data_5YD6
# 
_entry.id   5YD6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5YD6         
WWPDB D_1300005062 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'PGA1 bound Nurr1-LBD' 
_pdbx_database_related.db_id          5Y41 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5YD6 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sreekanth, R.' 1 ? 
'Yoon, H.S.'    2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Structure of Nurr1 bound to cyclopentenone prostaglandin A2 and its mechanism of action in ameliorating dopaminergic neurodegeneration in Drosophila
;
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rajan, S.'  1 ? 
primary 'Toh, H.T.'  2 ? 
primary 'Lim, K.H.'  3 ? 
primary 'Yoon, H.S.' 4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5YD6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     85.950 
_cell.length_a_esd                 ? 
_cell.length_b                     94.080 
_cell.length_b_esd                 ? 
_cell.length_c                     135.650 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5YD6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nuclear receptor subfamily 4 group A member 2' 30576.256 4   ? ? 'UNP residues 328-598' ? 
2 non-polymer syn 
'(~{Z})-7-[(1~{R},5~{S})-2-oxidanylidene-5-[(~{E},3~{S})-3-oxidanyloct-1-enyl]cyclopent-3-en-1-yl]hept-5-enoic acid' 334.450   4   
? ? ?                      ? 
3 non-polymer syn 'MAGNESIUM ION' 24.305    2   ? ? ?                      ? 
4 water       nat water 18.015    327 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Immediate-early response protein NOT,Orphan nuclear receptor NURR1,Transcriptionally-inducible nuclear receptor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFY
DLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIV
EFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCT
QGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFY
DLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIV
EFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCT
QGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   LYS n 
1 4   GLU n 
1 5   VAL n 
1 6   VAL n 
1 7   ARG n 
1 8   THR n 
1 9   ASP n 
1 10  SER n 
1 11  LEU n 
1 12  LYS n 
1 13  GLY n 
1 14  ARG n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  LEU n 
1 19  PRO n 
1 20  SER n 
1 21  LYS n 
1 22  PRO n 
1 23  LYS n 
1 24  SER n 
1 25  PRO n 
1 26  GLN n 
1 27  GLU n 
1 28  PRO n 
1 29  SER n 
1 30  PRO n 
1 31  PRO n 
1 32  SER n 
1 33  PRO n 
1 34  PRO n 
1 35  VAL n 
1 36  SER n 
1 37  LEU n 
1 38  ILE n 
1 39  SER n 
1 40  ALA n 
1 41  LEU n 
1 42  VAL n 
1 43  ARG n 
1 44  ALA n 
1 45  HIS n 
1 46  VAL n 
1 47  ASP n 
1 48  SER n 
1 49  ASN n 
1 50  PRO n 
1 51  ALA n 
1 52  MET n 
1 53  THR n 
1 54  SER n 
1 55  LEU n 
1 56  ASP n 
1 57  TYR n 
1 58  SER n 
1 59  ARG n 
1 60  PHE n 
1 61  GLN n 
1 62  ALA n 
1 63  ASN n 
1 64  PRO n 
1 65  ASP n 
1 66  TYR n 
1 67  GLN n 
1 68  MET n 
1 69  SER n 
1 70  GLY n 
1 71  ASP n 
1 72  ASP n 
1 73  THR n 
1 74  GLN n 
1 75  HIS n 
1 76  ILE n 
1 77  GLN n 
1 78  GLN n 
1 79  PHE n 
1 80  TYR n 
1 81  ASP n 
1 82  LEU n 
1 83  LEU n 
1 84  THR n 
1 85  GLY n 
1 86  SER n 
1 87  MET n 
1 88  GLU n 
1 89  ILE n 
1 90  ILE n 
1 91  ARG n 
1 92  GLY n 
1 93  TRP n 
1 94  ALA n 
1 95  GLU n 
1 96  LYS n 
1 97  ILE n 
1 98  PRO n 
1 99  GLY n 
1 100 PHE n 
1 101 ALA n 
1 102 ASP n 
1 103 LEU n 
1 104 PRO n 
1 105 LYS n 
1 106 ALA n 
1 107 ASP n 
1 108 GLN n 
1 109 ASP n 
1 110 LEU n 
1 111 LEU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 PHE n 
1 117 LEU n 
1 118 GLU n 
1 119 LEU n 
1 120 PHE n 
1 121 VAL n 
1 122 LEU n 
1 123 ARG n 
1 124 LEU n 
1 125 ALA n 
1 126 TYR n 
1 127 ARG n 
1 128 SER n 
1 129 ASN n 
1 130 PRO n 
1 131 VAL n 
1 132 GLU n 
1 133 GLY n 
1 134 LYS n 
1 135 LEU n 
1 136 ILE n 
1 137 PHE n 
1 138 CYS n 
1 139 ASN n 
1 140 GLY n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 HIS n 
1 145 ARG n 
1 146 LEU n 
1 147 GLN n 
1 148 CYS n 
1 149 VAL n 
1 150 ARG n 
1 151 GLY n 
1 152 PHE n 
1 153 GLY n 
1 154 GLU n 
1 155 TRP n 
1 156 ILE n 
1 157 ASP n 
1 158 SER n 
1 159 ILE n 
1 160 VAL n 
1 161 GLU n 
1 162 PHE n 
1 163 SER n 
1 164 SER n 
1 165 ASN n 
1 166 LEU n 
1 167 GLN n 
1 168 ASN n 
1 169 MET n 
1 170 ASN n 
1 171 ILE n 
1 172 ASP n 
1 173 ILE n 
1 174 SER n 
1 175 ALA n 
1 176 PHE n 
1 177 SER n 
1 178 CYS n 
1 179 ILE n 
1 180 ALA n 
1 181 ALA n 
1 182 LEU n 
1 183 ALA n 
1 184 MET n 
1 185 VAL n 
1 186 THR n 
1 187 GLU n 
1 188 ARG n 
1 189 HIS n 
1 190 GLY n 
1 191 LEU n 
1 192 LYS n 
1 193 GLU n 
1 194 PRO n 
1 195 LYS n 
1 196 ARG n 
1 197 VAL n 
1 198 GLU n 
1 199 GLU n 
1 200 LEU n 
1 201 GLN n 
1 202 ASN n 
1 203 LYS n 
1 204 ILE n 
1 205 VAL n 
1 206 ASN n 
1 207 CYS n 
1 208 LEU n 
1 209 LYS n 
1 210 ASP n 
1 211 HIS n 
1 212 VAL n 
1 213 THR n 
1 214 PHE n 
1 215 ASN n 
1 216 ASN n 
1 217 GLY n 
1 218 GLY n 
1 219 LEU n 
1 220 ASN n 
1 221 ARG n 
1 222 PRO n 
1 223 ASN n 
1 224 TYR n 
1 225 LEU n 
1 226 SER n 
1 227 LYS n 
1 228 LEU n 
1 229 LEU n 
1 230 GLY n 
1 231 LYS n 
1 232 LEU n 
1 233 PRO n 
1 234 GLU n 
1 235 LEU n 
1 236 ARG n 
1 237 THR n 
1 238 LEU n 
1 239 CYS n 
1 240 THR n 
1 241 GLN n 
1 242 GLY n 
1 243 LEU n 
1 244 GLN n 
1 245 ARG n 
1 246 ILE n 
1 247 PHE n 
1 248 TYR n 
1 249 LEU n 
1 250 LYS n 
1 251 LEU n 
1 252 GLU n 
1 253 ASP n 
1 254 LEU n 
1 255 VAL n 
1 256 PRO n 
1 257 PRO n 
1 258 PRO n 
1 259 ALA n 
1 260 ILE n 
1 261 ILE n 
1 262 ASP n 
1 263 LYS n 
1 264 LEU n 
1 265 PHE n 
1 266 LEU n 
1 267 ASP n 
1 268 THR n 
1 269 LEU n 
1 270 PRO n 
1 271 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   271 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR4A2, NOT, NURR1, TINUR' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-SUMO 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NR4A2_HUMAN 
_struct_ref.pdbx_db_accession          P43354 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFY
DLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIV
EFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCT
QGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
;
_struct_ref.pdbx_align_begin           328 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5YD6 A 1 ? 271 ? P43354 328 ? 598 ? 328 598 
2 1 5YD6 B 1 ? 271 ? P43354 328 ? 598 ? 328 598 
3 1 5YD6 C 1 ? 271 ? P43354 328 ? 598 ? 328 598 
4 1 5YD6 D 1 ? 271 ? P43354 328 ? 598 ? 328 598 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8SU non-polymer         . 
'(~{Z})-7-[(1~{R},5~{S})-2-oxidanylidene-5-[(~{E},3~{S})-3-oxidanyloct-1-enyl]cyclopent-3-en-1-yl]hept-5-enoic acid' 
'PROSTAGLANDIN A2 (PGA2)' 'C20 H30 O4'     334.450 
ALA 'L-peptide linking' y ALANINE ?                         'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                         'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                         'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                         'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ?                         'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                         'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                         'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                         'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                         'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                         'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                         'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                         'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                         'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                         'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                         'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?                         'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                         'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                         'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ?                         'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                         'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                         'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                         'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5YD6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.14 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, MES PH 5.5 AND MGCL2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE BL13B1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL13B1 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5YD6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.34 
_reflns.d_resolution_low                 94.08 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       46996 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.7 
_reflns.pdbx_Rmerge_I_obs                0.072 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.34 
_reflns_shell.d_res_low                   2.47 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           6778 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.746 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.57 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            3.04 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -2.47 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               55.042 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5YD6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.34 
_refine.ls_d_res_low                             20.00 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     44489 
_refine.ls_number_reflns_R_free                  2343 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.37 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.22722 
_refine.ls_R_factor_R_free                       0.26863 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.22507 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1OVL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.396 
_refine.pdbx_overall_ESU_R_Free                  0.265 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             19.847 
_refine.overall_SU_ML                            0.233 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        7199 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         98 
_refine_hist.number_atoms_solvent             327 
_refine_hist.number_atoms_total               7624 
_refine_hist.d_res_high                       2.34 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.019  7448  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.525  1.987  10067 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.215  5.000  889   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.022 24.353 340   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.577 15.000 1292  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.491 15.000 44    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.098  0.200  1153  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  5552  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 0.751  2.906  3592  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 1.293  4.353  4469  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.156  3.071  3856  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.972  41.173 11281 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.340 
_refine_ls_shell.d_res_low                        2.400 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             182 
_refine_ls_shell.number_reflns_R_work             3200 
_refine_ls_shell.percent_reflns_obs               99.82 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.328 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5YD6 
_struct.title                        'Crystal structure of PG-bound Nurr1-LBD' 
_struct.pdbx_descriptor              'Nuclear receptor subfamily 4 group A member 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5YD6 
_struct_keywords.text            'NURR1, LBD, PROSTAGLANDIN, TRANSCRIPTION, MICHAEL ADDITION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 36  ? ASP A 47  ? SER A 363 ASP A 374 1 ? 12 
HELX_P HELX_P2  AA2 THR A 73  ? LYS A 96  ? THR A 400 LYS A 423 1 ? 24 
HELX_P HELX_P3  AA3 GLY A 99  ? LEU A 103 ? GLY A 426 LEU A 430 5 ? 5  
HELX_P HELX_P4  AA4 PRO A 104 ? SER A 128 ? PRO A 431 SER A 455 1 ? 25 
HELX_P HELX_P5  AA5 ASN A 129 ? GLU A 132 ? ASN A 456 GLU A 459 5 ? 4  
HELX_P HELX_P6  AA6 ARG A 145 ? GLY A 153 ? ARG A 472 GLY A 480 1 ? 9  
HELX_P HELX_P7  AA7 GLY A 153 ? MET A 169 ? GLY A 480 MET A 496 1 ? 17 
HELX_P HELX_P8  AA8 ASP A 172 ? VAL A 185 ? ASP A 499 VAL A 512 1 ? 14 
HELX_P HELX_P9  AA9 GLU A 193 ? PHE A 214 ? GLU A 520 PHE A 541 1 ? 22 
HELX_P HELX_P10 AB1 ASN A 223 ? GLY A 230 ? ASN A 550 GLY A 557 1 ? 8  
HELX_P HELX_P11 AB2 GLY A 230 ? ASP A 253 ? GLY A 557 ASP A 580 1 ? 24 
HELX_P HELX_P12 AB3 PRO A 258 ? LEU A 269 ? PRO A 585 LEU A 596 1 ? 12 
HELX_P HELX_P13 AB4 SER B 36  ? ASP B 47  ? SER B 363 ASP B 374 1 ? 12 
HELX_P HELX_P14 AB5 THR B 73  ? GLU B 95  ? THR B 400 GLU B 422 1 ? 23 
HELX_P HELX_P15 AB6 GLY B 99  ? LEU B 103 ? GLY B 426 LEU B 430 5 ? 5  
HELX_P HELX_P16 AB7 PRO B 104 ? SER B 128 ? PRO B 431 SER B 455 1 ? 25 
HELX_P HELX_P17 AB8 ASN B 129 ? GLU B 132 ? ASN B 456 GLU B 459 5 ? 4  
HELX_P HELX_P18 AB9 ARG B 145 ? GLY B 153 ? ARG B 472 GLY B 480 1 ? 9  
HELX_P HELX_P19 AC1 GLU B 154 ? MET B 169 ? GLU B 481 MET B 496 1 ? 16 
HELX_P HELX_P20 AC2 ASP B 172 ? VAL B 185 ? ASP B 499 VAL B 512 1 ? 14 
HELX_P HELX_P21 AC3 GLU B 193 ? ASN B 215 ? GLU B 520 ASN B 542 1 ? 23 
HELX_P HELX_P22 AC4 TYR B 224 ? GLY B 230 ? TYR B 551 GLY B 557 1 ? 7  
HELX_P HELX_P23 AC5 GLY B 230 ? ASP B 253 ? GLY B 557 ASP B 580 1 ? 24 
HELX_P HELX_P24 AC6 PRO B 258 ? LEU B 269 ? PRO B 585 LEU B 596 1 ? 12 
HELX_P HELX_P25 AC7 SER C 36  ? ASP C 47  ? SER C 363 ASP C 374 1 ? 12 
HELX_P HELX_P26 AC8 THR C 73  ? GLU C 95  ? THR C 400 GLU C 422 1 ? 23 
HELX_P HELX_P27 AC9 PRO C 104 ? SER C 128 ? PRO C 431 SER C 455 1 ? 25 
HELX_P HELX_P28 AD1 ARG C 145 ? GLY C 153 ? ARG C 472 GLY C 480 1 ? 9  
HELX_P HELX_P29 AD2 GLU C 154 ? MET C 169 ? GLU C 481 MET C 496 1 ? 16 
HELX_P HELX_P30 AD3 ASP C 172 ? VAL C 185 ? ASP C 499 VAL C 512 1 ? 14 
HELX_P HELX_P31 AD4 GLU C 193 ? ASN C 215 ? GLU C 520 ASN C 542 1 ? 23 
HELX_P HELX_P32 AD5 ASN C 223 ? ASP C 253 ? ASN C 550 ASP C 580 1 ? 31 
HELX_P HELX_P33 AD6 PRO C 258 ? LEU C 269 ? PRO C 585 LEU C 596 1 ? 12 
HELX_P HELX_P34 AD7 SER D 36  ? SER D 48  ? SER D 363 SER D 375 1 ? 13 
HELX_P HELX_P35 AD8 THR D 73  ? GLY D 85  ? THR D 400 GLY D 412 1 ? 13 
HELX_P HELX_P36 AD9 SER D 86  ? GLU D 95  ? SER D 413 GLU D 422 1 ? 10 
HELX_P HELX_P37 AE1 PRO D 104 ? SER D 128 ? PRO D 431 SER D 455 1 ? 25 
HELX_P HELX_P38 AE2 ASN D 129 ? GLU D 132 ? ASN D 456 GLU D 459 5 ? 4  
HELX_P HELX_P39 AE3 CYS D 148 ? GLY D 153 ? CYS D 475 GLY D 480 1 ? 6  
HELX_P HELX_P40 AE4 GLU D 154 ? ASN D 168 ? GLU D 481 ASN D 495 1 ? 15 
HELX_P HELX_P41 AE5 ASP D 172 ? VAL D 185 ? ASP D 499 VAL D 512 1 ? 14 
HELX_P HELX_P42 AE6 GLU D 193 ? ASN D 215 ? GLU D 520 ASN D 542 1 ? 23 
HELX_P HELX_P43 AE7 ASN D 223 ? GLY D 230 ? ASN D 550 GLY D 557 1 ? 8  
HELX_P HELX_P44 AE8 GLY D 230 ? ASP D 253 ? GLY D 557 ASP D 580 1 ? 24 
HELX_P HELX_P45 AE9 PRO D 258 ? LEU D 269 ? PRO D 585 LEU D 596 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale none ? A CYS 239 SG ? ? ? 1_555 E 8SU . C11 ? ? A CYS 566 A 8SU 601 1_555 ? ? ? ? ? ? ? 1.637 ? 
covale2 covale none ? B CYS 239 SG ? ? ? 1_555 H 8SU . C11 ? ? B CYS 566 B 8SU 601 1_555 ? ? ? ? ? ? ? 1.629 ? 
covale3 covale none ? C CYS 239 SG ? ? ? 1_555 I 8SU . C11 ? ? C CYS 566 C 8SU 601 1_555 ? ? ? ? ? ? ? 1.616 ? 
covale4 covale none ? D CYS 239 SG ? ? ? 1_555 J 8SU . C11 ? ? D CYS 566 D 8SU 601 1_555 ? ? ? ? ? ? ? 1.616 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 134 ? ILE A 136 ? LYS A 461 ILE A 463 
AA1 2 VAL A 142 ? HIS A 144 ? VAL A 469 HIS A 471 
AA2 1 LYS B 134 ? ILE B 136 ? LYS B 461 ILE B 463 
AA2 2 VAL B 142 ? HIS B 144 ? VAL B 469 HIS B 471 
AA3 1 LYS C 134 ? ILE C 136 ? LYS C 461 ILE C 463 
AA3 2 VAL C 142 ? HIS C 144 ? VAL C 469 HIS C 471 
AA4 1 LYS D 134 ? ILE D 136 ? LYS D 461 ILE D 463 
AA4 2 VAL D 142 ? HIS D 144 ? VAL D 469 HIS D 471 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 135 ? N LEU A 462 O LEU A 143 ? O LEU A 470 
AA2 1 2 N LEU B 135 ? N LEU B 462 O LEU B 143 ? O LEU B 470 
AA3 1 2 N LEU C 135 ? N LEU C 462 O LEU C 143 ? O LEU C 470 
AA4 1 2 N LEU D 135 ? N LEU D 462 O LEU D 143 ? O LEU D 470 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 8SU 601 ? 16 'binding site for residue 8SU A 601'                  
AC2 Software A MG  602 ? 4  'binding site for residue MG A 602'                   
AC3 Software B MG  602 ? 1  'binding site for residue MG B 602'                   
AC4 Software B 8SU 601 ? 17 'binding site for Di-peptide 8SU B 602 and CYS B 566' 
AC5 Software C 8SU 601 ? 19 'binding site for Di-peptide 8SU C 601 and CYS C 566' 
AC6 Software D 8SU 601 ? 16 'binding site for Di-peptide 8SU D 601 and CYS D 566' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 GLU A 113 ? GLU A 440 . ? 1_555 ? 
