O   . LEU A 1 305  ? 34.247  -27.413 -20.767  1.00 100.63 ? 1677 LEU B O   1 
ATOM 2360  C CB  . LEU A 1 305  ? 32.756  -26.466 -23.400  1.00 91.34  ? 1677 LEU B CB  1 
ATOM 2361  C CG  . LEU A 1 305  ? 32.107  -26.950 -24.701  1.00 89.68  ? 1677 LEU B CG  1 
ATOM 2362  C CD1 . LEU A 1 305  ? 32.463  -26.024 -25.852  1.00 88.59  ? 1677 LEU B CD1 1 
ATOM 2363  C CD2 . LEU A 1 305  ? 32.510  -28.381 -25.030  1.00 88.67  ? 1677 LEU B CD2 1 
ATOM 2364  N N   . GLY A 1 306  ? 32.969  -25.610 -20.285  1.00 103.53 ? 1678 GLY B N   1 
ATOM 2365  C CA  . GLY A 1 306  ? 33.867  -25.050 -19.269  1.00 106.33 ? 1678 GLY B CA  1 
ATOM 2366  C C   . GLY A 1 306  ? 34.954  -24.146 -19.839  1.00 106.51 ? 1678 GLY B C   1 
ATOM 2367  O O   . GLY A 1 306  ? 35.796  -23.650 -19.093  1.00 107.66 ? 1678 GLY B O   1 
ATOM 2368  N N   . VAL A 1 307  ? 34.909  -23.910 -21.151  1.00 98.74  ? 1679 VAL B N   1 
ATOM 2369  C CA  . VAL A 1 307  ? 35.946  -23.190 -21.901  1.00 99.00  ? 1679 VAL B CA  1 
ATOM 2370  C C   . VAL A 1 307  ? 35.362  -22.721 -23.237  1.00 99.78  ? 1679 VAL B C   1 
ATOM 2371  O O   . VAL A 1 307  ? 34.292  -23.180 -23.650  1.00 104.04 ? 1679 VAL B O   1 
ATOM 2372  C CB  . VAL A 1 307  ? 37.195  -24.075 -22.205  1.00 98.43  ? 1679 VAL B CB  1 
ATOM 2373  C CG1 . VAL A 1 307  ? 38.217  -24.021 -21.076  1.00 102.86 ? 1679 VAL B CG1 1 
ATOM 2374  C CG2 . VAL A 1 307  ? 36.808  -25.519 -22.523  1.00 96.69  ? 1679 VAL B CG2 1 
ATOM 2375  N N   . ASP A 1 308  ? 36.066  -21.797 -23.890  1.00 100.96 ? 1680 ASP B N   1 
ATOM 2376  C CA  . ASP A 1 308  ? 35.844  -21.432 -25.307  1.00 105.02 ? 1680 ASP B CA  1 
ATOM 2377  C C   . ASP A 1 308  ? 34.507  -20.767 -25.662  1.00 121.09 ? 1680 ASP B C   1 
ATOM 2378  O O   . ASP A 1 308  ? 33.544  -21.452 -26.024  1.00 134.96 ? 1680 ASP B O   1 
ATOM 2379  C CB  . ASP A 1 308  ? 36.077  -22.647 -26.243  1.00 96.50  ? 1680 ASP B CB  1 
ATOM 2380  C CG  . ASP A 1 308  ? 35.872  -22.312 -27.735  1.00 84.71  ? 1680 ASP B CG  1 
ATOM 2381  O OD1 . ASP A 1 308  ? 36.413  -21.290 -28.216  1.00 78.46  ? 1680 ASP B OD1 1 
ATOM 2382  O OD2 . ASP A 1 308  ? 35.164  -23.086 -28.418  1.00 77.45  ? 1680 ASP B OD2 1 
ATOM 2383  N N   . PRO A 1 309  ? 34.446  -19.431 -25.530  1.00 128.99 ? 1681 PRO B N   1 
ATOM 2384  C CA  . PRO A 1 309  ? 33.809  -18.656 -26.587  1.00 128.92 ? 1681 PRO B CA  1 
ATOM 2385  C C   . PRO A 1 309  ? 34.919  -18.452 -27.614  1.00 131.12 ? 1681 PRO B C   1 
ATOM 2386  O O   . PRO A 1 309  ? 36.081  -18.353 -27.211  1.00 144.26 ? 1681 PRO B O   1 
ATOM 2387  C CB  . PRO A 1 309  ? 33.429  -17.350 -25.891  1.00 128.58 ? 1681 PRO B CB  1 
ATOM 2388  C CG  . PRO A 1 309  ? 34.438  -17.201 -24.806  1.00 132.72 ? 1681 PRO B CG  1 
ATOM 2389  C CD  . PRO A 1 309  ? 34.830  -18.593 -24.380  1.00 132.22 ? 1681 PRO B CD  1 
ATOM 2390  N N   . SER A 1 310  ? 34.601  -18.425 -28.906  1.00 119.76 ? 1682 SER B N   1 
ATOM 2391  C CA  . SER A 1 310  ? 35.644  -18.445 -29.953  1.00 117.97 ? 1682 SER B CA  1 
ATOM 2392  C C   . SER A 1 310  ? 36.729  -17.368 -29.757  1.00 114.66 ? 1682 SER B C   1 
ATOM 2393  O O   . SER A 1 310  ? 36.723  -16.323 -30.409  1.00 114.99 ? 1682 SER B O   1 
ATOM 2394  C CB  . SER A 1 310  ? 35.015  -18.360 -31.347  1.00 124.40 ? 1682 SER B CB  1 
ATOM 2395  O OG  . SER A 1 310  ? 34.393  -19.591 -31.682  1.00 129.26 ? 1682 SER B OG  1 
ATOM 2396  N N   . ARG A 1 311  ? 37.652  -17.663 -28.840  1.00 112.28 ? 1683 ARG B N   1 
ATOM 2397  C CA  . ARG A 1 311  ? 38.727  -16.759 -28.420  1.00 112.88 ? 1683 ARG B CA  1 
ATOM 2398  C C   . ARG A 1 311  ? 40.055  -17.362 -28.862  1.00 111.10 ? 1683 ARG B C   1 
ATOM 2399  O O   . ARG A 1 311  ? 40.801  -16.742 -29.623  1.00 109.54 ? 1683 ARG B O   1 
ATOM 2400  C CB  . ARG A 1 311  ? 38.706  -16.561 -26.896  1.00 115.59 ? 1683 ARG B CB  1 
ATOM 2401  C CG  . ARG A 1 311  ? 37.692  -15.537 -26.397  1.00 118.73 ? 1683 ARG B CG  1 
ATOM 2402  C CD  . ARG A 1 311  ? 37.660  -15.467 -24.872  1.00 122.95 ? 1683 ARG B CD  1 
ATOM 2403  N NE  . ARG A 1 311  ? 38.718  -14.626 -24.298  1.00 127.67 ? 1683 ARG B NE  1 
ATOM 2404  C CZ  . ARG A 1 311  ? 39.059  -14.587 -23.005  1.00 130.46 ? 1683 ARG B CZ  1 
ATOM 2405  N NH1 . ARG A 1 311  ? 38.443  -15.349 -22.098  1.00 133.27 ? 1683 ARG B NH1 1 
ATOM 2406  N NH2 . ARG A 1 311  ? 40.040  -13.777 -22.606  1.00 130.87 ? 1683 ARG B NH2 1 
ATOM 2407  N N   . GLN A 1 312  ? 40.340  -18.571 -28.373  1.00 111.66 ? 1684 GLN B N   1 
ATOM 2408  C CA  . GLN A 1 312  ? 41.412  -19.410 -28.911  1.00 108.21 ? 1684 GLN B CA  1 
ATOM 2409  C C   . GLN A 1 312  ? 40.838  -20.112 -30.134  1.00 96.74  ? 1684 GLN B C   1 
ATOM 2410  O O   . GLN A 1 312  ? 40.478  -21.286 -30.094  1.00 95.94  ? 1684 GLN B O   1 
ATOM 2411  C CB  . GLN A 1 312  ? 41.921  -20.403 -27.860  1.00 114.84 ? 1684 GLN B CB  1 
ATOM 2412  C CG  . GLN A 1 312  ? 42.596  -19.715 -26.678  1.00 125.99 ? 1684 GLN B CG  1 
ATOM 2413  C CD  . GLN A 1 312  ? 43.486  -20.638 -25.864  1.00 128.32 ? 1684 GLN B CD  1 
ATOM 2414  O OE1 . GLN A 1 312  ? 43.196  -21.825 -25.703  1.00 134.66 ? 1684 GLN B OE1 1 
ATOM 2415  N NE2 . GLN A 1 312  ? 44.575  -20.089 -25.335  1.00 122.39 ? 1684 GLN B NE2 1 
ATOM 2416  N N   . LEU A 1 313  ? 40.760  -19.351 -31.220  1.00 90.15  ? 1685 LEU B N   1 
ATOM 2417  C CA  . LEU A 1 313  ? 39.967  -19.710 -32.388  1.00 84.74  ? 1685 LEU B CA  1 
ATOM 2418  C C   . LEU A 1 313  ? 40.700  -20.690 -33.295  1.00 79.76  ? 1685 LEU B C   1 
ATOM 2419  O O   . LEU A 1 313  ? 40.094  -21.619 -33.815  1.00 76.24  ? 1685 LEU B O   1 
ATOM 2420  C CB  . LEU A 1 313  ? 39.581  -18.439 -33.156  1.00 88.07  ? 1685 LEU B CB  1 
ATOM 2421  C CG  . LEU A 1 313  ? 38.291  -18.496 -33.989  1.00 88.94  ? 1685 LEU B CG  1 
ATOM 2422  C CD1 . LEU A 1 313  ? 37.607  -17.136 -34.026  1.00 87.70  ? 1685 LEU B CD1 1 
ATOM 2423  C CD2 . LEU A 1 313  ? 38.551  -19.002 -35.405  1.00 91.97  ? 1685 LEU B CD2 1 
ATOM 2424  N N   . ASP A 1 314  ? 41.999  -20.474 -33.485  1.00 81.56  ? 1686 ASP B N   1 
ATOM 2425  C CA  . ASP A 1 314  ? 42.845  -21.400 -34.251  1.00 80.35  ? 1686 ASP B CA  1 
ATOM 2426  C C   . ASP A 1 314  ? 43.038  -22.771 -33.583  1.00 77.08  ? 1686 ASP B C   1 
ATOM 2427  O O   . ASP A 1 314  ? 43.339  -23.743 -34.271  1.00 76.09  ? 1686 ASP B O   1 
ATOM 2428  C CB  . ASP A 1 314  ? 44.224  -20.774 -34.536  1.00 83.60  ? 1686 ASP B CB  1 
ATOM 2429  C CG  . ASP A 1 314  ? 44.177  -19.688 -35.604  1.00 85.68  ? 1686 ASP B CG  1 
ATOM 2430  O OD1 . ASP A 1 314  ? 43.353  -19.787 -36.542  1.00 88.09  ? 1686 ASP B OD1 1 
ATOM 2431  O OD2 . ASP A 1 314  ? 44.987  -18.739 -35.512  1.00 85.81  ? 1686 ASP B OD2 1 
ATOM 2432  N N   . HIS A 1 315  ? 42.878  -22.851 -32.261  1.00 75.12  ? 1687 HIS B N   1 
ATOM 2433  C CA  . HIS A 1 315  ? 43.029  -24.122 -31.540  1.00 72.20  ? 1687 HIS B CA  1 
ATOM 2434  C C   . HIS A 1 315  ? 41.891  -25.120 -31.819  1.00 69.46  ? 1687 HIS B C   1 
ATOM 2435  O O   . HIS A 1 315  ? 40.763  -24.717 -32.108  1.00 67.18  ? 1687 HIS B O   1 
ATOM 2436  C CB  . HIS A 1 315  ? 43.116  -23.885 -30.033  1.00 72.73  ? 1687 HIS B CB  1 
ATOM 2437  C CG  . HIS A 1 315  ? 44.396  -23.255 -29.598  1.00 73.36  ? 1687 HIS B CG  1 
ATOM 2438  N ND1 . HIS A 1 315  ? 45.419  -23.976 -29.024  1.00 74.94  ? 1687 HIS B ND1 1 
ATOM 2439  C CD2 . HIS A 1 315  ? 44.824  -21.974 -29.660  1.00 74.76  ? 1687 HIS B CD2 1 
ATOM 2440  C CE1 . HIS A 1 315  ? 46.423  -23.165 -28.743  1.00 77.40  ? 1687 HIS B CE1 1 
ATOM 2441  N NE2 . HIS A 1 315  ? 46.087  -21.944 -29.119  1.00 78.18  ? 1687 HIS B NE2 1 
ATOM 2442  N N   . PRO A 1 316  ? 42.193  -26.428 -31.730  1.00 69.46  ? 1688 PRO B N   1 
ATOM 2443  C CA  . PRO A 1 316  ? 41.202  -27.507 -31.745  1.00 68.35  ? 1688 PRO B CA  1 
ATOM 2444  C C   . PRO A 1 316  ? 40.129  -27.390 -30.670  1.00 70.12  ? 1688 PRO B C   1 
ATOM 2445  O O   . PRO A 1 316  ? 40.368  -26.790 -29.623  1.00 74.44  ? 1688 PRO B O   1 
ATOM 2446  C CB  . PRO A 1 316  ? 42.045  -28.743 -31.443  1.00 68.84  ? 1688 PRO B CB  1 
ATOM 2447  C CG  . PRO A 1 316  ? 43.363  -28.434 -32.029  1.00 70.44  ? 1688 PRO B CG  1 
ATOM 2448  C CD  . PRO A 1 316  ? 43.563  -26.959 -31.864  1.00 71.11  ? 1688 PRO B CD  1 
ATOM 2449  N N   . LEU A 1 317  ? 38.968  -27.988 -30.930  1.00 68.74  ? 1689 LEU B N   1 
ATOM 2450  C CA  . LEU A 1 317  ? 37.883  -28.051 -29.945  1.00 68.84  ? 1689 LEU B CA  1 
ATOM 2451  C C   . LEU A 1 317  ? 38.224  -29.051 -28.839  1.00 70.72  ? 1689 LEU B C   1 
ATOM 2452  O O   . LEU A 1 317  ? 38.885  -30.055 -29.107  1.00 69.19  ? 1689 LEU B O   1 
ATOM 2453  C CB  . LEU A 1 317  ? 36.568  -28.464 -30.609  1.00 66.35  ? 1689 LEU B CB  1 
ATOM 2454  C CG  . LEU A 1 317  ? 35.911  -27.413 -31.504  1.00 65.96  ? 1689 LEU B CG  1 
ATOM 2455  C CD1 . LEU A 1 317  ? 34.980  -28.064 -32.517  1.00 65.55  ? 1689 LEU B CD1 1 
ATOM 2456  C CD2 . LEU A 1 317  ? 35.162  -26.381 -30.672  1.00 67.62  ? 1689 LEU B CD2 1 
ATOM 2457  N N   . PRO A 1 318  ? 37.768  -28.789 -27.596  1.00 75.01  ? 1690 PRO B N   1 
ATOM 2458  C CA  . PRO A 1 318  ? 37.990  -29.753 -26.527  1.00 78.44  ? 1690 PRO B CA  1 
ATOM 2459  C C   . PRO A 1 318  ? 36.994  -30.914 -26.606  1.00 79.12  ? 1690 PRO B C   1 
ATOM 2460  O O   . PRO A 1 318  ? 35.779  -30.696 -26.654  1.00 77.45  ? 1690 PRO B O   1 
ATOM 2461  C CB  . PRO A 1 318  ? 37.798  -28.920 -25.257  1.00 81.31  ? 1690 PRO B CB  1 
ATOM 2462  C CG  . PRO A 1 318  ? 36.829  -27.868 -25.647  1.00 80.72  ? 1690 PRO B CG  1 
ATOM 2463  C CD  . PRO A 1 318  ? 37.029  -27.605 -27.116  1.00 77.58  ? 1690 PRO B CD  1 
ATOM 2464  N N   . THR A 1 319  ? 37.534  -32.131 -26.639  1.00 82.60  ? 1691 THR B N   1 
ATOM 2465  C CA  . THR A 1 319  ? 36.757  -33.371 -26.709  1.00 84.07  ? 1691 THR B CA  1 
ATOM 2466  C C   . THR A 1 319  ? 36.123  -33.766 -25.365  1.00 88.13  ? 1691 THR B C   1 
ATOM 2467  O O   . THR A 1 319  ? 35.121  -34.480 -25.346  1.00 90.74  ? 1691 THR B O   1 
ATOM 2468  C CB  . THR A 1 319  ? 37.657  -34.532 -27.181  1.00 85.80  ? 1691 THR B CB  1 
ATOM 2469  O OG1 . THR A 1 319  ? 38.387  -34.125 -28.343  1.00 85.27  ? 1691 THR B OG1 1 
ATOM 2470  C CG2 . THR A 1 319  ? 36.844  -35.766 -27.523  1.00 87.67  ? 1691 THR B CG2 1 
ATOM 2471  N N   . VAL A 1 320  ? 36.718  -33.308 -24.259  1.00 89.33  ? 1692 VAL B N   1 
ATOM 2472  C CA  . VAL A 1 320  ? 36.259  -33.574 -22.873  1.00 89.73  ? 1692 VAL B CA  1 
ATOM 2473  C C   . VAL A 1 320  ? 34.828  -34.136 -22.706  1.00 86.47  ? 1692 VAL B C   1 
ATOM 2474  O O   . VAL A 1 320  ? 34.645  -35.157 -22.042  1.00 86.83  ? 1692 VAL B O   1 
ATOM 2475  C CB  . VAL A 1 320  ? 36.438  -32.321 -21.955  1.00 94.45  ? 1692 VAL B CB  1 
ATOM 2476  C CG1 . VAL A 1 320  ? 37.910  -32.089 -21.614  1.00 94.69  ? 1692 VAL B CG1 1 
ATOM 2477  C CG2 . VAL A 1 320  ? 35.834  -31.059 -22.572  1.00 95.41  ? 1692 VAL B CG2 1 
ATOM 2478  N N   . HIS A 1 321  ? 33.839  -33.484 -23.324  1.00 82.35  ? 1693 HIS B N   1 
ATOM 2479  C CA  . HIS A 1 321  ? 32.434  -33.892 -23.259  1.00 80.89  ? 1693 HIS B CA  1 
ATOM 2480  C C   . HIS A 1 321  ? 31.916  -34.056 -24.695  1.00 78.47  ? 1693 HIS B C   1 
ATOM 2481  O O   . HIS A 1 321  ? 31.363  -33.113 -25.262  1.00 77.72  ? 1693 HIS B O   1 
ATOM 2482  C CB  . HIS A 1 321  ? 31.604  -32.844 -22.507  1.00 82.05  ? 1693 HIS B CB  1 
ATOM 2483  C CG  . HIS A 1 321  ? 32.096  -32.554 -21.124  1.00 84.21  ? 1693 HIS B CG  1 
ATOM 2484  N ND1 . HIS A 1 321  ? 31.859  -33.392 -20.056  1.00 85.45  ? 1693 HIS B ND1 1 
ATOM 2485  C CD2 . HIS A 1 321  ? 32.807  -31.511 -20.633  1.00 85.51  ? 1693 HIS B CD2 1 
ATOM 2486  C CE1 . HIS A 1 321  ? 32.408  -32.881 -18.968  1.00 88.59  ? 1693 HIS B CE1 1 
ATOM 2487  N NE2 . HIS A 1 321  ? 32.989  -31.739 -19.292  1.00 88.57  ? 1693 HIS B NE2 1 
ATOM 2488  N N   . PRO A 1 322  ? 32.104  -35.251 -25.296  1.00 79.42  ? 1694 PRO B N   1 
ATOM 2489  C CA  . PRO A 1 322  ? 31.817  -35.492 -26.726  1.00 76.73  ? 1694 PRO B CA  1 
ATOM 2490  C C   . PRO A 1 322  ? 30.449  -35.023 -27.222  1.00 76.13  ? 1694 PRO B C   1 
ATOM 2491  O O   . PRO A 1 322  ? 30.333  -34.562 -28.359  1.00 75.39  ? 1694 PRO B O   1 
ATOM 2492  C CB  . PRO A 1 322  ? 31.924  -37.013 -26.852  1.00 76.92  ? 1694 PRO B CB  1 
ATOM 2493  C CG  . PRO A 1 322  ? 32.891  -37.400 -25.794  1.00 81.61  ? 1694 PRO B CG  1 
ATOM 2494  C CD  . PRO A 1 322  ? 32.645  -36.461 -24.647  1.00 83.26  ? 1694 PRO B CD  1 
ATOM 2495  N N   . GLN A 1 323  ? 29.432  -35.148 -26.374  1.00 78.31  ? 1695 GLN B N   1 
ATOM 2496  C CA  . GLN A 1 323  ? 28.077  -34.721 -26.720  1.00 78.06  ? 1695 GLN B CA  1 
ATOM 2497  C C   . GLN A 1 323  ? 27.988  -33.201 -26.898  1.00 75.30  ? 1695 GLN B C   1 
ATOM 2498  O O   . GLN A 1 323  ? 27.322  -32.716 -27.817  1.00 71.86  ? 1695 GLN B O   1 
ATOM 2499  C CB  . GLN A 1 323  ? 27.079  -35.177 -25.644  1.00 83.01  ? 1695 GLN B CB  1 
ATOM 2500  C CG  . GLN A 1 323  ? 25.685  -35.466 -26.176  1.00 83.25  ? 1695 GLN B CG  1 
ATOM 2501  C CD  . GLN A 1 323  ? 25.637  -36.692 -27.071  1.00 83.72  ? 1695 GLN B CD  1 
ATOM 2502  O OE1 . GLN A 1 323  ? 25.000  -36.678 -28.125  1.00 89.98  ? 1695 GLN B OE1 1 
ATOM 2503  N NE2 . GLN A 1 323  ? 26.318  -37.758 -26.660  1.00 82.69  ? 1695 GLN B NE2 1 
ATOM 2504  N N   . VAL A 1 324  ? 28.679  -32.467 -26.025  1.00 75.09  ? 1696 VAL B N   1 
ATOM 2505  C CA  . VAL A 1 324  ? 28.620  -31.001 -25.994  1.00 74.09  ? 1696 VAL B CA  1 
ATOM 2506  C C   . VAL A 1 324  ? 29.380  -30.387 -27.168  1.00 71.71  ? 1696 VAL B C   1 
ATOM 2507  O O   . VAL A 1 324  ? 28.911  -29.416 -27.763  1.00 70.73  ? 1696 VAL B O   1 
ATOM 2508  C CB  . VAL A 1 324  ? 29.176  -30.426 -24.667  1.00 76.81  ? 1696 VAL B CB  1 
ATOM 2509  C CG1 . VAL A 1 324  ? 29.089  -28.903 -24.641  1.00 77.69  ? 1696 VAL B CG1 1 
ATOM 2510  C CG2 . VAL A 1 324  ? 28.422  -30.991 -23.470  1.00 79.79  ? 1696 VAL B CG2 1 
ATOM 2511  N N   . THR A 1 325  ? 30.554  -30.936 -27.484  1.00 71.08  ? 1697 THR B N   1 
ATOM 2512  C CA  . THR A 1 325  ? 31.336  -30.483 -28.640  1.00 69.47  ? 1697 THR B CA  1 
ATOM 2513  C C   . THR A 1 325  ? 30.491  -30.548 -29.909  1.00 66.66  ? 1697 THR B C   1 
ATOM 2514  O O   . THR A 1 325  ? 30.368  -29.549 -30.618  1.00 66.54  ? 1697 THR B O   1 
ATOM 2515  C CB  . THR A 1 325  ? 32.621  -31.316 -28.838  1.00 69.62  ? 1697 THR B CB  1 
ATOM 2516  O OG1 . THR A 1 325  ? 33.327  -31.422 -27.594  1.00 73.06  ? 1697 THR B OG1 1 
ATOM 2517  C CG2 . THR A 1 325  ? 33.535  -30.665 -29.875  1.00 68.20  ? 1697 THR B CG2 1 
ATOM 2518  N N   . TYR A 1 326  ? 29.884  -31.712 -30.155  1.00 63.98  ? 1698 TYR B N   1 
ATOM 2519  C CA  . TYR A 1 326  ? 29.016  -31.931 -31.324  1.00 60.82  ? 1698 TYR B CA  1 
ATOM 2520  C C   . TYR A 1 326  ? 27.899  -30.887 -31.478  1.00 59.94  ? 1698 TYR B C   1 
ATOM 2521  O O   . TYR A 1 326  ? 27.528  -30.549 -32.600  1.00 58.58  ? 1698 TYR B O   1 
ATOM 2522  C CB  . TYR A 1 326  ? 28.412  -33.343 -31.287  1.00 60.31  ? 1698 TYR B CB  1 
ATOM 2523  C CG  . TYR A 1 326  ? 27.467  -33.652 -32.437  1.00 58.15  ? 1698 TYR B CG  1 
ATOM 2524  C CD1 . TYR A 1 326  ? 27.955  -33.985 -33.700  1.00 56.83  ? 1698 TYR B CD1 1 
ATOM 2525  C CD2 . TYR A 1 326  ? 26.081  -33.608 -32.260  1.00 58.43  ? 1698 TYR B CD2 1 
ATOM 2526  C CE1 . TYR A 1 326  ? 27.092  -34.268 -34.753  1.00 56.33  ? 1698 TYR B CE1 1 
ATOM 2527  C CE2 . TYR A 1 326  ? 25.210  -33.884 -33.306  1.00 57.71  ? 1698 TYR B CE2 1 
ATOM 2528  C CZ  . TYR A 1 326  ? 25.716  -34.216 -34.549  1.00 56.94  ? 1698 TYR B CZ  1 
ATOM 2529  O OH  . TYR A 1 326  ? 24.843  -34.488 -35.578  1.00 57.26  ? 1698 TYR B OH  1 
ATOM 2530  N N   . ALA A 1 327  ? 27.360  -30.393 -30.365  1.00 61.51  ? 1699 ALA B N   1 
ATOM 2531  C CA  . ALA A 1 327  ? 26.351  -29.331 -30.408  1.00 62.20  ? 1699 ALA B CA  1 
ATOM 2532  C C   . ALA A 1 327  ? 26.975  -28.035 -30.904  1.00 62.37  ? 1699 ALA B C   1 
ATOM 2533  O O   . ALA A 1 327  ? 26.480  -27.421 -31.851  1.00 61.09  ? 1699 ALA B O   1 
ATOM 2534  C CB  . ALA A 1 327  ? 25.725  -29.125 -29.039  1.00 64.82  ? 1699 ALA B CB  1 
ATOM 2535  N N   . TYR A 1 328  ? 28.073  -27.648 -30.256  1.00 64.79  ? 1700 TYR B N   1 
ATOM 2536  C CA  . TYR A 1 328  ? 28.868  -26.468 -30.633  1.00 67.12  ? 1700 TYR B CA  1 
ATOM 2537  C C   . TYR A 1 328  ? 29.248  -26.525 -32.108  1.00 66.29  ? 1700 TYR B C   1 
ATOM 2538  O O   . TYR A 1 328  ? 29.179  -25.523 -32.823  1.00 69.84  ? 1700 TYR B O   1 
ATOM 2539  C CB  . TYR A 1 328  ? 30.137  -26.388 -29.770  1.00 67.24  ? 1700 TYR B CB  1 
ATOM 2540  C CG  . TYR A 1 328  ? 30.903  -25.090 -29.859  1.00 67.20  ? 1700 TYR B CG  1 
ATOM 2541  C CD1 . TYR A 1 328  ? 30.698  -24.075 -28.932  1.00 68.99  ? 1700 TYR B CD1 1 
ATOM 2542  C CD2 . TYR A 1 328  ? 31.856  -24.888 -30.854  1.00 68.60  ? 1700 TYR B CD2 1 
ATOM 2543  C CE1 . TYR A 1 328  ? 31.407  -22.885 -29.000  1.00 72.13  ? 1700 TYR B CE1 1 
ATOM 2544  C CE2 . TYR A 1 328  ? 32.572  -23.702 -30.933  1.00 71.66  ? 1700 TYR B CE2 1 
ATOM 2545  C CZ  . TYR A 1 328  ? 32.346  -22.703 -30.003  1.00 73.34  ? 1700 TYR B CZ  1 
ATOM 2546  O OH  . TYR A 1 328  ? 33.061  -21.529 -30.080  1.00 76.11  ? 1700 TYR B OH  1 
ATOM 2547  N N   . MET A 1 329  ? 29.641  -27.714 -32.542  1.00 64.04  ? 1701 MET B N   1 
ATOM 2548  C CA  . MET A 1 329  ? 29.965  -27.984 -33.935  1.00 63.28  ? 1701 MET B CA  1 
ATOM 2549  C C   . MET A 1 329  ? 28.830  -27.605 -34.885  1.00 62.97  ? 1701 MET B C   1 
ATOM 2550  O O   . MET A 1 329  ? 29.036  -26.837 -35.825  1.00 61.30  ? 1701 MET B O   1 
ATOM 2551  C CB  . MET A 1 329  ? 30.298  -29.465 -34.086  1.00 63.57  ? 1701 MET B CB  1 
ATOM 2552  C CG  . MET A 1 329  ? 31.611  -29.872 -33.420  1.00 64.50  ? 1701 MET B CG  1 
ATOM 2553  S SD  . MET A 1 329  ? 32.715  -30.718 -34.535  1.00 63.47  ? 1701 MET B SD  1 
ATOM 2554  C CE  . MET A 1 329  ? 32.693  -29.492 -35.843  1.00 69.31  ? 1701 MET B CE  1 
ATOM 2555  N N   . LYS A 1 330  ? 27.637  -28.138 -34.627  1.00 65.82  ? 1702 LYS B N   1 
ATOM 2556  C CA  . LYS A 1 330  ? 26.471  -27.869 -35.481  1.00 67.49  ? 1702 LYS B CA  1 
ATOM 2557  C C   . LYS A 1 330  ? 25.837  -26.491 -35.247  1.00 66.98  ? 1702 LYS B C   1 
ATOM 2558  O O   . LYS A 1 330  ? 25.062  -26.032 -36.087  1.00 70.47  ? 1702 LYS B O   1 
ATOM 2559  C CB  . LYS A 1 330  ? 25.421  -28.997 -35.404  1.00 71.15  ? 1702 LYS B CB  1 
ATOM 2560  C CG  . LYS A 1 330  ? 24.729  -29.206 -34.062  1.00 78.25  ? 1702 LYS B CG  1 
ATOM 2561  C CD  . LYS A 1 330  ? 23.849  -30.459 -34.057  1.00 82.66  ? 1702 LYS B CD  1 
ATOM 2562  C CE  . LYS A 1 330  ? 22.380  -30.142 -34.316  1.00 90.34  ? 1702 LYS B CE  1 
ATOM 2563  N NZ  . LYS A 1 330  ? 21.553  -31.373 -34.469  1.00 95.77  ? 1702 LYS B NZ  1 
ATOM 2564  N N   . ASN A 1 331  ? 26.161  -25.836 -34.132  1.00 64.91  ? 1703 ASN B N   1 
ATOM 2565  C CA  . ASN A 1 331  ? 25.794  -24.427 -33.925  1.00 66.98  ? 1703 ASN B CA  1 
ATOM 2566  C C   . ASN A 1 331  ? 26.680  -23.506 -34.763  1.00 67.40  ? 1703 ASN B C   1 
ATOM 2567  O O   . ASN A 1 331  ? 26.207  -22.518 -35.333  1.00 66.98  ? 1703 ASN B O   1 
ATOM 2568  C CB  . ASN A 1 331  ? 25.918  -24.039 -32.450  1.00 70.21  ? 1703 ASN B CB  1 
ATOM 2569  C CG  . ASN A 1 331  ? 25.401  -22.636 -32.167  1.00 72.11  ? 1703 ASN B CG  1 
ATOM 2570  O OD1 . ASN A 1 331  ? 24.197  -22.382 -32.254  1.00 73.47  ? 1703 ASN B OD1 1 
ATOM 2571  N ND2 . ASN A 1 331  ? 26.309  -21.720 -31.823  1.00 70.89  ? 1703 ASN B ND2 1 
ATOM 2572  N N   . MET A 1 332  ? 27.971  -23.828 -34.803  1.00 69.31  ? 1704 MET B N   1 
ATOM 2573  C CA  . MET A 1 332  ? 28.953  -23.099 -35.608  1.00 72.10  ? 1704 MET B CA  1 
ATOM 2574  C C   . MET A 1 332  ? 28.590  -23.133 -37.096  1.00 71.90  ? 1704 MET B C   1 
ATOM 2575  O O   . MET A 1 332  ? 28.727  -22.125 -37.796  1.00 72.33  ? 1704 MET B O   1 
ATOM 2576  C CB  . MET A 1 332  ? 30.347  -23.690 -35.363  1.00 73.61  ? 1704 MET B CB  1 
ATOM 2577  C CG  . MET A 1 332  ? 31.480  -23.042 -36.134  1.00 76.76  ? 1704 MET B CG  1 
ATOM 2578  S SD  . MET A 1 332  ? 33.107  -23.292 -35.392  1.00 79.94  ? 1704 MET B SD  1 
ATOM 2579  C CE  . MET A 1 332  ? 33.053  -25.005 -34.877  1.00 78.39  ? 1704 MET B CE  1 
ATOM 2580  N N   . TRP A 1 333  ? 28.111  -24.285 -37.565  1.00 71.41  ? 1705 TRP B N   1 
ATOM 2581  C CA  . TRP A 1 333  ? 27.605  -24.423 -38.934  1.00 71.26  ? 1705 TRP B CA  1 
ATOM 2582  C C   . TRP A 1 333  ? 26.376  -23.540 -39.200  1.00 74.85  ? 1705 TRP B C   1 
ATOM 2583  O O   . TRP A 1 333  ? 26.289  -22.918 -40.258  1.00 78.33  ? 1705 TRP B O   1 
ATOM 2584  C CB  . TRP A 1 333  ? 27.275  -25.889 -39.250  1.00 67.01  ? 1705 TRP B CB  1 
ATOM 2585  C CG  . TRP A 1 333  ? 26.704  -26.084 -40.628  1.00 64.34  ? 1705 TRP B CG  1 
ATOM 2586  C CD1 . TRP A 1 333  ? 25.392  -25.999 -40.989  1.00 64.28  ? 1705 TRP B CD1 1 
ATOM 2587  C CD2 . TRP A 1 333  ? 27.431  -26.375 -41.827  1.00 61.24  ? 1705 TRP B CD2 1 
ATOM 2588  N NE1 . TRP A 1 333  ? 25.255  -26.222 -42.335  1.00 63.40  ? 1705 TRP B NE1 1 
ATOM 2589  C CE2 . TRP A 1 333  ? 26.490  -26.456 -42.875  1.00 60.53  ? 1705 TRP B CE2 1 
ATOM 2590  C CE3 . TRP A 1 333  ? 28.782  -26.585 -42.115  1.00 60.21  ? 1705 TRP B CE3 1 
ATOM 2591  C CZ2 . TRP A 1 333  ? 26.857  -26.737 -44.190  1.00 59.66  ? 1705 TRP B CZ2 1 
ATOM 2592  C CZ3 . TRP A 1 333  ? 29.147  -26.855 -43.425  1.00 60.23  ? 1705 TRP B CZ3 1 
ATOM 2593  C CH2 . TRP A 1 333  ? 28.185  -26.934 -44.446  1.00 59.64  ? 1705 TRP B CH2 1 
ATOM 2594  N N   . LYS A 1 334  ? 25.427  -23.515 -38.262  1.00 76.63  ? 1706 LYS B N   1 
ATOM 2595  C CA  . LYS A 1 334  ? 24.231  -22.658 -38.373  1.00 78.50  ? 1706 LYS B CA  1 
ATOM 2596  C C   . LYS A 1 334  ? 24.568  -21.164 -38.305  1.00 78.36  ? 1706 LYS B C   1 
ATOM 2597  O O   . LYS A 1 334  ? 23.828  -20.340 -38.840  1.00 81.69  ? 1706 LYS B O   1 
ATOM 2598  C CB  . LYS A 1 334  ? 23.187  -23.013 -37.308  1.00 82.43  ? 1706 LYS B CB  1 
ATOM 2599  C CG  . LYS A 1 334  ? 22.393  -24.267 -37.632  1.00 87.21  ? 1706 LYS B CG  1 
ATOM 2600  C CD  . LYS A 1 334  ? 21.634  -24.797 -36.423  1.00 95.26  ? 1706 LYS B CD  1 
ATOM 2601  C CE  . LYS A 1 334  ? 20.811  -26.028 -36.784  1.00 100.68 ? 1706 LYS B CE  1 
ATOM 2602  N NZ  . LYS A 1 334  ? 20.461  -26.864 -35.601  1.00 103.94 ? 1706 LYS B NZ  1 
ATOM 2603  N N   . SER A 1 335  ? 25.678  -20.825 -37.648  1.00 75.61  ? 1707 SER B N   1 
ATOM 2604  C CA  . SER A 1 335  ? 26.273  -19.489 -37.758  1.00 76.73  ? 1707 SER B CA  1 
ATOM 2605  C C   . SER A 1 335  ? 26.969  -19.352 -39.123  1.00 77.30  ? 1707 SER B C   1 
ATOM 2606  O O   . SER A 1 335  ? 26.840  -20.218 -39.986  1.00 75.20  ? 1707 SER B O   1 
ATOM 2607  C CB  . SER A 1 335  ? 27.267  -19.251 -36.614  1.00 76.13  ? 1707 SER B CB  1 
ATOM 2608  O OG  . SER A 1 335  ? 26.730  -19.678 -35.374  1.00 75.52  ? 1707 SER B OG  1 
ATOM 2609  N N   . ALA A 1 336  ? 27.702  -18.264 -39.328  1.00 82.28  ? 1708 ALA B N   1 
ATOM 2610  C CA  . ALA A 1 336  ? 28.417  -18.058 -40.590  1.00 88.57  ? 1708 ALA B CA  1 
ATOM 2611  C C   . ALA A 1 336  ? 29.549  -19.073 -40.798  1.00 88.22  ? 1708 ALA B C   1 
ATOM 2612  O O   . ALA A 1 336  ? 29.611  -19.716 -41.849  1.00 84.81  ? 1708 ALA B O   1 
ATOM 2613  C CB  . ALA A 1 336  ? 28.956  -16.635 -40.666  1.00 94.50  ? 1708 ALA B CB  1 
ATOM 2614  N N   . ARG A 1 337  ? 30.418  -19.210 -39.790  1.00 90.76  ? 1709 ARG B N   1 
ATOM 2615  C CA  . ARG A 1 337  ? 31.631  -20.057 -39.860  1.00 91.94  ? 1709 ARG B CA  1 
ATOM 2616  C C   . ARG A 1 337  ? 31.326  -21.540 -40.153  1.00 81.45  ? 1709 ARG B C   1 
ATOM 2617  O O   . ARG A 1 337  ? 31.304  -22.362 -39.242  1.00 80.08  ? 1709 ARG B O   1 
ATOM 2618  C CB  . ARG A 1 337  ? 32.468  -19.939 -38.559  1.00 101.72 ? 1709 ARG B CB  1 
ATOM 2619  C CG  . ARG A 1 337  ? 33.453  -18.774 -38.488  1.00 113.25 ? 1709 ARG B CG  1 
ATOM 2620  C CD  . ARG A 1 337  ? 32.801  -17.429 -38.187  1.00 128.58 ? 1709 ARG B CD  1 
ATOM 2621  N NE  . ARG A 1 337  ? 32.507  -16.642 -39.390  1.00 149.44 ? 1709 ARG B NE  1 
ATOM 2622  C CZ  . ARG A 1 337  ? 32.039  -15.388 -39.396  1.00 169.07 ? 1709 ARG B CZ  1 
ATOM 2623  N NH1 . ARG A 1 337  ? 31.786  -14.738 -38.258  1.00 178.69 ? 1709 ARG B NH1 1 
ATOM 2624  N NH2 . ARG A 1 337  ? 31.811  -14.775 -40.556  1.00 175.02 ? 1709 ARG B NH2 1 
ATOM 2625  N N   . LYS A 1 338  ? 31.103  -21.870 -41.425  1.00 74.55  ? 1710 LYS B N   1 
ATOM 2626  C CA  . LYS A 1 338  ? 30.738  -23.241 -41.829  1.00 68.68  ? 1710 LYS B CA  1 
ATOM 2627  C C   . LYS A 1 338  ? 31.848  -24.037 -42.532  1.00 65.33  ? 1710 LYS B C   1 
ATOM 2628  O O   . LYS A 1 338  ? 31.776  -25.261 -42.591  1.00 61.12  ? 1710 LYS B O   1 
ATOM 2629  C CB  . LYS A 1 338  ? 29.457  -23.232 -42.667  1.00 68.32  ? 1710 LYS B CB  1 
ATOM 2630  C CG  . LYS A 1 338  ? 29.577  -22.692 -44.083  1.00 72.02  ? 1710 LYS B CG  1 
ATOM 2631  C CD  . LYS A 1 338  ? 28.416  -23.166 -44.952  1.00 72.44  ? 1710 LYS B CD  1 
ATOM 2632  C CE  . LYS A 1 338  ? 27.065  -22.690 -44.439  1.00 71.61  ? 1710 LYS B CE  1 
ATOM 2633  N NZ  . LYS A 1 338  ? 25.975  -23.034 -45.389  1.00 70.59  ? 1710 LYS B NZ  1 
ATOM 2634  N N   . ILE A 1 339  ? 32.851  -23.352 -43.080  1.00 67.07  ? 1711 ILE B N   1 
ATOM 2635  C CA  . ILE A 1 339  ? 34.083  -24.013 -43.531  1.00 64.46  ? 1711 ILE B CA  1 
ATOM 2636  C C   . ILE A 1 339  ? 34.840  -24.489 -42.294  1.00 63.57  ? 1711 ILE B C   1 
ATOM 2637  O O   . ILE A 1 339  ? 35.367  -25.604 -42.271  1.00 60.33  ? 1711 ILE B O   1 
ATOM 2638  C CB  . ILE A 1 339  ? 34.987  -23.069 -44.361  1.00 65.56  ? 1711 ILE B CB  1 
ATOM 2639  C CG1 . ILE A 1 339  ? 34.295  -22.669 -45.668  1.00 67.43  ? 1711 ILE B CG1 1 
ATOM 2640  C CG2 . ILE A 1 339  ? 36.318  -23.736 -44.697  1.00 65.48  ? 1711 ILE B CG2 1 
ATOM 2641  C CD1 . ILE A 1 339  ? 34.862  -21.423 -46.315  1.00 71.07  ? 1711 ILE B CD1 1 
ATOM 2642  N N   . ASP A 1 340  ? 34.889  -23.624 -41.280  1.00 66.05  ? 1712 ASP B N   1 
ATOM 2643  C CA  . ASP A 1 340  ? 35.532  -23.933 -39.999  1.00 66.49  ? 1712 ASP B CA  1 
ATOM 2644  C C   . ASP A 1 340  ? 34.836  -25.113 -39.306  1.00 63.83  ? 1712 ASP B C   1 
ATOM 2645  O O   . ASP A 1 340  ? 35.500  -26.007 -38.782  1.00 63.07  ? 1712 ASP B O   1 
ATOM 2646  C CB  . ASP A 1 340  ? 35.538  -22.689 -39.085  1.00 68.05  ? 1712 ASP B CB  1 
ATOM 2647  C CG  . ASP A 1 340  ? 36.619  -22.740 -37.997  1.00 68.79  ? 1712 ASP B CG  1 
ATOM 2648  O OD1 . ASP A 1 340  ? 37.456  -23.672 -37.973  1.00 67.03  ? 1712 ASP B OD1 1 
ATOM 2649  O OD2 . ASP A 1 340  ? 36.632  -21.817 -37.157  1.00 70.90  ? 1712 ASP B OD2 1 
ATOM 2650  N N   . ALA A 1 341  ? 33.502  -25.109 -39.323  1.00 62.53  ? 1713 ALA B N   1 
ATOM 2651  C CA  . ALA A 1 341  ? 32.704  -26.214 -38.776  1.00 60.22  ? 1713 ALA B CA  1 
ATOM 2652  C C   . ALA A 1 341  ? 33.003  -27.535 -39.477  1.00 59.11  ? 1713 ALA B C   1 
ATOM 2653  O O   . ALA A 1 341  ? 33.197  -28.553 -38.825  1.00 60.13  ? 1713 ALA B O   1 
ATOM 2654  C CB  . ALA A 1 341  ? 31.216  -25.903 -38.876  1.00 59.58  ? 1713 ALA B CB  1 
ATOM 2655  N N   . PHE A 1 342  ? 33.040  -27.513 -40.805  1.00 60.05  ? 1714 PHE B N   1 
ATOM 2656  C CA  . PHE A 1 342  ? 33.327  -28.716 -41.589  1.00 60.00  ? 1714 PHE B CA  1 
ATOM 2657  C C   . PHE A 1 342  ? 34.701  -29.296 -41.260  1.00 60.51  ? 1714 PHE B C   1 
ATOM 2658  O O   . PHE A 1 342  ? 34.844  -30.513 -41.145  1.00 58.55  ? 1714 PHE B O   1 
ATOM 2659  C CB  . PHE A 1 342  ? 33.220  -28.421 -43.090  1.00 62.26  ? 1714 PHE B CB  1 
ATOM 2660  C CG  . PHE A 1 342  ? 33.454  -29.621 -43.962  1.00 63.48  ? 1714 PHE B CG  1 
ATOM 2661  C CD1 . PHE A 1 342  ? 32.591  -30.710 -43.906  1.00 63.43  ? 1714 PHE B CD1 1 
ATOM 2662  C CD2 . PHE A 1 342  ? 34.536  -29.669 -44.838  1.00 65.50  ? 1714 PHE B CD2 1 
ATOM 2663  C CE1 . PHE A 1 342  ? 32.800  -31.825 -44.703  1.00 64.30  ? 1714 PHE B CE1 1 
ATOM 2664  C CE2 . PHE A 1 342  ? 34.747  -30.780 -45.641  1.00 66.95  ? 1714 PHE B CE2 1 
ATOM 2665  C CZ  . PHE A 1 342  ? 33.880  -31.862 -45.571  1.00 65.72  ? 1714 PHE B CZ  1 
ATOM 2666  N N   . GLN A 1 343  ? 35.692  -28.417 -41.102  1.00 63.74  ? 1715 GLN B N   1 
ATOM 2667  C CA  . GLN A 1 343  ? 37.060  -28.824 -40.731  1.00 64.95  ? 1715 GLN B CA  1 
ATOM 2668  C C   . GLN A 1 343  ? 37.147  -29.402 -39.320  1.00 65.00  ? 1715 GLN B C   1 
ATOM 2669  O O   . GLN A 1 343  ? 37.824  -30.407 -39.108  1.00 68.04  ? 1715 GLN B O   1 
ATOM 2670  C CB  . GLN A 1 343  ? 38.063  -27.660 -40.880  1.00 64.94  ? 1715 GLN B CB  1 
ATOM 2671  C CG  . GLN A 1 343  ? 39.060  -27.852 -42.011  1.00 63.11  ? 1715 GLN B CG  1 
ATOM 2672  C CD  . GLN A 1 343  ? 39.996  -29.008 -41.756  1.00 60.95  ? 1715 GLN B CD  1 
ATOM 2673  O OE1 . GLN A 1 343  ? 40.431  -29.226 -40.630  1.00 60.13  ? 1715 GLN B OE1 1 
ATOM 2674  N NE2 . GLN A 1 343  ? 40.308  -29.756 -42.801  1.00 61.83  ? 1715 GLN B NE2 1 
ATOM 2675  N N   . HIS A 1 344  ? 36.470  -28.761 -38.368  1.00 63.34  ? 1716 HIS B N   1 
ATOM 2676  C CA  . HIS A 1 344  ? 36.407  -29.257 -36.988  1.00 61.89  ? 1716 HIS B CA  1 
ATOM 2677  C C   . HIS A 1 344  ? 35.762  -30.645 -36.873  1.00 61.66  ? 1716 HIS B C   1 
ATOM 2678  O O   . HIS A 1 344  ? 36.128  -31.412 -35.986  1.00 63.69  ? 1716 HIS B O   1 
ATOM 2679  C CB  . HIS A 1 344  ? 35.647  -28.281 -36.079  1.00 61.08  ? 1716 HIS B CB  1 
ATOM 2680  C CG  . HIS A 1 344  ? 36.497  -27.210 -35.481  1.00 63.43  ? 1716 HIS B CG  1 
ATOM 2681  N ND1 . HIS A 1 344  ? 37.511  -27.483 -34.589  1.00 66.19  ? 1716 HIS B ND1 1 
ATOM 2682  C CD2 . HIS A 1 344  ? 36.461  -25.863 -35.613  1.00 63.75  ? 1716 HIS B CD2 1 
ATOM 2683  C CE1 . HIS A 1 344  ? 38.075  -26.350 -34.210  1.00 67.93  ? 1716 HIS B CE1 1 
ATOM 2684  N NE2 . HIS A 1 344  ? 37.454  -25.352 -34.816  1.00 66.64  ? 1716 HIS B NE2 1 
ATOM 2685  N N   . MET A 1 345  ? 34.802  -30.955 -37.750  1.00 59.84  ? 1717 MET B N   1 
ATOM 2686  C CA  . MET A 1 345  ? 34.058  -32.218 -37.676  1.00 60.21  ? 1717 MET B CA  1 
ATOM 2687  C C   . MET A 1 345  ? 34.894  -33.389 -38.204  1.00 63.92  ? 1717 MET B C   1 
ATOM 2688  O O   . MET A 1 345  ? 34.870  -34.475 -37.619  1.00 64.95  ? 1717 MET B O   1 
ATOM 2689  C CB  . MET A 1 345  ? 32.726  -32.113 -38.429  1.00 58.64  ? 1717 MET B CB  1 
ATOM 2690  C CG  . MET A 1 345  ? 31.780  -33.308 -38.257  1.00 58.90  ? 1717 MET B CG  1 
ATOM 2691  S SD  . MET A 1 345  ? 30.999  -33.469 -36.633  1.00 58.48  ? 1717 MET B SD  1 
ATOM 2692  C CE  . MET A 1 345  ? 29.712  -32.232 -36.761  1.00 57.06  ? 1717 MET B CE  1 
ATOM 2693  N N   . GLN A 1 346  ? 35.627  -33.168 -39.298  1.00 65.62  ? 1718 GLN B N   1 
ATOM 2694  C CA  . GLN A 1 346  ? 36.546  -34.176 -39.842  1.00 65.62  ? 1718 GLN B CA  1 
ATOM 2695  C C   . GLN A 1 346  ? 37.529  -34.633 -38.776  1.00 67.28  ? 1718 GLN B C   1 
ATOM 2696  O O   . GLN A 1 346  ? 37.708  -35.833 -38.568  1.00 70.99  ? 1718 GLN B O   1 
ATOM 2697  C CB  . GLN A 1 346  ? 37.328  -33.629 -41.037  1.00 67.23  ? 1718 GLN B CB  1 
ATOM 2698  C CG  . GLN A 1 346  ? 36.512  -33.441 -42.301  1.00 67.65  ? 1718 GLN B CG  1 
ATOM 2699  C CD  . GLN A 1 346  ? 37.332  -32.820 -43.410  1.00 70.83  ? 1718 GLN B CD  1 
ATOM 2700  O OE1 . GLN A 1 346  ? 38.206  -33.465 -43.985  1.00 72.89  ? 1718 GLN B OE1 1 
ATOM 2701  N NE2 . GLN A 1 346  ? 37.064  -31.555 -43.706  1.00 74.97  ? 1718 GLN B NE2 1 
ATOM 2702  N N   . HIS A 1 347  ? 38.151  -33.664 -38.105  1.00 67.55  ? 1719 HIS B N   1 
ATOM 2703  C CA  . HIS A 1 347  ? 39.096  -33.944 -37.018  1.00 70.80  ? 1719 HIS B CA  1 
ATOM 2704  C C   . HIS A 1 347  ? 38.425  -34.550 -35.776  1.00 70.32  ? 1719 HIS B C   1 
ATOM 2705  O O   . HIS A 1 347  ? 39.029  -35.379 -35.098  1.00 73.49  ? 1719 HIS B O   1 
ATOM 2706  C CB  . HIS A 1 347  ? 39.866  -32.679 -36.613  1.00 73.32  ? 1719 HIS B CB  1 
ATOM 2707  C CG  . HIS A 1 347  ? 40.898  -32.242 -37.609  1.00 75.57  ? 1719 HIS B CG  1 
ATOM 2708  N ND1 . HIS A 1 347  ? 41.929  -33.058 -38.023  1.00 80.15  ? 1719 HIS B ND1 1 
ATOM 2709  C CD2 . HIS A 1 347  ? 41.075  -31.060 -38.246  1.00 75.09  ? 1719 HIS B CD2 1 
ATOM 2710  C CE1 . HIS A 1 347  ? 42.683  -32.405 -38.890  1.00 81.65  ? 1719 HIS B CE1 1 
ATOM 2711  N NE2 . HIS A 1 347  ? 42.187  -31.190 -39.042  1.00 77.46  ? 1719 HIS B NE2 1 
ATOM 2712  N N   . PHE A 1 348  ? 37.197  -34.127 -35.477  1.00 68.23  ? 1720 PHE B N   1 
ATOM 2713  C CA  . PHE A 1 348  ? 36.431  -34.656 -34.336  1.00 68.76  ? 1720 PHE B CA  1 
ATOM 2714  C C   . PHE A 1 348  ? 36.146  -36.152 -34.465  1.00 70.33  ? 1720 PHE B C   1 
ATOM 2715  O O   . PHE A 1 348  ? 36.334  -36.894 -33.503  1.00 74.43  ? 1720 PHE B O   1 
ATOM 2716  C CB  . PHE A 1 348  ? 35.113  -33.886 -34.171  1.00 67.35  ? 1720 PHE B CB  1 
ATOM 2717  C CG  . PHE A 1 348  ? 34.280  -34.321 -32.990  1.00 65.36  ? 1720 PHE B CG  1 
ATOM 2718  C CD1 . PHE A 1 348  ? 34.562  -33.852 -31.711  1.00 65.73  ? 1720 PHE B CD1 1 
ATOM 2719  C CD2 . PHE A 1 348  ? 33.192  -35.173 -33.160  1.00 62.85  ? 1720 PHE B CD2 1 
ATOM 2720  C CE1 . PHE A 1 348  ? 33.786  -34.235 -30.625  1.00 65.65  ? 1720 PHE B CE1 1 
ATOM 2721  C CE2 . PHE A 1 348  ? 32.414  -35.560 -32.077  1.00 62.39  ? 1720 PHE B CE2 1 
ATOM 2722  C CZ  . PHE A 1 348  ? 32.709  -35.087 -30.809  1.00 63.79  ? 1720 PHE B CZ  1 
ATOM 2723  N N   . VAL A 1 349  ? 35.699  -36.583 -35.646  1.00 70.13  ? 1721 VAL B N   1 
ATOM 2724  C CA  . VAL A 1 349  ? 35.386  -38.002 -35.897  1.00 72.03  ? 1721 VAL B CA  1 
ATOM 2725  C C   . VAL A 1 349  ? 36.652  -38.871 -35.813  1.00 75.18  ? 1721 VAL B C   1 
ATOM 2726  O O   . VAL A 1 349  ? 36.601  -39.988 -35.294  1.00 78.19  ? 1721 VAL B O   1 
ATOM 2727  C CB  . VAL A 1 349  ? 34.659  -38.203 -37.254  1.00 70.67  ? 1721 VAL B CB  1 
ATOM 2728  C CG1 . VAL A 1 349  ? 34.415  -39.677 -37.554  1.00 71.91  ? 1721 VAL B CG1 1 
ATOM 2729  C CG2 . VAL A 1 349  ? 33.316  -37.497 -37.245  1.00 71.78  ? 1721 VAL B CG2 1 
ATOM 2730  N N   . GLN A 1 350  ? 37.773  -38.353 -36.318  1.00 75.80  ? 1722 GLN B N   1 
ATOM 2731  C CA  . GLN A 1 350  ? 39.082  -39.014 -36.196  1.00 77.27  ? 1722 GLN B CA  1 
ATOM 2732  C C   . GLN A 1 350  ? 39.513  -39.216 -34.738  1.00 77.86  ? 1722 GLN B C   1 
ATOM 2733  O O   . GLN A 1 350  ? 40.094  -40.252 -34.399  1.00 79.25  ? 1722 GLN B O   1 
ATOM 2734  C CB  . GLN A 1 350  ? 40.164  -38.222 -36.946  1.00 79.63  ? 1722 GLN B CB  1 
ATOM 2735  C CG  . GLN A 1 350  ? 40.063  -38.304 -38.464  1.00 81.90  ? 1722 GLN B CG  1 
ATOM 2736  C CD  . GLN A 1 350  ? 41.058  -37.407 -39.187  1.00 84.47  ? 1722 GLN B CD  1 
ATOM 2737  O OE1 . GLN A 1 350  ? 41.948  -36.814 -38.575  1.00 89.11  ? 1722 GLN B OE1 1 
ATOM 2738  N NE2 . GLN A 1 350  ? 40.911  -37.310 -40.505  1.00 84.68  ? 1722 GLN B NE2 1 
ATOM 2739  N N   . THR A 1 351  ? 39.243  -38.218 -33.894  1.00 77.24  ? 1723 THR B N   1 
ATOM 2740  C CA  . THR A 1 351  ? 39.530  -38.296 -32.452  1.00 78.59  ? 1723 THR B CA  1 
ATOM 2741  C C   . THR A 1 351  ? 38.578  -39.264 -31.738  1.00 80.10  ? 1723 THR B C   1 
ATOM 2742  O O   . THR A 1 351  ? 38.977  -39.925 -30.780  1.00 81.70  ? 1723 THR B O   1 
ATOM 2743  C CB  . THR A 1 351  ? 39.464  -36.900 -31.780  1.00 75.79  ? 1723 THR B CB  1 
ATOM 2744  O OG1 . THR A 1 351  ? 40.303  -35.986 -32.493  1.00 75.11  ? 1723 THR B OG1 1 
ATOM 2745  C CG2 . THR A 1 351  ? 39.937  -36.941 -30.330  1.00 77.35  ? 1723 THR B CG2 1 
ATOM 2746  N N   . MET A 1 352  ? 37.335  -39.344 -32.211  1.00 81.97  ? 1724 MET B N   1 
ATOM 2747  C CA  . MET A 1 352  ? 36.307  -40.193 -31.591  1.00 88.17  ? 1724 MET B CA  1 
ATOM 2748  C C   . MET A 1 352  ? 36.545  -41.682 -31.855  1.00 92.06  ? 1724 MET B C   1 
ATOM 2749  O O   . MET A 1 352  ? 36.386  -42.503 -30.948  1.00 91.82  ? 1724 MET B O   1 
ATOM 2750  C CB  . MET A 1 352  ? 34.897  -39.786 -32.068  1.00 89.34  ? 1724 MET B CB  1 
ATOM 2751  C CG  . MET A 1 352  ? 33.849  -39.689 -30.963  1.00 94.32  ? 1724 MET B CG  1 
ATOM 2752  S SD  . MET A 1 352  ? 34.291  -38.654 -29.542  1.00 100.26 ? 1724 MET B SD  1 
ATOM 2753  C CE  . MET A 1 352  ? 35.148  -37.298 -30.335  1.00 102.95 ? 1724 MET B CE  1 
ATOM 2754  N N   . GLN A 1 353  ? 36.911  -42.021 -33.093  1.00 96.81  ? 1725 GLN B N   1 
ATOM 2755  C CA  . GLN A 1 353  ? 37.246  -43.408 -33.459  1.00 99.46  ? 1725 GLN B CA  1 
ATOM 2756  C C   . GLN A 1 353  ? 38.519  -43.919 -32.770  1.00 102.65 ? 1725 GLN B C   1 
ATOM 2757  O O   . GLN A 1 353  ? 38.589  -45.094 -32.413  1.00 107.03 ? 1725 GLN B O   1 
ATOM 2758  C CB  . GLN A 1 353  ? 37.327  -43.590 -34.984  1.00 101.37 ? 1725 GLN B CB  1 
ATOM 2759  C CG  . GLN A 1 353  ? 38.462  -42.857 -35.687  1.00 106.35 ? 1725 GLN B CG  1 
ATOM 2760  C CD  . GLN A 1 353  ? 38.302  -42.826 -37.199  1.00 109.56 ? 1725 GLN B CD  1 
ATOM 2761  O OE1 . GLN A 1 353  ? 37.200  -42.634 -37.723  1.00 102.45 ? 1725 GLN B OE1 1 
ATOM 2762  N NE2 . GLN A 1 353  ? 39.412  -43.000 -37.911  1.00 116.80 ? 1725 GLN B NE2 1 
ATOM 2763  N N   . GLN A 1 354  ? 39.509  -43.043 -32.578  1.00 105.84 ? 1726 GLN B N   1 
ATOM 2764  C CA  . GLN A 1 354  ? 40.680  -43.360 -31.738  1.00 106.84 ? 1726 GLN B CA  1 
ATOM 2765  C C   . GLN A 1 354  ? 40.310  -43.482 -30.250  1.00 106.10 ? 1726 GLN B C   1 
ATOM 2766  O O   . GLN A 1 354  ? 40.804  -44.379 -29.565  1.00 105.16 ? 1726 GLN B O   1 
ATOM 2767  C CB  . GLN A 1 354  ? 41.800  -42.325 -31.915  1.00 106.87 ? 1726 GLN B CB  1 
ATOM 2768  C CG  . GLN A 1 354  ? 42.579  -42.462 -33.218  1.00 106.49 ? 1726 GLN B CG  1 
ATOM 2769  C CD  . GLN A 1 354  ? 43.926  -41.755 -33.178  1.00 110.44 ? 1726 GLN B CD  1 
ATOM 2770  O OE1 . GLN A 1 354  ? 44.734  -41.983 -32.276  1.00 109.63 ? 1726 GLN B OE1 1 
ATOM 2771  N NE2 . GLN A 1 354  ? 44.178  -40.900 -34.165  1.00 112.57 ? 1726 GLN B NE2 1 
ATOM 2772  N N   . GLN A 1 355  ? 39.451  -42.582 -29.762  1.00 107.82 ? 1727 GLN B N   1 
ATOM 2773  C CA  . GLN A 1 355  ? 38.938  -42.643 -28.379  1.00 110.99 ? 1727 GLN B CA  1 
ATOM 2774  C C   . GLN A 1 355  ? 38.075  -43.889 -28.129  1.00 107.93 ? 1727 GLN B C   1 
ATOM 2775  O O   . GLN A 1 355  ? 37.936  -44.327 -26.987  1.00 110.51 ? 1727 GLN B O   1 
ATOM 2776  C CB  . GLN A 1 355  ? 38.148  -41.369 -28.021  1.00 112.56 ? 1727 GLN B CB  1 
ATOM 2777  C CG  . GLN A 1 355  ? 37.854  -41.194 -26.532  1.00 112.65 ? 1727 GLN B CG  1 
ATOM 2778  C CD  . GLN A 1 355  ? 37.108  -39.907 -26.221  1.00 107.42 ? 1727 GLN B CD  1 
ATOM 2779  O OE1 . GLN A 1 355  ? 37.581  -38.813 -26.525  1.00 101.95 ? 1727 GLN B OE1 1 
ATOM 2780  N NE2 . GLN A 1 355  ? 35.941  -40.034 -25.597  1.00 105.77 ? 1727 GLN B NE2 1 
ATOM 2781  N N   . ALA A 1 356  ? 37.486  -44.449 -29.184  1.00 103.17 ? 1728 ALA B N   1 
ATOM 2782  C CA  . ALA A 1 356  ? 36.846  -45.759 -29.090  1.00 102.10 ? 1728 ALA B CA  1 
ATOM 2783  C C   . ALA A 1 356  ? 37.906  -46.872 -29.040  1.00 108.08 ? 1728 ALA B C   1 
ATOM 2784  O O   . ALA A 1 356  ? 38.217  -47.374 -27.957  1.00 108.99 ? 1728 ALA B O   1 
ATOM 2785  C CB  . ALA A 1 356  ? 35.867  -45.973 -30.241  1.00 95.39  ? 1728 ALA B CB  1 
ATOM 2786  N N   . GLN A 1 357  ? 38.498  -47.201 -30.192  1.00 110.03 ? 1729 GLN B N   1 
ATOM 2787  C CA  . GLN A 1 357  ? 39.230  -48.471 -30.393  1.00 113.15 ? 1729 GLN B CA  1 
ATOM 2788  C C   . GLN A 1 357  ? 40.275  -48.820 -29.325  1.00 121.11 ? 1729 GLN B C   1 
ATOM 2789  O O   . GLN A 1 357  ? 40.301  -49.952 -28.838  1.00 119.80 ? 1729 GLN B O   1 
ATOM 2790  C CB  . GLN A 1 357  ? 39.868  -48.526 -31.796  1.00 111.32 ? 1729 GLN B CB  1 
ATOM 2791  C CG  . GLN A 1 357  ? 40.999  -47.532 -32.051  1.00 112.32 ? 1729 GLN B CG  1 
ATOM 2792  C CD  . GLN A 1 357  ? 41.456  -47.499 -33.499  1.00 111.50 ? 1729 GLN B CD  1 
ATOM 2793  O OE1 . GLN A 1 357  ? 41.124  -48.382 -34.294  1.00 111.49 ? 1729 GLN B OE1 1 
ATOM 2794  N NE2 . GLN A 1 357  ? 42.232  -46.475 -33.848  1.00 108.12 ? 1729 GLN B NE2 1 
ATOM 2795  N N   . HIS A 1 358  ? 41.109  -47.848 -28.956  1.00 133.29 ? 1730 HIS B N   1 
ATOM 2796  C CA  . HIS A 1 358  ? 42.222  -48.081 -28.025  1.00 143.19 ? 1730 HIS B CA  1 
ATOM 2797  C C   . HIS A 1 358  ? 41.783  -47.949 -26.569  1.00 154.07 ? 1730 HIS B C   1 
ATOM 2798  O O   . HIS A 1 358  ? 42.072  -48.828 -25.756  1.00 163.14 ? 1730 HIS B O   1 
ATOM 2799  C CB  . HIS A 1 358  ? 43.400  -47.136 -28.315  1.00 141.70 ? 1730 HIS B CB  1 
ATOM 2800  C CG  . HIS A 1 358  ? 44.214  -47.534 -29.509  1.00 145.93 ? 1730 HIS B CG  1 
ATOM 2801  N ND1 . HIS A 1 358  ? 44.463  -46.680 -30.562  1.00 148.62 ? 1730 HIS B ND1 1 
ATOM 2802  C CD2 . HIS A 1 358  ? 44.829  -48.701 -29.818  1.00 148.29 ? 1730 HIS B CD2 1 
ATOM 2803  C CE1 . HIS A 1 358  ? 45.199  -47.301 -31.466  1.00 149.54 ? 1730 HIS B CE1 1 
ATOM 2804  N NE2 . HIS A 1 358  ? 45.435  -48.529 -31.039  1.00 150.98 ? 1730 HIS B NE2 1 
ATOM 2805  N N   . ALA A 1 359  ? 41.082  -46.862 -26.249  1.00 161.07 ? 1731 ALA B N   1 
ATOM 2806  C CA  . ALA A 1 359  ? 40.663  -46.586 -24.866  1.00 165.55 ? 1731 ALA B CA  1 
ATOM 2807  C C   . ALA A 1 359  ? 39.525  -47.480 -24.349  1.00 166.24 ? 1731 ALA B C   1 
ATOM 2808  O O   . ALA A 1 359  ? 39.260  -47.481 -23.144  1.00 177.58 ? 1731 ALA B O   1 
ATOM 2809  C CB  . ALA A 1 359  ? 40.298  -45.116 -24.699  1.00 161.07 ? 1731 ALA B CB  1 
ATOM 2810  N N   . ILE A 1 360  ? 38.855  -48.227 -25.235  1.00 152.64 ? 1732 ILE B N   1 
ATOM 2811  C CA  . ILE A 1 360  ? 37.890  -49.250 -24.804  1.00 149.33 ? 1732 ILE B CA  1 
ATOM 2812  C C   . ILE A 1 360  ? 38.611  -50.433 -24.147  1.00 153.03 ? 1732 ILE B C   1 
ATOM 2813  O O   . ILE A 1 360  ? 39.213  -51.273 -24.822  1.00 149.92 ? 1732 ILE B O   1 
ATOM 2814  C CB  . ILE A 1 360  ? 36.968  -49.739 -25.960  1.00 141.68 ? 1732 ILE B CB  1 
ATOM 2815  C CG1 . ILE A 1 360  ? 35.934  -48.660 -26.299  1.00 144.17 ? 1732 ILE B CG1 1 
ATOM 2816  C CG2 . ILE A 1 360  ? 36.203  -51.018 -25.588  1.00 137.98 ? 1732 ILE B CG2 1 
ATOM 2817  C CD1 . ILE A 1 360  ? 35.294  -48.814 -27.665  1.00 145.61 ? 1732 ILE B CD1 1 
ATOM 2818  N N   . ALA A 1 361  ? 38.577  -50.446 -22.817  1.00 154.47 ? 1733 ALA B N   1 
ATOM 2819  C CA  . ALA A 1 361  ? 38.620  -51.683 -22.050  1.00 158.86 ? 1733 ALA B CA  1 
ATOM 2820  C C   . ALA A 1 361  ? 37.183  -52.200 -22.095  1.00 170.41 ? 1733 ALA B C   1 
ATOM 2821  O O   . ALA A 1 361  ? 36.244  -51.398 -22.082  1.00 182.17 ? 1733 ALA B O   1 
ATOM 2822  C CB  . ALA A 1 361  ? 39.056  -51.417 -20.619  1.00 157.94 ? 1733 ALA B CB  1 
ATOM 2823  N N   . THR A 1 362  ? 36.999  -53.518 -22.153  1.00 177.17 ? 1734 THR B N   1 
ATOM 2824  C CA  . THR A 1 362  ? 35.658  -54.101 -22.387  1.00 181.64 ? 1734 THR B CA  1 
ATOM 2825  C C   . THR A 1 362  ? 34.623  -53.901 -21.245  1.00 182.39 ? 1734 THR B C   1 
ATOM 2826  O O   . THR A 1 362  ? 33.443  -54.199 -21.428  1.00 177.05 ? 1734 THR B O   1 
ATOM 2827  C CB  . THR A 1 362  ? 35.737  -55.602 -22.762  1.00 186.49 ? 1734 THR B CB  1 
ATOM 2828  O OG1 . THR A 1 362  ? 36.987  -55.883 -23.405  1.00 187.74 ? 1734 THR B OG1 1 
ATOM 2829  C CG2 . THR A 1 362  ? 34.589  -55.986 -23.709  1.00 183.88 ? 1734 THR B CG2 1 
ATOM 2830  N N   . GLU A 1 363  ? 35.062  -53.420 -20.078  1.00 183.71 ? 1735 GLU B N   1 
ATOM 2831  C CA  . GLU A 1 363  ? 34.163  -52.876 -19.037  1.00 180.53 ? 1735 GLU B CA  1 
ATOM 2832  C C   . GLU A 1 363  ? 33.261  -51.777 -19.619  1.00 179.93 ? 1735 GLU B C   1 
ATOM 2833  O O   . GLU A 1 363  ? 32.039  -51.808 -19.446  1.00 178.38 ? 1735 GLU B O   1 
ATOM 2834  C CB  . GLU A 1 363  ? 34.989  -52.312 -17.864  1.00 177.21 ? 1735 GLU B CB  1 
ATOM 2835  C CG  . GLU A 1 363  ? 34.206  -51.987 -16.595  1.00 173.27 ? 1735 GLU B CG  1 
ATOM 2836  C CD  . GLU A 1 363  ? 33.747  -53.221 -15.838  1.00 170.98 ? 1735 GLU B CD  1 
ATOM 2837  O OE1 . GLU A 1 363  ? 34.574  -54.127 -15.602  1.00 170.13 ? 1735 GLU B OE1 1 
ATOM 2838  O OE2 . GLU A 1 363  ? 32.556  -53.282 -15.467  1.00 166.55 ? 1735 GLU B OE2 1 
ATOM 2839  N N   . ASP A 1 364  ? 33.880  -50.825 -20.318  1.00 180.09 ? 1736 ASP B N   1 
ATOM 2840  C CA  . ASP A 1 364  ? 33.165  -49.746 -21.010  1.00 171.28 ? 1736 ASP B CA  1 
ATOM 2841  C C   . ASP A 1 364  ? 32.553  -50.270 -22.317  1.00 159.30 ? 1736 ASP B C   1 
ATOM 2842  O O   . ASP A 1 364  ? 33.229  -50.331 -23.349  1.00 149.48 ? 1736 ASP B O   1 
ATOM 2843  C CB  . ASP A 1 364  ? 34.109  -48.563 -21.299  1.00 175.87 ? 1736 ASP B CB  1 
ATOM 2844  C CG  . ASP A 1 364  ? 34.711  -47.949 -20.033  1.00 182.66 ? 1736 ASP B CG  1 
ATOM 2845  O OD1 . ASP A 1 364  ? 34.107  -48.067 -18.945  1.00 191.39 ? 1736 ASP B OD1 1 
ATOM 2846  O OD2 . ASP A 1 364  ? 35.796  -47.337 -20.133  1.00 178.55 ? 1736 ASP B OD2 1 
ATOM 2847  N N   . GLN A 1 365  ? 31.278  -50.661 -22.251  1.00 159.55 ? 1737 GLN B N   1 
ATOM 2848  C CA  . GLN A 1 365  ? 30.527  -51.182 -23.414  1.00 156.17 ? 1737 GLN B CA  1 
ATOM 2849  C C   . GLN A 1 365  ? 29.271  -50.364 -23.755  1.00 153.30 ? 1737 GLN B C   1 
ATOM 2850  O O   . GLN A 1 365  ? 28.937  -50.216 -24.932  1.00 149.00 ? 1737 GLN B O   1 
ATOM 2851  C CB  . GLN A 1 365  ? 30.169  -52.661 -23.216  1.00 158.24 ? 1737 GLN B CB  1 
ATOM 2852  C CG  . GLN A 1 365  ? 29.223  -52.960 -22.061  1.00 159.03 ? 1737 GLN B CG  1 
ATOM 2853  C CD  . GLN A 1 365  ? 29.088  -54.446 -21.799  1.00 159.38 ? 1737 GLN B CD  1 
ATOM 2854  O OE1 . GLN A 1 365  ? 28.641  -55.201 -22.662  1.00 153.57 ? 1737 GLN B OE1 1 
ATOM 2855  N NE2 . GLN A 1 365  ? 29.471  -54.874 -20.600  1.00 163.96 ? 1737 GLN B NE2 1 
ATOM 2856  N N   . GLN A 1 366  ? 28.564  -49.871 -22.735  1.00 157.02 ? 1738 GLN B N   1 
ATOM 2857  C CA  . GLN A 1 366  ? 27.515  -48.860 -22.927  1.00 151.52 ? 1738 GLN B CA  1 
ATOM 2858  C C   . GLN A 1 366  ? 28.106  -47.549 -23.447  1.00 151.46 ? 1738 GLN B C   1 
ATOM 2859  O O   . GLN A 1 366  ? 27.503  -46.892 -24.300  1.00 151.58 ? 1738 GLN B O   1 
ATOM 2860  C CB  . GLN A 1 366  ? 26.759  -48.586 -21.622  1.00 151.33 ? 1738 GLN B CB  1 
ATOM 2861  C CG  . GLN A 1 366  ? 25.836  -49.709 -21.181  1.00 151.55 ? 1738 GLN B CG  1 
ATOM 2862  C CD  . GLN A 1 366  ? 25.161  -49.421 -19.852  1.00 155.15 ? 1738 GLN B CD  1 
ATOM 2863  O OE1 . GLN A 1 366  ? 24.799  -48.281 -19.556  1.00 156.52 ? 1738 GLN B OE1 1 
ATOM 2864  N NE2 . GLN A 1 366  ? 24.985  -50.458 -19.043  1.00 155.13 ? 1738 GLN B NE2 1 
ATOM 2865  N N   . HIS A 1 367  ? 29.276  -47.175 -22.921  1.00 147.45 ? 1739 HIS B N   1 
ATOM 2866  C CA  . HIS A 1 367  ? 29.996  -45.980 -23.373  1.00 139.71 ? 1739 HIS B CA  1 
ATOM 2867  C C   . HIS A 1 367  ? 30.416  -46.092 -24.841  1.00 137.71 ? 1739 HIS B C   1 
ATOM 2868  O O   . HIS A 1 367  ? 30.320  -45.112 -25.574  1.00 141.97 ? 1739 HIS B O   1 
ATOM 2869  C CB  . HIS A 1 367  ? 31.217  -45.699 -22.487  1.00 139.25 ? 1739 HIS B CB  1 
ATOM 2870  C CG  . HIS A 1 367  ? 31.857  -44.366 -22.739  1.00 134.56 ? 1739 HIS B CG  1 
ATOM 2871  N ND1 . HIS A 1 367  ? 31.272  -43.175 -22.363  1.00 131.43 ? 1739 HIS B ND1 1 
ATOM 2872  C CD2 . HIS A 1 367  ? 33.032  -44.037 -23.326  1.00 130.86 ? 1739 HIS B CD2 1 
ATOM 2873  C CE1 . HIS A 1 367  ? 32.057  -42.171 -22.711  1.00 127.33 ? 1739 HIS B CE1 1 
ATOM 2874  N NE2 . HIS A 1 367  ? 33.132  -42.667 -23.296  1.00 128.22 ? 1739 HIS B NE2 1 
ATOM 2875  N N   . LYS A 1 368  ? 30.870  -47.278 -25.258  1.00 137.02 ? 1740 LYS B N   1 
ATOM 2876  C CA  . LYS A 1 368  ? 31.177  -47.556 -26.676  1.00 135.66 ? 1740 LYS B CA  1 
ATOM 2877  C C   . LYS A 1 368  ? 29.966  -47.328 -27.581  1.00 128.40 ? 1740 LYS B C   1 
ATOM 2878  O O   . LYS A 1 368  ? 30.065  -46.638 -28.598  1.00 126.06 ? 1740 LYS B O   1 
ATOM 2879  C CB  . LYS A 1 368  ? 31.682  -49.000 -26.869  1.00 141.96 ? 1740 LYS B CB  1 
ATOM 2880  C CG  . LYS A 1 368  ? 31.635  -49.491 -28.317  1.00 146.10 ? 1740 LYS B CG  1 
ATOM 2881  C CD  . LYS A 1 368  ? 32.127  -50.919 -28.490  1.00 151.93 ? 1740 LYS B CD  1 
ATOM 2882  C CE  . LYS A 1 368  ? 31.441  -51.584 -29.678  1.00 149.14 ? 1740 LYS B CE  1 
ATOM 2883  N NZ  . LYS A 1 368  ? 32.176  -52.774 -30.183  1.00 149.70 ? 1740 LYS B NZ  1 
ATOM 2884  N N   . GLN A 1 369  ? 28.840  -47.930 -27.207  1.00 124.32 ? 1741 GLN B N   1 
ATOM 2885  C CA  . GLN A 1 369  ? 27.623  -47.902 -28.021  1.00 124.21 ? 1741 GLN B CA  1 
ATOM 2886  C C   . GLN A 1 369  ? 27.108  -46.477 -28.242  1.00 117.77 ? 1741 GLN B C   1 
ATOM 2887  O O   . GLN A 1 369  ? 26.727  -46.120 -29.358  1.00 117.45 ? 1741 GLN B O   1 
ATOM 2888  C CB  . GLN A 1 369  ? 26.532  -48.775 -27.385  1.00 132.71 ? 1741 GLN B CB  1 
ATOM 2889  C CG  . GLN A 1 369  ? 25.355  -49.076 -28.304  1.00 132.38 ? 1741 GLN B CG  1 
ATOM 2890  C CD  . GLN A 1 369  ? 24.417  -50.140 -27.752  1.00 133.28 ? 1741 GLN B CD  1 
ATOM 2891  O OE1 . GLN A 1 369  ? 24.438  -50.458 -26.561  1.00 135.59 ? 1741 GLN B OE1 1 
ATOM 2892  N NE2 . GLN A 1 369  ? 23.584  -50.696 -28.625  1.00 131.21 ? 1741 GLN B NE2 1 
ATOM 2893  N N   . GLU A 1 370  ? 27.108  -45.673 -27.181  1.00 111.99 ? 1742 GLU B N   1 
ATOM 2894  C CA  . GLU A 1 370  ? 26.750  -44.255 -27.278  1.00 108.30 ? 1742 GLU B CA  1 
ATOM 2895  C C   . GLU A 1 370  ? 27.772  -43.466 -28.102  1.00 100.39 ? 1742 GLU B C   1 
ATOM 2896  O O   . GLU A 1 370  ? 27.404  -42.535 -28.818  1.00 102.10 ? 1742 GLU B O   1 
ATOM 2897  C CB  . GLU A 1 370  ? 26.615  -43.635 -25.887  1.00 116.85 ? 1742 GLU B CB  1 
ATOM 2898  C CG  . GLU A 1 370  ? 25.443  -44.175 -25.081  1.00 127.26 ? 1742 GLU B CG  1 
ATOM 2899  C CD  . GLU A 1 370  ? 25.609  -43.967 -23.586  1.00 143.79 ? 1742 GLU B CD  1 
ATOM 2900  O OE1 . GLU A 1 370  ? 26.131  -42.905 -23.184  1.00 155.38 ? 1742 GLU B OE1 1 
ATOM 2901  O OE2 . GLU A 1 370  ? 25.217  -44.865 -22.809  1.00 151.28 ? 1742 GLU B OE2 1 
ATOM 2902  N N   . LEU A 1 371  ? 29.046  -43.842 -27.995  1.00 95.35  ? 1743 LEU B N   1 
ATOM 2903  C CA  . LEU A 1 371  ? 30.129  -43.200 -28.758  1.00 91.93  ? 1743 LEU B CA  1 
ATOM 2904  C C   . LEU A 1 371  ? 30.073  -43.539 -30.254  1.00 85.31  ? 1743 LEU B C   1 
ATOM 2905  O O   . LEU A 1 371  ? 30.406  -42.701 -31.092  1.00 82.43  ? 1743 LEU B O   1 
ATOM 2906  C CB  . LEU A 1 371  ? 31.505  -43.579 -28.181  1.00 95.47  ? 1743 LEU B CB  1 
ATOM 2907  C CG  . LEU A 1 371  ? 32.618  -42.531 -28.267  1.00 97.00  ? 1743 LEU B CG  1 
ATOM 2908  C CD1 . LEU A 1 371  ? 32.379  -41.400 -27.275  1.00 97.34  ? 1743 LEU B CD1 1 
ATOM 2909  C CD2 . LEU A 1 371  ? 33.976  -43.169 -28.010  1.00 100.11 ? 1743 LEU B CD2 1 
ATOM 2910  N N   . HIS A 1 372  ? 29.670  -44.765 -30.581  1.00 83.57  ? 1744 HIS B N   1 
ATOM 2911  C CA  . HIS A 1 372  ? 29.457  -45.169 -31.980  1.00 81.64  ? 1744 HIS B CA  1 
ATOM 2912  C C   . HIS A 1 372  ? 28.239  -44.478 -32.596  1.00 78.26  ? 1744 HIS B C   1 
ATOM 2913  O O   . HIS A 1 372  ? 28.287  -44.053 -33.750  1.00 74.53  ? 1744 HIS B O   1 
ATOM 2914  C CB  . HIS A 1 372  ? 29.290  -46.687 -32.094  1.00 84.24  ? 1744 HIS B CB  1 
ATOM 2915  C CG  . HIS A 1 372  ? 30.580  -47.440 -32.069  1.00 86.40  ? 1744 HIS B CG  1 
ATOM 2916  N ND1 . HIS A 1 372  ? 30.835  -48.500 -32.911  1.00 86.86  ? 1744 HIS B ND1 1 
ATOM 2917  C CD2 . HIS A 1 372  ? 31.691  -47.283 -31.313  1.00 91.95  ? 1744 HIS B CD2 1 
ATOM 2918  C CE1 . HIS A 1 372  ? 32.045  -48.970 -32.668  1.00 90.76  ? 1744 HIS B CE1 1 
ATOM 2919  N NE2 . HIS A 1 372  ? 32.586  -48.249 -31.703  1.00 94.03  ? 1744 HIS B NE2 1 
ATOM 2920  N N   . LYS A 1 373  ? 27.154  -44.382 -31.828  1.00 78.09  ? 1745 LYS B N   1 
ATOM 2921  C CA  . LYS A 1 373  ? 25.939  -43.691 -32.279  1.00 77.64  ? 1745 LYS B CA  1 
ATOM 2922  C C   . LYS A 1 373  ? 26.135  -42.184 -32.469  1.00 75.22  ? 1745 LYS B C   1 
ATOM 2923  O O   . LYS A 1 373  ? 25.461  -41.581 -33.309  1.00 75.93  ? 1745 LYS B O   1 
ATOM 2924  C CB  . LYS A 1 373  ? 24.768  -43.960 -31.327  1.00 81.62  ? 1745 LYS B CB  1 
ATOM 2925  C CG  . LYS A 1 373  ? 24.214  -45.366 -31.464  1.00 85.52  ? 1745 LYS B CG  1 
ATOM 2926  C CD  . LYS A 1 373  ? 23.214  -45.705 -30.374  1.00 88.64  ? 1745 LYS B CD  1 
ATOM 2927  C CE  . LYS A 1 373  ? 22.738  -47.144 -30.513  1.00 91.72  ? 1745 LYS B CE  1 
ATOM 2928  N NZ  . LYS A 1 373  ? 22.009  -47.610 -29.302  1.00 97.88  ? 1745 LYS B NZ  1 
ATOM 2929  N N   . LEU A 1 374  ? 27.042  -41.584 -31.694  1.00 73.07  ? 1746 LEU B N   1 
ATOM 2930  C CA  . LEU A 1 374  ? 27.431  -40.184 -31.899  1.00 70.70  ? 1746 LEU B CA  1 
ATOM 2931  C C   . LEU A 1 374  ? 28.196  -40.011 -33.208  1.00 69.56  ? 1746 LEU B C   1 
ATOM 2932  O O   . LEU A 1 374  ? 27.958  -39.052 -33.940  1.00 72.37  ? 1746 LEU B O   1 
ATOM 2933  C CB  . LEU A 1 374  ? 28.285  -39.668 -30.738  1.00 71.11  ? 1746 LEU B CB  1 
ATOM 2934  C CG  . LEU A 1 374  ? 28.695  -38.191 -30.789  1.00 71.45  ? 1746 LEU B CG  1 
ATOM 2935  C CD1 . LEU A 1 374  ? 27.496  -37.282 -30.583  1.00 71.68  ? 1746 LEU B CD1 1 
ATOM 2936  C CD2 . LEU A 1 374  ? 29.760  -37.892 -29.746  1.00 75.79  ? 1746 LEU B CD2 1 
ATOM 2937  N N   . MET A 1 375  ? 29.118  -40.930 -33.489  1.00 69.30  ? 1747 MET B N   1 
ATOM 2938  C CA  . MET A 1 375  ? 29.890  -40.898 -34.735  1.00 68.42  ? 1747 MET B CA  1 
ATOM 2939  C C   . MET A 1 375  ? 29.018  -41.018 -35.984  1.00 65.66  ? 1747 MET B C   1 
ATOM 2940  O O   . MET A 1 375  ? 29.296  -40.368 -36.992  1.00 64.36  ? 1747 MET B O   1 
ATOM 2941  C CB  . MET A 1 375  ? 30.957  -41.991 -34.751  1.00 69.47  ? 1747 MET B CB  1 
ATOM 2942  C CG  . MET A 1 375  ? 32.137  -41.696 -33.846  1.00 73.07  ? 1747 MET B CG  1 
ATOM 2943  S SD  . MET A 1 375  ? 33.156  -43.153 -33.569  1.00 78.77  ? 1747 MET B SD  1 
ATOM 2944  C CE  . MET A 1 375  ? 33.677  -43.532 -35.241  1.00 78.47  ? 1747 MET B CE  1 
ATOM 2945  N N   . ALA A 1 376  ? 27.971  -41.839 -35.916  1.00 65.75  ? 1748 ALA B N   1 
ATOM 2946  C CA  . ALA A 1 376  ? 27.017  -41.967 -37.027  1.00 64.87  ? 1748 ALA B CA  1 
ATOM 2947  C C   . ALA A 1 376  ? 26.358  -40.628 -37.351  1.00 64.15  ? 1748 ALA B C   1 
ATOM 2948  O O   . ALA A 1 376  ? 26.230  -40.250 -38.519  1.00 58.49  ? 1748 ALA B O   1 
ATOM 2949  C CB  . ALA A 1 376  ? 25.959  -43.013 -36.712  1.00 62.73  ? 1748 ALA B CB  1 
ATOM 2950  N N   . ARG A 1 377  ? 25.956  -39.916 -36.301  1.00 71.25  ? 1749 ARG B N   1 
ATOM 2951  C CA  . ARG A 1 377  ? 25.380  -38.578 -36.436  1.00 76.18  ? 1749 ARG B CA  1 
ATOM 2952  C C   . ARG A 1 377  ? 26.401  -37.560 -36.973  1.00 71.90  ? 1749 ARG B C   1 
ATOM 2953  O O   . ARG A 1 377  ? 26.028  -36.665 -37.728  1.00 76.67  ? 1749 ARG B O   1 
ATOM 2954  C CB  . ARG A 1 377  ? 24.773  -38.115 -35.101  1.00 83.41  ? 1749 ARG B CB  1 
ATOM 2955  C CG  . ARG A 1 377  ? 23.571  -38.949 -34.641  1.00 94.75  ? 1749 ARG B CG  1 
ATOM 2956  C CD  . ARG A 1 377  ? 23.363  -38.904 -33.127  1.00 112.82 ? 1749 ARG B CD  1 
ATOM 2957  N NE  . ARG A 1 377  ? 22.892  -37.597 -32.644  1.00 126.50 ? 1749 ARG B NE  1 
ATOM 2958  C CZ  . ARG A 1 377  ? 22.881  -37.193 -31.366  1.00 116.57 ? 1749 ARG B CZ  1 
ATOM 2959  N NH1 . ARG A 1 377  ? 23.327  -37.976 -30.379  1.00 105.31 ? 1749 ARG B NH1 1 
ATOM 2960  N NH2 . ARG A 1 377  ? 22.421  -35.976 -31.068  1.00 115.18 ? 1749 ARG B NH2 1 
ATOM 2961  N N   . CYS A 1 378  ? 27.674  -37.709 -36.598  1.00 67.13  ? 1750 CYS B N   1 
ATOM 2962  C CA  . CYS A 1 378  ? 28.766  -36.888 -37.156  1.00 63.81  ? 1750 CYS B CA  1 
ATOM 2963  C C   . CYS A 1 378  ? 29.040  -37.212 -38.624  1.00 62.86  ? 1750 CYS B C   1 
ATOM 2964  O O   . CYS A 1 378  ? 29.150  -36.303 -39.455  1.00 62.11  ? 1750 CYS B O   1 
ATOM 2965  C CB  . CYS A 1 378  ? 30.066  -37.082 -36.373  1.00 62.00  ? 1750 CYS B CB  1 
ATOM 2966  S SG  . CYS A 1 378  ? 30.007  -36.629 -34.630  1.00 62.29  ? 1750 CYS B SG  1 
ATOM 2967  N N   . PHE A 1 379  ? 29.177  -38.506 -38.920  1.00 61.80  ? 1751 PHE B N   1 
ATOM 2968  C CA  . PHE A 1 379  ? 29.367  -39.004 -40.295  1.00 59.88  ? 1751 PHE B CA  1 
ATOM 2969  C C   . PHE A 1 379  ? 28.272  -38.542 -41.258  1.00 57.58  ? 1751 PHE B C   1 
ATOM 2970  O O   . PHE A 1 379  ? 28.544  -38.281 -42.427  1.00 56.52  ? 1751 PHE B O   1 
ATOM 2971  C CB  . PHE A 1 379  ? 29.447  -40.542 -40.324  1.00 59.50  ? 1751 PHE B CB  1 
ATOM 2972  C CG  . PHE A 1 379  ? 30.836  -41.091 -40.136  1.00 61.00  ? 1751 PHE B CG  1 
ATOM 2973  C CD1 . PHE A 1 379  ? 31.141  -41.923 -39.061  1.00 62.72  ? 1751 PHE B CD1 1 
ATOM 2974  C CD2 . PHE A 1 379  ? 31.841  -40.792 -41.049  1.00 61.97  ? 1751 PHE B CD2 1 
ATOM 2975  C CE1 . PHE A 1 379  ? 32.423  -42.436 -38.896  1.00 64.99  ? 1751 PHE B CE1 1 
ATOM 2976  C CE2 . PHE A 1 379  ? 33.124  -41.301 -40.888  1.00 65.21  ? 1751 PHE B CE2 1 
ATOM 2977  C CZ  . PHE A 1 379  ? 33.416  -42.126 -39.811  1.00 65.24  ? 1751 PHE B CZ  1 
ATOM 2978  N N   . LEU A 1 380  ? 27.042  -38.444 -40.761  1.00 58.14  ? 1752 LEU B N   1 
ATOM 2979  C CA  . LEU A 1 380  ? 25.923  -37.936 -41.558  1.00 57.94  ? 1752 LEU B CA  1 
ATOM 2980  C C   . LEU A 1 380  ? 26.069  -36.439 -41.864  1.00 57.18  ? 1752 LEU B C   1 
ATOM 2981  O O   . LEU A 1 380  ? 25.787  -36.009 -42.979  1.00 59.60  ? 1752 LEU B O   1 
ATOM 2982  C CB  . LEU A 1 380  ? 24.588  -38.191 -40.851  1.00 58.46  ? 1752 LEU B CB  1 
ATOM 2983  C CG  . LEU A 1 380  ? 23.413  -38.408 -41.805  1.00 57.05  ? 1752 LEU B CG  1 
ATOM 2984  C CD1 . LEU A 1 380  ? 23.415  -39.841 -42.308  1.00 56.79  ? 1752 LEU B CD1 1 
ATOM 2985  C CD2 . LEU A 1 380  ? 22.087  -38.091 -41.132  1.00 58.22  ? 1752 LEU B CD2 1 
ATOM 2986  N N   . LYS A 1 381  ? 26.498  -35.658 -40.872  1.00 56.95  ? 1753 LYS B N   1 
ATOM 2987  C CA  . LYS A 1 381  ? 26.726  -34.219 -41.054  1.00 59.42  ? 1753 LYS B CA  1 
ATOM 2988  C C   . LYS A 1 381  ? 27.873  -33.930 -42.018  1.00 60.80  ? 1753 LYS B C   1 
ATOM 2989  O O   . LYS A 1 381  ? 27.778  -32.999 -42.821  1.00 61.00  ? 1753 LYS B O   1 
ATOM 2990  C CB  . LYS A 1 381  ? 26.989  -33.517 -39.712  1.00 63.40  ? 1753 LYS B CB  1 
ATOM 2991  C CG  . LYS A 1 381  ? 25.776  -33.438 -38.797  1.00 67.17  ? 1753 LYS B CG  1 
ATOM 2992  C CD  . LYS A 1 381  ? 24.785  -32.368 -39.235  1.00 69.34  ? 1753 LYS B CD  1 
ATOM 2993  C CE  . LYS A 1 381  ? 23.402  -32.620 -38.651  1.00 71.57  ? 1753 LYS B CE  1 
ATOM 2994  N NZ  . LYS A 1 381  ? 22.405  -31.616 -39.116  1.00 73.82  ? 1753 LYS B NZ  1 
ATOM 2995  N N   . LEU A 1 382  ? 28.950  -34.716 -41.935  1.00 61.38  ? 1754 LEU B N   1 
ATOM 2996  C CA  . LEU A 1 382  ? 30.084  -34.581 -42.863  1.00 61.22  ? 1754 LEU B CA  1 
ATOM 2997  C C   . LEU A 1 382  ? 29.635  -34.700 -44.317  1.00 63.09  ? 1754 LEU B C   1 
ATOM 2998  O O   . LEU A 1 382  ? 30.024  -33.884 -45.154  1.00 65.60  ? 1754 LEU B O   1 
ATOM 2999  C CB  . LEU A 1 382  ? 31.185  -35.614 -42.568  1.00 58.01  ? 1754 LEU B CB  1 
ATOM 3000  C CG  . LEU A 1 382  ? 32.100  -35.322 -41.373  1.00 56.50  ? 1754 LEU B CG  1 
ATOM 3001  C CD1 . LEU A 1 382  ? 32.916  -36.549 -41.008  1.00 55.76  ? 1754 LEU B CD1 1 
ATOM 3002  C CD2 . LEU A 1 382  ? 33.029  -34.151 -41.645  1.00 56.80  ? 1754 LEU B CD2 1 
ATOM 3003  N N   . GLY A 1 383  ? 28.809  -35.705 -44.601  1.00 61.96  ? 1755 GLY B N   1 
ATOM 3004  C CA  . GLY A 1 383  ? 28.255  -35.907 -45.939  1.00 62.56  ? 1755 GLY B CA  1 
ATOM 3005  C C   . GLY A 1 383  ? 27.341  -34.779 -46.381  1.00 61.52  ? 1755 GLY B C   1 
ATOM 3006  O O   . GLY A 1 383  ? 27.437  -34.298 -47.510  1.00 60.97  ? 1755 GLY B O   1 
ATOM 3007  N N   . GLU A 1 384  ? 26.456  -34.369 -45.476  1.00 63.11  ? 1756 GLU B N   1 
ATOM 3008  C CA  . GLU A 1 384  ? 25.524  -33.258 -45.693  1.00 68.31  ? 1756 GLU B CA  1 
ATOM 3009  C C   . GLU A 1 384  ? 26.251  -31.942 -45.979  1.00 68.22  ? 1756 GLU B C   1 
ATOM 3010  O O   . GLU A 1 384  ? 25.926  -31.235 -46.937  1.00 71.85  ? 1756 GLU B O   1 
ATOM 3011  C CB  . GLU A 1 384  ? 24.637  -33.108 -44.450  1.00 74.95  ? 1756 GLU B CB  1 
ATOM 3012  C CG  . GLU A 1 384  ? 23.586  -32.004 -44.492  1.00 83.25  ? 1756 GLU B CG  1 
ATOM 3013  C CD  . GLU A 1 384  ? 22.872  -31.845 -43.159  1.00 88.94  ? 1756 GLU B CD  1 
ATOM 3014  O OE1 . GLU A 1 384  ? 22.515  -32.882 -42.548  1.00 86.52  ? 1756 GLU B OE1 1 
ATOM 3015  O OE2 . GLU A 1 384  ? 22.673  -30.684 -42.721  1.00 88.72  ? 1756 GLU B OE2 1 
ATOM 3016  N N   . TRP A 1 385  ? 27.232  -31.633 -45.138  1.00 64.68  ? 1757 TRP B N   1 
ATOM 3017  C CA  . TRP A 1 385  ? 28.017  -30.402 -45.249  1.00 62.83  ? 1757 TRP B CA  1 
ATOM 3018  C C   . TRP A 1 385  ? 28.966  -30.381 -46.451  1.00 60.83  ? 1757 TRP B C   1 
ATOM 3019  O O   . TRP A 1 385  ? 29.186  -29.326 -47.047  1.00 60.06  ? 1757 TRP B O   1 
ATOM 3020  C CB  . TRP A 1 385  ? 28.822  -30.181 -43.967  1.00 63.16  ? 1757 TRP B CB  1 
ATOM 3021  C CG  . TRP A 1 385  ? 27.985  -29.924 -42.737  1.00 60.41  ? 1757 TRP B CG  1 
ATOM 3022  C CD1 . TRP A 1 385  ? 26.633  -29.741 -42.676  1.00 59.38  ? 1757 TRP B CD1 1 
ATOM 3023  C CD2 . TRP A 1 385  ? 28.464  -29.810 -41.394  1.00 59.25  ? 1757 TRP B CD2 1 
ATOM 3024  N NE1 . TRP A 1 385  ? 26.242  -29.526 -41.377  1.00 60.07  ? 1757 TRP B NE1 1 
ATOM 3025  C CE2 . TRP A 1 385  ? 27.346  -29.562 -40.569  1.00 59.44  ? 1757 TRP B CE2 1 
ATOM 3026  C CE3 . TRP A 1 385  ? 29.732  -29.892 -40.807  1.00 59.78  ? 1757 TRP B CE3 1 
ATOM 3027  C CZ2 . TRP A 1 385  ? 27.458  -29.397 -39.184  1.00 59.80  ? 1757 TRP B CZ2 1 
ATOM 3028  C CZ3 . TRP A 1 385  ? 29.845  -29.729 -39.428  1.00 61.05  ? 1757 TRP B CZ3 1 
ATOM 3029  C CH2 . TRP A 1 385  ? 28.712  -29.484 -38.633  1.00 61.35  ? 1757 TRP B CH2 1 
ATOM 3030  N N   . GLN A 1 386  ? 29.543  -31.534 -46.782  1.00 61.47  ? 1758 GLN B N   1 
ATOM 3031  C CA  . GLN A 1 386  ? 30.372  -31.689 -47.985  1.00 65.08  ? 1758 GLN B CA  1 
ATOM 3032  C C   . GLN A 1 386  ? 29.586  -31.310 -49.243  1.00 66.34  ? 1758 GLN B C   1 
ATOM 3033  O O   . GLN A 1 386  ? 30.115  -30.631 -50.130  1.00 67.56  ? 1758 GLN B O   1 
ATOM 3034  C CB  . GLN A 1 386  ? 30.881  -33.135 -48.092  1.00 65.67  ? 1758 GLN B CB  1 
ATOM 3035  C CG  . GLN A 1 386  ? 31.679  -33.474 -49.345  1.00 67.29  ? 1758 GLN B CG  1 
ATOM 3036  C CD  . GLN A 1 386  ? 33.104  -32.981 -49.277  1.00 67.97  ? 1758 GLN B CD  1 
ATOM 3037  O OE1 . GLN A 1 386  ? 33.438  -31.936 -49.836  1.00 67.93  ? 1758 GLN B OE1 1 
ATOM 3038  N NE2 . GLN A 1 386  ? 33.955  -33.733 -48.584  1.00 68.01  ? 1758 GLN B NE2 1 
ATOM 3039  N N   . LEU A 1 387  ? 28.332  -31.758 -49.306  1.00 66.03  ? 1759 LEU B N   1 
ATOM 3040  C CA  . LEU A 1 387  ? 27.437  -31.445 -50.426  1.00 66.80  ? 1759 LEU B CA  1 
ATOM 3041  C C   . LEU A 1 387  ? 27.083  -29.966 -50.484  1.00 64.58  ? 1759 LEU B C   1 
ATOM 3042  O O   . LEU A 1 387  ? 27.040  -29.379 -51.567  1.00 64.23  ? 1759 LEU B O   1 
ATOM 3043  C CB  . LEU A 1 387  ? 26.148  -32.271 -50.342  1.00 67.03  ? 1759 LEU B CB  1 
ATOM 3044  C CG  . LEU A 1 387  ? 26.323  -33.782 -50.515  1.00 67.65  ? 1759 LEU B CG  1 
ATOM 3045  C CD1 . LEU A 1 387  ? 25.123  -34.532 -49.960  1.00 68.25  ? 1759 LEU B CD1 1 
ATOM 3046  C CD2 . LEU A 1 387  ? 26.576  -34.144 -51.971  1.00 68.28  ? 1759 LEU B CD2 1 
ATOM 3047  N N   . ASN A 1 388  ? 26.827  -29.377 -49.319  1.00 63.45  ? 1760 ASN B N   1 
ATOM 3048  C CA  . ASN A 1 388  ? 26.496  -27.955 -49.218  1.00 64.80  ? 1760 ASN B CA  1 
ATOM 3049  C C   . ASN A 1 388  ? 27.656  -27.052 -49.657  1.00 68.07  ? 1760 ASN B C   1 
ATOM 3050  O O   . ASN A 1 388  ? 27.434  -26.026 -50.301  1.00 75.19  ? 1760 ASN B O   1 
ATOM 3051  C CB  . ASN A 1 388  ? 26.068  -27.607 -47.791  1.00 62.65  ? 1760 ASN B CB  1 
ATOM 3052  C CG  . ASN A 1 388  ? 25.352  -26.277 -47.705  1.00 66.28  ? 1760 ASN B CG  1 
ATOM 3053  O OD1 . ASN A 1 388  ? 24.137  -26.229 -47.526  1.00 70.70  ? 1760 ASN B OD1 1 
ATOM 3054  N ND2 . ASN A 1 388  ? 26.098  -25.190 -47.843  1.00 69.26  ? 1760 ASN B ND2 1 
ATOM 3055  N N   . LEU A 1 389  ? 28.880  -27.437 -49.310  1.00 66.64  ? 1761 LEU B N   1 
ATOM 3056  C CA  . LEU A 1 389  ? 30.057  -26.643 -49.646  1.00 70.68  ? 1761 LEU B CA  1 
ATOM 3057  C C   . LEU A 1 389  ? 30.460  -26.790 -51.113  1.00 75.33  ? 1761 LEU B C   1 
ATOM 3058  O O   . LEU A 1 389  ? 30.661  -25.787 -51.801  1.00 80.75  ? 1761 LEU B O   1 
ATOM 3059  C CB  . LEU A 1 389  ? 31.232  -27.017 -48.738  1.00 70.95  ? 1761 LEU B CB  1 
ATOM 3060  C CG  . LEU A 1 389  ? 31.090  -26.571 -47.277  1.00 68.62  ? 1761 LEU B CG  1 
ATOM 3061  C CD1 . LEU A 1 389  ? 31.947  -27.432 -46.359  1.00 69.57  ? 1761 LEU B CD1 1 
ATOM 3062  C CD2 . LEU A 1 389  ? 31.444  -25.100 -47.113  1.00 67.12  ? 1761 LEU B CD2 1 
ATOM 3063  N N   . GLN A 1 390  ? 30.571  -28.034 -51.580  1.00 75.80  ? 1762 GLN B N   1 
ATOM 3064  C CA  . GLN A 1 390  ? 31.109  -28.331 -52.914  1.00 79.38  ? 1762 GLN B CA  1 
ATOM 3065  C C   . GLN A 1 390  ? 30.040  -28.613 -53.977  1.00 77.48  ? 1762 GLN B C   1 
ATOM 3066  O O   . GLN A 1 390  ? 30.130  -28.095 -55.091  1.00 80.43  ? 1762 GLN B O   1 
ATOM 3067  C CB  . GLN A 1 390  ? 32.069  -29.521 -52.834  1.00 81.99  ? 1762 GLN B CB  1 
ATOM 3068  C CG  . GLN A 1 390  ? 33.230  -29.355 -51.861  1.00 86.93  ? 1762 GLN B CG  1 
ATOM 3069  C CD  . GLN A 1 390  ? 34.206  -28.247 -52.233  1.00 96.12  ? 1762 GLN B CD  1 
ATOM 3070  O OE1 . GLN A 1 390  ? 34.167  -27.693 -53.333  1.00 105.26 ? 1762 GLN B OE1 1 
ATOM 3071  N NE2 . GLN A 1 390  ? 35.104  -27.932 -51.311  1.00 101.93 ? 1762 GLN B NE2 1 
ATOM 3072  N N   . GLY A 1 391  ? 29.052  -29.442 -53.636  1.00 72.07  ? 1763 GLY B N   1 
ATOM 3073  C CA  . GLY A 1 391  ? 28.003  -29.867 -54.575  1.00 70.21  ? 1763 GLY B CA  1 
ATOM 3074  C C   . GLY A 1 391  ? 28.157  -31.319 -54.990  1.00 69.21  ? 1763 GLY B C   1 
ATOM 3075  O O   . GLY A 1 391  ? 29.023  -32.028 -54.479  1.00 69.02  ? 1763 GLY B O   1 
ATOM 3076  N N   . ILE A 1 392  ? 27.307  -31.764 -55.913  1.00 70.75  ? 1764 ILE B N   1 
ATOM 3077  C CA  . ILE A 1 392  ? 27.380  -33.128 -56.445  1.00 73.18  ? 1764 ILE B CA  1 
ATOM 3078  C C   . ILE A 1 392  ? 28.249  -33.130 -57.706  1.00 72.97  ? 1764 ILE B C   1 
ATOM 3079  O O   . ILE A 1 392  ? 27.922  -32.464 -58.690  1.00 73.29  ? 1764 ILE B O   1 
ATOM 3080  C CB  . ILE A 1 392  ? 25.976  -33.706 -56.740  1.00 78.70  ? 1764 ILE B CB  1 
ATOM 3081  C CG1 . ILE A 1 392  ? 25.150  -33.759 -55.444  1.00 79.41  ? 1764 ILE B CG1 1 
ATOM 3082  C CG2 . ILE A 1 392  ? 26.086  -35.108 -57.345  1.00 83.08  ? 1764 ILE B CG2 1 
ATOM 3083  C CD1 . ILE A 1 392  ? 23.699  -34.170 -55.605  1.00 79.11  ? 1764 ILE B CD1 1 
ATOM 3084  N N   . ASN A 1 393  ? 29.349  -33.882 -57.664  1.00 71.54  ? 1765 ASN B N   1 
ATOM 3085  C CA  . ASN A 1 393  ? 30.279  -33.990 -58.795  1.00 73.37  ? 1765 ASN B CA  1 
ATOM 3086  C C   . ASN A 1 393  ? 31.192  -35.215 -58.665  1.00 74.74  ? 1765 ASN B C   1 
ATOM 3087  O O   . ASN A 1 393  ? 31.175  -35.897 -57.640  1.00 71.42  ? 1765 ASN B O   1 
ATOM 3088  C CB  . ASN A 1 393  ? 31.107  -32.701 -58.934  1.00 73.81  ? 1765 ASN B CB  1 
ATOM 3089  C CG  . ASN A 1 393  ? 31.898  -32.367 -57.681  1.00 70.97  ? 1765 ASN B CG  1 
ATOM 3090  O OD1 . ASN A 1 393  ? 32.737  -33.147 -57.236  1.00 69.98  ? 1765 ASN B OD1 1 
ATOM 3091  N ND2 . ASN A 1 393  ? 31.643  -31.194 -57.115  1.00 70.34  ? 1765 ASN B ND2 1 
ATOM 3092  N N   . GLU A 1 394  ? 31.983  -35.469 -59.711  1.00 81.72  ? 1766 GLU B N   1 
ATOM 3093  C CA  . GLU A 1 394  ? 32.917  -36.613 -59.795  1.00 86.33  ? 1766 GLU B CA  1 
ATOM 3094  C C   . GLU A 1 394  ? 33.758  -36.895 -58.541  1.00 81.60  ? 1766 GLU B C   1 
ATOM 3095  O O   . GLU A 1 394  ? 34.007  -38.061 -58.218  1.00 79.62  ? 1766 GLU B O   1 
ATOM 3096  C CB  . GLU A 1 394  ? 33.863  -36.426 -60.991  1.00 97.77  ? 1766 GLU B CB  1 
ATOM 3097  C CG  . GLU A 1 394  ? 33.233  -36.732 -62.348  1.00 107.79 ? 1766 GLU B CG  1 
ATOM 3098  C CD  . GLU A 1 394  ? 33.374  -38.188 -62.779  1.00 117.50 ? 1766 GLU B CD  1 
ATOM 3099  O OE1 . GLU A 1 394  ? 33.567  -39.070 -61.912  1.00 122.45 ? 1766 GLU B OE1 1 
ATOM 3100  O OE2 . GLU A 1 394  ? 33.289  -38.454 -64.001  1.00 121.38 ? 1766 GLU B OE2 1 
ATOM 3101  N N   . SER A 1 395  ? 34.197  -35.837 -57.858  1.00 78.81  ? 1767 SER B N   1 
ATOM 3102  C CA  . SER A 1 395  ? 35.041  -35.963 -56.663  1.00 78.28  ? 1767 SER B CA  1 
ATOM 3103  C C   . SER A 1 395  ? 34.249  -36.114 -55.353  1.00 72.39  ? 1767 SER B C   1 
ATOM 3104  O O   . SER A 1 395  ? 34.675  -36.860 -54.469  1.00 71.81  ? 1767 SER B O   1 
ATOM 3105  C CB  . SER A 1 395  ? 36.023  -34.783 -56.569  1.00 82.78  ? 1767 SER B CB  1 
ATOM 3106  O OG  . SER A 1 395  ? 35.368  -33.542 -56.758  1.00 86.50  ? 1767 SER B OG  1 
ATOM 3107  N N   . THR A 1 396  ? 33.113  -35.422 -55.227  1.00 69.22  ? 1768 THR B N   1 
ATOM 3108  C CA  . THR A 1 396  ? 32.311  -35.453 -53.985  1.00 65.46  ? 1768 THR B CA  1 
ATOM 3109  C C   . THR A 1 396  ? 31.494  -36.727 -53.777  1.00 64.25  ? 1768 THR B C   1 
ATOM 3110  O O   . THR A 1 396  ? 31.335  -37.166 -52.638  1.00 62.08  ? 1768 THR B O   1 
ATOM 3111  C CB  . THR A 1 396  ? 31.337  -34.261 -53.882  1.00 61.88  ? 1768 THR B CB  1 
ATOM 3112  O OG1 . THR A 1 396  ? 30.533  -34.186 -55.064  1.00 61.78  ? 1768 THR B OG1 1 
ATOM 3113  C CG2 . THR A 1 396  ? 32.100  -32.971 -53.700  1.00 63.25  ? 1768 THR B CG2 1 
ATOM 3114  N N   . ILE A 1 397  ? 30.979  -37.304 -54.864  1.00 65.34  ? 1769 ILE B N   1 
ATOM 3115  C CA  . ILE A 1 397  ? 30.104  -38.493 -54.806  1.00 66.82  ? 1769 ILE B CA  1 
ATOM 3116  C C   . ILE A 1 397  ? 30.673  -39.659 -53.973  1.00 66.72  ? 1769 ILE B C   1 
ATOM 3117  O O   . ILE A 1 397  ? 29.978  -40.159 -53.085  1.00 62.73  ? 1769 ILE B O   1 
ATOM 3118  C CB  . ILE A 1 397  ? 29.689  -38.971 -56.229  1.00 70.03  ? 1769 ILE B CB  1 
ATOM 3119  C CG1 . ILE A 1 397  ? 28.686  -37.984 -56.839  1.00 72.43  ? 1769 ILE B CG1 1 
ATOM 3120  C CG2 . ILE A 1 397  ? 29.066  -40.370 -56.208  1.00 68.79  ? 1769 ILE B CG2 1 
ATOM 3121  C CD1 . ILE A 1 397  ? 28.593  -38.044 -58.349  1.00 75.62  ? 1769 ILE B CD1 1 
ATOM 3122  N N   . PRO A 1 398  ? 31.920  -40.100 -54.258  1.00 68.42  ? 1770 PRO B N   1 
ATOM 3123  C CA  . PRO A 1 398  ? 32.475  -41.195 -53.449  1.00 69.42  ? 1770 PRO B CA  1 
ATOM 3124  C C   . PRO A 1 398  ? 32.818  -40.807 -52.004  1.00 69.40  ? 1770 PRO B C   1 
ATOM 3125  O O   . PRO A 1 398  ? 32.782  -41.673 -51.128  1.00 69.48  ? 1770 PRO B O   1 
ATOM 3126  C CB  . PRO A 1 398  ? 33.730  -41.614 -54.222  1.00 71.62  ? 1770 PRO B CB  1 
ATOM 3127  C CG  . PRO A 1 398  ? 34.105  -40.421 -55.022  1.00 71.94  ? 1770 PRO B CG  1 
ATOM 3128  C CD  . PRO A 1 398  ? 32.823  -39.729 -55.365  1.00 69.57  ? 1770 PRO B CD  1 
ATOM 3129  N N   . LYS A 1 399  ? 33.138  -39.533 -51.762  1.00 70.26  ? 1771 LYS B N   1 
ATOM 3130  C CA  . LYS A 1 399  ? 33.429  -39.042 -50.406  1.00 73.36  ? 1771 LYS B CA  1 
ATOM 3131  C C   . LYS A 1 399  ? 32.201  -39.081 -49.499  1.00 69.90  ? 1771 LYS B C   1 
ATOM 3132  O O   . LYS A 1 399  ? 32.267  -39.592 -48.376  1.00 66.89  ? 1771 LYS B O   1 
ATOM 3133  C CB  . LYS A 1 399  ? 33.977  -37.610 -50.438  1.00 77.47  ? 1771 LYS B CB  1 
ATOM 3134  C CG  . LYS A 1 399  ? 35.352  -37.482 -51.067  1.00 86.27  ? 1771 LYS B CG  1 
ATOM 3135  C CD  . LYS A 1 399  ? 35.856  -36.051 -50.975  1.00 88.84  ? 1771 LYS B CD  1 
ATOM 3136  C CE  . LYS A 1 399  ? 37.251  -35.905 -51.561  1.00 88.87  ? 1771 LYS B CE  1 
ATOM 3137  N NZ  . LYS A 1 399  ? 37.841  -34.579 -51.230  1.00 87.83  ? 1771 LYS B NZ  1 
ATOM 3138  N N   . VAL A 1 400  ? 31.095  -38.520 -49.988  1.00 67.75  ? 1772 VAL B N   1 
ATOM 3139  C CA  . VAL A 1 400  ? 29.836  -38.491 -49.223  1.00 65.50  ? 1772 VAL B CA  1 
ATOM 3140  C C   . VAL A 1 400  ? 29.200  -39.877 -49.088  1.00 64.10  ? 1772 VAL B C   1 
ATOM 3141  O O   . VAL A 1 400  ? 28.554  -40.163 -48.077  1.00 66.28  ? 1772 VAL B O   1 
ATOM 3142  C CB  . VAL A 1 400  ? 28.804  -37.476 -49.775  1.00 65.31  ? 1772 VAL B CB  1 
ATOM 3143  C CG1 . VAL A 1 400  ? 29.365  -36.068 -49.719  1.00 65.86  ? 1772 VAL B CG1 1 
ATOM 3144  C CG2 . VAL A 1 400  ? 28.378  -37.810 -51.193  1.00 71.57  ? 1772 VAL B CG2 1 
ATOM 3145  N N   . LEU A 1 401  ? 29.383  -40.732 -50.095  1.00 61.09  ? 1773 LEU B N   1 
ATOM 3146  C CA  . LEU A 1 401  ? 28.993  -42.137 -49.977  1.00 59.54  ? 1773 LEU B CA  1 
ATOM 3147  C C   . LEU A 1 401  ? 29.818  -42.823 -48.892  1.00 62.57  ? 1773 LEU B C   1 
ATOM 3148  O O   . LEU A 1 401  ? 29.259  -43.516 -48.045  1.00 64.13  ? 1773 LEU B O   1 
ATOM 3149  C CB  . LEU A 1 401  ? 29.141  -42.878 -51.311  1.00 58.17  ? 1773 LEU B CB  1 
ATOM 3150  C CG  . LEU A 1 401  ? 28.069  -42.594 -52.364  1.00 56.06  ? 1773 LEU B CG  1 
ATOM 3151  C CD1 . LEU A 1 401  ? 28.499  -43.113 -53.727  1.00 57.26  ? 1773 LEU B CD1 1 
ATOM 3152  C CD2 . LEU A 1 401  ? 26.731  -43.199 -51.975  1.00 54.64  ? 1773 LEU B CD2 1 
ATOM 3153  N N   . GLN A 1 402  ? 31.137  -42.614 -48.925  1.00 66.82  ? 1774 GLN B N   1 
ATOM 3154  C CA  . GLN A 1 402  ? 32.056  -43.100 -47.874  1.00 71.12  ? 1774 GLN B CA  1 
ATOM 3155  C C   . GLN A 1 402  ? 31.632  -42.616 -46.476  1.00 66.45  ? 1774 GLN B C   1 
ATOM 3156  O O   . GLN A 1 402  ? 31.700  -43.377 -45.506  1.00 62.34  ? 1774 GLN B O   1 
ATOM 3157  C CB  . GLN A 1 402  ? 33.520  -42.707 -48.206  1.00 79.26  ? 1774 GLN B CB  1 
ATOM 3158  C CG  . GLN A 1 402  ? 34.541  -42.691 -47.062  1.00 86.21  ? 1774 GLN B CG  1 
ATOM 3159  C CD  . GLN A 1 402  ? 34.829  -44.056 -46.456  1.00 93.80  ? 1774 GLN B CD  1 
ATOM 3160  O OE1 . GLN A 1 402  ? 34.179  -45.055 -46.772  1.00 90.97  ? 1774 GLN B OE1 1 
ATOM 3161  N NE2 . GLN A 1 402  ? 35.820  -44.100 -45.569  1.00 101.29 ? 1774 GLN B NE2 1 
ATOM 3162  N N   . TYR A 1 403  ? 31.195  -41.358 -46.393  1.00 64.25  ? 1775 TYR B N   1 
ATOM 3163  C CA  . TYR A 1 403  ? 30.666  -40.791 -45.150  1.00 61.96  ? 1775 TYR B CA  1 
ATOM 3164  C C   . TYR A 1 403  ? 29.328  -41.422 -44.739  1.00 59.05  ? 1775 TYR B C   1 
ATOM 3165  O O   . TYR A 1 403  ? 29.186  -41.879 -43.604  1.00 55.58  ? 1775 TYR B O   1 
ATOM 3166  C CB  . TYR A 1 403  ? 30.497  -39.262 -45.262  1.00 62.69  ? 1775 TYR B CB  1 
ATOM 3167  C CG  . TYR A 1 403  ? 31.772  -38.432 -45.180  1.00 65.33  ? 1775 TYR B CG  1 
ATOM 3168  C CD1 . TYR A 1 403  ? 31.945  -37.309 -45.995  1.00 66.77  ? 1775 TYR B CD1 1 
ATOM 3169  C CD2 . TYR A 1 403  ? 32.793  -38.742 -44.272  1.00 67.53  ? 1775 TYR B CD2 1 
ATOM 3170  C CE1 . TYR A 1 403  ? 33.098  -36.535 -45.920  1.00 69.09  ? 1775 TYR B CE1 1 
ATOM 3171  C CE2 . TYR A 1 403  ? 33.949  -37.977 -44.197  1.00 68.63  ? 1775 TYR B CE2 1 
ATOM 3172  C CZ  . TYR A 1 403  ? 34.098  -36.877 -45.017  1.00 68.93  ? 1775 TYR B CZ  1 
ATOM 3173  O OH  . TYR A 1 403  ? 35.250  -36.129 -44.930  1.00 69.22  ? 1775 TYR B OH  1 
ATOM 3174  N N   . TYR A 1 404  ? 28.356  -41.435 -45.654  1.00 57.98  ? 1776 TYR B N   1 
ATOM 3175  C CA  . TYR A 1 404  ? 27.027  -41.994 -45.361  1.00 55.76  ? 1776 TYR B CA  1 
ATOM 3176  C C   . TYR A 1 404  ? 27.055  -43.494 -45.076  1.00 59.82  ? 1776 TYR B C   1 
ATOM 3177  O O   . TYR A 1 404  ? 26.304  -43.969 -44.224  1.00 63.02  ? 1776 TYR B O   1 
ATOM 3178  C CB  . TYR A 1 404  ? 26.028  -41.730 -46.494  1.00 51.89  ? 1776 TYR B CB  1 
ATOM 3179  C CG  . TYR A 1 404  ? 25.554  -40.295 -46.656  1.00 51.10  ? 1776 TYR B CG  1 
ATOM 3180  C CD1 . TYR A 1 404  ? 25.271  -39.787 -47.926  1.00 52.72  ? 1776 TYR B CD1 1 
ATOM 3181  C CD2 . TYR A 1 404  ? 25.365  -39.447 -45.559  1.00 49.31  ? 1776 TYR B CD2 1 
ATOM 3182  C CE1 . TYR A 1 404  ? 24.830  -38.485 -48.101  1.00 51.72  ? 1776 TYR B CE1 1 
ATOM 3183  C CE2 . TYR A 1 404  ? 24.922  -38.144 -45.729  1.00 48.77  ? 1776 TYR B CE2 1 
ATOM 3184  C CZ  . TYR A 1 404  ? 24.656  -37.669 -47.001  1.00 49.67  ? 1776 TYR B CZ  1 
ATOM 3185  O OH  . TYR A 1 404  ? 24.216  -36.382 -47.188  1.00 49.16  ? 1776 TYR B OH  1 
ATOM 3186  N N   . SER A 1 405  ? 27.904  -44.238 -45.785  1.00 62.77  ? 1777 SER B N   1 
ATOM 3187  C CA  . SER A 1 405  ? 28.067  -45.668 -45.513  1.00 63.25  ? 1777 SER B CA  1 
ATOM 3188  C C   . SER A 1 405  ? 28.596  -45.878 -44.096  1.00 62.80  ? 1777 SER B C   1 
ATOM 3189  O O   . SER A 1 405  ? 28.122  -46.765 -43.397  1.00 63.19  ? 1777 SER B O   1 
ATOM 3190  C CB  . SER A 1 405  ? 28.979  -46.351 -46.540  1.00 66.63  ? 1777 SER B CB  1 
ATOM 3191  O OG  . SER A 1 405  ? 30.345  -46.046 -46.319  1.00 73.92  ? 1777 SER B OG  1 
ATOM 3192  N N   . ALA A 1 406  ? 29.554  -45.046 -43.679  1.00 63.25  ? 1778 ALA B N   1 
ATOM 3193  C CA  . ALA A 1 406  ? 30.109  -45.098 -42.317  1.00 66.34  ? 1778 ALA B CA  1 
ATOM 3194  C C   . ALA A 1 406  ? 29.042  -44.886 -41.242  1.00 66.51  ? 1778 ALA B C   1 
ATOM 3195  O O   . ALA A 1 406  ? 29.045  -45.569 -40.218  1.00 66.80  ? 1778 ALA B O   1 
ATOM 3196  C CB  . ALA A 1 406  ? 31.231  -44.082 -42.150  1.00 67.71  ? 1778 ALA B CB  1 
ATOM 3197  N N   . ALA A 1 407  ? 28.126  -43.951 -41.484  1.00 66.71  ? 1779 ALA B N   1 
ATOM 3198  C CA  . ALA A 1 407  ? 26.979  -43.753 -40.596  1.00 68.25  ? 1779 ALA B CA  1 
ATOM 3199  C C   . ALA A 1 407  ? 26.115  -45.014 -40.541  1.00 70.68  ? 1779 ALA B C   1 
ATOM 3200  O O   . ALA A 1 407  ? 25.681  -45.437 -39.466  1.00 73.55  ? 1779 ALA B O   1 
ATOM 3201  C CB  . ALA A 1 407  ? 26.156  -42.557 -41.049  1.00 67.80  ? 1779 ALA B CB  1 
ATOM 3202  N N   . THR A 1 408  ? 25.889  -45.606 -41.712  1.00 71.32  ? 1780 THR B N   1 
ATOM 3203  C CA  . THR A 1 408  ? 25.206  -46.899 -41.840  1.00 74.98  ? 1780 THR B CA  1 
ATOM 3204  C C   . THR A 1 408  ? 25.871  -48.029 -41.019  1.00 78.87  ? 1780 THR B C   1 
ATOM 3205  O O   . THR A 1 408  ? 25.170  -48.884 -40.473  1.00 80.58  ? 1780 THR B O   1 
ATOM 3206  C CB  . THR A 1 408  ? 25.023  -47.274 -43.346  1.00 76.25  ? 1780 THR B CB  1 
ATOM 3207  O OG1 . THR A 1 408  ? 23.668  -47.016 -43.731  1.00 75.06  ? 1780 THR B OG1 1 
ATOM 3208  C CG2 . THR A 1 408  ? 25.373  -48.744 -43.664  1.00 79.98  ? 1780 THR B CG2 1 
ATOM 3209  N N   . GLU A 1 409  ? 27.204  -48.032 -40.945  1.00 80.39  ? 1781 GLU B N   1 
ATOM 3210  C CA  . GLU A 1 409  ? 27.939  -49.001 -40.114  1.00 81.54  ? 1781 GLU B CA  1 
ATOM 3211  C C   . GLU A 1 409  ? 27.720  -48.714 -38.630  1.00 78.50  ? 1781 GLU B C   1 
ATOM 3212  O O   . GLU A 1 409  ? 27.412  -49.624 -37.862  1.00 86.41  ? 1781 GLU B O   1 
ATOM 3213  C CB  . GLU A 1 409  ? 29.459  -48.981 -40.379  1.00 89.02  ? 1781 GLU B CB  1 
ATOM 3214  C CG  . GLU A 1 409  ? 29.943  -49.157 -41.819  1.00 94.56  ? 1781 GLU B CG  1 
ATOM 3215  C CD  . GLU A 1 409  ? 29.520  -50.464 -42.462  1.00 102.95 ? 1781 GLU B CD  1 
ATOM 3216  O OE1 . GLU A 1 409  ? 28.325  -50.619 -42.796  1.00 111.08 ? 1781 GLU B OE1 1 
ATOM 3217  O OE2 . GLU A 1 409  ? 30.396  -51.330 -42.664  1.00 110.88 ? 1781 GLU B OE2 1 
ATOM 3218  N N   . HIS A 1 410  ? 27.877  -47.448 -38.240  1.00 72.03  ? 1782 HIS B N   1 
ATOM 3219  C CA  . HIS A 1 410  ? 27.961  -47.070 -36.821  1.00 71.71  ? 1782 HIS B CA  1 
ATOM 3220  C C   . HIS A 1 410  ? 26.633  -47.029 -36.048  1.00 70.50  ? 1782 HIS B C   1 
ATOM 3221  O O   . HIS A 1 410  ? 26.638  -47.140 -34.817  1.00 67.04  ? 1782 HIS B O   1 
ATOM 3222  C CB  . HIS A 1 410  ? 28.723  -45.748 -36.670  1.00 70.81  ? 1782 HIS B CB  1 
ATOM 3223  C CG  . HIS A 1 410  ? 30.202  -45.890 -36.859  1.00 72.43  ? 1782 HIS B CG  1 
ATOM 3224  N ND1 . HIS A 1 410  ? 30.997  -46.579 -35.969  1.00 75.82  ? 1782 HIS B ND1 1 
ATOM 3225  C CD2 . HIS A 1 410  ? 31.028  -45.448 -37.836  1.00 71.68  ? 1782 HIS B CD2 1 
ATOM 3226  C CE1 . HIS A 1 410  ? 32.249  -46.551 -36.387  1.00 77.74  ? 1782 HIS B CE1 1 
ATOM 3227  N NE2 . HIS A 1 410  ? 32.296  -45.870 -37.518  1.00 73.85  ? 1782 HIS B NE2 1 
ATOM 3228  N N   . ASP A 1 411  ? 25.514  -46.857 -36.754  1.00 71.14  ? 1783 ASP B N   1 
ATOM 3229  C CA  . ASP A 1 411  ? 24.181  -47.066 -36.165  1.00 71.99  ? 1783 ASP B CA  1 
ATOM 3230  C C   . ASP A 1 411  ? 23.291  -47.802 -37.171  1.00 70.06  ? 1783 ASP B C   1 
ATOM 3231  O O   . ASP A 1 411  ? 22.479  -47.197 -37.874  1.00 65.57  ? 1783 ASP B O   1 
ATOM 3232  C CB  . ASP A 1 411  ? 23.556  -45.740 -35.702  1.00 72.37  ? 1783 ASP B CB  1 
ATOM 3233  C CG  . ASP A 1 411  ? 22.360  -45.934 -34.760  1.00 71.71  ? 1783 ASP B CG  1 
ATOM 3234  O OD1 . ASP A 1 411  ? 22.013  -47.085 -34.413  1.00 69.86  ? 1783 ASP B OD1 1 
ATOM 3235  O OD2 . ASP A 1 411  ? 21.763  -44.911 -34.357  1.00 72.60  ? 1783 ASP B OD2 1 
ATOM 3236  N N   . ARG A 1 412  ? 23.480  -49.123 -37.214  1.00 74.97  ? 1784 ARG B N   1 
ATOM 3237  C CA  . ARG A 1 412  ? 22.785  -50.043 -38.132  1.00 74.59  ? 1784 ARG B CA  1 
ATOM 3238  C C   . ARG A 1 412  ? 21.272  -49.849 -38.208  1.00 71.14  ? 1784 ARG B C   1 
ATOM 3239  O O   . ARG A 1 412  ? 20.692  -49.920 -39.291  1.00 66.74  ? 1784 ARG B O   1 
ATOM 3240  C CB  . ARG A 1 412  ? 23.096  -51.500 -37.750  1.00 80.79  ? 1784 ARG B CB  1 
ATOM 3241  C CG  . ARG A 1 412  ? 24.409  -52.008 -38.326  1.00 90.19  ? 1784 ARG B CG  1 
ATOM 3242  C CD  . ARG A 1 412  ? 24.201  -52.642 -39.696  1.00 101.60 ? 1784 ARG B CD  1 
ATOM 3243  N NE  . ARG A 1 412  ? 25.364  -52.524 -40.580  1.00 110.19 ? 1784 ARG B NE  1 
ATOM 3244  C CZ  . ARG A 1 412  ? 25.500  -53.143 -41.755  1.00 111.24 ? 1784 ARG B CZ  1 
ATOM 3245  N NH1 . ARG A 1 412  ? 24.552  -53.957 -42.217  1.00 106.04 ? 1784 ARG B NH1 1 
ATOM 3246  N NH2 . ARG A 1 412  ? 26.602  -52.955 -42.477  1.00 115.34 ? 1784 ARG B NH2 1 
ATOM 3247  N N   . SER A 1 413  ? 20.650  -49.597 -37.059  1.00 73.14  ? 1785 SER B N   1 
ATOM 3248  C CA  . SER A 1 413  ? 19.202  -49.431 -36.961  1.00 73.10  ? 1785 SER B CA  1 
ATOM 3249  C C   . SER A 1 413  ? 18.829  -47.950 -36.876  1.00 70.82  ? 1785 SER B C   1 
ATOM 3250  O O   . SER A 1 413  ? 18.144  -47.529 -35.942  1.00 80.15  ? 1785 SER B O   1 
ATOM 3251  C CB  . SER A 1 413  ? 18.684  -50.200 -35.739  1.00 77.08  ? 1785 SER B CB  1 
ATOM 3252  O OG  . SER A 1 413  ? 19.312  -49.748 -34.546  1.00 80.44  ? 1785 SER B OG  1 
ATOM 3253  N N   . TRP A 1 414  ? 19.286  -47.163 -37.850  1.00 65.89  ? 1786 TRP B N   1 
ATOM 3254  C CA  . TRP A 1 414  ? 18.964  -45.736 -37.917  1.00 64.63  ? 1786 TRP B CA  1 
ATOM 3255  C C   . TRP A 1 414  ? 18.404  -45.378 -39.287  1.00 62.37  ? 1786 TRP B C   1 
ATOM 3256  O O   . TRP A 1 414  ? 19.078  -45.548 -40.301  1.00 63.07  ? 1786 TRP B O   1 
ATOM 3257  C CB  . TRP A 1 414  ? 20.195  -44.875 -37.611  1.00 64.40  ? 1786 TRP B CB  1 
ATOM 3258  C CG  . TRP A 1 414  ? 19.897  -43.388 -37.466  1.00 63.94  ? 1786 TRP B CG  1 
ATOM 3259  C CD1 . TRP A 1 414  ? 18.702  -42.812 -37.126  1.00 62.05  ? 1786 TRP B CD1 1 
ATOM 3260  C CD2 . TRP A 1 414  ? 20.825  -42.306 -37.624  1.00 62.56  ? 1786 TRP B CD2 1 
ATOM 3261  N NE1 . TRP A 1 414  ? 18.825  -41.449 -37.083  1.00 61.32  ? 1786 TRP B NE1 1 
ATOM 3262  C CE2 . TRP A 1 414  ? 20.117  -41.109 -37.377  1.00 61.91  ? 1786 TRP B CE2 1 
ATOM 3263  C CE3 . TRP A 1 414  ? 22.182  -42.231 -37.955  1.00 60.31  ? 1786 TRP B CE3 1 
ATOM 3264  C CZ2 . TRP A 1 414  ? 20.720  -39.853 -37.457  1.00 60.87  ? 1786 TRP B CZ2 1 
ATOM 3265  C CZ3 . TRP A 1 414  ? 22.780  -40.980 -38.032  1.00 59.77  ? 1786 TRP B CZ3 1 
ATOM 3266  C CH2 . TRP A 1 414  ? 22.048  -39.809 -37.782  1.00 59.80  ? 1786 TRP B CH2 1 
ATOM 3267  N N   . TYR A 1 415  ? 17.173  -44.872 -39.296  1.00 61.27  ? 1787 TYR B N   1 
ATOM 3268  C CA  . TYR A 1 415  ? 16.472  -44.481 -40.524  1.00 60.51  ? 1787 TYR B CA  1 
ATOM 3269  C C   . TYR A 1 415  ? 17.290  -43.526 -41.407  1.00 58.33  ? 1787 TYR B C   1 
ATOM 3270  O O   . TYR A 1 415  ? 17.513  -43.807 -42.588  1.00 57.66  ? 1787 TYR B O   1 
ATOM 3271  C CB  . TYR A 1 415  ? 15.107  -43.859 -40.170  1.00 60.02  ? 1787 TYR B CB  1 
ATOM 3272  C CG  . TYR A 1 415  ? 14.412  -43.147 -41.309  1.00 61.51  ? 1787 TYR B CG  1 
ATOM 3273  C CD1 . TYR A 1 415  ? 14.171  -43.800 -42.519  1.00 67.70  ? 1787 TYR B CD1 1 
ATOM 3274  C CD2 . TYR A 1 415  ? 13.986  -41.825 -41.177  1.00 65.50  ? 1787 TYR B CD2 1 
ATOM 3275  C CE1 . TYR A 1 415  ? 13.533  -43.157 -43.574  1.00 74.04  ? 1787 TYR B CE1 1 
ATOM 3276  C CE2 . TYR A 1 415  ? 13.344  -41.170 -42.223  1.00 75.45  ? 1787 TYR B CE2 1 
ATOM 3277  C CZ  . TYR A 1 415  ? 13.117  -41.837 -43.424  1.00 80.20  ? 1787 TYR B CZ  1 
ATOM 3278  O OH  . TYR A 1 415  ? 12.478  -41.195 -44.471  1.00 81.46  ? 1787 TYR B OH  1 
ATOM 3279  N N   . LYS A 1 416  ? 17.733  -42.413 -40.826  1.00 57.69  ? 1788 LYS B N   1 
ATOM 3280  C CA  . LYS A 1 416  ? 18.396  -41.347 -41.588  1.00 60.71  ? 1788 LYS B CA  1 
ATOM 3281  C C   . LYS A 1 416  ? 19.659  -41.803 -42.311  1.00 57.43  ? 1788 LYS B C   1 
ATOM 3282  O O   . LYS A 1 416  ? 19.913  -41.376 -43.438  1.00 56.00  ? 1788 LYS B O   1 
ATOM 3283  C CB  . LYS A 1 416  ? 18.735  -40.147 -40.693  1.00 69.19  ? 1788 LYS B CB  1 
ATOM 3284  C CG  . LYS A 1 416  ? 17.597  -39.159 -40.495  1.00 77.44  ? 1788 LYS B CG  1 
ATOM 3285  C CD  . LYS A 1 416  ? 18.106  -37.866 -39.874  1.00 84.73  ? 1788 LYS B CD  1 
ATOM 3286  C CE  . LYS A 1 416  ? 17.007  -36.823 -39.747  1.00 89.66  ? 1788 LYS B CE  1 
ATOM 3287  N NZ  . LYS A 1 416  ? 17.536  -35.540 -39.205  1.00 91.35  ? 1788 LYS B NZ  1 
ATOM 3288  N N   . ALA A 1 417  ? 20.441  -42.659 -41.657  1.00 56.40  ? 1789 ALA B N   1 
ATOM 3289  C CA  . ALA A 1 417  ? 21.702  -43.152 -42.216  1.00 56.92  ? 1789 ALA B CA  1 
ATOM 3290  C C   . ALA A 1 417  ? 21.473  -43.909 -43.522  1.00 57.85  ? 1789 ALA B C   1 
ATOM 3291  O O   . ALA A 1 417  ? 22.086  -43.599 -44.550  1.00 56.59  ? 1789 ALA B O   1 
ATOM 3292  C CB  . ALA A 1 417  ? 22.412  -44.045 -41.209  1.00 58.57  ? 1789 ALA B CB  1 
ATOM 3293  N N   . TRP A 1 418  ? 20.578  -44.895 -43.460  1.00 58.28  ? 1790 TRP B N   1 
ATOM 3294  C CA  . TRP A 1 418  ? 20.193  -45.697 -44.628  1.00 54.32  ? 1790 TRP B CA  1 
ATOM 3295  C C   . TRP A 1 418  ? 19.509  -44.856 -45.695  1.00 52.29  ? 1790 TRP B C   1 
ATOM 3296  O O   . TRP A 1 418  ? 19.744  -45.061 -46.887  1.00 53.79  ? 1790 TRP B O   1 
ATOM 3297  C CB  . TRP A 1 418  ? 19.290  -46.869 -44.210  1.00 52.84  ? 1790 TRP B CB  1 
ATOM 3298  C CG  . TRP A 1 418  ? 20.053  -47.938 -43.510  1.00 52.38  ? 1790 TRP B CG  1 
ATOM 3299  C CD1 . TRP A 1 418  ? 20.023  -48.243 -42.180  1.00 52.06  ? 1790 TRP B CD1 1 
ATOM 3300  C CD2 . TRP A 1 418  ? 21.002  -48.823 -44.104  1.00 50.78  ? 1790 TRP B CD2 1 
ATOM 3301  N NE1 . TRP A 1 418  ? 20.889  -49.276 -41.913  1.00 52.34  ? 1790 TRP B NE1 1 
ATOM 3302  C CE2 . TRP A 1 418  ? 21.506  -49.648 -43.077  1.00 50.53  ? 1790 TRP B CE2 1 
ATOM 3303  C CE3 . TRP A 1 418  ? 21.478  -48.998 -45.408  1.00 50.10  ? 1790 TRP B CE3 1 
ATOM 3304  C CZ2 . TRP A 1 418  ? 22.451  -50.643 -43.315  1.00 50.93  ? 1790 TRP B CZ2 1 
ATOM 3305  C CZ3 . TRP A 1 418  ? 22.421  -49.984 -45.644  1.00 51.31  ? 1790 TRP B CZ3 1 
ATOM 3306  C CH2 . TRP A 1 418  ? 22.895  -50.797 -44.601  1.00 52.02  ? 1790 TRP B CH2 1 
ATOM 3307  N N   . HIS A 1 419  ? 18.674  -43.912 -45.263  1.00 49.25  ? 1791 HIS B N   1 
ATOM 3308  C CA  . HIS A 1 419  ? 18.024  -42.986 -46.177  1.00 49.84  ? 1791 HIS B CA  1 
ATOM 3309  C C   . HIS A 1 419  ? 19.049  -42.155 -46.962  1.00 53.33  ? 1791 HIS B C   1 
ATOM 3310  O O   . HIS A 1 419  ? 19.076  -42.195 -48.195  1.00 57.85  ? 1791 HIS B O   1 
ATOM 3311  C CB  . HIS A 1 419  ? 17.074  -42.073 -45.414  1.00 49.51  ? 1791 HIS B CB  1 
ATOM 3312  C CG  . HIS A 1 419  ? 16.322  -41.125 -46.291  1.00 51.92  ? 1791 HIS B CG  1 
ATOM 3313  N ND1 . HIS A 1 419  ? 15.293  -41.531 -47.113  1.00 53.98  ? 1791 HIS B ND1 1 
ATOM 3314  C CD2 . HIS A 1 419  ? 16.456  -39.793 -46.487  1.00 52.86  ? 1791 HIS B CD2 1 
ATOM 3315  C CE1 . HIS A 1 419  ? 14.819  -40.488 -47.770  1.00 53.20  ? 1791 HIS B CE1 1 
ATOM 3316  N NE2 . HIS A 1 419  ? 15.507  -39.421 -47.407  1.00 53.61  ? 1791 HIS B NE2 1 
ATOM 3317  N N   . ALA A 1 420  ? 19.904  -41.432 -46.242  1.00 51.99  ? 1792 ALA B N   1 
ATOM 3318  C CA  . ALA A 1 420  ? 20.926  -40.570 -46.859  1.00 48.90  ? 1792 ALA B CA  1 
ATOM 3319  C C   . ALA A 1 420  ? 21.852  -41.323 -47.811  1.00 47.40  ? 1792 ALA B C   1 
ATOM 3320  O O   . ALA A 1 420  ? 22.233  -40.800 -48.852  1.00 46.99  ? 1792 ALA B O   1 
ATOM 3321  C CB  . ALA A 1 420  ? 21.748  -39.872 -45.785  1.00 48.75  ? 1792 ALA B CB  1 
ATOM 3322  N N   . TRP A 1 421  ? 22.212  -42.547 -47.443  1.00 47.86  ? 1793 TRP B N   1 
ATOM 3323  C CA  . TRP A 1 421  ? 23.042  -43.393 -48.292  1.00 48.91  ? 1793 TRP B CA  1 
ATOM 3324  C C   . TRP A 1 421  ? 22.296  -43.783 -49.567  1.00 47.66  ? 1793 TRP B C   1 
ATOM 3325  O O   . TRP A 1 421  ? 22.870  -43.762 -50.653  1.00 47.09  ? 1793 TRP B O   1 
ATOM 3326  C CB  . TRP A 1 421  ? 23.492  -44.638 -47.522  1.00 50.50  ? 1793 TRP B CB  1 
ATOM 3327  C CG  . TRP A 1 421  ? 24.406  -45.524 -48.301  1.00 52.85  ? 1793 TRP B CG  1 
ATOM 3328  C CD1 . TRP A 1 421  ? 25.680  -45.243 -48.707  1.00 55.40  ? 1793 TRP B CD1 1 
ATOM 3329  C CD2 . TRP A 1 421  ? 24.118  -46.840 -48.769  1.00 54.18  ? 1793 TRP B CD2 1 
ATOM 3330  N NE1 . TRP A 1 421  ? 26.203  -46.305 -49.405  1.00 55.92  ? 1793 TRP B NE1 1 
ATOM 3331  C CE2 . TRP A 1 421  ? 25.263  -47.301 -49.455  1.00 56.29  ? 1793 TRP B CE2 1 
ATOM 3332  C CE3 . TRP A 1 421  ? 23.000  -47.680 -48.676  1.00 55.95  ? 1793 TRP B CE3 1 
ATOM 3333  C CZ2 . TRP A 1 421  ? 25.321  -48.564 -50.051  1.00 60.35  ? 1793 TRP B CZ2 1 
ATOM 3334  C CZ3 . TRP A 1 421  ? 23.058  -48.941 -49.267  1.00 58.59  ? 1793 TRP B CZ3 1 
ATOM 3335  C CH2 . TRP A 1 421  ? 24.213  -49.369 -49.947  1.00 60.02  ? 1793 TRP B CH2 1 
ATOM 3336  N N   . ALA A 1 422  ? 21.020  -44.129 -49.424  1.00 48.27  ? 1794 ALA B N   1 
ATOM 3337  C CA  . ALA A 1 422  ? 20.172  -44.467 -50.571  1.00 50.85  ? 1794 ALA B CA  1 
ATOM 3338  C C   . ALA A 1 422  ? 19.994  -43.278 -51.507  1.00 53.41  ? 1794 ALA B C   1 
ATOM 3339  O O   . ALA A 1 422  ? 20.182  -43.402 -52.721  1.00 54.36  ? 1794 ALA B O   1 
ATOM 3340  C CB  . ALA A 1 422  ? 18.811  -44.960 -50.100  1.00 49.57  ? 1794 ALA B CB  1 
ATOM 3341  N N   . VAL A 1 423  ? 19.647  -42.133 -50.924  1.00 52.16  ? 1795 VAL B N   1 
ATOM 3342  C CA  . VAL A 1 423  ? 19.387  -40.908 -51.682  1.00 51.59  ? 1795 VAL B CA  1 
ATOM 3343  C C   . VAL A 1 423  ? 20.619  -40.440 -52.455  1.00 52.03  ? 1795 VAL B C   1 
ATOM 3344  O O   . VAL A 1 423  ? 20.492  -39.963 -53.579  1.00 55.75  ? 1795 VAL B O   1 
ATOM 3345  C CB  . VAL A 1 423  ? 18.876  -39.777 -50.759  1.00 53.03  ? 1795 VAL B CB  1 
ATOM 3346  C CG1 . VAL A 1 423  ? 18.812  -38.433 -51.485  1.00 54.01  ? 1795 VAL B CG1 1 
ATOM 3347  C CG2 . VAL A 1 423  ? 17.496  -40.127 -50.216  1.00 54.47  ? 1795 VAL B CG2 1 
ATOM 3348  N N   . MET A 1 424  ? 21.799  -40.565 -51.855  1.00 52.63  ? 1796 MET B N   1 
ATOM 3349  C CA  . MET A 1 424  ? 23.039  -40.144 -52.514  1.00 56.10  ? 1796 MET B CA  1 
ATOM 3350  C C   . MET A 1 424  ? 23.402  -41.086 -53.661  1.00 59.27  ? 1796 MET B C   1 
ATOM 3351  O O   . MET A 1 424  ? 23.800  -40.627 -54.739  1.00 63.64  ? 1796 MET B O   1 
ATOM 3352  C CB  . MET A 1 424  ? 24.188  -40.044 -51.504  1.00 56.42  ? 1796 MET B CB  1 
ATOM 3353  C CG  . MET A 1 424  ? 25.555  -39.711 -52.094  1.00 57.59  ? 1796 MET B CG  1 
ATOM 3354  S SD  . MET A 1 424  ? 25.645  -38.340 -53.278  1.00 58.22  ? 1796 MET B SD  1 
ATOM 3355  C CE  . MET A 1 424  ? 24.815  -37.045 -52.368  1.00 57.49  ? 1796 MET B CE  1 
ATOM 3356  N N   . ASN A 1 425  ? 23.271  -42.393 -53.427  1.00 56.67  ? 1797 ASN B N   1 
ATOM 3357  C CA  . ASN A 1 425  ? 23.390  -43.383 -54.503  1.00 55.97  ? 1797 ASN B CA  1 
ATOM 3358  C C   . ASN A 1 425  ? 22.381  -43.097 -55.630  1.00 59.28  ? 1797 ASN B C   1 
ATOM 3359  O O   . ASN A 1 425  ? 22.728  -43.178 -56.814  1.00 60.72  ? 1797 ASN B O   1 
ATOM 3360  C CB  . ASN A 1 425  ? 23.196  -44.808 -53.969  1.00 52.87  ? 1797 ASN B CB  1 
ATOM 3361  C CG  . ASN A 1 425  ? 24.464  -45.395 -53.381  1.00 51.45  ? 1797 ASN B CG  1 
ATOM 3362  O OD1 . ASN A 1 425  ? 25.471  -45.546 -54.071  1.00 52.42  ? 1797 ASN B OD1 1 
ATOM 3363  N ND2 . ASN A 1 425  ? 24.410  -45.758 -52.108  1.00 50.39  ? 1797 ASN B ND2 1 
ATOM 3364  N N   . PHE A 1 426  ? 21.150  -42.748 -55.248  1.00 58.80  ? 1798 PHE B N   1 
ATOM 3365  C CA  . PHE A 1 426  ? 20.087  -42.384 -56.199  1.00 59.44  ? 1798 PHE B CA  1 
ATOM 3366  C C   . PHE A 1 426  ? 20.410  -41.120 -57.000  1.00 58.97  ? 1798 PHE B C   1 
ATOM 3367  O O   . PHE A 1 426  ? 20.094  -41.048 -58.185  1.00 60.63  ? 1798 PHE B O   1 
ATOM 3368  C CB  . PHE A 1 426  ? 18.748  -42.221 -55.458  1.00 59.28  ? 1798 PHE B CB  1 
ATOM 3369  C CG  . PHE A 1 426  ? 17.602  -41.784 -56.334  1.00 59.05  ? 1798 PHE B CG  1 
ATOM 3370  C CD1 . PHE A 1 426  ? 17.031  -42.662 -57.244  1.00 60.47  ? 1798 PHE B CD1 1 