2  AC1 16 SER A 114 ? SER A 441 . ? 1_555 ? 
3  AC1 16 PHE A 116 ? PHE A 443 . ? 1_555 ? 
4  AC1 16 LEU A 117 ? LEU A 444 . ? 1_555 ? 
5  AC1 16 GLU A 118 ? GLU A 445 . ? 1_555 ? 
6  AC1 16 ARG A 188 ? ARG A 515 . ? 1_555 ? 
7  AC1 16 HIS A 189 ? HIS A 516 . ? 1_555 ? 
8  AC1 16 ARG A 236 ? ARG A 563 . ? 1_555 ? 
9  AC1 16 CYS A 239 ? CYS A 566 . ? 1_555 ? 
10 AC1 16 THR A 240 ? THR A 567 . ? 1_555 ? 
11 AC1 16 LEU A 243 ? LEU A 570 . ? 1_555 ? 
12 AC1 16 ILE A 246 ? ILE A 573 . ? 1_555 ? 
13 AC1 16 LEU A 264 ? LEU A 591 . ? 1_555 ? 
14 AC1 16 PHE A 265 ? PHE A 592 . ? 1_555 ? 
15 AC1 16 THR A 268 ? THR A 595 . ? 1_555 ? 
16 AC1 16 LEU D 251 ? LEU D 578 . ? 2_455 ? 
17 AC2 4  HOH K .   ? HOH A 757 . ? 1_555 ? 
18 AC2 4  HOH M .   ? HOH C 722 . ? 4_545 ? 
19 AC2 4  PHE D 271 ? PHE D 598 . ? 2_455 ? 
20 AC2 4  HOH N .   ? HOH D 714 . ? 2_455 ? 
21 AC3 1  HOH M .   ? HOH C 754 . ? 2_455 ? 
22 AC4 17 GLU B 113 ? GLU B 440 . ? 1_555 ? 
23 AC4 17 SER B 114 ? SER B 441 . ? 1_555 ? 
24 AC4 17 PHE B 116 ? PHE B 443 . ? 1_555 ? 
25 AC4 17 LEU B 117 ? LEU B 444 . ? 1_555 ? 
26 AC4 17 ARG B 188 ? ARG B 515 . ? 1_555 ? 
27 AC4 17 LEU B 235 ? LEU B 562 . ? 1_555 ? 
28 AC4 17 ARG B 236 ? ARG B 563 . ? 1_555 ? 
29 AC4 17 THR B 237 ? THR B 564 . ? 1_555 ? 
30 AC4 17 LEU B 238 ? LEU B 565 . ? 1_555 ? 
31 AC4 17 THR B 240 ? THR B 567 . ? 1_555 ? 
32 AC4 17 GLN B 241 ? GLN B 568 . ? 1_555 ? 
33 AC4 17 GLY B 242 ? GLY B 569 . ? 1_555 ? 
34 AC4 17 LEU B 243 ? LEU B 570 . ? 1_555 ? 
35 AC4 17 LEU B 264 ? LEU B 591 . ? 1_555 ? 
36 AC4 17 PHE B 265 ? PHE B 592 . ? 1_555 ? 
37 AC4 17 THR B 268 ? THR B 595 . ? 1_555 ? 
38 AC4 17 HOH L .   ? HOH B 729 . ? 1_555 ? 
39 AC5 19 LEU B 251 ? LEU B 578 . ? 2_454 ? 
40 AC5 19 GLU C 113 ? GLU C 440 . ? 1_555 ? 
41 AC5 19 SER C 114 ? SER C 441 . ? 1_555 ? 
42 AC5 19 PHE C 116 ? PHE C 443 . ? 1_555 ? 
43 AC5 19 LEU C 117 ? LEU C 444 . ? 1_555 ? 
44 AC5 19 GLU C 118 ? GLU C 445 . ? 1_555 ? 
45 AC5 19 ARG C 188 ? ARG C 515 . ? 1_555 ? 
46 AC5 19 HIS C 189 ? HIS C 516 . ? 1_555 ? 
47 AC5 19 LEU C 235 ? LEU C 562 . ? 1_555 ? 
48 AC5 19 ARG C 236 ? ARG C 563 . ? 1_555 ? 
49 AC5 19 THR C 237 ? THR C 564 . ? 1_555 ? 
50 AC5 19 LEU C 238 ? LEU C 565 . ? 1_555 ? 
51 AC5 19 THR C 240 ? THR C 567 . ? 1_555 ? 
52 AC5 19 GLN C 241 ? GLN C 568 . ? 1_555 ? 
53 AC5 19 GLY C 242 ? GLY C 569 . ? 1_555 ? 
54 AC5 19 LEU C 243 ? LEU C 570 . ? 1_555 ? 
55 AC5 19 LEU C 264 ? LEU C 591 . ? 1_555 ? 
56 AC5 19 PHE C 265 ? PHE C 592 . ? 1_555 ? 
57 AC5 19 THR C 268 ? THR C 595 . ? 1_555 ? 
58 AC6 16 LEU A 251 ? LEU A 578 . ? 2_454 ? 
59 AC6 16 GLU D 113 ? GLU D 440 . ? 1_555 ? 
60 AC6 16 SER D 114 ? SER D 441 . ? 1_555 ? 
61 AC6 16 PHE D 116 ? PHE D 443 . ? 1_555 ? 
62 AC6 16 LEU D 117 ? LEU D 444 . ? 1_555 ? 
63 AC6 16 ARG D 188 ? ARG D 515 . ? 1_555 ? 
64 AC6 16 LEU D 235 ? LEU D 562 . ? 1_555 ? 
65 AC6 16 ARG D 236 ? ARG D 563 . ? 1_555 ? 
66 AC6 16 THR D 237 ? THR D 564 . ? 1_555 ? 
67 AC6 16 LEU D 238 ? LEU D 565 . ? 1_555 ? 
68 AC6 16 THR D 240 ? THR D 567 . ? 1_555 ? 
69 AC6 16 GLN D 241 ? GLN D 568 . ? 1_555 ? 
70 AC6 16 GLY D 242 ? GLY D 569 . ? 1_555 ? 
71 AC6 16 LEU D 243 ? LEU D 570 . ? 1_555 ? 
72 AC6 16 LEU D 264 ? LEU D 591 . ? 1_555 ? 
73 AC6 16 THR D 268 ? THR D 595 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5YD6 
_atom_sites.fract_transf_matrix[1][1]   0.011635 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010629 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007372 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 35  ? 0.104   -8.940  -13.598 1.00 79.81  ? 362 VAL A N   1 
ATOM   2    C  CA  . VAL A 1 35  ? 1.265   -9.249  -12.711 1.00 78.16  ? 362 VAL A CA  1 
ATOM   3    C  C   . VAL A 1 35  ? 1.227   -8.356  -11.456 1.00 76.19  ? 362 VAL A C   1 
ATOM   4    O  O   . VAL A 1 35  ? 2.022   -8.549  -10.524 1.00 76.65  ? 362 VAL A O   1 
ATOM   5    C  CB  . VAL A 1 35  ? 2.641   -9.125  -13.439 1.00 82.76  ? 362 VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 35  ? 3.648   -10.131 -12.866 1.00 81.90  ? 362 VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 35  ? 2.516   -9.292  -14.957 1.00 85.19  ? 362 VAL A CG2 1 
ATOM   8    N  N   . SER A 1 36  ? 0.296   -7.393  -11.441 1.00 73.19  ? 363 SER A N   1 
ATOM   9    C  CA  . SER A 1 36  ? 0.009   -6.546  -10.272 1.00 69.97  ? 363 SER A CA  1 
ATOM   10   C  C   . SER A 1 36  ? -0.132  -7.361  -8.964  1.00 64.89  ? 363 SER A C   1 
ATOM   11   O  O   . SER A 1 36  ? -0.592  -8.514  -8.996  1.00 62.41  ? 363 SER A O   1 
ATOM   12   C  CB  . SER A 1 36  ? -1.256  -5.728  -10.543 1.00 70.34  ? 363 SER A CB  1 
ATOM   13   O  OG  . SER A 1 36  ? -1.843  -5.253  -9.345  1.00 69.90  ? 363 SER A OG  1 
ATOM   14   N  N   . LEU A 1 37  ? 0.272   -6.768  -7.833  1.00 61.92  ? 364 LEU A N   1 
ATOM   15   C  CA  . LEU A 1 37  ? 0.203   -7.456  -6.537  1.00 57.23  ? 364 LEU A CA  1 
ATOM   16   C  C   . LEU A 1 37  ? -1.237  -7.767  -6.080  1.00 54.42  ? 364 LEU A C   1 
ATOM   17   O  O   . LEU A 1 37  ? -1.539  -8.913  -5.722  1.00 52.16  ? 364 LEU A O   1 
ATOM   18   C  CB  . LEU A 1 37  ? 1.018   -6.739  -5.441  1.00 56.95  ? 364 LEU A CB  1 
ATOM   19   C  CG  . LEU A 1 37  ? 1.049   -7.332  -4.006  1.00 54.31  ? 364 LEU A CG  1 
ATOM   20   C  CD1 . LEU A 1 37  ? 1.397   -8.818  -3.929  1.00 50.83  ? 364 LEU A CD1 1 
ATOM   21   C  CD2 . LEU A 1 37  ? 1.997   -6.528  -3.122  1.00 55.22  ? 364 LEU A CD2 1 
ATOM   22   N  N   . ILE A 1 38  ? -2.119  -6.768  -6.105  1.00 54.63  ? 365 ILE A N   1 
ATOM   23   C  CA  . ILE A 1 38  ? -3.521  -6.993  -5.729  1.00 52.41  ? 365 ILE A CA  1 
ATOM   24   C  C   . ILE A 1 38  ? -4.199  -8.053  -6.624  1.00 50.68  ? 365 ILE A C   1 
ATOM   25   O  O   . ILE A 1 38  ? -4.911  -8.904  -6.103  1.00 49.07  ? 365 ILE A O   1 
ATOM   26   C  CB  . ILE A 1 38  ? -4.336  -5.667  -5.544  1.00 54.54  ? 365 ILE A CB  1 
ATOM   27   C  CG1 . ILE A 1 38  ? -5.594  -5.920  -4.688  1.00 52.19  ? 365 ILE A CG1 1 
ATOM   28   C  CG2 . ILE A 1 38  ? -4.637  -4.969  -6.881  1.00 56.55  ? 365 ILE A CG2 1 
ATOM   29   C  CD1 . ILE A 1 38  ? -6.072  -4.716  -3.911  1.00 53.53  ? 365 ILE A CD1 1 
ATOM   30   N  N   . SER A 1 39  ? -3.921  -8.020  -7.937  1.00 52.18  ? 366 SER A N   1 
ATOM   31   C  CA  . SER A 1 39  ? -4.288  -9.071  -8.921  1.00 50.68  ? 366 SER A CA  1 
ATOM   32   C  C   . SER A 1 39  ? -3.829  -10.467 -8.515  1.00 48.18  ? 366 SER A C   1 
ATOM   33   O  O   . SER A 1 39  ? -4.630  -11.409 -8.516  1.00 47.72  ? 366 SER A O   1 
ATOM   34   C  CB  . SER A 1 39  ? -3.686  -8.765  -10.299 1.00 53.30  ? 366 SER A CB  1 
ATOM   35   O  OG  . SER A 1 39  ? -4.421  -7.778  -10.978 1.00 56.10  ? 366 SER A OG  1 
ATOM   36   N  N   . ALA A 1 40  ? -2.543  -10.586 -8.170  1.00 47.28  ? 367 ALA A N   1 
ATOM   37   C  CA  . ALA A 1 40  ? -1.950  -11.850 -7.737  1.00 44.95  ? 367 ALA A CA  1 
ATOM   38   C  C   . ALA A 1 40  ? -2.574  -12.396 -6.446  1.00 41.52  ? 367 ALA A C   1 
ATOM   39   O  O   . ALA A 1 40  ? -2.727  -13.612 -6.304  1.00 40.17  ? 367 ALA A O   1 
ATOM   40   C  CB  . ALA A 1 40  ? -0.443  -11.716 -7.601  1.00 44.78  ? 367 ALA A CB  1 
ATOM   41   N  N   . LEU A 1 41  ? -2.938  -11.497 -5.532  1.00 40.61  ? 368 LEU A N   1 
ATOM   42   C  CA  . LEU A 1 41  ? -3.599  -11.881 -4.284  1.00 38.81  ? 368 LEU A CA  1 
ATOM   43   C  C   . LEU A 1 41  ? -5.030  -12.352 -4.525  1.00 38.59  ? 368 LEU A C   1 
ATOM   44   O  O   . LEU A 1 41  ? -5.453  -13.361 -3.942  1.00 36.93  ? 368 LEU A O   1 
ATOM   45   C  CB  . LEU A 1 41  ? -3.596  -10.738 -3.270  1.00 38.61  ? 368 LEU A CB  1 
ATOM   46   C  CG  . LEU A 1 41  ? -2.264  -10.221 -2.742  1.00 39.71  ? 368 LEU A CG  1 
ATOM   47   C  CD1 . LEU A 1 41  ? -2.489  -8.897  -2.023  1.00 40.73  ? 368 LEU A CD1 1 
ATOM   48   C  CD2 . LEU A 1 41  ? -1.556  -11.242 -1.849  1.00 37.71  ? 368 LEU A CD2 1 
ATOM   49   N  N   . VAL A 1 42  ? -5.761  -11.616 -5.375  1.00 40.49  ? 369 VAL A N   1 
ATOM   50   C  CA  . VAL A 1 42  ? -7.110  -11.998 -5.829  1.00 40.26  ? 369 VAL A CA  1 
ATOM   51   C  C   . VAL A 1 42  ? -7.018  -13.377 -6.497  1.00 39.98  ? 369 VAL A C   1 
ATOM   52   O  O   . VAL A 1 42  ? -7.823  -14.258 -6.192  1.00 38.73  ? 369 VAL A O   1 
ATOM   53   C  CB  . VAL A 1 42  ? -7.750  -10.948 -6.793  1.00 42.13  ? 369 VAL A CB  1 
ATOM   54   C  CG1 . VAL A 1 42  ? -9.038  -11.476 -7.415  1.00 42.02  ? 369 VAL A CG1 1 
ATOM   55   C  CG2 . VAL A 1 42  ? -8.029  -9.627  -6.090  1.00 42.43  ? 369 VAL A CG2 1 
ATOM   56   N  N   . ARG A 1 43  ? -6.015  -13.557 -7.364  1.00 41.25  ? 370 ARG A N   1 
ATOM   57   C  CA  . ARG A 1 43  ? -5.788  -14.824 -8.080  1.00 41.51  ? 370 ARG A CA  1 
ATOM   58   C  C   . ARG A 1 43  ? -5.517  -15.975 -7.126  1.00 38.89  ? 370 ARG A C   1 
ATOM   59   O  O   . ARG A 1 43  ? -6.122  -17.031 -7.270  1.00 38.13  ? 370 ARG A O   1 
ATOM   60   C  CB  . ARG A 1 43  ? -4.650  -14.680 -9.108  1.00 45.36  ? 370 ARG A CB  1 
ATOM   61   C  CG  . ARG A 1 43  ? -4.478  -15.852 -10.062 1.00 48.01  ? 370 ARG A CG  1 
ATOM   62   C  CD  . ARG A 1 43  ? -3.603  -15.483 -11.263 1.00 53.53  ? 370 ARG A CD  1 
ATOM   63   N  NE  . ARG A 1 43  ? -4.256  -14.505 -12.159 1.00 57.62  ? 370 ARG A NE  1 
ATOM   64   C  CZ  . ARG A 1 43  ? -3.771  -13.302 -12.482 1.00 59.90  ? 370 ARG A CZ  1 
ATOM   65   N  NH1 . ARG A 1 43  ? -2.597  -12.883 -12.015 1.00 61.31  ? 370 ARG A NH1 1 
ATOM   66   N  NH2 . ARG A 1 43  ? -4.457  -12.515 -13.299 1.00 61.93  ? 370 ARG A NH2 1 
ATOM   67   N  N   . ALA A 1 44  ? -4.622  -15.763 -6.157  1.00 37.49  ? 371 ALA A N   1 
ATOM   68   C  CA  . ALA A 1 44  ? -4.420  -16.709 -5.051  1.00 36.42  ? 371 ALA A CA  1 
ATOM   69   C  C   . ALA A 1 44  ? -5.745  -17.104 -4.384  1.00 34.20  ? 371 ALA A C   1 
ATOM   70   O  O   . ALA A 1 44  ? -6.026  -18.292 -4.218  1.00 33.56  ? 371 ALA A O   1 
ATOM   71   C  CB  . ALA A 1 44  ? -3.443  -16.151 -4.004  1.00 35.83  ? 371 ALA A CB  1 
ATOM   72   N  N   . HIS A 1 45  ? -6.546  -16.113 -4.012  1.00 34.24  ? 372 HIS A N   1 
ATOM   73   C  CA  . HIS A 1 45  ? -7.846  -16.371 -3.352  1.00 34.37  ? 372 HIS A CA  1 
ATOM   74   C  C   . HIS A 1 45  ? -8.821  -17.158 -4.255  1.00 34.61  ? 372 HIS A C   1 
ATOM   75   O  O   . HIS A 1 45  ? -9.283  -18.238 -3.877  1.00 34.23  ? 372 HIS A O   1 
ATOM   76   C  CB  . HIS A 1 45  ? -8.494  -15.072 -2.869  1.00 35.16  ? 372 HIS A CB  1 
ATOM   77   C  CG  . HIS A 1 45  ? -9.842  -15.282 -2.272  1.00 35.66  ? 372 HIS A CG  1 
ATOM   78   N  ND1 . HIS A 1 45  ? -11.010 -15.077 -2.979  1.00 36.82  ? 372 HIS A ND1 1 
ATOM   79   C  CD2 . HIS A 1 45  ? -10.213 -15.738 -1.055  1.00 34.17  ? 372 HIS A CD2 1 
ATOM   80   C  CE1 . HIS A 1 45  ? -12.043 -15.384 -2.216  1.00 35.96  ? 372 HIS A CE1 1 
ATOM   81   N  NE2 . HIS A 1 45  ? -11.586 -15.791 -1.046  1.00 35.13  ? 372 HIS A NE2 1 
ATOM   82   N  N   . VAL A 1 46  ? -9.081  -16.636 -5.456  1.00 35.79  ? 373 VAL A N   1 
ATOM   83   C  CA  . VAL A 1 46  ? -9.996  -17.268 -6.421  1.00 36.45  ? 373 VAL A CA  1 
ATOM   84   C  C   . VAL A 1 46  ? -9.614  -18.714 -6.774  1.00 36.63  ? 373 VAL A C   1 
ATOM   85   O  O   . VAL A 1 46  ? -10.484 -19.588 -6.786  1.00 36.64  ? 373 VAL A O   1 
ATOM   86   C  CB  . VAL A 1 46  ? -10.208 -16.410 -7.688  1.00 37.70  ? 373 VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 46  ? -11.196 -17.084 -8.629  1.00 38.98  ? 373 VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 46  ? -10.724 -15.023 -7.335  1.00 37.72  ? 373 VAL A CG2 1 
ATOM   89   N  N   . ASP A 1 47  ? -8.330  -18.963 -7.029  1.00 37.72  ? 374 ASP A N   1 
ATOM   90   C  CA  . ASP A 1 47  ? -7.848  -20.293 -7.429  1.00 39.23  ? 374 ASP A CA  1 
ATOM   91   C  C   . ASP A 1 47  ? -7.800  -21.353 -6.327  1.00 38.68  ? 374 ASP A C   1 
ATOM   92   O  O   . ASP A 1 47  ? -7.511  -22.532 -6.610  1.00 41.75  ? 374 ASP A O   1 
ATOM   93   C  CB  . ASP A 1 47  ? -6.460  -20.202 -8.083  1.00 40.94  ? 374 ASP A CB  1 
ATOM   94   C  CG  . ASP A 1 47  ? -6.487  -19.557 -9.456  1.00 43.56  ? 374 ASP A CG  1 
ATOM   95   O  OD1 . ASP A 1 47  ? -7.578  -19.270 -9.985  1.00 44.30  ? 374 ASP A OD1 1 
ATOM   96   O  OD2 . ASP A 1 47  ? -5.396  -19.332 -10.012 1.00 45.52  ? 374 ASP A OD2 1 
ATOM   97   N  N   . SER A 1 48  ? -8.044  -20.956 -5.084  1.00 36.00  ? 375 SER A N   1 
ATOM   98   C  CA  . SER A 1 48  ? -7.990  -21.893 -3.975  1.00 34.71  ? 375 SER A CA  1 
ATOM   99   C  C   . SER A 1 48  ? -9.315  -21.995 -3.227  1.00 34.90  ? 375 SER A C   1 
ATOM   100  O  O   . SER A 1 48  ? -9.345  -22.495 -2.094  1.00 34.54  ? 375 SER A O   1 
ATOM   101  C  CB  . SER A 1 48  ? -6.863  -21.513 -3.007  1.00 33.80  ? 375 SER A CB  1 
ATOM   102  O  OG  . SER A 1 48  ? -7.112  -20.258 -2.418  1.00 32.84  ? 375 SER A OG  1 
ATOM   103  N  N   . ASN A 1 49  ? -10.395 -21.518 -3.856  1.00 35.08  ? 376 ASN A N   1 
ATOM   104  C  CA  . ASN A 1 49  ? -11.743 -21.615 -3.295  1.00 35.02  ? 376 ASN A CA  1 
ATOM   105  C  C   . ASN A 1 49  ? -12.674 -22.414 -4.200  1.00 35.33  ? 376 ASN A C   1 
ATOM   106  O  O   . ASN A 1 49  ? -12.473 -22.453 -5.408  1.00 36.59  ? 376 ASN A O   1 
ATOM   107  C  CB  . ASN A 1 49  ? -12.316 -20.226 -2.963  1.00 36.09  ? 376 ASN A CB  1 
ATOM   108  C  CG  . ASN A 1 49  ? -11.803 -19.689 -1.626  1.00 36.29  ? 376 ASN A CG  1 
ATOM   109  O  OD1 . ASN A 1 49  ? -12.262 -20.086 -0.548  1.00 35.33  ? 376 ASN A OD1 1 
ATOM   110  N  ND2 . ASN A 1 49  ? -10.821 -18.807 -1.695  1.00 36.63  ? 376 ASN A ND2 1 
ATOM   111  N  N   . PRO A 1 50  ? -13.676 -23.100 -3.612  1.00 34.70  ? 377 PRO A N   1 
ATOM   112  C  CA  . PRO A 1 50  ? -14.559 -23.910 -4.456  1.00 35.27  ? 377 PRO A CA  1 
ATOM   113  C  C   . PRO A 1 50  ? -15.462 -23.057 -5.352  1.00 36.55  ? 377 PRO A C   1 
ATOM   114  O  O   . PRO A 1 50  ? -15.756 -21.904 -5.023  1.00 35.80  ? 377 PRO A O   1 
ATOM   115  C  CB  . PRO A 1 50  ? -15.360 -24.729 -3.444  1.00 34.33  ? 377 PRO A CB  1 
ATOM   116  C  CG  . PRO A 1 50  ? -15.303 -23.938 -2.174  1.00 32.75  ? 377 PRO A CG  1 
ATOM   117  C  CD  . PRO A 1 50  ? -13.948 -23.308 -2.173  1.00 32.70  ? 377 PRO A CD  1 
ATOM   118  N  N   . ALA A 1 51  ? -15.827 -23.605 -6.506  1.00 38.40  ? 378 ALA A N   1 
ATOM   119  C  CA  . ALA A 1 51  ? -16.746 -22.940 -7.416  1.00 41.43  ? 378 ALA A CA  1 
ATOM   120  C  C   . ALA A 1 51  ? -18.184 -22.969 -6.876  1.00 43.08  ? 378 ALA A C   1 
ATOM   121  O  O   . ALA A 1 51  ? -18.704 -24.032 -6.512  1.00 43.34  ? 378 ALA A O   1 
ATOM   122  C  CB  . ALA A 1 51  ? -16.658 -23.564 -8.799  1.00 42.39  ? 378 ALA A CB  1 
ATOM   123  N  N   . MET A 1 52  ? -18.817 -21.798 -6.800  1.00 46.28  ? 379 MET A N   1 
ATOM   124  C  CA  . MET A 1 52  ? -20.226 -21.705 -6.375  1.00 49.26  ? 379 MET A CA  1 
ATOM   125  C  C   . MET A 1 52  ? -21.156 -22.413 -7.358  1.00 50.98  ? 379 MET A C   1 
ATOM   126  O  O   . MET A 1 52  ? -22.278 -22.764 -7.015  1.00 52.14  ? 379 MET A O   1 
ATOM   127  C  CB  . MET A 1 52  ? -20.640 -20.247 -6.155  1.00 52.81  ? 379 MET A CB  1 
ATOM   128  C  CG  . MET A 1 52  ? -20.862 -19.852 -4.686  1.00 56.56  ? 379 MET A CG  1 
ATOM   129  S  SD  . MET A 1 52  ? -19.723 -20.438 -3.379  1.00 60.35  ? 379 MET A SD  1 
ATOM   130  C  CE  . MET A 1 52  ? -18.187 -19.694 -3.943  1.00 56.71  ? 379 MET A CE  1 
ATOM   131  N  N   . THR A 1 53  ? -20.651 -22.656 -8.563  1.00 51.38  ? 380 THR A N   1 
ATOM   132  C  CA  . THR A 1 53  ? -21.385 -23.356 -9.620  1.00 53.79  ? 380 THR A CA  1 
ATOM   133  C  C   . THR A 1 53  ? -21.360 -24.891 -9.468  1.00 54.73  ? 380 THR A C   1 
ATOM   134  O  O   . THR A 1 53  ? -22.199 -25.590 -10.061 1.00 57.55  ? 380 THR A O   1 
ATOM   135  C  CB  . THR A 1 53  ? -20.905 -22.925 -11.031 1.00 54.29  ? 380 THR A CB  1 
ATOM   136  O  OG1 . THR A 1 53  ? -19.472 -22.930 -11.087 1.00 52.10  ? 380 THR A OG1 1 
ATOM   137  C  CG2 . THR A 1 53  ? -21.405 -21.524 -11.346 1.00 54.64  ? 380 THR A CG2 1 
ATOM   138  N  N   . SER A 1 54  ? -20.422 -25.401 -8.665  1.00 52.30  ? 381 SER A N   1 
ATOM   139  C  CA  . SER A 1 54  ? -20.294 -26.841 -8.395  1.00 52.66  ? 381 SER A CA  1 
ATOM   140  C  C   . SER A 1 54  ? -20.041 -27.087 -6.893  1.00 51.10  ? 381 SER A C   1 
ATOM   141  O  O   . SER A 1 54  ? -18.905 -27.367 -6.440  1.00 51.67  ? 381 SER A O   1 
ATOM   142  C  CB  . SER A 1 54  ? -19.180 -27.442 -9.254  1.00 52.71  ? 381 SER A CB  1 
ATOM   143  O  OG  . SER A 1 54  ? -17.926 -26.913 -8.852  1.00 50.60  ? 381 SER A OG  1 
ATOM   144  N  N   . LEU A 1 55  ? -21.105 -26.924 -6.118  1.00 49.52  ? 382 LEU A N   1 
ATOM   145  C  CA  . LEU A 1 55  ? -21.062 -27.212 -4.697  1.00 46.45  ? 382 LEU A CA  1 
ATOM   146  C  C   . LEU A 1 55  ? -21.705 -28.563 -4.406  1.00 46.87  ? 382 LEU A C   1 
ATOM   147  O  O   . LEU A 1 55  ? -22.556 -29.038 -5.157  1.00 48.12  ? 382 LEU A O   1 
ATOM   148  C  CB  . LEU A 1 55  ? -21.712 -26.090 -3.893  1.00 45.31  ? 382 LEU A CB  1 
ATOM   149  C  CG  . LEU A 1 55  ? -20.990 -24.749 -3.897  1.00 43.45  ? 382 LEU A CG  1 
ATOM   150  C  CD1 . LEU A 1 55  ? -21.811 -23.716 -3.154  1.00 43.85  ? 382 LEU A CD1 1 
ATOM   151  C  CD2 . LEU A 1 55  ? -19.602 -24.855 -3.293  1.00 41.87  ? 382 LEU A CD2 1 
ATOM   152  N  N   . ASP A 1 56  ? -21.263 -29.183 -3.319  1.00 45.23  ? 383 ASP A N   1 
ATOM   153  C  CA  . ASP A 1 56  ? -21.672 -30.525 -2.959  1.00 45.70  ? 383 ASP A CA  1 
ATOM   154  C  C   . ASP A 1 56  ? -22.695 -30.428 -1.830  1.00 45.85  ? 383 ASP A C   1 
ATOM   155  O  O   . ASP A 1 56  ? -22.333 -30.256 -0.645  1.00 44.19  ? 383 ASP A O   1 
ATOM   156  C  CB  . ASP A 1 56  ? -20.424 -31.310 -2.542  1.00 45.29  ? 383 ASP A CB  1 
ATOM   157  C  CG  . ASP A 1 56  ? -20.675 -32.791 -2.341  1.00 47.71  ? 383 ASP A CG  1 
ATOM   158  O  OD1 . ASP A 1 56  ? -21.809 -33.286 -2.579  1.00 49.61  ? 383 ASP A OD1 1 
ATOM   159  O  OD2 . ASP A 1 56  ? -19.697 -33.464 -1.930  1.00 47.57  ? 383 ASP A OD2 1 
ATOM   160  N  N   . TYR A 1 57  ? -23.966 -30.513 -2.214  1.00 47.55  ? 384 TYR A N   1 
ATOM   161  C  CA  . TYR A 1 57  ? -25.092 -30.568 -1.272  1.00 49.65  ? 384 TYR A CA  1 
ATOM   162  C  C   . TYR A 1 57  ? -25.515 -31.987 -0.868  1.00 51.19  ? 384 TYR A C   1 
ATOM   163  O  O   . TYR A 1 57  ? -26.486 -32.142 -0.126  1.00 52.74  ? 384 TYR A O   1 
ATOM   164  C  CB  . TYR A 1 57  ? -26.319 -29.839 -1.854  1.00 52.34  ? 384 TYR A CB  1 
ATOM   165  C  CG  . TYR A 1 57  ? -26.290 -28.334 -1.703  1.00 52.02  ? 384 TYR A CG  1 
ATOM   166  C  CD1 . TYR A 1 57  ? -27.010 -27.701 -0.674  1.00 52.54  ? 384 TYR A CD1 1 
ATOM   167  C  CD2 . TYR A 1 57  ? -25.557 -27.536 -2.593  1.00 50.92  ? 384 TYR A CD2 1 
ATOM   168  C  CE1 . TYR A 1 57  ? -26.990 -26.315 -0.532  1.00 52.34  ? 384 TYR A CE1 1 
ATOM   169  C  CE2 . TYR A 1 57  ? -25.538 -26.154 -2.461  1.00 51.09  ? 384 TYR A CE2 1 
ATOM   170  C  CZ  . TYR A 1 57  ? -26.258 -25.552 -1.431  1.00 51.78  ? 384 TYR A CZ  1 
ATOM   171  O  OH  . TYR A 1 57  ? -26.229 -24.182 -1.299  1.00 53.19  ? 384 TYR A OH  1 
ATOM   172  N  N   . SER A 1 58  ? -24.800 -33.011 -1.341  1.00 51.49  ? 385 SER A N   1 
ATOM   173  C  CA  . SER A 1 58  ? -25.192 -34.424 -1.129  1.00 53.67  ? 385 SER A CA  1 
ATOM   174  C  C   . SER A 1 58  ? -25.239 -34.897 0.334   1.00 53.45  ? 385 SER A C   1 
ATOM   175  O  O   . SER A 1 58  ? -25.801 -35.941 0.619   1.00 56.15  ? 385 SER A O   1 
ATOM   176  C  CB  . SER A 1 58  ? -24.285 -35.361 -1.922  1.00 53.96  ? 385 SER A CB  1 
ATOM   177  O  OG  . SER A 1 58  ? -23.064 -35.531 -1.228  1.00 52.33  ? 385 SER A OG  1 
ATOM   178  N  N   . ARG A 1 59  ? -24.645 -34.138 1.246   1.00 51.42  ? 386 ARG A N   1 
ATOM   179  C  CA  . ARG A 1 59  ? -24.666 -34.472 2.675   1.00 52.16  ? 386 ARG A CA  1 
ATOM   180  C  C   . ARG A 1 59  ? -25.456 -33.450 3.490   1.00 51.00  ? 386 ARG A C   1 
ATOM   181  O  O   . ARG A 1 59  ? -25.602 -33.610 4.708   1.00 51.60  ? 386 ARG A O   1 
ATOM   182  C  CB  . ARG A 1 59  ? -23.233 -34.541 3.237   1.00 51.24  ? 386 ARG A CB  1 