ATOM 3371  C CD2 . PHE A 1 426  ? 17.077  -40.500 -56.228  1.00 59.94  ? 1798 PHE B CD2 1 
ATOM 3372  C CE1 . PHE A 1 426  ? 15.967  -42.269 -58.041  1.00 62.21  ? 1798 PHE B CE1 1 
ATOM 3373  C CE2 . PHE A 1 426  ? 16.017  -40.099 -57.023  1.00 62.26  ? 1798 PHE B CE2 1 
ATOM 3374  C CZ  . PHE A 1 426  ? 15.459  -40.985 -57.931  1.00 62.65  ? 1798 PHE B CZ  1 
ATOM 3375  N N   . GLU A 1 427  ? 21.019  -40.131 -56.348  1.00 59.34  ? 1799 GLU B N   1 
ATOM 3376  C CA  . GLU A 1 427  ? 21.402  -38.881 -57.015  1.00 65.10  ? 1799 GLU B CA  1 
ATOM 3377  C C   . GLU A 1 427  ? 22.754  -38.977 -57.723  1.00 64.01  ? 1799 GLU B C   1 
ATOM 3378  O O   . GLU A 1 427  ? 23.068  -38.125 -58.559  1.00 66.91  ? 1799 GLU B O   1 
ATOM 3379  C CB  . GLU A 1 427  ? 21.357  -37.696 -56.040  1.00 70.85  ? 1799 GLU B CB  1 
ATOM 3380  C CG  . GLU A 1 427  ? 19.932  -37.208 -55.793  1.00 77.14  ? 1799 GLU B CG  1 
ATOM 3381  C CD  . GLU A 1 427  ? 19.828  -36.069 -54.794  1.00 86.34  ? 1799 GLU B CD  1 
ATOM 3382  O OE1 . GLU A 1 427  ? 20.851  -35.705 -54.173  1.00 93.84  ? 1799 GLU B OE1 1 
ATOM 3383  O OE2 . GLU A 1 427  ? 18.707  -35.536 -54.626  1.00 89.21  ? 1799 GLU B OE2 1 
ATOM 3384  N N   . ALA A 1 428  ? 23.545  -39.997 -57.387  1.00 59.72  ? 1800 ALA B N   1 
ATOM 3385  C CA  . ALA A 1 428  ? 24.708  -40.372 -58.193  1.00 60.66  ? 1800 ALA B CA  1 
ATOM 3386  C C   . ALA A 1 428  ? 24.265  -40.937 -59.540  1.00 61.02  ? 1800 ALA B C   1 
ATOM 3387  O O   . ALA A 1 428  ? 24.876  -40.649 -60.565  1.00 61.93  ? 1800 ALA B O   1 
ATOM 3388  C CB  . ALA A 1 428  ? 25.571  -41.384 -57.460  1.00 61.00  ? 1800 ALA B CB  1 
ATOM 3389  N N   . VAL A 1 429  ? 23.203  -41.741 -59.523  1.00 60.71  ? 1801 VAL B N   1 
ATOM 3390  C CA  . VAL A 1 429  ? 22.589  -42.262 -60.750  1.00 63.03  ? 1801 VAL B CA  1 
ATOM 3391  C C   . VAL A 1 429  ? 22.102  -41.110 -61.636  1.00 68.53  ? 1801 VAL B C   1 
ATOM 3392  O O   . VAL A 1 429  ? 22.488  -41.030 -62.802  1.00 74.14  ? 1801 VAL B O   1 
ATOM 3393  C CB  . VAL A 1 429  ? 21.434  -43.247 -60.431  1.00 59.88  ? 1801 VAL B CB  1 
ATOM 3394  C CG1 . VAL A 1 429  ? 20.568  -43.552 -61.649  1.00 59.99  ? 1801 VAL B CG1 1 
ATOM 3395  C CG2 . VAL A 1 429  ? 21.994  -44.540 -59.861  1.00 59.49  ? 1801 VAL B CG2 1 
ATOM 3396  N N   . LEU A 1 430  ? 21.274  -40.222 -61.080  1.00 70.64  ? 1802 LEU B N   1 
ATOM 3397  C CA  . LEU A 1 430  ? 20.754  -39.062 -61.827  1.00 76.16  ? 1802 LEU B CA  1 
ATOM 3398  C C   . LEU A 1 430  ? 21.863  -38.167 -62.372  1.00 83.29  ? 1802 LEU B C   1 
ATOM 3399  O O   . LEU A 1 430  ? 21.756  -37.672 -63.493  1.00 89.20  ? 1802 LEU B O   1 
ATOM 3400  C CB  . LEU A 1 430  ? 19.817  -38.199 -60.969  1.00 75.33  ? 1802 LEU B CB  1 
ATOM 3401  C CG  . LEU A 1 430  ? 18.516  -38.784 -60.407  1.00 77.73  ? 1802 LEU B CG  1 
ATOM 3402  C CD1 . LEU A 1 430  ? 17.625  -37.663 -59.894  1.00 80.59  ? 1802 LEU B CD1 1 
ATOM 3403  C CD2 . LEU A 1 430  ? 17.755  -39.620 -61.423  1.00 81.42  ? 1802 LEU B CD2 1 
ATOM 3404  N N   . HIS A 1 431  ? 22.912  -37.964 -61.573  1.00 84.25  ? 1803 HIS B N   1 
ATOM 3405  C CA  . HIS A 1 431  ? 24.046  -37.109 -61.952  1.00 83.50  ? 1803 HIS B CA  1 
ATOM 3406  C C   . HIS A 1 431  ? 24.710  -37.554 -63.255  1.00 85.84  ? 1803 HIS B C   1 
ATOM 3407  O O   . HIS A 1 431  ? 24.946  -36.733 -64.141  1.00 90.59  ? 1803 HIS B O   1 
ATOM 3408  C CB  . HIS A 1 431  ? 25.083  -37.071 -60.827  1.00 79.71  ? 1803 HIS B CB  1 
ATOM 3409  C CG  . HIS A 1 431  ? 26.334  -36.337 -61.184  1.00 79.22  ? 1803 HIS B CG  1 
ATOM 3410  N ND1 . HIS A 1 431  ? 27.473  -36.981 -61.619  1.00 82.59  ? 1803 HIS B ND1 1 
ATOM 3411  C CD2 . HIS A 1 431  ? 26.625  -35.016 -61.179  1.00 78.54  ? 1803 HIS B CD2 1 
ATOM 3412  C CE1 . HIS A 1 431  ? 28.415  -36.087 -61.860  1.00 85.66  ? 1803 HIS B CE1 1 
ATOM 3413  N NE2 . HIS A 1 431  ? 27.926  -34.887 -61.600  1.00 84.09  ? 1803 HIS B NE2 1 
ATOM 3414  N N   . TYR A 1 432  ? 25.001  -38.849 -63.360  1.00 85.18  ? 1804 TYR B N   1 
ATOM 3415  C CA  . TYR A 1 432  ? 25.609  -39.414 -64.572  1.00 88.75  ? 1804 TYR B CA  1 
ATOM 3416  C C   . TYR A 1 432  ? 24.630  -39.543 -65.748  1.00 90.51  ? 1804 TYR B C   1 
ATOM 3417  O O   . TYR A 1 432  ? 25.035  -39.401 -66.904  1.00 91.71  ? 1804 TYR B O   1 
ATOM 3418  C CB  . TYR A 1 432  ? 26.280  -40.760 -64.273  1.00 87.95  ? 1804 TYR B CB  1 
ATOM 3419  C CG  . TYR A 1 432  ? 27.579  -40.617 -63.513  1.00 86.63  ? 1804 TYR B CG  1 
ATOM 3420  C CD1 . TYR A 1 432  ? 27.714  -41.106 -62.217  1.00 86.69  ? 1804 TYR B CD1 1 
ATOM 3421  C CD2 . TYR A 1 432  ? 28.675  -39.976 -64.089  1.00 89.80  ? 1804 TYR B CD2 1 
ATOM 3422  C CE1 . TYR A 1 432  ? 28.906  -40.971 -61.522  1.00 87.81  ? 1804 TYR B CE1 1 
ATOM 3423  C CE2 . TYR A 1 432  ? 29.869  -39.834 -63.400  1.00 90.95  ? 1804 TYR B CE2 1 
ATOM 3424  C CZ  . TYR A 1 432  ? 29.979  -40.334 -62.117  1.00 87.89  ? 1804 TYR B CZ  1 
ATOM 3425  O OH  . TYR A 1 432  ? 31.156  -40.200 -61.425  1.00 89.17  ? 1804 TYR B OH  1 
ATOM 3426  N N   . LYS A 1 433  ? 23.357  -39.812 -65.461  1.00 90.93  ? 1805 LYS B N   1 
ATOM 3427  C CA  . LYS A 1 433  ? 22.324  -39.833 -66.501  1.00 94.43  ? 1805 LYS B CA  1 
ATOM 3428  C C   . LYS A 1 433  ? 22.139  -38.441 -67.106  1.00 97.78  ? 1805 LYS B C   1 
ATOM 3429  O O   . LYS A 1 433  ? 22.174  -38.289 -68.325  1.00 103.81 ? 1805 LYS B O   1 
ATOM 3430  C CB  . LYS A 1 433  ? 20.991  -40.343 -65.945  1.00 95.20  ? 1805 LYS B CB  1 
ATOM 3431  C CG  . LYS A 1 433  ? 19.901  -40.491 -67.001  1.00 100.59 ? 1805 LYS B CG  1 
ATOM 3432  C CD  . LYS A 1 433  ? 18.700  -41.272 -66.492  1.00 101.88 ? 1805 LYS B CD  1 
ATOM 3433  C CE  . LYS A 1 433  ? 17.853  -40.458 -65.525  1.00 100.90 ? 1805 LYS B CE  1 
ATOM 3434  N NZ  . LYS A 1 433  ? 16.772  -41.285 -64.922  1.00 102.38 ? 1805 LYS B NZ  1 
ATOM 3435  N N   . HIS A 1 434  ? 21.951  -37.437 -66.248  1.00 97.64  ? 1806 HIS B N   1 
ATOM 3436  C CA  . HIS A 1 434  ? 21.798  -36.042 -66.687  1.00 95.06  ? 1806 HIS B CA  1 
ATOM 3437  C C   . HIS A 1 434  ? 23.075  -35.474 -67.309  1.00 94.13  ? 1806 HIS B C   1 
ATOM 3438  O O   . HIS A 1 434  ? 23.006  -34.506 -68.068  1.00 94.73  ? 1806 HIS B O   1 
ATOM 3439  C CB  . HIS A 1 434  ? 21.339  -35.141 -65.532  1.00 96.26  ? 1806 HIS B CB  1 
ATOM 3440  C CG  . HIS A 1 434  ? 19.988  -35.492 -64.987  1.00 96.59  ? 1806 HIS B CG  1 
ATOM 3441  N ND1 . HIS A 1 434  ? 18.924  -35.835 -65.795  1.00 97.43  ? 1806 HIS B ND1 1 
ATOM 3442  C CD2 . HIS A 1 434  ? 19.525  -35.540 -63.716  1.00 96.21  ? 1806 HIS B CD2 1 
ATOM 3443  C CE1 . HIS A 1 434  ? 17.868  -36.091 -65.044  1.00 98.32  ? 1806 HIS B CE1 1 
ATOM 3444  N NE2 . HIS A 1 434  ? 18.206  -35.919 -63.778  1.00 99.90  ? 1806 HIS B NE2 1 
ATOM 3445  N N   . GLN A 1 435  ? 24.229  -36.060 -66.977  1.00 95.20  ? 1807 GLN B N   1 
ATOM 3446  C CA  . GLN A 1 435  ? 25.484  -35.766 -67.679  1.00 101.95 ? 1807 GLN B CA  1 
ATOM 3447  C C   . GLN A 1 435  ? 25.459  -36.333 -69.102  1.00 106.68 ? 1807 GLN B C   1 
ATOM 3448  O O   . GLN A 1 435  ? 25.792  -35.624 -70.050  1.00 103.29 ? 1807 GLN B O   1 
ATOM 3449  C CB  . GLN A 1 435  ? 26.700  -36.316 -66.914  1.00 99.97  ? 1807 GLN B CB  1 
ATOM 3450  C CG  . GLN A 1 435  ? 28.045  -35.830 -67.444  1.00 102.56 ? 1807 GLN B CG  1 
ATOM 3451  C CD  . GLN A 1 435  ? 29.231  -36.424 -66.705  1.00 100.11 ? 1807 GLN B CD  1 
ATOM 3452  O OE1 . GLN A 1 435  ? 29.250  -36.480 -65.476  1.00 93.62  ? 1807 GLN B OE1 1 
ATOM 3453  N NE2 . GLN A 1 435  ? 30.237  -36.861 -67.456  1.00 105.16 ? 1807 GLN B NE2 1 
ATOM 3454  N N   . ASN A 1 436  ? 25.059  -37.599 -69.242  1.00 113.74 ? 1808 ASN B N   1 
ATOM 3455  C CA  . ASN A 1 436  ? 25.047  -38.285 -70.550  1.00 121.65 ? 1808 ASN B CA  1 
ATOM 3456  C C   . ASN A 1 436  ? 24.005  -37.728 -71.538  1.00 122.41 ? 1808 ASN B C   1 
ATOM 3457  O O   . ASN A 1 436  ? 24.210  -37.799 -72.751  1.00 128.19 ? 1808 ASN B O   1 
ATOM 3458  C CB  . ASN A 1 436  ? 24.844  -39.798 -70.378  1.00 123.56 ? 1808 ASN B CB  1 
ATOM 3459  C CG  . ASN A 1 436  ? 25.206  -40.586 -71.630  1.00 128.19 ? 1808 ASN B CG  1 
ATOM 3460  O OD1 . ASN A 1 436  ? 26.340  -40.525 -72.114  1.00 127.86 ? 1808 ASN B OD1 1 
ATOM 3461  N ND2 . ASN A 1 436  ? 24.242  -41.330 -72.160  1.00 129.68 ? 1808 ASN B ND2 1 
ATOM 3462  N N   . GLN A 1 437  ? 22.896  -37.198 -71.021  1.00 120.39 ? 1809 GLN B N   1 
ATOM 3463  C CA  . GLN A 1 437  ? 21.916  -36.466 -71.842  1.00 124.46 ? 1809 GLN B CA  1 
ATOM 3464  C C   . GLN A 1 437  ? 22.500  -35.150 -72.379  1.00 131.28 ? 1809 GLN B C   1 
ATOM 3465  O O   . GLN A 1 437  ? 22.190  -34.743 -73.503  1.00 134.13 ? 1809 GLN B O   1 
ATOM 3466  C CB  . GLN A 1 437  ? 20.632  -36.198 -71.047  1.00 122.58 ? 1809 GLN B CB  1 
ATOM 3467  C CG  . GLN A 1 437  ? 19.821  -37.459 -70.765  1.00 124.57 ? 1809 GLN B CG  1 
ATOM 3468  C CD  . GLN A 1 437  ? 18.770  -37.292 -69.673  1.00 125.95 ? 1809 GLN B CD  1 
ATOM 3469  O OE1 . GLN A 1 437  ? 18.632  -36.225 -69.069  1.00 130.88 ? 1809 GLN B OE1 1 
ATOM 3470  N NE2 . GLN A 1 437  ? 18.022  -38.360 -69.415  1.00 122.05 ? 1809 GLN B NE2 1 
ATOM 3471  N N   . ALA A 1 438  ? 23.339  -34.496 -71.573  1.00 131.14 ? 1810 ALA B N   1 
ATOM 3472  C CA  . ALA A 1 438  ? 24.105  -33.326 -72.018  1.00 132.17 ? 1810 ALA B CA  1 
ATOM 3473  C C   . ALA A 1 438  ? 25.244  -33.705 -72.979  1.00 140.13 ? 1810 ALA B C   1 
ATOM 3474  O O   . ALA A 1 438  ? 25.540  -32.946 -73.904  1.00 146.56 ? 1810 ALA B O   1 
ATOM 3475  C CB  . ALA A 1 438  ? 24.647  -32.555 -70.820  1.00 127.04 ? 1810 ALA B CB  1 
ATOM 3476  N N   . ARG A 1 439  ? 25.877  -34.862 -72.758  1.00 143.55 ? 1811 ARG B N   1 
ATOM 3477  C CA  . ARG A 1 439  ? 26.919  -35.392 -73.665  1.00 147.41 ? 1811 ARG B CA  1 
ATOM 3478  C C   . ARG A 1 439  ? 26.363  -35.684 -75.061  1.00 154.50 ? 1811 ARG B C   1 
ATOM 3479  O O   . ARG A 1 439  ? 26.973  -35.309 -76.064  1.00 161.75 ? 1811 ARG B O   1 
ATOM 3480  C CB  . ARG A 1 439  ? 27.550  -36.677 -73.105  1.00 145.51 ? 1811 ARG B CB  1 
ATOM 3481  C CG  . ARG A 1 439  ? 28.343  -36.507 -71.816  1.00 144.61 ? 1811 ARG B CG  1 
ATOM 3482  C CD  . ARG A 1 439  ? 29.799  -36.151 -72.060  1.00 147.59 ? 1811 ARG B CD  1 
ATOM 3483  N NE  . ARG A 1 439  ? 30.479  -35.796 -70.813  1.00 148.82 ? 1811 ARG B NE  1 
ATOM 3484  C CZ  . ARG A 1 439  ? 31.740  -35.370 -70.717  1.00 157.10 ? 1811 ARG B CZ  1 
ATOM 3485  N NH1 . ARG A 1 439  ? 32.506  -35.234 -71.802  1.00 162.43 ? 1811 ARG B NH1 1 
ATOM 3486  N NH2 . ARG A 1 439  ? 32.246  -35.074 -69.521  1.00 155.30 ? 1811 ARG B NH2 1 
ATOM 3487  N N   . ASP A 1 440  ? 25.211  -36.357 -75.109  1.00 155.83 ? 1812 ASP B N   1 
ATOM 3488  C CA  . ASP A 1 440  ? 24.506  -36.649 -76.372  1.00 157.95 ? 1812 ASP B CA  1 
ATOM 3489  C C   . ASP A 1 440  ? 24.018  -35.395 -77.118  1.00 161.26 ? 1812 ASP B C   1 
ATOM 3490  O O   . ASP A 1 440  ? 23.847  -35.436 -78.339  1.00 165.79 ? 1812 ASP B O   1 
ATOM 3491  C CB  . ASP A 1 440  ? 23.312  -37.593 -76.130  1.00 154.38 ? 1812 ASP B CB  1 
ATOM 3492  C CG  . ASP A 1 440  ? 23.737  -39.030 -75.841  1.00 152.95 ? 1812 ASP B CG  1 
ATOM 3493  O OD1 . ASP A 1 440  ? 24.852  -39.246 -75.319  1.00 155.76 ? 1812 ASP B OD1 1 
ATOM 3494  O OD2 . ASP A 1 440  ? 22.942  -39.948 -76.135  1.00 147.94 ? 1812 ASP B OD2 1 
ATOM 3495  N N   . GLU A 1 441  ? 23.780  -34.303 -76.386  1.00 160.29 ? 1813 GLU B N   1 
ATOM 3496  C CA  . GLU A 1 441  ? 23.394  -33.009 -76.978  1.00 159.91 ? 1813 GLU B CA  1 
ATOM 3497  C C   . GLU A 1 441  ? 24.470  -32.480 -77.936  1.00 156.69 ? 1813 GLU B C   1 
ATOM 3498  O O   . GLU A 1 441  ? 24.170  -32.109 -79.073  1.00 159.86 ? 1813 GLU B O   1 
ATOM 3499  C CB  . GLU A 1 441  ? 23.117  -31.968 -75.879  1.00 158.01 ? 1813 GLU B CB  1 
ATOM 3500  C CG  . GLU A 1 441  ? 22.209  -30.818 -76.307  1.00 157.28 ? 1813 GLU B CG  1 
ATOM 3501  C CD  . GLU A 1 441  ? 20.722  -31.160 -76.277  1.00 150.69 ? 1813 GLU B CD  1 
ATOM 3502  O OE1 . GLU A 1 441  ? 20.360  -32.354 -76.196  1.00 143.51 ? 1813 GLU B OE1 1 
ATOM 3503  O OE2 . GLU A 1 441  ? 19.901  -30.219 -76.336  1.00 148.13 ? 1813 GLU B OE2 1 
ATOM 3504  N N   . LYS A 1 442  ? 25.714  -32.456 -77.462  1.00 150.12 ? 1814 LYS B N   1 
ATOM 3505  C CA  . LYS A 1 442  ? 26.862  -32.064 -78.289  1.00 154.69 ? 1814 LYS B CA  1 
ATOM 3506  C C   . LYS A 1 442  ? 27.246  -33.193 -79.246  1.00 154.36 ? 1814 LYS B C   1 
ATOM 3507  O O   . LYS A 1 442  ? 26.833  -33.206 -80.407  1.00 153.09 ? 1814 LYS B O   1 
ATOM 3508  C CB  . LYS A 1 442  ? 28.067  -31.671 -77.417  1.00 154.08 ? 1814 LYS B CB  1 
ATOM 3509  C CG  . LYS A 1 442  ? 28.093  -30.207 -76.998  1.00 153.09 ? 1814 LYS B CG  1 
ATOM 3510  C CD  . LYS A 1 442  ? 26.907  -29.818 -76.130  1.00 147.07 ? 1814 LYS B CD  1 
ATOM 3511  C CE  . LYS A 1 442  ? 27.000  -28.365 -75.697  1.00 146.01 ? 1814 LYS B CE  1 
ATOM 3512  N NZ  . LYS A 1 442  ? 25.748  -27.909 -75.038  1.00 142.84 ? 1814 LYS B NZ  1 
ATOM 3513  N N   . LYS A 1 495  ? 29.486  -46.556 -78.551  1.00 142.96 ? 1867 LYS B N   1 
ATOM 3514  C CA  . LYS A 1 495  ? 29.959  -47.936 -78.427  1.00 145.67 ? 1867 LYS B CA  1 
ATOM 3515  C C   . LYS A 1 495  ? 30.610  -48.196 -77.062  1.00 151.20 ? 1867 LYS B C   1 
ATOM 3516  O O   . LYS A 1 495  ? 30.159  -49.063 -76.315  1.00 150.87 ? 1867 LYS B O   1 
ATOM 3517  C CB  . LYS A 1 495  ? 30.924  -48.275 -79.571  1.00 145.83 ? 1867 LYS B CB  1 
ATOM 3518  C CG  . LYS A 1 495  ? 30.528  -47.645 -80.897  1.00 144.57 ? 1867 LYS B CG  1 
ATOM 3519  C CD  . LYS A 1 495  ? 31.059  -48.415 -82.091  1.00 145.74 ? 1867 LYS B CD  1 
ATOM 3520  C CE  . LYS A 1 495  ? 30.545  -47.820 -83.392  1.00 146.30 ? 1867 LYS B CE  1 
ATOM 3521  N NZ  . LYS A 1 495  ? 30.297  -48.869 -84.416  1.00 148.80 ? 1867 LYS B NZ  1 
ATOM 3522  N N   . LYS A 1 496  ? 31.663  -47.439 -76.752  1.00 162.11 ? 1868 LYS B N   1 
ATOM 3523  C CA  . LYS A 1 496  ? 32.319  -47.472 -75.434  1.00 165.86 ? 1868 LYS B CA  1 
ATOM 3524  C C   . LYS A 1 496  ? 31.547  -46.631 -74.399  1.00 167.00 ? 1868 LYS B C   1 
ATOM 3525  O O   . LYS A 1 496  ? 31.636  -46.892 -73.196  1.00 162.11 ? 1868 LYS B O   1 
ATOM 3526  C CB  . LYS A 1 496  ? 33.770  -46.972 -75.560  1.00 167.31 ? 1868 LYS B CB  1 
ATOM 3527  C CG  . LYS A 1 496  ? 34.636  -47.057 -74.303  1.00 165.12 ? 1868 LYS B CG  1 
ATOM 3528  C CD  . LYS A 1 496  ? 34.977  -48.488 -73.911  1.00 166.13 ? 1868 LYS B CD  1 
ATOM 3529  C CE  . LYS A 1 496  ? 36.025  -48.520 -72.805  1.00 163.97 ? 1868 LYS B CE  1 
ATOM 3530  N NZ  . LYS A 1 496  ? 36.507  -49.897 -72.506  1.00 165.53 ? 1868 LYS B NZ  1 
ATOM 3531  N N   . VAL A 1 497  ? 30.788  -45.639 -74.876  1.00 170.83 ? 1869 VAL B N   1 
ATOM 3532  C CA  . VAL A 1 497  ? 30.066  -44.688 -74.015  1.00 167.53 ? 1869 VAL B CA  1 
ATOM 3533  C C   . VAL A 1 497  ? 28.952  -45.380 -73.219  1.00 167.42 ? 1869 VAL B C   1 
ATOM 3534  O O   . VAL A 1 497  ? 28.864  -45.207 -72.001  1.00 172.94 ? 1869 VAL B O   1 
ATOM 3535  C CB  . VAL A 1 497  ? 29.476  -43.504 -74.834  1.00 165.08 ? 1869 VAL B CB  1 
ATOM 3536  C CG1 . VAL A 1 497  ? 28.683  -42.545 -73.949  1.00 161.00 ? 1869 VAL B CG1 1 
ATOM 3537  C CG2 . VAL A 1 497  ? 30.580  -42.729 -75.549  1.00 164.87 ? 1869 VAL B CG2 1 
ATOM 3538  N N   . THR A 1 498  ? 28.112  -46.151 -73.908  1.00 163.89 ? 1870 THR B N   1 
ATOM 3539  C CA  . THR A 1 498  ? 26.991  -46.860 -73.268  1.00 158.45 ? 1870 THR B CA  1 
ATOM 3540  C C   . THR A 1 498  ? 27.459  -48.033 -72.391  1.00 159.12 ? 1870 THR B C   1 
ATOM 3541  O O   . THR A 1 498  ? 26.817  -48.338 -71.383  1.00 149.39 ? 1870 THR B O   1 
ATOM 3542  C CB  . THR A 1 498  ? 25.965  -47.371 -74.306  1.00 156.30 ? 1870 THR B CB  1 
ATOM 3543  O OG1 . THR A 1 498  ? 25.761  -46.374 -75.315  1.00 162.93 ? 1870 THR B OG1 1 
ATOM 3544  C CG2 . THR A 1 498  ? 24.624  -47.689 -73.644  1.00 147.05 ? 1870 THR B CG2 1 
ATOM 3545  N N   . GLU A 1 499  ? 28.560  -48.686 -72.781  1.00 167.40 ? 1871 GLU B N   1 
ATOM 3546  C CA  . GLU A 1 499  ? 29.177  -49.755 -71.973  1.00 166.97 ? 1871 GLU B CA  1 
ATOM 3547  C C   . GLU A 1 499  ? 29.631  -49.246 -70.602  1.00 163.61 ? 1871 GLU B C   1 
ATOM 3548  O O   . GLU A 1 499  ? 29.334  -49.865 -69.575  1.00 162.79 ? 1871 GLU B O   1 
ATOM 3549  C CB  . GLU A 1 499  ? 30.368  -50.396 -72.705  1.00 170.91 ? 1871 GLU B CB  1 
ATOM 3550  C CG  . GLU A 1 499  ? 29.972  -51.363 -73.814  1.00 176.49 ? 1871 GLU B CG  1 
ATOM 3551  C CD  . GLU A 1 499  ? 31.162  -52.014 -74.510  1.00 181.41 ? 1871 GLU B CD  1 
ATOM 3552  O OE1 . GLU A 1 499  ? 32.324  -51.752 -74.126  1.00 176.22 ? 1871 GLU B OE1 1 
ATOM 3553  O OE2 . GLU A 1 499  ? 30.931  -52.801 -75.454  1.00 185.99 ? 1871 GLU B OE2 1 
ATOM 3554  N N   . ASP A 1 500  ? 30.352  -48.124 -70.599  1.00 157.44 ? 1872 ASP B N   1 
ATOM 3555  C CA  . ASP A 1 500  ? 30.745  -47.449 -69.353  1.00 145.36 ? 1872 ASP B CA  1 
ATOM 3556  C C   . ASP A 1 500  ? 29.531  -46.932 -68.577  1.00 136.46 ? 1872 ASP B C   1 
ATOM 3557  O O   . ASP A 1 500  ? 29.493  -47.049 -67.353  1.00 135.33 ? 1872 ASP B O   1 
ATOM 3558  C CB  . ASP A 1 500  ? 31.723  -46.295 -69.622  1.00 143.73 ? 1872 ASP B CB  1 
ATOM 3559  C CG  . ASP A 1 500  ? 33.139  -46.776 -69.883  1.00 144.34 ? 1872 ASP B CG  1 
ATOM 3560  O OD1 . ASP A 1 500  ? 33.333  -47.572 -70.825  1.00 148.10 ? 1872 ASP B OD1 1 
ATOM 3561  O OD2 . ASP A 1 500  ? 34.057  -46.354 -69.147  1.00 138.75 ? 1872 ASP B OD2 1 
ATOM 3562  N N   . LEU A 1 501  ? 28.551  -46.372 -69.291  1.00 130.87 ? 1873 LEU B N   1 
ATOM 3563  C CA  . LEU A 1 501  ? 27.316  -45.857 -68.677  1.00 123.57 ? 1873 LEU B CA  1 
ATOM 3564  C C   . LEU A 1 501  ? 26.550  -46.945 -67.927  1.00 121.44 ? 1873 LEU B C   1 
ATOM 3565  O O   . LEU A 1 501  ? 26.138  -46.735 -66.787  1.00 117.59 ? 1873 LEU B O   1 
ATOM 3566  C CB  . LEU A 1 501  ? 26.396  -45.231 -69.733  1.00 120.82 ? 1873 LEU B CB  1 
ATOM 3567  C CG  . LEU A 1 501  ? 25.136  -44.520 -69.214  1.00 113.54 ? 1873 LEU B CG  1 
ATOM 3568  C CD1 . LEU A 1 501  ? 25.491  -43.182 -68.584  1.00 108.17 ? 1873 LEU B CD1 1 
ATOM 3569  C CD2 . LEU A 1 501  ? 24.117  -44.334 -70.328  1.00 115.91 ? 1873 LEU B CD2 1 
ATOM 3570  N N   . SER A 1 502  ? 26.365  -48.095 -68.572  1.00 123.11 ? 1874 SER B N   1 
ATOM 3571  C CA  . SER A 1 502  ? 25.682  -49.237 -67.956  1.00 120.42 ? 1874 SER B CA  1 
ATOM 3572  C C   . SER A 1 502  ? 26.384  -49.689 -66.679  1.00 112.17 ? 1874 SER B C   1 
ATOM 3573  O O   . SER A 1 502  ? 25.738  -49.869 -65.649  1.00 107.90 ? 1874 SER B O   1 
ATOM 3574  C CB  . SER A 1 502  ? 25.590  -50.406 -68.938  1.00 130.24 ? 1874 SER B CB  1 
ATOM 3575  O OG  . SER A 1 502  ? 24.776  -50.065 -70.046  1.00 138.56 ? 1874 SER B OG  1 
ATOM 3576  N N   . LYS A 1 503  ? 27.703  -49.854 -66.754  1.00 111.41 ? 1875 LYS B N   1 
ATOM 3577  C CA  . LYS A 1 503  ? 28.515  -50.183 -65.573  1.00 112.87 ? 1875 LYS B CA  1 
ATOM 3578  C C   . LYS A 1 503  ? 28.510  -49.073 -64.512  1.00 110.55 ? 1875 LYS B C   1 
ATOM 3579  O O   . LYS A 1 503  ? 28.574  -49.370 -63.318  1.00 113.01 ? 1875 LYS B O   1 
ATOM 3580  C CB  . LYS A 1 503  ? 29.957  -50.544 -65.968  1.00 118.09 ? 1875 LYS B CB  1 
ATOM 3581  C CG  . LYS A 1 503  ? 30.114  -51.984 -66.435  1.00 120.82 ? 1875 LYS B CG  1 
ATOM 3582  C CD  . LYS A 1 503  ? 31.507  -52.269 -66.973  1.00 123.59 ? 1875 LYS B CD  1 
ATOM 3583  C CE  . LYS A 1 503  ? 31.652  -53.732 -67.364  1.00 126.06 ? 1875 LYS B CE  1 
ATOM 3584  N NZ  . LYS A 1 503  ? 32.740  -53.941 -68.358  1.00 131.35 ? 1875 LYS B NZ  1 
ATOM 3585  N N   . THR A 1 504  ? 28.438  -47.812 -64.948  1.00 107.51 ? 1876 THR B N   1 
ATOM 3586  C CA  . THR A 1 504  ? 28.356  -46.657 -64.036  1.00 100.94 ? 1876 THR B CA  1 
ATOM 3587  C C   . THR A 1 504  ? 27.001  -46.585 -63.328  1.00 93.21  ? 1876 THR B C   1 
ATOM 3588  O O   . THR A 1 504  ? 26.948  -46.377 -62.117  1.00 89.12  ? 1876 THR B O   1 
ATOM 3589  C CB  . THR A 1 504  ? 28.625  -45.320 -64.772  1.00 101.49 ? 1876 THR B CB  1 
ATOM 3590  O OG1 . THR A 1 504  ? 29.910  -45.367 -65.402  1.00 109.36 ? 1876 THR B OG1 1 
ATOM 3591  C CG2 . THR A 1 504  ? 28.605  -44.127 -63.809  1.00 96.38  ? 1876 THR B CG2 1 
ATOM 3592  N N   . LEU A 1 505  ? 25.916  -46.744 -64.082  1.00 91.17  ? 1877 LEU B N   1 
ATOM 3593  C CA  . LEU A 1 505  ? 24.564  -46.676 -63.512  1.00 87.31  ? 1877 LEU B CA  1 
ATOM 3594  C C   . LEU A 1 505  ? 24.228  -47.894 -62.640  1.00 85.54  ? 1877 LEU B C   1 
ATOM 3595  O O   . LEU A 1 505  ? 23.634  -47.738 -61.575  1.00 79.25  ? 1877 LEU B O   1 
ATOM 3596  C CB  . LEU A 1 505  ? 23.513  -46.501 -64.613  1.00 87.58  ? 1877 LEU B CB  1 
ATOM 3597  C CG  . LEU A 1 505  ? 23.568  -45.209 -65.438  1.00 89.77  ? 1877 LEU B CG  1 
ATOM 3598  C CD1 . LEU A 1 505  ? 22.588  -45.290 -66.601  1.00 93.44  ? 1877 LEU B CD1 1 
ATOM 3599  C CD2 . LEU A 1 505  ? 23.287  -43.973 -64.600  1.00 85.43  ? 1877 LEU B CD2 1 
ATOM 3600  N N   . LEU A 1 506  ? 24.614  -49.092 -63.087  1.00 88.14  ? 1878 LEU B N   1 
ATOM 3601  C CA  . LEU A 1 506  ? 24.414  -50.327 -62.303  1.00 86.18  ? 1878 LEU B CA  1 
ATOM 3602  C C   . LEU A 1 506  ? 25.184  -50.308 -60.979  1.00 86.97  ? 1878 LEU B C   1 
ATOM 3603  O O   . LEU A 1 506  ? 24.704  -50.839 -59.976  1.00 85.98  ? 1878 LEU B O   1 
ATOM 3604  C CB  . LEU A 1 506  ? 24.816  -51.564 -63.118  1.00 87.74  ? 1878 LEU B CB  1 
ATOM 3605  C CG  . LEU A 1 506  ? 24.479  -52.941 -62.516  1.00 87.46  ? 1878 LEU B CG  1 
ATOM 3606  C CD1 . LEU A 1 506  ? 23.979  -53.895 -63.595  1.00 90.60  ? 1878 LEU B CD1 1 
ATOM 3607  C CD2 . LEU A 1 506  ? 25.656  -53.564 -61.769  1.00 87.36  ? 1878 LEU B CD2 1 
ATOM 3608  N N   . MET A 1 507  ? 26.378  -49.712 -60.998  1.00 88.89  ? 1879 MET B N   1 
ATOM 3609  C CA  . MET A 1 507  ? 27.214  -49.529 -59.800  1.00 86.62  ? 1879 MET B CA  1 
ATOM 3610  C C   . MET A 1 507  ? 26.485  -48.800 -58.666  1.00 78.00  ? 1879 MET B C   1 
ATOM 3611  O O   . MET A 1 507  ? 26.591  -49.209 -57.507  1.00 74.63  ? 1879 MET B O   1 
ATOM 3612  C CB  . MET A 1 507  ? 28.514  -48.791 -60.177  1.00 92.34  ? 1879 MET B CB  1 
ATOM 3613  C CG  . MET A 1 507  ? 29.335  -48.214 -59.030  1.00 93.94  ? 1879 MET B CG  1 
ATOM 3614  S SD  . MET A 1 507  ? 31.062  -47.919 -59.471  1.00 101.77 ? 1879 MET B SD  1 
ATOM 3615  C CE  . MET A 1 507  ? 30.949  -47.132 -61.083  1.00 104.97 ? 1879 MET B CE  1 
ATOM 3616  N N   . TYR A 1 508  ? 25.751  -47.739 -59.008  1.00 73.47  ? 1880 TYR B N   1 
ATOM 3617  C CA  . TYR A 1 508  ? 25.014  -46.925 -58.025  1.00 70.03  ? 1880 TYR B CA  1 
ATOM 3618  C C   . TYR A 1 508  ? 23.536  -47.315 -57.850  1.00 67.08  ? 1880 TYR B C   1 
ATOM 3619  O O   . TYR A 1 508  ? 22.953  -47.036 -56.804  1.00 63.07  ? 1880 TYR B O   1 
ATOM 3620  C CB  . TYR A 1 508  ? 25.096  -45.437 -58.394  1.00 70.16  ? 1880 TYR B CB  1 
ATOM 3621  C CG  . TYR A 1 508  ? 26.502  -44.869 -58.392  1.00 69.41  ? 1880 TYR B CG  1 
ATOM 3622  C CD1 . TYR A 1 508  ? 27.102  -44.430 -59.575  1.00 69.47  ? 1880 TYR B CD1 1 
ATOM 3623  C CD2 . TYR A 1 508  ? 27.233  -44.767 -57.208  1.00 66.55  ? 1880 TYR B CD2 1 
ATOM 3624  C CE1 . TYR A 1 508  ? 28.387  -43.912 -59.578  1.00 69.33  ? 1880 TYR B CE1 1 
ATOM 3625  C CE2 . TYR A 1 508  ? 28.520  -44.251 -57.203  1.00 67.43  ? 1880 TYR B CE2 1 
ATOM 3626  C CZ  . TYR A 1 508  ? 29.093  -43.826 -58.389  1.00 68.39  ? 1880 TYR B CZ  1 
ATOM 3627  O OH  . TYR A 1 508  ? 30.368  -43.311 -58.380  1.00 67.95  ? 1880 TYR B OH  1 
ATOM 3628  N N   . THR A 1 509  ? 22.932  -47.935 -58.865  1.00 69.07  ? 1881 THR B N   1 
ATOM 3629  C CA  . THR A 1 509  ? 21.512  -48.314 -58.816  1.00 68.48  ? 1881 THR B CA  1 
ATOM 3630  C C   . THR A 1 509  ? 21.239  -49.380 -57.755  1.00 66.04  ? 1881 THR B C   1 
ATOM 3631  O O   . THR A 1 509  ? 20.314  -49.237 -56.961  1.00 62.90  ? 1881 THR B O   1 
ATOM 3632  C CB  . THR A 1 509  ? 21.017  -48.819 -60.192  1.00 74.18  ? 1881 THR B CB  1 
ATOM 3633  O OG1 . THR A 1 509  ? 21.112  -47.760 -61.152  1.00 76.98  ? 1881 THR B OG1 1 
ATOM 3634  C CG2 . THR A 1 509  ? 19.559  -49.298 -60.138  1.00 75.14  ? 1881 THR B CG2 1 
ATOM 3635  N N   . VAL A 1 510  ? 22.040  -50.442 -57.757  1.00 68.14  ? 1882 VAL B N   1 
ATOM 3636  C CA  . VAL A 1 510  ? 21.856  -51.574 -56.830  1.00 68.38  ? 1882 VAL B CA  1 
ATOM 3637  C C   . VAL A 1 510  ? 21.961  -51.183 -55.343  1.00 65.63  ? 1882 VAL B C   1 
ATOM 3638  O O   . VAL A 1 510  ? 21.097  -51.586 -54.555  1.00 65.38  ? 1882 VAL B O   1 
ATOM 3639  C CB  . VAL A 1 510  ? 22.807  -52.755 -57.169  1.00 70.91  ? 1882 VAL B CB  1 
ATOM 3640  C CG1 . VAL A 1 510  ? 22.779  -53.837 -56.094  1.00 68.92  ? 1882 VAL B CG1 1 
ATOM 3641  C CG2 . VAL A 1 510  ? 22.437  -53.357 -58.522  1.00 74.22  ? 1882 VAL B CG2 1 
ATOM 3642  N N   . PRO A 1 511  ? 23.009  -50.413 -54.954  1.00 63.35  ? 1883 PRO B N   1 
ATOM 3643  C CA  . PRO A 1 511  ? 23.044  -49.908 -53.570  1.00 60.05  ? 1883 PRO B CA  1 
ATOM 3644  C C   . PRO A 1 511  ? 21.876  -48.986 -53.213  1.00 57.65  ? 1883 PRO B C   1 
ATOM 3645  O O   . PRO A 1 511  ? 21.362  -49.069 -52.101  1.00 58.49  ? 1883 PRO B O   1 
ATOM 3646  C CB  . PRO A 1 511  ? 24.382  -49.157 -53.481  1.00 57.97  ? 1883 PRO B CB  1 
ATOM 3647  C CG  . PRO A 1 511  ? 24.899  -49.057 -54.868  1.00 59.49  ? 1883 PRO B CG  1 
ATOM 3648  C CD  . PRO A 1 511  ? 24.290  -50.178 -55.643  1.00 62.00  ? 1883 PRO B CD  1 
ATOM 3649  N N   . ALA A 1 512  ? 21.462  -48.127 -54.143  1.00 57.14  ? 1884 ALA B N   1 
ATOM 3650  C CA  . ALA A 1 512  ? 20.296  -47.262 -53.926  1.00 58.08  ? 1884 ALA B CA  1 
ATOM 3651  C C   . ALA A 1 512  ? 19.052  -48.083 -53.581  1.00 57.56  ? 1884 ALA B C   1 
ATOM 3652  O O   . ALA A 1 512  ? 18.364  -47.798 -52.599  1.00 54.85  ? 1884 ALA B O   1 
ATOM 3653  C CB  . ALA A 1 512  ? 20.030  -46.393 -55.150  1.00 59.70  ? 1884 ALA B CB  1 
ATOM 3654  N N   . VAL A 1 513  ? 18.792  -49.113 -54.383  1.00 59.38  ? 1885 VAL B N   1 
ATOM 3655  C CA  . VAL A 1 513  ? 17.642  -49.992 -54.176  1.00 58.33  ? 1885 VAL B CA  1 
ATOM 3656  C C   . VAL A 1 513  ? 17.718  -50.601 -52.780  1.00 57.19  ? 1885 VAL B C   1 
ATOM 3657  O O   . VAL A 1 513  ? 16.776  -50.469 -52.001  1.00 55.08  ? 1885 VAL B O   1 
ATOM 3658  C CB  . VAL A 1 513  ? 17.557  -51.092 -55.263  1.00 59.62  ? 1885 VAL B CB  1 
ATOM 3659  C CG1 . VAL A 1 513  ? 16.517  -52.148 -54.913  1.00 59.22  ? 1885 VAL B CG1 1 
ATOM 3660  C CG2 . VAL A 1 513  ? 17.208  -50.476 -56.611  1.00 60.01  ? 1885 VAL B CG2 1 
ATOM 3661  N N   . GLN A 1 514  ? 18.849  -51.243 -52.478  1.00 58.11  ? 1886 GLN B N   1 
ATOM 3662  C CA  . GLN A 1 514  ? 19.114  -51.828 -51.151  1.00 57.42  ? 1886 GLN B CA  1 
ATOM 3663  C C   . GLN A 1 514  ? 18.858  -50.834 -50.014  1.00 57.67  ? 1886 GLN B C   1 
ATOM 3664  O O   . GLN A 1 514  ? 18.172  -51.154 -49.036  1.00 61.09  ? 1886 GLN B O   1 
ATOM 3665  C CB  . GLN A 1 514  ? 20.569  -52.289 -51.041  1.00 57.63  ? 1886 GLN B CB  1 
ATOM 3666  C CG  . GLN A 1 514  ? 20.943  -53.540 -51.817  1.00 59.21  ? 1886 GLN B CG  1 
ATOM 3667  C CD  . GLN A 1 514  ? 22.447  -53.781 -51.826  1.00 60.02  ? 1886 GLN B CD  1 
ATOM 3668  O OE1 . GLN A 1 514  ? 23.178  -53.316 -50.944  1.00 58.92  ? 1886 GLN B OE1 1 
ATOM 3669  N NE2 . GLN A 1 514  ? 22.917  -54.507 -52.827  1.00 62.15  ? 1886 GLN B NE2 1 
ATOM 3670  N N   . GLY A 1 515  ? 19.425  -49.638 -50.154  1.00 54.08  ? 1887 GLY B N   1 
ATOM 3671  C CA  . GLY A 1 515  ? 19.388  -48.621 -49.108  1.00 51.55  ? 1887 GLY B CA  1 
ATOM 3672  C C   . GLY A 1 515  ? 17.986  -48.165 -48.766  1.00 49.63  ? 1887 GLY B C   1 
ATOM 3673  O O   . GLY A 1 515  ? 17.636  -48.052 -47.587  1.00 48.65  ? 1887 GLY B O   1 
ATOM 3674  N N   . PHE A 1 516  ? 17.191  -47.891 -49.800  1.00 49.57  ? 1888 PHE B N   1 
ATOM 3675  C CA  . PHE A 1 516  ? 15.780  -47.532 -49.615  1.00 49.06  ? 1888 PHE B CA  1 
ATOM 3676  C C   . PHE A 1 516  ? 15.009  -48.653 -48.911  1.00 47.36  ? 1888 PHE B C   1 
ATOM 3677  O O   . PHE A 1 516  ? 14.207  -48.387 -48.019  1.00 47.07  ? 1888 PHE B O   1 
ATOM 3678  C CB  . PHE A 1 516  ? 15.099  -47.173 -50.949  1.00 47.51  ? 1888 PHE B CB  1 
ATOM 3679  C CG  . PHE A 1 516  ? 15.532  -45.849 -51.527  1.00 45.93  ? 1888 PHE B CG  1 
ATOM 3680  C CD1 . PHE A 1 516  ? 16.064  -45.772 -52.809  1.00 45.68  ? 1888 PHE B CD1 1 
ATOM 3681  C CD2 . PHE A 1 516  ? 15.389  -44.672 -50.794  1.00 47.05  ? 1888 PHE B CD2 1 
ATOM 3682  C CE1 . PHE A 1 516  ? 16.455  -44.554 -53.340  1.00 47.13  ? 1888 PHE B CE1 1 
ATOM 3683  C CE2 . PHE A 1 516  ? 15.781  -43.450 -51.318  1.00 47.39  ? 1888 PHE B CE2 1 
ATOM 3684  C CZ  . PHE A 1 516  ? 16.315  -43.392 -52.593  1.00 47.65  ? 1888 PHE B CZ  1 
ATOM 3685  N N   . PHE A 1 517  ? 15.273  -49.900 -49.286  1.00 46.22  ? 1889 PHE B N   1 
ATOM 3686  C CA  . PHE A 1 517  ? 14.620  -51.031 -48.630  1.00 47.96  ? 1889 PHE B CA  1 
ATOM 3687  C C   . PHE A 1 517  ? 14.906  -51.110 -47.132  1.00 50.93  ? 1889 PHE B C   1 
ATOM 3688  O O   . PHE A 1 517  ? 13.983  -51.350 -46.355  1.00 52.69  ? 1889 PHE B O   1 
ATOM 3689  C CB  . PHE A 1 517  ? 14.961  -52.365 -49.308  1.00 48.46  ? 1889 PHE B CB  1 
ATOM 3690  C CG  . PHE A 1 517  ? 14.091  -52.678 -50.492  1.00 46.80  ? 1889 PHE B CG  1 
ATOM 3691  C CD1 . PHE A 1 517  ? 14.636  -52.821 -51.764  1.00 47.45  ? 1889 PHE B CD1 1 
ATOM 3692  C CD2 . PHE A 1 517  ? 12.718  -52.816 -50.337  1.00 45.67  ? 1889 PHE B CD2 1 
ATOM 3693  C CE1 . PHE A 1 517  ? 13.828  -53.107 -52.853  1.00 47.56  ? 1889 PHE B CE1 1 
ATOM 3694  C CE2 . PHE A 1 517  ? 11.906  -53.096 -51.422  1.00 46.80  ? 1889 PHE B CE2 1 
ATOM 3695  C CZ  . PHE A 1 517  ? 12.462  -53.248 -52.682  1.00 47.13  ? 1889 PHE B CZ  1 
ATOM 3696  N N   . ARG A 1 518  ? 16.153  -50.894 -46.712  1.00 55.20  ? 1890 ARG B N   1 
ATOM 3697  C CA  . ARG A 1 518  ? 16.440  -50.900 -45.268  1.00 58.03  ? 1890 ARG B CA  1 
ATOM 3698  C C   . ARG A 1 518  ? 15.927  -49.642 -44.569  1.00 55.09  ? 1890 ARG B C   1 
ATOM 3699  O O   . ARG A 1 518  ? 15.522  -49.712 -43.409  1.00 52.80  ? 1890 ARG B O   1 
ATOM 3700  C CB  . ARG A 1 518  ? 17.921  -51.156 -44.942  1.00 60.07  ? 1890 ARG B CB  1 
ATOM 3701  C CG  . ARG A 1 518  ? 18.071  -51.945 -43.636  1.00 63.95  ? 1890 ARG B CG  1 
ATOM 3702  C CD  . ARG A 1 518  ? 19.421  -52.609 -43.417  1.00 69.18  ? 1890 ARG B CD  1 
ATOM 3703  N NE  . ARG A 1 518  ? 19.854  -53.467 -44.521  1.00 76.34  ? 1890 ARG B NE  1 
ATOM 3704  C CZ  . ARG A 1 518  ? 20.938  -54.247 -44.505  1.00 88.46  ? 1890 ARG B CZ  1 
ATOM 3705  N NH1 . ARG A 1 518  ? 21.724  -54.313 -43.431  1.00 92.10  ? 1890 ARG B NH1 1 
ATOM 3706  N NH2 . ARG A 1 518  ? 21.243  -54.980 -45.577  1.00 95.18  ? 1890 ARG B NH2 1 
ATOM 3707  N N   . SER A 1 519  ? 15.923  -48.506 -45.271  1.00 53.11  ? 1891 SER B N   1 
ATOM 3708  C CA  . SER A 1 519  ? 15.356  -47.274 -44.716  1.00 53.49  ? 1891 SER B CA  1 
ATOM 3709  C C   . SER A 1 519  ? 13.839  -47.396 -44.544  1.00 50.98  ? 1891 SER B C   1 
ATOM 3710  O O   . SER A 1 519  ? 13.288  -46.883 -43.579  1.00 50.97  ? 1891 SER B O   1 
ATOM 3711  C CB  . SER A 1 519  ? 15.727  -46.038 -45.557  1.00 54.84  ? 1891 SER B CB  1 
ATOM 3712  O OG  . SER A 1 519  ? 14.828  -45.827 -46.627  1.00 57.29  ? 1891 SER B OG  1 
ATOM 3713  N N   . ILE A 1 520  ? 13.178  -48.089 -45.469  1.00 51.72  ? 1892 ILE B N   1 
ATOM 3714  C CA  . ILE A 1 520  ? 11.730  -48.338 -45.375  1.00 52.34  ? 1892 ILE B CA  1 
ATOM 3715  C C   . ILE A 1 520  ? 11.367  -49.192 -44.146  1.00 52.72  ? 1892 ILE B C   1 
ATOM 3716  O O   . ILE A 1 520  ? 10.451  -48.841 -43.398  1.00 52.95  ? 1892 ILE B O   1 
ATOM 3717  C CB  . ILE A 1 520  ? 11.169  -48.992 -46.667  1.00 49.68  ? 1892 ILE B CB  1 
ATOM 3718  C CG1 . ILE A 1 520  ? 11.177  -47.989 -47.822  1.00 50.32  ? 1892 ILE B CG1 1 
ATOM 3719  C CG2 . ILE A 1 520  ? 9.735   -49.464 -46.471  1.00 46.73  ? 1892 ILE B CG2 1 
ATOM 3720  C CD1 . ILE A 1 520  ? 11.167  -48.632 -49.193  1.00 51.69  ? 1892 ILE B CD1 1 
ATOM 3721  N N   . SER A 1 521  ? 12.077  -50.301 -43.939  1.00 51.85  ? 1893 SER B N   1 
ATOM 3722  C CA  . SER A 1 521  ? 11.824  -51.163 -42.778  1.00 53.16  ? 1893 SER B CA  1 
ATOM 3723  C C   . SER A 1 521  ? 12.066  -50.436 -41.450  1.00 58.43  ? 1893 SER B C   1 
ATOM 3724  O O   . SER A 1 521  ? 11.440  -50.765 -40.440  1.00 63.83  ? 1893 SER B O   1 
ATOM 3725  C CB  . SER A 1 521  ? 12.659  -52.443 -42.849  1.00 52.95  ? 1893 SER B CB  1 
ATOM 3726  O OG  . SER A 1 521  ? 14.028  -52.155 -43.044  1.00 54.25  ? 1893 SER B OG  1 
ATOM 3727  N N   . LEU A 1 522  ? 12.954  -49.439 -41.463  1.00 60.66  ? 1894 LEU B N   1 
ATOM 3728  C CA  . LEU A 1 522  ? 13.226  -48.612 -40.287  1.00 61.14  ? 1894 LEU B CA  1 
ATOM 3729  C C   . LEU A 1 522  ? 12.360  -47.345 -40.181  1.00 60.86  ? 1894 LEU B C   1 
ATOM 3730  O O   . LEU A 1 522  ? 12.660  -46.486 -39.360  1.00 65.85  ? 1894 LEU B O   1 
ATOM 3731  C CB  . LEU A 1 522  ? 14.717  -48.240 -40.248  1.00 61.48  ? 1894 LEU B CB  1 
ATOM 3732  C CG  . LEU A 1 522  ? 15.719  -49.394 -40.135  1.00 63.91  ? 1894 LEU B CG  1 
ATOM 3733  C CD1 . LEU A 1 522  ? 17.131  -48.867 -40.339  1.00 69.01  ? 1894 LEU B CD1 1 
ATOM 3734  C CD2 . LEU A 1 522  ? 15.621  -50.110 -38.799  1.00 64.34  ? 1894 LEU B CD2 1 
ATOM 3735  N N   . SER A 1 523  ? 11.302  -47.215 -40.986  1.00 61.46  ? 1895 SER B N   1 
ATOM 3736  C CA  . SER A 1 523  ? 10.324  -46.125 -40.805  1.00 66.00  ? 1895 SER B CA  1 
ATOM 3737  C C   . SER A 1 523  ? 8.989   -46.716 -40.357  1.00 72.00  ? 1895 SER B C   1 
ATOM 3738  O O   . SER A 1 523  ? 8.558   -46.481 -39.228  1.00 82.57  ? 1895 SER B O   1 
ATOM 3739  C CB  . SER A 1 523  ? 10.145  -45.272 -42.068  1.00 63.78  ? 1895 SER B CB  1 
ATOM 3740  O OG  . SER A 1 523  ? 11.195  -45.446 -43.001  1.00 67.91  ? 1895 SER B OG  1 
ATOM 3741  N N   . ARG A 1 524  ? 8.360   -47.493 -41.238  1.00 70.40  ? 1896 ARG B N   1 
ATOM 3742  C CA  . ARG A 1 524  ? 7.107   -48.201 -40.950  1.00 68.28  ? 1896 ARG B CA  1 
ATOM 3743  C C   . ARG A 1 524  ? 6.016   -47.246 -40.438  1.00 65.64  ? 1896 ARG B C   1 
ATOM 3744  O O   . ARG A 1 524  ? 5.883   -47.020 -39.237  1.00 66.33  ? 1896 ARG B O   1 
ATOM 3745  C CB  . ARG A 1 524  ? 7.362   -49.369 -39.971  1.00 68.93  ? 1896 ARG B CB  1 
ATOM 3746  C CG  . ARG A 1 524  ? 6.680   -50.682 -40.341  1.00 68.00  ? 1896 ARG B CG  1 
ATOM 3747  C CD  . ARG A 1 524  ? 5.160   -50.582 -40.367  1.00 67.82  ? 1896 ARG B CD  1 
ATOM 3748  N NE  . ARG A 1 524  ? 4.533   -51.805 -40.891  1.00 68.49  ? 1896 ARG B NE  1 
ATOM 3749  C CZ  . ARG A 1 524  ? 4.058   -52.825 -40.169  1.00 66.84  ? 1896 ARG B CZ  1 
ATOM 3750  N NH1 . ARG A 1 524  ? 4.107   -52.829 -38.838  1.00 71.35  ? 1896 ARG B NH1 1 
ATOM 3751  N NH2 . ARG A 1 524  ? 3.515   -53.867 -40.792  1.00 64.33  ? 1896 ARG B NH2 1 
ATOM 3752  N N   . GLY A 1 525  ? 5.247   -46.684 -41.366  1.00 66.84  ? 1897 GLY B N   1 
ATOM 3753  C CA  . GLY A 1 525  ? 4.215   -45.694 -41.040  1.00 69.67  ? 1897 GLY B CA  1 
ATOM 3754  C C   . GLY A 1 525  ? 4.449   -44.384 -41.765  1.00 72.16  ? 1897 GLY B C   1 
ATOM 3755  O O   . GLY A 1 525  ? 3.508   -43.783 -42.284  1.00 75.74  ? 1897 GLY B O   1 
ATOM 3756  N N   . ASN A 1 526  ? 5.705   -43.936 -41.788  1.00 71.17  ? 1898 ASN B N   1 
ATOM 3757  C CA  . ASN A 1 526  ? 6.106   -42.776 -42.581  1.00 64.05  ? 1898 ASN B CA  1 
ATOM 3758  C C   . ASN A 1 526  ? 7.269   -43.168 -43.496  1.00 56.49  ? 1898 ASN B C   1 
ATOM 3759  O O   . ASN A 1 526  ? 8.433   -42.948 -43.167  1.00 57.72  ? 1898 ASN B O   1 
ATOM 3760  C CB  . ASN A 1 526  ? 6.465   -41.598 -41.659  1.00 65.46  ? 1898 ASN B CB  1 
ATOM 3761  C CG  . ASN A 1 526  ? 6.535   -40.262 -42.393  1.00 69.12  ? 1898 ASN B CG  1 
ATOM 3762  O OD1 . ASN A 1 526  ? 6.442   -40.192 -43.622  1.00 73.08  ? 1898 ASN B OD1 1 
ATOM 3763  N ND2 . ASN A 1 526  ? 6.696   -39.188 -41.631  1.00 70.32  ? 1898 ASN B ND2 1 
ATOM 3764  N N   . ASN A 1 527  ? 6.930   -43.762 -44.642  1.00 51.19  ? 1899 ASN B N   1 
ATOM 3765  C CA  . ASN A 1 527  ? 7.914   -44.153 -45.671  1.00 49.21  ? 1899 ASN B CA  1 
ATOM 3766  C C   . ASN A 1 527  ? 7.381   -44.049 -47.109  1.00 46.31  ? 1899 ASN B C   1 
ATOM 3767  O O   . ASN A 1 527  ? 7.804   -44.801 -47.989  1.00 44.64  ? 1899 ASN B O   1 
ATOM 3768  C CB  . ASN A 1 527  ? 8.450   -45.570 -45.398  1.00 50.54  ? 1899 ASN B CB  1 
ATOM 3769  C CG  . ASN A 1 527  ? 7.351   -46.585 -45.111  1.00 54.29  ? 1899 ASN B CG  1 
ATOM 3770  O OD1 . ASN A 1 527  ? 7.530   -47.481 -44.288  1.00 63.12  ? 1899 ASN B OD1 1 
ATOM 3771  N ND2 . ASN A 1 527  ? 6.217   -46.460 -45.789  1.00 55.89  ? 1899 ASN B ND2 1 
ATOM 3772  N N   . LEU A 1 528  ? 6.470   -43.109 -47.350  1.00 45.63  ? 1900 LEU B N   1 
ATOM 3773  C CA  . LEU A 1 528  ? 5.874   -42.939 -48.678  1.00 44.34  ? 1900 LEU B CA  1 
ATOM 3774  C C   . LEU A 1 528  ? 6.924   -42.544 -49.717  1.00 44.52  ? 1900 LEU B C   1 
ATOM 3775  O O   . LEU A 1 528  ? 6.893   -43.055 -50.834  1.00 44.94  ? 1900 LEU B O   1 
ATOM 3776  C CB  . LEU A 1 528  ? 4.738   -41.909 -48.636  1.00 45.10  ? 1900 LEU B CB  1 
ATOM 3777  C CG  . LEU A 1 528  ? 4.107   -41.433 -49.948  1.00 43.79  ? 1900 LEU B CG  1 
ATOM 3778  C CD1 . LEU A 1 528  ? 3.536   -42.573 -50.768  1.00 42.94  ? 1900 LEU B CD1 1 
ATOM 3779  C CD2 . LEU A 1 528  ? 3.026   -40.419 -49.629  1.00 45.22  ? 1900 LEU B CD2 1 
ATOM 3780  N N   . GLN A 1 529  ? 7.846   -41.651 -49.347  1.00 46.41  ? 1901 GLN B N   1 
ATOM 3781  C CA  . GLN A 1 529  ? 8.910   -41.207 -50.259  1.00 48.08  ? 1901 GLN B CA  1 
ATOM 3782  C C   . GLN A 1 529  ? 9.812   -42.366 -50.675  1.00 47.34  ? 1901 GLN B C   1 
ATOM 3783  O O   . GLN A 1 529  ? 9.945   -42.664 -51.860  1.00 47.32  ? 1901 GLN B O   1 
ATOM 3784  C CB  . GLN A 1 529  ? 9.767   -40.094 -49.636  1.00 49.65  ? 1901 GLN B CB  1 
ATOM 3785  C CG  . GLN A 1 529  ? 10.707  -39.428 -50.642  1.00 52.07  ? 1901 GLN B CG  1 
ATOM 3786  C CD  . GLN A 1 529  ? 11.866  -38.690 -50.004  1.00 52.16  ? 1901 GLN B CD  1 
ATOM 3787  O OE1 . GLN A 1 529  ? 11.697  -37.991 -49.006  1.00 53.51  ? 1901 GLN B OE1 1 
ATOM 3788  N NE2 . GLN A 1 529  ? 13.053  -38.826 -50.596  1.00 51.82  ? 1901 GLN B NE2 1 
ATOM 3789  N N   . ASP A 1 530  ? 10.409  -43.018 -49.686  1.00 47.76  ? 1902 ASP B N   1 
ATOM 3790  C CA  . ASP A 1 530  ? 11.338  -44.121 -49.928  1.00 50.00  ? 1902 ASP B CA  1 
ATOM 3791  C C   . ASP A 1 530  ? 10.700  -45.217 -50.784  1.00 49.29  ? 1902 ASP B C   1 
ATOM 3792  O O   . ASP A 1 530  ? 11.332  -45.725 -51.703  1.00 52.36  ? 1902 ASP B O   1 
ATOM 3793  C CB  . ASP A 1 530  ? 11.814  -44.726 -48.605  1.00 54.96  ? 1902 ASP B CB  1 
ATOM 3794  C CG  . ASP A 1 530  ? 12.585  -43.738 -47.751  1.00 59.74  ? 1902 ASP B CG  1 
ATOM 3795  O OD1 . ASP A 1 530  ? 13.696  -43.347 -48.173  1.00 56.97  ? 1902 ASP B OD1 1 
ATOM 3796  O OD2 . ASP A 1 530  ? 12.075  -43.366 -46.662  1.00 61.87  ? 1902 ASP B OD2 1 
ATOM 3797  N N   . THR A 1 531  ? 9.450   -45.563 -50.478  1.00 46.78  ? 1903 THR B N   1 
ATOM 3798  C CA  . THR A 1 531  ? 8.691   -46.554 -51.246  1.00 44.11  ? 1903 THR B CA  1 
ATOM 3799  C C   . THR A 1 531  ? 8.523   -46.119 -52.698  1.00 44.33  ? 1903 THR B C   1 
ATOM 3800  O O   . THR A 1 531  ? 8.717   -46.920 -53.609  1.00 44.86  ? 1903 THR B O   1 
ATOM 3801  C CB  . THR A 1 531  ? 7.308   -46.801 -50.615  1.00 42.27  ? 1903 THR B CB  1 
ATOM 3802  O OG1 . THR A 1 531  ? 7.484   -47.188 -49.250  1.00 41.13  ? 1903 THR B OG1 1 
ATOM 3803  C CG2 . THR A 1 531  ? 6.534   -47.906 -51.346  1.00 42.52  ? 1903 THR B CG2 1 
ATOM 3804  N N   . LEU A 1 532  ? 8.164   -44.856 -52.903  1.00 45.05  ? 1904 LEU B N   1 
ATOM 3805  C CA  . LEU A 1 532  ? 8.029   -44.307 -54.252  1.00 49.08  ? 1904 LEU B CA  1 
ATOM 3806  C C   . LEU A 1 532  ? 9.358   -44.298 -55.018  1.00 52.09  ? 1904 LEU B C   1 
ATOM 3807  O O   . LEU A 1 532  ? 9.372   -44.524 -56.229  1.00 53.95  ? 1904 LEU B O   1 
ATOM 3808  C CB  . LEU A 1 532  ? 7.420   -42.895 -54.220  1.00 50.41  ? 1904 LEU B CB  1 
ATOM 3809  C CG  . LEU A 1 532  ? 5.911   -42.788 -53.963  1.00 50.80  ? 1904 LEU B CG  1 
ATOM 3810  C CD1 . LEU A 1 532  ? 5.520   -41.356 -53.622  1.00 50.48  ? 1904 LEU B CD1 1 
ATOM 3811  C CD2 . LEU A 1 532  ? 5.118   -43.268 -55.169  1.00 52.99  ? 1904 LEU B CD2 1 
ATOM 3812  N N   . ARG A 1 533  ? 10.461  -44.039 -54.317  1.00 55.39  ? 1905 ARG B N   1 
ATOM 3813  C CA  . ARG A 1 533  ? 11.796  -44.055 -54.936  1.00 58.85  ? 1905 ARG B CA  1 
ATOM 3814  C C   . ARG A 1 533  ? 12.221  -45.466 -55.349  1.00 56.07  ? 1905 ARG B C   1 
ATOM 3815  O O   . ARG A 1 533  ? 12.867  -45.641 -56.381  1.00 56.69  ? 1905 ARG B O   1 
ATOM 3816  C CB  . ARG A 1 533  ? 12.849  -43.432 -54.004  1.00 63.96  ? 1905 ARG B CB  1 
ATOM 3817  C CG  . ARG A 1 533  ? 12.671  -41.942 -53.736  1.00 70.02  ? 1905 ARG B CG  1 
ATOM 3818  C CD  . ARG A 1 533  ? 12.928  -41.083 -54.967  1.00 78.99  ? 1905 ARG B CD  1 
ATOM 3819  N NE  . ARG A 1 533  ? 12.666  -39.665 -54.704  1.00 88.59  ? 1905 ARG B NE  1 
ATOM 3820  C CZ  . ARG A 1 533  ? 12.465  -38.726 -55.635  1.00 96.08  ? 1905 ARG B CZ  1 
ATOM 3821  N NH1 . ARG A 1 533  ? 12.487  -39.017 -56.941  1.00 96.79  ? 1905 ARG B NH1 1 
ATOM 3822  N NH2 . ARG A 1 533  ? 12.233  -37.469 -55.255  1.00 95.19  ? 1905 ARG B NH2 1 
ATOM 3823  N N   . VAL A 1 534  ? 11.852  -46.465 -54.549  1.00 54.60  ? 1906 VAL B N   1 
ATOM 3824  C CA  . VAL A 1 534  ? 12.059  -47.867 -54.921  1.00 54.11  ? 1906 VAL B CA  1 
ATOM 3825  C C   . VAL A 1 534  ? 11.361  -48.155 -56.241  1.00 52.73  ? 1906 VAL B C   1 
ATOM 3826  O O   . VAL A 1 534  ? 11.926  -48.828 -57.098  1.00 57.27  ? 1906 VAL B O   1 
ATOM 3827  C CB  . VAL A 1 534  ? 11.564  -48.845 -53.826  1.00 55.12  ? 1906 VAL B CB  1 
ATOM 3828  C CG1 . VAL A 1 534  ? 11.468  -50.282 -54.336  1.00 54.84  ? 1906 VAL B CG1 1 
ATOM 3829  C CG2 . VAL A 1 534  ? 12.492  -48.793 -52.623  1.00 56.33  ? 1906 VAL B CG2 1 
ATOM 3830  N N   . LEU A 1 535  ? 10.141  -47.645 -56.398  1.00 49.57  ? 1907 LEU B N   1 
ATOM 3831  C CA  . LEU A 1 535  ? 9.391   -47.830 -57.637  1.00 49.18  ? 1907 LEU B CA  1 
ATOM 3832  C C   . LEU A 1 535  ? 10.051  -47.179 -58.850  1.00 49.75  ? 1907 LEU B C   1 
ATOM 3833  O O   . LEU A 1 535  ? 9.996   -47.750 -59.939  1.00 51.57  ? 1907 LEU B O   1 
ATOM 3834  C CB  . LEU A 1 535  ? 7.949   -47.327 -57.502  1.00 47.84  ? 1907 LEU B CB  1 
ATOM 3835  C CG  . LEU A 1 535  ? 7.003   -48.009 -56.510  1.00 46.60  ? 1907 LEU B CG  1 
ATOM 3836  C CD1 . LEU A 1 535  ? 5.587   -47.517 -56.749  1.00 45.91  ? 1907 LEU B CD1 1 
ATOM 3837  C CD2 . LEU A 1 535  ? 7.042   -49.527 -56.598  1.00 47.67  ? 1907 LEU B CD2 1 
ATOM 3838  N N   . THR A 1 536  ? 10.664  -46.004 -58.679  1.00 49.73  ? 1908 THR B N   1 
ATOM 3839  C CA  . THR A 1 536  ? 11.334  -45.321 -59.804  1.00 52.26  ? 1908 THR B CA  1 
ATOM 3840  C C   . THR A 1 536  ? 12.485  -46.164 -60.350  1.00 53.76  ? 1908 THR B C   1 
ATOM 3841  O O   . THR A 1 536  ? 12.617  -46.316 -61.559  1.00 57.91  ? 1908 THR B O   1 
ATOM 3842  C CB  . THR A 1 536  ? 11.879  -43.919 -59.439  1.00 52.28  ? 1908 THR B CB  1 
ATOM 3843  O OG1 . THR A 1 536  ? 10.936  -43.208 -58.629  1.00 53.50  ? 1908 THR B OG1 1 
ATOM 3844  C CG2 . THR A 1 536  ? 12.157  -43.107 -60.704  1.00 53.64  ? 1908 THR B CG2 1 
ATOM 3845  N N   . LEU A 1 537  ? 13.297  -46.716 -59.449  1.00 52.81  ? 1909 LEU B N   1 
ATOM 3846  C CA  . LEU A 1 537  ? 14.418  -47.591 -59.820  1.00 54.69  ? 1909 LEU B CA  1 
ATOM 3847  C C   . LEU A 1 537  ? 13.964  -48.948 -60.374  1.00 55.46  ? 1909 LEU B C   1 
ATOM 3848  O O   . LEU A 1 537  ? 14.584  -49.489 -61.290  1.00 57.13  ? 1909 LEU B O   1 
ATOM 3849  C CB  . LEU A 1 537  ? 15.330  -47.808 -58.615  1.00 56.15  ? 1909 LEU B CB  1 
ATOM 3850  C CG  . LEU A 1 537  ? 16.030  -46.544 -58.106  1.00 58.54  ? 1909 LEU B CG  1 
ATOM 3851  C CD1 . LEU A 1 537  ? 16.491  -46.716 -56.662  1.00 58.93  ? 1909 LEU B CD1 1 
ATOM 3852  C CD2 . LEU A 1 537  ? 17.196  -46.185 -59.015  1.00 60.52  ? 1909 LEU B CD2 1 
ATOM 3853  N N   . TRP A 1 538  ? 12.890  -49.486 -59.801  1.00 55.63  ? 1910 TRP B N   1 
ATOM 3854  C CA  . TRP A 1 538  ? 12.217  -50.691 -60.304  1.00 55.66  ? 1910 TRP B CA  1 
ATOM 3855  C C   . TRP A 1 538  ? 11.734  -50.468 -61.737  1.00 55.74  ? 1910 TRP B C   1 
ATOM 3856  O O   . TRP A 1 538  ? 12.110  -51.212 -62.636  1.00 56.53  ? 1910 TRP B O   1 
ATOM 3857  C CB  . TRP A 1 538  ? 11.028  -51.033 -59.391  1.00 55.72  ? 1910 TRP B CB  1 
ATOM 3858  C CG  . TRP A 1 538  ? 10.350  -52.369 -59.594  1.00 57.32  ? 1910 TRP B CG  1 
ATOM 3859  C CD1 . TRP A 1 538  ? 10.520  -53.253 -60.621  1.00 60.68  ? 1910 TRP B CD1 1 
ATOM 3860  C CD2 . TRP A 1 538  ? 9.356   -52.941 -58.739  1.00 56.27  ? 1910 TRP B CD2 1 
ATOM 3861  N NE1 . TRP A 1 538  ? 9.707   -54.347 -60.446  1.00 61.05  ? 1910 TRP B NE1 1 
ATOM 3862  C CE2 . TRP A 1 538  ? 8.981   -54.178 -59.298  1.00 57.90  ? 1910 TRP B CE2 1 
ATOM 3863  C CE3 . TRP A 1 538  ? 8.751   -52.529 -57.547  1.00 55.78  ? 1910 TRP B CE3 1 
ATOM 3864  C CZ2 . TRP A 1 538  ? 8.031   -55.009 -58.704  1.00 59.17  ? 1910 TRP B CZ2 1 
ATOM 3865  C CZ3 . TRP A 1 538  ? 7.805   -53.356 -56.955  1.00 55.64  ? 1910 TRP B CZ3 1 
ATOM 3866  C CH2 . TRP A 1 538  ? 7.455   -54.580 -57.537  1.00 57.95  ? 1910 TRP B CH2 1 
ATOM 3867  N N   . PHE A 1 539  ? 10.922  -49.435 -61.950  1.00 54.37  ? 1911 PHE B N   1 
ATOM 3868  C CA  . PHE A 1 539  ? 10.323  -49.203 -63.268  1.00 56.35  ? 1911 PHE B CA  1 
ATOM 3869  C C   . PHE A 1 539  ? 11.367  -48.792 -64.315  1.00 59.48  ? 1911 PHE B C   1 
ATOM 3870  O O   . PHE A 1 539  ? 11.294  -49.246 -65.463  1.00 64.84  ? 1911 PHE B O   1 
ATOM 3871  C CB  . PHE A 1 539  ? 9.166   -48.182 -63.212  1.00 55.44  ? 1911 PHE B CB  1 
ATOM 3872  C CG  . PHE A 1 539  ? 8.056   -48.528 -62.232  1.00 52.68  ? 1911 PHE B CG  1 
ATOM 3873  C CD1 . PHE A 1 539  ? 7.292   -47.507 -61.667  1.00 52.64  ? 1911 PHE B CD1 1 
ATOM 3874  C CD2 . PHE A 1 539  ? 7.773   -49.848 -61.860  1.00 51.98  ? 1911 PHE B CD2 1 
ATOM 3875  C CE1 . PHE A 1 539  ? 6.270   -47.787 -60.767  1.00 51.70  ? 1911 PHE B CE1 1 
ATOM 3876  C CE2 . PHE A 1 539  ? 6.755   -50.129 -60.956  1.00 51.62  ? 1911 PHE B CE2 1 
ATOM 3877  C CZ  . PHE A 1 539  ? 6.006   -49.099 -60.405  1.00 50.89  ? 1911 PHE B CZ  1 
ATOM 3878  N N   . ASP A 1 540  ? 12.337  -47.962 -63.924  1.00 58.97  ? 1912 ASP B N   1 
ATOM 3879  C CA  . ASP A 1 540  ? 13.390  -47.514 -64.849  1.00 62.43  ? 1912 ASP B CA  1 
ATOM 3880  C C   . ASP A 1 540  ? 14.455  -48.593 -65.107  1.00 65.05  ? 1912 ASP B C   1 
ATOM 3881  O O   . ASP A 1 540  ? 14.813  -48.841 -66.263  1.00 69.65  ? 1912 ASP B O   1 
ATOM 3882  C CB  . ASP A 1 540  ? 14.060  -46.215 -64.361  1.00 61.93  ? 1912 ASP B CB  1 
ATOM 3883  C CG  . ASP A 1 540  ? 13.122  -44.997 -64.409  1.00 63.27  ? 1912 ASP B CG  1 
ATOM 3884  O OD1 . ASP A 1 540  ? 11.910  -45.153 -64.683  1.00 64.62  ? 1912 ASP B OD1 1 
ATOM 3885  O OD2 . ASP A 1 540  ? 13.603  -43.868 -64.162  1.00 62.25  ? 1912 ASP B OD2 1 
ATOM 3886  N N   . TYR A 1 541  ? 14.940  -49.236 -64.043  1.00 61.13  ? 1913 TYR B N   1 
ATOM 3887  C CA  . TYR A 1 541  ? 16.103  -50.134 -64.131  1.00 61.94  ? 1913 TYR B CA  1 
ATOM 3888  C C   . TYR A 1 541  ? 15.877  -51.586 -63.675  1.00 61.44  ? 1913 TYR B C   1 
ATOM 3889  O O   . TYR A 1 541  ? 16.830  -52.364 -63.633  1.00 63.62  ? 1913 TYR B O   1 
ATOM 3890  C CB  . TYR A 1 541  ? 17.262  -49.538 -63.323  1.00 62.42  ? 1913 TYR B CB  1 
ATOM 3891  C CG  . TYR A 1 541  ? 17.560  -48.091 -63.644  1.00 63.44  ? 1913 TYR B CG  1 
ATOM 3892  C CD1 . TYR A 1 541  ? 17.226  -47.072 -62.752  1.00 62.27  ? 1913 TYR B CD1 1 
ATOM 3893  C CD2 . TYR A 1 541  ? 18.172  -47.736 -64.844  1.00 65.86  ? 1913 TYR B CD2 1 
ATOM 3894  C CE1 . TYR A 1 541  ? 17.496  -45.743 -63.044  1.00 62.49  ? 1913 TYR B CE1 1 
ATOM 3895  C CE2 . TYR A 1 541  ? 18.444  -46.408 -65.145  1.00 67.21  ? 1913 TYR B CE2 1 
ATOM 3896  C CZ  . TYR A 1 541  ? 18.106  -45.417 -64.242  1.00 64.41  ? 1913 TYR B CZ  1 
ATOM 3897  O OH  . TYR A 1 541  ? 18.373  -44.103 -64.535  1.00 64.35  ? 1913 TYR B OH  1 
ATOM 3898  N N   . GLY A 1 542  ? 14.641  -51.964 -63.354  1.00 60.17  ? 1914 GLY B N   1 
ATOM 3899  C CA  . GLY A 1 542  ? 14.357  -53.304 -62.812  1.00 59.97  ? 1914 GLY B CA  1 
ATOM 3900  C C   . GLY A 1 542  ? 14.507  -54.462 -63.786  1.00 61.82  ? 1914 GLY B C   1 
ATOM 3901  O O   . GLY A 1 542  ? 14.562  -55.619 -63.370  1.00 59.60  ? 1914 GLY B O   1 
ATOM 3902  N N   . HIS A 1 543  ? 14.529  -54.157 -65.081  1.00 65.80  ? 1915 HIS B N   1 
ATOM 3903  C CA  . HIS A 1 543  ? 14.836  -55.154 -66.113  1.00 70.47  ? 1915 HIS B CA  1 
ATOM 3904  C C   . HIS A 1 543  ? 16.293  -55.644 -66.082  1.00 72.40  ? 1915 HIS B C   1 
ATOM 3905  O O   . HIS A 1 543  ? 16.572  -56.753 -66.540  1.00 75.14  ? 1915 HIS B O   1 
ATOM 3906  C CB  . HIS A 1 543  ? 14.459  -54.642 -67.512  1.00 74.12  ? 1915 HIS B CB  1 
ATOM 3907  C CG  . HIS A 1 543  ? 15.286  -53.490 -67.988  1.00 76.87  ? 1915 HIS B CG  1 
ATOM 3908  N ND1 . HIS A 1 543  ? 15.146  -52.215 -67.486  1.00 79.27  ? 1915 HIS B ND1 1 
ATOM 3909  C CD2 . HIS A 1 543  ? 16.253  -53.419 -68.932  1.00 82.01  ? 1915 HIS B CD2 1 
ATOM 3910  C CE1 . HIS A 1 543  ? 16.001  -51.410 -68.091  1.00 83.42  ? 1915 HIS B CE1 1 
ATOM 3911  N NE2 . HIS A 1 543  ? 16.682  -52.116 -68.975  1.00 84.89  ? 1915 HIS B NE2 1 
ATOM 3912  N N   . TRP A 1 544  ? 17.212  -54.832 -65.548  1.00 73.56  ? 1916 TRP B N   1 
ATOM 3913  C CA  . TRP A 1 544  ? 18.602  -55.268 -65.340  1.00 76.91  ? 1916 TRP B CA  1 
ATOM 3914  C C   . TRP A 1 544  ? 18.647  -56.335 -64.238  1.00 77.10  ? 1916 TRP B C   1 
ATOM 3915  O O   . TRP A 1 544  ? 18.116  -56.102 -63.150  1.00 77.92  ? 1916 TRP B O   1 
ATOM 3916  C CB  . TRP A 1 544  ? 19.514  -54.099 -64.939  1.00 77.38  ? 1916 TRP B CB  1 
ATOM 3917  C CG  . TRP A 1 544  ? 19.694  -53.021 -65.979  1.00 80.64  ? 1916 TRP B CG  1 
ATOM 3918  C CD1 . TRP A 1 544  ? 19.347  -53.074 -67.298  1.00 85.43  ? 1916 TRP B CD1 1 
ATOM 3919  C CD2 . TRP A 1 544  ? 20.309  -51.743 -65.781  1.00 82.77  ? 1916 TRP B CD2 1 
ATOM 3920  N NE1 . TRP A 1 544  ? 19.687  -51.902 -67.929  1.00 86.46  ? 1916 TRP B NE1 1 
ATOM 3921  C CE2 . TRP A 1 544  ? 20.281  -51.067 -67.022  1.00 85.18  ? 1916 TRP B CE2 1 
ATOM 3922  C CE3 . TRP A 1 544  ? 20.874  -51.097 -64.672  1.00 82.26  ? 1916 TRP B CE3 1 
ATOM 3923  C CZ2 . TRP A 1 544  ? 20.797  -49.777 -67.188  1.00 86.17  ? 1916 TRP B CZ2 1 
ATOM 3924  C CZ3 . TRP A 1 544  ? 21.386  -49.810 -64.835  1.00 82.14  ? 1916 TRP B CZ3 1 
ATOM 3925  C CH2 . TRP A 1 544  ? 21.344  -49.166 -66.087  1.00 84.36  ? 1916 TRP B CH2 1 
ATOM 3926  N N   . PRO A 1 545  ? 19.282  -57.496 -64.506  1.00 77.42  ? 1917 PRO B N   1 
ATOM 3927  C CA  . PRO A 1 545  ? 19.203  -58.633 -63.575  1.00 77.33  ? 1917 PRO B CA  1 
ATOM 3928  C C   . PRO A 1 545  ? 19.781  -58.405 -62.168  1.00 75.18  ? 1917 PRO B C   1 
ATOM 3929  O O   . PRO A 1 545  ? 19.193  -58.872 -61.195  1.00 75.90  ? 1917 PRO B O   1 
ATOM 3930  C CB  . PRO A 1 545  ? 19.963  -59.748 -64.308  1.00 81.76  ? 1917 PRO B CB  1 
ATOM 3931  C CG  . PRO A 1 545  ? 20.834  -59.048 -65.284  1.00 84.09  ? 1917 PRO B CG  1 
ATOM 3932  C CD  . PRO A 1 545  ? 20.076  -57.830 -65.701  1.00 81.31  ? 1917 PRO B CD  1 
ATOM 3933  N N   . ASP A 1 546  ? 20.906  -57.702 -62.056  1.00 76.13  ? 1918 ASP B N   1 
ATOM 3934  C CA  . ASP A 1 546  ? 21.483  -57.374 -60.734  1.00 77.21  ? 1918 ASP B CA  1 
ATOM 3935  C C   . ASP A 1 546  ? 20.580  -56.446 -59.907  1.00 70.75  ? 1918 ASP B C   1 
ATOM 3936  O O   . ASP A 1 546  ? 20.526  -56.554 -58.676  1.00 66.44  ? 1918 ASP B O   1 
ATOM 3937  C CB  . ASP A 1 546  ? 22.875  -56.741 -60.878  1.00 80.46  ? 1918 ASP B CB  1 
ATOM 3938  C CG  . ASP A 1 546  ? 23.931  -57.732 -61.344  1.00 85.27  ? 1918 ASP B CG  1 
ATOM 3939  O OD1 . ASP A 1 546  ? 23.584  -58.750 -61.984  1.00 88.63  ? 1918 ASP B OD1 1 
ATOM 3940  O OD2 . ASP A 1 546  ? 25.123  -57.486 -61.069  1.00 88.26  ? 1918 ASP B OD2 1 
ATOM 3941  N N   . VAL A 1 547  ? 19.882  -55.543 -60.596  1.00 68.52  ? 1919 VAL B N   1 
ATOM 3942  C CA  . VAL A 1 547  ? 18.915  -54.638 -59.971  1.00 65.33  ? 1919 VAL B CA  1 
ATOM 3943  C C   . VAL A 1 547  ? 17.663  -55.418 -59.562  1.00 67.01  ? 1919 VAL B C   1 
ATOM 3944  O O   . VAL A 1 547  ? 17.095  -55.155 -58.500  1.00 67.44  ? 1919 VAL B O   1 
ATOM 3945  C CB  . VAL A 1 547  ? 18.529  -53.470 -60.912  1.00 63.99  ? 1919 VAL B CB  1 
ATOM 3946  C CG1 . VAL A 1 547  ? 17.480  -52.559 -60.283  1.00 60.27  ? 1919 VAL B CG1 1 
ATOM 3947  C CG2 . VAL A 1 547  ? 19.760  -52.649 -61.273  1.00 66.67  ? 1919 VAL B CG2 1 
ATOM 3948  N N   . ASN A 1 548  ? 17.234  -56.361 -60.405  1.00 67.91  ? 1920 ASN B N   1 
ATOM 3949  C CA  . ASN A 1 548  ? 16.078  -57.215 -60.103  1.00 64.60  ? 1920 ASN B CA  1 
ATOM 3950  C C   . ASN A 1 548  ? 16.318  -58.072 -58.869  1.00 66.05  ? 1920 ASN B C   1 
ATOM 3951  O O   . ASN A 1 548  ? 15.433  -58.194 -58.027  1.00 65.69  ? 1920 ASN B O   1 
ATOM 3952  C CB  . ASN A 1 548  ? 15.728  -58.125 -61.282  1.00 64.53  ? 1920 ASN B CB  1 
ATOM 3953  C CG  . ASN A 1 548  ? 14.359  -58.764 -61.136  1.00 62.47  ? 1920 ASN B CG  1 
ATOM 3954  O OD1 . ASN A 1 548  ? 13.337  -58.075 -61.141  1.00 63.78  ? 1920 ASN B OD1 1 
ATOM 3955  N ND2 . ASN A 1 548  ? 14.330  -60.083 -61.008  1.00 60.29  ? 1920 ASN B ND2 1 
ATOM 3956  N N   . GLU A 1 549  ? 17.511  -58.662 -58.774  1.00 70.77  ? 1921 GLU B N   1 
ATOM 3957  C CA  . GLU A 1 549  ? 17.905  -59.459 -57.603  1.00 74.76  ? 1921 GLU B CA  1 
ATOM 3958  C C   . GLU A 1 549  ? 17.784  -58.675 -56.299  1.00 71.17  ? 1921 GLU B C   1 
ATOM 3959  O O   . GLU A 1 549  ? 17.309  -59.216 -55.298  1.00 71.15  ? 1921 GLU B O   1 
ATOM 3960  C CB  . GLU A 1 549  ? 19.335  -59.995 -57.745  1.00 83.32  ? 1921 GLU B CB  1 
ATOM 3961  C CG  . GLU A 1 549  ? 19.457  -61.223 -58.634  1.00 90.56  ? 1921 GLU B CG  1 
ATOM 3962  C CD  . GLU A 1 549  ? 20.855  -61.806 -58.613  1.00 99.98  ? 1921 GLU B CD  1 
ATOM 3963  O OE1 . GLU A 1 549  ? 21.326  -62.184 -57.518  1.00 102.74 ? 1921 GLU B OE1 1 
ATOM 3964  O OE2 . GLU A 1 549  ? 21.483  -61.886 -59.691  1.00 108.67 ? 1921 GLU B OE2 1 
ATOM 3965  N N   . ALA A 1 550  ? 18.213  -57.412 -56.322  1.00 68.46  ? 1922 ALA B N   1 
ATOM 3966  C CA  . ALA A 1 550  ? 18.075  -56.512 -55.166  1.00 66.63  ? 1922 ALA B CA  1 
ATOM 3967  C C   . ALA A 1 550  ? 16.614  -56.201 -54.842  1.00 62.90  ? 1922 ALA B C   1 
ATOM 3968  O O   . ALA A 1 550  ? 16.241  -56.130 -53.668  1.00 59.91  ? 1922 ALA B O   1 
ATOM 3969  C CB  . ALA A 1 550  ? 18.840  -55.219 -55.403  1.00 66.29  ? 1922 ALA B CB  1 
ATOM 3970  N N   . LEU A 1 551  ? 15.808  -56.006 -55.887  1.00 63.21  ? 1923 LEU B N   1 
ATOM 3971  C CA  . LEU A 1 551  ? 14.366  -55.750 -55.752  1.00 62.80  ? 1923 LEU B CA  1 
ATOM 3972  C C   . LEU A 1 551  ? 13.603  -56.940 -55.173  1.00 63.50  ? 1923 LEU B C   1 
ATOM 3973  O O   . LEU A 1 551  ? 12.743  -56.757 -54.311  1.00 64.91  ? 1923 LEU B O   1 
ATOM 3974  C CB  . LEU A 1 551  ? 13.752  -55.353 -57.102  1.00 62.87  ? 1923 LEU B CB  1 
ATOM 3975  C CG  . LEU A 1 551  ? 14.062  -53.929 -57.573  1.00 61.22  ? 1923 LEU B CG  1 
ATOM 3976  C CD1 . LEU A 1 551  ? 14.005  -53.818 -59.093  1.00 63.35  ? 1923 LEU B CD1 1 
ATOM 3977  C CD2 . LEU A 1 551  ? 13.114  -52.932 -56.921  1.00 57.71  ? 1923 LEU B CD2 1 
ATOM 3978  N N   . VAL A 1 552  ? 13.913  -58.145 -55.654  1.00 65.07  ? 1924 VAL B N   1 
ATOM 3979  C CA  . VAL A 1 552  ? 13.286  -59.377 -55.146  1.00 66.12  ? 1924 VAL B CA  1 
ATOM 3980  C C   . VAL A 1 552  ? 13.673  -59.601 -53.681  1.00 68.87  ? 1924 VAL B C   1 
ATOM 3981  O O   . VAL A 1 552  ? 12.811  -59.902 -52.850  1.00 69.37  ? 1924 VAL B O   1 
ATOM 3982  C CB  . VAL A 1 552  ? 13.653  -60.614 -56.005  1.00 63.06  ? 1924 VAL B CB  1 
ATOM 3983  C CG1 . VAL A 1 552  ? 13.173  -61.907 -55.356  1.00 63.78  ? 1924 VAL B CG1 1 
ATOM 3984  C CG2 . VAL A 1 552  ? 13.041  -60.496 -57.392  1.00 62.19  ? 1924 VAL B CG2 1 
ATOM 3985  N N   . GLU A 1 553  ? 14.968  -59.467 -53.391  1.00 71.81  ? 1925 GLU B N   1 
ATOM 3986  C CA  . GLU A 1 553  ? 15.488  -59.455 -52.013  1.00 73.79  ? 1925 GLU B CA  1 
ATOM 3987  C C   . GLU A 1 553  ? 14.698  -58.511 -51.113  1.00 70.53  ? 1925 GLU B C   1 
ATOM 3988  O O   . GLU A 1 553  ? 14.289  -58.889 -50.014  1.00 69.64  ? 1925 GLU B O   1 
ATOM 3989  C CB  . GLU A 1 553  ? 16.972  -59.047 -51.988  1.00 80.17  ? 1925 GLU B CB  1 
ATOM 3990  C CG  . GLU A 1 553  ? 17.938  -60.218 -51.933  1.00 91.63  ? 1925 GLU B CG  1 
ATOM 3991  C CD  . GLU A 1 553  ? 18.166  -60.708 -50.515  1.00 104.30 ? 1925 GLU B CD  1 
ATOM 3992  O OE1 . GLU A 1 553  ? 18.927  -60.046 -49.777  1.00 106.65 ? 1925 GLU B OE1 1 
ATOM 3993  O OE2 . GLU A 1 553  ? 17.589  -61.753 -50.141  1.00 115.12 ? 1925 GLU B OE2 1 
ATOM 3994  N N   . GLY A 1 554  ? 14.495  -57.286 -51.595  1.00 69.41  ? 1926 GLY B N   1 
ATOM 3995  C CA  . GLY A 1 554  ? 13.773  -56.254 -50.860  1.00 64.10  ? 1926 GLY B CA  1 
ATOM 3996  C C   . GLY A 1 554  ? 12.333  -56.621 -50.573  1.00 60.43  ? 1926 GLY B C   1 
ATOM 3997  O O   . GLY A 1 554  ? 11.909  -56.588 -49.425  1.00 60.61  ? 1926 GLY B O   1 
ATOM 3998  N N   . VAL A 1 555  ? 11.597  -56.999 -51.616  1.00 59.88  ? 1927 VAL B N   1 
ATOM 3999  C CA  . VAL A 1 555  ? 10.177  -57.378 -51.497  1.00 59.18  ? 1927 VAL B CA  1 
ATOM 4000  C C   . VAL A 1 555  ? 9.958   -58.518 -50.485  1.00 58.44  ? 1927 VAL B C   1 
ATOM 4001  O O   . VAL A 1 555  ? 8.976   -58.502 -49.743  1.00 56.05  ? 1927 VAL B O   1 
ATOM 4002  C CB  . VAL A 1 555  ? 9.561   -57.715 -52.887  1.00 59.53  ? 1927 VAL B CB  1 
ATOM 4003  C CG1 . VAL A 1 555  ? 8.209   -58.418 -52.776  1.00 59.61  ? 1927 VAL B CG1 1 
ATOM 4004  C CG2 . VAL A 1 555  ? 9.404   -56.442 -53.708  1.00 57.95  ? 1927 VAL B CG2 1 
ATOM 4005  N N   . LYS A 1 556  ? 10.862  -59.496 -50.462  1.00 61.10  ? 1928 LYS B N   1 
ATOM 4006  C CA  . LYS A 1 556  ? 10.820  -60.563 -49.456  1.00 67.30  ? 1928 LYS B CA  1 
ATOM 4007  C C   . LYS A 1 556  ? 10.881  -60.014 -48.032  1.00 67.63  ? 1928 LYS B C   1 
ATOM 4008  O O   . LYS A 1 556  ? 10.091  -60.414 -47.178  1.00 74.67  ? 1928 LYS B O   1 
ATOM 4009  C CB  . LYS A 1 556  ? 11.982  -61.548 -49.642  1.00 74.93  ? 1928 LYS B CB  1 
ATOM 4010  C CG  . LYS A 1 556  ? 11.835  -62.522 -50.795  1.00 81.70  ? 1928 LYS B CG  1 
ATOM 4011  C CD  . LYS A 1 556  ? 13.077  -63.392 -50.890  1.00 88.08  ? 1928 LYS B CD  1 
ATOM 4012  C CE  . LYS A 1 556  ? 12.948  -64.464 -51.958  1.00 93.73  ? 1928 LYS B CE  1 
ATOM 4013  N NZ  . LYS A 1 556  ? 14.108  -65.399 -51.908  1.00 99.62  ? 1928 LYS B NZ  1 
ATOM 4014  N N   . ALA A 1 557  ? 11.824  -59.104 -47.791  1.00 65.58  ? 1929 ALA B N   1 
ATOM 4015  C CA  . ALA A 1 557  ? 12.169  -58.650 -46.434  1.00 64.03  ? 1929 ALA B CA  1 
ATOM 4016  C C   . ALA A 1 557  ? 11.162  -57.669 -45.847  1.00 58.71  ? 1929 ALA B C   1 
ATOM 4017  O O   . ALA A 1 557  ? 10.690  -57.842 -44.727  1.00 61.10  ? 1929 ALA B O   1 
ATOM 4018  C CB  . ALA A 1 557  ? 13.555  -58.018 -46.437  1.00 66.10  ? 1929 ALA B CB  1 
ATOM 4019  N N   . ILE A 1 558  ? 10.881  -56.622 -46.611  1.00 56.16  ? 1930 ILE B N   1 
ATOM 4020  C CA  . ILE A 1 558  ? 9.922   -55.566 -46.254  1.00 53.14  ? 1930 ILE B CA  1 
ATOM 4021  C C   . ILE A 1 558  ? 8.524   -56.095 -45.857  1.00 50.68  ? 1930 ILE B C   1 
ATOM 4022  O O   . ILE A 1 558  ? 8.072   -57.127 -46.367  1.00 48.90  ? 1930 ILE B O   1 
ATOM 4023  C CB  . ILE A 1 558  ? 9.785   -54.586 -47.443  1.00 51.92  ? 1930 ILE B CB  1 
ATOM 4024  C CG1 . ILE A 1 558  ? 9.054   -53.320 -47.032  1.00 53.28  ? 1930 ILE B CG1 1 
ATOM 4025  C CG2 . ILE A 1 558  ? 9.084   -55.255 -48.629  1.00 55.81  ? 1930 ILE B CG2 1 
ATOM 4026  C CD1 . ILE A 1 558  ? 8.929   -52.315 -48.151  1.00 57.25  ? 1930 ILE B CD1 1 
ATOM 4027  N N   . GLN A 1 559  ? 7.847   -55.377 -44.958  1.00 47.41  ? 1931 GLN B N   1 
ATOM 4028  C CA  . GLN A 1 559  ? 6.462   -55.696 -44.590  1.00 44.98  ? 1931 GLN B CA  1 
ATOM 4029  C C   . GLN A 1 559  ? 5.524   -55.350 -45.742  1.00 44.85  ? 1931 GLN B C   1 
ATOM 4030  O O   . GLN A 1 559  ? 5.714   -54.340 -46.427  1.00 44.30  ? 1931 GLN B O   1 
ATOM 4031  C CB  . GLN A 1 559  ? 6.026   -54.923 -43.348  1.00 44.19  ? 1931 GLN B CB  1 
ATOM 4032  C CG  . GLN A 1 559  ? 6.778   -55.277 -42.079  1.00 45.23  ? 1931 GLN B CG  1 
ATOM 4033  C CD  . GLN A 1 559  ? 6.440   -56.654 -41.552  1.00 47.10  ? 1931 GLN B CD  1 
ATOM 4034  O OE1 . GLN A 1 559  ? 5.327   -57.158 -41.735  1.00 47.84  ? 1931 GLN B OE1 1 
ATOM 4035  N NE2 . GLN A 1 559  ? 7.403   -57.273 -40.882  1.00 48.69  ? 1931 GLN B NE2 1 
ATOM 4036  N N   . ILE A 1 560  ? 4.504   -56.182 -45.940  1.00 45.75  ? 1932 ILE B N   1 
ATOM 4037  C CA  . ILE A 1 560  ? 3.623   -56.061 -47.107  1.00 44.39  ? 1932 ILE B CA  1 
ATOM 4038  C C   . ILE A 1 560  ? 2.627   -54.898 -47.013  1.00 45.46  ? 1932 ILE B C   1 
ATOM 4039  O O   . ILE A 1 560  ? 2.148   -54.431 -48.041  1.00 46.09  ? 1932 ILE B O   1 
ATOM 4040  C CB  . ILE A 1 560  ? 2.914   -57.403 -47.446  1.00 43.90  ? 1932 ILE B CB  1 
ATOM 4041  C CG1 . ILE A 1 560  ? 2.338   -57.350 -48.865  1.00 44.85  ? 1932 ILE B CG1 1 
ATOM 4042  C CG2 . ILE A 1 560  ? 1.830   -57.764 -46.433  1.00 43.71  ? 1932 ILE B CG2 1 
ATOM 4043  C CD1 . ILE A 1 560  ? 2.172   -58.707 -49.505  1.00 47.06  ? 1932 ILE B CD1 1 
ATOM 4044  N N   . ASP A 1 561  ? 2.310   -54.451 -45.794  1.00 49.19  ? 1933 ASP B N   1 
ATOM 4045  C CA  . ASP A 1 561  ? 1.582   -53.186 -45.562  1.00 52.07  ? 1933 ASP B CA  1 
ATOM 4046  C C   . ASP A 1 561  ? 2.065   -52.061 -46.470  1.00 52.28  ? 1933 ASP B C   1 
ATOM 4047  O O   . ASP A 1 561  ? 1.260   -51.359 -47.093  1.00 50.81  ? 1933 ASP B O   1 
ATOM 4048  C CB  . ASP A 1 561  ? 1.777   -52.697 -44.111  1.00 56.41  ? 1933 ASP B CB  1 
ATOM 4049  C CG  . ASP A 1 561  ? 0.693   -53.171 -43.162  1.00 64.30  ? 1933 ASP B CG  1 
ATOM 4050  O OD1 . ASP A 1 561  ? -0.438  -53.483 -43.599  1.00 70.23  ? 1933 ASP B OD1 1 
ATOM 4051  O OD2 . ASP A 1 561  ? 0.981   -53.209 -41.948  1.00 71.12  ? 1933 ASP B OD2 1 
ATOM 4052  N N   . THR A 1 562  ? 3.389   -51.902 -46.525  1.00 50.63  ? 1934 THR B N   1 
ATOM 4053  C CA  . THR A 1 562  ? 4.035   -50.799 -47.229  1.00 48.97  ? 1934 THR B CA  1 
ATOM 4054  C C   . THR A 1 562  ? 3.404   -50.470 -48.573  1.00 49.72  ? 1934 THR B C   1 
ATOM 4055  O O   . THR A 1 562  ? 3.179   -49.304 -48.883  1.00 55.91  ? 1934 THR B O   1 
ATOM 4056  C CB  . THR A 1 562  ? 5.533   -51.077 -47.480  1.00 47.74  ? 1934 THR B CB  1 
ATOM 4057  O OG1 . THR A 1 562  ? 6.135   -51.617 -46.298  1.00 45.27  ? 1934 THR B OG1 1 
ATOM 4058  C CG2 . THR A 1 562  ? 6.249   -49.774 -47.878  1.00 49.55  ? 1934 THR B CG2 1 
ATOM 4059  N N   . TRP A 1 563  ? 3.114   -51.506 -49.350  1.00 46.91  ? 1935 TRP B N   1 
ATOM 4060  C CA  . TRP A 1 563  ? 2.726   -51.347 -50.747  1.00 44.69  ? 1935 TRP B CA  1 
ATOM 4061  C C   . TRP A 1 563  ? 1.300   -50.802 -50.969  1.00 44.81  ? 1935 TRP B C   1 
ATOM 4062  O O   . TRP A 1 563  ? 1.001   -50.341 -52.072  1.00 45.10  ? 1935 TRP B O   1 
ATOM 4063  C CB  . TRP A 1 563  ? 2.917   -52.674 -51.492  1.00 44.81  ? 1935 TRP B CB  1 
ATOM 4064  C CG  . TRP A 1 563  ? 4.290   -53.260 -51.319  1.00 44.64  ? 1935 TRP B CG  1 
ATOM 4065  C CD1 . TRP A 1 563  ? 4.632   -54.329 -50.546  1.00 45.53  ? 1935 TRP B CD1 1 
ATOM 4066  C CD2 . TRP A 1 563  ? 5.503   -52.787 -51.911  1.00 45.18  ? 1935 TRP B CD2 1 
ATOM 4067  N NE1 . TRP A 1 563  ? 5.982   -54.563 -50.632  1.00 46.77  ? 1935 TRP B NE1 1 
ATOM 4068  C CE2 . TRP A 1 563  ? 6.541   -53.628 -51.463  1.00 46.39  ? 1935 TRP B CE2 1 
ATOM 4069  C CE3 . TRP A 1 563  ? 5.812   -51.739 -52.789  1.00 45.81  ? 1935 TRP B CE3 1 
ATOM 4070  C CZ2 . TRP A 1 563  ? 7.870   -53.454 -51.864  1.00 48.06  ? 1935 TRP B CZ2 1 
ATOM 4071  C CZ3 . TRP A 1 563  ? 7.132   -51.564 -53.186  1.00 45.77  ? 1935 TRP B CZ3 1 
ATOM 4072  C CH2 . TRP A 1 563  ? 8.144   -52.419 -52.724  1.00 47.81  ? 1935 TRP B CH2 1 
ATOM 4073  N N   . LEU A 1 564  ? 0.437   -50.837 -49.944  1.00 45.13  ? 1936 LEU B N   1 
ATOM 4074  C CA  . LEU A 1 564  ? -0.948  -50.322 -50.059  1.00 45.98  ? 1936 LEU B CA  1 
ATOM 4075  C C   . LEU A 1 564  ? -0.925  -48.831 -50.382  1.00 45.54  ? 1936 LEU B C   1 
ATOM 4076  O O   . LEU A 1 564  ? -1.574  -48.361 -51.321  1.00 43.66  ? 1936 LEU B O   1 
ATOM 4077  C CB  . LEU A 1 564  ? -1.749  -50.554 -48.769  1.00 46.63  ? 1936 LEU B CB  1 
ATOM 4078  C CG  . LEU A 1 564  ? -1.881  -51.973 -48.222  1.00 48.78  ? 1936 LEU B CG  1 
ATOM 4079  C CD1 . LEU A 1 564  ? -2.724  -51.938 -46.957  1.00 49.46  ? 1936 LEU B CD1 1 
ATOM 4080  C CD2 . LEU A 1 564  ? -2.477  -52.922 -49.250  1.00 50.32  ? 1936 LEU B CD2 1 
ATOM 4081  N N   . GLN A 1 565  ? -0.156  -48.122 -49.562  1.00 46.73  ? 1937 GLN B N   1 
ATOM 4082  C CA  . GLN A 1 565  ? 0.345   -46.755 -49.782  1.00 46.23  ? 1937 GLN B CA  1 
ATOM 4083  C C   . GLN A 1 565  ? 0.602   -46.326 -51.239  1.00 44.45  ? 1937 GLN B C   1 
ATOM 4084  O O   . GLN A 1 565  ? 0.423   -45.159 -51.583  1.00 43.44  ? 1937 GLN B O   1 
ATOM 4085  C CB  . GLN A 1 565  ? 1.674   -46.662 -49.026  1.00 47.09  ? 1937 GLN B CB  1 
ATOM 4086  C CG  . GLN A 1 565  ? 2.143   -45.299 -48.592  1.00 48.44  ? 1937 GLN B CG  1 
ATOM 4087  C CD  . GLN A 1 565  ? 3.409   -45.415 -47.763  1.00 50.19  ? 1937 GLN B CD  1 
ATOM 4088  O OE1 . GLN A 1 565  ? 4.236   -46.309 -47.995  1.00 44.25  ? 1937 GLN B OE1 1 
ATOM 4089  N NE2 . GLN A 1 565  ? 3.561   -44.530 -46.778  1.00 55.80  ? 1937 GLN B NE2 1 
ATOM 4090  N N   . VAL A 1 566  ? 1.049   -47.269 -52.069  1.00 45.33  ? 1938 VAL B N   1 
ATOM 4091  C CA  . VAL A 1 566  ? 1.545   -46.994 -53.415  1.00 45.31  ? 1938 VAL B CA  1 
ATOM 4092  C C   . VAL A 1 566  ? 0.871   -47.865 -54.507  1.00 45.58  ? 1938 VAL B C   1 
ATOM 4093  O O   . VAL A 1 566  ? 1.382   -47.954 -55.624  1.00 43.21  ? 1938 VAL B O   1 
ATOM 4094  C CB  . VAL A 1 566  ? 3.103   -47.132 -53.392  1.00 45.83  ? 1938 VAL B CB  1 
ATOM 4095  C CG1 . VAL A 1 566  ? 3.593   -48.563 -53.638  1.00 45.25  ? 1938 VAL B CG1 1 
ATOM 4096  C CG2 . VAL A 1 566  ? 3.759   -46.155 -54.342  1.00 48.51  ? 1938 VAL B CG2 1 
ATOM 4097  N N   . ILE A 1 567  ? -0.285  -48.466 -54.194  1.00 48.14  ? 1939 ILE B N   1 
ATOM 4098  C CA  . ILE A 1 567  ? -1.004  -49.371 -55.128  1.00 52.32  ? 1939 ILE B CA  1 
ATOM 4099  C C   . ILE A 1 567  ? -1.261  -48.791 -56.535  1.00 52.59  ? 1939 ILE B C   1 
ATOM 4100  O O   . ILE A 1 567  ? -0.870  -49.410 -57.529  1.00 52.35  ? 1939 ILE B O   1 
ATOM 4101  C CB  . ILE A 1 567  ? -2.330  -49.935 -54.509  1.00 54.38  ? 1939 ILE B CB  1 
ATOM 4102  C CG1 . ILE A 1 567  ? -2.006  -51.117 -53.593  1.00 54.86  ? 1939 ILE B CG1 1 
ATOM 4103  C CG2 . ILE A 1 567  ? -3.313  -50.433 -55.578  1.00 55.18  ? 1939 ILE B CG2 1 
ATOM 4104  C CD1 . ILE A 1 567  ? -3.141  -51.589 -52.708  1.00 55.25  ? 1939 ILE B CD1 1 
ATOM 4105  N N   . PRO A 1 568  ? -1.926  -47.622 -56.631  1.00 51.25  ? 1940 PRO B N   1 
ATOM 4106  C CA  . PRO A 1 568  ? -2.235  -47.091 -57.967  1.00 54.57  ? 1940 PRO B CA  1 
ATOM 4107  C C   . PRO A 1 568  ? -1.009  -46.908 -58.880  1.00 55.89  ? 1940 PRO B C   1 
ATOM 4108  O O   . PRO A 1 568  ? -1.119  -47.085 -60.098  1.00 59.43  ? 1940 PRO B O   1 
ATOM 4109  C CB  . PRO A 1 568  ? -2.926  -45.747 -57.673  1.00 55.06  ? 1940 PRO B CB  1 
ATOM 4110  C CG  . PRO A 1 568  ? -2.676  -45.460 -56.238  1.00 53.78  ? 1940 PRO B CG  1 
ATOM 4111  C CD  . PRO A 1 568  ? -2.512  -46.787 -55.570  1.00 51.88  ? 1940 PRO B CD  1 
ATOM 4112  N N   . GLN A 1 569  ? 0.137   -46.575 -58.285  1.00 53.07  ? 1941 GLN B N   1 
ATOM 4113  C CA  . GLN A 1 569  ? 1.395   -46.441 -59.023  1.00 52.45  ? 1941 GLN B CA  1 
ATOM 4114  C C   . GLN A 1 569  ? 1.867   -47.793 -59.568  1.00 53.29  ? 1941 GLN B C   1 
ATOM 4115  O O   . GLN A 1 569  ? 2.396   -47.854 -60.679  1.00 57.08  ? 1941 GLN B O   1 
ATOM 4116  C CB  . GLN A 1 569  ? 2.492   -45.817 -58.148  1.00 50.48  ? 1941 GLN B CB  1 
ATOM 4117  C CG  . GLN A 1 569  ? 2.413   -44.300 -57.976  1.00 51.67  ? 1941 GLN B CG  1 
ATOM 4118  C CD  . GLN A 1 569  ? 1.332   -43.814 -57.017  1.00 52.91  ? 1941 GLN B CD  1 
ATOM 4119  O OE1 . GLN A 1 569  ? 0.651   -42.823 -57.289  1.00 60.66  ? 1941 GLN B OE1 1 
ATOM 4120  N NE2 . GLN A 1 569  ? 1.184   -44.491 -55.887  1.00 50.83  ? 1941 GLN B NE2 1 
ATOM 4121  N N   . LEU A 1 570  ? 1.683   -48.861 -58.784  1.00 50.69  ? 1942 LEU B N   1 
ATOM 4122  C CA  . LEU A 1 570  ? 1.984   -50.234 -59.232  1.00 50.87  ? 1942 LEU B CA  1 
ATOM 4123  C C   . LEU A 1 570  ? 1.067   -50.688 -60.371  1.00 54.75  ? 1942 LEU B C   1 
ATOM 4124  O O   . LEU A 1 570  ? 1.537   -51.229 -61.379  1.00 55.53  ? 1942 LEU B O   1 
ATOM 4125  C CB  . LEU A 1 570  ? 1.874   -51.236 -58.075  1.00 47.20  ? 1942 LEU B CB  1 
ATOM 4126  C CG  . LEU A 1 570  ? 2.977   -51.206 -57.020  1.00 46.78  ? 1942 LEU B CG  1 
ATOM 4127  C CD1 . LEU A 1 570  ? 2.532   -51.904 -55.744  1.00 45.48  ? 1942 LEU B CD1 1 
ATOM 4128  C CD2 . LEU A 1 570  ? 4.247   -51.846 -57.557  1.00 48.77  ? 1942 LEU B CD2 1 
ATOM 4129  N N   . ILE A 1 571  ? -0.237  -50.471 -60.199  1.00 55.15  ? 1943 ILE B N   1 
ATOM 4130  C CA  . ILE A 1 571  ? -1.239  -50.874 -61.194  1.00 54.77  ? 1943 ILE B CA  1 
ATOM 4131  C C   . ILE A 1 571  ? -1.071  -50.114 -62.510  1.00 55.78  ? 1943 ILE B C   1 
ATOM 4132  O O   . ILE A 1 571  ? -1.380  -50.656 -63.570  1.00 59.34  ? 1943 ILE B O   1 
ATOM 4133  C CB  . ILE A 1 571  ? -2.682  -50.772 -60.625  1.00 54.87  ? 1943 ILE B CB  1 
ATOM 4134  C CG1 . ILE A 1 571  ? -2.914  -51.928 -59.647  1.00 57.37  ? 1943 ILE B CG1 1 
ATOM 4135  C CG2 . ILE A 1 571  ? -3.744  -50.841 -61.718  1.00 55.95  ? 1943 ILE B CG2 1 
ATOM 4136  C CD1 . ILE A 1 571  ? -4.125  -51.776 -58.756  1.00 58.91  ? 1943 ILE B CD1 1 
ATOM 4137  N N   . ALA A 1 572  ? -0.564  -48.882 -62.449  1.00 54.24  ? 1944 ALA B N   1 
ATOM 4138  C CA  . ALA A 1 572  ? -0.236  -48.116 -63.661  1.00 55.77  ? 1944 ALA B CA  1 
ATOM 4139  C C   . ALA A 1 572  ? 0.804   -48.808 -64.555  1.00 58.02  ? 1944 ALA B C   1 
ATOM 4140  O O   . ALA A 1 572  ? 0.816   -48.593 -65.768  1.00 58.21  ? 1944 ALA B O   1 
ATOM 4141  C CB  . ALA A 1 572  ? 0.234   -46.719 -63.293  1.00 55.23  ? 1944 ALA B CB  1 
ATOM 4142  N N   . ARG A 1 573  ? 1.665   -49.631 -63.952  1.00 59.91  ? 1945 ARG B N   1 
ATOM 4143  C CA  . ARG A 1 573  ? 2.657   -50.428 -64.680  1.00 63.07  ? 1945 ARG B CA  1 
ATOM 4144  C C   . ARG A 1 573  ? 2.307   -51.933 -64.696  1.00 65.17  ? 1945 ARG B C   1 
ATOM 4145  O O   . ARG A 1 573  ? 3.212   -52.769 -64.745  1.00 66.07  ? 1945 ARG B O   1 
ATOM 4146  C CB  . ARG A 1 573  ? 4.047   -50.233 -64.052  1.00 63.12  ? 1945 ARG B CB  1 
ATOM 4147  C CG  . ARG A 1 573  ? 4.423   -48.800 -63.709  1.00 64.85  ? 1945 ARG B CG  1 
ATOM 4148  C CD  . ARG A 1 573  ? 5.046   -48.062 -64.872  1.00 70.01  ? 1945 ARG B CD  1 
ATOM 4149  N NE  . ARG A 1 573  ? 5.355   -46.679 -64.504  1.00 73.55  ? 1945 ARG B NE  1 
ATOM 4150  C CZ  . ARG A 1 573  ? 6.252   -45.895 -65.112  1.00 79.62  ? 1945 ARG B CZ  1 
ATOM 4151  N NH1 . ARG A 1 573  ? 6.981   -46.333 -66.144  1.00 81.25  ? 1945 ARG B NH1 1 
ATOM 4152  N NH2 . ARG A 1 573  ? 6.431   -44.650 -64.674  1.00 80.55  ? 1945 ARG B NH2 1 
ATOM 4153  N N   . ILE A 1 574  ? 1.014   -52.278 -64.664  1.00 64.90  ? 1946 ILE B N   1 
ATOM 4154  C CA  . ILE A 1 574  ? 0.576   -53.691 -64.761  1.00 64.09  ? 1946 ILE B CA  1 
ATOM 4155  C C   . ILE A 1 574  ? 0.934   -54.304 -66.129  1.00 64.86  ? 1946 ILE B C   1 
ATOM 4156  O O   . ILE A 1 574  ? 1.215   -55.500 -66.215  1.00 65.24  ? 1946 ILE B O   1 
ATOM 4157  C CB  . ILE A 1 574  ? -0.941  -53.875 -64.402  1.00 63.59  ? 1946 ILE B CB  1 
ATOM 4158  C CG1 . ILE A 1 574  ? -1.078  -54.631 -63.077  1.00 61.38  ? 1946 ILE B CG1 1 
ATOM 4159  C CG2 . ILE A 1 574  ? -1.720  -54.636 -65.472  1.00 68.82  ? 1946 ILE B CG2 1 
ATOM 4160  C CD1 . ILE A 1 574  ? -2.489  -54.716 -62.528  1.00 61.39  ? 1946 ILE B CD1 1 
ATOM 4161  N N   . ASP A 1 575  ? 0.926   -53.473 -67.173  1.00 64.74  ? 1947 ASP B N   1 
ATOM 4162  C CA  . ASP A 1 575  ? 1.177   -53.902 -68.551  1.00 68.83  ? 1947 ASP B CA  1 
ATOM 4163  C C   . ASP A 1 575  ? 2.588   -53.523 -69.049  1.00 73.91  ? 1947 ASP B C   1 
ATOM 4164  O O   . ASP A 1 575  ? 2.762   -53.142 -70.211  1.00 81.35  ? 1947 ASP B O   1 
ATOM 4165  C CB  . ASP A 1 575  ? 0.078   -53.337 -69.483  1.00 71.15  ? 1947 ASP B CB  1 
ATOM 4166  C CG  . ASP A 1 575  ? 0.022   -51.798 -69.500  1.00 73.94  ? 1947 ASP B CG  1 
ATOM 4167  O OD1 . ASP A 1 575  ? 0.408   -51.157 -68.498  1.00 72.57  ? 1947 ASP B OD1 1 
ATOM 4168  O OD2 . ASP A 1 575  ? -0.440  -51.232 -70.514  1.00 78.21  ? 1947 ASP B OD2 1 
ATOM 4169  N N   . THR A 1 576  ? 3.599   -53.648 -68.186  1.00 74.50  ? 1948 THR B N   1 
ATOM 4170  C CA  . THR A 1 576  ? 4.977   -53.308 -68.565  1.00 77.43  ? 1948 THR B CA  1 
ATOM 4171  C C   . THR A 1 576  ? 5.506   -54.373 -69.519  1.00 83.04  ? 1948 THR B C   1 
ATOM 4172  O O   . THR A 1 576  ? 5.461   -55.558 -69.185  1.00 83.02  ? 1948 THR B O   1 
ATOM 4173  C CB  . THR A 1 576  ? 5.931   -53.239 -67.357  1.00 75.55  ? 1948 THR B CB  1 
ATOM 4174  O OG1 . THR A 1 576  ? 5.310   -52.515 -66.293  1.00 81.70  ? 1948 THR B OG1 1 
ATOM 4175  C CG2 . THR A 1 576  ? 7.226   -52.537 -67.729  1.00 74.03  ? 1948 THR B CG2 1 
ATOM 4176  N N   . PRO A 1 577  ? 6.002   -53.961 -70.703  1.00 90.56  ? 1949 PRO B N   1 
ATOM 4177  C CA  . PRO A 1 577  ? 6.526   -54.933 -71.671  1.00 96.50  ? 1949 PRO B CA  1 
ATOM 4178  C C   . PRO A 1 577  ? 7.861   -55.579 -71.257  1.00 100.74 ? 1949 PRO B C   1 
ATOM 4179  O O   . PRO A 1 577  ? 8.137   -56.708 -71.670  1.00 104.14 ? 1949 PRO B O   1 
ATOM 4180  C CB  . PRO A 1 577  ? 6.671   -54.110 -72.955  1.00 99.34  ? 1949 PRO B CB  1 
ATOM 4181  C CG  . PRO A 1 577  ? 6.840   -52.707 -72.496  1.00 97.38  ? 1949 PRO B CG  1 
ATOM 4182  C CD  . PRO A 1 577  ? 6.098   -52.576 -71.201  1.00 92.82  ? 1949 PRO B CD  1 
ATOM 4183  N N   . ARG A 1 578  ? 8.676   -54.870 -70.471  1.00 101.88 ? 1950 ARG B N   1 
ATOM 4184  C CA  . ARG A 1 578  ? 9.885   -55.449 -69.863  1.00 103.93 ? 1950 ARG B CA  1 
ATOM 4185  C C   . ARG A 1 578  ? 9.504   -56.621 -68.949  1.00 102.71 ? 1950 ARG B C   1 
ATOM 4186  O O   . ARG A 1 578  ? 8.888   -56.406 -67.904  1.00 96.55  ? 1950 ARG B O   1 
ATOM 4187  C CB  . ARG A 1 578  ? 10.657  -54.397 -69.062  1.00 103.79 ? 1950 ARG B CB  1 
ATOM 4188  C CG  . ARG A 1 578  ? 11.319  -53.328 -69.915  1.00 107.86 ? 1950 ARG B CG  1 
ATOM 4189  C CD  . ARG A 1 578  ? 11.834  -52.183 -69.058  1.00 107.38 ? 1950 ARG B CD  1 
ATOM 4190  N NE  . ARG A 1 578  ? 12.286  -51.047 -69.860  1.00 110.83 ? 1950 ARG B NE  1 
ATOM 4191  C CZ  . ARG A 1 578  ? 12.717  -49.885 -69.366  1.00 108.12 ? 1950 ARG B CZ  1 
ATOM 4192  N NH1 . ARG A 1 578  ? 12.765  -49.673 -68.049  1.00 97.91  ? 1950 ARG B NH1 1 
ATOM 4193  N NH2 . ARG A 1 578  ? 13.106  -48.920 -70.198  1.00 114.68 ? 1950 ARG B NH2 1 
ATOM 4194  N N   . PRO A 1 579  ? 9.876   -57.860 -69.336  1.00 111.24 ? 1951 PRO B N   1 
ATOM 4195  C CA  . PRO A 1 579  ? 9.318   -59.060 -68.700  1.00 104.51 ? 1951 PRO B CA  1 
ATOM 4196  C C   . PRO A 1 579  ? 9.758   -59.284 -67.252  1.00 96.36  ? 1951 PRO B C   1 
ATOM 4197  O O   . PRO A 1 579  ? 8.964   -59.767 -66.449  1.00 91.20  ? 1951 PRO B O   1 
ATOM 4198  C CB  . PRO A 1 579  ? 9.833   -60.192 -69.592  1.00 110.27 ? 1951 PRO B CB  1 
ATOM 4199  C CG  . PRO A 1 579  ? 11.136  -59.688 -70.108  1.00 117.43 ? 1951 PRO B CG  1 
ATOM 4200  C CD  . PRO A 1 579  ? 10.981  -58.199 -70.257  1.00 118.54 ? 1951 PRO B CD  1 
ATOM 4201  N N   . LEU A 1 580  ? 11.001  -58.929 -66.930  1.00 93.52  ? 1952 LEU B N   1 
ATOM 4202  C CA  . LEU A 1 580  ? 11.555  -59.156 -65.592  1.00 90.21  ? 1952 LEU B CA  1 
ATOM 4203  C C   . LEU A 1 580  ? 10.947  -58.208 -64.545  1.00 84.01  ? 1952 LEU B C   1 
ATOM 4204  O O   . LEU A 1 580  ? 10.811  -58.571 -63.373  1.00 79.41  ? 1952 LEU B O   1 
ATOM 4205  C CB  . LEU A 1 580  ? 13.082  -59.018 -65.624  1.00 92.49  ? 1952 LEU B CB  1 
ATOM 4206  C CG  . LEU A 1 580  ? 13.855  -59.825 -64.579  1.00 96.15  ? 1952 LEU B CG  1 
ATOM 4207  C CD1 . LEU A 1 580  ? 13.843  -61.313 -64.905  1.00 99.69  ? 1952 LEU B CD1 1 
ATOM 4208  C CD2 . LEU A 1 580  ? 15.287  -59.325 -64.485  1.00 98.89  ? 1952 LEU B CD2 1 
ATOM 4209  N N   . VAL A 1 581  ? 10.589  -57.001 -64.982  1.00 78.75  ? 1953 VAL B N   1 
ATOM 4210  C CA  . VAL A 1 581  ? 9.901   -56.021 -64.142  1.00 68.04  ? 1953 VAL B CA  1 
ATOM 4211  C C   . VAL A 1 581  ? 8.467   -56.467 -63.898  1.00 63.17  ? 1953 VAL B C   1 
ATOM 4212  O O   . VAL A 1 581  ? 8.022   -56.527 -62.755  1.00 62.41  ? 1953 VAL B O   1 
ATOM 4213  C CB  . VAL A 1 581  ? 9.896   -54.623 -64.804  1.00 67.04  ? 1953 VAL B CB  1 
ATOM 4214  C CG1 . VAL A 1 581  ? 9.012   -53.637 -64.049  1.00 65.31  ? 1953 VAL B CG1 1 
ATOM 4215  C CG2 . VAL A 1 581  ? 11.311  -54.078 -64.890  1.00 68.52  ? 1953 VAL B CG2 1 
ATOM 4216  N N   . GLY A 1 582  ? 7.753   -56.756 -64.982  1.00 62.85  ? 1954 GLY B N   1 
ATOM 4217  C CA  . GLY A 1 582  ? 6.339   -57.128 -64.926  1.00 63.52  ? 1954 GLY B CA  1 
ATOM 4218  C C   . GLY A 1 582  ? 6.033   -58.372 -64.112  1.00 64.02  ? 1954 GLY B C   1 
ATOM 4219  O O   . GLY A 1 582  ? 5.045   -58.412 -63.382  1.00 62.19  ? 1954 GLY B O   1 
ATOM 4220  N N   . ARG A 1 583  ? 6.887   -59.384 -64.237  1.00 67.72  ? 1955 ARG B N   1 
ATOM 4221  C CA  . ARG A 1 583  ? 6.727   -60.648 -63.512  1.00 70.66  ? 1955 ARG B CA  1 
ATOM 4222  C C   . ARG A 1 583  ? 6.699   -60.439 -62.000  1.00 67.08  ? 1955 ARG B C   1 
ATOM 4223  O O   . ARG A 1 583  ? 5.901   -61.066 -61.306  1.00 70.66  ? 1955 ARG B O   1 
ATOM 4224  C CB  . ARG A 1 583  ? 7.857   -61.610 -63.884  1.00 80.52  ? 1955 ARG B CB  1 
ATOM 4225  C CG  . ARG A 1 583  ? 7.620   -63.077 -63.547  1.00 88.45  ? 1955 ARG B CG  1 
ATOM 4226  C CD  . ARG A 1 583  ? 8.860   -63.904 -63.869  1.00 97.67  ? 1955 ARG B CD  1 
ATOM 4227  N NE  . ARG A 1 583  ? 9.276   -63.747 -65.269  1.00 106.89 ? 1955 ARG B NE  1 
ATOM 4228  C CZ  . ARG A 1 583  ? 10.497  -63.995 -65.757  1.00 116.95 ? 1955 ARG B CZ  1 
ATOM 4229  N NH1 . ARG A 1 583  ? 11.490  -64.431 -64.978  1.00 120.99 ? 1955 ARG B NH1 1 
ATOM 4230  N NH2 . ARG A 1 583  ? 10.731  -63.801 -67.055  1.00 121.65 ? 1955 ARG B NH2 1 
ATOM 4231  N N   . LEU A 1 584  ? 7.559   -59.551 -61.502  1.00 64.72  ? 1956 LEU B N   1 
ATOM 4232  C CA  . LEU A 1 584  ? 7.641   -59.260 -60.061  1.00 64.18  ? 1956 LEU B CA  1 
ATOM 4233  C C   . LEU A 1 584  ? 6.443   -58.417 -59.592  1.00 62.41  ? 1956 LEU B C   1 
ATOM 4234  O O   . LEU A 1 584  ? 5.943   -58.616 -58.483  1.00 63.18  ? 1956 LEU B O   1 
ATOM 4235  C CB  . LEU A 1 584  ? 8.966   -58.554 -59.713  1.00 65.54  ? 1956 LEU B CB  1 
ATOM 4236  C CG  . LEU A 1 584  ? 9.650   -58.802 -58.353  1.00 65.65  ? 1956 LEU B CG  1 
ATOM 4237  C CD1 . LEU A 1 584  ? 10.617  -57.665 -58.048  1.00 65.56  ? 1956 LEU B CD1 1 
ATOM 4238  C CD2 . LEU A 1 584  ? 8.702   -58.985 -57.176  1.00 64.52  ? 1956 LEU B CD2 1 
ATOM 4239  N N   . ILE A 1 585  ? 5.989   -57.485 -60.432  1.00 60.52  ? 1957 ILE B N   1 
ATOM 4240  C CA  . ILE A 1 585  ? 4.793   -56.678 -60.136  1.00 58.08  ? 1957 ILE B CA  1 
ATOM 4241  C C   . ILE A 1 585  ? 3.548   -57.570 -59.980  1.00 59.37  ? 1957 ILE B C   1 
ATOM 4242  O O   . ILE A 1 585  ? 2.747   -57.362 -59.073  1.00 57.72  ? 1957 ILE B O   1 
ATOM 4243  C CB  . ILE A 1 585  ? 4.558   -55.574 -61.204  1.00 57.89  ? 1957 ILE B CB  1 
ATOM 4244  C CG1 . ILE A 1 585  ? 5.661   -54.513 -61.112  1.00 57.92  ? 1957 ILE B CG1 1 
ATOM 4245  C CG2 . ILE A 1 585  ? 3.198   -54.897 -61.027  1.00 57.16  ? 1957 ILE B CG2 1 
ATOM 4246  C CD1 . ILE A 1 585  ? 5.686   -53.513 -62.252  1.00 59.92  ? 1957 ILE B CD1 1 
ATOM 4247  N N   . HIS A 1 586  ? 3.399   -58.558 -60.858  1.00 64.41  ? 1958 HIS B N   1 
ATOM 4248  C CA  . HIS A 1 586  ? 2.284   -59.509 -60.776  1.00 66.37  ? 1958 HIS B CA  1 
ATOM 4249  C C   . HIS A 1 586  ? 2.388   -60.346 -59.508  1.00 64.17  ? 1958 HIS B C   1 
ATOM 4250  O O   . HIS A 1 586  ? 1.400   -60.516 -58.798  1.00 62.11  ? 1958 HIS B O   1 
ATOM 4251  C CB  . HIS A 1 586  ? 2.251   -60.422 -62.006  1.00 74.15  ? 1958 HIS B CB  1 
ATOM 4252  C CG  . HIS A 1 586  ? 1.921   -59.710 -63.284  1.00 80.51  ? 1958 HIS B CG  1 
ATOM 4253  N ND1 . HIS A 1 586  ? 1.572   -60.379 -64.438  1.00 84.01  ? 1958 HIS B ND1 1 
ATOM 4254  C CD2 . HIS A 1 586  ? 1.876   -58.389 -63.587  1.00 79.37  ? 1958 HIS B CD2 1 
ATOM 4255  C CE1 . HIS A 1 586  ? 1.345   -59.503 -65.400  1.00 85.06  ? 1958 HIS B CE1 1 
ATOM 4256  N NE2 . HIS A 1 586  ? 1.517   -58.288 -64.909  1.00 81.81  ? 1958 HIS B NE2 1 
ATOM 4257  N N   . GLN A 1 587  ? 3.594   -60.842 -59.227  1.00 66.16  ? 1959 GLN B N   1 
ATOM 4258  C CA  . GLN A 1 587  ? 3.873   -61.622 -58.012  1.00 68.68  ? 1959 GLN B CA  1 
ATOM 4259  C C   . GLN A 1 587  ? 3.559   -60.825 -56.741  1.00 63.15  ? 1959 GLN B C   1 
ATOM 4260  O O   . GLN A 1 587  ? 3.001   -61.376 -55.791  1.00 61.93  ? 1959 GLN B O   1 
ATOM 4261  C CB  . GLN A 1 587  ? 5.337   -62.113 -58.000  1.00 75.82  ? 1959 GLN B CB  1 
ATOM 4262  C CG  . GLN A 1 587  ? 5.630   -63.298 -57.070  1.00 83.63  ? 1959 GLN B CG  1 
ATOM 4263  C CD  . GLN A 1 587  ? 6.302   -62.924 -55.750  1.00 92.79  ? 1959 GLN B CD  1 
ATOM 4264  O OE1 . GLN A 1 587  ? 7.082   -61.970 -55.673  1.00 97.99  ? 1959 GLN B OE1 1 
ATOM 4265  N NE2 . GLN A 1 587  ? 6.019   -63.703 -54.705  1.00 94.12  ? 1959 GLN B NE2 1 
ATOM 4266  N N   . LEU A 1 588  ? 3.895   -59.532 -56.739  1.00 60.29  ? 1960 LEU B N   1 
ATOM 4267  C CA  . LEU A 1 588  ? 3.673   -58.662 -55.572  1.00 57.07  ? 1960 LEU B CA  1 
ATOM 4268  C C   . LEU A 1 588  ? 2.199   -58.341 -55.359  1.00 54.80  ? 1960 LEU B C   1 
ATOM 4269  O O   . LEU A 1 588  ? 1.688   -58.471 -54.247  1.00 53.58  ? 1960 LEU B O   1 
ATOM 4270  C CB  . LEU A 1 588  ? 4.466   -57.353 -55.696  1.00 54.37  ? 1960 LEU B CB  1 
ATOM 4271  C CG  . LEU A 1 588  ? 4.307   -56.323 -54.565  1.00 52.58  ? 1960 LEU B CG  1 
ATOM 4272  C CD1 . LEU A 1 588  ? 4.670   -56.911 -53.208  1.00 52.66  ? 1960 LEU B CD1 1 
ATOM 4273  C CD2 . LEU A 1 588  ? 5.145   -55.083 -54.840  1.00 52.59  ? 1960 LEU B CD2 1 
ATOM 4274  N N   . LEU A 1 589  ? 1.529   -57.903 -56.421  1.00 54.88  ? 1961 LEU B N   1 
ATOM 4275  C CA  . LEU A 1 589  ? 0.088   -57.632 -56.370  1.00 53.54  ? 1961 LEU B CA  1 
ATOM 4276  C C   . LEU A 1 589  ? -0.710  -58.883 -55.995  1.00 54.02  ? 1961 LEU B C   1 
ATOM 4277  O O   . LEU A 1 589  ? -1.727  -58.782 -55.312  1.00 56.49  ? 1961 LEU B O   1 
ATOM 4278  C CB  . LEU A 1 589  ? -0.417  -57.061 -57.703  1.00 53.72  ? 1961 LEU B CB  1 
ATOM 4279  C CG  . LEU A 1 589  ? 0.065   -55.651 -58.072  1.00 52.23  ? 1961 LEU B CG  1 
ATOM 4280  C CD1 . LEU A 1 589  ? -0.231  -55.343 -59.528  1.00 53.02  ? 1961 LEU B CD1 1 
ATOM 4281  C CD2 . LEU A 1 589  ? -0.569  -54.592 -57.192  1.00 50.84  ? 1961 LEU B CD2 1 
ATOM 4282  N N   . THR A 1 590  ? -0.242  -60.052 -56.430  1.00 53.38  ? 1962 THR B N   1 
ATOM 4283  C CA  . THR A 1 590  ? -0.841  -61.325 -56.023  1.00 52.61  ? 1962 THR B CA  1 
ATOM 4284  C C   . THR A 1 590  ? -0.665  -61.579 -54.521  1.00 54.34  ? 1962 THR B C   1 
ATOM 4285  O O   . THR A 1 590  ? -1.603  -62.037 -53.871  1.00 54.57  ? 1962 THR B O   1 
ATOM 4286  C CB  . THR A 1 590  ? -0.275  -62.495 -56.846  1.00 51.84  ? 1962 THR B CB  1 
ATOM 4287  O OG1 . THR A 1 590  ? -0.449  -62.206 -58.238  1.00 52.48  ? 1962 THR B OG1 1 
ATOM 4288  C CG2 . THR A 1 590  ? -0.997  -63.793 -56.535  1.00 52.88  ? 1962 THR B CG2 1 
ATOM 4289  N N   . ASP A 1 591  ? 0.516   -61.267 -53.978  1.00 58.22  ? 1963 ASP B N   1 
ATOM 4290  C CA  . ASP A 1 591  ? 0.765   -61.348 -52.522  1.00 58.52  ? 1963 ASP B CA  1 
ATOM 4291  C C   . ASP A 1 591  ? -0.058  -60.334 -51.729  1.00 57.18  ? 1963 ASP B C   1 
ATOM 4292  O O   . ASP A 1 591  ? -0.546  -60.650 -50.644  1.00 56.92  ? 1963 ASP B O   1 
ATOM 4293  C CB  . ASP A 1 591  ? 2.254   -61.155 -52.194  1.00 60.13  ? 1963 ASP B CB  1 
ATOM 4294  C CG  . ASP A 1 591  ? 3.122   -62.315 -52.658  1.00 64.14  ? 1963 ASP B CG  1 
ATOM 4295  O OD1 . ASP A 1 591  ? 2.689   -63.479 -52.532  1.00 65.57  ? 1963 ASP B OD1 1 
ATOM 4296  O OD2 . ASP A 1 591  ? 4.253   -62.062 -53.131  1.00 68.11  ? 1963 ASP B OD2 1 
ATOM 4297  N N   . ILE A 1 592  ? -0.200  -59.123 -52.269  1.00 57.45  ? 1964 ILE B N   1 
ATOM 4298  C CA  . ILE A 1 592  ? -1.071  -58.094 -51.679  1.00 56.18  ? 1964 ILE B CA  1 
ATOM 4299  C C   . ILE A 1 592  ? -2.541  -58.523 -51.823  1.00 57.47  ? 1964 ILE B C   1 
ATOM 4300  O O   . ILE A 1 592  ? -3.386  -58.085 -51.063  1.00 61.04  ? 1964 ILE B O   1 
ATOM 4301  C CB  . ILE A 1 592  ? -0.825  -56.691 -52.306  1.00 54.61  ? 1964 ILE B CB  1 
ATOM 4302  C CG1 . ILE A 1 592  ? 0.618   -56.231 -52.071  1.00 54.25  ? 1964 ILE B CG1 1 
ATOM 4303  C CG2 . ILE A 1 592  ? -1.752  -55.626 -51.719  1.00 54.41  ? 1964 ILE B CG2 1 
ATOM 4304  C CD1 . ILE A 1 592  ? 1.095   -55.201 -53.072  1.00 54.13  ? 1964 ILE B CD1 1 
ATOM 4305  N N   . GLY A 1 593  ? -2.850  -59.361 -52.807  1.00 61.18  ? 1965 GLY B N   1 
ATOM 4306  C CA  . GLY A 1 593  ? -4.159  -60.008 -52.886  1.00 65.65  ? 1965 GLY B CA  1 
ATOM 4307  C C   . GLY A 1 593  ? -4.444  -60.925 -51.705  1.00 68.22  ? 1965 GLY B C   1 
ATOM 4308  O O   . GLY A 1 593  ? -5.514  -60.842 -51.104  1.00 67.78  ? 1965 GLY B O   1 
ATOM 4309  N N   . ARG A 1 594  ? -3.479  -61.787 -51.377  1.00 71.46  ? 1966 ARG B N   1 
ATOM 4310  C CA  . ARG A 1 594  ? -3.618  -62.777 -50.296  1.00 75.11  ? 1966 ARG B CA  1 
ATOM 4311  C C   . ARG A 1 594  ? -3.940  -62.107 -48.952  1.00 69.42  ? 1966 ARG B C   1 
ATOM 4312  O O   . ARG A 1 594  ? -4.939  -62.439 -48.313  1.00 69.61  ? 1966 ARG B O   1 
ATOM 4313  C CB  . ARG A 1 594  ? -2.354  -63.652 -50.199  1.00 90.26  ? 1966 ARG B CB  1 
ATOM 4314  C CG  . ARG A 1 594  ? -2.524  -64.950 -49.409  1.00 109.12 ? 1966 ARG B CG  1 
ATOM 4315  C CD  . ARG A 1 594  ? -1.527  -66.025 -49.841  1.00 121.40 ? 1966 ARG B CD  1 
ATOM 4316  N NE  . ARG A 1 594  ? -0.129  -65.626 -49.621  1.00 138.22 ? 1966 ARG B NE  1 
ATOM 4317  C CZ  . ARG A 1 594  ? 0.655   -65.995 -48.598  1.00 147.83 ? 1966 ARG B CZ  1 
ATOM 4318  N NH1 . ARG A 1 594  ? 0.228   -66.805 -47.624  1.00 144.21 ? 1966 ARG B NH1 1 
ATOM 4319  N NH2 . ARG A 1 594  ? 1.908   -65.540 -48.546  1.00 152.95 ? 1966 ARG B NH2 1 
ATOM 4320  N N   . TYR A 1 595  ? -3.099  -61.153 -48.553  1.00 64.62  ? 1967 TYR B N   1 
ATOM 4321  C CA  . TYR A 1 595  ? -3.341  -60.301 -47.381  1.00 59.22  ? 1967 TYR B CA  1 
ATOM 4322  C C   . TYR A 1 595  ? -3.879  -58.964 -47.898  1.00 60.70  ? 1967 TYR B C   1 
ATOM 4323  O O   . TYR A 1 595  ? -3.287  -58.392 -48.796  1.00 70.24  ? 1967 TYR B O   1 
ATOM 4324  C CB  . TYR A 1 595  ? -2.037  -60.047 -46.604  1.00 54.48  ? 1967 TYR B CB  1 
ATOM 4325  C CG  . TYR A 1 595  ? -1.144  -61.254 -46.399  1.00 52.54  ? 1967 TYR B CG  1 
ATOM 4326  C CD1 . TYR A 1 595  ? -0.021  -61.463 -47.199  1.00 51.42  ? 1967 TYR B CD1 1 
ATOM 4327  C CD2 . TYR A 1 595  ? -1.406  -62.175 -45.390  1.00 54.90  ? 1967 TYR B CD2 1 
ATOM 4328  C CE1 . TYR A 1 595  ? 0.804   -62.566 -47.006  1.00 52.75  ? 1967 TYR B CE1 1 
ATOM 4329  C CE2 . TYR A 1 595  ? -0.588  -63.281 -45.189  1.00 55.56  ? 1967 TYR B CE2 1 
ATOM 4330  C CZ  . TYR A 1 595  ? 0.513   -63.472 -45.997  1.00 54.40  ? 1967 TYR B CZ  1 
ATOM 4331  O OH  . TYR A 1 595  ? 1.313   -64.567 -45.789  1.00 55.86  ? 1967 TYR B OH  1 
ATOM 4332  N N   . HIS A 1 596  ? -4.958  -58.447 -47.312  1.00 56.14  ? 1968 HIS B N   1 
ATOM 4333  C CA  . HIS A 1 596  ? -5.651  -57.223 -47.809  1.00 55.25  ? 1968 HIS B CA  1 
ATOM 4334  C C   . HIS A 1 596  ? -6.202  -57.308 -49.265  1.00 53.55  ? 1968 HIS B C   1 
ATOM 4335  O O   . HIS A 1 596  ? -5.794  -56.525 -50.135  1.00 49.97  ? 1968 HIS B O   1 
ATOM 4336  C CB  . HIS A 1 596  ? -4.802  -55.919 -47.681  1.00 52.42  ? 1968 HIS B CB  1 
ATOM 4337  C CG  . HIS A 1 596  ? -3.699  -55.975 -46.678  1.00 50.78  ? 1968 HIS B CG  1 
ATOM 4338  N ND1 . HIS A 1 596  ? -3.906  -55.830 -45.325  1.00 52.39  ? 1968 HIS B ND1 1 
ATOM 4339  C CD2 . HIS A 1 596  ? -2.364  -56.113 -46.844  1.00 52.58  ? 1968 HIS B CD2 1 
ATOM 4340  C CE1 . HIS A 1 596  ? -2.745  -55.904 -44.697  1.00 56.49  ? 1968 HIS B CE1 1 
ATOM 4341  N NE2 . HIS A 1 596  ? -1.794  -56.079 -45.596  1.00 55.91  ? 1968 HIS B NE2 1 
ATOM 4342  N N   . PRO A 1 597  ? -7.149  -58.232 -49.531  1.00 53.98  ? 1969 PRO B N   1 
ATOM 4343  C CA  . PRO A 1 597  ? -7.812  -58.229 -50.847  1.00 52.32  ? 1969 PRO B CA  1 
ATOM 4344  C C   . PRO A 1 597  ? -8.723  -57.006 -51.059  1.00 51.96  ? 1969 PRO B C   1 
ATOM 4345  O O   . PRO A 1 597  ? -8.849  -56.524 -52.186  1.00 49.57  ? 1969 PRO B O   1 
ATOM 4346  C CB  . PRO A 1 597  ? -8.630  -59.520 -50.834  1.00 51.89  ? 1969 PRO B CB  1 
ATOM 4347  C CG  . PRO A 1 597  ? -8.888  -59.784 -49.394  1.00 54.56  ? 1969 PRO B CG  1 
ATOM 4348  C CD  . PRO A 1 597  ? -7.689  -59.279 -48.646  1.00 55.25  ? 1969 PRO B CD  1 
ATOM 4349  N N   . GLN A 1 598  ? -9.320  -56.504 -49.976  1.00 52.33  ? 1970 GLN B N   1 
ATOM 4350  C CA  . GLN A 1 598  ? -10.203 -55.326 -50.017  1.00 53.88  ? 1970 GLN B CA  1 
ATOM 4351  C C   . GLN A 1 598  ? -9.519  -54.077 -50.594  1.00 55.45  ? 1970 GLN B C   1 
ATOM 4352  O O   . GLN A 1 598  ? -10.184 -53.212 -51.167  1.00 55.45  ? 1970 GLN B O   1 
ATOM 4353  C CB  . GLN A 1 598  ? -10.728 -55.000 -48.610  1.00 55.11  ? 1970 GLN B CB  1 
ATOM 4354  C CG  . GLN A 1 598  ? -11.639 -56.059 -47.992  1.00 55.68  ? 1970 GLN B CG  1 
ATOM 4355  C CD  . GLN A 1 598  ? -13.057 -56.052 -48.538  1.00 53.45  ? 1970 GLN B CD  1 
ATOM 4356  O OE1 . GLN A 1 598  ? -13.383 -55.324 -49.476  1.00 50.65  ? 1970 GLN B OE1 1 
ATOM 4357  N NE2 . GLN A 1 598  ? -13.915 -56.868 -47.937  1.00 54.04  ? 1970 GLN B NE2 1 
ATOM 4358  N N   . ALA A 1 599  ? -8.201  -53.986 -50.418  1.00 56.18  ? 1971 ALA B N   1 
ATOM 4359  C CA  . ALA A 1 599  ? -7.404  -52.878 -50.946  1.00 55.16  ? 1971 ALA B CA  1 
ATOM 4360  C C   . ALA A 1 599  ? -7.193  -52.930 -52.462  1.00 57.27  ? 1971 ALA B C   1 
ATOM 4361  O O   . ALA A 1 599  ? -6.971  -51.891 -53.081  1.00 63.14  ? 1971 ALA B O   1 
ATOM 4362  C CB  . ALA A 1 599  ? -6.058  -52.829 -50.241  1.00 53.18  ? 1971 ALA B CB  1 
ATOM 4363  N N   . LEU A 1 600  ? -7.260  -54.122 -53.053  1.00 57.20  ? 1972 LEU B N   1 
ATOM 4364  C CA  . LEU A 1 600  ? -6.938  -54.315 -54.475  1.00 56.14  ? 1972 LEU B CA  1 
ATOM 4365  C C   . LEU A 1 600  ? -8.122  -54.503 -55.422  1.00 57.37  ? 1972 LEU B C   1 
ATOM 4366  O O   . LEU A 1 600  ? -7.957  -54.319 -56.626  1.00 57.49  ? 1972 LEU B O   1 
ATOM 4367  C CB  . LEU A 1 600  ? -5.995  -55.513 -54.640  1.00 55.58  ? 1972 LEU B CB  1 
ATOM 4368  C CG  . LEU A 1 600  ? -4.511  -55.192 -54.744  1.00 55.75  ? 1972 LEU B CG  1 
ATOM 4369  C CD1 . LEU A 1 600  ? -3.714  -56.477 -54.634  1.00 56.48  ? 1972 LEU B CD1 1 
ATOM 4370  C CD2 . LEU A 1 600  ? -4.192  -54.486 -56.052  1.00 56.90  ? 1972 LEU B CD2 1 
ATOM 4371  N N   . ILE A 1 601  ? -9.298  -54.856 -54.901  1.00 58.48  ? 1973 ILE B N   1 
ATOM 4372  C CA  . ILE A 1 601  ? -10.391 -55.357 -55.770  1.00 60.91  ? 1973 ILE B CA  1 
ATOM 4373  C C   . ILE A 1 601  ? -10.924 -54.287 -56.707  1.00 60.96  ? 1973 ILE B C   1 
ATOM 4374  O O   . ILE A 1 601  ? -11.054 -54.533 -57.902  1.00 66.43  ? 1973 ILE B O   1 
ATOM 4375  C CB  . ILE A 1 601  ? -11.654 -55.947 -55.066  1.00 62.95  ? 1973 ILE B CB  1 
ATOM 4376  C CG1 . ILE A 1 601  ? -11.595 -55.951 -53.534  1.00 65.90  ? 1973 ILE B CG1 1 
ATOM 4377  C CG2 . ILE A 1 601  ? -11.946 -57.341 -55.613  1.00 64.12  ? 1973 ILE B CG2 1 
ATOM 4378  C CD1 . ILE A 1 601  ? -12.945 -55.699 -52.915  1.00 68.80  ? 1973 ILE B CD1 1 
ATOM 4379  N N   . TYR A 1 602  ? -11.260 -53.121 -56.159  1.00 58.18  ? 1974 TYR B N   1 
ATOM 4380  C CA  . TYR A 1 602  ? -11.797 -52.028 -56.971  1.00 58.57  ? 1974 TYR B CA  1 
ATOM 4381  C C   . TYR A 1 602  ? -10.841 -51.618 -58.104  1.00 62.06  ? 1974 TYR B C   1 
ATOM 4382  O O   . TYR A 1 602  ? -11.241 -51.668 -59.273  1.00 65.11  ? 1974 TYR B O   1 
ATOM 4383  C CB  . TYR A 1 602  ? -12.178 -50.814 -56.113  1.00 57.44  ? 1974 TYR B CB  1 
ATOM 4384  C CG  . TYR A 1 602  ? -13.447 -50.981 -55.310  1.00 55.07  ? 1974 TYR B CG  1 
ATOM 4385  C CD1 . TYR A 1 602  ? -13.419 -50.972 -53.916  1.00 55.19  ? 1974 TYR B CD1 1 
ATOM 4386  C CD2 . TYR A 1 602  ? -14.677 -51.130 -55.938  1.00 56.54  ? 1974 TYR B CD2 1 
ATOM 4387  C CE1 . TYR A 1 602  ? -14.579 -51.115 -53.171  1.00 56.47  ? 1974 TYR B CE1 1 
ATOM 4388  C CE2 . TYR A 1 602  ? -15.844 -51.277 -55.202  1.00 59.61  ? 1974 TYR B CE2 1 
ATOM 4389  C CZ  . TYR A 1 602  ? -15.790 -51.268 -53.819  1.00 58.77  ? 1974 TYR B CZ  1 
ATOM 4390  O OH  . TYR A 1 602  ? -16.943 -51.412 -53.085  1.00 60.86  ? 1974 TYR B OH  1 
ATOM 4391  N N   . PRO A 1 603  ? -9.580  -51.240 -57.774  1.00 61.77  ? 1975 PRO B N   1 
ATOM 4392  C CA  . PRO A 1 603  ? -8.670  -50.802 -58.841  1.00 60.76  ? 1975 PRO B CA  1 
ATOM 4393  C C   . PRO A 1 603  ? -8.261  -51.887 -59.849  1.00 60.11  ? 1975 PRO B C   1 
ATOM 4394  O O   . PRO A 1 603  ? -7.966  -51.551 -60.998  1.00 62.76  ? 1975 PRO B O   1 
ATOM 4395  C CB  . PRO A 1 603  ? -7.449  -50.271 -58.072  1.00 58.82  ? 1975 PRO B CB  1 
ATOM 4396  C CG  . PRO A 1 603  ? -7.488  -50.967 -56.766  1.00 57.52  ? 1975 PRO B CG  1 
ATOM 4397  C CD  . PRO A 1 603  ? -8.948  -51.095 -56.446  1.00 60.57  ? 1975 PRO B CD  1 
ATOM 4398  N N   . LEU A 1 604  ? -8.235  -53.156 -59.438  1.00 58.62  ? 1976 LEU B N   1 
ATOM 4399  C CA  . LEU A 1 604  ? -8.008  -54.255 -60.394  1.00 62.97  ? 1976 LEU B CA  1 
ATOM 4400  C C   . LEU A 1 604  ? -9.213  -54.462 -61.316  1.00 68.41  ? 1976 LEU B C   1 
ATOM 4401  O O   . LEU A 1 604  ? -9.037  -54.791 -62.492  1.00 71.56  ? 1976 LEU B O   1 
ATOM 4402  C CB  . LEU A 1 604  ? -7.639  -55.574 -59.695  1.00 60.62  ? 1976 LEU B CB  1 
ATOM 4403  C CG  . LEU A 1 604  ? -6.167  -55.761 -59.303  1.00 59.58  ? 1976 LEU B CG  1 
ATOM 4404  C CD1 . LEU A 1 604  ? -6.015  -56.959 -58.381  1.00 60.63  ? 1976 LEU B CD1 1 
ATOM 4405  C CD2 . LEU A 1 604  ? -5.267  -55.934 -60.517  1.00 59.52  ? 1976 LEU B CD2 1 
ATOM 4406  N N   . THR A 1 605  ? -10.422 -54.269 -60.787  1.00 71.67  ? 1977 THR B N   1 
ATOM 4407  C CA  . THR A 1 605  ? -11.644 -54.381 -61.588  1.00 71.89  ? 1977 THR B CA  1 
ATOM 4408  C C   . THR A 1 605  ? -11.704 -53.312 -62.684  1.00 69.30  ? 1977 THR B C   1 
ATOM 4409  O O   . THR A 1 605  ? -12.186 -53.590 -63.780  1.00 75.45  ? 1977 THR B O   1 
ATOM 4410  C CB  . THR A 1 605  ? -12.920 -54.316 -60.723  1.00 76.09  ? 1977 THR B CB  1 
ATOM 4411  O OG1 . THR A 1 605  ? -12.791 -55.198 -59.601  1.00 75.68  ? 1977 THR B OG1 1 
ATOM 4412  C CG2 . THR A 1 605  ? -14.128 -54.755 -61.524  1.00 82.45  ? 1977 THR B CG2 1 
ATOM 4413  N N   . VAL A 1 606  ? -11.200 -52.113 -62.394  1.00 64.71  ? 1978 VAL B N   1 
ATOM 4414  C CA  . VAL A 1 606  ? -11.028 -51.070 -63.423  1.00 66.02  ? 1978 VAL B CA  1 
ATOM 4415  C C   . VAL A 1 606  ? -10.146 -51.612 -64.557  1.00 66.79  ? 1978 VAL B C   1 
ATOM 4416  O O   . VAL A 1 606  ? -10.525 -51.568 -65.732  1.00 65.81  ? 1978 VAL B O   1 
ATOM 4417  C CB  . VAL A 1 606  ? -10.380 -49.776 -62.855  1.00 66.39  ? 1978 VAL B CB  1 
ATOM 4418  C CG1 . VAL A 1 606  ? -10.172 -48.728 -63.945  1.00 69.18  ? 1978 VAL B CG1 1 
ATOM 4419  C CG2 . VAL A 1 606  ? -11.223 -49.173 -61.742  1.00 67.42  ? 1978 VAL B CG2 1 
ATOM 4420  N N   . ALA A 1 607  ? -8.978  -52.133 -64.180  1.00 67.53  ? 1979 ALA B N   1 
ATOM 4421  C CA  . ALA A 1 607  ? -7.979  -52.635 -65.132  1.00 68.91  ? 1979 ALA B CA  1 
ATOM 4422  C C   . ALA A 1 607  ? -8.469  -53.814 -65.974  1.00 70.49  ? 1979 ALA B C   1 
ATOM 4423  O O   . ALA A 1 607  ? -8.071  -53.948 -67.133  1.00 72.63  ? 1979 ALA B O   1 
ATOM 4424  C CB  . ALA A 1 607  ? -6.698  -53.009 -64.401  1.00 67.95  ? 1979 ALA B CB  1 
ATOM 4425  N N   . SER A 1 608  ? -9.332  -54.652 -65.397  1.00 70.77  ? 1980 SER B N   1 
ATOM 4426  C CA  . SER A 1 608  ? -9.901  -55.813 -66.103  1.00 72.60  ? 1980 SER B CA  1 
ATOM 4427  C C   . SER A 1 608  ? -10.855 -55.441 -67.235  1.00 72.87  ? 1980 SER B C   1 
ATOM 4428  O O   . SER A 1 608  ? -11.166 -56.289 -68.078  1.00 75.44  ? 1980 SER B O   1 
ATOM 4429  C CB  . SER A 1 608  ? -10.635 -56.737 -65.133  1.00 72.06  ? 1980 SER B CB  1 
ATOM 4430  O OG  . SER A 1 608  ? -11.794 -56.114 -64.615  1.00 75.16  ? 1980 SER B OG  1 
ATOM 4431  N N   . LYS A 1 609  ? -11.334 -54.197 -67.232  1.00 71.46  ? 1981 LYS B N   1 
ATOM 4432  C CA  . LYS A 1 609  ? -12.115 -53.652 -68.342  1.00 75.88  ? 1981 LYS B CA  1 
ATOM 4433  C C   . LYS A 1 609  ? -11.396 -52.439 -68.915  1.00 74.51  ? 1981 LYS B C   1 
ATOM 4434  O O   . LYS A 1 609  ? -11.787 -51.294 -68.695  1.00 77.37  ? 1981 LYS B O   1 
ATOM 4435  C CB  . LYS A 1 609  ? -13.570 -53.353 -67.935  1.00 78.59  ? 1981 LYS B CB  1 
ATOM 4436  C CG  . LYS A 1 609  ? -13.790 -52.561 -66.648  1.00 78.09  ? 1981 LYS B CG  1 
ATOM 4437  C CD  . LYS A 1 609  ? -14.943 -53.147 -65.845  1.00 79.52  ? 1981 LYS B CD  1 
ATOM 4438  C CE  . LYS A 1 609  ? -15.212 -52.358 -64.576  1.00 79.67  ? 1981 LYS B CE  1 
ATOM 4439  N NZ  . LYS A 1 609  ? -16.404 -52.898 -63.870  1.00 78.47  ? 1981 LYS B NZ  1 
ATOM 4440  N N   . SER A 1 610  ? -10.319 -52.729 -69.641  1.00 73.78  ? 1982 SER B N   1 
ATOM 4441  C CA  . SER A 1 610  ? -9.504  -51.723 -70.314  1.00 74.65  ? 1982 SER B CA  1 
ATOM 4442  C C   . SER A 1 610  ? -9.316  -52.115 -71.771  1.00 77.06  ? 1982 SER B C   1 
ATOM 4443  O O   . SER A 1 610  ? -9.051  -53.280 -72.074  1.00 77.37  ? 1982 SER B O   1 
ATOM 4444  C CB  . SER A 1 610  ? -8.141  -51.610 -69.639  1.00 74.11  ? 1982 SER B CB  1 
ATOM 4445  O OG  . SER A 1 610  ? -7.379  -50.563 -70.216  1.00 76.17  ? 1982 SER B OG  1 
ATOM 4446  N N   . THR A 1 611  ? -9.444  -51.134 -72.663  1.00 81.51  ? 1983 THR B N   1 
ATOM 4447  C CA  . THR A 1 611  ? -9.302  -51.345 -74.104  1.00 85.56  ? 1983 THR B CA  1 
ATOM 4448  C C   . THR A 1 611  ? -7.949  -51.962 -74.406  1.00 87.63  ? 1983 THR B C   1 
ATOM 4449  O O   . THR A 1 611  ? -7.877  -52.976 -75.100  1.00 92.64  ? 1983 THR B O   1 
ATOM 4450  C CB  . THR A 1 611  ? -9.444  -50.023 -74.891  1.00 91.21  ? 1983 THR B CB  1 
ATOM 4451  O OG1 . THR A 1 611  ? -10.620 -49.331 -74.456  1.00 95.51  ? 1983 THR B OG1 1 
ATOM 4452  C CG2 . THR A 1 611  ? -9.542  -50.272 -76.400  1.00 95.97  ? 1983 THR B CG2 1 
ATOM 4453  N N   . THR A 1 612  ? -6.887  -51.345 -73.883  1.00 88.02  ? 1984 THR B N   1 
ATOM 4454  C CA  . THR A 1 612  ? -5.523  -51.886 -74.023  1.00 88.55  ? 1984 THR B CA  1 
ATOM 4455  C C   . THR A 1 612  ? -5.462  -53.348 -73.539  1.00 84.69  ? 1984 THR B C   1 
ATOM 4456  O O   . THR A 1 612  ? -5.685  -53.645 -72.363  1.00 78.11  ? 1984 THR B O   1 
ATOM 4457  C CB  . THR A 1 612  ? -4.417  -50.998 -73.376  1.00 86.06  ? 1984 THR B CB  1 
ATOM 4458  O OG1 . THR A 1 612  ? -3.171  -51.708 -73.356  1.00 85.99  ? 1984 THR B OG1 1 
ATOM 4459  C CG2 . THR A 1 612  ? -4.750  -50.576 -71.968  1.00 82.86  ? 1984 THR B CG2 1 
ATOM 4460  N N   . THR A 1 613  ? -5.198  -54.238 -74.497  1.00 86.68  ? 1985 THR B N   1 
ATOM 4461  C CA  . THR A 1 613  ? -5.318  -55.685 -74.316  1.00 82.93  ? 1985 THR B CA  1 
ATOM 4462  C C   . THR A 1 613  ? -4.401  -56.246 -73.231  1.00 79.27  ? 1985 THR B C   1 
ATOM 4463  O O   . THR A 1 613  ? -4.811  -57.114 -72.463  1.00 79.26  ? 1985 THR B O   1 
ATOM 4464  C CB  . THR A 1 613  ? -5.120  -56.452 -75.656  1.00 85.64  ? 1985 THR B CB  1 
ATOM 4465  O OG1 . THR A 1 613  ? -5.402  -57.841 -75.459  1.00 85.07  ? 1985 THR B OG1 1 
ATOM 4466  C CG2 . THR A 1 613  ? -3.695  -56.300 -76.232  1.00 88.47  ? 1985 THR B CG2 1 
ATOM 4467  N N   . ALA A 1 614  ? -3.176  -55.735 -73.164  1.00 80.28  ? 1986 ALA B N   1 
ATOM 4468  C CA  . ALA A 1 614  ? -2.179  -56.215 -72.203  1.00 83.54  ? 1986 ALA B CA  1 
ATOM 4469  C C   . ALA A 1 614  ? -2.563  -55.974 -70.736  1.00 79.65  ? 1986 ALA B C   1 
ATOM 4470  O O   . ALA A 1 614  ? -2.213  -56.782 -69.873  1.00 76.22  ? 1986 ALA B O   1 
ATOM 4471  C CB  . ALA A 1 614  ? -0.820  -55.592 -72.497  1.00 88.08  ? 1986 ALA B CB  1 
ATOM 4472  N N   . ARG A 1 615  ? -3.268  -54.872 -70.464  1.00 78.15  ? 1987 ARG B N   1 
ATOM 4473  C CA  . ARG A 1 615  ? -3.680  -54.527 -69.096  1.00 74.79  ? 1987 ARG B CA  1 
ATOM 4474  C C   . ARG A 1 615  ? -4.687  -55.507 -68.541  1.00 74.32  ? 1987 ARG B C   1 
ATOM 4475  O O   . ARG A 1 615  ? -4.486  -56.064 -67.464  1.00 74.20  ? 1987 ARG B O   1 
ATOM 4476  C CB  . ARG A 1 615  ? -4.292  -53.126 -69.026  1.00 73.46  ? 1987 ARG B CB  1 
ATOM 4477  C CG  . ARG A 1 615  ? -3.281  -52.011 -69.167  1.00 74.38  ? 1987 ARG B CG  1 
ATOM 4478  C CD  . ARG A 1 615  ? -3.892  -50.669 -68.819  1.00 74.33  ? 1987 ARG B CD  1 
ATOM 4479  N NE  . ARG A 1 615  ? -4.082  -50.515 -67.385  1.00 72.12  ? 1987 ARG B NE  1 
ATOM 4480  C CZ  . ARG A 1 615  ? -3.119  -50.233 -66.509  1.00 72.61  ? 1987 ARG B CZ  1 
ATOM 4481  N NH1 . ARG A 1 615  ? -1.850  -50.073 -66.892  1.00 70.23  ? 1987 ARG B NH1 1 
ATOM 4482  N NH2 . ARG A 1 615  ? -3.434  -50.111 -65.224  1.00 75.01  ? 1987 ARG B NH2 1 
ATOM 4483  N N   . HIS A 1 616  ? -5.771  -55.709 -69.280  1.00 78.31  ? 1988 HIS B N   1 
ATOM 4484  C CA  . HIS A 1 616  ? -6.882  -56.505 -68.776  1.00 85.63  ? 1988 HIS B CA  1 
ATOM 4485  C C   . HIS A 1 616  ? -6.579  -58.009 -68.723  1.00 90.59  ? 1988 HIS B C   1 
ATOM 4486  O O   . HIS A 1 616  ? -7.214  -58.726 -67.951  1.00 100.59 ? 1988 HIS B O   1 
ATOM 4487  C CB  . HIS A 1 616  ? -8.183  -56.181 -69.530  1.00 89.91  ? 1988 HIS B CB  1 
ATOM 4488  C CG  . HIS A 1 616  ? -8.396  -56.974 -70.778  1.00 94.28  ? 1988 HIS B CG  1 
ATOM 4489  N ND1 . HIS A 1 616  ? -7.837  -56.626 -71.989  1.00 98.02  ? 1988 HIS B ND1 1 
ATOM 4490  C CD2 . HIS A 1 616  ? -9.138  -58.082 -71.008  1.00 97.84  ? 1988 HIS B CD2 1 
ATOM 4491  C CE1 . HIS A 1 616  ? -8.210  -57.498 -72.908  1.00 104.70 ? 1988 HIS B CE1 1 
ATOM 4492  N NE2 . HIS A 1 616  ? -8.999  -58.392 -72.338  1.00 107.37 ? 1988 HIS B NE2 1 
ATOM 4493  N N   . ASN A 1 617  ? -5.610  -58.476 -69.515  1.00 89.56  ? 1989 ASN B N   1 
ATOM 4494  C CA  . ASN A 1 617  ? -5.106  -59.857 -69.397  1.00 90.75  ? 1989 ASN B CA  1 
ATOM 4495  C C   . ASN A 1 617  ? -4.397  -60.064 -68.065  1.00 87.33  ? 1989 ASN B C   1 
ATOM 4496  O O   . ASN A 1 617  ? -4.677  -61.018 -67.337  1.00 90.15  ? 1989 ASN B O   1 
ATOM 4497  C CB  . ASN A 1 617  ? -4.122  -60.191 -70.524  1.00 93.46  ? 1989 ASN B CB  1 
ATOM 4498  C CG  . ASN A 1 617  ? -4.793  -60.317 -71.872  1.00 98.10  ? 1989 ASN B CG  1 
ATOM 4499  O OD1 . ASN A 1 617  ? -5.866  -60.908 -71.997  1.00 102.68 ? 1989 ASN B OD1 1 
ATOM 4500  N ND2 . ASN A 1 617  ? -4.156  -59.768 -72.897  1.00 104.06 ? 1989 ASN B ND2 1 
ATOM 4501  N N   . ALA A 1 618  ? -3.466  -59.160 -67.774  1.00 82.25  ? 1990 ALA B N   1 
ATOM 4502  C CA  . ALA A 1 618  ? -2.690  -59.193 -66.540  1.00 75.74  ? 1990 ALA B CA  1 
ATOM 4503  C C   . ALA A 1 618  ? -3.551  -58.935 -65.308  1.00 71.73  ? 1990 ALA B C   1 
ATOM 4504  O O   . ALA A 1 618  ? -3.337  -59.555 -64.268  1.00 71.13  ? 1990 ALA B O   1 
ATOM 4505  C CB  . ALA A 1 618  ? -1.563  -58.179 -66.610  1.00 76.70  ? 1990 ALA B CB  1 
ATOM 4506  N N   . ALA A 1 619  ? -4.515  -58.020 -65.427  1.00 71.77  ? 1991 ALA B N   1 
ATOM 4507  C CA  . ALA A 1 619  ? -5.424  -57.690 -64.322  1.00 69.19  ? 1991 ALA B CA  1 
ATOM 4508  C C   . ALA A 1 619  ? -6.336  -58.866 -63.972  1.00 69.81  ? 1991 ALA B C   1 
ATOM 4509  O O   . ALA A 1 619  ? -6.506  -59.190 -62.796  1.00 70.18  ? 1991 ALA B O   1 
ATOM 4510  C CB  . ALA A 1 619  ? -6.253  -56.461 -64.660  1.00 68.06  ? 1991 ALA B CB  1 
ATOM 4511  N N   . ASN A 1 620  ? -6.907  -59.500 -64.996  1.00 72.05  ? 1992 ASN B N   1 
ATOM 4512  C CA  . ASN A 1 620  ? -7.719  -60.711 -64.809  1.00 73.96  ? 1992 ASN B CA  1 
ATOM 4513  C C   . ASN A 1 620  ? -6.920  -61.892 -64.249  1.00 73.08  ? 1992 ASN B C   1 
ATOM 4514  O O   . ASN A 1 620  ? -7.470  -62.699 -63.499  1.00 77.67  ? 1992 ASN B O   1 
ATOM 4515  C CB  . ASN A 1 620  ? -8.413  -61.126 -66.117  1.00 76.93  ? 1992 ASN B CB  1 
ATOM 4516  C CG  . ASN A 1 620  ? -9.612  -60.254 -66.448  1.00 79.20  ? 1992 ASN B CG  1 
ATOM 4517  O OD1 . ASN A 1 620  ? -10.471 -60.018 -65.600  1.00 81.11  ? 1992 ASN B OD1 1 
ATOM 4518  N ND2 . ASN A 1 620  ? -9.685  -59.785 -67.690  1.00 81.85  ? 1992 ASN B ND2 1 
ATOM 4519  N N   . LYS A 1 621  ? -5.639  -61.993 -64.607  1.00 70.80  ? 1993 LYS B N   1 
ATOM 4520  C CA  . LYS A 1 621  ? -4.764  -63.041 -64.062  1.00 71.10  ? 1993 LYS B CA  1 
ATOM 4521  C C   . LYS A 1 621  ? -4.594  -62.911 -62.547  1.00 65.01  ? 1993 LYS B C   1 
ATOM 4522  O O   . LYS A 1 621  ? -4.559  -63.912 -61.835  1.00 60.89  ? 1993 LYS B O   1 
ATOM 4523  C CB  . LYS A 1 621  ? -3.384  -63.019 -64.729  1.00 78.21  ? 1993 LYS B CB  1 
ATOM 4524  C CG  . LYS A 1 621  ? -2.583  -64.300 -64.520  1.00 87.23  ? 1993 LYS B CG  1 
ATOM 4525  C CD  . LYS A 1 621  ? -1.088  -64.049 -64.408  1.00 95.32  ? 1993 LYS B CD  1 
ATOM 4526  C CE  . LYS A 1 621  ? -0.352  -65.328 -64.037  1.00 103.54 ? 1993 LYS B CE  1 
ATOM 4527  N NZ  . LYS A 1 621  ? 1.113   -65.108 -63.889  1.00 110.45 ? 1993 LYS B NZ  1 
ATOM 4528  N N   . ILE A 1 622  ? -4.483  -61.675 -62.068  1.00 65.84  ? 1994 ILE B N   1 
ATOM 4529  C CA  . ILE A 1 622  ? -4.350  -61.406 -60.634  1.00 66.07  ? 1994 ILE B CA  1 
ATOM 4530  C C   . ILE A 1 622  ? -5.689  -61.687 -59.947  1.00 68.13  ? 1994 ILE B C   1 
ATOM 4531  O O   . ILE A 1 622  ? -5.718  -62.302 -58.878  1.00 73.32  ? 1994 ILE B O   1 
ATOM 4532  C CB  . ILE A 1 622  ? -3.864  -59.959 -60.355  1.00 64.32  ? 1994 ILE B CB  1 
ATOM 4533  C CG1 . ILE A 1 622  ? -2.482  -59.722 -60.975  1.00 65.27  ? 1994 ILE B CG1 1 
ATOM 4534  C CG2 . ILE A 1 622  ? -3.763  -59.683 -58.859  1.00 64.46  ? 1994 ILE B CG2 1 
ATOM 4535  C CD1 . ILE A 1 622  ? -2.178  -58.265 -61.242  1.00 66.42  ? 1994 ILE B CD1 1 
ATOM 4536  N N   . LEU A 1 623  ? -6.785  -61.242 -60.565  1.00 65.68  ? 1995 LEU B N   1 
ATOM 4537  C CA  . LEU A 1 623  ? -8.138  -61.516 -60.057  1.00 66.91  ? 1995 LEU B CA  1 
ATOM 4538  C C   . LEU A 1 623  ? -8.461  -63.019 -60.012  1.00 69.43  ? 1995 LEU B C   1 
ATOM 4539  O O   . LEU A 1 623  ? -9.158  -63.479 -59.097  1.00 67.01  ? 1995 LEU B O   1 
ATOM 4540  C CB  . LEU A 1 623  ? -9.186  -60.776 -60.895  1.00 70.10  ? 1995 LEU B CB  1 
ATOM 4541  C CG  . LEU A 1 623  ? -9.200  -59.250 -60.750  1.00 72.37  ? 1995 LEU B CG  1 
ATOM 4542  C CD1 . LEU A 1 623  ? -9.832  -58.585 -61.966  1.00 74.04  ? 1995 LEU B CD1 1 
ATOM 4543  C CD2 . LEU A 1 623  ? -9.922  -58.825 -59.479  1.00 72.71  ? 1995 LEU B CD2 1 
ATOM 4544  N N   . LYS A 1 624  ? -7.954  -63.769 -60.995  1.00 71.38  ? 1996 LYS B N   1 
ATOM 4545  C CA  . LYS A 1 624  ? -8.044  -65.234 -61.007  1.00 74.24  ? 1996 LYS B CA  1 
ATOM 4546  C C   . LYS A 1 624  ? -7.341  -65.791 -59.770  1.00 75.39  ? 1996 LYS B C   1 
ATOM 4547  O O   . LYS A 1 624  ? -7.953  -66.511 -58.984  1.00 78.98  ? 1996 LYS B O   1 
ATOM 4548  C CB  . LYS A 1 624  ? -7.410  -65.801 -62.285  1.00 79.36  ? 1996 LYS B CB  1 
ATOM 4549  C CG  . LYS A 1 624  ? -7.526  -67.313 -62.480  1.00 83.88  ? 1996 LYS B CG  1 
ATOM 4550  C CD  . LYS A 1 624  ? -8.402  -67.697 -63.670  1.00 88.93  ? 1996 LYS B CD  1 
ATOM 4551  C CE  . LYS A 1 624  ? -8.094  -69.103 -64.168  1.00 94.80  ? 1996 LYS B CE  1 
ATOM 4552  N NZ  . LYS A 1 624  ? -8.404  -70.165 -63.168  1.00 101.21 ? 1996 LYS B NZ  1 
ATOM 4553  N N   . ASN A 1 625  ? -6.072  -65.419 -59.589  1.00 73.45  ? 1997 ASN B N   1 
ATOM 4554  C CA  . ASN A 1 625  ? -5.279  -65.836 -58.419  1.00 70.99  ? 1997 ASN B CA  1 
ATOM 4555  C C   . ASN A 1 625  ? -5.901  -65.443 -57.083  1.00 66.72  ? 1997 ASN B C   1 
ATOM 4556  O O   . ASN A 1 625  ? -5.673  -66.117 -56.086  1.00 70.87  ? 1997 ASN B O   1 
ATOM 4557  C CB  . ASN A 1 625  ? -3.849  -65.272 -58.479  1.00 73.53  ? 1997 ASN B CB  1 
ATOM 4558  C CG  . ASN A 1 625  ? -2.926  -66.100 -59.353  1.00 78.60  ? 1997 ASN B CG  1 
ATOM 4559  O OD1 . ASN A 1 625  ? -2.748  -67.297 -59.122  1.00 84.11  ? 1997 ASN B OD1 1 
ATOM 4560  N ND2 . ASN A 1 625  ? -2.318  -65.464 -60.351  1.00 76.19  ? 1997 ASN B ND2 1 
ATOM 4561  N N   . MET A 1 626  ? -6.652  -64.347 -57.056  1.00 62.96  ? 1998 MET B N   1 
ATOM 4562  C CA  . MET A 1 626  ? -7.335  -63.916 -55.833  1.00 63.10  ? 1998 MET B CA  1 
ATOM 4563  C C   . MET A 1 626  ? -8.568  -64.748 -55.493  1.00 63.95  ? 1998 MET B C   1 
ATOM 4564  O O   . MET A 1 626  ? -8.939  -64.839 -54.320  1.00 64.63  ? 1998 MET B O   1 
ATOM 4565  C CB  . MET A 1 626  ? -7.714  -62.430 -55.897  1.00 59.92  ? 1998 MET B CB  1 
ATOM 4566  C CG  . MET A 1 626  ? -6.560  -61.501 -55.572  1.00 57.00  ? 1998 MET B CG  1 
ATOM 4567  S SD  . MET A 1 626  ? -6.989  -59.766 -55.753  1.00 56.64  ? 1998 MET B SD  1 
ATOM 4568  C CE  . MET A 1 626  ? -8.134  -59.516 -54.400  1.00 57.12  ? 1998 MET B CE  1 
ATOM 4569  N N   . CYS A 1 627  ? -9.205  -65.335 -56.505  1.00 65.13  ? 1999 CYS B N   1 
ATOM 4570  C CA  . CYS A 1 627  ? -10.408 -66.146 -56.289  1.00 67.30  ? 1999 CYS B CA  1 
ATOM 4571  C C   . CYS A 1 627  ? -10.146 -67.467 -55.567  1.00 68.38  ? 1999 CYS B C   1 
ATOM 4572  O O   . CYS A 1 627  ? -11.045 -67.995 -54.915  1.00 69.75  ? 1999 CYS B O   1 
ATOM 4573  C CB  . CYS A 1 627  ? -11.142 -66.405 -57.605  1.00 69.64  ? 1999 CYS B CB  1 
ATOM 4574  S SG  . CYS A 1 627  ? -12.014 -64.951 -58.215  1.00 70.88  ? 1999 CYS B SG  1 
ATOM 4575  N N   . GLU A 1 628  ? -8.922  -67.987 -55.658  1.00 67.95  ? 2000 GLU B N   1 
ATOM 4576  C CA  . GLU A 1 628  ? -8.558  -69.208 -54.932  1.00 72.15  ? 2000 GLU B CA  1 
ATOM 4577  C C   . GLU A 1 628  ? -8.528  -69.020 -53.398  1.00 68.78  ? 2000 GLU B C   1 
ATOM 4578  O O   . GLU A 1 628  ? -8.432  -70.002 -52.663  1.00 74.20  ? 2000 GLU B O   1 
ATOM 4579  C CB  . GLU A 1 628  ? -7.238  -69.807 -55.468  1.00 80.92  ? 2000 GLU B CB  1 
ATOM 4580  C CG  . GLU A 1 628  ? -5.946  -69.250 -54.871  1.00 88.89  ? 2000 GLU B CG  1 
ATOM 4581  C CD  . GLU A 1 628  ? -4.713  -69.519 -55.730  1.00 100.92 ? 2000 GLU B CD  1 
ATOM 4582  O OE1 . GLU A 1 628  ? -4.734  -70.455 -56.563  1.00 105.13 ? 2000 GLU B OE1 1 
ATOM 4583  O OE2 . GLU A 1 628  ? -3.708  -68.789 -55.565  1.00 112.15 ? 2000 GLU B OE2 1 
ATOM 4584  N N   . HIS A 1 629  ? -8.578  -67.771 -52.926  1.00 64.55  ? 2001 HIS B N   1 
ATOM 4585  C CA  . HIS A 1 629  ? -8.798  -67.467 -51.502  1.00 62.22  ? 2001 HIS B CA  1 
ATOM 4586  C C   . HIS A 1 629  ? -9.952  -66.492 -51.195  1.00 57.68  ? 2001 HIS B C   1 
ATOM 4587  O O   . HIS A 1 629  ? -10.454 -66.494 -50.071  1.00 59.16  ? 2001 HIS B O   1 
ATOM 4588  C CB  . HIS A 1 629  ? -7.494  -66.959 -50.861  1.00 63.62  ? 2001 HIS B CB  1 
ATOM 4589  C CG  . HIS A 1 629  ? -7.138  -65.550 -51.228  1.00 61.10  ? 2001 HIS B CG  1 
ATOM 4590  N ND1 . HIS A 1 629  ? -6.451  -65.224 -52.379  1.00 59.02  ? 2001 HIS B ND1 1 
ATOM 4591  C CD2 . HIS A 1 629  ? -7.368  -64.382 -50.585  1.00 61.71  ? 2001 HIS B CD2 1 
ATOM 4592  C CE1 . HIS A 1 629  ? -6.281  -63.915 -52.432  1.00 58.19  ? 2001 HIS B CE1 1 
ATOM 4593  N NE2 . HIS A 1 629  ? -6.834  -63.381 -51.359  1.00 60.83  ? 2001 HIS B NE2 1 
ATOM 4594  N N   . SER A 1 630  ? -10.362 -65.664 -52.158  1.00 53.45  ? 2002 SER B N   1 
ATOM 4595  C CA  . SER A 1 630  ? -11.408 -64.661 -51.930  1.00 53.56  ? 2002 SER B CA  1 
ATOM 4596  C C   . SER A 1 630  ? -12.403 -64.591 -53.095  1.00 56.92  ? 2002 SER B C   1 
ATOM 4597  O O   . SER A 1 630  ? -12.673 -63.514 -53.626  1.00 55.90  ? 2002 SER B O   1 
ATOM 4598  C CB  . SER A 1 630  ? -10.760 -63.291 -51.679  1.00 49.81  ? 2002 SER B CB  1 
ATOM 4599  O OG  . SER A 1 630  ? -10.187 -63.229 -50.389  1.00 47.79  ? 2002 SER B OG  1 
ATOM 4600  N N   . ASN A 1 631  ? -12.974 -65.738 -53.465  1.00 62.68  ? 2003 ASN B N   1 
ATOM 4601  C CA  . ASN A 1 631  ? -13.801 -65.836 -54.680  1.00 62.60  ? 2003 ASN B CA  1 
ATOM 4602  C C   . ASN A 1 631  ? -15.025 -64.925 -54.660  1.00 62.07  ? 2003 ASN B C   1 
ATOM 4603  O O   . ASN A 1 631  ? -15.193 -64.083 -55.544  1.00 57.55  ? 2003 ASN B O   1 
ATOM 4604  C CB  . ASN A 1 631  ? -14.269 -67.270 -54.931  1.00 62.67  ? 2003 ASN B CB  1 
ATOM 4605  C CG  . ASN A 1 631  ? -15.083 -67.389 -56.204  1.00 61.72  ? 2003 ASN B CG  1 
ATOM 4606  O OD1 . ASN A 1 631  ? -14.616 -67.037 -57.290  1.00 58.03  ? 2003 ASN B OD1 1 
ATOM 4607  N ND2 . ASN A 1 631  ? -16.317 -67.859 -56.074  1.00 65.27  ? 2003 ASN B ND2 1 
ATOM 4608  N N   . THR A 1 632  ? -15.871 -65.096 -53.646  1.00 65.98  ? 2004 THR B N   1 
ATOM 4609  C CA  . THR A 1 632  ? -17.136 -64.354 -53.573  1.00 65.97  ? 2004 THR B CA  1 
ATOM 4610  C C   . THR A 1 632  ? -16.919 -62.842 -53.375  1.00 61.65  ? 2004 THR B C   1 
ATOM 4611  O O   . THR A 1 632  ? -17.799 -62.053 -53.697  1.00 59.60  ? 2004 THR B O   1 
ATOM 4612  C CB  . THR A 1 632  ? -18.102 -64.921 -52.498  1.00 66.09  ? 2004 THR B CB  1 
ATOM 4613  O OG1 . THR A 1 632  ? -17.519 -64.808 -51.196  1.00 68.95  ? 2004 THR B OG1 1 
ATOM 4614  C CG2 . THR A 1 632  ? -18.442 -66.392 -52.782  1.00 65.35  ? 2004 THR B CG2 1 
ATOM 4615  N N   . LEU A 1 633  ? -15.748 -62.450 -52.864  1.00 60.25  ? 2005 LEU B N   1 
ATOM 4616  C CA  . LEU A 1 633  ? -15.363 -61.032 -52.770  1.00 57.74  ? 2005 LEU B CA  1 
ATOM 4617  C C   . LEU A 1 633  ? -15.071 -60.443 -54.157  1.00 55.40  ? 2005 LEU B C   1 
ATOM 4618  O O   . LEU A 1 633  ? -15.536 -59.352 -54.484  1.00 53.20  ? 2005 LEU B O   1 
ATOM 4619  C CB  . LEU A 1 633  ? -14.125 -60.862 -51.872  1.00 57.44  ? 2005 LEU B CB  1 
ATOM 4620  C CG  . LEU A 1 633  ? -13.885 -59.557 -51.087  1.00 54.50  ? 2005 LEU B CG  1 
ATOM 4621  C CD1 . LEU A 1 633  ? -12.392 -59.258 -51.023  1.00 53.04  ? 2005 LEU B CD1 1 
ATOM 4622  C CD2 . LEU A 1 633  ? -14.625 -58.344 -51.628  1.00 52.44  ? 2005 LEU B CD2 1 
ATOM 4623  N N   . VAL A 1 634  ? -14.288 -61.170 -54.952  1.00 55.76  ? 2006 VAL B N   1 
ATOM 4624  C CA  . VAL A 1 634  ? -13.933 -60.755 -56.314  1.00 55.60  ? 2006 VAL B CA  1 
ATOM 4625  C C   . VAL A 1 634  ? -15.175 -60.643 -57.196  1.00 58.51  ? 2006 VAL B C   1 
ATOM 4626  O O   . VAL A 1 634  ? -15.358 -59.632 -57.872  1.00 64.26  ? 2006 VAL B O   1 
ATOM 4627  C CB  . VAL A 1 634  ? -12.907 -61.724 -56.961  1.00 54.56  ? 2006 VAL B CB  1 
ATOM 4628  C CG1 . VAL A 1 634  ? -12.740 -61.473 -58.458  1.00 53.12  ? 2006 VAL B CG1 1 
ATOM 4629  C CG2 . VAL A 1 634  ? -11.555 -61.598 -56.273  1.00 54.98  ? 2006 VAL B CG2 1 
ATOM 4630  N N   . GLN A 1 635  ? -16.020 -61.673 -57.182  1.00 59.47  ? 2007 GLN B N   1 
ATOM 4631  C CA  . GLN A 1 635  ? -17.200 -61.710 -58.053  1.00 61.01  ? 2007 GLN B CA  1 
ATOM 4632  C C   . GLN A 1 635  ? -18.222 -60.640 -57.664  1.00 59.80  ? 2007 GLN B C   1 
ATOM 4633  O O   . GLN A 1 635  ? -18.865 -60.052 -58.538  1.00 61.15  ? 2007 GLN B O   1 
ATOM 4634  C CB  . GLN A 1 635  ? -17.856 -63.100 -58.060  1.00 64.55  ? 2007 GLN B CB  1 
ATOM 4635  C CG  . GLN A 1 635  ? -16.961 -64.254 -58.518  1.00 68.30  ? 2007 GLN B CG  1 
ATOM 4636  C CD  . GLN A 1 635  ? -16.346 -64.059 -59.898  1.00 71.94  ? 2007 GLN B CD  1 
ATOM 4637  O OE1 . GLN A 1 635  ? -16.900 -63.367 -60.758  1.00 77.61  ? 2007 GLN B OE1 1 
ATOM 4638  N NE2 . GLN A 1 635  ? -15.192 -64.680 -60.116  1.00 70.15  ? 2007 GLN B NE2 1 
ATOM 4639  N N   . GLN A 1 636  ? -18.360 -60.389 -56.361  1.00 57.68  ? 2008 GLN B N   1 
ATOM 4640  C CA  . GLN A 1 636  ? -19.172 -59.268 -55.864  1.00 55.85  ? 2008 GLN B CA  1 
ATOM 4641  C C   . GLN A 1 636  ? -18.614 -57.931 -56.349  1.00 54.93  ? 2008 GLN B C   1 
ATOM 4642  O O   . GLN A 1 636  ? -19.364 -57.087 -56.842  1.00 53.89  ? 2008 GLN B O   1 
ATOM 4643  C CB  . GLN A 1 636  ? -19.271 -59.272 -54.326  1.00 53.72  ? 2008 GLN B CB  1 
ATOM 4644  C CG  . GLN A 1 636  ? -20.331 -60.213 -53.766  1.00 51.57  ? 2008 GLN B CG  1 
ATOM 4645  C CD  . GLN A 1 636  ? -20.292 -60.322 -52.252  1.00 50.17  ? 2008 GLN B CD  1 
ATOM 4646  O OE1 . GLN A 1 636  ? -19.793 -59.435 -51.556  1.00 47.63  ? 2008 GLN B OE1 1 
ATOM 4647  N NE2 . GLN A 1 636  ? -20.832 -61.415 -51.734  1.00 52.02  ? 2008 GLN B NE2 1 
ATOM 4648  N N   . ALA A 1 637  ? -17.300 -57.754 -56.210  1.00 55.98  ? 2009 ALA B N   1 
ATOM 4649  C CA  . ALA A 1 637  ? -16.613 -56.543 -56.685  1.00 56.96  ? 2009 ALA B CA  1 
ATOM 4650  C C   . ALA A 1 637  ? -16.787 -56.332 -58.193  1.00 57.35  ? 2009 ALA B C   1 
ATOM 4651  O O   . ALA A 1 637  ? -16.921 -55.193 -58.654  1.00 57.02  ? 2009 ALA B O   1 
ATOM 4652  C CB  . ALA A 1 637  ? -15.133 -56.588 -56.321  1.00 55.15  ? 2009 ALA B CB  1 
ATOM 4653  N N   . MET A 1 638  ? -16.799 -57.434 -58.943  1.00 56.98  ? 2010 MET B N   1 
ATOM 4654  C CA  . MET A 1 638  ? -17.007 -57.398 -60.392  1.00 60.51  ? 2010 MET B CA  1 
ATOM 4655  C C   . MET A 1 638  ? -18.387 -56.871 -60.762  1.00 60.44  ? 2010 MET B C   1 
ATOM 4656  O O   . MET A 1 638  ? -18.518 -56.065 -61.680  1.00 62.72  ? 2010 MET B O   1 
ATOM 4657  C CB  . MET A 1 638  ? -16.841 -58.793 -61.008  1.00 66.88  ? 2010 MET B CB  1 
ATOM 4658  C CG  . MET A 1 638  ? -16.109 -58.783 -62.337  1.00 72.24  ? 2010 MET B CG  1 
ATOM 4659  S SD  . MET A 1 638  ? -14.329 -58.655 -62.083  1.00 79.45  ? 2010 MET B SD  1 
ATOM 4660  C CE  . MET A 1 638  ? -13.939 -60.347 -61.625  1.00 81.11  ? 2010 MET B CE  1 
ATOM 4661  N N   . MET A 1 639  ? -19.407 -57.335 -60.046  1.00 60.14  ? 2011 MET B N   1 
ATOM 4662  C CA  . MET A 1 639  ? -20.795 -56.966 -60.333  1.00 61.44  ? 2011 MET B CA  1 
ATOM 4663  C C   . MET A 1 639  ? -21.120 -55.521 -59.957  1.00 59.76  ? 2011 MET B C   1 
ATOM 4664  O O   . MET A 1 639  ? -21.717 -54.801 -60.758  1.00 60.77  ? 2011 MET B O   1 
ATOM 4665  C CB  . MET A 1 639  ? -21.757 -57.926 -59.621  1.00 64.32  ? 2011 MET B CB  1 
ATOM 4666  C CG  . MET A 1 639  ? -23.236 -57.590 -59.780  1.00 67.50  ? 2011 MET B CG  1 
ATOM 4667  S SD  . MET A 1 639  ? -23.916 -56.719 -58.351  1.00 69.18  ? 2011 MET B SD  1 
ATOM 4668  C CE  . MET A 1 639  ? -24.470 -58.131 -57.393  1.00 74.26  ? 2011 MET B CE  1 
ATOM 4669  N N   . VAL A 1 640  ? -20.746 -55.115 -58.744  1.00 58.01  ? 2012 VAL B N   1 
ATOM 4670  C CA  . VAL A 1 640  ? -21.072 -53.773 -58.223  1.00 58.12  ? 2012 VAL B CA  1 
ATOM 4671  C C   . VAL A 1 640  ? -20.513 -52.677 -59.132  1.00 57.84  ? 2012 VAL B C   1 
ATOM 4672  O O   . VAL A 1 640  ? -21.226 -51.741 -59.494  1.00 59.10  ? 2012 VAL B O   1 
ATOM 4673  C CB  . VAL A 1 640  ? -20.569 -53.578 -56.765  1.00 56.53  ? 2012 VAL B CB  1 
ATOM 4674  C CG1 . VAL A 1 640  ? -20.652 -52.120 -56.317  1.00 54.87  ? 2012 VAL B CG1 1 
ATOM 4675  C CG2 . VAL A 1 640  ? -21.371 -54.453 -55.810  1.00 56.94  ? 2012 VAL B CG2 1 
ATOM 4676  N N   . SER A 1 641  ? -19.246 -52.809 -59.505  1.00 56.35  ? 2013 SER B N   1 
ATOM 4677  C CA  . SER A 1 641  ? -18.599 -51.831 -60.374  1.00 57.60  ? 2013 SER B CA  1 
ATOM 4678  C C   . SER A 1 641  ? -19.154 -51.859 -61.805  1.00 57.82  ? 2013 SER B C   1 
ATOM 4679  O O   . SER A 1 641  ? -19.301 -50.803 -62.418  1.00 59.32  ? 2013 SER B O   1 
ATOM 4680  C CB  . SER A 1 641  ? -17.086 -52.040 -60.367  1.00 58.19  ? 2013 SER B CB  1 
ATOM 4681  O OG  . SER A 1 641  ? -16.777 -53.380 -60.677  1.00 58.51  ? 2013 SER B OG  1 
ATOM 4682  N N   . GLU A 1 642  ? -19.457 -53.051 -62.326  1.00 58.36  ? 2014 GLU B N   1 
ATOM 4683  C CA  . GLU A 1 642  ? -20.130 -53.192 -63.637  1.00 61.73  ? 2014 GLU B CA  1 
ATOM 4684  C C   . GLU A 1 642  ? -21.424 -52.400 -63.673  1.00 58.59  ? 2014 GLU B C   1 
ATOM 4685  O O   . GLU A 1 642  ? -21.634 -51.571 -64.558  1.00 58.35  ? 2014 GLU B O   1 
ATOM 4686  C CB  . GLU A 1 642  ? -20.459 -54.658 -63.961  1.00 67.56  ? 2014 GLU B CB  1 
ATOM 4687  C CG  . GLU A 1 642  ? -19.375 -55.415 -64.708  1.00 75.75  ? 2014 GLU B CG  1 
ATOM 4688  C CD  . GLU A 1 642  ? -19.716 -56.887 -64.881  1.00 84.69  ? 2014 GLU B CD  1 
ATOM 4689  O OE1 . GLU A 1 642  ? -20.805 -57.187 -65.416  1.00 87.89  ? 2014 GLU B OE1 1 
ATOM 4690  O OE2 . GLU A 1 642  ? -18.896 -57.746 -64.486  1.00 95.00  ? 2014 GLU B OE2 1 
ATOM 4691  N N   . GLU A 1 643  ? -22.277 -52.670 -62.690  1.00 56.31  ? 2015 GLU B N   1 
ATOM 4692  C CA  . GLU A 1 643  ? -23.592 -52.043 -62.596  1.00 56.47  ? 2015 GLU B CA  1 
ATOM 4693  C C   . GLU A 1 643  ? -23.510 -50.547 -62.314  1.00 56.27  ? 2015 GLU B C   1 
ATOM 4694  O O   . GLU A 1 643  ? -24.314 -49.784 -62.839  1.00 59.06  ? 2015 GLU B O   1 
ATOM 4695  C CB  . GLU A 1 643  ? -24.443 -52.724 -61.520  1.00 55.48  ? 2015 GLU B CB  1 
ATOM 4696  C CG  . GLU A 1 643  ? -24.779 -54.179 -61.800  1.00 54.42  ? 2015 GLU B CG  1 
ATOM 4697  C CD  . GLU A 1 643  ? -25.642 -54.354 -63.029  1.00 56.31  ? 2015 GLU B CD  1 
ATOM 4698  O OE1 . GLU A 1 643  ? -25.175 -55.014 -63.979  1.00 56.16  ? 2015 GLU B OE1 1 
ATOM 4699  O OE2 . GLU A 1 643  ? -26.774 -53.817 -63.064  1.00 58.17  ? 2015 GLU B OE2 1 
ATOM 4700  N N   . LEU A 1 644  ? -22.548 -50.128 -61.496  1.00 53.91  ? 2016 LEU B N   1 
ATOM 4701  C CA  . LEU A 1 644  ? -22.345 -48.697 -61.239  1.00 55.86  ? 2016 LEU B CA  1 
ATOM 4702  C C   . LEU A 1 644  ? -21.975 -47.896 -62.503  1.00 57.33  ? 2016 LEU B C   1 
ATOM 4703  O O   . LEU A 1 644  ? -22.376 -46.739 -62.640  1.00 58.82  ? 2016 LEU B O   1 
ATOM 4704  C CB  . LEU A 1 644  ? -21.303 -48.483 -60.138  1.00 55.14  ? 2016 LEU B CB  1 
ATOM 4705  C CG  . LEU A 1 644  ? -21.797 -48.765 -58.716  1.00 55.33  ? 2016 LEU B CG  1 
ATOM 4706  C CD1 . LEU A 1 644  ? -20.618 -48.941 -57.772  1.00 53.88  ? 2016 LEU B CD1 1 
ATOM 4707  C CD2 . LEU A 1 644  ? -22.715 -47.659 -58.219  1.00 57.94  ? 2016 LEU B CD2 1 
ATOM 4708  N N   . ILE A 1 645  ? -21.233 -48.517 -63.420  1.00 55.80  ? 2017 ILE B N   1 
ATOM 4709  C CA  . ILE A 1 645  ? -20.929 -47.908 -64.722  1.00 56.44  ? 2017 ILE B CA  1 
ATOM 4710  C C   . ILE A 1 645  ? -22.195 -47.828 -65.594  1.00 57.13  ? 2017 ILE B C   1 
ATOM 4711  O O   . ILE A 1 645  ? -22.391 -46.843 -66.311  1.00 57.53  ? 2017 ILE B O   1 
ATOM 4712  C CB  . ILE A 1 645  ? -19.789 -48.670 -65.446  1.00 56.52  ? 2017 ILE B CB  1 
ATOM 4713  C CG1 . ILE A 1 645  ? -18.486 -48.543 -64.656  1.00 54.24  ? 2017 ILE B CG1 1 
ATOM 4714  C CG2 . ILE A 1 645  ? -19.548 -48.132 -66.856  1.00 60.15  ? 2017 ILE B CG2 1 
ATOM 4715  C CD1 . ILE A 1 645  ? -17.484 -49.628 -64.962  1.00 54.15  ? 2017 ILE B CD1 1 
ATOM 4716  N N   . ARG A 1 646  ? -23.035 -48.865 -65.533  1.00 56.90  ? 2018 ARG B N   1 
ATOM 4717  C CA  . ARG A 1 646  ? -24.345 -48.868 -66.211  1.00 59.66  ? 2018 ARG B CA  1 
ATOM 4718  C C   . ARG A 1 646  ? -25.259 -47.758 -65.682  1.00 60.97  ? 2018 ARG B C   1 
ATOM 4719  O O   . ARG A 1 646  ? -25.908 -47.059 -66.467  1.00 63.07  ? 2018 ARG B O   1 
ATOM 4720  C CB  . ARG A 1 646  ? -25.041 -50.229 -66.049  1.00 58.41  ? 2018 ARG B CB  1 
ATOM 4721  C CG  . ARG A 1 646  ? -26.317 -50.415 -66.863  1.00 60.25  ? 2018 ARG B CG  1 
ATOM 4722  C CD  . ARG A 1 646  ? -27.281 -51.375 -66.176  1.00 60.17  ? 2018 ARG B CD  1 
ATOM 4723  N NE  . ARG A 1 646  ? -26.678 -52.688 -65.961  1.00 58.05  ? 2018 ARG B NE  1 
ATOM 4724  C CZ  . ARG A 1 646  ? -26.532 -53.635 -66.891  1.00 59.60  ? 2018 ARG B CZ  1 
ATOM 4725  N NH1 . ARG A 1 646  ? -26.946 -53.448 -68.145  1.00 63.09  ? 2018 ARG B NH1 1 
ATOM 4726  N NH2 . ARG A 1 646  ? -25.960 -54.791 -66.566  1.00 58.29  ? 2018 ARG B NH2 1 
ATOM 4727  N N   . VAL A 1 647  ? -25.301 -47.607 -64.358  1.00 59.11  ? 2019 VAL B N   1 
ATOM 4728  C CA  . VAL A 1 647  ? -26.110 -46.568 -63.709  1.00 61.03  ? 2019 VAL B CA  1 
ATOM 4729  C C   . VAL A 1 647  ? -25.529 -45.159 -63.940  1.00 62.77  ? 2019 VAL B C   1 
ATOM 4730  O O   . VAL A 1 647  ? -26.288 -44.200 -64.102  1.00 65.36  ? 2019 VAL B O   1 
ATOM 4731  C CB  . VAL A 1 647  ? -26.264 -46.829 -62.187  1.00 59.49  ? 2019 VAL B CB  1 
ATOM 4732  C CG1 . VAL A 1 647  ? -27.055 -45.717 -61.502  1.00 61.38  ? 2019 VAL B CG1 1 
ATOM 4733  C CG2 . VAL A 1 647  ? -26.958 -48.161 -61.925  1.00 58.27  ? 2019 VAL B CG2 1 
ATOM 4734  N N   . ALA A 1 648  ? -24.200 -45.038 -63.946  1.00 60.88  ? 2020 ALA B N   1 
ATOM 4735  C CA  . ALA A 1 648  ? -23.531 -43.737 -64.097  1.00 62.19  ? 2020 ALA B CA  1 
ATOM 4736  C C   . ALA A 1 648  ? -23.907 -43.003 -65.387  1.00 65.58  ? 2020 ALA B C   1 
ATOM 4737  O O   . ALA A 1 648  ? -24.178 -41.801 -65.358  1.00 69.31  ? 2020 ALA B O   1 
ATOM 4738  C CB  . ALA A 1 648  ? -22.018 -43.900 -64.017  1.00 60.59  ? 2020 ALA B CB  1 
ATOM 4739  N N   . ILE A 1 649  ? -23.898 -43.723 -66.509  1.00 65.29  ? 2021 ILE B N   1 
ATOM 4740  C CA  . ILE A 1 649  ? -24.290 -43.168 -67.811  1.00 67.28  ? 2021 ILE B CA  1 
ATOM 4741  C C   . ILE A 1 649  ? -25.283 -44.135 -68.457  1.00 66.19  ? 2021 ILE B C   1 
ATOM 4742  O O   . ILE A 1 649  ? -24.938 -45.297 -68.695  1.00 68.18  ? 2021 ILE B O   1 
ATOM 4743  C CB  . ILE A 1 649  ? -23.082 -42.976 -68.769  1.00 68.86  ? 2021 ILE B CB  1 
ATOM 4744  C CG1 . ILE A 1 649  ? -21.853 -42.383 -68.057  1.00 71.04  ? 2021 ILE B CG1 1 
ATOM 4745  C CG2 . ILE A 1 649  ? -23.473 -42.072 -69.926  1.00 71.91  ? 2021 ILE B CG2 1 
ATOM 4746  C CD1 . ILE A 1 649  ? -20.533 -42.733 -68.720  1.00 72.57  ? 2021 ILE B CD1 1 
ATOM 4747  N N   . LEU A 1 650  ? -26.499 -43.661 -68.742  1.00 103.43 ? 2022 LEU B N   1 
ATOM 4748  C CA  . LEU A 1 650  ? -27.530 -44.500 -69.365  1.00 99.80  ? 2022 LEU B CA  1 
ATOM 4749  C C   . LEU A 1 650  ? -27.398 -44.571 -70.881  1.00 99.21  ? 2022 LEU B C   1 
ATOM 4750  O O   . LEU A 1 650  ? -26.631 -43.824 -71.485  1.00 100.42 ? 2022 LEU B O   1 
ATOM 4751  C CB  . LEU A 1 650  ? -28.927 -44.010 -68.986  1.00 98.45  ? 2022 LEU B CB  1 
ATOM 4752  C CG  . LEU A 1 650  ? -29.268 -44.081 -67.500  1.00 96.91  ? 2022 LEU B CG  1 
ATOM 4753  C CD1 . LEU A 1 650  ? -30.610 -43.423 -67.240  1.00 96.37  ? 2022 LEU B CD1 1 
ATOM 4754  C CD2 . LEU A 1 650  ? -29.291 -45.507 -66.982  1.00 95.65  ? 2022 LEU B CD2 1 
ATOM 4755  N N   . TRP A 1 651  ? -28.151 -45.494 -71.476  1.00 97.17  ? 2023 TRP B N   1 
ATOM 4756  C CA  . TRP A 1 651  ? -28.137 -45.732 -72.922  1.00 97.19  ? 2023 TRP B CA  1 
ATOM 4757  C C   . TRP A 1 651  ? -28.425 -44.468 -73.736  1.00 98.26  ? 2023 TRP B C   1 
ATOM 4758  O O   . TRP A 1 651  ? -27.670 -44.139 -74.654  1.00 99.96  ? 2023 TRP B O   1 
ATOM 4759  C CB  . TRP A 1 651  ? -29.125 -46.856 -73.297  1.00 95.63  ? 2023 TRP B CB  1 
ATOM 4760  C CG  . TRP A 1 651  ? -28.551 -48.258 -73.237  1.00 94.87  ? 2023 TRP B CG  1 
ATOM 4761  C CD1 . TRP A 1 651  ? -27.413 -48.658 -72.599  1.00 95.02  ? 2023 TRP B CD1 1 
ATOM 4762  C CD2 . TRP A 1 651  ? -29.111 -49.441 -73.827  1.00 94.12  ? 2023 TRP B CD2 1 
ATOM 4763  N NE1 . TRP A 1 651  ? -27.222 -50.007 -72.766  1.00 94.72  ? 2023 TRP B NE1 1 
ATOM 4764  C CE2 . TRP A 1 651  ? -28.249 -50.513 -73.513  1.00 94.15  ? 2023 TRP B CE2 1 
ATOM 4765  C CE3 . TRP A 1 651  ? -30.256 -49.698 -74.593  1.00 93.71  ? 2023 TRP B CE3 1 
ATOM 4766  C CZ2 . TRP A 1 651  ? -28.494 -51.824 -73.938  1.00 93.94  ? 2023 TRP B CZ2 1 
ATOM 4767  C CZ3 . TRP A 1 651  ? -30.501 -51.003 -75.015  1.00 93.44  ? 2023 TRP B CZ3 1 
ATOM 4768  C CH2 . TRP A 1 651  ? -29.620 -52.048 -74.687  1.00 93.59  ? 2023 TRP B CH2 1 
ATOM 4769  N N   . HIS A 1 652  ? -29.499 -43.760 -73.395  1.00 97.43  ? 2024 HIS B N   1 
ATOM 4770  C CA  . HIS A 1 652  ? -29.868 -42.528 -74.116  1.00 98.33  ? 2024 HIS B CA  1 
ATOM 4771  C C   . HIS A 1 652  ? -28.865 -41.385 -73.937  1.00 99.25  ? 2024 HIS B C   1 
ATOM 4772  O O   . HIS A 1 652  ? -28.686 -40.563 -74.839  1.00 100.52 ? 2024 HIS B O   1 
ATOM 4773  C CB  . HIS A 1 652  ? -31.265 -42.049 -73.721  1.00 97.76  ? 2024 HIS B CB  1 
ATOM 4774  C CG  . HIS A 1 652  ? -31.391 -41.649 -72.290  1.00 97.13  ? 2024 HIS B CG  1 
ATOM 4775  N ND1 . HIS A 1 652  ? -31.877 -42.502 -71.325  1.00 95.71  ? 2024 HIS B ND1 1 
ATOM 4776  C CD2 . HIS A 1 652  ? -31.108 -40.485 -71.661  1.00 97.96  ? 2024 HIS B CD2 1 
ATOM 4777  C CE1 . HIS A 1 652  ? -31.886 -41.880 -70.160  1.00 95.73  ? 2024 HIS B CE1 1 
ATOM 4778  N NE2 . HIS A 1 652  ? -31.424 -40.655 -70.337  1.00 97.03  ? 2024 HIS B NE2 1 
ATOM 4779  N N   . GLU A 1 653  ? -28.223 -41.343 -72.775  1.00 98.64  ? 2025 GLU B N   1 
ATOM 4780  C CA  . GLU A 1 653  ? -27.233 -40.315 -72.471  1.00 100.03 ? 2025 GLU B CA  1 
ATOM 4781  C C   . GLU A 1 653  ? -25.979 -40.494 -73.326  1.00 102.15 ? 2025 GLU B C   1 
ATOM 4782  O O   . GLU A 1 653  ? -25.368 -39.514 -73.749  1.00 103.89 ? 2025 GLU B O   1 
ATOM 4783  C CB  . GLU A 1 653  ? -26.873 -40.340 -70.987  1.00 98.77  ? 2025 GLU B CB  1 
ATOM 4784  C CG  . GLU A 1 653  ? -28.067 -40.130 -70.071  1.00 97.23  ? 2025 GLU B CG  1 
ATOM 4785  C CD  . GLU A 1 653  ? -27.681 -39.940 -68.617  1.00 96.50  ? 2025 GLU B CD  1 
ATOM 4786  O OE1 . GLU A 1 653  ? -26.713 -40.581 -68.163  1.00 96.27  ? 2025 GLU B OE1 1 
ATOM 4787  O OE2 . GLU A 1 653  ? -28.358 -39.159 -67.915  1.00 96.09  ? 2025 GLU B OE2 1 
ATOM 4788  N N   . MET A 1 654  ? -25.610 -41.748 -73.584  1.00 102.50 ? 2026 MET B N   1 
ATOM 4789  C CA  . MET A 1 654  ? -24.499 -42.071 -74.484  1.00 104.80 ? 2026 MET B CA  1 
ATOM 4790  C C   . MET A 1 654  ? -24.842 -41.726 -75.933  1.00 106.65 ? 2026 MET B C   1 
ATOM 4791  O O   . MET A 1 654  ? -23.998 -41.202 -76.666  1.00 108.54 ? 2026 MET B O   1 
ATOM 4792  C CB  . MET A 1 654  ? -24.136 -43.554 -74.381  1.00 104.24 ? 2026 MET B CB  1 
ATOM 4793  C CG  . MET A 1 654  ? -23.614 -43.967 -73.017  1.00 103.73 ? 2026 MET B CG  1 
ATOM 4794  S SD  . MET A 1 654  ? -23.531 -45.752 -72.833  1.00 103.03 ? 2026 MET B SD  1 
ATOM 4795  C CE  . MET A 1 654  ? -22.087 -46.096 -73.848  1.00 105.20 ? 2026 MET B CE  1 
ATOM 4796  N N   . TRP A 1 655  ? -26.076 -42.031 -76.339  1.00 106.49 ? 2027 TRP B N   1 
ATOM 4797  C CA  . TRP A 1 655  ? -26.577 -41.666 -77.674  1.00 108.10 ? 2027 TRP B CA  1 
ATOM 4798  C C   . TRP A 1 655  ? -26.638 -40.152 -77.889  1.00 110.24 ? 2027 TRP B C   1 
ATOM 4799  O O   . TRP A 1 655  ? -26.426 -39.679 -79.005  1.00 111.58 ? 2027 TRP B O   1 
ATOM 4800  C CB  . TRP A 1 655  ? -27.955 -42.294 -77.948  1.00 106.71 ? 2027 TRP B CB  1 
ATOM 4801  C CG  . TRP A 1 655  ? -27.876 -43.699 -78.461  1.00 106.17 ? 2027 TRP B CG  1 
ATOM 4802  C CD1 . TRP A 1 655  ? -28.275 -44.832 -77.819  1.00 104.70 ? 2027 TRP B CD1 1 
ATOM 4803  C CD2 . TRP A 1 655  ? -27.356 -44.116 -79.727  1.00 107.47 ? 2027 TRP B CD2 1 
ATOM 4804  N NE1 . TRP A 1 655  ? -28.042 -45.932 -78.608  1.00 105.10 ? 2027 TRP B NE1 1 
ATOM 4805  C CE2 . TRP A 1 655  ? -27.475 -45.521 -79.785  1.00 106.76 ? 2027 TRP B CE2 1 
ATOM 4806  C CE3 . TRP A 1 655  ? -26.800 -43.439 -80.820  1.00 109.65 ? 2027 TRP B CE3 1 
ATOM 4807  C CZ2 . TRP A 1 655  ? -27.058 -46.265 -80.897  1.00 107.97 ? 2027 TRP B CZ2 1 
ATOM 4808  C CZ3 . TRP A 1 655  ? -26.384 -44.179 -81.927  1.00 110.68 ? 2027 TRP B CZ3 1 
ATOM 4809  C CH2 . TRP A 1 655  ? -26.517 -45.578 -81.954  1.00 109.69 ? 2027 TRP B CH2 1 
ATOM 4810  N N   . HIS A 1 656  ? -26.922 -39.405 -76.824  1.00 110.97 ? 2028 HIS B N   1 
ATOM 4811  C CA  . HIS A 1 656  ? -26.961 -37.944 -76.887  1.00 113.42 ? 2028 HIS B CA  1 
ATOM 4812  C C   . HIS A 1 656  ? -25.590 -37.355 -77.226  1.00 116.87 ? 2028 HIS B C   1 
ATOM 4813  O O   . HIS A 1 656  ? -25.476 -36.558 -78.156  1.00 119.04 ? 2028 HIS B O   1 
ATOM 4814  C CB  . HIS A 1 656  ? -27.470 -37.371 -75.565  1.00 112.53 ? 2028 HIS B CB  1 
ATOM 4815  C CG  . HIS A 1 656  ? -27.686 -35.892 -75.590  1.00 114.00 ? 2028 HIS B CG  1 
ATOM 4816  N ND1 . HIS A 1 656  ? -28.822 -35.314 -76.115  1.00 114.23 ? 2028 HIS B ND1 1 
ATOM 4817  C CD2 . HIS A 1 656  ? -26.917 -34.872 -75.142  1.00 115.55 ? 2028 HIS B CD2 1 
ATOM 4818  C CE1 . HIS A 1 656  ? -28.739 -34.001 -75.995  1.00 115.90 ? 2028 HIS B CE1 1 
ATOM 4819  N NE2 . HIS A 1 656  ? -27.594 -33.707 -75.407  1.00 116.78 ? 2028 HIS B NE2 1 
ATOM 4820  N N   . GLU A 1 657  ? -24.562 -37.751 -76.476  1.00 118.46 ? 2029 GLU B N   1 
ATOM 4821  C CA  . GLU A 1 657  ? -23.186 -37.300 -76.746  1.00 122.06 ? 2029 GLU B CA  1 
ATOM 4822  C C   . GLU A 1 657  ? -22.618 -37.863 -78.052  1.00 123.82 ? 2029 GLU B C   1 
ATOM 4823  O O   . GLU A 1 657  ? -21.823 -37.200 -78.721  1.00 125.93 ? 2029 GLU B O   1 
ATOM 4824  C CB  . GLU A 1 657  ? -22.237 -37.627 -75.583  1.00 122.80 ? 2029 GLU B CB  1 
ATOM 4825  C CG  . GLU A 1 657  ? -21.993 -39.115 -75.314  1.00 122.44 ? 2029 GLU B CG  1 
ATOM 4826  C CD  . GLU A 1 657  ? -20.726 -39.391 -74.520  1.00 124.37 ? 2029 GLU B CD  1 
ATOM 4827  O OE1 . GLU A 1 657  ? -20.106 -38.440 -73.996  1.00 127.05 ? 2029 GLU B OE1 1 
ATOM 4828  O OE2 . GLU A 1 657  ? -20.344 -40.577 -74.420  1.00 124.24 ? 2029 GLU B OE2 1 
ATOM 4829  N N   . GLY A 1 658  ? -23.016 -39.088 -78.394  1.00 123.68 ? 2030 GLY B N   1 
ATOM 4830  C CA  . GLY A 1 658  ? -22.610 -39.725 -79.644  1.00 126.31 ? 2030 GLY B CA  1 
ATOM 4831  C C   . GLY A 1 658  ? -23.124 -39.015 -80.882  1.00 128.94 ? 2030 GLY B C   1 
ATOM 4832  O O   . GLY A 1 658  ? -22.437 -38.974 -81.904  1.00 131.16 ? 2030 GLY B O   1 
ATOM 4833  N N   . LEU A 1 659  ? -24.333 -38.464 -80.785  1.00 129.28 ? 2031 LEU B N   1 
ATOM 4834  C CA  . LEU A 1 659  ? -24.935 -37.676 -81.866  1.00 131.35 ? 2031 LEU B CA  1 
ATOM 4835  C C   . LEU A 1 659  ? -24.464 -36.211 -81.880  1.00 134.78 ? 2031 LEU B C   1 
ATOM 4836  O O   . LEU A 1 659  ? -24.521 -35.560 -82.926  1.00 137.32 ? 2031 LEU B O   1 
ATOM 4837  C CB  . LEU A 1 659  ? -26.464 -37.765 -81.796  1.00 129.54 ? 2031 LEU B CB  1 
ATOM 4838  C CG  . LEU A 1 659  ? -27.021 -39.172 -82.059  1.00 128.43 ? 2031 LEU B CG  1 
ATOM 4839  C CD1 . LEU A 1 659  ? -28.448 -39.307 -81.548  1.00 126.78 ? 2031 LEU B CD1 1 
ATOM 4840  C CD2 . LEU A 1 659  ? -26.950 -39.533 -83.537  1.00 130.43 ? 2031 LEU B CD2 1 
ATOM 4841  N N   . GLU A 1 660  ? -24.011 -35.696 -80.732  1.00 135.40 ? 2032 GLU B N   1 
ATOM 4842  C CA  . GLU A 1 660  ? -23.301 -34.405 -80.682  1.00 137.40 ? 2032 GLU B CA  1 
ATOM 4843  C C   . GLU A 1 660  ? -21.991 -34.486 -81.456  1.00 140.24 ? 2032 GLU B C   1 
ATOM 4844  O O   . GLU A 1 660  ? -21.720 -33.647 -82.311  1.00 142.40 ? 2032 GLU B O   1 
ATOM 4845  C CB  . GLU A 1 660  ? -22.998 -33.972 -79.241  1.00 136.59 ? 2032 GLU B CB  1 
ATOM 4846  C CG  . GLU A 1 660  ? -24.157 -33.301 -78.520  1.00 135.72 ? 2032 GLU B CG  1 
ATOM 4847  C CD  . GLU A 1 660  ? -23.762 -32.754 -77.155  1.00 135.71 ? 2032 GLU B CD  1 
ATOM 4848  O OE1 . GLU A 1 660  ? -22.731 -32.054 -77.059  1.00 137.55 ? 2032 GLU B OE1 1 
ATOM 4849  O OE2 . GLU A 1 660  ? -24.488 -33.016 -76.173  1.00 133.73 ? 2032 GLU B OE2 1 
ATOM 4850  N N   . GLU A 1 661  ? -21.192 -35.503 -81.145  1.00 141.68 ? 2033 GLU B N   1 
ATOM 4851  C CA  . GLU A 1 661  ? -19.895 -35.716 -81.791  1.00 146.85 ? 2033 GLU B CA  1 
ATOM 4852  C C   . GLU A 1 661  ? -20.022 -36.114 -83.268  1.00 150.53 ? 2033 GLU B C   1 
ATOM 4853  O O   . GLU A 1 661  ? -19.243 -35.641 -84.101  1.00 155.36 ? 2033 GLU B O   1 
ATOM 4854  C CB  . GLU A 1 661  ? -19.093 -36.778 -81.022  1.00 146.98 ? 2033 GLU B CB  1 
ATOM 4855  C CG  . GLU A 1 661  ? -17.684 -37.048 -81.543  1.00 150.32 ? 2033 GLU B CG  1 
ATOM 4856  C CD  . GLU A 1 661  ? -16.799 -35.816 -81.543  1.00 154.37 ? 2033 GLU B CD  1 
ATOM 4857  O OE1 . GLU A 1 661  ? -16.704 -35.154 -80.487  1.00 154.28 ? 2033 GLU B OE1 1 
ATOM 4858  O OE2 . GLU A 1 661  ? -16.197 -35.512 -82.598  1.00 158.12 ? 2033 GLU B OE2 1 
ATOM 4859  N N   . ALA A 1 662  ? -20.987 -36.982 -83.580  1.00 149.73 ? 2034 ALA B N   1 
ATOM 4860  C CA  . ALA A 1 662  ? -21.194 -37.470 -84.955  1.00 151.13 ? 2034 ALA B CA  1 
ATOM 4861  C C   . ALA A 1 662  ? -21.657 -36.383 -85.931  1.00 153.09 ? 2034 ALA B C   1 
ATOM 4862  O O   . ALA A 1 662  ? -21.295 -36.422 -87.110  1.00 157.93 ? 2034 ALA B O   1 
ATOM 4863  C CB  . ALA A 1 662  ? -22.174 -38.638 -84.971  1.00 149.18 ? 2034 ALA B CB  1 
ATOM 4864  N N   . SER A 1 663  ? -22.457 -35.431 -85.447  1.00 150.22 ? 2035 SER B N   1 
ATOM 4865  C CA  . SER A 1 663  ? -22.918 -34.303 -86.270  1.00 150.35 ? 2035 SER B CA  1 
ATOM 4866  C C   . SER A 1 663  ? -21.801 -33.298 -86.592  1.00 153.80 ? 2035 SER B C   1 
ATOM 4867  O O   . SER A 1 663  ? -21.800 -32.704 -87.672  1.00 155.16 ? 2035 SER B O   1 
ATOM 4868  C CB  . SER A 1 663  ? -24.091 -33.587 -85.596  1.00 147.37 ? 2035 SER B CB  1 
ATOM 4869  O OG  . SER A 1 663  ? -23.708 -33.054 -84.342  1.00 146.24 ? 2035 SER B OG  1 
ATOM 4870  N N   . ARG A 1 664  ? -20.864 -33.110 -85.661  1.00 155.48 ? 2036 ARG B N   1 
ATOM 4871  C CA  . ARG A 1 664  ? -19.711 -32.219 -85.872  1.00 160.02 ? 2036 ARG B CA  1 
ATOM 4872  C C   . ARG A 1 664  ? -18.706 -32.791 -86.870  1.00 163.35 ? 2036 ARG B C   1 
ATOM 4873  O O   . ARG A 1 664  ? -18.108 -32.044 -87.646  1.00 166.72 ? 2036 ARG B O   1 
ATOM 4874  C CB  . ARG A 1 664  ? -19.001 -31.911 -84.546  1.00 160.28 ? 2036 ARG B CB  1 
ATOM 4875  C CG  . ARG A 1 664  ? -19.852 -31.160 -83.532  1.00 159.91 ? 2036 ARG B CG  1 
ATOM 4876  C CD  . ARG A 1 664  ? -20.082 -29.705 -83.914  1.00 163.31 ? 2036 ARG B CD  1 
ATOM 4877  N NE  . ARG A 1 664  ? -21.354 -29.197 -83.397  1.00 163.80 ? 2036 ARG B NE  1 
ATOM 4878  C CZ  . ARG A 1 664  ? -22.563 -29.477 -83.896  1.00 164.59 ? 2036 ARG B CZ  1 
ATOM 4879  N NH1 . ARG A 1 664  ? -22.715 -30.286 -84.946  1.00 165.53 ? 2036 ARG B NH1 1 
ATOM 4880  N NH2 . ARG A 1 664  ? -23.644 -28.946 -83.329  1.00 164.56 ? 2036 ARG B NH2 1 
ATOM 4881  N N   . LEU A 1 665  ? -18.518 -34.109 -86.836  1.00 164.00 ? 2037 LEU B N   1 
ATOM 4882  C CA  . LEU A 1 665  ? -17.649 -34.802 -87.793  1.00 167.43 ? 2037 LEU B CA  1 
ATOM 4883  C C   . LEU A 1 665  ? -18.215 -34.780 -89.222  1.00 169.35 ? 2037 LEU B C   1 
ATOM 4884  O O   . LEU A 1 665  ? -17.491 -34.455 -90.165  1.00 170.40 ? 2037 LEU B O   1 
ATOM 4885  C CB  . LEU A 1 665  ? -17.390 -36.246 -87.337  1.00 165.59 ? 2037 LEU B CB  1 
ATOM 4886  C CG  . LEU A 1 665  ? -16.416 -36.366 -86.157  1.00 164.95 ? 2037 LEU B CG  1 
ATOM 4887  C CD1 . LEU A 1 665  ? -16.666 -37.629 -85.348  1.00 161.76 ? 2037 LEU B CD1 1 
ATOM 4888  C CD2 . LEU A 1 665  ? -14.976 -36.323 -86.647  1.00 168.25 ? 2037 LEU B CD2 1 
ATOM 4889  N N   . TYR A 1 666  ? -19.499 -35.114 -89.369  1.00 169.95 ? 2038 TYR B N   1 
ATOM 4890  C CA  . TYR A 1 666  ? -20.151 -35.171 -90.688  1.00 171.63 ? 2038 TYR B CA  1 
ATOM 4891  C C   . TYR A 1 666  ? -20.461 -33.775 -91.242  1.00 172.99 ? 2038 TYR B C   1 
ATOM 4892  O O   . TYR A 1 666  ? -19.839 -33.351 -92.216  1.00 175.13 ? 2038 TYR B O   1 
ATOM 4893  C CB  . TYR A 1 666  ? -21.426 -36.031 -90.639  1.00 170.90 ? 2038 TYR B CB  1 
ATOM 4894  C CG  . TYR A 1 666  ? -22.091 -36.229 -91.991  1.00 173.12 ? 2038 TYR B CG  1 
ATOM 4895  C CD1 . TYR A 1 666  ? -21.485 -37.006 -92.977  1.00 174.49 ? 2038 TYR B CD1 1 
ATOM 4896  C CD2 . TYR A 1 666  ? -23.328 -35.645 -92.284  1.00 172.56 ? 2038 TYR B CD2 1 
ATOM 4897  C CE1 . TYR A 1 666  ? -22.084 -37.195 -94.217  1.00 173.98 ? 2038 TYR B CE1 1 
ATOM 4898  C CE2 . TYR A 1 666  ? -23.937 -35.829 -93.521  1.00 171.73 ? 2038 TYR B CE2 1 
ATOM 4899  C CZ  . TYR A 1 666  ? -23.313 -36.605 -94.485  1.00 172.34 ? 2038 TYR B CZ  1 
ATOM 4900  O OH  . TYR A 1 666  ? -23.912 -36.790 -95.711  1.00 171.47 ? 2038 TYR B OH  1 
ATOM 4901  N N   . PHE A 1 667  ? -21.405 -33.068 -90.617  1.00 171.57 ? 2039 PHE B N   1 
ATOM 4902  C CA  . PHE A 1 667  ? -21.859 -31.760 -91.114  1.00 172.41 ? 2039 PHE B CA  1 
ATOM 4903  C C   . PHE A 1 667  ? -20.818 -30.664 -90.881  1.00 172.97 ? 2039 PHE B C   1 
ATOM 4904  O O   . PHE A 1 667  ? -20.549 -29.861 -91.776  1.00 176.35 ? 2039 PHE B O   1 
ATOM 4905  C CB  . PHE A 1 667  ? -23.184 -31.340 -90.460  1.00 171.27 ? 2039 PHE B CB  1 
ATOM 4906  C CG  . PHE A 1 667  ? -24.333 -32.271 -90.744  1.00 169.65 ? 2039 PHE B CG  1 
ATOM 4907  C CD1 . PHE A 1 667  ? -24.980 -32.247 -91.977  1.00 170.87 ? 2039 PHE B CD1 1 
ATOM 4908  C CD2 . PHE A 1 667  ? -24.783 -33.162 -89.773  1.00 167.11 ? 2039 PHE B CD2 1 
ATOM 4909  C CE1 . PHE A 1 667  ? -26.044 -33.101 -92.240  1.00 168.64 ? 2039 PHE B CE1 1 
ATOM 4910  C CE2 . PHE A 1 667  ? -25.845 -34.018 -90.031  1.00 165.27 ? 2039 PHE B CE2 1 
ATOM 4911  C CZ  . PHE A 1 667  ? -26.478 -33.987 -91.265  1.00 165.67 ? 2039 PHE B CZ  1 
ATOM 4912  N N   . GLY A 1 668  ? -20.240 -30.638 -89.682  1.00 169.85 ? 2040 GLY B N   1 
ATOM 4913  C CA  . GLY A 1 668  ? -19.309 -29.585 -89.280  1.00 170.63 ? 2040 GLY B CA  1 
ATOM 4914  C C   . GLY A 1 668  ? -17.924 -29.648 -89.904  1.00 171.93 ? 2040 GLY B C   1 
ATOM 4915  O O   . GLY A 1 668  ? -17.376 -28.612 -90.287  1.00 174.57 ? 2040 GLY B O   1 
ATOM 4916  N N   . GLU A 1 669  ? -17.358 -30.853 -90.001  1.00 170.25 ? 2041 GLU B N   1 
ATOM 4917  C CA  . GLU A 1 669  ? -15.961 -31.049 -90.428  1.00 172.48 ? 2041 GLU B CA  1 
ATOM 4918  C C   . GLU A 1 669  ? -15.741 -31.803 -91.750  1.00 175.41 ? 2041 GLU B C   1 
ATOM 4919  O O   . GLU A 1 669  ? -14.614 -31.811 -92.252  1.00 179.50 ? 2041 GLU B O   1 
ATOM 4920  C CB  . GLU A 1 669  ? -15.194 -31.771 -89.318  1.00 169.74 ? 2041 GLU B CB  1 
ATOM 4921  C CG  . GLU A 1 669  ? -14.930 -30.908 -88.098  1.00 169.30 ? 2041 GLU B CG  1 
ATOM 4922  C CD  . GLU A 1 669  ? -14.088 -31.610 -87.050  1.00 168.53 ? 2041 GLU B CD  1 
ATOM 4923  O OE1 . GLU A 1 669  ? -14.303 -32.819 -86.815  1.00 166.43 ? 2041 GLU B OE1 1 
ATOM 4924  O OE2 . GLU A 1 669  ? -13.212 -30.950 -86.453  1.00 170.19 ? 2041 GLU B OE2 1 
ATOM 4925  N N   . ARG A 1 670  ? -16.791 -32.415 -92.308  1.00 174.61 ? 2042 ARG B N   1 
ATOM 4926  C CA  . ARG A 1 670  ? -16.677 -33.332 -93.461  1.00 175.40 ? 2042 ARG B CA  1 
ATOM 4927  C C   . ARG A 1 670  ? -15.748 -34.515 -93.140  1.00 175.06 ? 2042 ARG B C   1 
ATOM 4928  O O   . ARG A 1 670  ? -14.587 -34.545 -93.559  1.00 177.93 ? 2042 ARG B O   1 
ATOM 4929  C CB  . ARG A 1 670  ? -16.236 -32.595 -94.744  1.00 178.69 ? 2042 ARG B CB  1 
ATOM 4930  C CG  . ARG A 1 670  ? -17.263 -31.602 -95.276  1.00 178.97 ? 2042 ARG B CG  1 
ATOM 4931  C CD  . ARG A 1 670  ? -18.241 -32.237 -96.258  1.00 177.95 ? 2042 ARG B CD  1 
ATOM 4932  N NE  . ARG A 1 670  ? -19.576 -31.635 -96.169  1.00 177.72 ? 2042 ARG B NE  1 
ATOM 4933  C CZ  . ARG A 1 670  ? -20.613 -32.114 -95.471  1.00 175.68 ? 2042 ARG B CZ  1 
ATOM 4934  N NH1 . ARG A 1 670  ? -20.532 -33.244 -94.763  1.00 173.14 ? 2042 ARG B NH1 1 
ATOM 4935  N NH2 . ARG A 1 670  ? -21.768 -31.450 -95.484  1.00 175.88 ? 2042 ARG B NH2 1 
ATOM 4936  N N   . ASN A 1 671  ? -16.281 -35.471 -92.377  1.00 171.32 ? 2043 ASN B N   1 
ATOM 4937  C CA  . ASN A 1 671  ? -15.532 -36.647 -91.919  1.00 169.12 ? 2043 ASN B CA  1 
ATOM 4938  C C   . ASN A 1 671  ? -16.512 -37.789 -91.594  1.00 165.80 ? 2043 ASN B C   1 
ATOM 4939  O O   . ASN A 1 671  ? -17.104 -37.821 -90.512  1.00 164.45 ? 2043 ASN B O   1 
ATOM 4940  C CB  . ASN A 1 671  ? -14.672 -36.275 -90.694  1.00 168.26 ? 2043 ASN B CB  1 
ATOM 4941  C CG  . ASN A 1 671  ? -13.679 -37.364 -90.296  1.00 167.41 ? 2043 ASN B CG  1 
ATOM 4942  O OD1 . ASN A 1 671  ? -13.518 -38.375 -90.981  1.00 167.34 ? 2043 ASN B OD1 1 
ATOM 4943  N ND2 . ASN A 1 671  ? -13.002 -37.150 -89.175  1.00 166.70 ? 2043 ASN B ND2 1 
ATOM 4944  N N   . VAL A 1 672  ? -16.672 -38.717 -92.540  1.00 164.60 ? 2044 VAL B N   1 
ATOM 4945  C CA  . VAL A 1 672  ? -17.643 -39.822 -92.420  1.00 160.63 ? 2044 VAL B CA  1 
ATOM 4946  C C   . VAL A 1 672  ? -16.988 -41.069 -91.809  1.00 158.93 ? 2044 VAL B C   1 
ATOM 4947  O O   . VAL A 1 672  ? -17.629 -41.783 -91.036  1.00 157.09 ? 2044 VAL B O   1 
ATOM 4948  C CB  . VAL A 1 672  ? -18.304 -40.204 -93.775  1.00 160.57 ? 2044 VAL B CB  1 
ATOM 4949  C CG1 . VAL A 1 672  ? -19.593 -40.982 -93.532  1.00 157.38 ? 2044 VAL B CG1 1 
ATOM 4950  C CG2 . VAL A 1 672  ? -18.611 -38.978 -94.631  1.00 161.74 ? 2044 VAL B CG2 1 
ATOM 4951  N N   . LYS A 1 673  ? -15.729 -41.335 -92.169  1.00 159.47 ? 2045 LYS B N   1 
ATOM 4952  C CA  . LYS A 1 673  ? -14.929 -42.394 -91.524  1.00 157.75 ? 2045 LYS B CA  1 
ATOM 4953  C C   . LYS A 1 673  ? -14.645 -42.094 -90.040  1.00 157.54 ? 2045 LYS B C   1 
ATOM 4954  O O   . LYS A 1 673  ? -14.475 -43.015 -89.239  1.00 158.11 ? 2045 LYS B O   1 
ATOM 4955  C CB  . LYS A 1 673  ? -13.621 -42.644 -92.294  1.00 158.38 ? 2045 LYS B CB  1 
ATOM 4956  C CG  . LYS A 1 673  ? -13.830 -43.415 -93.589  1.00 157.28 ? 2045 LYS B CG  1 
ATOM 4957  C CD  . LYS A 1 673  ? -12.658 -43.278 -94.547  1.00 159.82 ? 2045 LYS B CD  1 
ATOM 4958  C CE  . LYS A 1 673  ? -12.924 -44.026 -95.846  1.00 159.42 ? 2045 LYS B CE  1 
ATOM 4959  N NZ  . LYS A 1 673  ? -11.930 -43.703 -96.907  1.00 161.75 ? 2045 LYS B NZ  1 
ATOM 4960  N N   . GLY A 1 674  ? -14.595 -40.810 -89.686  1.00 156.93 ? 2046 GLY B N   1 
ATOM 4961  C CA  . GLY A 1 674  ? -14.580 -40.382 -88.287  1.00 155.15 ? 2046 GLY B CA  1 
ATOM 4962  C C   . GLY A 1 674  ? -15.922 -40.597 -87.602  1.00 152.34 ? 2046 GLY B C   1 
ATOM 4963  O O   . GLY A 1 674  ? -15.968 -41.041 -86.455  1.00 150.06 ? 2046 GLY B O   1 
ATOM 4964  N N   . MET A 1 675  ? -17.007 -40.268 -88.309  1.00 152.81 ? 2047 MET B N   1 
ATOM 4965  C CA  . MET A 1 675  ? -18.389 -40.437 -87.816  1.00 151.35 ? 2047 MET B CA  1 
ATOM 4966  C C   . MET A 1 675  ? -18.743 -41.893 -87.484  1.00 153.23 ? 2047 MET B C   1 
ATOM 4967  O O   . MET A 1 675  ? -19.368 -42.152 -86.453  1.00 150.34 ? 2047 MET B O   1 
ATOM 4968  C CB  . MET A 1 675  ? -19.394 -39.892 -88.848  1.00 149.30 ? 2047 MET B CB  1 
ATOM 4969  C CG  . MET A 1 675  ? -20.847 -39.815 -88.381  1.00 145.41 ? 2047 MET B CG  1 
ATOM 4970  S SD  . MET A 1 675  ? -22.039 -39.872 -89.736  1.00 143.22 ? 2047 MET B SD  1 
ATOM 4971  C CE  . MET A 1 675  ? -21.960 -41.597 -90.224  1.00 142.07 ? 2047 MET B CE  1 
ATOM 4972  N N   . PHE A 1 676  ? -18.361 -42.827 -88.358  1.00 159.26 ? 2048 PHE B N   1 
ATOM 4973  C CA  . PHE A 1 676  ? -18.656 -44.260 -88.154  1.00 161.07 ? 2048 PHE B CA  1 
ATOM 4974  C C   . PHE A 1 676  ? -18.004 -44.839 -86.893  1.00 159.11 ? 2048 PHE B C   1 
ATOM 4975  O O   . PHE A 1 676  ? -18.589 -45.704 -86.240  1.00 158.10 ? 2048 PHE B O   1 
ATOM 4976  C CB  . PHE A 1 676  ? -18.248 -45.105 -89.378  1.00 166.64 ? 2048 PHE B CB  1 
ATOM 4977  C CG  . PHE A 1 676  ? -19.224 -45.043 -90.529  1.00 170.86 ? 2048 PHE B CG  1 
ATOM 4978  C CD1 . PHE A 1 676  ? -18.809 -44.634 -91.797  1.00 174.78 ? 2048 PHE B CD1 1 
ATOM 4979  C CD2 . PHE A 1 676  ? -20.558 -45.410 -90.353  1.00 171.26 ? 2048 PHE B CD2 1 
ATOM 4980  C CE1 . PHE A 1 676  ? -19.705 -44.586 -92.858  1.00 175.95 ? 2048 PHE B CE1 1 
ATOM 4981  C CE2 . PHE A 1 676  ? -21.455 -45.358 -91.410  1.00 172.40 ? 2048 PHE B CE2 1 
ATOM 4982  C CZ  . PHE A 1 676  ? -21.030 -44.946 -92.665  1.00 174.38 ? 2048 PHE B CZ  1 
ATOM 4983  N N   . GLU A 1 677  ? -16.803 -44.361 -86.562  1.00 158.26 ? 2049 GLU B N   1 
ATOM 4984  C CA  . GLU A 1 677  ? -16.095 -44.778 -85.341  1.00 156.12 ? 2049 GLU B CA  1 
ATOM 4985  C C   . GLU A 1 677  ? -16.786 -44.330 -84.041  1.00 151.55 ? 2049 GLU B C   1 
ATOM 4986  O O   . GLU A 1 677  ? -16.616 -44.964 -82.997  1.00 149.21 ? 2049 GLU B O   1 
ATOM 4987  C CB  . GLU A 1 677  ? -14.650 -44.266 -85.359  1.00 159.84 ? 2049 GLU B CB  1 
ATOM 4988  C CG  . GLU A 1 677  ? -13.783 -44.898 -86.438  1.00 163.51 ? 2049 GLU B CG  1 
ATOM 4989  C CD  . GLU A 1 677  ? -12.416 -44.247 -86.543  1.00 168.34 ? 2049 GLU B CD  1 
ATOM 4990  O OE1 . GLU A 1 677  ? -11.740 -44.109 -85.501  1.00 170.73 ? 2049 GLU B OE1 1 
ATOM 4991  O OE2 . GLU A 1 677  ? -12.012 -43.881 -87.666  1.00 171.02 ? 2049 GLU B OE2 1 
ATOM 4992  N N   . VAL A 1 678  ? -17.551 -43.239 -84.113  1.00 149.54 ? 2050 VAL B N   1 
ATOM 4993  C CA  . VAL A 1 678  ? -18.333 -42.732 -82.976  1.00 146.03 ? 2050 VAL B CA  1 
ATOM 4994  C C   . VAL A 1 678  ? -19.608 -43.557 -82.760  1.00 141.80 ? 2050 VAL B C   1 
ATOM 4995  O O   . VAL A 1 678  ? -19.958 -43.859 -81.618  1.00 139.87 ? 2050 VAL B O   1 
ATOM 4996  C CB  . VAL A 1 678  ? -18.713 -41.240 -83.173  1.00 146.72 ? 2050 VAL B CB  1 
ATOM 4997  C CG1 . VAL A 1 678  ? -19.582 -40.719 -82.030  1.00 144.04 ? 2050 VAL B CG1 1 
ATOM 4998  C CG2 . VAL A 1 678  ? -17.462 -40.381 -83.294  1.00 149.54 ? 2050 VAL B CG2 1 
ATOM 4999  N N   . LEU A 1 679  ? -20.294 -43.900 -83.853  1.00 139.68 ? 2051 LEU B N   1 
ATOM 5000  C CA  . LEU A 1 679  ? -21.607 -44.560 -83.793  1.00 135.53 ? 2051 LEU B CA  1 
ATOM 5001  C C   . LEU A 1 679  ? -21.554 -46.088 -83.667  1.00 133.45 ? 2051 LEU B C   1 
ATOM 5002  O O   . LEU A 1 679  ? -22.432 -46.670 -83.025  1.00 130.83 ? 2051 LEU B O   1 
ATOM 5003  C CB  . LEU A 1 679  ? -22.451 -44.183 -85.021  1.00 135.31 ? 2051 LEU B CB  1 
ATOM 5004  C CG  . LEU A 1 679  ? -22.756 -42.695 -85.242  1.00 135.31 ? 2051 LEU B CG  1 
ATOM 5005  C CD1 . LEU A 1 679  ? -23.390 -42.487 -86.609  1.00 135.56 ? 2051 LEU B CD1 1 
ATOM 5006  C CD2 . LEU A 1 679  ? -23.655 -42.132 -84.151  1.00 132.96 ? 2051 LEU B CD2 1 
ATOM 5007  N N   . GLU A 1 680  ? -20.550 -46.736 -84.267  1.00 134.40 ? 2052 GLU B N   1 
ATOM 5008  C CA  . GLU A 1 680  ? -20.509 -48.212 -84.312  1.00 133.93 ? 2052 GLU B CA  1 
ATOM 5009  C C   . GLU A 1 680  ? -20.335 -48.915 -82.950  1.00 131.59 ? 2052 GLU B C   1 
ATOM 5010  O O   . GLU A 1 680  ? -20.798 -50.047 -82.800  1.00 131.47 ? 2052 GLU B O   1 
ATOM 5011  C CB  . GLU A 1 680  ? -19.505 -48.743 -85.363  1.00 137.59 ? 2052 GLU B CB  1 
ATOM 5012  C CG  . GLU A 1 680  ? -18.025 -48.772 -84.980  1.00 141.07 ? 2052 GLU B CG  1 
ATOM 5013  C CD  . GLU A 1 680  ? -17.161 -49.529 -85.982  1.00 144.49 ? 2052 GLU B CD  1 
ATOM 5014  O OE1 . GLU A 1 680  ? -17.554 -50.636 -86.413  1.00 145.13 ? 2052 GLU B OE1 1 
ATOM 5015  O OE2 . GLU A 1 680  ? -16.071 -49.024 -86.330  1.00 147.17 ? 2052 GLU B OE2 1 
ATOM 5016  N N   . PRO A 1 681  ? -19.675 -48.264 -81.964  1.00 130.32 ? 2053 PRO B N   1 
ATOM 5017  C CA  . PRO A 1 681  ? -19.724 -48.813 -80.601  1.00 128.24 ? 2053 PRO B CA  1 
ATOM 5018  C C   . PRO A 1 681  ? -21.111 -48.700 -79.953  1.00 125.40 ? 2053 PRO B C   1 
ATOM 5019  O O   . PRO A 1 681  ? -21.506 -49.596 -79.205  1.00 124.77 ? 2053 PRO B O   1 
ATOM 5020  C CB  . PRO A 1 681  ? -18.699 -47.962 -79.836  1.00 129.20 ? 2053 PRO B CB  1 
ATOM 5021  C CG  . PRO A 1 681  ? -17.821 -47.377 -80.884  1.00 131.44 ? 2053 PRO B CG  1 
ATOM 5022  C CD  . PRO A 1 681  ? -18.738 -47.131 -82.039  1.00 131.53 ? 2053 PRO B CD  1 
ATOM 5023  N N   . LEU A 1 682  ? -21.828 -47.611 -80.244  1.00 124.07 ? 2054 LEU B N   1 
ATOM 5024  C CA  . LEU A 1 682  ? -23.180 -47.382 -79.707  1.00 121.20 ? 2054 LEU B CA  1 
ATOM 5025  C C   . LEU A 1 682  ? -24.243 -48.314 -80.300  1.00 119.27 ? 2054 LEU B C   1 
ATOM 5026  O O   . LEU A 1 682  ? -25.231 -48.626 -79.630  1.00 117.79 ? 2054 LEU B O   1 
ATOM 5027  C CB  . LEU A 1 682  ? -23.606 -45.923 -79.909  1.00 121.21 ? 2054 LEU B CB  1 
ATOM 5028  C CG  . LEU A 1 682  ? -22.752 -44.876 -79.187  1.00 122.47 ? 2054 LEU B CG  1 
ATOM 5029  C CD1 . LEU A 1 682  ? -22.995 -43.492 -79.765  1.00 123.60 ? 2054 LEU B CD1 1 
ATOM 5030  C CD2 . LEU A 1 682  ? -23.019 -44.880 -77.688  1.00 121.23 ? 2054 LEU B CD2 1 
ATOM 5031  N N   . HIS A 1 683  ? -24.050 -48.739 -81.549  1.00 118.94 ? 2055 HIS B N   1 
ATOM 5032  C CA  . HIS A 1 683  ? -24.900 -49.773 -82.155  1.00 117.07 ? 2055 HIS B CA  1 
ATOM 5033  C C   . HIS A 1 683  ? -24.557 -51.164 -81.607  1.00 116.00 ? 2055 HIS B C   1 
ATOM 5034  O O   . HIS A 1 683  ? -25.453 -51.933 -81.258  1.00 114.56 ? 2055 HIS B O   1 
ATOM 5035  C CB  . HIS A 1 683  ? -24.782 -49.758 -83.683  1.00 117.85 ? 2055 HIS B CB  1 
ATOM 5036  C CG  . HIS A 1 683  ? -25.405 -48.556 -84.325  1.00 117.67 ? 2055 HIS B CG  1 
ATOM 5037  N ND1 . HIS A 1 683  ? -26.768 -48.353 -84.359  1.00 115.84 ? 2055 HIS B ND1 1 
ATOM 5038  C CD2 . HIS A 1 683  ? -24.852 -47.499 -84.965  1.00 119.14 ? 2055 HIS B CD2 1 
ATOM 5039  C CE1 . HIS A 1 683  ? -27.027 -47.223 -84.992  1.00 116.59 ? 2055 HIS B CE1 1 
ATOM 5040  N NE2 . HIS A 1 683  ? -25.882 -46.683 -85.367  1.00 118.56 ? 2055 HIS B NE2 1 
ATOM 5041  N N   . ALA A 1 684  ? -23.261 -51.473 -81.534  1.00 116.77 ? 2056 ALA B N   1 
ATOM 5042  C CA  . ALA A 1 684  ? -22.768 -52.751 -80.987  1.00 116.30 ? 2056 ALA B CA  1 
ATOM 5043  C C   . ALA A 1 684  ? -23.044 -52.924 -79.486  1.00 114.35 ? 2056 ALA B C   1 
ATOM 5044  O O   . ALA A 1 684  ? -23.114 -54.052 -78.994  1.00 114.54 ? 2056 ALA B O   1 
ATOM 5045  C CB  . ALA A 1 684  ? -21.277 -52.902 -81.261  1.00 118.23 ? 2056 ALA B CB  1 
ATOM 5046  N N   . MET A 1 685  ? -23.166 -51.806 -78.771  1.00 112.77 ? 2057 MET B N   1 
ATOM 5047  C CA  . MET A 1 685  ? -23.612 -51.788 -77.375  1.00 111.07 ? 2057 MET B CA  1 
ATOM 5048  C C   . MET A 1 685  ? -24.989 -52.443 -77.212  1.00 108.97 ? 2057 MET B C   1 
ATOM 5049  O O   . MET A 1 685  ? -25.169 -53.317 -76.362  1.00 108.21 ? 2057 MET B O   1 
ATOM 5050  C CB  . MET A 1 685  ? -23.661 -50.336 -76.889  1.00 111.86 ? 2057 MET B CB  1 
ATOM 5051  C CG  . MET A 1 685  ? -24.199 -50.105 -75.486  1.00 111.72 ? 2057 MET B CG  1 
ATOM 5052  S SD  . MET A 1 685  ? -24.461 -48.344 -75.197  1.00 113.69 ? 2057 MET B SD  1 
ATOM 5053  C CE  . MET A 1 685  ? -26.000 -48.056 -76.068  1.00 113.05 ? 2057 MET B CE  1 
ATOM 5054  N N   . MET A 1 686  ? -25.946 -52.001 -78.029  1.00 107.91 ? 2058 MET B N   1 
ATOM 5055  C CA  . MET A 1 686  ? -27.328 -52.513 -78.006  1.00 105.53 ? 2058 MET B CA  1 
ATOM 5056  C C   . MET A 1 686  ? -27.501 -53.863 -78.715  1.00 104.72 ? 2058 MET B C   1 
ATOM 5057  O O   . MET A 1 686  ? -28.467 -54.581 -78.447  1.00 103.56 ? 2058 MET B O   1 
ATOM 5058  C CB  . MET A 1 686  ? -28.283 -51.487 -78.628  1.00 105.44 ? 2058 MET B CB  1 
ATOM 5059  C CG  . MET A 1 686  ? -28.330 -50.162 -77.883  1.00 105.06 ? 2058 MET B CG  1 
ATOM 5060  S SD  . MET A 1 686  ? -29.415 -48.937 -78.634  1.00 105.02 ? 2058 MET B SD  1 
ATOM 5061  C CE  . MET A 1 686  ? -31.029 -49.688 -78.441  1.00 103.28 ? 2058 MET B CE  1 
ATOM 5062  N N   . GLU A 1 687  ? -26.571 -54.197 -79.612  1.00 105.24 ? 2059 GLU B N   1 
ATOM 5063  C CA  . GLU A 1 687  ? -26.521 -55.508 -80.288  1.00 105.06 ? 2059 GLU B CA  1 
ATOM 5064  C C   . GLU A 1 687  ? -26.512 -56.700 -79.314  1.00 103.90 ? 2059 GLU B C   1 
ATOM 5065  O O   . GLU A 1 687  ? -26.985 -57.786 -79.657  1.00 103.94 ? 2059 GLU B O   1 
ATOM 5066  C CB  . GLU A 1 687  ? -25.286 -55.569 -81.199  1.00 106.95 ? 2059 GLU B CB  1 
ATOM 5067  C CG  . GLU A 1 687  ? -25.260 -56.723 -82.189  1.00 107.96 ? 2059 GLU B CG  1 
ATOM 5068  C CD  . GLU A 1 687  ? -24.065 -56.659 -83.128  1.00 109.70 ? 2059 GLU B CD  1 
ATOM 5069  O OE1 . GLU A 1 687  ? -23.819 -55.583 -83.719  1.00 109.99 ? 2059 GLU B OE1 1 
ATOM 5070  O OE2 . GLU A 1 687  ? -23.374 -57.689 -83.281  1.00 110.69 ? 2059 GLU B OE2 1 
ATOM 5071  N N   . ARG A 1 688  ? -25.960 -56.490 -78.118  1.00 102.86 ? 2060 ARG B N   1 
ATOM 5072  C CA  . ARG A 1 688  ? -26.025 -57.468 -77.023  1.00 101.53 ? 2060 ARG B CA  1 
ATOM 5073  C C   . ARG A 1 688  ? -27.455 -57.661 -76.529  1.00 98.28  ? 2060 ARG B C   1 
ATOM 5074  O O   . ARG A 1 688  ? -27.832 -58.760 -76.141  1.00 97.89  ? 2060 ARG B O   1 
ATOM 5075  C CB  . ARG A 1 688  ? -25.148 -57.023 -75.846  1.00 102.64 ? 2060 ARG B CB  1 
ATOM 5076  C CG  . ARG A 1 688  ? -23.660 -56.933 -76.172  1.00 105.55 ? 2060 ARG B CG  1 
ATOM 5077  C CD  . ARG A 1 688  ? -22.950 -55.851 -75.366  1.00 106.73 ? 2060 ARG B CD  1 
ATOM 5078  N NE  . ARG A 1 688  ? -21.745 -55.366 -76.045  1.00 109.85 ? 2060 ARG B NE  1 
ATOM 5079  C CZ  . ARG A 1 688  ? -21.032 -54.294 -75.686  1.00 111.35 ? 2060 ARG B CZ  1 
ATOM 5080  N NH1 . ARG A 1 688  ? -21.379 -53.551 -74.631  1.00 110.48 ? 2060 ARG B NH1 1 
ATOM 5081  N NH2 . ARG A 1 688  ? -19.953 -53.955 -76.396  1.00 113.22 ? 2060 ARG B NH2 1 
ATOM 5082  N N   . GLY A 1 689  ? -28.230 -56.581 -76.518  1.00 96.05  ? 2061 GLY B N   1 
ATOM 5083  C CA  . GLY A 1 689  ? -29.644 -56.617 -76.150  1.00 93.83  ? 2061 GLY B CA  1 
ATOM 5084  C C   . GLY A 1 689  ? -29.853 -56.089 -74.740  1.00 91.82  ? 2061 GLY B C   1 
ATOM 5085  O O   . GLY A 1 689  ? -28.936 -56.152 -73.920  1.00 91.98  ? 2061 GLY B O   1 
ATOM 5086  N N   . PRO A 1 690  ? -31.063 -55.576 -74.443  1.00 89.91  ? 2062 PRO B N   1 
ATOM 5087  C CA  . PRO A 1 690  ? -31.325 -54.923 -73.159  1.00 88.43  ? 2062 PRO B CA  1 
ATOM 5088  C C   . PRO A 1 690  ? -31.268 -55.877 -71.970  1.00 87.23  ? 2062 PRO B C   1 
ATOM 5089  O O   . PRO A 1 690  ? -31.779 -56.992 -72.057  1.00 87.11  ? 2062 PRO B O   1 
ATOM 5090  C CB  . PRO A 1 690  ? -32.741 -54.359 -73.331  1.00 88.00  ? 2062 PRO B CB  1 
ATOM 5091  C CG  . PRO A 1 690  ? -33.376 -55.234 -74.348  1.00 88.52  ? 2062 PRO B CG  1 
ATOM 5092  C CD  . PRO A 1 690  ? -32.270 -55.614 -75.290  1.00 89.72  ? 2062 PRO B CD  1 
ATOM 5093  N N   . GLN A 1 691  ? -30.640 -55.422 -70.884  1.00 86.35  ? 2063 GLN B N   1 
ATOM 5094  C CA  . GLN A 1 691  ? -30.449 -56.206 -69.653  1.00 85.44  ? 2063 GLN B CA  1 
ATOM 5095  C C   . GLN A 1 691  ? -31.241 -55.690 -68.434  1.00 83.98  ? 2063 GLN B C   1 
ATOM 5096  O O   . GLN A 1 691  ? -31.301 -56.374 -67.411  1.00 83.42  ? 2063 GLN B O   1 
ATOM 5097  C CB  . GLN A 1 691  ? -28.954 -56.249 -69.318  1.00 86.08  ? 2063 GLN B CB  1 
ATOM 5098  C CG  . GLN A 1 691  ? -28.127 -57.068 -70.300  1.00 87.33  ? 2063 GLN B CG  1 
ATOM 5099  C CD  . GLN A 1 691  ? -26.770 -56.452 -70.593  1.00 88.46  ? 2063 GLN B CD  1 
ATOM 5100  O OE1 . GLN A 1 691  ? -25.739 -56.955 -70.139  1.00 89.15  ? 2063 GLN B OE1 1 
ATOM 5101  N NE2 . GLN A 1 691  ? -26.762 -55.354 -71.354  1.00 88.77  ? 2063 GLN B NE2 1 
ATOM 5102  N N   . THR A 1 692  ? -31.830 -54.495 -68.538  1.00 83.41  ? 2064 THR B N   1 
ATOM 5103  C CA  . THR A 1 692  ? -32.624 -53.885 -67.456  1.00 82.30  ? 2064 THR B CA  1 
ATOM 5104  C C   . THR A 1 692  ? -33.879 -53.221 -68.021  1.00 82.00  ? 2064 THR B C   1 
ATOM 5105  O O   . THR A 1 692  ? -33.958 -52.960 -69.222  1.00 82.67  ? 2064 THR B O   1 
ATOM 5106  C CB  . THR A 1 692  ? -31.818 -52.810 -66.701  1.00 82.24  ? 2064 THR B CB  1 
ATOM 5107  O OG1 . THR A 1 692  ? -31.492 -51.734 -67.590  1.00 82.98  ? 2064 THR B OG1 1 
ATOM 5108  C CG2 . THR A 1 692  ? -30.530 -53.391 -66.129  1.00 82.51  ? 2064 THR B CG2 1 
ATOM 5109  N N   . LEU A 1 693  ? -34.844 -52.928 -67.154  1.00 81.12  ? 2065 LEU B N   1 
ATOM 5110  C CA  . LEU A 1 693  ? -36.106 -52.295 -67.579  1.00 81.03  ? 2065 LEU B CA  1 
ATOM 5111  C C   . LEU A 1 693  ? -35.903 -50.950 -68.287  1.00 81.55  ? 2065 LEU B C   1 
ATOM 5112  O O   . LEU A 1 693  ? -36.609 -50.642 -69.259  1.00 81.99  ? 2065 LEU B O   1 
ATOM 5113  C CB  . LEU A 1 693  ? -37.052 -52.103 -66.386  1.00 80.30  ? 2065 LEU B CB  1 
ATOM 5114  C CG  . LEU A 1 693  ? -37.671 -53.367 -65.783  1.00 79.88  ? 2065 LEU B CG  1 
ATOM 5115  C CD1 . LEU A 1 693  ? -38.237 -53.102 -64.395  1.00 79.23  ? 2065 LEU B CD1 1 
ATOM 5116  C CD2 . LEU A 1 693  ? -38.753 -53.927 -66.692  1.00 80.27  ? 2065 LEU B CD2 1 
ATOM 5117  N N   . LYS A 1 694  ? -34.941 -50.165 -67.800  1.00 81.58  ? 2066 LYS B N   1 
ATOM 5118  C CA  . LYS A 1 694  ? -34.624 -48.859 -68.385  1.00 82.28  ? 2066 LYS B CA  1 
ATOM 5119  C C   . LYS A 1 694  ? -34.065 -49.001 -69.802  1.00 83.20  ? 2066 LYS B C   1 
ATOM 5120  O O   . LYS A 1 694  ? -34.439 -48.243 -70.697  1.00 83.84  ? 2066 LYS B O   1 
ATOM 5121  C CB  . LYS A 1 694  ? -33.638 -48.089 -67.495  1.00 82.25  ? 2066 LYS B CB  1 
ATOM 5122  C CG  . LYS A 1 694  ? -33.479 -46.611 -67.846  1.00 83.04  ? 2066 LYS B CG  1 
ATOM 5123  C CD  . LYS A 1 694  ? -34.624 -45.758 -67.315  1.00 82.81  ? 2066 LYS B CD  1 
ATOM 5124  C CE  . LYS A 1 694  ? -34.573 -44.349 -67.890  1.00 83.88  ? 2066 LYS B CE  1 
ATOM 5125  N NZ  . LYS A 1 694  ? -35.454 -43.401 -67.152  1.00 83.87  ? 2066 LYS B NZ  1 
ATOM 5126  N N   . GLU A 1 695  ? -33.175 -49.970 -69.997  1.00 83.40  ? 2067 GLU B N   1 
ATOM 5127  C CA  . GLU A 1 695  ? -32.619 -50.255 -71.324  1.00 84.38  ? 2067 GLU B CA  1 
ATOM 5128  C C   . GLU A 1 695  ? -33.682 -50.793 -72.290  1.00 84.54  ? 2067 GLU B C   1 
ATOM 5129  O O   . GLU A 1 695  ? -33.597 -50.551 -73.495  1.00 85.31  ? 2067 GLU B O   1 
ATOM 5130  C CB  . GLU A 1 695  ? -31.431 -51.224 -71.222  1.00 84.61  ? 2067 GLU B CB  1 
ATOM 5131  C CG  . GLU A 1 695  ? -30.214 -50.627 -70.520  1.00 84.93  ? 2067 GLU B CG  1 
ATOM 5132  C CD  . GLU A 1 695  ? -29.055 -51.601 -70.340  1.00 85.31  ? 2067 GLU B CD  1 
ATOM 5133  O OE1 . GLU A 1 695  ? -29.089 -52.721 -70.890  1.00 85.49  ? 2067 GLU B OE1 1 
ATOM 5134  O OE2 . GLU A 1 695  ? -28.088 -51.236 -69.641  1.00 85.56  ? 2067 GLU B OE2 1 
ATOM 5135  N N   . THR A 1 696  ? -34.675 -51.509 -71.758  1.00 83.97  ? 2068 THR B N   1 
ATOM 5136  C CA  . THR A 1 696  ? -35.799 -52.006 -72.556  1.00 84.25  ? 2068 THR B CA  1 
ATOM 5137  C C   . THR A 1 696  ? -36.700 -50.864 -73.024  1.00 84.79  ? 2068 THR B C   1 
ATOM 5138  O O   . THR A 1 696  ? -37.014 -50.779 -74.214  1.00 85.47  ? 2068 THR B O   1 
ATOM 5139  C CB  . THR A 1 696  ? -36.667 -53.025 -71.781  1.00 83.54  ? 2068 THR B CB  1 
ATOM 5140  O OG1 . THR A 1 696  ? -35.826 -53.934 -71.065  1.00 83.29  ? 2068 THR B OG1 1 
ATOM 5141  C CG2 . THR A 1 696  ? -37.552 -53.826 -72.731  1.00 83.85  ? 2068 THR B CG2 1 
ATOM 5142  N N   . SER A 1 697  ? -37.114 -49.998 -72.096  1.00 84.67  ? 2069 SER B N   1 
ATOM 5143  C CA  . SER A 1 697  ? -38.008 -48.870 -72.427  1.00 85.31  ? 2069 SER B CA  1 
ATOM 5144  C C   . SER A 1 697  ? -37.384 -47.868 -73.410  1.00 86.49  ? 2069 SER B C   1 
ATOM 5145  O O   . SER A 1 697  ? -38.106 -47.184 -74.137  1.00 87.10  ? 2069 SER B O   1 
ATOM 5146  C CB  . SER A 1 697  ? -38.498 -48.153 -71.160  1.00 84.85  ? 2069 SER B CB  1 
ATOM 5147  O OG  . SER A 1 697  ? -37.428 -47.595 -70.427  1.00 84.71  ? 2069 SER B OG  1 
ATOM 5148  N N   . PHE A 1 698  ? -36.053 -47.790 -73.423  1.00 87.08  ? 2070 PHE B N   1 
ATOM 5149  C CA  . PHE A 1 698  ? -35.321 -47.098 -74.485  1.00 88.52  ? 2070 PHE B CA  1 
ATOM 5150  C C   . PHE A 1 698  ? -35.464 -47.864 -75.796  1.00 89.49  ? 2070 PHE B C   1 
ATOM 5151  O O   . PHE A 1 698  ? -35.918 -47.312 -76.802  1.00 90.28  ? 2070 PHE B O   1 
ATOM 5152  C CB  . PHE A 1 698  ? -33.832 -46.966 -74.134  1.00 88.66  ? 2070 PHE B CB  1 
ATOM 5153  C CG  . PHE A 1 698  ? -33.018 -46.283 -75.200  1.00 89.80  ? 2070 PHE B CG  1 
ATOM 5154  C CD1 . PHE A 1 698  ? -32.901 -44.904 -75.212  1.00 90.56  ? 2070 PHE B CD1 1 
ATOM 5155  C CD2 . PHE A 1 698  ? -32.380 -47.016 -76.202  1.00 90.29  ? 2070 PHE B CD2 1 
ATOM 5156  C CE1 . PHE A 1 698  ? -32.160 -44.260 -76.194  1.00 91.88  ? 2070 PHE B CE1 1 
ATOM 5157  C CE2 . PHE A 1 698  ? -31.638 -46.377 -77.186  1.00 91.54  ? 2070 PHE B CE2 1 
ATOM 5158  C CZ  . PHE A 1 698  ? -31.527 -44.998 -77.182  1.00 92.36  ? 2070 PHE B CZ  1 
ATOM 5159  N N   . ASN A 1 699  ? -35.068 -49.137 -75.765  1.00 89.78  ? 2071 ASN B N   1 
ATOM 5160  C CA  . ASN A 1 699  ? -35.070 -50.009 -76.949  1.00 90.84  ? 2071 ASN B CA  1 
ATOM 5161  C C   . ASN A 1 699  ? -36.470 -50.132 -77.576  1.00 91.70  ? 2071 ASN B C   1 
ATOM 5162  O O   . ASN A 1 699  ? -36.598 -50.269 -78.797  1.00 92.44  ? 2071 ASN B O   1 
ATOM 5163  C CB  . ASN A 1 699  ? -34.514 -51.397 -76.581  1.00 90.31  ? 2071 ASN B CB  1 
ATOM 5164  C CG  . ASN A 1 699  ? -34.083 -52.208 -77.792  1.00 90.93  ? 2071 ASN B CG  1 
ATOM 5165  O OD1 . ASN A 1 699  ? -33.439 -51.698 -78.708  1.00 91.72  ? 2071 ASN B OD1 1 
ATOM 5166  N ND2 . ASN A 1 699  ? -34.414 -53.493 -77.782  1.00 90.65  ? 2071 ASN B ND2 1 
ATOM 5167  N N   . GLN A 1 700  ? -37.504 -50.057 -76.734  1.00 92.10  ? 2072 GLN B N   1 
ATOM 5168  C CA  . GLN A 1 700  ? -38.905 -50.031 -77.173  1.00 93.11  ? 2072 GLN B CA  1 
ATOM 5169  C C   . GLN A 1 700  ? -39.173 -48.852 -78.111  1.00 94.80  ? 2072 GLN B C   1 
ATOM 5170  O O   . GLN A 1 700  ? -39.547 -49.046 -79.271  1.00 95.38  ? 2072 GLN B O   1 
ATOM 5171  C CB  . GLN A 1 700  ? -39.847 -49.949 -75.955  1.00 92.55  ? 2072 GLN B CB  1 
ATOM 5172  C CG  . GLN A 1 700  ? -41.285 -50.357 -76.236  1.00 92.81  ? 2072 GLN B CG  1 
ATOM 5173  C CD  . GLN A 1 700  ? -41.442 -51.851 -76.462  1.00 92.86  ? 2072 GLN B CD  1 
ATOM 5174  O OE1 . GLN A 1 700  ? -40.600 -52.652 -76.045  1.00 92.33  ? 2072 GLN B OE1 1 
ATOM 5175  N NE2 . GLN A 1 700  ? -42.528 -52.235 -77.131  1.00 93.52  ? 2072 GLN B NE2 1 
ATOM 5176  N N   . ALA A 1 701  ? -38.947 -47.643 -77.602  1.00 96.01  ? 2073 ALA B N   1 
ATOM 5177  C CA  . ALA A 1 701  ? -39.270 -46.411 -78.318  1.00 97.99  ? 2073 ALA B CA  1 
ATOM 5178  C C   . ALA A 1 701  ? -38.248 -46.120 -79.408  1.00 99.96  ? 2073 ALA B C   1 
ATOM 5179  O O   . ALA A 1 701  ? -38.589 -46.020 -80.589  1.00 100.97 ? 2073 ALA B O   1 
ATOM 5180  C CB  . ALA A 1 701  ? -39.345 -45.243 -77.343  1.00 97.92  ? 2073 ALA B CB  1 
ATOM 5181  N N   . TYR A 1 702  ? -36.991 -46.011 -78.997  1.00 101.29 ? 2074 TYR B N   1 
ATOM 5182  C CA  . TYR A 1 702  ? -35.918 -45.542 -79.869  1.00 103.63 ? 2074 TYR B CA  1 
ATOM 5183  C C   . TYR A 1 702  ? -35.314 -46.662 -80.716  1.00 105.14 ? 2074 TYR B C   1 
ATOM 5184  O O   . TYR A 1 702  ? -35.107 -46.481 -81.916  1.00 106.72 ? 2074 TYR B O   1 
ATOM 5185  C CB  . TYR A 1 702  ? -34.822 -44.871 -79.037  1.00 103.78 ? 2074 TYR B CB  1 
ATOM 5186  C CG  . TYR A 1 702  ? -35.318 -43.726 -78.177  1.00 103.87 ? 2074 TYR B CG  1 
ATOM 5187  C CD1 . TYR A 1 702  ? -35.459 -42.445 -78.702  1.00 105.15 ? 2074 TYR B CD1 1 
ATOM 5188  C CD2 . TYR A 1 702  ? -35.653 -43.925 -76.836  1.00 102.91 ? 2074 TYR B CD2 1 
ATOM 5189  C CE1 . TYR A 1 702  ? -35.915 -41.395 -77.918  1.00 105.51 ? 2074 TYR B CE1 1 
ATOM 5190  C CE2 . TYR A 1 702  ? -36.108 -42.881 -76.042  1.00 103.09 ? 2074 TYR B CE2 1 
ATOM 5191  C CZ  . TYR A 1 702  ? -36.239 -41.616 -76.586  1.00 104.47 ? 2074 TYR B CZ  1 
ATOM 5192  O OH  . TYR A 1 702  ? -36.690 -40.575 -75.805  1.00 104.86 ? 2074 TYR B OH  1 
ATOM 5193  N N   . GLY A 1 703  ? -35.046 -47.807 -80.088  1.00 105.66 ? 2075 GLY B N   1 
ATOM 5194  C CA  . GLY A 1 703  ? -34.290 -48.916 -80.696  1.00 107.44 ? 2075 GLY B CA  1 
ATOM 5195  C C   . GLY A 1 703  ? -34.661 -49.353 -82.104  1.00 109.69 ? 2075 GLY B C   1 
ATOM 5196  O O   . GLY A 1 703  ? -33.785 -49.729 -82.889  1.00 109.57 ? 2075 GLY B O   1 
ATOM 5197  N N   . ARG A 1 704  ? -35.956 -49.311 -82.418  1.00 112.43 ? 2076 ARG B N   1 
ATOM 5198  C CA  . ARG A 1 704  ? -36.457 -49.630 -83.764  1.00 115.00 ? 2076 ARG B CA  1 
ATOM 5199  C C   . ARG A 1 704  ? -35.883 -48.670 -84.812  1.00 117.06 ? 2076 ARG B C   1 
ATOM 5200  O O   . ARG A 1 704  ? -35.403 -49.106 -85.861  1.00 116.85 ? 2076 ARG B O   1 
ATOM 5201  C CB  . ARG A 1 704  ? -37.995 -49.595 -83.788  1.00 115.37 ? 2076 ARG B CB  1 
ATOM 5202  C CG  . ARG A 1 704  ? -38.647 -50.139 -85.062  1.00 116.28 ? 2076 ARG B CG  1 
ATOM 5203  C CD  . ARG A 1 704  ? -39.317 -49.068 -85.926  1.00 117.66 ? 2076 ARG B CD  1 
ATOM 5204  N NE  . ARG A 1 704  ? -38.393 -48.370 -86.825  1.00 119.34 ? 2076 ARG B NE  1 
ATOM 5205  C CZ  . ARG A 1 704  ? -38.703 -47.310 -87.578  1.00 120.48 ? 2076 ARG B CZ  1 
ATOM 5206  N NH1 . ARG A 1 704  ? -39.929 -46.784 -87.567  1.00 120.60 ? 2076 ARG B NH1 1 
ATOM 5207  N NH2 . ARG A 1 704  ? -37.768 -46.762 -88.354  1.00 121.40 ? 2076 ARG B NH2 1 
ATOM 5208  N N   . ASP A 1 705  ? -35.924 -47.373 -84.508  1.00 119.09 ? 2077 ASP B N   1 
ATOM 5209  C CA  . ASP A 1 705  ? -35.445 -46.327 -85.423  1.00 121.38 ? 2077 ASP B CA  1 
ATOM 5210  C C   . ASP A 1 705  ? -33.930 -46.388 -85.650  1.00 123.47 ? 2077 ASP B C   1 
ATOM 5211  O O   . ASP A 1 705  ? -33.464 -46.157 -86.768  1.00 124.38 ? 2077 ASP B O   1 
ATOM 5212  C CB  . ASP A 1 705  ? -35.827 -44.930 -84.905  1.00 121.94 ? 2077 ASP B CB  1 
ATOM 5213  C CG  . ASP A 1 705  ? -37.338 -44.716 -84.813  1.00 121.55 ? 2077 ASP B CG  1 
ATOM 5214  O OD1 . ASP A 1 705  ? -38.095 -45.705 -84.718  1.00 119.97 ? 2077 ASP B OD1 1 
ATOM 5215  O OD2 . ASP A 1 705  ? -37.768 -43.543 -84.819  1.00 122.86 ? 2077 ASP B OD2 1 
ATOM 5216  N N   . LEU A 1 706  ? -33.174 -46.696 -84.592  1.00 124.87 ? 2078 LEU B N   1 
ATOM 5217  C CA  . LEU A 1 706  ? -31.704 -46.769 -84.666  1.00 126.96 ? 2078 LEU B CA  1 
ATOM 5218  C C   . LEU A 1 706  ? -31.187 -47.960 -85.486  1.00 129.19 ? 2078 LEU B C   1 
ATOM 5219  O O   . LEU A 1 706  ? -30.138 -47.849 -86.123  1.00 130.00 ? 2078 LEU B O   1 
ATOM 5220  C CB  . LEU A 1 706  ? -31.061 -46.790 -83.262  1.00 125.69 ? 2078 LEU B CB  1 
ATOM 5221  C CG  . LEU A 1 706  ? -30.915 -45.497 -82.440  1.00 124.68 ? 2078 LEU B CG  1 
ATOM 5222  C CD1 . LEU A 1 706  ? -30.205 -44.387 -83.207  1.00 126.01 ? 2078 LEU B CD1 1 
ATOM 5223  C CD2 . LEU A 1 706  ? -32.258 -45.010 -81.920  1.00 123.53 ? 2078 LEU B CD2 1 
ATOM 5224  N N   . MET A 1 707  ? -31.903 -49.087 -85.462  1.00 130.74 ? 2079 MET B N   1 
ATOM 5225  C CA  . MET A 1 707  ? -31.528 -50.252 -86.278  1.00 133.83 ? 2079 MET B CA  1 
ATOM 5226  C C   . MET A 1 707  ? -31.725 -49.980 -87.775  1.00 135.40 ? 2079 MET B C   1 
ATOM 5227  O O   . MET A 1 707  ? -30.937 -50.454 -88.595  1.00 137.74 ? 2079 MET B O   1 
ATOM 5228  C CB  . MET A 1 707  ? -32.306 -51.506 -85.862  1.00 136.08 ? 2079 MET B CB  1 
ATOM 5229  C CG  . MET A 1 707  ? -31.682 -52.800 -86.371  1.00 140.76 ? 2079 MET B CG  1 
ATOM 5230  S SD  . MET A 1 707  ? -32.479 -54.298 -85.758  1.00 147.95 ? 2079 MET B SD  1 
ATOM 5231  C CE  . MET A 1 707  ? -33.917 -54.400 -86.824  1.00 146.48 ? 2079 MET B CE  1 
ATOM 5232  N N   . GLU A 1 708  ? -32.772 -49.227 -88.119  1.00 134.83 ? 2080 GLU B N   1 
ATOM 5233  C CA  . GLU A 1 708  ? -33.004 -48.782 -89.503  1.00 134.58 ? 2080 GLU B CA  1 
ATOM 5234  C C   . GLU A 1 708  ? -32.089 -47.608 -89.888  1.00 134.74 ? 2080 GLU B C   1 
ATOM 5235  O O   . GLU A 1 708  ? -31.744 -47.453 -91.060  1.00 137.48 ? 2080 GLU B O   1 
ATOM 5236  C CB  . GLU A 1 708  ? -34.474 -48.396 -89.722  1.00 134.02 ? 2080 GLU B CB  1 
ATOM 5237  C CG  . GLU A 1 708  ? -34.912 -48.437 -91.182  1.00 134.36 ? 2080 GLU B CG  1 
ATOM 5238  C CD  . GLU A 1 708  ? -36.182 -47.648 -91.443  1.00 133.54 ? 2080 GLU B CD  1 
ATOM 5239  O OE1 . GLU A 1 708  ? -37.181 -47.871 -90.726  1.00 131.29 ? 2080 GLU B OE1 1 
ATOM 5240  O OE2 . GLU A 1 708  ? -36.182 -46.809 -92.371  1.00 133.84 ? 2080 GLU B OE2 1 
ATOM 5241  N N   . ALA A 1 709  ? -31.721 -46.775 -88.911  1.00 132.31 ? 2081 ALA B N   1 
ATOM 5242  C CA  . ALA A 1 709  ? -30.705 -45.729 -89.115  1.00 132.41 ? 2081 ALA B CA  1 
ATOM 5243  C C   . ALA A 1 709  ? -29.329 -46.313 -89.455  1.00 133.59 ? 2081 ALA B C   1 
ATOM 5244  O O   . ALA A 1 709  ? -28.554 -45.692 -90.184  1.00 133.66 ? 2081 ALA B O   1 
ATOM 5245  C CB  . ALA A 1 709  ? -30.606 -44.836 -87.887  1.00 131.25 ? 2081 ALA B CB  1 
ATOM 5246  N N   . GLN A 1 710  ? -29.037 -47.498 -88.915  1.00 135.28 ? 2082 GLN B N   1 
ATOM 5247  C CA  . GLN A 1 710  ? -27.818 -48.243 -89.248  1.00 138.16 ? 2082 GLN B CA  1 
ATOM 5248  C C   . GLN A 1 710  ? -27.912 -48.899 -90.635  1.00 139.70 ? 2082 GLN B C   1 
ATOM 5249  O O   . GLN A 1 710  ? -26.915 -48.954 -91.356  1.00 140.58 ? 2082 GLN B O   1 
ATOM 5250  C CB  . GLN A 1 710  ? -27.528 -49.307 -88.182  1.00 138.82 ? 2082 GLN B CB  1 
ATOM 5251  C CG  . GLN A 1 710  ? -26.068 -49.742 -88.127  1.00 140.90 ? 2082 GLN B CG  1 
ATOM 5252  C CD  . GLN A 1 710  ? -25.781 -50.825 -87.093  1.00 140.90 ? 2082 GLN B CD  1 
ATOM 5253  O OE1 . GLN A 1 710  ? -24.644 -50.975 -86.650  1.00 143.48 ? 2082 GLN B OE1 1 
ATOM 5254  N NE2 . GLN A 1 710  ? -26.802 -51.588 -86.714  1.00 138.99 ? 2082 GLN B NE2 1 
ATOM 5255  N N   . GLU A 1 711  ? -29.100 -49.406 -90.985  1.00 140.53 ? 2083 GLU B N   1 
ATOM 5256  C CA  . GLU A 1 711  ? -29.382 -49.974 -92.320  1.00 142.81 ? 2083 GLU B CA  1 
ATOM 5257  C C   . GLU A 1 711  ? -29.043 -48.978 -93.440  1.00 147.54 ? 2083 GLU B C   1 
ATOM 5258  O O   . GLU A 1 711  ? -28.307 -49.321 -94.369  1.00 151.79 ? 2083 GLU B O   1 
ATOM 5259  C CB  . GLU A 1 711  ? -30.855 -50.435 -92.412  1.00 140.43 ? 2083 GLU B CB  1 
ATOM 5260  C CG  . GLU A 1 711  ? -31.361 -50.891 -93.784  1.00 140.64 ? 2083 GLU B CG  1 
ATOM 5261  C CD  . GLU A 1 711  ? -30.843 -52.257 -94.201  1.00 139.96 ? 2083 GLU B CD  1 
ATOM 5262  O OE1 . GLU A 1 711  ? -31.116 -53.242 -93.483  1.00 137.72 ? 2083 GLU B OE1 1 
ATOM 5263  O OE2 . GLU A 1 711  ? -30.185 -52.353 -95.260  1.00 140.44 ? 2083 GLU B OE2 1 
ATOM 5264  N N   . TRP A 1 712  ? -29.574 -47.757 -93.339  1.00 147.40 ? 2084 TRP B N   1 
ATOM 5265  C CA  . TRP A 1 712  ? -29.281 -46.684 -94.311  1.00 148.55 ? 2084 TRP B CA  1 
ATOM 5266  C C   . TRP A 1 712  ? -27.809 -46.232 -94.289  1.00 148.81 ? 2084 TRP B C   1 
ATOM 5267  O O   . TRP A 1 712  ? -27.269 -45.822 -95.320  1.00 150.06 ? 2084 TRP B O   1 
ATOM 5268  C CB  . TRP A 1 712  ? -30.203 -45.471 -94.101  1.00 148.81 ? 2084 TRP B CB  1 
ATOM 5269  C CG  . TRP A 1 712  ? -31.612 -45.657 -94.603  1.00 148.72 ? 2084 TRP B CG  1 
ATOM 5270  C CD1 . TRP A 1 712  ? -32.736 -45.817 -93.846  1.00 147.03 ? 2084 TRP B CD1 1 
ATOM 5271  C CD2 . TRP A 1 712  ? -32.044 -45.691 -95.972  1.00 151.33 ? 2084 TRP B CD2 1 
ATOM 5272  N NE1 . TRP A 1 712  ? -33.840 -45.952 -94.653  1.00 147.73 ? 2084 TRP B NE1 1 
ATOM 5273  C CE2 . TRP A 1 712  ? -33.445 -45.880 -95.963  1.00 150.18 ? 2084 TRP B CE2 1 
ATOM 5274  C CE3 . TRP A 1 712  ? -31.384 -45.585 -97.207  1.00 153.74 ? 2084 TRP B CE3 1 
ATOM 5275  C CZ2 . TRP A 1 712  ? -34.201 -45.965 -97.141  1.00 150.74 ? 2084 TRP B CZ2 1 
ATOM 5276  C CZ3 . TRP A 1 712  ? -32.139 -45.670 -98.381  1.00 154.31 ? 2084 TRP B CZ3 1 
ATOM 5277  C CH2 . TRP A 1 712  ? -33.532 -45.858 -98.335  1.00 152.87 ? 2084 TRP B CH2 1 
ATOM 5278  N N   . CYS A 1 713  ? -27.178 -46.296 -93.116  1.00 148.00 ? 2085 CYS B N   1 
ATOM 5279  C CA  . CYS A 1 713  ? -25.738 -46.010 -92.976  1.00 150.03 ? 2085 CYS B CA  1 
ATOM 5280  C C   . CYS A 1 713  ? -24.849 -47.038 -93.695  1.00 152.04 ? 2085 CYS B C   1 
ATOM 5281  O O   . CYS A 1 713  ? -23.854 -46.663 -94.321  1.00 153.15 ? 2085 CYS B O   1 
ATOM 5282  C CB  . CYS A 1 713  ? -25.335 -45.901 -91.494  1.00 149.00 ? 2085 CYS B CB  1 
ATOM 5283  S SG  . CYS A 1 713  ? -25.296 -44.207 -90.855  1.00 147.27 ? 2085 CYS B SG  1 
ATOM 5284  N N   . ARG A 1 714  ? -25.205 -48.320 -93.590  1.00 151.76 ? 2086 ARG B N   1 
ATOM 5285  C CA  . ARG A 1 714  ? -24.473 -49.407 -94.269  1.00 152.13 ? 2086 ARG B CA  1 
ATOM 5286  C C   . ARG A 1 714  ? -24.868 -49.585 -95.746  1.00 152.69 ? 2086 ARG B C   1 
ATOM 5287  O O   . ARG A 1 714  ? -24.168 -50.277 -96.487  1.00 153.34 ? 2086 ARG B O   1 
ATOM 5288  C CB  . ARG A 1 714  ? -24.627 -50.726 -93.499  1.00 150.36 ? 2086 ARG B CB  1 
ATOM 5289  C CG  . ARG A 1 714  ? -23.809 -50.768 -92.209  1.00 149.25 ? 2086 ARG B CG  1 
ATOM 5290  C CD  . ARG A 1 714  ? -24.552 -51.439 -91.066  1.00 146.06 ? 2086 ARG B CD  1 
ATOM 5291  N NE  . ARG A 1 714  ? -24.610 -52.894 -91.192  1.00 144.92 ? 2086 ARG B NE  1 
ATOM 5292  C CZ  . ARG A 1 714  ? -25.413 -53.695 -90.487  1.00 143.53 ? 2086 ARG B CZ  1 
ATOM 5293  N NH1 . ARG A 1 714  ? -26.264 -53.207 -89.583  1.00 142.22 ? 2086 ARG B NH1 1 
ATOM 5294  N NH2 . ARG A 1 714  ? -25.370 -55.009 -90.692  1.00 143.99 ? 2086 ARG B NH2 1 
ATOM 5295  N N   . LYS A 1 715  ? -25.988 -48.985 -96.161  1.00 152.11 ? 2087 LYS B N   1 
ATOM 5296  C CA  . LYS A 1 715  ? -26.318 -48.844 -97.592  1.00 152.84 ? 2087 LYS B CA  1 
ATOM 5297  C C   . LYS A 1 715  ? -25.338 -47.893 -98.290  1.00 156.65 ? 2087 LYS B C   1 
ATOM 5298  O O   . LYS A 1 715  ? -24.944 -48.135 -99.432  1.00 159.29 ? 2087 LYS B O   1 
ATOM 5299  C CB  . LYS A 1 715  ? -27.760 -48.348 -97.796  1.00 149.50 ? 2087 LYS B CB  1 
ATOM 5300  C CG  . LYS A 1 715  ? -28.819 -49.439 -97.744  1.00 145.79 ? 2087 LYS B CG  1 
ATOM 5301  C CD  . LYS A 1 715  ? -30.219 -48.845 -97.764  1.00 143.04 ? 2087 LYS B CD  1 
ATOM 5302  C CE  . LYS A 1 715  ? -31.289 -49.920 -97.678  1.00 140.66 ? 2087 LYS B CE  1 
ATOM 5303  N NZ  . LYS A 1 715  ? -32.624 -49.347 -97.357  1.00 138.80 ? 2087 LYS B NZ  1 
ATOM 5304  N N   . TYR A 1 716  ? -24.965 -46.814 -97.599  1.00 158.58 ? 2088 TYR B N   1 
ATOM 5305  C CA  . TYR A 1 716  ? -23.939 -45.876 -98.083  1.00 164.24 ? 2088 TYR B CA  1 
ATOM 5306  C C   . TYR A 1 716  ? -22.541 -46.508 -98.190  1.00 167.58 ? 2088 TYR B C   1 
ATOM 5307  O O   . TYR A 1 716  ? -21.796 -46.195 -99.123  1.00 167.59 ? 2088 TYR B O   1 
ATOM 5308  C CB  . TYR A 1 716  ? -23.885 -44.623 -97.191  1.00 165.46 ? 2088 TYR B CB  1 
ATOM 5309  C CG  . TYR A 1 716  ? -22.657 -43.757 -97.404  1.00 168.88 ? 2088 TYR B CG  1 
ATOM 5310  C CD1 . TYR A 1 716  ? -22.480 -43.045 -98.590  1.00 171.65 ? 2088 TYR B CD1 1 
ATOM 5311  C CD2 . TYR A 1 716  ? -21.663 -43.661 -96.427  1.00 169.12 ? 2088 TYR B CD2 1 
ATOM 5312  C CE1 . TYR A 1 716  ? -21.357 -42.256 -98.797  1.00 174.13 ? 2088 TYR B CE1 1 
ATOM 5313  C CE2 . TYR A 1 716  ? -20.536 -42.873 -96.625  1.00 171.34 ? 2088 TYR B CE2 1 
ATOM 5314  C CZ  . TYR A 1 716  ? -20.386 -42.172 -97.810  1.00 173.19 ? 2088 TYR B CZ  1 
ATOM 5315  O OH  . TYR A 1 716  ? -19.271 -41.389 -98.013  1.00 172.96 ? 2088 TYR B OH  1 
ATOM 5316  N N   . MET A 1 717  ? -22.194 -47.380 -97.241  1.00 169.48 ? 2089 MET B N   1 
ATOM 5317  C CA  . MET A 1 717  ? -20.891 -48.068 -97.233  1.00 172.03 ? 2089 MET B CA  1 
ATOM 5318  C C   . MET A 1 717  ? -20.575 -48.745 -98.571  1.00 169.98 ? 2089 MET B C   1 
ATOM 5319  O O   . MET A 1 717  ? -19.469 -48.597 -99.094  1.00 169.17 ? 2089 MET B O   1 
ATOM 5320  C CB  . MET A 1 717  ? -20.826 -49.109 -96.103  1.00 175.59 ? 2089 MET B CB  1 
ATOM 5321  C CG  . MET A 1 717  ? -20.696 -48.525 -94.703  1.00 178.16 ? 2089 MET B CG  1 
ATOM 5322  S SD  . MET A 1 717  ? -20.593 -49.802 -93.430  1.00 182.01 ? 2089 MET B SD  1 
ATOM 5323  C CE  . MET A 1 717  ? -20.195 -48.824 -91.983  1.00 182.01 ? 2089 MET B CE  1 
ATOM 5324  N N   . LYS A 1 718  ? -21.557 -49.468 -99.114  1.00 168.17 ? 2090 LYS B N   1 
ATOM 5325  C CA  . LYS A 1 718  ? -21.403 -50.182 -100.393 1.00 168.68 ? 2090 LYS B CA  1 
ATOM 5326  C C   . LYS A 1 718  ? -21.736 -49.323 -101.624 1.00 169.54 ? 2090 LYS B C   1 
ATOM 5327  O O   . LYS A 1 718  ? -21.024 -49.396 -102.628 1.00 174.71 ? 2090 LYS B O   1 
ATOM 5328  C CB  . LYS A 1 718  ? -22.214 -51.495 -100.413 1.00 166.82 ? 2090 LYS B CB  1 
ATOM 5329  C CG  . LYS A 1 718  ? -23.727 -51.373 -100.241 1.00 164.04 ? 2090 LYS B CG  1 
ATOM 5330  C CD  . LYS A 1 718  ? -24.450 -52.597 -100.781 1.00 162.98 ? 2090 LYS B CD  1 
ATOM 5331  C CE  . LYS A 1 718  ? -25.956 -52.454 -100.644 1.00 161.20 ? 2090 LYS B CE  1 
ATOM 5332  N NZ  . LYS A 1 718  ? -26.681 -53.480 -101.443 1.00 161.53 ? 2090 LYS B NZ  1 
ATOM 5333  N N   . SER A 1 719  ? -22.798 -48.518 -101.546 1.00 165.45 ? 2091 SER B N   1 
ATOM 5334  C CA  . SER A 1 719  ? -23.276 -47.739 -102.699 1.00 163.69 ? 2091 SER B CA  1 
ATOM 5335  C C   . SER A 1 719  ? -22.471 -46.452 -102.874 1.00 166.20 ? 2091 SER B C   1 
ATOM 5336  O O   . SER A 1 719  ? -21.945 -46.184 -103.955 1.00 168.82 ? 2091 SER B O   1 
ATOM 5337  C CB  . SER A 1 719  ? -24.771 -47.419 -102.564 1.00 159.40 ? 2091 SER B CB  1 
ATOM 5338  O OG  . SER A 1 719  ? -25.020 -46.481 -101.530 1.00 156.97 ? 2091 SER B OG  1 
ATOM 5339  N N   . GLY A 1 720  ? -22.392 -45.665 -101.802 1.00 165.89 ? 2092 GLY B N   1 
ATOM 5340  C CA  . GLY A 1 720  ? -21.634 -44.409 -101.782 1.00 167.68 ? 2092 GLY B CA  1 
ATOM 5341  C C   . GLY A 1 720  ? -22.445 -43.157 -102.083 1.00 168.34 ? 2092 GLY B C   1 
ATOM 5342  O O   . GLY A 1 720  ? -21.866 -42.097 -102.333 1.00 169.81 ? 2092 GLY B O   1 
ATOM 5343  N N   . ASN A 1 721  ? -23.776 -43.267 -102.044 1.00 166.78 ? 2093 ASN B N   1 
ATOM 5344  C CA  . ASN A 1 721  ? -24.672 -42.142 -102.344 1.00 165.97 ? 2093 ASN B CA  1 
ATOM 5345  C C   . ASN A 1 721  ? -24.904 -41.288 -101.097 1.00 163.82 ? 2093 ASN B C   1 
ATOM 5346  O O   . ASN A 1 721  ? -25.107 -41.823 -100.007 1.00 162.50 ? 2093 ASN B O   1 
ATOM 5347  C CB  . ASN A 1 721  ? -26.028 -42.647 -102.858 1.00 164.07 ? 2093 ASN B CB  1 
ATOM 5348  C CG  . ASN A 1 721  ? -25.909 -43.479 -104.124 1.00 164.13 ? 2093 ASN B CG  1 
ATOM 5349  O OD1 . ASN A 1 721  ? -25.416 -43.005 -105.148 1.00 164.99 ? 2093 ASN B OD1 1 
ATOM 5350  N ND2 . ASN A 1 721  ? -26.376 -44.722 -104.063 1.00 162.42 ? 2093 ASN B ND2 1 
ATOM 5351  N N   . VAL A 1 722  ? -24.898 -39.965 -101.266 1.00 162.89 ? 2094 VAL B N   1 
ATOM 5352  C CA  . VAL A 1 722  ? -25.229 -39.030 -100.173 1.00 160.30 ? 2094 VAL B CA  1 
ATOM 5353  C C   . VAL A 1 722  ? -26.748 -39.081 -99.891  1.00 157.70 ? 2094 VAL B C   1 
ATOM 5354  O O   . VAL A 1 722  ? -27.187 -38.804 -98.770  1.00 154.65 ? 2094 VAL B O   1 
ATOM 5355  C CB  . VAL A 1 722  ? -24.754 -37.579 -100.477 1.00 160.21 ? 2094 VAL B CB  1 
ATOM 5356  C CG1 . VAL A 1 722  ? -25.036 -36.637 -99.308  1.00 158.44 ? 2094 VAL B CG1 1 
ATOM 5357  C CG2 . VAL A 1 722  ? -23.260 -37.547 -100.789 1.00 161.08 ? 2094 VAL B CG2 1 
ATOM 5358  N N   . LYS A 1 723  ? -27.533 -39.445 -100.908 1.00 158.16 ? 2095 LYS B N   1 
ATOM 5359  C CA  . LYS A 1 723  ? -28.981 -39.662 -100.762 1.00 156.49 ? 2095 LYS B CA  1 
ATOM 5360  C C   . LYS A 1 723  ? -29.340 -40.905 -99.926  1.00 156.19 ? 2095 LYS B C   1 
ATOM 5361  O O   . LYS A 1 723  ? -30.407 -40.947 -99.313  1.00 153.88 ? 2095 LYS B O   1 
ATOM 5362  C CB  . LYS A 1 723  ? -29.654 -39.728 -102.139 1.00 155.06 ? 2095 LYS B CB  1 
ATOM 5363  C CG  . LYS A 1 723  ? -29.615 -38.399 -102.876 1.00 155.43 ? 2095 LYS B CG  1 
ATOM 5364  C CD  . LYS A 1 723  ? -30.233 -38.477 -104.260 1.00 154.49 ? 2095 LYS B CD  1 
ATOM 5365  C CE  . LYS A 1 723  ? -30.160 -37.126 -104.951 1.00 155.63 ? 2095 LYS B CE  1 
ATOM 5366  N NZ  . LYS A 1 723  ? -30.839 -37.125 -106.275 1.00 155.75 ? 2095 LYS B NZ  1 
ATOM 5367  N N   . ASP A 1 724  ? -28.467 -41.915 -99.926  1.00 158.46 ? 2096 ASP B N   1 
ATOM 5368  C CA  . ASP A 1 724  ? -28.568 -43.038 -98.976  1.00 157.30 ? 2096 ASP B CA  1 
ATOM 5369  C C   . ASP A 1 724  ? -28.274 -42.562 -97.547  1.00 158.62 ? 2096 ASP B C   1 
ATOM 5370  O O   . ASP A 1 724  ? -29.004 -42.904 -96.614  1.00 156.97 ? 2096 ASP B O   1 
ATOM 5371  C CB  . ASP A 1 724  ? -27.606 -44.189 -99.346  1.00 157.04 ? 2096 ASP B CB  1 
ATOM 5372  C CG  . ASP A 1 724  ? -28.193 -45.154 -100.371 1.00 155.70 ? 2096 ASP B CG  1 
ATOM 5373  O OD1 . ASP A 1 724  ? -29.301 -45.680 -100.136 1.00 153.22 ? 2096 ASP B OD1 1 
ATOM 5374  O OD2 . ASP A 1 724  ? -27.532 -45.415 -101.399 1.00 155.68 ? 2096 ASP B OD2 1 
ATOM 5375  N N   . LEU A 1 725  ? -27.210 -41.771 -97.394  1.00 161.71 ? 2097 LEU B N   1 
ATOM 5376  C CA  . LEU A 1 725  ? -26.716 -41.329 -96.078  1.00 160.83 ? 2097 LEU B CA  1 
ATOM 5377  C C   . LEU A 1 725  ? -27.548 -40.213 -95.419  1.00 156.42 ? 2097 LEU B C   1 
ATOM 5378  O O   . LEU A 1 725  ? -27.559 -40.101 -94.191  1.00 152.18 ? 2097 LEU B O   1 
ATOM 5379  C CB  . LEU A 1 725  ? -25.246 -40.891 -96.196  1.00 165.86 ? 2097 LEU B CB  1 
ATOM 5380  C CG  . LEU A 1 725  ? -24.404 -40.726 -94.924  1.00 168.21 ? 2097 LEU B CG  1 
ATOM 5381  C CD1 . LEU A 1 725  ? -24.283 -42.022 -94.132  1.00 169.17 ? 2097 LEU B CD1 1 
ATOM 5382  C CD2 . LEU A 1 725  ? -23.021 -40.219 -95.300  1.00 169.92 ? 2097 LEU B CD2 1 
ATOM 5383  N N   . THR A 1 726  ? -28.219 -39.386 -96.224  1.00 155.66 ? 2098 THR B N   1 
ATOM 5384  C CA  . THR A 1 726  ? -29.128 -38.350 -95.699  1.00 152.46 ? 2098 THR B CA  1 
ATOM 5385  C C   . THR A 1 726  ? -30.406 -38.940 -95.073  1.00 148.09 ? 2098 THR B C   1 
ATOM 5386  O O   . THR A 1 726  ? -30.989 -38.335 -94.173  1.00 145.64 ? 2098 THR B O   1 
ATOM 5387  C CB  . THR A 1 726  ? -29.490 -37.288 -96.775  1.00 153.41 ? 2098 THR B CB  1 
ATOM 5388  O OG1 . THR A 1 726  ? -30.068 -36.140 -96.143  1.00 152.19 ? 2098 THR B OG1 1 
ATOM 5389  C CG2 . THR A 1 726  ? -30.461 -37.832 -97.831  1.00 152.67 ? 2098 THR B CG2 1 
ATOM 5390  N N   . GLN A 1 727  ? -30.832 -40.107 -95.562  1.00 146.74 ? 2099 GLN B N   1 
ATOM 5391  C CA  . GLN A 1 727  ? -31.994 -40.824 -95.016  1.00 144.66 ? 2099 GLN B CA  1 
ATOM 5392  C C   . GLN A 1 727  ? -31.735 -41.336 -93.595  1.00 144.16 ? 2099 GLN B C   1 
ATOM 5393  O O   . GLN A 1 727  ? -32.652 -41.374 -92.772  1.00 142.69 ? 2099 GLN B O   1 