ATOM   183  C  CG  . ARG A 1 59  ? -22.458 -35.791 2.851   1.00 53.82  ? 386 ARG A CG  1 
ATOM   184  C  CD  . ARG A 1 59  ? -21.263 -35.978 3.772   1.00 53.60  ? 386 ARG A CD  1 
ATOM   185  N  NE  . ARG A 1 59  ? -20.069 -35.335 3.242   1.00 52.19  ? 386 ARG A NE  1 
ATOM   186  C  CZ  . ARG A 1 59  ? -19.052 -34.896 3.977   1.00 52.13  ? 386 ARG A CZ  1 
ATOM   187  N  NH1 . ARG A 1 59  ? -19.065 -34.998 5.315   1.00 52.47  ? 386 ARG A NH1 1 
ATOM   188  N  NH2 . ARG A 1 59  ? -18.011 -34.335 3.366   1.00 51.28  ? 386 ARG A NH2 1 
ATOM   189  N  N   . PHE A 1 60  ? -25.941 -32.399 2.826   1.00 48.94  ? 387 PHE A N   1 
ATOM   190  C  CA  . PHE A 1 60  ? -26.571 -31.282 3.520   1.00 47.92  ? 387 PHE A CA  1 
ATOM   191  C  C   . PHE A 1 60  ? -27.913 -31.655 4.139   1.00 50.64  ? 387 PHE A C   1 
ATOM   192  O  O   . PHE A 1 60  ? -28.752 -32.262 3.474   1.00 52.66  ? 387 PHE A O   1 
ATOM   193  C  CB  . PHE A 1 60  ? -26.728 -30.066 2.596   1.00 45.62  ? 387 PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 60  ? -27.409 -28.911 3.258   1.00 45.14  ? 387 PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 60  ? -26.723 -28.113 4.180   1.00 42.57  ? 387 PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 60  ? -28.761 -28.650 3.009   1.00 46.48  ? 387 PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 60  ? -27.370 -27.058 4.815   1.00 43.05  ? 387 PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 60  ? -29.403 -27.599 3.647   1.00 46.97  ? 387 PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 60  ? -28.713 -26.801 4.548   1.00 45.55  ? 387 PHE A CZ  1 
ATOM   200  N  N   . GLN A 1 61  ? -28.100 -31.271 5.403   1.00 51.61  ? 388 GLN A N   1 
ATOM   201  C  CA  . GLN A 1 61  ? -29.369 -31.480 6.140   1.00 55.84  ? 388 GLN A CA  1 
ATOM   202  C  C   . GLN A 1 61  ? -29.735 -30.268 7.000   1.00 57.18  ? 388 GLN A C   1 
ATOM   203  O  O   . GLN A 1 61  ? -29.076 -30.006 8.013   1.00 55.94  ? 388 GLN A O   1 
ATOM   204  C  CB  . GLN A 1 61  ? -29.261 -32.690 7.062   1.00 56.69  ? 388 GLN A CB  1 
ATOM   205  C  CG  . GLN A 1 61  ? -29.414 -34.043 6.411   1.00 58.35  ? 388 GLN A CG  1 
ATOM   206  C  CD  . GLN A 1 61  ? -29.547 -35.120 7.459   1.00 60.48  ? 388 GLN A CD  1 
ATOM   207  O  OE1 . GLN A 1 61  ? -30.641 -35.418 7.906   1.00 62.94  ? 388 GLN A OE1 1 
ATOM   208  N  NE2 . GLN A 1 61  ? -28.421 -35.666 7.900   1.00 59.68  ? 388 GLN A NE2 1 
ATOM   209  N  N   . ALA A 1 62  ? -30.793 -29.556 6.615   1.00 60.83  ? 389 ALA A N   1 
ATOM   210  C  CA  . ALA A 1 62  ? -31.239 -28.344 7.321   1.00 63.96  ? 389 ALA A CA  1 
ATOM   211  C  C   . ALA A 1 62  ? -31.717 -28.590 8.760   1.00 67.90  ? 389 ALA A C   1 
ATOM   212  O  O   . ALA A 1 62  ? -31.584 -27.714 9.619   1.00 69.18  ? 389 ALA A O   1 
ATOM   213  C  CB  . ALA A 1 62  ? -32.308 -27.621 6.519   1.00 65.91  ? 389 ALA A CB  1 
ATOM   214  N  N   . ASN A 1 63  ? -32.260 -29.776 9.022   1.00 71.54  ? 390 ASN A N   1 
ATOM   215  C  CA  . ASN A 1 63  ? -32.674 -30.144 10.372  1.00 75.15  ? 390 ASN A CA  1 
ATOM   216  C  C   . ASN A 1 63  ? -32.324 -31.618 10.658  1.00 76.25  ? 390 ASN A C   1 
ATOM   217  O  O   . ASN A 1 63  ? -33.171 -32.496 10.475  1.00 79.32  ? 390 ASN A O   1 
ATOM   218  C  CB  . ASN A 1 63  ? -34.176 -29.858 10.555  1.00 80.28  ? 390 ASN A CB  1 
ATOM   219  C  CG  . ASN A 1 63  ? -34.547 -29.472 11.989  1.00 82.84  ? 390 ASN A CG  1 
ATOM   220  O  OD1 . ASN A 1 63  ? -33.686 -29.223 12.846  1.00 81.92  ? 390 ASN A OD1 1 
ATOM   221  N  ND2 . ASN A 1 63  ? -35.849 -29.407 12.249  1.00 86.63  ? 390 ASN A ND2 1 
ATOM   222  N  N   . PRO A 1 64  ? -31.067 -31.895 11.094  1.00 74.70  ? 391 PRO A N   1 
ATOM   223  C  CA  . PRO A 1 64  ? -30.620 -33.287 11.322  1.00 76.05  ? 391 PRO A CA  1 
ATOM   224  C  C   . PRO A 1 64  ? -31.102 -33.921 12.635  1.00 80.82  ? 391 PRO A C   1 
ATOM   225  O  O   . PRO A 1 64  ? -31.358 -33.206 13.612  1.00 81.78  ? 391 PRO A O   1 
ATOM   226  C  CB  . PRO A 1 64  ? -29.094 -33.168 11.332  1.00 70.75  ? 391 PRO A CB  1 
ATOM   227  C  CG  . PRO A 1 64  ? -28.833 -31.781 11.788  1.00 69.09  ? 391 PRO A CG  1 
ATOM   228  C  CD  . PRO A 1 64  ? -29.958 -30.934 11.270  1.00 70.63  ? 391 PRO A CD  1 
ATOM   229  N  N   . ASP A 1 65  ? -31.207 -35.254 12.633  1.00 84.49  ? 392 ASP A N   1 
ATOM   230  C  CA  . ASP A 1 65  ? -31.517 -36.048 13.828  1.00 88.81  ? 392 ASP A CA  1 
ATOM   231  C  C   . ASP A 1 65  ? -30.306 -36.184 14.758  1.00 87.16  ? 392 ASP A C   1 
ATOM   232  O  O   . ASP A 1 65  ? -30.414 -36.721 15.867  1.00 90.09  ? 392 ASP A O   1 
ATOM   233  C  CB  . ASP A 1 65  ? -32.046 -37.438 13.437  1.00 92.79  ? 392 ASP A CB  1 
ATOM   234  C  CG  . ASP A 1 65  ? -33.575 -37.507 13.403  1.00 98.21  ? 392 ASP A CG  1 
ATOM   235  O  OD1 . ASP A 1 65  ? -34.233 -37.045 14.372  1.00 100.91 ? 392 ASP A OD1 1 
ATOM   236  O  OD2 . ASP A 1 65  ? -34.126 -38.048 12.410  1.00 99.94  ? 392 ASP A OD2 1 
ATOM   237  N  N   . ASP A 1 72  ? -20.268 -38.273 19.295  1.00 68.54  ? 399 ASP A N   1 
ATOM   238  C  CA  . ASP A 1 72  ? -20.282 -39.293 18.201  1.00 69.06  ? 399 ASP A CA  1 
ATOM   239  C  C   . ASP A 1 72  ? -18.961 -39.318 17.413  1.00 65.60  ? 399 ASP A C   1 
ATOM   240  O  O   . ASP A 1 72  ? -18.443 -38.272 17.025  1.00 63.00  ? 399 ASP A O   1 
ATOM   241  C  CB  . ASP A 1 72  ? -21.499 -39.080 17.282  1.00 70.03  ? 399 ASP A CB  1 
ATOM   242  C  CG  . ASP A 1 72  ? -21.559 -40.079 16.119  1.00 71.83  ? 399 ASP A CG  1 
ATOM   243  O  OD1 . ASP A 1 72  ? -22.303 -41.084 16.238  1.00 73.60  ? 399 ASP A OD1 1 
ATOM   244  O  OD2 . ASP A 1 72  ? -20.862 -39.849 15.089  1.00 69.63  ? 399 ASP A OD2 1 
ATOM   245  N  N   . THR A 1 73  ? -18.454 -40.531 17.181  1.00 66.34  ? 400 THR A N   1 
ATOM   246  C  CA  . THR A 1 73  ? -17.165 -40.799 16.533  1.00 64.81  ? 400 THR A CA  1 
ATOM   247  C  C   . THR A 1 73  ? -17.040 -40.189 15.136  1.00 62.66  ? 400 THR A C   1 
ATOM   248  O  O   . THR A 1 73  ? -16.051 -39.499 14.839  1.00 60.25  ? 400 THR A O   1 
ATOM   249  C  CB  . THR A 1 73  ? -16.888 -42.325 16.503  1.00 67.72  ? 400 THR A CB  1 
ATOM   250  O  OG1 . THR A 1 73  ? -16.611 -42.775 17.836  1.00 70.48  ? 400 THR A OG1 1 
ATOM   251  C  CG2 . THR A 1 73  ? -15.711 -42.701 15.591  1.00 66.19  ? 400 THR A CG2 1 
ATOM   252  N  N   . GLN A 1 74  ? -18.032 -40.435 14.288  1.00 63.85  ? 401 GLN A N   1 
ATOM   253  C  CA  . GLN A 1 74  ? -17.934 -39.974 12.912  1.00 62.60  ? 401 GLN A CA  1 
ATOM   254  C  C   . GLN A 1 74  ? -18.110 -38.467 12.732  1.00 58.60  ? 401 GLN A C   1 
ATOM   255  O  O   . GLN A 1 74  ? -17.575 -37.916 11.781  1.00 56.32  ? 401 GLN A O   1 
ATOM   256  C  CB  . GLN A 1 74  ? -18.782 -40.809 11.930  1.00 66.79  ? 401 GLN A CB  1 
ATOM   257  C  CG  . GLN A 1 74  ? -17.974 -41.868 11.160  1.00 70.17  ? 401 GLN A CG  1 
ATOM   258  C  CD  . GLN A 1 74  ? -16.662 -41.332 10.542  1.00 69.85  ? 401 GLN A CD  1 
ATOM   259  O  OE1 . GLN A 1 74  ? -16.670 -40.586 9.544   1.00 67.49  ? 401 GLN A OE1 1 
ATOM   260  N  NE2 . GLN A 1 74  ? -15.522 -41.725 11.140  1.00 69.75  ? 401 GLN A NE2 1 
ATOM   261  N  N   . HIS A 1 75  ? -18.812 -37.804 13.654  1.00 57.63  ? 402 HIS A N   1 
ATOM   262  C  CA  . HIS A 1 75  ? -18.878 -36.336 13.643  1.00 54.39  ? 402 HIS A CA  1 
ATOM   263  C  C   . HIS A 1 75  ? -17.526 -35.699 13.995  1.00 51.45  ? 402 HIS A C   1 
ATOM   264  O  O   . HIS A 1 75  ? -17.117 -34.721 13.349  1.00 48.23  ? 402 HIS A O   1 
ATOM   265  C  CB  . HIS A 1 75  ? -19.994 -35.809 14.543  1.00 56.09  ? 402 HIS A CB  1 
ATOM   266  C  CG  . HIS A 1 75  ? -21.363 -35.966 13.955  1.00 58.80  ? 402 HIS A CG  1 
ATOM   267  N  ND1 . HIS A 1 75  ? -22.274 -36.890 14.424  1.00 61.52  ? 402 HIS A ND1 1 
ATOM   268  C  CD2 . HIS A 1 75  ? -21.965 -35.336 12.917  1.00 57.75  ? 402 HIS A CD2 1 
ATOM   269  C  CE1 . HIS A 1 75  ? -23.382 -36.811 13.709  1.00 62.46  ? 402 HIS A CE1 1 
ATOM   270  N  NE2 . HIS A 1 75  ? -23.220 -35.878 12.789  1.00 59.91  ? 402 HIS A NE2 1 
ATOM   271  N  N   . ILE A 1 76  ? -16.841 -36.272 14.993  1.00 51.02  ? 403 ILE A N   1 
ATOM   272  C  CA  . ILE A 1 76  ? -15.489 -35.840 15.377  1.00 49.28  ? 403 ILE A CA  1 
ATOM   273  C  C   . ILE A 1 76  ? -14.496 -36.092 14.236  1.00 48.52  ? 403 ILE A C   1 
ATOM   274  O  O   . ILE A 1 76  ? -13.768 -35.181 13.843  1.00 45.92  ? 403 ILE A O   1 
ATOM   275  C  CB  . ILE A 1 76  ? -15.007 -36.479 16.702  1.00 50.17  ? 403 ILE A CB  1 
ATOM   276  C  CG1 . ILE A 1 76  ? -15.974 -36.137 17.841  1.00 50.65  ? 403 ILE A CG1 1 
ATOM   277  C  CG2 . ILE A 1 76  ? -13.591 -36.014 17.028  1.00 48.54  ? 403 ILE A CG2 1 
ATOM   278  C  CD1 . ILE A 1 76  ? -15.800 -36.969 19.092  1.00 53.26  ? 403 ILE A CD1 1 
ATOM   279  N  N   . GLN A 1 77  ? -14.510 -37.304 13.679  1.00 51.43  ? 404 GLN A N   1 
ATOM   280  C  CA  . GLN A 1 77  ? -13.682 -37.626 12.515  1.00 51.99  ? 404 GLN A CA  1 
ATOM   281  C  C   . GLN A 1 77  ? -13.944 -36.710 11.323  1.00 50.31  ? 404 GLN A C   1 
ATOM   282  O  O   . GLN A 1 77  ? -12.990 -36.347 10.639  1.00 50.30  ? 404 GLN A O   1 
ATOM   283  C  CB  . GLN A 1 77  ? -13.793 -39.099 12.118  1.00 55.22  ? 404 GLN A CB  1 
ATOM   284  C  CG  . GLN A 1 77  ? -12.727 -39.575 11.133  1.00 56.18  ? 404 GLN A CG  1 
ATOM   285  C  CD  . GLN A 1 77  ? -11.309 -39.439 11.668  1.00 56.72  ? 404 GLN A CD  1 
ATOM   286  O  OE1 . GLN A 1 77  ? -10.950 -40.055 12.671  1.00 59.27  ? 404 GLN A OE1 1 
ATOM   287  N  NE2 . GLN A 1 77  ? -10.497 -38.621 10.999  1.00 54.98  ? 404 GLN A NE2 1 
ATOM   288  N  N   . GLN A 1 78  ? -15.206 -36.319 11.097  1.00 50.94  ? 405 GLN A N   1 
ATOM   289  C  CA  . GLN A 1 78  ? -15.560 -35.327 10.055  1.00 49.25  ? 405 GLN A CA  1 
ATOM   290  C  C   . GLN A 1 78  ? -14.837 -34.006 10.284  1.00 44.61  ? 405 GLN A C   1 
ATOM   291  O  O   . GLN A 1 78  ? -14.276 -33.431 9.353   1.00 41.07  ? 405 GLN A O   1 
ATOM   292  C  CB  . GLN A 1 78  ? -17.073 -35.023 9.996   1.00 53.65  ? 405 GLN A CB  1 
ATOM   293  C  CG  . GLN A 1 78  ? -18.016 -36.165 9.640   1.00 60.70  ? 405 GLN A CG  1 
ATOM   294  C  CD  . GLN A 1 78  ? -17.655 -36.907 8.366   1.00 63.76  ? 405 GLN A CD  1 
ATOM   295  O  OE1 . GLN A 1 78  ? -17.024 -36.347 7.455   1.00 67.36  ? 405 GLN A OE1 1 
ATOM   296  N  NE2 . GLN A 1 78  ? -18.071 -38.172 8.285   1.00 65.34  ? 405 GLN A NE2 1 
ATOM   297  N  N   . PHE A 1 79  ? -14.879 -33.549 11.539  1.00 43.00  ? 406 PHE A N   1 
ATOM   298  C  CA  . PHE A 1 79  ? -14.238 -32.318 11.992  1.00 40.76  ? 406 PHE A CA  1 
ATOM   299  C  C   . PHE A 1 79  ? -12.740 -32.313 11.673  1.00 38.93  ? 406 PHE A C   1 
ATOM   300  O  O   . PHE A 1 79  ? -12.238 -31.338 11.108  1.00 37.12  ? 406 PHE A O   1 
ATOM   301  C  CB  . PHE A 1 79  ? -14.522 -32.097 13.493  1.00 41.04  ? 406 PHE A CB  1 
ATOM   302  C  CG  . PHE A 1 79  ? -13.667 -31.051 14.146  1.00 39.33  ? 406 PHE A CG  1 
ATOM   303  C  CD1 . PHE A 1 79  ? -13.946 -29.696 13.979  1.00 38.13  ? 406 PHE A CD1 1 
ATOM   304  C  CD2 . PHE A 1 79  ? -12.602 -31.423 14.973  1.00 39.55  ? 406 PHE A CD2 1 
ATOM   305  C  CE1 . PHE A 1 79  ? -13.168 -28.730 14.607  1.00 36.91  ? 406 PHE A CE1 1 
ATOM   306  C  CE2 . PHE A 1 79  ? -11.815 -30.461 15.587  1.00 38.19  ? 406 PHE A CE2 1 
ATOM   307  C  CZ  . PHE A 1 79  ? -12.097 -29.116 15.400  1.00 37.00  ? 406 PHE A CZ  1 
ATOM   308  N  N   . TYR A 1 80  ? -12.061 -33.411 12.008  1.00 39.60  ? 407 TYR A N   1 
ATOM   309  C  CA  . TYR A 1 80  ? -10.651 -33.581 11.703  1.00 39.26  ? 407 TYR A CA  1 
ATOM   310  C  C   . TYR A 1 80  ? -10.387 -33.579 10.208  1.00 37.77  ? 407 TYR A C   1 
ATOM   311  O  O   . TYR A 1 80  ? -9.472  -32.887 9.748   1.00 36.85  ? 407 TYR A O   1 
ATOM   312  C  CB  . TYR A 1 80  ? -10.083 -34.856 12.346  1.00 42.04  ? 407 TYR A CB  1 
ATOM   313  C  CG  . TYR A 1 80  ? -9.989  -34.853 13.864  1.00 43.91  ? 407 TYR A CG  1 
ATOM   314  C  CD1 . TYR A 1 80  ? -9.579  -33.711 14.587  1.00 43.94  ? 407 TYR A CD1 1 
ATOM   315  C  CD2 . TYR A 1 80  ? -10.257 -36.019 14.582  1.00 46.90  ? 407 TYR A CD2 1 
ATOM   316  C  CE1 . TYR A 1 80  ? -9.489  -33.741 15.982  1.00 45.96  ? 407 TYR A CE1 1 
ATOM   317  C  CE2 . TYR A 1 80  ? -10.164 -36.060 15.963  1.00 48.67  ? 407 TYR A CE2 1 
ATOM   318  C  CZ  . TYR A 1 80  ? -9.790  -34.927 16.662  1.00 48.62  ? 407 TYR A CZ  1 
ATOM   319  O  OH  . TYR A 1 80  ? -9.710  -35.013 18.049  1.00 53.32  ? 407 TYR A OH  1 
ATOM   320  N  N   . ASP A 1 81  ? -11.195 -34.337 9.465   1.00 38.44  ? 408 ASP A N   1 
ATOM   321  C  CA  . ASP A 1 81  ? -11.095 -34.441 8.001   1.00 39.01  ? 408 ASP A CA  1 
ATOM   322  C  C   . ASP A 1 81  ? -11.234 -33.083 7.312   1.00 37.42  ? 408 ASP A C   1 
ATOM   323  O  O   . ASP A 1 81  ? -10.523 -32.802 6.347   1.00 37.31  ? 408 ASP A O   1 
ATOM   324  C  CB  . ASP A 1 81  ? -12.147 -35.411 7.435   1.00 40.32  ? 408 ASP A CB  1 
ATOM   325  C  CG  . ASP A 1 81  ? -11.881 -36.885 7.794   1.00 42.70  ? 408 ASP A CG  1 
ATOM   326  O  OD1 . ASP A 1 81  ? -10.791 -37.242 8.297   1.00 42.67  ? 408 ASP A OD1 1 
ATOM   327  O  OD2 . ASP A 1 81  ? -12.793 -37.707 7.555   1.00 45.04  ? 408 ASP A OD2 1 
ATOM   328  N  N   . LEU A 1 82  ? -12.139 -32.251 7.824   1.00 36.53  ? 409 LEU A N   1 
ATOM   329  C  CA  . LEU A 1 82  ? -12.341 -30.914 7.306   1.00 36.00  ? 409 LEU A CA  1 
ATOM   330  C  C   . LEU A 1 82  ? -11.140 -30.035 7.553   1.00 35.72  ? 409 LEU A C   1 
ATOM   331  O  O   . LEU A 1 82  ? -10.769 -29.260 6.668   1.00 34.63  ? 409 LEU A O   1 
ATOM   332  C  CB  . LEU A 1 82  ? -13.597 -30.282 7.889   1.00 36.65  ? 409 LEU A CB  1 
ATOM   333  C  CG  . LEU A 1 82  ? -14.887 -30.889 7.310   1.00 39.30  ? 409 LEU A CG  1 
ATOM   334  C  CD1 . LEU A 1 82  ? -16.080 -30.516 8.187   1.00 39.80  ? 409 LEU A CD1 1 
ATOM   335  C  CD2 . LEU A 1 82  ? -15.098 -30.543 5.828   1.00 38.09  ? 409 LEU A CD2 1 
ATOM   336  N  N   . LEU A 1 83  ? -10.531 -30.174 8.739   1.00 35.80  ? 410 LEU A N   1 
ATOM   337  C  CA  . LEU A 1 83  ? -9.321  -29.456 9.066   1.00 35.35  ? 410 LEU A CA  1 
ATOM   338  C  C   . LEU A 1 83  ? -8.167  -29.887 8.166   1.00 35.08  ? 410 LEU A C   1 
ATOM   339  O  O   . LEU A 1 83  ? -7.522  -29.027 7.560   1.00 33.79  ? 410 LEU A O   1 
ATOM   340  C  CB  . LEU A 1 83  ? -8.942  -29.594 10.559  1.00 36.45  ? 410 LEU A CB  1 
ATOM   341  C  CG  . LEU A 1 83  ? -9.770  -28.871 11.637  1.00 37.47  ? 410 LEU A CG  1 
ATOM   342  C  CD1 . LEU A 1 83  ? -9.086  -29.026 12.992  1.00 37.90  ? 410 LEU A CD1 1 
ATOM   343  C  CD2 . LEU A 1 83  ? -10.013 -27.388 11.334  1.00 36.09  ? 410 LEU A CD2 1 
ATOM   344  N  N   . THR A 1 84  ? -7.918  -31.197 8.076   1.00 36.68  ? 411 THR A N   1 
ATOM   345  C  CA  . THR A 1 84  ? -6.787  -31.707 7.277   1.00 39.02  ? 411 THR A CA  1 
ATOM   346  C  C   . THR A 1 84  ? -6.976  -31.385 5.786   1.00 39.66  ? 411 THR A C   1 
ATOM   347  O  O   . THR A 1 84  ? -6.038  -30.908 5.150   1.00 39.51  ? 411 THR A O   1 
ATOM   348  C  CB  . THR A 1 84  ? -6.427  -33.212 7.512   1.00 40.97  ? 411 THR A CB  1 
ATOM   349  O  OG1 . THR A 1 84  ? -7.394  -34.063 6.908   1.00 43.45  ? 411 THR A OG1 1 
ATOM   350  C  CG2 . THR A 1 84  ? -6.359  -33.560 8.976   1.00 41.32  ? 411 THR A CG2 1 
ATOM   351  N  N   . GLY A 1 85  ? -8.192  -31.589 5.259   1.00 40.34  ? 412 GLY A N   1 
ATOM   352  C  CA  . GLY A 1 85  ? -8.517  -31.270 3.844   1.00 42.59  ? 412 GLY A CA  1 
ATOM   353  C  C   . GLY A 1 85  ? -8.306  -29.812 3.454   1.00 42.93  ? 412 GLY A C   1 
ATOM   354  O  O   . GLY A 1 85  ? -7.873  -29.501 2.346   1.00 44.05  ? 412 GLY A O   1 
ATOM   355  N  N   . SER A 1 86  ? -8.612  -28.933 4.394   1.00 43.48  ? 413 SER A N   1 
ATOM   356  C  CA  . SER A 1 86  ? -8.377  -27.506 4.307   1.00 44.73  ? 413 SER A CA  1 
ATOM   357  C  C   . SER A 1 86  ? -6.879  -27.120 4.300   1.00 46.54  ? 413 SER A C   1 
ATOM   358  O  O   . SER A 1 86  ? -6.506  -26.089 3.711   1.00 44.49  ? 413 SER A O   1 
ATOM   359  C  CB  . SER A 1 86  ? -9.114  -26.852 5.487   1.00 46.30  ? 413 SER A CB  1 
ATOM   360  O  OG  . SER A 1 86  ? -8.542  -25.624 5.912   1.00 49.89  ? 413 SER A OG  1 
ATOM   361  N  N   . MET A 1 87  ? -6.037  -27.937 4.951   1.00 47.18  ? 414 MET A N   1 
ATOM   362  C  CA  . MET A 1 87  ? -4.604  -27.632 5.117   1.00 48.23  ? 414 MET A CA  1 
ATOM   363  C  C   . MET A 1 87  ? -3.858  -27.486 3.801   1.00 47.09  ? 414 MET A C   1 
ATOM   364  O  O   . MET A 1 87  ? -3.219  -26.460 3.568   1.00 46.18  ? 414 MET A O   1 
ATOM   365  C  CB  . MET A 1 87  ? -3.900  -28.671 5.996   1.00 50.74  ? 414 MET A CB  1 
ATOM   366  C  CG  . MET A 1 87  ? -4.069  -28.436 7.478   1.00 52.54  ? 414 MET A CG  1 
ATOM   367  S  SD  . MET A 1 87  ? -3.327  -29.690 8.548   1.00 58.81  ? 414 MET A SD  1 
ATOM   368  C  CE  . MET A 1 87  ? -1.577  -29.411 8.192   1.00 59.20  ? 414 MET A CE  1 
ATOM   369  N  N   . GLU A 1 88  ? -3.955  -28.504 2.950   1.00 47.88  ? 415 GLU A N   1 
ATOM   370  C  CA  . GLU A 1 88  ? -3.290  -28.492 1.657   1.00 49.95  ? 415 GLU A CA  1 
ATOM   371  C  C   . GLU A 1 88  ? -3.808  -27.400 0.732   1.00 48.50  ? 415 GLU A C   1 
ATOM   372  O  O   . GLU A 1 88  ? -3.043  -26.881 -0.085  1.00 50.14  ? 415 GLU A O   1 
ATOM   373  C  CB  . GLU A 1 88  ? -3.348  -29.861 0.982   1.00 55.52  ? 415 GLU A CB  1 
ATOM   374  C  CG  . GLU A 1 88  ? -2.063  -30.665 1.213   1.00 63.00  ? 415 GLU A CG  1 
ATOM   375  C  CD  . GLU A 1 88  ? -2.078  -32.078 0.624   1.00 68.92  ? 415 GLU A CD  1 
ATOM   376  O  OE1 . GLU A 1 88  ? -2.912  -32.379 -0.271  1.00 71.40  ? 415 GLU A OE1 1 
ATOM   377  O  OE2 . GLU A 1 88  ? -1.236  -32.902 1.068   1.00 71.42  ? 415 GLU A OE2 1 
ATOM   378  N  N   . ILE A 1 89  ? -5.084  -27.031 0.866   1.00 43.63  ? 416 ILE A N   1 
ATOM   379  C  CA  . ILE A 1 89  ? -5.636  -25.990 0.009   1.00 41.68  ? 416 ILE A CA  1 
ATOM   380  C  C   . ILE A 1 89  ? -5.148  -24.598 0.426   1.00 40.25  ? 416 ILE A C   1 
ATOM   381  O  O   . ILE A 1 89  ? -4.833  -23.770 -0.437  1.00 42.06  ? 416 ILE A O   1 
ATOM   382  C  CB  . ILE A 1 89  ? -7.171  -26.137 -0.177  1.00 42.05  ? 416 ILE A CB  1 
ATOM   383  C  CG1 . ILE A 1 89  ? -7.446  -27.249 -1.214  1.00 43.01  ? 416 ILE A CG1 1 
ATOM   384  C  CG2 . ILE A 1 89  ? -7.816  -24.833 -0.638  1.00 40.51  ? 416 ILE A CG2 1 
ATOM   385  C  CD1 . ILE A 1 89  ? -8.725  -28.021 -0.981  1.00 44.64  ? 416 ILE A CD1 1 
ATOM   386  N  N   . ILE A 1 90  ? -5.038  -24.361 1.732   1.00 37.90  ? 417 ILE A N   1 
ATOM   387  C  CA  . ILE A 1 90  ? -4.511  -23.096 2.240   1.00 36.39  ? 417 ILE A CA  1 
ATOM   388  C  C   . ILE A 1 90  ? -3.014  -22.949 1.953   1.00 37.33  ? 417 ILE A C   1 
ATOM   389  O  O   . ILE A 1 90  ? -2.575  -21.877 1.552   1.00 36.98  ? 417 ILE A O   1 
ATOM   390  C  CB  . ILE A 1 90  ? -4.855  -22.858 3.732   1.00 34.76  ? 417 ILE A CB  1 
ATOM   391  C  CG1 . ILE A 1 90  ? -6.374  -22.712 3.892   1.00 33.39  ? 417 ILE A CG1 1 
ATOM   392  C  CG2 . ILE A 1 90  ? -4.123  -21.628 4.279   1.00 33.79  ? 417 ILE A CG2 1 
ATOM   393  C  CD1 . ILE A 1 90  ? -6.887  -22.878 5.304   1.00 33.07  ? 417 ILE A CD1 1 
ATOM   394  N  N   . ARG A 1 91  ? -2.246  -24.015 2.156   1.00 39.86  ? 418 ARG A N   1 
ATOM   395  C  CA  . ARG A 1 91  ? -0.816  -24.022 1.803   1.00 44.03  ? 418 ARG A CA  1 
ATOM   396  C  C   . ARG A 1 91  ? -0.652  -23.662 0.312   1.00 44.06  ? 418 ARG A C   1 
ATOM   397  O  O   . ARG A 1 91  ? 0.180   -22.833 -0.041  1.00 46.28  ? 418 ARG A O   1 
ATOM   398  C  CB  . ARG A 1 91  ? -0.192  -25.379 2.139   1.00 47.80  ? 418 ARG A CB  1 
ATOM   399  C  CG  . ARG A 1 91  ? 1.306   -25.488 1.891   1.00 53.75  ? 418 ARG A CG  1 
ATOM   400  C  CD  . ARG A 1 91  ? 1.929   -26.651 2.663   1.00 57.91  ? 418 ARG A CD  1 
ATOM   401  N  NE  . ARG A 1 91  ? 1.072   -27.846 2.650   1.00 61.54  ? 418 ARG A NE  1 
ATOM   402  C  CZ  . ARG A 1 91  ? 0.639   -28.500 3.732   1.00 63.13  ? 418 ARG A CZ  1 