ATOM 5394  C CB  . GLN A 1 727  ? -32.380 -42.008 -95.917  1.00 143.44 ? 2099 GLN B CB  1 
ATOM 5395  C CG  . GLN A 1 727  ? -32.830 -41.633 -97.325  1.00 143.78 ? 2099 GLN B CG  1 
ATOM 5396  C CD  . GLN A 1 727  ? -34.303 -41.284 -97.411  1.00 142.49 ? 2099 GLN B CD  1 
ATOM 5397  O OE1 . GLN A 1 727  ? -34.818 -40.510 -96.606  1.00 141.75 ? 2099 GLN B OE1 1 
ATOM 5398  N NE2 . GLN A 1 727  ? -34.987 -41.848 -98.400  1.00 142.04 ? 2099 GLN B NE2 1 
ATOM 5399  N N   . ALA A 1 728  ? -30.492 -41.739 -93.324  1.00 145.82 ? 2100 ALA B N   1 
ATOM 5400  C CA  . ALA A 1 728  ? -30.065 -42.170 -91.984  1.00 144.82 ? 2100 ALA B CA  1 
ATOM 5401  C C   . ALA A 1 728  ? -30.067 -41.010 -90.987  1.00 143.77 ? 2100 ALA B C   1 
ATOM 5402  O O   . ALA A 1 728  ? -30.602 -41.138 -89.884  1.00 141.85 ? 2100 ALA B O   1 
ATOM 5403  C CB  . ALA A 1 728  ? -28.678 -42.800 -92.044  1.00 146.34 ? 2100 ALA B CB  1 
ATOM 5404  N N   . TRP A 1 729  ? -29.464 -39.887 -91.385  1.00 144.45 ? 2101 TRP B N   1 
ATOM 5405  C CA  . TRP A 1 729  ? -29.454 -38.662 -90.564  1.00 143.22 ? 2101 TRP B CA  1 
ATOM 5406  C C   . TRP A 1 729  ? -30.849 -38.082 -90.297  1.00 141.70 ? 2101 TRP B C   1 
ATOM 5407  O O   . TRP A 1 729  ? -31.046 -37.388 -89.299  1.00 139.70 ? 2101 TRP B O   1 
ATOM 5408  C CB  . TRP A 1 729  ? -28.542 -37.584 -91.176  1.00 145.22 ? 2101 TRP B CB  1 
ATOM 5409  C CG  . TRP A 1 729  ? -27.114 -37.695 -90.735  1.00 146.39 ? 2101 TRP B CG  1 
ATOM 5410  C CD1 . TRP A 1 729  ? -26.038 -38.030 -91.505  1.00 148.47 ? 2101 TRP B CD1 1 
ATOM 5411  C CD2 . TRP A 1 729  ? -26.610 -37.479 -89.412  1.00 145.37 ? 2101 TRP B CD2 1 
ATOM 5412  N NE1 . TRP A 1 729  ? -24.892 -38.031 -90.743  1.00 148.79 ? 2101 TRP B NE1 1 
ATOM 5413  C CE2 . TRP A 1 729  ? -25.215 -37.697 -89.454  1.00 146.68 ? 2101 TRP B CE2 1 
ATOM 5414  C CE3 . TRP A 1 729  ? -27.203 -37.120 -88.193  1.00 143.30 ? 2101 TRP B CE3 1 
ATOM 5415  C CZ2 . TRP A 1 729  ? -24.401 -37.568 -88.321  1.00 145.86 ? 2101 TRP B CZ2 1 
ATOM 5416  C CZ3 . TRP A 1 729  ? -26.393 -36.991 -87.066  1.00 142.47 ? 2101 TRP B CZ3 1 
ATOM 5417  C CH2 . TRP A 1 729  ? -25.006 -37.215 -87.140  1.00 143.87 ? 2101 TRP B CH2 1 
ATOM 5418  N N   . ASP A 1 730  ? -31.800 -38.362 -91.189  1.00 142.85 ? 2102 ASP B N   1 
ATOM 5419  C CA  . ASP A 1 730  ? -33.213 -38.024 -90.974  1.00 141.95 ? 2102 ASP B CA  1 
ATOM 5420  C C   . ASP A 1 730  ? -33.786 -38.801 -89.780  1.00 138.61 ? 2102 ASP B C   1 
ATOM 5421  O O   . ASP A 1 730  ? -34.520 -38.239 -88.965  1.00 136.88 ? 2102 ASP B O   1 
ATOM 5422  C CB  . ASP A 1 730  ? -34.035 -38.314 -92.242  1.00 142.45 ? 2102 ASP B CB  1 
ATOM 5423  C CG  . ASP A 1 730  ? -35.358 -37.570 -92.271  1.00 142.13 ? 2102 ASP B CG  1 
ATOM 5424  O OD1 . ASP A 1 730  ? -35.340 -36.321 -92.264  1.00 143.11 ? 2102 ASP B OD1 1 
ATOM 5425  O OD2 . ASP A 1 730  ? -36.416 -38.232 -92.321  1.00 140.69 ? 2102 ASP B OD2 1 
ATOM 5426  N N   . LEU A 1 731  ? -33.441 -40.086 -89.690  1.00 137.49 ? 2103 LEU B N   1 
ATOM 5427  C CA  . LEU A 1 731  ? -33.812 -40.928 -88.541  1.00 136.26 ? 2103 LEU B CA  1 
ATOM 5428  C C   . LEU A 1 731  ? -33.026 -40.604 -87.260  1.00 135.49 ? 2103 LEU B C   1 
ATOM 5429  O O   . LEU A 1 731  ? -33.572 -40.733 -86.163  1.00 132.55 ? 2103 LEU B O   1 
ATOM 5430  C CB  . LEU A 1 731  ? -33.661 -42.420 -88.882  1.00 136.03 ? 2103 LEU B CB  1 
ATOM 5431  C CG  . LEU A 1 731  ? -34.804 -43.047 -89.691  1.00 136.21 ? 2103 LEU B CG  1 
ATOM 5432  C CD1 . LEU A 1 731  ? -34.343 -44.310 -90.404  1.00 136.82 ? 2103 LEU B CD1 1 
ATOM 5433  C CD2 . LEU A 1 731  ? -36.002 -43.349 -88.800  1.00 134.79 ? 2103 LEU B CD2 1 
ATOM 5434  N N   . TYR A 1 732  ? -31.756 -40.208 -87.395  1.00 136.76 ? 2104 TYR B N   1 
ATOM 5435  C CA  . TYR A 1 732  ? -30.916 -39.856 -86.232  1.00 136.64 ? 2104 TYR B CA  1 
ATOM 5436  C C   . TYR A 1 732  ? -31.387 -38.584 -85.517  1.00 136.32 ? 2104 TYR B C   1 
ATOM 5437  O O   . TYR A 1 732  ? -31.460 -38.559 -84.286  1.00 134.67 ? 2104 TYR B O   1 
ATOM 5438  C CB  . TYR A 1 732  ? -29.434 -39.692 -86.620  1.00 139.57 ? 2104 TYR B CB  1 
ATOM 5439  C CG  . TYR A 1 732  ? -28.637 -40.982 -86.769  1.00 141.50 ? 2104 TYR B CG  1 
ATOM 5440  C CD1 . TYR A 1 732  ? -27.882 -41.230 -87.920  1.00 145.32 ? 2104 TYR B CD1 1 
ATOM 5441  C CD2 . TYR A 1 732  ? -28.611 -41.943 -85.752  1.00 139.93 ? 2104 TYR B CD2 1 
ATOM 5442  C CE1 . TYR A 1 732  ? -27.142 -42.397 -88.059  1.00 145.72 ? 2104 TYR B CE1 1 
ATOM 5443  C CE2 . TYR A 1 732  ? -27.874 -43.113 -85.885  1.00 140.49 ? 2104 TYR B CE2 1 
ATOM 5444  C CZ  . TYR A 1 732  ? -27.142 -43.336 -87.038  1.00 143.36 ? 2104 TYR B CZ  1 
ATOM 5445  O OH  . TYR A 1 732  ? -26.409 -44.492 -87.174  1.00 144.60 ? 2104 TYR B OH  1 
ATOM 5446  N N   . TYR A 1 733  ? -31.690 -37.534 -86.283  1.00 137.76 ? 2105 TYR B N   1 
ATOM 5447  C CA  . TYR A 1 733  ? -32.196 -36.268 -85.710  1.00 137.13 ? 2105 TYR B CA  1 
ATOM 5448  C C   . TYR A 1 733  ? -33.609 -36.380 -85.116  1.00 133.44 ? 2105 TYR B C   1 
ATOM 5449  O O   . TYR A 1 733  ? -33.997 -35.539 -84.306  1.00 133.64 ? 2105 TYR B O   1 
ATOM 5450  C CB  . TYR A 1 733  ? -32.151 -35.117 -86.735  1.00 140.61 ? 2105 TYR B CB  1 
ATOM 5451  C CG  . TYR A 1 733  ? -30.819 -34.388 -86.809  1.00 144.14 ? 2105 TYR B CG  1 
ATOM 5452  C CD1 . TYR A 1 733  ? -30.059 -34.389 -87.983  1.00 146.97 ? 2105 TYR B CD1 1 
ATOM 5453  C CD2 . TYR A 1 733  ? -30.319 -33.688 -85.706  1.00 144.63 ? 2105 TYR B CD2 1 
ATOM 5454  C CE1 . TYR A 1 733  ? -28.843 -33.719 -88.054  1.00 148.99 ? 2105 TYR B CE1 1 
ATOM 5455  C CE2 . TYR A 1 733  ? -29.102 -33.019 -85.767  1.00 147.03 ? 2105 TYR B CE2 1 
ATOM 5456  C CZ  . TYR A 1 733  ? -28.368 -33.036 -86.943  1.00 149.00 ? 2105 TYR B CZ  1 
ATOM 5457  O OH  . TYR A 1 733  ? -27.163 -32.374 -87.010  1.00 150.86 ? 2105 TYR B OH  1 
ATOM 5458  N N   . HIS A 1 734  ? -34.369 -37.398 -85.526  1.00 130.17 ? 2106 HIS B N   1 
ATOM 5459  C CA  . HIS A 1 734  ? -35.677 -37.694 -84.929  1.00 126.99 ? 2106 HIS B CA  1 
ATOM 5460  C C   . HIS A 1 734  ? -35.532 -38.113 -83.459  1.00 124.12 ? 2106 HIS B C   1 
ATOM 5461  O O   . HIS A 1 734  ? -36.165 -37.526 -82.581  1.00 123.18 ? 2106 HIS B O   1 
ATOM 5462  C CB  . HIS A 1 734  ? -36.397 -38.784 -85.738  1.00 125.66 ? 2106 HIS B CB  1 
ATOM 5463  C CG  . HIS A 1 734  ? -37.740 -39.162 -85.192  1.00 124.14 ? 2106 HIS B CG  1 
ATOM 5464  N ND1 . HIS A 1 734  ? -38.878 -38.421 -85.427  1.00 124.23 ? 2106 HIS B ND1 1 
ATOM 5465  C CD2 . HIS A 1 734  ? -38.125 -40.211 -84.428  1.00 122.06 ? 2106 HIS B CD2 1 
ATOM 5466  C CE1 . HIS A 1 734  ? -39.906 -38.995 -84.827  1.00 122.54 ? 2106 HIS B CE1 1 
ATOM 5467  N NE2 . HIS A 1 734  ? -39.476 -40.084 -84.215  1.00 121.13 ? 2106 HIS B NE2 1 
ATOM 5468  N N   . VAL A 1 735  ? -34.693 -39.119 -83.206  1.00 122.04 ? 2107 VAL B N   1 
ATOM 5469  C CA  . VAL A 1 735  ? -34.443 -39.612 -81.836  1.00 118.99 ? 2107 VAL B CA  1 
ATOM 5470  C C   . VAL A 1 735  ? -33.644 -38.651 -80.952  1.00 118.26 ? 2107 VAL B C   1 
ATOM 5471  O O   . VAL A 1 735  ? -33.846 -38.627 -79.741  1.00 117.16 ? 2107 VAL B O   1 
ATOM 5472  C CB  . VAL A 1 735  ? -33.765 -41.011 -81.802  1.00 118.02 ? 2107 VAL B CB  1 
ATOM 5473  C CG1 . VAL A 1 735  ? -34.669 -42.055 -82.445  1.00 117.60 ? 2107 VAL B CG1 1 
ATOM 5474  C CG2 . VAL A 1 735  ? -32.380 -41.013 -82.449  1.00 119.27 ? 2107 VAL B CG2 1 
ATOM 5475  N N   . PHE A 1 736  ? -32.744 -37.871 -81.552  1.00 119.01 ? 2108 PHE B N   1 
ATOM 5476  C CA  . PHE A 1 736  ? -31.936 -36.891 -80.811  1.00 119.25 ? 2108 PHE B CA  1 
ATOM 5477  C C   . PHE A 1 736  ? -32.794 -35.826 -80.124  1.00 118.53 ? 2108 PHE B C   1 
ATOM 5478  O O   . PHE A 1 736  ? -32.591 -35.524 -78.949  1.00 117.32 ? 2108 PHE B O   1 
ATOM 5479  C CB  . PHE A 1 736  ? -30.931 -36.211 -81.746  1.00 121.63 ? 2108 PHE B CB  1 
ATOM 5480  C CG  . PHE A 1 736  ? -29.970 -35.288 -81.044  1.00 123.39 ? 2108 PHE B CG  1 
ATOM 5481  C CD1 . PHE A 1 736  ? -29.121 -35.771 -80.052  1.00 122.90 ? 2108 PHE B CD1 1 
ATOM 5482  C CD2 . PHE A 1 736  ? -29.901 -33.937 -81.381  1.00 125.95 ? 2108 PHE B CD2 1 
ATOM 5483  C CE1 . PHE A 1 736  ? -28.231 -34.925 -79.404  1.00 124.32 ? 2108 PHE B CE1 1 
ATOM 5484  C CE2 . PHE A 1 736  ? -29.010 -33.087 -80.736  1.00 127.39 ? 2108 PHE B CE2 1 
ATOM 5485  C CZ  . PHE A 1 736  ? -28.174 -33.582 -79.746  1.00 126.44 ? 2108 PHE B CZ  1 
ATOM 5486  N N   . ARG A 1 737  ? -33.746 -35.271 -80.868  1.00 118.87 ? 2109 ARG B N   1 
ATOM 5487  C CA  . ARG A 1 737  ? -34.686 -34.272 -80.340  1.00 119.01 ? 2109 ARG B CA  1 
ATOM 5488  C C   . ARG A 1 737  ? -35.594 -34.848 -79.248  1.00 117.33 ? 2109 ARG B C   1 
ATOM 5489  O O   . ARG A 1 737  ? -35.907 -34.157 -78.278  1.00 117.63 ? 2109 ARG B O   1 
ATOM 5490  C CB  . ARG A 1 737  ? -35.540 -33.681 -81.473  1.00 119.88 ? 2109 ARG B CB  1 
ATOM 5491  C CG  . ARG A 1 737  ? -34.746 -32.848 -82.472  1.00 121.44 ? 2109 ARG B CG  1 
ATOM 5492  C CD  . ARG A 1 737  ? -35.444 -32.716 -83.819  1.00 121.70 ? 2109 ARG B CD  1 
ATOM 5493  N NE  . ARG A 1 737  ? -34.510 -32.296 -84.868  1.00 122.64 ? 2109 ARG B NE  1 
ATOM 5494  C CZ  . ARG A 1 737  ? -34.781 -32.260 -86.174  1.00 122.86 ? 2109 ARG B CZ  1 
ATOM 5495  N NH1 . ARG A 1 737  ? -35.975 -32.620 -86.643  1.00 122.05 ? 2109 ARG B NH1 1 
ATOM 5496  N NH2 . ARG A 1 737  ? -33.840 -31.858 -87.025  1.00 124.38 ? 2109 ARG B NH2 1 
ATOM 5497  N N   . ARG A 1 738  ? -36.012 -36.104 -79.416  1.00 116.04 ? 2110 ARG B N   1 
ATOM 5498  C CA  . ARG A 1 738  ? -36.846 -36.808 -78.425  1.00 114.66 ? 2110 ARG B CA  1 
ATOM 5499  C C   . ARG A 1 738  ? -36.104 -37.076 -77.110  1.00 113.28 ? 2110 ARG B C   1 
ATOM 5500  O O   . ARG A 1 738  ? -36.692 -36.964 -76.031  1.00 112.26 ? 2110 ARG B O   1 
ATOM 5501  C CB  . ARG A 1 738  ? -37.351 -38.136 -78.994  1.00 114.30 ? 2110 ARG B CB  1 
ATOM 5502  C CG  . ARG A 1 738  ? -38.342 -38.001 -80.139  1.00 116.10 ? 2110 ARG B CG  1 
ATOM 5503  C CD  . ARG A 1 738  ? -38.506 -39.317 -80.894  1.00 116.18 ? 2110 ARG B CD  1 
ATOM 5504  N NE  . ARG A 1 738  ? -39.280 -40.309 -80.140  1.00 115.45 ? 2110 ARG B NE  1 
ATOM 5505  C CZ  . ARG A 1 738  ? -39.371 -41.611 -80.432  1.00 115.22 ? 2110 ARG B CZ  1 
ATOM 5506  N NH1 . ARG A 1 738  ? -38.723 -42.141 -81.473  1.00 115.40 ? 2110 ARG B NH1 1 
ATOM 5507  N NH2 . ARG A 1 738  ? -40.118 -42.402 -79.662  1.00 114.51 ? 2110 ARG B NH2 1 
ATOM 5508  N N   . ILE A 1 739  ? -34.825 -37.446 -77.215  1.00 112.80 ? 2111 ILE B N   1 
ATOM 5509  C CA  . ILE A 1 739  ? -33.946 -37.618 -76.048  1.00 111.22 ? 2111 ILE B CA  1 
ATOM 5510  C C   . ILE A 1 739  ? -33.707 -36.263 -75.382  1.00 111.87 ? 2111 ILE B C   1 
ATOM 5511  O O   . ILE A 1 739  ? -33.933 -36.122 -74.182  1.00 111.46 ? 2111 ILE B O   1 
ATOM 5512  C CB  . ILE A 1 739  ? -32.584 -38.256 -76.435  1.00 111.23 ? 2111 ILE B CB  1 
ATOM 5513  C CG1 . ILE A 1 739  ? -32.775 -39.703 -76.906  1.00 110.11 ? 2111 ILE B CG1 1 
ATOM 5514  C CG2 . ILE A 1 739  ? -31.603 -38.249 -75.263  1.00 110.69 ? 2111 ILE B CG2 1 
ATOM 5515  C CD1 . ILE A 1 739  ? -31.668 -40.205 -77.812  1.00 110.92 ? 2111 ILE B CD1 1 
ATOM 5516  N N   . SER A 1 740  ? -33.268 -35.282 -76.175  1.00 113.08 ? 2112 SER B N   1 
ATOM 5517  C CA  . SER A 1 740  ? -32.946 -33.922 -75.699  1.00 114.12 ? 2112 SER B CA  1 
ATOM 5518  C C   . SER A 1 740  ? -34.052 -33.241 -74.882  1.00 113.79 ? 2112 SER B C   1 
ATOM 5519  O O   . SER A 1 740  ? -33.757 -32.450 -73.988  1.00 113.48 ? 2112 SER B O   1 
ATOM 5520  C CB  . SER A 1 740  ? -32.589 -33.024 -76.885  1.00 116.54 ? 2112 SER B CB  1 
ATOM 5521  O OG  . SER A 1 740  ? -31.542 -33.584 -77.658  1.00 117.00 ? 2112 SER B OG  1 
ATOM 5522  N N   . LYS A 1 741  ? -35.310 -33.535 -75.209  1.00 113.94 ? 2113 LYS B N   1 
ATOM 5523  C CA  . LYS A 1 741  ? -36.461 -33.061 -74.428  1.00 114.70 ? 2113 LYS B CA  1 
ATOM 5524  C C   . LYS A 1 741  ? -36.653 -33.852 -73.123  1.00 113.95 ? 2113 LYS B C   1 
ATOM 5525  O O   . LYS A 1 741  ? -37.074 -33.285 -72.115  1.00 113.51 ? 2113 LYS B O   1 
ATOM 5526  C CB  . LYS A 1 741  ? -37.738 -33.082 -75.281  1.00 114.93 ? 2113 LYS B CB  1 
ATOM 5527  C CG  . LYS A 1 741  ? -37.730 -32.039 -76.393  1.00 116.95 ? 2113 LYS B CG  1 
ATOM 5528  C CD  . LYS A 1 741  ? -38.887 -32.206 -77.365  1.00 117.25 ? 2113 LYS B CD  1 
ATOM 5529  C CE  . LYS A 1 741  ? -38.730 -31.281 -78.564  1.00 119.21 ? 2113 LYS B CE  1 
ATOM 5530  N NZ  . LYS A 1 741  ? -39.930 -31.275 -79.444  1.00 119.64 ? 2113 LYS B NZ  1 
ATOM 5531  N N   . GLN A 1 742  ? -36.346 -35.151 -73.148  1.00 114.61 ? 2114 GLN B N   1 
ATOM 5532  C CA  . GLN A 1 742  ? -36.403 -36.007 -71.945  1.00 115.23 ? 2114 GLN B CA  1 
ATOM 5533  C C   . GLN A 1 742  ? -35.233 -35.859 -70.948  1.00 118.05 ? 2114 GLN B C   1 
ATOM 5534  O O   . GLN A 1 742  ? -35.320 -36.386 -69.840  1.00 116.31 ? 2114 GLN B O   1 
ATOM 5535  C CB  . GLN A 1 742  ? -36.523 -37.493 -72.337  1.00 113.71 ? 2114 GLN B CB  1 
ATOM 5536  C CG  . GLN A 1 742  ? -37.925 -37.948 -72.722  1.00 113.72 ? 2114 GLN B CG  1 
ATOM 5537  C CD  . GLN A 1 742  ? -38.069 -39.466 -72.775  1.00 112.20 ? 2114 GLN B CD  1 
ATOM 5538  O OE1 . GLN A 1 742  ? -37.086 -40.197 -72.915  1.00 110.59 ? 2114 GLN B OE1 1 
ATOM 5539  N NE2 . GLN A 1 742  ? -39.304 -39.944 -72.667  1.00 112.21 ? 2114 GLN B NE2 1 
ATOM 5540  N N   . LEU A 1 743  ? -34.149 -35.173 -71.320  1.00 124.85 ? 2115 LEU B N   1 
ATOM 5541  C CA  . LEU A 1 743  ? -32.943 -35.114 -70.461  1.00 130.35 ? 2115 LEU B CA  1 
ATOM 5542  C C   . LEU A 1 743  ? -33.119 -34.355 -69.139  1.00 137.91 ? 2115 LEU B C   1 
ATOM 5543  O O   . LEU A 1 743  ? -32.684 -34.848 -68.097  1.00 137.18 ? 2115 LEU B O   1 
ATOM 5544  C CB  . LEU A 1 743  ? -31.724 -34.554 -71.217  1.00 132.49 ? 2115 LEU B CB  1 
ATOM 5545  C CG  . LEU A 1 743  ? -31.059 -35.403 -72.300  1.00 133.16 ? 2115 LEU B CG  1 
ATOM 5546  C CD1 . LEU A 1 743  ? -29.857 -34.648 -72.845  1.00 135.62 ? 2115 LEU B CD1 1 
ATOM 5547  C CD2 . LEU A 1 743  ? -30.638 -36.777 -71.801  1.00 130.95 ? 2115 LEU B CD2 1 
ATOM 5548  N N   . PRO A 1 744  ? -33.731 -33.153 -69.173  1.00 104.31 ? 2116 PRO B N   1 
ATOM 5549  C CA  . PRO A 1 744  ? -34.030 -32.475 -67.903  1.00 106.84 ? 2116 PRO B CA  1 
ATOM 5550  C C   . PRO A 1 744  ? -35.148 -33.136 -67.077  1.00 110.60 ? 2116 PRO B C   1 
ATOM 5551  O O   . PRO A 1 744  ? -35.290 -32.819 -65.896  1.00 113.91 ? 2116 PRO B O   1 
ATOM 5552  C CB  . PRO A 1 744  ? -34.442 -31.060 -68.341  1.00 107.66 ? 2116 PRO B CB  1 
ATOM 5553  C CG  . PRO A 1 744  ? -33.963 -30.920 -69.745  1.00 108.68 ? 2116 PRO B CG  1 
ATOM 5554  C CD  . PRO A 1 744  ? -34.068 -32.295 -70.322  1.00 108.81 ? 2116 PRO B CD  1 
ATOM 5555  N N   . GLN A 1 745  ? -35.930 -34.031 -67.687  1.00 113.70 ? 2117 GLN B N   1 
ATOM 5556  C CA  . GLN A 1 745  ? -36.887 -34.858 -66.945  1.00 119.37 ? 2117 GLN B CA  1 
ATOM 5557  C C   . GLN A 1 745  ? -36.192 -35.849 -65.997  1.00 116.24 ? 2117 GLN B C   1 
ATOM 5558  O O   . GLN A 1 745  ? -36.790 -36.259 -65.003  1.00 117.85 ? 2117 GLN B O   1 
ATOM 5559  C CB  . GLN A 1 745  ? -37.833 -35.612 -67.892  1.00 131.34 ? 2117 GLN B CB  1 
ATOM 5560  C CG  . GLN A 1 745  ? -38.718 -34.718 -68.755  1.00 138.61 ? 2117 GLN B CG  1 
ATOM 5561  C CD  . GLN A 1 745  ? -39.775 -35.491 -69.536  1.00 144.49 ? 2117 GLN B CD  1 
ATOM 5562  O OE1 . GLN A 1 745  ? -39.673 -36.707 -69.723  1.00 140.84 ? 2117 GLN B OE1 1 
ATOM 5563  N NE2 . GLN A 1 745  ? -40.798 -34.782 -70.000  1.00 148.18 ? 2117 GLN B NE2 1 
ATOM 5564  N N   . LEU A 1 746  ? -34.950 -36.240 -66.304  1.00 113.79 ? 2118 LEU B N   1 
ATOM 5565  C CA  . LEU A 1 746  ? -34.128 -37.016 -65.360  1.00 110.84 ? 2118 LEU B CA  1 
ATOM 5566  C C   . LEU A 1 746  ? -33.624 -36.147 -64.209  1.00 101.46 ? 2118 LEU B C   1 
ATOM 5567  O O   . LEU A 1 746  ? -32.597 -35.466 -64.327  1.00 92.98  ? 2118 LEU B O   1 
ATOM 5568  C CB  . LEU A 1 746  ? -32.925 -37.682 -66.043  1.00 116.36 ? 2118 LEU B CB  1 
ATOM 5569  C CG  . LEU A 1 746  ? -33.131 -38.912 -66.932  1.00 125.21 ? 2118 LEU B CG  1 
ATOM 5570  C CD1 . LEU A 1 746  ? -31.762 -39.463 -67.300  1.00 126.43 ? 2118 LEU B CD1 1 
ATOM 5571  C CD2 . LEU A 1 746  ? -33.972 -40.005 -66.280  1.00 125.37 ? 2118 LEU B CD2 1 
ATOM 5572  N N   . THR A 1 747  ? -34.378 -36.170 -63.112  1.00 98.01  ? 2119 THR B N   1 
ATOM 5573  C CA  . THR A 1 747  ? -33.944 -35.637 -61.817  1.00 91.64  ? 2119 THR B CA  1 
ATOM 5574  C C   . THR A 1 747  ? -33.992 -36.722 -60.719  1.00 84.03  ? 2119 THR B C   1 
ATOM 5575  O O   . THR A 1 747  ? -33.882 -36.416 -59.527  1.00 79.66  ? 2119 THR B O   1 
ATOM 5576  C CB  . THR A 1 747  ? -34.809 -34.424 -61.413  1.00 91.77  ? 2119 THR B CB  1 
ATOM 5577  O OG1 . THR A 1 747  ? -36.198 -34.755 -61.545  1.00 89.63  ? 2119 THR B OG1 1 
ATOM 5578  C CG2 . THR A 1 747  ? -34.484 -33.221 -62.293  1.00 91.83  ? 2119 THR B CG2 1 
ATOM 5579  N N   . SER A 1 748  ? -34.120 -37.986 -61.127  1.00 81.79  ? 2120 SER B N   1 
ATOM 5580  C CA  . SER A 1 748  ? -34.270 -39.109 -60.198  1.00 81.63  ? 2120 SER B CA  1 
ATOM 5581  C C   . SER A 1 748  ? -34.162 -40.439 -60.944  1.00 81.28  ? 2120 SER B C   1 
ATOM 5582  O O   . SER A 1 748  ? -34.781 -40.608 -61.995  1.00 85.52  ? 2120 SER B O   1 
ATOM 5583  C CB  . SER A 1 748  ? -35.631 -39.042 -59.494  1.00 85.06  ? 2120 SER B CB  1 
ATOM 5584  O OG  . SER A 1 748  ? -35.844 -40.174 -58.667  1.00 83.13  ? 2120 SER B OG  1 
ATOM 5585  N N   . LEU A 1 749  ? -33.385 -41.373 -60.399  1.00 78.80  ? 2121 LEU B N   1 
ATOM 5586  C CA  . LEU A 1 749  ? -33.281 -42.725 -60.952  1.00 80.80  ? 2121 LEU B CA  1 
ATOM 5587  C C   . LEU A 1 749  ? -33.634 -43.766 -59.900  1.00 79.32  ? 2121 LEU B C   1 
ATOM 5588  O O   . LEU A 1 749  ? -33.086 -43.756 -58.796  1.00 76.82  ? 2121 LEU B O   1 
ATOM 5589  C CB  . LEU A 1 749  ? -31.875 -42.985 -61.485  1.00 82.17  ? 2121 LEU B CB  1 
ATOM 5590  C CG  . LEU A 1 749  ? -31.483 -42.240 -62.760  1.00 87.03  ? 2121 LEU B CG  1 
ATOM 5591  C CD1 . LEU A 1 749  ? -30.025 -42.531 -63.074  1.00 88.48  ? 2121 LEU B CD1 1 
ATOM 5592  C CD2 . LEU A 1 749  ? -32.361 -42.607 -63.953  1.00 91.49  ? 2121 LEU B CD2 1 
ATOM 5593  N N   . GLU A 1 750  ? -34.547 -44.664 -60.264  1.00 81.34  ? 2122 GLU B N   1 
ATOM 5594  C CA  . GLU A 1 750  ? -35.028 -45.709 -59.373  1.00 83.65  ? 2122 GLU B CA  1 
ATOM 5595  C C   . GLU A 1 750  ? -34.295 -47.009 -59.721  1.00 81.68  ? 2122 GLU B C   1 
ATOM 5596  O O   . GLU A 1 750  ? -34.260 -47.422 -60.881  1.00 83.64  ? 2122 GLU B O   1 
ATOM 5597  C CB  . GLU A 1 750  ? -36.551 -45.855 -59.513  1.00 91.40  ? 2122 GLU B CB  1 
ATOM 5598  C CG  . GLU A 1 750  ? -37.281 -46.164 -58.211  1.00 96.87  ? 2122 GLU B CG  1 
ATOM 5599  C CD  . GLU A 1 750  ? -38.765 -45.839 -58.275  1.00 105.87 ? 2122 GLU B CD  1 
ATOM 5600  O OE1 . GLU A 1 750  ? -39.436 -46.263 -59.241  1.00 112.50 ? 2122 GLU B OE1 1 
ATOM 5601  O OE2 . GLU A 1 750  ? -39.265 -45.160 -57.354  1.00 110.96 ? 2122 GLU B OE2 1 
ATOM 5602  N N   . LEU A 1 751  ? -33.723 -47.652 -58.707  1.00 78.22  ? 2123 LEU B N   1 
ATOM 5603  C CA  . LEU A 1 751  ? -32.782 -48.763 -58.904  1.00 74.98  ? 2123 LEU B CA  1 
ATOM 5604  C C   . LEU A 1 751  ? -33.448 -50.028 -59.460  1.00 75.52  ? 2123 LEU B C   1 
ATOM 5605  O O   . LEU A 1 751  ? -32.800 -50.815 -60.146  1.00 73.56  ? 2123 LEU B O   1 
ATOM 5606  C CB  . LEU A 1 751  ? -32.039 -49.077 -57.591  1.00 72.51  ? 2123 LEU B CB  1 
ATOM 5607  C CG  . LEU A 1 751  ? -30.590 -49.561 -57.647  1.00 71.87  ? 2123 LEU B CG  1 
ATOM 5608  C CD1 . LEU A 1 751  ? -29.661 -48.559 -58.323  1.00 70.54  ? 2123 LEU B CD1 1 
ATOM 5609  C CD2 . LEU A 1 751  ? -30.103 -49.824 -56.232  1.00 70.78  ? 2123 LEU B CD2 1 
ATOM 5610  N N   . GLN A 1 752  ? -34.730 -50.218 -59.154  1.00 77.25  ? 2124 GLN B N   1 
ATOM 5611  C CA  . GLN A 1 752  ? -35.531 -51.299 -59.755  1.00 79.66  ? 2124 GLN B CA  1 
ATOM 5612  C C   . GLN A 1 752  ? -35.604 -51.259 -61.297  1.00 81.57  ? 2124 GLN B C   1 
ATOM 5613  O O   . GLN A 1 752  ? -35.651 -52.319 -61.938  1.00 80.65  ? 2124 GLN B O   1 
ATOM 5614  C CB  . GLN A 1 752  ? -36.951 -51.331 -59.166  1.00 81.68  ? 2124 GLN B CB  1 
ATOM 5615  C CG  . GLN A 1 752  ? -37.707 -50.004 -59.200  1.00 82.10  ? 2124 GLN B CG  1 
ATOM 5616  C CD  . GLN A 1 752  ? -39.215 -50.162 -59.170  1.00 85.15  ? 2124 GLN B CD  1 
ATOM 5617  O OE1 . GLN A 1 752  ? -39.938 -49.296 -59.654  1.00 88.20  ? 2124 GLN B OE1 1 
ATOM 5618  N NE2 . GLN A 1 752  ? -39.697 -51.264 -58.599  1.00 85.39  ? 2124 GLN B NE2 1 
ATOM 5619  N N   . TYR A 1 753  ? -35.614 -50.052 -61.875  1.00 82.01  ? 2125 TYR B N   1 
ATOM 5620  C CA  . TYR A 1 753  ? -35.657 -49.868 -63.337  1.00 84.51  ? 2125 TYR B CA  1 
ATOM 5621  C C   . TYR A 1 753  ? -34.269 -49.868 -63.985  1.00 82.56  ? 2125 TYR B C   1 
ATOM 5622  O O   . TYR A 1 753  ? -34.084 -50.417 -65.074  1.00 83.64  ? 2125 TYR B O   1 
ATOM 5623  C CB  . TYR A 1 753  ? -36.354 -48.550 -63.711  1.00 86.78  ? 2125 TYR B CB  1 
ATOM 5624  C CG  . TYR A 1 753  ? -37.806 -48.417 -63.287  1.00 90.89  ? 2125 TYR B CG  1 
ATOM 5625  C CD1 . TYR A 1 753  ? -38.272 -47.243 -62.687  1.00 91.80  ? 2125 TYR B CD1 1 
ATOM 5626  C CD2 . TYR A 1 753  ? -38.721 -49.450 -63.499  1.00 96.52  ? 2125 TYR B CD2 1 
ATOM 5627  C CE1 . TYR A 1 753  ? -39.601 -47.108 -62.304  1.00 94.97  ? 2125 TYR B CE1 1 
ATOM 5628  C CE2 . TYR A 1 753  ? -40.051 -49.324 -63.116  1.00 100.68 ? 2125 TYR B CE2 1 
ATOM 5629  C CZ  . TYR A 1 753  ? -40.486 -48.151 -62.522  1.00 99.99  ? 2125 TYR B CZ  1 
ATOM 5630  O OH  . TYR A 1 753  ? -41.799 -48.023 -62.139  1.00 106.30 ? 2125 TYR B OH  1 
ATOM 5631  N N   . VAL A 1 754  ? -33.305 -49.244 -63.312  1.00 80.33  ? 2126 VAL B N   1 
ATOM 5632  C CA  . VAL A 1 754  ? -31.985 -48.957 -63.886  1.00 79.77  ? 2126 VAL B CA  1 
ATOM 5633  C C   . VAL A 1 754  ? -30.963 -50.082 -63.685  1.00 78.78  ? 2126 VAL B C   1 
ATOM 5634  O O   . VAL A 1 754  ? -30.125 -50.311 -64.560  1.00 77.87  ? 2126 VAL B O   1 
ATOM 5635  C CB  . VAL A 1 754  ? -31.424 -47.647 -63.298  1.00 79.22  ? 2126 VAL B CB  1 
ATOM 5636  C CG1 . VAL A 1 754  ? -30.061 -47.323 -63.879  1.00 79.29  ? 2126 VAL B CG1 1 
ATOM 5637  C CG2 . VAL A 1 754  ? -32.373 -46.491 -63.580  1.00 82.24  ? 2126 VAL B CG2 1 
ATOM 5638  N N   . SER A 1 755  ? -31.015 -50.750 -62.532  1.00 78.27  ? 2127 SER B N   1 
ATOM 5639  C CA  . SER A 1 755  ? -30.083 -51.837 -62.205  1.00 77.75  ? 2127 SER B CA  1 
ATOM 5640  C C   . SER A 1 755  ? -30.642 -52.736 -61.089  1.00 78.91  ? 2127 SER B C   1 
ATOM 5641  O O   . SER A 1 755  ? -30.401 -52.463 -59.907  1.00 80.12  ? 2127 SER B O   1 
ATOM 5642  C CB  . SER A 1 755  ? -28.729 -51.260 -61.783  1.00 74.04  ? 2127 SER B CB  1 
ATOM 5643  O OG  . SER A 1 755  ? -27.904 -52.259 -61.204  1.00 71.29  ? 2127 SER B OG  1 
ATOM 5644  N N   . PRO A 1 756  ? -31.382 -53.807 -61.453  1.00 78.23  ? 2128 PRO B N   1 
ATOM 5645  C CA  . PRO A 1 756  ? -31.980 -54.674 -60.428  1.00 77.50  ? 2128 PRO B CA  1 
ATOM 5646  C C   . PRO A 1 756  ? -30.967 -55.443 -59.574  1.00 76.13  ? 2128 PRO B C   1 
ATOM 5647  O O   . PRO A 1 756  ? -31.263 -55.747 -58.415  1.00 75.64  ? 2128 PRO B O   1 
ATOM 5648  C CB  . PRO A 1 756  ? -32.847 -55.656 -61.234  1.00 80.03  ? 2128 PRO B CB  1 
ATOM 5649  C CG  . PRO A 1 756  ? -32.883 -55.137 -62.625  1.00 81.88  ? 2128 PRO B CG  1 
ATOM 5650  C CD  . PRO A 1 756  ? -31.654 -54.309 -62.809  1.00 79.88  ? 2128 PRO B CD  1 
ATOM 5651  N N   . LYS A 1 757  ? -29.799 -55.756 -60.140  1.00 75.97  ? 2129 LYS B N   1 
ATOM 5652  C CA  . LYS A 1 757  ? -28.736 -56.448 -59.397  1.00 75.83  ? 2129 LYS B CA  1 
ATOM 5653  C C   . LYS A 1 757  ? -28.238 -55.646 -58.186  1.00 73.17  ? 2129 LYS B C   1 
ATOM 5654  O O   . LYS A 1 757  ? -27.915 -56.234 -57.149  1.00 71.12  ? 2129 LYS B O   1 
ATOM 5655  C CB  . LYS A 1 757  ? -27.553 -56.794 -60.313  1.00 76.96  ? 2129 LYS B CB  1 
ATOM 5656  C CG  . LYS A 1 757  ? -27.848 -57.865 -61.352  1.00 79.71  ? 2129 LYS B CG  1 
ATOM 5657  C CD  . LYS A 1 757  ? -26.566 -58.473 -61.907  1.00 80.88  ? 2129 LYS B CD  1 
ATOM 5658  C CE  . LYS A 1 757  ? -26.854 -59.428 -63.056  1.00 85.19  ? 2129 LYS B CE  1 
ATOM 5659  N NZ  . LYS A 1 757  ? -25.641 -60.170 -63.500  1.00 85.72  ? 2129 LYS B NZ  1 
ATOM 5660  N N   . LEU A 1 758  ? -28.178 -54.319 -58.322  1.00 72.62  ? 2130 LEU B N   1 
ATOM 5661  C CA  . LEU A 1 758  ? -27.796 -53.440 -57.207  1.00 72.74  ? 2130 LEU B CA  1 
ATOM 5662  C C   . LEU A 1 758  ? -28.900 -53.310 -56.140  1.00 74.11  ? 2130 LEU B C   1 
ATOM 5663  O O   . LEU A 1 758  ? -28.596 -53.144 -54.953  1.00 75.43  ? 2130 LEU B O   1 
ATOM 5664  C CB  . LEU A 1 758  ? -27.364 -52.049 -57.713  1.00 71.45  ? 2130 LEU B CB  1 
ATOM 5665  C CG  . LEU A 1 758  ? -26.039 -51.954 -58.486  1.00 69.36  ? 2130 LEU B CG  1 
ATOM 5666  C CD1 . LEU A 1 758  ? -25.863 -50.570 -59.094  1.00 68.97  ? 2130 LEU B CD1 1 
ATOM 5667  C CD2 . LEU A 1 758  ? -24.832 -52.281 -57.620  1.00 67.00  ? 2130 LEU B CD2 1 
ATOM 5668  N N   . LEU A 1 759  ? -30.166 -53.380 -56.552  1.00 74.20  ? 2131 LEU B N   1 
ATOM 5669  C CA  . LEU A 1 759  ? -31.280 -53.383 -55.598  1.00 75.30  ? 2131 LEU B CA  1 
ATOM 5670  C C   . LEU A 1 759  ? -31.252 -54.659 -54.766  1.00 78.51  ? 2131 LEU B C   1 
ATOM 5671  O O   . LEU A 1 759  ? -31.328 -54.615 -53.537  1.00 75.81  ? 2131 LEU B O   1 
ATOM 5672  C CB  . LEU A 1 759  ? -32.617 -53.259 -56.329  1.00 76.73  ? 2131 LEU B CB  1 
ATOM 5673  C CG  . LEU A 1 759  ? -33.891 -53.177 -55.478  1.00 78.40  ? 2131 LEU B CG  1 
ATOM 5674  C CD1 . LEU A 1 759  ? -33.886 -51.943 -54.583  1.00 78.37  ? 2131 LEU B CD1 1 
ATOM 5675  C CD2 . LEU A 1 759  ? -35.119 -53.180 -56.372  1.00 79.97  ? 2131 LEU B CD2 1 
ATOM 5676  N N   . MET A 1 760  ? -31.134 -55.783 -55.468  1.00 86.78  ? 2132 MET B N   1 
ATOM 5677  C CA  . MET A 1 760  ? -30.992 -57.115 -54.873  1.00 94.34  ? 2132 MET B CA  1 
ATOM 5678  C C   . MET A 1 760  ? -29.905 -57.197 -53.780  1.00 88.51  ? 2132 MET B C   1 
ATOM 5679  O O   . MET A 1 760  ? -30.106 -57.876 -52.774  1.00 87.90  ? 2132 MET B O   1 
ATOM 5680  C CB  . MET A 1 760  ? -30.700 -58.125 -55.996  1.00 106.91 ? 2132 MET B CB  1 
ATOM 5681  C CG  . MET A 1 760  ? -30.565 -59.582 -55.580  1.00 122.22 ? 2132 MET B CG  1 
ATOM 5682  S SD  . MET A 1 760  ? -29.805 -60.573 -56.882  1.00 144.55 ? 2132 MET B SD  1 
ATOM 5683  C CE  . MET A 1 760  ? -28.079 -60.092 -56.754  1.00 137.49 ? 2132 MET B CE  1 
ATOM 5684  N N   . CYS A 1 761  ? -28.774 -56.514 -53.982  1.00 83.23  ? 2133 CYS B N   1 
ATOM 5685  C CA  . CYS A 1 761  ? -27.626 -56.565 -53.055  1.00 81.52  ? 2133 CYS B CA  1 
ATOM 5686  C C   . CYS A 1 761  ? -28.013 -56.454 -51.583  1.00 81.72  ? 2133 CYS B C   1 
ATOM 5687  O O   . CYS A 1 761  ? -28.559 -55.432 -51.162  1.00 87.45  ? 2133 CYS B O   1 
ATOM 5688  C CB  . CYS A 1 761  ? -26.626 -55.440 -53.356  1.00 80.96  ? 2133 CYS B CB  1 
ATOM 5689  S SG  . CYS A 1 761  ? -25.578 -55.695 -54.801  1.00 82.29  ? 2133 CYS B SG  1 
ATOM 5690  N N   . ARG A 1 762  ? -27.730 -57.509 -50.819  1.00 80.06  ? 2134 ARG B N   1 
ATOM 5691  C CA  . ARG A 1 762  ? -27.890 -57.504 -49.363  1.00 80.80  ? 2134 ARG B CA  1 
ATOM 5692  C C   . ARG A 1 762  ? -26.691 -58.174 -48.708  1.00 74.72  ? 2134 ARG B C   1 
ATOM 5693  O O   . ARG A 1 762  ? -26.195 -59.185 -49.202  1.00 72.35  ? 2134 ARG B O   1 
ATOM 5694  C CB  . ARG A 1 762  ? -29.169 -58.238 -48.941  1.00 90.93  ? 2134 ARG B CB  1 
ATOM 5695  C CG  . ARG A 1 762  ? -30.467 -57.490 -49.216  1.00 100.60 ? 2134 ARG B CG  1 
ATOM 5696  C CD  . ARG A 1 762  ? -30.713 -56.375 -48.208  1.00 104.31 ? 2134 ARG B CD  1 
ATOM 5697  N NE  . ARG A 1 762  ? -31.970 -55.665 -48.463  1.00 106.00 ? 2134 ARG B NE  1 
ATOM 5698  C CZ  . ARG A 1 762  ? -32.393 -54.587 -47.800  1.00 107.83 ? 2134 ARG B CZ  1 
ATOM 5699  N NH1 . ARG A 1 762  ? -31.670 -54.055 -46.813  1.00 108.95 ? 2134 ARG B NH1 1 
ATOM 5700  N NH2 . ARG A 1 762  ? -33.556 -54.030 -48.127  1.00 110.82 ? 2134 ARG B NH2 1 
ATOM 5701  N N   . ASP A 1 763  ? -26.241 -57.591 -47.598  1.00 74.05  ? 2135 ASP B N   1 
ATOM 5702  C CA  . ASP A 1 763  ? -25.185 -58.141 -46.739  1.00 72.74  ? 2135 ASP B CA  1 
ATOM 5703  C C   . ASP A 1 763  ? -23.987 -58.719 -47.506  1.00 68.10  ? 2135 ASP B C   1 
ATOM 5704  O O   . ASP A 1 763  ? -23.622 -59.883 -47.345  1.00 65.30  ? 2135 ASP B O   1 
ATOM 5705  C CB  . ASP A 1 763  ? -25.800 -59.157 -45.769  1.00 78.35  ? 2135 ASP B CB  1 
ATOM 5706  C CG  . ASP A 1 763  ? -26.850 -58.525 -44.859  1.00 85.03  ? 2135 ASP B CG  1 
ATOM 5707  O OD1 . ASP A 1 763  ? -26.474 -57.698 -43.999  1.00 89.03  ? 2135 ASP B OD1 1 
ATOM 5708  O OD2 . ASP A 1 763  ? -28.051 -58.842 -45.009  1.00 90.65  ? 2135 ASP B OD2 1 
ATOM 5709  N N   . LEU A 1 764  ? -23.397 -57.876 -48.350  1.00 66.75  ? 2136 LEU B N   1 
ATOM 5710  C CA  . LEU A 1 764  ? -22.196 -58.227 -49.117  1.00 65.29  ? 2136 LEU B CA  1 
ATOM 5711  C C   . LEU A 1 764  ? -20.981 -58.284 -48.201  1.00 64.55  ? 2136 LEU B C   1 
ATOM 5712  O O   . LEU A 1 764  ? -20.989 -57.696 -47.117  1.00 63.32  ? 2136 LEU B O   1 
ATOM 5713  C CB  . LEU A 1 764  ? -21.933 -57.201 -50.232  1.00 64.28  ? 2136 LEU B CB  1 
ATOM 5714  C CG  . LEU A 1 764  ? -22.702 -57.310 -51.548  1.00 65.69  ? 2136 LEU B CG  1 
ATOM 5715  C CD1 . LEU A 1 764  ? -24.205 -57.369 -51.340  1.00 69.33  ? 2136 LEU B CD1 1 
ATOM 5716  C CD2 . LEU A 1 764  ? -22.338 -56.139 -52.446  1.00 64.30  ? 2136 LEU B CD2 1 
ATOM 5717  N N   . GLU A 1 765  ? -19.947 -59.003 -48.640  1.00 65.27  ? 2137 GLU B N   1 
ATOM 5718  C CA  . GLU A 1 765  ? -18.642 -58.989 -47.963  1.00 66.01  ? 2137 GLU B CA  1 
ATOM 5719  C C   . GLU A 1 765  ? -17.663 -57.983 -48.593  1.00 64.96  ? 2137 GLU B C   1 
ATOM 5720  O O   . GLU A 1 765  ? -16.557 -57.788 -48.086  1.00 66.02  ? 2137 GLU B O   1 
ATOM 5721  C CB  . GLU A 1 765  ? -18.040 -60.401 -47.871  1.00 68.57  ? 2137 GLU B CB  1 
ATOM 5722  C CG  . GLU A 1 765  ? -17.555 -61.039 -49.165  1.00 72.91  ? 2137 GLU B CG  1 
ATOM 5723  C CD  . GLU A 1 765  ? -17.058 -62.469 -48.949  1.00 77.16  ? 2137 GLU B CD  1 
ATOM 5724  O OE1 . GLU A 1 765  ? -17.876 -63.331 -48.552  1.00 76.31  ? 2137 GLU B OE1 1 
ATOM 5725  O OE2 . GLU A 1 765  ? -15.851 -62.738 -49.179  1.00 76.90  ? 2137 GLU B OE2 1 
ATOM 5726  N N   . LEU A 1 766  ? -18.086 -57.346 -49.687  1.00 63.40  ? 2138 LEU B N   1 
ATOM 5727  C CA  . LEU A 1 766  ? -17.355 -56.239 -50.314  1.00 60.04  ? 2138 LEU B CA  1 
ATOM 5728  C C   . LEU A 1 766  ? -17.438 -54.987 -49.431  1.00 56.83  ? 2138 LEU B C   1 
ATOM 5729  O O   . LEU A 1 766  ? -18.526 -54.605 -48.996  1.00 57.02  ? 2138 LEU B O   1 
ATOM 5730  C CB  . LEU A 1 766  ? -17.947 -55.931 -51.707  1.00 61.18  ? 2138 LEU B CB  1 
ATOM 5731  C CG  . LEU A 1 766  ? -17.099 -55.329 -52.844  1.00 60.40  ? 2138 LEU B CG  1 
ATOM 5732  C CD1 . LEU A 1 766  ? -17.982 -54.544 -53.803  1.00 60.33  ? 2138 LEU B CD1 1 
ATOM 5733  C CD2 . LEU A 1 766  ? -15.973 -54.435 -52.366  1.00 60.30  ? 2138 LEU B CD2 1 
ATOM 5734  N N   . ALA A 1 767  ? -16.292 -54.354 -49.185  1.00 53.72  ? 2139 ALA B N   1 
ATOM 5735  C CA  . ALA A 1 767  ? -16.218 -53.121 -48.389  1.00 51.36  ? 2139 ALA B CA  1 
ATOM 5736  C C   . ALA A 1 767  ? -16.884 -51.930 -49.074  1.00 50.12  ? 2139 ALA B C   1 
ATOM 5737  O O   . ALA A 1 767  ? -16.990 -51.887 -50.296  1.00 50.56  ? 2139 ALA B O   1 
ATOM 5738  C CB  . ALA A 1 767  ? -14.769 -52.783 -48.079  1.00 51.37  ? 2139 ALA B CB  1 
ATOM 5739  N N   . VAL A 1 768  ? -17.315 -50.959 -48.275  1.00 50.28  ? 2140 VAL B N   1 
ATOM 5740  C CA  . VAL A 1 768  ? -17.859 -49.699 -48.797  1.00 50.69  ? 2140 VAL B CA  1 
ATOM 5741  C C   . VAL A 1 768  ? -16.719 -48.954 -49.501  1.00 49.96  ? 2140 VAL B C   1 
ATOM 5742  O O   . VAL A 1 768  ? -15.621 -48.881 -48.952  1.00 49.57  ? 2140 VAL B O   1 
ATOM 5743  C CB  . VAL A 1 768  ? -18.448 -48.821 -47.668  1.00 50.81  ? 2140 VAL B CB  1 
ATOM 5744  C CG1 . VAL A 1 768  ? -18.824 -47.436 -48.170  1.00 49.56  ? 2140 VAL B CG1 1 
ATOM 5745  C CG2 . VAL A 1 768  ? -19.671 -49.488 -47.055  1.00 53.71  ? 2140 VAL B CG2 1 
ATOM 5746  N N   . PRO A 1 769  ? -16.963 -48.416 -50.716  1.00 50.59  ? 2141 PRO B N   1 
ATOM 5747  C CA  . PRO A 1 769  ? -15.884 -47.778 -51.482  1.00 51.25  ? 2141 PRO B CA  1 
ATOM 5748  C C   . PRO A 1 769  ? -15.074 -46.723 -50.715  1.00 51.09  ? 2141 PRO B C   1 
ATOM 5749  O O   . PRO A 1 769  ? -15.637 -45.758 -50.188  1.00 51.23  ? 2141 PRO B O   1 
ATOM 5750  C CB  . PRO A 1 769  ? -16.626 -47.149 -52.661  1.00 51.06  ? 2141 PRO B CB  1 
ATOM 5751  C CG  . PRO A 1 769  ? -17.768 -48.063 -52.887  1.00 52.03  ? 2141 PRO B CG  1 
ATOM 5752  C CD  . PRO A 1 769  ? -18.197 -48.506 -51.517  1.00 51.97  ? 2141 PRO B CD  1 
ATOM 5753  N N   . GLY A 1 770  ? -13.763 -46.943 -50.640  1.00 50.91  ? 2142 GLY B N   1 
ATOM 5754  C CA  . GLY A 1 770  ? -12.844 -46.019 -49.985  1.00 50.95  ? 2142 GLY B CA  1 
ATOM 5755  C C   . GLY A 1 770  ? -12.832 -46.042 -48.468  1.00 52.78  ? 2142 GLY B C   1 
ATOM 5756  O O   . GLY A 1 770  ? -12.243 -45.149 -47.853  1.00 56.11  ? 2142 GLY B O   1 
ATOM 5757  N N   . THR A 1 771  ? -13.465 -47.047 -47.859  1.00 53.19  ? 2143 THR B N   1 
ATOM 5758  C CA  . THR A 1 771  ? -13.514 -47.162 -46.400  1.00 52.52  ? 2143 THR B CA  1 
ATOM 5759  C C   . THR A 1 771  ? -12.470 -48.106 -45.839  1.00 50.80  ? 2143 THR B C   1 
ATOM 5760  O O   . THR A 1 771  ? -12.084 -47.937 -44.690  1.00 53.09  ? 2143 THR B O   1 
ATOM 5761  C CB  . THR A 1 771  ? -14.887 -47.640 -45.891  1.00 55.59  ? 2143 THR B CB  1 
ATOM 5762  O OG1 . THR A 1 771  ? -15.173 -48.943 -46.413  1.00 58.61  ? 2143 THR B OG1 1 
ATOM 5763  C CG2 . THR A 1 771  ? -15.976 -46.662 -46.291  1.00 57.26  ? 2143 THR B CG2 1 
ATOM 5764  N N   . TYR A 1 772  ? -12.028 -49.101 -46.614  1.00 49.29  ? 2144 TYR B N   1 
ATOM 5765  C CA  . TYR A 1 772  ? -11.073 -50.092 -46.100  1.00 49.97  ? 2144 TYR B CA  1 
ATOM 5766  C C   . TYR A 1 772  ? -9.747  -49.475 -45.668  1.00 50.27  ? 2144 TYR B C   1 
ATOM 5767  O O   . TYR A 1 772  ? -9.083  -48.796 -46.448  1.00 49.21  ? 2144 TYR B O   1 
ATOM 5768  C CB  . TYR A 1 772  ? -10.767 -51.203 -47.118  1.00 49.59  ? 2144 TYR B CB  1 
ATOM 5769  C CG  . TYR A 1 772  ? -9.711  -52.173 -46.608  1.00 47.43  ? 2144 TYR B CG  1 
ATOM 5770  C CD1 . TYR A 1 772  ? -9.992  -53.023 -45.550  1.00 48.75  ? 2144 TYR B CD1 1 
ATOM 5771  C CD2 . TYR A 1 772  ? -8.429  -52.211 -47.153  1.00 46.44  ? 2144 TYR B CD2 1 
ATOM 5772  C CE1 . TYR A 1 772  ? -9.038  -53.906 -45.058  1.00 49.88  ? 2144 TYR B CE1 1 
ATOM 5773  C CE2 . TYR A 1 772  ? -7.464  -53.087 -46.665  1.00 47.10  ? 2144 TYR B CE2 1 
ATOM 5774  C CZ  . TYR A 1 772  ? -7.772  -53.934 -45.615  1.00 48.30  ? 2144 TYR B CZ  1 
ATOM 5775  O OH  . TYR A 1 772  ? -6.830  -54.810 -45.116  1.00 47.71  ? 2144 TYR B OH  1 
ATOM 5776  N N   . ASP A 1 773  ? -9.388  -49.710 -44.411  1.00 53.90  ? 2145 ASP B N   1 
ATOM 5777  C CA  . ASP A 1 773  ? -8.014  -49.549 -43.949  1.00 58.85  ? 2145 ASP B CA  1 
ATOM 5778  C C   . ASP A 1 773  ? -7.732  -50.676 -42.939  1.00 60.42  ? 2145 ASP B C   1 
ATOM 5779  O O   . ASP A 1 773  ? -8.629  -51.065 -42.183  1.00 62.07  ? 2145 ASP B O   1 
ATOM 5780  C CB  . ASP A 1 773  ? -7.759  -48.126 -43.401  1.00 62.16  ? 2145 ASP B CB  1 
ATOM 5781  C CG  . ASP A 1 773  ? -7.689  -48.055 -41.880  1.00 64.39  ? 2145 ASP B CG  1 
ATOM 5782  O OD1 . ASP A 1 773  ? -6.583  -47.815 -41.352  1.00 64.39  ? 2145 ASP B OD1 1 
ATOM 5783  O OD2 . ASP A 1 773  ? -8.731  -48.219 -41.215  1.00 71.21  ? 2145 ASP B OD2 1 
ATOM 5784  N N   . PRO A 1 774  ? -6.503  -51.224 -42.944  1.00 58.59  ? 2146 PRO B N   1 
ATOM 5785  C CA  . PRO A 1 774  ? -6.219  -52.408 -42.127  1.00 60.51  ? 2146 PRO B CA  1 
ATOM 5786  C C   . PRO A 1 774  ? -6.282  -52.214 -40.603  1.00 61.33  ? 2146 PRO B C   1 
ATOM 5787  O O   . PRO A 1 774  ? -6.360  -53.202 -39.882  1.00 63.50  ? 2146 PRO B O   1 
ATOM 5788  C CB  . PRO A 1 774  ? -4.799  -52.803 -42.559  1.00 61.21  ? 2146 PRO B CB  1 
ATOM 5789  C CG  . PRO A 1 774  ? -4.201  -51.560 -43.107  1.00 58.66  ? 2146 PRO B CG  1 
ATOM 5790  C CD  . PRO A 1 774  ? -5.330  -50.806 -43.731  1.00 57.24  ? 2146 PRO B CD  1 
ATOM 5791  N N   . ASN A 1 775  ? -6.231  -50.969 -40.127  1.00 62.70  ? 2147 ASN B N   1 
ATOM 5792  C CA  . ASN A 1 775  ? -6.267  -50.672 -38.689  1.00 64.36  ? 2147 ASN B CA  1 
ATOM 5793  C C   . ASN A 1 775  ? -7.649  -50.850 -38.087  1.00 65.37  ? 2147 ASN B C   1 
ATOM 5794  O O   . ASN A 1 775  ? -7.793  -51.490 -37.042  1.00 67.56  ? 2147 ASN B O   1 
ATOM 5795  C CB  . ASN A 1 775  ? -5.775  -49.245 -38.409  1.00 66.34  ? 2147 ASN B CB  1 
ATOM 5796  C CG  . ASN A 1 775  ? -4.342  -49.013 -38.870  1.00 68.53  ? 2147 ASN B CG  1 
ATOM 5797  O OD1 . ASN A 1 775  ? -3.440  -49.781 -38.536  1.00 70.15  ? 2147 ASN B OD1 1 
ATOM 5798  N ND2 . ASN A 1 775  ? -4.127  -47.946 -39.639  1.00 68.93  ? 2147 ASN B ND2 1 
ATOM 5799  N N   . GLN A 1 776  ? -8.654  -50.273 -38.744  1.00 65.44  ? 2148 GLN B N   1 
ATOM 5800  C CA  . GLN A 1 776  ? -10.042 -50.340 -38.282  1.00 65.27  ? 2148 GLN B CA  1 
ATOM 5801  C C   . GLN A 1 776  ? -10.794 -51.509 -38.931  1.00 60.07  ? 2148 GLN B C   1 
ATOM 5802  O O   . GLN A 1 776  ? -10.438 -51.936 -40.029  1.00 56.47  ? 2148 GLN B O   1 
ATOM 5803  C CB  . GLN A 1 776  ? -10.756 -49.017 -38.575  1.00 68.73  ? 2148 GLN B CB  1 
ATOM 5804  C CG  . GLN A 1 776  ? -10.133 -47.796 -37.905  1.00 77.84  ? 2148 GLN B CG  1 
ATOM 5805  C CD  . GLN A 1 776  ? -10.250 -47.818 -36.383  1.00 92.23  ? 2148 GLN B CD  1 
ATOM 5806  O OE1 . GLN A 1 776  ? -11.138 -47.187 -35.808  1.00 103.22 ? 2148 GLN B OE1 1 
ATOM 5807  N NE2 . GLN A 1 776  ? -9.355  -48.551 -35.726  1.00 98.69  ? 2148 GLN B NE2 1 
ATOM 5808  N N   . PRO A 1 777  ? -11.838 -52.032 -38.253  1.00 59.80  ? 2149 PRO B N   1 
ATOM 5809  C CA  . PRO A 1 777  ? -12.609 -53.140 -38.833  1.00 60.08  ? 2149 PRO B CA  1 
ATOM 5810  C C   . PRO A 1 777  ? -13.314 -52.793 -40.151  1.00 57.83  ? 2149 PRO B C   1 
ATOM 5811  O O   . PRO A 1 777  ? -13.592 -51.620 -40.427  1.00 56.03  ? 2149 PRO B O   1 
ATOM 5812  C CB  . PRO A 1 777  ? -13.625 -53.496 -37.731  1.00 60.91  ? 2149 PRO B CB  1 
ATOM 5813  C CG  . PRO A 1 777  ? -13.654 -52.324 -36.816  1.00 60.53  ? 2149 PRO B CG  1 
ATOM 5814  C CD  . PRO A 1 777  ? -12.292 -51.708 -36.887  1.00 60.81  ? 2149 PRO B CD  1 
ATOM 5815  N N   . ILE A 1 778  ? -13.592 -53.828 -40.941  1.00 56.47  ? 2150 ILE B N   1 
ATOM 5816  C CA  . ILE A 1 778  ? -14.069 -53.668 -42.309  1.00 54.97  ? 2150 ILE B CA  1 
ATOM 5817  C C   . ILE A 1 778  ? -15.557 -53.336 -42.290  1.00 54.94  ? 2150 ILE B C   1 
ATOM 5818  O O   . ILE A 1 778  ? -16.359 -54.122 -41.801  1.00 55.99  ? 2150 ILE B O   1 
ATOM 5819  C CB  . ILE A 1 778  ? -13.789 -54.936 -43.162  1.00 54.76  ? 2150 ILE B CB  1 
ATOM 5820  C CG1 . ILE A 1 778  ? -12.277 -55.179 -43.264  1.00 54.41  ? 2150 ILE B CG1 1 
ATOM 5821  C CG2 . ILE A 1 778  ? -14.362 -54.789 -44.570  1.00 55.40  ? 2150 ILE B CG2 1 
ATOM 5822  C CD1 . ILE A 1 778  ? -11.876 -56.525 -43.830  1.00 55.46  ? 2150 ILE B CD1 1 
ATOM 5823  N N   . ILE A 1 779  ? -15.902 -52.161 -42.818  1.00 55.69  ? 2151 ILE B N   1 
ATOM 5824  C CA  . ILE A 1 779  ? -17.293 -51.735 -42.997  1.00 57.75  ? 2151 ILE B CA  1 
ATOM 5825  C C   . ILE A 1 779  ? -17.735 -52.158 -44.396  1.00 59.70  ? 2151 ILE B C   1 
ATOM 5826  O O   . ILE A 1 779  ? -17.262 -51.597 -45.388  1.00 60.63  ? 2151 ILE B O   1 
ATOM 5827  C CB  . ILE A 1 779  ? -17.433 -50.200 -42.848  1.00 57.12  ? 2151 ILE B CB  1 
ATOM 5828  C CG1 . ILE A 1 779  ? -16.999 -49.764 -41.446  1.00 59.27  ? 2151 ILE B CG1 1 
ATOM 5829  C CG2 . ILE A 1 779  ? -18.866 -49.748 -43.106  1.00 56.73  ? 2151 ILE B CG2 1 
ATOM 5830  C CD1 . ILE A 1 779  ? -16.679 -48.291 -41.327  1.00 59.84  ? 2151 ILE B CD1 1 
ATOM 5831  N N   . ARG A 1 780  ? -18.648 -53.126 -44.476  1.00 62.06  ? 2152 ARG B N   1 
ATOM 5832  C CA  . ARG A 1 780  ? -19.090 -53.664 -45.778  1.00 64.82  ? 2152 ARG B CA  1 
ATOM 5833  C C   . ARG A 1 780  ? -20.449 -53.130 -46.241  1.00 62.13  ? 2152 ARG B C   1 
ATOM 5834  O O   . ARG A 1 780  ? -21.201 -52.538 -45.466  1.00 59.94  ? 2152 ARG B O   1 
ATOM 5835  C CB  . ARG A 1 780  ? -19.024 -55.209 -45.848  1.00 71.46  ? 2152 ARG B CB  1 
ATOM 5836  C CG  . ARG A 1 780  ? -19.446 -56.021 -44.620  1.00 76.17  ? 2152 ARG B CG  1 
ATOM 5837  C CD  . ARG A 1 780  ? -18.268 -56.546 -43.796  1.00 78.14  ? 2152 ARG B CD  1 
ATOM 5838  N NE  . ARG A 1 780  ? -17.329 -57.370 -44.572  1.00 78.80  ? 2152 ARG B NE  1 
ATOM 5839  C CZ  . ARG A 1 780  ? -16.307 -58.065 -44.065  1.00 81.07  ? 2152 ARG B CZ  1 
ATOM 5840  N NH1 . ARG A 1 780  ? -16.062 -58.082 -42.752  1.00 84.41  ? 2152 ARG B NH1 1 
ATOM 5841  N NH2 . ARG A 1 780  ? -15.517 -58.763 -44.884  1.00 77.58  ? 2152 ARG B NH2 1 
ATOM 5842  N N   . ILE A 1 781  ? -20.725 -53.342 -47.528  1.00 61.88  ? 2153 ILE B N   1 
ATOM 5843  C CA  . ILE A 1 781  ? -21.958 -52.892 -48.171  1.00 63.02  ? 2153 ILE B CA  1 
ATOM 5844  C C   . ILE A 1 781  ? -23.115 -53.767 -47.691  1.00 64.47  ? 2153 ILE B C   1 
ATOM 5845  O O   . ILE A 1 781  ? -23.294 -54.892 -48.164  1.00 62.12  ? 2153 ILE B O   1 
ATOM 5846  C CB  . ILE A 1 781  ? -21.858 -52.957 -49.716  1.00 64.04  ? 2153 ILE B CB  1 
ATOM 5847  C CG1 . ILE A 1 781  ? -20.717 -52.065 -50.229  1.00 62.75  ? 2153 ILE B CG1 1 
ATOM 5848  C CG2 . ILE A 1 781  ? -23.169 -52.525 -50.372  1.00 65.09  ? 2153 ILE B CG2 1 
ATOM 5849  C CD1 . ILE A 1 781  ? -20.224 -52.456 -51.605  1.00 63.76  ? 2153 ILE B CD1 1 
ATOM 5850  N N   . GLN A 1 782  ? -23.891 -53.239 -46.747  1.00 67.81  ? 2154 GLN B N   1 
ATOM 5851  C CA  . GLN A 1 782  ? -25.031 -53.959 -46.180  1.00 71.87  ? 2154 GLN B CA  1 
ATOM 5852  C C   . GLN A 1 782  ? -26.219 -53.932 -47.140  1.00 70.73  ? 2154 GLN B C   1 
ATOM 5853  O O   . GLN A 1 782  ? -26.874 -54.949 -47.340  1.00 72.77  ? 2154 GLN B O   1 
ATOM 5854  C CB  . GLN A 1 782  ? -25.406 -53.374 -44.814  1.00 76.97  ? 2154 GLN B CB  1 
ATOM 5855  C CG  . GLN A 1 782  ? -26.474 -54.154 -44.061  1.00 82.56  ? 2154 GLN B CG  1 
ATOM 5856  C CD  . GLN A 1 782  ? -27.830 -53.481 -44.116  1.00 89.32  ? 2154 GLN B CD  1 
ATOM 5857  O OE1 . GLN A 1 782  ? -28.061 -52.479 -43.436  1.00 94.22  ? 2154 GLN B OE1 1 
ATOM 5858  N NE2 . GLN A 1 782  ? -28.736 -54.026 -44.925  1.00 92.46  ? 2154 GLN B NE2 1 
ATOM 5859  N N   . SER A 1 783  ? -26.490 -52.769 -47.723  1.00 69.90  ? 2155 SER B N   1 
ATOM 5860  C CA  . SER A 1 783  ? -27.494 -52.640 -48.781  1.00 73.29  ? 2155 SER B CA  1 
ATOM 5861  C C   . SER A 1 783  ? -27.327 -51.314 -49.512  1.00 73.96  ? 2155 SER B C   1 
ATOM 5862  O O   . SER A 1 783  ? -26.659 -50.404 -49.011  1.00 74.59  ? 2155 SER B O   1 
ATOM 5863  C CB  . SER A 1 783  ? -28.911 -52.734 -48.210  1.00 77.04  ? 2155 SER B CB  1 
ATOM 5864  O OG  . SER A 1 783  ? -29.133 -51.751 -47.214  1.00 79.38  ? 2155 SER B OG  1 
ATOM 5865  N N   . ILE A 1 784  ? -27.938 -51.216 -50.691  1.00 73.77  ? 2156 ILE B N   1 
ATOM 5866  C CA  . ILE A 1 784  ? -27.897 -49.995 -51.504  1.00 71.91  ? 2156 ILE B CA  1 
ATOM 5867  C C   . ILE A 1 784  ? -29.286 -49.359 -51.510  1.00 72.27  ? 2156 ILE B C   1 
ATOM 5868  O O   . ILE A 1 784  ? -30.298 -50.057 -51.599  1.00 76.06  ? 2156 ILE B O   1 
ATOM 5869  C CB  . ILE A 1 784  ? -27.420 -50.282 -52.949  1.00 70.90  ? 2156 ILE B CB  1 
ATOM 5870  C CG1 . ILE A 1 784  ? -26.089 -51.052 -52.915  1.00 70.03  ? 2156 ILE B CG1 1 
ATOM 5871  C CG2 . ILE A 1 784  ? -27.279 -48.978 -53.736  1.00 69.11  ? 2156 ILE B CG2 1 
ATOM 5872  C CD1 . ILE A 1 784  ? -25.535 -51.469 -54.260  1.00 70.06  ? 2156 ILE B CD1 1 
ATOM 5873  N N   . ALA A 1 785  ? -29.325 -48.032 -51.418  1.00 69.10  ? 2157 ALA B N   1 
ATOM 5874  C CA  . ALA A 1 785  ? -30.586 -47.299 -51.436  1.00 69.59  ? 2157 ALA B CA  1 
ATOM 5875  C C   . ALA A 1 785  ? -31.181 -47.337 -52.838  1.00 70.22  ? 2157 ALA B C   1 
ATOM 5876  O O   . ALA A 1 785  ? -30.439 -47.219 -53.816  1.00 71.07  ? 2157 ALA B O   1 
ATOM 5877  C CB  . ALA A 1 785  ? -30.372 -45.863 -51.011  1.00 69.49  ? 2157 ALA B CB  1 
ATOM 5878  N N   . PRO A 1 786  ? -32.517 -47.476 -52.940  1.00 69.81  ? 2158 PRO B N   1 
ATOM 5879  C CA  . PRO A 1 786  ? -33.162 -47.656 -54.240  1.00 71.29  ? 2158 PRO B CA  1 
ATOM 5880  C C   . PRO A 1 786  ? -33.282 -46.391 -55.095  1.00 71.54  ? 2158 PRO B C   1 
ATOM 5881  O O   . PRO A 1 786  ? -33.467 -46.506 -56.301  1.00 74.61  ? 2158 PRO B O   1 
ATOM 5882  C CB  . PRO A 1 786  ? -34.551 -48.165 -53.862  1.00 73.03  ? 2158 PRO B CB  1 
ATOM 5883  C CG  . PRO A 1 786  ? -34.832 -47.497 -52.566  1.00 72.68  ? 2158 PRO B CG  1 
ATOM 5884  C CD  . PRO A 1 786  ? -33.511 -47.367 -51.857  1.00 69.82  ? 2158 PRO B CD  1 
ATOM 5885  N N   . SER A 1 787  ? -33.194 -45.207 -54.492  1.00 71.47  ? 2159 SER B N   1 
ATOM 5886  C CA  . SER A 1 787  ? -33.367 -43.953 -55.228  1.00 74.21  ? 2159 SER B CA  1 
ATOM 5887  C C   . SER A 1 787  ? -32.058 -43.180 -55.315  1.00 73.94  ? 2159 SER B C   1 
ATOM 5888  O O   . SER A 1 787  ? -31.406 -42.937 -54.293  1.00 73.42  ? 2159 SER B O   1 
ATOM 5889  C CB  . SER A 1 787  ? -34.445 -43.096 -54.563  1.00 76.63  ? 2159 SER B CB  1 
ATOM 5890  O OG  . SER A 1 787  ? -35.732 -43.652 -54.778  1.00 80.25  ? 2159 SER B OG  1 
ATOM 5891  N N   . LEU A 1 788  ? -31.673 -42.819 -56.541  1.00 76.68  ? 2160 LEU B N   1 
ATOM 5892  C CA  . LEU A 1 788  ? -30.501 -41.979 -56.797  1.00 78.40  ? 2160 LEU B CA  1 
ATOM 5893  C C   . LEU A 1 788  ? -30.949 -40.618 -57.328  1.00 79.16  ? 2160 LEU B C   1 
ATOM 5894  O O   . LEU A 1 788  ? -31.564 -40.543 -58.395  1.00 81.06  ? 2160 LEU B O   1 
ATOM 5895  C CB  . LEU A 1 788  ? -29.571 -42.636 -57.821  1.00 79.26  ? 2160 LEU B CB  1 
ATOM 5896  C CG  . LEU A 1 788  ? -29.143 -44.098 -57.642  1.00 81.69  ? 2160 LEU B CG  1 
ATOM 5897  C CD1 . LEU A 1 788  ? -27.878 -44.333 -58.452  1.00 80.51  ? 2160 LEU B CD1 1 
ATOM 5898  C CD2 . LEU A 1 788  ? -28.910 -44.505 -56.192  1.00 83.02  ? 2160 LEU B CD2 1 
ATOM 5899  N N   . GLN A 1 789  ? -30.648 -39.552 -56.585  1.00 78.24  ? 2161 GLN B N   1 
ATOM 5900  C CA  . GLN A 1 789  ? -30.944 -38.189 -57.029  1.00 82.14  ? 2161 GLN B CA  1 
ATOM 5901  C C   . GLN A 1 789  ? -29.970 -37.796 -58.142  1.00 83.04  ? 2161 GLN B C   1 
ATOM 5902  O O   . GLN A 1 789  ? -28.759 -37.869 -57.950  1.00 87.55  ? 2161 GLN B O   1 
ATOM 5903  C CB  . GLN A 1 789  ? -30.832 -37.194 -55.863  1.00 86.71  ? 2161 GLN B CB  1 
ATOM 5904  C CG  . GLN A 1 789  ? -31.458 -35.823 -56.139  1.00 96.52  ? 2161 GLN B CG  1 
ATOM 5905  C CD  . GLN A 1 789  ? -30.860 -34.688 -55.307  1.00 102.79 ? 2161 GLN B CD  1 
ATOM 5906  O OE1 . GLN A 1 789  ? -30.367 -34.898 -54.196  1.00 108.53 ? 2161 GLN B OE1 1 
ATOM 5907  N NE2 . GLN A 1 789  ? -30.916 -33.471 -55.844  1.00 104.93 ? 2161 GLN B NE2 1 
ATOM 5908  N N   . VAL A 1 790  ? -30.500 -37.398 -59.299  1.00 83.72  ? 2162 VAL B N   1 
ATOM 5909  C CA  . VAL A 1 790  ? -29.686 -36.884 -60.402  1.00 81.43  ? 2162 VAL B CA  1 
ATOM 5910  C C   . VAL A 1 790  ? -29.549 -35.375 -60.236  1.00 82.68  ? 2162 VAL B C   1 
ATOM 5911  O O   . VAL A 1 790  ? -30.525 -34.638 -60.391  1.00 80.49  ? 2162 VAL B O   1 
ATOM 5912  C CB  . VAL A 1 790  ? -30.313 -37.192 -61.780  1.00 86.30  ? 2162 VAL B CB  1 
ATOM 5913  C CG1 . VAL A 1 790  ? -29.433 -36.676 -62.915  1.00 87.00  ? 2162 VAL B CG1 1 
ATOM 5914  C CG2 . VAL A 1 790  ? -30.542 -38.687 -61.944  1.00 90.49  ? 2162 VAL B CG2 1 
ATOM 5915  N N   . ILE A 1 791  ? -28.335 -34.925 -59.919  1.00 88.76  ? 2163 ILE B N   1 
ATOM 5916  C CA  . ILE A 1 791  ? -28.011 -33.497 -59.884  1.00 92.07  ? 2163 ILE B CA  1 
ATOM 5917  C C   . ILE A 1 791  ? -27.924 -33.068 -61.350  1.00 95.02  ? 2163 ILE B C   1 
ATOM 5918  O O   . ILE A 1 791  ? -27.106 -33.605 -62.093  1.00 94.14  ? 2163 ILE B O   1 
ATOM 5919  C CB  . ILE A 1 791  ? -26.663 -33.204 -59.163  1.00 88.99  ? 2163 ILE B CB  1 
ATOM 5920  C CG1 . ILE A 1 791  ? -26.626 -33.772 -57.724  1.00 86.18  ? 2163 ILE B CG1 1 
ATOM 5921  C CG2 . ILE A 1 791  ? -26.361 -31.706 -59.147  1.00 88.09  ? 2163 ILE B CG2 1 
ATOM 5922  C CD1 . ILE A 1 791  ? -27.590 -33.140 -56.736  1.00 87.57  ? 2163 ILE B CD1 1 
ATOM 5923  N N   . THR A 1 792  ? -28.775 -32.131 -61.766  1.00 103.74 ? 2164 THR B N   1 
ATOM 5924  C CA  . THR A 1 792  ? -28.831 -31.696 -63.173  1.00 109.50 ? 2164 THR B CA  1 
ATOM 5925  C C   . THR A 1 792  ? -27.741 -30.660 -63.513  1.00 104.04 ? 2164 THR B C   1 
ATOM 5926  O O   . THR A 1 792  ? -27.957 -29.451 -63.400  1.00 102.21 ? 2164 THR B O   1 
ATOM 5927  C CB  . THR A 1 792  ? -30.233 -31.156 -63.559  1.00 109.67 ? 2164 THR B CB  1 
ATOM 5928  O OG1 . THR A 1 792  ? -30.768 -30.389 -62.474  1.00 111.94 ? 2164 THR B OG1 1 
ATOM 5929  C CG2 . THR A 1 792  ? -31.195 -32.302 -63.889  1.00 105.58 ? 2164 THR B CG2 1 
ATOM 5930  N N   . SER A 1 793  ? -26.568 -31.165 -63.899  1.00 96.34  ? 2165 SER B N   1 
ATOM 5931  C CA  . SER A 1 793  ? -25.489 -30.371 -64.497  1.00 86.24  ? 2165 SER B CA  1 
ATOM 5932  C C   . SER A 1 793  ? -25.390 -30.780 -65.971  1.00 89.22  ? 2165 SER B C   1 
ATOM 5933  O O   . SER A 1 793  ? -26.327 -31.382 -66.509  1.00 85.85  ? 2165 SER B O   1 
ATOM 5934  C CB  . SER A 1 793  ? -24.165 -30.634 -63.765  1.00 81.15  ? 2165 SER B CB  1 
ATOM 5935  O OG  . SER A 1 793  ? -24.341 -30.643 -62.360  1.00 77.61  ? 2165 SER B OG  1 
ATOM 5936  N N   . LYS A 1 794  ? -24.281 -30.442 -66.631  1.00 96.96  ? 2166 LYS B N   1 
ATOM 5937  C CA  . LYS A 1 794  ? -23.999 -30.953 -67.981  1.00 109.95 ? 2166 LYS B CA  1 
ATOM 5938  C C   . LYS A 1 794  ? -23.631 -32.439 -67.930  1.00 111.46 ? 2166 LYS B C   1 
ATOM 5939  O O   . LYS A 1 794  ? -24.156 -33.235 -68.710  1.00 106.06 ? 2166 LYS B O   1 
ATOM 5940  C CB  . LYS A 1 794  ? -22.880 -30.140 -68.663  1.00 113.94 ? 2166 LYS B CB  1 
ATOM 5941  C CG  . LYS A 1 794  ? -22.511 -30.572 -70.087  1.00 115.54 ? 2166 LYS B CG  1 
ATOM 5942  C CD  . LYS A 1 794  ? -23.669 -30.457 -71.072  1.00 114.43 ? 2166 LYS B CD  1 
ATOM 5943  C CE  . LYS A 1 794  ? -23.261 -30.914 -72.464  1.00 113.68 ? 2166 LYS B CE  1 
ATOM 5944  N NZ  . LYS A 1 794  ? -24.404 -30.901 -73.417  1.00 114.11 ? 2166 LYS B NZ  1 
ATOM 5945  N N   . GLN A 1 795  ? -22.727 -32.796 -67.015  1.00 115.27 ? 2167 GLN B N   1 
ATOM 5946  C CA  . GLN A 1 795  ? -22.301 -34.196 -66.824  1.00 118.46 ? 2167 GLN B CA  1 
ATOM 5947  C C   . GLN A 1 795  ? -23.379 -35.060 -66.149  1.00 112.26 ? 2167 GLN B C   1 
ATOM 5948  O O   . GLN A 1 795  ? -23.446 -36.270 -66.393  1.00 116.71 ? 2167 GLN B O   1 
ATOM 5949  C CB  . GLN A 1 795  ? -20.985 -34.275 -66.029  1.00 123.52 ? 2167 GLN B CB  1 
ATOM 5950  C CG  . GLN A 1 795  ? -19.728 -34.041 -66.860  1.00 124.47 ? 2167 GLN B CG  1 
ATOM 5951  C CD  . GLN A 1 795  ? -19.562 -32.599 -67.296  1.00 125.08 ? 2167 GLN B CD  1 
ATOM 5952  O OE1 . GLN A 1 795  ? -19.629 -32.285 -68.486  1.00 125.96 ? 2167 GLN B OE1 1 
ATOM 5953  N NE2 . GLN A 1 795  ? -19.354 -31.710 -66.332  1.00 125.84 ? 2167 GLN B NE2 1 
ATOM 5954  N N   . ARG A 1 796  ? -24.206 -34.433 -65.307  1.00 98.01  ? 2168 ARG B N   1 
ATOM 5955  C CA  . ARG A 1 796  ? -25.352 -35.075 -64.639  1.00 88.00  ? 2168 ARG B CA  1 
ATOM 5956  C C   . ARG A 1 796  ? -24.950 -36.238 -63.720  1.00 77.17  ? 2168 ARG B C   1 
ATOM 5957  O O   . ARG A 1 796  ? -25.263 -37.399 -63.986  1.00 72.51  ? 2168 ARG B O   1 
ATOM 5958  C CB  . ARG A 1 796  ? -26.454 -35.452 -65.656  1.00 92.94  ? 2168 ARG B CB  1 
ATOM 5959  C CG  . ARG A 1 796  ? -27.704 -34.578 -65.558  1.00 98.04  ? 2168 ARG B CG  1 
ATOM 5960  C CD  . ARG A 1 796  ? -28.439 -34.352 -66.874  1.00 104.32 ? 2168 ARG B CD  1 
ATOM 5961  N NE  . ARG A 1 796  ? -28.496 -35.530 -67.742  1.00 108.41 ? 2168 ARG B NE  1 
ATOM 5962  C CZ  . ARG A 1 796  ? -27.660 -35.803 -68.751  1.00 115.18 ? 2168 ARG B CZ  1 
ATOM 5963  N NH1 . ARG A 1 796  ? -26.637 -35.004 -69.066  1.00 117.56 ? 2168 ARG B NH1 1 
ATOM 5964  N NH2 . ARG A 1 796  ? -27.844 -36.910 -69.454  1.00 122.59 ? 2168 ARG B NH2 1 
ATOM 5965  N N   . PRO A 1 797  ? -24.248 -35.916 -62.621  1.00 74.08  ? 2169 PRO B N   1 
ATOM 5966  C CA  . PRO A 1 797  ? -23.848 -36.939 -61.669  1.00 74.57  ? 2169 PRO B CA  1 
ATOM 5967  C C   . PRO A 1 797  ? -25.007 -37.371 -60.788  1.00 74.82  ? 2169 PRO B C   1 
ATOM 5968  O O   . PRO A 1 797  ? -25.881 -36.559 -60.478  1.00 77.95  ? 2169 PRO B O   1 
ATOM 5969  C CB  . PRO A 1 797  ? -22.793 -36.228 -60.825  1.00 74.49  ? 2169 PRO B CB  1 
ATOM 5970  C CG  . PRO A 1 797  ? -23.240 -34.813 -60.818  1.00 75.08  ? 2169 PRO B CG  1 
ATOM 5971  C CD  . PRO A 1 797  ? -23.795 -34.577 -62.194  1.00 75.70  ? 2169 PRO B CD  1 
ATOM 5972  N N   . ARG A 1 798  ? -24.986 -38.637 -60.379  1.00 73.05  ? 2170 ARG B N   1 
ATOM 5973  C CA  . ARG A 1 798  ? -26.017 -39.215 -59.522  1.00 70.03  ? 2170 ARG B CA  1 
ATOM 5974  C C   . ARG A 1 798  ? -25.549 -39.175 -58.073  1.00 66.40  ? 2170 ARG B C   1 
ATOM 5975  O O   . ARG A 1 798  ? -24.346 -39.169 -57.801  1.00 63.30  ? 2170 ARG B O   1 
ATOM 5976  C CB  . ARG A 1 798  ? -26.322 -40.661 -59.934  1.00 70.44  ? 2170 ARG B CB  1 
ATOM 5977  C CG  . ARG A 1 798  ? -26.913 -40.823 -61.330  1.00 71.93  ? 2170 ARG B CG  1 
ATOM 5978  C CD  . ARG A 1 798  ? -25.871 -40.715 -62.434  1.00 73.02  ? 2170 ARG B CD  1 
ATOM 5979  N NE  . ARG A 1 798  ? -26.297 -41.386 -63.660  1.00 76.74  ? 2170 ARG B NE  1 
ATOM 5980  C CZ  . ARG A 1 798  ? -27.088 -40.869 -64.606  1.00 82.07  ? 2170 ARG B CZ  1 
ATOM 5981  N NH1 . ARG A 1 798  ? -27.591 -39.634 -64.513  1.00 85.17  ? 2170 ARG B NH1 1 
ATOM 5982  N NH2 . ARG A 1 798  ? -27.379 -41.608 -65.674  1.00 83.24  ? 2170 ARG B NH2 1 
ATOM 5983  N N   . LYS A 1 799  ? -26.509 -39.149 -57.153  1.00 66.57  ? 2171 LYS B N   1 
ATOM 5984  C CA  . LYS A 1 799  ? -26.232 -39.169 -55.725  1.00 67.22  ? 2171 LYS B CA  1 
ATOM 5985  C C   . LYS A 1 799  ? -26.530 -40.564 -55.180  1.00 68.64  ? 2171 LYS B C   1 
ATOM 5986  O O   . LYS A 1 799  ? -27.632 -40.849 -54.697  1.00 70.25  ? 2171 LYS B O   1 
ATOM 5987  C CB  . LYS A 1 799  ? -27.052 -38.099 -55.010  1.00 71.67  ? 2171 LYS B CB  1 
ATOM 5988  C CG  . LYS A 1 799  ? -26.672 -37.895 -53.554  1.00 74.64  ? 2171 LYS B CG  1 
ATOM 5989  C CD  . LYS A 1 799  ? -27.212 -36.575 -53.025  1.00 80.12  ? 2171 LYS B CD  1 
ATOM 5990  C CE  . LYS A 1 799  ? -26.899 -36.388 -51.551  1.00 83.94  ? 2171 LYS B CE  1 
ATOM 5991  N NZ  . LYS A 1 799  ? -27.493 -35.133 -51.014  1.00 88.85  ? 2171 LYS B NZ  1 
ATOM 5992  N N   . LEU A 1 800  ? -25.530 -41.435 -55.300  1.00 68.32  ? 2172 LEU B N   1 
ATOM 5993  C CA  . LEU A 1 800  ? -25.580 -42.794 -54.757  1.00 67.52  ? 2172 LEU B CA  1 
ATOM 5994  C C   . LEU A 1 800  ? -25.404 -42.749 -53.247  1.00 64.02  ? 2172 LEU B C   1 
ATOM 5995  O O   . LEU A 1 800  ? -24.553 -42.016 -52.745  1.00 61.38  ? 2172 LEU B O   1 
ATOM 5996  C CB  . LEU A 1 800  ? -24.479 -43.659 -55.379  1.00 69.25  ? 2172 LEU B CB  1 
ATOM 5997  C CG  . LEU A 1 800  ? -24.345 -45.117 -54.918  1.00 70.79  ? 2172 LEU B CG  1 
ATOM 5998  C CD1 . LEU A 1 800  ? -25.511 -45.954 -55.413  1.00 73.53  ? 2172 LEU B CD1 1 
ATOM 5999  C CD2 . LEU A 1 800  ? -23.027 -45.697 -55.405  1.00 71.23  ? 2172 LEU B CD2 1 
ATOM 6000  N N   . THR A 1 801  ? -26.194 -43.551 -52.535  1.00 64.58  ? 2173 THR B N   1 
ATOM 6001  C CA  . THR A 1 801  ? -26.148 -43.608 -51.069  1.00 65.13  ? 2173 THR B CA  1 
ATOM 6002  C C   . THR A 1 801  ? -26.242 -45.069 -50.585  1.00 66.30  ? 2173 THR B C   1 
ATOM 6003  O O   . THR A 1 801  ? -27.261 -45.732 -50.773  1.00 68.97  ? 2173 THR B O   1 
ATOM 6004  C CB  . THR A 1 801  ? -27.214 -42.672 -50.421  1.00 66.56  ? 2173 THR B CB  1 
ATOM 6005  O OG1 . THR A 1 801  ? -27.503 -43.094 -49.081  1.00 67.09  ? 2173 THR B OG1 1 
ATOM 6006  C CG2 . THR A 1 801  ? -28.517 -42.614 -51.236  1.00 68.67  ? 2173 THR B CG2 1 
ATOM 6007  N N   . LEU A 1 802  ? -25.149 -45.557 -49.990  1.00 66.25  ? 2174 LEU B N   1 
ATOM 6008  C CA  . LEU A 1 802  ? -25.027 -46.940 -49.515  1.00 67.74  ? 2174 LEU B CA  1 
ATOM 6009  C C   . LEU A 1 802  ? -25.285 -47.009 -48.024  1.00 71.62  ? 2174 LEU B C   1 
ATOM 6010  O O   . LEU A 1 802  ? -25.032 -46.046 -47.301  1.00 75.04  ? 2174 LEU B O   1 
ATOM 6011  C CB  . LEU A 1 802  ? -23.617 -47.484 -49.779  1.00 65.31  ? 2174 LEU B CB  1 
ATOM 6012  C CG  . LEU A 1 802  ? -23.015 -47.295 -51.172  1.00 65.59  ? 2174 LEU B CG  1 
ATOM 6013  C CD1 . LEU A 1 802  ? -21.649 -47.944 -51.227  1.00 64.27  ? 2174 LEU B CD1 1 
ATOM 6014  C CD2 . LEU A 1 802  ? -23.900 -47.872 -52.262  1.00 68.58  ? 2174 LEU B CD2 1 
ATOM 6015  N N   . MET A 1 803  ? -25.776 -48.157 -47.569  1.00 75.97  ? 2175 MET B N   1 
ATOM 6016  C CA  . MET A 1 803  ? -25.920 -48.435 -46.146  1.00 79.04  ? 2175 MET B CA  1 
ATOM 6017  C C   . MET A 1 803  ? -24.799 -49.375 -45.726  1.00 75.50  ? 2175 MET B C   1 
ATOM 6018  O O   . MET A 1 803  ? -24.630 -50.440 -46.321  1.00 77.78  ? 2175 MET B O   1 
ATOM 6019  C CB  . MET A 1 803  ? -27.278 -49.078 -45.866  1.00 87.32  ? 2175 MET B CB  1 
ATOM 6020  C CG  . MET A 1 803  ? -27.594 -49.266 -44.387  1.00 93.42  ? 2175 MET B CG  1 
ATOM 6021  S SD  . MET A 1 803  ? -27.707 -47.714 -43.478  1.00 99.35  ? 2175 MET B SD  1 
ATOM 6022  C CE  . MET A 1 803  ? -29.280 -47.088 -44.073  1.00 97.93  ? 2175 MET B CE  1 
ATOM 6023  N N   . GLY A 1 804  ? -24.044 -48.980 -44.703  1.00 72.15  ? 2176 GLY B N   1 
ATOM 6024  C CA  . GLY A 1 804  ? -22.929 -49.785 -44.198  1.00 72.30  ? 2176 GLY B CA  1 
ATOM 6025  C C   . GLY A 1 804  ? -23.363 -50.836 -43.192  1.00 72.43  ? 2176 GLY B C   1 
ATOM 6026  O O   . GLY A 1 804  ? -24.427 -50.713 -42.580  1.00 76.30  ? 2176 GLY B O   1 
ATOM 6027  N N   . SER A 1 805  ? -22.530 -51.866 -43.019  1.00 69.02  ? 2177 SER B N   1 
ATOM 6028  C CA  . SER A 1 805  ? -22.758 -52.915 -42.009  1.00 66.85  ? 2177 SER B CA  1 
ATOM 6029  C C   . SER A 1 805  ? -22.580 -52.399 -40.585  1.00 65.20  ? 2177 SER B C   1 
ATOM 6030  O O   . SER A 1 805  ? -23.140 -52.957 -39.647  1.00 65.60  ? 2177 SER B O   1 
ATOM 6031  C CB  . SER A 1 805  ? -21.816 -54.099 -42.233  1.00 66.65  ? 2177 SER B CB  1 
ATOM 6032  O OG  . SER A 1 805  ? -20.467 -53.737 -41.997  1.00 64.70  ? 2177 SER B OG  1 
ATOM 6033  N N   . ASN A 1 806  ? -21.767 -51.356 -40.437  1.00 66.24  ? 2178 ASN B N   1 
ATOM 6034  C CA  . ASN A 1 806  ? -21.615 -50.633 -39.166  1.00 71.09  ? 2178 ASN B CA  1 
ATOM 6035  C C   . ASN A 1 806  ? -22.852 -49.854 -38.699  1.00 74.90  ? 2178 ASN B C   1 
ATOM 6036  O O   . ASN A 1 806  ? -22.924 -49.474 -37.529  1.00 76.16  ? 2178 ASN B O   1 
ATOM 6037  C CB  . ASN A 1 806  ? -20.396 -49.691 -39.215  1.00 72.31  ? 2178 ASN B CB  1 
ATOM 6038  C CG  . ASN A 1 806  ? -20.627 -48.439 -40.057  1.00 72.97  ? 2178 ASN B CG  1 
ATOM 6039  O OD1 . ASN A 1 806  ? -20.122 -47.367 -39.727  1.00 75.74  ? 2178 ASN B OD1 1 
ATOM 6040  N ND2 . ASN A 1 806  ? -21.379 -48.568 -41.146  1.00 73.33  ? 2178 ASN B ND2 1 
ATOM 6041  N N   . GLY A 1 807  ? -23.796 -49.598 -39.609  1.00 79.03  ? 2179 GLY B N   1 
ATOM 6042  C CA  . GLY A 1 807  ? -25.043 -48.890 -39.297  1.00 79.84  ? 2179 GLY B CA  1 
ATOM 6043  C C   . GLY A 1 807  ? -25.155 -47.567 -40.034  1.00 79.10  ? 2179 GLY B C   1 
ATOM 6044  O O   . GLY A 1 807  ? -26.236 -47.205 -40.496  1.00 77.14  ? 2179 GLY B O   1 
ATOM 6045  N N   . HIS A 1 808  ? -24.036 -46.850 -40.142  1.00 78.90  ? 2180 HIS B N   1 
ATOM 6046  C CA  . HIS A 1 808  ? -23.998 -45.536 -40.788  1.00 80.04  ? 2180 HIS B CA  1 
ATOM 6047  C C   . HIS A 1 808  ? -24.171 -45.618 -42.307  1.00 76.37  ? 2180 HIS B C   1 
ATOM 6048  O O   . HIS A 1 808  ? -23.705 -46.566 -42.944  1.00 75.96  ? 2180 HIS B O   1 
ATOM 6049  C CB  . HIS A 1 808  ? -22.684 -44.806 -40.465  1.00 85.04  ? 2180 HIS B CB  1 
ATOM 6050  C CG  . HIS A 1 808  ? -22.443 -44.608 -38.998  1.00 97.28  ? 2180 HIS B CG  1 
ATOM 6051  N ND1 . HIS A 1 808  ? -23.462 -44.382 -38.097  1.00 101.29 ? 2180 HIS B ND1 1 
ATOM 6052  C CD2 . HIS A 1 808  ? -21.295 -44.591 -38.277  1.00 103.06 ? 2180 HIS B CD2 1 
ATOM 6053  C CE1 . HIS A 1 808  ? -22.955 -44.244 -36.885  1.00 102.66 ? 2180 HIS B CE1 1 
ATOM 6054  N NE2 . HIS A 1 808  ? -21.642 -44.366 -36.967  1.00 104.71 ? 2180 HIS B NE2 1 
ATOM 6055  N N   . GLU A 1 809  ? -24.852 -44.619 -42.870  1.00 73.68  ? 2181 GLU B N   1 
ATOM 6056  C CA  . GLU A 1 809  ? -24.968 -44.454 -44.322  1.00 69.18  ? 2181 GLU B CA  1 
ATOM 6057  C C   . GLU A 1 809  ? -23.692 -43.848 -44.901  1.00 66.23  ? 2181 GLU B C   1 
ATOM 6058  O O   . GLU A 1 809  ? -22.927 -43.187 -44.193  1.00 67.35  ? 2181 GLU B O   1 
ATOM 6059  C CB  . GLU A 1 809  ? -26.146 -43.546 -44.684  1.00 69.47  ? 2181 GLU B CB  1 
ATOM 6060  C CG  . GLU A 1 809  ? -27.517 -44.154 -44.443  1.00 71.48  ? 2181 GLU B CG  1 
ATOM 6061  C CD  . GLU A 1 809  ? -28.664 -43.258 -44.896  1.00 75.00  ? 2181 GLU B CD  1 
ATOM 6062  O OE1 . GLU A 1 809  ? -28.417 -42.109 -45.327  1.00 75.16  ? 2181 GLU B OE1 1 
ATOM 6063  O OE2 . GLU A 1 809  ? -29.831 -43.705 -44.823  1.00 79.26  ? 2181 GLU B OE2 1 
ATOM 6064  N N   . PHE A 1 810  ? -23.482 -44.080 -46.196  1.00 63.94  ? 2182 PHE B N   1 
ATOM 6065  C CA  . PHE A 1 810  ? -22.315 -43.581 -46.931  1.00 60.13  ? 2182 PHE B CA  1 
ATOM 6066  C C   . PHE A 1 810  ? -22.759 -43.043 -48.285  1.00 61.06  ? 2182 PHE B C   1 
ATOM 6067  O O   . PHE A 1 810  ? -23.157 -43.808 -49.163  1.00 63.12  ? 2182 PHE B O   1 
ATOM 6068  C CB  . PHE A 1 810  ? -21.280 -44.695 -47.123  1.00 56.71  ? 2182 PHE B CB  1 
ATOM 6069  C CG  . PHE A 1 810  ? -20.575 -45.087 -45.858  1.00 53.47  ? 2182 PHE B CG  1 
ATOM 6070  C CD1 . PHE A 1 810  ? -21.150 -46.000 -44.983  1.00 55.38  ? 2182 PHE B CD1 1 
ATOM 6071  C CD2 . PHE A 1 810  ? -19.336 -44.550 -45.543  1.00 49.47  ? 2182 PHE B CD2 1 
ATOM 6072  C CE1 . PHE A 1 810  ? -20.506 -46.359 -43.812  1.00 54.81  ? 2182 PHE B CE1 1 
ATOM 6073  C CE2 . PHE A 1 810  ? -18.686 -44.906 -44.377  1.00 49.65  ? 2182 PHE B CE2 1 
ATOM 6074  C CZ  . PHE A 1 810  ? -19.270 -45.810 -43.509  1.00 52.94  ? 2182 PHE B CZ  1 
ATOM 6075  N N   . VAL A 1 811  ? -22.683 -41.724 -48.442  1.00 62.08  ? 2183 VAL B N   1 
ATOM 6076  C CA  . VAL A 1 811  ? -23.150 -41.037 -49.646  1.00 62.48  ? 2183 VAL B CA  1 
ATOM 6077  C C   . VAL A 1 811  ? -21.974 -40.791 -50.602  1.00 60.47  ? 2183 VAL B C   1 
ATOM 6078  O O   . VAL A 1 811  ? -20.849 -40.533 -50.165  1.00 61.94  ? 2183 VAL B O   1 
ATOM 6079  C CB  . VAL A 1 811  ? -23.849 -39.708 -49.274  1.00 64.31  ? 2183 VAL B CB  1 
ATOM 6080  C CG1 . VAL A 1 811  ? -24.435 -39.025 -50.505  1.00 66.78  ? 2183 VAL B CG1 1 
ATOM 6081  C CG2 . VAL A 1 811  ? -24.949 -39.949 -48.242  1.00 64.87  ? 2183 VAL B CG2 1 
ATOM 6082  N N   . PHE A 1 812  ? -22.244 -40.902 -51.903  1.00 59.41  ? 2184 PHE B N   1 
ATOM 6083  C CA  . PHE A 1 812  ? -21.250 -40.676 -52.958  1.00 59.73  ? 2184 PHE B CA  1 
ATOM 6084  C C   . PHE A 1 812  ? -21.870 -39.925 -54.132  1.00 61.56  ? 2184 PHE B C   1 
ATOM 6085  O O   . PHE A 1 812  ? -23.094 -39.817 -54.241  1.00 64.19  ? 2184 PHE B O   1 
ATOM 6086  C CB  . PHE A 1 812  ? -20.692 -42.005 -53.487  1.00 60.69  ? 2184 PHE B CB  1 
ATOM 6087  C CG  . PHE A 1 812  ? -20.036 -42.862 -52.439  1.00 59.99  ? 2184 PHE B CG  1 
ATOM 6088  C CD1 . PHE A 1 812  ? -20.780 -43.789 -51.713  1.00 58.30  ? 2184 PHE B CD1 1 
ATOM 6089  C CD2 . PHE A 1 812  ? -18.673 -42.754 -52.185  1.00 59.70  ? 2184 PHE B CD2 1 
ATOM 6090  C CE1 . PHE A 1 812  ? -20.181 -44.579 -50.745  1.00 55.82  ? 2184 PHE B CE1 1 
ATOM 6091  C CE2 . PHE A 1 812  ? -18.068 -43.546 -51.218  1.00 57.90  ? 2184 PHE B CE2 1 
ATOM 6092  C CZ  . PHE A 1 812  ? -18.823 -44.459 -50.498  1.00 55.66  ? 2184 PHE B CZ  1 
ATOM 6093  N N   . LEU A 1 813  ? -21.005 -39.416 -55.005  1.00 60.74  ? 2185 LEU B N   1 
ATOM 6094  C CA  . LEU A 1 813  ? -21.406 -38.814 -56.271  1.00 62.09  ? 2185 LEU B CA  1 
ATOM 6095  C C   . LEU A 1 813  ? -20.920 -39.727 -57.380  1.00 61.52  ? 2185 LEU B C   1 
ATOM 6096  O O   . LEU A 1 813  ? -19.715 -39.816 -57.632  1.00 60.34  ? 2185 LEU B O   1 
ATOM 6097  C CB  . LEU A 1 813  ? -20.821 -37.397 -56.422  1.00 65.89  ? 2185 LEU B CB  1 
ATOM 6098  C CG  . LEU A 1 813  ? -21.751 -36.169 -56.381  1.00 68.52  ? 2185 LEU B CG  1 
ATOM 6099  C CD1 . LEU A 1 813  ? -22.961 -36.328 -55.466  1.00 70.24  ? 2185 LEU B CD1 1 
ATOM 6100  C CD2 . LEU A 1 813  ? -20.955 -34.928 -55.993  1.00 68.84  ? 2185 LEU B CD2 1 
ATOM 6101  N N   . LEU A 1 814  ? -21.857 -40.429 -58.016  1.00 62.62  ? 2186 LEU B N   1 
ATOM 6102  C CA  . LEU A 1 814  ? -21.529 -41.342 -59.111  1.00 63.64  ? 2186 LEU B CA  1 
ATOM 6103  C C   . LEU A 1 814  ? -21.457 -40.539 -60.402  1.00 62.88  ? 2186 LEU B C   1 
ATOM 6104  O O   . LEU A 1 814  ? -22.481 -40.094 -60.914  1.00 66.67  ? 2186 LEU B O   1 
ATOM 6105  C CB  . LEU A 1 814  ? -22.569 -42.462 -59.214  1.00 63.87  ? 2186 LEU B CB  1 
ATOM 6106  C CG  . LEU A 1 814  ? -22.402 -43.507 -60.322  1.00 65.84  ? 2186 LEU B CG  1 
ATOM 6107  C CD1 . LEU A 1 814  ? -21.025 -44.152 -60.325  1.00 63.75  ? 2186 LEU B CD1 1 
ATOM 6108  C CD2 . LEU A 1 814  ? -23.483 -44.564 -60.167  1.00 69.26  ? 2186 LEU B CD2 1 
ATOM 6109  N N   . LYS A 1 815  ? -20.244 -40.357 -60.917  1.00 60.95  ? 2187 LYS B N   1 
ATOM 6110  C CA  . LYS A 1 815  ? -19.992 -39.436 -62.020  1.00 64.41  ? 2187 LYS B CA  1 
ATOM 6111  C C   . LYS A 1 815  ? -19.756 -40.166 -63.336  1.00 67.75  ? 2187 LYS B C   1 
ATOM 6112  O O   . LYS A 1 815  ? -19.137 -41.226 -63.358  1.00 66.40  ? 2187 LYS B O   1 
ATOM 6113  C CB  . LYS A 1 815  ? -18.796 -38.545 -61.681  1.00 66.15  ? 2187 LYS B CB  1 
ATOM 6114  C CG  . LYS A 1 815  ? -19.108 -37.527 -60.593  1.00 68.81  ? 2187 LYS B CG  1 
ATOM 6115  C CD  . LYS A 1 815  ? -17.900 -36.680 -60.219  1.00 70.35  ? 2187 LYS B CD  1 
ATOM 6116  C CE  . LYS A 1 815  ? -18.311 -35.277 -59.784  1.00 73.08  ? 2187 LYS B CE  1 
ATOM 6117  N NZ  . LYS A 1 815  ? -17.140 -34.413 -59.458  1.00 72.97  ? 2187 LYS B NZ  1 
ATOM 6118  N N   . GLY A 1 816  ? -20.270 -39.584 -64.420  1.00 75.23  ? 2188 GLY B N   1 
ATOM 6119  C CA  . GLY A 1 816  ? -20.066 -40.083 -65.782  1.00 79.88  ? 2188 GLY B CA  1 
ATOM 6120  C C   . GLY A 1 816  ? -19.356 -39.036 -66.624  1.00 87.31  ? 2188 GLY B C   1 
ATOM 6121  O O   . GLY A 1 816  ? -19.599 -37.832 -66.466  1.00 87.37  ? 2188 GLY B O   1 
ATOM 6122  N N   . HIS A 1 817  ? -18.478 -39.500 -67.516  1.00 92.61  ? 2189 HIS B N   1 
ATOM 6123  C CA  . HIS A 1 817  ? -17.674 -38.633 -68.399  1.00 96.73  ? 2189 HIS B CA  1 
ATOM 6124  C C   . HIS A 1 817  ? -16.739 -37.690 -67.629  1.00 89.19  ? 2189 HIS B C   1 
ATOM 6125  O O   . HIS A 1 817  ? -16.627 -36.509 -67.959  1.00 89.18  ? 2189 HIS B O   1 
ATOM 6126  C CB  . HIS A 1 817  ? -18.574 -37.837 -69.360  1.00 106.74 ? 2189 HIS B CB  1 
ATOM 6127  C CG  . HIS A 1 817  ? -19.719 -38.629 -69.911  1.00 116.31 ? 2189 HIS B CG  1 
ATOM 6128  N ND1 . HIS A 1 817  ? -19.543 -39.704 -70.756  1.00 118.93 ? 2189 HIS B ND1 1 
ATOM 6129  C CD2 . HIS A 1 817  ? -21.055 -38.509 -69.726  1.00 113.09 ? 2189 HIS B CD2 1 
ATOM 6130  C CE1 . HIS A 1 817  ? -20.722 -40.205 -71.078  1.00 114.53 ? 2189 HIS B CE1 1 
ATOM 6131  N NE2 . HIS A 1 817  ? -21.656 -39.501 -70.463  1.00 115.36 ? 2189 HIS B NE2 1 
ATOM 6132  N N   . GLU A 1 818  ? -16.082 -38.226 -66.599  1.00 86.68  ? 2190 GLU B N   1 
ATOM 6133  C CA  . GLU A 1 818  ? -15.117 -37.487 -65.776  1.00 84.94  ? 2190 GLU B CA  1 
ATOM 6134  C C   . GLU A 1 818  ? -14.003 -38.427 -65.308  1.00 84.77  ? 2190 GLU B C   1 
ATOM 6135  O O   . GLU A 1 818  ? -14.257 -39.336 -64.513  1.00 89.19  ? 2190 GLU B O   1 
ATOM 6136  C CB  . GLU A 1 818  ? -15.808 -36.884 -64.552  1.00 87.19  ? 2190 GLU B CB  1 
ATOM 6137  C CG  . GLU A 1 818  ? -16.892 -35.868 -64.866  1.00 94.10  ? 2190 GLU B CG  1 
ATOM 6138  C CD  . GLU A 1 818  ? -17.523 -35.294 -63.617  1.00 98.16  ? 2190 GLU B CD  1 
ATOM 6139  O OE1 . GLU A 1 818  ? -16.776 -34.757 -62.771  1.00 99.39  ? 2190 GLU B OE1 1 
ATOM 6140  O OE2 . GLU A 1 818  ? -18.764 -35.375 -63.485  1.00 101.03 ? 2190 GLU B OE2 1 
ATOM 6141  N N   . ASP A 1 819  ? -12.779 -38.214 -65.797  1.00 85.18  ? 2191 ASP B N   1 
ATOM 6142  C CA  . ASP A 1 819  ? -11.637 -39.073 -65.447  1.00 82.05  ? 2191 ASP B CA  1 
ATOM 6143  C C   . ASP A 1 819  ? -11.122 -38.725 -64.054  1.00 78.01  ? 2191 ASP B C   1 
ATOM 6144  O O   . ASP A 1 819  ? -10.340 -37.785 -63.884  1.00 80.83  ? 2191 ASP B O   1 
ATOM 6145  C CB  . ASP A 1 819  ? -10.510 -38.950 -66.482  1.00 82.10  ? 2191 ASP B CB  1 
ATOM 6146  C CG  . ASP A 1 819  ? -9.328  -39.850 -66.169  1.00 80.98  ? 2191 ASP B CG  1 
ATOM 6147  O OD1 . ASP A 1 819  ? -9.543  -41.055 -65.919  1.00 77.66  ? 2191 ASP B OD1 1 
ATOM 6148  O OD2 . ASP A 1 819  ? -8.179  -39.360 -66.173  1.00 87.67  ? 2191 ASP B OD2 1 
ATOM 6149  N N   . LEU A 1 820  ? -11.546 -39.510 -63.066  1.00 73.32  ? 2192 LEU B N   1 
ATOM 6150  C CA  . LEU A 1 820  ? -11.235 -39.230 -61.664  1.00 67.74  ? 2192 LEU B CA  1 
ATOM 6151  C C   . LEU A 1 820  ? -9.871  -39.756 -61.209  1.00 63.73  ? 2192 LEU B C   1 
ATOM 6152  O O   . LEU A 1 820  ? -9.532  -39.625 -60.038  1.00 62.08  ? 2192 LEU B O   1 
ATOM 6153  C CB  . LEU A 1 820  ? -12.333 -39.798 -60.760  1.00 68.68  ? 2192 LEU B CB  1 
ATOM 6154  C CG  . LEU A 1 820  ? -13.782 -39.449 -61.112  1.00 70.08  ? 2192 LEU B CG  1 
ATOM 6155  C CD1 . LEU A 1 820  ? -14.701 -39.987 -60.035  1.00 69.21  ? 2192 LEU B CD1 1 
ATOM 6156  C CD2 . LEU A 1 820  ? -13.999 -37.952 -61.280  1.00 71.45  ? 2192 LEU B CD2 1 
ATOM 6157  N N   . ARG A 1 821  ? -9.095  -40.347 -62.116  1.00 63.68  ? 2193 ARG B N   1 
ATOM 6158  C CA  . ARG A 1 821  ? -7.773  -40.871 -61.775  1.00 64.77  ? 2193 ARG B CA  1 
ATOM 6159  C C   . ARG A 1 821  ? -6.790  -39.783 -61.329  1.00 65.93  ? 2193 ARG B C   1 
ATOM 6160  O O   . ARG A 1 821  ? -5.984  -40.012 -60.426  1.00 65.96  ? 2193 ARG B O   1 
ATOM 6161  C CB  . ARG A 1 821  ? -7.194  -41.664 -62.947  1.00 65.91  ? 2193 ARG B CB  1 
ATOM 6162  C CG  . ARG A 1 821  ? -7.921  -42.974 -63.208  1.00 65.90  ? 2193 ARG B CG  1 
ATOM 6163  C CD  . ARG A 1 821  ? -7.359  -43.676 -64.428  1.00 67.97  ? 2193 ARG B CD  1 
ATOM 6164  N NE  . ARG A 1 821  ? -7.609  -42.907 -65.643  1.00 69.82  ? 2193 ARG B NE  1 
ATOM 6165  C CZ  . ARG A 1 821  ? -7.104  -43.179 -66.847  1.00 74.18  ? 2193 ARG B CZ  1 
ATOM 6166  N NH1 . ARG A 1 821  ? -6.294  -44.223 -67.042  1.00 75.26  ? 2193 ARG B NH1 1 
ATOM 6167  N NH2 . ARG A 1 821  ? -7.413  -42.392 -67.875  1.00 75.22  ? 2193 ARG B NH2 1 
ATOM 6168  N N   . GLN A 1 822  ? -6.865  -38.606 -61.947  1.00 69.11  ? 2194 GLN B N   1 
ATOM 6169  C CA  . GLN A 1 822  ? -6.049  -37.464 -61.517  1.00 72.37  ? 2194 GLN B CA  1 
ATOM 6170  C C   . GLN A 1 822  ? -6.425  -37.039 -60.106  1.00 62.35  ? 2194 GLN B C   1 
ATOM 6171  O O   . GLN A 1 822  ? -5.551  -36.883 -59.259  1.00 58.35  ? 2194 GLN B O   1 
ATOM 6172  C CB  . GLN A 1 822  ? -6.191  -36.279 -62.475  1.00 84.23  ? 2194 GLN B CB  1 
ATOM 6173  C CG  . GLN A 1 822  ? -5.613  -36.531 -63.863  1.00 94.96  ? 2194 GLN B CG  1 
ATOM 6174  C CD  . GLN A 1 822  ? -5.689  -35.313 -64.768  1.00 99.14  ? 2194 GLN B CD  1 
ATOM 6175  O OE1 . GLN A 1 822  ? -5.527  -34.176 -64.316  1.00 100.11 ? 2194 GLN B OE1 1 
ATOM 6176  N NE2 . GLN A 1 822  ? -5.931  -35.546 -66.057  1.00 96.03  ? 2194 GLN B NE2 1 
ATOM 6177  N N   . ASP A 1 823  ? -7.727  -36.885 -59.862  1.00 59.63  ? 2195 ASP B N   1 
ATOM 6178  C CA  . ASP A 1 823  ? -8.259  -36.575 -58.519  1.00 60.46  ? 2195 ASP B CA  1 
ATOM 6179  C C   . ASP A 1 823  ? -7.838  -37.593 -57.441  1.00 60.87  ? 2195 ASP B C   1 
ATOM 6180  O O   . ASP A 1 823  ? -7.709  -37.231 -56.270  1.00 56.74  ? 2195 ASP B O   1 
ATOM 6181  C CB  . ASP A 1 823  ? -9.795  -36.489 -58.537  1.00 62.31  ? 2195 ASP B CB  1 
ATOM 6182  C CG  . ASP A 1 823  ? -10.320 -35.279 -59.293  1.00 62.44  ? 2195 ASP B CG  1 
ATOM 6183  O OD1 . ASP A 1 823  ? -9.849  -35.019 -60.423  1.00 63.37  ? 2195 ASP B OD1 1 
ATOM 6184  O OD2 . ASP A 1 823  ? -11.227 -34.599 -58.759  1.00 61.08  ? 2195 ASP B OD2 1 
ATOM 6185  N N   . GLU A 1 824  ? -7.653  -38.856 -57.840  1.00 65.79  ? 2196 GLU B N   1 
ATOM 6186  C CA  . GLU A 1 824  ? -7.183  -39.918 -56.936  1.00 66.79  ? 2196 GLU B CA  1 
ATOM 6187  C C   . GLU A 1 824  ? -5.772  -39.623 -56.421  1.00 69.48  ? 2196 GLU B C   1 
ATOM 6188  O O   . GLU A 1 824  ? -5.539  -39.625 -55.211  1.00 74.52  ? 2196 GLU B O   1 
ATOM 6189  C CB  . GLU A 1 824  ? -7.212  -41.299 -57.622  1.00 66.62  ? 2196 GLU B CB  1 
ATOM 6190  C CG  . GLU A 1 824  ? -7.240  -42.472 -56.643  1.00 66.90  ? 2196 GLU B CG  1 
ATOM 6191  C CD  . GLU A 1 824  ? -6.928  -43.826 -57.269  1.00 67.35  ? 2196 GLU B CD  1 
ATOM 6192  O OE1 . GLU A 1 824  ? -6.599  -43.893 -58.476  1.00 67.88  ? 2196 GLU B OE1 1 
ATOM 6193  O OE2 . GLU A 1 824  ? -7.005  -44.837 -56.531  1.00 64.70  ? 2196 GLU B OE2 1 
ATOM 6194  N N   . ARG A 1 825  ? -4.848  -39.346 -57.339  1.00 67.91  ? 2197 ARG B N   1 
ATOM 6195  C CA  . ARG A 1 825  ? -3.453  -39.088 -56.969  1.00 65.52  ? 2197 ARG B CA  1 
ATOM 6196  C C   . ARG A 1 825  ? -3.291  -37.770 -56.216  1.00 62.53  ? 2197 ARG B C   1 
ATOM 6197  O O   . ARG A 1 825  ? -2.351  -37.616 -55.438  1.00 68.99  ? 2197 ARG B O   1 
ATOM 6198  C CB  . ARG A 1 825  ? -2.526  -39.081 -58.192  1.00 67.83  ? 2197 ARG B CB  1 
ATOM 6199  C CG  . ARG A 1 825  ? -2.639  -40.256 -59.147  1.00 72.02  ? 2197 ARG B CG  1 
ATOM 6200  C CD  . ARG A 1 825  ? -2.520  -41.614 -58.474  1.00 76.69  ? 2197 ARG B CD  1 
ATOM 6201  N NE  . ARG A 1 825  ? -3.212  -42.629 -59.268  1.00 80.18  ? 2197 ARG B NE  1 
ATOM 6202  C CZ  . ARG A 1 825  ? -2.746  -43.185 -60.388  1.00 78.71  ? 2197 ARG B CZ  1 
ATOM 6203  N NH1 . ARG A 1 825  ? -1.552  -42.853 -60.882  1.00 76.56  ? 2197 ARG B NH1 1 
ATOM 6204  N NH2 . ARG A 1 825  ? -3.485  -44.097 -61.020  1.00 77.76  ? 2197 ARG B NH2 1 
ATOM 6205  N N   . VAL A 1 826  ? -4.189  -36.819 -56.459  1.00 56.34  ? 2198 VAL B N   1 
ATOM 6206  C CA  . VAL A 1 826  ? -4.163  -35.546 -55.744  1.00 56.35  ? 2198 VAL B CA  1 
ATOM 6207  C C   . VAL A 1 826  ? -4.560  -35.750 -54.284  1.00 56.52  ? 2198 VAL B C   1 
ATOM 6208  O O   . VAL A 1 826  ? -3.984  -35.123 -53.387  1.00 56.82  ? 2198 VAL B O   1 
ATOM 6209  C CB  . VAL A 1 826  ? -5.050  -34.485 -56.435  1.00 56.11  ? 2198 VAL B CB  1 
ATOM 6210  C CG1 . VAL A 1 826  ? -5.212  -33.236 -55.577  1.00 54.37  ? 2198 VAL B CG1 1 
ATOM 6211  C CG2 . VAL A 1 826  ? -4.432  -34.103 -57.772  1.00 58.83  ? 2198 VAL B CG2 1 
ATOM 6212  N N   . MET A 1 827  ? -5.533  -36.624 -54.044  1.00 55.52  ? 2199 MET B N   1 
ATOM 6213  C CA  . MET A 1 827  ? -5.901  -36.987 -52.672  1.00 54.69  ? 2199 MET B CA  1 
ATOM 6214  C C   . MET A 1 827  ? -4.775  -37.734 -51.958  1.00 55.79  ? 2199 MET B C   1 
ATOM 6215  O O   . MET A 1 827  ? -4.614  -37.604 -50.745  1.00 56.30  ? 2199 MET B O   1 
ATOM 6216  C CB  . MET A 1 827  ? -7.189  -37.806 -52.652  1.00 53.23  ? 2199 MET B CB  1 
ATOM 6217  C CG  . MET A 1 827  ? -8.416  -36.972 -52.959  1.00 54.01  ? 2199 MET B CG  1 
ATOM 6218  S SD  . MET A 1 827  ? -8.811  -35.851 -51.612  1.00 52.70  ? 2199 MET B SD  1 
ATOM 6219  C CE  . MET A 1 827  ? -9.658  -34.550 -52.490  1.00 55.32  ? 2199 MET B CE  1 
ATOM 6220  N N   . GLN A 1 828  ? -4.004  -38.509 -52.715  1.00 56.43  ? 2200 GLN B N   1 
ATOM 6221  C CA  . GLN A 1 828  ? -2.785  -39.136 -52.203  1.00 58.19  ? 2200 GLN B CA  1 
ATOM 6222  C C   . GLN A 1 828  ? -1.773  -38.076 -51.739  1.00 58.89  ? 2200 GLN B C   1 
ATOM 6223  O O   . GLN A 1 828  ? -1.172  -38.217 -50.671  1.00 63.29  ? 2200 GLN B O   1 
ATOM 6224  C CB  . GLN A 1 828  ? -2.167  -40.055 -53.270  1.00 60.77  ? 2200 GLN B CB  1 
ATOM 6225  C CG  . GLN A 1 828  ? -1.216  -41.115 -52.734  1.00 62.58  ? 2200 GLN B CG  1 
ATOM 6226  C CD  . GLN A 1 828  ? -0.769  -42.112 -53.795  1.00 64.13  ? 2200 GLN B CD  1 
ATOM 6227  O OE1 . GLN A 1 828  ? -1.300  -42.150 -54.910  1.00 61.12  ? 2200 GLN B OE1 1 
ATOM 6228  N NE2 . GLN A 1 828  ? 0.220   -42.930 -53.446  1.00 66.35  ? 2200 GLN B NE2 1 
ATOM 6229  N N   . LEU A 1 829  ? -1.599  -37.019 -52.536  1.00 54.59  ? 2201 LEU B N   1 
ATOM 6230  C CA  . LEU A 1 829  ? -0.733  -35.896 -52.158  1.00 51.34  ? 2201 LEU B CA  1 
ATOM 6231  C C   . LEU A 1 829  ? -1.231  -35.213 -50.884  1.00 51.38  ? 2201 LEU B C   1 
ATOM 6232  O O   . LEU A 1 829  ? -0.450  -34.980 -49.962  1.00 50.86  ? 2201 LEU B O   1 
ATOM 6233  C CB  . LEU A 1 829  ? -0.609  -34.876 -53.301  1.00 48.69  ? 2201 LEU B CB  1 
ATOM 6234  C CG  . LEU A 1 829  ? -0.034  -33.486 -52.979  1.00 47.89  ? 2201 LEU B CG  1 
ATOM 6235  C CD1 . LEU A 1 829  ? 1.377   -33.583 -52.414  1.00 48.61  ? 2201 LEU B CD1 1 
ATOM 6236  C CD2 . LEU A 1 829  ? -0.059  -32.599 -54.219  1.00 47.74  ? 2201 LEU B CD2 1 
ATOM 6237  N N   . PHE A 1 830  ? -2.523  -34.901 -50.831  1.00 50.84  ? 2202 PHE B N   1 
ATOM 6238  C CA  . PHE A 1 830  ? -3.095  -34.215 -49.662  1.00 51.90  ? 2202 PHE B CA  1 
ATOM 6239  C C   . PHE A 1 830  ? -2.931  -35.029 -48.383  1.00 49.67  ? 2202 PHE B C   1 
ATOM 6240  O O   . PHE A 1 830  ? -2.703  -34.463 -47.312  1.00 46.24  ? 2202 PHE B O   1 
ATOM 6241  C CB  . PHE A 1 830  ? -4.588  -33.876 -49.862  1.00 53.02  ? 2202 PHE B CB  1 
ATOM 6242  C CG  . PHE A 1 830  ? -4.877  -32.887 -50.975  1.00 52.03  ? 2202 PHE B CG  1 
ATOM 6243  C CD1 . PHE A 1 830  ? -3.886  -32.065 -51.535  1.00 51.89  ? 2202 PHE B CD1 1 
ATOM 6244  C CD2 . PHE A 1 830  ? -6.178  -32.753 -51.440  1.00 51.61  ? 2202 PHE B CD2 1 
ATOM 6245  C CE1 . PHE A 1 830  ? -4.196  -31.166 -52.543  1.00 51.85  ? 2202 PHE B CE1 1 
ATOM 6246  C CE2 . PHE A 1 830  ? -6.488  -31.853 -52.445  1.00 51.52  ? 2202 PHE B CE2 1 
ATOM 6247  C CZ  . PHE A 1 830  ? -5.500  -31.057 -52.997  1.00 51.64  ? 2202 PHE B CZ  1 
ATOM 6248  N N   . GLY A 1 831  ? -3.048  -36.350 -48.508  1.00 50.79  ? 2203 GLY B N   1 
ATOM 6249  C CA  . GLY A 1 831  ? -2.847  -37.263 -47.388  1.00 51.22  ? 2203 GLY B CA  1 
ATOM 6250  C C   . GLY A 1 831  ? -1.468  -37.117 -46.781  1.00 49.49  ? 2203 GLY B C   1 
ATOM 6251  O O   . GLY A 1 831  ? -1.334  -37.014 -45.558  1.00 48.11  ? 2203 GLY B O   1 
ATOM 6252  N N   . LEU A 1 832  ? -0.452  -37.097 -47.642  1.00 48.17  ? 2204 LEU B N   1 
ATOM 6253  C CA  . LEU A 1 832  ? 0.925   -36.868 -47.211  1.00 50.88  ? 2204 LEU B CA  1 
ATOM 6254  C C   . LEU A 1 832  ? 1.043   -35.530 -46.494  1.00 52.53  ? 2204 LEU B C   1 
ATOM 6255  O O   . LEU A 1 832  ? 1.587   -35.460 -45.394  1.00 53.38  ? 2204 LEU B O   1 
ATOM 6256  C CB  . LEU A 1 832  ? 1.901   -36.913 -48.400  1.00 52.19  ? 2204 LEU B CB  1 
ATOM 6257  C CG  . LEU A 1 832  ? 3.354   -36.464 -48.159  1.00 53.12  ? 2204 LEU B CG  1 
ATOM 6258  C CD1 . LEU A 1 832  ? 4.004   -37.262 -47.045  1.00 54.36  ? 2204 LEU B CD1 1 
ATOM 6259  C CD2 . LEU A 1 832  ? 4.172   -36.577 -49.436  1.00 54.18  ? 2204 LEU B CD2 1 
ATOM 6260  N N   . VAL A 1 833  ? 0.517   -34.480 -47.121  1.00 53.65  ? 2205 VAL B N   1 
ATOM 6261  C CA  . VAL A 1 833  ? 0.633   -33.116 -46.591  1.00 53.08  ? 2205 VAL B CA  1 
ATOM 6262  C C   . VAL A 1 833  ? -0.011  -33.023 -45.201  1.00 54.07  ? 2205 VAL B C   1 
ATOM 6263  O O   . VAL A 1 833  ? 0.542   -32.373 -44.307  1.00 54.58  ? 2205 VAL B O   1 
ATOM 6264  C CB  . VAL A 1 833  ? 0.041   -32.067 -47.568  1.00 51.37  ? 2205 VAL B CB  1 
ATOM 6265  C CG1 . VAL A 1 833  ? 0.003   -30.677 -46.944  1.00 50.73  ? 2205 VAL B CG1 1 
ATOM 6266  C CG2 . VAL A 1 833  ? 0.859   -32.013 -48.852  1.00 52.14  ? 2205 VAL B CG2 1 
ATOM 6267  N N   . ASN A 1 834  ? -1.160  -33.683 -45.027  1.00 53.35  ? 2206 ASN B N   1 
ATOM 6268  C CA  . ASN A 1 834  ? -1.834  -33.755 -43.721  1.00 54.21  ? 2206 ASN B CA  1 
ATOM 6269  C C   . ASN A 1 834  ? -0.961  -34.420 -42.660  1.00 56.13  ? 2206 ASN B C   1 
ATOM 6270  O O   . ASN A 1 834  ? -0.931  -33.968 -41.512  1.00 56.72  ? 2206 ASN B O   1 
ATOM 6271  C CB  . ASN A 1 834  ? -3.167  -34.508 -43.825  1.00 54.50  ? 2206 ASN B CB  1 
ATOM 6272  C CG  . ASN A 1 834  ? -4.249  -33.696 -44.509  1.00 51.95  ? 2206 ASN B CG  1 
ATOM 6273  O OD1 . ASN A 1 834  ? -4.484  -32.536 -44.174  1.00 51.79  ? 2206 ASN B OD1 1 
ATOM 6274  N ND2 . ASN A 1 834  ? -4.924  -34.307 -45.463  1.00 49.78  ? 2206 ASN B ND2 1 
ATOM 6275  N N   . THR A 1 835  ? -0.265  -35.491 -43.049  1.00 56.94  ? 2207 THR B N   1 
ATOM 6276  C CA  . THR A 1 835  ? 0.707   -36.159 -42.175  1.00 57.40  ? 2207 THR B CA  1 
ATOM 6277  C C   . THR A 1 835  ? 1.817   -35.191 -41.777  1.00 54.74  ? 2207 THR B C   1 
ATOM 6278  O O   . THR A 1 835  ? 2.144   -35.080 -40.601  1.00 54.74  ? 2207 THR B O   1 
ATOM 6279  C CB  . THR A 1 835  ? 1.339   -37.405 -42.843  1.00 60.54  ? 2207 THR B CB  1 
ATOM 6280  O OG1 . THR A 1 835  ? 0.324   -38.183 -43.490  1.00 66.13  ? 2207 THR B OG1 1 
ATOM 6281  C CG2 . THR A 1 835  ? 2.054   -38.281 -41.818  1.00 62.35  ? 2207 THR B CG2 1 
ATOM 6282  N N   . LEU A 1 836  ? 2.369   -34.480 -42.757  1.00 53.48  ? 2208 LEU B N   1 
ATOM 6283  C CA  . LEU A 1 836  ? 3.432   -33.503 -42.500  1.00 55.53  ? 2208 LEU B CA  1 
ATOM 6284  C C   . LEU A 1 836  ? 2.964   -32.396 -41.551  1.00 56.96  ? 2208 LEU B C   1 
ATOM 6285  O O   . LEU A 1 836  ? 3.699   -32.008 -40.642  1.00 57.75  ? 2208 LEU B O   1 
ATOM 6286  C CB  . LEU A 1 836  ? 3.950   -32.887 -43.808  1.00 54.75  ? 2208 LEU B CB  1 
ATOM 6287  C CG  . LEU A 1 836  ? 4.546   -33.827 -44.863  1.00 54.66  ? 2208 LEU B CG  1 
ATOM 6288  C CD1 . LEU A 1 836  ? 4.958   -33.043 -46.097  1.00 53.72  ? 2208 LEU B CD1 1 
ATOM 6289  C CD2 . LEU A 1 836  ? 5.721   -34.608 -44.303  1.00 57.56  ? 2208 LEU B CD2 1 
ATOM 6290  N N   . LEU A 1 837  ? 1.738   -31.913 -41.754  1.00 57.40  ? 2209 LEU B N   1 
ATOM 6291  C CA  . LEU A 1 837  ? 1.156   -30.880 -40.889  1.00 59.35  ? 2209 LEU B CA  1 
ATOM 6292  C C   . LEU A 1 837  ? 0.822   -31.393 -39.481  1.00 61.84  ? 2209 LEU B C   1 
ATOM 6293  O O   . LEU A 1 837  ? 0.961   -30.657 -38.507  1.00 63.80  ? 2209 LEU B O   1 
ATOM 6294  C CB  . LEU A 1 837  ? -0.083  -30.259 -41.546  1.00 57.12  ? 2209 LEU B CB  1 
ATOM 6295  C CG  . LEU A 1 837  ? 0.201   -29.449 -42.816  1.00 55.20  ? 2209 LEU B CG  1 
ATOM 6296  C CD1 . LEU A 1 837  ? -1.066  -29.255 -43.633  1.00 54.49  ? 2209 LEU B CD1 1 
ATOM 6297  C CD2 . LEU A 1 837  ? 0.825   -28.104 -42.480  1.00 57.15  ? 2209 LEU B CD2 1 
ATOM 6298  N N   . ALA A 1 838  ? 0.389   -32.648 -39.374  1.00 61.82  ? 2210 ALA B N   1 
ATOM 6299  C CA  . ALA A 1 838  ? 0.198   -33.287 -38.065  1.00 61.06  ? 2210 ALA B CA  1 
ATOM 6300  C C   . ALA A 1 838  ? 1.514   -33.421 -37.294  1.00 63.19  ? 2210 ALA B C   1 
ATOM 6301  O O   . ALA A 1 838  ? 1.526   -33.295 -36.073  1.00 62.23  ? 2210 ALA B O   1 
ATOM 6302  C CB  . ALA A 1 838  ? -0.447  -34.652 -38.229  1.00 59.81  ? 2210 ALA B CB  1 
ATOM 6303  N N   . ASN A 1 839  ? 2.610   -33.669 -38.016  1.00 66.67  ? 2211 ASN B N   1 
ATOM 6304  C CA  . ASN A 1 839  ? 3.936   -33.873 -37.412  1.00 70.09  ? 2211 ASN B CA  1 
ATOM 6305  C C   . ASN A 1 839  ? 4.658   -32.580 -37.034  1.00 72.02  ? 2211 ASN B C   1 
ATOM 6306  O O   . ASN A 1 839  ? 5.435   -32.581 -36.084  1.00 74.38  ? 2211 ASN B O   1 
ATOM 6307  C CB  . ASN A 1 839  ? 4.831   -34.709 -38.339  1.00 71.84  ? 2211 ASN B CB  1 
ATOM 6308  C CG  . ASN A 1 839  ? 4.282   -36.108 -38.588  1.00 72.26  ? 2211 ASN B CG  1 
ATOM 6309  O OD1 . ASN A 1 839  ? 3.525   -36.652 -37.783  1.00 73.20  ? 2211 ASN B OD1 1 
ATOM 6310  N ND2 . ASN A 1 839  ? 4.664   -36.696 -39.716  1.00 73.21  ? 2211 ASN B ND2 1 
ATOM 6311  N N   . ASP A 1 840  ? 4.424   -31.494 -37.774  1.00 75.30  ? 2212 ASP B N   1 
ATOM 6312  C CA  . ASP A 1 840  ? 4.963   -30.172 -37.407  1.00 77.06  ? 2212 ASP B CA  1 
ATOM 6313  C C   . ASP A 1 840  ? 4.155   -29.618 -36.216  1.00 79.73  ? 2212 ASP B C   1 
ATOM 6314  O O   . ASP A 1 840  ? 2.937   -29.466 -36.339  1.00 78.30  ? 2212 ASP B O   1 
ATOM 6315  C CB  . ASP A 1 840  ? 4.892   -29.204 -38.592  1.00 73.61  ? 2212 ASP B CB  1 
ATOM 6316  C CG  . ASP A 1 840  ? 5.501   -27.845 -38.281  1.00 74.11  ? 2212 ASP B CG  1 
ATOM 6317  O OD1 . ASP A 1 840  ? 6.658   -27.801 -37.820  1.00 80.89  ? 2212 ASP B OD1 1 
ATOM 6318  O OD2 . ASP A 1 840  ? 4.827   -26.817 -38.505  1.00 72.97  ? 2212 ASP B OD2 1 
ATOM 6319  N N   . PRO A 1 841  ? 4.818   -29.324 -35.066  1.00 82.79  ? 2213 PRO B N   1 
ATOM 6320  C CA  . PRO A 1 841  ? 4.100   -28.878 -33.854  1.00 84.31  ? 2213 PRO B CA  1 
ATOM 6321  C C   . PRO A 1 841  ? 3.234   -27.622 -34.012  1.00 83.19  ? 2213 PRO B C   1 
ATOM 6322  O O   . PRO A 1 841  ? 2.083   -27.620 -33.572  1.00 84.41  ? 2213 PRO B O   1 
ATOM 6323  C CB  . PRO A 1 841  ? 5.228   -28.615 -32.849  1.00 86.90  ? 2213 PRO B CB  1 
ATOM 6324  C CG  . PRO A 1 841  ? 6.342   -29.481 -33.298  1.00 88.24  ? 2213 PRO B CG  1 
ATOM 6325  C CD  . PRO A 1 841  ? 6.260   -29.490 -34.794  1.00 85.97  ? 2213 PRO B CD  1 
ATOM 6326  N N   . THR A 1 842  ? 3.783   -26.575 -34.626  1.00 79.38  ? 2214 THR B N   1 
ATOM 6327  C CA  . THR A 1 842  ? 3.043   -25.328 -34.860  1.00 77.16  ? 2214 THR B CA  1 
ATOM 6328  C C   . THR A 1 842  ? 1.776   -25.568 -35.685  1.00 75.00  ? 2214 THR B C   1 
ATOM 6329  O O   . THR A 1 842  ? 0.734   -24.971 -35.415  1.00 74.22  ? 2214 THR B O   1 
ATOM 6330  C CB  . THR A 1 842  ? 3.914   -24.278 -35.581  1.00 77.06  ? 2214 THR B CB  1 
ATOM 6331  O OG1 . THR A 1 842  ? 5.235   -24.293 -35.028  1.00 82.63  ? 2214 THR B OG1 1 
ATOM 6332  C CG2 . THR A 1 842  ? 3.320   -22.874 -35.433  1.00 74.50  ? 2214 THR B CG2 1 
ATOM 6333  N N   . SER A 1 843  ? 1.882   -26.439 -36.687  1.00 75.10  ? 2215 SER B N   1 
ATOM 6334  C CA  . SER A 1 843  ? 0.744   -26.810 -37.531  1.00 73.77  ? 2215 SER B CA  1 
ATOM 6335  C C   . SER A 1 843  ? -0.291  -27.653 -36.775  1.00 77.17  ? 2215 SER B C   1 
ATOM 6336  O O   . SER A 1 843  ? -1.493  -27.497 -36.998  1.00 78.53  ? 2215 SER B O   1 
ATOM 6337  C CB  . SER A 1 843  ? 1.228   -27.552 -38.781  1.00 70.65  ? 2215 SER B CB  1 
ATOM 6338  O OG  . SER A 1 843  ? 2.042   -26.719 -39.590  1.00 69.38  ? 2215 SER B OG  1 
ATOM 6339  N N   . LEU A 1 844  ? 0.179   -28.539 -35.894  1.00 80.42  ? 2216 LEU B N   1 
ATOM 6340  C CA  . LEU A 1 844  ? -0.703  -29.359 -35.046  1.00 81.28  ? 2216 LEU B CA  1 
ATOM 6341  C C   . LEU A 1 844  ? -1.388  -28.509 -33.979  1.00 81.13  ? 2216 LEU B C   1 
ATOM 6342  O O   . LEU A 1 844  ? -2.573  -28.685 -33.703  1.00 79.46  ? 2216 LEU B O   1 
ATOM 6343  C CB  . LEU A 1 844  ? 0.086   -30.495 -34.382  1.00 83.02  ? 2216 LEU B CB  1 
ATOM 6344  C CG  . LEU A 1 844  ? -0.694  -31.564 -33.605  1.00 85.50  ? 2216 LEU B CG  1 
ATOM 6345  C CD1 . LEU A 1 844  ? -1.620  -32.364 -34.508  1.00 87.98  ? 2216 LEU B CD1 1 
ATOM 6346  C CD2 . LEU A 1 844  ? 0.268   -32.500 -32.891  1.00 88.03  ? 2216 LEU B CD2 1 
ATOM 6347  N N   . ARG A 1 845  ? -0.618  -27.606 -33.376  1.00 87.12  ? 2217 ARG B N   1 
ATOM 6348  C CA  . ARG A 1 845  ? -1.128  -26.557 -32.475  1.00 95.39  ? 2217 ARG B CA  1 
ATOM 6349  C C   . ARG A 1 845  ? -2.356  -25.821 -33.038  1.00 92.44  ? 2217 ARG B C   1 
ATOM 6350  O O   . ARG A 1 845  ? -3.311  -25.563 -32.303  1.00 93.59  ? 2217 ARG B O   1 
ATOM 6351  C CB  . ARG A 1 845  ? 0.022   -25.572 -32.141  1.00 104.63 ? 2217 ARG B CB  1 
ATOM 6352  C CG  . ARG A 1 845  ? -0.339  -24.153 -31.703  1.00 106.84 ? 2217 ARG B CG  1 
ATOM 6353  C CD  . ARG A 1 845  ? -0.910  -24.097 -30.299  1.00 112.98 ? 2217 ARG B CD  1 
ATOM 6354  N NE  . ARG A 1 845  ? -1.059  -22.713 -29.846  1.00 119.97 ? 2217 ARG B NE  1 
ATOM 6355  C CZ  . ARG A 1 845  ? -1.443  -22.338 -28.622  1.00 129.42 ? 2217 ARG B CZ  1 
ATOM 6356  N NH1 . ARG A 1 845  ? -1.734  -23.239 -27.680  1.00 130.50 ? 2217 ARG B NH1 1 
ATOM 6357  N NH2 . ARG A 1 845  ? -1.536  -21.041 -28.335  1.00 129.64 ? 2217 ARG B NH2 1 
ATOM 6358  N N   . LYS A 1 846  ? -2.318  -25.502 -34.333  1.00 87.93  ? 2218 LYS B N   1 
ATOM 6359  C CA  . LYS A 1 846  ? -3.382  -24.738 -35.004  1.00 84.47  ? 2218 LYS B CA  1 
ATOM 6360  C C   . LYS A 1 846  ? -4.420  -25.584 -35.779  1.00 78.14  ? 2218 LYS B C   1 
ATOM 6361  O O   . LYS A 1 846  ? -5.255  -25.026 -36.495  1.00 79.91  ? 2218 LYS B O   1 
ATOM 6362  C CB  . LYS A 1 846  ? -2.744  -23.701 -35.939  1.00 88.63  ? 2218 LYS B CB  1 
ATOM 6363  C CG  . LYS A 1 846  ? -1.944  -22.631 -35.207  1.00 94.25  ? 2218 LYS B CG  1 
ATOM 6364  C CD  . LYS A 1 846  ? -1.538  -21.469 -36.115  1.00 97.48  ? 2218 LYS B CD  1 
ATOM 6365  C CE  . LYS A 1 846  ? -0.084  -21.538 -36.556  1.00 96.39  ? 2218 LYS B CE  1 
ATOM 6366  N NZ  . LYS A 1 846  ? 0.320   -20.324 -37.316  1.00 91.56  ? 2218 LYS B NZ  1 
ATOM 6367  N N   . ASN A 1 847  ? -4.387  -26.908 -35.622  1.00 73.45  ? 2219 ASN B N   1 
ATOM 6368  C CA  . ASN A 1 847  ? -5.315  -27.828 -36.306  1.00 73.04  ? 2219 ASN B CA  1 
ATOM 6369  C C   . ASN A 1 847  ? -5.315  -27.730 -37.852  1.00 70.46  ? 2219 ASN B C   1 
ATOM 6370  O O   . ASN A 1 847  ? -6.327  -28.016 -38.502  1.00 70.65  ? 2219 ASN B O   1 
ATOM 6371  C CB  . ASN A 1 847  ? -6.743  -27.683 -35.722  1.00 76.31  ? 2219 ASN B CB  1 
ATOM 6372  C CG  . ASN A 1 847  ? -7.039  -28.704 -34.637  1.00 81.21  ? 2219 ASN B CG  1 
ATOM 6373  O OD1 . ASN A 1 847  ? -7.039  -29.911 -34.892  1.00 81.28  ? 2219 ASN B OD1 1 
ATOM 6374  N ND2 . ASN A 1 847  ? -7.310  -28.226 -33.424  1.00 81.91  ? 2219 ASN B ND2 1 
ATOM 6375  N N   . LEU A 1 848  ? -4.164  -27.376 -38.429  1.00 67.76  ? 2220 LEU B N   1 
ATOM 6376  C CA  . LEU A 1 848  ? -4.039  -27.176 -39.881  1.00 62.29  ? 2220 LEU B CA  1 
ATOM 6377  C C   . LEU A 1 848  ? -4.152  -28.506 -40.633  1.00 62.55  ? 2220 LEU B C   1 
ATOM 6378  O O   . LEU A 1 848  ? -3.424  -29.458 -40.336  1.00 64.36  ? 2220 LEU B O   1 
ATOM 6379  C CB  . LEU A 1 848  ? -2.702  -26.507 -40.234  1.00 59.38  ? 2220 LEU B CB  1 
ATOM 6380  C CG  . LEU A 1 848  ? -2.319  -25.187 -39.554  1.00 59.82  ? 2220 LEU B CG  1 
ATOM 6381  C CD1 . LEU A 1 848  ? -1.022  -24.654 -40.142  1.00 59.54  ? 2220 LEU B CD1 1 
ATOM 6382  C CD2 . LEU A 1 848  ? -3.413  -24.137 -39.672  1.00 60.84  ? 2220 LEU B CD2 1 
ATOM 6383  N N   . SER A 1 849  ? -5.069  -28.566 -41.598  1.00 63.11  ? 2221 SER B N   1 
ATOM 6384  C CA  . SER A 1 849  ? -5.288  -29.776 -42.398  1.00 63.71  ? 2221 SER B CA  1 
ATOM 6385  C C   . SER A 1 849  ? -6.078  -29.492 -43.669  1.00 57.70  ? 2221 SER B C   1 
ATOM 6386  O O   . SER A 1 849  ? -6.809  -28.504 -43.754  1.00 61.76  ? 2221 SER B O   1 
ATOM 6387  C CB  . SER A 1 849  ? -6.038  -30.838 -41.587  1.00 70.09  ? 2221 SER B CB  1 
ATOM 6388  O OG  . SER A 1 849  ? -7.394  -30.470 -41.383  1.00 76.77  ? 2221 SER B OG  1 
ATOM 6389  N N   . ILE A 1 850  ? -5.922  -30.382 -44.641  1.00 52.36  ? 2222 ILE B N   1 
ATOM 6390  C CA  . ILE A 1 850  ? -6.673  -30.348 -45.885  1.00 52.17  ? 2222 ILE B CA  1 
ATOM 6391  C C   . ILE A 1 850  ? -7.827  -31.322 -45.728  1.00 53.93  ? 2222 ILE B C   1 
ATOM 6392  O O   . ILE A 1 850  ? -7.600  -32.498 -45.441  1.00 56.22  ? 2222 ILE B O   1 
ATOM 6393  C CB  . ILE A 1 850  ? -5.804  -30.791 -47.085  1.00 51.45  ? 2222 ILE B CB  1 
ATOM 6394  C CG1 . ILE A 1 850  ? -4.538  -29.932 -47.186  1.00 52.88  ? 2222 ILE B CG1 1 
ATOM 6395  C CG2 . ILE A 1 850  ? -6.583  -30.692 -48.394  1.00 51.10  ? 2222 ILE B CG2 1 
ATOM 6396  C CD1 . ILE A 1 850  ? -3.431  -30.568 -47.997  1.00 54.28  ? 2222 ILE B CD1 1 
ATOM 6397  N N   . GLN A 1 851  ? -9.056  -30.839 -45.918  1.00 57.76  ? 2223 GLN B N   1 
ATOM 6398  C CA  . GLN A 1 851  ? -10.238 -31.720 -45.937  1.00 60.09  ? 2223 GLN B CA  1 
ATOM 6399  C C   . GLN A 1 851  ? -10.238 -32.513 -47.236  1.00 54.29  ? 2223 GLN B C   1 
ATOM 6400  O O   . GLN A 1 851  ? -10.124 -31.938 -48.319  1.00 56.18  ? 2223 GLN B O   1 
ATOM 6401  C CB  . GLN A 1 851  ? -11.561 -30.944 -45.786  1.00 66.24  ? 2223 GLN B CB  1 
ATOM 6402  C CG  . GLN A 1 851  ? -12.379 -31.317 -44.552  1.00 74.92  ? 2223 GLN B CG  1 
ATOM 6403  C CD  . GLN A 1 851  ? -11.869 -30.686 -43.257  1.00 85.44  ? 2223 GLN B CD  1 
ATOM 6404  O OE1 . GLN A 1 851  ? -10.786 -30.088 -43.205  1.00 80.85  ? 2223 GLN B OE1 1 
ATOM 6405  N NE2 . GLN A 1 851  ? -12.660 -30.818 -42.198  1.00 99.52  ? 2223 GLN B NE2 1 
ATOM 6406  N N   . ARG A 1 852  ? -10.371 -33.828 -47.121  1.00 51.33  ? 2224 ARG B N   1 
ATOM 6407  C CA  . ARG A 1 852  ? -10.279 -34.725 -48.276  1.00 49.65  ? 2224 ARG B CA  1 
ATOM 6408  C C   . ARG A 1 852  ? -11.491 -35.638 -48.370  1.00 47.71  ? 2224 ARG B C   1 
ATOM 6409  O O   . ARG A 1 852  ? -12.272 -35.762 -47.429  1.00 47.18  ? 2224 ARG B O   1 
ATOM 6410  C CB  . ARG A 1 852  ? -8.965  -35.520 -48.276  1.00 49.86  ? 2224 ARG B CB  1 
ATOM 6411  C CG  . ARG A 1 852  ? -8.445  -36.005 -46.934  1.00 53.90  ? 2224 ARG B CG  1 
ATOM 6412  C CD  . ARG A 1 852  ? -6.927  -36.102 -46.957  1.00 57.82  ? 2224 ARG B CD  1 
ATOM 6413  N NE  . ARG A 1 852  ? -6.411  -37.052 -47.943  1.00 56.33  ? 2224 ARG B NE  1 
ATOM 6414  C CZ  . ARG A 1 852  ? -6.350  -38.377 -47.784  1.00 56.87  ? 2224 ARG B CZ  1 
ATOM 6415  N NH1 . ARG A 1 852  ? -6.792  -38.972 -46.674  1.00 58.26  ? 2224 ARG B NH1 1 
ATOM 6416  N NH2 . ARG A 1 852  ? -5.850  -39.125 -48.758  1.00 58.79  ? 2224 ARG B NH2 1 
ATOM 6417  N N   . TYR A 1 853  ? -11.650 -36.247 -49.536  1.00 47.94  ? 2225 TYR B N   1 
ATOM 6418  C CA  . TYR A 1 853  ? -12.770 -37.138 -49.803  1.00 52.02  ? 2225 TYR B CA  1 
ATOM 6419  C C   . TYR A 1 853  ? -12.314 -38.356 -50.620  1.00 52.48  ? 2225 TYR B C   1 
ATOM 6420  O O   . TYR A 1 853  ? -11.319 -38.293 -51.354  1.00 53.24  ? 2225 TYR B O   1 
ATOM 6421  C CB  . TYR A 1 853  ? -13.918 -36.371 -50.485  1.00 53.50  ? 2225 TYR B CB  1 
ATOM 6422  C CG  . TYR A 1 853  ? -13.555 -35.647 -51.771  1.00 55.91  ? 2225 TYR B CG  1 
ATOM 6423  C CD1 . TYR A 1 853  ? -13.565 -36.319 -52.998  1.00 58.86  ? 2225 TYR B CD1 1 
ATOM 6424  C CD2 . TYR A 1 853  ? -13.225 -34.283 -51.772  1.00 52.96  ? 2225 TYR B CD2 1 
ATOM 6425  C CE1 . TYR A 1 853  ? -13.240 -35.664 -54.182  1.00 56.86  ? 2225 TYR B CE1 1 
ATOM 6426  C CE2 . TYR A 1 853  ? -12.898 -33.622 -52.955  1.00 50.32  ? 2225 TYR B CE2 1 
ATOM 6427  C CZ  . TYR A 1 853  ? -12.909 -34.318 -54.157  1.00 52.00  ? 2225 TYR B CZ  1 
ATOM 6428  O OH  . TYR A 1 853  ? -12.595 -33.700 -55.343  1.00 48.68  ? 2225 TYR B OH  1 
ATOM 6429  N N   . ALA A 1 854  ? -13.034 -39.464 -50.463  1.00 49.88  ? 2226 ALA B N   1 
ATOM 6430  C CA  . ALA A 1 854  ? -12.672 -40.717 -51.112  1.00 50.30  ? 2226 ALA B CA  1 
ATOM 6431  C C   . ALA A 1 854  ? -12.858 -40.599 -52.613  1.00 50.10  ? 2226 ALA B C   1 
ATOM 6432  O O   . ALA A 1 854  ? -13.885 -40.096 -53.057  1.00 51.92  ? 2226 ALA B O   1 
ATOM 6433  C CB  . ALA A 1 854  ? -13.522 -41.853 -50.571  1.00 52.29  ? 2226 ALA B CB  1 
ATOM 6434  N N   . VAL A 1 855  ? -11.859 -41.040 -53.380  1.00 50.12  ? 2227 VAL B N   1 
ATOM 6435  C CA  . VAL A 1 855  ? -11.927 -41.054 -54.848  1.00 51.23  ? 2227 VAL B CA  1 
ATOM 6436  C C   . VAL A 1 855  ? -11.729 -42.487 -55.344  1.00 54.07  ? 2227 VAL B C   1 
ATOM 6437  O O   . VAL A 1 855  ? -10.681 -43.092 -55.105  1.00 56.61  ? 2227 VAL B O   1 
ATOM 6438  C CB  . VAL A 1 855  ? -10.870 -40.124 -55.482  1.00 50.08  ? 2227 VAL B CB  1 
ATOM 6439  C CG1 . VAL A 1 855  ? -10.967 -40.139 -57.004  1.00 50.39  ? 2227 VAL B CG1 1 
ATOM 6440  C CG2 . VAL A 1 855  ? -11.049 -38.699 -54.976  1.00 49.87  ? 2227 VAL B CG2 1 
ATOM 6441  N N   . ILE A 1 856  ? -12.736 -43.007 -56.046  1.00 54.95  ? 2228 ILE B N   1 
ATOM 6442  C CA  . ILE A 1 856  ? -12.769 -44.400 -56.493  1.00 56.44  ? 2228 ILE B CA  1 
ATOM 6443  C C   . ILE A 1 856  ? -13.038 -44.435 -58.004  1.00 58.85  ? 2228 ILE B C   1 
ATOM 6444  O O   . ILE A 1 856  ? -14.193 -44.357 -58.430  1.00 62.60  ? 2228 ILE B O   1 
ATOM 6445  C CB  . ILE A 1 856  ? -13.884 -45.217 -55.776  1.00 55.82  ? 2228 ILE B CB  1 
ATOM 6446  C CG1 . ILE A 1 856  ? -14.111 -44.768 -54.321  1.00 54.50  ? 2228 ILE B CG1 1 
ATOM 6447  C CG2 . ILE A 1 856  ? -13.596 -46.710 -55.873  1.00 57.56  ? 2228 ILE B CG2 1 
ATOM 6448  C CD1 . ILE A 1 856  ? -12.996 -45.091 -53.359  1.00 55.91  ? 2228 ILE B CD1 1 
ATOM 6449  N N   . PRO A 1 857  ? -11.979 -44.519 -58.828  1.00 58.33  ? 2229 PRO B N   1 
ATOM 6450  C CA  . PRO A 1 857  ? -12.213 -44.737 -60.259  1.00 61.55  ? 2229 PRO B CA  1 
ATOM 6451  C C   . PRO A 1 857  ? -12.904 -46.074 -60.528  1.00 65.52  ? 2229 PRO B C   1 
ATOM 6452  O O   . PRO A 1 857  ? -12.582 -47.061 -59.867  1.00 71.21  ? 2229 PRO B O   1 
ATOM 6453  C CB  . PRO A 1 857  ? -10.800 -44.741 -60.851  1.00 61.68  ? 2229 PRO B CB  1 
ATOM 6454  C CG  . PRO A 1 857  ? -9.990  -43.932 -59.902  1.00 59.32  ? 2229 PRO B CG  1 
ATOM 6455  C CD  . PRO A 1 857  ? -10.576 -44.173 -58.543  1.00 57.57  ? 2229 PRO B CD  1 
ATOM 6456  N N   . LEU A 1 858  ? -13.867 -46.081 -61.451  1.00 66.54  ? 2230 LEU B N   1 
ATOM 6457  C CA  . LEU A 1 858  ? -14.491 -47.318 -61.961  1.00 69.81  ? 2230 LEU B CA  1 
ATOM 6458  C C   . LEU A 1 858  ? -14.113 -47.619 -63.417  1.00 70.74  ? 2230 LEU B C   1 
ATOM 6459  O O   . LEU A 1 858  ? -14.148 -48.779 -63.841  1.00 70.88  ? 2230 LEU B O   1 
ATOM 6460  C CB  . LEU A 1 858  ? -16.014 -47.242 -61.835  1.00 72.25  ? 2230 LEU B CB  1 
ATOM 6461  C CG  . LEU A 1 858  ? -16.586 -47.187 -60.416  1.00 72.91  ? 2230 LEU B CG  1 
ATOM 6462  C CD1 . LEU A 1 858  ? -18.050 -46.780 -60.446  1.00 74.49  ? 2230 LEU B CD1 1 
ATOM 6463  C CD2 . LEU A 1 858  ? -16.426 -48.518 -59.697  1.00 75.07  ? 2230 LEU B CD2 1 
ATOM 6464  N N   . SER A 1 859  ? -13.783 -46.576 -64.179  1.00 71.13  ? 2231 SER B N   1 
ATOM 6465  C CA  . SER A 1 859  ? -13.257 -46.715 -65.532  1.00 75.77  ? 2231 SER B CA  1 
ATOM 6466  C C   . SER A 1 859  ? -12.496 -45.435 -65.897  1.00 76.40  ? 2231 SER B C   1 
ATOM 6467  O O   . SER A 1 859  ? -12.247 -44.595 -65.027  1.00 79.76  ? 2231 SER B O   1 
ATOM 6468  C CB  . SER A 1 859  ? -14.408 -46.972 -66.509  1.00 81.92  ? 2231 SER B CB  1 
ATOM 6469  O OG  . SER A 1 859  ? -15.275 -45.853 -66.584  1.00 87.37  ? 2231 SER B OG  1 
ATOM 6470  N N   . THR A 1 860  ? -12.111 -45.301 -67.166  1.00 78.15  ? 2232 THR B N   1 
ATOM 6471  C CA  . THR A 1 860  ? -11.583 -44.036 -67.698  1.00 76.74  ? 2232 THR B CA  1 
ATOM 6472  C C   . THR A 1 860  ? -12.639 -42.923 -67.702  1.00 76.69  ? 2232 THR B C   1 
ATOM 6473  O O   . THR A 1 860  ? -12.328 -41.776 -67.389  1.00 70.84  ? 2232 THR B O   1 
ATOM 6474  C CB  . THR A 1 860  ? -11.039 -44.205 -69.131  1.00 78.20  ? 2232 THR B CB  1 
ATOM 6475  O OG1 . THR A 1 860  ? -11.981 -44.939 -69.922  1.00 82.72  ? 2232 THR B OG1 1 
ATOM 6476  C CG2 . THR A 1 860  ? -9.717  -44.950 -69.120  1.00 79.18  ? 2232 THR B CG2 1 
ATOM 6477  N N   . ASN A 1 861  ? -13.878 -43.271 -68.059  1.00 85.69  ? 2233 ASN B N   1 
ATOM 6478  C CA  . ASN A 1 861  ? -14.996 -42.311 -68.090  1.00 89.53  ? 2233 ASN B CA  1 
ATOM 6479  C C   . ASN A 1 861  ? -15.561 -41.980 -66.712  1.00 86.32  ? 2233 ASN B C   1 
ATOM 6480  O O   . ASN A 1 861  ? -15.773 -40.812 -66.408  1.00 85.88  ? 2233 ASN B O   1 
ATOM 6481  C CB  . ASN A 1 861  ? -16.146 -42.814 -68.977  1.00 96.61  ? 2233 ASN B CB  1 
ATOM 6482  C CG  . ASN A 1 861  ? -15.920 -42.526 -70.446  1.00 109.58 ? 2233 ASN B CG  1 
ATOM 6483  O OD1 . ASN A 1 861  ? -15.034 -43.101 -71.076  1.00 119.84 ? 2233 ASN B OD1 1 
ATOM 6484  N ND2 . ASN A 1 861  ? -16.727 -41.630 -71.002  1.00 124.06 ? 2233 ASN B ND2 1 
ATOM 6485  N N   . SER A 1 862  ? -15.814 -43.003 -65.895  1.00 83.78  ? 2234 SER B N   1 
ATOM 6486  C CA  . SER A 1 862  ? -16.618 -42.851 -64.673  1.00 80.83  ? 2234 SER B CA  1 
ATOM 6487  C C   . SER A 1 862  ? -15.846 -43.071 -63.367  1.00 75.77  ? 2234 SER B C   1 
ATOM 6488  O O   . SER A 1 862  ? -14.661 -43.415 -63.371  1.00 78.64  ? 2234 SER B O   1 
ATOM 6489  C CB  . SER A 1 862  ? -17.805 -43.815 -64.740  1.00 82.36  ? 2234 SER B CB  1 
ATOM 6490  O OG  . SER A 1 862  ? -17.356 -45.154 -64.803  1.00 85.96  ? 2234 SER B OG  1 
ATOM 6491  N N   . GLY A 1 863  ? -16.542 -42.844 -62.254  1.00 69.47  ? 2235 GLY B N   1 
ATOM 6492  C CA  . GLY A 1 863  ? -16.046 -43.187 -60.921  1.00 67.98  ? 2235 GLY B CA  1 
ATOM 6493  C C   . GLY A 1 863  ? -16.890 -42.603 -59.796  1.00 66.68  ? 2235 GLY B C   1 
ATOM 6494  O O   . GLY A 1 863  ? -17.727 -41.732 -60.032  1.00 71.63  ? 2235 GLY B O   1 
ATOM 6495  N N   . LEU A 1 864  ? -16.674 -43.097 -58.576  1.00 64.61  ? 2236 LEU B N   1 
ATOM 6496  C CA  . LEU A 1 864  ? -17.354 -42.589 -57.374  1.00 63.55  ? 2236 LEU B CA  1 
ATOM 6497  C C   . LEU A 1 864  ? -16.490 -41.554 -56.668  1.00 59.82  ? 2236 LEU B C   1 
ATOM 6498  O O   . LEU A 1 864  ? -15.261 -41.655 -56.676  1.00 57.35  ? 2236 LEU B O   1 
ATOM 6499  C CB  . LEU A 1 864  ? -17.640 -43.716 -56.382  1.00 66.68  ? 2236 LEU B CB  1 
ATOM 6500  C CG  . LEU A 1 864  ? -18.657 -44.785 -56.772  1.00 71.31  ? 2236 LEU B CG  1 
ATOM 6501  C CD1 . LEU A 1 864  ? -18.520 -45.998 -55.866  1.00 72.28  ? 2236 LEU B CD1 1 
ATOM 6502  C CD2 . LEU A 1 864  ? -20.071 -44.232 -56.704  1.00 76.28  ? 2236 LEU B CD2 1 
ATOM 6503  N N   . ILE A 1 865  ? -17.146 -40.580 -56.043  1.00 57.19  ? 2237 ILE B N   1 
ATOM 6504  C CA  . ILE A 1 865  ? -16.477 -39.553 -55.251  1.00 56.11  ? 2237 ILE B CA  1 
ATOM 6505  C C   . ILE A 1 865  ? -17.249 -39.366 -53.957  1.00 57.35  ? 2237 ILE B C   1 
ATOM 6506  O O   . ILE A 1 865  ? -18.479 -39.349 -53.961  1.00 59.95  ? 2237 ILE B O   1 
ATOM 6507  C CB  . ILE A 1 865  ? -16.308 -38.240 -56.066  1.00 58.96  ? 2237 ILE B CB  1 
ATOM 6508  C CG1 . ILE A 1 865  ? -14.885 -38.191 -56.635  1.00 66.54  ? 2237 ILE B CG1 1 
ATOM 6509  C CG2 . ILE A 1 865  ? -16.574 -36.977 -55.240  1.00 55.28  ? 2237 ILE B CG2 1 
ATOM 6510  C CD1 . ILE A 1 865  ? -14.674 -37.192 -57.754  1.00 75.36  ? 2237 ILE B CD1 1 
ATOM 6511  N N   . GLY A 1 866  ? -16.517 -39.219 -52.856  1.00 58.31  ? 2238 GLY B N   1 
ATOM 6512  C CA  . GLY A 1 866  ? -17.115 -39.143 -51.528  1.00 59.68  ? 2238 GLY B CA  1 
ATOM 6513  C C   . GLY A 1 866  ? -17.859 -37.844 -51.270  1.00 59.83  ? 2238 GLY B C   1 
ATOM 6514  O O   . GLY A 1 866  ? -17.295 -36.756 -51.432  1.00 64.05  ? 2238 GLY B O   1 
ATOM 6515  N N   . TRP A 1 867  ? -19.126 -37.963 -50.874  1.00 57.92  ? 2239 TRP B N   1 
ATOM 6516  C CA  . TRP A 1 867  ? -19.940 -36.813 -50.479  1.00 59.57  ? 2239 TRP B CA  1 
ATOM 6517  C C   . TRP A 1 867  ? -19.492 -36.322 -49.111  1.00 58.22  ? 2239 TRP B C   1 
ATOM 6518  O O   . TRP A 1 867  ? -19.588 -37.048 -48.128  1.00 57.08  ? 2239 TRP B O   1 
ATOM 6519  C CB  . TRP A 1 867  ? -21.421 -37.200 -50.422  1.00 65.36  ? 2239 TRP B CB  1 
ATOM 6520  C CG  . TRP A 1 867  ? -22.367 -36.105 -49.971  1.00 69.52  ? 2239 TRP B CG  1 
ATOM 6521  C CD1 . TRP A 1 867  ? -22.750 -35.815 -48.685  1.00 72.20  ? 2239 TRP B CD1 1 
ATOM 6522  C CD2 . TRP A 1 867  ? -23.069 -35.190 -50.811  1.00 71.56  ? 2239 TRP B CD2 1 
ATOM 6523  N NE1 . TRP A 1 867  ? -23.637 -34.766 -48.679  1.00 72.22  ? 2239 TRP B NE1 1 
ATOM 6524  C CE2 . TRP A 1 867  ? -23.850 -34.362 -49.971  1.00 73.71  ? 2239 TRP B CE2 1 
ATOM 6525  C CE3 . TRP A 1 867  ? -23.110 -34.984 -52.195  1.00 73.29  ? 2239 TRP B CE3 1 
ATOM 6526  C CZ2 . TRP A 1 867  ? -24.661 -33.340 -50.472  1.00 78.01  ? 2239 TRP B CZ2 1 
ATOM 6527  C CZ3 . TRP A 1 867  ? -23.915 -33.970 -52.697  1.00 78.13  ? 2239 TRP B CZ3 1 
ATOM 6528  C CH2 . TRP A 1 867  ? -24.680 -33.158 -51.835  1.00 81.97  ? 2239 TRP B CH2 1 
ATOM 6529  N N   . VAL A 1 868  ? -19.014 -35.084 -49.053  1.00 62.06  ? 2240 VAL B N   1 
ATOM 6530  C CA  . VAL A 1 868  ? -18.616 -34.474 -47.792  1.00 61.96  ? 2240 VAL B CA  1 
ATOM 6531  C C   . VAL A 1 868  ? -19.863 -33.807 -47.197  1.00 66.26  ? 2240 VAL B C   1 
ATOM 6532  O O   . VAL A 1 868  ? -20.493 -32.969 -47.859  1.00 63.59  ? 2240 VAL B O   1 
ATOM 6533  C CB  . VAL A 1 868  ? -17.487 -33.441 -47.979  1.00 58.64  ? 2240 VAL B CB  1 
ATOM 6534  C CG1 . VAL A 1 868  ? -16.981 -32.952 -46.627  1.00 57.53  ? 2240 VAL B CG1 1 
ATOM 6535  C CG2 . VAL A 1 868  ? -16.333 -34.041 -48.773  1.00 58.57  ? 2240 VAL B CG2 1 
ATOM 6536  N N   . PRO A 1 869  ? -20.225 -34.169 -45.950  1.00 69.54  ? 2241 PRO B N   1 
ATOM 6537  C CA  . PRO A 1 869  ? -21.433 -33.632 -45.336  1.00 72.14  ? 2241 PRO B CA  1 
ATOM 6538  C C   . PRO A 1 869  ? -21.257 -32.213 -44.798  1.00 70.79  ? 2241 PRO B C   1 
ATOM 6539  O O   . PRO A 1 869  ? -20.132 -31.779 -44.527  1.00 66.01  ? 2241 PRO B O   1 
ATOM 6540  C CB  . PRO A 1 869  ? -21.668 -34.589 -44.175  1.00 74.47  ? 2241 PRO B CB  1 
ATOM 6541  C CG  . PRO A 1 869  ? -20.288 -34.928 -43.731  1.00 73.82  ? 2241 PRO B CG  1 
ATOM 6542  C CD  . PRO A 1 869  ? -19.472 -35.003 -44.994  1.00 71.66  ? 2241 PRO B CD  1 
ATOM 6543  N N   . HIS A 1 870  ? -22.385 -31.526 -44.623  1.00 71.91  ? 2242 HIS B N   1 
ATOM 6544  C CA  . HIS A 1 870  ? -22.449 -30.156 -44.091  1.00 73.42  ? 2242 HIS B CA  1 
ATOM 6545  C C   . HIS A 1 870  ? -21.803 -29.102 -44.995  1.00 69.19  ? 2242 HIS B C   1 
ATOM 6546  O O   . HIS A 1 870  ? -21.482 -28.008 -44.526  1.00 66.24  ? 2242 HIS B O   1 
ATOM 6547  C CB  . HIS A 1 870  ? -21.840 -30.061 -42.677  1.00 78.28  ? 2242 HIS B CB  1 
ATOM 6548  C CG  . HIS A 1 870  ? -22.204 -31.200 -41.776  1.00 82.48  ? 2242 HIS B CG  1 
ATOM 6549  N ND1 . HIS A 1 870  ? -23.473 -31.370 -41.265  1.00 80.40  ? 2242 HIS B ND1 1 
ATOM 6550  C CD2 . HIS A 1 870  ? -21.460 -32.218 -41.285  1.00 83.57  ? 2242 HIS B CD2 1 
ATOM 6551  C CE1 . HIS A 1 870  ? -23.497 -32.449 -40.503  1.00 82.87  ? 2242 HIS B CE1 1 
ATOM 6552  N NE2 . HIS A 1 870  ? -22.288 -32.981 -40.498  1.00 85.20  ? 2242 HIS B NE2 1 
ATOM 6553  N N   . CYS A 1 871  ? -21.641 -29.416 -46.283  1.00 68.69  ? 2243 CYS B N   1 
ATOM 6554  C CA  . CYS A 1 871  ? -20.929 -28.546 -47.226  1.00 66.49  ? 2243 CYS B CA  1 
ATOM 6555  C C   . CYS A 1 871  ? -21.865 -27.948 -48.271  1.00 65.03  ? 2243 CYS B C   1 
ATOM 6556  O O   . CYS A 1 871  ? -22.874 -28.552 -48.636  1.00 67.54  ? 2243 CYS B O   1 
ATOM 6557  C CB  . CYS A 1 871  ? -19.798 -29.315 -47.917  1.00 63.99  ? 2243 CYS B CB  1 
ATOM 6558  S SG  . CYS A 1 871  ? -18.303 -29.441 -46.911  1.00 60.92  ? 2243 CYS B SG  1 
ATOM 6559  N N   . ASP A 1 872  ? -21.514 -26.751 -48.734  1.00 65.83  ? 2244 ASP B N   1 
ATOM 6560  C CA  . ASP A 1 872  ? -22.216 -26.070 -49.832  1.00 66.65  ? 2244 ASP B CA  1 
ATOM 6561  C C   . ASP A 1 872  ? -21.255 -25.099 -50.540  1.00 59.62  ? 2244 ASP B C   1 
ATOM 6562  O O   . ASP A 1 872  ? -20.439 -24.450 -49.879  1.00 55.22  ? 2244 ASP B O   1 
ATOM 6563  C CB  . ASP A 1 872  ? -23.499 -25.351 -49.341  1.00 69.53  ? 2244 ASP B CB  1 
ATOM 6564  C CG  . ASP A 1 872  ? -23.417 -24.875 -47.883  1.00 71.63  ? 2244 ASP B CG  1 
ATOM 6565  O OD1 . ASP A 1 872  ? -24.484 -24.807 -47.235  1.00 70.97  ? 2244 ASP B OD1 1 
ATOM 6566  O OD2 . ASP A 1 872  ? -22.309 -24.567 -47.383  1.00 73.16  ? 2244 ASP B OD2 1 
ATOM 6567  N N   . THR A 1 873  ? -21.345 -25.016 -51.872  1.00 55.75  ? 2245 THR B N   1 
ATOM 6568  C CA  . THR A 1 873  ? -20.431 -24.177 -52.670  1.00 51.20  ? 2245 THR B CA  1 
ATOM 6569  C C   . THR A 1 873  ? -20.506 -22.703 -52.326  1.00 48.69  ? 2245 THR B C   1 
ATOM 6570  O O   . THR A 1 873  ? -21.538 -22.201 -51.878  1.00 50.54  ? 2245 THR B O   1 
ATOM 6571  C CB  . THR A 1 873  ? -20.671 -24.291 -54.190  1.00 51.42  ? 2245 THR B CB  1 
ATOM 6572  O OG1 . THR A 1 873  ? -22.050 -24.052 -54.492  1.00 53.43  ? 2245 THR B OG1 1 
ATOM 6573  C CG2 . THR A 1 873  ? -20.248 -25.646 -54.701  1.00 52.45  ? 2245 THR B CG2 1 
ATOM 6574  N N   . LEU A 1 874  ? -19.393 -22.016 -52.558  1.00 45.39  ? 2246 LEU B N   1 
ATOM 6575  C CA  . LEU A 1 874  ? -19.339 -20.570 -52.421  1.00 44.50  ? 2246 LEU B CA  1 
ATOM 6576  C C   . LEU A 1 874  ? -20.450 -19.938 -53.258  1.00 45.35  ? 2246 LEU B C   1 
ATOM 6577  O O   . LEU A 1 874  ? -21.112 -19.001 -52.807  1.00 45.29  ? 2246 LEU B O   1 
ATOM 6578  C CB  . LEU A 1 874  ? -17.972 -20.043 -52.863  1.00 43.87  ? 2246 LEU B CB  1 
ATOM 6579  C CG  . LEU A 1 874  ? -17.701 -18.564 -52.583  1.00 45.29  ? 2246 LEU B CG  1 
ATOM 6580  C CD1 . LEU A 1 874  ? -17.484 -18.335 -51.101  1.00 46.69  ? 2246 LEU B CD1 1 
ATOM 6581  C CD2 . LEU A 1 874  ? -16.496 -18.071 -53.366  1.00 45.15  ? 2246 LEU B CD2 1 
ATOM 6582  N N   . HIS A 1 875  ? -20.647 -20.473 -54.466  1.00 46.53  ? 2247 HIS B N   1 
ATOM 6583  C CA  . HIS A 1 875  ? -21.717 -20.046 -55.365  1.00 47.31  ? 2247 HIS B CA  1 
ATOM 6584  C C   . HIS A 1 875  ? -23.089 -20.212 -54.726  1.00 51.60  ? 2247 HIS B C   1 
ATOM 6585  O O   . HIS A 1 875  ? -23.899 -19.289 -54.761  1.00 56.28  ? 2247 HIS B O   1 
ATOM 6586  C CB  . HIS A 1 875  ? -21.672 -20.833 -56.679  1.00 46.10  ? 2247 HIS B CB  1 
ATOM 6587  C CG  . HIS A 1 875  ? -22.770 -20.475 -57.629  1.00 46.81  ? 2247 HIS B CG  1 
ATOM 6588  N ND1 . HIS A 1 875  ? -22.651 -19.460 -58.552  1.00 47.81  ? 2247 HIS B ND1 1 
ATOM 6589  C CD2 . HIS A 1 875  ? -24.014 -20.987 -57.789  1.00 47.68  ? 2247 HIS B CD2 1 
ATOM 6590  C CE1 . HIS A 1 875  ? -23.773 -19.366 -59.244  1.00 49.31  ? 2247 HIS B CE1 1 
ATOM 6591  N NE2 . HIS A 1 875  ? -24.617 -20.280 -58.799  1.00 49.00  ? 2247 HIS B NE2 1 
ATOM 6592  N N   . ALA A 1 876  ? -23.348 -21.390 -54.163  1.00 52.31  ? 2248 ALA B N   1 
ATOM 6593  C CA  . ALA A 1 876  ? -24.640 -21.677 -53.530  1.00 54.61  ? 2248 ALA B CA  1 
ATOM 6594  C C   . ALA A 1 876  ? -24.949 -20.714 -52.385  1.00 54.12  ? 2248 ALA B C   1 
ATOM 6595  O O   . ALA A 1 876  ? -26.065 -20.211 -52.272  1.00 53.65  ? 2248 ALA B O   1 
ATOM 6596  C CB  . ALA A 1 876  ? -24.683 -23.115 -53.032  1.00 56.67  ? 2248 ALA B CB  1 
ATOM 6597  N N   . LEU A 1 877  ? -23.946 -20.458 -51.554  1.00 54.51  ? 2249 LEU B N   1 
ATOM 6598  C CA  . LEU A 1 877  ? -24.090 -19.559 -50.412  1.00 57.57  ? 2249 LEU B CA  1 
ATOM 6599  C C   . LEU A 1 877  ? -24.400 -18.134 -50.863  1.00 57.10  ? 2249 LEU B C   1 
ATOM 6600  O O   . LEU A 1 877  ? -25.312 -17.492 -50.334  1.00 59.84  ? 2249 LEU B O   1 
ATOM 6601  C CB  . LEU A 1 877  ? -22.817 -19.569 -49.565  1.00 59.38  ? 2249 LEU B CB  1 
ATOM 6602  C CG  . LEU A 1 877  ? -22.484 -20.899 -48.881  1.00 60.91  ? 2249 LEU B CG  1 
ATOM 6603  C CD1 . LEU A 1 877  ? -21.023 -20.939 -48.467  1.00 59.39  ? 2249 LEU B CD1 1 
ATOM 6604  C CD2 . LEU A 1 877  ? -23.391 -21.127 -47.683  1.00 65.78  ? 2249 LEU B CD2 1 
ATOM 6605  N N   . ILE A 1 878  ? -23.638 -17.653 -51.842  1.00 53.69  ? 2250 ILE B N   1 
ATOM 6606  C CA  . ILE A 1 878  ? -23.861 -16.326 -52.419  1.00 53.68  ? 2250 ILE B CA  1 
ATOM 6607  C C   . ILE A 1 878  ? -25.203 -16.271 -53.158  1.00 54.93  ? 2250 ILE B C   1 
ATOM 6608  O O   . ILE A 1 878  ? -25.902 -15.272 -53.067  1.00 54.47  ? 2250 ILE B O   1 
ATOM 6609  C CB  . ILE A 1 878  ? -22.666 -15.882 -53.308  1.00 51.97  ? 2250 ILE B CB  1 
ATOM 6610  C CG1 . ILE A 1 878  ? -21.475 -15.521 -52.414  1.00 51.17  ? 2250 ILE B CG1 1 
ATOM 6611  C CG2 . ILE A 1 878  ? -23.011 -14.678 -54.183  1.00 51.99  ? 2250 ILE B CG2 1 
ATOM 6612  C CD1 . ILE A 1 878  ? -20.145 -15.512 -53.126  1.00 52.83  ? 2250 ILE B CD1 1 
ATOM 6613  N N   . ARG A 1 879  ? -25.567 -17.341 -53.865  1.00 58.67  ? 2251 ARG B N   1 
ATOM 6614  C CA  . ARG A 1 879  ? -26.874 -17.419 -54.528  1.00 62.26  ? 2251 ARG B CA  1 
ATOM 6615  C C   . ARG A 1 879  ? -27.990 -17.178 -53.527  1.00 64.18  ? 2251 ARG B C   1 
ATOM 6616  O O   . ARG A 1 879  ? -28.859 -16.340 -53.764  1.00 64.29  ? 2251 ARG B O   1 
ATOM 6617  C CB  . ARG A 1 879  ? -27.072 -18.772 -55.222  1.00 66.85  ? 2251 ARG B CB  1 
ATOM 6618  C CG  . ARG A 1 879  ? -28.401 -18.915 -55.964  1.00 74.64  ? 2251 ARG B CG  1 
ATOM 6619  C CD  . ARG A 1 879  ? -28.523 -20.210 -56.773  1.00 82.34  ? 2251 ARG B CD  1 
ATOM 6620  N NE  . ARG A 1 879  ? -27.924 -21.390 -56.131  1.00 85.56  ? 2251 ARG B NE  1 
ATOM 6621  C CZ  . ARG A 1 879  ? -28.394 -22.018 -55.048  1.00 85.98  ? 2251 ARG B CZ  1 
ATOM 6622  N NH1 . ARG A 1 879  ? -29.494 -21.596 -54.423  1.00 94.03  ? 2251 ARG B NH1 1 
ATOM 6623  N NH2 . ARG A 1 879  ? -27.748 -23.082 -54.572  1.00 81.00  ? 2251 ARG B NH2 1 
ATOM 6624  N N   . ASP A 1 880  ? -27.933 -17.898 -52.403  1.00 68.38  ? 2252 ASP B N   1 
ATOM 6625  C CA  . ASP A 1 880  ? -28.955 -17.816 -51.348  1.00 70.89  ? 2252 ASP B CA  1 
ATOM 6626  C C   . ASP A 1 880  ? -29.028 -16.414 -50.758  1.00 70.40  ? 2252 ASP B C   1 
ATOM 6627  O O   . ASP A 1 880  ? -30.093 -15.807 -50.743  1.00 76.09  ? 2252 ASP B O   1 
ATOM 6628  C CB  . ASP A 1 880  ? -28.680 -18.829 -50.225  1.00 72.14  ? 2252 ASP B CB  1 
ATOM 6629  C CG  . ASP A 1 880  ? -28.753 -20.283 -50.697  1.00 74.84  ? 2252 ASP B CG  1 
ATOM 6630  O OD1 . ASP A 1 880  ? -28.996 -20.533 -51.898  1.00 71.42  ? 2252 ASP B OD1 1 
ATOM 6631  O OD2 . ASP A 1 880  ? -28.546 -21.186 -49.859  1.00 82.42  ? 2252 ASP B OD2 1 
ATOM 6632  N N   . TYR A 1 881  ? -27.886 -15.908 -50.293  1.00 67.72  ? 2253 TYR B N   1 
ATOM 6633  C CA  . TYR A 1 881  ? -27.781 -14.550 -49.730  1.00 66.07  ? 2253 TYR B CA  1 
ATOM 6634  C C   . TYR A 1 881  ? -28.306 -13.459 -50.667  1.00 64.10  ? 2253 TYR B C   1 
ATOM 6635  O O   . TYR A 1 881  ? -28.969 -12.528 -50.222  1.00 65.85  ? 2253 TYR B O   1 
ATOM 6636  C CB  . TYR A 1 881  ? -26.323 -14.235 -49.358  1.00 64.07  ? 2253 TYR B CB  1 
ATOM 6637  C CG  . TYR A 1 881  ? -26.104 -12.837 -48.808  1.00 62.55  ? 2253 TYR B CG  1 
ATOM 6638  C CD1 . TYR A 1 881  ? -26.310 -12.557 -47.458  1.00 62.30  ? 2253 TYR B CD1 1 
ATOM 6639  C CD2 . TYR A 1 881  ? -25.690 -11.795 -49.638  1.00 60.90  ? 2253 TYR B CD2 1 
ATOM 6640  C CE1 . TYR A 1 881  ? -26.109 -11.283 -46.953  1.00 62.20  ? 2253 TYR B CE1 1 
ATOM 6641  C CE2 . TYR A 1 881  ? -25.492 -10.518 -49.140  1.00 60.51  ? 2253 TYR B CE2 1 
ATOM 6642  C CZ  . TYR A 1 881  ? -25.700 -10.269 -47.799  1.00 61.94  ? 2253 TYR B CZ  1 
ATOM 6643  O OH  . TYR A 1 881  ? -25.505 -9.005  -47.309  1.00 68.27  ? 2253 TYR B OH  1 
ATOM 6644  N N   . ARG A 1 882  ? -27.989 -13.581 -51.952  1.00 63.97  ? 2254 ARG B N   1 
ATOM 6645  C CA  . ARG A 1 882  ? -28.348 -12.572 -52.950  1.00 65.59  ? 2254 ARG B CA  1 
ATOM 6646  C C   . ARG A 1 882  ? -29.853 -12.530 -53.232  1.00 69.88  ? 2254 ARG B C   1 
ATOM 6647  O O   . ARG A 1 882  ? -30.430 -11.443 -53.293  1.00 71.01  ? 2254 ARG B O   1 
ATOM 6648  C CB  . ARG A 1 882  ? -27.577 -12.811 -54.252  1.00 64.55  ? 2254 ARG B CB  1 
ATOM 6649  C CG  . ARG A 1 882  ? -26.076 -12.519 -54.180  1.00 59.32  ? 2254 ARG B CG  1 
ATOM 6650  C CD  . ARG A 1 882  ? -25.721 -11.115 -54.636  1.00 57.79  ? 2254 ARG B CD  1 
ATOM 6651  N NE  . ARG A 1 882  ? -24.696 -11.117 -55.686  1.00 54.73  ? 2254 ARG B NE  1 
ATOM 6652  C CZ  . ARG A 1 882  ? -23.476 -10.573 -55.614  1.00 52.86  ? 2254 ARG B CZ  1 
ATOM 6653  N NH1 . ARG A 1 882  ? -23.027 -9.947  -54.524  1.00 55.33  ? 2254 ARG B NH1 1 
ATOM 6654  N NH2 . ARG A 1 882  ? -22.684 -10.651 -56.671  1.00 49.07  ? 2254 ARG B NH2 1 
ATOM 6655  N N   . GLU A 1 883  ? -30.481 -13.696 -53.409  1.00 73.12  ? 2255 GLU B N   1 
ATOM 6656  C CA  . GLU A 1 883  ? -31.944 -13.760 -53.595  1.00 80.35  ? 2255 GLU B CA  1 
ATOM 6657  C C   . GLU A 1 883  ? -32.696 -13.394 -52.311  1.00 79.24  ? 2255 GLU B C   1 
ATOM 6658  O O   . GLU A 1 883  ? -33.782 -12.817 -52.373  1.00 86.67  ? 2255 GLU B O   1 
ATOM 6659  C CB  . GLU A 1 883  ? -32.405 -15.128 -54.138  1.00 87.27  ? 2255 GLU B CB  1 
ATOM 6660  C CG  . GLU A 1 883  ? -32.520 -16.267 -53.127  1.00 95.87  ? 2255 GLU B CG  1 
ATOM 6661  C CD  . GLU A 1 883  ? -33.106 -17.535 -53.735  1.00 111.27 ? 2255 GLU B CD  1 
ATOM 6662  O OE1 . GLU A 1 883  ? -32.675 -17.925 -54.844  1.00 124.12 ? 2255 GLU B OE1 1 
ATOM 6663  O OE2 . GLU A 1 883  ? -33.994 -18.150 -53.101  1.00 116.34 ? 2255 GLU B OE2 1 
ATOM 6664  N N   . LYS A 1 884  ? -32.106 -13.729 -51.164  1.00 75.02  ? 2256 LYS B N   1 
ATOM 6665  C CA  . LYS A 1 884  ? -32.651 -13.378 -49.847  1.00 75.09  ? 2256 LYS B CA  1 
ATOM 6666  C C   . LYS A 1 884  ? -32.625 -11.865 -49.602  1.00 72.91  ? 2256 LYS B C   1 
ATOM 6667  O O   . LYS A 1 884  ? -33.592 -11.305 -49.090  1.00 73.62  ? 2256 LYS B O   1 
ATOM 6668  C CB  . LYS A 1 884  ? -31.868 -14.116 -48.757  1.00 78.84  ? 2256 LYS B CB  1 
ATOM 6669  C CG  . LYS A 1 884  ? -32.468 -14.083 -47.364  1.00 89.69  ? 2256 LYS B CG  1 
ATOM 6670  C CD  . LYS A 1 884  ? -31.828 -15.161 -46.490  1.00 96.80  ? 2256 LYS B CD  1 
ATOM 6671  C CE  . LYS A 1 884  ? -32.255 -15.066 -45.031  1.00 106.88 ? 2256 LYS B CE  1 
ATOM 6672  N NZ  . LYS A 1 884  ? -31.597 -13.944 -44.300  1.00 109.49 ? 2256 LYS B NZ  1 
ATOM 6673  N N   . LYS A 1 885  ? -31.529 -11.211 -49.996  1.00 72.39  ? 2257 LYS B N   1 
ATOM 6674  C CA  . LYS A 1 885  ? -31.386 -9.742  -49.904  1.00 72.86  ? 2257 LYS B CA  1 
ATOM 6675  C C   . LYS A 1 885  ? -31.865 -8.969  -51.155  1.00 71.72  ? 2257 LYS B C   1 
ATOM 6676  O O   . LYS A 1 885  ? -31.638 -7.761  -51.252  1.00 74.17  ? 2257 LYS B O   1 
ATOM 6677  C CB  . LYS A 1 885  ? -29.926 -9.375  -49.577  1.00 72.95  ? 2257 LYS B CB  1 
ATOM 6678  C CG  . LYS A 1 885  ? -29.518 -9.716  -48.151  1.00 77.05  ? 2257 LYS B CG  1 
ATOM 6679  C CD  . LYS A 1 885  ? -30.014 -8.676  -47.148  1.00 85.07  ? 2257 LYS B CD  1 
ATOM 6680  C CE  . LYS A 1 885  ? -30.661 -9.307  -45.917  1.00 92.79  ? 2257 LYS B CE  1 
ATOM 6681  N NZ  . LYS A 1 885  ? -29.727 -10.114 -45.084  1.00 95.12  ? 2257 LYS B NZ  1 
ATOM 6682  N N   . LYS A 1 886  ? -32.527 -9.659  -52.090  1.00 70.19  ? 2258 LYS B N   1 
ATOM 6683  C CA  . LYS A 1 886  ? -33.081 -9.063  -53.318  1.00 69.22  ? 2258 LYS B CA  1 
ATOM 6684  C C   . LYS A 1 886  ? -32.026 -8.400  -54.218  1.00 64.38  ? 2258 LYS B C   1 
ATOM 6685  O O   . LYS A 1 886  ? -32.313 -7.412  -54.900  1.00 61.72  ? 2258 LYS B O   1 
ATOM 6686  C CB  . LYS A 1 886  ? -34.217 -8.077  -52.990  1.00 73.75  ? 2258 LYS B CB  1 
ATOM 6687  C CG  . LYS A 1 886  ? -35.258 -8.590  -52.002  1.00 78.09  ? 2258 LYS B CG  1 
ATOM 6688  C CD  . LYS A 1 886  ? -36.114 -9.693  -52.599  1.00 82.65  ? 2258 LYS B CD  1 
ATOM 6689  C CE  . LYS A 1 886  ? -37.003 -10.327 -51.544  1.00 88.42  ? 2258 LYS B CE  1 
ATOM 6690  N NZ  . LYS A 1 886  ? -38.055 -11.185 -52.157  1.00 92.86  ? 2258 LYS B NZ  1 
ATOM 6691  N N   . ILE A 1 887  ? -30.813 -8.955  -54.214  1.00 63.65  ? 2259 ILE B N   1 
ATOM 6692  C CA  . ILE A 1 887  ? -29.729 -8.508  -55.089  1.00 64.51  ? 2259 ILE B CA  1 
ATOM 6693  C C   . ILE A 1 887  ? -29.674 -9.450  -56.294  1.00 64.42  ? 2259 ILE B C   1 
ATOM 6694  O O   . ILE A 1 887  ? -29.779 -10.675 -56.146  1.00 62.12  ? 2259 ILE B O   1 
ATOM 6695  C CB  . ILE A 1 887  ? -28.356 -8.515  -54.374  1.00 64.90  ? 2259 ILE B CB  1 
ATOM 6696  C CG1 . ILE A 1 887  ? -28.398 -7.681  -53.087  1.00 69.19  ? 2259 ILE B CG1 1 
ATOM 6697  C CG2 . ILE A 1 887  ? -27.266 -7.963  -55.295  1.00 63.84  ? 2259 ILE B CG2 1 
ATOM 6698  C CD1 . ILE A 1 887  ? -27.234 -7.930  -52.146  1.00 68.59  ? 2259 ILE B CD1 1 
ATOM 6699  N N   . LEU A 1 888  ? -29.501 -8.865  -57.480  1.00 64.06  ? 2260 LEU B N   1 
ATOM 6700  C CA  . LEU A 1 888  ? -29.393 -9.623  -58.727  1.00 63.26  ? 2260 LEU B CA  1 
ATOM 6701  C C   . LEU A 1 888  ? -28.115 -10.463 -58.717  1.00 60.16  ? 2260 LEU B C   1 
ATOM 6702  O O   . LEU A 1 888  ? -27.023 -9.923  -58.570  1.00 57.46  ? 2260 LEU B O   1 
ATOM 6703  C CB  . LEU A 1 888  ? -29.407 -8.662  -59.920  1.00 64.55  ? 2260 LEU B CB  1 
ATOM 6704  C CG  . LEU A 1 888  ? -29.197 -9.190  -61.342  1.00 65.37  ? 2260 LEU B CG  1 
ATOM 6705  C CD1 . LEU A 1 888  ? -29.994 -10.448 -61.640  1.00 68.27  ? 2260 LEU B CD1 1 
ATOM 6706  C CD2 . LEU A 1 888  ? -29.577 -8.099  -62.324  1.00 67.30  ? 2260 LEU B CD2 1 
ATOM 6707  N N   . LEU A 1 889  ? -28.271 -11.780 -58.861  1.00 61.07  ? 2261 LEU B N   1 
ATOM 6708  C CA  . LEU A 1 889  ? -27.179 -12.747 -58.668  1.00 59.34  ? 2261 LEU B CA  1 
ATOM 6709  C C   . LEU A 1 889  ? -25.906 -12.405 -59.422  1.00 57.64  ? 2261 LEU B C   1 
ATOM 6710  O O   . LEU A 1 889  ? -24.827 -12.373 -58.830  1.00 54.74  ? 2261 LEU B O   1 
ATOM 6711  C CB  . LEU A 1 889  ? -27.630 -14.160 -59.070  1.00 59.95  ? 2261 LEU B CB  1 
ATOM 6712  C CG  . LEU A 1 889  ? -26.597 -15.292 -58.970  1.00 58.32  ? 2261 LEU B CG  1 
ATOM 6713  C CD1 . LEU A 1 889  ? -25.920 -15.326 -57.608  1.00 58.29  ? 2261 LEU B CD1 1 
ATOM 6714  C CD2 . LEU A 1 889  ? -27.260 -16.625 -59.258  1.00 59.14  ? 2261 LEU B CD2 1 
ATOM 6715  N N   . ASN A 1 890  ? -26.045 -12.165 -60.723  1.00 60.38  ? 2262 ASN B N   1 
ATOM 6716  C CA  . ASN A 1 890  ? -24.914 -11.820 -61.585  1.00 62.86  ? 2262 ASN B CA  1 
ATOM 6717  C C   . ASN A 1 890  ? -24.916 -10.317 -61.875  1.00 61.57  ? 2262 ASN B C   1 
ATOM 6718  O O   . ASN A 1 890  ? -24.988 -9.885  -63.029  1.00 66.07  ? 2262 ASN B O   1 
ATOM 6719  C CB  . ASN A 1 890  ? -24.957 -12.666 -62.864  1.00 66.55  ? 2262 ASN B CB  1 
ATOM 6720  C CG  . ASN A 1 890  ? -24.648 -14.133 -62.598  1.00 68.70  ? 2262 ASN B CG  1 
ATOM 6721  O OD1 . ASN A 1 890  ? -23.637 -14.465 -61.970  1.00 67.52  ? 2262 ASN B OD1 1 
ATOM 6722  N ND2 . ASN A 1 890  ? -25.516 -15.019 -63.074  1.00 70.78  ? 2262 ASN B ND2 1 
ATOM 6723  N N   . ILE A 1 891  ? -24.829 -9.533  -60.802  1.00 56.77  ? 2263 ILE B N   1 
ATOM 6724  C CA  . ILE A 1 891  ? -24.897 -8.067  -60.885  1.00 54.03  ? 2263 ILE B CA  1 
ATOM 6725  C C   . ILE A 1 891  ? -23.606 -7.451  -61.434  1.00 51.50  ? 2263 ILE B C   1 
ATOM 6726  O O   . ILE A 1 891  ? -23.668 -6.504  -62.216  1.00 52.63  ? 2263 ILE B O   1 
ATOM 6727  C CB  . ILE A 1 891  ? -25.315 -7.403  -59.535  1.00 53.23  ? 2263 ILE B CB  1 
ATOM 6728  C CG1 . ILE A 1 891  ? -25.492 -5.880  -59.674  1.00 55.34  ? 2263 ILE B CG1 1 
ATOM 6729  C CG2 . ILE A 1 891  ? -24.321 -7.685  -58.410  1.00 51.26  ? 2263 ILE B CG2 1 
ATOM 6730  C CD1 . ILE A 1 891  ? -26.585 -5.440  -60.632  1.00 57.28  ? 2263 ILE B CD1 1 
ATOM 6731  N N   . GLU A 1 892  ? -22.450 -7.985  -61.041  1.00 50.53  ? 2264 GLU B N   1 
ATOM 6732  C CA  . GLU A 1 892  ? -21.156 -7.436  -61.479  1.00 49.95  ? 2264 GLU B CA  1 
ATOM 6733  C C   . GLU A 1 892  ? -20.998 -7.629  -62.973  1.00 51.87  ? 2264 GLU B C   1 
ATOM 6734  O O   . GLU A 1 892  ? -20.622 -6.705  -63.691  1.00 53.05  ? 2264 GLU B O   1 
ATOM 6735  C CB  . GLU A 1 892  ? -19.982 -8.111  -60.774  1.00 48.01  ? 2264 GLU B CB  1 
ATOM 6736  C CG  . GLU A 1 892  ? -19.927 -7.879  -59.271  1.00 49.47  ? 2264 GLU B CG  1 
ATOM 6737  C CD  . GLU A 1 892  ? -20.695 -8.906  -58.452  1.00 51.27  ? 2264 GLU B CD  1 
ATOM 6738  O OE1 . GLU A 1 892  ? -21.454 -9.719  -59.032  1.00 52.17  ? 2264 GLU B OE1 1 
ATOM 6739  O OE2 . GLU A 1 892  ? -20.560 -8.896  -57.208  1.00 49.56  ? 2264 GLU B OE2 1 
ATOM 6740  N N   . HIS A 1 893  ? -21.298 -8.847  -63.417  1.00 51.79  ? 2265 HIS B N   1 
ATOM 6741  C CA  . HIS A 1 893  ? -21.350 -9.206  -64.836  1.00 50.88  ? 2265 HIS B CA  1 
ATOM 6742  C C   . HIS A 1 893  ? -22.231 -8.235  -65.637  1.00 49.42  ? 2265 HIS B C   1 
ATOM 6743  O O   . HIS A 1 893  ? -21.826 -7.760  -66.692  1.00 47.85  ? 2265 HIS B O   1 
ATOM 6744  C CB  . HIS A 1 893  ? -21.890 -10.639 -64.975  1.00 53.81  ? 2265 HIS B CB  1 
ATOM 6745  C CG  . HIS A 1 893  ? -21.574 -11.302 -66.280  1.00 56.17  ? 2265 HIS B CG  1 
ATOM 6746  N ND1 . HIS A 1 893  ? -21.094 -10.621 -67.379  1.00 59.35  ? 2265 HIS B ND1 1 
ATOM 6747  C CD2 . HIS A 1 893  ? -21.706 -12.593 -66.668  1.00 56.10  ? 2265 HIS B CD2 1 
ATOM 6748  C CE1 . HIS A 1 893  ? -20.928 -11.466 -68.380  1.00 59.70  ? 2265 HIS B CE1 1 
ATOM 6749  N NE2 . HIS A 1 893  ? -21.295 -12.668 -67.975  1.00 58.02  ? 2265 HIS B NE2 1 
ATOM 6750  N N   . ARG A 1 894  ? -23.421 -7.934  -65.122  1.00 51.53  ? 2266 ARG B N   1 
ATOM 6751  C CA  . ARG A 1 894  ? -24.366 -7.057  -65.819  1.00 55.57  ? 2266 ARG B CA  1 
ATOM 6752  C C   . ARG A 1 894  ? -23.858 -5.615  -65.871  1.00 54.15  ? 2266 ARG B C   1 
ATOM 6753  O O   . ARG A 1 894  ? -23.973 -4.958  -66.905  1.00 55.45  ? 2266 ARG B O   1 
ATOM 6754  C CB  . ARG A 1 894  ? -25.762 -7.121  -65.182  1.00 60.79  ? 2266 ARG B CB  1 
ATOM 6755  C CG  . ARG A 1 894  ? -26.878 -6.652  -66.115  1.00 70.98  ? 2266 ARG B CG  1 
ATOM 6756  C CD  . ARG A 1 894  ? -28.278 -6.750  -65.507  1.00 79.15  ? 2266 ARG B CD  1 
ATOM 6757  N NE  . ARG A 1 894  ? -29.161 -7.711  -66.184  1.00 81.79  ? 2266 ARG B NE  1 
ATOM 6758  C CZ  . ARG A 1 894  ? -29.163 -9.041  -66.016  1.00 89.44  ? 2266 ARG B CZ  1 
ATOM 6759  N NH1 . ARG A 1 894  ? -28.310 -9.652  -65.190  1.00 92.57  ? 2266 ARG B NH1 1 
ATOM 6760  N NH2 . ARG A 1 894  ? -30.035 -9.785  -66.694  1.00 92.46  ? 2266 ARG B NH2 1 
ATOM 6761  N N   . ILE A 1 895  ? -23.298 -5.136  -64.760  1.00 53.02  ? 2267 ILE B N   1 
ATOM 6762  C CA  . ILE A 1 895  ? -22.673 -3.805  -64.690  1.00 52.29  ? 2267 ILE B CA  1 
ATOM 6763  C C   . ILE A 1 895  ? -21.528 -3.662  -65.698  1.00 52.53  ? 2267 ILE B C   1 
ATOM 6764  O O   . ILE A 1 895  ? -21.430 -2.645  -66.390  1.00 53.36  ? 2267 ILE B O   1 
ATOM 6765  C CB  . ILE A 1 895  ? -22.146 -3.501  -63.262  1.00 51.09  ? 2267 ILE B CB  1 
ATOM 6766  C CG1 . ILE A 1 895  ? -23.316 -3.211  -62.320  1.00 50.94  ? 2267 ILE B CG1 1 
ATOM 6767  C CG2 . ILE A 1 895  ? -21.184 -2.312  -63.251  1.00 52.45  ? 2267 ILE B CG2 1 
ATOM 6768  C CD1 . ILE A 1 895  ? -22.963 -3.335  -60.852  1.00 50.80  ? 2267 ILE B CD1 1 
ATOM 6769  N N   . MET A 1 896  ? -20.662 -4.674  -65.751  1.00 50.95  ? 2268 MET B N   1 
ATOM 6770  C CA  . MET A 1 896  ? -19.485 -4.652  -66.618  1.00 50.48  ? 2268 MET B CA  1 
ATOM 6771  C C   . MET A 1 896  ? -19.862 -4.552  -68.091  1.00 53.20  ? 2268 MET B C   1 
ATOM 6772  O O   . MET A 1 896  ? -19.338 -3.695  -68.807  1.00 57.87  ? 2268 MET B O   1 
ATOM 6773  C CB  . MET A 1 896  ? -18.615 -5.890  -66.390  1.00 50.31  ? 2268 MET B CB  1 
ATOM 6774  C CG  . MET A 1 896  ? -17.884 -5.895  -65.059  1.00 49.95  ? 2268 MET B CG  1 
ATOM 6775  S SD  . MET A 1 896  ? -17.116 -7.481  -64.685  1.00 50.88  ? 2268 MET B SD  1 
ATOM 6776  C CE  . MET A 1 896  ? -15.652 -7.385  -65.710  1.00 52.30  ? 2268 MET B CE  1 
ATOM 6777  N N   . LEU A 1 897  ? -20.770 -5.420  -68.532  1.00 53.96  ? 2269 LEU B N   1 
ATOM 6778  C CA  . LEU A 1 897  ? -21.234 -5.416  -69.924  1.00 55.68  ? 2269 LEU B CA  1 
ATOM 6779  C C   . LEU A 1 897  ? -21.987 -4.138  -70.281  1.00 57.95  ? 2269 LEU B C   1 
ATOM 6780  O O   . LEU A 1 897  ? -21.858 -3.640  -71.400  1.00 59.55  ? 2269 LEU B O   1 
ATOM 6781  C CB  . LEU A 1 897  ? -22.117 -6.631  -70.216  1.00 56.10  ? 2269 LEU B CB  1 
ATOM 6782  C CG  . LEU A 1 897  ? -21.459 -8.012  -70.164  1.00 55.69  ? 2269 LEU B CG  1 
ATOM 6783  C CD1 . LEU A 1 897  ? -22.536 -9.070  -70.336  1.00 57.79  ? 2269 LEU B CD1 1 
ATOM 6784  C CD2 . LEU A 1 897  ? -20.380 -8.178  -71.223  1.00 55.71  ? 2269 LEU B CD2 1 
ATOM 6785  N N   . ARG A 1 898  ? -22.766 -3.614  -69.335  1.00 59.96  ? 2270 ARG B N   1 
ATOM 6786  C CA  . ARG A 1 898  ? -23.434 -2.324  -69.514  1.00 63.55  ? 2270 ARG B CA  1 
ATOM 6787  C C   . ARG A 1 898  ? -22.425 -1.218  -69.795  1.00 60.46  ? 2270 ARG B C   1 
ATOM 6788  O O   . ARG A 1 898  ? -22.652 -0.390  -70.674  1.00 65.09  ? 2270 ARG B O   1 
ATOM 6789  C CB  . ARG A 1 898  ? -24.282 -1.960  -68.292  1.00 69.42  ? 2270 ARG B CB  1 
ATOM 6790  C CG  . ARG A 1 898  ? -24.981 -0.616  -68.417  1.00 78.26  ? 2270 ARG B CG  1 
ATOM 6791  C CD  . ARG A 1 898  ? -26.210 -0.529  -67.542  1.00 89.35  ? 2270 ARG B CD  1 
ATOM 6792  N NE  . ARG A 1 898  ? -27.403 -1.093  -68.191  1.00 103.71 ? 2270 ARG B NE  1 
ATOM 6793  C CZ  . ARG A 1 898  ? -27.948 -2.297  -67.957  1.00 112.64 ? 2270 ARG B CZ  1 
ATOM 6794  N NH1 . ARG A 1 898  ? -27.439 -3.150  -67.066  1.00 115.34 ? 2270 ARG B NH1 1 
ATOM 6795  N NH2 . ARG A 1 898  ? -29.050 -2.650  -68.620  1.00 115.15 ? 2270 ARG B NH2 1 
ATOM 6796  N N   . MET A 1 899  ? -21.321 -1.209  -69.051  1.00 55.59  ? 2271 MET B N   1 
ATOM 6797  C CA  . MET A 1 899  ? -20.250 -0.237  -69.271  1.00 53.45  ? 2271 MET B CA  1 
ATOM 6798  C C   . MET A 1 899  ? -19.517 -0.511  -70.576  1.00 53.04  ? 2271 MET B C   1 
ATOM 6799  O O   . MET A 1 899  ? -19.320 0.398   -71.382  1.00 53.83  ? 2271 MET B O   1 
ATOM 6800  C CB  . MET A 1 899  ? -19.246 -0.253  -68.112  1.00 49.80  ? 2271 MET B CB  1 
ATOM 6801  C CG  . MET A 1 899  ? -18.114 0.748   -68.278  1.00 47.31  ? 2271 MET B CG  1 
ATOM 6802  S SD  . MET A 1 899  ? -17.155 0.987   -66.784  1.00 43.56  ? 2271 MET B SD  1 
ATOM 6803  C CE  . MET A 1 899  ? -15.793 1.945   -67.443  1.00 43.48  ? 2271 MET B CE  1 
ATOM 6804  N N   . ALA A 1 900  ? -19.103 -1.761  -70.758  1.00 53.53  ? 2272 ALA B N   1 
ATOM 6805  C CA  . ALA A 1 900  ? -18.277 -2.164  -71.892  1.00 56.53  ? 2272 ALA B CA  1 
ATOM 6806  C C   . ALA A 1 900  ? -18.808 -3.465  -72.500  1.00 56.60  ? 2272 ALA B C   1 
ATOM 6807  O O   . ALA A 1 900  ? -18.481 -4.556  -72.015  1.00 53.75  ? 2272 ALA B O   1 
ATOM 6808  C CB  . ALA A 1 900  ? -16.834 -2.332  -71.446  1.00 58.00  ? 2272 ALA B CB  1 
ATOM 6809  N N   . PRO A 1 901  ? -19.631 -3.361  -73.563  1.00 57.30  ? 2273 PRO B N   1 
ATOM 6810  C CA  . PRO A 1 901  ? -20.197 -4.576  -74.152  1.00 56.64  ? 2273 PRO B CA  1 
ATOM 6811  C C   . PRO A 1 901  ? -19.155 -5.509  -74.766  1.00 57.61  ? 2273 PRO B C   1 
ATOM 6812  O O   . PRO A 1 901  ? -19.405 -6.707  -74.843  1.00 59.28  ? 2273 PRO B O   1 
ATOM 6813  C CB  . PRO A 1 901  ? -21.155 -4.043  -75.221  1.00 58.76  ? 2273 PRO B CB  1 
ATOM 6814  C CG  . PRO A 1 901  ? -20.645 -2.690  -75.556  1.00 59.88  ? 2273 PRO B CG  1 
ATOM 6815  C CD  . PRO A 1 901  ? -20.052 -2.150  -74.294  1.00 58.57  ? 2273 PRO B CD  1 
ATOM 6816  N N   . ASP A 1 902  ? -18.005 -4.969  -75.178  1.00 59.64  ? 2274 ASP B N   1 
ATOM 6817  C CA  . ASP A 1 902  ? -16.890 -5.772  -75.707  1.00 60.01  ? 2274 ASP B CA  1 
ATOM 6818  C C   . ASP A 1 902  ? -15.802 -6.024  -74.655  1.00 56.68  ? 2274 ASP B C   1 
ATOM 6819  O O   . ASP A 1 902  ? -14.611 -6.036  -74.984  1.00 55.09  ? 2274 ASP B O   1 
ATOM 6820  C CB  . ASP A 1 902  ? -16.268 -5.071  -76.923  1.00 62.31  ? 2274 ASP B CB  1 
ATOM 6821  C CG  . ASP A 1 902  ? -17.284 -4.733  -77.980  1.00 65.73  ? 2274 ASP B CG  1 
ATOM 6822  O OD1 . ASP A 1 902  ? -17.889 -5.673  -78.540  1.00 63.39  ? 2274 ASP B OD1 1 
ATOM 6823  O OD2 . ASP A 1 902  ? -17.467 -3.523  -78.245  1.00 71.77  ? 2274 ASP B OD2 1 
ATOM 6824  N N   . TYR A 1 903  ? -16.206 -6.262  -73.405  1.00 55.04  ? 2275 TYR B N   1 
ATOM 6825  C CA  . TYR A 1 903  ? -15.259 -6.338  -72.283  1.00 54.24  ? 2275 TYR B CA  1 
ATOM 6826  C C   . TYR A 1 903  ? -14.109 -7.327  -72.491  1.00 55.22  ? 2275 TYR B C   1 
ATOM 6827  O O   . TYR A 1 903  ? -12.974 -7.054  -72.096  1.00 54.68  ? 2275 TYR B O   1 
ATOM 6828  C CB  . TYR A 1 903  ? -15.969 -6.680  -70.968  1.00 52.78  ? 2275 TYR B CB  1 
ATOM 6829  C CG  . TYR A 1 903  ? -14.987 -6.906  -69.844  1.00 51.03  ? 2275 TYR B CG  1 
ATOM 6830  C CD1 . TYR A 1 903  ? -14.437 -5.832  -69.154  1.00 50.39  ? 2275 TYR B CD1 1 
ATOM 6831  C CD2 . TYR A 1 903  ? -14.556 -8.191  -69.513  1.00 51.72  ? 2275 TYR B CD2 1 
ATOM 6832  C CE1 . TYR A 1 903  ? -13.513 -6.032  -68.144  1.00 49.47  ? 2275 TYR B CE1 1 
ATOM 6833  C CE2 . TYR A 1 903  ? -13.630 -8.398  -68.505  1.00 50.27  ? 2275 TYR B CE2 1 
ATOM 6834  C CZ  . TYR A 1 903  ? -13.114 -7.315  -67.827  1.00 48.70  ? 2275 TYR B CZ  1 
ATOM 6835  O OH  . TYR A 1 903  ? -12.210 -7.510  -66.824  1.00 49.57  ? 2275 TYR B OH  1 
ATOM 6836  N N   . ASP A 1 904  ? -14.410 -8.475  -73.087  1.00 57.74  ? 2276 ASP B N   1 
ATOM 6837  C CA  . ASP A 1 904  ? -13.405 -9.524  -73.284  1.00 59.61  ? 2276 ASP B CA  1 
ATOM 6838  C C   . ASP A 1 904  ? -12.278 -9.092  -74.241  1.00 60.55  ? 2276 ASP B C   1 
ATOM 6839  O O   . ASP A 1 904  ? -11.134 -9.527  -74.082  1.00 58.70  ? 2276 ASP B O   1 
ATOM 6840  C CB  . ASP A 1 904  ? -14.066 -10.818 -73.776  1.00 62.85  ? 2276 ASP B CB  1 
ATOM 6841  C CG  . ASP A 1 904  ? -15.051 -11.395 -72.767  1.00 63.08  ? 2276 ASP B CG  1 
ATOM 6842  O OD1 . ASP A 1 904  ? -14.617 -11.856 -71.693  1.00 59.40  ? 2276 ASP B OD1 1 
ATOM 6843  O OD2 . ASP A 1 904  ? -16.265 -11.381 -73.050  1.00 70.79  ? 2276 ASP B OD2 1 
ATOM 6844  N N   . HIS A 1 905  ? -12.600 -8.223  -75.205  1.00 61.90  ? 2277 HIS B N   1 
ATOM 6845  C CA  . HIS A 1 905  ? -11.624 -7.732  -76.193  1.00 63.58  ? 2277 HIS B CA  1 
ATOM 6846  C C   . HIS A 1 905  ? -10.880 -6.444  -75.808  1.00 61.84  ? 2277 HIS B C   1 
ATOM 6847  O O   . HIS A 1 905  ? -10.083 -5.938  -76.603  1.00 64.09  ? 2277 HIS B O   1 
ATOM 6848  C CB  . HIS A 1 905  ? -12.314 -7.529  -77.548  1.00 68.63  ? 2277 HIS B CB  1 
ATOM 6849  C CG  . HIS A 1 905  ? -12.789 -8.799  -78.178  1.00 71.45  ? 2277 HIS B CG  1 
ATOM 6850  N ND1 . HIS A 1 905  ? -13.757 -8.824  -79.159  1.00 74.64  ? 2277 HIS B ND1 1 
ATOM 6851  C CD2 . HIS A 1 905  ? -12.440 -10.089 -77.958  1.00 70.56  ? 2277 HIS B CD2 1 
ATOM 6852  C CE1 . HIS A 1 905  ? -13.977 -10.074 -79.522  1.00 80.53  ? 2277 HIS B CE1 1 
ATOM 6853  N NE2 . HIS A 1 905  ? -13.192 -10.861 -78.807  1.00 78.76  ? 2277 HIS B NE2 1 
ATOM 6854  N N   . LEU A 1 906  ? -11.124 -5.917  -74.606  1.00 58.96  ? 2278 LEU B N   1 
ATOM 6855  C CA  . LEU A 1 906  ? -10.479 -4.672  -74.156  1.00 54.96  ? 2278 LEU B CA  1 
ATOM 6856  C C   . LEU A 1 906  ? -8.986  -4.852  -73.867  1.00 52.05  ? 2278 LEU B C   1 
ATOM 6857  O O   . LEU A 1 906  ? -8.507  -5.976  -73.696  1.00 52.01  ? 2278 LEU B O   1 
ATOM 6858  C CB  . LEU A 1 906  ? -11.170 -4.133  -72.896  1.00 52.38  ? 2278 LEU B CB  1 
ATOM 6859  C CG  . LEU A 1 906  ? -12.570 -3.525  -73.001  1.00 53.33  ? 2278 LEU B CG  1 
ATOM 6860  C CD1 . LEU A 1 906  ? -13.146 -3.274  -71.614  1.00 53.53  ? 2278 LEU B CD1 1 
ATOM 6861  C CD2 . LEU A 1 906  ? -12.540 -2.228  -73.780  1.00 54.33  ? 2278 LEU B CD2 1 
ATOM 6862  N N   . THR A 1 907  ? -8.263  -3.733  -73.818  1.00 49.77  ? 2279 THR B N   1 
ATOM 6863  C CA  . THR A 1 907  ? -6.876  -3.722  -73.344  1.00 48.75  ? 2279 THR B CA  1 
ATOM 6864  C C   . THR A 1 907  ? -6.884  -3.868  -71.830  1.00 46.72  ? 2279 THR B C   1 
ATOM 6865  O O   . THR A 1 907  ? -7.874  -3.530  -71.183  1.00 49.39  ? 2279 THR B O   1 
ATOM 6866  C CB  . THR A 1 907  ? -6.126  -2.423  -73.707  1.00 50.39  ? 2279 THR B CB  1 
ATOM 6867  O OG1 . THR A 1 907  ? -6.739  -1.302  -73.059  1.00 48.64  ? 2279 THR B OG1 1 
ATOM 6868  C CG2 . THR A 1 907  ? -6.102  -2.202  -75.221  1.00 52.75  ? 2279 THR B CG2 1 
ATOM 6869  N N   . LEU A 1 908  ? -5.782  -4.367  -71.270  1.00 44.80  ? 2280 LEU B N   1 
ATOM 6870  C CA  . LEU A 1 908  ? -5.651  -4.583  -69.812  1.00 41.73  ? 2280 LEU B CA  1 
ATOM 6871  C C   . LEU A 1 908  ? -6.074  -3.350  -69.009  1.00 42.43  ? 2280 LEU B C   1 
ATOM 6872  O O   . LEU A 1 908  ? -6.882  -3.444  -68.076  1.00 40.79  ? 2280 LEU B O   1 
ATOM 6873  C CB  . LEU A 1 908  ? -4.204  -4.949  -69.454  1.00 39.07  ? 2280 LEU B CB  1 
ATOM 6874  C CG  . LEU A 1 908  ? -3.893  -5.229  -67.982  1.00 36.61  ? 2280 LEU B CG  1 
ATOM 6875  C CD1 . LEU A 1 908  ? -4.535  -6.528  -67.520  1.00 35.90  ? 2280 LEU B CD1 1 
ATOM 6876  C CD2 . LEU A 1 908  ? -2.393  -5.270  -67.762  1.00 36.90  ? 2280 LEU B CD2 1 
ATOM 6877  N N   . MET A 1 909  ? -5.523  -2.202  -69.401  1.00 43.73  ? 2281 MET B N   1 
ATOM 6878  C CA  . MET A 1 909  ? -5.836  -0.910  -68.791  1.00 42.45  ? 2281 MET B CA  1 
ATOM 6879  C C   . MET A 1 909  ? -7.344  -0.643  -68.823  1.00 40.09  ? 2281 MET B C   1 
ATOM 6880  O O   . MET A 1 909  ? -7.939  -0.284  -67.811  1.00 39.48  ? 2281 MET B O   1 
ATOM 6881  C CB  . MET A 1 909  ? -5.063  0.210   -69.516  1.00 46.48  ? 2281 MET B CB  1 
ATOM 6882  C CG  . MET A 1 909  ? -3.537  0.174   -69.315  1.00 48.02  ? 2281 MET B CG  1 
ATOM 6883  S SD  . MET A 1 909  ? -2.841  1.214   -68.007  1.00 44.92  ? 2281 MET B SD  1 
ATOM 6884  C CE  . MET A 1 909  ? -4.091  1.034   -66.738  1.00 43.00  ? 2281 MET B CE  1 
ATOM 6885  N N   . GLN A 1 910  ? -7.955  -0.847  -69.987  1.00 39.75  ? 2282 GLN B N   1 
ATOM 6886  C CA  . GLN A 1 910  ? -9.406  -0.699  -70.149  1.00 39.71  ? 2282 GLN B CA  1 
ATOM 6887  C C   . GLN A 1 910  ? -10.225 -1.680  -69.299  1.00 39.60  ? 2282 GLN B C   1 
ATOM 6888  O O   . GLN A 1 910  ? -11.278 -1.310  -68.777  1.00 39.60  ? 2282 GLN B O   1 
ATOM 6889  C CB  . GLN A 1 910  ? -9.799  -0.863  -71.620  1.00 39.99  ? 2282 GLN B CB  1 
ATOM 6890  C CG  . GLN A 1 910  ? -9.381  0.284   -72.527  1.00 40.65  ? 2282 GLN B CG  1 
ATOM 6891  C CD  . GLN A 1 910  ? -9.398  -0.076  -74.008  1.00 41.45  ? 2282 GLN B CD  1 
ATOM 6892  O OE1 . GLN A 1 910  ? -9.434  -1.249  -74.379  1.00 40.70  ? 2282 GLN B OE1 1 
ATOM 6893  N NE2 . GLN A 1 910  ? -9.349  0.941   -74.861  1.00 42.86  ? 2282 GLN B NE2 1 
ATOM 6894  N N   . LYS A 1 911  ? -9.752  -2.923  -69.192  1.00 40.57  ? 2283 LYS B N   1 
ATOM 6895  C CA  . LYS A 1 911  ? -10.423 -3.958  -68.390  1.00 42.18  ? 2283 LYS B CA  1 
ATOM 6896  C C   . LYS A 1 911  ? -10.442 -3.635  -66.901  1.00 42.31  ? 2283 LYS B C   1 
ATOM 6897  O O   . LYS A 1 911  ? -11.449 -3.868  -66.228  1.00 42.96  ? 2283 LYS B O   1 
ATOM 6898  C CB  . LYS A 1 911  ? -9.769  -5.334  -68.581  1.00 43.84  ? 2283 LYS B CB  1 
ATOM 6899  C CG  . LYS A 1 911  ? -10.053 -5.976  -69.923  1.00 47.38  ? 2283 LYS B CG  1 
ATOM 6900  C CD  . LYS A 1 911  ? -9.824  -7.475  -69.899  1.00 49.61  ? 2283 LYS B CD  1 
ATOM 6901  C CE  . LYS A 1 911  ? -9.769  -8.040  -71.309  1.00 54.15  ? 2283 LYS B CE  1 
ATOM 6902  N NZ  . LYS A 1 911  ? -9.984  -9.511  -71.329  1.00 58.52  ? 2283 LYS B NZ  1 
ATOM 6903  N N   . VAL A 1 912  ? -9.329  -3.109  -66.392  1.00 40.93  ? 2284 VAL B N   1 
ATOM 6904  C CA  . VAL A 1 912  ? -9.217  -2.789  -64.972  1.00 39.00  ? 2284 VAL B CA  1 
ATOM 6905  C C   . VAL A 1 912  ? -10.272 -1.761  -64.552  1.00 39.73  ? 2284 VAL B C   1 
ATOM 6906  O O   . VAL A 1 912  ? -10.925 -1.934  -63.524  1.00 38.84  ? 2284 VAL B O   1 
ATOM 6907  C CB  . VAL A 1 912  ? -7.794  -2.320  -64.610  1.00 37.28  ? 2284 VAL B CB  1 
ATOM 6908  C CG1 . VAL A 1 912  ? -7.742  -1.741  -63.203  1.00 36.56  ? 2284 VAL B CG1 1 
ATOM 6909  C CG2 . VAL A 1 912  ? -6.827  -3.491  -64.717  1.00 36.71  ? 2284 VAL B CG2 1 
ATOM 6910  N N   . GLU A 1 913  ? -10.449 -0.712  -65.351  1.00 41.96  ? 2285 GLU B N   1 
ATOM 6911  C CA  . GLU A 1 913  ? -11.480 0.292   -65.071  1.00 45.24  ? 2285 GLU B CA  1 
ATOM 6912  C C   . GLU A 1 913  ? -12.865 -0.334  -64.918  1.00 46.86  ? 2285 GLU B C   1 
ATOM 6913  O O   . GLU A 1 913  ? -13.583 -0.026  -63.967  1.00 51.01  ? 2285 GLU B O   1 
ATOM 6914  C CB  . GLU A 1 913  ? -11.544 1.360   -66.169  1.00 46.80  ? 2285 GLU B CB  1 
ATOM 6915  C CG  . GLU A 1 913  ? -12.441 2.535   -65.791  1.00 46.67  ? 2285 GLU B CG  1 
ATOM 6916  C CD  . GLU A 1 913  ? -12.693 3.512   -66.916  1.00 45.69  ? 2285 GLU B CD  1 
ATOM 6917  O OE1 . GLU A 1 913  ? -13.147 4.628   -66.587  1.00 44.50  ? 2285 GLU B OE1 1 
ATOM 6918  O OE2 . GLU A 1 913  ? -12.463 3.172   -68.103  1.00 45.03  ? 2285 GLU B OE2 1 
ATOM 6919  N N   . VAL A 1 914  ? -13.225 -1.198  -65.862  1.00 46.56  ? 2286 VAL B N   1 
ATOM 6920  C CA  . VAL A 1 914  ? -14.554 -1.815  -65.899  1.00 45.94  ? 2286 VAL B CA  1 
ATOM 6921  C C   . VAL A 1 914  ? -14.725 -2.750  -64.699  1.00 44.28  ? 2286 VAL B C   1 
ATOM 6922  O O   . VAL A 1 914  ? -15.786 -2.790  -64.078  1.00 43.42  ? 2286 VAL B O   1 
ATOM 6923  C CB  . VAL A 1 914  ? -14.793 -2.562  -67.236  1.00 46.33  ? 2286 VAL B CB  1 
ATOM 6924  C CG1 . VAL A 1 914  ? -16.124 -3.303  -67.239  1.00 45.93  ? 2286 VAL B CG1 1 
ATOM 6925  C CG2 . VAL A 1 914  ? -14.758 -1.586  -68.407  1.00 48.56  ? 2286 VAL B CG2 1 
ATOM 6926  N N   . PHE A 1 915  ? -13.672 -3.491  -64.377  1.00 44.41  ? 2287 PHE B N   1 
ATOM 6927  C CA  . PHE A 1 915  ? -13.661 -4.355  -63.199  1.00 43.75  ? 2287 PHE B CA  1 
ATOM 6928  C C   . PHE A 1 915  ? -13.820 -3.517  -61.942  1.00 41.53  ? 2287 PHE B C   1 
ATOM 6929  O O   . PHE A 1 915  ? -14.645 -3.826  -61.089  1.00 42.29  ? 2287 PHE B O   1 
ATOM 6930  C CB  . PHE A 1 915  ? -12.355 -5.153  -63.140  1.00 44.35  ? 2287 PHE B CB  1 
ATOM 6931  C CG  . PHE A 1 915  ? -12.230 -6.034  -61.931  1.00 44.95  ? 2287 PHE B CG  1 
ATOM 6932  C CD1 . PHE A 1 915  ? -12.895 -7.250  -61.873  1.00 45.76  ? 2287 PHE B CD1 1 
ATOM 6933  C CD2 . PHE A 1 915  ? -11.436 -5.654  -60.849  1.00 45.41  ? 2287 PHE B CD2 1 
ATOM 6934  C CE1 . PHE A 1 915  ? -12.776 -8.071  -60.760  1.00 44.28  ? 2287 PHE B CE1 1 
ATOM 6935  C CE2 . PHE A 1 915  ? -11.311 -6.472  -59.737  1.00 43.57  ? 2287 PHE B CE2 1 
ATOM 6936  C CZ  . PHE A 1 915  ? -11.981 -7.684  -59.694  1.00 42.76  ? 2287 PHE B CZ  1 
ATOM 6937  N N   . GLU A 1 916  ? -13.027 -2.457  -61.844  1.00 40.64  ? 2288 GLU B N   1 
ATOM 6938  C CA  . GLU A 1 916  ? -13.064 -1.567  -60.686  1.00 41.02  ? 2288 GLU B CA  1 
ATOM 6939  C C   . GLU A 1 916  ? -14.417 -0.850  -60.561  1.00 42.25  ? 2288 GLU B C   1 
ATOM 6940  O O   . GLU A 1 916  ? -14.921 -0.660  -59.456  1.00 42.22  ? 2288 GLU B O   1 
ATOM 6941  C CB  . GLU A 1 916  ? -11.883 -0.583  -60.721  1.00 40.23  ? 2288 GLU B CB  1 
ATOM 6942  C CG  . GLU A 1 916  ? -10.562 -1.263  -60.379  1.00 39.95  ? 2288 GLU B CG  1 
ATOM 6943  C CD  . GLU A 1 916  ? -9.353  -0.346  -60.390  1.00 42.37  ? 2288 GLU B CD  1 
ATOM 6944  O OE1 . GLU A 1 916  ? -9.468  0.844   -60.771  1.00 46.31  ? 2288 GLU B OE1 1 
ATOM 6945  O OE2 . GLU A 1 916  ? -8.267  -0.831  -60.003  1.00 42.28  ? 2288 GLU B OE2 1 
ATOM 6946  N N   . HIS A 1 917  ? -15.012 -0.488  -61.692  1.00 42.82  ? 2289 HIS B N   1 
ATOM 6947  C CA  . HIS A 1 917  ? -16.346 0.100   -61.703  1.00 43.03  ? 2289 HIS B CA  1 
ATOM 6948  C C   . HIS A 1 917  ? -17.384 -0.848  -61.096  1.00 45.99  ? 2289 HIS B C   1 
ATOM 6949  O O   . HIS A 1 917  ? -18.265 -0.410  -60.359  1.00 47.57  ? 2289 HIS B O   1 
ATOM 6950  C CB  . HIS A 1 917  ? -16.749 0.470   -63.128  1.00 41.36  ? 2289 HIS B CB  1 
ATOM 6951  C CG  . HIS A 1 917  ? -18.114 1.066   -63.228  1.00 41.38  ? 2289 HIS B CG  1 
ATOM 6952  N ND1 . HIS A 1 917  ? -18.419 2.308   -62.720  1.00 42.39  ? 2289 HIS B ND1 1 
ATOM 6953  C CD2 . HIS A 1 917  ? -19.259 0.586   -63.764  1.00 42.91  ? 2289 HIS B CD2 1 
ATOM 6954  C CE1 . HIS A 1 917  ? -19.692 2.572   -62.946  1.00 44.55  ? 2289 HIS B CE1 1 
ATOM 6955  N NE2 . HIS A 1 917  ? -20.226 1.542   -63.577  1.00 44.47  ? 2289 HIS B NE2 1 
ATOM 6956  N N   . ALA A 1 918  ? -17.266 -2.138  -61.410  1.00 48.27  ? 2290 ALA B N   1 
ATOM 6957  C CA  . ALA A 1 918  ? -18.179 -3.165  -60.896  1.00 51.15  ? 2290 ALA B CA  1 
ATOM 6958  C C   . ALA A 1 918  ? -17.997 -3.393  -59.403  1.00 51.08  ? 2290 ALA B C   1 
ATOM 6959  O O   . ALA A 1 918  ? -18.967 -3.409  -58.648  1.00 53.72  ? 2290 ALA B O   1 
ATOM 6960  C CB  . ALA A 1 918  ? -17.976 -4.473  -61.642  1.00 52.74  ? 2290 ALA B CB  1 
ATOM 6961  N N   . VAL A 1 919  ? -16.746 -3.577  -58.997  1.00 50.89  ? 2291 VAL B N   1 
ATOM 6962  C CA  . VAL A 1 919  ? -16.381 -3.743  -57.587  1.00 53.06  ? 2291 VAL B CA  1 
ATOM 6963  C C   . VAL A 1 919  ? -16.854 -2.549  -56.742  1.00 57.26  ? 2291 VAL B C   1 
ATOM 6964  O O   . VAL A 1 919  ? -17.462 -2.731  -55.683  1.00 61.41  ? 2291 VAL B O   1 
ATOM 6965  C CB  . VAL A 1 919  ? -14.850 -3.954  -57.445  1.00 51.36  ? 2291 VAL B CB  1 
ATOM 6966  C CG1 . VAL A 1 919  ? -14.371 -3.796  -56.005  1.00 52.65  ? 2291 VAL B CG1 1 
ATOM 6967  C CG2 . VAL A 1 919  ? -14.468 -5.330  -57.975  1.00 50.15  ? 2291 VAL B CG2 1 
ATOM 6968  N N   . ASN A 1 920  ? -16.591 -1.338  -57.228  1.00 57.19  ? 2292 ASN B N   1 
ATOM 6969  C CA  . ASN A 1 920  ? -16.918 -0.109  -56.490  1.00 55.39  ? 2292 ASN B CA  1 
ATOM 6970  C C   . ASN A 1 920  ? -18.407 0.221   -56.394  1.00 53.34  ? 2292 ASN B C   1 
ATOM 6971  O O   . ASN A 1 920  ? -18.785 1.065   -55.585  1.00 56.81  ? 2292 ASN B O   1 
ATOM 6972  C CB  . ASN A 1 920  ? -16.196 1.095   -57.103  1.00 57.25  ? 2292 ASN B CB  1 
ATOM 6973  C CG  . ASN A 1 920  ? -14.689 1.012   -56.971  1.00 56.43  ? 2292 ASN B CG  1 
ATOM 6974  O OD1 . ASN A 1 920  ? -14.155 0.293   -56.121  1.00 54.37  ? 2292 ASN B OD1 1 
ATOM 6975  N ND2 . ASN A 1 920  ? -13.993 1.753   -57.825  1.00 57.63  ? 2292 ASN B ND2 1 
ATOM 6976  N N   . ASN A 1 921  ? -19.238 -0.410  -57.220  1.00 51.26  ? 2293 ASN B N   1 
ATOM 6977  C CA  . ASN A 1 921  ? -20.685 -0.214  -57.170  1.00 52.60  ? 2293 ASN B CA  1 
ATOM 6978  C C   . ASN A 1 921  ? -21.427 -1.482  -56.736  1.00 51.83  ? 2293 ASN B C   1 
ATOM 6979  O O   . ASN A 1 921  ? -22.598 -1.667  -57.069  1.00 54.87  ? 2293 ASN B O   1 
ATOM 6980  C CB  . ASN A 1 921  ? -21.165 0.280   -58.536  1.00 55.12  ? 2293 ASN B CB  1 
ATOM 6981  C CG  . ASN A 1 921  ? -20.629 1.657   -58.868  1.00 57.88  ? 2293 ASN B CG  1 
ATOM 6982  O OD1 . ASN A 1 921  ? -21.096 2.656   -58.322  1.00 67.21  ? 2293 ASN B OD1 1 
ATOM 6983  N ND2 . ASN A 1 921  ? -19.643 1.720   -59.760  1.00 54.16  ? 2293 ASN B ND2 1 
ATOM 6984  N N   . THR A 1 922  ? -20.750 -2.352  -55.990  1.00 51.23  ? 2294 THR B N   1 
ATOM 6985  C CA  . THR A 1 922  ? -21.374 -3.552  -55.427  1.00 53.09  ? 2294 THR B CA  1 
ATOM 6986  C C   . THR A 1 922  ? -20.790 -3.852  -54.056  1.00 54.24  ? 2294 THR B C   1 
ATOM 6987  O O   . THR A 1 922  ? -19.633 -3.527  -53.776  1.00 52.53  ? 2294 THR B O   1 
ATOM 6988  C CB  . THR A 1 922  ? -21.171 -4.798  -56.313  1.00 52.68  ? 2294 THR B CB  1 
ATOM 6989  O OG1 . THR A 1 922  ? -19.778 -4.956  -56.609  1.00 51.82  ? 2294 THR B OG1 1 
ATOM 6990  C CG2 . THR A 1 922  ? -21.975 -4.702  -57.614  1.00 53.18  ? 2294 THR B CG2 1 
ATOM 6991  N N   . ALA A 1 923  ? -21.603 -4.486  -53.216  1.00 58.48  ? 2295 ALA B N   1 
ATOM 6992  C CA  . ALA A 1 923  ? -21.200 -4.842  -51.862  1.00 61.82  ? 2295 ALA B CA  1 
ATOM 6993  C C   . ALA A 1 923  ? -20.324 -6.090  -51.899  1.00 59.92  ? 2295 ALA B C   1 
ATOM 6994  O O   . ALA A 1 923  ? -20.779 -7.154  -52.338  1.00 62.89  ? 2295 ALA B O   1 
ATOM 6995  C CB  . ALA A 1 923  ? -22.425 -5.086  -50.997  1.00 66.35  ? 2295 ALA B CB  1 
ATOM 6996  N N   . GLY A 1 924  ? -19.083 -5.957  -51.428  1.00 54.71  ? 2296 GLY B N   1 
ATOM 6997  C CA  . GLY A 1 924  ? -18.132 -7.068  -51.395  1.00 55.96  ? 2296 GLY B CA  1 
ATOM 6998  C C   . GLY A 1 924  ? -18.007 -7.747  -50.042  1.00 56.58  ? 2296 GLY B C   1 
ATOM 6999  O O   . GLY A 1 924  ? -16.921 -8.204  -49.680  1.00 58.33  ? 2296 GLY B O   1 
ATOM 7000  N N   . ASP A 1 925  ? -19.121 -7.836  -49.312  1.00 57.59  ? 2297 ASP B N   1 
ATOM 7001  C CA  . ASP A 1 925  ? -19.155 -8.395  -47.957  1.00 57.37  ? 2297 ASP B CA  1 
ATOM 7002  C C   . ASP A 1 925  ? -20.223 -9.496  -47.775  1.00 58.25  ? 2297 ASP B C   1 
ATOM 7003  O O   . ASP A 1 925  ? -20.582 -9.825  -46.650  1.00 58.10  ? 2297 ASP B O   1 
ATOM 7004  C CB  . ASP A 1 925  ? -19.365 -7.255  -46.943  1.00 57.73  ? 2297 ASP B CB  1 
ATOM 7005  C CG  . ASP A 1 925  ? -20.745 -6.593  -47.048  1.00 61.14  ? 2297 ASP B CG  1 
ATOM 7006  O OD1 . ASP A 1 925  ? -21.451 -6.767  -48.067  1.00 62.15  ? 2297 ASP B OD1 1 
ATOM 7007  O OD2 . ASP A 1 925  ? -21.124 -5.882  -46.094  1.00 64.03  ? 2297 ASP B OD2 1 
ATOM 7008  N N   . ASP A 1 926  ? -20.708 -10.069 -48.878  1.00 60.70  ? 2298 ASP B N   1 
ATOM 7009  C CA  . ASP A 1 926  ? -21.803 -11.051 -48.845  1.00 60.83  ? 2298 ASP B CA  1 
ATOM 7010  C C   . ASP A 1 926  ? -21.446 -12.241 -47.964  1.00 61.37  ? 2298 ASP B C   1 
ATOM 7011  O O   . ASP A 1 926  ? -22.189 -12.578 -47.045  1.00 63.03  ? 2298 ASP B O   1 
ATOM 7012  C CB  . ASP A 1 926  ? -22.133 -11.564 -50.258  1.00 61.16  ? 2298 ASP B CB  1 
ATOM 7013  C CG  . ASP A 1 926  ? -22.835 -10.527 -51.128  1.00 62.31  ? 2298 ASP B CG  1 
ATOM 7014  O OD1 . ASP A 1 926  ? -22.664 -9.306  -50.912  1.00 67.20  ? 2298 ASP B OD1 1 
ATOM 7015  O OD2 . ASP A 1 926  ? -23.563 -10.947 -52.050  1.00 60.14  ? 2298 ASP B OD2 1 
ATOM 7016  N N   . LEU A 1 927  ? -20.298 -12.856 -48.254  1.00 63.58  ? 2299 LEU B N   1 
ATOM 7017  C CA  . LEU A 1 927  ? -19.833 -14.056 -47.542  1.00 63.77  ? 2299 LEU B CA  1 
ATOM 7018  C C   . LEU A 1 927  ? -19.543 -13.789 -46.075  1.00 65.31  ? 2299 LEU B C   1 
ATOM 7019  O O   . LEU A 1 927  ? -19.822 -14.630 -45.218  1.00 62.64  ? 2299 LEU B O   1 
ATOM 7020  C CB  . LEU A 1 927  ? -18.573 -14.633 -48.196  1.00 60.98  ? 2299 LEU B CB  1 
ATOM 7021  C CG  . LEU A 1 927  ? -17.970 -15.879 -47.532  1.00 59.09  ? 2299 LEU B CG  1 
ATOM 7022  C CD1 . LEU A 1 927  ? -18.919 -17.068 -47.614  1.00 58.94  ? 2299 LEU B CD1 1 
ATOM 7023  C CD2 . LEU A 1 927  ? -16.624 -16.208 -48.157  1.00 57.19  ? 2299 LEU B CD2 1 
ATOM 7024  N N   . ALA A 1 928  ? -18.941 -12.638 -45.799  1.00 68.12  ? 2300 ALA B N   1 
ATOM 7025  C CA  . ALA A 1 928  ? -18.724 -12.207 -44.425  1.00 70.57  ? 2300 ALA B CA  1 
ATOM 7026  C C   . ALA A 1 928  ? -20.053 -12.115 -43.682  1.00 67.57  ? 2300 ALA B C   1 
ATOM 7027  O O   . ALA A 1 928  ? -20.233 -12.731 -42.632  1.00 65.50  ? 2300 ALA B O   1 
ATOM 7028  C CB  . ALA A 1 928  ? -18.018 -10.861 -44.405  1.00 73.95  ? 2300 ALA B CB  1 
ATOM 7029  N N   . LYS A 1 929  ? -20.987 -11.379 -44.275  1.00 69.78  ? 2301 LYS B N   1 
ATOM 7030  C CA  . LYS A 1 929  ? -22.248 -11.032 -43.622  1.00 77.49  ? 2301 LYS B CA  1 
ATOM 7031  C C   . LYS A 1 929  ? -23.197 -12.228 -43.478  1.00 74.47  ? 2301 LYS B C   1 
ATOM 7032  O O   . LYS A 1 929  ? -23.939 -12.300 -42.500  1.00 78.45  ? 2301 LYS B O   1 
ATOM 7033  C CB  . LYS A 1 929  ? -22.939 -9.866  -44.360  1.00 84.53  ? 2301 LYS B CB  1 
ATOM 7034  C CG  . LYS A 1 929  ? -23.568 -8.817  -43.451  1.00 93.14  ? 2301 LYS B CG  1 
ATOM 7035  C CD  . LYS A 1 929  ? -23.670 -7.462  -44.142  1.00 95.64  ? 2301 LYS B CD  1 
ATOM 7036  C CE  . LYS A 1 929  ? -24.017 -6.361  -43.155  1.00 104.17 ? 2301 LYS B CE  1 
ATOM 7037  N NZ  . LYS A 1 929  ? -23.981 -5.022  -43.800  1.00 107.46 ? 2301 LYS B NZ  1 
ATOM 7038  N N   . LEU A 1 930  ? -23.173 -13.157 -44.435  1.00 70.13  ? 2302 LEU B N   1 
ATOM 7039  C CA  . LEU A 1 930  ? -23.994 -14.373 -44.345  1.00 71.95  ? 2302 LEU B CA  1 
ATOM 7040  C C   . LEU A 1 930  ? -23.445 -15.363 -43.321  1.00 74.50  ? 2302 LEU B C   1 
ATOM 7041  O O   . LEU A 1 930  ? -24.220 -16.079 -42.692  1.00 82.66  ? 2302 LEU B O   1 
ATOM 7042  C CB  . LEU A 1 930  ? -24.170 -15.052 -45.712  1.00 69.91  ? 2302 LEU B CB  1 
ATOM 7043  C CG  . LEU A 1 930  ? -22.985 -15.746 -46.403  1.00 67.22  ? 2302 LEU B CG  1 
ATOM 7044  C CD1 . LEU A 1 930  ? -22.824 -17.207 -46.001  1.00 67.07  ? 2302 LEU B CD1 1 
ATOM 7045  C CD2 . LEU A 1 930  ? -23.140 -15.673 -47.917  1.00 66.77  ? 2302 LEU B CD2 1 
ATOM 7046  N N   . LEU A 1 931  ? -22.120 -15.418 -43.170  1.00 74.02  ? 2303 LEU B N   1 
ATOM 7047  C CA  . LEU A 1 931  ? -21.494 -16.271 -42.147  1.00 73.51  ? 2303 LEU B CA  1 
ATOM 7048  C C   . LEU A 1 931  ? -21.782 -15.779 -40.724  1.00 77.54  ? 2303 LEU B C   1 
ATOM 7049  O O   . LEU A 1 931  ? -21.773 -16.579 -39.786  1.00 87.10  ? 2303 LEU B O   1 
ATOM 7050  C CB  . LEU A 1 931  ? -19.979 -16.413 -42.377  1.00 69.34  ? 2303 LEU B CB  1 
ATOM 7051  C CG  . LEU A 1 931  ? -19.531 -17.342 -43.517  1.00 64.58  ? 2303 LEU B CG  1 
ATOM 7052  C CD1 . LEU A 1 931  ? -18.037 -17.192 -43.759  1.00 61.02  ? 2303 LEU B CD1 1 
ATOM 7053  C CD2 . LEU A 1 931  ? -19.871 -18.804 -43.250  1.00 64.33  ? 2303 LEU B CD2 1 
ATOM 7054  N N   . TRP A 1 932  ? -22.032 -14.476 -40.573  1.00 74.00  ? 2304 TRP B N   1 
ATOM 7055  C CA  . TRP A 1 932  ? -22.529 -13.907 -39.314  1.00 74.22  ? 2304 TRP B CA  1 
ATOM 7056  C C   . TRP A 1 932  ? -23.981 -14.328 -39.043  1.00 71.76  ? 2304 TRP B C   1 
ATOM 7057  O O   . TRP A 1 932  ? -24.300 -14.738 -37.930  1.00 71.42  ? 2304 TRP B O   1 
ATOM 7058  C CB  . TRP A 1 932  ? -22.390 -12.372 -39.320  1.00 77.88  ? 2304 TRP B CB  1 
ATOM 7059  C CG  . TRP A 1 932  ? -23.024 -11.662 -38.145  1.00 84.43  ? 2304 TRP B CG  1 
ATOM 7060  C CD1 . TRP A 1 932  ? -24.095 -10.816 -38.183  1.00 86.89  ? 2304 TRP B CD1 1 
ATOM 7061  C CD2 . TRP A 1 932  ? -22.624 -11.736 -36.768  1.00 90.29  ? 2304 TRP B CD2 1 
ATOM 7062  N NE1 . TRP A 1 932  ? -24.389 -10.360 -36.921  1.00 90.92  ? 2304 TRP B NE1 1 
ATOM 7063  C CE2 . TRP A 1 932  ? -23.503 -10.908 -36.032  1.00 92.09  ? 2304 TRP B CE2 1 
ATOM 7064  C CE3 . TRP A 1 932  ? -21.609 -12.421 -36.085  1.00 92.89  ? 2304 TRP B CE3 1 
ATOM 7065  C CZ2 . TRP A 1 932  ? -23.399 -10.746 -34.644  1.00 95.13  ? 2304 TRP B CZ2 1 
ATOM 7066  C CZ3 . TRP A 1 932  ? -21.506 -12.261 -34.701  1.00 94.51  ? 2304 TRP B CZ3 1 
ATOM 7067  C CH2 . TRP A 1 932  ? -22.398 -11.429 -33.998  1.00 95.53  ? 2304 TRP B CH2 1 
ATOM 7068  N N   . LEU A 1 933  ? -24.845 -14.234 -40.056  1.00 72.90  ? 2305 LEU B N   1 
ATOM 7069  C CA  . LEU A 1 933  ? -26.278 -14.560 -39.901  1.00 77.49  ? 2305 LEU B CA  1 
ATOM 7070  C C   . LEU A 1 933  ? -26.554 -16.057 -39.654  1.00 77.17  ? 2305 LEU B C   1 
ATOM 7071  O O   . LEU A 1 933  ? -27.506 -16.407 -38.956  1.00 81.35  ? 2305 LEU B O   1 
ATOM 7072  C CB  . LEU A 1 933  ? -27.099 -14.091 -41.119  1.00 81.11  ? 2305 LEU B CB  1 
ATOM 7073  C CG  . LEU A 1 933  ? -27.056 -12.639 -41.643  1.00 84.80  ? 2305 LEU B CG  1 
ATOM 7074  C CD1 . LEU A 1 933  ? -28.378 -12.256 -42.300  1.00 88.55  ? 2305 LEU B CD1 1 
ATOM 7075  C CD2 . LEU A 1 933  ? -26.712 -11.617 -40.571  1.00 86.16  ? 2305 LEU B CD2 1 
ATOM 7076  N N   . LYS A 1 934  ? -25.734 -16.927 -40.239  1.00 74.56  ? 2306 LYS B N   1 
ATOM 7077  C CA  . LYS A 1 934  ? -25.862 -18.382 -40.065  1.00 72.95  ? 2306 LYS B CA  1 
ATOM 7078  C C   . LYS A 1 934  ? -25.573 -18.870 -38.641  1.00 73.03  ? 2306 LYS B C   1 
ATOM 7079  O O   . LYS A 1 934  ? -26.107 -19.895 -38.217  1.00 74.35  ? 2306 LYS B O   1 
ATOM 7080  C CB  . LYS A 1 934  ? -24.918 -19.119 -41.029  1.00 72.80  ? 2306 LYS B CB  1 
ATOM 7081  C CG  . LYS A 1 934  ? -25.354 -19.107 -42.489  1.00 74.00  ? 2306 LYS B CG  1 
ATOM 7082  C CD  . LYS A 1 934  ? -24.189 -19.342 -43.444  1.00 73.94  ? 2306 LYS B CD  1 
ATOM 7083  C CE  . LYS A 1 934  ? -23.671 -20.776 -43.423  1.00 74.80  ? 2306 LYS B CE  1 
ATOM 7084  N NZ  . LYS A 1 934  ? -24.535 -21.700 -44.210  1.00 76.29  ? 2306 LYS B NZ  1 
ATOM 7085  N N   . SER A 1 935  ? -24.717 -18.151 -37.918  1.00 73.84  ? 2307 SER B N   1 
ATOM 7086  C CA  . SER A 1 935  ? -24.180 -18.634 -36.648  1.00 76.24  ? 2307 SER B CA  1 
ATOM 7087  C C   . SER A 1 935  ? -25.177 -18.482 -35.494  1.00 80.03  ? 2307 SER B C   1 
ATOM 7088  O O   . SER A 1 935  ? -25.785 -17.415 -35.344  1.00 78.75  ? 2307 SER B O   1 
ATOM 7089  C CB  . SER A 1 935  ? -22.892 -17.884 -36.311  1.00 76.96  ? 2307 SER B CB  1 
ATOM 7090  O OG  . SER A 1 935  ? -23.137 -16.491 -36.238  1.00 81.71  ? 2307 SER B OG  1 
ATOM 7091  N N   . PRO A 1 936  ? -25.324 -19.535 -34.656  1.00 83.61  ? 2308 PRO B N   1 
ATOM 7092  C CA  . PRO A 1 936  ? -26.225 -19.465 -33.501  1.00 85.33  ? 2308 PRO B CA  1 
ATOM 7093  C C   . PRO A 1 936  ? -25.705 -18.590 -32.356  1.00 87.00  ? 2308 PRO B C   1 
ATOM 7094  O O   . PRO A 1 936  ? -26.487 -18.210 -31.484  1.00 92.53  ? 2308 PRO B O   1 
ATOM 7095  C CB  . PRO A 1 936  ? -26.314 -20.922 -33.047  1.00 85.18  ? 2308 PRO B CB  1 
ATOM 7096  C CG  . PRO A 1 936  ? -24.980 -21.483 -33.395  1.00 84.15  ? 2308 PRO B CG  1 
ATOM 7097  C CD  . PRO A 1 936  ? -24.577 -20.811 -34.678  1.00 82.04  ? 2308 PRO B CD  1 
ATOM 7098  N N   . SER A 1 937  ? -24.404 -18.292 -32.352  1.00 86.48  ? 2309 SER B N   1 
ATOM 7099  C CA  . SER A 1 937  ? -23.793 -17.449 -31.324  1.00 90.26  ? 2309 SER B CA  1 
ATOM 7100  C C   . SER A 1 937  ? -22.456 -16.858 -31.780  1.00 87.71  ? 2309 SER B C   1 
ATOM 7101  O O   . SER A 1 937  ? -21.880 -17.295 -32.777  1.00 92.99  ? 2309 SER B O   1 
ATOM 7102  C CB  . SER A 1 937  ? -23.591 -18.266 -30.052  1.00 94.65  ? 2309 SER B CB  1 
ATOM 7103  O OG  . SER A 1 937  ? -22.865 -19.452 -30.325  1.00 94.13  ? 2309 SER B OG  1 
ATOM 7104  N N   . SER A 1 938  ? -21.968 -15.875 -31.028  1.00 84.25  ? 2310 SER B N   1 
ATOM 7105  C CA  . SER A 1 938  ? -20.749 -15.141 -31.383  1.00 84.17  ? 2310 SER B CA  1 
ATOM 7106  C C   . SER A 1 938  ? -19.454 -15.952 -31.228  1.00 81.94  ? 2310 SER B C   1 
ATOM 7107  O O   . SER A 1 938  ? -18.515 -15.765 -32.006  1.00 77.55  ? 2310 SER B O   1 
ATOM 7108  C CB  . SER A 1 938  ? -20.651 -13.859 -30.557  1.00 88.35  ? 2310 SER B CB  1 
ATOM 7109  O OG  . SER A 1 938  ? -20.633 -14.155 -29.172  1.00 95.45  ? 2310 SER B OG  1 
ATOM 7110  N N   . GLU A 1 939  ? -19.392 -16.826 -30.224  1.00 85.04  ? 2311 GLU B N   1 
ATOM 7111  C CA  . GLU A 1 939  ? -18.210 -17.679 -30.022  1.00 86.99  ? 2311 GLU B CA  1 
ATOM 7112  C C   . GLU A 1 939  ? -18.090 -18.753 -31.111  1.00 84.54  ? 2311 GLU B C   1 
ATOM 7113  O O   . GLU A 1 939  ? -16.982 -19.087 -31.530  1.00 88.23  ? 2311 GLU B O   1 
ATOM 7114  C CB  . GLU A 1 939  ? -18.165 -18.287 -28.598  1.00 92.37  ? 2311 GLU B CB  1 
ATOM 7115  C CG  . GLU A 1 939  ? -18.951 -19.579 -28.329  1.00 94.02  ? 2311 GLU B CG  1 
ATOM 7116  C CD  . GLU A 1 939  ? -20.431 -19.377 -28.031  1.00 97.60  ? 2311 GLU B CD  1 
ATOM 7117  O OE1 . GLU A 1 939  ? -20.844 -18.254 -27.669  1.00 101.02 ? 2311 GLU B OE1 1 
ATOM 7118  O OE2 . GLU A 1 939  ? -21.189 -20.367 -28.139  1.00 95.94  ? 2311 GLU B OE2 1 
ATOM 7119  N N   . VAL A 1 940  ? -19.231 -19.278 -31.559  1.00 80.11  ? 2312 VAL B N   1 
ATOM 7120  C CA  . VAL A 1 940  ? -19.280 -20.247 -32.660  1.00 75.58  ? 2312 VAL B CA  1 
ATOM 7121  C C   . VAL A 1 940  ? -18.951 -19.556 -33.986  1.00 70.94  ? 2312 VAL B C   1 
ATOM 7122  O O   . VAL A 1 940  ? -18.298 -20.142 -34.851  1.00 67.03  ? 2312 VAL B O   1 
ATOM 7123  C CB  . VAL A 1 940  ? -20.660 -20.943 -32.738  1.00 78.84  ? 2312 VAL B CB  1 
ATOM 7124  C CG1 . VAL A 1 940  ? -20.765 -21.867 -33.947  1.00 77.76  ? 2312 VAL B CG1 1 
ATOM 7125  C CG2 . VAL A 1 940  ? -20.915 -21.750 -31.473  1.00 84.21  ? 2312 VAL B CG2 1 
ATOM 7126  N N   . TRP A 1 941  ? -19.412 -18.319 -34.143  1.00 70.98  ? 2313 TRP B N   1 
ATOM 7127  C CA  . TRP A 1 941  ? -19.056 -17.501 -35.303  1.00 70.04  ? 2313 TRP B CA  1 
ATOM 7128  C C   . TRP A 1 941  ? -17.547 -17.306 -35.416  1.00 68.43  ? 2313 TRP B C   1 
ATOM 7129  O O   . TRP A 1 941  ? -16.972 -17.534 -36.479  1.00 67.74  ? 2313 TRP B O   1 
ATOM 7130  C CB  . TRP A 1 941  ? -19.745 -16.135 -35.238  1.00 71.05  ? 2313 TRP B CB  1 
ATOM 7131  C CG  . TRP A 1 941  ? -19.197 -15.152 -36.203  1.00 70.87  ? 2313 TRP B CG  1 
ATOM 7132  C CD1 . TRP A 1 941  ? -19.389 -15.135 -37.552  1.00 71.50  ? 2313 TRP B CD1 1 
ATOM 7133  C CD2 . TRP A 1 941  ? -18.353 -14.038 -35.899  1.00 75.07  ? 2313 TRP B CD2 1 
ATOM 7134  N NE1 . TRP A 1 941  ? -18.719 -14.076 -38.112  1.00 75.43  ? 2313 TRP B NE1 1 
ATOM 7135  C CE2 . TRP A 1 941  ? -18.072 -13.385 -37.120  1.00 77.90  ? 2313 TRP B CE2 1 
ATOM 7136  C CE3 . TRP A 1 941  ? -17.803 -13.527 -34.713  1.00 76.66  ? 2313 TRP B CE3 1 
ATOM 7137  C CZ2 . TRP A 1 941  ? -17.263 -12.241 -37.192  1.00 78.63  ? 2313 TRP B CZ2 1 
ATOM 7138  C CZ3 . TRP A 1 941  ? -16.999 -12.386 -34.783  1.00 76.50  ? 2313 TRP B CZ3 1 
ATOM 7139  C CH2 . TRP A 1 941  ? -16.738 -11.758 -36.017  1.00 77.47  ? 2313 TRP B CH2 1 
ATOM 7140  N N   . PHE A 1 942  ? -16.925 -16.882 -34.316  1.00 70.49  ? 2314 PHE B N   1 
ATOM 7141  C CA  . PHE A 1 942  ? -15.488 -16.578 -34.287  1.00 71.42  ? 2314 PHE B CA  1 
ATOM 7142  C C   . PHE A 1 942  ? -14.602 -17.788 -34.600  1.00 76.12  ? 2314 PHE B C   1 
ATOM 7143  O O   . PHE A 1 942  ? -13.639 -17.664 -35.362  1.00 80.88  ? 2314 PHE B O   1 
ATOM 7144  C CB  . PHE A 1 942  ? -15.089 -15.983 -32.931  1.00 70.41  ? 2314 PHE B CB  1 
ATOM 7145  C CG  . PHE A 1 942  ? -13.648 -15.568 -32.854  1.00 67.62  ? 2314 PHE B CG  1 
ATOM 7146  C CD1 . PHE A 1 942  ? -13.249 -14.319 -33.308  1.00 67.55  ? 2314 PHE B CD1 1 
ATOM 7147  C CD2 . PHE A 1 942  ? -12.686 -16.434 -32.336  1.00 67.96  ? 2314 PHE B CD2 1 
ATOM 7148  C CE1 . PHE A 1 942  ? -11.918 -13.937 -33.246  1.00 69.25  ? 2314 PHE B CE1 1 
ATOM 7149  C CE2 . PHE A 1 942  ? -11.354 -16.059 -32.273  1.00 68.54  ? 2314 PHE B CE2 1 
ATOM 7150  C CZ  . PHE A 1 942  ? -10.970 -14.808 -32.727  1.00 69.55  ? 2314 PHE B CZ  1 
ATOM 7151  N N   . ASP A 1 943  ? -14.922 -18.939 -34.007  1.00 79.01  ? 2315 ASP B N   1 
ATOM 7152  C CA  . ASP A 1 943  ? -14.135 -20.167 -34.202  1.00 80.82  ? 2315 ASP B CA  1 
ATOM 7153  C C   . ASP A 1 943  ? -14.258 -20.693 -35.628  1.00 78.97  ? 2315 ASP B C   1 
ATOM 7154  O O   . ASP A 1 943  ? -13.261 -21.108 -36.223  1.00 83.42  ? 2315 ASP B O   1 
ATOM 7155  C CB  . ASP A 1 943  ? -14.558 -21.260 -33.213  1.00 86.48  ? 2315 ASP B CB  1 
ATOM 7156  C CG  . ASP A 1 943  ? -14.293 -20.883 -31.759  1.00 93.09  ? 2315 ASP B CG  1 
ATOM 7157  O OD1 . ASP A 1 943  ? -13.545 -19.913 -31.504  1.00 95.94  ? 2315 ASP B OD1 1 
ATOM 7158  O OD2 . ASP A 1 943  ? -14.841 -21.566 -30.866  1.00 96.77  ? 2315 ASP B OD2 1 
ATOM 7159  N N   . ARG A 1 944  ? -15.479 -20.674 -36.164  1.00 75.21  ? 2316 ARG B N   1 
ATOM 7160  C CA  . ARG A 1 944  ? -15.726 -20.981 -37.583  1.00 70.03  ? 2316 ARG B CA  1 
ATOM 7161  C C   . ARG A 1 944  ? -14.861 -20.128 -38.505  1.00 66.27  ? 2316 ARG B C   1 
ATOM 7162  O O   . ARG A 1 944  ? -14.303 -20.634 -39.477  1.00 65.86  ? 2316 ARG B O   1 
ATOM 7163  C CB  . ARG A 1 944  ? -17.203 -20.780 -37.943  1.00 68.20  ? 2316 ARG B CB  1 
ATOM 7164  C CG  . ARG A 1 944  ? -18.093 -21.934 -37.531  1.00 66.76  ? 2316 ARG B CG  1 
ATOM 7165  C CD  . ARG A 1 944  ? -19.564 -21.603 -37.711  1.00 68.01  ? 2316 ARG B CD  1 
ATOM 7166  N NE  . ARG A 1 944  ? -20.415 -22.728 -37.317  1.00 69.50  ? 2316 ARG B NE  1 
ATOM 7167  C CZ  . ARG A 1 944  ? -21.749 -22.721 -37.299  1.00 71.68  ? 2316 ARG B CZ  1 
ATOM 7168  N NH1 . ARG A 1 944  ? -22.440 -21.640 -37.657  1.00 73.61  ? 2316 ARG B NH1 1 
ATOM 7169  N NH2 . ARG A 1 944  ? -22.404 -23.814 -36.918  1.00 74.40  ? 2316 ARG B NH2 1 
ATOM 7170  N N   . ARG A 1 945  ? -14.751 -18.842 -38.179  1.00 65.48  ? 2317 ARG B N   1 
ATOM 7171  C CA  . ARG A 1 945  ? -13.936 -17.908 -38.950  1.00 65.34  ? 2317 ARG B CA  1 
ATOM 7172  C C   . ARG A 1 945  ? -12.436 -18.176 -38.799  1.00 61.69  ? 2317 ARG B C   1 
ATOM 7173  O O   . ARG A 1 945  ? -11.688 -18.026 -39.763  1.00 62.22  ? 2317 ARG B O   1 
ATOM 7174  C CB  . ARG A 1 945  ? -14.252 -16.461 -38.565  1.00 68.50  ? 2317 ARG B CB  1 
ATOM 7175  C CG  . ARG A 1 945  ? -13.858 -15.457 -39.635  1.00 70.42  ? 2317 ARG B CG  1 
ATOM 7176  C CD  . ARG A 1 945  ? -14.253 -14.045 -39.247  1.00 71.60  ? 2317 ARG B CD  1 
ATOM 7177  N NE  . ARG A 1 945  ? -13.454 -13.535 -38.137  1.00 71.95  ? 2317 ARG B NE  1 
ATOM 7178  C CZ  . ARG A 1 945  ? -13.514 -12.290 -37.670  1.00 71.88  ? 2317 ARG B CZ  1 
ATOM 7179  N NH1 . ARG A 1 945  ? -14.343 -11.399 -38.214  1.00 72.65  ? 2317 ARG B NH1 1 
ATOM 7180  N NH2 . ARG A 1 945  ? -12.735 -11.930 -36.655  1.00 73.48  ? 2317 ARG B NH2 1 
ATOM 7181  N N   . THR A 1 946  ? -11.999 -18.558 -37.600  1.00 60.71  ? 2318 THR B N   1 
ATOM 7182  C CA  . THR A 1 946  ? -10.596 -18.920 -37.371  1.00 61.11  ? 2318 THR B CA  1 
ATOM 7183  C C   . THR A 1 946  ? -10.242 -20.136 -38.217  1.00 63.11  ? 2318 THR B C   1 
ATOM 7184  O O   . THR A 1 946  ? -9.262  -20.113 -38.964  1.00 63.89  ? 2318 THR B O   1 
ATOM 7185  C CB  . THR A 1 946  ? -10.300 -19.222 -35.885  1.00 61.71  ? 2318 THR B CB  1 
ATOM 7186  O OG1 . THR A 1 946  ? -10.923 -18.237 -35.054  1.00 67.40  ? 2318 THR B OG1 1 
ATOM 7187  C CG2 . THR A 1 946  ? -8.802  -19.208 -35.616  1.00 60.31  ? 2318 THR B CG2 1 
ATOM 7188  N N   . ASN A 1 947  ? -11.058 -21.184 -38.099  1.00 67.75  ? 2319 ASN B N   1 
ATOM 7189  C CA  . ASN A 1 947  ? -10.926 -22.400 -38.918  1.00 68.66  ? 2319 ASN B CA  1 
ATOM 7190  C C   . ASN A 1 947  ? -10.929 -22.081 -40.409  1.00 63.64  ? 2319 ASN B C   1 
ATOM 7191  O O   . ASN A 1 947  ? -10.130 -22.639 -41.165  1.00 66.29  ? 2319 ASN B O   1 
ATOM 7192  C CB  . ASN A 1 947  ? -12.059 -23.391 -38.613  1.00 75.17  ? 2319 ASN B CB  1 
ATOM 7193  C CG  . ASN A 1 947  ? -11.878 -24.104 -37.280  1.00 84.17  ? 2319 ASN B CG  1 
ATOM 7194  O OD1 . ASN A 1 947  ? -11.469 -23.502 -36.287  1.00 88.04  ? 2319 ASN B OD1 1 
ATOM 7195  N ND2 . ASN A 1 947  ? -12.193 -25.395 -37.254  1.00 91.99  ? 2319 ASN B ND2 1 
ATOM 7196  N N   . TYR A 1 948  ? -11.832 -21.182 -40.809  1.00 58.40  ? 2320 TYR B N   1 
ATOM 7197  C CA  . TYR A 1 948  ? -11.973 -20.740 -42.206  1.00 52.65  ? 2320 TYR B CA  1 
ATOM 7198  C C   . TYR A 1 948  ? -10.687 -20.122 -42.755  1.00 49.27  ? 2320 TYR B C   1 
ATOM 7199  O O   . TYR A 1 948  ? -10.151 -20.586 -43.762  1.00 49.41  ? 2320 TYR B O   1 
ATOM 7200  C CB  . TYR A 1 948  ? -13.141 -19.741 -42.351  1.00 50.99  ? 2320 TYR B CB  1 
ATOM 7201  C CG  . TYR A 1 948  ? -13.087 -18.929 -43.621  1.00 49.15  ? 2320 TYR B CG  1 
ATOM 7202  C CD1 . TYR A 1 948  ? -13.407 -19.501 -44.853  1.00 47.56  ? 2320 TYR B CD1 1 
ATOM 7203  C CD2 . TYR A 1 948  ? -12.688 -17.592 -43.599  1.00 49.37  ? 2320 TYR B CD2 1 
ATOM 7204  C CE1 . TYR A 1 948  ? -13.342 -18.761 -46.025  1.00 45.42  ? 2320 TYR B CE1 1 
ATOM 7205  C CE2 . TYR A 1 948  ? -12.618 -16.849 -44.766  1.00 47.86  ? 2320 TYR B CE2 1 
ATOM 7206  C CZ  . TYR A 1 948  ? -12.948 -17.438 -45.972  1.00 44.96  ? 2320 TYR B CZ  1 
ATOM 7207  O OH  . TYR A 1 948  ? -12.874 -16.699 -47.118  1.00 42.82  ? 2320 TYR B OH  1 
ATOM 7208  N N   . THR A 1 949  ? -10.209 -19.076 -42.089  1.00 47.74  ? 2321 THR B N   1 
ATOM 7209  C CA  . THR A 1 949  ? -9.002  -18.363 -42.505  1.00 46.92  ? 2321 THR B CA  1 
ATOM 7210  C C   . THR A 1 949  ? -7.805  -19.298 -42.637  1.00 50.17  ? 2321 THR B C   1 
ATOM 7211  O O   . THR A 1 949  ? -7.051  -19.200 -43.604  1.00 53.89  ? 2321 THR B O   1 
ATOM 7212  C CB  . THR A 1 949  ? -8.658  -17.230 -41.522  1.00 46.52  ? 2321 THR B CB  1 
ATOM 7213  O OG1 . THR A 1 949  ? -9.758  -16.318 -41.456  1.00 45.88  ? 2321 THR B OG1 1 
ATOM 7214  C CG2 . THR A 1 949  ? -7.395  -16.465 -41.951  1.00 46.97  ? 2321 THR B CG2 1 
ATOM 7215  N N   . ARG A 1 950  ? -7.638  -20.196 -41.670  1.00 52.77  ? 2322 ARG B N   1 
ATOM 7216  C CA  . ARG A 1 950  ? -6.522  -21.139 -41.689  1.00 55.67  ? 2322 ARG B CA  1 
ATOM 7217  C C   . ARG A 1 950  ? -6.645  -22.122 -42.835  1.00 58.44  ? 2322 ARG B C   1 
ATOM 7218  O O   . ARG A 1 950  ? -5.732  -22.229 -43.649  1.00 63.96  ? 2322 ARG B O   1 
ATOM 7219  C CB  . ARG A 1 950  ? -6.398  -21.883 -40.356  1.00 59.24  ? 2322 ARG B CB  1 
ATOM 7220  C CG  . ARG A 1 950  ? -5.655  -21.069 -39.317  1.00 62.16  ? 2322 ARG B CG  1 
ATOM 7221  C CD  . ARG A 1 950  ? -5.844  -21.575 -37.900  1.00 63.23  ? 2322 ARG B CD  1 
ATOM 7222  N NE  . ARG A 1 950  ? -5.427  -20.559 -36.935  1.00 66.10  ? 2322 ARG B NE  1 
ATOM 7223  C CZ  . ARG A 1 950  ? -5.527  -20.672 -35.612  1.00 69.16  ? 2322 ARG B CZ  1 
ATOM 7224  N NH1 . ARG A 1 950  ? -6.031  -21.773 -35.056  1.00 69.70  ? 2322 ARG B NH1 1 
ATOM 7225  N NH2 . ARG A 1 950  ? -5.114  -19.671 -34.835  1.00 72.29  ? 2322 ARG B NH2 1 
ATOM 7226  N N   . SER A 1 951  ? -7.778  -22.815 -42.910  1.00 59.91  ? 2323 SER B N   1 
ATOM 7227  C CA  . SER A 1 951  ? -7.977  -23.865 -43.918  1.00 62.55  ? 2323 SER B CA  1 
ATOM 7228  C C   . SER A 1 951  ? -7.868  -23.350 -45.361  1.00 60.17  ? 2323 SER B C   1 
ATOM 7229  O O   . SER A 1 951  ? -7.366  -24.064 -46.234  1.00 60.88  ? 2323 SER B O   1 
ATOM 7230  C CB  . SER A 1 951  ? -9.316  -24.580 -43.704  1.00 61.60  ? 2323 SER B CB  1 
ATOM 7231  O OG  . SER A 1 951  ? -10.408 -23.708 -43.930  1.00 60.42  ? 2323 SER B OG  1 
ATOM 7232  N N   . LEU A 1 952  ? -8.330  -22.121 -45.594  1.00 56.61  ? 2324 LEU B N   1 
ATOM 7233  C CA  . LEU A 1 952  ? -8.181  -21.453 -46.894  1.00 57.50  ? 2324 LEU B CA  1 
ATOM 7234  C C   . LEU A 1 952  ? -6.708  -21.220 -47.227  1.00 55.88  ? 2324 LEU B C   1 
ATOM 7235  O O   . LEU A 1 952  ? -6.272  -21.509 -48.345  1.00 59.50  ? 2324 LEU B O   1 
ATOM 7236  C CB  . LEU A 1 952  ? -8.954  -20.124 -46.915  1.00 57.81  ? 2324 LEU B CB  1 
ATOM 7237  C CG  . LEU A 1 952  ? -8.833  -19.206 -48.143  1.00 57.93  ? 2324 LEU B CG  1 
ATOM 7238  C CD1 . LEU A 1 952  ? -9.599  -19.752 -49.335  1.00 55.07  ? 2324 LEU B CD1 1 
ATOM 7239  C CD2 . LEU A 1 952  ? -9.316  -17.800 -47.817  1.00 60.85  ? 2324 LEU B CD2 1 
ATOM 7240  N N   . ALA A 1 953  ? -5.963  -20.693 -46.257  1.00 53.25  ? 2325 ALA B N   1 
ATOM 7241  C CA  . ALA A 1 953  ? -4.518  -20.449 -46.404  1.00 53.30  ? 2325 ALA B CA  1 
ATOM 7242  C C   . ALA A 1 953  ? -3.717  -21.724 -46.665  1.00 52.26  ? 2325 ALA B C   1 
ATOM 7243  O O   . ALA A 1 953  ? -2.751  -21.706 -47.428  1.00 51.18  ? 2325 ALA B O   1 
ATOM 7244  C CB  . ALA A 1 953  ? -3.969  -19.750 -45.169  1.00 54.12  ? 2325 ALA B CB  1 
ATOM 7245  N N   . VAL A 1 954  ? -4.119  -22.820 -46.026  1.00 52.26  ? 2326 VAL B N   1 
ATOM 7246  C CA  . VAL A 1 954  ? -3.451  -24.109 -46.203  1.00 53.36  ? 2326 VAL B CA  1 
ATOM 7247  C C   . VAL A 1 954  ? -3.509  -24.515 -47.681  1.00 50.96  ? 2326 VAL B C   1 
ATOM 7248  O O   . VAL A 1 954  ? -2.486  -24.835 -48.280  1.00 50.81  ? 2326 VAL B O   1 
ATOM 7249  C CB  . VAL A 1 954  ? -4.080  -25.211 -45.304  1.00 57.58  ? 2326 VAL B CB  1 
ATOM 7250  C CG1 . VAL A 1 954  ? -3.538  -26.597 -45.647  1.00 61.25  ? 2326 VAL B CG1 1 
ATOM 7251  C CG2 . VAL A 1 954  ? -3.830  -24.926 -43.828  1.00 56.39  ? 2326 VAL B CG2 1 
ATOM 7252  N N   . MET A 1 955  ? -4.707  -24.483 -48.260  1.00 48.65  ? 2327 MET B N   1 
ATOM 7253  C CA  . MET A 1 955  ? -4.897  -24.875 -49.662  1.00 45.65  ? 2327 MET B CA  1 
ATOM 7254  C C   . MET A 1 955  ? -4.479  -23.807 -50.670  1.00 42.86  ? 2327 MET B C   1 
ATOM 7255  O O   . MET A 1 955  ? -4.352  -24.106 -51.862  1.00 41.51  ? 2327 MET B O   1 
ATOM 7256  C CB  . MET A 1 955  ? -6.343  -25.333 -49.928  1.00 44.68  ? 2327 MET B CB  1 
ATOM 7257  C CG  . MET A 1 955  ? -6.582  -26.811 -49.646  1.00 45.01  ? 2327 MET B CG  1 
ATOM 7258  S SD  . MET A 1 955  ? -5.459  -27.925 -50.519  1.00 46.09  ? 2327 MET B SD  1 
ATOM 7259  C CE  . MET A 1 955  ? -5.821  -27.540 -52.231  1.00 45.38  ? 2327 MET B CE  1 
ATOM 7260  N N   . SER A 1 956  ? -4.279  -22.575 -50.207  1.00 41.48  ? 2328 SER B N   1 
ATOM 7261  C CA  . SER A 1 956  ? -3.662  -21.541 -51.033  1.00 41.41  ? 2328 SER B CA  1 
ATOM 7262  C C   . SER A 1 956  ? -2.235  -21.954 -51.359  1.00 43.03  ? 2328 SER B C   1 
ATOM 7263  O O   . SER A 1 956  ? -1.836  -21.990 -52.525  1.00 44.81  ? 2328 SER B O   1 
ATOM 7264  C CB  . SER A 1 956  ? -3.665  -20.183 -50.324  1.00 40.87  ? 2328 SER B CB  1 
ATOM 7265  O OG  . SER A 1 956  ? -4.985  -19.767 -50.008  1.00 39.50  ? 2328 SER B OG  1 
ATOM 7266  N N   . MET A 1 957  ? -1.485  -22.297 -50.320  1.00 43.92  ? 2329 MET B N   1 
ATOM 7267  C CA  . MET A 1 957  ? -0.079  -22.648 -50.468  1.00 46.67  ? 2329 MET B CA  1 
ATOM 7268  C C   . MET A 1 957  ? 0.098   -24.032 -51.098  1.00 48.36  ? 2329 MET B C   1 
ATOM 7269  O O   . MET A 1 957  ? 0.926   -24.210 -51.995  1.00 50.40  ? 2329 MET B O   1 
ATOM 7270  C CB  . MET A 1 957  ? 0.621   -22.592 -49.110  1.00 48.37  ? 2329 MET B CB  1 
ATOM 7271  C CG  . MET A 1 957  ? 0.592   -21.233 -48.417  1.00 49.34  ? 2329 MET B CG  1 
ATOM 7272  S SD  . MET A 1 957  ? 1.436   -19.904 -49.285  1.00 49.57  ? 2329 MET B SD  1 
ATOM 7273  C CE  . MET A 1 957  ? 0.070   -19.159 -50.187  1.00 49.01  ? 2329 MET B CE  1 
ATOM 7274  N N   . VAL A 1 958  ? -0.679  -25.004 -50.628  1.00 47.82  ? 2330 VAL B N   1 
ATOM 7275  C CA  . VAL A 1 958  ? -0.599  -26.375 -51.138  1.00 48.45  ? 2330 VAL B CA  1 
ATOM 7276  C C   . VAL A 1 958  ? -1.013  -26.409 -52.606  1.00 46.10  ? 2330 VAL B C   1 
ATOM 7277  O O   . VAL A 1 958  ? -0.313  -26.984 -53.440  1.00 45.43  ? 2330 VAL B O   1 
ATOM 7278  C CB  . VAL A 1 958  ? -1.459  -27.340 -50.289  1.00 50.74  ? 2330 VAL B CB  1 
ATOM 7279  C CG1 . VAL A 1 958  ? -1.617  -28.703 -50.951  1.00 52.08  ? 2330 VAL B CG1 1 
ATOM 7280  C CG2 . VAL A 1 958  ? -0.821  -27.517 -48.921  1.00 53.49  ? 2330 VAL B CG2 1 
ATOM 7281  N N   . GLY A 1 959  ? -2.146  -25.782 -52.905  1.00 45.62  ? 2331 GLY B N   1 
ATOM 7282  C CA  . GLY A 1 959  ? -2.649  -25.657 -54.272  1.00 46.37  ? 2331 GLY B CA  1 
ATOM 7283  C C   . GLY A 1 959  ? -1.655  -25.019 -55.220  1.00 47.18  ? 2331 GLY B C   1 
ATOM 7284  O O   . GLY A 1 959  ? -1.521  -25.464 -56.362  1.00 46.01  ? 2331 GLY B O   1 
ATOM 7285  N N   . TYR A 1 960  ? -0.954  -23.988 -54.737  1.00 48.73  ? 2332 TYR B N   1 
ATOM 7286  C CA  . TYR A 1 960  ? 0.063   -23.283 -55.526  1.00 49.53  ? 2332 TYR B CA  1 
ATOM 7287  C C   . TYR A 1 960  ? 1.163   -24.230 -56.010  1.00 50.69  ? 2332 TYR B C   1 
ATOM 7288  O O   . TYR A 1 960  ? 1.519   -24.215 -57.187  1.00 53.68  ? 2332 TYR B O   1 
ATOM 7289  C CB  . TYR A 1 960  ? 0.681   -22.107 -54.742  1.00 49.21  ? 2332 TYR B CB  1 
ATOM 7290  C CG  . TYR A 1 960  ? 1.862   -21.458 -55.454  1.00 49.83  ? 2332 TYR B CG  1 
ATOM 7291  C CD1 . TYR A 1 960  ? 1.701   -20.868 -56.706  1.00 49.32  ? 2332 TYR B CD1 1 
ATOM 7292  C CD2 . TYR A 1 960  ? 3.140   -21.453 -54.888  1.00 51.45  ? 2332 TYR B CD2 1 
ATOM 7293  C CE1 . TYR A 1 960  ? 2.768   -20.291 -57.375  1.00 50.36  ? 2332 TYR B CE1 1 
ATOM 7294  C CE2 . TYR A 1 960  ? 4.215   -20.870 -55.548  1.00 53.37  ? 2332 TYR B CE2 1 
ATOM 7295  C CZ  . TYR A 1 960  ? 4.024   -20.295 -56.797  1.00 52.87  ? 2332 TYR B CZ  1 
ATOM 7296  O OH  . TYR A 1 960  ? 5.077   -19.708 -57.468  1.00 53.55  ? 2332 TYR B OH  1 
ATOM 7297  N N   . ILE A 1 961  ? 1.668   -25.069 -55.110  1.00 50.36  ? 2333 ILE B N   1 
ATOM 7298  C CA  . ILE A 1 961  ? 2.725   -26.025 -55.452  1.00 50.99  ? 2333 ILE B CA  1 
ATOM 7299  C C   . ILE A 1 961  ? 2.210   -27.018 -56.494  1.00 51.36  ? 2333 ILE B C   1 
ATOM 7300  O O   . ILE A 1 961  ? 2.850   -27.226 -57.535  1.00 51.85  ? 2333 ILE B O   1 
ATOM 7301  C CB  . ILE A 1 961  ? 3.251   -26.735 -54.189  1.00 51.61  ? 2333 ILE B CB  1 
ATOM 7302  C CG1 . ILE A 1 961  ? 3.984   -25.723 -53.311  1.00 54.42  ? 2333 ILE B CG1 1 
ATOM 7303  C CG2 . ILE A 1 961  ? 4.207   -27.875 -54.527  1.00 52.94  ? 2333 ILE B CG2 1 
ATOM 7304  C CD1 . ILE A 1 961  ? 3.981   -26.107 -51.858  1.00 58.36  ? 2333 ILE B CD1 1 
ATOM 7305  N N   . LEU A 1 962  ? 1.037   -27.592 -56.217  1.00 50.92  ? 2334 LEU B N   1 
ATOM 7306  C CA  . LEU A 1 962  ? 0.333   -28.468 -57.165  1.00 51.08  ? 2334 LEU B CA  1 
ATOM 7307  C C   . LEU A 1 962  ? 0.042   -27.777 -58.507  1.00 53.45  ? 2334 LEU B C   1 
ATOM 7308  O O   . LEU A 1 962  ? -0.006  -28.446 -59.540  1.00 57.37  ? 2334 LEU B O   1 
ATOM 7309  C CB  . LEU A 1 962  ? -0.975  -28.987 -56.541  1.00 49.28  ? 2334 LEU B CB  1 
ATOM 7310  C CG  . LEU A 1 962  ? -1.871  -29.962 -57.322  1.00 47.44  ? 2334 LEU B CG  1 
ATOM 7311  C CD1 . LEU A 1 962  ? -1.119  -31.201 -57.778  1.00 47.83  ? 2334 LEU B CD1 1 
ATOM 7312  C CD2 . LEU A 1 962  ? -3.062  -30.366 -56.468  1.00 45.33  ? 2334 LEU B CD2 1 
ATOM 7313  N N   . GLY A 1 963  ? -0.140  -26.452 -58.475  1.00 50.84  ? 2335 GLY B N   1 
ATOM 7314  C CA  . GLY A 1 963  ? -0.462  -25.642 -59.651  1.00 46.74  ? 2335 GLY B CA  1 
ATOM 7315  C C   . GLY A 1 963  ? -1.960  -25.588 -59.881  1.00 44.04  ? 2335 GLY B C   1 
ATOM 7316  O O   . GLY A 1 963  ? -2.421  -25.280 -60.975  1.00 42.84  ? 2335 GLY B O   1 
ATOM 7317  N N   . LEU A 1 964  ? -2.723  -25.855 -58.828  1.00 44.59  ? 2336 LEU B N   1 
ATOM 7318  C CA  . LEU A 1 964  ? -4.154  -26.093 -58.939  1.00 43.99  ? 2336 LEU B CA  1 
ATOM 7319  C C   . LEU A 1 964  ? -4.889  -24.856 -59.446  1.00 41.72  ? 2336 LEU B C   1 
ATOM 7320  O O   . LEU A 1 964  ? -4.967  -23.852 -58.746  1.00 41.65  ? 2336 LEU B O   1 
ATOM 7321  C CB  . LEU A 1 964  ? -4.706  -26.525 -57.576  1.00 44.43  ? 2336 LEU B CB  1 
ATOM 7322  C CG  . LEU A 1 964  ? -6.191  -26.855 -57.480  1.00 44.56  ? 2336 LEU B CG  1 
ATOM 7323  C CD1 . LEU A 1 964  ? -6.599  -27.927 -58.479  1.00 47.79  ? 2336 LEU B CD1 1 
ATOM 7324  C CD2 . LEU A 1 964  ? -6.544  -27.281 -56.063  1.00 44.49  ? 2336 LEU B CD2 1 
ATOM 7325  N N   . GLY A 1 965  ? -5.394  -24.936 -60.674  1.00 41.80  ? 2337 GLY B N   1 
ATOM 7326  C CA  . GLY A 1 965  ? -6.172  -23.860 -61.289  1.00 42.88  ? 2337 GLY B CA  1 
ATOM 7327  C C   . GLY A 1 965  ? -7.661  -24.161 -61.328  1.00 43.39  ? 2337 GLY B C   1 
ATOM 7328  O O   . GLY A 1 965  ? -8.114  -25.150 -60.774  1.00 44.29  ? 2337 GLY B O   1 
ATOM 7329  N N   . ASP A 1 966  ? -8.411  -23.295 -62.000  1.00 45.17  ? 2338 ASP B N   1 
ATOM 7330  C CA  . ASP A 1 966  ? -9.868  -23.426 -62.180  1.00 45.47  ? 2338 ASP B CA  1 
ATOM 7331  C C   . ASP A 1 966  ? -10.635 -23.438 -60.855  1.00 43.80  ? 2338 ASP B C   1 
ATOM 7332  O O   . ASP A 1 966  ? -11.577 -24.212 -60.664  1.00 41.71  ? 2338 ASP B O   1 
ATOM 7333  C CB  . ASP A 1 966  ? -10.210 -24.656 -63.037  1.00 48.20  ? 2338 ASP B CB  1 
ATOM 7334  C CG  . ASP A 1 966  ? -11.581 -24.549 -63.698  1.00 51.74  ? 2338 ASP B CG  1 
ATOM 7335  O OD1 . ASP A 1 966  ? -11.811 -23.560 -64.427  1.00 57.58  ? 2338 ASP B OD1 1 
ATOM 7336  O OD2 . ASP A 1 966  ? -12.423 -25.455 -63.496  1.00 51.22  ? 2338 ASP B OD2 1 
ATOM 7337  N N   . ARG A 1 967  ? -10.243 -22.535 -59.958  1.00 45.05  ? 2339 ARG B N   1 
ATOM 7338  C CA  . ARG A 1 967  ? -10.832 -22.427 -58.615  1.00 43.46  ? 2339 ARG B CA  1 
ATOM 7339  C C   . ARG A 1 967  ? -12.015 -21.452 -58.601  1.00 41.97  ? 2339 ARG B C   1 
ATOM 7340  O O   . ARG A 1 967  ? -12.043 -20.485 -57.833  1.00 40.00  ? 2339 ARG B O   1 
ATOM 7341  C CB  . ARG A 1 967  ? -9.760  -22.008 -57.606  1.00 42.63  ? 2339 ARG B CB  1 
ATOM 7342  C CG  . ARG A 1 967  ? -8.496  -22.855 -57.671  1.00 43.86  ? 2339 ARG B CG  1 
ATOM 7343  C CD  . ARG A 1 967  ? -8.451  -23.973 -56.643  1.00 46.16  ? 2339 ARG B CD  1 
ATOM 7344  N NE  . ARG A 1 967  ? -9.589  -24.903 -56.634  1.00 48.37  ? 2339 ARG B NE  1 
ATOM 7345  C CZ  . ARG A 1 967  ? -9.851  -25.841 -57.547  1.00 47.04  ? 2339 ARG B CZ  1 
ATOM 7346  N NH1 . ARG A 1 967  ? -9.108  -25.984 -58.633  1.00 48.70  ? 2339 ARG B NH1 1 
ATOM 7347  N NH2 . ARG A 1 967  ? -10.907 -26.629 -57.382  1.00 45.00  ? 2339 ARG B NH2 1 
ATOM 7348  N N   . HIS A 1 968  ? -12.996 -21.742 -59.454  1.00 42.02  ? 2340 HIS B N   1 
ATOM 7349  C CA  . HIS A 1 968  ? -14.237 -20.967 -59.542  1.00 43.12  ? 2340 HIS B CA  1 
ATOM 7350  C C   . HIS A 1 968  ? -15.171 -21.305 -58.364  1.00 43.09  ? 2340 HIS B C   1 
ATOM 7351  O O   . HIS A 1 968  ? -14.985 -22.339 -57.719  1.00 44.96  ? 2340 HIS B O   1 
ATOM 7352  C CB  . HIS A 1 968  ? -14.932 -21.203 -60.897  1.00 45.67  ? 2340 HIS B CB  1 
ATOM 7353  C CG  . HIS A 1 968  ? -15.230 -22.642 -61.201  1.00 47.17  ? 2340 HIS B CG  1 
ATOM 7354  N ND1 . HIS A 1 968  ? -16.180 -23.370 -60.518  1.00 46.16  ? 2340 HIS B ND1 1 
ATOM 7355  C CD2 . HIS A 1 968  ? -14.709 -23.482 -62.128  1.00 48.43  ? 2340 HIS B CD2 1 
ATOM 7356  C CE1 . HIS A 1 968  ? -16.230 -24.595 -61.008  1.00 46.74  ? 2340 HIS B CE1 1 
ATOM 7357  N NE2 . HIS A 1 968  ? -15.345 -24.690 -61.983  1.00 48.02  ? 2340 HIS B NE2 1 
ATOM 7358  N N   . PRO A 1 969  ? -16.184 -20.452 -58.083  1.00 43.33  ? 2341 PRO B N   1 
ATOM 7359  C CA  . PRO A 1 969  ? -17.008 -20.627 -56.869  1.00 42.93  ? 2341 PRO B CA  1 
ATOM 7360  C C   . PRO A 1 969  ? -17.806 -21.927 -56.707  1.00 42.66  ? 2341 PRO B C   1 
ATOM 7361  O O   . PRO A 1 969  ? -18.262 -22.202 -55.604  1.00 44.79  ? 2341 PRO B O   1 
ATOM 7362  C CB  . PRO A 1 969  ? -17.962 -19.426 -56.914  1.00 42.60  ? 2341 PRO B CB  1 
ATOM 7363  C CG  . PRO A 1 969  ? -17.239 -18.406 -57.714  1.00 42.51  ? 2341 PRO B CG  1 
ATOM 7364  C CD  . PRO A 1 969  ? -16.534 -19.196 -58.774  1.00 43.56  ? 2341 PRO B CD  1 
ATOM 7365  N N   . SER A 1 970  ? -17.985 -22.703 -57.772  1.00 43.11  ? 2342 SER B N   1 
ATOM 7366  C CA  . SER A 1 970  ? -18.566 -24.051 -57.664  1.00 46.13  ? 2342 SER B CA  1 
ATOM 7367  C C   . SER A 1 970  ? -17.551 -25.173 -57.382  1.00 45.07  ? 2342 SER B C   1 
ATOM 7368  O O   . SER A 1 970  ? -17.951 -26.299 -57.083  1.00 46.33  ? 2342 SER B O   1 
ATOM 7369  C CB  . SER A 1 970  ? -19.361 -24.383 -58.929  1.00 49.82  ? 2342 SER B CB  1 
ATOM 7370  O OG  . SER A 1 970  ? -20.486 -23.528 -59.042  1.00 52.69  ? 2342 SER B OG  1 
ATOM 7371  N N   . ASN A 1 971  ? -16.257 -24.873 -57.476  1.00 44.21  ? 2343 ASN B N   1 
ATOM 7372  C CA  . ASN A 1 971  ? -15.192 -25.860 -57.245  1.00 46.41  ? 2343 ASN B CA  1 
ATOM 7373  C C   . ASN A 1 971  ? -14.521 -25.757 -55.865  1.00 48.86  ? 2343 ASN B C   1 
ATOM 7374  O O   . ASN A 1 971  ? -13.661 -26.583 -55.525  1.00 46.37  ? 2343 ASN B O   1 
ATOM 7375  C CB  . ASN A 1 971  ? -14.128 -25.753 -58.350  1.00 46.41  ? 2343 ASN B CB  1 
ATOM 7376  C CG  . ASN A 1 971  ? -14.404 -26.652 -59.537  1.00 49.30  ? 2343 ASN B CG  1 
ATOM 7377  O OD1 . ASN A 1 971  ? -13.645 -26.633 -60.503  1.00 53.62  ? 2343 ASN B OD1 1 
ATOM 7378  N ND2 . ASN A 1 971  ? -15.481 -27.436 -59.486  1.00 50.16  ? 2343 ASN B ND2 1 
ATOM 7379  N N   . LEU A 1 972  ? -14.883 -24.745 -55.081  1.00 51.90  ? 2344 LEU B N   1 
ATOM 7380  C CA  . LEU A 1 972  ? -14.535 -24.741 -53.666  1.00 54.52  ? 2344 LEU B CA  1 
ATOM 7381  C C   . LEU A 1 972  ? -15.771 -24.420 -52.851  1.00 52.01  ? 2344 LEU B C   1 
ATOM 7382  O O   . LEU A 1 972  ? -16.603 -23.617 -53.265  1.00 49.66  ? 2344 LEU B O   1 
ATOM 7383  C CB  . LEU A 1 972  ? -13.364 -23.794 -53.366  1.00 59.45  ? 2344 LEU B CB  1 
ATOM 7384  C CG  . LEU A 1 972  ? -13.539 -22.284 -53.149  1.00 61.32  ? 2344 LEU B CG  1 
ATOM 7385  C CD1 . LEU A 1 972  ? -14.000 -21.949 -51.739  1.00 64.75  ? 2344 LEU B CD1 1 
ATOM 7386  C CD2 . LEU A 1 972  ? -12.217 -21.576 -53.407  1.00 59.58  ? 2344 LEU B CD2 1 
ATOM 7387  N N   . MET A 1 973  ? -15.868 -25.058 -51.688  1.00 53.85  ? 2345 MET B N   1 
ATOM 7388  C CA  . MET A 1 973  ? -17.050 -24.982 -50.830  1.00 55.88  ? 2345 MET B CA  1 
ATOM 7389  C C   . MET A 1 973  ? -16.663 -24.829 -49.355  1.00 54.25  ? 2345 MET B C   1 
ATOM 7390  O O   . MET A 1 973  ? -15.493 -24.962 -48.998  1.00 52.54  ? 2345 MET B O   1 
ATOM 7391  C CB  . MET A 1 973  ? -17.955 -26.210 -51.058  1.00 58.15  ? 2345 MET B CB  1 
ATOM 7392  C CG  . MET A 1 973  ? -17.267 -27.558 -51.207  1.00 56.84  ? 2345 MET B CG  1 
ATOM 7393  S SD  . MET A 1 973  ? -18.473 -28.812 -51.688  1.00 55.04  ? 2345 MET B SD  1 
ATOM 7394  C CE  . MET A 1 973  ? -18.419 -28.676 -53.469  1.00 54.67  ? 2345 MET B CE  1 
ATOM 7395  N N   . LEU A 1 974  ? -17.657 -24.532 -48.517  1.00 55.62  ? 2346 LEU B N   1 
ATOM 7396  C CA  . LEU A 1 974  ? -17.456 -24.254 -47.091  1.00 56.19  ? 2346 LEU B CA  1 
ATOM 7397  C C   . LEU A 1 974  ? -18.317 -25.159 -46.212  1.00 59.52  ? 2346 LEU B C   1 
ATOM 7398  O O   . LEU A 1 974  ? -19.533 -25.249 -46.410  1.00 56.88  ? 2346 LEU B O   1 
ATOM 7399  C CB  . LEU A 1 974  ? -17.805 -22.797 -46.791  1.00 54.22  ? 2346 LEU B CB  1 
ATOM 7400  C CG  . LEU A 1 974  ? -16.892 -21.744 -47.412  1.00 54.51  ? 2346 LEU B CG  1 
ATOM 7401  C CD1 . LEU A 1 974  ? -17.576 -20.392 -47.455  1.00 53.31  ? 2346 LEU B CD1 1 
ATOM 7402  C CD2 . LEU A 1 974  ? -15.584 -21.648 -46.644  1.00 58.32  ? 2346 LEU B CD2 1 
ATOM 7403  N N   . ASP A 1 975  ? -17.677 -25.805 -45.234  1.00 65.41  ? 2347 ASP B N   1 
ATOM 7404  C CA  . ASP A 1 975  ? -18.373 -26.587 -44.208  1.00 66.97  ? 2347 ASP B CA  1 
ATOM 7405  C C   . ASP A 1 975  ? -19.072 -25.612 -43.265  1.00 67.69  ? 2347 ASP B C   1 
ATOM 7406  O O   . ASP A 1 975  ? -18.419 -24.781 -42.632  1.00 67.20  ? 2347 ASP B O   1 
ATOM 7407  C CB  . ASP A 1 975  ? -17.383 -27.466 -43.437  1.00 67.89  ? 2347 ASP B CB  1 
ATOM 7408  C CG  . ASP A 1 975  ? -18.063 -28.390 -42.439  1.00 72.47  ? 2347 ASP B CG  1 
ATOM 7409  O OD1 . ASP A 1 975  ? -18.501 -27.906 -41.377  1.00 76.62  ? 2347 ASP B OD1 1 
ATOM 7410  O OD2 . ASP A 1 975  ? -18.138 -29.609 -42.700  1.00 78.57  ? 2347 ASP B OD2 1 
ATOM 7411  N N   . ARG A 1 976  ? -20.396 -25.721 -43.177  1.00 69.66  ? 2348 ARG B N   1 
ATOM 7412  C CA  . ARG A 1 976  ? -21.204 -24.741 -42.446  1.00 72.34  ? 2348 ARG B CA  1 
ATOM 7413  C C   . ARG A 1 976  ? -21.145 -24.875 -40.921  1.00 72.41  ? 2348 ARG B C   1 
ATOM 7414  O O   . ARG A 1 976  ? -21.462 -23.920 -40.212  1.00 76.16  ? 2348 ARG B O   1 
ATOM 7415  C CB  . ARG A 1 976  ? -22.660 -24.759 -42.933  1.00 74.56  ? 2348 ARG B CB  1 
ATOM 7416  C CG  . ARG A 1 976  ? -23.507 -25.949 -42.499  1.00 77.63  ? 2348 ARG B CG  1 
ATOM 7417  C CD  . ARG A 1 976  ? -24.855 -25.928 -43.205  1.00 80.10  ? 2348 ARG B CD  1 