ATOM   403  N  NH1 . ARG A 1 91  ? 1.000   -28.116 4.957   1.00 64.63  ? 418 ARG A NH1 1 
ATOM   404  N  NH2 . ARG A 1 91  ? -0.143  -29.570 3.590   1.00 63.42  ? 418 ARG A NH2 1 
ATOM   405  N  N   . GLY A 1 92  ? -1.498  -24.242 -0.537  1.00 42.00  ? 419 GLY A N   1 
ATOM   406  C  CA  . GLY A 1 92  ? -1.541  -23.904 -1.954  1.00 41.39  ? 419 GLY A CA  1 
ATOM   407  C  C   . GLY A 1 92  ? -1.895  -22.460 -2.281  1.00 39.90  ? 419 GLY A C   1 
ATOM   408  O  O   . GLY A 1 92  ? -1.394  -21.910 -3.264  1.00 42.73  ? 419 GLY A O   1 
ATOM   409  N  N   . TRP A 1 93  ? -2.776  -21.859 -1.485  1.00 35.29  ? 420 TRP A N   1 
ATOM   410  C  CA  . TRP A 1 93  ? -3.047  -20.420 -1.551  1.00 33.52  ? 420 TRP A CA  1 
ATOM   411  C  C   . TRP A 1 93  ? -1.799  -19.613 -1.123  1.00 33.91  ? 420 TRP A C   1 
ATOM   412  O  O   . TRP A 1 93  ? -1.455  -18.588 -1.764  1.00 32.80  ? 420 TRP A O   1 
ATOM   413  C  CB  . TRP A 1 93  ? -4.284  -20.068 -0.687  1.00 30.90  ? 420 TRP A CB  1 
ATOM   414  C  CG  . TRP A 1 93  ? -4.425  -18.609 -0.318  1.00 30.07  ? 420 TRP A CG  1 
ATOM   415  C  CD1 . TRP A 1 93  ? -5.055  -17.635 -1.041  1.00 30.09  ? 420 TRP A CD1 1 
ATOM   416  C  CD2 . TRP A 1 93  ? -3.937  -17.974 0.874   1.00 29.42  ? 420 TRP A CD2 1 
ATOM   417  N  NE1 . TRP A 1 93  ? -4.974  -16.437 -0.384  1.00 30.04  ? 420 TRP A NE1 1 
ATOM   418  C  CE2 . TRP A 1 93  ? -4.297  -16.614 0.795   1.00 29.64  ? 420 TRP A CE2 1 
ATOM   419  C  CE3 . TRP A 1 93  ? -3.208  -18.425 1.996   1.00 29.49  ? 420 TRP A CE3 1 
ATOM   420  C  CZ2 . TRP A 1 93  ? -3.963  -15.687 1.793   1.00 30.39  ? 420 TRP A CZ2 1 
ATOM   421  C  CZ3 . TRP A 1 93  ? -2.870  -17.497 3.004   1.00 29.44  ? 420 TRP A CZ3 1 
ATOM   422  C  CH2 . TRP A 1 93  ? -3.251  -16.141 2.888   1.00 29.99  ? 420 TRP A CH2 1 
ATOM   423  N  N   . ALA A 1 94  ? -1.142  -20.085 -0.046  1.00 33.45  ? 421 ALA A N   1 
ATOM   424  C  CA  . ALA A 1 94  ? 0.028   -19.408 0.527   1.00 35.31  ? 421 ALA A CA  1 
ATOM   425  C  C   . ALA A 1 94  ? 1.147   -19.296 -0.518  1.00 37.93  ? 421 ALA A C   1 
ATOM   426  O  O   . ALA A 1 94  ? 1.707   -18.218 -0.731  1.00 38.26  ? 421 ALA A O   1 
ATOM   427  C  CB  . ALA A 1 94  ? 0.511   -20.116 1.784   1.00 34.26  ? 421 ALA A CB  1 
ATOM   428  N  N   . GLU A 1 95  ? 1.402   -20.400 -1.209  1.00 40.08  ? 422 GLU A N   1 
ATOM   429  C  CA  . GLU A 1 95  ? 2.432   -20.468 -2.234  1.00 44.42  ? 422 GLU A CA  1 
ATOM   430  C  C   . GLU A 1 95  ? 2.231   -19.532 -3.432  1.00 45.25  ? 422 GLU A C   1 
ATOM   431  O  O   . GLU A 1 95  ? 3.214   -19.157 -4.075  1.00 47.18  ? 422 GLU A O   1 
ATOM   432  C  CB  . GLU A 1 95  ? 2.639   -21.914 -2.663  1.00 47.72  ? 422 GLU A CB  1 
ATOM   433  C  CG  . GLU A 1 95  ? 3.528   -22.650 -1.667  1.00 51.74  ? 422 GLU A CG  1 
ATOM   434  C  CD  . GLU A 1 95  ? 3.202   -24.126 -1.533  1.00 54.82  ? 422 GLU A CD  1 
ATOM   435  O  OE1 . GLU A 1 95  ? 2.463   -24.678 -2.391  1.00 56.74  ? 422 GLU A OE1 1 
ATOM   436  O  OE2 . GLU A 1 95  ? 3.704   -24.737 -0.558  1.00 55.96  ? 422 GLU A OE2 1 
ATOM   437  N  N   . LYS A 1 96  ? 0.975   -19.140 -3.684  1.00 43.76  ? 423 LYS A N   1 
ATOM   438  C  CA  . LYS A 1 96  ? 0.596   -18.189 -4.742  1.00 44.18  ? 423 LYS A CA  1 
ATOM   439  C  C   . LYS A 1 96  ? 0.634   -16.716 -4.311  1.00 43.10  ? 423 LYS A C   1 
ATOM   440  O  O   . LYS A 1 96  ? 0.274   -15.832 -5.098  1.00 44.61  ? 423 LYS A O   1 
ATOM   441  C  CB  . LYS A 1 96  ? -0.806  -18.505 -5.273  1.00 44.73  ? 423 LYS A CB  1 
ATOM   442  C  CG  . LYS A 1 96  ? -0.918  -19.693 -6.211  1.00 47.56  ? 423 LYS A CG  1 
ATOM   443  C  CD  . LYS A 1 96  ? -2.397  -20.049 -6.395  1.00 48.28  ? 423 LYS A CD  1 
ATOM   444  C  CE  . LYS A 1 96  ? -2.648  -20.888 -7.642  1.00 50.71  ? 423 LYS A CE  1 
ATOM   445  N  NZ  . LYS A 1 96  ? -3.048  -20.026 -8.796  1.00 52.15  ? 423 LYS A NZ  1 
ATOM   446  N  N   . ILE A 1 97  ? 1.031   -16.447 -3.070  1.00 40.73  ? 424 ILE A N   1 
ATOM   447  C  CA  . ILE A 1 97  ? 1.299   -15.067 -2.632  1.00 40.93  ? 424 ILE A CA  1 
ATOM   448  C  C   . ILE A 1 97  ? 2.721   -14.728 -3.112  1.00 42.58  ? 424 ILE A C   1 
ATOM   449  O  O   . ILE A 1 97  ? 3.648   -15.478 -2.813  1.00 42.75  ? 424 ILE A O   1 
ATOM   450  C  CB  . ILE A 1 97  ? 1.132   -14.875 -1.091  1.00 39.36  ? 424 ILE A CB  1 
ATOM   451  C  CG1 . ILE A 1 97  ? -0.278  -15.273 -0.643  1.00 37.50  ? 424 ILE A CG1 1 
ATOM   452  C  CG2 . ILE A 1 97  ? 1.412   -13.433 -0.668  1.00 39.84  ? 424 ILE A CG2 1 
ATOM   453  C  CD1 . ILE A 1 97  ? -0.432  -15.310 0.859   1.00 37.72  ? 424 ILE A CD1 1 
ATOM   454  N  N   . PRO A 1 98  ? 2.884   -13.635 -3.904  1.00 44.47  ? 425 PRO A N   1 
ATOM   455  C  CA  . PRO A 1 98  ? 4.210   -13.252 -4.400  1.00 46.46  ? 425 PRO A CA  1 
ATOM   456  C  C   . PRO A 1 98  ? 5.133   -12.983 -3.247  1.00 46.89  ? 425 PRO A C   1 
ATOM   457  O  O   . PRO A 1 98  ? 4.741   -12.309 -2.288  1.00 47.01  ? 425 PRO A O   1 
ATOM   458  C  CB  . PRO A 1 98  ? 3.950   -11.945 -5.162  1.00 48.22  ? 425 PRO A CB  1 
ATOM   459  C  CG  . PRO A 1 98  ? 2.542   -12.060 -5.619  1.00 47.12  ? 425 PRO A CG  1 
ATOM   460  C  CD  . PRO A 1 98  ? 1.822   -12.799 -4.510  1.00 44.73  ? 425 PRO A CD  1 
ATOM   461  N  N   . GLY A 1 99  ? 6.339   -13.535 -3.324  1.00 48.05  ? 426 GLY A N   1 
ATOM   462  C  CA  . GLY A 1 99  ? 7.327   -13.364 -2.280  1.00 47.75  ? 426 GLY A CA  1 
ATOM   463  C  C   . GLY A 1 99  ? 7.280   -14.474 -1.254  1.00 45.91  ? 426 GLY A C   1 
ATOM   464  O  O   . GLY A 1 99  ? 8.317   -14.787 -0.652  1.00 47.22  ? 426 GLY A O   1 
ATOM   465  N  N   . PHE A 1 100 ? 6.099   -15.076 -1.046  1.00 42.62  ? 427 PHE A N   1 
ATOM   466  C  CA  . PHE A 1 100 ? 5.954   -16.154 -0.056  1.00 40.39  ? 427 PHE A CA  1 
ATOM   467  C  C   . PHE A 1 100 ? 6.864   -17.361 -0.343  1.00 41.41  ? 427 PHE A C   1 
ATOM   468  O  O   . PHE A 1 100 ? 7.554   -17.832 0.567   1.00 42.23  ? 427 PHE A O   1 
ATOM   469  C  CB  . PHE A 1 100 ? 4.487   -16.599 0.129   1.00 37.23  ? 427 PHE A CB  1 
ATOM   470  C  CG  . PHE A 1 100 ? 4.299   -17.607 1.235   1.00 35.39  ? 427 PHE A CG  1 
ATOM   471  C  CD1 . PHE A 1 100 ? 4.159   -17.192 2.549   1.00 34.57  ? 427 PHE A CD1 1 
ATOM   472  C  CD2 . PHE A 1 100 ? 4.290   -18.972 0.962   1.00 34.67  ? 427 PHE A CD2 1 
ATOM   473  C  CE1 . PHE A 1 100 ? 4.020   -18.112 3.582   1.00 33.58  ? 427 PHE A CE1 1 
ATOM   474  C  CE2 . PHE A 1 100 ? 4.138   -19.899 1.984   1.00 33.93  ? 427 PHE A CE2 1 
ATOM   475  C  CZ  . PHE A 1 100 ? 4.006   -19.469 3.304   1.00 33.25  ? 427 PHE A CZ  1 
ATOM   476  N  N   . ALA A 1 101 ? 6.842   -17.844 -1.592  1.00 41.92  ? 428 ALA A N   1 
ATOM   477  C  CA  . ALA A 1 101 ? 7.639   -18.996 -2.058  1.00 43.27  ? 428 ALA A CA  1 
ATOM   478  C  C   . ALA A 1 101 ? 9.155   -18.740 -2.012  1.00 45.64  ? 428 ALA A C   1 
ATOM   479  O  O   . ALA A 1 101 ? 9.984   -19.667 -2.143  1.00 47.25  ? 428 ALA A O   1 
ATOM   480  C  CB  . ALA A 1 101 ? 7.211   -19.379 -3.470  1.00 43.60  ? 428 ALA A CB  1 
ATOM   481  N  N   . ASP A 1 102 ? 9.500   -17.471 -1.841  1.00 46.18  ? 429 ASP A N   1 
ATOM   482  C  CA  . ASP A 1 102 ? 10.880  -17.020 -1.866  1.00 48.75  ? 429 ASP A CA  1 
ATOM   483  C  C   . ASP A 1 102 ? 11.534  -17.088 -0.497  1.00 48.56  ? 429 ASP A C   1 
ATOM   484  O  O   . ASP A 1 102 ? 12.747  -16.957 -0.387  1.00 50.21  ? 429 ASP A O   1 
ATOM   485  C  CB  . ASP A 1 102 ? 10.934  -15.595 -2.412  1.00 50.25  ? 429 ASP A CB  1 
ATOM   486  C  CG  . ASP A 1 102 ? 10.574  -15.514 -3.915  1.00 51.78  ? 429 ASP A CG  1 
ATOM   487  O  OD1 . ASP A 1 102 ? 10.604  -16.555 -4.630  1.00 52.21  ? 429 ASP A OD1 1 
ATOM   488  O  OD2 . ASP A 1 102 ? 10.282  -14.386 -4.382  1.00 52.72  ? 429 ASP A OD2 1 
ATOM   489  N  N   . LEU A 1 103 ? 10.717  -17.283 0.542   1.00 46.36  ? 430 LEU A N   1 
ATOM   490  C  CA  . LEU A 1 103 ? 11.209  -17.380 1.910   1.00 46.95  ? 430 LEU A CA  1 
ATOM   491  C  C   . LEU A 1 103 ? 11.801  -18.773 2.134   1.00 48.46  ? 430 LEU A C   1 
ATOM   492  O  O   . LEU A 1 103 ? 11.394  -19.707 1.439   1.00 47.75  ? 430 LEU A O   1 
ATOM   493  C  CB  . LEU A 1 103 ? 10.074  -17.095 2.912   1.00 43.95  ? 430 LEU A CB  1 
ATOM   494  C  CG  . LEU A 1 103 ? 9.352   -15.738 2.802   1.00 43.23  ? 430 LEU A CG  1 
ATOM   495  C  CD1 . LEU A 1 103 ? 8.126   -15.725 3.688   1.00 40.23  ? 430 LEU A CD1 1 
ATOM   496  C  CD2 . LEU A 1 103 ? 10.267  -14.556 3.135   1.00 45.71  ? 430 LEU A CD2 1 
ATOM   497  N  N   . PRO A 1 104 ? 12.755  -18.925 3.099   1.00 50.70  ? 431 PRO A N   1 
ATOM   498  C  CA  . PRO A 1 104 ? 13.200  -20.276 3.510   1.00 52.08  ? 431 PRO A CA  1 
ATOM   499  C  C   . PRO A 1 104 ? 12.017  -21.156 3.917   1.00 50.56  ? 431 PRO A C   1 
ATOM   500  O  O   . PRO A 1 104 ? 11.012  -20.654 4.447   1.00 48.41  ? 431 PRO A O   1 
ATOM   501  C  CB  . PRO A 1 104 ? 14.056  -20.027 4.754   1.00 53.26  ? 431 PRO A CB  1 
ATOM   502  C  CG  . PRO A 1 104 ? 14.417  -18.586 4.722   1.00 54.37  ? 431 PRO A CG  1 
ATOM   503  C  CD  . PRO A 1 104 ? 13.361  -17.865 3.934   1.00 51.97  ? 431 PRO A CD  1 
ATOM   504  N  N   . LYS A 1 105 ? 12.148  -22.455 3.668   1.00 51.96  ? 432 LYS A N   1 
ATOM   505  C  CA  . LYS A 1 105 ? 11.101  -23.426 3.948   1.00 50.39  ? 432 LYS A CA  1 
ATOM   506  C  C   . LYS A 1 105 ? 10.630  -23.351 5.410   1.00 48.71  ? 432 LYS A C   1 
ATOM   507  O  O   . LYS A 1 105 ? 9.427   -23.471 5.682   1.00 47.34  ? 432 LYS A O   1 
ATOM   508  C  CB  . LYS A 1 105 ? 11.586  -24.838 3.555   1.00 53.66  ? 432 LYS A CB  1 
ATOM   509  C  CG  . LYS A 1 105 ? 10.557  -25.959 3.676   1.00 53.07  ? 432 LYS A CG  1 
ATOM   510  C  CD  . LYS A 1 105 ? 9.426   -25.800 2.672   1.00 52.18  ? 432 LYS A CD  1 
ATOM   511  C  CE  . LYS A 1 105 ? 8.143   -26.431 3.189   1.00 50.19  ? 432 LYS A CE  1 
ATOM   512  N  NZ  . LYS A 1 105 ? 7.023   -26.098 2.276   1.00 48.25  ? 432 LYS A NZ  1 
ATOM   513  N  N   . ALA A 1 106 ? 11.570  -23.104 6.325   1.00 49.38  ? 433 ALA A N   1 
ATOM   514  C  CA  . ALA A 1 106 ? 11.278  -22.921 7.744   1.00 48.49  ? 433 ALA A CA  1 
ATOM   515  C  C   . ALA A 1 106 ? 10.315  -21.752 7.994   1.00 46.80  ? 433 ALA A C   1 
ATOM   516  O  O   . ALA A 1 106 ? 9.411   -21.850 8.833   1.00 44.65  ? 433 ALA A O   1 
ATOM   517  C  CB  . ALA A 1 106 ? 12.565  -22.732 8.529   1.00 50.04  ? 433 ALA A CB  1 
ATOM   518  N  N   . ASP A 1 107 ? 10.511  -20.660 7.249   1.00 47.69  ? 434 ASP A N   1 
ATOM   519  C  CA  . ASP A 1 107 ? 9.683   -19.463 7.387   1.00 46.09  ? 434 ASP A CA  1 
ATOM   520  C  C   . ASP A 1 107 ? 8.288   -19.664 6.828   1.00 43.74  ? 434 ASP A C   1 
ATOM   521  O  O   . ASP A 1 107 ? 7.292   -19.258 7.454   1.00 42.10  ? 434 ASP A O   1 
ATOM   522  C  CB  . ASP A 1 107 ? 10.373  -18.259 6.753   1.00 47.85  ? 434 ASP A CB  1 
ATOM   523  C  CG  . ASP A 1 107 ? 11.478  -17.692 7.628   1.00 50.18  ? 434 ASP A CG  1 
ATOM   524  O  OD1 . ASP A 1 107 ? 11.850  -18.304 8.662   1.00 50.60  ? 434 ASP A OD1 1 
ATOM   525  O  OD2 . ASP A 1 107 ? 11.974  -16.603 7.287   1.00 52.31  ? 434 ASP A OD2 1 
ATOM   526  N  N   . GLN A 1 108 ? 8.218   -20.316 5.671   1.00 43.77  ? 435 GLN A N   1 
ATOM   527  C  CA  . GLN A 1 108 ? 6.947   -20.708 5.073   1.00 42.09  ? 435 GLN A CA  1 
ATOM   528  C  C   . GLN A 1 108 ? 6.120   -21.545 6.067   1.00 41.49  ? 435 GLN A C   1 
ATOM   529  O  O   . GLN A 1 108 ? 4.967   -21.202 6.348   1.00 39.22  ? 435 GLN A O   1 
ATOM   530  C  CB  . GLN A 1 108 ? 7.175   -21.456 3.760   1.00 42.91  ? 435 GLN A CB  1 
ATOM   531  C  CG  . GLN A 1 108 ? 7.664   -20.586 2.605   1.00 43.63  ? 435 GLN A CG  1 
ATOM   532  C  CD  . GLN A 1 108 ? 7.958   -21.393 1.360   1.00 45.83  ? 435 GLN A CD  1 
ATOM   533  O  OE1 . GLN A 1 108 ? 9.067   -21.333 0.809   1.00 48.61  ? 435 GLN A OE1 1 
ATOM   534  N  NE2 . GLN A 1 108 ? 6.975   -22.163 0.906   1.00 44.55  ? 435 GLN A NE2 1 
ATOM   535  N  N   . ASP A 1 109 ? 6.733   -22.595 6.628   1.00 42.52  ? 436 ASP A N   1 
ATOM   536  C  CA  . ASP A 1 109 ? 6.081   -23.452 7.618   1.00 41.87  ? 436 ASP A CA  1 
ATOM   537  C  C   . ASP A 1 109 ? 5.623   -22.631 8.826   1.00 41.26  ? 436 ASP A C   1 
ATOM   538  O  O   . ASP A 1 109 ? 4.452   -22.711 9.208   1.00 40.16  ? 436 ASP A O   1 
ATOM   539  C  CB  . ASP A 1 109 ? 7.001   -24.601 8.071   1.00 44.59  ? 436 ASP A CB  1 
ATOM   540  C  CG  . ASP A 1 109 ? 7.359   -25.580 6.937   1.00 46.19  ? 436 ASP A CG  1 
ATOM   541  O  OD1 . ASP A 1 109 ? 6.703   -25.554 5.869   1.00 46.62  ? 436 ASP A OD1 1 
ATOM   542  O  OD2 . ASP A 1 109 ? 8.303   -26.388 7.124   1.00 48.00  ? 436 ASP A OD2 1 
ATOM   543  N  N   . LEU A 1 110 ? 6.530   -21.835 9.402   1.00 41.15  ? 437 LEU A N   1 
ATOM   544  C  CA  . LEU A 1 110 ? 6.189   -20.966 10.532  1.00 40.49  ? 437 LEU A CA  1 
ATOM   545  C  C   . LEU A 1 110 ? 4.954   -20.079 10.260  1.00 39.52  ? 437 LEU A C   1 
ATOM   546  O  O   . LEU A 1 110 ? 4.016   -20.079 11.060  1.00 37.67  ? 437 LEU A O   1 
ATOM   547  C  CB  . LEU A 1 110 ? 7.393   -20.115 10.958  1.00 41.48  ? 437 LEU A CB  1 
ATOM   548  C  CG  . LEU A 1 110 ? 7.364   -19.248 12.232  1.00 41.97  ? 437 LEU A CG  1 
ATOM   549  C  CD1 . LEU A 1 110 ? 6.703   -19.874 13.467  1.00 40.58  ? 437 LEU A CD1 1 
ATOM   550  C  CD2 . LEU A 1 110 ? 8.796   -18.855 12.553  1.00 44.23  ? 437 LEU A CD2 1 
ATOM   551  N  N   . LEU A 1 111 ? 4.966   -19.347 9.140   1.00 39.55  ? 438 LEU A N   1 
ATOM   552  C  CA  . LEU A 1 111 ? 3.855   -18.455 8.770   1.00 38.68  ? 438 LEU A CA  1 
ATOM   553  C  C   . LEU A 1 111 ? 2.552   -19.218 8.540   1.00 37.19  ? 438 LEU A C   1 
ATOM   554  O  O   . LEU A 1 111 ? 1.509   -18.838 9.087   1.00 37.11  ? 438 LEU A O   1 
ATOM   555  C  CB  . LEU A 1 111 ? 4.188   -17.605 7.532   1.00 38.60  ? 438 LEU A CB  1 
ATOM   556  C  CG  . LEU A 1 111 ? 5.332   -16.575 7.559   1.00 40.69  ? 438 LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1 111 ? 5.418   -15.900 6.202   1.00 40.36  ? 438 LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1 111 ? 5.188   -15.534 8.673   1.00 40.78  ? 438 LEU A CD2 1 
ATOM   559  N  N   . PHE A 1 112 ? 2.630   -20.290 7.752   1.00 36.84  ? 439 PHE A N   1 
ATOM   560  C  CA  . PHE A 1 112 ? 1.490   -21.107 7.421   1.00 35.64  ? 439 PHE A CA  1 
ATOM   561  C  C   . PHE A 1 112 ? 0.853   -21.712 8.679   1.00 36.30  ? 439 PHE A C   1 
ATOM   562  O  O   . PHE A 1 112 ? -0.335  -21.476 8.966   1.00 35.35  ? 439 PHE A O   1 
ATOM   563  C  CB  . PHE A 1 112 ? 1.858   -22.183 6.400   1.00 35.62  ? 439 PHE A CB  1 
ATOM   564  C  CG  . PHE A 1 112 ? 0.814   -23.254 6.255   1.00 34.99  ? 439 PHE A CG  1 
ATOM   565  C  CD1 . PHE A 1 112 ? -0.401  -22.980 5.618   1.00 33.12  ? 439 PHE A CD1 1 
ATOM   566  C  CD2 . PHE A 1 112 ? 1.025   -24.532 6.799   1.00 35.25  ? 439 PHE A CD2 1 
ATOM   567  C  CE1 . PHE A 1 112 ? -1.371  -23.964 5.512   1.00 33.13  ? 439 PHE A CE1 1 
ATOM   568  C  CE2 . PHE A 1 112 ? 0.055   -25.520 6.689   1.00 34.94  ? 439 PHE A CE2 1 
ATOM   569  C  CZ  . PHE A 1 112 ? -1.147  -25.236 6.046   1.00 33.68  ? 439 PHE A CZ  1 
ATOM   570  N  N   . GLU A 1 113 ? 1.652   -22.466 9.423   1.00 38.00  ? 440 GLU A N   1 
ATOM   571  C  CA  . GLU A 1 113 ? 1.206   -23.148 10.645  1.00 38.22  ? 440 GLU A CA  1 
ATOM   572  C  C   . GLU A 1 113 ? 0.644   -22.219 11.701  1.00 38.11  ? 440 GLU A C   1 
ATOM   573  O  O   . GLU A 1 113 ? -0.320  -22.575 12.376  1.00 37.53  ? 440 GLU A O   1 
ATOM   574  C  CB  . GLU A 1 113 ? 2.339   -23.980 11.238  1.00 39.77  ? 440 GLU A CB  1 
ATOM   575  C  CG  . GLU A 1 113 ? 2.809   -25.031 10.252  1.00 42.00  ? 440 GLU A CG  1 
ATOM   576  C  CD  . GLU A 1 113 ? 3.997   -25.852 10.699  1.00 44.73  ? 440 GLU A CD  1 
ATOM   577  O  OE1 . GLU A 1 113 ? 4.657   -25.520 11.706  1.00 47.65  ? 440 GLU A OE1 1 
ATOM   578  O  OE2 . GLU A 1 113 ? 4.259   -26.863 10.013  1.00 46.37  ? 440 GLU A OE2 1 
ATOM   579  N  N   . SER A 1 114 ? 1.241   -21.036 11.841  1.00 38.07  ? 441 SER A N   1 
ATOM   580  C  CA  . SER A 1 114 ? 0.767   -20.049 12.813  1.00 38.60  ? 441 SER A CA  1 
ATOM   581  C  C   . SER A 1 114 ? -0.601  -19.472 12.456  1.00 36.88  ? 441 SER A C   1 
ATOM   582  O  O   . SER A 1 114 ? -1.356  -19.104 13.337  1.00 37.28  ? 441 SER A O   1 
ATOM   583  C  CB  . SER A 1 114 ? 1.766   -18.896 12.952  1.00 40.17  ? 441 SER A CB  1 
ATOM   584  O  OG  . SER A 1 114 ? 3.048   -19.374 13.327  1.00 42.96  ? 441 SER A OG  1 
ATOM   585  N  N   . ALA A 1 115 ? -0.894  -19.371 11.163  1.00 35.33  ? 442 ALA A N   1 
ATOM   586  C  CA  . ALA A 1 115 ? -2.080  -18.664 10.693  1.00 33.79  ? 442 ALA A CA  1 
ATOM   587  C  C   . ALA A 1 115 ? -3.153  -19.617 10.188  1.00 32.60  ? 442 ALA A C   1 
ATOM   588  O  O   . ALA A 1 115 ? -4.222  -19.176 9.780   1.00 32.12  ? 442 ALA A O   1 
ATOM   589  C  CB  . ALA A 1 115 ? -1.705  -17.651 9.617   1.00 33.02  ? 442 ALA A CB  1 
ATOM   590  N  N   . PHE A 1 116 ? -2.881  -20.921 10.252  1.00 32.99  ? 443 PHE A N   1 
ATOM   591  C  CA  . PHE A 1 116 ? -3.719  -21.910 9.569   1.00 32.98  ? 443 PHE A CA  1 
ATOM   592  C  C   . PHE A 1 116 ? -5.189  -21.828 9.998   1.00 33.40  ? 443 PHE A C   1 
ATOM   593  O  O   . PHE A 1 116 ? -6.088  -21.733 9.140   1.00 33.06  ? 443 PHE A O   1 
ATOM   594  C  CB  . PHE A 1 116 ? -3.172  -23.343 9.715   1.00 33.06  ? 443 PHE A CB  1 
ATOM   595  C  CG  . PHE A 1 116 ? -4.219  -24.396 9.488   1.00 34.91  ? 443 PHE A CG  1 
ATOM   596  C  CD1 . PHE A 1 116 ? -4.842  -24.536 8.225   1.00 34.75  ? 443 PHE A CD1 1 
ATOM   597  C  CD2 . PHE A 1 116 ? -4.632  -25.221 10.542  1.00 35.79  ? 443 PHE A CD2 1 
ATOM   598  C  CE1 . PHE A 1 116 ? -5.838  -25.484 8.024   1.00 35.73  ? 443 PHE A CE1 1 
ATOM   599  C  CE2 . PHE A 1 116 ? -5.628  -26.171 10.347  1.00 36.68  ? 443 PHE A CE2 1 
ATOM   600  C  CZ  . PHE A 1 116 ? -6.237  -26.302 9.090   1.00 36.87  ? 443 PHE A CZ  1 
ATOM   601  N  N   . LEU A 1 117 ? -5.425  -21.878 11.313  1.00 33.77  ? 444 LEU A N   1 
ATOM   602  C  CA  . LEU A 1 117 ? -6.785  -21.876 11.847  1.00 33.66  ? 444 LEU A CA  1 
ATOM   603  C  C   . LEU A 1 117 ? -7.472  -20.541 11.620  1.00 33.21  ? 444 LEU A C   1 
ATOM   604  O  O   . LEU A 1 117 ? -8.672  -20.515 11.312  1.00 33.32  ? 444 LEU A O   1 
ATOM   605  C  CB  . LEU A 1 117 ? -6.814  -22.266 13.320  1.00 34.83  ? 444 LEU A CB  1 
ATOM   606  C  CG  . LEU A 1 117 ? -6.639  -23.756 13.592  1.00 36.00  ? 444 LEU A CG  1 
ATOM   607  C  CD1 . LEU A 1 117 ? -6.292  -23.949 15.067  1.00 37.91  ? 444 LEU A CD1 1 
ATOM   608  C  CD2 . LEU A 1 117 ? -7.904  -24.526 13.229  1.00 36.30  ? 444 LEU A CD2 1 
ATOM   609  N  N   . GLU A 1 118 ? -6.700  -19.459 11.737  1.00 32.53  ? 445 GLU A N   1 
ATOM   610  C  CA  . GLU A 1 118 ? -7.133  -18.127 11.340  1.00 34.16  ? 445 GLU A CA  1 
ATOM   611  C  C   . GLU A 1 118 ? -7.592  -18.119 9.876   1.00 33.40  ? 445 GLU A C   1 
ATOM   612  O  O   . GLU A 1 118 ? -8.658  -17.578 9.571   1.00 33.93  ? 445 GLU A O   1 
ATOM   613  C  CB  . GLU A 1 118 ? -6.030  -17.090 11.597  1.00 37.15  ? 445 GLU A CB  1 
ATOM   614  C  CG  . GLU A 1 118 ? -5.786  -16.816 13.075  1.00 40.88  ? 445 GLU A CG  1 
ATOM   615  C  CD  . GLU A 1 118 ? -4.505  -16.056 13.368  1.00 45.80  ? 445 GLU A CD  1 
ATOM   616  O  OE1 . GLU A 1 118 ? -3.649  -16.592 14.109  1.00 48.95  ? 445 GLU A OE1 1 
ATOM   617  O  OE2 . GLU A 1 118 ? -4.344  -14.910 12.885  1.00 48.79  ? 445 GLU A OE2 1 
ATOM   618  N  N   . LEU A 1 119 ? -6.827  -18.768 8.995   1.00 31.10  ? 446 LEU A N   1 
ATOM   619  C  CA  . LEU A 1 119 ? -7.185  -18.839 7.589   1.00 31.28  ? 446 LEU A CA  1 
ATOM   620  C  C   . LEU A 1 119 ? -8.395  -19.707 7.320   1.00 30.39  ? 446 LEU A C   1 
ATOM   621  O  O   . LEU A 1 119 ? -9.268  -19.324 6.536   1.00 29.62  ? 446 LEU A O   1 
ATOM   622  C  CB  . LEU A 1 119 ? -5.989  -19.227 6.695   1.00 31.59  ? 446 LEU A CB  1 
ATOM   623  C  CG  . LEU A 1 119 ? -5.044  -18.012 6.625   1.00 33.69  ? 446 LEU A CG  1 