ATOM 7418  N NE  . ARG A 1 976  ? -24.758 -26.425 -44.581  1.00 81.00  ? 2348 ARG B NE  1 
ATOM 7419  C CZ  . ARG A 1 976  ? -25.117 -27.641 -45.008  1.00 83.13  ? 2348 ARG B CZ  1 
ATOM 7420  N NH1 . ARG A 1 976  ? -25.633 -28.554 -44.182  1.00 85.55  ? 2348 ARG B NH1 1 
ATOM 7421  N NH2 . ARG A 1 976  ? -24.964 -27.951 -46.296  1.00 82.37  ? 2348 ARG B NH2 1 
ATOM 7422  N N   . LEU A 1 977  ? -20.751 -26.047 -40.424  1.00 71.34  ? 2349 LEU B N   1 
ATOM 7423  C CA  . LEU A 1 977  ? -20.620 -26.273 -38.979  1.00 73.25  ? 2349 LEU B CA  1 
ATOM 7424  C C   . LEU A 1 977  ? -19.228 -25.906 -38.480  1.00 72.30  ? 2349 LEU B C   1 
ATOM 7425  O O   . LEU A 1 977  ? -19.092 -25.108 -37.553  1.00 72.26  ? 2349 LEU B O   1 
ATOM 7426  C CB  . LEU A 1 977  ? -20.940 -27.730 -38.616  1.00 72.69  ? 2349 LEU B CB  1 
ATOM 7427  C CG  . LEU A 1 977  ? -22.423 -28.102 -38.571  1.00 71.47  ? 2349 LEU B CG  1 
ATOM 7428  C CD1 . LEU A 1 977  ? -22.580 -29.613 -38.537  1.00 74.29  ? 2349 LEU B CD1 1 
ATOM 7429  C CD2 . LEU A 1 977  ? -23.113 -27.474 -37.369  1.00 72.78  ? 2349 LEU B CD2 1 
ATOM 7430  N N   . SER A 1 978  ? -18.207 -26.500 -39.097  1.00 71.20  ? 2350 SER B N   1 
ATOM 7431  C CA  . SER A 1 978  ? -16.806 -26.293 -38.704  1.00 69.46  ? 2350 SER B CA  1 
ATOM 7432  C C   . SER A 1 978  ? -16.218 -24.963 -39.179  1.00 67.67  ? 2350 SER B C   1 
ATOM 7433  O O   . SER A 1 978  ? -15.289 -24.444 -38.564  1.00 67.94  ? 2350 SER B O   1 
ATOM 7434  C CB  . SER A 1 978  ? -15.930 -27.441 -39.224  1.00 68.98  ? 2350 SER B CB  1 
ATOM 7435  O OG  . SER A 1 978  ? -15.682 -27.325 -40.613  1.00 68.16  ? 2350 SER B OG  1 
ATOM 7436  N N   . GLY A 1 979  ? -16.729 -24.437 -40.291  1.00 70.53  ? 2351 GLY B N   1 
ATOM 7437  C CA  . GLY A 1 979  ? -16.152 -23.256 -40.933  1.00 69.49  ? 2351 GLY B CA  1 
ATOM 7438  C C   . GLY A 1 979  ? -15.002 -23.556 -41.889  1.00 65.23  ? 2351 GLY B C   1 
ATOM 7439  O O   . GLY A 1 979  ? -14.590 -22.676 -42.640  1.00 60.63  ? 2351 GLY B O   1 
ATOM 7440  N N   . LYS A 1 980  ? -14.492 -24.791 -41.883  1.00 66.21  ? 2352 LYS B N   1 
ATOM 7441  C CA  . LYS A 1 980  ? -13.358 -25.166 -42.729  1.00 67.53  ? 2352 LYS B CA  1 
ATOM 7442  C C   . LYS A 1 980  ? -13.759 -25.227 -44.195  1.00 64.98  ? 2352 LYS B C   1 
ATOM 7443  O O   . LYS A 1 980  ? -14.940 -25.342 -44.526  1.00 63.48  ? 2352 LYS B O   1 
ATOM 7444  C CB  . LYS A 1 980  ? -12.753 -26.503 -42.285  1.00 70.74  ? 2352 LYS B CB  1 
ATOM 7445  C CG  . LYS A 1 980  ? -12.117 -26.435 -40.907  1.00 76.15  ? 2352 LYS B CG  1 
ATOM 7446  C CD  . LYS A 1 980  ? -11.303 -27.675 -40.585  1.00 82.30  ? 2352 LYS B CD  1 
ATOM 7447  C CE  . LYS A 1 980  ? -10.809 -27.638 -39.146  1.00 85.35  ? 2352 LYS B CE  1 
ATOM 7448  N NZ  . LYS A 1 980  ? -9.776  -28.673 -38.867  1.00 86.88  ? 2352 LYS B NZ  1 
ATOM 7449  N N   . ILE A 1 981  ? -12.749 -25.152 -45.056  1.00 63.35  ? 2353 ILE B N   1 
ATOM 7450  C CA  . ILE A 1 981  ? -12.922 -25.023 -46.499  1.00 58.41  ? 2353 ILE B CA  1 
ATOM 7451  C C   . ILE A 1 981  ? -12.586 -26.338 -47.195  1.00 53.56  ? 2353 ILE B C   1 
ATOM 7452  O O   . ILE A 1 981  ? -11.885 -27.178 -46.635  1.00 55.45  ? 2353 ILE B O   1 
ATOM 7453  C CB  . ILE A 1 981  ? -12.040 -23.871 -47.031  1.00 62.21  ? 2353 ILE B CB  1 
ATOM 7454  C CG1 . ILE A 1 981  ? -12.639 -23.252 -48.293  1.00 71.69  ? 2353 ILE B CG1 1 
ATOM 7455  C CG2 . ILE A 1 981  ? -10.600 -24.315 -47.280  1.00 60.72  ? 2353 ILE B CG2 1 
ATOM 7456  C CD1 . ILE A 1 981  ? -12.216 -21.817 -48.474  1.00 81.02  ? 2353 ILE B CD1 1 
ATOM 7457  N N   . LEU A 1 982  ? -13.073 -26.491 -48.425  1.00 49.93  ? 2354 LEU B N   1 
ATOM 7458  C CA  . LEU A 1 982  ? -12.957 -27.739 -49.178  1.00 46.09  ? 2354 LEU B CA  1 
ATOM 7459  C C   . LEU A 1 982  ? -12.876 -27.464 -50.679  1.00 45.63  ? 2354 LEU B C   1 
ATOM 7460  O O   . LEU A 1 982  ? -13.768 -26.824 -51.233  1.00 44.60  ? 2354 LEU B O   1 
ATOM 7461  C CB  . LEU A 1 982  ? -14.172 -28.617 -48.866  1.00 45.03  ? 2354 LEU B CB  1 
ATOM 7462  C CG  . LEU A 1 982  ? -14.428 -29.898 -49.664  1.00 45.86  ? 2354 LEU B CG  1 
ATOM 7463  C CD1 . LEU A 1 982  ? -13.311 -30.907 -49.463  1.00 46.55  ? 2354 LEU B CD1 1 
ATOM 7464  C CD2 . LEU A 1 982  ? -15.761 -30.503 -49.260  1.00 46.58  ? 2354 LEU B CD2 1 
ATOM 7465  N N   . HIS A 1 983  ? -11.814 -27.956 -51.323  1.00 47.50  ? 2355 HIS B N   1 
ATOM 7466  C CA  . HIS A 1 983  ? -11.654 -27.882 -52.786  1.00 48.54  ? 2355 HIS B CA  1 
ATOM 7467  C C   . HIS A 1 983  ? -12.074 -29.192 -53.461  1.00 48.59  ? 2355 HIS B C   1 
ATOM 7468  O O   . HIS A 1 983  ? -11.858 -30.275 -52.916  1.00 49.47  ? 2355 HIS B O   1 
ATOM 7469  C CB  . HIS A 1 983  ? -10.197 -27.580 -53.154  1.00 47.31  ? 2355 HIS B CB  1 
ATOM 7470  C CG  . HIS A 1 983  ? -9.756  -26.202 -52.783  1.00 46.96  ? 2355 HIS B CG  1 
ATOM 7471  N ND1 . HIS A 1 983  ? -9.596  -25.199 -53.711  1.00 43.50  ? 2355 HIS B ND1 1 
ATOM 7472  C CD2 . HIS A 1 983  ? -9.456  -25.654 -51.582  1.00 50.00  ? 2355 HIS B CD2 1 
ATOM 7473  C CE1 . HIS A 1 983  ? -9.208  -24.093 -53.100  1.00 45.39  ? 2355 HIS B CE1 1 
ATOM 7474  N NE2 . HIS A 1 983  ? -9.117  -24.342 -51.807  1.00 48.77  ? 2355 HIS B NE2 1 
ATOM 7475  N N   . ILE A 1 984  ? -12.664 -29.078 -54.649  1.00 47.88  ? 2356 ILE B N   1 
ATOM 7476  C CA  . ILE A 1 984  ? -12.990 -30.235 -55.489  1.00 49.60  ? 2356 ILE B CA  1 
ATOM 7477  C C   . ILE A 1 984  ? -12.456 -30.015 -56.908  1.00 54.03  ? 2356 ILE B C   1 
ATOM 7478  O O   . ILE A 1 984  ? -11.928 -28.944 -57.207  1.00 58.62  ? 2356 ILE B O   1 
ATOM 7479  C CB  . ILE A 1 984  ? -14.512 -30.512 -55.517  1.00 48.78  ? 2356 ILE B CB  1 
ATOM 7480  C CG1 . ILE A 1 984  ? -15.290 -29.344 -56.131  1.00 49.16  ? 2356 ILE B CG1 1 
ATOM 7481  C CG2 . ILE A 1 984  ? -15.022 -30.779 -54.108  1.00 49.51  ? 2356 ILE B CG2 1 
ATOM 7482  C CD1 . ILE A 1 984  ? -16.676 -29.726 -56.596  1.00 50.87  ? 2356 ILE B CD1 1 
ATOM 7483  N N   . ASP A 1 985  ? -12.590 -31.034 -57.762  1.00 55.45  ? 2357 ASP B N   1 
ATOM 7484  C CA  . ASP A 1 985  ? -12.226 -30.968 -59.190  1.00 52.91  ? 2357 ASP B CA  1 
ATOM 7485  C C   . ASP A 1 985  ? -10.750 -30.619 -59.403  1.00 51.80  ? 2357 ASP B C   1 
ATOM 7486  O O   . ASP A 1 985  ? -10.389 -29.447 -59.528  1.00 57.70  ? 2357 ASP B O   1 
ATOM 7487  C CB  . ASP A 1 985  ? -13.143 -29.982 -59.933  1.00 53.00  ? 2357 ASP B CB  1 
ATOM 7488  C CG  . ASP A 1 985  ? -13.001 -30.057 -61.450  1.00 56.38  ? 2357 ASP B CG  1 
ATOM 7489  O OD1 . ASP A 1 985  ? -11.911 -30.400 -61.961  1.00 58.24  ? 2357 ASP B OD1 1 
ATOM 7490  O OD2 . ASP A 1 985  ? -13.995 -29.755 -62.142  1.00 61.14  ? 2357 ASP B OD2 1 
ATOM 7491  N N   . PHE A 1 986  ? -9.909  -31.642 -59.476  1.00 49.03  ? 2358 PHE B N   1 
ATOM 7492  C CA  . PHE A 1 986  ? -8.470  -31.449 -59.638  1.00 50.67  ? 2358 PHE B CA  1 
ATOM 7493  C C   . PHE A 1 986  ? -8.010  -31.841 -61.041  1.00 53.79  ? 2358 PHE B C   1 
ATOM 7494  O O   . PHE A 1 986  ? -6.985  -32.508 -61.212  1.00 57.86  ? 2358 PHE B O   1 
ATOM 7495  C CB  . PHE A 1 986  ? -7.727  -32.220 -58.550  1.00 50.11  ? 2358 PHE B CB  1 
ATOM 7496  C CG  . PHE A 1 986  ? -8.205  -31.897 -57.166  1.00 50.17  ? 2358 PHE B CG  1 
ATOM 7497  C CD1 . PHE A 1 986  ? -9.157  -32.698 -56.536  1.00 50.75  ? 2358 PHE B CD1 1 
ATOM 7498  C CD2 . PHE A 1 986  ? -7.734  -30.769 -56.503  1.00 47.14  ? 2358 PHE B CD2 1 
ATOM 7499  C CE1 . PHE A 1 986  ? -9.610  -32.385 -55.262  1.00 48.79  ? 2358 PHE B CE1 1 
ATOM 7500  C CE2 . PHE A 1 986  ? -8.182  -30.457 -55.229  1.00 45.73  ? 2358 PHE B CE2 1 
ATOM 7501  C CZ  . PHE A 1 986  ? -9.125  -31.262 -54.612  1.00 46.42  ? 2358 PHE B CZ  1 
ATOM 7502  N N   . GLY A 1 987  ? -8.769  -31.399 -62.043  1.00 54.79  ? 2359 GLY B N   1 
ATOM 7503  C CA  . GLY A 1 987  ? -8.426  -31.625 -63.441  1.00 57.74  ? 2359 GLY B CA  1 
ATOM 7504  C C   . GLY A 1 987  ? -7.265  -30.744 -63.856  1.00 58.16  ? 2359 GLY B C   1 
ATOM 7505  O O   . GLY A 1 987  ? -6.230  -31.242 -64.291  1.00 59.81  ? 2359 GLY B O   1 
ATOM 7506  N N   . ASP A 1 988  ? -7.439  -29.432 -63.702  1.00 59.36  ? 2360 ASP B N   1 
ATOM 7507  C CA  . ASP A 1 988  ? -6.393  -28.456 -64.036  1.00 59.04  ? 2360 ASP B CA  1 
ATOM 7508  C C   . ASP A 1 988  ? -5.344  -28.352 -62.925  1.00 57.60  ? 2360 ASP B C   1 
ATOM 7509  O O   . ASP A 1 988  ? -5.375  -27.433 -62.101  1.00 56.76  ? 2360 ASP B O   1 
ATOM 7510  C CB  . ASP A 1 988  ? -7.000  -27.076 -64.335  1.00 57.71  ? 2360 ASP B CB  1 
ATOM 7511  C CG  . ASP A 1 988  ? -7.807  -27.049 -65.622  1.00 60.35  ? 2360 ASP B CG  1 
ATOM 7512  O OD1 . ASP A 1 988  ? -7.797  -28.040 -66.380  1.00 66.79  ? 2360 ASP B OD1 1 
ATOM 7513  O OD2 . ASP A 1 988  ? -8.455  -26.017 -65.883  1.00 63.12  ? 2360 ASP B OD2 1 
ATOM 7514  N N   . CYS A 1 989  ? -4.423  -29.314 -62.919  1.00 56.94  ? 2361 CYS B N   1 
ATOM 7515  C CA  . CYS A 1 989  ? -3.250  -29.295 -62.044  1.00 54.53  ? 2361 CYS B CA  1 
ATOM 7516  C C   . CYS A 1 989  ? -2.019  -28.873 -62.833  1.00 55.20  ? 2361 CYS B C   1 
ATOM 7517  O O   . CYS A 1 989  ? -2.017  -28.900 -64.064  1.00 54.54  ? 2361 CYS B O   1 
ATOM 7518  C CB  . CYS A 1 989  ? -3.028  -30.663 -61.410  1.00 53.79  ? 2361 CYS B CB  1 
ATOM 7519  S SG  . CYS A 1 989  ? -4.256  -31.042 -60.149  1.00 50.89  ? 2361 CYS B SG  1 
ATOM 7520  N N   . PHE A 1 990  ? -0.981  -28.471 -62.102  1.00 56.97  ? 2362 PHE B N   1 
ATOM 7521  C CA  . PHE A 1 990  ? 0.216   -27.832 -62.672  1.00 56.92  ? 2362 PHE B CA  1 
ATOM 7522  C C   . PHE A 1 990  ? -0.185  -26.540 -63.404  1.00 57.32  ? 2362 PHE B C   1 
ATOM 7523  O O   . PHE A 1 990  ? -1.323  -26.089 -63.277  1.00 61.30  ? 2362 PHE B O   1 
ATOM 7524  C CB  . PHE A 1 990  ? 1.012   -28.838 -63.512  1.00 56.08  ? 2362 PHE B CB  1 
ATOM 7525  C CG  . PHE A 1 990  ? 1.265   -30.136 -62.783  1.00 57.20  ? 2362 PHE B CG  1 
ATOM 7526  C CD1 . PHE A 1 990  ? 0.554   -31.290 -63.104  1.00 59.21  ? 2362 PHE B CD1 1 
ATOM 7527  C CD2 . PHE A 1 990  ? 2.169   -30.189 -61.724  1.00 55.83  ? 2362 PHE B CD2 1 
ATOM 7528  C CE1 . PHE A 1 990  ? 0.769   -32.478 -62.411  1.00 57.47  ? 2362 PHE B CE1 1 
ATOM 7529  C CE2 . PHE A 1 990  ? 2.389   -31.372 -61.031  1.00 54.95  ? 2362 PHE B CE2 1 
ATOM 7530  C CZ  . PHE A 1 990  ? 1.686   -32.519 -61.372  1.00 55.42  ? 2362 PHE B CZ  1 
ATOM 7531  N N   . GLU A 1 991  ? 0.707   -25.928 -64.165  1.00 58.14  ? 2363 GLU B N   1 
ATOM 7532  C CA  . GLU A 1 991  ? 0.398   -24.602 -64.733  1.00 58.92  ? 2363 GLU B CA  1 
ATOM 7533  C C   . GLU A 1 991  ? -0.666  -24.596 -65.858  1.00 59.09  ? 2363 GLU B C   1 
ATOM 7534  O O   . GLU A 1 991  ? -0.865  -23.566 -66.500  1.00 59.76  ? 2363 GLU B O   1 
ATOM 7535  C CB  . GLU A 1 991  ? 1.703   -23.899 -65.185  1.00 64.60  ? 2363 GLU B CB  1 
ATOM 7536  C CG  . GLU A 1 991  ? 2.050   -22.617 -64.433  1.00 62.78  ? 2363 GLU B CG  1 
ATOM 7537  C CD  . GLU A 1 991  ? 2.315   -22.818 -62.951  1.00 57.59  ? 2363 GLU B CD  1 
ATOM 7538  O OE1 . GLU A 1 991  ? 1.413   -23.275 -62.221  1.00 54.86  ? 2363 GLU B OE1 1 
ATOM 7539  O OE2 . GLU A 1 991  ? 3.424   -22.483 -62.503  1.00 54.74  ? 2363 GLU B OE2 1 
ATOM 7540  N N   . VAL A 1 992  ? -1.391  -25.707 -66.033  1.00 58.48  ? 2364 VAL B N   1 
ATOM 7541  C CA  . VAL A 1 992  ? -2.256  -25.951 -67.201  1.00 55.72  ? 2364 VAL B CA  1 
ATOM 7542  C C   . VAL A 1 992  ? -3.276  -24.839 -67.425  1.00 50.25  ? 2364 VAL B C   1 
ATOM 7543  O O   . VAL A 1 992  ? -3.462  -24.383 -68.551  1.00 50.47  ? 2364 VAL B O   1 
ATOM 7544  C CB  . VAL A 1 992  ? -2.977  -27.321 -67.082  1.00 57.06  ? 2364 VAL B CB  1 
ATOM 7545  C CG1 . VAL A 1 992  ? -4.084  -27.480 -68.121  1.00 60.25  ? 2364 VAL B CG1 1 
ATOM 7546  C CG2 . VAL A 1 992  ? -1.975  -28.458 -67.233  1.00 58.98  ? 2364 VAL B CG2 1 
ATOM 7547  N N   . ALA A 1 993  ? -3.924  -24.417 -66.345  1.00 46.56  ? 2365 ALA B N   1 
ATOM 7548  C CA  . ALA A 1 993  ? -4.907  -23.329 -66.385  1.00 44.91  ? 2365 ALA B CA  1 
ATOM 7549  C C   . ALA A 1 993  ? -4.317  -21.994 -66.870  1.00 44.86  ? 2365 ALA B C   1 
ATOM 7550  O O   . ALA A 1 993  ? -5.012  -21.192 -67.487  1.00 44.44  ? 2365 ALA B O   1 
ATOM 7551  C CB  . ALA A 1 993  ? -5.538  -23.154 -65.006  1.00 42.91  ? 2365 ALA B CB  1 
ATOM 7552  N N   . MET A 1 994  ? -3.036  -21.773 -66.591  1.00 46.24  ? 2366 MET B N   1 
ATOM 7553  C CA  . MET A 1 994  ? -2.353  -20.518 -66.899  1.00 47.28  ? 2366 MET B CA  1 
ATOM 7554  C C   . MET A 1 994  ? -1.729  -20.531 -68.298  1.00 51.39  ? 2366 MET B C   1 
ATOM 7555  O O   . MET A 1 994  ? -1.587  -19.473 -68.914  1.00 53.09  ? 2366 MET B O   1 
ATOM 7556  C CB  . MET A 1 994  ? -1.274  -20.243 -65.843  1.00 47.29  ? 2366 MET B CB  1 
ATOM 7557  C CG  . MET A 1 994  ? -1.744  -20.432 -64.404  1.00 47.32  ? 2366 MET B CG  1 
ATOM 7558  S SD  . MET A 1 994  ? -0.472  -20.069 -63.192  1.00 49.49  ? 2366 MET B SD  1 
ATOM 7559  C CE  . MET A 1 994  ? -0.571  -18.280 -63.130  1.00 53.37  ? 2366 MET B CE  1 
ATOM 7560  N N   . THR A 1 995  ? -1.365  -21.723 -68.787  1.00 55.34  ? 2367 THR B N   1 
ATOM 7561  C CA  . THR A 1 995  ? -0.729  -21.912 -70.102  1.00 59.12  ? 2367 THR B CA  1 
ATOM 7562  C C   . THR A 1 995  ? -1.725  -22.047 -71.270  1.00 61.83  ? 2367 THR B C   1 
ATOM 7563  O O   . THR A 1 995  ? -1.320  -21.989 -72.434  1.00 63.08  ? 2367 THR B O   1 
ATOM 7564  C CB  . THR A 1 995  ? 0.179   -23.165 -70.089  1.00 63.19  ? 2367 THR B CB  1 
ATOM 7565  O OG1 . THR A 1 995  ? 0.809   -23.292 -68.807  1.00 61.08  ? 2367 THR B OG1 1 
ATOM 7566  C CG2 . THR A 1 995  ? 1.270   -23.086 -71.170  1.00 69.49  ? 2367 THR B CG2 1 
ATOM 7567  N N   . ARG A 1 996  ? -3.017  -22.212 -70.969  1.00 65.86  ? 2368 ARG B N   1 
ATOM 7568  C CA  . ARG A 1 996  ? -4.050  -22.379 -72.007  1.00 72.17  ? 2368 ARG B CA  1 
ATOM 7569  C C   . ARG A 1 996  ? -4.132  -21.174 -72.950  1.00 77.81  ? 2368 ARG B C   1 
ATOM 7570  O O   . ARG A 1 996  ? -3.650  -20.082 -72.631  1.00 76.63  ? 2368 ARG B O   1 
ATOM 7571  C CB  . ARG A 1 996  ? -5.435  -22.686 -71.388  1.00 73.78  ? 2368 ARG B CB  1 
ATOM 7572  C CG  . ARG A 1 996  ? -6.176  -21.506 -70.750  1.00 75.17  ? 2368 ARG B CG  1 
ATOM 7573  C CD  . ARG A 1 996  ? -7.562  -21.886 -70.215  1.00 74.63  ? 2368 ARG B CD  1 
ATOM 7574  N NE  . ARG A 1 996  ? -7.669  -21.924 -68.752  1.00 74.66  ? 2368 ARG B NE  1 
ATOM 7575  C CZ  . ARG A 1 996  ? -8.815  -22.013 -68.067  1.00 79.04  ? 2368 ARG B CZ  1 
ATOM 7576  N NH1 . ARG A 1 996  ? -9.993  -22.078 -68.690  1.00 90.85  ? 2368 ARG B NH1 1 
ATOM 7577  N NH2 . ARG A 1 996  ? -8.791  -22.039 -66.735  1.00 75.26  ? 2368 ARG B NH2 1 
ATOM 7578  N N   . GLU A 1 997  ? -4.749  -21.388 -74.108  1.00 85.98  ? 2369 GLU B N   1 
ATOM 7579  C CA  . GLU A 1 997  ? -4.817  -20.360 -75.145  1.00 91.96  ? 2369 GLU B CA  1 
ATOM 7580  C C   . GLU A 1 997  ? -5.886  -19.319 -74.832  1.00 87.79  ? 2369 GLU B C   1 
ATOM 7581  O O   . GLU A 1 997  ? -5.573  -18.135 -74.684  1.00 81.33  ? 2369 GLU B O   1 
ATOM 7582  C CB  . GLU A 1 997  ? -5.064  -20.994 -76.520  1.00 103.05 ? 2369 GLU B CB  1 
ATOM 7583  C CG  . GLU A 1 997  ? -3.913  -21.860 -77.017  1.00 111.68 ? 2369 GLU B CG  1 
ATOM 7584  C CD  . GLU A 1 997  ? -2.655  -21.058 -77.309  1.00 117.95 ? 2369 GLU B CD  1 
ATOM 7585  O OE1 . GLU A 1 997  ? -2.672  -20.242 -78.256  1.00 120.43 ? 2369 GLU B OE1 1 
ATOM 7586  O OE2 . GLU A 1 997  ? -1.648  -21.244 -76.592  1.00 122.69 ? 2369 GLU B OE2 1 
ATOM 7587  N N   . LYS A 1 998  ? -7.136  -19.766 -74.724  1.00 92.18  ? 2370 LYS B N   1 
ATOM 7588  C CA  . LYS A 1 998  ? -8.277  -18.868 -74.503  1.00 98.87  ? 2370 LYS B CA  1 
ATOM 7589  C C   . LYS A 1 998  ? -8.540  -18.698 -72.999  1.00 94.24  ? 2370 LYS B C   1 
ATOM 7590  O O   . LYS A 1 998  ? -8.734  -19.682 -72.290  1.00 88.25  ? 2370 LYS B O   1 
ATOM 7591  C CB  . LYS A 1 998  ? -9.529  -19.400 -75.226  1.00 104.78 ? 2370 LYS B CB  1 
ATOM 7592  C CG  . LYS A 1 998  ? -10.657 -18.385 -75.402  1.00 112.18 ? 2370 LYS B CG  1 
ATOM 7593  C CD  . LYS A 1 998  ? -10.384 -17.377 -76.516  1.00 122.23 ? 2370 LYS B CD  1 
ATOM 7594  C CE  . LYS A 1 998  ? -11.262 -16.134 -76.397  1.00 129.27 ? 2370 LYS B CE  1 
ATOM 7595  N NZ  . LYS A 1 998  ? -10.764 -15.165 -75.376  1.00 132.55 ? 2370 LYS B NZ  1 
ATOM 7596  N N   . PHE A 1 999  ? -8.549  -17.443 -72.538  1.00 91.39  ? 2371 PHE B N   1 
ATOM 7597  C CA  . PHE A 1 999  ? -8.751  -17.076 -71.122  1.00 81.90  ? 2371 PHE B CA  1 
ATOM 7598  C C   . PHE A 1 999  ? -7.754  -17.755 -70.167  1.00 73.73  ? 2371 PHE B C   1 
ATOM 7599  O O   . PHE A 1 999  ? -8.141  -18.619 -69.371  1.00 75.18  ? 2371 PHE B O   1 
ATOM 7600  C CB  . PHE A 1 999  ? -10.206 -17.324 -70.682  1.00 83.77  ? 2371 PHE B CB  1 
ATOM 7601  C CG  . PHE A 1 999  ? -11.201 -16.375 -71.299  1.00 87.47  ? 2371 PHE B CG  1 
ATOM 7602  C CD1 . PHE A 1 999  ? -12.111 -16.818 -72.253  1.00 86.87  ? 2371 PHE B CD1 1 
ATOM 7603  C CD2 . PHE A 1 999  ? -11.233 -15.032 -70.920  1.00 92.55  ? 2371 PHE B CD2 1 
ATOM 7604  C CE1 . PHE A 1 999  ? -13.028 -15.945 -72.819  1.00 89.10  ? 2371 PHE B CE1 1 
ATOM 7605  C CE2 . PHE A 1 999  ? -12.149 -14.154 -71.484  1.00 93.11  ? 2371 PHE B CE2 1 
ATOM 7606  C CZ  . PHE A 1 999  ? -13.047 -14.613 -72.435  1.00 92.42  ? 2371 PHE B CZ  1 
ATOM 7607  N N   . PRO A 1 1000 ? -6.464  -17.367 -70.243  1.00 64.97  ? 2372 PRO B N   1 
ATOM 7608  C CA  . PRO A 1 1000 ? -5.458  -17.960 -69.370  1.00 61.45  ? 2372 PRO B CA  1 
ATOM 7609  C C   . PRO A 1 1000 ? -5.473  -17.309 -67.998  1.00 59.08  ? 2372 PRO B C   1 
ATOM 7610  O O   . PRO A 1 1000 ? -5.488  -16.082 -67.909  1.00 64.11  ? 2372 PRO B O   1 
ATOM 7611  C CB  . PRO A 1 1000 ? -4.135  -17.663 -70.089  1.00 61.41  ? 2372 PRO B CB  1 
ATOM 7612  C CG  . PRO A 1 1000 ? -4.455  -16.692 -71.176  1.00 64.94  ? 2372 PRO B CG  1 
ATOM 7613  C CD  . PRO A 1 1000 ? -5.886  -16.280 -71.046  1.00 64.95  ? 2372 PRO B CD  1 
ATOM 7614  N N   . GLU A 1 1001 ? -5.452  -18.125 -66.947  1.00 54.05  ? 2373 GLU B N   1 
ATOM 7615  C CA  . GLU A 1 1001 ? -5.528  -17.630 -65.571  1.00 50.78  ? 2373 GLU B CA  1 
ATOM 7616  C C   . GLU A 1 1001 ? -4.193  -17.017 -65.152  1.00 50.82  ? 2373 GLU B C   1 
ATOM 7617  O O   . GLU A 1 1001 ? -3.143  -17.576 -65.450  1.00 48.57  ? 2373 GLU B O   1 
ATOM 7618  C CB  . GLU A 1 1001 ? -5.934  -18.760 -64.616  1.00 48.93  ? 2373 GLU B CB  1 
ATOM 7619  C CG  . GLU A 1 1001 ? -7.286  -19.372 -64.968  1.00 49.39  ? 2373 GLU B CG  1 
ATOM 7620  C CD  . GLU A 1 1001 ? -7.843  -20.319 -63.913  1.00 48.15  ? 2373 GLU B CD  1 
ATOM 7621  O OE1 . GLU A 1 1001 ? -7.120  -20.690 -62.955  1.00 43.64  ? 2373 GLU B OE1 1 
ATOM 7622  O OE2 . GLU A 1 1001 ? -9.029  -20.706 -64.058  1.00 49.46  ? 2373 GLU B OE2 1 
ATOM 7623  N N   . LYS A 1 1002 ? -4.248  -15.862 -64.480  1.00 55.70  ? 2374 LYS B N   1 
ATOM 7624  C CA  . LYS A 1 1002 ? -3.049  -15.145 -63.994  1.00 58.65  ? 2374 LYS B CA  1 
ATOM 7625  C C   . LYS A 1 1002 ? -2.887  -15.227 -62.460  1.00 58.39  ? 2374 LYS B C   1 
ATOM 7626  O O   . LYS A 1 1002 ? -2.168  -14.420 -61.864  1.00 57.23  ? 2374 LYS B O   1 
ATOM 7627  C CB  . LYS A 1 1002 ? -3.118  -13.669 -64.410  1.00 59.99  ? 2374 LYS B CB  1 
ATOM 7628  C CG  . LYS A 1 1002 ? -3.553  -13.400 -65.844  1.00 62.48  ? 2374 LYS B CG  1 
ATOM 7629  C CD  . LYS A 1 1002 ? -2.654  -14.080 -66.859  1.00 66.56  ? 2374 LYS B CD  1 
ATOM 7630  C CE  . LYS A 1 1002 ? -2.881  -13.509 -68.247  1.00 72.11  ? 2374 LYS B CE  1 
ATOM 7631  N NZ  . LYS A 1 1002 ? -2.098  -14.233 -69.286  1.00 78.04  ? 2374 LYS B NZ  1 
ATOM 7632  N N   . ILE A 1 1003 ? -3.527  -16.223 -61.845  1.00 58.03  ? 2375 ILE B N   1 
ATOM 7633  C CA  . ILE A 1 1003 ? -3.754  -16.283 -60.405  1.00 55.24  ? 2375 ILE B CA  1 
ATOM 7634  C C   . ILE A 1 1003 ? -3.224  -17.625 -59.878  1.00 59.63  ? 2375 ILE B C   1 
ATOM 7635  O O   . ILE A 1 1003 ? -3.517  -18.672 -60.467  1.00 65.02  ? 2375 ILE B O   1 
ATOM 7636  C CB  . ILE A 1 1003 ? -5.272  -16.169 -60.123  1.00 54.95  ? 2375 ILE B CB  1 
ATOM 7637  C CG1 . ILE A 1 1003 ? -5.793  -14.782 -60.514  1.00 60.92  ? 2375 ILE B CG1 1 
ATOM 7638  C CG2 . ILE A 1 1003 ? -5.625  -16.462 -58.671  1.00 55.97  ? 2375 ILE B CG2 1 
ATOM 7639  C CD1 . ILE A 1 1003 ? -5.269  -13.626 -59.680  1.00 64.09  ? 2375 ILE B CD1 1 
ATOM 7640  N N   . PRO A 1 1004 ? -2.449  -17.606 -58.769  1.00 57.73  ? 2376 PRO B N   1 
ATOM 7641  C CA  . PRO A 1 1004 ? -1.979  -18.856 -58.142  1.00 56.42  ? 2376 PRO B CA  1 
ATOM 7642  C C   . PRO A 1 1004 ? -3.039  -19.582 -57.292  1.00 54.23  ? 2376 PRO B C   1 
ATOM 7643  O O   . PRO A 1 1004 ? -2.995  -20.808 -57.158  1.00 60.44  ? 2376 PRO B O   1 
ATOM 7644  C CB  . PRO A 1 1004 ? -0.824  -18.382 -57.259  1.00 56.41  ? 2376 PRO B CB  1 
ATOM 7645  C CG  . PRO A 1 1004 ? -1.196  -16.994 -56.883  1.00 54.64  ? 2376 PRO B CG  1 
ATOM 7646  C CD  . PRO A 1 1004 ? -1.917  -16.420 -58.069  1.00 55.05  ? 2376 PRO B CD  1 
ATOM 7647  N N   . PHE A 1 1005 ? -3.956  -18.822 -56.704  1.00 47.81  ? 2377 PHE B N   1 
ATOM 7648  C CA  . PHE A 1 1005 ? -5.049  -19.367 -55.903  1.00 45.53  ? 2377 PHE B CA  1 
ATOM 7649  C C   . PHE A 1 1005 ? -6.058  -18.248 -55.701  1.00 45.05  ? 2377 PHE B C   1 
ATOM 7650  O O   . PHE A 1 1005 ? -5.664  -17.080 -55.712  1.00 51.24  ? 2377 PHE B O   1 
ATOM 7651  C CB  . PHE A 1 1005 ? -4.525  -19.872 -54.553  1.00 44.79  ? 2377 PHE B CB  1 
ATOM 7652  C CG  . PHE A 1 1005 ? -3.549  -18.942 -53.887  1.00 42.86  ? 2377 PHE B CG  1 
ATOM 7653  C CD1 . PHE A 1 1005 ? -3.997  -17.878 -53.109  1.00 42.24  ? 2377 PHE B CD1 1 
ATOM 7654  C CD2 . PHE A 1 1005 ? -2.179  -19.129 -54.034  1.00 44.17  ? 2377 PHE B CD2 1 
ATOM 7655  C CE1 . PHE A 1 1005 ? -3.097  -17.017 -52.498  1.00 43.07  ? 2377 PHE B CE1 1 
ATOM 7656  C CE2 . PHE A 1 1005 ? -1.271  -18.270 -53.425  1.00 45.04  ? 2377 PHE B CE2 1 
ATOM 7657  C CZ  . PHE A 1 1005 ? -1.731  -17.215 -52.653  1.00 44.72  ? 2377 PHE B CZ  1 
ATOM 7658  N N   . ARG A 1 1006 ? -7.342  -18.562 -55.522  1.00 42.25  ? 2378 ARG B N   1 
ATOM 7659  C CA  . ARG A 1 1006 ? -8.317  -17.475 -55.411  1.00 42.38  ? 2378 ARG B CA  1 
ATOM 7660  C C   . ARG A 1 1006 ? -8.217  -16.824 -54.037  1.00 41.91  ? 2378 ARG B C   1 
ATOM 7661  O O   . ARG A 1 1006 ? -8.441  -17.473 -53.022  1.00 40.28  ? 2378 ARG B O   1 
ATOM 7662  C CB  . ARG A 1 1006 ? -9.750  -17.877 -55.810  1.00 43.41  ? 2378 ARG B CB  1 
ATOM 7663  C CG  . ARG A 1 1006 ? -10.681 -18.551 -54.802  1.00 44.76  ? 2378 ARG B CG  1 
ATOM 7664  C CD  . ARG A 1 1006 ? -12.123 -18.041 -54.892  1.00 44.15  ? 2378 ARG B CD  1 
ATOM 7665  N NE  . ARG A 1 1006 ? -12.570 -17.752 -56.253  1.00 45.16  ? 2378 ARG B NE  1 
ATOM 7666  C CZ  . ARG A 1 1006 ? -13.704 -17.129 -56.570  1.00 48.03  ? 2378 ARG B CZ  1 
ATOM 7667  N NH1 . ARG A 1 1006 ? -14.564 -16.724 -55.638  1.00 52.65  ? 2378 ARG B NH1 1 
ATOM 7668  N NH2 . ARG A 1 1006 ? -13.988 -16.915 -57.844  1.00 48.40  ? 2378 ARG B NH2 1 
ATOM 7669  N N   . LEU A 1 1007 ? -7.776  -15.564 -54.026  1.00 42.33  ? 2379 LEU B N   1 
ATOM 7670  C CA  . LEU A 1 1007 ? -7.781  -14.734 -52.824  1.00 41.69  ? 2379 LEU B CA  1 
ATOM 7671  C C   . LEU A 1 1007 ? -8.614  -13.503 -53.149  1.00 43.13  ? 2379 LEU B C   1 
ATOM 7672  O O   . LEU A 1 1007 ? -8.171  -12.357 -53.075  1.00 42.66  ? 2379 LEU B O   1 
ATOM 7673  C CB  . LEU A 1 1007 ? -6.355  -14.389 -52.403  1.00 42.03  ? 2379 LEU B CB  1 
ATOM 7674  C CG  . LEU A 1 1007 ? -6.142  -13.672 -51.064  1.00 42.78  ? 2379 LEU B CG  1 
ATOM 7675  C CD1 . LEU A 1 1007 ? -6.899  -14.313 -49.904  1.00 42.81  ? 2379 LEU B CD1 1 
ATOM 7676  C CD2 . LEU A 1 1007 ? -4.651  -13.633 -50.767  1.00 43.48  ? 2379 LEU B CD2 1 
ATOM 7677  N N   . THR A 1 1008 ? -9.852  -13.795 -53.518  1.00 47.21  ? 2380 THR B N   1 
ATOM 7678  C CA  . THR A 1 1008 ? -10.797 -12.814 -54.033  1.00 49.98  ? 2380 THR B CA  1 
ATOM 7679  C C   . THR A 1 1008 ? -11.380 -11.973 -52.883  1.00 47.09  ? 2380 THR B C   1 
ATOM 7680  O O   . THR A 1 1008 ? -11.201 -12.311 -51.716  1.00 46.24  ? 2380 THR B O   1 
ATOM 7681  C CB  . THR A 1 1008 ? -11.881 -13.525 -54.889  1.00 55.71  ? 2380 THR B CB  1 
ATOM 7682  O OG1 . THR A 1 1008 ? -12.650 -12.563 -55.612  1.00 73.85  ? 2380 THR B OG1 1 
ATOM 7683  C CG2 . THR A 1 1008 ? -12.809 -14.376 -54.044  1.00 55.29  ? 2380 THR B CG2 1 
ATOM 7684  N N   . ARG A 1 1009 ? -12.074 -10.886 -53.217  1.00 47.75  ? 2381 ARG B N   1 
ATOM 7685  C CA  . ARG A 1 1009 ? -12.477 -9.874  -52.218  1.00 47.80  ? 2381 ARG B CA  1 
ATOM 7686  C C   . ARG A 1 1009 ? -13.423 -10.359 -51.119  1.00 48.94  ? 2381 ARG B C   1 
ATOM 7687  O O   . ARG A 1 1009 ? -13.263 -9.973  -49.965  1.00 52.73  ? 2381 ARG B O   1 
ATOM 7688  C CB  . ARG A 1 1009 ? -13.071 -8.623  -52.889  1.00 46.54  ? 2381 ARG B CB  1 
ATOM 7689  C CG  . ARG A 1 1009 ? -14.392 -8.810  -53.624  1.00 45.42  ? 2381 ARG B CG  1 
ATOM 7690  C CD  . ARG A 1 1009 ? -15.086 -7.480  -53.855  1.00 45.49  ? 2381 ARG B CD  1 
ATOM 7691  N NE  . ARG A 1 1009 ? -16.351 -7.652  -54.562  1.00 47.16  ? 2381 ARG B NE  1 
ATOM 7692  C CZ  . ARG A 1 1009 ? -17.256 -6.695  -54.765  1.00 49.16  ? 2381 ARG B CZ  1 
ATOM 7693  N NH1 . ARG A 1 1009 ? -17.061 -5.459  -54.311  1.00 51.06  ? 2381 ARG B NH1 1 
ATOM 7694  N NH2 . ARG A 1 1009 ? -18.376 -6.983  -55.425  1.00 49.60  ? 2381 ARG B NH2 1 
ATOM 7695  N N   . MET A 1 1010 ? -14.395 -11.196 -51.480  1.00 49.25  ? 2382 MET B N   1 
ATOM 7696  C CA  . MET A 1 1010 ? -15.374 -11.712 -50.520  1.00 48.58  ? 2382 MET B CA  1 
ATOM 7697  C C   . MET A 1 1010 ? -14.748 -12.709 -49.561  1.00 49.38  ? 2382 MET B C   1 
ATOM 7698  O O   . MET A 1 1010 ? -15.155 -12.786 -48.405  1.00 54.50  ? 2382 MET B O   1 
ATOM 7699  C CB  . MET A 1 1010 ? -16.551 -12.367 -51.228  1.00 48.27  ? 2382 MET B CB  1 
ATOM 7700  C CG  . MET A 1 1010 ? -17.440 -11.382 -51.950  1.00 49.81  ? 2382 MET B CG  1 
ATOM 7701  S SD  . MET A 1 1010 ? -18.932 -12.187 -52.539  1.00 52.30  ? 2382 MET B SD  1 
ATOM 7702  C CE  . MET A 1 1010 ? -19.799 -10.776 -53.220  1.00 55.41  ? 2382 MET B CE  1 
ATOM 7703  N N   . LEU A 1 1011 ? -13.778 -13.479 -50.045  1.00 48.39  ? 2383 LEU B N   1 
ATOM 7704  C CA  . LEU A 1 1011 ? -12.991 -14.347 -49.179  1.00 48.70  ? 2383 LEU B CA  1 
ATOM 7705  C C   . LEU A 1 1011 ? -12.116 -13.537 -48.228  1.00 50.41  ? 2383 LEU B C   1 
ATOM 7706  O O   . LEU A 1 1011 ? -11.946 -13.922 -47.074  1.00 53.74  ? 2383 LEU B O   1 
ATOM 7707  C CB  . LEU A 1 1011 ? -12.098 -15.285 -49.990  1.00 48.11  ? 2383 LEU B CB  1 
ATOM 7708  C CG  . LEU A 1 1011 ? -12.742 -16.261 -50.975  1.00 48.30  ? 2383 LEU B CG  1 
ATOM 7709  C CD1 . LEU A 1 1011 ? -11.654 -17.144 -51.555  1.00 49.33  ? 2383 LEU B CD1 1 
ATOM 7710  C CD2 . LEU A 1 1011 ? -13.821 -17.119 -50.346  1.00 50.00  ? 2383 LEU B CD2 1 
ATOM 7711  N N   . THR A 1 1012 ? -11.546 -12.438 -48.728  1.00 51.04  ? 2384 THR B N   1 
ATOM 7712  C CA  . THR A 1 1012 ? -10.731 -11.526 -47.918  1.00 53.29  ? 2384 THR B CA  1 
ATOM 7713  C C   . THR A 1 1012 ? -11.572 -10.877 -46.825  1.00 56.39  ? 2384 THR B C   1 
ATOM 7714  O O   . THR A 1 1012 ? -11.178 -10.860 -45.658  1.00 58.77  ? 2384 THR B O   1 
ATOM 7715  C CB  . THR A 1 1012 ? -10.111 -10.411 -48.782  1.00 54.78  ? 2384 THR B CB  1 
ATOM 7716  O OG1 . THR A 1 1012 ? -9.529  -10.986 -49.951  1.00 62.40  ? 2384 THR B OG1 1 
ATOM 7717  C CG2 . THR A 1 1012 ? -9.035  -9.644  -48.021  1.00 56.38  ? 2384 THR B CG2 1 
ATOM 7718  N N   . ASN A 1 1013 ? -12.729 -10.350 -47.218  1.00 54.99  ? 2385 ASN B N   1 
ATOM 7719  C CA  . ASN A 1 1013 ? -13.643 -9.682  -46.295  1.00 55.95  ? 2385 ASN B CA  1 
ATOM 7720  C C   . ASN A 1 1013 ? -14.144 -10.634 -45.204  1.00 57.12  ? 2385 ASN B C   1 
ATOM 7721  O O   . ASN A 1 1013 ? -14.317 -10.220 -44.059  1.00 62.97  ? 2385 ASN B O   1 
ATOM 7722  C CB  . ASN A 1 1013 ? -14.826 -9.079  -47.066  1.00 61.09  ? 2385 ASN B CB  1 
ATOM 7723  C CG  . ASN A 1 1013 ? -15.520 -7.965  -46.305  1.00 70.03  ? 2385 ASN B CG  1 
ATOM 7724  O OD1 . ASN A 1 1013 ? -15.376 -6.793  -46.647  1.00 79.57  ? 2385 ASN B OD1 1 
ATOM 7725  N ND2 . ASN A 1 1013 ? -16.282 -8.322  -45.275  1.00 73.97  ? 2385 ASN B ND2 1 
ATOM 7726  N N   . ALA A 1 1014 ? -14.365 -11.900 -45.563  1.00 56.24  ? 2386 ALA B N   1 
ATOM 7727  C CA  . ALA A 1 1014 ? -14.843 -12.929 -44.619  1.00 54.95  ? 2386 ALA B CA  1 
ATOM 7728  C C   . ALA A 1 1014 ? -13.834 -13.298 -43.525  1.00 54.31  ? 2386 ALA B C   1 
ATOM 7729  O O   . ALA A 1 1014 ? -14.225 -13.823 -42.484  1.00 54.33  ? 2386 ALA B O   1 
ATOM 7730  C CB  . ALA A 1 1014 ? -15.269 -14.182 -45.374  1.00 55.48  ? 2386 ALA B CB  1 
ATOM 7731  N N   . MET A 1 1015 ? -12.548 -13.044 -43.771  1.00 54.03  ? 2387 MET B N   1 
ATOM 7732  C CA  . MET A 1 1015 ? -11.517 -13.127 -42.730  1.00 56.68  ? 2387 MET B CA  1 
ATOM 7733  C C   . MET A 1 1015 ? -11.746 -12.020 -41.693  1.00 59.37  ? 2387 MET B C   1 
ATOM 7734  O O   . MET A 1 1015 ? -12.654 -11.198 -41.848  1.00 61.73  ? 2387 MET B O   1 
ATOM 7735  C CB  . MET A 1 1015 ? -10.111 -13.010 -43.356  1.00 56.83  ? 2387 MET B CB  1 
ATOM 7736  C CG  . MET A 1 1015 ? -9.651  -14.273 -44.078  1.00 56.35  ? 2387 MET B CG  1 
ATOM 7737  S SD  . MET A 1 1015 ? -8.652  -14.078 -45.571  1.00 52.53  ? 2387 MET B SD  1 
ATOM 7738  C CE  . MET A 1 1015 ? -7.431  -12.880 -45.063  1.00 55.49  ? 2387 MET B CE  1 
ATOM 7739  N N   . GLU A 1 1016 ? -10.940 -11.998 -40.632  1.00 60.48  ? 2388 GLU B N   1 
ATOM 7740  C CA  . GLU A 1 1016 ? -10.969 -10.871 -39.699  1.00 64.35  ? 2388 GLU B CA  1 
ATOM 7741  C C   . GLU A 1 1016 ? -10.524 -9.611  -40.441  1.00 66.83  ? 2388 GLU B C   1 
ATOM 7742  O O   . GLU A 1 1016 ? -9.761  -9.707  -41.400  1.00 71.10  ? 2388 GLU B O   1 
ATOM 7743  C CB  . GLU A 1 1016 ? -10.095 -11.132 -38.456  1.00 68.45  ? 2388 GLU B CB  1 
ATOM 7744  C CG  . GLU A 1 1016 ? -8.569  -11.032 -38.627  1.00 71.95  ? 2388 GLU B CG  1 
ATOM 7745  C CD  . GLU A 1 1016 ? -7.830  -12.364 -38.546  1.00 69.68  ? 2388 GLU B CD  1 
ATOM 7746  O OE1 . GLU A 1 1016 ? -8.374  -13.390 -39.004  1.00 68.97  ? 2388 GLU B OE1 1 
ATOM 7747  O OE2 . GLU A 1 1016 ? -6.688  -12.377 -38.031  1.00 64.54  ? 2388 GLU B OE2 1 
ATOM 7748  N N   . VAL A 1 1017 ? -11.019 -8.444  -40.037  1.00 70.89  ? 2389 VAL B N   1 
ATOM 7749  C CA  . VAL A 1 1017 ? -10.461 -7.186  -40.558  1.00 74.27  ? 2389 VAL B CA  1 
ATOM 7750  C C   . VAL A 1 1017 ? -9.003  -7.149  -40.105  1.00 77.20  ? 2389 VAL B C   1 
ATOM 7751  O O   . VAL A 1 1017 ? -8.729  -7.422  -38.941  1.00 84.76  ? 2389 VAL B O   1 
ATOM 7752  C CB  . VAL A 1 1017 ? -11.243 -5.916  -40.118  1.00 76.20  ? 2389 VAL B CB  1 
ATOM 7753  C CG1 . VAL A 1 1017 ? -12.666 -5.953  -40.663  1.00 79.32  ? 2389 VAL B CG1 1 
ATOM 7754  C CG2 . VAL A 1 1017 ? -11.246 -5.713  -38.604  1.00 73.64  ? 2389 VAL B CG2 1 
ATOM 7755  N N   . THR A 1 1018 ? -8.094  -6.841  -41.031  1.00 74.93  ? 2390 THR B N   1 
ATOM 7756  C CA  . THR A 1 1018 ? -6.638  -7.068  -40.878  1.00 80.51  ? 2390 THR B CA  1 
ATOM 7757  C C   . THR A 1 1018 ? -6.238  -8.539  -41.155  1.00 83.89  ? 2390 THR B C   1 
ATOM 7758  O O   . THR A 1 1018 ? -5.131  -8.965  -40.817  1.00 88.57  ? 2390 THR B O   1 
ATOM 7759  C CB  . THR A 1 1018 ? -6.061  -6.535  -39.519  1.00 82.89  ? 2390 THR B CB  1 
ATOM 7760  O OG1 . THR A 1 1018 ? -4.784  -5.934  -39.746  1.00 92.28  ? 2390 THR B OG1 1 
ATOM 7761  C CG2 . THR A 1 1018 ? -5.905  -7.627  -38.413  1.00 81.12  ? 2390 THR B CG2 1 
ATOM 7762  N N   . GLY A 1 1019 ? -7.117  -9.289  -41.822  1.00 84.39  ? 2391 GLY B N   1 
ATOM 7763  C CA  . GLY A 1 1019 ? -6.942  -10.736 -42.015  1.00 82.36  ? 2391 GLY B CA  1 
ATOM 7764  C C   . GLY A 1 1019 ? -5.690  -11.153 -42.762  1.00 79.32  ? 2391 GLY B C   1 
ATOM 7765  O O   . GLY A 1 1019 ? -4.976  -12.061 -42.320  1.00 80.37  ? 2391 GLY B O   1 
ATOM 7766  N N   . LEU A 1 1020 ? -5.428  -10.489 -43.889  1.00 71.98  ? 2392 LEU B N   1 
ATOM 7767  C CA  . LEU A 1 1020 ? -4.230  -10.752 -44.700  1.00 67.49  ? 2392 LEU B CA  1 
ATOM 7768  C C   . LEU A 1 1020 ? -2.920  -10.490 -43.938  1.00 68.64  ? 2392 LEU B C   1 
ATOM 7769  O O   . LEU A 1 1020 ? -1.916  -11.139 -44.201  1.00 66.44  ? 2392 LEU B O   1 
ATOM 7770  C CB  . LEU A 1 1020 ? -4.259  -9.926  -45.990  1.00 63.13  ? 2392 LEU B CB  1 
ATOM 7771  C CG  . LEU A 1 1020 ? -5.338  -10.308 -47.000  1.00 60.88  ? 2392 LEU B CG  1 
ATOM 7772  C CD1 . LEU A 1 1020 ? -5.553  -9.194  -48.013  1.00 62.21  ? 2392 LEU B CD1 1 
ATOM 7773  C CD2 . LEU A 1 1020 ? -4.965  -11.600 -47.704  1.00 62.19  ? 2392 LEU B CD2 1 
ATOM 7774  N N   . ASP A 1 1021 ? -2.933  -9.538  -43.009  1.00 68.41  ? 2393 ASP B N   1 
ATOM 7775  C CA  . ASP A 1 1021 ? -1.797  -9.322  -42.116  1.00 71.21  ? 2393 ASP B CA  1 
ATOM 7776  C C   . ASP A 1 1021 ? -1.754  -10.390 -41.017  1.00 69.91  ? 2393 ASP B C   1 
ATOM 7777  O O   . ASP A 1 1021 ? -0.677  -10.852 -40.648  1.00 74.22  ? 2393 ASP B O   1 
ATOM 7778  C CB  . ASP A 1 1021 ? -1.854  -7.922  -41.478  1.00 77.37  ? 2393 ASP B CB  1 
ATOM 7779  C CG  . ASP A 1 1021 ? -1.734  -6.789  -42.498  1.00 79.96  ? 2393 ASP B CG  1 
ATOM 7780  O OD1 . ASP A 1 1021 ? -1.118  -6.996  -43.567  1.00 88.70  ? 2393 ASP B OD1 1 
ATOM 7781  O OD2 . ASP A 1 1021 ? -2.249  -5.679  -42.217  1.00 75.56  ? 2393 ASP B OD2 1 
ATOM 7782  N N   . GLY A 1 1022 ? -2.922  -10.767 -40.495  1.00 67.93  ? 2394 GLY B N   1 
ATOM 7783  C CA  . GLY A 1 1022 ? -3.023  -11.672 -39.346  1.00 68.83  ? 2394 GLY B CA  1 
ATOM 7784  C C   . GLY A 1 1022 ? -2.905  -13.162 -39.634  1.00 66.91  ? 2394 GLY B C   1 
ATOM 7785  O O   . GLY A 1 1022 ? -1.863  -13.628 -40.099  1.00 64.16  ? 2394 GLY B O   1 
ATOM 7786  N N   . ASN A 1 1023 ? -3.977  -13.902 -39.341  1.00 66.65  ? 2395 ASN B N   1 
ATOM 7787  C CA  . ASN A 1 1023 ? -3.995  -15.373 -39.414  1.00 66.50  ? 2395 ASN B CA  1 
ATOM 7788  C C   . ASN A 1 1023 ? -3.617  -15.955 -40.775  1.00 63.59  ? 2395 ASN B C   1 
ATOM 7789  O O   . ASN A 1 1023 ? -2.889  -16.948 -40.836  1.00 65.02  ? 2395 ASN B O   1 
ATOM 7790  C CB  . ASN A 1 1023 ? -5.381  -15.921 -39.037  1.00 68.26  ? 2395 ASN B CB  1 
ATOM 7791  C CG  . ASN A 1 1023 ? -5.588  -16.026 -37.542  1.00 72.21  ? 2395 ASN B CG  1 
ATOM 7792  O OD1 . ASN A 1 1023 ? -5.016  -16.894 -36.883  1.00 73.78  ? 2395 ASN B OD1 1 
ATOM 7793  N ND2 . ASN A 1 1023 ? -6.436  -15.163 -37.004  1.00 74.98  ? 2395 ASN B ND2 1 
ATOM 7794  N N   . TYR A 1 1024 ? -4.127  -15.355 -41.850  1.00 58.34  ? 2396 TYR B N   1 
ATOM 7795  C CA  . TYR A 1 1024 ? -3.927  -15.891 -43.197  1.00 56.62  ? 2396 TYR B CA  1 
ATOM 7796  C C   . TYR A 1 1024 ? -2.444  -15.990 -43.565  1.00 55.96  ? 2396 TYR B C   1 
ATOM 7797  O O   . TYR A 1 1024 ? -1.962  -17.068 -43.917  1.00 56.11  ? 2396 TYR B O   1 
ATOM 7798  C CB  . TYR A 1 1024 ? -4.685  -15.060 -44.241  1.00 57.53  ? 2396 TYR B CB  1 
ATOM 7799  C CG  . TYR A 1 1024 ? -4.550  -15.598 -45.650  1.00 57.84  ? 2396 TYR B CG  1 
ATOM 7800  C CD1 . TYR A 1 1024 ? -5.386  -16.610 -46.112  1.00 57.86  ? 2396 TYR B CD1 1 
ATOM 7801  C CD2 . TYR A 1 1024 ? -3.571  -15.107 -46.517  1.00 57.89  ? 2396 TYR B CD2 1 
ATOM 7802  C CE1 . TYR A 1 1024 ? -5.250  -17.117 -47.395  1.00 57.94  ? 2396 TYR B CE1 1 
ATOM 7803  C CE2 . TYR A 1 1024 ? -3.432  -15.605 -47.802  1.00 54.86  ? 2396 TYR B CE2 1 
ATOM 7804  C CZ  . TYR A 1 1024 ? -4.272  -16.608 -48.236  1.00 55.41  ? 2396 TYR B CZ  1 
ATOM 7805  O OH  . TYR A 1 1024 ? -4.135  -17.104 -49.509  1.00 57.56  ? 2396 TYR B OH  1 
ATOM 7806  N N   . ARG A 1 1025 ? -1.733  -14.867 -43.467  1.00 56.10  ? 2397 ARG B N   1 
ATOM 7807  C CA  . ARG A 1 1025 ? -0.300  -14.804 -43.811  1.00 57.61  ? 2397 ARG B CA  1 
ATOM 7808  C C   . ARG A 1 1025 ? 0.565   -15.674 -42.906  1.00 58.17  ? 2397 ARG B C   1 
ATOM 7809  O O   . ARG A 1 1025 ? 1.478   -16.363 -43.375  1.00 57.24  ? 2397 ARG B O   1 
ATOM 7810  C CB  . ARG A 1 1025 ? 0.212   -13.365 -43.735  1.00 58.68  ? 2397 ARG B CB  1 
ATOM 7811  C CG  . ARG A 1 1025 ? 1.515   -13.124 -44.476  1.00 59.98  ? 2397 ARG B CG  1 
ATOM 7812  C CD  . ARG A 1 1025 ? 2.081   -11.742 -44.201  1.00 61.38  ? 2397 ARG B CD  1 
ATOM 7813  N NE  . ARG A 1 1025 ? 2.360   -11.032 -45.449  1.00 63.17  ? 2397 ARG B NE  1 
ATOM 7814  C CZ  . ARG A 1 1025 ? 1.471   -10.326 -46.152  1.00 64.60  ? 2397 ARG B CZ  1 
ATOM 7815  N NH1 . ARG A 1 1025 ? 0.204   -10.201 -45.750  1.00 68.26  ? 2397 ARG B NH1 1 
ATOM 7816  N NH2 . ARG A 1 1025 ? 1.854   -9.731  -47.278  1.00 64.82  ? 2397 ARG B NH2 1 
ATOM 7817  N N   . ILE A 1 1026 ? 0.273   -15.623 -41.610  1.00 59.47  ? 2398 ILE B N   1 
ATOM 7818  C CA  . ILE A 1 1026 ? 1.016   -16.386 -40.607  1.00 60.75  ? 2398 ILE B CA  1 
ATOM 7819  C C   . ILE A 1 1026 ? 0.853   -17.894 -40.864  1.00 59.45  ? 2398 ILE B C   1 
ATOM 7820  O O   . ILE A 1 1026 ? 1.816   -18.655 -40.731  1.00 63.34  ? 2398 ILE B O   1 
ATOM 7821  C CB  . ILE A 1 1026 ? 0.597   -15.976 -39.170  1.00 62.70  ? 2398 ILE B CB  1 
ATOM 7822  C CG1 . ILE A 1 1026 ? 1.004   -14.517 -38.905  1.00 64.06  ? 2398 ILE B CG1 1 
ATOM 7823  C CG2 . ILE A 1 1026 ? 1.252   -16.868 -38.121  1.00 66.42  ? 2398 ILE B CG2 1 
ATOM 7824  C CD1 . ILE A 1 1026 ? 0.343   -13.877 -37.703  1.00 66.78  ? 2398 ILE B CD1 1 
ATOM 7825  N N   . THR A 1 1027 ? -0.355  -18.309 -41.246  1.00 55.90  ? 2399 THR B N   1 
ATOM 7826  C CA  . THR A 1 1027 ? -0.629  -19.697 -41.626  1.00 53.24  ? 2399 THR B CA  1 
ATOM 7827  C C   . THR A 1 1027 ? 0.022   -20.032 -42.972  1.00 50.39  ? 2399 THR B C   1 
ATOM 7828  O O   . THR A 1 1027 ? 0.554   -21.130 -43.143  1.00 48.97  ? 2399 THR B O   1 
ATOM 7829  C CB  . THR A 1 1027 ? -2.148  -19.966 -41.673  1.00 53.12  ? 2399 THR B CB  1 
ATOM 7830  O OG1 . THR A 1 1027 ? -2.723  -19.612 -40.410  1.00 56.09  ? 2399 THR B OG1 1 
ATOM 7831  C CG2 . THR A 1 1027 ? -2.457  -21.433 -41.958  1.00 52.80  ? 2399 THR B CG2 1 
ATOM 7832  N N   . CYS A 1 1028 ? -0.024  -19.091 -43.919  1.00 48.16  ? 2400 CYS B N   1 
ATOM 7833  C CA  . CYS A 1 1028 ? 0.667   -19.257 -45.203  1.00 46.02  ? 2400 CYS B CA  1 
ATOM 7834  C C   . CYS A 1 1028 ? 2.155   -19.496 -45.009  1.00 49.21  ? 2400 CYS B C   1 
ATOM 7835  O O   . CYS A 1 1028 ? 2.723   -20.337 -45.706  1.00 52.85  ? 2400 CYS B O   1 
ATOM 7836  C CB  . CYS A 1 1028 ? 0.468   -18.052 -46.120  1.00 43.30  ? 2400 CYS B CB  1 
ATOM 7837  S SG  . CYS A 1 1028 ? -1.160  -17.955 -46.868  1.00 40.96  ? 2400 CYS B SG  1 
ATOM 7838  N N   . HIS A 1 1029 ? 2.777   -18.764 -44.076  1.00 49.94  ? 2401 HIS B N   1 
ATOM 7839  C CA  . HIS A 1 1029 ? 4.197   -18.968 -43.743  1.00 51.84  ? 2401 HIS B CA  1 
ATOM 7840  C C   . HIS A 1 1029 ? 4.417   -20.381 -43.214  1.00 52.82  ? 2401 HIS B C   1 
ATOM 7841  O O   . HIS A 1 1029 ? 5.203   -21.147 -43.774  1.00 54.53  ? 2401 HIS B O   1 
ATOM 7842  C CB  . HIS A 1 1029 ? 4.699   -17.979 -42.682  1.00 53.39  ? 2401 HIS B CB  1 
ATOM 7843  C CG  . HIS A 1 1029 ? 4.735   -16.552 -43.131  1.00 52.96  ? 2401 HIS B CG  1 
ATOM 7844  N ND1 . HIS A 1 1029 ? 4.700   -15.499 -42.243  1.00 52.25  ? 2401 HIS B ND1 1 
ATOM 7845  C CD2 . HIS A 1 1029 ? 4.795   -16.002 -44.366  1.00 53.03  ? 2401 HIS B CD2 1 
ATOM 7846  C CE1 . HIS A 1 1029 ? 4.745   -14.361 -42.912  1.00 53.26  ? 2401 HIS B CE1 1 
ATOM 7847  N NE2 . HIS A 1 1029 ? 4.801   -14.637 -44.202  1.00 53.29  ? 2401 HIS B NE2 1 
ATOM 7848  N N   . THR A 1 1030 ? 3.697   -20.712 -42.145  1.00 52.71  ? 2402 THR B N   1 
ATOM 7849  C CA  . THR A 1 1030 ? 3.835   -21.995 -41.454  1.00 55.30  ? 2402 THR B CA  1 
ATOM 7850  C C   . THR A 1 1030 ? 3.720   -23.174 -42.412  1.00 53.71  ? 2402 THR B C   1 
ATOM 7851  O O   . THR A 1 1030 ? 4.590   -24.043 -42.434  1.00 52.83  ? 2402 THR B O   1 
ATOM 7852  C CB  . THR A 1 1030 ? 2.773   -22.149 -40.343  1.00 58.15  ? 2402 THR B CB  1 
ATOM 7853  O OG1 . THR A 1 1030 ? 2.716   -20.946 -39.565  1.00 60.16  ? 2402 THR B OG1 1 
ATOM 7854  C CG2 . THR A 1 1030 ? 3.098   -23.331 -39.423  1.00 59.96  ? 2402 THR B CG2 1 
ATOM 7855  N N   . VAL A 1 1031 ? 2.656   -23.174 -43.213  1.00 53.45  ? 2403 VAL B N   1 
ATOM 7856  C CA  . VAL A 1 1031 ? 2.381   -24.264 -44.158  1.00 52.48  ? 2403 VAL B CA  1 
ATOM 7857  C C   . VAL A 1 1031 ? 3.504   -24.356 -45.194  1.00 53.19  ? 2403 VAL B C   1 
ATOM 7858  O O   . VAL A 1 1031 ? 4.080   -25.426 -45.406  1.00 49.51  ? 2403 VAL B O   1 
ATOM 7859  C CB  . VAL A 1 1031 ? 1.002   -24.083 -44.845  1.00 48.66  ? 2403 VAL B CB  1 
ATOM 7860  C CG1 . VAL A 1 1031 ? 0.782   -25.101 -45.956  1.00 46.60  ? 2403 VAL B CG1 1 
ATOM 7861  C CG2 . VAL A 1 1031 ? -0.114  -24.226 -43.827  1.00 49.73  ? 2403 VAL B CG2 1 
ATOM 7862  N N   . MET A 1 1032 ? 3.822   -23.224 -45.815  1.00 56.36  ? 2404 MET B N   1 
ATOM 7863  C CA  . MET A 1 1032 ? 4.871   -23.169 -46.830  1.00 60.39  ? 2404 MET B CA  1 
ATOM 7864  C C   . MET A 1 1032 ? 6.232   -23.580 -46.252  1.00 61.96  ? 2404 MET B C   1 
ATOM 7865  O O   . MET A 1 1032 ? 7.040   -24.185 -46.959  1.00 64.18  ? 2404 MET B O   1 
ATOM 7866  C CB  . MET A 1 1032 ? 4.929   -21.773 -47.476  1.00 62.50  ? 2404 MET B CB  1 
ATOM 7867  C CG  . MET A 1 1032 ? 5.880   -21.628 -48.663  1.00 66.00  ? 2404 MET B CG  1 
ATOM 7868  S SD  . MET A 1 1032 ? 5.530   -22.691 -50.084  1.00 64.89  ? 2404 MET B SD  1 
ATOM 7869  C CE  . MET A 1 1032 ? 4.057   -21.911 -50.734  1.00 62.01  ? 2404 MET B CE  1 
ATOM 7870  N N   . GLU A 1 1033 ? 6.470   -23.277 -44.974  1.00 62.49  ? 2405 GLU B N   1 
ATOM 7871  C CA  . GLU A 1 1033 ? 7.704   -23.706 -44.287  1.00 63.49  ? 2405 GLU B CA  1 
ATOM 7872  C C   . GLU A 1 1033 ? 7.772   -25.238 -44.156  1.00 59.48  ? 2405 GLU B C   1 
ATOM 7873  O O   . GLU A 1 1033 ? 8.830   -25.842 -44.360  1.00 55.00  ? 2405 GLU B O   1 
ATOM 7874  C CB  . GLU A 1 1033 ? 7.823   -23.054 -42.899  1.00 65.23  ? 2405 GLU B CB  1 
ATOM 7875  C CG  . GLU A 1 1033 ? 9.256   -22.776 -42.462  1.00 69.15  ? 2405 GLU B CG  1 
ATOM 7876  C CD  . GLU A 1 1033 ? 9.839   -21.507 -43.067  1.00 73.38  ? 2405 GLU B CD  1 
ATOM 7877  O OE1 . GLU A 1 1033 ? 9.094   -20.515 -43.219  1.00 77.68  ? 2405 GLU B OE1 1 
ATOM 7878  O OE2 . GLU A 1 1033 ? 11.054  -21.487 -43.376  1.00 75.05  ? 2405 GLU B OE2 1 
ATOM 7879  N N   . VAL A 1 1034 ? 6.632   -25.844 -43.817  1.00 58.21  ? 2406 VAL B N   1 
ATOM 7880  C CA  . VAL A 1 1034 ? 6.496   -27.304 -43.730  1.00 58.48  ? 2406 VAL B CA  1 
ATOM 7881  C C   . VAL A 1 1034 ? 6.766   -27.960 -45.091  1.00 56.19  ? 2406 VAL B C   1 
ATOM 7882  O O   . VAL A 1 1034 ? 7.426   -28.996 -45.168  1.00 55.09  ? 2406 VAL B O   1 
ATOM 7883  C CB  . VAL A 1 1034 ? 5.089   -27.711 -43.190  1.00 59.36  ? 2406 VAL B CB  1 
ATOM 7884  C CG1 . VAL A 1 1034 ? 4.821   -29.209 -43.338  1.00 59.68  ? 2406 VAL B CG1 1 
ATOM 7885  C CG2 . VAL A 1 1034 ? 4.942   -27.310 -41.727  1.00 60.58  ? 2406 VAL B CG2 1 
ATOM 7886  N N   . LEU A 1 1035 ? 6.252   -27.352 -46.155  1.00 55.35  ? 2407 LEU B N   1 
ATOM 7887  C CA  . LEU A 1 1035 ? 6.396   -27.903 -47.505  1.00 54.71  ? 2407 LEU B CA  1 
ATOM 7888  C C   . LEU A 1 1035 ? 7.844   -27.868 -48.000  1.00 57.04  ? 2407 LEU B C   1 
ATOM 7889  O O   . LEU A 1 1035 ? 8.316   -28.833 -48.605  1.00 57.81  ? 2407 LEU B O   1 
ATOM 7890  C CB  . LEU A 1 1035 ? 5.446   -27.191 -48.480  1.00 51.28  ? 2407 LEU B CB  1 
ATOM 7891  C CG  . LEU A 1 1035 ? 3.974   -27.573 -48.235  1.00 49.44  ? 2407 LEU B CG  1 
ATOM 7892  C CD1 . LEU A 1 1035 ? 3.019   -26.413 -48.465  1.00 48.50  ? 2407 LEU B CD1 1 
ATOM 7893  C CD2 . LEU A 1 1035 ? 3.567   -28.776 -49.072  1.00 48.92  ? 2407 LEU B CD2 1 
ATOM 7894  N N   . ARG A 1 1036 ? 8.543   -26.769 -47.725  1.00 60.39  ? 2408 ARG B N   1 
ATOM 7895  C CA  . ARG A 1 1036 ? 9.963   -26.633 -48.089  1.00 64.97  ? 2408 ARG B CA  1 
ATOM 7896  C C   . ARG A 1 1036 ? 10.854  -27.586 -47.300  1.00 67.62  ? 2408 ARG B C   1 
ATOM 7897  O O   . ARG A 1 1036 ? 11.770  -28.180 -47.865  1.00 70.41  ? 2408 ARG B O   1 
ATOM 7898  C CB  . ARG A 1 1036 ? 10.451  -25.189 -47.899  1.00 67.65  ? 2408 ARG B CB  1 
ATOM 7899  C CG  . ARG A 1 1036 ? 10.242  -24.288 -49.113  1.00 71.04  ? 2408 ARG B CG  1 
ATOM 7900  C CD  . ARG A 1 1036 ? 9.629   -22.945 -48.741  1.00 73.49  ? 2408 ARG B CD  1 
ATOM 7901  N NE  . ARG A 1 1036 ? 9.971   -21.871 -49.673  1.00 72.62  ? 2408 ARG B NE  1 
ATOM 7902  C CZ  . ARG A 1 1036 ? 11.163  -21.278 -49.757  1.00 69.13  ? 2408 ARG B CZ  1 
ATOM 7903  N NH1 . ARG A 1 1036 ? 12.181  -21.652 -48.982  1.00 71.19  ? 2408 ARG B NH1 1 
ATOM 7904  N NH2 . ARG A 1 1036 ? 11.346  -20.305 -50.638  1.00 67.59  ? 2408 ARG B NH2 1 
ATOM 7905  N N   . GLU A 1 1037 ? 10.585  -27.720 -46.001  1.00 68.54  ? 2409 GLU B N   1 
ATOM 7906  C CA  . GLU A 1 1037 ? 11.319  -28.657 -45.139  1.00 69.56  ? 2409 GLU B CA  1 
ATOM 7907  C C   . GLU A 1 1037 ? 11.216  -30.085 -45.662  1.00 64.10  ? 2409 GLU B C   1 
ATOM 7908  O O   . GLU A 1 1037 ? 12.215  -30.792 -45.751  1.00 63.36  ? 2409 GLU B O   1 
ATOM 7909  C CB  . GLU A 1 1037 ? 10.791  -28.597 -43.701  1.00 75.16  ? 2409 GLU B CB  1 
ATOM 7910  C CG  . GLU A 1 1037 ? 11.619  -29.381 -42.688  1.00 81.62  ? 2409 GLU B CG  1 
ATOM 7911  C CD  . GLU A 1 1037 ? 10.985  -29.423 -41.309  1.00 88.32  ? 2409 GLU B CD  1 
ATOM 7912  O OE1 . GLU A 1 1037 ? 9.788   -29.772 -41.203  1.00 89.82  ? 2409 GLU B OE1 1 
ATOM 7913  O OE2 . GLU A 1 1037 ? 11.692  -29.121 -40.324  1.00 98.17  ? 2409 GLU B OE2 1 
ATOM 7914  N N   . HIS A 1 1038 ? 9.999   -30.486 -46.015  1.00 63.16  ? 2410 HIS B N   1 
ATOM 7915  C CA  . HIS A 1 1038 ? 9.728   -31.810 -46.567  1.00 64.41  ? 2410 HIS B CA  1 
ATOM 7916  C C   . HIS A 1 1038 ? 9.508   -31.735 -48.087  1.00 65.47  ? 2410 HIS B C   1 
ATOM 7917  O O   . HIS A 1 1038 ? 8.559   -32.318 -48.618  1.00 62.47  ? 2410 HIS B O   1 
ATOM 7918  C CB  . HIS A 1 1038 ? 8.506   -32.409 -45.864  1.00 62.30  ? 2410 HIS B CB  1 
ATOM 7919  C CG  . HIS A 1 1038 ? 8.658   -32.517 -44.379  1.00 64.28  ? 2410 HIS B CG  1 
ATOM 7920  N ND1 . HIS A 1 1038 ? 9.317   -33.565 -43.775  1.00 68.01  ? 2410 HIS B ND1 1 
ATOM 7921  C CD2 . HIS A 1 1038 ? 8.232   -31.714 -43.376  1.00 66.01  ? 2410 HIS B CD2 1 
ATOM 7922  C CE1 . HIS A 1 1038 ? 9.298   -33.399 -42.464  1.00 70.64  ? 2410 HIS B CE1 1 
ATOM 7923  N NE2 . HIS A 1 1038 ? 8.644   -32.284 -42.196  1.00 69.53  ? 2410 HIS B NE2 1 
ATOM 7924  N N   . LYS A 1 1039 ? 10.393  -31.020 -48.784  1.00 67.14  ? 2411 LYS B N   1 
ATOM 7925  C CA  . LYS A 1 1039 ? 10.274  -30.851 -50.236  1.00 66.68  ? 2411 LYS B CA  1 
ATOM 7926  C C   . LYS A 1 1039 ? 10.472  -32.164 -50.996  1.00 67.82  ? 2411 LYS B C   1 
ATOM 7927  O O   . LYS A 1 1039 ? 9.768   -32.418 -51.967  1.00 70.22  ? 2411 LYS B O   1 
ATOM 7928  C CB  . LYS A 1 1039 ? 11.224  -29.762 -50.772  1.00 69.56  ? 2411 LYS B CB  1 
ATOM 7929  C CG  . LYS A 1 1039 ? 12.714  -29.962 -50.508  1.00 75.49  ? 2411 LYS B CG  1 
ATOM 7930  C CD  . LYS A 1 1039 ? 13.580  -29.184 -51.487  1.00 78.23  ? 2411 LYS B CD  1 
ATOM 7931  C CE  . LYS A 1 1039 ? 13.710  -29.918 -52.814  1.00 84.86  ? 2411 LYS B CE  1 
ATOM 7932  N NZ  . LYS A 1 1039 ? 14.758  -29.327 -53.688  1.00 91.41  ? 2411 LYS B NZ  1 
ATOM 7933  N N   . ASP A 1 1040 ? 11.401  -33.001 -50.535  1.00 69.74  ? 2412 ASP B N   1 
ATOM 7934  C CA  . ASP A 1 1040 ? 11.719  -34.276 -51.202  1.00 71.63  ? 2412 ASP B CA  1 
ATOM 7935  C C   . ASP A 1 1040 ? 10.534  -35.243 -51.261  1.00 65.60  ? 2412 ASP B C   1 
ATOM 7936  O O   . ASP A 1 1040 ? 10.323  -35.899 -52.281  1.00 63.24  ? 2412 ASP B O   1 
ATOM 7937  C CB  . ASP A 1 1040 ? 12.897  -34.977 -50.506  1.00 77.25  ? 2412 ASP B CB  1 
ATOM 7938  C CG  . ASP A 1 1040 ? 14.214  -34.246 -50.685  1.00 80.80  ? 2412 ASP B CG  1 
ATOM 7939  O OD1 . ASP A 1 1040 ? 15.241  -34.800 -50.242  1.00 87.62  ? 2412 ASP B OD1 1 
ATOM 7940  O OD2 . ASP A 1 1040 ? 14.233  -33.132 -51.256  1.00 79.73  ? 2412 ASP B OD2 1 
ATOM 7941  N N   . SER A 1 1041 ? 9.786   -35.336 -50.162  1.00 63.03  ? 2413 SER B N   1 
ATOM 7942  C CA  . SER A 1 1041 ? 8.601   -36.194 -50.084  1.00 61.92  ? 2413 SER B CA  1 
ATOM 7943  C C   . SER A 1 1041 ? 7.490   -35.705 -51.020  1.00 62.26  ? 2413 SER B C   1 
ATOM 7944  O O   . SER A 1 1041 ? 6.845   -36.507 -51.702  1.00 62.52  ? 2413 SER B O   1 
ATOM 7945  C CB  . SER A 1 1041 ? 8.074   -36.268 -48.643  1.00 60.09  ? 2413 SER B CB  1 
ATOM 7946  O OG  . SER A 1 1041 ? 9.054   -36.767 -47.753  1.00 60.59  ? 2413 SER B OG  1 
ATOM 7947  N N   . VAL A 1 1042 ? 7.281   -34.389 -51.047  1.00 61.31  ? 2414 VAL B N   1 
ATOM 7948  C CA  . VAL A 1 1042 ? 6.284   -33.765 -51.928  1.00 59.39  ? 2414 VAL B CA  1 
ATOM 7949  C C   . VAL A 1 1042 ? 6.678   -33.953 -53.393  1.00 59.93  ? 2414 VAL B C   1 
ATOM 7950  O O   . VAL A 1 1042 ? 5.833   -34.267 -54.231  1.00 60.71  ? 2414 VAL B O   1 
ATOM 7951  C CB  . VAL A 1 1042 ? 6.110   -32.259 -51.607  1.00 58.50  ? 2414 VAL B CB  1 
ATOM 7952  C CG1 . VAL A 1 1042 ? 5.231   -31.557 -52.636  1.00 57.03  ? 2414 VAL B CG1 1 
ATOM 7953  C CG2 . VAL A 1 1042 ? 5.509   -32.083 -50.219  1.00 58.30  ? 2414 VAL B CG2 1 
ATOM 7954  N N   . MET A 1 1043 ? 7.961   -33.750 -53.684  1.00 61.04  ? 2415 MET B N   1 
ATOM 7955  C CA  . MET A 1 1043 ? 8.512   -33.968 -55.021  1.00 61.50  ? 2415 MET B CA  1 
ATOM 7956  C C   . MET A 1 1043 ? 8.370   -35.422 -55.481  1.00 60.29  ? 2415 MET B C   1 
ATOM 7957  O O   . MET A 1 1043 ? 8.055   -35.671 -56.638  1.00 65.03  ? 2415 MET B O   1 
ATOM 7958  C CB  . MET A 1 1043 ? 9.984   -33.553 -55.056  1.00 66.23  ? 2415 MET B CB  1 
ATOM 7959  C CG  . MET A 1 1043 ? 10.211  -32.051 -54.948  1.00 68.58  ? 2415 MET B CG  1 
ATOM 7960  S SD  . MET A 1 1043 ? 10.648  -31.264 -56.504  1.00 74.16  ? 2415 MET B SD  1 
ATOM 7961  C CE  . MET A 1 1043 ? 9.297   -31.788 -57.549  1.00 74.39  ? 2415 MET B CE  1 
ATOM 7962  N N   . ALA A 1 1044 ? 8.596   -36.369 -54.576  1.00 56.38  ? 2416 ALA B N   1 
ATOM 7963  C CA  . ALA A 1 1044 ? 8.463   -37.795 -54.887  1.00 53.92  ? 2416 ALA B CA  1 
ATOM 7964  C C   . ALA A 1 1044 ? 7.051   -38.166 -55.319  1.00 50.39  ? 2416 ALA B C   1 
ATOM 7965  O O   . ALA A 1 1044 ? 6.868   -38.922 -56.268  1.00 50.09  ? 2416 ALA B O   1 
ATOM 7966  C CB  . ALA A 1 1044 ? 8.874   -38.636 -53.688  1.00 54.56  ? 2416 ALA B CB  1 
ATOM 7967  N N   . VAL A 1 1045 ? 6.064   -37.630 -54.610  1.00 49.26  ? 2417 VAL B N   1 
ATOM 7968  C CA  . VAL A 1 1045 ? 4.647   -37.871 -54.913  1.00 49.07  ? 2417 VAL B CA  1 
ATOM 7969  C C   . VAL A 1 1045 ? 4.243   -37.242 -56.250  1.00 50.48  ? 2417 VAL B C   1 
ATOM 7970  O O   . VAL A 1 1045 ? 3.594   -37.887 -57.069  1.00 50.28  ? 2417 VAL B O   1 
ATOM 7971  C CB  . VAL A 1 1045 ? 3.742   -37.344 -53.774  1.00 46.36  ? 2417 VAL B CB  1 
ATOM 7972  C CG1 . VAL A 1 1045 ? 2.274   -37.333 -54.170  1.00 45.81  ? 2417 VAL B CG1 1 
ATOM 7973  C CG2 . VAL A 1 1045 ? 3.926   -38.200 -52.533  1.00 46.78  ? 2417 VAL B CG2 1 
ATOM 7974  N N   . LEU A 1 1046 ? 4.621   -35.985 -56.460  1.00 53.41  ? 2418 LEU B N   1 
ATOM 7975  C CA  . LEU A 1 1046 ? 4.311   -35.287 -57.712  1.00 54.43  ? 2418 LEU B CA  1 
ATOM 7976  C C   . LEU A 1 1046 ? 5.008   -35.932 -58.912  1.00 56.47  ? 2418 LEU B C   1 
ATOM 7977  O O   . LEU A 1 1046 ? 4.358   -36.211 -59.918  1.00 58.46  ? 2418 LEU B O   1 
ATOM 7978  C CB  . LEU A 1 1046 ? 4.652   -33.797 -57.607  1.00 53.81  ? 2418 LEU B CB  1 
ATOM 7979  C CG  . LEU A 1 1046 ? 3.681   -33.021 -56.710  1.00 53.57  ? 2418 LEU B CG  1 
ATOM 7980  C CD1 . LEU A 1 1046 ? 4.282   -31.702 -56.259  1.00 55.46  ? 2418 LEU B CD1 1 
ATOM 7981  C CD2 . LEU A 1 1046 ? 2.367   -32.759 -57.423  1.00 51.66  ? 2418 LEU B CD2 1 
ATOM 7982  N N   . GLU A 1 1047 ? 6.308   -36.193 -58.789  1.00 57.70  ? 2419 GLU B N   1 
ATOM 7983  C CA  . GLU A 1 1047 ? 7.059   -36.921 -59.820  1.00 60.61  ? 2419 GLU B CA  1 
ATOM 7984  C C   . GLU A 1 1047 ? 6.413   -38.266 -60.156  1.00 61.05  ? 2419 GLU B C   1 
ATOM 7985  O O   . GLU A 1 1047 ? 6.431   -38.688 -61.309  1.00 61.92  ? 2419 GLU B O   1 
ATOM 7986  C CB  . GLU A 1 1047 ? 8.511   -37.170 -59.390  1.00 64.12  ? 2419 GLU B CB  1 
ATOM 7987  C CG  . GLU A 1 1047 ? 9.429   -35.963 -59.493  1.00 65.64  ? 2419 GLU B CG  1 
ATOM 7988  C CD  . GLU A 1 1047 ? 10.817  -36.225 -58.929  1.00 70.51  ? 2419 GLU B CD  1 
ATOM 7989  O OE1 . GLU A 1 1047 ? 11.260  -37.396 -58.914  1.00 74.47  ? 2419 GLU B OE1 1 
ATOM 7990  O OE2 . GLU A 1 1047 ? 11.476  -35.252 -58.503  1.00 73.34  ? 2419 GLU B OE2 1 
ATOM 7991  N N   . ALA A 1 1048 ? 5.856   -38.932 -59.146  1.00 61.61  ? 2420 ALA B N   1 
ATOM 7992  C CA  . ALA A 1 1048 ? 5.195   -40.224 -59.334  1.00 64.55  ? 2420 ALA B CA  1 
ATOM 7993  C C   . ALA A 1 1048 ? 4.007   -40.167 -60.284  1.00 65.04  ? 2420 ALA B C   1 
ATOM 7994  O O   . ALA A 1 1048 ? 3.764   -41.140 -61.000  1.00 64.07  ? 2420 ALA B O   1 
ATOM 7995  C CB  . ALA A 1 1048 ? 4.765   -40.816 -57.997  1.00 65.06  ? 2420 ALA B CB  1 
ATOM 7996  N N   . PHE A 1 1049 ? 3.269   -39.051 -60.294  1.00 68.64  ? 2421 PHE B N   1 
ATOM 7997  C CA  . PHE A 1 1049 ? 2.147   -38.914 -61.233  1.00 73.94  ? 2421 PHE B CA  1 
ATOM 7998  C C   . PHE A 1 1049 ? 2.316   -37.940 -62.397  1.00 67.92  ? 2421 PHE B C   1 
ATOM 7999  O O   . PHE A 1 1049 ? 1.426   -37.839 -63.241  1.00 68.13  ? 2421 PHE B O   1 
ATOM 8000  C CB  . PHE A 1 1049 ? 0.782   -38.778 -60.528  1.00 86.40  ? 2421 PHE B CB  1 
ATOM 8001  C CG  . PHE A 1 1049 ? 0.641   -37.603 -59.599  1.00 88.66  ? 2421 PHE B CG  1 
ATOM 8002  C CD1 . PHE A 1 1049 ? 0.422   -36.323 -60.092  1.00 89.61  ? 2421 PHE B CD1 1 
ATOM 8003  C CD2 . PHE A 1 1049 ? 0.617   -37.800 -58.218  1.00 92.24  ? 2421 PHE B CD2 1 
ATOM 8004  C CE1 . PHE A 1 1049 ? 0.238   -35.254 -59.225  1.00 95.49  ? 2421 PHE B CE1 1 
ATOM 8005  C CE2 . PHE A 1 1049 ? 0.428   -36.739 -57.349  1.00 91.46  ? 2421 PHE B CE2 1 
ATOM 8006  C CZ  . PHE A 1 1049 ? 0.237   -35.465 -57.852  1.00 93.11  ? 2421 PHE B CZ  1 
ATOM 8007  N N   . VAL A 1 1050 ? 3.455   -37.253 -62.473  1.00 65.17  ? 2422 VAL B N   1 
ATOM 8008  C CA  . VAL A 1 1050 ? 3.842   -36.579 -63.717  1.00 63.79  ? 2422 VAL B CA  1 
ATOM 8009  C C   . VAL A 1 1050 ? 4.327   -37.656 -64.687  1.00 66.76  ? 2422 VAL B C   1 
ATOM 8010  O O   . VAL A 1 1050 ? 3.796   -37.773 -65.788  1.00 70.19  ? 2422 VAL B O   1 
ATOM 8011  C CB  . VAL A 1 1050 ? 4.902   -35.477 -63.499  1.00 62.08  ? 2422 VAL B CB  1 
ATOM 8012  C CG1 . VAL A 1 1050 ? 5.464   -34.972 -64.820  1.00 63.41  ? 2422 VAL B CG1 1 
ATOM 8013  C CG2 . VAL A 1 1050 ? 4.292   -34.308 -62.746  1.00 60.33  ? 2422 VAL B CG2 1 
ATOM 8014  N N   . TYR A 1 1051 ? 5.294   -38.469 -64.257  1.00 68.35  ? 2423 TYR B N   1 
ATOM 8015  C CA  . TYR A 1 1051 ? 5.798   -39.597 -65.066  1.00 70.47  ? 2423 TYR B CA  1 
ATOM 8016  C C   . TYR A 1 1051 ? 4.895   -40.857 -65.039  1.00 73.43  ? 2423 TYR B C   1 
ATOM 8017  O O   . TYR A 1 1051 ? 5.362   -41.958 -65.348  1.00 74.95  ? 2423 TYR B O   1 
ATOM 8018  C CB  . TYR A 1 1051 ? 7.216   -39.990 -64.623  1.00 70.71  ? 2423 TYR B CB  1 
ATOM 8019  C CG  . TYR A 1 1051 ? 8.259   -38.904 -64.747  1.00 71.42  ? 2423 TYR B CG  1 
ATOM 8020  C CD1 . TYR A 1 1051 ? 8.953   -38.444 -63.627  1.00 72.94  ? 2423 TYR B CD1 1 
ATOM 8021  C CD2 . TYR A 1 1051 ? 8.576   -38.352 -65.983  1.00 72.95  ? 2423 TYR B CD2 1 
ATOM 8022  C CE1 . TYR A 1 1051 ? 9.924   -37.462 -63.737  1.00 73.30  ? 2423 TYR B CE1 1 
ATOM 8023  C CE2 . TYR A 1 1051 ? 9.543   -37.362 -66.101  1.00 74.62  ? 2423 TYR B CE2 1 
ATOM 8024  C CZ  . TYR A 1 1051 ? 10.211  -36.920 -64.975  1.00 74.10  ? 2423 TYR B CZ  1 
ATOM 8025  O OH  . TYR A 1 1051 ? 11.164  -35.938 -65.083  1.00 75.51  ? 2423 TYR B OH  1 
ATOM 8026  N N   . ASP A 1 1052 ? 3.619   -40.710 -64.674  1.00 74.33  ? 2424 ASP B N   1 
ATOM 8027  C CA  . ASP A 1 1052 ? 2.655   -41.810 -64.743  1.00 75.89  ? 2424 ASP B CA  1 
ATOM 8028  C C   . ASP A 1 1052 ? 2.258   -42.015 -66.207  1.00 82.17  ? 2424 ASP B C   1 
ATOM 8029  O O   . ASP A 1 1052 ? 1.879   -41.046 -66.873  1.00 81.91  ? 2424 ASP B O   1 
ATOM 8030  C CB  . ASP A 1 1052 ? 1.418   -41.470 -63.911  1.00 73.90  ? 2424 ASP B CB  1 
ATOM 8031  C CG  . ASP A 1 1052 ? 0.658   -42.690 -63.456  1.00 74.35  ? 2424 ASP B CG  1 
ATOM 8032  O OD1 . ASP A 1 1052 ? 0.187   -43.460 -64.317  1.00 77.23  ? 2424 ASP B OD1 1 
ATOM 8033  O OD2 . ASP A 1 1052 ? 0.512   -42.863 -62.222  1.00 71.05  ? 2424 ASP B OD2 1 
ATOM 8034  N N   . PRO A 1 1053 ? 2.346   -43.264 -66.719  1.00 89.42  ? 2425 PRO B N   1 
ATOM 8035  C CA  . PRO A 1 1053 ? 2.039   -43.493 -68.141  1.00 93.32  ? 2425 PRO B CA  1 
ATOM 8036  C C   . PRO A 1 1053 ? 0.574   -43.248 -68.528  1.00 94.47  ? 2425 PRO B C   1 
ATOM 8037  O O   . PRO A 1 1053 ? 0.298   -42.899 -69.675  1.00 101.31 ? 2425 PRO B O   1 
ATOM 8038  C CB  . PRO A 1 1053 ? 2.422   -44.965 -68.355  1.00 95.69  ? 2425 PRO B CB  1 
ATOM 8039  C CG  . PRO A 1 1053 ? 2.325   -45.584 -67.008  1.00 95.36  ? 2425 PRO B CG  1 
ATOM 8040  C CD  . PRO A 1 1053 ? 2.750   -44.515 -66.046  1.00 92.97  ? 2425 PRO B CD  1 
ATOM 8041  N N   . LEU A 1 1054 ? -0.341  -43.423 -67.577  1.00 93.35  ? 2426 LEU B N   1 
ATOM 8042  C CA  . LEU A 1 1054 ? -1.775  -43.256 -67.818  1.00 96.46  ? 2426 LEU B CA  1 
ATOM 8043  C C   . LEU A 1 1054 ? -2.308  -41.837 -67.540  1.00 97.04  ? 2426 LEU B C   1 
ATOM 8044  O O   . LEU A 1 1054 ? -3.487  -41.581 -67.775  1.00 105.39 ? 2426 LEU B O   1 
ATOM 8045  C CB  . LEU A 1 1054 ? -2.560  -44.273 -66.976  1.00 99.24  ? 2426 LEU B CB  1 
ATOM 8046  C CG  . LEU A 1 1054 ? -2.121  -45.743 -67.050  1.00 102.54 ? 2426 LEU B CG  1 
ATOM 8047  C CD1 . LEU A 1 1054 ? -2.896  -46.570 -66.035  1.00 101.13 ? 2426 LEU B CD1 1 
ATOM 8048  C CD2 . LEU A 1 1054 ? -2.286  -46.318 -68.450  1.00 104.49 ? 2426 LEU B CD2 1 
ATOM 8049  N N   . LEU A 1 1055 ? -1.464  -40.927 -67.042  1.00 96.43  ? 2427 LEU B N   1 
ATOM 8050  C CA  . LEU A 1 1055 ? -1.885  -39.546 -66.730  1.00 100.00 ? 2427 LEU B CA  1 
ATOM 8051  C C   . LEU A 1 1055 ? -1.048  -38.438 -67.399  1.00 107.78 ? 2427 LEU B C   1 
ATOM 8052  O O   . LEU A 1 1055 ? -1.196  -37.263 -67.053  1.00 110.36 ? 2427 LEU B O   1 
ATOM 8053  C CB  . LEU A 1 1055 ? -1.886  -39.341 -65.211  1.00 101.90 ? 2427 LEU B CB  1 
ATOM 8054  C CG  . LEU A 1 1055 ? -2.751  -40.290 -64.381  1.00 102.77 ? 2427 LEU B CG  1 
ATOM 8055  C CD1 . LEU A 1 1055 ? -2.457  -40.097 -62.901  1.00 104.47 ? 2427 LEU B CD1 1 
ATOM 8056  C CD2 . LEU A 1 1055 ? -4.230  -40.076 -64.666  1.00 103.74 ? 2427 LEU B CD2 1 
ATOM 8057  N N   . ASN A 1 1056 ? -0.195  -38.799 -68.359  1.00 114.51 ? 2428 ASN B N   1 
ATOM 8058  C CA  . ASN A 1 1056 ? 0.546   -37.814 -69.169  1.00 116.22 ? 2428 ASN B CA  1 
ATOM 8059  C C   . ASN A 1 1056 ? -0.358  -36.963 -70.073  1.00 119.93 ? 2428 ASN B C   1 
ATOM 8060  O O   . ASN A 1 1056 ? 0.029   -35.862 -70.465  1.00 127.35 ? 2428 ASN B O   1 
ATOM 8061  C CB  . ASN A 1 1056 ? 1.597   -38.516 -70.042  1.00 120.86 ? 2428 ASN B CB  1 
ATOM 8062  C CG  . ASN A 1 1056 ? 2.777   -39.025 -69.239  1.00 118.37 ? 2428 ASN B CG  1 
ATOM 8063  O OD1 . ASN A 1 1056 ? 3.482   -38.248 -68.602  1.00 115.27 ? 2428 ASN B OD1 1 
ATOM 8064  N ND2 . ASN A 1 1056 ? 3.004   -40.333 -69.275  1.00 114.35 ? 2428 ASN B ND2 1 
ATOM 8065  N N   . TRP A 1 1057 ? -1.543  -37.482 -70.402  1.00 122.69 ? 2429 TRP B N   1 
ATOM 8066  C CA  . TRP A 1 1057 ? -2.495  -36.831 -71.318  1.00 121.90 ? 2429 TRP B CA  1 
ATOM 8067  C C   . TRP A 1 1057 ? -2.954  -35.412 -70.927  1.00 126.30 ? 2429 TRP B C   1 
ATOM 8068  O O   . TRP A 1 1057 ? -3.357  -34.645 -71.801  1.00 139.15 ? 2429 TRP B O   1 
ATOM 8069  C CB  . TRP A 1 1057 ? -3.718  -37.742 -71.547  1.00 121.81 ? 2429 TRP B CB  1 
ATOM 8070  C CG  . TRP A 1 1057 ? -4.736  -37.742 -70.433  1.00 125.20 ? 2429 TRP B CG  1 
ATOM 8071  C CD1 . TRP A 1 1057 ? -4.498  -37.823 -69.085  1.00 127.12 ? 2429 TRP B CD1 1 
ATOM 8072  C CD2 . TRP A 1 1057 ? -6.157  -37.676 -70.584  1.00 128.89 ? 2429 TRP B CD2 1 
ATOM 8073  N NE1 . TRP A 1 1057 ? -5.684  -37.795 -68.391  1.00 128.07 ? 2429 TRP B NE1 1 
ATOM 8074  C CE2 . TRP A 1 1057 ? -6.719  -37.708 -69.286  1.00 132.28 ? 2429 TRP B CE2 1 
ATOM 8075  C CE3 . TRP A 1 1057 ? -7.014  -37.589 -71.693  1.00 128.61 ? 2429 TRP B CE3 1 
ATOM 8076  C CZ2 . TRP A 1 1057 ? -8.103  -37.654 -69.066  1.00 132.94 ? 2429 TRP B CZ2 1 
ATOM 8077  C CZ3 . TRP A 1 1057 ? -8.391  -37.536 -71.474  1.00 131.66 ? 2429 TRP B CZ3 1 
ATOM 8078  C CH2 . TRP A 1 1057 ? -8.920  -37.569 -70.168  1.00 132.19 ? 2429 TRP B CH2 1 
ATOM 8079  N N   . ARG A 1 1058 ? -2.898  -35.069 -69.636  1.00 124.22 ? 2430 ARG B N   1 
ATOM 8080  C CA  . ARG A 1 1058 ? -3.237  -33.706 -69.163  1.00 119.64 ? 2430 ARG B CA  1 
ATOM 8081  C C   . ARG A 1 1058 ? -2.304  -32.586 -69.663  1.00 117.76 ? 2430 ARG B C   1 
ATOM 8082  O O   . ARG A 1 1058 ? -2.716  -31.425 -69.736  1.00 103.06 ? 2430 ARG B O   1 
ATOM 8083  C CB  . ARG A 1 1058 ? -3.315  -33.662 -67.627  1.00 116.43 ? 2430 ARG B CB  1 
ATOM 8084  C CG  . ARG A 1 1058 ? -2.005  -33.933 -66.887  1.00 120.80 ? 2430 ARG B CG  1 
ATOM 8085  C CD  . ARG A 1 1058 ? -2.201  -33.962 -65.374  1.00 124.64 ? 2430 ARG B CD  1 
ATOM 8086  N NE  . ARG A 1 1058 ? -1.623  -35.149 -64.733  1.00 122.20 ? 2430 ARG B NE  1 
ATOM 8087  C CZ  . ARG A 1 1058 ? -1.881  -35.557 -63.484  1.00 117.38 ? 2430 ARG B CZ  1 
ATOM 8088  N NH1 . ARG A 1 1058 ? -2.719  -34.887 -62.679  1.00 105.21 ? 2430 ARG B NH1 1 
ATOM 8089  N NH2 . ARG A 1 1058 ? -1.293  -36.663 -63.029  1.00 112.82 ? 2430 ARG B NH2 1 
ATOM 8090  N N   . LEU A 1 1059 ? -1.068  -32.946 -70.014  1.00 125.45 ? 2431 LEU B N   1 
ATOM 8091  C CA  . LEU A 1 1059 ? -0.007  -31.991 -70.370  1.00 123.50 ? 2431 LEU B CA  1 
ATOM 8092  C C   . LEU A 1 1059 ? 0.111   -31.724 -71.875  1.00 127.82 ? 2431 LEU B C   1 
ATOM 8093  O O   . LEU A 1 1059 ? 0.567   -30.653 -72.275  1.00 122.80 ? 2431 LEU B O   1 
ATOM 8094  C CB  . LEU A 1 1059 ? 1.334   -32.500 -69.839  1.00 124.77 ? 2431 LEU B CB  1 
ATOM 8095  C CG  . LEU A 1 1059 ? 1.331   -32.985 -68.385  1.00 123.83 ? 2431 LEU B CG  1 
ATOM 8096  C CD1 . LEU A 1 1059 ? 2.667   -33.627 -68.049  1.00 132.32 ? 2431 LEU B CD1 1 
ATOM 8097  C CD2 . LEU A 1 1059 ? 0.989   -31.849 -67.431  1.00 114.14 ? 2431 LEU B CD2 1 
ATOM 8098  N N   . MET A 1 1060 ? -0.282  -32.700 -72.697  1.00 141.30 ? 2432 MET B N   1 
ATOM 8099  C CA  . MET A 1 1060 ? -0.359  -32.529 -74.158  1.00 152.76 ? 2432 MET B CA  1 
ATOM 8100  C C   . MET A 1 1060 ? -1.514  -31.606 -74.592  1.00 159.39 ? 2432 MET B C   1 
ATOM 8101  O O   . MET A 1 1060 ? -1.506  -31.092 -75.714  1.00 152.01 ? 2432 MET B O   1 
ATOM 8102  C CB  . MET A 1 1060 ? -0.506  -33.893 -74.849  1.00 160.95 ? 2432 MET B CB  1 
ATOM 8103  C CG  . MET A 1 1060 ? -0.107  -33.907 -76.322  1.00 171.51 ? 2432 MET B CG  1 
ATOM 8104  S SD  . MET A 1 1060 ? -1.135  -34.982 -77.344  1.00 181.68 ? 2432 MET B SD  1 
ATOM 8105  C CE  . MET A 1 1060 ? -2.668  -34.054 -77.399  1.00 181.96 ? 2432 MET B CE  1 
ATOM 8106  N N   . ASP A 1 1061 ? -2.494  -31.386 -73.708  1.00 172.20 ? 2433 ASP B N   1 
ATOM 8107  C CA  . ASP A 1 1061 ? -3.633  -30.489 -73.984  1.00 175.99 ? 2433 ASP B CA  1 
ATOM 8108  C C   . ASP A 1 1061 ? -3.286  -28.977 -73.986  1.00 192.67 ? 2433 ASP B C   1 
ATOM 8109  O O   . ASP A 1 1061 ? -4.186  -28.140 -74.114  1.00 194.54 ? 2433 ASP B O   1 
ATOM 8110  C CB  . ASP A 1 1061 ? -4.779  -30.772 -72.993  1.00 160.76 ? 2433 ASP B CB  1 
ATOM 8111  C CG  . ASP A 1 1061 ? -6.145  -30.349 -73.525  1.00 152.68 ? 2433 ASP B CG  1 
ATOM 8112  O OD1 . ASP A 1 1061 ? -6.501  -30.735 -74.660  1.00 146.11 ? 2433 ASP B OD1 1 
ATOM 8113  O OD2 . ASP A 1 1061 ? -6.870  -29.636 -72.802  1.00 155.06 ? 2433 ASP B OD2 1 
ATOM 8114  N N   . THR A 1 1062 ? -2.001  -28.630 -73.834  1.00 204.14 ? 2434 THR B N   1 
ATOM 8115  C CA  . THR A 1 1062 ? -1.493  -27.272 -74.118  1.00 198.39 ? 2434 THR B CA  1 
ATOM 8116  C C   . THR A 1 1062 ? -1.830  -26.801 -75.547  1.00 207.37 ? 2434 THR B C   1 
ATOM 8117  O O   . THR A 1 1062 ? -1.983  -25.598 -75.779  1.00 206.62 ? 2434 THR B O   1 
ATOM 8118  C CB  . THR A 1 1062 ? 0.045   -27.180 -73.918  1.00 182.36 ? 2434 THR B CB  1 
ATOM 8119  O OG1 . THR A 1 1062 ? 0.441   -27.945 -72.772  1.00 172.93 ? 2434 THR B OG1 1 
ATOM 8120  C CG2 . THR A 1 1062 ? 0.496   -25.729 -73.729  1.00 169.42 ? 2434 THR B CG2 1 
ATOM 8121  N N   . ASN A 1 1063 ? -1.920  -27.753 -76.484  1.00 201.87 ? 2435 ASN B N   1 
ATOM 8122  C CA  . ASN A 1 1063 ? -2.354  -27.506 -77.874  1.00 188.27 ? 2435 ASN B CA  1 
ATOM 8123  C C   . ASN A 1 1063 ? -3.599  -26.614 -77.970  1.00 196.68 ? 2435 ASN B C   1 
ATOM 8124  O O   . ASN A 1 1063 ? -3.574  -25.590 -78.656  1.00 204.24 ? 2435 ASN B O   1 
ATOM 8125  C CB  . ASN A 1 1063 ? -2.632  -28.837 -78.597  1.00 173.13 ? 2435 ASN B CB  1 
ATOM 8126  C CG  . ASN A 1 1063 ? -1.365  -29.620 -78.904  1.00 167.57 ? 2435 ASN B CG  1 
ATOM 8127  O OD1 . ASN A 1 1063 ? -0.444  -29.111 -79.544  1.00 165.51 ? 2435 ASN B OD1 1 
ATOM 8128  N ND2 . ASN A 1 1063 ? -1.321  -30.870 -78.459  1.00 160.34 ? 2435 ASN B ND2 1 
ATOM 8129  N N   . THR A 1 1064 ? -4.671  -27.012 -77.281  1.00 195.10 ? 2436 THR B N   1 
ATOM 8130  C CA  . THR A 1 1064 ? -5.921  -26.238 -77.215  1.00 175.75 ? 2436 THR B CA  1 
ATOM 8131  C C   . THR A 1 1064 ? -6.152  -25.741 -75.787  1.00 157.71 ? 2436 THR B C   1 
ATOM 8132  O O   . THR A 1 1064 ? -5.659  -24.682 -75.395  1.00 137.61 ? 2436 THR B O   1 
ATOM 8133  C CB  . THR A 1 1064 ? -7.140  -27.078 -77.662  1.00 169.20 ? 2436 THR B CB  1 
ATOM 8134  O OG1 . THR A 1 1064 ? -6.808  -27.843 -78.828  1.00 175.51 ? 2436 THR B OG1 1 
ATOM 8135  C CG2 . THR A 1 1064 ? -8.336  -26.180 -77.978  1.00 160.53 ? 2436 THR B CG2 1 
ATOM 8136  N N   . ALA A 1 1120 ? 9.933   -36.534 -76.028  1.00 97.91  ? 2492 ALA B N   1 
ATOM 8137  C CA  . ALA A 1 1120 ? 8.853   -35.694 -76.546  1.00 106.24 ? 2492 ALA B CA  1 
ATOM 8138  C C   . ALA A 1 1120 ? 8.043   -35.054 -75.403  1.00 111.55 ? 2492 ALA B C   1 
ATOM 8139  O O   . ALA A 1 1120 ? 8.230   -33.870 -75.111  1.00 96.47  ? 2492 ALA B O   1 
ATOM 8140  C CB  . ALA A 1 1120 ? 7.965   -36.500 -77.490  1.00 100.40 ? 2492 ALA B CB  1 
ATOM 8141  N N   . LEU A 1 1121 ? 7.161   -35.829 -74.763  1.00 122.30 ? 2493 LEU B N   1 
ATOM 8142  C CA  . LEU A 1 1121 ? 6.521   -35.416 -73.503  1.00 119.82 ? 2493 LEU B CA  1 
ATOM 8143  C C   . LEU A 1 1121 ? 7.481   -35.600 -72.322  1.00 113.20 ? 2493 LEU B C   1 
ATOM 8144  O O   . LEU A 1 1121 ? 7.285   -34.991 -71.270  1.00 111.77 ? 2493 LEU B O   1 
ATOM 8145  C CB  . LEU A 1 1121 ? 5.212   -36.186 -73.241  1.00 131.18 ? 2493 LEU B CB  1 
ATOM 8146  C CG  . LEU A 1 1121 ? 3.920   -35.608 -73.832  1.00 139.21 ? 2493 LEU B CG  1 
ATOM 8147  C CD1 . LEU A 1 1121 ? 2.806   -36.646 -73.804  1.00 139.89 ? 2493 LEU B CD1 1 
ATOM 8148  C CD2 . LEU A 1 1121 ? 3.481   -34.351 -73.092  1.00 136.75 ? 2493 LEU B CD2 1 
ATOM 8149  N N   . ASN A 1 1122 ? 8.495   -36.452 -72.497  1.00 113.27 ? 2494 ASN B N   1 
ATOM 8150  C CA  . ASN A 1 1122 ? 9.604   -36.583 -71.542  1.00 112.81 ? 2494 ASN B CA  1 
ATOM 8151  C C   . ASN A 1 1122 ? 10.245  -35.226 -71.228  1.00 108.54 ? 2494 ASN B C   1 
ATOM 8152  O O   . ASN A 1 1122 ? 10.583  -34.953 -70.076  1.00 102.62 ? 2494 ASN B O   1 
ATOM 8153  C CB  . ASN A 1 1122 ? 10.666  -37.555 -72.086  1.00 117.88 ? 2494 ASN B CB  1 
ATOM 8154  C CG  . ASN A 1 1122 ? 11.806  -37.802 -71.107  1.00 124.17 ? 2494 ASN B CG  1 
ATOM 8155  O OD1 . ASN A 1 1122 ? 11.603  -37.868 -69.893  1.00 120.57 ? 2494 ASN B OD1 1 
ATOM 8156  N ND2 . ASN A 1 1122 ? 13.016  -37.948 -71.637  1.00 126.38 ? 2494 ASN B ND2 1 
ATOM 8157  N N   . LYS A 1 1123 ? 10.401  -34.387 -72.255  1.00 107.74 ? 2495 LYS B N   1 
ATOM 8158  C CA  . LYS A 1 1123 ? 10.921  -33.025 -72.085  1.00 104.60 ? 2495 LYS B CA  1 
ATOM 8159  C C   . LYS A 1 1123 ? 9.927   -32.124 -71.345  1.00 90.92  ? 2495 LYS B C   1 
ATOM 8160  O O   . LYS A 1 1123 ? 10.322  -31.355 -70.467  1.00 84.40  ? 2495 LYS B O   1 
ATOM 8161  C CB  . LYS A 1 1123 ? 11.271  -32.394 -73.439  1.00 114.75 ? 2495 LYS B CB  1 
ATOM 8162  C CG  . LYS A 1 1123 ? 12.233  -31.215 -73.333  1.00 126.88 ? 2495 LYS B CG  1 
ATOM 8163  C CD  . LYS A 1 1123 ? 11.872  -30.074 -74.275  1.00 138.55 ? 2495 LYS B CD  1 
ATOM 8164  C CE  . LYS A 1 1123 ? 12.768  -28.864 -74.047  1.00 139.82 ? 2495 LYS B CE  1 
ATOM 8165  N NZ  . LYS A 1 1123 ? 12.221  -27.623 -74.661  1.00 127.99 ? 2495 LYS B NZ  1 
ATOM 8166  N N   . LYS A 1 1124 ? 8.649   -32.215 -71.716  1.00 79.69  ? 2496 LYS B N   1 
ATOM 8167  C CA  . LYS A 1 1124 ? 7.582   -31.430 -71.075  1.00 73.82  ? 2496 LYS B CA  1 
ATOM 8168  C C   . LYS A 1 1124 ? 7.393   -31.798 -69.597  1.00 64.14  ? 2496 LYS B C   1 
ATOM 8169  O O   . LYS A 1 1124 ? 7.131   -30.925 -68.770  1.00 56.91  ? 2496 LYS B O   1 
ATOM 8170  C CB  . LYS A 1 1124 ? 6.258   -31.591 -71.845  1.00 77.98  ? 2496 LYS B CB  1 
ATOM 8171  C CG  . LYS A 1 1124 ? 5.046   -30.859 -71.266  1.00 78.49  ? 2496 LYS B CG  1 
ATOM 8172  C CD  . LYS A 1 1124 ? 5.279   -29.365 -71.085  1.00 82.41  ? 2496 LYS B CD  1 
ATOM 8173  C CE  . LYS A 1 1124 ? 4.046   -28.671 -70.526  1.00 85.97  ? 2496 LYS B CE  1 
ATOM 8174  N NZ  . LYS A 1 1124 ? 4.373   -27.345 -69.929  1.00 84.43  ? 2496 LYS B NZ  1 
ATOM 8175  N N   . ALA A 1 1125 ? 7.518   -33.086 -69.280  1.00 64.29  ? 2497 ALA B N   1 
ATOM 8176  C CA  . ALA A 1 1125 ? 7.453   -33.569 -67.894  1.00 61.62  ? 2497 ALA B CA  1 
ATOM 8177  C C   . ALA A 1 1125 ? 8.537   -32.946 -67.015  1.00 57.11  ? 2497 ALA B C   1 
ATOM 8178  O O   . ALA A 1 1125 ? 8.276   -32.573 -65.871  1.00 56.93  ? 2497 ALA B O   1 
ATOM 8179  C CB  . ALA A 1 1125 ? 7.567   -35.085 -67.861  1.00 63.21  ? 2497 ALA B CB  1 
ATOM 8180  N N   . ILE A 1 1126 ? 9.745   -32.838 -67.565  1.00 59.80  ? 2498 ILE B N   1 
ATOM 8181  C CA  . ILE A 1 1126 ? 10.891  -32.251 -66.860  1.00 68.01  ? 2498 ILE B CA  1 
ATOM 8182  C C   . ILE A 1 1126 ? 10.648  -30.772 -66.513  1.00 68.36  ? 2498 ILE B C   1 
ATOM 8183  O O   . ILE A 1 1126 ? 11.015  -30.332 -65.420  1.00 60.32  ? 2498 ILE B O   1 
ATOM 8184  C CB  . ILE A 1 1126 ? 12.205  -32.442 -67.672  1.00 71.67  ? 2498 ILE B CB  1 
ATOM 8185  C CG1 . ILE A 1 1126 ? 12.588  -33.930 -67.718  1.00 79.39  ? 2498 ILE B CG1 1 
ATOM 8186  C CG2 . ILE A 1 1126 ? 13.367  -31.649 -67.077  1.00 66.99  ? 2498 ILE B CG2 1 
ATOM 8187  C CD1 . ILE A 1 1126 ? 13.496  -34.306 -68.870  1.00 84.14  ? 2498 ILE B CD1 1 
ATOM 8188  N N   . GLN A 1 1127 ? 10.028  -30.025 -67.432  1.00 76.31  ? 2499 GLN B N   1 
ATOM 8189  C CA  . GLN A 1 1127 ? 9.708   -28.599 -67.220  1.00 81.66  ? 2499 GLN B CA  1 
ATOM 8190  C C   . GLN A 1 1127 ? 8.835   -28.375 -65.989  1.00 71.74  ? 2499 GLN B C   1 
ATOM 8191  O O   . GLN A 1 1127 ? 9.119   -27.503 -65.168  1.00 74.35  ? 2499 GLN B O   1 
ATOM 8192  C CB  . GLN A 1 1127 ? 8.981   -28.004 -68.435  1.00 98.05  ? 2499 GLN B CB  1 
ATOM 8193  C CG  . GLN A 1 1127 ? 9.832   -27.836 -69.685  1.00 114.09 ? 2499 GLN B CG  1 
ATOM 8194  C CD  . GLN A 1 1127 ? 9.044   -27.296 -70.871  1.00 116.61 ? 2499 GLN B CD  1 
ATOM 8195  O OE1 . GLN A 1 1127 ? 8.031   -26.608 -70.708  1.00 95.44  ? 2499 GLN B OE1 1 
ATOM 8196  N NE2 . GLN A 1 1127 ? 9.512   -27.603 -72.075  1.00 128.31 ? 2499 GLN B NE2 1 
ATOM 8197  N N   . ILE A 1 1128 ? 7.776   -29.175 -65.885  1.00 60.72  ? 2500 ILE B N   1 
ATOM 8198  C CA  . ILE A 1 1128 ? 6.783   -29.072 -64.807  1.00 55.88  ? 2500 ILE B CA  1 
ATOM 8199  C C   . ILE A 1 1128 ? 7.399   -29.358 -63.444  1.00 54.18  ? 2500 ILE B C   1 
ATOM 8200  O O   . ILE A 1 1128 ? 7.192   -28.601 -62.497  1.00 51.82  ? 2500 ILE B O   1 
ATOM 8201  C CB  . ILE A 1 1128 ? 5.612   -30.048 -65.058  1.00 55.77  ? 2500 ILE B CB  1 
ATOM 8202  C CG1 . ILE A 1 1128 ? 4.825   -29.607 -66.293  1.00 58.35  ? 2500 ILE B CG1 1 
ATOM 8203  C CG2 . ILE A 1 1128 ? 4.661   -30.136 -63.866  1.00 54.88  ? 2500 ILE B CG2 1 
ATOM 8204  C CD1 . ILE A 1 1128 ? 4.213   -30.763 -67.035  1.00 62.93  ? 2500 ILE B CD1 1 
ATOM 8205  N N   . ILE A 1 1129 ? 8.147   -30.454 -63.364  1.00 53.81  ? 2501 ILE B N   1 
ATOM 8206  C CA  . ILE A 1 1129 ? 8.787   -30.887 -62.119  1.00 53.65  ? 2501 ILE B CA  1 
ATOM 8207  C C   . ILE A 1 1129 ? 9.854   -29.887 -61.672  1.00 54.10  ? 2501 ILE B C   1 
ATOM 8208  O O   . ILE A 1 1129 ? 9.998   -29.639 -60.473  1.00 55.55  ? 2501 ILE B O   1 
ATOM 8209  C CB  . ILE A 1 1129 ? 9.369   -32.313 -62.261  1.00 54.83  ? 2501 ILE B CB  1 
ATOM 8210  C CG1 . ILE A 1 1129 ? 8.224   -33.317 -62.432  1.00 55.04  ? 2501 ILE B CG1 1 
ATOM 8211  C CG2 . ILE A 1 1129 ? 10.211  -32.716 -61.052  1.00 55.05  ? 2501 ILE B CG2 1 
ATOM 8212  C CD1 . ILE A 1 1129 ? 8.648   -34.593 -63.114  1.00 62.11  ? 2501 ILE B CD1 1 
ATOM 8213  N N   . ASN A 1 1130 ? 10.594  -29.320 -62.627  1.00 56.63  ? 2502 ASN B N   1 
ATOM 8214  C CA  . ASN A 1 1130 ? 11.488  -28.187 -62.343  1.00 60.36  ? 2502 ASN B CA  1 
ATOM 8215  C C   . ASN A 1 1130 ? 10.705  -26.999 -61.785  1.00 55.65  ? 2502 ASN B C   1 
ATOM 8216  O O   . ASN A 1 1130 ? 11.126  -26.374 -60.811  1.00 54.20  ? 2502 ASN B O   1 
ATOM 8217  C CB  . ASN A 1 1130 ? 12.258  -27.747 -63.598  1.00 59.64  ? 2502 ASN B CB  1 
ATOM 8218  C CG  . ASN A 1 1130 ? 13.372  -28.704 -63.974  1.00 60.71  ? 2502 ASN B CG  1 
ATOM 8219  O OD1 . ASN A 1 1130 ? 14.079  -29.233 -63.115  1.00 58.87  ? 2502 ASN B OD1 1 
ATOM 8220  N ND2 . ASN A 1 1130 ? 13.545  -28.919 -65.271  1.00 68.77  ? 2502 ASN B ND2 1 
ATOM 8221  N N   . ARG A 1 1131 ? 9.563   -26.707 -62.406  1.00 51.47  ? 2503 ARG B N   1 
ATOM 8222  C CA  . ARG A 1 1131 ? 8.681   -25.621 -61.957  1.00 53.31  ? 2503 ARG B CA  1 
ATOM 8223  C C   . ARG A 1 1131 ? 8.160   -25.844 -60.527  1.00 54.91  ? 2503 ARG B C   1 
ATOM 8224  O O   . ARG A 1 1131 ? 7.987   -24.886 -59.773  1.00 50.70  ? 2503 ARG B O   1 
ATOM 8225  C CB  . ARG A 1 1131 ? 7.508   -25.415 -62.940  1.00 52.89  ? 2503 ARG B CB  1 
ATOM 8226  C CG  . ARG A 1 1131 ? 7.306   -23.967 -63.375  1.00 52.39  ? 2503 ARG B CG  1 
ATOM 8227  C CD  . ARG A 1 1131 ? 6.508   -23.152 -62.367  1.00 48.11  ? 2503 ARG B CD  1 
ATOM 8228  N NE  . ARG A 1 1131 ? 7.032   -21.796 -62.164  1.00 48.81  ? 2503 ARG B NE  1 
ATOM 8229  C CZ  . ARG A 1 1131 ? 6.378   -20.791 -61.573  1.00 48.87  ? 2503 ARG B CZ  1 
ATOM 8230  N NH1 . ARG A 1 1131 ? 5.136   -20.941 -61.117  1.00 53.23  ? 2503 ARG B NH1 1 
ATOM 8231  N NH2 . ARG A 1 1131 ? 6.972   -19.609 -61.443  1.00 51.97  ? 2503 ARG B NH2 1 
ATOM 8232  N N   . VAL A 1 1132 ? 7.917   -27.104 -60.162  1.00 60.89  ? 2504 VAL B N   1 
ATOM 8233  C CA  . VAL A 1 1132 ? 7.541   -27.463 -58.789  1.00 59.76  ? 2504 VAL B CA  1 
ATOM 8234  C C   . VAL A 1 1132 ? 8.720   -27.265 -57.827  1.00 57.91  ? 2504 VAL B C   1 
ATOM 8235  O O   . VAL A 1 1132 ? 8.547   -26.701 -56.746  1.00 59.86  ? 2504 VAL B O   1 
ATOM 8236  C CB  . VAL A 1 1132 ? 7.003   -28.913 -58.704  1.00 57.97  ? 2504 VAL B CB  1 
ATOM 8237  C CG1 . VAL A 1 1132 ? 6.796   -29.354 -57.260  1.00 57.54  ? 2504 VAL B CG1 1 
ATOM 8238  C CG2 . VAL A 1 1132 ? 5.688   -29.032 -59.460  1.00 59.70  ? 2504 VAL B CG2 1 
ATOM 8239  N N   . ARG A 1 1133 ? 9.905   -27.734 -58.218  1.00 55.84  ? 2505 ARG B N   1 
ATOM 8240  C CA  . ARG A 1 1133 ? 11.116  -27.570 -57.401  1.00 56.74  ? 2505 ARG B CA  1 
ATOM 8241  C C   . ARG A 1 1133 ? 11.478  -26.093 -57.198  1.00 51.48  ? 2505 ARG B C   1 
ATOM 8242  O O   . ARG A 1 1133 ? 11.976  -25.718 -56.135  1.00 51.05  ? 2505 ARG B O   1 
ATOM 8243  C CB  . ARG A 1 1133 ? 12.304  -28.329 -58.014  1.00 61.95  ? 2505 ARG B CB  1 
ATOM 8244  C CG  . ARG A 1 1133 ? 13.551  -28.337 -57.137  1.00 65.76  ? 2505 ARG B CG  1 
ATOM 8245  C CD  . ARG A 1 1133 ? 14.421  -29.571 -57.334  1.00 72.19  ? 2505 ARG B CD  1 
ATOM 8246  N NE  . ARG A 1 1133 ? 14.732  -29.831 -58.744  1.00 81.07  ? 2505 ARG B NE  1 
ATOM 8247  C CZ  . ARG A 1 1133 ? 14.182  -30.777 -59.515  1.00 90.54  ? 2505 ARG B CZ  1 
ATOM 8248  N NH1 . ARG A 1 1133 ? 13.253  -31.619 -59.052  1.00 100.81 ? 2505 ARG B NH1 1 
ATOM 8249  N NH2 . ARG A 1 1133 ? 14.573  -30.886 -60.784  1.00 89.69  ? 2505 ARG B NH2 1 
ATOM 8250  N N   . ASP A 1 1134 ? 11.226  -25.271 -58.217  1.00 49.39  ? 2506 ASP B N   1 
ATOM 8251  C CA  . ASP A 1 1134 ? 11.393  -23.817 -58.118  1.00 54.84  ? 2506 ASP B CA  1 
ATOM 8252  C C   . ASP A 1 1134 ? 10.507  -23.210 -57.020  1.00 54.20  ? 2506 ASP B C   1 
ATOM 8253  O O   . ASP A 1 1134 ? 10.957  -22.343 -56.268  1.00 58.05  ? 2506 ASP B O   1 
ATOM 8254  C CB  . ASP A 1 1134 ? 11.090  -23.135 -59.467  1.00 61.76  ? 2506 ASP B CB  1 
ATOM 8255  C CG  . ASP A 1 1134 ? 12.178  -23.365 -60.516  1.00 63.37  ? 2506 ASP B CG  1 
ATOM 8256  O OD1 . ASP A 1 1134 ? 13.382  -23.289 -60.185  1.00 62.90  ? 2506 ASP B OD1 1 
ATOM 8257  O OD2 . ASP A 1 1134 ? 11.823  -23.606 -61.690  1.00 63.90  ? 2506 ASP B OD2 1 
ATOM 8258  N N   . LYS A 1 1135 ? 9.257   -23.666 -56.935  1.00 51.49  ? 2507 LYS B N   1 
ATOM 8259  C CA  . LYS A 1 1135 ? 8.329   -23.220 -55.884  1.00 50.32  ? 2507 LYS B CA  1 
ATOM 8260  C C   . LYS A 1 1135 ? 8.747   -23.688 -54.492  1.00 51.01  ? 2507 LYS B C   1 
ATOM 8261  O O   . LYS A 1 1135 ? 8.604   -22.947 -53.516  1.00 52.41  ? 2507 LYS B O   1 
ATOM 8262  C CB  . LYS A 1 1135 ? 6.907   -23.706 -56.172  1.00 51.10  ? 2507 LYS B CB  1 
ATOM 8263  C CG  . LYS A 1 1135 ? 6.268   -23.081 -57.398  1.00 48.66  ? 2507 LYS B CG  1 
ATOM 8264  C CD  . LYS A 1 1135 ? 4.886   -23.664 -57.638  1.00 49.42  ? 2507 LYS B CD  1 
ATOM 8265  C CE  . LYS A 1 1135 ? 4.323   -23.239 -58.980  1.00 49.77  ? 2507 LYS B CE  1 
ATOM 8266  N NZ  . LYS A 1 1135 ? 3.092   -23.998 -59.340  1.00 52.27  ? 2507 LYS B NZ  1 
ATOM 8267  N N   . LEU A 1 1136 ? 9.256   -24.917 -54.412  1.00 52.05  ? 2508 LEU B N   1 
ATOM 8268  C CA  . LEU A 1 1136 ? 9.703   -25.508 -53.145  1.00 49.87  ? 2508 LEU B CA  1 
ATOM 8269  C C   . LEU A 1 1136 ? 11.103  -25.051 -52.693  1.00 53.58  ? 2508 LEU B C   1 
ATOM 8270  O O   . LEU A 1 1136 ? 11.543  -25.436 -51.611  1.00 57.74  ? 2508 LEU B O   1 
ATOM 8271  C CB  . LEU A 1 1136 ? 9.647   -27.042 -53.233  1.00 49.12  ? 2508 LEU B CB  1 
ATOM 8272  C CG  . LEU A 1 1136 ? 8.253   -27.660 -53.429  1.00 48.63  ? 2508 LEU B CG  1 
ATOM 8273  C CD1 . LEU A 1 1136 ? 8.350   -29.094 -53.930  1.00 50.59  ? 2508 LEU B CD1 1 
ATOM 8274  C CD2 . LEU A 1 1136 ? 7.440   -27.610 -52.143  1.00 46.61  ? 2508 LEU B CD2 1 
ATOM 8275  N N   . THR A 1 1137 ? 11.805  -24.268 -53.520  1.00 54.37  ? 2509 THR B N   1 
ATOM 8276  C CA  . THR A 1 1137 ? 13.078  -23.628 -53.136  1.00 55.41  ? 2509 THR B CA  1 
ATOM 8277  C C   . THR A 1 1137 ? 13.062  -22.089 -53.154  1.00 62.44  ? 2509 THR B C   1 
ATOM 8278  O O   . THR A 1 1137 ? 14.029  -21.463 -52.711  1.00 71.92  ? 2509 THR B O   1 
ATOM 8279  C CB  . THR A 1 1137 ? 14.230  -24.102 -54.048  1.00 52.79  ? 2509 THR B CB  1 
ATOM 8280  O OG1 . THR A 1 1137 ? 13.896  -23.857 -55.419  1.00 51.10  ? 2509 THR B OG1 1 
ATOM 8281  C CG2 . THR A 1 1137 ? 14.496  -25.582 -53.845  1.00 55.67  ? 2509 THR B CG2 1 
ATOM 8282  N N   . GLY A 1 1138 ? 11.984  -21.482 -53.654  1.00 64.39  ? 2510 GLY B N   1 
ATOM 8283  C CA  . GLY A 1 1138 ? 11.891  -20.025 -53.779  1.00 61.59  ? 2510 GLY B CA  1 
ATOM 8284  C C   . GLY A 1 1138 ? 12.610  -19.428 -54.976  1.00 60.08  ? 2510 GLY B C   1 
ATOM 8285  O O   . GLY A 1 1138 ? 13.081  -18.292 -54.905  1.00 59.79  ? 2510 GLY B O   1 
ATOM 8286  N N   . ARG A 1 1139 ? 12.692  -20.187 -56.070  1.00 60.89  ? 2511 ARG B N   1 
ATOM 8287  C CA  . ARG A 1 1139 ? 13.188  -19.691 -57.354  1.00 65.27  ? 2511 ARG B CA  1 
ATOM 8288  C C   . ARG A 1 1139 ? 12.028  -19.619 -58.358  1.00 66.43  ? 2511 ARG B C   1 
ATOM 8289  O O   . ARG A 1 1139 ? 12.201  -19.891 -59.552  1.00 66.58  ? 2511 ARG B O   1 
ATOM 8290  C CB  . ARG A 1 1139 ? 14.297  -20.610 -57.877  1.00 73.74  ? 2511 ARG B CB  1 
ATOM 8291  C CG  . ARG A 1 1139 ? 15.558  -20.631 -57.028  1.00 77.58  ? 2511 ARG B CG  1 
ATOM 8292  C CD  . ARG A 1 1139 ? 16.696  -21.318 -57.768  1.00 86.72  ? 2511 ARG B CD  1 
ATOM 8293  N NE  . ARG A 1 1139 ? 17.993  -21.109 -57.128  1.00 98.74  ? 2511 ARG B NE  1 
ATOM 8294  C CZ  . ARG A 1 1139 ? 19.162  -21.539 -57.609  1.00 125.60 ? 2511 ARG B CZ  1 
ATOM 8295  N NH1 . ARG A 1 1139 ? 19.228  -22.217 -58.757  1.00 132.52 ? 2511 ARG B NH1 1 
ATOM 8296  N NH2 . ARG A 1 1139 ? 20.283  -21.288 -56.936  1.00 136.94 ? 2511 ARG B NH2 1 
ATOM 8297  N N   . ASP A 1 1140 ? 10.858  -19.206 -57.867  1.00 64.63  ? 2512 ASP B N   1 
ATOM 8298  C CA  . ASP A 1 1140 ? 9.595   -19.279 -58.622  1.00 64.43  ? 2512 ASP B CA  1 
ATOM 8299  C C   . ASP A 1 1140 ? 9.096   -17.914 -59.117  1.00 68.55  ? 2512 ASP B C   1 
ATOM 8300  O O   . ASP A 1 1140 ? 7.967   -17.805 -59.601  1.00 79.76  ? 2512 ASP B O   1 
ATOM 8301  C CB  . ASP A 1 1140 ? 8.504   -19.999 -57.800  1.00 60.21  ? 2512 ASP B CB  1 
ATOM 8302  C CG  . ASP A 1 1140 ? 8.289   -19.391 -56.415  1.00 58.06  ? 2512 ASP B CG  1 
ATOM 8303  O OD1 . ASP A 1 1140 ? 9.274   -18.949 -55.787  1.00 57.10  ? 2512 ASP B OD1 1 
ATOM 8304  O OD2 . ASP A 1 1140 ? 7.136   -19.379 -55.940  1.00 56.89  ? 2512 ASP B OD2 1 
ATOM 8305  N N   . PHE A 1 1141 ? 9.938   -16.885 -59.003  1.00 67.93  ? 2513 PHE B N   1 
ATOM 8306  C CA  . PHE A 1 1141 ? 9.655   -15.568 -59.572  1.00 71.69  ? 2513 PHE B CA  1 
ATOM 8307  C C   . PHE A 1 1141 ? 10.846  -15.090 -60.399  1.00 85.98  ? 2513 PHE B C   1 
ATOM 8308  O O   . PHE A 1 1141 ? 10.742  -14.962 -61.621  1.00 106.12 ? 2513 PHE B O   1 
ATOM 8309  C CB  . PHE A 1 1141 ? 9.317   -14.568 -58.466  1.00 67.04  ? 2513 PHE B CB  1 
ATOM 8310  C CG  . PHE A 1 1141 ? 7.972   -14.795 -57.837  1.00 59.45  ? 2513 PHE B CG  1 
ATOM 8311  C CD1 . PHE A 1 1141 ? 7.834   -15.641 -56.744  1.00 58.81  ? 2513 PHE B CD1 1 
ATOM 8312  C CD2 . PHE A 1 1141 ? 6.839   -14.163 -58.340  1.00 58.79  ? 2513 PHE B CD2 1 
ATOM 8313  C CE1 . PHE A 1 1141 ? 6.592   -15.852 -56.163  1.00 59.93  ? 2513 PHE B CE1 1 
ATOM 8314  C CE2 . PHE A 1 1141 ? 5.594   -14.370 -57.765  1.00 55.83  ? 2513 PHE B CE2 1 
ATOM 8315  C CZ  . PHE A 1 1141 ? 5.469   -15.217 -56.675  1.00 56.90  ? 2513 PHE B CZ  1 
ATOM 8316  N N   . SER A 1 1142 ? 11.969  -14.842 -59.728  1.00 94.49  ? 2514 SER B N   1 
ATOM 8317  C CA  . SER A 1 1142 ? 13.212  -14.432 -60.374  1.00 101.34 ? 2514 SER B CA  1 
ATOM 8318  C C   . SER A 1 1142 ? 14.188  -15.604 -60.337  1.00 101.71 ? 2514 SER B C   1 
ATOM 8319  O O   . SER A 1 1142 ? 14.572  -16.058 -59.258  1.00 112.27 ? 2514 SER B O   1 
ATOM 8320  C CB  . SER A 1 1142 ? 13.802  -13.208 -59.668  1.00 113.02 ? 2514 SER B CB  1 
ATOM 8321  O OG  . SER A 1 1142 ? 13.613  -13.279 -58.264  1.00 122.56 ? 2514 SER B OG  1 
ATOM 8322  N N   . HIS A 1 1143 ? 14.559  -16.097 -61.520  1.00 103.54 ? 2515 HIS B N   1 
ATOM 8323  C CA  . HIS A 1 1143 ? 15.491  -17.239 -61.669  1.00 108.68 ? 2515 HIS B CA  1 
ATOM 8324  C C   . HIS A 1 1143 ? 16.806  -17.123 -60.878  1.00 109.88 ? 2515 HIS B C   1 
ATOM 8325  O O   . HIS A 1 1143 ? 17.298  -18.125 -60.355  1.00 105.78 ? 2515 HIS B O   1 
ATOM 8326  C CB  . HIS A 1 1143 ? 15.795  -17.549 -63.156  1.00 110.05 ? 2515 HIS B CB  1 
ATOM 8327  C CG  . HIS A 1 1143 ? 15.890  -16.339 -64.038  1.00 122.52 ? 2515 HIS B CG  1 
ATOM 8328  N ND1 . HIS A 1 1143 ? 16.770  -15.306 -63.799  1.00 136.70 ? 2515 HIS B ND1 1 
ATOM 8329  C CD2 . HIS A 1 1143 ? 15.209  -16.001 -65.159  1.00 128.29 ? 2515 HIS B CD2 1 
ATOM 8330  C CE1 . HIS A 1 1143 ? 16.627  -14.383 -64.734  1.00 136.82 ? 2515 HIS B CE1 1 
ATOM 8331  N NE2 . HIS A 1 1143 ? 15.687  -14.780 -65.572  1.00 135.01 ? 2515 HIS B NE2 1 
ATOM 8332  N N   . ASP A 1 1144 ? 17.354  -15.911 -60.783  1.00 116.05 ? 2516 ASP B N   1 
ATOM 8333  C CA  . ASP A 1 1144 ? 18.618  -15.677 -60.072  1.00 117.21 ? 2516 ASP B CA  1 
ATOM 8334  C C   . ASP A 1 1144 ? 18.448  -15.748 -58.557  1.00 113.65 ? 2516 ASP B C   1 
ATOM 8335  O O   . ASP A 1 1144 ? 19.154  -16.503 -57.884  1.00 114.31 ? 2516 ASP B O   1 
ATOM 8336  C CB  . ASP A 1 1144 ? 19.219  -14.316 -60.451  1.00 119.77 ? 2516 ASP B CB  1 
ATOM 8337  C CG  . ASP A 1 1144 ? 19.795  -14.298 -61.855  1.00 126.62 ? 2516 ASP B CG  1 
ATOM 8338  O OD1 . ASP A 1 1144 ? 19.227  -14.959 -62.749  1.00 136.68 ? 2516 ASP B OD1 1 
ATOM 8339  O OD2 . ASP A 1 1144 ? 20.819  -13.615 -62.064  1.00 136.56 ? 2516 ASP B OD2 1 
ATOM 8340  N N   . ASP A 1 1145 ? 17.511  -14.958 -58.034  1.00 108.51 ? 2517 ASP B N   1 
ATOM 8341  C CA  . ASP A 1 1145 ? 17.302  -14.844 -56.585  1.00 108.29 ? 2517 ASP B CA  1 
ATOM 8342  C C   . ASP A 1 1145 ? 16.686  -16.103 -55.977  1.00 94.68  ? 2517 ASP B C   1 
ATOM 8343  O O   . ASP A 1 1145 ? 15.986  -16.856 -56.657  1.00 97.31  ? 2517 ASP B O   1 
ATOM 8344  C CB  . ASP A 1 1145 ? 16.412  -13.641 -56.252  1.00 110.79 ? 2517 ASP B CB  1 
ATOM 8345  C CG  . ASP A 1 1145 ? 17.063  -12.314 -56.600  1.00 121.26 ? 2517 ASP B CG  1 
ATOM 8346  O OD1 . ASP A 1 1145 ? 18.153  -12.025 -56.063  1.00 129.22 ? 2517 ASP B OD1 1 
ATOM 8347  O OD2 . ASP A 1 1145 ? 16.478  -11.555 -57.401  1.00 124.96 ? 2517 ASP B OD2 1 
ATOM 8348  N N   . THR A 1 1146 ? 16.970  -16.312 -54.692  1.00 77.85  ? 2518 THR B N   1 
ATOM 8349  C CA  . THR A 1 1146 ? 16.407  -17.407 -53.904  1.00 70.80  ? 2518 THR B CA  1 
ATOM 8350  C C   . THR A 1 1146 ? 15.595  -16.775 -52.772  1.00 65.34  ? 2518 THR B C   1 
ATOM 8351  O O   . THR A 1 1146 ? 16.148  -16.368 -51.748  1.00 66.28  ? 2518 THR B O   1 
ATOM 8352  C CB  . THR A 1 1146 ? 17.514  -18.330 -53.351  1.00 72.85  ? 2518 THR B CB  1 
ATOM 8353  O OG1 . THR A 1 1146 ? 18.338  -18.786 -54.433  1.00 80.37  ? 2518 THR B OG1 1 
ATOM 8354  C CG2 . THR A 1 1146 ? 16.919  -19.543 -52.633  1.00 68.70  ? 2518 THR B CG2 1 
ATOM 8355  N N   . LEU A 1 1147 ? 14.282  -16.698 -52.975  1.00 62.28  ? 2519 LEU B N   1 
ATOM 8356  C CA  . LEU A 1 1147 ? 13.380  -15.981 -52.072  1.00 58.98  ? 2519 LEU B CA  1 
ATOM 8357  C C   . LEU A 1 1147 ? 13.077  -16.798 -50.823  1.00 59.26  ? 2519 LEU B C   1 
ATOM 8358  O O   . LEU A 1 1147 ? 12.779  -17.987 -50.920  1.00 57.93  ? 2519 LEU B O   1 
ATOM 8359  C CB  . LEU A 1 1147 ? 12.062  -15.665 -52.784  1.00 58.43  ? 2519 LEU B CB  1 
ATOM 8360  C CG  . LEU A 1 1147 ? 12.157  -14.819 -54.058  1.00 65.34  ? 2519 LEU B CG  1 
ATOM 8361  C CD1 . LEU A 1 1147 ? 10.930  -15.020 -54.931  1.00 70.77  ? 2519 LEU B CD1 1 
ATOM 8362  C CD2 . LEU A 1 1147 ? 12.346  -13.349 -53.724  1.00 67.78  ? 2519 LEU B CD2 1 
ATOM 8363  N N   . ASP A 1 1148 ? 13.145  -16.153 -49.657  1.00 61.34  ? 2520 ASP B N   1 
ATOM 8364  C CA  . ASP A 1 1148 ? 12.700  -16.768 -48.397  1.00 65.80  ? 2520 ASP B CA  1 
ATOM 8365  C C   . ASP A 1 1148 ? 11.168  -16.792 -48.326  1.00 70.44  ? 2520 ASP B C   1 
ATOM 8366  O O   . ASP A 1 1148 ? 10.494  -16.151 -49.138  1.00 79.13  ? 2520 ASP B O   1 
ATOM 8367  C CB  . ASP A 1 1148 ? 13.308  -16.054 -47.173  1.00 72.03  ? 2520 ASP B CB  1 
ATOM 8368  C CG  . ASP A 1 1148 ? 12.773  -14.639 -46.971  1.00 73.85  ? 2520 ASP B CG  1 
ATOM 8369  O OD1 . ASP A 1 1148 ? 12.492  -13.956 -47.976  1.00 73.72  ? 2520 ASP B OD1 1 
ATOM 8370  O OD2 . ASP A 1 1148 ? 12.654  -14.209 -45.803  1.00 71.54  ? 2520 ASP B OD2 1 
ATOM 8371  N N   . VAL A 1 1149 ? 10.632  -17.517 -47.343  1.00 68.75  ? 2521 VAL B N   1 
ATOM 8372  C CA  . VAL A 1 1149 ? 9.187   -17.802 -47.272  1.00 69.03  ? 2521 VAL B CA  1 
ATOM 8373  C C   . VAL A 1 1149 ? 8.300   -16.540 -47.156  1.00 69.01  ? 2521 VAL B C   1 
ATOM 8374  O O   . VAL A 1 1149 ? 7.370   -16.386 -47.952  1.00 69.48  ? 2521 VAL B O   1 
ATOM 8375  C CB  . VAL A 1 1149 ? 8.863   -18.860 -46.173  1.00 66.71  ? 2521 VAL B CB  1 
ATOM 8376  C CG1 . VAL A 1 1149 ? 7.363   -18.995 -45.922  1.00 64.66  ? 2521 VAL B CG1 1 
ATOM 8377  C CG2 . VAL A 1 1149 ? 9.440   -20.212 -46.567  1.00 63.97  ? 2521 VAL B CG2 1 
ATOM 8378  N N   . PRO A 1 1150 ? 8.579   -15.638 -46.186  1.00 65.26  ? 2522 PRO B N   1 
ATOM 8379  C CA  . PRO A 1 1150 ? 7.756   -14.419 -46.075  1.00 60.86  ? 2522 PRO B CA  1 
ATOM 8380  C C   . PRO A 1 1150 ? 7.719   -13.530 -47.323  1.00 59.49  ? 2522 PRO B C   1 
ATOM 8381  O O   . PRO A 1 1150 ? 6.695   -12.894 -47.586  1.00 59.71  ? 2522 PRO B O   1 
ATOM 8382  C CB  . PRO A 1 1150 ? 8.397   -13.665 -44.905  1.00 61.43  ? 2522 PRO B CB  1 
ATOM 8383  C CG  . PRO A 1 1150 ? 9.044   -14.722 -44.089  1.00 66.28  ? 2522 PRO B CG  1 
ATOM 8384  C CD  . PRO A 1 1150 ? 9.543   -15.736 -45.075  1.00 68.58  ? 2522 PRO B CD  1 
ATOM 8385  N N   . THR A 1 1151 ? 8.823   -13.486 -48.069  1.00 55.78  ? 2523 THR B N   1 
ATOM 8386  C CA  . THR A 1 1151 ? 8.884   -12.748 -49.332  1.00 55.22  ? 2523 THR B CA  1 
ATOM 8387  C C   . THR A 1 1151 ? 8.081   -13.464 -50.419  1.00 52.01  ? 2523 THR B C   1 
ATOM 8388  O O   . THR A 1 1151 ? 7.316   -12.823 -51.144  1.00 50.10  ? 2523 THR B O   1 
ATOM 8389  C CB  . THR A 1 1151 ? 10.342  -12.545 -49.796  1.00 58.41  ? 2523 THR B CB  1 
ATOM 8390  O OG1 . THR A 1 1151 ? 11.098  -11.950 -48.734  1.00 53.76  ? 2523 THR B OG1 1 
ATOM 8391  C CG2 . THR A 1 1151 ? 10.419  -11.635 -51.026  1.00 60.95  ? 2523 THR B CG2 1 
ATOM 8392  N N   . GLN A 1 1152 ? 8.263   -14.782 -50.528  1.00 50.85  ? 2524 GLN B N   1 
ATOM 8393  C CA  . GLN A 1 1152 ? 7.511   -15.612 -51.486  1.00 52.57  ? 2524 GLN B CA  1 
ATOM 8394  C C   . GLN A 1 1152 ? 6.005   -15.505 -51.250  1.00 50.55  ? 2524 GLN B C   1 
ATOM 8395  O O   . GLN A 1 1152 ? 5.239   -15.294 -52.190  1.00 49.43  ? 2524 GLN B O   1 
ATOM 8396  C CB  . GLN A 1 1152 ? 7.940   -17.083 -51.386  1.00 55.28  ? 2524 GLN B CB  1 
ATOM 8397  C CG  . GLN A 1 1152 ? 7.408   -17.980 -52.501  1.00 56.59  ? 2524 GLN B CG  1 
ATOM 8398  C CD  . GLN A 1 1152 ? 7.658   -19.461 -52.261  1.00 56.95  ? 2524 GLN B CD  1 
ATOM 8399  O OE1 . GLN A 1 1152 ? 7.878   -19.900 -51.130  1.00 50.71  ? 2524 GLN B OE1 1 
ATOM 8400  N NE2 . GLN A 1 1152 ? 7.610   -20.244 -53.335  1.00 60.97  ? 2524 GLN B NE2 1 
ATOM 8401  N N   . VAL A 1 1153 ? 5.601   -15.653 -49.990  1.00 50.02  ? 2525 VAL B N   1 
ATOM 8402  C CA  . VAL A 1 1153 ? 4.193   -15.545 -49.585  1.00 48.00  ? 2525 VAL B CA  1 
ATOM 8403  C C   . VAL A 1 1153 ? 3.622   -14.153 -49.881  1.00 46.53  ? 2525 VAL B C   1 
ATOM 8404  O O   . VAL A 1 1153 ? 2.489   -14.042 -50.353  1.00 44.51  ? 2525 VAL B O   1 
ATOM 8405  C CB  . VAL A 1 1153 ? 4.013   -15.929 -48.091  1.00 49.23  ? 2525 VAL B CB  1 
ATOM 8406  C CG1 . VAL A 1 1153 ? 2.638   -15.543 -47.553  1.00 50.03  ? 2525 VAL B CG1 1 
ATOM 8407  C CG2 . VAL A 1 1153 ? 4.230   -17.427 -47.915  1.00 50.49  ? 2525 VAL B CG2 1 
ATOM 8408  N N   . GLU A 1 1154 ? 4.401   -13.107 -49.603  1.00 52.62  ? 2526 GLU B N   1 
ATOM 8409  C CA  . GLU A 1 1154 ? 4.005   -11.723 -49.928  1.00 57.28  ? 2526 GLU B CA  1 
ATOM 8410  C C   . GLU A 1 1154 ? 3.823   -11.539 -51.435  1.00 58.35  ? 2526 GLU B C   1 
ATOM 8411  O O   . GLU A 1 1154 ? 2.815   -10.982 -51.875  1.00 64.87  ? 2526 GLU B O   1 
ATOM 8412  C CB  . GLU A 1 1154 ? 5.016   -10.701 -49.357  1.00 59.72  ? 2526 GLU B CB  1 
ATOM 8413  C CG  . GLU A 1 1154 ? 5.077   -9.315  -50.018  1.00 60.93  ? 2526 GLU B CG  1 
ATOM 8414  C CD  . GLU A 1 1154 ? 3.813   -8.475  -49.874  1.00 65.73  ? 2526 GLU B CD  1 
ATOM 8415  O OE1 . GLU A 1 1154 ? 2.713   -9.023  -49.655  1.00 70.25  ? 2526 GLU B OE1 1 
ATOM 8416  O OE2 . GLU A 1 1154 ? 3.921   -7.237  -49.993  1.00 70.17  ? 2526 GLU B OE2 1 
ATOM 8417  N N   . LEU A 1 1155 ? 4.803   -12.003 -52.210  1.00 54.01  ? 2527 LEU B N   1 
ATOM 8418  C CA  . LEU A 1 1155 ? 4.731   -11.967 -53.678  1.00 52.65  ? 2527 LEU B CA  1 
ATOM 8419  C C   . LEU A 1 1155 ? 3.497   -12.691 -54.229  1.00 51.77  ? 2527 LEU B C   1 
ATOM 8420  O O   . LEU A 1 1155 ? 2.880   -12.216 -55.185  1.00 54.24  ? 2527 LEU B O   1 
ATOM 8421  C CB  . LEU A 1 1155 ? 6.002   -12.562 -54.301  1.00 56.94  ? 2527 LEU B CB  1 
ATOM 8422  C CG  . LEU A 1 1155 ? 7.223   -11.639 -54.364  1.00 56.45  ? 2527 LEU B CG  1 
ATOM 8423  C CD1 . LEU A 1 1155 ? 8.512   -12.439 -54.486  1.00 59.02  ? 2527 LEU B CD1 1 
ATOM 8424  C CD2 . LEU A 1 1155 ? 7.096   -10.660 -55.522  1.00 61.08  ? 2527 LEU B CD2 1 
ATOM 8425  N N   . LEU A 1 1156 ? 3.153   -13.829 -53.622  1.00 50.18  ? 2528 LEU B N   1 
ATOM 8426  C CA  . LEU A 1 1156 ? 1.987   -14.628 -54.032  1.00 47.65  ? 2528 LEU B CA  1 
ATOM 8427  C C   . LEU A 1 1156 ? 0.663   -13.934 -53.744  1.00 45.77  ? 2528 LEU B C   1 
ATOM 8428  O O   . LEU A 1 1156 ? -0.222  -13.908 -54.600  1.00 51.91  ? 2528 LEU B O   1 
ATOM 8429  C CB  . LEU A 1 1156 ? 1.990   -16.002 -53.348  1.00 44.86  ? 2528 LEU B CB  1 
ATOM 8430  C CG  . LEU A 1 1156 ? 2.980   -17.031 -53.891  1.00 43.08  ? 2528 LEU B CG  1 
ATOM 8431  C CD1 . LEU A 1 1156 ? 3.110   -18.203 -52.931  1.00 44.57  ? 2528 LEU B CD1 1 
ATOM 8432  C CD2 . LEU A 1 1156 ? 2.556   -17.518 -55.267  1.00 42.81  ? 2528 LEU B CD2 1 
ATOM 8433  N N   . ILE A 1 1157 ? 0.535   -13.385 -52.538  1.00 43.40  ? 2529 ILE B N   1 
ATOM 8434  C CA  . ILE A 1 1157 ? -0.671  -12.650 -52.133  1.00 47.57  ? 2529 ILE B CA  1 
ATOM 8435  C C   . ILE A 1 1157 ? -0.888  -11.432 -53.044  1.00 53.09  ? 2529 ILE B C   1 
ATOM 8436  O O   . ILE A 1 1157 ? -2.017  -11.146 -53.439  1.00 52.83  ? 2529 ILE B O   1 
ATOM 8437  C CB  . ILE A 1 1157 ? -0.606  -12.239 -50.639  1.00 47.19  ? 2529 ILE B CB  1 
ATOM 8438  C CG1 . ILE A 1 1157 ? -0.676  -13.485 -49.746  1.00 50.12  ? 2529 ILE B CG1 1 
ATOM 8439  C CG2 . ILE A 1 1157 ? -1.750  -11.304 -50.259  1.00 45.58  ? 2529 ILE B CG2 1 
ATOM 8440  C CD1 . ILE A 1 1157 ? -0.136  -13.283 -48.347  1.00 52.33  ? 2529 ILE B CD1 1 
ATOM 8441  N N   . LYS A 1 1158 ? 0.201   -10.739 -53.376  1.00 66.04  ? 2530 LYS B N   1 
ATOM 8442  C CA  . LYS A 1 1158 ? 0.179   -9.627  -54.341  1.00 74.97  ? 2530 LYS B CA  1 
ATOM 8443  C C   . LYS A 1 1158 ? -0.362  -10.076 -55.710  1.00 65.13  ? 2530 LYS B C   1 
ATOM 8444  O O   . LYS A 1 1158 ? -1.193  -9.389  -56.309  1.00 62.26  ? 2530 LYS B O   1 
ATOM 8445  C CB  . LYS A 1 1158 ? 1.589   -9.027  -54.505  1.00 90.61  ? 2530 LYS B CB  1 
ATOM 8446  C CG  . LYS A 1 1158 ? 1.622   -7.558  -54.913  1.00 103.10 ? 2530 LYS B CG  1 
ATOM 8447  C CD  . LYS A 1 1158 ? 1.837   -6.618  -53.728  1.00 110.25 ? 2530 LYS B CD  1 
ATOM 8448  C CE  . LYS A 1 1158 ? 0.689   -6.664  -52.729  1.00 121.99 ? 2530 LYS B CE  1 
ATOM 8449  N NZ  . LYS A 1 1158 ? 0.840   -5.649  -51.649  1.00 130.14 ? 2530 LYS B NZ  1 
ATOM 8450  N N   . GLN A 1 1159 ? 0.113   -11.232 -56.180  1.00 54.59  ? 2531 GLN B N   1 
ATOM 8451  C CA  . GLN A 1 1159 ? -0.318  -11.822 -57.456  1.00 50.64  ? 2531 GLN B CA  1 
ATOM 8452  C C   . GLN A 1 1159 ? -1.799  -12.223 -57.446  1.00 48.52  ? 2531 GLN B C   1 
ATOM 8453  O O   . GLN A 1 1159 ? -2.515  -11.991 -58.423  1.00 48.80  ? 2531 GLN B O   1 
ATOM 8454  C CB  . GLN A 1 1159 ? 0.546   -13.048 -57.795  1.00 49.05  ? 2531 GLN B CB  1 
ATOM 8455  C CG  . GLN A 1 1159 ? 0.443   -13.528 -59.239  1.00 55.79  ? 2531 GLN B CG  1 
ATOM 8456  C CD  . GLN A 1 1159 ? 1.208   -14.819 -59.494  1.00 62.00  ? 2531 GLN B CD  1 
ATOM 8457  O OE1 . GLN A 1 1159 ? 2.009   -15.259 -58.670  1.00 64.11  ? 2531 GLN B OE1 1 
ATOM 8458  N NE2 . GLN A 1 1159 ? 0.956   -15.437 -60.645  1.00 65.84  ? 2531 GLN B NE2 1 
ATOM 8459  N N   . ALA A 1 1160 ? -2.241  -12.830 -56.346  1.00 44.68  ? 2532 ALA B N   1 
ATOM 8460  C CA  . ALA A 1 1160 ? -3.632  -13.274 -56.190  1.00 44.85  ? 2532 ALA B CA  1 
ATOM 8461  C C   . ALA A 1 1160 ? -4.617  -12.125 -55.980  1.00 46.92  ? 2532 ALA B C   1 
ATOM 8462  O O   . ALA A 1 1160 ? -5.797  -12.256 -56.312  1.00 54.21  ? 2532 ALA B O   1 
ATOM 8463  C CB  . ALA A 1 1160 ? -3.738  -14.258 -55.037  1.00 47.32  ? 2532 ALA B CB  1 
ATOM 8464  N N   . THR A 1 1161 ? -4.129  -11.022 -55.412  1.00 47.14  ? 2533 THR B N   1 
ATOM 8465  C CA  . THR A 1 1161 ? -4.929  -9.821  -55.147  1.00 44.84  ? 2533 THR B CA  1 
ATOM 8466  C C   . THR A 1 1161 ? -5.004  -8.871  -56.358  1.00 41.57  ? 2533 THR B C   1 
ATOM 8467  O O   . THR A 1 1161 ? -5.964  -8.107  -56.477  1.00 38.79  ? 2533 THR B O   1 
ATOM 8468  C CB  . THR A 1 1161 ? -4.360  -9.075  -53.913  1.00 50.59  ? 2533 THR B CB  1 
ATOM 8469  O OG1 . THR A 1 1161 ? -4.362  -9.964  -52.790  1.00 49.32  ? 2533 THR B OG1 1 
ATOM 8470  C CG2 . THR A 1 1161 ? -5.173  -7.833  -53.543  1.00 62.24  ? 2533 THR B CG2 1 
ATOM 8471  N N   . SER A 1 1162 ? -4.011  -8.932  -57.250  1.00 42.00  ? 2534 SER B N   1 
ATOM 8472  C CA  . SER A 1 1162 ? -3.877  -7.982  -58.370  1.00 46.93  ? 2534 SER B CA  1 
ATOM 8473  C C   . SER A 1 1162 ? -5.123  -7.851  -59.253  1.00 45.27  ? 2534 SER B C   1 
ATOM 8474  O O   . SER A 1 1162 ? -5.585  -8.835  -59.832  1.00 48.83  ? 2534 SER B O   1 
ATOM 8475  C CB  . SER A 1 1162 ? -2.683  -8.366  -59.256  1.00 52.49  ? 2534 SER B CB  1 
ATOM 8476  O OG  . SER A 1 1162 ? -2.546  -7.483  -60.359  1.00 56.61  ? 2534 SER B OG  1 
ATOM 8477  N N   . HIS A 1 1163 ? -5.646  -6.626  -59.346  1.00 44.03  ? 2535 HIS B N   1 
ATOM 8478  C CA  . HIS A 1 1163 ? -6.758  -6.292  -60.249  1.00 43.02  ? 2535 HIS B CA  1 
ATOM 8479  C C   . HIS A 1 1163 ? -6.441  -6.608  -61.711  1.00 42.25  ? 2535 HIS B C   1 
ATOM 8480  O O   . HIS A 1 1163 ? -7.324  -7.026  -62.457  1.00 41.97  ? 2535 HIS B O   1 
ATOM 8481  C CB  . HIS A 1 1163 ? -7.126  -4.806  -60.127  1.00 45.22  ? 2535 HIS B CB  1 
ATOM 8482  C CG  . HIS A 1 1163 ? -7.891  -4.468  -58.886  1.00 47.69  ? 2535 HIS B CG  1 
ATOM 8483  N ND1 . HIS A 1 1163 ? -8.665  -3.333  -58.779  1.00 48.50  ? 2535 HIS B ND1 1 
ATOM 8484  C CD2 . HIS A 1 1163 ? -8.014  -5.120  -57.706  1.00 51.67  ? 2535 HIS B CD2 1 
ATOM 8485  C CE1 . HIS A 1 1163 ? -9.222  -3.295  -57.582  1.00 52.55  ? 2535 HIS B CE1 1 
ATOM 8486  N NE2 . HIS A 1 1163 ? -8.846  -4.369  -56.912  1.00 51.76  ? 2535 HIS B NE2 1 
ATOM 8487  N N   . GLU A 1 1164 ? -5.186  -6.397  -62.111  1.00 44.34  ? 2536 GLU B N   1 
ATOM 8488  C CA  . GLU A 1 1164 ? -4.730  -6.719  -63.470  1.00 45.57  ? 2536 GLU B CA  1 
ATOM 8489  C C   . GLU A 1 1164 ? -4.844  -8.216  -63.765  1.00 45.30  ? 2536 GLU B C   1 
ATOM 8490  O O   . GLU A 1 1164 ? -5.260  -8.606  -64.860  1.00 49.41  ? 2536 GLU B O   1 
ATOM 8491  C CB  . GLU A 1 1164 ? -3.282  -6.267  -63.686  1.00 44.24  ? 2536 GLU B CB  1 
ATOM 8492  C CG  . GLU A 1 1164 ? -3.087  -4.758  -63.707  1.00 43.45  ? 2536 GLU B CG  1 
ATOM 8493  C CD  . GLU A 1 1164 ? -1.635  -4.346  -63.895  1.00 50.46  ? 2536 GLU B CD  1 
ATOM 8494  O OE1 . GLU A 1 1164 ? -0.776  -5.226  -64.122  1.00 58.52  ? 2536 GLU B OE1 1 
ATOM 8495  O OE2 . GLU A 1 1164 ? -1.345  -3.131  -63.816  1.00 53.23  ? 2536 GLU B OE2 1 
ATOM 8496  N N   . ASN A 1 1165 ? -4.467  -9.038  -62.786  1.00 39.46  ? 2537 ASN B N   1 
ATOM 8497  C CA  . ASN A 1 1165 ? -4.612  -10.494 -62.884  1.00 41.63  ? 2537 ASN B CA  1 
ATOM 8498  C C   . ASN A 1 1165 ? -6.075  -10.954 -62.804  1.00 45.36  ? 2537 ASN B C   1 
ATOM 8499  O O   . ASN A 1 1165 ? -6.486  -11.854 -63.542  1.00 52.94  ? 2537 ASN B O   1 
ATOM 8500  C CB  . ASN A 1 1165 ? -3.800  -11.194 -61.784  1.00 39.98  ? 2537 ASN B CB  1 
ATOM 8501  C CG  . ASN A 1 1165 ? -2.298  -11.069 -61.982  1.00 38.75  ? 2537 ASN B CG  1 
ATOM 8502  O OD1 . ASN A 1 1165 ? -1.821  -10.689 -63.053  1.00 41.96  ? 2537 ASN B OD1 1 
ATOM 8503  N ND2 . ASN A 1 1165 ? -1.542  -11.405 -60.942  1.00 34.76  ? 2537 ASN B ND2 1 
ATOM 8504  N N   . LEU A 1 1166 ? -6.845  -10.344 -61.905  1.00 40.63  ? 2538 LEU B N   1 
ATOM 8505  C CA  . LEU A 1 1166 ? -8.239  -10.736 -61.674  1.00 39.42  ? 2538 LEU B CA  1 
ATOM 8506  C C   . LEU A 1 1166 ? -9.171  -10.367 -62.830  1.00 39.83  ? 2538 LEU B C   1 
ATOM 8507  O O   . LEU A 1 1166 ? -10.005 -11.175 -63.230  1.00 41.06  ? 2538 LEU B O   1 
ATOM 8508  C CB  . LEU A 1 1166 ? -8.764  -10.124 -60.370  1.00 41.16  ? 2538 LEU B CB  1 
ATOM 8509  C CG  . LEU A 1 1166 ? -8.190  -10.732 -59.087  1.00 40.73  ? 2538 LEU B CG  1 
ATOM 8510  C CD1 . LEU A 1 1166 ? -8.321  -9.770  -57.919  1.00 42.04  ? 2538 LEU B CD1 1 
ATOM 8511  C CD2 . LEU A 1 1166 ? -8.869  -12.053 -58.760  1.00 43.50  ? 2538 LEU B CD2 1 
ATOM 8512  N N   . CYS A 1 1167 ? -9.026  -9.155  -63.363  1.00 44.22  ? 2539 CYS B N   1 
ATOM 8513  C CA  . CYS A 1 1167 ? -9.881  -8.680  -64.463  1.00 44.50  ? 2539 CYS B CA  1 
ATOM 8514  C C   . CYS A 1 1167 ? -9.731  -9.529  -65.735  1.00 43.38  ? 2539 CYS B C   1 
ATOM 8515  O O   . CYS A 1 1167 ? -10.683 -9.678  -66.499  1.00 43.80  ? 2539 CYS B O   1 
ATOM 8516  C CB  . CYS A 1 1167 ? -9.602  -7.197  -64.771  1.00 45.56  ? 2539 CYS B CB  1 
ATOM 8517  S SG  . CYS A 1 1167 ? -8.064  -6.864  -65.670  1.00 44.39  ? 2539 CYS B SG  1 
ATOM 8518  N N   . GLN A 1 1168 ? -8.539  -10.084 -65.945  1.00 45.57  ? 2540 GLN B N   1 
ATOM 8519  C CA  . GLN A 1 1168 ? -8.268  -10.958 -67.092  1.00 48.30  ? 2540 GLN B CA  1 
ATOM 8520  C C   . GLN A 1 1168 ? -8.958  -12.327 -67.027  1.00 49.86  ? 2540 GLN B C   1 
ATOM 8521  O O   . GLN A 1 1168 ? -9.154  -12.957 -68.069  1.00 55.36  ? 2540 GLN B O   1 
ATOM 8522  C CB  . GLN A 1 1168 ? -6.757  -11.156 -67.272  1.00 47.16  ? 2540 GLN B CB  1 
ATOM 8523  C CG  . GLN A 1 1168 ? -6.052  -9.957  -67.870  1.00 45.35  ? 2540 GLN B CG  1 
ATOM 8524  C CD  . GLN A 1 1168 ? -4.562  -10.163 -67.955  1.00 48.10  ? 2540 GLN B CD  1 
ATOM 8525  O OE1 . GLN A 1 1168 ? -4.039  -10.549 -68.999  1.00 56.86  ? 2540 GLN B OE1 1 
ATOM 8526  N NE2 . GLN A 1 1168 ? -3.869  -9.920  -66.852  1.00 48.83  ? 2540 GLN B NE2 1 
ATOM 8527  N N   . CYS A 1 1169 ? -9.317  -12.785 -65.824  1.00 50.72  ? 2541 CYS B N   1 
ATOM 8528  C CA  . CYS A 1 1169 ? -9.964  -14.095 -65.634  1.00 51.23  ? 2541 CYS B CA  1 
ATOM 8529  C C   . CYS A 1 1169 ? -11.243 -14.251 -66.448  1.00 50.76  ? 2541 CYS B C   1 
ATOM 8530  O O   . CYS A 1 1169 ? -11.892 -13.266 -66.803  1.00 55.14  ? 2541 CYS B O   1 
ATOM 8531  C CB  . CYS A 1 1169 ? -10.317 -14.333 -64.157  1.00 50.90  ? 2541 CYS B CB  1 
ATOM 8532  S SG  . CYS A 1 1169 ? -8.930  -14.410 -62.998  1.00 56.96  ? 2541 CYS B SG  1 
ATOM 8533  N N   . TYR A 1 1170 ? -11.594 -15.503 -66.730  1.00 55.45  ? 2542 TYR B N   1 
ATOM 8534  C CA  . TYR A 1 1170 ? -12.893 -15.845 -67.312  1.00 58.92  ? 2542 TYR B CA  1 
ATOM 8535  C C   . TYR A 1 1170 ? -13.998 -15.338 -66.382  1.00 61.15  ? 2542 TYR B C   1 
ATOM 8536  O O   . TYR A 1 1170 ? -13.863 -15.413 -65.161  1.00 63.46  ? 2542 TYR B O   1 
ATOM 8537  C CB  . TYR A 1 1170 ? -12.994 -17.366 -67.506  1.00 59.23  ? 2542 TYR B CB  1 
ATOM 8538  C CG  . TYR A 1 1170 ? -14.289 -17.853 -68.129  1.00 68.26  ? 2542 TYR B CG  1 
ATOM 8539  C CD1 . TYR A 1 1170 ? -14.709 -17.382 -69.376  1.00 77.55  ? 2542 TYR B CD1 1 
ATOM 8540  C CD2 . TYR A 1 1170 ? -15.087 -18.804 -67.484  1.00 69.24  ? 2542 TYR B CD2 1 
ATOM 8541  C CE1 . TYR A 1 1170 ? -15.892 -17.829 -69.953  1.00 81.08  ? 2542 TYR B CE1 1 
ATOM 8542  C CE2 . TYR A 1 1170 ? -16.272 -19.256 -68.054  1.00 74.69  ? 2542 TYR B CE2 1 
ATOM 8543  C CZ  . TYR A 1 1170 ? -16.670 -18.767 -69.289  1.00 81.33  ? 2542 TYR B CZ  1 
ATOM 8544  O OH  . TYR A 1 1170 ? -17.841 -19.209 -69.864  1.00 84.09  ? 2542 TYR B OH  1 
ATOM 8545  N N   . ILE A 1 1171 ? -15.075 -14.806 -66.956  1.00 62.57  ? 2543 ILE B N   1 
ATOM 8546  C CA  . ILE A 1 1171 ? -16.145 -14.180 -66.165  1.00 61.09  ? 2543 ILE B CA  1 
ATOM 8547  C C   . ILE A 1 1171 ? -16.853 -15.185 -65.240  1.00 56.79  ? 2543 ILE B C   1 
ATOM 8548  O O   . ILE A 1 1171 ? -17.282 -14.823 -64.144  1.00 53.33  ? 2543 ILE B O   1 
ATOM 8549  C CB  . ILE A 1 1171 ? -17.158 -13.422 -67.071  1.00 71.84  ? 2543 ILE B CB  1 
ATOM 8550  C CG1 . ILE A 1 1171 ? -17.882 -12.320 -66.284  1.00 70.67  ? 2543 ILE B CG1 1 
ATOM 8551  C CG2 . ILE A 1 1171 ? -18.138 -14.373 -67.762  1.00 78.03  ? 2543 ILE B CG2 1 
ATOM 8552  C CD1 . ILE A 1 1171 ? -17.072 -11.049 -66.133  1.00 69.29  ? 2543 ILE B CD1 1 
ATOM 8553  N N   . GLY A 1 1172 ? -16.963 -16.437 -65.688  1.00 55.07  ? 2544 GLY B N   1 
ATOM 8554  C CA  . GLY A 1 1172 ? -17.479 -17.538 -64.868  1.00 51.85  ? 2544 GLY B CA  1 
ATOM 8555  C C   . GLY A 1 1172 ? -16.686 -17.812 -63.601  1.00 48.24  ? 2544 GLY B C   1 
ATOM 8556  O O   . GLY A 1 1172 ? -17.245 -18.268 -62.606  1.00 46.40  ? 2544 GLY B O   1 
ATOM 8557  N N   . TRP A 1 1173 ? -15.383 -17.534 -63.642  1.00 53.34  ? 2545 TRP B N   1 
ATOM 8558  C CA  . TRP A 1 1173 ? -14.510 -17.626 -62.461  1.00 54.11  ? 2545 TRP B CA  1 
ATOM 8559  C C   . TRP A 1 1173 ? -14.892 -16.647 -61.346  1.00 56.29  ? 2545 TRP B C   1 
ATOM 8560  O O   . TRP A 1 1173 ? -14.521 -16.869 -60.201  1.00 61.81  ? 2545 TRP B O   1 
ATOM 8561  C CB  . TRP A 1 1173 ? -13.049 -17.385 -62.856  1.00 54.91  ? 2545 TRP B CB  1 
ATOM 8562  C CG  . TRP A 1 1173 ? -12.036 -17.826 -61.844  1.00 52.43  ? 2545 TRP B CG  1 
ATOM 8563  C CD1 . TRP A 1 1173 ? -11.540 -19.084 -61.683  1.00 54.34  ? 2545 TRP B CD1 1 
ATOM 8564  C CD2 . TRP A 1 1173 ? -11.374 -17.005 -60.872  1.00 50.48  ? 2545 TRP B CD2 1 
ATOM 8565  N NE1 . TRP A 1 1173 ? -10.617 -19.103 -60.667  1.00 52.97  ? 2545 TRP B NE1 1 
ATOM 8566  C CE2 . TRP A 1 1173 ? -10.496 -17.841 -60.152  1.00 50.28  ? 2545 TRP B CE2 1 
ATOM 8567  C CE3 . TRP A 1 1173 ? -11.439 -15.646 -60.538  1.00 54.24  ? 2545 TRP B CE3 1 
ATOM 8568  C CZ2 . TRP A 1 1173 ? -9.684  -17.364 -59.119  1.00 51.53  ? 2545 TRP B CZ2 1 
ATOM 8569  C CZ3 . TRP A 1 1173 ? -10.630 -15.173 -59.502  1.00 55.23  ? 2545 TRP B CZ3 1 
ATOM 8570  C CH2 . TRP A 1 1173 ? -9.766  -16.033 -58.807  1.00 53.63  ? 2545 TRP B CH2 1 
ATOM 8571  N N   . CYS A 1 1174 ? -15.595 -15.564 -61.689  1.00 56.54  ? 2546 CYS B N   1 
ATOM 8572  C CA  . CYS A 1 1174 ? -16.119 -14.590 -60.720  1.00 53.16  ? 2546 CYS B CA  1 
ATOM 8573  C C   . CYS A 1 1174 ? -14.999 -13.959 -59.886  1.00 49.32  ? 2546 CYS B C   1 
ATOM 8574  O O   . CYS A 1 1174 ? -14.903 -14.210 -58.680  1.00 51.30  ? 2546 CYS B O   1 
ATOM 8575  C CB  . CYS A 1 1174 ? -17.196 -15.214 -59.816  1.00 53.67  ? 2546 CYS B CB  1 
ATOM 8576  S SG  . CYS A 1 1174 ? -18.673 -15.778 -60.690  1.00 52.19  ? 2546 CYS B SG  1 
ATOM 8577  N N   . PRO A 1 1175 ? -14.156 -13.123 -60.525  1.00 45.47  ? 2547 PRO B N   1 
ATOM 8578  C CA  . PRO A 1 1175 ? -13.079 -12.430 -59.803  1.00 46.21  ? 2547 PRO B CA  1 
ATOM 8579  C C   . PRO A 1 1175 ? -13.556 -11.301 -58.880  1.00 47.72  ? 2547 PRO B C   1 
ATOM 8580  O O   . PRO A 1 1175 ? -12.748 -10.731 -58.146  1.00 59.92  ? 2547 PRO B O   1 
ATOM 8581  C CB  . PRO A 1 1175 ? -12.192 -11.872 -60.924  1.00 46.75  ? 2547 PRO B CB  1 
ATOM 8582  C CG  . PRO A 1 1175 ? -12.994 -11.953 -62.179  1.00 46.70  ? 2547 PRO B CG  1 
ATOM 8583  C CD  . PRO A 1 1175 ? -14.299 -12.627 -61.904  1.00 44.54  ? 2547 PRO B CD  1 
ATOM 8584  N N   . PHE A 1 1176 ? -14.851 -10.998 -58.931  1.00 43.97  ? 2548 PHE B N   1 
ATOM 8585  C CA  . PHE A 1 1176 ? -15.500 -9.995  -58.086  1.00 44.99  ? 2548 PHE B CA  1 
ATOM 8586  C C   . PHE A 1 1176 ? -16.279 -10.616 -56.907  1.00 48.99  ? 2548 PHE B C   1 
ATOM 8587  O O   . PHE A 1 1176 ? -16.933 -9.890  -56.154  1.00 48.87  ? 2548 PHE B O   1 
ATOM 8588  C CB  . PHE A 1 1176 ? -16.420 -9.103  -58.944  1.00 45.18  ? 2548 PHE B CB  1 
ATOM 8589  C CG  . PHE A 1 1176 ? -17.098 -9.834  -60.074  1.00 44.60  ? 2548 PHE B CG  1 
ATOM 8590  C CD1 . PHE A 1 1176 ? -18.107 -10.751 -59.815  1.00 41.83  ? 2548 PHE B CD1 1 
ATOM 8591  C CD2 . PHE A 1 1176 ? -16.692 -9.641  -61.394  1.00 46.26  ? 2548 PHE B CD2 1 
ATOM 8592  C CE1 . PHE A 1 1176 ? -18.718 -11.450 -60.845  1.00 42.58  ? 2548 PHE B CE1 1 
ATOM 8593  C CE2 . PHE A 1 1176 ? -17.304 -10.333 -62.430  1.00 46.32  ? 2548 PHE B CE2 1 
ATOM 8594  C CZ  . PHE A 1 1176 ? -18.319 -11.237 -62.155  1.00 45.11  ? 2548 PHE B CZ  1 
ATOM 8595  N N   . TRP A 1 1177 ? -16.215 -11.944 -56.748  1.00 54.39  ? 2549 TRP B N   1 
ATOM 8596  C CA  . TRP A 1 1177 ? -16.783 -12.635 -55.575  1.00 53.26  ? 2549 TRP B CA  1 
ATOM 8597  C C   . TRP A 1 1177 ? -15.679 -13.005 -54.608  1.00 47.90  ? 2549 TRP B C   1 
ATOM 8598  O O   . TRP A 1 1177 ? -14.980 -12.137 -54.094  1.00 48.53  ? 2549 TRP B O   1 
ATOM 8599  C CB  . TRP A 1 1177 ? -17.528 -13.909 -55.981  1.00 52.72  ? 2549 TRP B CB  1 
ATOM 8600  C CG  . TRP A 1 1177 ? -18.845 -13.678 -56.652  1.00 49.57  ? 2549 TRP B CG  1 
ATOM 8601  C CD1 . TRP A 1 1177 ? -19.371 -12.485 -57.047  1.00 47.56  ? 2549 TRP B CD1 1 
ATOM 8602  C CD2 . TRP A 1 1177 ? -19.788 -14.680 -57.042  1.00 50.01  ? 2549 TRP B CD2 1 
ATOM 8603  N NE1 . TRP A 1 1177 ? -20.586 -12.679 -57.645  1.00 52.54  ? 2549 TRP B NE1 1 
ATOM 8604  C CE2 . TRP A 1 1177 ? -20.869 -14.017 -57.658  1.00 51.13  ? 2549 TRP B CE2 1 
ATOM 8605  C CE3 . TRP A 1 1177 ? -19.827 -16.074 -56.926  1.00 54.36  ? 2549 TRP B CE3 1 
ATOM 8606  C CZ2 . TRP A 1 1177 ? -21.984 -14.700 -58.159  1.00 52.02  ? 2549 TRP B CZ2 1 
ATOM 8607  C CZ3 . TRP A 1 1177 ? -20.935 -16.756 -57.426  1.00 58.84  ? 2549 TRP B CZ3 1 
ATOM 8608  C CH2 . TRP A 1 1177 ? -21.999 -16.065 -58.034  1.00 55.76  ? 2549 TRP B CH2 1 
ATOM 8609  N N   . VAL B 2 10   ? -16.738 17.821  -93.160  1.00 148.96 ? 8    VAL D N   1 
ATOM 8610  C CA  . VAL B 2 10   ? -16.032 17.093  -92.041  1.00 144.36 ? 8    VAL D CA  1 
ATOM 8611  C C   . VAL B 2 10   ? -14.512 17.160  -92.219  1.00 138.46 ? 8    VAL D C   1 
ATOM 8612  O O   . VAL B 2 10   ? -13.785 17.435  -91.266  1.00 128.29 ? 8    VAL D O   1 
ATOM 8613  C CB  . VAL B 2 10   ? -16.486 15.615  -91.906  1.00 139.85 ? 8    VAL D CB  1 
ATOM 8614  C CG1 . VAL B 2 10   ? -15.832 14.950  -90.698  1.00 123.62 ? 8    VAL D CG1 1 
ATOM 8615  C CG2 . VAL B 2 10   ? -18.005 15.523  -91.780  1.00 148.38 ? 8    VAL D CG2 1 
ATOM 8616  N N   . GLY B 2 11   ? -14.050 16.878  -93.436  1.00 144.56 ? 9    GLY D N   1 
ATOM 8617  C CA  . GLY B 2 11   ? -12.663 17.122  -93.839  1.00 141.39 ? 9    GLY D CA  1 
ATOM 8618  C C   . GLY B 2 11   ? -12.434 18.559  -94.294  1.00 143.15 ? 9    GLY D C   1 
ATOM 8619  O O   . GLY B 2 11   ? -11.401 19.152  -93.980  1.00 133.23 ? 9    GLY D O   1 
ATOM 8620  N N   . SER B 2 12   ? -13.396 19.111  -95.041  1.00 150.98 ? 10   SER D N   1 
ATOM 8621  C CA  . SER B 2 12   ? -13.329 20.499  -95.538  1.00 150.05 ? 10   SER D CA  1 
ATOM 8622  C C   . SER B 2 12   ? -13.508 21.575  -94.450  1.00 139.16 ? 10   SER D C   1 
ATOM 8623  O O   . SER B 2 12   ? -13.146 22.735  -94.664  1.00 135.01 ? 10   SER D O   1 
ATOM 8624  C CB  . SER B 2 12   ? -14.357 20.719  -96.656  1.00 158.72 ? 10   SER D CB  1 
ATOM 8625  O OG  . SER B 2 12   ? -15.677 20.494  -96.193  1.00 163.71 ? 10   SER D OG  1 
ATOM 8626  N N   . ASP B 2 13   ? -14.079 21.196  -93.305  1.00 132.80 ? 11   ASP D N   1 
ATOM 8627  C CA  . ASP B 2 13   ? -14.120 22.059  -92.115  1.00 123.31 ? 11   ASP D CA  1 
ATOM 8628  C C   . ASP B 2 13   ? -12.686 22.211  -91.566  1.00 111.44 ? 11   ASP D C   1 
ATOM 8629  O O   . ASP B 2 13   ? -11.960 21.215  -91.480  1.00 109.24 ? 11   ASP D O   1 
ATOM 8630  C CB  . ASP B 2 13   ? -15.047 21.438  -91.053  1.00 121.18 ? 11   ASP D CB  1 
ATOM 8631  C CG  . ASP B 2 13   ? -15.403 22.401  -89.926  1.00 118.52 ? 11   ASP D CG  1 
ATOM 8632  O OD1 . ASP B 2 13   ? -14.530 22.704  -89.084  1.00 118.25 ? 11   ASP D OD1 1 
ATOM 8633  O OD2 . ASP B 2 13   ? -16.572 22.836  -89.864  1.00 117.39 ? 11   ASP D OD2 1 
ATOM 8634  N N   . PRO B 2 14   ? -12.269 23.446  -91.201  1.00 101.16 ? 12   PRO D N   1 
ATOM 8635  C CA  . PRO B 2 14   ? -10.882 23.658  -90.756  1.00 91.64  ? 12   PRO D CA  1 
ATOM 8636  C C   . PRO B 2 14   ? -10.477 22.911  -89.485  1.00 83.99  ? 12   PRO D C   1 
ATOM 8637  O O   . PRO B 2 14   ? -9.311  22.546  -89.358  1.00 84.42  ? 12   PRO D O   1 
ATOM 8638  C CB  . PRO B 2 14   ? -10.815 25.171  -90.514  1.00 93.41  ? 12   PRO D CB  1 
ATOM 8639  C CG  . PRO B 2 14   ? -12.221 25.571  -90.261  1.00 99.24  ? 12   PRO D CG  1 
ATOM 8640  C CD  . PRO B 2 14   ? -13.023 24.712  -91.191  1.00 104.26 ? 12   PRO D CD  1 
ATOM 8641  N N   . VAL B 2 15   ? -11.419 22.699  -88.564  1.00 78.66  ? 13   VAL D N   1 
ATOM 8642  C CA  . VAL B 2 15   ? -11.150 21.995  -87.305  1.00 71.71  ? 13   VAL D CA  1 
ATOM 8643  C C   . VAL B 2 15   ? -11.763 20.594  -87.342  1.00 68.66  ? 13   VAL D C   1 
ATOM 8644  O O   . VAL B 2 15   ? -12.986 20.450  -87.405  1.00 69.35  ? 13   VAL D O   1 
ATOM 8645  C CB  . VAL B 2 15   ? -11.719 22.759  -86.089  1.00 71.98  ? 13   VAL D CB  1 
ATOM 8646  C CG1 . VAL B 2 15   ? -11.155 22.197  -84.788  1.00 67.87  ? 13   VAL D CG1 1 
ATOM 8647  C CG2 . VAL B 2 15   ? -11.407 24.245  -86.187  1.00 76.45  ? 13   VAL D CG2 1 
ATOM 8648  N N   . ILE B 2 16   ? -10.907 19.572  -87.310  1.00 65.63  ? 14   ILE D N   1 
ATOM 8649  C CA  . ILE B 2 16   ? -11.342 18.180  -87.195  1.00 63.65  ? 14   ILE D CA  1 
ATOM 8650  C C   . ILE B 2 16   ? -11.242 17.768  -85.724  1.00 61.85  ? 14   ILE D C   1 
ATOM 8651  O O   . ILE B 2 16   ? -10.173 17.880  -85.118  1.00 59.55  ? 14   ILE D O   1 
ATOM 8652  C CB  . ILE B 2 16   ? -10.487 17.240  -88.072  1.00 61.86  ? 14   ILE D CB  1 
ATOM 8653  C CG1 . ILE B 2 16   ? -10.646 17.613  -89.550  1.00 67.04  ? 14   ILE D CG1 1 
ATOM 8654  C CG2 . ILE B 2 16   ? -10.898 15.784  -87.869  1.00 59.40  ? 14   ILE D CG2 1 
ATOM 8655  C CD1 . ILE B 2 16   ? -9.647  16.961  -90.486  1.00 68.84  ? 14   ILE D CD1 1 
ATOM 8656  N N   . LEU B 2 17   ? -12.361 17.304  -85.164  1.00 60.80  ? 15   LEU D N   1 
ATOM 8657  C CA  . LEU B 2 17   ? -12.405 16.750  -83.811  1.00 57.56  ? 15   LEU D CA  1 
ATOM 8658  C C   . LEU B 2 17   ? -13.172 15.428  -83.818  1.00 57.66  ? 15   LEU D C   1 
ATOM 8659  O O   . LEU B 2 17   ? -14.401 15.423  -83.937  1.00 56.99  ? 15   LEU D O   1 
ATOM 8660  C CB  . LEU B 2 17   ? -13.060 17.736  -82.840  1.00 58.48  ? 15   LEU D CB  1 
ATOM 8661  C CG  . LEU B 2 17   ? -13.397 17.238  -81.422  1.00 56.59  ? 15   LEU D CG  1 
ATOM 8662  C CD1 . LEU B 2 17   ? -12.221 16.541  -80.754  1.00 52.23  ? 15   LEU D CD1 1 
ATOM 8663  C CD2 . LEU B 2 17   ? -13.885 18.385  -80.550  1.00 57.94  ? 15   LEU D CD2 1 
ATOM 8664  N N   . ALA B 2 18   ? -12.435 14.323  -83.675  1.00 58.43  ? 16   ALA D N   1 
ATOM 8665  C CA  . ALA B 2 18   ? -12.997 12.965  -83.687  1.00 61.53  ? 16   ALA D CA  1 
ATOM 8666  C C   . ALA B 2 18   ? -12.895 12.287  -82.312  1.00 61.53  ? 16   ALA D C   1 
ATOM 8667  O O   . ALA B 2 18   ? -11.931 12.499  -81.564  1.00 59.86  ? 16   ALA D O   1 
ATOM 8668  C CB  . ALA B 2 18   ? -12.303 12.118  -84.746  1.00 62.29  ? 16   ALA D CB  1 
ATOM 8669  N N   . THR B 2 19   ? -13.892 11.455  -82.010  1.00 60.46  ? 17   THR D N   1 
ATOM 8670  C CA  . THR B 2 19   ? -14.075 10.857  -80.688  1.00 58.07  ? 17   THR D CA  1 
ATOM 8671  C C   . THR B 2 19   ? -14.612 9.434   -80.827  1.00 57.12  ? 17   THR D C   1 
ATOM 8672  O O   . THR B 2 19   ? -15.492 9.196   -81.650  1.00 63.23  ? 17   THR D O   1 
ATOM 8673  C CB  . THR B 2 19   ? -15.112 11.658  -79.888  1.00 59.75  ? 17   THR D CB  1 
ATOM 8674  O OG1 . THR B 2 19   ? -14.774 13.046  -79.897  1.00 60.59  ? 17   THR D OG1 1 
ATOM 8675  C CG2 . THR B 2 19   ? -15.179 11.202  -78.455  1.00 63.81  ? 17   THR D CG2 1 
ATOM 8676  N N   . ALA B 2 20   ? -14.119 8.506   -80.008  1.00 52.81  ? 18   ALA D N   1 
ATOM 8677  C CA  . ALA B 2 20   ? -14.588 7.117   -80.067  1.00 54.77  ? 18   ALA D CA  1 
ATOM 8678  C C   . ALA B 2 20   ? -14.358 6.319   -78.787  1.00 50.56  ? 18   ALA D C   1 
ATOM 8679  O O   . ALA B 2 20   ? -13.619 6.739   -77.899  1.00 43.99  ? 18   ALA D O   1 
ATOM 8680  C CB  . ALA B 2 20   ? -13.941 6.402   -81.243  1.00 58.04  ? 18   ALA D CB  1 
ATOM 8681  N N   . GLY B 2 21   ? -15.011 5.159   -78.718  1.00 52.34  ? 19   GLY D N   1 
ATOM 8682  C CA  . GLY B 2 21   ? -14.846 4.237   -77.600  1.00 51.90  ? 19   GLY D CA  1 
ATOM 8683  C C   . GLY B 2 21   ? -15.684 2.967   -77.697  1.00 54.78  ? 19   GLY D C   1 
ATOM 8684  O O   . GLY B 2 21   ? -15.792 2.353   -78.765  1.00 56.95  ? 19   GLY D O   1 
ATOM 8685  N N   . TYR B 2 22   ? -16.298 2.588   -76.579  1.00 56.03  ? 20   TYR D N   1 
ATOM 8686  C CA  . TYR B 2 22   ? -16.982 1.300   -76.466  1.00 59.77  ? 20   TYR D CA  1 
ATOM 8687  C C   . TYR B 2 22   ? -18.363 1.225   -77.153  1.00 67.31  ? 20   TYR D C   1 
ATOM 8688  O O   . TYR B 2 22   ? -18.904 0.125   -77.294  1.00 73.71  ? 20   TYR D O   1 
ATOM 8689  C CB  . TYR B 2 22   ? -17.154 0.898   -74.990  1.00 58.36  ? 20   TYR D CB  1 
ATOM 8690  C CG  . TYR B 2 22   ? -15.913 0.900   -74.096  1.00 52.47  ? 20   TYR D CG  1 
ATOM 8691  C CD1 . TYR B 2 22   ? -16.059 0.972   -72.710  1.00 52.28  ? 20   TYR D CD1 1 
ATOM 8692  C CD2 . TYR B 2 22   ? -14.612 0.816   -74.610  1.00 48.67  ? 20   TYR D CD2 1 
ATOM 8693  C CE1 . TYR B 2 22   ? -14.962 0.963   -71.863  1.00 50.87  ? 20   TYR D CE1 1 
ATOM 8694  C CE2 . TYR B 2 22   ? -13.503 0.818   -73.764  1.00 46.13  ? 20   TYR D CE2 1 
ATOM 8695  C CZ  . TYR B 2 22   ? -13.686 0.884   -72.389  1.00 48.10  ? 20   TYR D CZ  1 
ATOM 8696  O OH  . TYR B 2 22   ? -12.622 0.888   -71.511  1.00 45.19  ? 20   TYR D OH  1 
ATOM 8697  N N   . ASP B 2 23   ? -18.927 2.363   -77.580  1.00 70.33  ? 21   ASP D N   1 
ATOM 8698  C CA  . ASP B 2 23   ? -20.300 2.413   -78.152  1.00 70.85  ? 21   ASP D CA  1 
ATOM 8699  C C   . ASP B 2 23   ? -20.426 2.131   -79.660  1.00 69.23  ? 21   ASP D C   1 
ATOM 8700  O O   . ASP B 2 23   ? -21.429 2.508   -80.266  1.00 68.22  ? 21   ASP D O   1 
ATOM 8701  C CB  . ASP B 2 23   ? -20.978 3.765   -77.824  1.00 73.26  ? 21   ASP D CB  1 
ATOM 8702  C CG  . ASP B 2 23   ? -20.421 4.934   -78.628  1.00 74.07  ? 21   ASP D CG  1 
ATOM 8703  O OD1 . ASP B 2 23   ? -19.212 4.915   -78.961  1.00 78.89  ? 21   ASP D OD1 1 
ATOM 8704  O OD2 . ASP B 2 23   ? -21.197 5.877   -78.907  1.00 69.81  ? 21   ASP D OD2 1 
ATOM 8705  N N   . HIS B 2 24   ? -19.420 1.493   -80.260  1.00 69.62  ? 22   HIS D N   1 
ATOM 8706  C CA  . HIS B 2 24   ? -19.450 1.097   -81.674  1.00 72.71  ? 22   HIS D CA  1 
ATOM 8707  C C   . HIS B 2 24   ? -19.635 2.256   -82.675  1.00 76.62  ? 22   HIS D C   1 
ATOM 8708  O O   . HIS B 2 24   ? -20.151 2.042   -83.782  1.00 80.02  ? 22   HIS D O   1 
ATOM 8709  C CB  . HIS B 2 24   ? -20.537 0.040   -81.925  1.00 74.78  ? 22   HIS D CB  1 
ATOM 8710  C CG  . HIS B 2 24   ? -20.501 -1.117  -80.979  1.00 74.34  ? 22   HIS D CG  1 
ATOM 8711  N ND1 . HIS B 2 24   ? -19.598 -2.149  -81.099  1.00 72.06  ? 22   HIS D ND1 1 
ATOM 8712  C CD2 . HIS B 2 24   ? -21.285 -1.424  -79.919  1.00 79.56  ? 22   HIS D CD2 1 
ATOM 8713  C CE1 . HIS B 2 24   ? -19.817 -3.037  -80.146  1.00 75.22  ? 22   HIS D CE1 1 
ATOM 8714  N NE2 . HIS B 2 24   ? -20.833 -2.619  -79.414  1.00 81.13  ? 22   HIS D NE2 1 
ATOM 8715  N N   . THR B 2 25   ? -19.214 3.467   -82.298  1.00 75.03  ? 23   THR D N   1 
ATOM 8716  C CA  . THR B 2 25   ? -19.264 4.626   -83.198  1.00 73.28  ? 23   THR D CA  1 
ATOM 8717  C C   . THR B 2 25   ? -17.995 5.454   -83.098  1.00 72.33  ? 23   THR D C   1 
ATOM 8718  O O   . THR B 2 25   ? -17.353 5.500   -82.039  1.00 77.94  ? 23   THR D O   1 
ATOM 8719  C CB  . THR B 2 25   ? -20.449 5.570   -82.897  1.00 74.98  ? 23   THR D CB  1 
ATOM 8720  O OG1 . THR B 2 25   ? -20.321 6.115   -81.576  1.00 73.75  ? 23   THR D OG1 1 
ATOM 8721  C CG2 . THR B 2 25   ? -21.777 4.840   -83.028  1.00 80.76  ? 23   THR D CG2 1 
ATOM 8722  N N   . VAL B 2 26   ? -17.639 6.089   -84.213  1.00 66.93  ? 24   VAL D N   1 
ATOM 8723  C CA  . VAL B 2 26   ? -16.667 7.177   -84.231  1.00 61.86  ? 24   VAL D CA  1 
ATOM 8724  C C   . VAL B 2 26   ? -17.471 8.413   -84.611  1.00 60.91  ? 24   VAL D C   1 
ATOM 8725  O O   . VAL B 2 26   ? -18.062 8.455   -85.687  1.00 63.28  ? 24   VAL D O   1 
ATOM 8726  C CB  . VAL B 2 26   ? -15.529 6.937   -85.245  1.00 63.05  ? 24   VAL D CB  1 
ATOM 8727  C CG1 . VAL B 2 26   ? -14.504 8.065   -85.198  1.00 64.40  ? 24   VAL D CG1 1 
ATOM 8728  C CG2 . VAL B 2 26   ? -14.831 5.616   -84.967  1.00 62.08  ? 24   VAL D CG2 1 
ATOM 8729  N N   . ARG B 2 27   ? -17.504 9.401   -83.720  1.00 58.35  ? 25   ARG D N   1 
ATOM 8730  C CA  . ARG B 2 27   ? -18.297 10.612  -83.911  1.00 59.54  ? 25   ARG D CA  1 
ATOM 8731  C C   . ARG B 2 27   ? -17.405 11.804  -84.177  1.00 60.31  ? 25   ARG D C   1 
ATOM 8732  O O   . ARG B 2 27   ? -16.383 11.985  -83.507  1.00 59.18  ? 25   ARG D O   1 
ATOM 8733  C CB  . ARG B 2 27   ? -19.134 10.893  -82.673  1.00 60.36  ? 25   ARG D CB  1 
ATOM 8734  C CG  . ARG B 2 27   ? -20.018 9.726   -82.287  1.00 63.18  ? 25   ARG D CG  1 
ATOM 8735  C CD  . ARG B 2 27   ? -21.280 10.168  -81.574  1.00 64.69  ? 25   ARG D CD  1 
ATOM 8736  N NE  . ARG B 2 27   ? -22.132 9.016   -81.296  1.00 65.79  ? 25   ARG D NE  1 
ATOM 8737  C CZ  . ARG B 2 27   ? -23.428 9.068   -81.003  1.00 68.88  ? 25   ARG D CZ  1 
ATOM 8738  N NH1 . ARG B 2 27   ? -24.083 10.230  -80.942  1.00 71.19  ? 25   ARG D NH1 1 
ATOM 8739  N NH2 . ARG B 2 27   ? -24.083 7.933   -80.772  1.00 71.51  ? 25   ARG D NH2 1 
ATOM 8740  N N   . PHE B 2 28   ? -17.813 12.620  -85.147  1.00 62.96  ? 26   PHE D N   1 
ATOM 8741  C CA  . PHE B 2 28   ? -17.102 13.838  -85.515  1.00 61.75  ? 26   PHE D CA  1 
ATOM 8742  C C   . PHE B 2 28   ? -17.905 15.043  -85.042  1.00 63.99  ? 26   PHE D C   1 
ATOM 8743  O O   . PHE B 2 28   ? -19.137 15.053  -85.130  1.00 65.09  ? 26   PHE D O   1 
ATOM 8744  C CB  . PHE B 2 28   ? -16.889 13.882  -87.026  1.00 63.24  ? 26   PHE D CB  1 
ATOM 8745  C CG  . PHE B 2 28   ? -16.046 12.754  -87.539  1.00 61.41  ? 26   PHE D CG  1 
ATOM 8746  C CD1 . PHE B 2 28   ? -16.628 11.544  -87.893  1.00 63.50  ? 26   PHE D CD1 1 
ATOM 8747  C CD2 . PHE B 2 28   ? -14.665 12.887  -87.644  1.00 59.04  ? 26   PHE D CD2 1 
ATOM 8748  C CE1 . PHE B 2 28   ? -15.850 10.492  -88.350  1.00 63.15  ? 26   PHE D CE1 1 
ATOM 8749  C CE2 . PHE B 2 28   ? -13.882 11.837  -88.103  1.00 58.79  ? 26   PHE D CE2 1 
ATOM 8750  C CZ  . PHE B 2 28   ? -14.477 10.637  -88.455  1.00 60.43  ? 26   PHE D CZ  1 
ATOM 8751  N N   . TRP B 2 29   ? -17.194 16.051  -84.540  1.00 63.83  ? 27   TRP D N   1 
ATOM 8752  C CA  . TRP B 2 29   ? -17.801 17.240  -83.938  1.00 64.39  ? 27   TRP D CA  1 
ATOM 8753  C C   . TRP B 2 29   ? -17.265 18.488  -84.604  1.00 66.33  ? 27   TRP D C   1 
ATOM 8754  O O   . TRP B 2 29   ? -16.153 18.471  -85.142  1.00 67.54  ? 27   TRP D O   1 
ATOM 8755  C CB  . TRP B 2 29   ? -17.445 17.311  -82.451  1.00 61.56  ? 27   TRP D CB  1 
ATOM 8756  C CG  . TRP B 2 29   ? -17.728 16.056  -81.711  1.00 57.68  ? 27   TRP D CG  1 
ATOM 8757  C CD1 . TRP B 2 29   ? -16.922 14.969  -81.609  1.00 53.96  ? 27   TRP D CD1 1 
ATOM 8758  C CD2 . TRP B 2 29   ? -18.912 15.751  -80.977  1.00 58.04  ? 27   TRP D CD2 1 
ATOM 8759  N NE1 . TRP B 2 29   ? -17.529 14.002  -80.856  1.00 53.56  ? 27   TRP D NE1 1 
ATOM 8760  C CE2 . TRP B 2 29   ? -18.753 14.457  -80.452  1.00 55.08  ? 27   TRP D CE2 1 
ATOM 8761  C CE3 . TRP B 2 29   ? -20.096 16.448  -80.711  1.00 62.28  ? 27   TRP D CE3 1 
ATOM 8762  C CZ2 . TRP B 2 29   ? -19.728 13.839  -79.672  1.00 56.10  ? 27   TRP D CZ2 1 
ATOM 8763  C CZ3 . TRP B 2 29   ? -21.066 15.835  -79.932  1.00 62.96  ? 27   TRP D CZ3 1 
ATOM 8764  C CH2 . TRP B 2 29   ? -20.872 14.540  -79.423  1.00 59.49  ? 27   TRP D CH2 1 
ATOM 8765  N N   . GLN B 2 30   ? -18.048 19.567  -84.569  1.00 68.70  ? 28   GLN D N   1 
ATOM 8766  C CA  . GLN B 2 30   ? -17.505 20.903  -84.826  1.00 70.55  ? 28   GLN D CA  1 
ATOM 8767  C C   . GLN B 2 30   ? -17.208 21.540  -83.464  1.00 67.91  ? 28   GLN D C   1 
ATOM 8768  O O   . GLN B 2 30   ? -18.083 21.634  -82.595  1.00 65.95  ? 28   GLN D O   1 
ATOM 8769  C CB  . GLN B 2 30   ? -18.408 21.755  -85.742  1.00 75.55  ? 28   GLN D CB  1 
ATOM 8770  C CG  . GLN B 2 30   ? -19.649 22.378  -85.124  1.00 77.40  ? 28   GLN D CG  1 
ATOM 8771  C CD  . GLN B 2 30   ? -20.501 23.141  -86.132  1.00 81.91  ? 28   GLN D CD  1 
ATOM 8772  O OE1 . GLN B 2 30   ? -20.095 23.371  -87.275  1.00 84.46  ? 28   GLN D OE1 1 
ATOM 8773  N NE2 . GLN B 2 30   ? -21.693 23.537  -85.708  1.00 82.15  ? 28   GLN D NE2 1 
ATOM 8774  N N   . ALA B 2 31   ? -15.952 21.944  -83.291  1.00 66.92  ? 29   ALA D N   1 
ATOM 8775  C CA  . ALA B 2 31   ? -15.398 22.288  -81.984  1.00 67.02  ? 29   ALA D CA  1 
ATOM 8776  C C   . ALA B 2 31   ? -16.023 23.533  -81.370  1.00 69.74  ? 29   ALA D C   1 
ATOM 8777  O O   . ALA B 2 31   ? -16.303 23.565  -80.175  1.00 69.41  ? 29   ALA D O   1 
ATOM 8778  C CB  . ALA B 2 31   ? -13.889 22.465  -82.093  1.00 66.47  ? 29   ALA D CB  1 
ATOM 8779  N N   . HIS B 2 32   ? -16.228 24.552  -82.195  1.00 75.07  ? 30   HIS D N   1 
ATOM 8780  C CA  . HIS B 2 32   ? -16.798 25.828  -81.743  1.00 80.69  ? 30   HIS D CA  1 
ATOM 8781  C C   . HIS B 2 32   ? -18.261 25.764  -81.267  1.00 79.94  ? 30   HIS D C   1 
ATOM 8782  O O   . HIS B 2 32   ? -18.689 26.642  -80.524  1.00 81.18  ? 30   HIS D O   1 
ATOM 8783  C CB  . HIS B 2 32   ? -16.674 26.892  -82.847  1.00 86.16  ? 30   HIS D CB  1 
ATOM 8784  C CG  . HIS B 2 32   ? -17.610 26.684  -83.998  1.00 90.28  ? 30   HIS D CG  1 
ATOM 8785  N ND1 . HIS B 2 32   ? -17.358 25.782  -85.009  1.00 90.29  ? 30   HIS D ND1 1 
ATOM 8786  C CD2 . HIS B 2 32   ? -18.801 27.256  -84.293  1.00 96.21  ? 30   HIS D CD2 1 
ATOM 8787  C CE1 . HIS B 2 32   ? -18.351 25.809  -85.878  1.00 96.43  ? 30   HIS D CE1 1 
ATOM 8788  N NE2 . HIS B 2 32   ? -19.240 26.696  -85.468  1.00 101.12 ? 30   HIS D NE2 1 
ATOM 8789  N N   . SER B 2 33   ? -19.020 24.758  -81.709  1.00 78.57  ? 31   SER D N   1 
ATOM 8790  C CA  . SER B 2 33   ? -20.461 24.671  -81.416  1.00 80.01  ? 31   SER D CA  1 
ATOM 8791  C C   . SER B 2 33   ? -20.842 23.611  -80.383  1.00 75.91  ? 31   SER D C   1 
ATOM 8792  O O   . SER B 2 33   ? -21.726 23.846  -79.558  1.00 77.51  ? 31   SER D O   1 
ATOM 8793  C CB  . SER B 2 33   ? -21.242 24.405  -82.705  1.00 83.84  ? 31   SER D CB  1 
ATOM 8794  O OG  . SER B 2 33   ? -21.481 23.020  -82.896  1.00 82.79  ? 31   SER D OG  1 
ATOM 8795  N N   . GLY B 2 34   ? -20.197 22.447  -80.447  1.00 71.32  ? 32   GLY D N   1 
ATOM 8796  C CA  . GLY B 2 34   ? -20.564 21.295  -79.619  1.00 68.44  ? 32   GLY D CA  1 
ATOM 8797  C C   . GLY B 2 34   ? -21.431 20.277  -80.340  1.00 68.31  ? 32   GLY D C   1 
ATOM 8798  O O   . GLY B 2 34   ? -21.702 19.208  -79.798  1.00 65.42  ? 32   GLY D O   1 
ATOM 8799  N N   . ILE B 2 35   ? -21.849 20.600  -81.565  1.00 71.44  ? 33   ILE D N   1 
ATOM 8800  C CA  . ILE B 2 35   ? -22.736 19.746  -82.359  1.00 74.09  ? 33   ILE D CA  1 
ATOM 8801  C C   . ILE B 2 35   ? -21.940 18.590  -82.965  1.00 73.54  ? 33   ILE D C   1 
ATOM 8802  O O   . ILE B 2 35   ? -20.762 18.748  -83.292  1.00 74.51  ? 33   ILE D O   1 
ATOM 8803  C CB  . ILE B 2 35   ? -23.438 20.555  -83.484  1.00 76.84  ? 33   ILE D CB  1 
ATOM 8804  C CG1 . ILE B 2 35   ? -24.319 21.655  -82.876  1.00 80.40  ? 33   ILE D CG1 1 
ATOM 8805  C CG2 . ILE B 2 35   ? -24.308 19.659  -84.361  1.00 78.66  ? 33   ILE D CG2 1 
ATOM 8806  C CD1 . ILE B 2 35   ? -24.692 22.764  -83.837  1.00 84.60  ? 33   ILE D CD1 1 
ATOM 8807  N N   . CYS B 2 36   ? -22.595 17.435  -83.098  1.00 74.56  ? 34   CYS D N   1 
ATOM 8808  C CA  . CYS B 2 36   ? -22.022 16.256  -83.759  1.00 73.42  ? 34   CYS D CA  1 
ATOM 8809  C C   . CYS B 2 36   ? -22.288 16.312  -85.267  1.00 75.55  ? 34   CYS D C   1 
ATOM 8810  O O   . CYS B 2 36   ? -23.441 16.227  -85.699  1.00 75.51  ? 34   CYS D O   1 
ATOM 8811  C CB  . CYS B 2 36   ? -22.624 14.975  -83.171  1.00 73.27  ? 34   CYS D CB  1 
ATOM 8812  S SG  . CYS B 2 36   ? -21.951 13.443  -83.848  1.00 70.34  ? 34   CYS D SG  1 
ATOM 8813  N N   . THR B 2 37   ? -21.219 16.455  -86.054  1.00 75.72  ? 35   THR D N   1 
ATOM 8814  C CA  . THR B 2 37   ? -21.317 16.591  -87.512  1.00 78.10  ? 35   THR D CA  1 
ATOM 8815  C C   . THR B 2 37   ? -21.750 15.278  -88.154  1.00 79.44  ? 35   THR D C   1 
ATOM 8816  O O   . THR B 2 37   ? -22.737 15.251  -88.885  1.00 86.51  ? 35   THR D O   1 
ATOM 8817  C CB  . THR B 2 37   ? -19.984 17.054  -88.151  1.00 77.13  ? 35   THR D CB  1 
ATOM 8818  O OG1 . THR B 2 37   ? -19.428 18.137  -87.395  1.00 75.46  ? 35   THR D OG1 1 
ATOM 8819  C CG2 . THR B 2 37   ? -20.204 17.523  -89.585  1.00 82.29  ? 35   THR D CG2 1 
ATOM 8820  N N   . ARG B 2 38   ? -21.007 14.203  -87.899  1.00 76.53  ? 36   ARG D N   1 
ATOM 8821  C CA  . ARG B 2 38   ? -21.399 12.869  -88.378  1.00 78.61  ? 36   ARG D CA  1 
ATOM 8822  C C   . ARG B 2 38   ? -20.900 11.742  -87.489  1.00 74.97  ? 36   ARG D C   1 
ATOM 8823  O O   . ARG B 2 38   ? -20.005 11.932  -86.660  1.00 72.13  ? 36   ARG D O   1 
ATOM 8824  C CB  . ARG B 2 38   ? -20.973 12.635  -89.840  1.00 81.73  ? 36   ARG D CB  1 
ATOM 8825  C CG  . ARG B 2 38   ? -19.512 12.259  -90.101  1.00 78.50  ? 36   ARG D CG  1 
ATOM 8826  C CD  . ARG B 2 38   ? -19.338 11.937  -91.582  1.00 80.62  ? 36   ARG D CD  1 
ATOM 8827  N NE  . ARG B 2 38   ? -17.935 11.834  -92.008  1.00 76.52  ? 36   ARG D NE  1 
ATOM 8828  C CZ  . ARG B 2 38   ? -17.319 10.744  -92.479  1.00 73.40  ? 36   ARG D CZ  1 
ATOM 8829  N NH1 . ARG B 2 38   ? -17.939 9.568   -92.612  1.00 73.85  ? 36   ARG D NH1 1 
ATOM 8830  N NH2 . ARG B 2 38   ? -16.043 10.839  -92.832  1.00 71.01  ? 36   ARG D NH2 1 
ATOM 8831  N N   . THR B 2 39   ? -21.499 10.569  -87.698  1.00 74.53  ? 37   THR D N   1 
ATOM 8832  C CA  . THR B 2 39   ? -21.237 9.368   -86.908  1.00 71.04  ? 37   THR D CA  1 
ATOM 8833  C C   . THR B 2 39   ? -20.978 8.181   -87.840  1.00 70.08  ? 37   THR D C   1 
ATOM 8834  O O   . THR B 2 39   ? -21.722 7.967   -88.796  1.00 72.25  ? 37   THR D O   1 
ATOM 8835  C CB  . THR B 2 39   ? -22.429 9.045   -85.988  1.00 71.85  ? 37   THR D CB  1 
ATOM 8836  O OG1 . THR B 2 39   ? -23.620 8.923   -86.772  1.00 80.11  ? 37   THR D OG1 1 
ATOM 8837  C CG2 . THR B 2 39   ? -22.632 10.146  -84.965  1.00 70.67  ? 37   THR D CG2 1 
ATOM 8838  N N   . VAL B 2 40   ? -19.927 7.417   -87.541  1.00 67.60  ? 38   VAL D N   1 
ATOM 8839  C CA  . VAL B 2 40   ? -19.447 6.324   -88.391  1.00 68.33  ? 38   VAL D CA  1 
ATOM 8840  C C   . VAL B 2 40   ? -19.435 5.022   -87.589  1.00 69.90  ? 38   VAL D C   1 
ATOM 8841  O O   . VAL B 2 40   ? -19.015 5.011   -86.431  1.00 70.62  ? 38   VAL D O   1 
ATOM 8842  C CB  . VAL B 2 40   ? -18.025 6.630   -88.911  1.00 65.96  ? 38   VAL D CB  1 
ATOM 8843  C CG1 . VAL B 2 40   ? -17.461 5.480   -89.732  1.00 66.95  ? 38   VAL D CG1 1 
ATOM 8844  C CG2 . VAL B 2 40   ? -18.035 7.900   -89.748  1.00 67.96  ? 38   VAL D CG2 1 
ATOM 8845  N N   . GLN B 2 41   ? -19.872 3.932   -88.220  1.00 73.52  ? 39   GLN D N   1 
ATOM 8846  C CA  . GLN B 2 41   ? -20.008 2.634   -87.553  1.00 75.68  ? 39   GLN D CA  1 
ATOM 8847  C C   . GLN B 2 41   ? -18.650 1.954   -87.391  1.00 75.21  ? 39   GLN D C   1 
ATOM 8848  O O   . GLN B 2 41   ? -17.965 1.713   -88.384  1.00 77.48  ? 39   GLN D O   1 
ATOM 8849  C CB  . GLN B 2 41   ? -20.931 1.706   -88.358  1.00 82.10  ? 39   GLN D CB  1 
ATOM 8850  C CG  . GLN B 2 41   ? -22.354 2.216   -88.571  1.00 87.94  ? 39   GLN D CG  1 
ATOM 8851  C CD  . GLN B 2 41   ? -23.241 2.096   -87.342  1.00 89.80  ? 39   GLN D CD  1 
ATOM 8852  O OE1 . GLN B 2 41   ? -22.769 1.857   -86.226  1.00 88.27  ? 39   GLN D OE1 1 
ATOM 8853  N NE2 . GLN B 2 41   ? -24.543 2.268   -87.545  1.00 92.46  ? 39   GLN D NE2 1 
ATOM 8854  N N   . HIS B 2 42   ? -18.266 1.661   -86.144  1.00 74.41  ? 40   HIS D N   1 
ATOM 8855  C CA  . HIS B 2 42   ? -17.082 0.834   -85.838  1.00 72.14  ? 40   HIS D CA  1 
ATOM 8856  C C   . HIS B 2 42   ? -17.505 -0.356  -84.972  1.00 73.48  ? 40   HIS D C   1 
ATOM 8857  O O   . HIS B 2 42   ? -17.175 -0.442  -83.789  1.00 70.69  ? 40   HIS D O   1 
ATOM 8858  C CB  . HIS B 2 42   ? -15.982 1.660   -85.155  1.00 66.88  ? 40   HIS D CB  1 
ATOM 8859  C CG  . HIS B 2 42   ? -14.716 0.896   -84.911  1.00 64.08  ? 40   HIS D CG  1 
ATOM 8860  N ND1 . HIS B 2 42   ? -14.506 0.151   -83.770  1.00 62.12  ? 40   HIS D ND1 1 
ATOM 8861  C CD2 . HIS B 2 42   ? -13.601 0.752   -85.666  1.00 63.52  ? 40   HIS D CD2 1 
ATOM 8862  C CE1 . HIS B 2 42   ? -13.314 -0.415  -83.831  1.00 62.68  ? 40   HIS D CE1 1 
ATOM 8863  N NE2 . HIS B 2 42   ? -12.744 -0.067  -84.971  1.00 64.29  ? 40   HIS D NE2 1 
ATOM 8864  N N   . GLN B 2 43   ? -18.231 -1.279  -85.593  1.00 82.42  ? 41   GLN D N   1 
ATOM 8865  C CA  . GLN B 2 43   ? -18.850 -2.405  -84.889  1.00 87.10  ? 41   GLN D CA  1 
ATOM 8866  C C   . GLN B 2 43   ? -17.866 -3.552  -84.618  1.00 84.44  ? 41   GLN D C   1 
ATOM 8867  O O   . GLN B 2 43   ? -16.719 -3.526  -85.070  1.00 79.43  ? 41   GLN D O   1 
ATOM 8868  C CB  . GLN B 2 43   ? -20.078 -2.900  -85.671  1.00 93.45  ? 41   GLN D CB  1 
ATOM 8869  C CG  . GLN B 2 43   ? -21.224 -1.897  -85.688  1.00 97.31  ? 41   GLN D CG  1 
ATOM 8870  C CD  . GLN B 2 43   ? -22.279 -2.228  -86.723  1.00 108.63 ? 41   GLN D CD  1 
ATOM 8871  O OE1 . GLN B 2 43   ? -22.711 -3.374  -86.838  1.00 117.57 ? 41   GLN D OE1 1 
ATOM 8872  N NE2 . GLN B 2 43   ? -22.704 -1.221  -87.483  1.00 113.54 ? 41   GLN D NE2 1 
ATOM 8873  N N   . ASP B 2 44   ? -18.334 -4.531  -83.841  1.00 88.26  ? 42   ASP D N   1 
ATOM 8874  C CA  . ASP B 2 44   ? -17.582 -5.746  -83.473  1.00 88.34  ? 42   ASP D CA  1 
ATOM 8875  C C   . ASP B 2 44   ? -16.427 -5.523  -82.485  1.00 75.89  ? 42   ASP D C   1 
ATOM 8876  O O   . ASP B 2 44   ? -15.712 -6.472  -82.165  1.00 74.07  ? 42   ASP D O   1 
ATOM 8877  C CB  . ASP B 2 44   ? -17.052 -6.489  -84.716  1.00 96.51  ? 42   ASP D CB  1 
ATOM 8878  C CG  . ASP B 2 44   ? -18.118 -6.694  -85.786  1.00 108.86 ? 42   ASP D CG  1 
ATOM 8879  O OD1 . ASP B 2 44   ? -19.243 -7.128  -85.448  1.00 110.86 ? 42   ASP D OD1 1 
ATOM 8880  O OD2 . ASP B 2 44   ? -17.820 -6.425  -86.970  1.00 118.60 ? 42   ASP D OD2 1 
ATOM 8881  N N   . SER B 2 45   ? -16.267 -4.301  -81.974  1.00 68.09  ? 43   SER D N   1 
ATOM 8882  C CA  . SER B 2 45   ? -15.056 -3.922  -81.239  1.00 64.15  ? 43   SER D CA  1 
ATOM 8883  C C   . SER B 2 45   ? -15.166 -2.563  -80.553  1.00 60.46  ? 43   SER D C   1 
ATOM 8884  O O   . SER B 2 45   ? -16.200 -1.898  -80.578  1.00 65.84  ? 43   SER D O   1 
ATOM 8885  C CB  . SER B 2 45   ? -13.848 -3.905  -82.197  1.00 65.07  ? 43   SER D CB  1 
ATOM 8886  O OG  . SER B 2 45   ? -12.665 -3.408  -81.575  1.00 59.60  ? 43   SER D OG  1 
ATOM 8887  N N   . GLN B 2 46   ? -14.059 -2.169  -79.946  1.00 55.51  ? 44   GLN D N   1 
ATOM 8888  C CA  . GLN B 2 46   ? -13.916 -0.870  -79.314  1.00 54.78  ? 44   GLN D CA  1 
ATOM 8889  C C   . GLN B 2 46   ? -12.689 -0.208  -79.910  1.00 54.51  ? 44   GLN D C   1 
ATOM 8890  O O   . GLN B 2 46   ? -11.785 -0.890  -80.405  1.00 56.83  ? 44   GLN D O   1 
ATOM 8891  C CB  . GLN B 2 46   ? -13.799 -1.002  -77.793  1.00 52.40  ? 44   GLN D CB  1 
ATOM 8892  C CG  . GLN B 2 46   ? -13.227 -2.324  -77.277  1.00 52.05  ? 44   GLN D CG  1 
ATOM 8893  C CD  . GLN B 2 46   ? -11.726 -2.475  -77.473  1.00 47.56  ? 44   GLN D CD  1 
ATOM 8894  O OE1 . GLN B 2 46   ? -10.982 -1.501  -77.438  1.00 44.93  ? 44   GLN D OE1 1 
ATOM 8895  N NE2 . GLN B 2 46   ? -11.277 -3.708  -77.657  1.00 46.19  ? 44   GLN D NE2 1 
ATOM 8896  N N   . VAL B 2 47   ? -12.676 1.121   -79.877  1.00 52.85  ? 45   VAL D N   1 
ATOM 8897  C CA  . VAL B 2 47   ? -11.597 1.906   -80.472  1.00 51.03  ? 45   VAL D CA  1 
ATOM 8898  C C   . VAL B 2 47   ? -10.560 2.185   -79.382  1.00 49.93  ? 45   VAL D C   1 
ATOM 8899  O O   . VAL B 2 47   ? -10.880 2.801   -78.362  1.00 54.99  ? 45   VAL D O   1 
ATOM 8900  C CB  . VAL B 2 47   ? -12.122 3.220   -81.099  1.00 49.37  ? 45   VAL D CB  1 
ATOM 8901  C CG1 . VAL B 2 47   ? -11.021 3.920   -81.880  1.00 49.23  ? 45   VAL D CG1 1 
ATOM 8902  C CG2 . VAL B 2 47   ? -13.293 2.938   -82.034  1.00 50.61  ? 45   VAL D CG2 1 
ATOM 8903  N N   . ASN B 2 48   ? -9.335  1.707   -79.602  1.00 46.98  ? 46   ASN D N   1 
ATOM 8904  C CA  . ASN B 2 48   ? -8.223  1.877   -78.660  1.00 45.69  ? 46   ASN D CA  1 
ATOM 8905  C C   . ASN B 2 48   ? -7.507  3.220   -78.840  1.00 49.06  ? 46   ASN D C   1 
ATOM 8906  O O   . ASN B 2 48   ? -7.085  3.831   -77.850  1.00 49.60  ? 46   ASN D O   1 
ATOM 8907  C CB  . ASN B 2 48   ? -7.209  0.741   -78.819  1.00 45.00  ? 46   ASN D CB  1 
ATOM 8908  C CG  . ASN B 2 48   ? -7.763  -0.608  -78.397  1.00 45.61  ? 46   ASN D CG  1 
ATOM 8909  O OD1 . ASN B 2 48   ? -8.447  -0.721  -77.381  1.00 44.13  ? 46   ASN D OD1 1 
ATOM 8910  N ND2 . ASN B 2 48   ? -7.443  -1.646  -79.166  1.00 46.46  ? 46   ASN D ND2 1 
ATOM 8911  N N   . ALA B 2 49   ? -7.356  3.657   -80.097  1.00 50.23  ? 47   ALA D N   1 
ATOM 8912  C CA  . ALA B 2 49   ? -6.740  4.950   -80.433  1.00 47.71  ? 47   ALA D CA  1 
ATOM 8913  C C   . ALA B 2 49   ? -7.254  5.486   -81.767  1.00 50.92  ? 47   ALA D C   1 
ATOM 8914  O O   . ALA B 2 49   ? -7.572  4.707   -82.666  1.00 56.28  ? 47   ALA D O   1 
ATOM 8915  C CB  . ALA B 2 49   ? -5.231  4.809   -80.488  1.00 48.05  ? 47   ALA D CB  1 
ATOM 8916  N N   . LEU B 2 50   ? -7.331  6.814   -81.881  1.00 49.95  ? 48   LEU D N   1 
ATOM 8917  C CA  . LEU B 2 50   ? -7.657  7.496   -83.139  1.00 50.41  ? 48   LEU D CA  1 
ATOM 8918  C C   . LEU B 2 50   ? -6.537  8.458   -83.507  1.00 54.33  ? 48   LEU D C   1 
ATOM 8919  O O   . LEU B 2 50   ? -5.981  9.120   -82.629  1.00 56.87  ? 48   LEU D O   1 
ATOM 8920  C CB  . LEU B 2 50   ? -8.948  8.304   -83.014  1.00 48.81  ? 48   LEU D CB  1 
ATOM 8921  C CG  . LEU B 2 50   ? -10.290 7.588   -82.952  1.00 50.54  ? 48   LEU D CG  1 
ATOM 8922  C CD1 . LEU B 2 50   ? -11.380 8.603   -82.656  1.00 54.31  ? 48   LEU D CD1 1 
ATOM 8923  C CD2 . LEU B 2 50   ? -10.594 6.875   -84.252  1.00 53.11  ? 48   LEU D CD2 1 
ATOM 8924  N N   . GLU B 2 51   ? -6.220  8.534   -84.799  1.00 59.43  ? 49   GLU D N   1 
ATOM 8925  C CA  . GLU B 2 51   ? -5.278  9.529   -85.323  1.00 62.56  ? 49   GLU D CA  1 
ATOM 8926  C C   . GLU B 2 51   ? -5.666  9.957   -86.735  1.00 63.21  ? 49   GLU D C   1 
ATOM 8927  O O   . GLU B 2 51   ? -5.902  9.112   -87.602  1.00 64.53  ? 49   GLU D O   1 
ATOM 8928  C CB  . GLU B 2 51   ? -3.843  8.978   -85.340  1.00 66.57  ? 49   GLU D CB  1 
ATOM 8929  C CG  . GLU B 2 51   ? -3.149  8.897   -83.981  1.00 70.84  ? 49   GLU D CG  1 
ATOM 8930  C CD  . GLU B 2 51   ? -3.036  10.239  -83.261  1.00 71.34  ? 49   GLU D CD  1 
ATOM 8931  O OE1 . GLU B 2 51   ? -2.972  11.293  -83.937  1.00 75.13  ? 49   GLU D OE1 1 
ATOM 8932  O OE2 . GLU B 2 51   ? -3.005  10.238  -82.009  1.00 64.45  ? 49   GLU D OE2 1 
ATOM 8933  N N   . VAL B 2 52   ? -5.729  11.270  -86.951  1.00 62.32  ? 50   VAL D N   1 
ATOM 8934  C CA  . VAL B 2 52   ? -5.924  11.847  -88.283  1.00 62.97  ? 50   VAL D CA  1 
ATOM 8935  C C   . VAL B 2 52   ? -4.572  11.916  -89.000  1.00 60.44  ? 50   VAL D C   1 
ATOM 8936  O O   . VAL B 2 52   ? -3.567  12.311  -88.406  1.00 59.86  ? 50   VAL D O   1 
ATOM 8937  C CB  . VAL B 2 52   ? -6.546  13.262  -88.197  1.00 64.38  ? 50   VAL D CB  1 
ATOM 8938  C CG1 . VAL B 2 52   ? -6.682  13.897  -89.573  1.00 68.69  ? 50   VAL D CG1 1 
ATOM 8939  C CG2 . VAL B 2 52   ? -7.916  13.199  -87.542  1.00 63.58  ? 50   VAL D CG2 1 
ATOM 8940  N N   . THR B 2 53   ? -4.564  11.541  -90.278  1.00 59.72  ? 51   THR D N   1 
ATOM 8941  C CA  . THR B 2 53   ? -3.341  11.522  -91.087  1.00 60.93  ? 51   THR D CA  1 
ATOM 8942  C C   . THR B 2 53   ? -2.835  12.945  -91.328  1.00 61.54  ? 51   THR D C   1 
ATOM 8943  O O   . THR B 2 53   ? -3.638  13.872  -91.346  1.00 64.51  ? 51   THR D O   1 
ATOM 8944  C CB  . THR B 2 53   ? -3.578  10.860  -92.461  1.00 64.21  ? 51   THR D CB  1 
ATOM 8945  O OG1 . THR B 2 53   ? -4.690  11.485  -93.120  1.00 66.66  ? 51   THR D OG1 1 
ATOM 8946  C CG2 . THR B 2 53   ? -3.858  9.376   -92.302  1.00 62.60  ? 51   THR D CG2 1 
ATOM 8947  N N   . PRO B 2 54   ? -1.514  13.127  -91.536  1.00 60.64  ? 52   PRO D N   1 
ATOM 8948  C CA  . PRO B 2 54   ? -0.975  14.482  -91.730  1.00 61.00  ? 52   PRO D CA  1 
ATOM 8949  C C   . PRO B 2 54   ? -1.682  15.286  -92.819  1.00 63.28  ? 52   PRO D C   1 
ATOM 8950  O O   . PRO B 2 54   ? -1.966  16.462  -92.620  1.00 64.36  ? 52   PRO D O   1 
ATOM 8951  C CB  . PRO B 2 54   ? 0.485   14.227  -92.113  1.00 63.41  ? 52   PRO D CB  1 
ATOM 8952  C CG  . PRO B 2 54   ? 0.812   12.916  -91.496  1.00 62.07  ? 52   PRO D CG  1 
ATOM 8953  C CD  . PRO B 2 54   ? -0.449  12.109  -91.593  1.00 61.31  ? 52   PRO D CD  1 
ATOM 8954  N N   . ASP B 2 55   ? -1.982  14.636  -93.942  1.00 66.40  ? 53   ASP D N   1 
ATOM 8955  C CA  . ASP B 2 55   ? -2.700  15.268  -95.066  1.00 69.72  ? 53   ASP D CA  1 
ATOM 8956  C C   . ASP B 2 55   ? -4.217  15.475  -94.862  1.00 68.56  ? 53   ASP D C   1 
ATOM 8957  O O   . ASP B 2 55   ? -4.869  16.078  -95.716  1.00 69.68  ? 53   ASP D O   1 
ATOM 8958  C CB  . ASP B 2 55   ? -2.474  14.456  -96.348  1.00 73.70  ? 53   ASP D CB  1 
ATOM 8959  C CG  . ASP B 2 55   ? -3.150  13.093  -96.310  1.00 73.98  ? 53   ASP D CG  1 
ATOM 8960  O OD1 . ASP B 2 55   ? -3.586  12.624  -97.384  1.00 79.17  ? 53   ASP D OD1 1 
ATOM 8961  O OD2 . ASP B 2 55   ? -3.245  12.496  -95.211  1.00 69.75  ? 53   ASP D OD2 1 
ATOM 8962  N N   . ARG B 2 56   ? -4.766  14.936  -93.767  1.00 66.00  ? 54   ARG D N   1 
ATOM 8963  C CA  . ARG B 2 56   ? -6.175  15.111  -93.355  1.00 65.37  ? 54   ARG D CA  1 
ATOM 8964  C C   . ARG B 2 56   ? -7.185  14.422  -94.277  1.00 67.26  ? 54   ARG D C   1 
ATOM 8965  O O   . ARG B 2 56   ? -8.374  14.744  -94.246  1.00 65.97  ? 54   ARG D O   1 
ATOM 8966  C CB  . ARG B 2 56   ? -6.539  16.594  -93.188  1.00 67.55  ? 54   ARG D CB  1 
ATOM 8967  C CG  . ARG B 2 56   ? -5.553  17.401  -92.355  1.00 68.70  ? 54   ARG D CG  1 
ATOM 8968  C CD  . ARG B 2 56   ? -5.792  18.901  -92.475  1.00 74.86  ? 54   ARG D CD  1 
ATOM 8969  N NE  . ARG B 2 56   ? -6.493  19.449  -91.309  1.00 76.08  ? 54   ARG D NE  1 
ATOM 8970  C CZ  . ARG B 2 56   ? -7.794  19.747  -91.233  1.00 79.99  ? 54   ARG D CZ  1 
ATOM 8971  N NH1 . ARG B 2 56   ? -8.627  19.574  -92.261  1.00 84.50  ? 54   ARG D NH1 1 
ATOM 8972  N NH2 . ARG B 2 56   ? -8.276  20.232  -90.094  1.00 82.50  ? 54   ARG D NH2 1 
ATOM 8973  N N   . SER B 2 57   ? -6.718  13.455  -95.067  1.00 71.05  ? 55   SER D N   1 
ATOM 8974  C CA  . SER B 2 57   ? -7.567  12.753  -96.028  1.00 75.85  ? 55   SER D CA  1 
ATOM 8975  C C   . SER B 2 57   ? -8.397  11.670  -95.340  1.00 74.99  ? 55   SER D C   1 
ATOM 8976  O O   . SER B 2 57   ? -9.560  11.464  -95.687  1.00 77.79  ? 55   SER D O   1 
ATOM 8977  C CB  . SER B 2 57   ? -6.719  12.135  -97.144  1.00 77.51  ? 55   SER D CB  1 
ATOM 8978  O OG  . SER B 2 57   ? -5.760  11.237  -96.615  1.00 73.98  ? 55   SER D OG  1 
ATOM 8979  N N   . MET B 2 58   ? -7.793  10.979  -94.375  1.00 73.00  ? 56   MET D N   1 
ATOM 8980  C CA  . MET B 2 58   ? -8.469  9.898   -93.652  1.00 72.46  ? 56   MET D CA  1 
ATOM 8981  C C   . MET B 2 58   ? -8.045  9.822   -92.181  1.00 68.01  ? 56   MET D C   1 
ATOM 8982  O O   . MET B 2 58   ? -7.035  10.412  -91.787  1.00 67.10  ? 56   MET D O   1 
ATOM 8983  C CB  . MET B 2 58   ? -8.238  8.555   -94.367  1.00 73.46  ? 56   MET D CB  1 
ATOM 8984  C CG  . MET B 2 58   ? -6.785  8.220   -94.678  1.00 73.28  ? 56   MET D CG  1 
ATOM 8985  S SD  . MET B 2 58   ? -6.623  6.738   -95.697  1.00 76.12  ? 56   MET D SD  1 
ATOM 8986  C CE  . MET B 2 58   ? -6.997  7.376   -97.328  1.00 84.13  ? 56   MET D CE  1 
ATOM 8987  N N   . ILE B 2 59   ? -8.843  9.102   -91.388  1.00 64.70  ? 57   ILE D N   1 
ATOM 8988  C CA  . ILE B 2 59   ? -8.616  8.919   -89.943  1.00 61.16  ? 57   ILE D CA  1 
ATOM 8989  C C   . ILE B 2 59   ? -8.497  7.427   -89.618  1.00 59.72  ? 57   ILE D C   1 
ATOM 8990  O O   . ILE B 2 59   ? -9.294  6.625   -90.101  1.00 58.16  ? 57   ILE D O   1 
ATOM 8991  C CB  . ILE B 2 59   ? -9.727  9.578   -89.073  1.00 60.10  ? 57   ILE D CB  1 
ATOM 8992  C CG1 . ILE B 2 59   ? -9.401  9.439   -87.579  1.00 59.20  ? 57   ILE D CG1 1 
ATOM 8993  C CG2 . ILE B 2 59   ? -11.110 8.994   -89.357  1.00 60.31  ? 57   ILE D CG2 1 
ATOM 8994  C CD1 . ILE B 2 59   ? -10.222 10.326  -86.666  1.00 59.48  ? 57   ILE D CD1 1 
ATOM 8995  N N   . ALA B 2 60   ? -7.503  7.072   -88.798  1.00 59.16  ? 58   ALA D N   1 
ATOM 8996  C CA  . ALA B 2 60   ? -7.265  5.679   -88.394  1.00 58.10  ? 58   ALA D CA  1 
ATOM 8997  C C   . ALA B 2 60   ? -7.960  5.380   -87.080  1.00 55.35  ? 58   ALA D C   1 
ATOM 8998  O O   . ALA B 2 60   ? -7.910  6.191   -86.161  1.00 50.86  ? 58   ALA D O   1 
ATOM 8999  C CB  . ALA B 2 60   ? -5.778  5.404   -88.255  1.00 56.09  ? 58   ALA D CB  1 
ATOM 9000  N N   . ALA B 2 61   ? -8.591  4.208   -87.006  1.00 56.74  ? 59   ALA D N   1 
ATOM 9001  C CA  . ALA B 2 61   ? -9.253  3.726   -85.796  1.00 53.39  ? 59   ALA D CA  1 
ATOM 9002  C C   . ALA B 2 61   ? -8.710  2.348   -85.418  1.00 52.46  ? 59   ALA D C   1 
ATOM 9003  O O   . ALA B 2 61   ? -9.253  1.313   -85.819  1.00 55.74  ? 59   ALA D O   1 
ATOM 9004  C CB  . ALA B 2 61   ? -10.761 3.681   -85.998  1.00 55.91  ? 59   ALA D CB  1 
ATOM 9005  N N   . ALA B 2 62   ? -7.625  2.356   -84.646  1.00 49.48  ? 60   ALA D N   1 
ATOM 9006  C CA  . ALA B 2 62   ? -7.014  1.132   -84.124  1.00 47.69  ? 60   ALA D CA  1 
ATOM 9007  C C   . ALA B 2 62   ? -7.923  0.476   -83.087  1.00 45.51  ? 60   ALA D C   1 
ATOM 9008  O O   . ALA B 2 62   ? -8.529  1.167   -82.268  1.00 43.84  ? 60   ALA D O   1 
ATOM 9009  C CB  . ALA B 2 62   ? -5.664  1.447   -83.505  1.00 47.50  ? 60   ALA D CB  1 
ATOM 9010  N N   . GLY B 2 63   ? -8.009  -0.853  -83.131  1.00 46.40  ? 61   GLY D N   1 
ATOM 9011  C CA  . GLY B 2 63   ? -8.906  -1.617  -82.254  1.00 46.26  ? 61   GLY D CA  1 
ATOM 9012  C C   . GLY B 2 63   ? -8.434  -3.042  -82.032  1.00 46.69  ? 61   GLY D C   1 
ATOM 9013  O O   . GLY B 2 63   ? -7.230  -3.313  -82.053  1.00 45.53  ? 61   GLY D O   1 
ATOM 9014  N N   . TYR B 2 64   ? -9.385  -3.950  -81.816  1.00 48.96  ? 62   TYR D N   1 
ATOM 9015  C CA  . TYR B 2 64   ? -9.074  -5.365  -81.585  1.00 52.31  ? 62   TYR D CA  1 
ATOM 9016  C C   . TYR B 2 64   ? -8.862  -6.103  -82.906  1.00 56.10  ? 62   TYR D C   1 
ATOM 9017  O O   . TYR B 2 64   ? -9.816  -6.352  -83.648  1.00 58.04  ? 62   TYR D O   1 
ATOM 9018  C CB  . TYR B 2 64   ? -10.186 -6.041  -80.785  1.00 53.94  ? 62   TYR D CB  1 
ATOM 9019  C CG  . TYR B 2 64   ? -9.855  -7.446  -80.324  1.00 55.41  ? 62   TYR D CG  1 
ATOM 9020  C CD1 . TYR B 2 64   ? -8.923  -7.664  -79.315  1.00 55.03  ? 62   TYR D CD1 1 
ATOM 9021  C CD2 . TYR B 2 64   ? -10.491 -8.555  -80.875  1.00 58.88  ? 62   TYR D CD2 1 
ATOM 9022  C CE1 . TYR B 2 64   ? -8.619  -8.945  -78.872  1.00 56.69  ? 62   TYR D CE1 1 
ATOM 9023  C CE2 . TYR B 2 64   ? -10.195 -9.842  -80.436  1.00 61.88  ? 62   TYR D CE2 1 
ATOM 9024  C CZ  . TYR B 2 64   ? -9.256  -10.031 -79.433  1.00 59.55  ? 62   TYR D CZ  1 
ATOM 9025  O OH  . TYR B 2 64   ? -8.951  -11.298 -78.985  1.00 61.35  ? 62   TYR D OH  1 
ATOM 9026  N N   . GLN B 2 65   ? -7.601  -6.430  -83.189  1.00 57.00  ? 63   GLN D N   1 
ATOM 9027  C CA  . GLN B 2 65   ? -7.206  -7.176  -84.390  1.00 60.24  ? 63   GLN D CA  1 
ATOM 9028  C C   . GLN B 2 65   ? -7.521  -6.472  -85.736  1.00 61.27  ? 63   GLN D C   1 
ATOM 9029  O O   . GLN B 2 65   ? -7.701  -7.138  -86.763  1.00 63.65  ? 63   GLN D O   1 
ATOM 9030  C CB  . GLN B 2 65   ? -7.800  -8.597  -84.357  1.00 62.70  ? 63   GLN D CB  1 
ATOM 9031  C CG  . GLN B 2 65   ? -7.556  -9.358  -83.056  1.00 62.65  ? 63   GLN D CG  1 
ATOM 9032  C CD  . GLN B 2 65   ? -8.160  -10.755 -83.053  1.00 65.70  ? 63   GLN D CD  1 
ATOM 9033  O OE1 . GLN B 2 65   ? -9.073  -11.056 -83.824  1.00 69.76  ? 63   GLN D OE1 1 
ATOM 9034  N NE2 . GLN B 2 65   ? -7.659  -11.614 -82.173  1.00 64.11  ? 63   GLN D NE2 1 
ATOM 9035  N N   . HIS B 2 66   ? -7.558  -5.137  -85.726  1.00 59.20  ? 64   HIS D N   1 
ATOM 9036  C CA  . HIS B 2 66   ? -7.735  -4.345  -86.945  1.00 61.62  ? 64   HIS D CA  1 
ATOM 9037  C C   . HIS B 2 66   ? -7.412  -2.859  -86.752  1.00 60.71  ? 64   HIS D C   1 
ATOM 9038  O O   . HIS B 2 66   ? -7.593  -2.319  -85.660  1.00 61.05  ? 64   HIS D O   1 
ATOM 9039  C CB  . HIS B 2 66   ? -9.167  -4.473  -87.467  1.00 66.93  ? 64   HIS D CB  1 
ATOM 9040  C CG  . HIS B 2 66   ? -10.214 -4.073  -86.474  1.00 69.58  ? 64   HIS D CG  1 
ATOM 9041  N ND1 . HIS B 2 66   ? -10.996 -4.993  -85.812  1.00 72.23  ? 64   HIS D ND1 1 
ATOM 9042  C CD2 . HIS B 2 66   ? -10.618 -2.853  -86.041  1.00 69.48  ? 64   HIS D CD2 1 
ATOM 9043  C CE1 . HIS B 2 66   ? -11.834 -4.359  -85.012  1.00 72.79  ? 64   HIS D CE1 1 
ATOM 9044  N NE2 . HIS B 2 66   ? -11.623 -3.060  -85.129  1.00 71.62  ? 64   HIS D NE2 1 
ATOM 9045  N N   . ILE B 2 67   ? -6.928  -2.216  -87.816  1.00 61.20  ? 65   ILE D N   1 
ATOM 9046  C CA  . ILE B 2 67   ? -6.940  -0.754  -87.929  1.00 62.03  ? 65   ILE D CA  1 
ATOM 9047  C C   . ILE B 2 67   ? -7.859  -0.422  -89.105  1.00 65.69  ? 65   ILE D C   1 
ATOM 9048  O O   . ILE B 2 67   ? -7.499  -0.655  -90.258  1.00 69.73  ? 65   ILE D O   1 
ATOM 9049  C CB  . ILE B 2 67   ? -5.536  -0.137  -88.175  1.00 63.33  ? 65   ILE D CB  1 
ATOM 9050  C CG1 . ILE B 2 67   ? -4.489  -0.714  -87.213  1.00 65.75  ? 65   ILE D CG1 1 
ATOM 9051  C CG2 . ILE B 2 67   ? -5.581  1.386   -88.055  1.00 61.98  ? 65   ILE D CG2 1 
ATOM 9052  C CD1 . ILE B 2 67   ? -3.576  -1.725  -87.870  1.00 70.43  ? 65   ILE D CD1 1 
ATOM 9053  N N   . ARG B 2 68   ? -9.051  0.092   -88.806  1.00 66.59  ? 66   ARG D N   1 
ATOM 9054  C CA  . ARG B 2 68   ? -9.980  0.567   -89.834  1.00 68.52  ? 66   ARG D CA  1 
ATOM 9055  C C   . ARG B 2 68   ? -9.718  2.047   -90.097  1.00 65.61  ? 66   ARG D C   1 
ATOM 9056  O O   . ARG B 2 68   ? -9.458  2.810   -89.166  1.00 58.05  ? 66   ARG D O   1 
ATOM 9057  C CB  . ARG B 2 68   ? -11.429 0.330   -89.408  1.00 72.62  ? 66   ARG D CB  1 
ATOM 9058  C CG  . ARG B 2 68   ? -11.786 -1.145  -89.318  1.00 80.04  ? 66   ARG D CG  1 
ATOM 9059  C CD  . ARG B 2 68   ? -13.180 -1.373  -88.760  1.00 86.77  ? 66   ARG D CD  1 
ATOM 9060  N NE  . ARG B 2 68   ? -13.354 -2.742  -88.267  1.00 93.87  ? 66   ARG D NE  1 
ATOM 9061  C CZ  . ARG B 2 68   ? -14.377 -3.171  -87.524  1.00 103.17 ? 66   ARG D CZ  1 
ATOM 9062  N NH1 . ARG B 2 68   ? -15.362 -2.347  -87.161  1.00 107.73 ? 66   ARG D NH1 1 
ATOM 9063  N NH2 . ARG B 2 68   ? -14.419 -4.444  -87.133  1.00 106.98 ? 66   ARG D NH2 1 
ATOM 9064  N N   . MET B 2 69   ? -9.778  2.440   -91.370  1.00 70.22  ? 67   MET D N   1 
ATOM 9065  C CA  . MET B 2 69   ? -9.453  3.802   -91.789  1.00 70.57  ? 67   MET D CA  1 
ATOM 9066  C C   . MET B 2 69   ? -10.587 4.398   -92.616  1.00 68.03  ? 67   MET D C   1 
ATOM 9067  O O   . MET B 2 69   ? -10.921 3.871   -93.673  1.00 70.53  ? 67   MET D O   1 
ATOM 9068  C CB  . MET B 2 69   ? -8.147  3.807   -92.578  1.00 76.28  ? 67   MET D CB  1 
ATOM 9069  C CG  . MET B 2 69   ? -6.970  3.314   -91.750  1.00 79.86  ? 67   MET D CG  1 
ATOM 9070  S SD  . MET B 2 69   ? -5.351  3.604   -92.481  1.00 88.30  ? 67   MET D SD  1 
ATOM 9071  C CE  . MET B 2 69   ? -5.197  5.380   -92.312  1.00 88.26  ? 67   MET D CE  1 
ATOM 9072  N N   . TYR B 2 70   ? -11.155 5.501   -92.121  1.00 63.15  ? 68   TYR D N   1 
ATOM 9073  C CA  . TYR B 2 70   ? -12.350 6.132   -92.689  1.00 62.64  ? 68   TYR D CA  1 
ATOM 9074  C C   . TYR B 2 70   ? -12.018 7.412   -93.454  1.00 65.24  ? 68   TYR D C   1 
ATOM 9075  O O   . TYR B 2 70   ? -11.075 8.116   -93.112  1.00 64.01  ? 68   TYR D O   1 
ATOM 9076  C CB  . TYR B 2 70   ? -13.342 6.452   -91.570  1.00 58.85  ? 68   TYR D CB  1 
ATOM 9077  C CG  . TYR B 2 70   ? -13.753 5.239   -90.776  1.00 56.26  ? 68   TYR D CG  1 
ATOM 9078  C CD1 . TYR B 2 70   ? -13.227 4.995   -89.510  1.00 53.17  ? 68   TYR D CD1 1 
ATOM 9079  C CD2 . TYR B 2 70   ? -14.649 4.317   -91.303  1.00 58.70  ? 68   TYR D CD2 1 
ATOM 9080  C CE1 . TYR B 2 70   ? -13.596 3.872   -88.786  1.00 52.52  ? 68   TYR D CE1 1 
ATOM 9081  C CE2 . TYR B 2 70   ? -15.028 3.193   -90.588  1.00 58.45  ? 68   TYR D CE2 1 
ATOM 9082  C CZ  . TYR B 2 70   ? -14.499 2.973   -89.331  1.00 55.45  ? 68   TYR D CZ  1 
ATOM 9083  O OH  . TYR B 2 70   ? -14.874 1.856   -88.623  1.00 56.06  ? 68   TYR D OH  1 
ATOM 9084  N N   . ASP B 2 71   ? -12.822 7.716   -94.471  1.00 70.69  ? 69   ASP D N   1 
ATOM 9085  C CA  . ASP B 2 71   ? -12.574 8.852   -95.360  1.00 76.07  ? 69   ASP D CA  1 
ATOM 9086  C C   . ASP B 2 71   ? -13.118 10.148  -94.764  1.00 77.99  ? 69   ASP D C   1 
ATOM 9087  O O   . ASP B 2 71   ? -14.317 10.262  -94.505  1.00 78.37  ? 69   ASP D O   1 
ATOM 9088  C CB  . ASP B 2 71   ? -13.224 8.596   -96.733  1.00 83.15  ? 69   ASP D CB  1 
ATOM 9089  C CG  . ASP B 2 71   ? -12.590 9.412   -97.865  1.00 86.18  ? 69   ASP D CG  1 
ATOM 9090  O OD1 . ASP B 2 71   ? -11.956 10.459  -97.607  1.00 84.73  ? 69   ASP D OD1 1 
ATOM 9091  O OD2 . ASP B 2 71   ? -12.756 9.004   -99.039  1.00 90.35  ? 69   ASP D OD2 1 
ATOM 9092  N N   . LEU B 2 72   ? -12.232 11.124  -94.572  1.00 79.26  ? 70   LEU D N   1 
ATOM 9093  C CA  . LEU B 2 72   ? -12.615 12.454  -94.093  1.00 81.39  ? 70   LEU D CA  1 
ATOM 9094  C C   . LEU B 2 72   ? -13.128 13.350  -95.224  1.00 87.33  ? 70   LEU D C   1 
ATOM 9095  O O   . LEU B 2 72   ? -14.095 14.091  -95.031  1.00 91.27  ? 70   LEU D O   1 
ATOM 9096  C CB  . LEU B 2 72   ? -11.435 13.131  -93.391  1.00 79.81  ? 70   LEU D CB  1 
ATOM 9097  C CG  . LEU B 2 72   ? -10.970 12.453  -92.100  1.00 76.37  ? 70   LEU D CG  1 
ATOM 9098  C CD1 . LEU B 2 72   ? -9.576  12.923  -91.711  1.00 75.70  ? 70   LEU D CD1 1 
ATOM 9099  C CD2 . LEU B 2 72   ? -11.960 12.715  -90.974  1.00 74.73  ? 70   LEU D CD2 1 
ATOM 9100  N N   . ASN B 2 73   ? -12.482 13.279  -96.392  1.00 89.41  ? 71   ASN D N   1 
ATOM 9101  C CA  . ASN B 2 73   ? -12.850 14.107  -97.550  1.00 92.95  ? 71   ASN D CA  1 
ATOM 9102  C C   . ASN B 2 73   ? -14.238 13.741  -98.073  1.00 97.73  ? 71   ASN D C   1 
ATOM 9103  O O   . ASN B 2 73   ? -15.139 14.583  -98.077  1.00 100.17 ? 71   ASN D O   1 
ATOM 9104  C CB  . ASN B 2 73   ? -11.814 13.979  -98.678  1.00 94.17  ? 71   ASN D CB  1 
ATOM 9105  C CG  . ASN B 2 73   ? -10.439 14.487  -98.280  1.00 91.74  ? 71   ASN D CG  1 
ATOM 9106  O OD1 . ASN B 2 73   ? -10.306 15.384  -97.444  1.00 88.15  ? 71   ASN D OD1 1 
ATOM 9107  N ND2 . ASN B 2 73   ? -9.403  13.913  -98.886  1.00 92.83  ? 71   ASN D ND2 1 
ATOM 9108  N N   . SER B 2 74   ? -14.404 12.489  -98.501  1.00 100.33 ? 72   SER D N   1 
ATOM 9109  C CA  . SER B 2 74   ? -15.713 11.970  -98.907  1.00 104.88 ? 72   SER D CA  1 
ATOM 9110  C C   . SER B 2 74   ? -16.529 11.640  -97.654  1.00 106.56 ? 72   SER D C   1 
ATOM 9111  O O   . SER B 2 74   ? -16.251 10.660  -96.966  1.00 105.06 ? 72   SER D O   1 
ATOM 9112  C CB  . SER B 2 74   ? -15.573 10.742  -99.825  1.00 106.10 ? 72   SER D CB  1 
ATOM 9113  O OG  . SER B 2 74   ? -15.421 9.528   -99.105  1.00 100.24 ? 72   SER D OG  1 
ATOM 9114  N N   . ASN B 2 75   ? -17.515 12.480  -97.353  1.00 115.91 ? 73   ASN D N   1 
ATOM 9115  C CA  . ASN B 2 75   ? -18.382 12.281  -96.189  1.00 119.85 ? 73   ASN D CA  1 
ATOM 9116  C C   . ASN B 2 75   ? -19.368 11.150  -96.477  1.00 120.96 ? 73   ASN D C   1 
ATOM 9117  O O   . ASN B 2 75   ? -19.749 10.952  -97.631  1.00 127.28 ? 73   ASN D O   1 
ATOM 9118  C CB  . ASN B 2 75   ? -19.152 13.569  -95.846  1.00 128.37 ? 73   ASN D CB  1 
ATOM 9119  C CG  . ASN B 2 75   ? -18.235 14.737  -95.496  1.00 133.30 ? 73   ASN D CG  1 
ATOM 9120  O OD1 . ASN B 2 75   ? -17.114 14.549  -95.023  1.00 132.87 ? 73   ASN D OD1 1 
ATOM 9121  N ND2 . ASN B 2 75   ? -18.717 15.956  -95.730  1.00 135.33 ? 73   ASN D ND2 1 
ATOM 9122  N N   . ASN B 2 76   ? -19.736 10.414  -95.421  1.00 119.41 ? 74   ASN D N   1 
ATOM 9123  C CA  . ASN B 2 76   ? -20.784 9.347   -95.392  1.00 123.24 ? 74   ASN D CA  1 
ATOM 9124  C C   . ASN B 2 76   ? -20.344 7.855   -95.301  1.00 112.82 ? 74   ASN D C   1 
ATOM 9125  O O   . ASN B 2 76   ? -20.940 7.109   -94.518  1.00 112.80 ? 74   ASN D O   1 
ATOM 9126  C CB  . ASN B 2 76   ? -21.868 9.498   -96.494  1.00 136.43 ? 74   ASN D CB  1 
ATOM 9127  C CG  . ASN B 2 76   ? -22.639 10.814  -96.406  1.00 140.05 ? 74   ASN D CG  1 
ATOM 9128  O OD1 . ASN B 2 76   ? -22.375 11.661  -95.547  1.00 143.05 ? 74   ASN D OD1 1 
ATOM 9129  N ND2 . ASN B 2 76   ? -23.601 10.988  -97.308  1.00 138.01 ? 74   ASN D ND2 1 
ATOM 9130  N N   . PRO B 2 77   ? -19.330 7.411   -96.080  1.00 104.08 ? 75   PRO D N   1 
ATOM 9131  C CA  . PRO B 2 77   ? -19.153 5.955   -96.233  1.00 101.64 ? 75   PRO D CA  1 
ATOM 9132  C C   . PRO B 2 77   ? -18.615 5.209   -95.001  1.00 99.10  ? 75   PRO D C   1 
ATOM 9133  O O   . PRO B 2 77   ? -18.442 5.791   -93.926  1.00 92.35  ? 75   PRO D O   1 
ATOM 9134  C CB  . PRO B 2 77   ? -18.166 5.854   -97.408  1.00 100.38 ? 75   PRO D CB  1 
ATOM 9135  C CG  . PRO B 2 77   ? -17.346 7.081   -97.297  1.00 99.91  ? 75   PRO D CG  1 
ATOM 9136  C CD  . PRO B 2 77   ? -18.266 8.153   -96.781  1.00 101.66 ? 75   PRO D CD  1 
ATOM 9137  N N   . ASN B 2 78   ? -18.375 3.913   -95.187  1.00 101.51 ? 76   ASN D N   1 
ATOM 9138  C CA  . ASN B 2 78   ? -17.780 3.036   -94.173  1.00 96.54  ? 76   ASN D CA  1 
ATOM 9139  C C   . ASN B 2 78   ? -16.248 3.054   -94.409  1.00 89.42  ? 76   ASN D C   1 
ATOM 9140  O O   . ASN B 2 78   ? -15.760 4.002   -95.034  1.00 90.45  ? 76   ASN D O   1 
ATOM 9141  C CB  . ASN B 2 78   ? -18.425 1.650   -94.285  1.00 103.60 ? 76   ASN D CB  1 
ATOM 9142  C CG  . ASN B 2 78   ? -19.929 1.721   -94.476  1.00 111.43 ? 76   ASN D CG  1 
ATOM 9143  O OD1 . ASN B 2 78   ? -20.604 2.543   -93.854  1.00 122.99 ? 76   ASN D OD1 1 
ATOM 9144  N ND2 . ASN B 2 78   ? -20.459 0.868   -95.345  1.00 109.81 ? 76   ASN D ND2 1 
ATOM 9145  N N   . PRO B 2 79   ? -15.473 2.048   -93.924  1.00 83.23  ? 77   PRO D N   1 
ATOM 9146  C CA  . PRO B 2 79   ? -14.024 2.276   -94.053  1.00 79.14  ? 77   PRO D CA  1 
ATOM 9147  C C   . PRO B 2 79   ? -13.485 2.123   -95.475  1.00 79.21  ? 77   PRO D C   1 
ATOM 9148  O O   . PRO B 2 79   ? -14.069 1.405   -96.285  1.00 81.16  ? 77   PRO D O   1 
ATOM 9149  C CB  . PRO B 2 79   ? -13.417 1.211   -93.131  1.00 76.88  ? 77   PRO D CB  1 
ATOM 9150  C CG  . PRO B 2 79   ? -14.391 0.100   -93.157  1.00 80.12  ? 77   PRO D CG  1 
ATOM 9151  C CD  . PRO B 2 79   ? -15.750 0.713   -93.354  1.00 84.08  ? 77   PRO D CD  1 
ATOM 9152  N N   . ILE B 2 80   ? -12.375 2.807   -95.752  1.00 78.46  ? 78   ILE D N   1 
ATOM 9153  C CA  . ILE B 2 80   ? -11.662 2.676   -97.018  1.00 81.27  ? 78   ILE D CA  1 
ATOM 9154  C C   . ILE B 2 80   ? -10.775 1.440   -96.896  1.00 85.56  ? 78   ILE D C   1 
ATOM 9155  O O   . ILE B 2 80   ? -10.927 0.476   -97.650  1.00 92.54  ? 78   ILE D O   1 
ATOM 9156  C CB  . ILE B 2 80   ? -10.743 3.881   -97.354  1.00 78.47  ? 78   ILE D CB  1 
ATOM 9157  C CG1 . ILE B 2 80   ? -11.421 5.237   -97.139  1.00 75.79  ? 78   ILE D CG1 1 
ATOM 9158  C CG2 . ILE B 2 80   ? -10.273 3.784   -98.800  1.00 85.10  ? 78   ILE D CG2 1 
ATOM 9159  C CD1 . ILE B 2 80   ? -10.407 6.341   -96.926  1.00 74.21  ? 78   ILE D CD1 1 
ATOM 9160  N N   . ILE B 2 81   ? -9.864  1.485   -95.921  1.00 85.36  ? 79   ILE D N   1 
ATOM 9161  C CA  . ILE B 2 81   ? -8.827  0.473   -95.731  1.00 86.51  ? 79   ILE D CA  1 
ATOM 9162  C C   . ILE B 2 81   ? -9.032  -0.183  -94.368  1.00 82.27  ? 79   ILE D C   1 
ATOM 9163  O O   . ILE B 2 81   ? -9.318  0.502   -93.383  1.00 83.35  ? 79   ILE D O   1 
ATOM 9164  C CB  . ILE B 2 81   ? -7.403  1.089   -95.778  1.00 86.06  ? 79   ILE D CB  1 
ATOM 9165  C CG1 . ILE B 2 81   ? -7.217  1.973   -97.021  1.00 88.45  ? 79   ILE D CG1 1 
ATOM 9166  C CG2 . ILE B 2 81   ? -6.342  -0.008  -95.776  1.00 85.99  ? 79   ILE D CG2 1 
ATOM 9167  C CD1 . ILE B 2 81   ? -6.036  2.919   -96.936  1.00 86.69  ? 79   ILE D CD1 1 
ATOM 9168  N N   . SER B 2 82   ? -8.897  -1.509  -94.334  1.00 77.76  ? 80   SER D N   1 
ATOM 9169  C CA  . SER B 2 82   ? -8.826  -2.278  -93.095  1.00 73.51  ? 80   SER D CA  1 
ATOM 9170  C C   . SER B 2 82   ? -7.556  -3.108  -93.118  1.00 72.63  ? 80   SER D C   1 
ATOM 9171  O O   . SER B 2 82   ? -7.086  -3.492  -94.186  1.00 77.99  ? 80   SER D O   1 
ATOM 9172  C CB  . SER B 2 82   ? -10.042 -3.191  -92.949  1.00 76.05  ? 80   SER D CB  1 
ATOM 9173  O OG  . SER B 2 82   ? -11.211 -2.433  -92.699  1.00 79.43  ? 80   SER D OG  1 
ATOM 9174  N N   . TYR B 2 83   ? -7.007  -3.383  -91.938  1.00 69.56  ? 81   TYR D N   1 
ATOM 9175  C CA  . TYR B 2 83   ? -5.778  -4.160  -91.802  1.00 70.71  ? 81   TYR D CA  1 
ATOM 9176  C C   . TYR B 2 83   ? -5.962  -5.273  -90.764  1.00 71.93  ? 81   TYR D C   1 
ATOM 9177  O O   . TYR B 2 83   ? -5.589  -5.119  -89.604  1.00 76.20  ? 81   TYR D O   1 
ATOM 9178  C CB  . TYR B 2 83   ? -4.613  -3.240  -91.415  1.00 70.49  ? 81   TYR D CB  1 
ATOM 9179  C CG  . TYR B 2 83   ? -4.101  -2.344  -92.530  1.00 72.99  ? 81   TYR D CG  1 
ATOM 9180  C CD1 . TYR B 2 83   ? -4.315  -0.963  -92.504  1.00 73.30  ? 81   TYR D CD1 1 
ATOM 9181  C CD2 . TYR B 2 83   ? -3.381  -2.874  -93.604  1.00 76.91  ? 81   TYR D CD2 1 
ATOM 9182  C CE1 . TYR B 2 83   ? -3.836  -0.141  -93.520  1.00 76.83  ? 81   TYR D CE1 1 
ATOM 9183  C CE2 . TYR B 2 83   ? -2.899  -2.061  -94.625  1.00 78.85  ? 81   TYR D CE2 1 
ATOM 9184  C CZ  . TYR B 2 83   ? -3.128  -0.696  -94.581  1.00 78.44  ? 81   TYR D CZ  1 
ATOM 9185  O OH  . TYR B 2 83   ? -2.655  0.111   -95.592  1.00 79.14  ? 81   TYR D OH  1 
ATOM 9186  N N   . ASP B 2 84   ? -6.527  -6.399  -91.198  1.00 75.61  ? 82   ASP D N   1 
ATOM 9187  C CA  . ASP B 2 84   ? -6.781  -7.560  -90.324  1.00 75.90  ? 82   ASP D CA  1 
ATOM 9188  C C   . ASP B 2 84   ? -5.516  -8.419  -90.160  1.00 74.35  ? 82   ASP D C   1 
ATOM 9189  O O   . ASP B 2 84   ? -4.419  -8.001  -90.533  1.00 73.26  ? 82   ASP D O   1 
ATOM 9190  C CB  . ASP B 2 84   ? -7.925  -8.413  -90.902  1.00 81.75  ? 82   ASP D CB  1 
ATOM 9191  C CG  . ASP B 2 84   ? -9.225  -7.637  -91.069  1.00 84.62  ? 82   ASP D CG  1 
ATOM 9192  O OD1 . ASP B 2 84   ? -9.379  -6.549  -90.469  1.00 80.65  ? 82   ASP D OD1 1 
ATOM 9193  O OD2 . ASP B 2 84   ? -10.101 -8.136  -91.809  1.00 91.39  ? 82   ASP D OD2 1 
ATOM 9194  N N   . GLY B 2 85   ? -5.666  -9.604  -89.571  1.00 75.17  ? 83   GLY D N   1 
ATOM 9195  C CA  . GLY B 2 85   ? -4.618  -10.622 -89.595  1.00 78.60  ? 83   GLY D CA  1 
ATOM 9196  C C   . GLY B 2 85   ? -3.495  -10.423 -88.599  1.00 78.58  ? 83   GLY D C   1 
ATOM 9197  O O   . GLY B 2 85   ? -2.396  -10.939 -88.797  1.00 81.97  ? 83   GLY D O   1 
ATOM 9198  N N   . VAL B 2 86   ? -3.770  -9.670  -87.536  1.00 78.84  ? 84   VAL D N   1 
ATOM 9199  C CA  . VAL B 2 86   ? -2.841  -9.494  -86.422  1.00 79.82  ? 84   VAL D CA  1 
ATOM 9200  C C   . VAL B 2 86   ? -3.655  -9.792  -85.172  1.00 80.71  ? 84   VAL D C   1 
ATOM 9201  O O   . VAL B 2 86   ? -4.632  -9.096  -84.908  1.00 85.82  ? 84   VAL D O   1 
ATOM 9202  C CB  . VAL B 2 86   ? -2.286  -8.052  -86.340  1.00 82.20  ? 84   VAL D CB  1 
ATOM 9203  C CG1 . VAL B 2 86   ? -1.018  -8.020  -85.501  1.00 87.06  ? 84   VAL D CG1 1 
ATOM 9204  C CG2 . VAL B 2 86   ? -2.002  -7.482  -87.721  1.00 85.07  ? 84   VAL D CG2 1 
ATOM 9205  N N   . ASN B 2 87   ? -3.289  -10.833 -84.425  1.00 81.55  ? 85   ASN D N   1 
ATOM 9206  C CA  . ASN B 2 87   ? -4.043  -11.200 -83.209  1.00 79.80  ? 85   ASN D CA  1 
ATOM 9207  C C   . ASN B 2 87   ? -3.824  -10.221 -82.048  1.00 72.19  ? 85   ASN D C   1 
ATOM 9208  O O   . ASN B 2 87   ? -2.835  -9.486  -82.026  1.00 69.49  ? 85   ASN D O   1 
ATOM 9209  C CB  . ASN B 2 87   ? -3.794  -12.664 -82.776  1.00 85.00  ? 85   ASN D CB  1 
ATOM 9210  C CG  . ASN B 2 87   ? -2.331  -12.984 -82.491  1.00 89.96  ? 85   ASN D CG  1 
ATOM 9211  O OD1 . ASN B 2 87   ? -1.962  -14.158 -82.441  1.00 95.06  ? 85   ASN D OD1 1 
ATOM 9212  N ND2 . ASN B 2 87   ? -1.497  -11.960 -82.299  1.00 89.16  ? 85   ASN D ND2 1 
ATOM 9213  N N   . LYS B 2 88   ? -4.772  -10.218 -81.108  1.00 67.69  ? 86   LYS D N   1 
ATOM 9214  C CA  . LYS B 2 88   ? -4.815  -9.286  -79.963  1.00 62.86  ? 86   LYS D CA  1 
ATOM 9215  C C   . LYS B 2 88   ? -4.945  -7.807  -80.377  1.00 57.13  ? 86   LYS D C   1 
ATOM 9216  O O   . LYS B 2 88   ? -4.988  -7.495  -81.571  1.00 58.23  ? 86   LYS D O   1 
ATOM 9217  C CB  . LYS B 2 88   ? -3.629  -9.528  -79.009  1.00 63.94  ? 86   LYS D CB  1 
ATOM 9218  C CG  . LYS B 2 88   ? -3.451  -10.999 -78.619  1.00 67.38  ? 86   LYS D CG  1 
ATOM 9219  C CD  . LYS B 2 88   ? -3.188  -11.207 -77.133  1.00 68.78  ? 86   LYS D CD  1 
ATOM 9220  C CE  . LYS B 2 88   ? -1.765  -10.846 -76.737  1.00 71.39  ? 86   LYS D CE  1 
ATOM 9221  N NZ  . LYS B 2 88   ? -0.803  -11.951 -76.986  1.00 75.64  ? 86   LYS D NZ  1 
ATOM 9222  N N   . ASN B 2 89   ? -5.047  -6.907  -79.395  1.00 51.51  ? 87   ASN D N   1 
ATOM 9223  C CA  . ASN B 2 89   ? -5.311  -5.482  -79.668  1.00 48.45  ? 87   ASN D CA  1 
ATOM 9224  C C   . ASN B 2 89   ? -4.183  -4.771  -80.409  1.00 47.86  ? 87   ASN D C   1 
ATOM 9225  O O   . ASN B 2 89   ? -3.035  -5.225  -80.422  1.00 48.01  ? 87   ASN D O   1 
ATOM 9226  C CB  . ASN B 2 89   ? -5.607  -4.703  -78.377  1.00 46.53  ? 87   ASN D CB  1 
ATOM 9227  C CG  . ASN B 2 89   ? -7.048  -4.832  -77.926  1.00 47.51  ? 87   ASN D CG  1 
ATOM 9228  O OD1 . ASN B 2 89   ? -7.957  -4.258  -78.529  1.00 46.69  ? 87   ASN D OD1 1 
ATOM 9229  N ND2 . ASN B 2 89   ? -7.262  -5.569  -76.845  1.00 49.24  ? 87   ASN D ND2 1 
ATOM 9230  N N   . ILE B 2 90   ? -4.549  -3.657  -81.037  1.00 48.60  ? 88   ILE D N   1 
ATOM 9231  C CA  . ILE B 2 90   ? -3.603  -2.694  -81.594  1.00 51.38  ? 88   ILE D CA  1 
ATOM 9232  C C   . ILE B 2 90   ? -3.804  -1.412  -80.777  1.00 50.32  ? 88   ILE D C   1 
ATOM 9233  O O   . ILE B 2 90   ? -4.825  -0.733  -80.903  1.00 51.15  ? 88   ILE D O   1 
ATOM 9234  C CB  . ILE B 2 90   ? -3.832  -2.499  -83.114  1.00 52.99  ? 88   ILE D CB  1 
ATOM 9235  C CG1 . ILE B 2 90   ? -3.413  -3.771  -83.856  1.00 57.69  ? 88   ILE D CG1 1 
ATOM 9236  C CG2 . ILE B 2 90   ? -3.033  -1.324  -83.669  1.00 51.02  ? 88   ILE D CG2 1 
ATOM 9237  C CD1 . ILE B 2 90   ? -4.153  -3.988  -85.150  1.00 62.04  ? 88   ILE D CD1 1 
ATOM 9238  N N   . ALA B 2 91   ? -2.827  -1.108  -79.927  1.00 47.94  ? 89   ALA D N   1 
ATOM 9239  C CA  . ALA B 2 91   ? -2.965  -0.074  -78.906  1.00 46.79  ? 89   ALA D CA  1 
ATOM 9240  C C   . ALA B 2 91   ? -2.676  1.331   -79.411  1.00 46.65  ? 89   ALA D C   1 
ATOM 9241  O O   . ALA B 2 91   ? -3.380  2.264   -79.039  1.00 45.80  ? 89   ALA D O   1 
ATOM 9242  C CB  . ALA B 2 91   ? -2.064  -0.388  -77.727  1.00 49.03  ? 89   ALA D CB  1 
ATOM 9243  N N   . SER B 2 92   ? -1.635  1.483   -80.229  1.00 50.84  ? 90   SER D N   1 
ATOM 9244  C CA  . SER B 2 92   ? -1.232  2.794   -80.763  1.00 54.71  ? 90   SER D CA  1 
ATOM 9245  C C   . SER B 2 92   ? -1.203  2.861   -82.294  1.00 58.45  ? 90   SER D C   1 
ATOM 9246  O O   . SER B 2 92   ? -1.062  1.840   -82.973  1.00 59.55  ? 90   SER D O   1 
ATOM 9247  C CB  . SER B 2 92   ? 0.142   3.196   -80.210  1.00 53.64  ? 90   SER D CB  1 
ATOM 9248  O OG  . SER B 2 92   ? 0.011   4.226   -79.250  1.00 56.22  ? 90   SER D OG  1 
ATOM 9249  N N   . VAL B 2 93   ? -1.349  4.086   -82.806  1.00 56.57  ? 91   VAL D N   1 
ATOM 9250  C CA  . VAL B 2 93   ? -1.128  4.415   -84.219  1.00 57.31  ? 91   VAL D CA  1 
ATOM 9251  C C   . VAL B 2 93   ? -0.262  5.680   -84.327  1.00 57.70  ? 91   VAL D C   1 
ATOM 9252  O O   . VAL B 2 93   ? -0.263  6.538   -83.441  1.00 52.06  ? 91   VAL D O   1 
ATOM 9253  C CB  . VAL B 2 93   ? -2.441  4.602   -85.044  1.00 56.66  ? 91   VAL D CB  1 
ATOM 9254  C CG1 . VAL B 2 93   ? -2.834  3.316   -85.755  1.00 56.79  ? 91   VAL D CG1 1 
ATOM 9255  C CG2 . VAL B 2 93   ? -3.594  5.117   -84.190  1.00 57.09  ? 91   VAL D CG2 1 
ATOM 9256  N N   . GLY B 2 94   ? 0.484   5.768   -85.423  1.00 63.08  ? 92   GLY D N   1 
ATOM 9257  C CA  . GLY B 2 94   ? 1.340   6.919   -85.719  1.00 63.20  ? 92   GLY D CA  1 
ATOM 9258  C C   . GLY B 2 94   ? 1.603   7.021   -87.212  1.00 66.07  ? 92   GLY D C   1 
ATOM 9259  O O   . GLY B 2 94   ? 1.523   6.020   -87.928  1.00 70.87  ? 92   GLY D O   1 
ATOM 9260  N N   . PHE B 2 95   ? 1.928   8.225   -87.680  1.00 64.44  ? 93   PHE D N   1 
ATOM 9261  C CA  . PHE B 2 95   ? 2.067   8.499   -89.112  1.00 64.76  ? 93   PHE D CA  1 
ATOM 9262  C C   . PHE B 2 95   ? 3.355   9.247   -89.470  1.00 63.85  ? 93   PHE D C   1 
ATOM 9263  O O   . PHE B 2 95   ? 3.769   10.175  -88.776  1.00 61.93  ? 93   PHE D O   1 
ATOM 9264  C CB  . PHE B 2 95   ? 0.855   9.298   -89.609  1.00 65.97  ? 93   PHE D CB  1 
ATOM 9265  C CG  . PHE B 2 95   ? -0.414  8.492   -89.701  1.00 66.69  ? 93   PHE D CG  1 
ATOM 9266  C CD1 . PHE B 2 95   ? -1.513  8.789   -88.894  1.00 65.93  ? 93   PHE D CD1 1 
ATOM 9267  C CD2 . PHE B 2 95   ? -0.519  7.434   -90.606  1.00 68.82  ? 93   PHE D CD2 1 
ATOM 9268  C CE1 . PHE B 2 95   ? -2.684  8.044   -88.988  1.00 65.71  ? 93   PHE D CE1 1 
ATOM 9269  C CE2 . PHE B 2 95   ? -1.687  6.688   -90.701  1.00 67.23  ? 93   PHE D CE2 1 
ATOM 9270  C CZ  . PHE B 2 95   ? -2.769  6.992   -89.891  1.00 65.23  ? 93   PHE D CZ  1 
ATOM 9271  N N   . HIS B 2 96   ? 3.972   8.826   -90.570  1.00 65.82  ? 94   HIS D N   1 
ATOM 9272  C CA  . HIS B 2 96   ? 5.076   9.547   -91.191  1.00 67.91  ? 94   HIS D CA  1 
ATOM 9273  C C   . HIS B 2 96   ? 4.496   10.788  -91.862  1.00 70.71  ? 94   HIS D C   1 
ATOM 9274  O O   . HIS B 2 96   ? 3.476   10.698  -92.547  1.00 72.60  ? 94   HIS D O   1 
ATOM 9275  C CB  . HIS B 2 96   ? 5.750   8.637   -92.221  1.00 70.22  ? 94   HIS D CB  1 
ATOM 9276  C CG  . HIS B 2 96   ? 7.012   9.189   -92.802  1.00 73.04  ? 94   HIS D CG  1 
ATOM 9277  N ND1 . HIS B 2 96   ? 7.093   9.657   -94.094  1.00 77.26  ? 94   HIS D ND1 1 
ATOM 9278  C CD2 . HIS B 2 96   ? 8.252   9.315   -92.278  1.00 73.57  ? 94   HIS D CD2 1 
ATOM 9279  C CE1 . HIS B 2 96   ? 8.326   10.066  -94.334  1.00 80.26  ? 94   HIS D CE1 1 
ATOM 9280  N NE2 . HIS B 2 96   ? 9.050   9.871   -93.247  1.00 76.93  ? 94   HIS D NE2 1 
ATOM 9281  N N   . GLU B 2 97   ? 5.134   11.939  -91.648  1.00 73.51  ? 95   GLU D N   1 
ATOM 9282  C CA  . GLU B 2 97   ? 4.679   13.237  -92.190  1.00 77.17  ? 95   GLU D CA  1 
ATOM 9283  C C   . GLU B 2 97   ? 4.318   13.226  -93.682  1.00 79.39  ? 95   GLU D C   1 
ATOM 9284  O O   . GLU B 2 97   ? 3.347   13.862  -94.096  1.00 78.02  ? 95   GLU D O   1 
ATOM 9285  C CB  . GLU B 2 97   ? 5.732   14.327  -91.926  1.00 81.38  ? 95   GLU D CB  1 
ATOM 9286  C CG  . GLU B 2 97   ? 7.098   14.085  -92.575  1.00 86.54  ? 95   GLU D CG  1 
ATOM 9287  C CD  . GLU B 2 97   ? 8.095   15.208  -92.334  1.00 87.78  ? 95   GLU D CD  1 
ATOM 9288  O OE1 . GLU B 2 97   ? 7.805   16.122  -91.530  1.00 86.57  ? 95   GLU D OE1 1 
ATOM 9289  O OE2 . GLU B 2 97   ? 9.178   15.173  -92.961  1.00 88.72  ? 95   GLU D OE2 1 
ATOM 9290  N N   . ASP B 2 98   ? 5.101   12.496  -94.474  1.00 81.70  ? 96   ASP D N   1 
ATOM 9291  C CA  . ASP B 2 98   ? 4.883   12.398  -95.916  1.00 87.31  ? 96   ASP D CA  1 
ATOM 9292  C C   . ASP B 2 98   ? 3.674   11.534  -96.302  1.00 85.05  ? 96   ASP D C   1 
ATOM 9293  O O   . ASP B 2 98   ? 3.292   11.505  -97.470  1.00 94.61  ? 96   ASP D O   1 
ATOM 9294  C CB  . ASP B 2 98   ? 6.153   11.891  -96.620  1.00 95.59  ? 96   ASP D CB  1 
ATOM 9295  C CG  . ASP B 2 98   ? 7.346   12.848  -96.469  1.00 99.71  ? 96   ASP D CG  1 
ATOM 9296  O OD1 . ASP B 2 98   ? 7.148   14.053  -96.187  1.00 98.32  ? 96   ASP D OD1 1 
ATOM 9297  O OD2 . ASP B 2 98   ? 8.494   12.391  -96.651  1.00 101.59 ? 96   ASP D OD2 1 
ATOM 9298  N N   . GLY B 2 99   ? 3.093   10.816  -95.342  1.00 77.34  ? 97   GLY D N   1 
ATOM 9299  C CA  . GLY B 2 99   ? 1.802   10.159  -95.532  1.00 74.74  ? 97   GLY D CA  1 
ATOM 9300  C C   . GLY B 2 99   ? 1.836   8.755   -96.113  1.00 74.47  ? 97   GLY D C   1 
ATOM 9301  O O   . GLY B 2 99   ? 0.776   8.181   -96.368  1.00 73.79  ? 97   GLY D O   1 
ATOM 9302  N N   . ARG B 2 100  ? 3.029   8.193   -96.322  1.00 73.89  ? 98   ARG D N   1 
ATOM 9303  C CA  . ARG B 2 100  ? 3.153   6.828   -96.832  1.00 74.75  ? 98   ARG D CA  1 
ATOM 9304  C C   . ARG B 2 100  ? 3.070   5.807   -95.705  1.00 69.51  ? 98   ARG D C   1 
ATOM 9305  O O   . ARG B 2 100  ? 2.254   4.890   -95.752  1.00 68.57  ? 98   ARG D O   1 
ATOM 9306  C CB  . ARG B 2 100  ? 4.465   6.642   -97.594  1.00 80.37  ? 98   ARG D CB  1 
ATOM 9307  C CG  . ARG B 2 100  ? 4.599   5.273   -98.255  1.00 84.69  ? 98   ARG D CG  1 
ATOM 9308  C CD  . ARG B 2 100  ? 5.658   5.269   -99.345  1.00 90.70  ? 98   ARG D CD  1 
ATOM 9309  N NE  . ARG B 2 100  ? 5.966   3.920   -99.815  1.00 92.52  ? 98   ARG D NE  1 
ATOM 9310  C CZ  . ARG B 2 100  ? 6.862   3.627   -100.757 1.00 98.24  ? 98   ARG D CZ  1 
ATOM 9311  N NH1 . ARG B 2 100  ? 7.563   4.587   -101.364 1.00 101.89 ? 98   ARG D NH1 1 
ATOM 9312  N NH2 . ARG B 2 100  ? 7.061   2.357   -101.101 1.00 101.48 ? 98   ARG D NH2 1 
ATOM 9313  N N   . TRP B 2 101  ? 3.921   5.972   -94.698  1.00 66.53  ? 99   TRP D N   1 
ATOM 9314  C CA  . TRP B 2 101  ? 4.084   4.970   -93.641  1.00 63.53  ? 99   TRP D CA  1 
ATOM 9315  C C   . TRP B 2 101  ? 3.156   5.205   -92.443  1.00 59.55  ? 99   TRP D C   1 
ATOM 9316  O O   . TRP B 2 101  ? 3.030   6.329   -91.959  1.00 57.13  ? 99   TRP D O   1 
ATOM 9317  C CB  . TRP B 2 101  ? 5.538   4.939   -93.162  1.00 63.60  ? 99   TRP D CB  1 
ATOM 9318  C CG  . TRP B 2 101  ? 6.534   4.755   -94.266  1.00 66.18  ? 99   TRP D CG  1 
ATOM 9319  C CD1 . TRP B 2 101  ? 7.487   5.641   -94.661  1.00 67.85  ? 99   TRP D CD1 1 
ATOM 9320  C CD2 . TRP B 2 101  ? 6.662   3.619   -95.121  1.00 67.48  ? 99   TRP D CD2 1 
ATOM 9321  N NE1 . TRP B 2 101  ? 8.208   5.126   -95.704  1.00 70.92  ? 99   TRP D NE1 1 
ATOM 9322  C CE2 . TRP B 2 101  ? 7.724   3.883   -96.007  1.00 70.77  ? 99   TRP D CE2 1 
ATOM 9323  C CE3 . TRP B 2 101  ? 5.985   2.397   -95.221  1.00 67.61  ? 99   TRP D CE3 1 
ATOM 9324  C CZ2 . TRP B 2 101  ? 8.127   2.975   -96.986  1.00 74.87  ? 99   TRP D CZ2 1 
ATOM 9325  C CZ3 . TRP B 2 101  ? 6.387   1.490   -96.192  1.00 71.40  ? 99   TRP D CZ3 1 
ATOM 9326  C CH2 . TRP B 2 101  ? 7.449   1.786   -97.065  1.00 75.08  ? 99   TRP D CH2 1 
ATOM 9327  N N   . MET B 2 102  ? 2.507   4.134   -91.987  1.00 59.61  ? 100  MET D N   1 
ATOM 9328  C CA  . MET B 2 102  ? 1.756   4.120   -90.730  1.00 57.97  ? 100  MET D CA  1 
ATOM 9329  C C   . MET B 2 102  ? 2.444   3.162   -89.760  1.00 59.42  ? 100  MET D C   1 
ATOM 9330  O O   . MET B 2 102  ? 2.950   2.111   -90.168  1.00 61.60  ? 100  MET D O   1 
ATOM 9331  C CB  . MET B 2 102  ? 0.309   3.673   -90.958  1.00 57.56  ? 100  MET D CB  1 
ATOM 9332  C CG  . MET B 2 102  ? -0.545  3.634   -89.692  1.00 54.34  ? 100  MET D CG  1 
ATOM 9333  S SD  . MET B 2 102  ? -2.275  3.226   -89.993  1.00 55.30  ? 100  MET D SD  1 
ATOM 9334  C CE  . MET B 2 102  ? -2.154  1.478   -90.339  1.00 56.96  ? 100  MET D CE  1 
ATOM 9335  N N   . TYR B 2 103  ? 2.432   3.528   -88.479  1.00 58.10  ? 101  TYR D N   1 
ATOM 9336  C CA  . TYR B 2 103  ? 3.118   2.786   -87.418  1.00 57.71  ? 101  TYR D CA  1 
ATOM 9337  C C   . TYR B 2 103  ? 2.097   2.340   -86.386  1.00 56.06  ? 101  TYR D C   1 
ATOM 9338  O O   . TYR B 2 103  ? 1.193   3.099   -86.058  1.00 56.46  ? 101  TYR D O   1 
ATOM 9339  C CB  . TYR B 2 103  ? 4.180   3.669   -86.758  1.00 56.89  ? 101  TYR D CB  1 
ATOM 9340  C CG  . TYR B 2 103  ? 5.180   4.234   -87.741  1.00 61.22  ? 101  TYR D CG  1 
ATOM 9341  C CD1 . TYR B 2 103  ? 4.990   5.490   -88.318  1.00 63.87  ? 101  TYR D CD1 1 
ATOM 9342  C CD2 . TYR B 2 103  ? 6.306   3.505   -88.115  1.00 65.00  ? 101  TYR D CD2 1 
ATOM 9343  C CE1 . TYR B 2 103  ? 5.901   6.008   -89.232  1.00 68.33  ? 101  TYR D CE1 1 
ATOM 9344  C CE2 . TYR B 2 103  ? 7.225   4.014   -89.027  1.00 70.01  ? 101  TYR D CE2 1 
ATOM 9345  C CZ  . TYR B 2 103  ? 7.020   5.268   -89.584  1.00 71.15  ? 101  TYR D CZ  1 
ATOM 9346  O OH  . TYR B 2 103  ? 7.923   5.782   -90.493  1.00 75.20  ? 101  TYR D OH  1 
ATOM 9347  N N   . THR B 2 104  ? 2.228   1.111   -85.888  1.00 55.95  ? 102  THR D N   1 
ATOM 9348  C CA  . THR B 2 104  ? 1.302   0.576   -84.883  1.00 53.61  ? 102  THR D CA  1 
ATOM 9349  C C   . THR B 2 104  ? 2.022   -0.261  -83.841  1.00 53.53  ? 102  THR D C   1 
ATOM 9350  O O   . THR B 2 104  ? 2.851   -1.096  -84.195  1.00 54.70  ? 102  THR D O   1 
ATOM 9351  C CB  . THR B 2 104  ? 0.226   -0.343  -85.502  1.00 55.30  ? 102  THR D CB  1 
ATOM 9352  O OG1 . THR B 2 104  ? 0.835   -1.553  -85.983  1.00 58.17  ? 102  THR D OG1 1 
ATOM 9353  C CG2 . THR B 2 104  ? -0.537  0.355   -86.627  1.00 55.78  ? 102  THR D CG2 1 
ATOM 9354  N N   . GLY B 2 105  ? 1.680   -0.047  -82.569  1.00 52.20  ? 103  GLY D N   1 
ATOM 9355  C CA  . GLY B 2 105  ? 2.101   -0.922  -81.464  1.00 51.82  ? 103  GLY D CA  1 
ATOM 9356  C C   . GLY B 2 105  ? 0.967   -1.850  -81.059  1.00 49.89  ? 103  GLY D C   1 
ATOM 9357  O O   . GLY B 2 105  ? -0.182  -1.409  -80.965  1.00 46.81  ? 103  GLY D O   1 
ATOM 9358  N N   . GLY B 2 106  ? 1.283   -3.123  -80.806  1.00 50.86  ? 104  GLY D N   1 
ATOM 9359  C CA  . GLY B 2 106  ? 0.260   -4.142  -80.528  1.00 54.12  ? 104  GLY D CA  1 
ATOM 9360  C C   . GLY B 2 106  ? 0.457   -4.960  -79.259  1.00 54.81  ? 104  GLY D C   1 
ATOM 9361  O O   . GLY B 2 106  ? 1.580   -5.116  -78.787  1.00 55.99  ? 104  GLY D O   1 
ATOM 9362  N N   . GLU B 2 107  ? -0.648  -5.477  -78.711  1.00 54.40  ? 105  GLU D N   1 
ATOM 9363  C CA  . GLU B 2 107  ? -0.620  -6.489  -77.634  1.00 56.60  ? 105  GLU D CA  1 
ATOM 9364  C C   . GLU B 2 107  ? 0.175   -7.732  -78.041  1.00 58.19  ? 105  GLU D C   1 
ATOM 9365  O O   . GLU B 2 107  ? 0.770   -8.405  -77.200  1.00 58.20  ? 105  GLU D O   1 
ATOM 9366  C CB  . GLU B 2 107  ? -2.038  -6.946  -77.245  1.00 60.75  ? 105  GLU D CB  1 
ATOM 9367  C CG  . GLU B 2 107  ? -2.717  -6.163  -76.129  1.00 63.07  ? 105  GLU D CG  1 
ATOM 9368  C CD  . GLU B 2 107  ? -3.827  -6.968  -75.460  1.00 63.32  ? 105  GLU D CD  1 
ATOM 9369  O OE1 . GLU B 2 107  ? -3.509  -7.778  -74.562  1.00 67.08  ? 105  GLU D OE1 1 
ATOM 9370  O OE2 . GLU B 2 107  ? -5.011  -6.802  -75.828  1.00 60.01  ? 105  GLU D OE2 1 
ATOM 9371  N N   . ASP B 2 108  ? 0.163   -8.037  -79.336  1.00 59.54  ? 106  ASP D N   1 
ATOM 9372  C CA  . ASP B 2 108  ? 1.002   -9.091  -79.911  1.00 62.03  ? 106  ASP D CA  1 
ATOM 9373  C C   . ASP B 2 108  ? 2.512   -8.785  -79.937  1.00 61.52  ? 106  ASP D C   1 
ATOM 9374  O O   . ASP B 2 108  ? 3.260   -9.473  -80.625  1.00 63.57  ? 106  ASP D O   1 
ATOM 9375  C CB  . ASP B 2 108  ? 0.514   -9.434  -81.324  1.00 66.15  ? 106  ASP D CB  1 
ATOM 9376  C CG  . ASP B 2 108  ? 0.616   -8.261  -82.284  1.00 68.74  ? 106  ASP D CG  1 
ATOM 9377  O OD1 . ASP B 2 108  ? 1.304   -8.415  -83.309  1.00 70.76  ? 106  ASP D OD1 1 
ATOM 9378  O OD2 . ASP B 2 108  ? 0.011   -7.194  -82.015  1.00 67.43  ? 106  ASP D OD2 1 
ATOM 9379  N N   . CYS B 2 109  ? 2.952   -7.759  -79.204  1.00 61.53  ? 107  CYS D N   1 
ATOM 9380  C CA  . CYS B 2 109  ? 4.370   -7.483  -78.950  1.00 62.54  ? 107  CYS D CA  1 
ATOM 9381  C C   . CYS B 2 109  ? 5.129   -7.077  -80.214  1.00 63.89  ? 107  CYS D C   1 
ATOM 9382  O O   . CYS B 2 109  ? 6.299   -7.417  -80.374  1.00 66.29  ? 107  CYS D O   1 
ATOM 9383  C CB  . CYS B 2 109  ? 5.051   -8.682  -78.272  1.00 64.32  ? 107  CYS D CB  1 
ATOM 9384  S SG  . CYS B 2 109  ? 4.110   -9.422  -76.924  1.00 63.40  ? 107  CYS D SG  1 
ATOM 9385  N N   . THR B 2 110  ? 4.460   -6.335  -81.094  1.00 63.90  ? 108  THR D N   1 
ATOM 9386  C CA  . THR B 2 110  ? 5.041   -5.925  -82.366  1.00 65.57  ? 108  THR D CA  1 
ATOM 9387  C C   . THR B 2 110  ? 4.769   -4.459  -82.677  1.00 63.42  ? 108  THR D C   1 
ATOM 9388  O O   . THR B 2 110  ? 3.614   -4.008  -82.644  1.00 61.02  ? 108  THR D O   1 
ATOM 9389  C CB  . THR B 2 110  ? 4.468   -6.748  -83.527  1.00 67.61  ? 108  THR D CB  1 
ATOM 9390  O OG1 . THR B 2 110  ? 3.038   -6.650  -83.513  1.00 66.10  ? 108  THR D OG1 1 
ATOM 9391  C CG2 . THR B 2 110  ? 4.901   -8.198  -83.419  1.00 71.06  ? 108  THR D CG2 1 
ATOM 9392  N N   . ALA B 2 111  ? 5.850   -3.730  -82.955  1.00 62.26  ? 109  ALA D N   1 
ATOM 9393  C CA  . ALA B 2 111  ? 5.781   -2.443  -83.631  1.00 60.81  ? 109  ALA D CA  1 
ATOM 9394  C C   . ALA B 2 111  ? 5.855   -2.733  -85.126  1.00 59.77  ? 109  ALA D C   1 
ATOM 9395  O O   . ALA B 2 111  ? 6.854   -3.274  -85.601  1.00 59.96  ? 109  ALA D O   1 
ATOM 9396  C CB  . ALA B 2 111  ? 6.927   -1.541  -83.200  1.00 62.82  ? 109  ALA D CB  1 
ATOM 9397  N N   . ARG B 2 112  ? 4.795   -2.385  -85.854  1.00 59.10  ? 110  ARG D N   1 
ATOM 9398  C CA  . ARG B 2 112  ? 4.671   -2.700  -87.276  1.00 62.45  ? 110  ARG D CA  1 
ATOM 9399  C C   . ARG B 2 112  ? 4.617   -1.429  -88.133  1.00 61.93  ? 110  ARG D C   1 
ATOM 9400  O O   . ARG B 2 112  ? 3.951   -0.458  -87.764  1.00 56.61  ? 110  ARG D O   1 
ATOM 9401  C CB  . ARG B 2 112  ? 3.414   -3.543  -87.502  1.00 63.82  ? 110  ARG D CB  1 
ATOM 9402  C CG  . ARG B 2 112  ? 3.516   -4.971  -86.979  1.00 65.88  ? 110  ARG D CG  1 
ATOM 9403  C CD  . ARG B 2 112  ? 2.189   -5.704  -87.113  1.00 66.91  ? 110  ARG D CD  1 
ATOM 9404  N NE  . ARG B 2 112  ? 2.354   -7.066  -87.635  1.00 70.62  ? 110  ARG D NE  1 
ATOM 9405  C CZ  . ARG B 2 112  ? 2.421   -8.189  -86.917  1.00 72.32  ? 110  ARG D CZ  1 
ATOM 9406  N NH1 . ARG B 2 112  ? 2.343   -8.179  -85.590  1.00 71.04  ? 110  ARG D NH1 1 
ATOM 9407  N NH2 . ARG B 2 112  ? 2.564   -9.355  -87.544  1.00 77.00  ? 110  ARG D NH2 1 
ATOM 9408  N N   . ILE B 2 113  ? 5.320   -1.448  -89.270  1.00 65.11  ? 111  ILE D N   1 
ATOM 9409  C CA  . ILE B 2 113  ? 5.291   -0.347  -90.241  1.00 65.53  ? 111  ILE D CA  1 
ATOM 9410  C C   . ILE B 2 113  ? 4.445   -0.778  -91.432  1.00 67.03  ? 111  ILE D C   1 
ATOM 9411  O O   . ILE B 2 113  ? 4.788   -1.744  -92.109  1.00 72.16  ? 111  ILE D O   1 
ATOM 9412  C CB  . ILE B 2 113  ? 6.697   0.047   -90.748  1.00 67.75  ? 111  ILE D CB  1 
ATOM 9413  C CG1 . ILE B 2 113  ? 7.666   0.247   -89.571  1.00 67.69  ? 111  ILE D CG1 1 
ATOM 9414  C CG2 . ILE B 2 113  ? 6.603   1.319   -91.585  1.00 67.77  ? 111  ILE D CG2 1 
ATOM 9415  C CD1 . ILE B 2 113  ? 9.112   0.477   -89.965  1.00 70.48  ? 111  ILE D CD1 1 
ATOM 9416  N N   . TRP B 2 114  ? 3.360   -0.049  -91.687  1.00 65.59  ? 112  TRP D N   1 
ATOM 9417  C CA  . TRP B 2 114  ? 2.410   -0.379  -92.755  1.00 68.36  ? 112  TRP D CA  1 
ATOM 9418  C C   . TRP B 2 114  ? 2.593   0.532   -93.971  1.00 70.32  ? 112  TRP D C   1 
ATOM 9419  O O   . TRP B 2 114  ? 2.731   1.744   -93.821  1.00 69.27  ? 112  TRP D O   1 
ATOM 9420  C CB  . TRP B 2 114  ? 0.976   -0.237  -92.245  1.00 67.17  ? 112  TRP D CB  1 
ATOM 9421  C CG  . TRP B 2 114  ? 0.660   -1.089  -91.060  1.00 68.04  ? 112  TRP D CG  1 
ATOM 9422  C CD1 . TRP B 2 114  ? 0.889   -0.788  -89.746  1.00 66.29  ? 112  TRP D CD1 1 
ATOM 9423  C CD2 . TRP B 2 114  ? 0.048   -2.385  -91.074  1.00 70.16  ? 112  TRP D CD2 1 
ATOM 9424  N NE1 . TRP B 2 114  ? 0.462   -1.821  -88.942  1.00 64.74  ? 112  TRP D NE1 1 
ATOM 9425  C CE2 . TRP B 2 114  ? -0.060  -2.812  -89.730  1.00 66.54  ? 112  TRP D CE2 1 
ATOM 9426  C CE3 . TRP B 2 114  ? -0.415  -3.230  -92.093  1.00 73.55  ? 112  TRP D CE3 1 
ATOM 9427  C CZ2 . TRP B 2 114  ? -0.615  -4.047  -89.378  1.00 66.72  ? 112  TRP D CZ2 1 
ATOM 9428  C CZ3 . TRP B 2 114  ? -0.965  -4.462  -91.742  1.00 73.84  ? 112  TRP D CZ3 1 
ATOM 9429  C CH2 . TRP B 2 114  ? -1.060  -4.856  -90.394  1.00 71.14  ? 112  TRP D CH2 1 
ATOM 9430  N N   . ASP B 2 115  ? 2.579   -0.058  -95.168  1.00 73.08  ? 113  ASP D N   1 
ATOM 9431  C CA  . ASP B 2 115  ? 2.613   0.698   -96.422  1.00 75.05  ? 113  ASP D CA  1 
ATOM 9432  C C   . ASP B 2 115  ? 1.174   1.041   -96.848  1.00 74.65  ? 113  ASP D C   1 
ATOM 9433  O O   . ASP B 2 115  ? 0.420   0.169   -97.296  1.00 74.54  ? 113  ASP D O   1 
ATOM 9434  C CB  . ASP B 2 115  ? 3.342   -0.111  -97.508  1.00 78.79  ? 113  ASP D CB  1 
ATOM 9435  C CG  . ASP B 2 115  ? 3.845   0.755   -98.671  1.00 80.92  ? 113  ASP D CG  1 
ATOM 9436  O OD1 . ASP B 2 115  ? 3.352   1.892   -98.860  1.00 79.77  ? 113  ASP D OD1 1 
ATOM 9437  O OD2 . ASP B 2 115  ? 4.747   0.287   -99.402  1.00 82.44  ? 113  ASP D OD2 1 
ATOM 9438  N N   . LEU B 2 116  ? 0.805   2.314   -96.692  1.00 73.78  ? 114  LEU D N   1 
ATOM 9439  C CA  . LEU B 2 116  ? -0.549  2.791   -97.002  1.00 74.94  ? 114  LEU D CA  1 
ATOM 9440  C C   . LEU B 2 116  ? -0.807  2.898   -98.497  1.00 83.04  ? 114  LEU D C   1 