ATOM   624  C  CD1 . LEU A 1 119 ? -3.585  -18.431 6.496   1.00 34.21  ? 446 LEU A CD1 1 
ATOM   625  C  CD2 . LEU A 1 119 ? -5.467  -17.001 5.556   1.00 34.10  ? 446 LEU A CD2 1 
ATOM   626  N  N   . PHE A 1 120 ? -8.434  -20.862 7.980   1.00 30.15  ? 447 PHE A N   1 
ATOM   627  C  CA  . PHE A 1 120 ? -9.545  -21.788 7.895   1.00 30.54  ? 447 PHE A CA  1 
ATOM   628  C  C   . PHE A 1 120 ? -10.858 -21.049 8.184   1.00 31.09  ? 447 PHE A C   1 
ATOM   629  O  O   . PHE A 1 120 ? -11.804 -21.128 7.397   1.00 31.34  ? 447 PHE A O   1 
ATOM   630  C  CB  . PHE A 1 120 ? -9.325  -22.959 8.864   1.00 31.22  ? 447 PHE A CB  1 
ATOM   631  C  CG  . PHE A 1 120 ? -10.520 -23.849 9.027   1.00 32.09  ? 447 PHE A CG  1 
ATOM   632  C  CD1 . PHE A 1 120 ? -10.836 -24.803 8.061   1.00 33.01  ? 447 PHE A CD1 1 
ATOM   633  C  CD2 . PHE A 1 120 ? -11.339 -23.743 10.158  1.00 32.63  ? 447 PHE A CD2 1 
ATOM   634  C  CE1 . PHE A 1 120 ? -11.965 -25.624 8.209   1.00 34.11  ? 447 PHE A CE1 1 
ATOM   635  C  CE2 . PHE A 1 120 ? -12.438 -24.567 10.312  1.00 33.53  ? 447 PHE A CE2 1 
ATOM   636  C  CZ  . PHE A 1 120 ? -12.754 -25.510 9.343   1.00 33.17  ? 447 PHE A CZ  1 
ATOM   637  N  N   . VAL A 1 121 ? -10.863 -20.282 9.271   1.00 30.78  ? 448 VAL A N   1 
ATOM   638  C  CA  . VAL A 1 121 ? -12.046 -19.608 9.782   1.00 31.52  ? 448 VAL A CA  1 
ATOM   639  C  C   . VAL A 1 121 ? -12.451 -18.456 8.868   1.00 32.26  ? 448 VAL A C   1 
ATOM   640  O  O   . VAL A 1 121 ? -13.635 -18.349 8.493   1.00 32.97  ? 448 VAL A O   1 
ATOM   641  C  CB  . VAL A 1 121 ? -11.841 -19.159 11.267  1.00 31.75  ? 448 VAL A CB  1 
ATOM   642  C  CG1 . VAL A 1 121 ? -12.843 -18.104 11.701  1.00 33.49  ? 448 VAL A CG1 1 
ATOM   643  C  CG2 . VAL A 1 121 ? -11.969 -20.349 12.186  1.00 31.71  ? 448 VAL A CG2 1 
ATOM   644  N  N   . LEU A 1 122 ? -11.472 -17.625 8.494   1.00 31.88  ? 449 LEU A N   1 
ATOM   645  C  CA  . LEU A 1 122 ? -11.729 -16.460 7.649   1.00 32.46  ? 449 LEU A CA  1 
ATOM   646  C  C   . LEU A 1 122 ? -12.331 -16.876 6.304   1.00 31.32  ? 449 LEU A C   1 
ATOM   647  O  O   . LEU A 1 122 ? -13.371 -16.365 5.900   1.00 33.14  ? 449 LEU A O   1 
ATOM   648  C  CB  . LEU A 1 122 ? -10.462 -15.604 7.466   1.00 32.55  ? 449 LEU A CB  1 
ATOM   649  C  CG  . LEU A 1 122 ? -10.473 -14.300 6.640   1.00 34.00  ? 449 LEU A CG  1 
ATOM   650  C  CD1 . LEU A 1 122 ? -11.339 -13.187 7.250   1.00 35.11  ? 449 LEU A CD1 1 
ATOM   651  C  CD2 . LEU A 1 122 ? -9.047  -13.808 6.406   1.00 33.17  ? 449 LEU A CD2 1 
ATOM   652  N  N   . ARG A 1 123 ? -11.690 -17.821 5.643   1.00 30.13  ? 450 ARG A N   1 
ATOM   653  C  CA  . ARG A 1 123 ? -12.123 -18.289 4.327   1.00 30.48  ? 450 ARG A CA  1 
ATOM   654  C  C   . ARG A 1 123 ? -13.505 -18.957 4.408   1.00 31.12  ? 450 ARG A C   1 
ATOM   655  O  O   . ARG A 1 123 ? -14.350 -18.747 3.516   1.00 31.39  ? 450 ARG A O   1 
ATOM   656  C  CB  . ARG A 1 123 ? -11.075 -19.221 3.711   1.00 29.56  ? 450 ARG A CB  1 
ATOM   657  C  CG  . ARG A 1 123 ? -9.758  -18.520 3.324   1.00 29.89  ? 450 ARG A CG  1 
ATOM   658  C  CD  . ARG A 1 123 ? -8.563  -19.469 3.285   1.00 28.79  ? 450 ARG A CD  1 
ATOM   659  N  NE  . ARG A 1 123 ? -8.824  -20.614 2.414   1.00 29.90  ? 450 ARG A NE  1 
ATOM   660  C  CZ  . ARG A 1 123 ? -8.612  -20.641 1.090   1.00 29.83  ? 450 ARG A CZ  1 
ATOM   661  N  NH1 . ARG A 1 123 ? -8.142  -19.576 0.430   1.00 29.75  ? 450 ARG A NH1 1 
ATOM   662  N  NH2 . ARG A 1 123 ? -8.911  -21.738 0.419   1.00 29.34  ? 450 ARG A NH2 1 
ATOM   663  N  N   . LEU A 1 124 ? -13.732 -19.702 5.501   1.00 30.75  ? 451 LEU A N   1 
ATOM   664  C  CA  . LEU A 1 124 ? -15.007 -20.329 5.772   1.00 31.20  ? 451 LEU A CA  1 
ATOM   665  C  C   . LEU A 1 124 ? -16.069 -19.246 5.946   1.00 33.16  ? 451 LEU A C   1 
ATOM   666  O  O   . LEU A 1 124 ? -17.125 -19.286 5.286   1.00 33.53  ? 451 LEU A O   1 
ATOM   667  C  CB  . LEU A 1 124 ? -14.940 -21.274 6.990   1.00 30.76  ? 451 LEU A CB  1 
ATOM   668  C  CG  . LEU A 1 124 ? -16.187 -22.070 7.430   1.00 31.53  ? 451 LEU A CG  1 
ATOM   669  C  CD1 . LEU A 1 124 ? -16.692 -23.027 6.348   1.00 30.81  ? 451 LEU A CD1 1 
ATOM   670  C  CD2 . LEU A 1 124 ? -15.901 -22.820 8.729   1.00 31.10  ? 451 LEU A CD2 1 
ATOM   671  N  N   . ALA A 1 125 ? -15.754 -18.266 6.797   1.00 33.25  ? 452 ALA A N   1 
ATOM   672  C  CA  . ALA A 1 125 ? -16.675 -17.191 7.127   1.00 34.62  ? 452 ALA A CA  1 
ATOM   673  C  C   . ALA A 1 125 ? -17.087 -16.397 5.905   1.00 35.17  ? 452 ALA A C   1 
ATOM   674  O  O   . ALA A 1 125 ? -18.229 -15.962 5.802   1.00 35.91  ? 452 ALA A O   1 
ATOM   675  C  CB  . ALA A 1 125 ? -16.071 -16.270 8.182   1.00 35.23  ? 452 ALA A CB  1 
ATOM   676  N  N   . TYR A 1 126 ? -16.143 -16.207 4.986   1.00 35.28  ? 453 TYR A N   1 
ATOM   677  C  CA  . TYR A 1 126 ? -16.386 -15.403 3.798   1.00 36.84  ? 453 TYR A CA  1 
ATOM   678  C  C   . TYR A 1 126 ? -17.191 -16.141 2.755   1.00 37.02  ? 453 TYR A C   1 
ATOM   679  O  O   . TYR A 1 126 ? -17.974 -15.536 2.051   1.00 38.60  ? 453 TYR A O   1 
ATOM   680  C  CB  . TYR A 1 126 ? -15.074 -14.962 3.183   1.00 35.87  ? 453 TYR A CB  1 
ATOM   681  C  CG  . TYR A 1 126 ? -15.185 -13.793 2.208   1.00 36.88  ? 453 TYR A CG  1 
ATOM   682  C  CD1 . TYR A 1 126 ? -15.770 -12.567 2.603   1.00 38.40  ? 453 TYR A CD1 1 
ATOM   683  C  CD2 . TYR A 1 126 ? -14.657 -13.895 0.909   1.00 36.05  ? 453 TYR A CD2 1 
ATOM   684  C  CE1 . TYR A 1 126 ? -15.837 -11.495 1.729   1.00 39.76  ? 453 TYR A CE1 1 
ATOM   685  C  CE2 . TYR A 1 126 ? -14.724 -12.832 0.027   1.00 37.62  ? 453 TYR A CE2 1 
ATOM   686  C  CZ  . TYR A 1 126 ? -15.309 -11.638 0.444   1.00 40.24  ? 453 TYR A CZ  1 
ATOM   687  O  OH  . TYR A 1 126 ? -15.370 -10.583 -0.438  1.00 43.32  ? 453 TYR A OH  1 
ATOM   688  N  N   . ARG A 1 127 ? -16.976 -17.446 2.683   1.00 36.40  ? 454 ARG A N   1 
ATOM   689  C  CA  . ARG A 1 127 ? -17.588 -18.330 1.696   1.00 37.65  ? 454 ARG A CA  1 
ATOM   690  C  C   . ARG A 1 127 ? -19.039 -18.689 2.014   1.00 38.66  ? 454 ARG A C   1 
ATOM   691  O  O   . ARG A 1 127 ? -19.834 -18.886 1.102   1.00 39.86  ? 454 ARG A O   1 
ATOM   692  C  CB  . ARG A 1 127 ? -16.793 -19.622 1.700   1.00 36.79  ? 454 ARG A CB  1 
ATOM   693  C  CG  . ARG A 1 127 ? -16.649 -20.301 0.377   1.00 38.12  ? 454 ARG A CG  1 
ATOM   694  C  CD  . ARG A 1 127 ? -15.275 -20.953 0.330   1.00 37.75  ? 454 ARG A CD  1 
ATOM   695  N  NE  . ARG A 1 127 ? -15.090 -21.809 1.475   1.00 38.78  ? 454 ARG A NE  1 
ATOM   696  C  CZ  . ARG A 1 127 ? -13.929 -22.104 2.051   1.00 38.90  ? 454 ARG A CZ  1 
ATOM   697  N  NH1 . ARG A 1 127 ? -12.765 -21.629 1.598   1.00 37.62  ? 454 ARG A NH1 1 
ATOM   698  N  NH2 . ARG A 1 127 ? -13.955 -22.908 3.103   1.00 38.44  ? 454 ARG A NH2 1 
ATOM   699  N  N   . SER A 1 128 ? -19.362 -18.757 3.308   1.00 38.64  ? 455 SER A N   1 
ATOM   700  C  CA  . SER A 1 128 ? -20.570 -19.410 3.821   1.00 40.35  ? 455 SER A CA  1 
ATOM   701  C  C   . SER A 1 128 ? -21.841 -18.566 3.711   1.00 42.55  ? 455 SER A C   1 
ATOM   702  O  O   . SER A 1 128 ? -21.791 -17.448 3.214   1.00 43.32  ? 455 SER A O   1 
ATOM   703  C  CB  . SER A 1 128 ? -20.314 -19.817 5.269   1.00 39.93  ? 455 SER A CB  1 
ATOM   704  O  OG  . SER A 1 128 ? -19.393 -20.884 5.302   1.00 38.86  ? 455 SER A OG  1 
ATOM   705  N  N   . ASN A 1 129 ? -22.968 -19.099 4.176   1.00 44.17  ? 456 ASN A N   1 
ATOM   706  C  CA  . ASN A 1 129 ? -24.238 -18.346 4.191   1.00 47.48  ? 456 ASN A CA  1 
ATOM   707  C  C   . ASN A 1 129 ? -24.783 -18.337 5.629   1.00 48.23  ? 456 ASN A C   1 
ATOM   708  O  O   . ASN A 1 129 ? -25.571 -19.217 6.008   1.00 49.28  ? 456 ASN A O   1 
ATOM   709  C  CB  . ASN A 1 129 ? -25.249 -18.926 3.174   1.00 49.45  ? 456 ASN A CB  1 
ATOM   710  C  CG  . ASN A 1 129 ? -26.436 -17.990 2.885   1.00 54.29  ? 456 ASN A CG  1 
ATOM   711  O  OD1 . ASN A 1 129 ? -26.746 -17.063 3.646   1.00 57.06  ? 456 ASN A OD1 1 
ATOM   712  N  ND2 . ASN A 1 129 ? -27.120 -18.248 1.768   1.00 55.07  ? 456 ASN A ND2 1 
ATOM   713  N  N   . PRO A 1 130 ? -24.349 -17.349 6.440   1.00 47.98  ? 457 PRO A N   1 
ATOM   714  C  CA  . PRO A 1 130 ? -24.668 -17.342 7.873   1.00 49.47  ? 457 PRO A CA  1 
ATOM   715  C  C   . PRO A 1 130 ? -26.168 -17.118 8.176   1.00 52.80  ? 457 PRO A C   1 
ATOM   716  O  O   . PRO A 1 130 ? -26.690 -17.706 9.132   1.00 53.39  ? 457 PRO A O   1 
ATOM   717  C  CB  . PRO A 1 130 ? -23.786 -16.216 8.428   1.00 49.01  ? 457 PRO A CB  1 
ATOM   718  C  CG  . PRO A 1 130 ? -23.551 -15.304 7.267   1.00 48.33  ? 457 PRO A CG  1 
ATOM   719  C  CD  . PRO A 1 130 ? -23.527 -16.183 6.050   1.00 47.17  ? 457 PRO A CD  1 
ATOM   720  N  N   . VAL A 1 131 ? -26.839 -16.313 7.345   1.00 54.43  ? 458 VAL A N   1 
ATOM   721  C  CA  . VAL A 1 131 ? -28.298 -16.120 7.387   1.00 58.01  ? 458 VAL A CA  1 
ATOM   722  C  C   . VAL A 1 131 ? -29.059 -17.460 7.384   1.00 58.61  ? 458 VAL A C   1 
ATOM   723  O  O   . VAL A 1 131 ? -30.054 -17.628 8.117   1.00 61.67  ? 458 VAL A O   1 
ATOM   724  C  CB  . VAL A 1 131 ? -28.798 -15.223 6.209   1.00 59.76  ? 458 VAL A CB  1 
ATOM   725  C  CG1 . VAL A 1 131 ? -30.322 -15.102 6.195   1.00 62.90  ? 458 VAL A CG1 1 
ATOM   726  C  CG2 . VAL A 1 131 ? -28.172 -13.832 6.260   1.00 60.05  ? 458 VAL A CG2 1 
ATOM   727  N  N   . GLU A 1 132 ? -28.586 -18.403 6.568   1.00 55.85  ? 459 GLU A N   1 
ATOM   728  C  CA  . GLU A 1 132 ? -29.249 -19.698 6.411   1.00 56.02  ? 459 GLU A CA  1 
ATOM   729  C  C   . GLU A 1 132 ? -28.647 -20.840 7.241   1.00 53.31  ? 459 GLU A C   1 
ATOM   730  O  O   . GLU A 1 132 ? -29.094 -21.986 7.133   1.00 54.47  ? 459 GLU A O   1 
ATOM   731  C  CB  . GLU A 1 132 ? -29.316 -20.068 4.931   1.00 56.32  ? 459 GLU A CB  1 
ATOM   732  C  CG  . GLU A 1 132 ? -30.435 -19.347 4.186   1.00 60.86  ? 459 GLU A CG  1 
ATOM   733  C  CD  . GLU A 1 132 ? -30.320 -19.461 2.676   1.00 61.45  ? 459 GLU A CD  1 
ATOM   734  O  OE1 . GLU A 1 132 ? -29.565 -20.328 2.175   1.00 60.78  ? 459 GLU A OE1 1 
ATOM   735  O  OE2 . GLU A 1 132 ? -30.989 -18.672 1.982   1.00 64.26  ? 459 GLU A OE2 1 
ATOM   736  N  N   . GLY A 1 133 ? -27.655 -20.526 8.071   1.00 50.22  ? 460 GLY A N   1 
ATOM   737  C  CA  . GLY A 1 133 ? -26.904 -21.537 8.826   1.00 47.93  ? 460 GLY A CA  1 
ATOM   738  C  C   . GLY A 1 133 ? -26.046 -22.486 7.990   1.00 44.34  ? 460 GLY A C   1 
ATOM   739  O  O   . GLY A 1 133 ? -25.719 -23.578 8.443   1.00 42.98  ? 460 GLY A O   1 
ATOM   740  N  N   . LYS A 1 134 ? -25.704 -22.074 6.769   1.00 42.72  ? 461 LYS A N   1 
ATOM   741  C  CA  . LYS A 1 134 ? -24.958 -22.918 5.820   1.00 40.69  ? 461 LYS A CA  1 
ATOM   742  C  C   . LYS A 1 134 ? -23.477 -22.604 5.896   1.00 37.86  ? 461 LYS A C   1 
ATOM   743  O  O   . LYS A 1 134 ? -23.059 -21.446 5.692   1.00 37.70  ? 461 LYS A O   1 
ATOM   744  C  CB  . LYS A 1 134 ? -25.446 -22.730 4.364   1.00 40.62  ? 461 LYS A CB  1 
ATOM   745  C  CG  . LYS A 1 134 ? -26.776 -23.390 4.040   1.00 42.98  ? 461 LYS A CG  1 
ATOM   746  C  CD  . LYS A 1 134 ? -27.208 -23.021 2.630   1.00 43.86  ? 461 LYS A CD  1 
ATOM   747  C  CE  . LYS A 1 134 ? -28.395 -23.831 2.178   1.00 46.42  ? 461 LYS A CE  1 
ATOM   748  N  NZ  . LYS A 1 134 ? -29.689 -23.342 2.746   1.00 49.88  ? 461 LYS A NZ  1 
ATOM   749  N  N   . LEU A 1 135 ? -22.693 -23.636 6.193   1.00 36.02  ? 462 LEU A N   1 
ATOM   750  C  CA  . LEU A 1 135 ? -21.239 -23.556 6.136   1.00 33.07  ? 462 LEU A CA  1 
ATOM   751  C  C   . LEU A 1 135 ? -20.815 -24.266 4.884   1.00 32.35  ? 462 LEU A C   1 
ATOM   752  O  O   . LEU A 1 135 ? -21.299 -25.383 4.609   1.00 32.89  ? 462 LEU A O   1 
ATOM   753  C  CB  . LEU A 1 135 ? -20.636 -24.196 7.377   1.00 32.51  ? 462 LEU A CB  1 
ATOM   754  C  CG  . LEU A 1 135 ? -21.013 -23.243 8.514   1.00 33.72  ? 462 LEU A CG  1 
ATOM   755  C  CD1 . LEU A 1 135 ? -21.812 -23.975 9.574   1.00 34.75  ? 462 LEU A CD1 1 
ATOM   756  C  CD2 . LEU A 1 135 ? -19.836 -22.429 9.055   1.00 32.09  ? 462 LEU A CD2 1 
ATOM   757  N  N   . ILE A 1 136 ? -19.983 -23.585 4.094   1.00 30.99  ? 463 ILE A N   1 
ATOM   758  C  CA  . ILE A 1 136 ? -19.495 -24.114 2.808   1.00 30.86  ? 463 ILE A CA  1 
ATOM   759  C  C   . ILE A 1 136 ? -17.992 -24.328 2.954   1.00 29.98  ? 463 ILE A C   1 
ATOM   760  O  O   . ILE A 1 136 ? -17.227 -23.373 3.126   1.00 28.84  ? 463 ILE A O   1 
ATOM   761  C  CB  . ILE A 1 136 ? -19.808 -23.188 1.604   1.00 31.00  ? 463 ILE A CB  1 
ATOM   762  C  CG1 . ILE A 1 136 ? -21.333 -22.983 1.448   1.00 33.20  ? 463 ILE A CG1 1 
ATOM   763  C  CG2 . ILE A 1 136 ? -19.206 -23.779 0.329   1.00 30.96  ? 463 ILE A CG2 1 
ATOM   764  C  CD1 . ILE A 1 136 ? -21.772 -21.882 0.486   1.00 33.52  ? 463 ILE A CD1 1 
ATOM   765  N  N   . PHE A 1 137 ? -17.580 -25.588 2.921   1.00 30.28  ? 464 PHE A N   1 
ATOM   766  C  CA  . PHE A 1 137 ? -16.194 -25.920 3.184   1.00 30.62  ? 464 PHE A CA  1 
ATOM   767  C  C   . PHE A 1 137 ? -15.342 -25.848 1.919   1.00 31.60  ? 464 PHE A C   1 
ATOM   768  O  O   . PHE A 1 137 ? -15.888 -25.787 0.785   1.00 31.26  ? 464 PHE A O   1 
ATOM   769  C  CB  . PHE A 1 137 ? -16.098 -27.280 3.881   1.00 31.24  ? 464 PHE A CB  1 
ATOM   770  C  CG  . PHE A 1 137 ? -16.601 -27.254 5.296   1.00 31.98  ? 464 PHE A CG  1 
ATOM   771  C  CD1 . PHE A 1 137 ? -15.766 -26.816 6.347   1.00 30.99  ? 464 PHE A CD1 1 
ATOM   772  C  CD2 . PHE A 1 137 ? -17.912 -27.639 5.590   1.00 32.95  ? 464 PHE A CD2 1 
ATOM   773  C  CE1 . PHE A 1 137 ? -16.226 -26.772 7.651   1.00 30.99  ? 464 PHE A CE1 1 
ATOM   774  C  CE2 . PHE A 1 137 ? -18.372 -27.598 6.901   1.00 33.95  ? 464 PHE A CE2 1 
ATOM   775  C  CZ  . PHE A 1 137 ? -17.531 -27.165 7.929   1.00 32.93  ? 464 PHE A CZ  1 
ATOM   776  N  N   . CYS A 1 138 ? -14.013 -25.846 2.110   1.00 31.77  ? 465 CYS A N   1 
ATOM   777  C  CA  . CYS A 1 138 ? -13.075 -25.605 0.999   1.00 32.71  ? 465 CYS A CA  1 
ATOM   778  C  C   . CYS A 1 138 ? -13.153 -26.638 -0.138  1.00 32.93  ? 465 CYS A C   1 
ATOM   779  O  O   . CYS A 1 138 ? -12.864 -26.319 -1.264  1.00 33.43  ? 465 CYS A O   1 
ATOM   780  C  CB  . CYS A 1 138 ? -11.641 -25.423 1.513   1.00 34.26  ? 465 CYS A CB  1 
ATOM   781  S  SG  . CYS A 1 138 ? -10.847 -26.979 1.935   1.00 39.30  ? 465 CYS A SG  1 
ATOM   782  N  N   . ASN A 1 139 ? -13.563 -27.864 0.164   1.00 34.19  ? 466 ASN A N   1 
ATOM   783  C  CA  . ASN A 1 139 ? -13.824 -28.882 -0.867  1.00 36.29  ? 466 ASN A CA  1 
ATOM   784  C  C   . ASN A 1 139 ? -15.194 -28.739 -1.569  1.00 36.98  ? 466 ASN A C   1 
ATOM   785  O  O   . ASN A 1 139 ? -15.539 -29.557 -2.411  1.00 38.47  ? 466 ASN A O   1 
ATOM   786  C  CB  . ASN A 1 139 ? -13.694 -30.287 -0.267  1.00 38.21  ? 466 ASN A CB  1 
ATOM   787  C  CG  . ASN A 1 139 ? -14.662 -30.531 0.887   1.00 40.19  ? 466 ASN A CG  1 
ATOM   788  O  OD1 . ASN A 1 139 ? -15.359 -29.616 1.365   1.00 40.58  ? 466 ASN A OD1 1 
ATOM   789  N  ND2 . ASN A 1 139 ? -14.709 -31.772 1.346   1.00 41.75  ? 466 ASN A ND2 1 
ATOM   790  N  N   . GLY A 1 140 ? -15.969 -27.715 -1.208  1.00 36.02  ? 467 GLY A N   1 
ATOM   791  C  CA  . GLY A 1 140 ? -17.279 -27.478 -1.799  1.00 36.34  ? 467 GLY A CA  1 
ATOM   792  C  C   . GLY A 1 140 ? -18.455 -28.145 -1.088  1.00 37.57  ? 467 GLY A C   1 
ATOM   793  O  O   . GLY A 1 140 ? -19.611 -28.001 -1.542  1.00 39.01  ? 467 GLY A O   1 
ATOM   794  N  N   . VAL A 1 141 ? -18.177 -28.878 -0.002  1.00 36.03  ? 468 VAL A N   1 
ATOM   795  C  CA  . VAL A 1 141 ? -19.221 -29.548 0.783   1.00 37.34  ? 468 VAL A CA  1 
ATOM   796  C  C   . VAL A 1 141 ? -19.980 -28.517 1.623   1.00 36.44  ? 468 VAL A C   1 
ATOM   797  O  O   . VAL A 1 141 ? -19.390 -27.668 2.268   1.00 35.46  ? 468 VAL A O   1 
ATOM   798  C  CB  . VAL A 1 141 ? -18.686 -30.765 1.621   1.00 38.46  ? 468 VAL A CB  1 
ATOM   799  C  CG1 . VAL A 1 141 ? -19.740 -31.329 2.578   1.00 38.93  ? 468 VAL A CG1 1 
ATOM   800  C  CG2 . VAL A 1 141 ? -18.202 -31.890 0.696   1.00 39.15  ? 468 VAL A CG2 1 
ATOM   801  N  N   . VAL A 1 142 ? -21.302 -28.578 1.540   1.00 37.84  ? 469 VAL A N   1 
ATOM   802  C  CA  . VAL A 1 142 ? -22.190 -27.687 2.268   1.00 37.66  ? 469 VAL A CA  1 
ATOM   803  C  C   . VAL A 1 142 ? -22.808 -28.486 3.423   1.00 38.93  ? 469 VAL A C   1 
ATOM   804  O  O   . VAL A 1 142 ? -23.391 -29.562 3.224   1.00 40.37  ? 469 VAL A O   1 
ATOM   805  C  CB  . VAL A 1 142 ? -23.302 -27.092 1.362   1.00 38.67  ? 469 VAL A CB  1 
ATOM   806  C  CG1 . VAL A 1 142 ? -24.076 -26.002 2.105   1.00 38.85  ? 469 VAL A CG1 1 
ATOM   807  C  CG2 . VAL A 1 142 ? -22.725 -26.554 0.050   1.00 37.13  ? 469 VAL A CG2 1 
ATOM   808  N  N   . LEU A 1 143 ? -22.657 -27.952 4.628   1.00 38.07  ? 470 LEU A N   1 
ATOM   809  C  CA  . LEU A 1 143 ? -23.251 -28.543 5.814   1.00 38.73  ? 470 LEU A CA  1 
ATOM   810  C  C   . LEU A 1 143 ? -23.987 -27.470 6.588   1.00 39.08  ? 470 LEU A C   1 
ATOM   811  O  O   . LEU A 1 143 ? -23.543 -26.317 6.626   1.00 37.50  ? 470 LEU A O   1 
ATOM   812  C  CB  . LEU A 1 143 ? -22.165 -29.184 6.689   1.00 37.61  ? 470 LEU A CB  1 
ATOM   813  C  CG  . LEU A 1 143 ? -21.449 -30.459 6.206   1.00 37.33  ? 470 LEU A CG  1 
ATOM   814  C  CD1 . LEU A 1 143 ? -20.388 -30.846 7.235   1.00 36.53  ? 470 LEU A CD1 1 
ATOM   815  C  CD2 . LEU A 1 143 ? -22.402 -31.628 5.978   1.00 39.47  ? 470 LEU A CD2 1 
ATOM   816  N  N   . HIS A 1 144 ? -25.111 -27.848 7.197   1.00 41.58  ? 471 HIS A N   1 
ATOM   817  C  CA  . HIS A 1 144 ? -25.789 -26.963 8.149   1.00 43.62  ? 471 HIS A CA  1 
ATOM   818  C  C   . HIS A 1 144 ? -24.983 -26.853 9.446   1.00 43.09  ? 471 HIS A C   1 
ATOM   819  O  O   . HIS A 1 144 ? -24.275 -27.789 9.828   1.00 41.58  ? 471 HIS A O   1 
ATOM   820  C  CB  . HIS A 1 144 ? -27.216 -27.423 8.457   1.00 46.95  ? 471 HIS A CB  1 
ATOM   821  C  CG  . HIS A 1 144 ? -28.092 -26.337 9.011   1.00 49.04  ? 471 HIS A CG  1 
ATOM   822  N  ND1 . HIS A 1 144 ? -28.211 -26.091 10.363  1.00 50.23  ? 471 HIS A ND1 1 
ATOM   823  C  CD2 . HIS A 1 144 ? -28.871 -25.413 8.392   1.00 50.19  ? 471 HIS A CD2 1 
ATOM   824  C  CE1 . HIS A 1 144 ? -29.031 -25.072 10.554  1.00 52.14  ? 471 HIS A CE1 1 
ATOM   825  N  NE2 . HIS A 1 144 ? -29.448 -24.644 9.376   1.00 52.31  ? 471 HIS A NE2 1 
ATOM   826  N  N   . ARG A 1 145 ? -25.101 -25.700 10.100  1.00 44.55  ? 472 ARG A N   1 
ATOM   827  C  CA  . ARG A 1 145 ? -24.497 -25.448 11.411  1.00 45.74  ? 472 ARG A CA  1 
ATOM   828  C  C   . ARG A 1 145 ? -24.861 -26.524 12.451  1.00 47.34  ? 472 ARG A C   1 
ATOM   829  O  O   . ARG A 1 145 ? -23.986 -26.984 13.198  1.00 46.98  ? 472 ARG A O   1 
ATOM   830  C  CB  . ARG A 1 145 ? -24.857 -24.036 11.883  1.00 47.83  ? 472 ARG A CB  1 
ATOM   831  C  CG  . ARG A 1 145 ? -24.354 -23.671 13.269  1.00 49.58  ? 472 ARG A CG  1 
ATOM   832  C  CD  . ARG A 1 145 ? -25.032 -22.410 13.779  1.00 52.53  ? 472 ARG A CD  1 
ATOM   833  N  NE  . ARG A 1 145 ? -26.450 -22.577 14.060  1.00 56.13  ? 472 ARG A NE  1 
ATOM   834  C  CZ  . ARG A 1 145 ? -26.966 -23.157 15.155  1.00 60.03  ? 472 ARG A CZ  1 
ATOM   835  N  NH1 . ARG A 1 145 ? -26.176 -23.685 16.097  1.00 59.74  ? 472 ARG A NH1 1 
ATOM   836  N  NH2 . ARG A 1 145 ? -28.293 -23.226 15.312  1.00 61.93  ? 472 ARG A NH2 1 
ATOM   837  N  N   . LEU A 1 146 ? -26.135 -26.934 12.463  1.00 49.30  ? 473 LEU A N   1 
ATOM   838  C  CA  . LEU A 1 146 ? -26.632 -28.010 13.335  1.00 50.98  ? 473 LEU A CA  1 
ATOM   839  C  C   . LEU A 1 146 ? -25.895 -29.331 13.087  1.00 49.10  ? 473 LEU A C   1 
ATOM   840  O  O   . LEU A 1 146 ? -25.731 -30.129 14.009  1.00 50.36  ? 473 LEU A O   1 
ATOM   841  C  CB  . LEU A 1 146 ? -28.151 -28.217 13.168  1.00 54.75  ? 473 LEU A CB  1 
ATOM   842  C  CG  . LEU A 1 146 ? -29.207 -27.625 14.124  1.00 58.89  ? 473 LEU A CG  1 
ATOM   843  C  CD1 . LEU A 1 146 ? -29.420 -26.127 13.940  1.00 59.63  ? 473 LEU A CD1 1 
ATOM   844  C  CD2 . LEU A 1 146 ? -30.542 -28.337 13.936  1.00 61.87  ? 473 LEU A CD2 1 
ATOM   845  N  N   . GLN A 1 147 ? -25.467 -29.553 11.846  1.00 46.31  ? 474 GLN A N   1 
ATOM   846  C  CA  . GLN A 1 147 ? -24.705 -30.742 11.473  1.00 45.38  ? 474 GLN A CA  1 
ATOM   847  C  C   . GLN A 1 147 ? -23.267 -30.642 11.970  1.00 43.95  ? 474 GLN A C   1 
ATOM   848  O  O   . GLN A 1 147 ? -22.588 -31.656 12.084  1.00 43.90  ? 474 GLN A O   1 
ATOM   849  C  CB  . GLN A 1 147 ? -24.687 -30.938 9.949   1.00 43.69  ? 474 GLN A CB  1 
ATOM   850  C  CG  . GLN A 1 147 ? -25.924 -31.580 9.327   1.00 44.67  ? 474 GLN A CG  1 
ATOM   851  C  CD  . GLN A 1 147 ? -25.867 -31.581 7.810   1.00 43.34  ? 474 GLN A CD  1 
ATOM   852  O  OE1 . GLN A 1 147 ? -25.759 -30.527 7.167   1.00 41.31  ? 474 GLN A OE1 1 
ATOM   853  N  NE2 . GLN A 1 147 ? -25.943 -32.768 7.226   1.00 44.02  ? 474 GLN A NE2 1 
ATOM   854  N  N   . CYS A 1 148 ? -22.818 -29.420 12.258  1.00 43.57  ? 475 CYS A N   1 
ATOM   855  C  CA  . CYS A 1 148 ? -21.456 -29.167 12.678  1.00 43.18  ? 475 CYS A CA  1 
ATOM   856  C  C   . CYS A 1 148 ? -21.272 -29.157 14.205  1.00 44.97  ? 475 CYS A C   1 
ATOM   857  O  O   . CYS A 1 148 ? -20.130 -29.183 14.679  1.00 42.90  ? 475 CYS A O   1 
ATOM   858  C  CB  . CYS A 1 148 ? -20.960 -27.850 12.073  1.00 41.87  ? 475 CYS A CB  1 
ATOM   859  S  SG  . CYS A 1 148 ? -20.853 -27.828 10.272  1.00 41.37  ? 475 CYS A SG  1 
ATOM   860  N  N   . VAL A 1 149 ? -22.386 -29.121 14.957  1.00 48.62  ? 476 VAL A N   1 
ATOM   861  C  CA  . VAL A 1 149 ? -22.366 -28.994 16.440  1.00 51.14  ? 476 VAL A CA  1 
ATOM   862  C  C   . VAL A 1 149 ? -21.607 -30.104 17.173  1.00 52.31  ? 476 VAL A C   1 
ATOM   863  O  O   . VAL A 1 149 ? -20.821 -29.815 18.071  1.00 51.90  ? 476 VAL A O   1 
ATOM   864  C  CB  . VAL A 1 149 ? -23.783 -28.772 17.043  1.00 54.39  ? 476 VAL A CB  1 
ATOM   865  C  CG1 . VAL A 1 149 ? -23.815 -28.999 18.559  1.00 56.99  ? 476 VAL A CG1 1 
ATOM   866  C  CG2 . VAL A 1 149 ? -24.263 -27.365 16.740  1.00 54.60  ? 476 VAL A CG2 1 
ATOM   867  N  N   . ARG A 1 150 ? -21.824 -31.362 16.788  1.00 55.01  ? 477 ARG A N   1 
ATOM   868  C  CA  . ARG A 1 150 ? -21.144 -32.489 17.455  1.00 57.44  ? 477 ARG A CA  1 
ATOM   869  C  C   . ARG A 1 150 ? -19.615 -32.493 17.282  1.00 54.95  ? 477 ARG A C   1 
ATOM   870  O  O   . ARG A 1 150 ? -18.890 -32.770 18.241  1.00 56.06  ? 477 ARG A O   1 
ATOM   871  C  CB  . ARG A 1 150 ? -21.731 -33.833 17.026  1.00 61.54  ? 477 ARG A CB  1 
ATOM   872  C  CG  . ARG A 1 150 ? -23.046 -34.201 17.700  1.00 67.93  ? 477 ARG A CG  1 
ATOM   873  C  CD  . ARG A 1 150 ? -23.400 -35.652 17.399  1.00 72.76  ? 477 ARG A CD  1 
ATOM   874  N  NE  . ARG A 1 150 ? -24.793 -35.981 17.705  1.00 78.78  ? 477 ARG A NE  1 
ATOM   875  C  CZ  . ARG A 1 150 ? -25.445 -37.037 17.220  1.00 82.52  ? 477 ARG A CZ  1 
ATOM   876  N  NH1 . ARG A 1 150 ? -24.837 -37.885 16.390  1.00 83.28  ? 477 ARG A NH1 1 
ATOM   877  N  NH2 . ARG A 1 150 ? -26.716 -37.246 17.561  1.00 85.83  ? 477 ARG A NH2 1 
ATOM   878  N  N   . GLY A 1 151 ? -19.141 -32.175 16.075  1.00 51.65  ? 478 GLY A N   1 
ATOM   879  C  CA  . GLY A 1 151 ? -17.708 -32.092 15.777  1.00 49.06  ? 478 GLY A CA  1 
ATOM   880  C  C   . GLY A 1 151 ? -17.032 -30.830 16.295  1.00 47.45  ? 478 GLY A C   1 
ATOM   881  O  O   . GLY A 1 151 ? -16.065 -30.900 17.058  1.00 47.22  ? 478 GLY A O   1 
ATOM   882  N  N   . PHE A 1 152 ? -17.553 -29.677 15.888  1.00 46.08  ? 479 PHE A N   1 
ATOM   883  C  CA  . PHE A 1 152 ? -16.921 -28.383 16.166  1.00 44.70  ? 479 PHE A CA  1 
ATOM   884  C  C   . PHE A 1 152 ? -17.243 -27.867 17.549  1.00 46.49  ? 479 PHE A C   1 
ATOM   885  O  O   . PHE A 1 152 ? -16.519 -27.025 18.078  1.00 46.86  ? 479 PHE A O   1 
ATOM   886  C  CB  . PHE A 1 152 ? -17.372 -27.330 15.139  1.00 43.32  ? 479 PHE A CB  1 
ATOM   887  C  CG  . PHE A 1 152 ? -16.814 -27.531 13.754  1.00 41.37  ? 479 PHE A CG  1 
ATOM   888  C  CD1 . PHE A 1 152 ? -15.817 -26.683 13.269  1.00 39.61  ? 479 PHE A CD1 1 
ATOM   889  C  CD2 . PHE A 1 152 ? -17.290 -28.552 12.922  1.00 41.66  ? 479 PHE A CD2 1 
ATOM   890  C  CE1 . PHE A 1 152 ? -15.297 -26.854 11.988  1.00 38.47  ? 479 PHE A CE1 1 
ATOM   891  C  CE2 . PHE A 1 152 ? -16.771 -28.724 11.639  1.00 40.89  ? 479 PHE A CE2 1 
ATOM   892  C  CZ  . PHE A 1 152 ? -15.774 -27.872 11.175  1.00 38.75  ? 479 PHE A CZ  1 
ATOM   893  N  N   . GLY A 1 153 ? -18.347 -28.348 18.120  1.00 49.04  ? 480 GLY A N   1 
ATOM   894  C  CA  . GLY A 1 153 ? -18.888 -27.803 19.364  1.00 50.99  ? 480 GLY A CA  1 
ATOM   895  C  C   . GLY A 1 153 ? -19.288 -26.339 19.233  1.00 51.12  ? 480 GLY A C   1 
ATOM   896  O  O   . GLY A 1 153 ? -19.615 -25.859 18.140  1.00 49.74  ? 480 GLY A O   1 
ATOM   897  N  N   . GLU A 1 154 ? -19.216 -25.631 20.358  1.00 52.86  ? 481 GLU A N   1 
ATOM   898  C  CA  . GLU A 1 154 ? -19.511 -24.202 20.470  1.00 53.56  ? 481 GLU A CA  1 
ATOM   899  C  C   . GLU A 1 154 ? -18.736 -23.344 19.450  1.00 50.25  ? 481 GLU A C   1 
ATOM   900  O  O   . GLU A 1 154 ? -19.136 -22.218 19.132  1.00 50.63  ? 481 GLU A O   1 
ATOM   901  C  CB  . GLU A 1 154 ? -19.217 -23.755 21.915  1.00 56.86  ? 481 GLU A CB  1 
ATOM   902  C  CG  . GLU A 1 154 ? -19.900 -22.474 22.386  1.00 59.74  ? 481 GLU A CG  1 
ATOM   903  C  CD  . GLU A 1 154 ? -19.735 -22.251 23.891  1.00 63.35  ? 481 GLU A CD  1 
ATOM   904  O  OE1 . GLU A 1 154 ? -20.496 -22.873 24.664  1.00 65.91  ? 481 GLU A OE1 1 
ATOM   905  O  OE2 . GLU A 1 154 ? -18.851 -21.462 24.309  1.00 62.72  ? 481 GLU A OE2 1 
ATOM   906  N  N   . TRP A 1 155 ? -17.646 -23.888 18.919  1.00 46.88  ? 482 TRP A N   1 
ATOM   907  C  CA  . TRP A 1 155 ? -16.836 -23.167 17.955  1.00 43.99  ? 482 TRP A CA  1 
ATOM   908  C  C   . TRP A 1 155 ? -17.579 -22.755 16.626  1.00 44.45  ? 482 TRP A C   1 
ATOM   909  O  O   . TRP A 1 155 ? -17.433 -21.601 16.201  1.00 44.80  ? 482 TRP A O   1 
ATOM   910  C  CB  . TRP A 1 155 ? -15.507 -23.896 17.744  1.00 40.63  ? 482 TRP A CB  1 
ATOM   911  C  CG  . TRP A 1 155 ? -14.455 -23.128 16.992  1.00 38.06  ? 482 TRP A CG  1 
ATOM   912  C  CD1 . TRP A 1 155 ? -14.174 -21.784 17.086  1.00 37.66  ? 482 TRP A CD1 1 
ATOM   913  C  CD2 . TRP A 1 155 ? -13.536 -23.661 16.032  1.00 35.05  ? 482 TRP A CD2 1 
ATOM   914  N  NE1 . TRP A 1 155 ? -13.148 -21.459 16.230  1.00 35.10  ? 482 TRP A NE1 1 
ATOM   915  C  CE2 . TRP A 1 155 ? -12.738 -22.588 15.575  1.00 33.75  ? 482 TRP A CE2 1 
ATOM   916  C  CE3 . TRP A 1 155 ? -13.304 -24.946 15.517  1.00 34.28  ? 482 TRP A CE3 1 
ATOM   917  C  CZ2 . TRP A 1 155 ? -11.714 -22.763 14.635  1.00 32.33  ? 482 TRP A CZ2 1 
ATOM   918  C  CZ3 . TRP A 1 155 ? -12.288 -25.119 14.564  1.00 32.39  ? 482 TRP A CZ3 1 
ATOM   919  C  CH2 . TRP A 1 155 ? -11.510 -24.033 14.139  1.00 31.72  ? 482 TRP A CH2 1 
ATOM   920  N  N   . ILE A 1 156 ? -18.381 -23.635 15.994  1.00 44.58  ? 483 ILE A N   1 
ATOM   921  C  CA  . ILE A 1 156 ? -19.152 -23.190 14.784  1.00 44.61  ? 483 ILE A CA  1 
ATOM   922  C  C   . ILE A 1 156 ? -20.118 -22.045 15.046  1.00 45.62  ? 483 ILE A C   1 
ATOM   923  O  O   . ILE A 1 156 ? -20.364 -21.248 14.138  1.00 45.05  ? 483 ILE A O   1 
ATOM   924  C  CB  . ILE A 1 156 ? -19.932 -24.270 13.957  1.00 45.43  ? 483 ILE A CB  1 
ATOM   925  C  CG1 . ILE A 1 156 ? -20.384 -25.454 14.811  1.00 47.55  ? 483 ILE A CG1 1 
ATOM   926  C  CG2 . ILE A 1 156 ? -19.181 -24.653 12.676  1.00 43.41  ? 483 ILE A CG2 1 
ATOM   927  C  CD1 . ILE A 1 156 ? -21.722 -25.233 15.475  1.00 50.97  ? 483 ILE A CD1 1 
ATOM   928  N  N   . ASP A 1 157 ? -20.652 -21.962 16.267  1.00 47.14  ? 484 ASP A N   1 
ATOM   929  C  CA  . ASP A 1 157 ? -21.479 -20.815 16.668  1.00 48.86  ? 484 ASP A CA  1 
ATOM   930  C  C   . ASP A 1 157 ? -20.676 -19.500 16.624  1.00 47.73  ? 484 ASP A C   1 
ATOM   931  O  O   . ASP A 1 157 ? -21.183 -18.487 16.138  1.00 47.69  ? 484 ASP A O   1 
ATOM   932  C  CB  . ASP A 1 157 ? -22.120 -21.041 18.047  1.00 51.99  ? 484 ASP A CB  1 
ATOM   933  C  CG  . ASP A 1 157 ? -23.285 -22.046 18.016  1.00 54.56  ? 484 ASP A CG  1 
ATOM   934  O  OD1 . ASP A 1 157 ? -23.742 -22.444 16.915  1.00 53.57  ? 484 ASP A OD1 1 
ATOM   935  O  OD2 . ASP A 1 157 ? -23.771 -22.429 19.115  1.00 57.85  ? 484 ASP A OD2 1 
ATOM   936  N  N   . SER A 1 158 ? -19.428 -19.536 17.110  1.00 46.17  ? 485 SER A N   1 
ATOM   937  C  CA  . SER A 1 158 ? -18.506 -18.396 17.034  1.00 45.83  ? 485 SER A CA  1 
ATOM   938  C  C   . SER A 1 158 ? -18.159 -18.083 15.559  1.00 43.14  ? 485 SER A C   1 
ATOM   939  O  O   . SER A 1 158 ? -18.121 -16.914 15.140  1.00 42.86  ? 485 SER A O   1 
ATOM   940  C  CB  . SER A 1 158 ? -17.211 -18.665 17.827  1.00 45.15  ? 485 SER A CB  1 
ATOM   941  O  OG  . SER A 1 158 ? -17.440 -19.091 19.160  1.00 48.44  ? 485 SER A OG  1 
ATOM   942  N  N   . ILE A 1 159 ? -17.924 -19.142 14.794  1.00 40.81  ? 486 ILE A N   1 
ATOM   943  C  CA  . ILE A 1 159 ? -17.617 -19.045 13.364  1.00 40.14  ? 486 ILE A CA  1 
ATOM   944  C  C   . ILE A 1 159 ? -18.773 -18.399 12.574  1.00 41.23  ? 486 ILE A C   1 
ATOM   945  O  O   . ILE A 1 159 ? -18.551 -17.425 11.830  1.00 41.25  ? 486 ILE A O   1 
ATOM   946  C  CB  . ILE A 1 159 ? -17.179 -20.412 12.776  1.00 38.08  ? 486 ILE A CB  1 
ATOM   947  C  CG1 . ILE A 1 159 ? -15.786 -20.785 13.326  1.00 36.94  ? 486 ILE A CG1 1 
ATOM   948  C  CG2 . ILE A 1 159 ? -17.182 -20.366 11.247  1.00 37.17  ? 486 ILE A CG2 1 
ATOM   949  C  CD1 . ILE A 1 159 ? -15.356 -22.233 13.129  1.00 35.55  ? 486 ILE A CD1 1 
ATOM   950  N  N   . VAL A 1 160 ? -19.983 -18.938 12.756  1.00 42.57  ? 487 VAL A N   1 
ATOM   951  C  CA  . VAL A 1 160 ? -21.215 -18.427 12.109  1.00 44.63  ? 487 VAL A CA  1 
ATOM   952  C  C   . VAL A 1 160 ? -21.500 -16.967 12.506  1.00 47.13  ? 487 VAL A C   1 
ATOM   953  O  O   . VAL A 1 160 ? -21.812 -16.140 11.630  1.00 47.63  ? 487 VAL A O   1 
ATOM   954  C  CB  . VAL A 1 160 ? -22.430 -19.372 12.346  1.00 46.32  ? 487 VAL A CB  1 
ATOM   955  C  CG1 . VAL A 1 160 ? -23.764 -18.687 12.058  1.00 48.97  ? 487 VAL A CG1 1 
ATOM   956  C  CG2 . VAL A 1 160 ? -22.294 -20.632 11.498  1.00 44.60  ? 487 VAL A CG2 1 
ATOM   957  N  N   . GLU A 1 161 ? -21.354 -16.652 13.799  1.00 48.84  ? 488 GLU A N   1 
ATOM   958  C  CA  . GLU A 1 161 ? -21.447 -15.269 14.275  1.00 52.18  ? 488 GLU A CA  1 
ATOM   959  C  C   . GLU A 1 161 ? -20.437 -14.356 13.581  1.00 50.73  ? 488 GLU A C   1 
ATOM   960  O  O   . GLU A 1 161 ? -20.797 -13.266 13.148  1.00 52.95  ? 488 GLU A O   1 
ATOM   961  C  CB  . GLU A 1 161 ? -21.273 -15.167 15.795  1.00 55.56  ? 488 GLU A CB  1 
ATOM   962  C  CG  . GLU A 1 161 ? -21.672 -13.796 16.351  1.00 61.04  ? 488 GLU A CG  1 
ATOM   963  C  CD  . GLU A 1 161 ? -21.032 -13.443 17.689  1.00 63.06  ? 488 GLU A CD  1 
ATOM   964  O  OE1 . GLU A 1 161 ? -19.789 -13.515 17.809  1.00 62.04  ? 488 GLU A OE1 1 
ATOM   965  O  OE2 . GLU A 1 161 ? -21.777 -13.060 18.617  1.00 66.29  ? 488 GLU A OE2 1 
ATOM   966  N  N   . PHE A 1 162 ? -19.183 -14.805 13.495  1.00 47.71  ? 489 PHE A N   1 
ATOM   967  C  CA  . PHE A 1 162 ? -18.118 -14.051 12.828  1.00 46.44  ? 489 PHE A CA  1 
ATOM   968  C  C   . PHE A 1 162 ? -18.432 -13.861 11.341  1.00 45.70  ? 489 PHE A C   1 
ATOM   969  O  O   . PHE A 1 162 ? -18.312 -12.741 10.809  1.00 46.40  ? 489 PHE A O   1 
ATOM   970  C  CB  . PHE A 1 162 ? -16.749 -14.725 13.020  1.00 43.55  ? 489 PHE A CB  1 
ATOM   971  C  CG  . PHE A 1 162 ? -15.626 -14.020 12.311  1.00 43.08  ? 489 PHE A CG  1 
ATOM   972  C  CD1 . PHE A 1 162 ? -15.127 -12.810 12.791  1.00 44.62  ? 489 PHE A CD1 1 
ATOM   973  C  CD2 . PHE A 1 162 ? -15.064 -14.566 11.145  1.00 41.10  ? 489 PHE A CD2 1 
ATOM   974  C  CE1 . PHE A 1 162 ? -14.103 -12.153 12.121  1.00 44.80  ? 489 PHE A CE1 1 
ATOM   975  C  CE2 . PHE A 1 162 ? -14.041 -13.914 10.470  1.00 40.66  ? 489 PHE A CE2 1 
ATOM   976  C  CZ  . PHE A 1 162 ? -13.557 -12.706 10.958  1.00 42.56  ? 489 PHE A CZ  1 
ATOM   977  N  N   . SER A 1 163 ? -18.856 -14.949 10.693  1.00 43.85  ? 490 SER A N   1 
ATOM   978  C  CA  . SER A 1 163 ? -19.330 -14.907 9.304   1.00 44.12  ? 490 SER A CA  1 
ATOM   979  C  C   . SER A 1 163 ? -20.417 -13.851 9.078   1.00 47.42  ? 490 SER A C   1 
ATOM   980  O  O   . SER A 1 163 ? -20.384 -13.160 8.057   1.00 48.18  ? 490 SER A O   1 
ATOM   981  C  CB  . SER A 1 163 ? -19.806 -16.283 8.837   1.00 42.42  ? 490 SER A CB  1 
ATOM   982  O  OG  . SER A 1 163 ? -20.238 -16.238 7.488   1.00 41.62  ? 490 SER A OG  1 
ATOM   983  N  N   . SER A 1 164 ? -21.347 -13.715 10.034  1.00 50.33  ? 491 SER A N   1 
ATOM   984  C  CA  . SER A 1 164 ? -22.373 -12.656 10.006  1.00 54.07  ? 491 SER A CA  1 
ATOM   985  C  C   . SER A 1 164 ? -21.784 -11.242 9.992   1.00 56.03  ? 491 SER A C   1 
ATOM   986  O  O   . SER A 1 164 ? -22.207 -10.413 9.170   1.00 57.68  ? 491 SER A O   1 
ATOM   987  C  CB  . SER A 1 164 ? -23.358 -12.795 11.177  1.00 56.98  ? 491 SER A CB  1 
ATOM   988  O  OG  . SER A 1 164 ? -24.554 -13.445 10.798  1.00 58.25  ? 491 SER A OG  1 
ATOM   989  N  N   . ASN A 1 165 ? -20.830 -10.980 10.903  1.00 56.27  ? 492 ASN A N   1 
ATOM   990  C  CA  . ASN A 1 165 ? -20.145 -9.674  11.046  1.00 57.36  ? 492 ASN A CA  1 
ATOM   991  C  C   . ASN A 1 165 ? -19.301 -9.339  9.818   1.00 54.57  ? 492 ASN A C   1 
ATOM   992  O  O   . ASN A 1 165 ? -19.394 -8.240  9.265   1.00 56.02  ? 492 ASN A O   1 
ATOM   993  C  CB  . ASN A 1 165 ? -19.244 -9.647  12.297  1.00 58.95  ? 492 ASN A CB  1 
ATOM   994  C  CG  . ASN A 1 165 ? -20.022 -9.513  13.606  1.00 64.12  ? 492 ASN A CG  1 
ATOM   995  O  OD1 . ASN A 1 165 ? -19.497 -9.864  14.667  1.00 66.04  ? 492 ASN A OD1 1 
ATOM   996  N  ND2 . ASN A 1 165 ? -21.260 -9.001  13.548  1.00 67.18  ? 492 ASN A ND2 1 
ATOM   997  N  N   . LEU A 1 166 ? -18.483 -10.306 9.406   1.00 50.02  ? 493 LEU A N   1 
ATOM   998  C  CA  . LEU A 1 166 ? -17.655 -10.192 8.215   1.00 47.88  ? 493 LEU A CA  1 
ATOM   999  C  C   . LEU A 1 166 ? -18.461 -9.812  6.979   1.00 48.70  ? 493 LEU A C   1 
ATOM   1000 O  O   . LEU A 1 166 ? -18.094 -8.878  6.251   1.00 49.31  ? 493 LEU A O   1 
ATOM   1001 C  CB  . LEU A 1 166 ? -16.915 -11.503 7.962   1.00 43.84  ? 493 LEU A CB  1 
ATOM   1002 C  CG  . LEU A 1 166 ? -15.812 -11.465 6.897   1.00 42.11  ? 493 LEU A CG  1 
ATOM   1003 C  CD1 . LEU A 1 166 ? -14.601 -10.662 7.367   1.00 41.53  ? 493 LEU A CD1 1 
ATOM   1004 C  CD2 . LEU A 1 166 ? -15.428 -12.887 6.520   1.00 38.70  ? 493 LEU A CD2 1 
ATOM   1005 N  N   . GLN A 1 167 ? -19.562 -10.529 6.769   1.00 49.16  ? 494 GLN A N   1 
ATOM   1006 C  CA  . GLN A 1 167 ? -20.420 -10.311 5.599   1.00 50.93  ? 494 GLN A CA  1 
ATOM   1007 C  C   . GLN A 1 167 ? -21.268 -9.046  5.650   1.00 55.08  ? 494 GLN A C   1 
ATOM   1008 O  O   . GLN A 1 167 ? -21.548 -8.470  4.599   1.00 56.97  ? 494 GLN A O   1 
ATOM   1009 C  CB  . GLN A 1 167 ? -21.251 -11.547 5.278   1.00 49.10  ? 494 GLN A CB  1 
ATOM   1010 C  CG  . GLN A 1 167 ? -20.413 -12.591 4.555   1.00 45.74  ? 494 GLN A CG  1 
ATOM   1011 C  CD  . GLN A 1 167 ? -21.154 -13.865 4.214   1.00 44.92  ? 494 GLN A CD  1 
ATOM   1012 O  OE1 . GLN A 1 167 ? -20.555 -14.939 4.225   1.00 43.36  ? 494 GLN A OE1 1 
ATOM   1013 N  NE2 . GLN A 1 167 ? -22.442 -13.761 3.890   1.00 46.48  ? 494 GLN A NE2 1 
ATOM   1014 N  N   . ASN A 1 168 ? -21.637 -8.599  6.854   1.00 57.62  ? 495 ASN A N   1 
ATOM   1015 C  CA  . ASN A 1 168 ? -22.365 -7.332  7.016   1.00 62.51  ? 495 ASN A CA  1 
ATOM   1016 C  C   . ASN A 1 168 ? -21.516 -6.109  6.628   1.00 64.25  ? 495 ASN A C   1 
ATOM   1017 O  O   . ASN A 1 168 ? -22.069 -5.053  6.307   1.00 68.20  ? 495 ASN A O   1 
ATOM   1018 C  CB  . ASN A 1 168 ? -22.930 -7.175  8.441   1.00 65.07  ? 495 ASN A CB  1 
ATOM   1019 C  CG  . ASN A 1 168 ? -24.167 -8.035  8.708   1.00 65.86  ? 495 ASN A CG  1 
ATOM   1020 O  OD1 . ASN A 1 168 ? -24.733 -7.975  9.800   1.00 68.10  ? 495 ASN A OD1 1 
ATOM   1021 N  ND2 . ASN A 1 168 ? -24.591 -8.836  7.726   1.00 64.45  ? 495 ASN A ND2 1 
ATOM   1022 N  N   . MET A 1 169 ? -20.188 -6.268  6.648   1.00 62.75  ? 496 MET A N   1 
ATOM   1023 C  CA  . MET A 1 169 ? -19.227 -5.246  6.174   1.00 64.00  ? 496 MET A CA  1 
ATOM   1024 C  C   . MET A 1 169 ? -19.096 -5.138  4.640   1.00 62.67  ? 496 MET A C   1 
ATOM   1025 O  O   . MET A 1 169 ? -18.516 -4.172  4.140   1.00 63.71  ? 496 MET A O   1 
ATOM   1026 C  CB  . MET A 1 169 ? -17.835 -5.492  6.770   1.00 63.89  ? 496 MET A CB  1 
ATOM   1027 C  CG  . MET A 1 169 ? -17.700 -5.280  8.271   1.00 66.38  ? 496 MET A CG  1 
ATOM   1028 S  SD  . MET A 1 169 ? -16.019 -5.659  8.826   1.00 66.45  ? 496 MET A SD  1 
ATOM   1029 C  CE  . MET A 1 169 ? -15.156 -4.170  8.302   1.00 67.81  ? 496 MET A CE  1 
ATOM   1030 N  N   . ASN A 1 170 ? -19.618 -6.134  3.913   1.00 60.61  ? 497 ASN A N   1 
ATOM   1031 C  CA  . ASN A 1 170 ? -19.631 -6.176  2.435   1.00 59.42  ? 497 ASN A CA  1 
ATOM   1032 C  C   . ASN A 1 170 ? -18.263 -5.902  1.799   1.00 56.92  ? 497 ASN A C   1 
ATOM   1033 O  O   . ASN A 1 170 ? -18.118 -5.029  0.944   1.00 58.27  ? 497 ASN A O   1 
ATOM   1034 C  CB  . ASN A 1 170 ? -20.729 -5.268  1.847   1.00 64.10  ? 497 ASN A CB  1 
ATOM   1035 C  CG  . ASN A 1 170 ? -22.139 -5.823  2.048   1.00 66.27  ? 497 ASN A CG  1 
ATOM   1036 O  OD1 . ASN A 1 170 ? -23.052 -5.078  2.400   1.00 70.94  ? 497 ASN A OD1 1 
ATOM   1037 N  ND2 . ASN A 1 170 ? -22.328 -7.118  1.804   1.00 63.89  ? 497 ASN A ND2 1 
ATOM   1038 N  N   . ILE A 1 171 ? -17.272 -6.670  2.245   1.00 53.68  ? 498 ILE A N   1 
ATOM   1039 C  CA  . ILE A 1 171 ? -15.881 -6.591  1.789   1.00 51.09  ? 498 ILE A CA  1 
ATOM   1040 C  C   . ILE A 1 171 ? -15.776 -7.256  0.426   1.00 49.28  ? 498 ILE A C   1 
ATOM   1041 O  O   . ILE A 1 171 ? -16.172 -8.405  0.255   1.00 46.84  ? 498 ILE A O   1 
ATOM   1042 C  CB  . ILE A 1 171 ? -14.958 -7.278  2.811   1.00 48.76  ? 498 ILE A CB  1 
ATOM   1043 C  CG1 . ILE A 1 171 ? -15.165 -6.639  4.187   1.00 49.98  ? 498 ILE A CG1 1 
ATOM   1044 C  CG2 . ILE A 1 171 ? -13.494 -7.260  2.365   1.00 47.52  ? 498 ILE A CG2 1 
ATOM   1045 C  CD1 . ILE A 1 171 ? -14.886 -7.570  5.337   1.00 48.95  ? 498 ILE A CD1 1 
ATOM   1046 N  N   . ASP A 1 172 ? -15.262 -6.516  -0.547  1.00 50.53  ? 499 ASP A N   1 
ATOM   1047 C  CA  . ASP A 1 172 ? -15.095 -7.029  -1.905  1.00 49.98  ? 499 ASP A CA  1 
ATOM   1048 C  C   . ASP A 1 172 ? -13.973 -8.068  -1.959  1.00 46.94  ? 499 ASP A C   1 
ATOM   1049 O  O   . ASP A 1 172 ? -13.217 -8.213  -0.995  1.00 45.61  ? 499 ASP A O   1 
ATOM   1050 C  CB  . ASP A 1 172 ? -14.826 -5.886  -2.877  1.00 53.11  ? 499 ASP A CB  1 
ATOM   1051 C  CG  . ASP A 1 172 ? -13.693 -4.997  -2.419  1.00 54.92  ? 499 ASP A CG  1 
ATOM   1052 O  OD1 . ASP A 1 172 ? -13.967 -3.867  -1.960  1.00 57.98  ? 499 ASP A OD1 1 
ATOM   1053 O  OD2 . ASP A 1 172 ? -12.531 -5.446  -2.484  1.00 53.51  ? 499 ASP A OD2 1 
ATOM   1054 N  N   . ILE A 1 173 ? -13.883 -8.782  -3.081  1.00 45.95  ? 500 ILE A N   1 
ATOM   1055 C  CA  . ILE A 1 173 ? -12.876 -9.834  -3.274  1.00 44.31  ? 500 ILE A CA  1 
ATOM   1056 C  C   . ILE A 1 173 ? -11.437 -9.321  -3.136  1.00 44.00  ? 500 ILE A C   1 
ATOM   1057 O  O   . ILE A 1 173 ? -10.622 -9.977  -2.502  1.00 41.76  ? 500 ILE A O   1 
ATOM   1058 C  CB  . ILE A 1 173 ? -13.110 -10.630 -4.578  1.00 43.68  ? 500 ILE A CB  1 
ATOM   1059 C  CG1 . ILE A 1 173 ? -14.351 -11.502 -4.398  1.00 43.12  ? 500 ILE A CG1 1 
ATOM   1060 C  CG2 . ILE A 1 173 ? -11.913 -11.516 -4.918  1.00 42.26  ? 500 ILE A CG2 1 
ATOM   1061 C  CD1 . ILE A 1 173 ? -14.939 -12.040 -5.684  1.00 44.22  ? 500 ILE A CD1 1 
ATOM   1062 N  N   . SER A 1 174 ? -11.164 -8.140  -3.696  1.00 46.25  ? 501 SER A N   1 
ATOM   1063 C  CA  . SER A 1 174 ? -9.832  -7.526  -3.655  1.00 47.00  ? 501 SER A CA  1 
ATOM   1064 C  C   . SER A 1 174 ? -9.348  -7.231  -2.241  1.00 46.33  ? 501 SER A C   1 
ATOM   1065 O  O   . SER A 1 174 ? -8.213  -7.567  -1.884  1.00 45.41  ? 501 SER A O   1 