ATOM 9441  O O   . LEU B 2 116  ? -1.948  2.745   -98.935  1.00 85.94  ? 114  LEU D O   1 
ATOM 9442  C CB  . LEU B 2 116  ? -0.808  4.154   -96.364  1.00 72.25  ? 114  LEU D CB  1 
ATOM 9443  C CG  . LEU B 2 116  ? -0.725  4.225   -94.837  1.00 69.73  ? 114  LEU D CG  1 
ATOM 9444  C CD1 . LEU B 2 116  ? -0.677  5.675   -94.378  1.00 69.58  ? 114  LEU D CD1 1 
ATOM 9445  C CD2 . LEU B 2 116  ? -1.890  3.495   -94.186  1.00 66.79  ? 114  LEU D CD2 1 
ATOM 9446  N N   . ARG B 2 117  ? 0.247   3.167   -99.270  1.00 89.36  ? 115  ARG D N   1 
ATOM 9447  C CA  . ARG B 2 117  ? 0.170   3.191   -100.735 1.00 96.24  ? 115  ARG D CA  1 
ATOM 9448  C C   . ARG B 2 117  ? 0.610   1.849   -101.344 1.00 98.79  ? 115  ARG D C   1 
ATOM 9449  O O   . ARG B 2 117  ? 1.302   1.818   -102.365 1.00 102.75 ? 115  ARG D O   1 
ATOM 9450  C CB  . ARG B 2 117  ? 1.019   4.343   -101.283 1.00 101.71 ? 115  ARG D CB  1 
ATOM 9451  C CG  . ARG B 2 117  ? 0.576   5.713   -100.798 1.00 104.24 ? 115  ARG D CG  1 
ATOM 9452  C CD  . ARG B 2 117  ? 1.639   6.770   -101.038 1.00 113.86 ? 115  ARG D CD  1 
ATOM 9453  N NE  . ARG B 2 117  ? 1.422   7.956   -100.208 1.00 120.98 ? 115  ARG D NE  1 
ATOM 9454  C CZ  . ARG B 2 117  ? 2.249   9.001   -100.126 1.00 132.56 ? 115  ARG D CZ  1 
ATOM 9455  N NH1 . ARG B 2 117  ? 3.383   9.045   -100.831 1.00 141.14 ? 115  ARG D NH1 1 
ATOM 9456  N NH2 . ARG B 2 117  ? 1.938   10.021  -99.328  1.00 131.76 ? 115  ARG D NH2 1 
ATOM 9457  N N   . SER B 2 118  ? 0.214   0.746   -100.704 1.00 97.34  ? 116  SER D N   1 
ATOM 9458  C CA  . SER B 2 118  ? 0.412   -0.601  -101.234 1.00 101.78 ? 116  SER D CA  1 
ATOM 9459  C C   . SER B 2 118  ? -0.762  -1.481  -100.822 1.00 102.10 ? 116  SER D C   1 
ATOM 9460  O O   . SER B 2 118  ? -1.301  -1.334  -99.721  1.00 99.75  ? 116  SER D O   1 
ATOM 9461  C CB  . SER B 2 118  ? 1.719   -1.209  -100.722 1.00 102.11 ? 116  SER D CB  1 
ATOM 9462  O OG  . SER B 2 118  ? 1.974   -2.468  -101.325 1.00 104.77 ? 116  SER D OG  1 
ATOM 9463  N N   . ARG B 2 119  ? -1.142  -2.395  -101.710 1.00 106.98 ? 117  ARG D N   1 
ATOM 9464  C CA  . ARG B 2 119  ? -2.303  -3.262  -101.498 1.00 107.14 ? 117  ARG D CA  1 
ATOM 9465  C C   . ARG B 2 119  ? -2.099  -4.353  -100.453 1.00 106.61 ? 117  ARG D C   1 
ATOM 9466  O O   . ARG B 2 119  ? -3.082  -4.859  -99.912  1.00 111.27 ? 117  ARG D O   1 
ATOM 9467  C CB  . ARG B 2 119  ? -2.735  -3.923  -102.812 1.00 112.42 ? 117  ARG D CB  1 
ATOM 9468  C CG  . ARG B 2 119  ? -3.479  -2.994  -103.754 1.00 115.75 ? 117  ARG D CG  1 
ATOM 9469  C CD  . ARG B 2 119  ? -4.270  -3.773  -104.790 1.00 122.91 ? 117  ARG D CD  1 
ATOM 9470  N NE  . ARG B 2 119  ? -5.374  -2.986  -105.331 1.00 126.63 ? 117  ARG D NE  1 
ATOM 9471  C CZ  . ARG B 2 119  ? -6.348  -3.465  -106.105 1.00 135.82 ? 117  ARG D CZ  1 
ATOM 9472  N NH1 . ARG B 2 119  ? -6.388  -4.752  -106.465 1.00 138.78 ? 117  ARG D NH1 1 
ATOM 9473  N NH2 . ARG B 2 119  ? -7.299  -2.642  -106.531 1.00 140.10 ? 117  ARG D NH2 1 
ATOM 9474  N N   . ASN B 2 120  ? -0.844  -4.718  -100.180 1.00 105.67 ? 118  ASN D N   1 
ATOM 9475  C CA  . ASN B 2 120  ? -0.534  -5.868  -99.319  1.00 105.99 ? 118  ASN D CA  1 
ATOM 9476  C C   . ASN B 2 120  ? -1.294  -5.835  -97.988  1.00 104.74 ? 118  ASN D C   1 
ATOM 9477  O O   . ASN B 2 120  ? -1.312  -4.812  -97.297  1.00 101.56 ? 118  ASN D O   1 
ATOM 9478  C CB  . ASN B 2 120  ? 0.976   -5.968  -99.065  1.00 104.85 ? 118  ASN D CB  1 
ATOM 9479  C CG  . ASN B 2 120  ? 1.741   -6.448  -100.283 1.00 111.16 ? 118  ASN D CG  1 
ATOM 9480  O OD1 . ASN B 2 120  ? 1.540   -7.567  -100.755 1.00 115.48 ? 118  ASN D OD1 1 
ATOM 9481  N ND2 . ASN B 2 120  ? 2.625   -5.602  -100.799 1.00 114.96 ? 118  ASN D ND2 1 
ATOM 9482  N N   . LEU B 2 121  ? -1.938  -6.956  -97.660  1.00 108.74 ? 119  LEU D N   1 
ATOM 9483  C CA  . LEU B 2 121  ? -2.712  -7.093  -96.421  1.00 107.37 ? 119  LEU D CA  1 
ATOM 9484  C C   . LEU B 2 121  ? -1.787  -7.179  -95.205  1.00 103.72 ? 119  LEU D C   1 
ATOM 9485  O O   . LEU B 2 121  ? -2.118  -6.665  -94.136  1.00 94.23  ? 119  LEU D O   1 
ATOM 9486  C CB  . LEU B 2 121  ? -3.625  -8.328  -96.480  1.00 108.25 ? 119  LEU D CB  1 
ATOM 9487  C CG  . LEU B 2 121  ? -4.631  -8.433  -97.637  1.00 108.37 ? 119  LEU D CG  1 
ATOM 9488  C CD1 . LEU B 2 121  ? -5.413  -9.732  -97.527  1.00 109.15 ? 119  LEU D CD1 1 
ATOM 9489  C CD2 . LEU B 2 121  ? -5.585  -7.248  -97.681  1.00 108.11 ? 119  LEU D CD2 1 
ATOM 9490  N N   . GLN B 2 122  ? -0.639  -7.836  -95.383  1.00 107.88 ? 120  GLN D N   1 
ATOM 9491  C CA  . GLN B 2 122  ? 0.426   -7.864  -94.375  1.00 105.87 ? 120  GLN D CA  1 
ATOM 9492  C C   . GLN B 2 122  ? 1.181   -6.531  -94.356  1.00 98.95  ? 120  GLN D C   1 
ATOM 9493  O O   . GLN B 2 122  ? 1.107   -5.750  -95.305  1.00 97.96  ? 120  GLN D O   1 
ATOM 9494  C CB  . GLN B 2 122  ? 1.400   -9.020  -94.650  1.00 110.22 ? 120  GLN D CB  1 
ATOM 9495  C CG  . GLN B 2 122  ? 0.765   -10.404 -94.566  1.00 114.71 ? 120  GLN D CG  1 
ATOM 9496  C CD  . GLN B 2 122  ? 1.739   -11.532 -94.867  1.00 121.46 ? 120  GLN D CD  1 
ATOM 9497  O OE1 . GLN B 2 122  ? 2.645   -11.390 -95.689  1.00 126.06 ? 120  GLN D OE1 1 
ATOM 9498  N NE2 . GLN B 2 122  ? 1.545   -12.670 -94.207  1.00 123.82 ? 120  GLN D NE2 1 
ATOM 9499  N N   . CYS B 2 123  ? 1.908   -6.285  -93.270  1.00 94.19  ? 121  CYS D N   1 
ATOM 9500  C CA  . CYS B 2 123  ? 2.682   -5.051  -93.108  1.00 90.55  ? 121  CYS D CA  1 
ATOM 9501  C C   . CYS B 2 123  ? 4.068   -5.160  -93.749  1.00 89.43  ? 121  CYS D C   1 
ATOM 9502  O O   . CYS B 2 123  ? 4.510   -6.250  -94.121  1.00 91.62  ? 121  CYS D O   1 
ATOM 9503  C CB  . CYS B 2 123  ? 2.815   -4.701  -91.626  1.00 88.38  ? 121  CYS D CB  1 
ATOM 9504  S SG  . CYS B 2 123  ? 3.771   -5.890  -90.665  1.00 92.69  ? 121  CYS D SG  1 
ATOM 9505  N N   . GLN B 2 124  ? 4.745   -4.019  -93.856  1.00 86.71  ? 122  GLN D N   1 
ATOM 9506  C CA  . GLN B 2 124  ? 6.048   -3.930  -94.517  1.00 87.42  ? 122  GLN D CA  1 
ATOM 9507  C C   . GLN B 2 124  ? 7.163   -4.483  -93.626  1.00 82.85  ? 122  GLN D C   1 
ATOM 9508  O O   . GLN B 2 124  ? 7.874   -5.399  -94.026  1.00 85.30  ? 122  GLN D O   1 
ATOM 9509  C CB  . GLN B 2 124  ? 6.336   -2.478  -94.930  1.00 91.22  ? 122  GLN D CB  1 
ATOM 9510  C CG  . GLN B 2 124  ? 7.327   -2.321  -96.083  1.00 101.54 ? 122  GLN D CG  1 
ATOM 9511  C CD  . GLN B 2 124  ? 8.760   -2.072  -95.635  1.00 105.88 ? 122  GLN D CD  1 
ATOM 9512  O OE1 . GLN B 2 124  ? 9.022   -1.191  -94.814  1.00 105.67 ? 122  GLN D OE1 1 
ATOM 9513  N NE2 . GLN B 2 124  ? 9.699   -2.832  -96.198  1.00 110.53 ? 122  GLN D NE2 1 
ATOM 9514  N N   . ARG B 2 125  ? 7.293   -3.935  -92.418  1.00 80.28  ? 123  ARG D N   1 
ATOM 9515  C CA  . ARG B 2 125  ? 8.315   -4.362  -91.443  1.00 79.80  ? 123  ARG D CA  1 
ATOM 9516  C C   . ARG B 2 125  ? 7.716   -4.636  -90.059  1.00 75.67  ? 123  ARG D C   1 
ATOM 9517  O O   . ARG B 2 125  ? 6.663   -4.093  -89.706  1.00 69.93  ? 123  ARG D O   1 
ATOM 9518  C CB  . ARG B 2 125  ? 9.410   -3.302  -91.323  1.00 79.71  ? 123  ARG D CB  1 
ATOM 9519  C CG  . ARG B 2 125  ? 10.393  -3.298  -92.480  1.00 84.70  ? 123  ARG D CG  1 
ATOM 9520  C CD  . ARG B 2 125  ? 11.136  -1.974  -92.579  1.00 85.29  ? 123  ARG D CD  1 
ATOM 9521  N NE  . ARG B 2 125  ? 12.110  -1.786  -91.505  1.00 83.00  ? 123  ARG D NE  1 
ATOM 9522  C CZ  . ARG B 2 125  ? 12.760  -0.648  -91.248  1.00 81.16  ? 123  ARG D CZ  1 
ATOM 9523  N NH1 . ARG B 2 125  ? 12.553  0.455   -91.975  1.00 79.72  ? 123  ARG D NH1 1 
ATOM 9524  N NH2 . ARG B 2 125  ? 13.629  -0.609  -90.241  1.00 81.25  ? 123  ARG D NH2 1 
ATOM 9525  N N   . ILE B 2 126  ? 8.408   -5.484  -89.293  1.00 76.44  ? 124  ILE D N   1 
ATOM 9526  C CA  . ILE B 2 126  ? 7.988   -5.913  -87.950  1.00 72.66  ? 124  ILE D CA  1 
ATOM 9527  C C   . ILE B 2 126  ? 9.178   -5.805  -86.994  1.00 71.58  ? 124  ILE D C   1 
ATOM 9528  O O   . ILE B 2 126  ? 10.224  -6.416  -87.238  1.00 76.64  ? 124  ILE D O   1 
ATOM 9529  C CB  . ILE B 2 126  ? 7.488   -7.382  -87.951  1.00 74.54  ? 124  ILE D CB  1 
ATOM 9530  C CG1 . ILE B 2 126  ? 6.257   -7.548  -88.852  1.00 77.71  ? 124  ILE D CG1 1 
ATOM 9531  C CG2 . ILE B 2 126  ? 7.136   -7.859  -86.543  1.00 70.65  ? 124  ILE D CG2 1 
ATOM 9532  C CD1 . ILE B 2 126  ? 6.060   -8.961  -89.366  1.00 83.80  ? 124  ILE D CD1 1 
ATOM 9533  N N   . PHE B 2 127  ? 9.008   -5.035  -85.918  1.00 66.96  ? 125  PHE D N   1 
ATOM 9534  C CA  . PHE B 2 127  ? 9.957   -4.988  -84.798  1.00 66.74  ? 125  PHE D CA  1 
ATOM 9535  C C   . PHE B 2 127  ? 9.300   -5.656  -83.585  1.00 65.67  ? 125  PHE D C   1 
ATOM 9536  O O   . PHE B 2 127  ? 8.425   -5.066  -82.940  1.00 62.11  ? 125  PHE D O   1 
ATOM 9537  C CB  . PHE B 2 127  ? 10.355  -3.536  -84.491  1.00 64.37  ? 125  PHE D CB  1 
ATOM 9538  C CG  . PHE B 2 127  ? 11.223  -3.379  -83.265  1.00 64.32  ? 125  PHE D CG  1 
ATOM 9539  C CD1 . PHE B 2 127  ? 12.506  -3.926  -83.223  1.00 67.77  ? 125  PHE D CD1 1 
ATOM 9540  C CD2 . PHE B 2 127  ? 10.766  -2.673  -82.152  1.00 61.92  ? 125  PHE D CD2 1 
ATOM 9541  C CE1 . PHE B 2 127  ? 13.310  -3.781  -82.097  1.00 67.12  ? 125  PHE D CE1 1 
ATOM 9542  C CE2 . PHE B 2 127  ? 11.568  -2.525  -81.025  1.00 61.91  ? 125  PHE D CE2 1 
ATOM 9543  C CZ  . PHE B 2 127  ? 12.840  -3.080  -80.998  1.00 63.89  ? 125  PHE D CZ  1 
ATOM 9544  N N   . GLN B 2 128  ? 9.719   -6.887  -83.291  1.00 68.26  ? 126  GLN D N   1 
ATOM 9545  C CA  . GLN B 2 128  ? 9.137   -7.679  -82.205  1.00 67.64  ? 126  GLN D CA  1 
ATOM 9546  C C   . GLN B 2 128  ? 9.930   -7.521  -80.906  1.00 65.78  ? 126  GLN D C   1 
ATOM 9547  O O   . GLN B 2 128  ? 11.152  -7.661  -80.902  1.00 67.38  ? 126  GLN D O   1 
ATOM 9548  C CB  . GLN B 2 128  ? 9.064   -9.157  -82.605  1.00 72.26  ? 126  GLN D CB  1 
ATOM 9549  C CG  . GLN B 2 128  ? 8.401   -10.053 -81.563  1.00 72.79  ? 126  GLN D CG  1 
ATOM 9550  C CD  . GLN B 2 128  ? 7.638   -11.216 -82.170  1.00 75.50  ? 126  GLN D CD  1 
ATOM 9551  O OE1 . GLN B 2 128  ? 8.083   -11.826 -83.141  1.00 80.03  ? 126  GLN D OE1 1 
ATOM 9552  N NE2 . GLN B 2 128  ? 6.480   -11.528 -81.598  1.00 75.43  ? 126  GLN D NE2 1 
ATOM 9553  N N   . VAL B 2 129  ? 9.214   -7.241  -79.815  1.00 63.13  ? 127  VAL D N   1 
ATOM 9554  C CA  . VAL B 2 129  ? 9.795   -7.106  -78.470  1.00 63.27  ? 127  VAL D CA  1 
ATOM 9555  C C   . VAL B 2 129  ? 9.236   -8.217  -77.568  1.00 63.71  ? 127  VAL D C   1 
ATOM 9556  O O   . VAL B 2 129  ? 8.496   -9.077  -78.044  1.00 64.01  ? 127  VAL D O   1 
ATOM 9557  C CB  . VAL B 2 129  ? 9.550   -5.694  -77.866  1.00 61.23  ? 127  VAL D CB  1 
ATOM 9558  C CG1 . VAL B 2 129  ? 10.087  -4.613  -78.794  1.00 61.43  ? 127  VAL D CG1 1 
ATOM 9559  C CG2 . VAL B 2 129  ? 8.079   -5.446  -77.564  1.00 59.06  ? 127  VAL D CG2 1 
ATOM 9560  N N   . ASN B 2 130  ? 9.599   -8.209  -76.283  1.00 66.18  ? 128  ASN D N   1 
ATOM 9561  C CA  . ASN B 2 130  ? 9.168   -9.261  -75.348  1.00 68.99  ? 128  ASN D CA  1 
ATOM 9562  C C   . ASN B 2 130  ? 7.738   -9.062  -74.859  1.00 66.77  ? 128  ASN D C   1 
ATOM 9563  O O   . ASN B 2 130  ? 6.859   -9.862  -75.167  1.00 74.84  ? 128  ASN D O   1 
ATOM 9564  C CB  . ASN B 2 130  ? 10.126  -9.384  -74.155  1.00 71.59  ? 128  ASN D CB  1 
ATOM 9565  C CG  . ASN B 2 130  ? 11.325  -10.253 -74.469  1.00 77.07  ? 128  ASN D CG  1 
ATOM 9566  O OD1 . ASN B 2 130  ? 12.329  -9.781  -75.002  1.00 79.99  ? 128  ASN D OD1 1 
ATOM 9567  N ND2 . ASN B 2 130  ? 11.223  -11.536 -74.145  1.00 81.24  ? 128  ASN D ND2 1 
ATOM 9568  N N   . ALA B 2 131  ? 7.508   -8.001  -74.098  1.00 61.14  ? 129  ALA D N   1 
ATOM 9569  C CA  . ALA B 2 131  ? 6.180   -7.733  -73.553  1.00 58.64  ? 129  ALA D CA  1 
ATOM 9570  C C   . ALA B 2 131  ? 5.252   -7.102  -74.604  1.00 54.45  ? 129  ALA D C   1 
ATOM 9571  O O   . ALA B 2 131  ? 5.708   -6.691  -75.668  1.00 54.69  ? 129  ALA D O   1 
ATOM 9572  C CB  . ALA B 2 131  ? 6.293   -6.825  -72.345  1.00 59.73  ? 129  ALA D CB  1 
ATOM 9573  N N   . PRO B 2 132  ? 3.937   -7.046  -74.318  1.00 50.98  ? 130  PRO D N   1 
ATOM 9574  C CA  . PRO B 2 132  ? 3.029   -6.290  -75.177  1.00 49.57  ? 130  PRO D CA  1 
ATOM 9575  C C   . PRO B 2 132  ? 3.374   -4.802  -75.246  1.00 48.46  ? 130  PRO D C   1 
ATOM 9576  O O   . PRO B 2 132  ? 3.746   -4.217  -74.233  1.00 46.99  ? 130  PRO D O   1 
ATOM 9577  C CB  . PRO B 2 132  ? 1.651   -6.487  -74.518  1.00 48.33  ? 130  PRO D CB  1 
ATOM 9578  C CG  . PRO B 2 132  ? 1.866   -7.309  -73.300  1.00 49.34  ? 130  PRO D CG  1 
ATOM 9579  C CD  . PRO B 2 132  ? 3.204   -7.951  -73.418  1.00 51.96  ? 130  PRO D CD  1 
ATOM 9580  N N   . ILE B 2 133  ? 3.238   -4.216  -76.435  1.00 49.42  ? 131  ILE D N   1 
ATOM 9581  C CA  . ILE B 2 133  ? 3.501   -2.792  -76.668  1.00 48.64  ? 131  ILE D CA  1 
ATOM 9582  C C   . ILE B 2 133  ? 2.221   -1.984  -76.435  1.00 45.41  ? 131  ILE D C   1 
ATOM 9583  O O   . ILE B 2 133  ? 1.191   -2.261  -77.050  1.00 42.89  ? 131  ILE D O   1 
ATOM 9584  C CB  . ILE B 2 133  ? 4.060   -2.556  -78.097  1.00 51.85  ? 131  ILE D CB  1 
ATOM 9585  C CG1 . ILE B 2 133  ? 5.476   -3.138  -78.202  1.00 55.99  ? 131  ILE D CG1 1 
ATOM 9586  C CG2 . ILE B 2 133  ? 4.098   -1.070  -78.461  1.00 49.69  ? 131  ILE D CG2 1 
ATOM 9587  C CD1 . ILE B 2 133  ? 5.947   -3.379  -79.619  1.00 59.51  ? 131  ILE D CD1 1 
ATOM 9588  N N   . ASN B 2 134  ? 2.303   -0.990  -75.548  1.00 46.67  ? 132  ASN D N   1 
ATOM 9589  C CA  . ASN B 2 134  ? 1.185   -0.081  -75.248  1.00 46.93  ? 132  ASN D CA  1 
ATOM 9590  C C   . ASN B 2 134  ? 1.203   1.198   -76.090  1.00 46.39  ? 132  ASN D C   1 
ATOM 9591  O O   . ASN B 2 134  ? 0.145   1.783   -76.335  1.00 48.87  ? 132  ASN D O   1 
ATOM 9592  C CB  . ASN B 2 134  ? 1.185   0.318   -73.765  1.00 45.87  ? 132  ASN D CB  1 
ATOM 9593  C CG  . ASN B 2 134  ? 0.969   -0.862  -72.831  1.00 46.84  ? 132  ASN D CG  1 
ATOM 9594  O OD1 . ASN B 2 134  ? 0.215   -1.789  -73.132  1.00 48.97  ? 132  ASN D OD1 1 
ATOM 9595  N ND2 . ASN B 2 134  ? 1.623   -0.822  -71.677  1.00 46.35  ? 132  ASN D ND2 1 
ATOM 9596  N N   . CYS B 2 135  ? 2.388   1.645   -76.509  1.00 46.53  ? 133  CYS D N   1 
ATOM 9597  C CA  . CYS B 2 135  ? 2.508   2.907   -77.239  1.00 49.61  ? 133  CYS D CA  1 
ATOM 9598  C C   . CYS B 2 135  ? 3.641   2.953   -78.260  1.00 50.48  ? 133  CYS D C   1 
ATOM 9599  O O   . CYS B 2 135  ? 4.674   2.295   -78.115  1.00 51.09  ? 133  CYS D O   1 
ATOM 9600  C CB  . CYS B 2 135  ? 2.698   4.048   -76.255  1.00 53.24  ? 133  CYS D CB  1 
ATOM 9601  S SG  . CYS B 2 135  ? 4.233   3.905   -75.313  1.00 65.16  ? 133  CYS D SG  1 
ATOM 9602  N N   . VAL B 2 136  ? 3.422   3.763   -79.288  1.00 51.18  ? 134  VAL D N   1 
ATOM 9603  C CA  . VAL B 2 136  ? 4.371   3.967   -80.370  1.00 55.69  ? 134  VAL D CA  1 
ATOM 9604  C C   . VAL B 2 136  ? 4.276   5.446   -80.728  1.00 56.97  ? 134  VAL D C   1 
ATOM 9605  O O   . VAL B 2 136  ? 3.168   5.958   -80.903  1.00 64.79  ? 134  VAL D O   1 
ATOM 9606  C CB  . VAL B 2 136  ? 4.022   3.067   -81.586  1.00 58.37  ? 134  VAL D CB  1 
ATOM 9607  C CG1 . VAL B 2 136  ? 4.746   3.500   -82.849  1.00 60.34  ? 134  VAL D CG1 1 
ATOM 9608  C CG2 . VAL B 2 136  ? 4.363   1.616   -81.292  1.00 60.73  ? 134  VAL D CG2 1 
ATOM 9609  N N   . CYS B 2 137  ? 5.414   6.135   -80.809  1.00 55.58  ? 135  CYS D N   1 
ATOM 9610  C CA  . CYS B 2 137  ? 5.434   7.506   -81.330  1.00 60.30  ? 135  CYS D CA  1 
ATOM 9611  C C   . CYS B 2 137  ? 6.731   7.819   -82.088  1.00 62.33  ? 135  CYS D C   1 
ATOM 9612  O O   . CYS B 2 137  ? 7.788   7.242   -81.815  1.00 61.66  ? 135  CYS D O   1 
ATOM 9613  C CB  . CYS B 2 137  ? 5.158   8.532   -80.220  1.00 61.08  ? 135  CYS D CB  1 
ATOM 9614  S SG  . CYS B 2 137  ? 6.606   9.311   -79.483  1.00 65.43  ? 135  CYS D SG  1 
ATOM 9615  N N   . LEU B 2 138  ? 6.618   8.758   -83.025  1.00 62.56  ? 136  LEU D N   1 
ATOM 9616  C CA  . LEU B 2 138  ? 7.629   9.005   -84.048  1.00 66.28  ? 136  LEU D CA  1 
ATOM 9617  C C   . LEU B 2 138  ? 8.396   10.304  -83.791  1.00 64.21  ? 136  LEU D C   1 
ATOM 9618  O O   . LEU B 2 138  ? 7.802   11.389  -83.740  1.00 62.37  ? 136  LEU D O   1 
ATOM 9619  C CB  . LEU B 2 138  ? 6.933   9.068   -85.411  1.00 69.96  ? 136  LEU D CB  1 
ATOM 9620  C CG  . LEU B 2 138  ? 7.745   9.199   -86.705  1.00 75.38  ? 136  LEU D CG  1 
ATOM 9621  C CD1 . LEU B 2 138  ? 8.764   8.081   -86.872  1.00 78.10  ? 136  LEU D CD1 1 
ATOM 9622  C CD2 . LEU B 2 138  ? 6.784   9.207   -87.883  1.00 75.03  ? 136  LEU D CD2 1 
ATOM 9623  N N   . HIS B 2 139  ? 9.714   10.183  -83.629  1.00 62.71  ? 137  HIS D N   1 
ATOM 9624  C CA  . HIS B 2 139  ? 10.611  11.340  -83.510  1.00 65.29  ? 137  HIS D CA  1 
ATOM 9625  C C   . HIS B 2 139  ? 10.356  12.240  -84.721  1.00 66.85  ? 137  HIS D C   1 
ATOM 9626  O O   . HIS B 2 139  ? 10.290  11.734  -85.840  1.00 73.62  ? 137  HIS D O   1 
ATOM 9627  C CB  . HIS B 2 139  ? 12.078  10.870  -83.503  1.00 68.17  ? 137  HIS D CB  1 
ATOM 9628  C CG  . HIS B 2 139  ? 13.074  11.885  -83.012  1.00 67.76  ? 137  HIS D CG  1 
ATOM 9629  N ND1 . HIS B 2 139  ? 14.246  11.511  -82.388  1.00 70.70  ? 137  HIS D ND1 1 
ATOM 9630  C CD2 . HIS B 2 139  ? 13.094  13.239  -83.058  1.00 67.04  ? 137  HIS D CD2 1 
ATOM 9631  C CE1 . HIS B 2 139  ? 14.943  12.588  -82.071  1.00 71.66  ? 137  HIS D CE1 1 
ATOM 9632  N NE2 . HIS B 2 139  ? 14.268  13.649  -82.470  1.00 70.75  ? 137  HIS D NE2 1 
ATOM 9633  N N   . PRO B 2 140  ? 10.172  13.557  -84.510  1.00 64.83  ? 138  PRO D N   1 
ATOM 9634  C CA  . PRO B 2 140  ? 10.066  14.516  -85.614  1.00 65.82  ? 138  PRO D CA  1 
ATOM 9635  C C   . PRO B 2 140  ? 11.067  14.363  -86.781  1.00 66.12  ? 138  PRO D C   1 
ATOM 9636  O O   . PRO B 2 140  ? 10.721  14.697  -87.912  1.00 66.86  ? 138  PRO D O   1 
ATOM 9637  C CB  . PRO B 2 140  ? 10.267  15.854  -84.907  1.00 67.56  ? 138  PRO D CB  1 
ATOM 9638  C CG  . PRO B 2 140  ? 9.643   15.648  -83.569  1.00 64.64  ? 138  PRO D CG  1 
ATOM 9639  C CD  . PRO B 2 140  ? 9.736   14.178  -83.244  1.00 63.63  ? 138  PRO D CD  1 
ATOM 9640  N N   . ASN B 2 141  ? 12.277  13.871  -86.512  1.00 65.13  ? 139  ASN D N   1 
ATOM 9641  C CA  . ASN B 2 141  ? 13.257  13.579  -87.570  1.00 69.02  ? 139  ASN D CA  1 
ATOM 9642  C C   . ASN B 2 141  ? 12.858  12.447  -88.533  1.00 69.16  ? 139  ASN D C   1 
ATOM 9643  O O   . ASN B 2 141  ? 13.520  12.251  -89.553  1.00 73.52  ? 139  ASN D O   1 
ATOM 9644  C CB  . ASN B 2 141  ? 14.670  13.330  -86.986  1.00 71.55  ? 139  ASN D CB  1 
ATOM 9645  C CG  . ASN B 2 141  ? 14.756  12.104  -86.074  1.00 68.75  ? 139  ASN D CG  1 
ATOM 9646  O OD1 . ASN B 2 141  ? 14.066  11.101  -86.263  1.00 66.09  ? 139  ASN D OD1 1 
ATOM 9647  N ND2 . ASN B 2 141  ? 15.642  12.181  -85.086  1.00 68.39  ? 139  ASN D ND2 1 
ATOM 9648  N N   . GLN B 2 142  ? 11.821  11.682  -88.174  1.00 65.43  ? 140  GLN D N   1 
ATOM 9649  C CA  . GLN B 2 142  ? 11.192  10.663  -89.032  1.00 65.37  ? 140  GLN D CA  1 
ATOM 9650  C C   . GLN B 2 142  ? 11.982  9.354   -89.183  1.00 67.46  ? 140  GLN D C   1 
ATOM 9651  O O   . GLN B 2 142  ? 11.477  8.418   -89.802  1.00 69.04  ? 140  GLN D O   1 
ATOM 9652  C CB  . GLN B 2 142  ? 10.841  11.219  -90.427  1.00 68.11  ? 140  GLN D CB  1 
ATOM 9653  C CG  . GLN B 2 142  ? 10.041  12.520  -90.442  1.00 66.59  ? 140  GLN D CG  1 
ATOM 9654  C CD  . GLN B 2 142  ? 8.700   12.425  -89.737  1.00 61.61  ? 140  GLN D CD  1 
ATOM 9655  O OE1 . GLN B 2 142  ? 8.261   13.369  -89.088  1.00 60.28  ? 140  GLN D OE1 1 
ATOM 9656  N NE2 . GLN B 2 142  ? 8.041   11.289  -89.870  1.00 60.48  ? 140  GLN D NE2 1 
ATOM 9657  N N   . ALA B 2 143  ? 13.188  9.275   -88.613  1.00 69.02  ? 141  ALA D N   1 
ATOM 9658  C CA  . ALA B 2 143  ? 14.065  8.110   -88.773  1.00 73.00  ? 141  ALA D CA  1 
ATOM 9659  C C   . ALA B 2 143  ? 14.105  7.216   -87.531  1.00 72.55  ? 141  ALA D C   1 
ATOM 9660  O O   . ALA B 2 143  ? 14.810  6.205   -87.534  1.00 78.39  ? 141  ALA D O   1 
ATOM 9661  C CB  . ALA B 2 143  ? 15.475  8.570   -89.125  1.00 77.99  ? 141  ALA D CB  1 
ATOM 9662  N N   . GLU B 2 144  ? 13.352  7.575   -86.488  1.00 68.13  ? 142  GLU D N   1 
ATOM 9663  C CA  . GLU B 2 144  ? 13.395  6.879   -85.201  1.00 64.52  ? 142  GLU D CA  1 
ATOM 9664  C C   . GLU B 2 144  ? 11.995  6.719   -84.606  1.00 59.73  ? 142  GLU D C   1 
ATOM 9665  O O   . GLU B 2 144  ? 11.276  7.706   -84.416  1.00 56.02  ? 142  GLU D O   1 
ATOM 9666  C CB  . GLU B 2 144  ? 14.288  7.652   -84.232  1.00 66.62  ? 142  GLU D CB  1 
ATOM 9667  C CG  . GLU B 2 144  ? 15.773  7.353   -84.390  1.00 73.24  ? 142  GLU D CG  1 
ATOM 9668  C CD  . GLU B 2 144  ? 16.671  8.550   -84.118  1.00 78.78  ? 142  GLU D CD  1 
ATOM 9669  O OE1 . GLU B 2 144  ? 16.304  9.427   -83.304  1.00 75.08  ? 142  GLU D OE1 1 
ATOM 9670  O OE2 . GLU B 2 144  ? 17.769  8.603   -84.716  1.00 90.18  ? 142  GLU D OE2 1 
ATOM 9671  N N   . LEU B 2 145  ? 11.622  5.472   -84.314  1.00 59.61  ? 143  LEU D N   1 
ATOM 9672  C CA  . LEU B 2 145  ? 10.342  5.149   -83.679  1.00 56.60  ? 143  LEU D CA  1 
ATOM 9673  C C   . LEU B 2 145  ? 10.568  4.738   -82.229  1.00 55.96  ? 143  LEU D C   1 
ATOM 9674  O O   . LEU B 2 145  ? 11.334  3.808   -81.950  1.00 56.79  ? 143  LEU D O   1 
ATOM 9675  C CB  . LEU B 2 145  ? 9.640   4.011   -84.425  1.00 56.36  ? 143  LEU D CB  1 
ATOM 9676  C CG  . LEU B 2 145  ? 8.155   3.796   -84.100  1.00 52.54  ? 143  LEU D CG  1 
ATOM 9677  C CD1 . LEU B 2 145  ? 7.309   4.873   -84.770  1.00 52.96  ? 143  LEU D CD1 1 
ATOM 9678  C CD2 . LEU B 2 145  ? 7.708   2.410   -84.541  1.00 51.82  ? 143  LEU D CD2 1 
ATOM 9679  N N   . ILE B 2 146  ? 9.892   5.431   -81.318  1.00 55.07  ? 144  ILE D N   1 
ATOM 9680  C CA  . ILE B 2 146  ? 9.958   5.130   -79.891  1.00 54.54  ? 144  ILE D CA  1 
ATOM 9681  C C   . ILE B 2 146  ? 8.813   4.171   -79.558  1.00 51.92  ? 144  ILE D C   1 
ATOM 9682  O O   . ILE B 2 146  ? 7.681   4.388   -79.987  1.00 51.78  ? 144  ILE D O   1 
ATOM 9683  C CB  . ILE B 2 146  ? 9.917   6.428   -79.063  1.00 54.92  ? 144  ILE D CB  1 
ATOM 9684  C CG1 . ILE B 2 146  ? 11.202  7.237   -79.328  1.00 59.18  ? 144  ILE D CG1 1 
ATOM 9685  C CG2 . ILE B 2 146  ? 9.783   6.138   -77.571  1.00 53.35  ? 144  ILE D CG2 1 
ATOM 9686  C CD1 . ILE B 2 146  ? 11.064  8.727   -79.081  1.00 61.32  ? 144  ILE D CD1 1 
ATOM 9687  N N   . VAL B 2 147  ? 9.128   3.113   -78.808  1.00 51.89  ? 145  VAL D N   1 
ATOM 9688  C CA  . VAL B 2 147  ? 8.211   1.994   -78.545  1.00 51.99  ? 145  VAL D CA  1 
ATOM 9689  C C   . VAL B 2 147  ? 8.275   1.648   -77.060  1.00 52.53  ? 145  VAL D C   1 
ATOM 9690  O O   . VAL B 2 147  ? 9.348   1.294   -76.570  1.00 56.14  ? 145  VAL D O   1 
ATOM 9691  C CB  . VAL B 2 147  ? 8.619   0.740   -79.369  1.00 54.20  ? 145  VAL D CB  1 
ATOM 9692  C CG1 . VAL B 2 147  ? 7.750   -0.472  -79.040  1.00 52.79  ? 145  VAL D CG1 1 
ATOM 9693  C CG2 . VAL B 2 147  ? 8.560   1.029   -80.861  1.00 55.61  ? 145  VAL D CG2 1 
ATOM 9694  N N   . GLY B 2 148  ? 7.137   1.730   -76.363  1.00 48.89  ? 146  GLY D N   1 
ATOM 9695  C CA  . GLY B 2 148  ? 7.047   1.377   -74.935  1.00 49.46  ? 146  GLY D CA  1 
ATOM 9696  C C   . GLY B 2 148  ? 6.202   0.137   -74.660  1.00 50.22  ? 146  GLY D C   1 
ATOM 9697  O O   . GLY B 2 148  ? 5.111   0.008   -75.218  1.00 49.93  ? 146  GLY D O   1 
ATOM 9698  N N   . ASP B 2 149  ? 6.683   -0.755  -73.782  1.00 51.38  ? 147  ASP D N   1 
ATOM 9699  C CA  . ASP B 2 149  ? 6.005   -2.040  -73.500  1.00 53.76  ? 147  ASP D CA  1 
ATOM 9700  C C   . ASP B 2 149  ? 5.641   -2.263  -72.022  1.00 54.47  ? 147  ASP D C   1 
ATOM 9701  O O   . ASP B 2 149  ? 6.038   -1.483  -71.155  1.00 57.92  ? 147  ASP D O   1 
ATOM 9702  C CB  . ASP B 2 149  ? 6.825   -3.225  -74.061  1.00 59.06  ? 147  ASP D CB  1 
ATOM 9703  C CG  . ASP B 2 149  ? 8.171   -3.440  -73.353  1.00 61.36  ? 147  ASP D CG  1 
ATOM 9704  O OD1 . ASP B 2 149  ? 8.455   -2.801  -72.315  1.00 60.22  ? 147  ASP D OD1 1 
ATOM 9705  O OD2 . ASP B 2 149  ? 8.950   -4.283  -73.855  1.00 62.94  ? 147  ASP D OD2 1 
ATOM 9706  N N   . GLN B 2 150  ? 4.887   -3.335  -71.757  1.00 53.94  ? 148  GLN D N   1 
ATOM 9707  C CA  . GLN B 2 150  ? 4.405   -3.660  -70.402  1.00 51.83  ? 148  GLN D CA  1 
ATOM 9708  C C   . GLN B 2 150  ? 5.472   -4.117  -69.408  1.00 50.37  ? 148  GLN D C   1 
ATOM 9709  O O   . GLN B 2 150  ? 5.216   -4.108  -68.206  1.00 49.24  ? 148  GLN D O   1 
ATOM 9710  C CB  . GLN B 2 150  ? 3.290   -4.713  -70.445  1.00 55.56  ? 148  GLN D CB  1 
ATOM 9711  C CG  . GLN B 2 150  ? 1.977   -4.204  -71.015  1.00 60.72  ? 148  GLN D CG  1 
ATOM 9712  C CD  . GLN B 2 150  ? 0.775   -4.675  -70.222  1.00 69.31  ? 148  GLN D CD  1 
ATOM 9713  O OE1 . GLN B 2 150  ? 0.600   -4.277  -69.070  1.00 76.97  ? 148  GLN D OE1 1 
ATOM 9714  N NE2 . GLN B 2 150  ? -0.065  -5.515  -70.833  1.00 70.16  ? 148  GLN D NE2 1 
ATOM 9715  N N   . SER B 2 151  ? 6.650   -4.512  -69.889  1.00 51.04  ? 149  SER D N   1 
ATOM 9716  C CA  . SER B 2 151  ? 7.764   -4.869  -69.001  1.00 54.08  ? 149  SER D CA  1 
ATOM 9717  C C   . SER B 2 151  ? 8.425   -3.626  -68.402  1.00 53.17  ? 149  SER D C   1 
ATOM 9718  O O   . SER B 2 151  ? 9.130   -3.725  -67.397  1.00 56.36  ? 149  SER D O   1 
ATOM 9719  C CB  . SER B 2 151  ? 8.818   -5.707  -69.735  1.00 56.50  ? 149  SER D CB  1 
ATOM 9720  O OG  . SER B 2 151  ? 9.465   -4.958  -70.745  1.00 56.55  ? 149  SER D OG  1 
ATOM 9721  N N   . GLY B 2 152  ? 8.202   -2.471  -69.026  1.00 50.00  ? 150  GLY D N   1 
ATOM 9722  C CA  . GLY B 2 152  ? 8.784   -1.212  -68.586  1.00 51.53  ? 150  GLY D CA  1 
ATOM 9723  C C   . GLY B 2 152  ? 9.979   -0.747  -69.399  1.00 53.90  ? 150  GLY D C   1 
ATOM 9724  O O   . GLY B 2 152  ? 10.739  0.108   -68.939  1.00 57.44  ? 150  GLY D O   1 
ATOM 9725  N N   . ALA B 2 153  ? 10.141  -1.300  -70.602  1.00 52.73  ? 151  ALA D N   1 
ATOM 9726  C CA  . ALA B 2 153  ? 11.236  -0.951  -71.491  1.00 53.23  ? 151  ALA D CA  1 
ATOM 9727  C C   . ALA B 2 153  ? 10.742  0.009   -72.575  1.00 52.81  ? 151  ALA D C   1 
ATOM 9728  O O   . ALA B 2 153  ? 9.691   -0.219  -73.184  1.00 49.19  ? 151  ALA D O   1 
ATOM 9729  C CB  . ALA B 2 153  ? 11.809  -2.209  -72.122  1.00 54.77  ? 151  ALA D CB  1 
ATOM 9730  N N   . ILE B 2 154  ? 11.498  1.087   -72.790  1.00 55.19  ? 152  ILE D N   1 
ATOM 9731  C CA  . ILE B 2 154  ? 11.294  2.001   -73.916  1.00 54.25  ? 152  ILE D CA  1 
ATOM 9732  C C   . ILE B 2 154  ? 12.374  1.682   -74.949  1.00 56.04  ? 152  ILE D C   1 
ATOM 9733  O O   . ILE B 2 154  ? 13.561  1.828   -74.667  1.00 56.20  ? 152  ILE D O   1 
ATOM 9734  C CB  . ILE B 2 154  ? 11.399  3.482   -73.485  1.00 53.41  ? 152  ILE D CB  1 
ATOM 9735  C CG1 . ILE B 2 154  ? 10.382  3.792   -72.378  1.00 52.25  ? 152  ILE D CG1 1 
ATOM 9736  C CG2 . ILE B 2 154  ? 11.173  4.416   -74.676  1.00 52.22  ? 152  ILE D CG2 1 
ATOM 9737  C CD1 . ILE B 2 154  ? 10.700  5.033   -71.572  1.00 53.31  ? 152  ILE D CD1 1 
ATOM 9738  N N   . HIS B 2 155  ? 11.954  1.220   -76.124  1.00 56.62  ? 153  HIS D N   1 
ATOM 9739  C CA  . HIS B 2 155  ? 12.864  0.931   -77.228  1.00 59.31  ? 153  HIS D CA  1 
ATOM 9740  C C   . HIS B 2 155  ? 12.908  2.107   -78.183  1.00 59.87  ? 153  HIS D C   1 
ATOM 9741  O O   . HIS B 2 155  ? 11.865  2.638   -78.560  1.00 60.50  ? 153  HIS D O   1 
ATOM 9742  C CB  . HIS B 2 155  ? 12.396  -0.301  -77.997  1.00 59.98  ? 153  HIS D CB  1 
ATOM 9743  C CG  . HIS B 2 155  ? 12.297  -1.533  -77.158  1.00 61.07  ? 153  HIS D CG  1 
ATOM 9744  N ND1 . HIS B 2 155  ? 11.182  -1.831  -76.404  1.00 58.83  ? 153  HIS D ND1 1 
ATOM 9745  C CD2 . HIS B 2 155  ? 13.173  -2.546  -76.956  1.00 63.21  ? 153  HIS D CD2 1 
ATOM 9746  C CE1 . HIS B 2 155  ? 11.377  -2.975  -75.773  1.00 60.79  ? 153  HIS D CE1 1 
ATOM 9747  N NE2 . HIS B 2 155  ? 12.577  -3.428  -76.091  1.00 63.75  ? 153  HIS D NE2 1 
ATOM 9748  N N   . ILE B 2 156  ? 14.116  2.519   -78.553  1.00 61.98  ? 154  ILE D N   1 
ATOM 9749  C CA  . ILE B 2 156  ? 14.318  3.428   -79.674  1.00 63.91  ? 154  ILE D CA  1 
ATOM 9750  C C   . ILE B 2 156  ? 14.646  2.522   -80.850  1.00 64.90  ? 154  ILE D C   1 
ATOM 9751  O O   . ILE B 2 156  ? 15.645  1.805   -80.814  1.00 69.76  ? 154  ILE D O   1 
ATOM 9752  C CB  . ILE B 2 156  ? 15.465  4.441   -79.414  1.00 68.74  ? 154  ILE D CB  1 
ATOM 9753  C CG1 . ILE B 2 156  ? 15.089  5.416   -78.281  1.00 67.58  ? 154  ILE D CG1 1 
ATOM 9754  C CG2 . ILE B 2 156  ? 15.808  5.235   -80.674  1.00 71.09  ? 154  ILE D CG2 1 
ATOM 9755  C CD1 . ILE B 2 156  ? 15.511  4.964   -76.898  1.00 69.38  ? 154  ILE D CD1 1 
ATOM 9756  N N   . TRP B 2 157  ? 13.794  2.537   -81.872  1.00 62.68  ? 155  TRP D N   1 
ATOM 9757  C CA  . TRP B 2 157  ? 14.004  1.750   -83.085  1.00 64.78  ? 155  TRP D CA  1 
ATOM 9758  C C   . TRP B 2 157  ? 14.446  2.673   -84.226  1.00 68.81  ? 155  TRP D C   1 
ATOM 9759  O O   . TRP B 2 157  ? 13.653  3.480   -84.715  1.00 67.97  ? 155  TRP D O   1 
ATOM 9760  C CB  . TRP B 2 157  ? 12.719  0.995   -83.444  1.00 61.29  ? 155  TRP D CB  1 
ATOM 9761  C CG  . TRP B 2 157  ? 12.788  0.171   -84.718  1.00 62.19  ? 155  TRP D CG  1 
ATOM 9762  C CD1 . TRP B 2 157  ? 13.912  -0.294  -85.347  1.00 65.15  ? 155  TRP D CD1 1 
ATOM 9763  C CD2 . TRP B 2 157  ? 11.678  -0.304  -85.486  1.00 59.98  ? 155  TRP D CD2 1 
ATOM 9764  N NE1 . TRP B 2 157  ? 13.568  -1.009  -86.468  1.00 65.53  ? 155  TRP D NE1 1 
ATOM 9765  C CE2 . TRP B 2 157  ? 12.204  -1.033  -86.576  1.00 62.73  ? 155  TRP D CE2 1 
ATOM 9766  C CE3 . TRP B 2 157  ? 10.289  -0.180  -85.363  1.00 57.25  ? 155  TRP D CE3 1 
ATOM 9767  C CZ2 . TRP B 2 157  ? 11.387  -1.634  -87.538  1.00 63.66  ? 155  TRP D CZ2 1 
ATOM 9768  C CZ3 . TRP B 2 157  ? 9.476   -0.778  -86.319  1.00 58.19  ? 155  TRP D CZ3 1 
ATOM 9769  C CH2 . TRP B 2 157  ? 10.030  -1.500  -87.391  1.00 61.28  ? 155  TRP D CH2 1 
ATOM 9770  N N   . ASP B 2 158  ? 15.710  2.546   -84.637  1.00 73.79  ? 156  ASP D N   1 
ATOM 9771  C CA  . ASP B 2 158  ? 16.267  3.324   -85.752  1.00 78.11  ? 156  ASP D CA  1 
ATOM 9772  C C   . ASP B 2 158  ? 15.795  2.738   -87.089  1.00 81.41  ? 156  ASP D C   1 
ATOM 9773  O O   . ASP B 2 158  ? 16.274  1.689   -87.520  1.00 83.91  ? 156  ASP D O   1 
ATOM 9774  C CB  . ASP B 2 158  ? 17.802  3.337   -85.680  1.00 81.72  ? 156  ASP D CB  1 
ATOM 9775  C CG  . ASP B 2 158  ? 18.451  4.227   -86.740  1.00 83.51  ? 156  ASP D CG  1 
ATOM 9776  O OD1 . ASP B 2 158  ? 17.765  5.050   -87.385  1.00 82.07  ? 156  ASP D OD1 1 
ATOM 9777  O OD2 . ASP B 2 158  ? 19.677  4.102   -86.917  1.00 86.13  ? 156  ASP D OD2 1 
ATOM 9778  N N   . LEU B 2 159  ? 14.884  3.451   -87.749  1.00 81.06  ? 157  LEU D N   1 
ATOM 9779  C CA  . LEU B 2 159  ? 14.188  2.950   -88.940  1.00 81.97  ? 157  LEU D CA  1 
ATOM 9780  C C   . LEU B 2 159  ? 15.094  2.760   -90.154  1.00 89.20  ? 157  LEU D C   1 
ATOM 9781  O O   . LEU B 2 159  ? 14.821  1.905   -90.997  1.00 91.27  ? 157  LEU D O   1 
ATOM 9782  C CB  . LEU B 2 159  ? 13.030  3.880   -89.315  1.00 78.61  ? 157  LEU D CB  1 
ATOM 9783  C CG  . LEU B 2 159  ? 11.956  4.131   -88.253  1.00 75.27  ? 157  LEU D CG  1 
ATOM 9784  C CD1 . LEU B 2 159  ? 10.938  5.137   -88.766  1.00 74.27  ? 157  LEU D CD1 1 
ATOM 9785  C CD2 . LEU B 2 159  ? 11.267  2.839   -87.843  1.00 74.73  ? 157  LEU D CD2 1 
ATOM 9786  N N   . LYS B 2 160  ? 16.160  3.549   -90.242  1.00 94.76  ? 158  LYS D N   1 
ATOM 9787  C CA  . LYS B 2 160  ? 17.093  3.451   -91.359  1.00 106.22 ? 158  LYS D CA  1 
ATOM 9788  C C   . LYS B 2 160  ? 18.017  2.248   -91.195  1.00 107.47 ? 158  LYS D C   1 
ATOM 9789  O O   . LYS B 2 160  ? 18.023  1.344   -92.034  1.00 107.63 ? 158  LYS D O   1 
ATOM 9790  C CB  . LYS B 2 160  ? 17.903  4.743   -91.492  1.00 116.29 ? 158  LYS D CB  1 
ATOM 9791  C CG  . LYS B 2 160  ? 17.038  5.954   -91.804  1.00 119.44 ? 158  LYS D CG  1 
ATOM 9792  C CD  . LYS B 2 160  ? 17.870  7.158   -92.212  1.00 125.48 ? 158  LYS D CD  1 
ATOM 9793  C CE  . LYS B 2 160  ? 17.003  8.264   -92.792  1.00 127.17 ? 158  LYS D CE  1 
ATOM 9794  N NZ  . LYS B 2 160  ? 17.829  9.296   -93.475  1.00 136.81 ? 158  LYS D NZ  1 
ATOM 9795  N N   . THR B 2 161  ? 18.776  2.238   -90.101  1.00 106.02 ? 159  THR D N   1 
ATOM 9796  C CA  . THR B 2 161  ? 19.765  1.186   -89.841  1.00 106.69 ? 159  THR D CA  1 
ATOM 9797  C C   . THR B 2 161  ? 19.135  -0.117  -89.345  1.00 100.48 ? 159  THR D C   1 
ATOM 9798  O O   . THR B 2 161  ? 19.775  -1.164  -89.398  1.00 100.80 ? 159  THR D O   1 
ATOM 9799  C CB  . THR B 2 161  ? 20.818  1.640   -88.801  1.00 110.36 ? 159  THR D CB  1 
ATOM 9800  O OG1 . THR B 2 161  ? 20.974  3.063   -88.852  1.00 111.72 ? 159  THR D OG1 1 
ATOM 9801  C CG2 . THR B 2 161  ? 22.172  0.977   -89.068  1.00 118.87 ? 159  THR D CG2 1 
ATOM 9802  N N   . ASP B 2 162  ? 17.899  -0.043  -88.847  1.00 96.32  ? 160  ASP D N   1 
ATOM 9803  C CA  . ASP B 2 162  ? 17.215  -1.173  -88.199  1.00 96.02  ? 160  ASP D CA  1 
ATOM 9804  C C   . ASP B 2 162  ? 17.894  -1.582  -86.874  1.00 96.00  ? 160  ASP D C   1 
ATOM 9805  O O   . ASP B 2 162  ? 17.633  -2.669  -86.353  1.00 95.68  ? 160  ASP D O   1 
ATOM 9806  C CB  . ASP B 2 162  ? 17.079  -2.372  -89.165  1.00 100.01 ? 160  ASP D CB  1 
ATOM 9807  C CG  . ASP B 2 162  ? 15.803  -3.191  -88.935  1.00 97.01  ? 160  ASP D CG  1 
ATOM 9808  O OD1 . ASP B 2 162  ? 14.717  -2.601  -88.746  1.00 90.47  ? 160  ASP D OD1 1 
ATOM 9809  O OD2 . ASP B 2 162  ? 15.883  -4.436  -88.970  1.00 99.92  ? 160  ASP D OD2 1 
ATOM 9810  N N   . HIS B 2 163  ? 18.731  -0.698  -86.320  1.00 96.23  ? 161  HIS D N   1 
ATOM 9811  C CA  . HIS B 2 163  ? 19.396  -0.943  -85.041  1.00 95.77  ? 161  HIS D CA  1 
ATOM 9812  C C   . HIS B 2 163  ? 18.390  -0.650  -83.931  1.00 90.21  ? 161  HIS D C   1 
ATOM 9813  O O   . HIS B 2 163  ? 17.492  0.183   -84.083  1.00 83.83  ? 161  HIS D O   1 
ATOM 9814  C CB  . HIS B 2 163  ? 20.665  -0.078  -84.873  1.00 99.91  ? 161  HIS D CB  1 
ATOM 9815  C CG  . HIS B 2 163  ? 21.952  -0.817  -85.106  1.00 107.69 ? 161  HIS D CG  1 
ATOM 9816  N ND1 . HIS B 2 163  ? 22.819  -1.140  -84.083  1.00 110.81 ? 161  HIS D ND1 1 
ATOM 9817  C CD2 . HIS B 2 163  ? 22.528  -1.277  -86.242  1.00 112.41 ? 161  HIS D CD2 1 
ATOM 9818  C CE1 . HIS B 2 163  ? 23.869  -1.772  -84.577  1.00 113.95 ? 161  HIS D CE1 1 
ATOM 9819  N NE2 . HIS B 2 163  ? 23.717  -1.869  -85.886  1.00 115.05 ? 161  HIS D NE2 1 
ATOM 9820  N N   . ASN B 2 164  ? 18.552  -1.355  -82.820  1.00 91.67  ? 162  ASN D N   1 
ATOM 9821  C CA  . ASN B 2 164  ? 17.656  -1.268  -81.679  1.00 86.38  ? 162  ASN D CA  1 
ATOM 9822  C C   . ASN B 2 164  ? 18.483  -0.892  -80.451  1.00 87.96  ? 162  ASN D C   1 
ATOM 9823  O O   . ASN B 2 164  ? 19.567  -1.438  -80.236  1.00 96.27  ? 162  ASN D O   1 
ATOM 9824  C CB  . ASN B 2 164  ? 16.950  -2.617  -81.495  1.00 86.89  ? 162  ASN D CB  1 
ATOM 9825  C CG  . ASN B 2 164  ? 16.534  -2.879  -80.062  1.00 90.10  ? 162  ASN D CG  1 
ATOM 9826  O OD1 . ASN B 2 164  ? 15.800  -2.093  -79.462  1.00 93.31  ? 162  ASN D OD1 1 
ATOM 9827  N ND2 . ASN B 2 164  ? 17.002  -3.994  -79.504  1.00 93.17  ? 162  ASN D ND2 1 
ATOM 9828  N N   . GLU B 2 165  ? 17.975  0.058   -79.669  1.00 85.81  ? 163  GLU D N   1 
ATOM 9829  C CA  . GLU B 2 165  ? 18.542  0.402   -78.360  1.00 88.10  ? 163  GLU D CA  1 
ATOM 9830  C C   . GLU B 2 165  ? 17.404  0.663   -77.376  1.00 80.35  ? 163  GLU D C   1 
ATOM 9831  O O   . GLU B 2 165  ? 16.457  1.391   -77.696  1.00 74.07  ? 163  GLU D O   1 
ATOM 9832  C CB  . GLU B 2 165  ? 19.457  1.623   -78.459  1.00 95.13  ? 163  GLU D CB  1 
ATOM 9833  C CG  . GLU B 2 165  ? 20.756  1.359   -79.212  1.00 107.89 ? 163  GLU D CG  1 
ATOM 9834  C CD  . GLU B 2 165  ? 21.767  2.488   -79.083  1.00 118.15 ? 163  GLU D CD  1 
ATOM 9835  O OE1 . GLU B 2 165  ? 21.371  3.624   -78.741  1.00 127.45 ? 163  GLU D OE1 1 
ATOM 9836  O OE2 . GLU B 2 165  ? 22.967  2.238   -79.328  1.00 121.88 ? 163  GLU D OE2 1 
ATOM 9837  N N   . GLN B 2 166  ? 17.494  0.063   -76.188  1.00 79.21  ? 164  GLN D N   1 
ATOM 9838  C CA  . GLN B 2 166  ? 16.414  0.131   -75.200  1.00 75.95  ? 164  GLN D CA  1 
ATOM 9839  C C   . GLN B 2 166  ? 16.832  0.793   -73.888  1.00 73.82  ? 164  GLN D C   1 
ATOM 9840  O O   . GLN B 2 166  ? 18.016  0.952   -73.590  1.00 73.56  ? 164  GLN D O   1 
ATOM 9841  C CB  . GLN B 2 166  ? 15.789  -1.259  -74.966  1.00 76.90  ? 164  GLN D CB  1 
ATOM 9842  C CG  . GLN B 2 166  ? 16.385  -2.110  -73.850  1.00 78.67  ? 164  GLN D CG  1 
ATOM 9843  C CD  . GLN B 2 166  ? 15.567  -3.360  -73.576  1.00 79.76  ? 164  GLN D CD  1 
ATOM 9844  O OE1 . GLN B 2 166  ? 14.831  -3.835  -74.438  1.00 82.95  ? 164  GLN D OE1 1 
ATOM 9845  N NE2 . GLN B 2 166  ? 15.685  -3.893  -72.367  1.00 81.44  ? 164  GLN D NE2 1 
ATOM 9846  N N   . LEU B 2 167  ? 15.818  1.143   -73.105  1.00 72.24  ? 165  LEU D N   1 
ATOM 9847  C CA  . LEU B 2 167  ? 15.962  2.020   -71.958  1.00 72.08  ? 165  LEU D CA  1 
ATOM 9848  C C   . LEU B 2 167  ? 14.861  1.700   -70.945  1.00 70.08  ? 165  LEU D C   1 
ATOM 9849  O O   . LEU B 2 167  ? 13.678  1.780   -71.283  1.00 65.68  ? 165  LEU D O   1 
ATOM 9850  C CB  . LEU B 2 167  ? 15.849  3.460   -72.451  1.00 71.46  ? 165  LEU D CB  1 
ATOM 9851  C CG  . LEU B 2 167  ? 15.811  4.609   -71.452  1.00 74.49  ? 165  LEU D CG  1 
ATOM 9852  C CD1 . LEU B 2 167  ? 17.039  4.621   -70.557  1.00 80.02  ? 165  LEU D CD1 1 
ATOM 9853  C CD2 . LEU B 2 167  ? 15.695  5.909   -72.228  1.00 75.46  ? 165  LEU D CD2 1 
ATOM 9854  N N   . ILE B 2 168  ? 15.255  1.333   -69.722  1.00 72.97  ? 166  ILE D N   1 
ATOM 9855  C CA  . ILE B 2 168  ? 14.320  0.935   -68.655  1.00 70.69  ? 166  ILE D CA  1 
ATOM 9856  C C   . ILE B 2 168  ? 14.431  1.925   -67.486  1.00 68.52  ? 166  ILE D C   1 
ATOM 9857  O O   . ILE B 2 168  ? 15.368  1.822   -66.687  1.00 70.92  ? 166  ILE D O   1 
ATOM 9858  C CB  . ILE B 2 168  ? 14.596  -0.509  -68.173  1.00 73.60  ? 166  ILE D CB  1 
ATOM 9859  C CG1 . ILE B 2 168  ? 14.354  -1.500  -69.320  1.00 74.20  ? 166  ILE D CG1 1 
ATOM 9860  C CG2 . ILE B 2 168  ? 13.699  -0.881  -66.994  1.00 73.10  ? 166  ILE D CG2 1 
ATOM 9861  C CD1 . ILE B 2 168  ? 14.970  -2.866  -69.111  1.00 78.42  ? 166  ILE D CD1 1 
ATOM 9862  N N   . PRO B 2 169  ? 13.475  2.877   -67.375  1.00 64.64  ? 167  PRO D N   1 
ATOM 9863  C CA  . PRO B 2 169  ? 13.548  3.875   -66.305  1.00 65.22  ? 167  PRO D CA  1 
ATOM 9864  C C   . PRO B 2 169  ? 13.139  3.313   -64.949  1.00 65.13  ? 167  PRO D C   1 
ATOM 9865  O O   . PRO B 2 169  ? 13.926  3.368   -64.000  1.00 68.29  ? 167  PRO D O   1 
ATOM 9866  C CB  . PRO B 2 169  ? 12.580  4.980   -66.761  1.00 62.62  ? 167  PRO D CB  1 
ATOM 9867  C CG  . PRO B 2 169  ? 11.752  4.399   -67.851  1.00 61.02  ? 167  PRO D CG  1 
ATOM 9868  C CD  . PRO B 2 169  ? 12.248  3.024   -68.179  1.00 62.61  ? 167  PRO D CD  1 
ATOM 9869  N N   . GLU B 2 170  ? 11.914  2.792   -64.874  1.00 61.41  ? 168  GLU D N   1 
ATOM 9870  C CA  . GLU B 2 170  ? 11.406  2.102   -63.696  1.00 57.16  ? 168  GLU D CA  1 
ATOM 9871  C C   . GLU B 2 170  ? 11.212  0.648   -64.120  1.00 54.74  ? 168  GLU D C   1 
ATOM 9872  O O   . GLU B 2 170  ? 10.356  0.373   -64.974  1.00 48.73  ? 168  GLU D O   1 
ATOM 9873  C CB  . GLU B 2 170  ? 10.095  2.738   -63.237  1.00 53.75  ? 168  GLU D CB  1 
ATOM 9874  C CG  . GLU B 2 170  ? 9.688   2.391   -61.809  1.00 53.14  ? 168  GLU D CG  1 
ATOM 9875  C CD  . GLU B 2 170  ? 8.489   3.188   -61.295  1.00 49.84  ? 168  GLU D CD  1 
ATOM 9876  O OE1 . GLU B 2 170  ? 8.231   4.313   -61.775  1.00 47.89  ? 168  GLU D OE1 1 
ATOM 9877  O OE2 . GLU B 2 170  ? 7.793   2.683   -60.392  1.00 49.17  ? 168  GLU D OE2 1 
ATOM 9878  N N   . PRO B 2 171  ? 12.048  -0.276  -63.584  1.00 57.88  ? 169  PRO D N   1 
ATOM 9879  C CA  . PRO B 2 171  ? 11.918  -1.695  -63.949  1.00 59.81  ? 169  PRO D CA  1 
ATOM 9880  C C   . PRO B 2 171  ? 10.621  -2.310  -63.446  1.00 59.81  ? 169  PRO D C   1 
ATOM 9881  O O   . PRO B 2 171  ? 10.072  -1.852  -62.447  1.00 60.91  ? 169  PRO D O   1 
ATOM 9882  C CB  . PRO B 2 171  ? 13.128  -2.364  -63.274  1.00 62.41  ? 169  PRO D CB  1 
ATOM 9883  C CG  . PRO B 2 171  ? 14.071  -1.265  -62.959  1.00 63.61  ? 169  PRO D CG  1 
ATOM 9884  C CD  . PRO B 2 171  ? 13.231  -0.045  -62.733  1.00 60.90  ? 169  PRO D CD  1 
ATOM 9885  N N   . GLU B 2 172  ? 10.128  -3.311  -64.171  1.00 61.04  ? 170  GLU D N   1 
ATOM 9886  C CA  . GLU B 2 172  ? 8.919   -4.062  -63.817  1.00 61.87  ? 170  GLU D CA  1 
ATOM 9887  C C   . GLU B 2 172  ? 7.580   -3.313  -63.958  1.00 58.13  ? 170  GLU D C   1 
ATOM 9888  O O   . GLU B 2 172  ? 6.543   -3.945  -63.774  1.00 58.85  ? 170  GLU D O   1 
ATOM 9889  C CB  . GLU B 2 172  ? 9.017   -4.651  -62.395  1.00 68.42  ? 170  GLU D CB  1 
ATOM 9890  C CG  . GLU B 2 172  ? 10.275  -5.465  -62.098  1.00 75.86  ? 170  GLU D CG  1 
ATOM 9891  C CD  . GLU B 2 172  ? 10.098  -6.954  -62.324  1.00 81.25  ? 170  GLU D CD  1 
ATOM 9892  O OE1 . GLU B 2 172  ? 10.578  -7.740  -61.477  1.00 86.12  ? 170  GLU D OE1 1 
ATOM 9893  O OE2 . GLU B 2 172  ? 9.478   -7.336  -63.341  1.00 84.17  ? 170  GLU D OE2 1 
ATOM 9894  N N   . VAL B 2 173  ? 7.570   -2.013  -64.292  1.00 56.72  ? 171  VAL D N   1 
ATOM 9895  C CA  . VAL B 2 173  ? 6.301   -1.245  -64.391  1.00 56.39  ? 171  VAL D CA  1 
ATOM 9896  C C   . VAL B 2 173  ? 5.950   -0.861  -65.840  1.00 54.39  ? 171  VAL D C   1 
ATOM 9897  O O   . VAL B 2 173  ? 6.727   -0.199  -66.529  1.00 51.45  ? 171  VAL D O   1 
ATOM 9898  C CB  . VAL B 2 173  ? 6.264   0.008   -63.469  1.00 56.24  ? 171  VAL D CB  1 
ATOM 9899  C CG1 . VAL B 2 173  ? 6.814   -0.321  -62.084  1.00 57.99  ? 171  VAL D CG1 1 
ATOM 9900  C CG2 . VAL B 2 173  ? 7.011   1.190   -64.064  1.00 58.49  ? 171  VAL D CG2 1 
ATOM 9901  N N   . SER B 2 174  ? 4.763   -1.277  -66.277  1.00 56.25  ? 172  SER D N   1 
ATOM 9902  C CA  . SER B 2 174  ? 4.287   -1.039  -67.640  1.00 58.33  ? 172  SER D CA  1 
ATOM 9903  C C   . SER B 2 174  ? 4.320   0.445   -68.002  1.00 54.47  ? 172  SER D C   1 
ATOM 9904  O O   . SER B 2 174  ? 3.612   1.237   -67.381  1.00 53.67  ? 172  SER D O   1 
ATOM 9905  C CB  . SER B 2 174  ? 2.851   -1.574  -67.783  1.00 62.34  ? 172  SER D CB  1 
ATOM 9906  O OG  . SER B 2 174  ? 2.277   -1.255  -69.042  1.00 65.50  ? 172  SER D OG  1 
ATOM 9907  N N   . ILE B 2 175  ? 5.141   0.822   -68.989  1.00 53.19  ? 173  ILE D N   1 
ATOM 9908  C CA  . ILE B 2 175  ? 5.098   2.203   -69.500  1.00 51.39  ? 173  ILE D CA  1 
ATOM 9909  C C   . ILE B 2 175  ? 3.920   2.245   -70.482  1.00 45.73  ? 173  ILE D C   1 
ATOM 9910  O O   . ILE B 2 175  ? 3.827   1.433   -71.398  1.00 44.69  ? 173  ILE D O   1 
ATOM 9911  C CB  . ILE B 2 175  ? 6.467   2.793   -70.018  1.00 53.80  ? 173  ILE D CB  1 
ATOM 9912  C CG1 . ILE B 2 175  ? 6.687   2.642   -71.528  1.00 54.46  ? 173  ILE D CG1 1 
ATOM 9913  C CG2 . ILE B 2 175  ? 7.664   2.287   -69.212  1.00 56.92  ? 173  ILE D CG2 1 
ATOM 9914  C CD1 . ILE B 2 175  ? 6.207   3.862   -72.291  1.00 56.44  ? 173  ILE D CD1 1 
ATOM 9915  N N   . THR B 2 176  ? 3.002   3.173   -70.233  1.00 43.72  ? 174  THR D N   1 
ATOM 9916  C CA  . THR B 2 176  ? 1.678   3.181   -70.847  1.00 41.56  ? 174  THR D CA  1 
ATOM 9917  C C   . THR B 2 176  ? 1.566   4.120   -72.034  1.00 40.77  ? 174  THR D C   1 
ATOM 9918  O O   . THR B 2 176  ? 0.752   3.882   -72.919  1.00 43.67  ? 174  THR D O   1 
ATOM 9919  C CB  . THR B 2 176  ? 0.620   3.604   -69.819  1.00 41.66  ? 174  THR D CB  1 
ATOM 9920  O OG1 . THR B 2 176  ? 0.998   4.855   -69.241  1.00 40.76  ? 174  THR D OG1 1 
ATOM 9921  C CG2 . THR B 2 176  ? 0.497   2.562   -68.713  1.00 44.13  ? 174  THR D CG2 1 
ATOM 9922  N N   . SER B 2 177  ? 2.343   5.201   -72.028  1.00 41.22  ? 175  SER D N   1 
ATOM 9923  C CA  . SER B 2 177  ? 2.383   6.139   -73.149  1.00 43.62  ? 175  SER D CA  1 
ATOM 9924  C C   . SER B 2 177  ? 3.671   6.955   -73.151  1.00 44.92  ? 175  SER D C   1 
ATOM 9925  O O   . SER B 2 177  ? 4.204   7.288   -72.091  1.00 48.49  ? 175  SER D O   1 
ATOM 9926  C CB  . SER B 2 177  ? 1.162   7.065   -73.113  1.00 42.53  ? 175  SER D CB  1 
ATOM 9927  O OG  . SER B 2 177  ? 1.351   8.238   -73.891  1.00 41.09  ? 175  SER D OG  1 
ATOM 9928  N N   . ALA B 2 178  ? 4.161   7.265   -74.350  1.00 44.23  ? 176  ALA D N   1 
ATOM 9929  C CA  . ALA B 2 178  ? 5.306   8.155   -74.522  1.00 44.79  ? 176  ALA D CA  1 
ATOM 9930  C C   . ALA B 2 178  ? 5.031   9.149   -75.631  1.00 46.06  ? 176  ALA D C   1 
ATOM 9931  O O   . ALA B 2 178  ? 4.209   8.898   -76.520  1.00 46.48  ? 176  ALA D O   1 
ATOM 9932  C CB  . ALA B 2 178  ? 6.568   7.367   -74.823  1.00 45.40  ? 176  ALA D CB  1 
ATOM 9933  N N   . HIS B 2 179  ? 5.721   10.284  -75.557  1.00 49.02  ? 177  HIS D N   1 
ATOM 9934  C CA  . HIS B 2 179  ? 5.604   11.349  -76.551  1.00 51.25  ? 177  HIS D CA  1 
ATOM 9935  C C   . HIS B 2 179  ? 6.898   12.163  -76.605  1.00 53.46  ? 177  HIS D C   1 
ATOM 9936  O O   . HIS B 2 179  ? 7.728   12.104  -75.697  1.00 53.87  ? 177  HIS D O   1 
ATOM 9937  C CB  . HIS B 2 179  ? 4.401   12.249  -76.241  1.00 50.83  ? 177  HIS D CB  1 
ATOM 9938  C CG  . HIS B 2 179  ? 3.934   13.061  -77.411  1.00 53.29  ? 177  HIS D CG  1 
ATOM 9939  N ND1 . HIS B 2 179  ? 4.158   14.417  -77.514  1.00 51.94  ? 177  HIS D ND1 1 
ATOM 9940  C CD2 . HIS B 2 179  ? 3.281   12.703  -78.541  1.00 54.00  ? 177  HIS D CD2 1 
ATOM 9941  C CE1 . HIS B 2 179  ? 3.645   14.863  -78.646  1.00 51.26  ? 177  HIS D CE1 1 
ATOM 9942  N NE2 . HIS B 2 179  ? 3.109   13.842  -79.290  1.00 51.67  ? 177  HIS D NE2 1 
ATOM 9943  N N   . ILE B 2 180  ? 7.055   12.905  -77.692  1.00 56.18  ? 178  ILE D N   1 
ATOM 9944  C CA  . ILE B 2 180  ? 8.243   13.703  -77.959  1.00 58.20  ? 178  ILE D CA  1 
ATOM 9945  C C   . ILE B 2 180  ? 7.758   15.019  -78.582  1.00 56.10  ? 178  ILE D C   1 
ATOM 9946  O O   . ILE B 2 180  ? 6.894   15.011  -79.463  1.00 55.24  ? 178  ILE D O   1 
ATOM 9947  C CB  . ILE B 2 180  ? 9.229   12.910  -78.861  1.00 62.53  ? 178  ILE D CB  1 
ATOM 9948  C CG1 . ILE B 2 180  ? 10.408  13.773  -79.299  1.00 66.67  ? 178  ILE D CG1 1 
ATOM 9949  C CG2 . ILE B 2 180  ? 8.529   12.342  -80.093  1.00 68.79  ? 178  ILE D CG2 1 
ATOM 9950  C CD1 . ILE B 2 180  ? 11.557  12.959  -79.850  1.00 73.94  ? 178  ILE D CD1 1 
ATOM 9951  N N   . ASP B 2 181  ? 8.277   16.147  -78.100  1.00 57.09  ? 179  ASP D N   1 
ATOM 9952  C CA  . ASP B 2 181  ? 7.790   17.463  -78.541  1.00 60.22  ? 179  ASP D CA  1 
ATOM 9953  C C   . ASP B 2 181  ? 8.207   17.765  -79.993  1.00 67.59  ? 179  ASP D C   1 
ATOM 9954  O O   . ASP B 2 181  ? 9.181   17.184  -80.483  1.00 72.65  ? 179  ASP D O   1 
ATOM 9955  C CB  . ASP B 2 181  ? 8.250   18.580  -77.585  1.00 59.94  ? 179  ASP D CB  1 
ATOM 9956  C CG  . ASP B 2 181  ? 9.719   18.941  -77.742  1.00 62.00  ? 179  ASP D CG  1 
ATOM 9957  O OD1 . ASP B 2 181  ? 10.559  18.026  -77.824  1.00 64.48  ? 179  ASP D OD1 1 
ATOM 9958  O OD2 . ASP B 2 181  ? 10.042  20.145  -77.766  1.00 63.90  ? 179  ASP D OD2 1 
ATOM 9959  N N   . PRO B 2 182  ? 7.473   18.665  -80.687  1.00 68.48  ? 180  PRO D N   1 
ATOM 9960  C CA  . PRO B 2 182  ? 7.823   19.002  -82.076  1.00 70.86  ? 180  PRO D CA  1 
ATOM 9961  C C   . PRO B 2 182  ? 9.251   19.522  -82.289  1.00 73.04  ? 180  PRO D C   1 
ATOM 9962  O O   . PRO B 2 182  ? 9.888   19.151  -83.276  1.00 75.74  ? 180  PRO D O   1 
ATOM 9963  C CB  . PRO B 2 182  ? 6.798   20.077  -82.443  1.00 72.18  ? 180  PRO D CB  1 
ATOM 9964  C CG  . PRO B 2 182  ? 5.627   19.773  -81.588  1.00 67.97  ? 180  PRO D CG  1 
ATOM 9965  C CD  . PRO B 2 182  ? 6.203   19.302  -80.287  1.00 66.10  ? 180  PRO D CD  1 
ATOM 9966  N N   . ASP B 2 183  ? 9.746   20.358  -81.375  1.00 73.62  ? 181  ASP D N   1 
ATOM 9967  C CA  . ASP B 2 183  ? 11.134  20.853  -81.443  1.00 78.88  ? 181  ASP D CA  1 
ATOM 9968  C C   . ASP B 2 183  ? 12.195  19.769  -81.194  1.00 74.16  ? 181  ASP D C   1 
ATOM 9969  O O   . ASP B 2 183  ? 13.380  20.017  -81.424  1.00 80.82  ? 181  ASP D O   1 
ATOM 9970  C CB  . ASP B 2 183  ? 11.363  22.026  -80.465  1.00 85.85  ? 181  ASP D CB  1 
ATOM 9971  C CG  . ASP B 2 183  ? 10.723  23.333  -80.930  1.00 92.45  ? 181  ASP D CG  1 
ATOM 9972  O OD1 . ASP B 2 183  ? 10.538  23.536  -82.152  1.00 98.13  ? 181  ASP D OD1 1 
ATOM 9973  O OD2 . ASP B 2 183  ? 10.422  24.175  -80.057  1.00 93.43  ? 181  ASP D OD2 1 
ATOM 9974  N N   . ALA B 2 184  ? 11.775  18.596  -80.711  1.00 65.78  ? 182  ALA D N   1 
ATOM 9975  C CA  . ALA B 2 184  ? 12.646  17.428  -80.522  1.00 64.62  ? 182  ALA D CA  1 
ATOM 9976  C C   . ALA B 2 184  ? 13.745  17.679  -79.489  1.00 65.36  ? 182  ALA D C   1 
ATOM 9977  O O   . ALA B 2 184  ? 14.874  17.208  -79.638  1.00 67.51  ? 182  ALA D O   1 
ATOM 9978  C CB  . ALA B 2 184  ? 13.229  16.958  -81.853  1.00 67.90  ? 182  ALA D CB  1 
ATOM 9979  N N   . SER B 2 185  ? 13.395  18.439  -78.452  1.00 66.54  ? 183  SER D N   1 
ATOM 9980  C CA  . SER B 2 185  ? 14.279  18.729  -77.321  1.00 68.26  ? 183  SER D CA  1 
ATOM 9981  C C   . SER B 2 185  ? 14.022  17.793  -76.136  1.00 67.07  ? 183  SER D C   1 
ATOM 9982  O O   . SER B 2 185  ? 14.964  17.428  -75.434  1.00 70.40  ? 183  SER D O   1 
ATOM 9983  C CB  . SER B 2 185  ? 14.114  20.189  -76.883  1.00 67.52  ? 183  SER D CB  1 
ATOM 9984  O OG  . SER B 2 185  ? 12.749  20.514  -76.693  1.00 64.24  ? 183  SER D OG  1 
ATOM 9985  N N   . TYR B 2 186  ? 12.758  17.413  -75.927  1.00 65.42  ? 184  TYR D N   1 
ATOM 9986  C CA  . TYR B 2 186  ? 12.339  16.548  -74.818  1.00 63.87  ? 184  TYR D CA  1 
ATOM 9987  C C   . TYR B 2 186  ? 11.617  15.300  -75.311  1.00 61.93  ? 184  TYR D C   1 
ATOM 9988  O O   . TYR B 2 186  ? 10.794  15.388  -76.221  1.00 65.23  ? 184  TYR D O   1 
ATOM 9989  C CB  . TYR B 2 186  ? 11.370  17.302  -73.901  1.00 65.07  ? 184  TYR D CB  1 
ATOM 9990  C CG  . TYR B 2 186  ? 11.972  18.481  -73.183  1.00 70.12  ? 184  TYR D CG  1 
ATOM 9991  C CD1 . TYR B 2 186  ? 11.802  19.780  -73.664  1.00 72.70  ? 184  TYR D CD1 1 
ATOM 9992  C CD2 . TYR B 2 186  ? 12.713  18.301  -72.013  1.00 73.93  ? 184  TYR D CD2 1 
ATOM 9993  C CE1 . TYR B 2 186  ? 12.365  20.866  -73.004  1.00 79.96  ? 184  TYR D CE1 1 
ATOM 9994  C CE2 . TYR B 2 186  ? 13.274  19.380  -71.342  1.00 77.92  ? 184  TYR D CE2 1 
ATOM 9995  C CZ  . TYR B 2 186  ? 13.098  20.660  -71.837  1.00 81.26  ? 184  TYR D CZ  1 
ATOM 9996  O OH  . TYR B 2 186  ? 13.656  21.728  -71.169  1.00 85.26  ? 184  TYR D OH  1 
ATOM 9997  N N   . MET B 2 187  ? 11.918  14.149  -74.710  1.00 61.36  ? 185  MET D N   1 
ATOM 9998  C CA  . MET B 2 187  ? 11.036  12.974  -74.776  1.00 60.13  ? 185  MET D CA  1 
ATOM 9999  C C   . MET B 2 187  ? 10.440  12.766  -73.393  1.00 57.16  ? 185  MET D C   1 
ATOM 10000 O O   . MET B 2 187  ? 11.116  12.989  -72.385  1.00 57.20  ? 185  MET D O   1 
ATOM 10001 C CB  . MET B 2 187  ? 11.791  11.712  -75.192  1.00 65.11  ? 185  MET D CB  1 
ATOM 10002 C CG  . MET B 2 187  ? 10.894  10.541  -75.587  1.00 65.83  ? 185  MET D CG  1 
ATOM 10003 S SD  . MET B 2 187  ? 11.495  8.940   -74.998  1.00 67.03  ? 185  MET D SD  1 
ATOM 10004 C CE  . MET B 2 187  ? 10.591  8.798   -73.464  1.00 65.62  ? 185  MET D CE  1 
ATOM 10005 N N   . ALA B 2 188  ? 9.173   12.353  -73.355  1.00 54.41  ? 186  ALA D N   1 
ATOM 10006 C CA  . ALA B 2 188  ? 8.466   12.060  -72.109  1.00 50.38  ? 186  ALA D CA  1 
ATOM 10007 C C   . ALA B 2 188  ? 7.831   10.680  -72.181  1.00 47.74  ? 186  ALA D C   1 
ATOM 10008 O O   . ALA B 2 188  ? 7.287   10.291  -73.213  1.00 45.55  ? 186  ALA D O   1 
ATOM 10009 C CB  . ALA B 2 188  ? 7.401   13.108  -71.837  1.00 48.80  ? 186  ALA D CB  1 
ATOM 10010 N N   . ALA B 2 189  ? 7.925   9.947   -71.078  1.00 49.24  ? 187  ALA D N   1 
ATOM 10011 C CA  . ALA B 2 189  ? 7.273   8.651   -70.916  1.00 49.26  ? 187  ALA D CA  1 
ATOM 10012 C C   . ALA B 2 189  ? 6.490   8.660   -69.619  1.00 48.23  ? 187  ALA D C   1 
ATOM 10013 O O   . ALA B 2 189  ? 6.737   9.478   -68.739  1.00 54.59  ? 187  ALA D O   1 
ATOM 10014 C CB  . ALA B 2 189  ? 8.303   7.536   -70.896  1.00 53.64  ? 187  ALA D CB  1 
ATOM 10015 N N   . VAL B 2 190  ? 5.561   7.724   -69.502  1.00 45.71  ? 188  VAL D N   1 
ATOM 10016 C CA  . VAL B 2 190  ? 4.612   7.692   -68.393  1.00 44.16  ? 188  VAL D CA  1 
ATOM 10017 C C   . VAL B 2 190  ? 4.199   6.234   -68.137  1.00 44.33  ? 188  VAL D C   1 
ATOM 10018 O O   . VAL B 2 190  ? 4.040   5.465   -69.087  1.00 47.54  ? 188  VAL D O   1 
ATOM 10019 C CB  . VAL B 2 190  ? 3.425   8.653   -68.707  1.00 43.74  ? 188  VAL D CB  1 
ATOM 10020 C CG1 . VAL B 2 190  ? 2.056   7.996   -68.581  1.00 43.06  ? 188  VAL D CG1 1 
ATOM 10021 C CG2 . VAL B 2 190  ? 3.512   9.905   -67.850  1.00 43.66  ? 188  VAL D CG2 1 
ATOM 10022 N N   . ASN B 2 191  ? 4.027   5.859   -66.867  1.00 43.77  ? 189  ASN D N   1 
ATOM 10023 C CA  . ASN B 2 191  ? 3.787   4.447   -66.496  1.00 42.81  ? 189  ASN D CA  1 
ATOM 10024 C C   . ASN B 2 191  ? 2.610   4.223   -65.543  1.00 41.26  ? 189  ASN D C   1 
ATOM 10025 O O   . ASN B 2 191  ? 1.964   5.171   -65.095  1.00 39.32  ? 189  ASN D O   1 
ATOM 10026 C CB  . ASN B 2 191  ? 5.080   3.807   -65.947  1.00 44.92  ? 189  ASN D CB  1 
ATOM 10027 C CG  . ASN B 2 191  ? 5.586   4.464   -64.677  1.00 45.34  ? 189  ASN D CG  1 
ATOM 10028 O OD1 . ASN B 2 191  ? 4.837   5.107   -63.940  1.00 44.46  ? 189  ASN D OD1 1 
ATOM 10029 N ND2 . ASN B 2 191  ? 6.876   4.297   -64.415  1.00 45.62  ? 189  ASN D ND2 1 
ATOM 10030 N N   . SER B 2 192  ? 2.339   2.951   -65.260  1.00 42.72  ? 190  SER D N   1 
ATOM 10031 C CA  . SER B 2 192  ? 1.254   2.538   -64.364  1.00 43.50  ? 190  SER D CA  1 
ATOM 10032 C C   . SER B 2 192  ? 1.400   3.011   -62.907  1.00 43.29  ? 190  SER D C   1 
ATOM 10033 O O   . SER B 2 192  ? 0.400   3.205   -62.218  1.00 41.58  ? 190  SER D O   1 
ATOM 10034 C CB  . SER B 2 192  ? 1.098   1.009   -64.401  1.00 46.11  ? 190  SER D CB  1 
ATOM 10035 O OG  . SER B 2 192  ? 2.329   0.347   -64.149  1.00 50.47  ? 190  SER D OG  1 
ATOM 10036 N N   . THR B 2 193  ? 2.637   3.186   -62.441  1.00 44.81  ? 191  THR D N   1 
ATOM 10037 C CA  . THR B 2 193  ? 2.895   3.773   -61.120  1.00 45.26  ? 191  THR D CA  1 
ATOM 10038 C C   . THR B 2 193  ? 2.310   5.186   -61.037  1.00 44.67  ? 191  THR D C   1 
ATOM 10039 O O   . THR B 2 193  ? 1.912   5.629   -59.963  1.00 46.98  ? 191  THR D O   1 
ATOM 10040 C CB  . THR B 2 193  ? 4.411   3.842   -60.803  1.00 46.10  ? 191  THR D CB  1 
ATOM 10041 O OG1 . THR B 2 193  ? 5.035   2.593   -61.120  1.00 46.73  ? 191  THR D OG1 1 
ATOM 10042 C CG2 . THR B 2 193  ? 4.656   4.146   -59.332  1.00 47.96  ? 191  THR D CG2 1 
ATOM 10043 N N   . GLY B 2 194  ? 2.267   5.879   -62.175  1.00 43.69  ? 192  GLY D N   1 
ATOM 10044 C CA  . GLY B 2 194  ? 1.758   7.245   -62.269  1.00 42.29  ? 192  GLY D CA  1 
ATOM 10045 C C   . GLY B 2 194  ? 2.869   8.273   -62.423  1.00 44.28  ? 192  GLY D C   1 
ATOM 10046 O O   . GLY B 2 194  ? 2.593   9.472   -62.480  1.00 44.07  ? 192  GLY D O   1 
ATOM 10047 N N   . ASN B 2 195  ? 4.121   7.808   -62.495  1.00 46.77  ? 193  ASN D N   1 
ATOM 10048 C CA  . ASN B 2 195  ? 5.276   8.679   -62.715  1.00 47.52  ? 193  ASN D CA  1 
ATOM 10049 C C   . ASN B 2 195  ? 5.389   9.102   -64.183  1.00 49.28  ? 193  ASN D C   1 
ATOM 10050 O O   . ASN B 2 195  ? 4.940   8.386   -65.085  1.00 47.16  ? 193  ASN D O   1 
ATOM 10051 C CB  . ASN B 2 195  ? 6.567   7.973   -62.297  1.00 47.84  ? 193  ASN D CB  1 
ATOM 10052 C CG  . ASN B 2 195  ? 6.610   7.662   -60.818  1.00 49.55  ? 193  ASN D CG  1 
ATOM 10053 O OD1 . ASN B 2 195  ? 6.337   8.524   -59.986  1.00 52.52  ? 193  ASN D OD1 1 
ATOM 10054 N ND2 . ASN B 2 195  ? 6.971   6.428   -60.481  1.00 51.00  ? 193  ASN D ND2 1 
ATOM 10055 N N   . CYS B 2 196  ? 5.990   10.273  -64.401  1.00 51.33  ? 194  CYS D N   1 
ATOM 10056 C CA  . CYS B 2 196  ? 6.277   10.794  -65.737  1.00 48.97  ? 194  CYS D CA  1 
ATOM 10057 C C   . CYS B 2 196  ? 7.756   11.142  -65.837  1.00 50.47  ? 194  CYS D C   1 
ATOM 10058 O O   . CYS B 2 196  ? 8.200   12.143  -65.276  1.00 51.65  ? 194  CYS D O   1 
ATOM 10059 C CB  . CYS B 2 196  ? 5.445   12.040  -66.041  1.00 48.35  ? 194  CYS D CB  1 
ATOM 10060 S SG  . CYS B 2 196  ? 5.877   12.829  -67.615  1.00 45.61  ? 194  CYS D SG  1 
ATOM 10061 N N   . TYR B 2 197  ? 8.505   10.307  -66.553  1.00 51.20  ? 195  TYR D N   1 
ATOM 10062 C CA  . TYR B 2 197  ? 9.932   10.527  -66.788  1.00 51.91  ? 195  TYR D CA  1 
ATOM 10063 C C   . TYR B 2 197  ? 10.129  11.465  -67.966  1.00 51.71  ? 195  TYR D C   1 
ATOM 10064 O O   . TYR B 2 197  ? 9.370   11.407  -68.935  1.00 53.61  ? 195  TYR D O   1 
ATOM 10065 C CB  . TYR B 2 197  ? 10.636  9.197   -67.041  1.00 52.82  ? 195  TYR D CB  1 
ATOM 10066 C CG  . TYR B 2 197  ? 10.595  8.321   -65.821  1.00 53.81  ? 195  TYR D CG  1 
ATOM 10067 C CD1 . TYR B 2 197  ? 9.565   7.399   -65.627  1.00 51.40  ? 195  TYR D CD1 1 
ATOM 10068 C CD2 . TYR B 2 197  ? 11.559  8.444   -64.831  1.00 56.13  ? 195  TYR D CD2 1 
ATOM 10069 C CE1 . TYR B 2 197  ? 9.518   6.608   -64.491  1.00 49.72  ? 195  TYR D CE1 1 
ATOM 10070 C CE2 . TYR B 2 197  ? 11.521  7.656   -63.695  1.00 56.12  ? 195  TYR D CE2 1 
ATOM 10071 C CZ  . TYR B 2 197  ? 10.497  6.745   -63.531  1.00 53.17  ? 195  TYR D CZ  1 
ATOM 10072 O OH  . TYR B 2 197  ? 10.457  5.978   -62.401  1.00 57.21  ? 195  TYR D OH  1 
ATOM 10073 N N   . VAL B 2 198  ? 11.135  12.334  -67.866  1.00 49.85  ? 196  VAL D N   1 
ATOM 10074 C CA  . VAL B 2 198  ? 11.464  13.287  -68.923  1.00 49.71  ? 196  VAL D CA  1 
ATOM 10075 C C   . VAL B 2 198  ? 12.959  13.227  -69.204  1.00 53.94  ? 196  VAL D C   1 
ATOM 10076 O O   . VAL B 2 198  ? 13.765  13.182  -68.275  1.00 57.92  ? 196  VAL D O   1 
ATOM 10077 C CB  . VAL B 2 198  ? 11.078  14.730  -68.544  1.00 49.53  ? 196  VAL D CB  1 
ATOM 10078 C CG1 . VAL B 2 198  ? 11.388  15.686  -69.689  1.00 51.20  ? 196  VAL D CG1 1 
ATOM 10079 C CG2 . VAL B 2 198  ? 9.599   14.819  -68.190  1.00 46.86  ? 196  VAL D CG2 1 
ATOM 10080 N N   . TRP B 2 199  ? 13.311  13.247  -70.489  1.00 54.53  ? 197  TRP D N   1 
ATOM 10081 C CA  . TRP B 2 199  ? 14.699  13.190  -70.939  1.00 57.80  ? 197  TRP D CA  1 
ATOM 10082 C C   . TRP B 2 199  ? 14.960  14.344  -71.909  1.00 60.37  ? 197  TRP D C   1 
ATOM 10083 O O   . TRP B 2 199  ? 14.090  14.679  -72.710  1.00 58.17  ? 197  TRP D O   1 
ATOM 10084 C CB  . TRP B 2 199  ? 14.986  11.861  -71.655  1.00 58.16  ? 197  TRP D CB  1 
ATOM 10085 C CG  . TRP B 2 199  ? 14.264  10.653  -71.111  1.00 57.86  ? 197  TRP D CG  1 
ATOM 10086 C CD1 . TRP B 2 199  ? 12.937  10.332  -71.275  1.00 56.37  ? 197  TRP D CD1 1 
ATOM 10087 C CD2 . TRP B 2 199  ? 14.836  9.593   -70.358  1.00 58.79  ? 197  TRP D CD2 1 
ATOM 10088 N NE1 . TRP B 2 199  ? 12.648  9.143   -70.648  1.00 53.33  ? 197  TRP D NE1 1 
ATOM 10089 C CE2 . TRP B 2 199  ? 13.797  8.667   -70.078  1.00 57.27  ? 197  TRP D CE2 1 
ATOM 10090 C CE3 . TRP B 2 199  ? 16.124  9.335   -69.880  1.00 64.11  ? 197  TRP D CE3 1 
ATOM 10091 C CZ2 . TRP B 2 199  ? 14.010  7.510   -69.342  1.00 61.90  ? 197  TRP D CZ2 1 
ATOM 10092 C CZ3 . TRP B 2 199  ? 16.341  8.179   -69.144  1.00 69.17  ? 197  TRP D CZ3 1 
ATOM 10093 C CH2 . TRP B 2 199  ? 15.287  7.278   -68.883  1.00 69.76  ? 197  TRP D CH2 1 
ATOM 10094 N N   . ASN B 2 200  ? 16.144  14.952  -71.824  1.00 65.95  ? 198  ASN D N   1 
ATOM 10095 C CA  . ASN B 2 200  ? 16.651  15.846  -72.876  1.00 70.81  ? 198  ASN D CA  1 
ATOM 10096 C C   . ASN B 2 200  ? 17.189  15.011  -74.040  1.00 74.88  ? 198  ASN D C   1 
ATOM 10097 O O   . ASN B 2 200  ? 17.619  13.870  -73.831  1.00 76.72  ? 198  ASN D O   1 
ATOM 10098 C CB  . ASN B 2 200  ? 17.774  16.743  -72.350  1.00 75.48  ? 198  ASN D CB  1 
ATOM 10099 C CG  . ASN B 2 200  ? 17.278  17.812  -71.401  1.00 77.96  ? 198  ASN D CG  1 
ATOM 10100 O OD1 . ASN B 2 200  ? 16.327  18.538  -71.698  1.00 79.35  ? 198  ASN D OD1 1 
ATOM 10101 N ND2 . ASN B 2 200  ? 17.940  17.933  -70.257  1.00 82.37  ? 198  ASN D ND2 1 
ATOM 10102 N N   . LEU B 2 201  ? 17.174  15.581  -75.251  1.00 76.52  ? 199  LEU D N   1 
ATOM 10103 C CA  . LEU B 2 201  ? 17.627  14.883  -76.471  1.00 78.89  ? 199  LEU D CA  1 
ATOM 10104 C C   . LEU B 2 201  ? 18.861  15.530  -77.125  1.00 89.23  ? 199  LEU D C   1 
ATOM 10105 O O   . LEU B 2 201  ? 18.858  16.729  -77.405  1.00 90.62  ? 199  LEU D O   1 
ATOM 10106 C CB  . LEU B 2 201  ? 16.491  14.829  -77.493  1.00 73.24  ? 199  LEU D CB  1 
ATOM 10107 C CG  . LEU B 2 201  ? 15.103  14.373  -77.028  1.00 67.00  ? 199  LEU D CG  1 
ATOM 10108 C CD1 . LEU B 2 201  ? 14.233  14.061  -78.225  1.00 65.22  ? 199  LEU D CD1 1 
ATOM 10109 C CD2 . LEU B 2 201  ? 15.152  13.146  -76.151  1.00 65.55  ? 199  LEU D CD2 1 
ATOM 10110 N N   . THR B 2 202  ? 19.896  14.723  -77.381  1.00 100.51 ? 200  THR D N   1 
ATOM 10111 C CA  . THR B 2 202  ? 21.127  15.185  -78.036  1.00 118.87 ? 200  THR D CA  1 
ATOM 10112 C C   . THR B 2 202  ? 20.937  15.247  -79.552  1.00 133.23 ? 200  THR D C   1 
ATOM 10113 O O   . THR B 2 202  ? 20.590  14.245  -80.186  1.00 129.44 ? 200  THR D O   1 
ATOM 10114 C CB  . THR B 2 202  ? 22.325  14.257  -77.725  1.00 128.28 ? 200  THR D CB  1 
ATOM 10115 O OG1 . THR B 2 202  ? 22.454  14.099  -76.308  1.00 132.85 ? 200  THR D OG1 1 
ATOM 10116 C CG2 . THR B 2 202  ? 23.643  14.824  -78.281  1.00 132.68 ? 200  THR D CG2 1 
ATOM 10117 N N   . GLY B 2 203  ? 21.193  16.424  -80.123  1.00 151.49 ? 201  GLY D N   1 
ATOM 10118 C CA  . GLY B 2 203  ? 21.096  16.640  -81.561  1.00 160.13 ? 201  GLY D CA  1 
ATOM 10119 C C   . GLY B 2 203  ? 22.278  16.057  -82.310  1.00 176.75 ? 201  GLY D C   1 
ATOM 10120 O O   . GLY B 2 203  ? 23.240  16.763  -82.615  1.00 181.24 ? 201  GLY D O   1 
ATOM 10121 N N   . GLY B 2 204  ? 22.206  14.755  -82.578  1.00 188.23 ? 202  GLY D N   1 
ATOM 10122 C CA  . GLY B 2 204  ? 23.123  14.071  -83.492  1.00 201.77 ? 202  GLY D CA  1 
ATOM 10123 C C   . GLY B 2 204  ? 22.295  13.374  -84.554  1.00 211.65 ? 202  GLY D C   1 
ATOM 10124 O O   . GLY B 2 204  ? 22.486  12.190  -84.818  1.00 229.07 ? 202  GLY D O   1 
ATOM 10125 N N   . ILE B 2 205  ? 21.385  14.132  -85.167  1.00 202.29 ? 203  ILE D N   1 
ATOM 10126 C CA  . ILE B 2 205  ? 20.332  13.592  -86.043  1.00 183.51 ? 203  ILE D CA  1 
ATOM 10127 C C   . ILE B 2 205  ? 20.826  13.316  -87.478  1.00 186.43 ? 203  ILE D C   1 
ATOM 10128 O O   . ILE B 2 205  ? 20.335  12.389  -88.129  1.00 197.27 ? 203  ILE D O   1 
ATOM 10129 C CB  . ILE B 2 205  ? 19.076  14.514  -86.013  1.00 164.06 ? 203  ILE D CB  1 
ATOM 10130 C CG1 . ILE B 2 205  ? 18.441  14.475  -84.612  1.00 151.95 ? 203  ILE D CG1 1 
ATOM 10131 C CG2 . ILE B 2 205  ? 18.031  14.105  -87.050  1.00 159.69 ? 203  ILE D CG2 1 
ATOM 10132 C CD1 . ILE B 2 205  ? 17.513  15.631  -84.301  1.00 146.95 ? 203  ILE D CD1 1 
ATOM 10133 N N   . GLY B 2 206  ? 21.791  14.102  -87.962  1.00 177.91 ? 204  GLY D N   1 
ATOM 10134 C CA  . GLY B 2 206  ? 22.368  13.912  -89.300  1.00 174.67 ? 204  GLY D CA  1 
ATOM 10135 C C   . GLY B 2 206  ? 23.177  12.632  -89.430  1.00 174.27 ? 204  GLY D C   1 
ATOM 10136 O O   . GLY B 2 206  ? 22.837  11.752  -90.223  1.00 168.02 ? 204  GLY D O   1 
ATOM 10137 N N   . ASP B 2 207  ? 24.247  12.532  -88.640  1.00 180.60 ? 205  ASP D N   1 
ATOM 10138 C CA  . ASP B 2 207  ? 25.057  11.306  -88.550  1.00 185.92 ? 205  ASP D CA  1 
ATOM 10139 C C   . ASP B 2 207  ? 24.359  10.172  -87.781  1.00 188.93 ? 205  ASP D C   1 
ATOM 10140 O O   . ASP B 2 207  ? 24.836  9.036   -87.806  1.00 187.05 ? 205  ASP D O   1 
ATOM 10141 C CB  . ASP B 2 207  ? 26.418  11.600  -87.899  1.00 187.90 ? 205  ASP D CB  1 
ATOM 10142 C CG  . ASP B 2 207  ? 27.323  12.451  -88.778  1.00 194.68 ? 205  ASP D CG  1 
ATOM 10143 O OD1 . ASP B 2 207  ? 27.490  12.122  -89.972  1.00 198.47 ? 205  ASP D OD1 1 
ATOM 10144 O OD2 . ASP B 2 207  ? 27.885  13.443  -88.268  1.00 197.75 ? 205  ASP D OD2 1 
ATOM 10145 N N   . GLU B 2 208  ? 23.262  10.494  -87.088  1.00 198.04 ? 206  GLU D N   1 
ATOM 10146 C CA  . GLU B 2 208  ? 22.404  9.533   -86.371  1.00 205.24 ? 206  GLU D CA  1 
ATOM 10147 C C   . GLU B 2 208  ? 23.083  8.978   -85.111  1.00 200.93 ? 206  GLU D C   1 
ATOM 10148 O O   . GLU B 2 208  ? 23.857  8.020   -85.168  1.00 211.73 ? 206  GLU D O   1 
ATOM 10149 C CB  . GLU B 2 208  ? 21.857  8.424   -87.289  1.00 213.64 ? 206  GLU D CB  1 
ATOM 10150 C CG  . GLU B 2 208  ? 20.895  8.949   -88.348  1.00 207.52 ? 206  GLU D CG  1 
ATOM 10151 C CD  . GLU B 2 208  ? 20.170  7.849   -89.095  1.00 195.00 ? 206  GLU D CD  1 
ATOM 10152 O OE1 . GLU B 2 208  ? 19.140  7.363   -88.583  1.00 175.10 ? 206  GLU D OE1 1 
ATOM 10153 O OE2 . GLU B 2 208  ? 20.620  7.485   -90.202  1.00 198.45 ? 206  GLU D OE2 1 
ATOM 10154 N N   . VAL B 2 209  ? 22.790  9.633   -83.986  1.00 181.53 ? 207  VAL D N   1 
ATOM 10155 C CA  . VAL B 2 209  ? 23.307  9.274   -82.658  1.00 166.58 ? 207  VAL D CA  1 
ATOM 10156 C C   . VAL B 2 209  ? 22.133  9.234   -81.659  1.00 150.81 ? 207  VAL D C   1 
ATOM 10157 O O   . VAL B 2 209  ? 21.916  8.215   -81.002  1.00 149.65 ? 207  VAL D O   1 
ATOM 10158 C CB  . VAL B 2 209  ? 24.420  10.262  -82.206  1.00 162.60 ? 207  VAL D CB  1 
ATOM 10159 C CG1 . VAL B 2 209  ? 24.951  9.915   -80.822  1.00 158.23 ? 207  VAL D CG1 1 
ATOM 10160 C CG2 . VAL B 2 209  ? 25.574  10.276  -83.204  1.00 160.12 ? 207  VAL D CG2 1 
ATOM 10161 N N   . THR B 2 210  ? 21.410  10.354  -81.547  1.00 135.41 ? 208  THR D N   1 
ATOM 10162 C CA  . THR B 2 210  ? 20.112  10.481  -80.834  1.00 115.56 ? 208  THR D CA  1 
ATOM 10163 C C   . THR B 2 210  ? 20.069  10.066  -79.348  1.00 109.44 ? 208  THR D C   1 
ATOM 10164 O O   . THR B 2 210  ? 19.099  9.458   -78.898  1.00 100.85 ? 208  THR D O   1 
ATOM 10165 C CB  . THR B 2 210  ? 18.934  9.831   -81.628  1.00 104.35 ? 208  THR D CB  1 
ATOM 10166 O OG1 . THR B 2 210  ? 17.686  10.296  -81.095  1.00 87.35  ? 208  THR D OG1 1 
ATOM 10167 C CG2 . THR B 2 210  ? 18.964  8.268   -81.633  1.00 102.80 ? 208  THR D CG2 1 
ATOM 10168 N N   . GLN B 2 211  ? 21.093  10.442  -78.583  1.00 113.96 ? 209  GLN D N   1 
ATOM 10169 C CA  . GLN B 2 211  ? 21.169  10.086  -77.155  1.00 111.04 ? 209  GLN D CA  1 
ATOM 10170 C C   . GLN B 2 211  ? 20.044  10.719  -76.329  1.00 98.33  ? 209  GLN D C   1 
ATOM 10171 O O   . GLN B 2 211  ? 19.602  11.830  -76.631  1.00 96.70  ? 209  GLN D O   1 
ATOM 10172 C CB  . GLN B 2 211  ? 22.522  10.507  -76.559  1.00 124.12 ? 209  GLN D CB  1 
ATOM 10173 C CG  . GLN B 2 211  ? 23.729  9.726   -77.066  1.00 133.34 ? 209  GLN D CG  1 
ATOM 10174 C CD  . GLN B 2 211  ? 23.698  8.240   -76.730  1.00 140.75 ? 209  GLN D CD  1 
ATOM 10175 O OE1 . GLN B 2 211  ? 24.318  7.433   -77.421  1.00 149.95 ? 209  GLN D OE1 1 
ATOM 10176 N NE2 . GLN B 2 211  ? 22.981  7.872   -75.670  1.00 142.94 ? 209  GLN D NE2 1 
ATOM 10177 N N   . LEU B 2 212  ? 19.581  9.995   -75.305  1.00 88.42  ? 210  LEU D N   1 
ATOM 10178 C CA  . LEU B 2 212  ? 18.602  10.508  -74.336  1.00 80.45  ? 210  LEU D CA  1 
ATOM 10179 C C   . LEU B 2 212  ? 19.272  10.730  -72.976  1.00 79.36  ? 210  LEU D C   1 
ATOM 10180 O O   . LEU B 2 212  ? 19.652  9.770   -72.301  1.00 77.61  ? 210  LEU D O   1 
ATOM 10181 C CB  . LEU B 2 212  ? 17.419  9.542   -74.166  1.00 76.08  ? 210  LEU D CB  1 
ATOM 10182 C CG  . LEU B 2 212  ? 16.753  8.881   -75.379  1.00 75.33  ? 210  LEU D CG  1 
ATOM 10183 C CD1 . LEU B 2 212  ? 15.413  8.283   -74.969  1.00 71.51  ? 210  LEU D CD1 1 
ATOM 10184 C CD2 . LEU B 2 212  ? 16.529  9.836   -76.532  1.00 76.06  ? 210  LEU D CD2 1 
ATOM 10185 N N   . ILE B 2 213  ? 19.422  11.994  -72.584  1.00 80.40  ? 211  ILE D N   1 
ATOM 10186 C CA  . ILE B 2 213  ? 19.938  12.354  -71.260  1.00 82.59  ? 211  ILE D CA  1 
ATOM 10187 C C   . ILE B 2 213  ? 18.736  12.625  -70.344  1.00 80.98  ? 211  ILE D C   1 
ATOM 10188 O O   . ILE B 2 213  ? 17.874  13.424  -70.707  1.00 80.94  ? 211  ILE D O   1 
ATOM 10189 C CB  . ILE B 2 213  ? 20.849  13.602  -71.323  1.00 83.96  ? 211  ILE D CB  1 
ATOM 10190 C CG1 . ILE B 2 213  ? 22.056  13.330  -72.231  1.00 89.28  ? 211  ILE D CG1 1 
ATOM 10191 C CG2 . ILE B 2 213  ? 21.330  13.997  -69.927  1.00 84.22  ? 211  ILE D CG2 1 
ATOM 10192 C CD1 . ILE B 2 213  ? 22.825  14.569  -72.650  1.00 94.11  ? 211  ILE D CD1 1 
ATOM 10193 N N   . PRO B 2 214  ? 18.677  11.977  -69.157  1.00 78.99  ? 212  PRO D N   1 
ATOM 10194 C CA  . PRO B 2 214  ? 17.547  12.183  -68.233  1.00 75.40  ? 212  PRO D CA  1 
ATOM 10195 C C   . PRO B 2 214  ? 17.542  13.557  -67.556  1.00 75.39  ? 212  PRO D C   1 
ATOM 10196 O O   . PRO B 2 214  ? 18.613  14.083  -67.240  1.00 77.94  ? 212  PRO D O   1 
ATOM 10197 C CB  . PRO B 2 214  ? 17.751  11.085  -67.185  1.00 74.35  ? 212  PRO D CB  1 
ATOM 10198 C CG  . PRO B 2 214  ? 19.201  10.809  -67.200  1.00 79.26  ? 212  PRO D CG  1 
ATOM 10199 C CD  . PRO B 2 214  ? 19.640  10.999  -68.619  1.00 81.25  ? 212  PRO D CD  1 
ATOM 10200 N N   . LYS B 2 215  ? 16.346  14.114  -67.333  1.00 72.61  ? 213  LYS D N   1 
ATOM 10201 C CA  . LYS B 2 215  ? 16.192  15.416  -66.670  1.00 74.42  ? 213  LYS D CA  1 
ATOM 10202 C C   . LYS B 2 215  ? 15.412  15.344  -65.351  1.00 73.15  ? 213  LYS D C   1 
ATOM 10203 O O   . LYS B 2 215  ? 15.944  15.723  -64.304  1.00 74.60  ? 213  LYS D O   1 
ATOM 10204 C CB  . LYS B 2 215  ? 15.537  16.438  -67.605  1.00 75.06  ? 213  LYS D CB  1 
ATOM 10205 C CG  . LYS B 2 215  ? 15.661  17.867  -67.092  1.00 80.19  ? 213  LYS D CG  1 
ATOM 10206 C CD  . LYS B 2 215  ? 15.304  18.900  -68.142  1.00 81.98  ? 213  LYS D CD  1 
ATOM 10207 C CE  . LYS B 2 215  ? 15.593  20.302  -67.632  1.00 88.40  ? 213  LYS D CE  1 
ATOM 10208 N NZ  . LYS B 2 215  ? 15.031  21.344  -68.532  1.00 91.29  ? 213  LYS D NZ  1 
ATOM 10209 N N   . THR B 2 216  ? 14.158  14.889  -65.405  1.00 69.72  ? 214  THR D N   1 
ATOM 10210 C CA  . THR B 2 216  ? 13.289  14.857  -64.218  1.00 68.92  ? 214  THR D CA  1 
ATOM 10211 C C   . THR B 2 216  ? 12.375  13.646  -64.214  1.00 62.65  ? 214  THR D C   1 
ATOM 10212 O O   . THR B 2 216  ? 11.999  13.140  -65.266  1.00 62.27  ? 214  THR D O   1 
ATOM 10213 C CB  . THR B 2 216  ? 12.381  16.108  -64.124  1.00 74.27  ? 214  THR D CB  1 
ATOM 10214 O OG1 . THR B 2 216  ? 13.107  17.274  -64.526  1.00 91.54  ? 214  THR D OG1 1 
ATOM 10215 C CG2 . THR B 2 216  ? 11.872  16.324  -62.696  1.00 75.37  ? 214  THR D CG2 1 
ATOM 10216 N N   . LYS B 2 217  ? 12.047  13.192  -63.007  1.00 62.18  ? 215  LYS D N   1 
ATOM 10217 C CA  . LYS B 2 217  ? 10.927  12.300  -62.746  1.00 59.58  ? 215  LYS D CA  1 
ATOM 10218 C C   . LYS B 2 217  ? 9.866   13.125  -62.028  1.00 55.13  ? 215  LYS D C   1 
ATOM 10219 O O   . LYS B 2 217  ? 10.085  13.553  -60.895  1.00 58.16  ? 215  LYS D O   1 
ATOM 10220 C CB  . LYS B 2 217  ? 11.365  11.145  -61.841  1.00 65.38  ? 215  LYS D CB  1 
ATOM 10221 C CG  . LYS B 2 217  ? 10.260  10.158  -61.454  1.00 68.37  ? 215  LYS D CG  1 
ATOM 10222 C CD  . LYS B 2 217  ? 10.219  9.855   -59.955  1.00 74.55  ? 215  LYS D CD  1 
ATOM 10223 C CE  . LYS B 2 217  ? 10.051  8.370   -59.676  1.00 80.77  ? 215  LYS D CE  1 
ATOM 10224 N NZ  . LYS B 2 217  ? 11.334  7.636   -59.860  1.00 87.56  ? 215  LYS D NZ  1 
ATOM 10225 N N   . ILE B 2 218  ? 8.730   13.348  -62.684  1.00 49.76  ? 216  ILE D N   1 
ATOM 10226 C CA  . ILE B 2 218  ? 7.580   13.996  -62.055  1.00 47.43  ? 216  ILE D CA  1 
ATOM 10227 C C   . ILE B 2 218  ? 6.744   12.885  -61.424  1.00 45.18  ? 216  ILE D C   1 
ATOM 10228 O O   . ILE B 2 218  ? 6.411   11.918  -62.112  1.00 40.39  ? 216  ILE D O   1 
ATOM 10229 C CB  . ILE B 2 218  ? 6.689   14.750  -63.070  1.00 47.68  ? 216  ILE D CB  1 
ATOM 10230 C CG1 . ILE B 2 218  ? 7.510   15.735  -63.916  1.00 50.45  ? 216  ILE D CG1 1 
ATOM 10231 C CG2 . ILE B 2 218  ? 5.572   15.508  -62.354  1.00 46.46  ? 216  ILE D CG2 1 
ATOM 10232 C CD1 . ILE B 2 218  ? 6.828   16.160  -65.202  1.00 48.60  ? 216  ILE D CD1 1 
ATOM 10233 N N   . PRO B 2 219  ? 6.399   13.014  -60.120  1.00 47.97  ? 217  PRO D N   1 
ATOM 10234 C CA  . PRO B 2 219  ? 5.442   12.101  -59.504  1.00 47.03  ? 217  PRO D CA  1 
ATOM 10235 C C   . PRO B 2 219  ? 4.033   12.614  -59.789  1.00 45.49  ? 217  PRO D C   1 
ATOM 10236 O O   . PRO B 2 219  ? 3.372   13.175  -58.910  1.00 47.83  ? 217  PRO D O   1 
ATOM 10237 C CB  . PRO B 2 219  ? 5.811   12.168  -58.021  1.00 48.61  ? 217  PRO D CB  1 
ATOM 10238 C CG  . PRO B 2 219  ? 6.322   13.551  -57.828  1.00 50.20  ? 217  PRO D CG  1 
ATOM 10239 C CD  . PRO B 2 219  ? 6.859   14.031  -59.152  1.00 50.01  ? 217  PRO D CD  1 
ATOM 10240 N N   . ALA B 2 220  ? 3.598   12.418  -61.031  1.00 43.56  ? 218  ALA D N   1 
ATOM 10241 C CA  . ALA B 2 220  ? 2.414   13.096  -61.567  1.00 43.70  ? 218  ALA D CA  1 
ATOM 10242 C C   . ALA B 2 220  ? 1.091   12.607  -60.992  1.00 42.36  ? 218  ALA D C   1 
ATOM 10243 O O   . ALA B 2 220  ? 0.165   13.400  -60.841  1.00 42.83  ? 218  ALA D O   1 
ATOM 10244 C CB  . ALA B 2 220  ? 2.382   12.989  -63.087  1.00 44.29  ? 218  ALA D CB  1 
ATOM 10245 N N   . HIS B 2 221  ? 0.991   11.310  -60.708  1.00 42.51  ? 219  HIS D N   1 
ATOM 10246 C CA  . HIS B 2 221  ? -0.256  10.715  -60.213  1.00 44.52  ? 219  HIS D CA  1 
ATOM 10247 C C   . HIS B 2 221  ? -0.009  9.534   -59.268  1.00 46.60  ? 219  HIS D C   1 
ATOM 10248 O O   . HIS B 2 221  ? 0.996   8.836   -59.387  1.00 50.49  ? 219  HIS D O   1 
ATOM 10249 C CB  . HIS B 2 221  ? -1.116  10.238  -61.391  1.00 44.10  ? 219  HIS D CB  1 
ATOM 10250 C CG  . HIS B 2 221  ? -1.357  11.284  -62.432  1.00 42.89  ? 219  HIS D CG  1 
ATOM 10251 N ND1 . HIS B 2 221  ? -2.374  12.209  -62.337  1.00 44.54  ? 219  HIS D ND1 1 
ATOM 10252 C CD2 . HIS B 2 221  ? -0.702  11.560  -63.583  1.00 42.78  ? 219  HIS D CD2 1 
ATOM 10253 C CE1 . HIS B 2 221  ? -2.339  13.005  -63.390  1.00 46.09  ? 219  HIS D CE1 1 
ATOM 10254 N NE2 . HIS B 2 221  ? -1.332  12.634  -64.159  1.00 45.98  ? 219  HIS D NE2 1 
ATOM 10255 N N   . THR B 2 222  ? -0.937  9.318   -58.338  1.00 46.15  ? 220  THR D N   1 
ATOM 10256 C CA  . THR B 2 222  ? -0.939  8.126   -57.491  1.00 48.57  ? 220  THR D CA  1 
ATOM 10257 C C   . THR B 2 222  ? -1.443  6.915   -58.260  1.00 47.30  ? 220  THR D C   1 
ATOM 10258 O O   . THR B 2 222  ? -0.845  5.851   -58.188  1.00 51.01  ? 220  THR D O   1 
ATOM 10259 C CB  . THR B 2 222  ? -1.855  8.318   -56.278  1.00 55.02  ? 220  THR D CB  1 
ATOM 10260 O OG1 . THR B 2 222  ? -1.411  9.457   -55.539  1.00 55.77  ? 220  THR D OG1 1 
ATOM 10261 C CG2 . THR B 2 222  ? -1.867  7.070   -55.363  1.00 60.07  ? 220  THR D CG2 1 
ATOM 10262 N N   . ARG B 2 223  ? -2.567  7.083   -58.953  1.00 46.25  ? 221  ARG D N   1 
ATOM 10263 C CA  . ARG B 2 223  ? -3.168  6.023   -59.771  1.00 47.08  ? 221  ARG D CA  1 
ATOM 10264 C C   . ARG B 2 223  ? -2.504  5.936   -61.148  1.00 42.35  ? 221  ARG D C   1 
ATOM 10265 O O   . ARG B 2 223  ? -1.619  6.729   -61.469  1.00 39.27  ? 221  ARG D O   1 
ATOM 10266 C CB  . ARG B 2 223  ? -4.679  6.262   -59.913  1.00 49.97  ? 221  ARG D CB  1 
ATOM 10267 C CG  . ARG B 2 223  ? -5.416  6.234   -58.583  1.00 55.09  ? 221  ARG D CG  1 
ATOM 10268 C CD  . ARG B 2 223  ? -6.919  6.344   -58.758  1.00 56.99  ? 221  ARG D CD  1 
ATOM 10269 N NE  . ARG B 2 223  ? -7.513  5.120   -59.293  1.00 61.13  ? 221  ARG D NE  1 
ATOM 10270 C CZ  . ARG B 2 223  ? -8.796  4.980   -59.645  1.00 71.15  ? 221  ARG D CZ  1 
ATOM 10271 N NH1 . ARG B 2 223  ? -9.664  5.993   -59.532  1.00 70.42  ? 221  ARG D NH1 1 
ATOM 10272 N NH2 . ARG B 2 223  ? -9.220  3.810   -60.124  1.00 76.95  ? 221  ARG D NH2 1 
ATOM 10273 N N   . TYR B 2 224  ? -2.925  4.956   -61.945  1.00 41.68  ? 222  TYR D N   1 
ATOM 10274 C CA  . TYR B 2 224  ? -2.440  4.782   -63.316  1.00 41.41  ? 222  TYR D CA  1 
ATOM 10275 C C   . TYR B 2 224  ? -2.376  6.103   -64.065  1.00 40.08  ? 222  TYR D C   1 
ATOM 10276 O O   . TYR B 2 224  ? -3.320  6.888   -64.004  1.00 38.91  ? 222  TYR D O   1 
ATOM 10277 C CB  . TYR B 2 224  ? -3.385  3.898   -64.130  1.00 43.01  ? 222  TYR D CB  1 
ATOM 10278 C CG  . TYR B 2 224  ? -3.418  2.413   -63.840  1.00 46.54  ? 222  TYR D CG  1 
ATOM 10279 C CD1 . TYR B 2 224  ? -4.605  1.796   -63.442  1.00 52.23  ? 222  TYR D CD1 1 
ATOM 10280 C CD2 . TYR B 2 224  ? -2.304  1.604   -64.056  1.00 47.43  ? 222  TYR D CD2 1 
ATOM 10281 C CE1 . TYR B 2 224  ? -4.670  0.430   -63.232  1.00 56.65  ? 222  TYR D CE1 1 
ATOM 10282 C CE2 . TYR B 2 224  ? -2.361  0.229   -63.847  1.00 51.15  ? 222  TYR D CE2 1 
ATOM 10283 C CZ  . TYR B 2 224  ? -3.549  -0.354  -63.435  1.00 53.77  ? 222  TYR D CZ  1 
ATOM 10284 O OH  . TYR B 2 224  ? -3.634  -1.709  -63.210  1.00 51.11  ? 222  TYR D OH  1 
ATOM 10285 N N   . ALA B 2 225  ? -1.268  6.334   -64.766  1.00 41.36  ? 223  ALA D N   1 
ATOM 10286 C CA  . ALA B 2 225  ? -1.189  7.370   -65.796  1.00 40.42  ? 223  ALA D CA  1 
ATOM 10287 C C   . ALA B 2 225  ? -1.412  6.690   -67.146  1.00 41.01  ? 223  ALA D C   1 
ATOM 10288 O O   . ALA B 2 225  ? -0.818  5.644   -67.411  1.00 42.82  ? 223  ALA D O   1 
ATOM 10289 C CB  . ALA B 2 225  ? 0.159   8.061   -65.753  1.00 40.28  ? 223  ALA D CB  1 
ATOM 10290 N N   . LEU B 2 226  ? -2.266  7.282   -67.983  1.00 41.12  ? 224  LEU D N   1 
ATOM 10291 C CA  . LEU B 2 226  ? -2.750  6.650   -69.228  1.00 43.58  ? 224  LEU D CA  1 
ATOM 10292 C C   . LEU B 2 226  ? -2.219  7.252   -70.542  1.00 44.50  ? 224  LEU D C   1 
ATOM 10293 O O   . LEU B 2 226  ? -2.113  6.543   -71.548  1.00 42.37  ? 224  LEU D O   1 
ATOM 10294 C CB  . LEU B 2 226  ? -4.285  6.675   -69.242  1.00 45.47  ? 224  LEU D CB  1 
ATOM 10295 C CG  . LEU B 2 226  ? -4.991  6.127   -67.996  1.00 46.26  ? 224  LEU D CG  1 
ATOM 10296 C CD1 . LEU B 2 226  ? -6.495  6.300   -68.109  1.00 46.95  ? 224  LEU D CD1 1 
ATOM 10297 C CD2 . LEU B 2 226  ? -4.654  4.663   -67.770  1.00 50.30  ? 224  LEU D CD2 1 
ATOM 10298 N N   . GLN B 2 227  ? -1.925  8.553   -70.539  1.00 49.32  ? 225  GLN D N   1 
ATOM 10299 C CA  . GLN B 2 227  ? -1.331  9.238   -71.691  1.00 50.33  ? 225  GLN D CA  1 
ATOM 10300 C C   . GLN B 2 227  ? -0.425  10.377  -71.244  1.00 50.45  ? 225  GLN D C   1 
ATOM 10301 O O   . GLN B 2 227  ? -0.550  10.876  -70.125  1.00 58.98  ? 225  GLN D O   1 
ATOM 10302 C CB  . GLN B 2 227  ? -2.422  9.796   -72.602  1.00 52.18  ? 225  GLN D CB  1 
ATOM 10303 C CG  . GLN B 2 227  ? -1.941  10.116  -74.006  1.00 53.68  ? 225  GLN D CG  1 
ATOM 10304 C CD  . GLN B 2 227  ? -3.051  10.633  -74.893  1.00 53.75  ? 225  GLN D CD  1 
ATOM 10305 O OE1 . GLN B 2 227  ? -3.669  11.656  -74.594  1.00 50.66  ? 225  GLN D OE1 1 
ATOM 10306 N NE2 . GLN B 2 227  ? -3.306  9.934   -75.995  1.00 54.60  ? 225  GLN D NE2 1 
ATOM 10307 N N   . CYS B 2 228  ? 0.500   10.764  -72.113  1.00 47.15  ? 226  CYS D N   1 
ATOM 10308 C CA  . CYS B 2 228  ? 1.190   12.042  -71.984  1.00 50.34  ? 226  CYS D CA  1 
ATOM 10309 C C   . CYS B 2 228  ? 1.370   12.641  -73.366  1.00 51.58  ? 226  CYS D C   1 
ATOM 10310 O O   . CYS B 2 228  ? 1.520   11.909  -74.341  1.00 51.53  ? 226  CYS D O   1 
ATOM 10311 C CB  . CYS B 2 228  ? 2.536   11.888  -71.265  1.00 54.47  ? 226  CYS D CB  1 
ATOM 10312 S SG  . CYS B 2 228  ? 3.832   11.018  -72.177  1.00 54.43  ? 226  CYS D SG  1 
ATOM 10313 N N   . ARG B 2 229  ? 1.334   13.968  -73.454  1.00 55.77  ? 227  ARG D N   1 
ATOM 10314 C CA  . ARG B 2 229  ? 1.455   14.658  -74.747  1.00 57.96  ? 227  ARG D CA  1 
ATOM 10315 C C   . ARG B 2 229  ? 1.903   16.104  -74.597  1.00 53.68  ? 227  ARG D C   1 
ATOM 10316 O O   . ARG B 2 229  ? 1.222   16.893  -73.948  1.00 52.20  ? 227  ARG D O   1 
ATOM 10317 C CB  . ARG B 2 229  ? 0.124   14.598  -75.513  1.00 62.16  ? 227  ARG D CB  1 
ATOM 10318 C CG  . ARG B 2 229  ? 0.163   13.731  -76.767  1.00 67.86  ? 227  ARG D CG  1 
ATOM 10319 C CD  . ARG B 2 229  ? -1.223  13.257  -77.176  1.00 74.86  ? 227  ARG D CD  1 
ATOM 10320 N NE  . ARG B 2 229  ? -1.359  13.127  -78.628  1.00 80.20  ? 227  ARG D NE  1 
ATOM 10321 C CZ  . ARG B 2 229  ? -1.636  14.124  -79.476  1.00 82.32  ? 227  ARG D CZ  1 
ATOM 10322 N NH1 . ARG B 2 229  ? -1.818  15.379  -79.051  1.00 79.66  ? 227  ARG D NH1 1 
ATOM 10323 N NH2 . ARG B 2 229  ? -1.731  13.865  -80.780  1.00 85.31  ? 227  ARG D NH2 1 
ATOM 10324 N N   . PHE B 2 230  ? 3.057   16.429  -75.187  1.00 50.45  ? 228  PHE D N   1 
ATOM 10325 C CA  . PHE B 2 230  ? 3.556   17.807  -75.268  1.00 50.08  ? 228  PHE D CA  1 
ATOM 10326 C C   . PHE B 2 230  ? 2.672   18.706  -76.133  1.00 50.31  ? 228  PHE D C   1 
ATOM 10327 O O   . PHE B 2 230  ? 2.072   18.250  -77.109  1.00 49.52  ? 228  PHE D O   1 
ATOM 10328 C CB  . PHE B 2 230  ? 4.967   17.840  -75.854  1.00 49.67  ? 228  PHE D CB  1 
ATOM 10329 C CG  . PHE B 2 230  ? 6.033   17.361  -74.919  1.00 48.16  ? 228  PHE D CG  1 
ATOM 10330 C CD1 . PHE B 2 230  ? 6.497   16.055  -74.982  1.00 46.67  ? 228  PHE D CD1 1 
ATOM 10331 C CD2 . PHE B 2 230  ? 6.607   18.233  -74.001  1.00 50.94  ? 228  PHE D CD2 1 
ATOM 10332 C CE1 . PHE B 2 230  ? 7.500   15.619  -74.130  1.00 47.96  ? 228  PHE D CE1 1 
ATOM 10333 C CE2 . PHE B 2 230  ? 7.610   17.805  -73.142  1.00 52.83  ? 228  PHE D CE2 1 
ATOM 10334 C CZ  . PHE B 2 230  ? 8.056   16.493  -73.205  1.00 51.15  ? 228  PHE D CZ  1 
ATOM 10335 N N   . SER B 2 231  ? 2.618   19.988  -75.776  1.00 50.14  ? 229  SER D N   1 
ATOM 10336 C CA  . SER B 2 231  ? 1.919   20.983  -76.580  1.00 51.42  ? 229  SER D CA  1 
ATOM 10337 C C   . SER B 2 231  ? 2.757   21.287  -77.821  1.00 52.40  ? 229  SER D C   1 
ATOM 10338 O O   . SER B 2 231  ? 3.970   21.083  -77.799  1.00 53.19  ? 229  SER D O   1 
ATOM 10339 C CB  . SER B 2 231  ? 1.681   22.261  -75.774  1.00 53.93  ? 229  SER D CB  1 
ATOM 10340 O OG  . SER B 2 231  ? 2.901   22.903  -75.449  1.00 57.56  ? 229  SER D OG  1 
ATOM 10341 N N   . PRO B 2 232  ? 2.124   21.765  -78.907  1.00 53.32  ? 230  PRO D N   1 
ATOM 10342 C CA  . PRO B 2 232  ? 2.893   22.130  -80.107  1.00 57.19  ? 230  PRO D CA  1 
ATOM 10343 C C   . PRO B 2 232  ? 3.957   23.220  -79.884  1.00 60.75  ? 230  PRO D C   1 
ATOM 10344 O O   . PRO B 2 232  ? 4.997   23.208  -80.548  1.00 58.85  ? 230  PRO D O   1 
ATOM 10345 C CB  . PRO B 2 232  ? 1.819   22.593  -81.104  1.00 59.62  ? 230  PRO D CB  1 
ATOM 10346 C CG  . PRO B 2 232  ? 0.558   22.723  -80.330  1.00 57.42  ? 230  PRO D CG  1 
ATOM 10347 C CD  . PRO B 2 232  ? 0.673   21.828  -79.143  1.00 53.45  ? 230  PRO D CD  1 
ATOM 10348 N N   . ASP B 2 233  ? 3.690   24.138  -78.952  1.00 65.73  ? 231  ASP D N   1 
ATOM 10349 C CA  . ASP B 2 233  ? 4.671   25.142  -78.511  1.00 67.81  ? 231  ASP D CA  1 
ATOM 10350 C C   . ASP B 2 233  ? 5.931   24.532  -77.894  1.00 66.05  ? 231  ASP D C   1 
ATOM 10351 O O   . ASP B 2 233  ? 7.002   25.129  -77.978  1.00 72.31  ? 231  ASP D O   1 
ATOM 10352 C CB  . ASP B 2 233  ? 4.057   26.077  -77.461  1.00 70.51  ? 231  ASP D CB  1 
ATOM 10353 C CG  . ASP B 2 233  ? 2.993   26.988  -78.022  1.00 85.64  ? 231  ASP D CG  1 
ATOM 10354 O OD1 . ASP B 2 233  ? 2.307   26.595  -78.993  1.00 101.56 ? 231  ASP D OD1 1 
ATOM 10355 O OD2 . ASP B 2 233  ? 2.830   28.101  -77.474  1.00 95.19  ? 231  ASP D OD2 1 
ATOM 10356 N N   . SER B 2 234  ? 5.774   23.363  -77.264  1.00 61.11  ? 232  SER D N   1 
ATOM 10357 C CA  . SER B 2 234  ? 6.755   22.742  -76.357  1.00 57.91  ? 232  SER D CA  1 
ATOM 10358 C C   . SER B 2 234  ? 6.804   23.458  -74.997  1.00 59.01  ? 232  SER D C   1 
ATOM 10359 O O   . SER B 2 234  ? 7.716   23.231  -74.201  1.00 59.24  ? 232  SER D O   1 
ATOM 10360 C CB  . SER B 2 234  ? 8.147   22.618  -76.992  1.00 59.59  ? 232  SER D CB  1 
ATOM 10361 O OG  . SER B 2 234  ? 8.062   22.097  -78.310  1.00 59.83  ? 232  SER D OG  1 
ATOM 10362 N N   . THR B 2 235  ? 5.789   24.286  -74.733  1.00 62.09  ? 233  THR D N   1 
ATOM 10363 C CA  . THR B 2 235  ? 5.635   25.030  -73.487  1.00 64.11  ? 233  THR D CA  1 
ATOM 10364 C C   . THR B 2 235  ? 5.194   24.081  -72.387  1.00 60.40  ? 233  THR D C   1 
ATOM 10365 O O   . THR B 2 235  ? 5.689   24.156  -71.262  1.00 62.42  ? 233  THR D O   1 
ATOM 10366 C CB  . THR B 2 235  ? 4.542   26.119  -73.627  1.00 68.40  ? 233  THR D CB  1 
ATOM 10367 O OG1 . THR B 2 235  ? 4.853   26.971  -74.728  1.00 71.89  ? 233  THR D OG1 1 
ATOM 10368 C CG2 . THR B 2 235  ? 4.403   26.980  -72.352  1.00 71.92  ? 233  THR D CG2 1 
ATOM 10369 N N   . LEU B 2 236  ? 4.262   23.194  -72.729  1.00 55.48  ? 234  LEU D N   1 
ATOM 10370 C CA  . LEU B 2 236  ? 3.522   22.410  -71.755  1.00 51.97  ? 234  LEU D CA  1 
ATOM 10371 C C   . LEU B 2 236  ? 3.648   20.915  -72.014  1.00 50.37  ? 234  LEU D C   1 
ATOM 10372 O O   . LEU B 2 236  ? 4.084   20.499  -73.089  1.00 50.34  ? 234  LEU D O   1 
ATOM 10373 C CB  . LEU B 2 236  ? 2.048   22.810  -71.811  1.00 49.58  ? 234  LEU D CB  1 
ATOM 10374 C CG  . LEU B 2 236  ? 1.757   24.304  -71.652  1.00 49.83  ? 234  LEU D CG  1 
ATOM 10375 C CD1 . LEU B 2 236  ? 0.324   24.593  -72.049  1.00 50.05  ? 234  LEU D CD1 1 
ATOM 10376 C CD2 . LEU B 2 236  ? 2.032   24.773  -70.231  1.00 50.03  ? 234  LEU D CD2 1 
ATOM 10377 N N   . LEU B 2 237  ? 3.249   20.128  -71.012  1.00 48.73  ? 235  LEU D N   1 
ATOM 10378 C CA  . LEU B 2 237  ? 3.230   18.660  -71.077  1.00 45.07  ? 235  LEU D CA  1 
ATOM 10379 C C   . LEU B 2 237  ? 1.999   18.127  -70.347  1.00 42.38  ? 235  LEU D C   1 
ATOM 10380 O O   . LEU B 2 237  ? 1.953   18.151  -69.125  1.00 41.99  ? 235  LEU D O   1 
ATOM 10381 C CB  . LEU B 2 237  ? 4.503   18.084  -70.445  1.00 45.38  ? 235  LEU D CB  1 
ATOM 10382 C CG  . LEU B 2 237  ? 4.586   16.571  -70.174  1.00 43.19  ? 235  LEU D CG  1 
ATOM 10383 C CD1 . LEU B 2 237  ? 4.318   15.757  -71.433  1.00 41.01  ? 235  LEU D CD1 1 
ATOM 10384 C CD2 . LEU B 2 237  ? 5.942   16.221  -69.574  1.00 43.70  ? 235  LEU D CD2 1 
ATOM 10385 N N   . ALA B 2 238  ? 1.012   17.647  -71.097  1.00 42.22  ? 236  ALA D N   1 
ATOM 10386 C CA  . ALA B 2 238  ? -0.215  17.108  -70.511  1.00 43.63  ? 236  ALA D CA  1 
ATOM 10387 C C   . ALA B 2 238  ? 0.015   15.683  -70.018  1.00 47.71  ? 236  ALA D C   1 
ATOM 10388 O O   . ALA B 2 238  ? 0.794   14.935  -70.618  1.00 45.76  ? 236  ALA D O   1 
ATOM 10389 C CB  . ALA B 2 238  ? -1.341  17.130  -71.527  1.00 43.73  ? 236  ALA D CB  1 
ATOM 10390 N N   . THR B 2 239  ? -0.664  15.325  -68.924  1.00 53.17  ? 237  THR D N   1 
ATOM 10391 C CA  . THR B 2 239  ? -0.593  13.983  -68.320  1.00 49.78  ? 237  THR D CA  1 
ATOM 10392 C C   . THR B 2 239  ? -1.988  13.554  -67.878  1.00 46.23  ? 237  THR D C   1 
ATOM 10393 O O   . THR B 2 239  ? -2.482  14.022  -66.857  1.00 50.15  ? 237  THR D O   1 
ATOM 10394 C CB  . THR B 2 239  ? 0.345   13.948  -67.090  1.00 51.06  ? 237  THR D CB  1 
ATOM 10395 O OG1 . THR B 2 239  ? 1.595   14.558  -67.414  1.00 58.88  ? 237  THR D OG1 1 
ATOM 10396 C CG2 . THR B 2 239  ? 0.618   12.531  -66.661  1.00 53.22  ? 237  THR D CG2 1 
ATOM 10397 N N   . CYS B 2 240  ? -2.615  12.669  -68.647  1.00 44.09  ? 238  CYS D N   1 
ATOM 10398 C CA  . CYS B 2 240  ? -3.934  12.121  -68.306  1.00 44.44  ? 238  CYS D CA  1 
ATOM 10399 C C   . CYS B 2 240  ? -3.805  10.835  -67.496  1.00 39.11  ? 238  CYS D C   1 
ATOM 10400 O O   . CYS B 2 240  ? -2.871  10.065  -67.705  1.00 39.16  ? 238  CYS D O   1 
ATOM 10401 C CB  . CYS B 2 240  ? -4.730  11.856  -69.572  1.00 48.55  ? 238  CYS D CB  1 
ATOM 10402 S SG  . CYS B 2 240  ? -4.939  13.335  -70.571  1.00 56.29  ? 238  CYS D SG  1 
ATOM 10403 N N   . SER B 2 241  ? -4.752  10.605  -66.586  1.00 36.18  ? 239  SER D N   1 
ATOM 10404 C CA  . SER B 2 241  ? -4.640  9.530   -65.589  1.00 34.52  ? 239  SER D CA  1 
ATOM 10405 C C   . SER B 2 241  ? -5.974  8.967   -65.087  1.00 32.96  ? 239  SER D C   1 
ATOM 10406 O O   . SER B 2 241  ? -7.035  9.565   -65.257  1.00 31.19  ? 239  SER D O   1 
ATOM 10407 C CB  . SER B 2 241  ? -3.818  10.043  -64.400  1.00 35.04  ? 239  SER D CB  1 
ATOM 10408 O OG  . SER B 2 241  ? -4.075  9.317   -63.209  1.00 35.88  ? 239  SER D OG  1 
ATOM 10409 N N   . ALA B 2 242  ? -5.879  7.811   -64.435  1.00 34.34  ? 240  ALA D N   1 
ATOM 10410 C CA  . ALA B 2 242  ? -7.027  7.135   -63.821  1.00 35.62  ? 240  ALA D CA  1 
ATOM 10411 C C   . ALA B 2 242  ? -7.526  7.811   -62.551  1.00 38.52  ? 240  ALA D C   1 
ATOM 10412 O O   . ALA B 2 242  ? -8.574  7.427   -62.034  1.00 42.03  ? 240  ALA D O   1 
ATOM 10413 C CB  . ALA B 2 242  ? -6.691  5.684   -63.524  1.00 34.92  ? 240  ALA D CB  1 
ATOM 10414 N N   . ASP B 2 243  ? -6.789  8.807   -62.051  1.00 40.01  ? 241  ASP D N   1 
ATOM 10415 C CA  . ASP B 2 243  ? -7.267  9.673   -60.968  1.00 41.77  ? 241  ASP D CA  1 
ATOM 10416 C C   . ASP B 2 243  ? -8.272  10.753  -61.418  1.00 40.97  ? 241  ASP D C   1 
ATOM 10417 O O   . ASP B 2 243  ? -8.465  11.737  -60.707  1.00 41.05  ? 241  ASP D O   1 
ATOM 10418 C CB  . ASP B 2 243  ? -6.071  10.302  -60.228  1.00 45.51  ? 241  ASP D CB  1 
ATOM 10419 C CG  . ASP B 2 243  ? -5.317  11.351  -61.061  1.00 49.50  ? 241  ASP D CG  1 
ATOM 10420 O OD1 . ASP B 2 243  ? -4.424  12.010  -60.487  1.00 58.75  ? 241  ASP D OD1 1 
ATOM 10421 O OD2 . ASP B 2 243  ? -5.594  11.517  -62.270  1.00 46.02  ? 241  ASP D OD2 1 
ATOM 10422 N N   . GLN B 2 244  ? -8.892  10.566  -62.591  1.00 41.93  ? 242  GLN D N   1 
ATOM 10423 C CA  . GLN B 2 244  ? -9.962  11.426  -63.119  1.00 45.39  ? 242  GLN D CA  1 
ATOM 10424 C C   . GLN B 2 244  ? -9.465  12.834  -63.449  1.00 46.75  ? 242  GLN D C   1 
ATOM 10425 O O   . GLN B 2 244  ? -10.143 13.833  -63.179  1.00 48.35  ? 242  GLN D O   1 
ATOM 10426 C CB  . GLN B 2 244  ? -11.153 11.501  -62.155  1.00 47.59  ? 242  GLN D CB  1 
ATOM 10427 C CG  . GLN B 2 244  ? -11.660 10.176  -61.632  1.00 48.21  ? 242  GLN D CG  1 
ATOM 10428 C CD  . GLN B 2 244  ? -12.962 10.364  -60.900  1.00 52.05  ? 242  GLN D CD  1 
ATOM 10429 O OE1 . GLN B 2 244  ? -14.033 10.215  -61.481  1.00 56.05  ? 242  GLN D OE1 1 
ATOM 10430 N NE2 . GLN B 2 244  ? -12.881 10.745  -59.630  1.00 54.61  ? 242  GLN D NE2 1 
ATOM 10431 N N   . THR B 2 245  ? -8.293  12.911  -64.069  1.00 47.22  ? 243  THR D N   1 
ATOM 10432 C CA  . THR B 2 245  ? -7.575  14.172  -64.125  1.00 47.58  ? 243  THR D CA  1 
ATOM 10433 C C   . THR B 2 245  ? -6.560  14.242  -65.265  1.00 48.86  ? 243  THR D C   1 
ATOM 10434 O O   . THR B 2 245  ? -5.876  13.263  -65.565  1.00 53.17  ? 243  THR D O   1 
ATOM 10435 C CB  . THR B 2 245  ? -6.937  14.434  -62.736  1.00 46.93  ? 243  THR D CB  1 
ATOM 10436 O OG1 . THR B 2 245  ? -7.835  15.234  -61.962  1.00 53.20  ? 243  THR D OG1 1 
ATOM 10437 C CG2 . THR B 2 245  ? -5.599  15.133  -62.803  1.00 45.98  ? 243  THR D CG2 1 
ATOM 10438 N N   . CYS B 2 246  ? -6.488  15.416  -65.890  1.00 48.29  ? 244  CYS D N   1 
ATOM 10439 C CA  . CYS B 2 246  ? -5.439  15.752  -66.843  1.00 49.38  ? 244  CYS D CA  1 
ATOM 10440 C C   . CYS B 2 246  ? -4.620  16.874  -66.224  1.00 45.40  ? 244  CYS D C   1 
ATOM 10441 O O   . CYS B 2 246  ? -5.144  17.958  -65.980  1.00 44.85  ? 244  CYS D O   1 
ATOM 10442 C CB  . CYS B 2 246  ? -6.042  16.214  -68.171  1.00 54.84  ? 244  CYS D CB  1 
ATOM 10443 S SG  . CYS B 2 246  ? -4.831  16.688  -69.432  1.00 54.22  ? 244  CYS D SG  1 
ATOM 10444 N N   . LYS B 2 247  ? -3.349  16.606  -65.951  1.00 44.57  ? 245  LYS D N   1 
ATOM 10445 C CA  . LYS B 2 247  ? -2.452  17.606  -65.375  1.00 50.12  ? 245  LYS D CA  1 
ATOM 10446 C C   . LYS B 2 247  ? -1.538  18.189  -66.451  1.00 51.61  ? 245  LYS D C   1 
ATOM 10447 O O   . LYS B 2 247  ? -0.860  17.443  -67.164  1.00 52.52  ? 245  LYS D O   1 
ATOM 10448 C CB  . LYS B 2 247  ? -1.638  17.000  -64.227  1.00 51.55  ? 245  LYS D CB  1 
ATOM 10449 C CG  . LYS B 2 247  ? -2.422  16.945  -62.928  1.00 51.49  ? 245  LYS D CG  1 
ATOM 10450 C CD  . LYS B 2 247  ? -1.684  16.192  -61.843  1.00 51.02  ? 245  LYS D CD  1 
ATOM 10451 C CE  . LYS B 2 247  ? -2.511  16.112  -60.577  1.00 51.51  ? 245  LYS D CE  1 
ATOM 10452 N NZ  . LYS B 2 247  ? -1.979  15.068  -59.664  1.00 54.