ATOM   1066 C  CB  . SER A 1 174 ? -9.803  -6.250  -4.492  1.00 49.98  ? 501 SER A CB  1 
ATOM   1067 O  OG  . SER A 1 174 ? -9.878  -6.574  -5.861  1.00 50.85  ? 501 SER A OG  1 
ATOM   1068 N  N   . ALA A 1 175 ? -10.227 -6.608  -1.456  1.00 46.56  ? 502 ALA A N   1 
ATOM   1069 C  CA  . ALA A 1 175 ? -9.957  -6.263  -0.064  1.00 45.77  ? 502 ALA A CA  1 
ATOM   1070 C  C   . ALA A 1 175 ? -9.813  -7.500  0.810   1.00 42.49  ? 502 ALA A C   1 
ATOM   1071 O  O   . ALA A 1 175 ? -8.909  -7.561  1.658   1.00 41.68  ? 502 ALA A O   1 
ATOM   1072 C  CB  . ALA A 1 175 ? -11.024 -5.313  0.479   1.00 47.60  ? 502 ALA A CB  1 
ATOM   1073 N  N   . PHE A 1 176 ? -10.683 -8.490  0.587   1.00 40.47  ? 503 PHE A N   1 
ATOM   1074 C  CA  . PHE A 1 176 ? -10.615 -9.753  1.319   1.00 37.56  ? 503 PHE A CA  1 
ATOM   1075 C  C   . PHE A 1 176 ? -9.311  -10.491 1.042   1.00 36.82  ? 503 PHE A C   1 
ATOM   1076 O  O   . PHE A 1 176 ? -8.706  -11.050 1.952   1.00 36.55  ? 503 PHE A O   1 
ATOM   1077 C  CB  . PHE A 1 176 ? -11.797 -10.677 0.993   1.00 36.41  ? 503 PHE A CB  1 
ATOM   1078 C  CG  . PHE A 1 176 ? -11.736 -11.992 1.727   1.00 34.07  ? 503 PHE A CG  1 
ATOM   1079 C  CD1 . PHE A 1 176 ? -12.257 -12.104 3.021   1.00 33.81  ? 503 PHE A CD1 1 
ATOM   1080 C  CD2 . PHE A 1 176 ? -11.107 -13.103 1.153   1.00 31.86  ? 503 PHE A CD2 1 
ATOM   1081 C  CE1 . PHE A 1 176 ? -12.167 -13.304 3.715   1.00 32.30  ? 503 PHE A CE1 1 
ATOM   1082 C  CE2 . PHE A 1 176 ? -11.000 -14.293 1.857   1.00 30.63  ? 503 PHE A CE2 1 
ATOM   1083 C  CZ  . PHE A 1 176 ? -11.540 -14.400 3.135   1.00 30.56  ? 503 PHE A CZ  1 
ATOM   1084 N  N   . SER A 1 177 ? -8.904  -10.517 -0.225  1.00 37.29  ? 504 SER A N   1 
ATOM   1085 C  CA  . SER A 1 177 ? -7.658  -11.145 -0.640  1.00 36.71  ? 504 SER A CA  1 
ATOM   1086 C  C   . SER A 1 177 ? -6.442  -10.526 0.056   1.00 37.69  ? 504 SER A C   1 
ATOM   1087 O  O   . SER A 1 177 ? -5.475  -11.227 0.343   1.00 36.99  ? 504 SER A O   1 
ATOM   1088 C  CB  . SER A 1 177 ? -7.526  -11.086 -2.154  1.00 37.30  ? 504 SER A CB  1 
ATOM   1089 O  OG  . SER A 1 177 ? -8.639  -11.741 -2.743  1.00 36.58  ? 504 SER A OG  1 
ATOM   1090 N  N   . CYS A 1 178 ? -6.522  -9.225  0.345   1.00 40.07  ? 505 CYS A N   1 
ATOM   1091 C  CA  . CYS A 1 178 ? -5.500  -8.508  1.115   1.00 41.62  ? 505 CYS A CA  1 
ATOM   1092 C  C   . CYS A 1 178 ? -5.501  -8.897  2.598   1.00 40.52  ? 505 CYS A C   1 
ATOM   1093 O  O   . CYS A 1 178 ? -4.440  -9.225  3.140   1.00 40.37  ? 505 CYS A O   1 
ATOM   1094 C  CB  . CYS A 1 178 ? -5.661  -6.992  0.955   1.00 44.66  ? 505 CYS A CB  1 
ATOM   1095 S  SG  . CYS A 1 178 ? -5.274  -6.378  -0.706  1.00 48.21  ? 505 CYS A SG  1 
ATOM   1096 N  N   . ILE A 1 179 ? -6.685  -8.884  3.230   1.00 40.03  ? 506 ILE A N   1 
ATOM   1097 C  CA  . ILE A 1 179 ? -6.842  -9.227  4.648   1.00 39.21  ? 506 ILE A CA  1 
ATOM   1098 C  C   . ILE A 1 179 ? -6.412  -10.675 4.886   1.00 36.66  ? 506 ILE A C   1 
ATOM   1099 O  O   . ILE A 1 179 ? -5.734  -10.978 5.882   1.00 36.27  ? 506 ILE A O   1 
ATOM   1100 C  CB  . ILE A 1 179 ? -8.293  -9.008  5.166   1.00 40.45  ? 506 ILE A CB  1 
ATOM   1101 C  CG1 . ILE A 1 179 ? -8.784  -7.577  4.907   1.00 43.56  ? 506 ILE A CG1 1 
ATOM   1102 C  CG2 . ILE A 1 179 ? -8.432  -9.389  6.645   1.00 40.08  ? 506 ILE A CG2 1 
ATOM   1103 C  CD1 . ILE A 1 179 ? -8.347  -6.535  5.917   1.00 46.87  ? 506 ILE A CD1 1 
ATOM   1104 N  N   . ALA A 1 180 ? -6.785  -11.556 3.961   1.00 34.89  ? 507 ALA A N   1 
ATOM   1105 C  CA  . ALA A 1 180 ? -6.388  -12.954 4.052   1.00 33.46  ? 507 ALA A CA  1 
ATOM   1106 C  C   . ALA A 1 180 ? -4.882  -13.081 4.031   1.00 33.77  ? 507 ALA A C   1 
ATOM   1107 O  O   . ALA A 1 180 ? -4.331  -13.787 4.873   1.00 33.04  ? 507 ALA A O   1 
ATOM   1108 C  CB  . ALA A 1 180 ? -7.022  -13.799 2.957   1.00 32.59  ? 507 ALA A CB  1 
ATOM   1109 N  N   . ALA A 1 181 ? -4.228  -12.362 3.110   1.00 34.60  ? 508 ALA A N   1 
ATOM   1110 C  CA  . ALA A 1 181 ? -2.775  -12.390 3.018   1.00 36.06  ? 508 ALA A CA  1 
ATOM   1111 C  C   . ALA A 1 181 ? -2.118  -11.847 4.293   1.00 36.92  ? 508 ALA A C   1 
ATOM   1112 O  O   . ALA A 1 181 ? -1.165  -12.445 4.781   1.00 37.22  ? 508 ALA A O   1 
ATOM   1113 C  CB  . ALA A 1 181 ? -2.273  -11.663 1.773   1.00 36.85  ? 508 ALA A CB  1 
ATOM   1114 N  N   . LEU A 1 182 ? -2.651  -10.752 4.840   1.00 38.42  ? 509 LEU A N   1 
ATOM   1115 C  CA  . LEU A 1 182 ? -2.132  -10.143 6.090   1.00 39.75  ? 509 LEU A CA  1 
ATOM   1116 C  C   . LEU A 1 182 ? -2.289  -10.978 7.367   1.00 38.58  ? 509 LEU A C   1 
ATOM   1117 O  O   . LEU A 1 182 ? -1.497  -10.845 8.290   1.00 39.57  ? 509 LEU A O   1 
ATOM   1118 C  CB  . LEU A 1 182 ? -2.744  -8.762  6.315   1.00 41.44  ? 509 LEU A CB  1 
ATOM   1119 C  CG  . LEU A 1 182 ? -2.321  -7.666  5.344   1.00 43.51  ? 509 LEU A CG  1 
ATOM   1120 C  CD1 . LEU A 1 182 ? -3.131  -6.407  5.612   1.00 45.74  ? 509 LEU A CD1 1 
ATOM   1121 C  CD2 . LEU A 1 182 ? -0.828  -7.384  5.427   1.00 44.21  ? 509 LEU A CD2 1 
ATOM   1122 N  N   . ALA A 1 183 ? -3.299  -11.841 7.407   1.00 37.38  ? 510 ALA A N   1 
ATOM   1123 C  CA  . ALA A 1 183 ? -3.437  -12.807 8.498   1.00 37.13  ? 510 ALA A CA  1 
ATOM   1124 C  C   . ALA A 1 183 ? -2.246  -13.766 8.548   1.00 36.73  ? 510 ALA A C   1 
ATOM   1125 O  O   . ALA A 1 183 ? -1.842  -14.191 9.627   1.00 36.21  ? 510 ALA A O   1 
ATOM   1126 C  CB  . ALA A 1 183 ? -4.744  -13.586 8.375   1.00 35.14  ? 510 ALA A CB  1 
ATOM   1127 N  N   . MET A 1 184 ? -1.705  -14.108 7.375   1.00 36.68  ? 511 MET A N   1 
ATOM   1128 C  CA  . MET A 1 184 ? -0.527  -14.978 7.302   1.00 36.95  ? 511 MET A CA  1 
ATOM   1129 C  C   . MET A 1 184 ? 0.825   -14.274 7.218   1.00 36.95  ? 511 MET A C   1 
ATOM   1130 O  O   . MET A 1 184 ? 1.791   -14.707 7.835   1.00 35.88  ? 511 MET A O   1 
ATOM   1131 C  CB  . MET A 1 184 ? -0.636  -15.979 6.158   1.00 37.63  ? 511 MET A CB  1 
ATOM   1132 C  CG  . MET A 1 184 ? 0.418   -17.061 6.343   1.00 40.26  ? 511 MET A CG  1 
ATOM   1133 S  SD  . MET A 1 184 ? 0.509   -18.309 5.090   1.00 43.06  ? 511 MET A SD  1 
ATOM   1134 C  CE  . MET A 1 184 ? 0.701   -17.268 3.643   1.00 44.19  ? 511 MET A CE  1 
ATOM   1135 N  N   . VAL A 1 185 ? 0.890   -13.220 6.423   1.00 37.91  ? 512 VAL A N   1 
ATOM   1136 C  CA  . VAL A 1 185 ? 2.140   -12.515 6.228   1.00 41.16  ? 512 VAL A CA  1 
ATOM   1137 C  C   . VAL A 1 185 ? 2.247   -11.436 7.299   1.00 43.24  ? 512 VAL A C   1 
ATOM   1138 O  O   . VAL A 1 185 ? 1.809   -10.293 7.130   1.00 45.56  ? 512 VAL A O   1 
ATOM   1139 C  CB  . VAL A 1 185 ? 2.288   -11.989 4.784   1.00 41.13  ? 512 VAL A CB  1 
ATOM   1140 C  CG1 . VAL A 1 185 ? 3.653   -11.343 4.591   1.00 42.91  ? 512 VAL A CG1 1 
ATOM   1141 C  CG2 . VAL A 1 185 ? 2.065   -13.129 3.790   1.00 39.17  ? 512 VAL A CG2 1 
ATOM   1142 N  N   . THR A 1 186 ? 2.810   -11.848 8.421   1.00 44.30  ? 513 THR A N   1 
ATOM   1143 C  CA  . THR A 1 186 ? 2.963   -11.008 9.609   1.00 47.34  ? 513 THR A CA  1 
ATOM   1144 C  C   . THR A 1 186 ? 4.196   -11.523 10.339  1.00 48.83  ? 513 THR A C   1 
ATOM   1145 O  O   . THR A 1 186 ? 4.546   -12.687 10.183  1.00 47.86  ? 513 THR A O   1 
ATOM   1146 C  CB  . THR A 1 186 ? 1.669   -11.033 10.495  1.00 46.24  ? 513 THR A CB  1 
ATOM   1147 O  OG1 . THR A 1 186 ? 1.779   -10.089 11.566  1.00 48.53  ? 513 THR A OG1 1 
ATOM   1148 C  CG2 . THR A 1 186 ? 1.359   -12.422 11.056  1.00 43.40  ? 513 THR A CG2 1 
ATOM   1149 N  N   . GLU A 1 187 ? 4.867   -10.666 11.106  1.00 53.47  ? 514 GLU A N   1 
ATOM   1150 C  CA  . GLU A 1 187 ? 6.045   -11.091 11.878  1.00 55.87  ? 514 GLU A CA  1 
ATOM   1151 C  C   . GLU A 1 187 ? 5.720   -12.073 13.002  1.00 55.20  ? 514 GLU A C   1 
ATOM   1152 O  O   . GLU A 1 187 ? 4.726   -11.924 13.722  1.00 55.06  ? 514 GLU A O   1 
ATOM   1153 C  CB  . GLU A 1 187 ? 6.842   -9.894  12.390  1.00 61.19  ? 514 GLU A CB  1 
ATOM   1154 C  CG  . GLU A 1 187 ? 8.013   -9.515  11.483  1.00 64.74  ? 514 GLU A CG  1 
ATOM   1155 C  CD  . GLU A 1 187 ? 8.377   -8.041  11.566  1.00 69.42  ? 514 GLU A CD  1 
ATOM   1156 O  OE1 . GLU A 1 187 ? 9.450   -7.723  12.142  1.00 71.68  ? 514 GLU A OE1 1 
ATOM   1157 O  OE2 . GLU A 1 187 ? 7.584   -7.203  11.059  1.00 70.36  ? 514 GLU A OE2 1 
ATOM   1158 N  N   . ARG A 1 188 ? 6.549   -13.107 13.096  1.00 54.83  ? 515 ARG A N   1 
ATOM   1159 C  CA  . ARG A 1 188 ? 6.411   -14.173 14.082  1.00 53.74  ? 515 ARG A CA  1 
ATOM   1160 C  C   . ARG A 1 188 ? 7.785   -14.373 14.677  1.00 56.56  ? 515 ARG A C   1 
ATOM   1161 O  O   . ARG A 1 188 ? 8.794   -14.187 13.990  1.00 58.75  ? 515 ARG A O   1 
ATOM   1162 C  CB  . ARG A 1 188 ? 5.960   -15.490 13.428  1.00 51.08  ? 515 ARG A CB  1 
ATOM   1163 C  CG  . ARG A 1 188 ? 4.674   -15.447 12.602  1.00 48.74  ? 515 ARG A CG  1 
ATOM   1164 C  CD  . ARG A 1 188 ? 3.429   -15.534 13.471  1.00 47.84  ? 515 ARG A CD  1 
ATOM   1165 N  NE  . ARG A 1 188 ? 2.210   -15.559 12.675  1.00 45.98  ? 515 ARG A NE  1 
ATOM   1166 C  CZ  . ARG A 1 188 ? 0.974   -15.373 13.145  1.00 45.81  ? 515 ARG A CZ  1 
ATOM   1167 N  NH1 . ARG A 1 188 ? 0.776   -15.120 14.433  1.00 45.99  ? 515 ARG A NH1 1 
ATOM   1168 N  NH2 . ARG A 1 188 ? -0.077  -15.426 12.310  1.00 43.16  ? 515 ARG A NH2 1 
ATOM   1169 N  N   . HIS A 1 189 ? 7.828   -14.745 15.952  1.00 57.79  ? 516 HIS A N   1 
ATOM   1170 C  CA  . HIS A 1 189 ? 9.076   -15.073 16.613  1.00 59.10  ? 516 HIS A CA  1 
ATOM   1171 C  C   . HIS A 1 189 ? 9.669   -16.321 15.973  1.00 57.11  ? 516 HIS A C   1 
ATOM   1172 O  O   . HIS A 1 189 ? 8.960   -17.302 15.749  1.00 55.10  ? 516 HIS A O   1 
ATOM   1173 C  CB  . HIS A 1 189 ? 8.858   -15.301 18.114  1.00 61.66  ? 516 HIS A CB  1 
ATOM   1174 C  CG  . HIS A 1 189 ? 10.128  -15.253 18.905  1.00 66.34  ? 516 HIS A CG  1 
ATOM   1175 N  ND1 . HIS A 1 189 ? 10.880  -16.377 19.178  1.00 67.36  ? 516 HIS A ND1 1 
ATOM   1176 C  CD2 . HIS A 1 189 ? 10.805  -14.207 19.437  1.00 69.15  ? 516 HIS A CD2 1 
ATOM   1177 C  CE1 . HIS A 1 189 ? 11.953  -16.029 19.865  1.00 70.31  ? 516 HIS A CE1 1 
ATOM   1178 N  NE2 . HIS A 1 189 ? 11.931  -14.718 20.037  1.00 72.14  ? 516 HIS A NE2 1 
ATOM   1179 N  N   . GLY A 1 190 ? 10.962  -16.270 15.668  1.00 57.83  ? 517 GLY A N   1 
ATOM   1180 C  CA  . GLY A 1 190 ? 11.654  -17.395 15.033  1.00 56.78  ? 517 GLY A CA  1 
ATOM   1181 C  C   . GLY A 1 190 ? 11.780  -17.335 13.516  1.00 55.56  ? 517 GLY A C   1 
ATOM   1182 O  O   . GLY A 1 190 ? 12.209  -18.316 12.896  1.00 56.14  ? 517 GLY A O   1 
ATOM   1183 N  N   . LEU A 1 191 ? 11.400  -16.206 12.910  1.00 53.42  ? 518 LEU A N   1 
ATOM   1184 C  CA  . LEU A 1 191 ? 11.632  -16.005 11.476  1.00 52.84  ? 518 LEU A CA  1 
ATOM   1185 C  C   . LEU A 1 191 ? 13.109  -15.757 11.161  1.00 56.07  ? 518 LEU A C   1 
ATOM   1186 O  O   . LEU A 1 191 ? 13.788  -14.960 11.831  1.00 58.19  ? 518 LEU A O   1 
ATOM   1187 C  CB  . LEU A 1 191 ? 10.759  -14.886 10.893  1.00 50.80  ? 518 LEU A CB  1 
ATOM   1188 C  CG  . LEU A 1 191 ? 9.251   -15.105 10.718  1.00 46.91  ? 518 LEU A CG  1 
ATOM   1189 C  CD1 . LEU A 1 191 ? 8.597   -13.756 10.490  1.00 46.50  ? 518 LEU A CD1 1 
ATOM   1190 C  CD2 . LEU A 1 191 ? 8.886   -16.087 9.603   1.00 44.89  ? 518 LEU A CD2 1 
ATOM   1191 N  N   . LYS A 1 192 ? 13.593  -16.466 10.145  1.00 56.68  ? 519 LYS A N   1 
ATOM   1192 C  CA  . LYS A 1 192 ? 14.955  -16.299 9.645   1.00 59.71  ? 519 LYS A CA  1 
ATOM   1193 C  C   . LYS A 1 192 ? 15.078  -15.014 8.836   1.00 60.67  ? 519 LYS A C   1 
ATOM   1194 O  O   . LYS A 1 192 ? 16.134  -14.398 8.824   1.00 63.74  ? 519 LYS A O   1 
ATOM   1195 C  CB  . LYS A 1 192 ? 15.356  -17.495 8.788   1.00 60.30  ? 519 LYS A CB  1 
ATOM   1196 C  CG  . LYS A 1 192 ? 15.322  -18.819 9.530   1.00 59.90  ? 519 LYS A CG  1 
ATOM   1197 C  CD  . LYS A 1 192 ? 15.254  -19.974 8.547   1.00 60.03  ? 519 LYS A CD  1 
ATOM   1198 C  CE  . LYS A 1 192 ? 16.092  -21.145 9.034   1.00 62.69  ? 519 LYS A CE  1 
ATOM   1199 N  NZ  . LYS A 1 192 ? 17.557  -20.812 9.030   1.00 67.58  ? 519 LYS A NZ  1 
ATOM   1200 N  N   . GLU A 1 193 ? 13.997  -14.609 8.163   1.00 58.84  ? 520 GLU A N   1 
ATOM   1201 C  CA  . GLU A 1 193 ? 14.017  -13.388 7.337   1.00 60.61  ? 520 GLU A CA  1 
ATOM   1202 C  C   . GLU A 1 193 ? 12.847  -12.420 7.613   1.00 58.01  ? 520 GLU A C   1 
ATOM   1203 O  O   . GLU A 1 193 ? 12.037  -12.154 6.718   1.00 56.12  ? 520 GLU A O   1 
ATOM   1204 C  CB  . GLU A 1 193 ? 14.183  -13.729 5.834   1.00 62.42  ? 520 GLU A CB  1 
ATOM   1205 C  CG  . GLU A 1 193 ? 15.312  -14.736 5.574   1.00 65.85  ? 520 GLU A CG  1 
ATOM   1206 C  CD  . GLU A 1 193 ? 16.071  -14.532 4.283   1.00 69.37  ? 520 GLU A CD  1 
ATOM   1207 O  OE1 . GLU A 1 193 ? 15.412  -14.205 3.260   1.00 69.53  ? 520 GLU A OE1 1 
ATOM   1208 O  OE2 . GLU A 1 193 ? 17.319  -14.736 4.304   1.00 71.89  ? 520 GLU A OE2 1 
ATOM   1209 N  N   . PRO A 1 194 ? 12.790  -11.861 8.848   1.00 58.16  ? 521 PRO A N   1 
ATOM   1210 C  CA  . PRO A 1 194 ? 11.637  -11.051 9.270   1.00 56.61  ? 521 PRO A CA  1 
ATOM   1211 C  C   . PRO A 1 194 ? 11.445  -9.754  8.486   1.00 57.62  ? 521 PRO A C   1 
ATOM   1212 O  O   . PRO A 1 194 ? 10.296  -9.354  8.256   1.00 56.49  ? 521 PRO A O   1 
ATOM   1213 C  CB  . PRO A 1 194 ? 11.924  -10.755 10.751  1.00 58.05  ? 521 PRO A CB  1 
ATOM   1214 C  CG  . PRO A 1 194 ? 13.400  -10.889 10.903  1.00 60.62  ? 521 PRO A CG  1 
ATOM   1215 C  CD  . PRO A 1 194 ? 13.832  -11.917 9.903   1.00 60.22  ? 521 PRO A CD  1 
ATOM   1216 N  N   . LYS A 1 195 ? 12.546  -9.112  8.091   1.00 60.41  ? 522 LYS A N   1 
ATOM   1217 C  CA  . LYS A 1 195 ? 12.500  -7.907  7.258   1.00 61.94  ? 522 LYS A CA  1 
ATOM   1218 C  C   . LYS A 1 195 ? 11.797  -8.171  5.927   1.00 59.77  ? 522 LYS A C   1 
ATOM   1219 O  O   . LYS A 1 195 ? 11.053  -7.322  5.461   1.00 59.49  ? 522 LYS A O   1 
ATOM   1220 C  CB  . LYS A 1 195 ? 13.898  -7.308  7.032   1.00 65.39  ? 522 LYS A CB  1 
ATOM   1221 C  CG  . LYS A 1 195 ? 14.362  -6.408  8.169   1.00 68.40  ? 522 LYS A CG  1 
ATOM   1222 C  CD  . LYS A 1 195 ? 15.884  -6.243  8.208   1.00 71.90  ? 522 LYS A CD  1 
ATOM   1223 C  CE  . LYS A 1 195 ? 16.349  -5.749  9.574   1.00 73.80  ? 522 LYS A CE  1 
ATOM   1224 N  NZ  . LYS A 1 195 ? 17.811  -5.449  9.615   1.00 77.89  ? 522 LYS A NZ  1 
ATOM   1225 N  N   . ARG A 1 196 ? 12.023  -9.348  5.344   1.00 58.80  ? 523 ARG A N   1 
ATOM   1226 C  CA  . ARG A 1 196 ? 11.349  -9.752  4.110   1.00 58.18  ? 523 ARG A CA  1 
ATOM   1227 C  C   . ARG A 1 196 ? 9.838   -9.872  4.311   1.00 54.35  ? 523 ARG A C   1 
ATOM   1228 O  O   . ARG A 1 196 ? 9.062   -9.382  3.489   1.00 53.68  ? 523 ARG A O   1 
ATOM   1229 C  CB  . ARG A 1 196 ? 11.913  -11.064 3.593   1.00 59.17  ? 523 ARG A CB  1 
ATOM   1230 C  CG  . ARG A 1 196 ? 11.979  -11.137 2.084   1.00 61.72  ? 523 ARG A CG  1 
ATOM   1231 C  CD  . ARG A 1 196 ? 13.162  -12.011 1.706   1.00 65.03  ? 523 ARG A CD  1 
ATOM   1232 N  NE  . ARG A 1 196 ? 13.665  -11.771 0.350   1.00 68.34  ? 523 ARG A NE  1 
ATOM   1233 C  CZ  . ARG A 1 196 ? 13.112  -12.253 -0.763  1.00 67.75  ? 523 ARG A CZ  1 
ATOM   1234 N  NH1 . ARG A 1 196 ? 12.013  -12.993 -0.690  1.00 64.31  ? 523 ARG A NH1 1 
ATOM   1235 N  NH2 . ARG A 1 196 ? 13.663  -11.992 -1.955  1.00 70.72  ? 523 ARG A NH2 1 
ATOM   1236 N  N   . VAL A 1 197 ? 9.450   -10.503 5.419   1.00 52.08  ? 524 VAL A N   1 
ATOM   1237 C  CA  . VAL A 1 197 ? 8.049   -10.647 5.823   1.00 49.50  ? 524 VAL A CA  1 
ATOM   1238 C  C   . VAL A 1 197 ? 7.440   -9.272  6.104   1.00 50.66  ? 524 VAL A C   1 
ATOM   1239 O  O   . VAL A 1 197 ? 6.342   -8.978  5.640   1.00 49.29  ? 524 VAL A O   1 
ATOM   1240 C  CB  . VAL A 1 197 ? 7.884   -11.615 7.029   1.00 47.46  ? 524 VAL A CB  1 
ATOM   1241 C  CG1 . VAL A 1 197 ? 6.423   -11.754 7.435   1.00 44.87  ? 524 VAL A CG1 1 
ATOM   1242 C  CG2 . VAL A 1 197 ? 8.450   -12.994 6.705   1.00 46.42  ? 524 VAL A CG2 1 
ATOM   1243 N  N   . GLU A 1 198 ? 8.173   -8.437  6.843   1.00 53.98  ? 525 GLU A N   1 
ATOM   1244 C  CA  . GLU A 1 198 ? 7.772   -7.054  7.115   1.00 56.20  ? 525 GLU A CA  1 
ATOM   1245 C  C   . GLU A 1 198 ? 7.551   -6.276  5.824   1.00 57.27  ? 525 GLU A C   1 
ATOM   1246 O  O   . GLU A 1 198 ? 6.536   -5.583  5.706   1.00 57.49  ? 525 GLU A O   1 
ATOM   1247 C  CB  . GLU A 1 198 ? 8.796   -6.318  7.997   1.00 59.37  ? 525 GLU A CB  1 
ATOM   1248 C  CG  . GLU A 1 198 ? 8.221   -5.085  8.685   1.00 61.75  ? 525 GLU A CG  1 
ATOM   1249 C  CD  . GLU A 1 198 ? 9.261   -4.069  9.126   1.00 66.82  ? 525 GLU A CD  1 
ATOM   1250 O  OE1 . GLU A 1 198 ? 10.313  -4.442  9.708   1.00 68.25  ? 525 GLU A OE1 1 
ATOM   1251 O  OE2 . GLU A 1 198 ? 9.008   -2.867  8.903   1.00 69.54  ? 525 GLU A OE2 1 
ATOM   1252 N  N   . GLU A 1 199 ? 8.489   -6.402  4.876   1.00 58.14  ? 526 GLU A N   1 
ATOM   1253 C  CA  . GLU A 1 199 ? 8.405   -5.712  3.591   1.00 59.89  ? 526 GLU A CA  1 
ATOM   1254 C  C   . GLU A 1 199 ? 7.164   -6.163  2.814   1.00 57.06  ? 526 GLU A C   1 
ATOM   1255 O  O   . GLU A 1 199 ? 6.398   -5.313  2.332   1.00 57.25  ? 526 GLU A O   1 
ATOM   1256 C  CB  . GLU A 1 199 ? 9.692   -5.870  2.763   1.00 63.20  ? 526 GLU A CB  1 
ATOM   1257 C  CG  . GLU A 1 199 ? 10.850  -4.974  3.235   1.00 69.15  ? 526 GLU A CG  1 
ATOM   1258 C  CD  . GLU A 1 199 ? 12.251  -5.412  2.772   1.00 72.25  ? 526 GLU A CD  1 
ATOM   1259 O  OE1 . GLU A 1 199 ? 13.204  -4.593  2.877   1.00 76.26  ? 526 GLU A OE1 1 
ATOM   1260 O  OE2 . GLU A 1 199 ? 12.418  -6.565  2.306   1.00 71.58  ? 526 GLU A OE2 1 
ATOM   1261 N  N   . LEU A 1 200 ? 6.953   -7.483  2.732   1.00 53.73  ? 527 LEU A N   1 
ATOM   1262 C  CA  . LEU A 1 200 ? 5.798   -8.037  2.020   1.00 51.47  ? 527 LEU A CA  1 
ATOM   1263 C  C   . LEU A 1 200 ? 4.464   -7.631  2.661   1.00 49.98  ? 527 LEU A C   1 
ATOM   1264 O  O   . LEU A 1 200 ? 3.515   -7.302  1.940   1.00 49.43  ? 527 LEU A O   1 
ATOM   1265 C  CB  . LEU A 1 200 ? 5.897   -9.564  1.809   1.00 49.69  ? 527 LEU A CB  1 
ATOM   1266 C  CG  . LEU A 1 200 ? 4.691   -10.257 1.120   1.00 48.18  ? 527 LEU A CG  1 
ATOM   1267 C  CD1 . LEU A 1 200 ? 4.374   -9.692  -0.265  1.00 49.48  ? 527 LEU A CD1 1 
ATOM   1268 C  CD2 . LEU A 1 200 ? 4.866   -11.767 1.046   1.00 46.74  ? 527 LEU A CD2 1 
ATOM   1269 N  N   . GLN A 1 201 ? 4.414   -7.641  3.995   1.00 48.94  ? 528 GLN A N   1 
ATOM   1270 C  CA  . GLN A 1 201 ? 3.230   -7.236  4.749   1.00 48.36  ? 528 GLN A CA  1 
ATOM   1271 C  C   . GLN A 1 201 ? 2.817   -5.796  4.429   1.00 50.84  ? 528 GLN A C   1 
ATOM   1272 O  O   . GLN A 1 201 ? 1.666   -5.544  4.079   1.00 50.79  ? 528 GLN A O   1 
ATOM   1273 C  CB  . GLN A 1 201 ? 3.477   -7.422  6.246   1.00 48.65  ? 528 GLN A CB  1 
ATOM   1274 C  CG  . GLN A 1 201 ? 2.406   -6.866  7.172   1.00 48.98  ? 528 GLN A CG  1 
ATOM   1275 C  CD  . GLN A 1 201 ? 2.892   -6.770  8.599   1.00 50.09  ? 528 GLN A CD  1 
ATOM   1276 O  OE1 . GLN A 1 201 ? 3.827   -6.033  8.902   1.00 53.46  ? 528 GLN A OE1 1 
ATOM   1277 N  NE2 . GLN A 1 201 ? 2.274   -7.525  9.482   1.00 48.78  ? 528 GLN A NE2 1 
ATOM   1278 N  N   . ASN A 1 202 ? 3.761   -4.863  4.519   1.00 53.66  ? 529 ASN A N   1 
ATOM   1279 C  CA  . ASN A 1 202 ? 3.482   -3.451  4.235   1.00 56.36  ? 529 ASN A CA  1 
ATOM   1280 C  C   . ASN A 1 202 ? 3.047   -3.177  2.770   1.00 56.44  ? 529 ASN A C   1 
ATOM   1281 O  O   . ASN A 1 202 ? 2.216   -2.290  2.514   1.00 57.57  ? 529 ASN A O   1 
ATOM   1282 C  CB  . ASN A 1 202 ? 4.667   -2.565  4.681   1.00 59.90  ? 529 ASN A CB  1 
ATOM   1283 C  CG  . ASN A 1 202 ? 4.964   -2.679  6.183   1.00 60.40  ? 529 ASN A CG  1 
ATOM   1284 O  OD1 . ASN A 1 202 ? 4.142   -3.175  6.975   1.00 58.83  ? 529 ASN A OD1 1 
ATOM   1285 N  ND2 . ASN A 1 202 ? 6.146   -2.222  6.582   1.00 62.92  ? 529 ASN A ND2 1 
ATOM   1286 N  N   . LYS A 1 203 ? 3.595   -3.952  1.832   1.00 54.89  ? 530 LYS A N   1 
ATOM   1287 C  CA  . LYS A 1 203 ? 3.195   -3.902  0.434   1.00 55.35  ? 530 LYS A CA  1 
ATOM   1288 C  C   . LYS A 1 203 ? 1.718   -4.278  0.269   1.00 53.45  ? 530 LYS A C   1 
ATOM   1289 O  O   . LYS A 1 203 ? 1.011   -3.646  -0.514  1.00 54.42  ? 530 LYS A O   1 
ATOM   1290 C  CB  . LYS A 1 203 ? 4.041   -4.853  -0.402  1.00 54.71  ? 530 LYS A CB  1 
ATOM   1291 C  CG  . LYS A 1 203 ? 5.363   -4.330  -0.920  1.00 57.56  ? 530 LYS A CG  1 
ATOM   1292 C  CD  . LYS A 1 203 ? 6.254   -5.538  -1.149  1.00 56.61  ? 530 LYS A CD  1 
ATOM   1293 C  CE  . LYS A 1 203 ? 7.002   -5.475  -2.466  1.00 58.84  ? 530 LYS A CE  1 
ATOM   1294 N  NZ  . LYS A 1 203 ? 8.433   -5.150  -2.241  1.00 61.31  ? 530 LYS A NZ  1 
ATOM   1295 N  N   . ILE A 1 204 ? 1.276   -5.305  1.009   1.00 51.03  ? 531 ILE A N   1 
ATOM   1296 C  CA  . ILE A 1 204 ? -0.127  -5.739  1.042   1.00 49.24  ? 531 ILE A CA  1 
ATOM   1297 C  C   . ILE A 1 204 ? -1.006  -4.683  1.745   1.00 51.19  ? 531 ILE A C   1 
ATOM   1298 O  O   . ILE A 1 204 ? -2.118  -4.384  1.282   1.00 51.29  ? 531 ILE A O   1 
ATOM   1299 C  CB  . ILE A 1 204 ? -0.280  -7.150  1.684   1.00 46.40  ? 531 ILE A CB  1 
ATOM   1300 C  CG1 . ILE A 1 204 ? 0.605   -8.179  0.959   1.00 45.27  ? 531 ILE A CG1 1 
ATOM   1301 C  CG2 . ILE A 1 204 ? -1.745  -7.617  1.686   1.00 44.25  ? 531 ILE A CG2 1 
ATOM   1302 C  CD1 . ILE A 1 204 ? 0.860   -9.455  1.737   1.00 42.77  ? 531 ILE A CD1 1 
ATOM   1303 N  N   . VAL A 1 205 ? -0.499  -4.117  2.845   1.00 53.11  ? 532 VAL A N   1 
ATOM   1304 C  CA  . VAL A 1 205 ? -1.189  -3.032  3.571   1.00 55.80  ? 532 VAL A CA  1 
ATOM   1305 C  C   . VAL A 1 205 ? -1.492  -1.871  2.611   1.00 59.39  ? 532 VAL A C   1 
ATOM   1306 O  O   . VAL A 1 205 ? -2.647  -1.451  2.487   1.00 59.87  ? 532 VAL A O   1 
ATOM   1307 C  CB  . VAL A 1 205 ? -0.408  -2.568  4.840   1.00 57.24  ? 532 VAL A CB  1 
ATOM   1308 C  CG1 . VAL A 1 205 ? -1.008  -1.309  5.443   1.00 59.88  ? 532 VAL A CG1 1 
ATOM   1309 C  CG2 . VAL A 1 205 ? -0.387  -3.663  5.904   1.00 54.51  ? 532 VAL A CG2 1 
ATOM   1310 N  N   . ASN A 1 206 ? -0.462  -1.396  1.909   1.00 62.23  ? 533 ASN A N   1 
ATOM   1311 C  CA  . ASN A 1 206 ? -0.600  -0.306  0.934   1.00 66.07  ? 533 ASN A CA  1 
ATOM   1312 C  C   . ASN A 1 206 ? -1.513  -0.629  -0.280  1.00 65.86  ? 533 ASN A C   1 
ATOM   1313 O  O   . ASN A 1 206 ? -2.196  0.266   -0.778  1.00 68.03  ? 533 ASN A O   1 
ATOM   1314 C  CB  . ASN A 1 206 ? 0.781   0.208   0.495   1.00 68.38  ? 533 ASN A CB  1 
ATOM   1315 C  CG  . ASN A 1 206 ? 1.589   0.808   1.648   1.00 70.64  ? 533 ASN A CG  1 
ATOM   1316 O  OD1 . ASN A 1 206 ? 1.069   1.106   2.731   1.00 71.12  ? 533 ASN A OD1 1 
ATOM   1317 N  ND2 . ASN A 1 206 ? 2.877   0.990   1.411   1.00 72.27  ? 533 ASN A ND2 1 
ATOM   1318 N  N   . CYS A 1 207 ? -1.511  -1.888  -0.735  1.00 63.45  ? 534 CYS A N   1 
ATOM   1319 C  CA  . CYS A 1 207 ? -2.478  -2.412  -1.719  1.00 63.63  ? 534 CYS A CA  1 
ATOM   1320 C  C   . CYS A 1 207 ? -3.921  -2.192  -1.284  1.00 62.20  ? 534 CYS A C   1 
ATOM   1321 O  O   . CYS A 1 207 ? -4.758  -1.708  -2.050  1.00 62.44  ? 534 CYS A O   1 
ATOM   1322 C  CB  . CYS A 1 207 ? -2.298  -3.926  -1.882  1.00 62.82  ? 534 CYS A CB  1 
ATOM   1323 S  SG  . CYS A 1 207 ? -1.249  -4.459  -3.242  1.00 69.21  ? 534 CYS A SG  1 
ATOM   1324 N  N   . LEU A 1 208 ? -4.188  -2.606  -0.049  1.00 60.41  ? 535 LEU A N   1 
ATOM   1325 C  CA  . LEU A 1 208 ? -5.477  -2.487  0.593   1.00 59.63  ? 535 LEU A CA  1 
ATOM   1326 C  C   . LEU A 1 208 ? -5.840  -1.015  0.742   1.00 63.76  ? 535 LEU A C   1 
ATOM   1327 O  O   . LEU A 1 208 ? -6.960  -0.632  0.401   1.00 64.78  ? 535 LEU A O   1 
ATOM   1328 C  CB  . LEU A 1 208 ? -5.439  -3.208  1.942   1.00 56.53  ? 535 LEU A CB  1 
ATOM   1329 C  CG  . LEU A 1 208 ? -6.665  -3.340  2.843   1.00 55.76  ? 535 LEU A CG  1 
ATOM   1330 C  CD1 . LEU A 1 208 ? -7.841  -3.989  2.132   1.00 54.43  ? 535 LEU A CD1 1 
ATOM   1331 C  CD2 . LEU A 1 208 ? -6.288  -4.144  4.072   1.00 53.08  ? 535 LEU A CD2 1 
ATOM   1332 N  N   . LYS A 1 209 ? -4.881  -0.205  1.212   1.00 67.15  ? 536 LYS A N   1 
ATOM   1333 C  CA  . LYS A 1 209 ? -5.035  1.261   1.351   1.00 72.09  ? 536 LYS A CA  1 
ATOM   1334 C  C   . LYS A 1 209 ? -5.479  1.912   0.047   1.00 74.39  ? 536 LYS A C   1 
ATOM   1335 O  O   . LYS A 1 209 ? -6.503  2.595   0.017   1.00 76.33  ? 536 LYS A O   1 
ATOM   1336 C  CB  . LYS A 1 209 ? -3.746  1.927   1.866   1.00 74.44  ? 536 LYS A CB  1 
ATOM   1337 C  CG  . LYS A 1 209 ? -3.447  1.653   3.332   1.00 74.37  ? 536 LYS A CG  1 
ATOM   1338 C  CD  . LYS A 1 209 ? -2.434  2.628   3.919   1.00 77.98  ? 536 LYS A CD  1 
ATOM   1339 C  CE  . LYS A 1 209 ? -2.094  2.259   5.361   1.00 77.44  ? 536 LYS A CE  1 
ATOM   1340 N  NZ  . LYS A 1 209 ? -1.237  3.277   6.038   1.00 81.77  ? 536 LYS A NZ  1 
ATOM   1341 N  N   . ASP A 1 210 ? -4.713  1.665   -1.018  1.00 75.05  ? 537 ASP A N   1 
ATOM   1342 C  CA  . ASP A 1 210 ? -5.000  2.178   -2.356  1.00 78.32  ? 537 ASP A CA  1 
ATOM   1343 C  C   . ASP A 1 210 ? -6.367  1.711   -2.863  1.00 77.35  ? 537 ASP A C   1 
ATOM   1344 O  O   . ASP A 1 210 ? -7.124  2.512   -3.418  1.00 79.98  ? 537 ASP A O   1 
ATOM   1345 C  CB  . ASP A 1 210 ? -3.900  1.783   -3.356  1.00 78.72  ? 537 ASP A CB  1 
ATOM   1346 C  CG  . ASP A 1 210 ? -2.512  2.299   -2.970  1.00 81.49  ? 537 ASP A CG  1 
ATOM   1347 O  OD1 . ASP A 1 210 ? -2.390  3.326   -2.256  1.00 84.67  ? 537 ASP A OD1 1 
ATOM   1348 O  OD2 . ASP A 1 210 ? -1.528  1.652   -3.394  1.00 80.53  ? 537 ASP A OD2 1 
ATOM   1349 N  N   . HIS A 1 211 ? -6.681  0.430   -2.657  1.00 73.71  ? 538 HIS A N   1 
ATOM   1350 C  CA  . HIS A 1 211 ? -7.983  -0.119  -3.045  1.00 72.89  ? 538 HIS A CA  1 
ATOM   1351 C  C   . HIS A 1 211 ? -9.157  0.505   -2.274  1.00 74.68  ? 538 HIS A C   1 
ATOM   1352 O  O   . HIS A 1 211 ? -10.215 0.752   -2.864  1.00 75.85  ? 538 HIS A O   1 
ATOM   1353 C  CB  . HIS A 1 211 ? -8.022  -1.649  -2.934  1.00 68.63  ? 538 HIS A CB  1 
ATOM   1354 C  CG  . HIS A 1 211 ? -9.253  -2.251  -3.531  1.00 67.43  ? 538 HIS A CG  1 
ATOM   1355 N  ND1 . HIS A 1 211 ? -10.393 -2.497  -2.795  1.00 66.61  ? 538 HIS A ND1 1 
ATOM   1356 C  CD2 . HIS A 1 211 ? -9.543  -2.605  -4.806  1.00 67.50  ? 538 HIS A CD2 1 
ATOM   1357 C  CE1 . HIS A 1 211 ? -11.326 -2.993  -3.589  1.00 65.96  ? 538 HIS A CE1 1 
ATOM   1358 N  NE2 . HIS A 1 211 ? -10.836 -3.068  -4.813  1.00 66.80  ? 538 HIS A NE2 1 
ATOM   1359 N  N   . VAL A 1 212 ? -8.965  0.752   -0.975  1.00 74.98  ? 539 VAL A N   1 
ATOM   1360 C  CA  . VAL A 1 212 ? -9.991  1.371   -0.126  1.00 77.83  ? 539 VAL A CA  1 
ATOM   1361 C  C   . VAL A 1 212 ? -10.322 2.785   -0.640  1.00 84.02  ? 539 VAL A C   1 
ATOM   1362 O  O   . VAL A 1 212 ? -11.500 3.124   -0.816  1.00 86.43  ? 539 VAL A O   1 
ATOM   1363 C  CB  . VAL A 1 212 ? -9.607  1.302   1.384   1.00 77.19  ? 539 VAL A CB  1 
ATOM   1364 C  CG1 . VAL A 1 212 ? -10.249 2.411   2.218   1.00 81.10  ? 539 VAL A CG1 1 
ATOM   1365 C  CG2 . VAL A 1 212 ? -9.978  -0.062  1.956   1.00 73.46  ? 539 VAL A CG2 1 
ATOM   1366 N  N   . THR A 1 213 ? -9.277  3.568   -0.924  1.00 86.95  ? 540 THR A N   1 
ATOM   1367 C  CA  . THR A 1 213 ? -9.393  4.898   -1.535  1.00 92.11  ? 540 THR A CA  1 
ATOM   1368 C  C   . THR A 1 213 ? -10.006 4.832   -2.956  1.00 93.53  ? 540 THR A C   1 
ATOM   1369 O  O   . THR A 1 213 ? -10.706 5.756   -3.372  1.00 96.94  ? 540 THR A O   1 
ATOM   1370 C  CB  . THR A 1 213 ? -8.022  5.625   -1.529  1.00 94.14  ? 540 THR A CB  1 
ATOM   1371 O  OG1 . THR A 1 213 ? -7.337  5.351   -0.295  1.00 91.93  ? 540 THR A OG1 1 
ATOM   1372 C  CG2 . THR A 1 213 ? -8.186  7.137   -1.687  1.00 98.72  ? 540 THR A CG2 1 
ATOM   1373 N  N   . PHE A 1 214 ? -9.767  3.714   -3.650  1.00 92.10  ? 541 PHE A N   1 
ATOM   1374 C  CA  . PHE A 1 214 ? -10.252 3.406   -5.021  1.00 93.61  ? 541 PHE A CA  1 
ATOM   1375 C  C   . PHE A 1 214 ? -9.982  4.460   -6.084  1.00 96.62  ? 541 PHE A C   1 
ATOM   1376 O  O   . PHE A 1 214 ? -9.832  4.128   -7.258  1.00 96.50  ? 541 PHE A O   1 
ATOM   1377 C  CB  . PHE A 1 214 ? -11.722 2.891   -5.070  1.00 94.62  ? 541 PHE A CB  1 
ATOM   1378 C  CG  . PHE A 1 214 ? -12.759 3.893   -4.611  1.00 100.28 ? 541 PHE A CG  1 
ATOM   1379 C  CD1 . PHE A 1 214 ? -13.160 4.960   -5.438  1.00 105.79 ? 541 PHE A CD1 1 
ATOM   1380 C  CD2 . PHE A 1 214 ? -13.360 3.760   -3.354  1.00 100.67 ? 541 PHE A CD2 1 
ATOM   1381 C  CE1 . PHE A 1 214 ? -14.115 5.886   -5.006  1.00 110.26 ? 541 PHE A CE1 1 
ATOM   1382 C  CE2 . PHE A 1 214 ? -14.318 4.679   -2.918  1.00 104.90 ? 541 PHE A CE2 1 
ATOM   1383 C  CZ  . PHE A 1 214 ? -14.697 5.741   -3.745  1.00 109.81 ? 541 PHE A CZ  1 
ATOM   1384 N  N   . PRO A 1 222 ? -10.525 6.212   4.983   1.00 100.76 ? 549 PRO A N   1 
ATOM   1385 C  CA  . PRO A 1 222 ? -9.578  5.938   6.065   1.00 99.32  ? 549 PRO A CA  1 
ATOM   1386 C  C   . PRO A 1 222 ? -10.202 5.185   7.250   1.00 96.98  ? 549 PRO A C   1 
ATOM   1387 O  O   . PRO A 1 222 ? -9.514  4.394   7.903   1.00 93.22  ? 549 PRO A O   1 
ATOM   1388 C  CB  . PRO A 1 222 ? -9.138  7.343   6.497   1.00 104.83 ? 549 PRO A CB  1 
ATOM   1389 C  CG  . PRO A 1 222 ? -9.253  8.172   5.253   1.00 107.47 ? 549 PRO A CG  1 
ATOM   1390 C  CD  . PRO A 1 222 ? -10.370 7.576   4.433   1.00 105.66 ? 549 PRO A CD  1 
ATOM   1391 N  N   . ASN A 1 223 ? -11.490 5.438   7.499   1.00 98.96  ? 550 ASN A N   1 
ATOM   1392 C  CA  . ASN A 1 223 ? -12.248 4.903   8.644   1.00 98.52  ? 550 ASN A CA  1 
ATOM   1393 C  C   . ASN A 1 223 ? -12.420 3.381   8.570   1.00 93.50  ? 550 ASN A C   1 
ATOM   1394 O  O   . ASN A 1 223 ? -12.080 2.653   9.510   1.00 90.93  ? 550 ASN A O   1 
ATOM   1395 C  CB  . ASN A 1 223 ? -13.622 5.600   8.705   1.00 102.37 ? 550 ASN A CB  1 
ATOM   1396 C  CG  . ASN A 1 223 ? -14.318 5.436   10.048  1.00 103.51 ? 550 ASN A CG  1 
ATOM   1397 O  OD1 . ASN A 1 223 ? -14.788 4.346   10.395  1.00 99.41  ? 550 ASN A OD1 1 
ATOM   1398 N  ND2 . ASN A 1 223 ? -14.420 6.535   10.796  1.00 107.28 ? 550 ASN A ND2 1 
ATOM   1399 N  N   . TYR A 1 224 ? -12.938 2.940   7.424   1.00 91.89  ? 551 TYR A N   1 
ATOM   1400 C  CA  . TYR A 1 224 ? -13.261 1.559   7.091   1.00 86.53  ? 551 TYR A CA  1 
ATOM   1401 C  C   . TYR A 1 224 ? -12.042 0.624   7.171   1.00 82.88  ? 551 TYR A C   1 
ATOM   1402 O  O   . TYR A 1 224 ? -12.194 -0.559  7.486   1.00 80.59  ? 551 TYR A O   1 
ATOM   1403 C  CB  . TYR A 1 224 ? -13.884 1.573   5.686   1.00 87.49  ? 551 TYR A CB  1 
ATOM   1404 C  CG  . TYR A 1 224 ? -14.473 0.285   5.137   1.00 85.13  ? 551 TYR A CG  1 
ATOM   1405 C  CD1 . TYR A 1 224 ? -15.636 -0.285  5.686   1.00 85.05  ? 551 TYR A CD1 1 
ATOM   1406 C  CD2 . TYR A 1 224 ? -13.900 -0.332  4.015   1.00 82.98  ? 551 TYR A CD2 1 
ATOM   1407 C  CE1 . TYR A 1 224 ? -16.181 -1.456  5.156   1.00 82.77  ? 551 TYR A CE1 1 
ATOM   1408 C  CE2 . TYR A 1 224 ? -14.435 -1.500  3.478   1.00 80.96  ? 551 TYR A CE2 1 
ATOM   1409 C  CZ  . TYR A 1 224 ? -15.575 -2.056  4.046   1.00 80.69  ? 551 TYR A CZ  1 
ATOM   1410 O  OH  . TYR A 1 224 ? -16.096 -3.207  3.499   1.00 77.77  ? 551 TYR A OH  1 
ATOM   1411 N  N   . LEU A 1 225 ? -10.846 1.168   6.915   1.00 82.23  ? 552 LEU A N   1 
ATOM   1412 C  CA  . LEU A 1 225 ? -9.575  0.424   6.955   1.00 78.18  ? 552 LEU A CA  1 
ATOM   1413 C  C   . LEU A 1 225 ? -9.259  -0.164  8.329   1.00 76.46  ? 552 LEU A C   1 
ATOM   1414 O  O   . LEU A 1 225 ? -8.828  -1.322  8.430   1.00 73.99  ? 552 LEU A O   1 
ATOM   1415 C  CB  . LEU A 1 225 ? -8.409  1.325   6.523   1.00 80.09  ? 552 LEU A CB  1 
ATOM   1416 C  CG  . LEU A 1 225 ? -7.197  0.847   5.700   1.00 77.92  ? 552 LEU A CG  1 
ATOM   1417 C  CD1 . LEU A 1 225 ? -6.178  1.976   5.670   1.00 81.11  ? 552 LEU A CD1 1 
ATOM   1418 C  CD2 . LEU A 1 225 ? -6.527  -0.435  6.179   1.00 74.10  ? 552 LEU A CD2 1 
ATOM   1419 N  N   . SER A 1 226 ? -9.453  0.640   9.372   1.00 78.76  ? 553 SER A N   1 
ATOM   1420 C  CA  . SER A 1 226 ? -9.211  0.212   10.755  1.00 77.60  ? 553 SER A CA  1 
ATOM   1421 C  C   . SER A 1 226 ? -10.139 -0.943  11.156  1.00 74.23  ? 553 SER A C   1 
ATOM   1422 O  O   . SER A 1 226 ? -9.675  -1.930  11.741  1.00 71.24  ? 553 SER A O   1 
ATOM   1423 C  CB  . SER A 1 226 ? -9.333  1.394   11.728  1.00 82.08  ? 553 SER A CB  1 
ATOM   1424 O  OG  . SER A 1 226 ? -10.555 2.088   11.540  1.00 84.59  ? 553 SER A OG  1 
ATOM   1425 N  N   . LYS A 1 227 ? -11.426 -0.821  10.805  1.00 73.84  ? 554 LYS A N   1 
ATOM   1426 C  CA  . LYS A 1 227 ? -12.431 -1.878  11.023  1.00 71.18  ? 554 LYS A CA  1 
ATOM   1427 C  C   . LYS A 1 227 ? -12.149 -3.152  10.206  1.00 66.47  ? 554 LYS A C   1 
ATOM   1428 O  O   . LYS A 1 227 ? -12.469 -4.261  10.654  1.00 63.97  ? 554 LYS A O   1 
ATOM   1429 C  CB  . LYS A 1 227 ? -13.856 -1.356  10.773  1.00 73.42  ? 554 LYS A CB  1 
ATOM   1430 C  CG  . LYS A 1 227 ? -14.463 -0.617  11.965  1.00 77.73  ? 554 LYS A CG  1 
ATOM   1431 C  CD  . LYS A 1 227 ? -15.958 -0.361  11.797  1.00 79.93  ? 554 LYS A CD  1 
ATOM   1432 C  CE  . LYS A 1 227 ? -16.267 1.078   11.393  1.00 83.81  ? 554 LYS A CE  1 
ATOM   1433 N  NZ  . LYS A 1 227 ? -16.378 1.984   12.568  1.00 87.11  ? 554 LYS A NZ  1 
ATOM   1434 N  N   . LEU A 1 228 ? -11.550 -2.974  9.024   1.00 65.09  ? 555 LEU A N   1 
ATOM   1435 C  CA  . LEU A 1 228 ? -11.027 -4.071  8.211   1.00 61.66  ? 555 LEU A CA  1 
ATOM   1436 C  C   . LEU A 1 228 ? -9.865  -4.787  8.902   1.00 59.61  ? 555 LEU A C   1 
ATOM   1437 O  O   . LEU A 1 228 ? -9.928  -5.995  9.125   1.00 56.50  ? 555 LEU A O   1 
ATOM   1438 C  CB  . LEU A 1 228 ? -10.603 -3.572  6.822   1.00 62.49  ? 555 LEU A CB  1 
ATOM   1439 C  CG  . LEU A 1 228 ? -11.687 -3.325  5.764   1.00 64.00  ? 555 LEU A CG  1 
ATOM   1440 C  CD1 . LEU A 1 228 ? -11.083 -2.664  4.536   1.00 65.54  ? 555 LEU A CD1 1 
ATOM   1441 C  CD2 . LEU A 1 228 ? -12.408 -4.608  5.362   1.00 61.58  ? 555 LEU A CD2 1 
ATOM   1442 N  N   . LEU A 1 229 ? -8.824  -4.037  9.264   1.00 61.62  ? 556 LEU A N   1 
ATOM   1443 C  CA  . LEU A 1 229 ? -7.679  -4.603  9.992   1.00 60.84  ? 556 LEU A CA  1 
ATOM   1444 C  C   . LEU A 1 229 ? -8.051  -5.107  11.394  1.00 61.01  ? 556 LEU A C   1 
ATOM   1445 O  O   . LEU A 1 229 ? -7.329  -5.919  11.980  1.00 59.73  ? 556 LEU A O   1 
ATOM   1446 C  CB  . LEU A 1 229 ? -6.519  -3.602  10.069  1.00 62.79  ? 556 LEU A CB  1 
ATOM   1447 C  CG  . LEU A 1 229 ? -5.761  -3.230  8.788   1.00 62.74  ? 556 LEU A CG  1 
ATOM   1448 C  CD1 . LEU A 1 229 ? -4.695  -2.187  9.090   1.00 64.96  ? 556 LEU A CD1 1 
ATOM   1449 C  CD2 . LEU A 1 229 ? -5.138  -4.446  8.120   1.00 59.45  ? 556 LEU A CD2 1 
ATOM   1450 N  N   . GLY A 1 230 ? -9.186  -4.627  11.907  1.00 62.42  ? 557 GLY A N   1 
ATOM   1451 C  CA  . GLY A 1 230 ? -9.727  -5.055  13.189  1.00 62.66  ? 557 GLY A CA  1 
ATOM   1452 C  C   . GLY A 1 230 ? -10.283 -6.465  13.184  1.00 60.21  ? 557 GLY A C   1 
ATOM   1453 O  O   . GLY A 1 230 ? -10.491 -7.053  14.248  1.00 60.42  ? 557 GLY A O   1 
ATOM   1454 N  N   . LYS A 1 231 ? -10.531 -7.008  11.993  1.00 58.10  ? 558 LYS A N   1 
ATOM   1455 C  CA  . LYS A 1 231 ? -10.955 -8.405  11.856  1.00 55.41  ? 558 LYS A CA  1 
ATOM   1456 C  C   . LYS A 1 231 ? -9.814  -9.386  12.152  1.00 52.96  ? 558 LYS A C   1 
ATOM   1457 O  O   . LYS A 1 231 ? -10.066 -10.536 12.503  1.00 51.74  ? 558 LYS A O   1 
ATOM   1458 C  CB  . LYS A 1 231 ? -11.594 -8.670  10.477  1.00 54.07  ? 558 LYS A CB  1 
ATOM   1459 C  CG  . LYS A 1 231 ? -12.933 -7.961  10.236  1.00 55.57  ? 558 LYS A CG  1 
ATOM   1460 C  CD  . LYS A 1 231 ? -14.157 -8.815  10.573  1.00 54.78  ? 558 LYS A CD  1 
ATOM   1461 C  CE  . LYS A 1 231 ? -14.762 -8.512  11.934  1.00 57.34  ? 558 LYS A CE  1 
ATOM   1462 N  NZ  . LYS A 1 231 ? -15.461 -7.197  12.040  1.00 60.17  ? 558 LYS A NZ  1 
ATOM   1463 N  N   . LEU A 1 232 ? -8.570  -8.920  12.044  1.00 53.88  ? 559 LEU A N   1 
ATOM   1464 C  CA  . LEU A 1 232 ? -7.376  -9.759  12.278  1.00 52.65  ? 559 LEU A CA  1 
ATOM   1465 C  C   . LEU A 1 232 ? -7.123  -10.176 13.750  1.00 53.54  ? 559 LEU A C   1 
ATOM   1466 O  O   . LEU A 1 232 ? -6.794  -11.348 13.984  1.00 52.63  ? 559 LEU A O   1 
ATOM   1467 C  CB  . LEU A 1 232 ? -6.120  -9.141  11.631  1.00 52.95  ? 559 LEU A CB  1 
ATOM   1468 C  CG  . LEU A 1 232 ? -6.179  -8.906  10.110  1.00 52.33  ? 559 LEU A CG  1 
ATOM   1469 C  CD1 . LEU A 1 232 ? -5.112  -7.924  9.668   1.00 53.97  ? 559 LEU A CD1 1 
ATOM   1470 C  CD2 . LEU A 1 232 ? -6.043  -10.197 9.322   1.00 49.39  ? 559 LEU A CD2 1 
ATOM   1471 N  N   . PRO A 1 233 ? -7.263  -9.242  14.736  1.00 55.68  ? 560 PRO A N   1 
ATOM   1472 C  CA  . PRO A 1 233 ? -7.232  -9.727  16.134  1.00 56.69  ? 560 PRO A CA  1 
ATOM   1473 C  C   . PRO A 1 233 ? -8.441  -10.590 16.527  1.00 56.23  ? 560 PRO A C   1 
ATOM   1474 O  O   . PRO A 1 233 ? -8.307  -11.484 17.370  1.00 56.45  ? 560 PRO A O   1 
ATOM   1475 C  CB  . PRO A 1 233 ? -7.192  -8.434  16.965  1.00 59.66  ? 560 PRO A CB  1 
ATOM   1476 C  CG  . PRO A 1 233 ? -6.579  -7.434  16.047  1.00 60.34  ? 560 PRO A CG  1 
ATOM   1477 C  CD  . PRO A 1 233 ? -7.165  -7.769  14.697  1.00 58.12  ? 560 PRO A CD  1 
ATOM   1478 N  N   . GLU A 1 234 ? -9.595  -10.338 15.911  1.00 55.69  ? 561 GLU A N   1 
ATOM   1479 C  CA  . GLU A 1 234 ? -10.782 -11.167 16.107  1.00 54.74  ? 561 GLU A CA  1 
ATOM   1480 C  C   . GLU A 1 234 ? -10.586 -12.630 15.643  1.00 51.48  ? 561 GLU A C   1 
ATOM   1481 O  O   . GLU A 1 234 ? -11.171 -13.553 16.228  1.00 50.74  ? 561 GLU A O   1 
ATOM   1482 C  CB  . GLU A 1 234 ? -11.977 -10.533 15.403  1.00 56.61  ? 561 GLU A CB  1 
ATOM   1483 C  CG  . GLU A 1 234 ? -12.443 -9.227  16.028  1.00 60.99  ? 561 GLU A CG  1 
ATOM   1484 C  CD  . GLU A 1 234 ? -13.805 -8.784  15.526  1.00 63.55  ? 561 GLU A CD  1 
ATOM   1485 O  OE1 . GLU A 1 234 ? -14.200 -7.631  15.807  1.00 66.83  ? 561 GLU A OE1 1 
ATOM   1486 O  OE2 . GLU A 1 234 ? -14.493 -9.591  14.859  1.00 63.55  ? 561 GLU A OE2 1 
ATOM   1487 N  N   . LEU A 1 235 ? -9.769  -12.830 14.601  1.00 48.65  ? 562 LEU A N   1 
ATOM   1488 C  CA  . LEU A 1 235 ? -9.366  -14.176 14.158  1.00 45.96  ? 562 LEU A CA  1 
ATOM   1489 C  C   . LEU A 1 235 ? -8.482  -14.898 15.161  1.00 45.91  ? 562 LEU A C   1 
ATOM   1490 O  O   . LEU A 1 235 ? -8.579  -16.113 15.308  1.00 45.60  ? 562 LEU A O   1 
ATOM   1491 C  CB  . LEU A 1 235 ? -8.671  -14.144 12.791  1.00 44.05  ? 562 LEU A CB  1 
ATOM   1492 C  CG  . LEU A 1 235 ? -9.509  -13.927 11.526  1.00 42.98  ? 562 LEU A CG  1 
ATOM   1493 C  CD1 . LEU A 1 235 ? -8.601  -13.549 10.369  1.00 42.48  ? 562 LEU A CD1 1 
ATOM   1494 C  CD2 . LEU A 1 235 ? -10.367 -15.137 11.173  1.00 41.39  ? 562 LEU A CD2 1 
ATOM   1495 N  N   . ARG A 1 236 ? -7.617  -14.159 15.847  1.00 48.64  ? 563 ARG A N   1 
ATOM   1496 C  CA  . ARG A 1 236 ? -6.770  -14.746 16.879  1.00 49.18  ? 563 ARG A CA  1 
ATOM   1497 C  C   . ARG A 1 236 ? -7.635  -15.373 17.978  1.00 48.16  ? 563 ARG A C   1 
ATOM   1498 O  O   . ARG A 1 236 ? -7.365  -16.487 18.396  1.00 47.82  ? 563 ARG A O   1 
ATOM   1499 C  CB  . ARG A 1 236 ? -5.772  -13.730 17.441  1.00 53.92  ? 563 ARG A CB  1 
ATOM   1500 C  CG  . ARG A 1 236 ? -4.454  -14.357 17.885  1.00 57.40  ? 563 ARG A CG  1 
ATOM   1501 C  CD  . ARG A 1 236 ? -3.767  -13.541 18.977  1.00 63.45  ? 563 ARG A CD  1 
ATOM   1502 N  NE  . ARG A 1 236 ? -2.589  -14.224 19.548  1.00 67.50  ? 563 ARG A NE  1 
ATOM   1503 C  CZ  . ARG A 1 236 ? -2.583  -15.026 20.624  1.00 69.48  ? 563 ARG A CZ  1 
ATOM   1504 N  NH1 . ARG A 1 236 ? -3.695  -15.300 21.309  1.00 70.64  ? 563 ARG A NH1 1 
ATOM   1505 N  NH2 . ARG A 1 236 ? -1.440  -15.567 21.028  1.00 71.01  ? 563 ARG A NH2 1 
ATOM   1506 N  N   . THR A 1 237 ? -8.689  -14.677 18.403  1.00 47.59  ? 564 THR A N   1 
ATOM   1507 C  CA  . THR A 1 237 ? -9.657  -15.222 19.357  1.00 48.11  ? 564 THR A CA  1 
ATOM   1508 C  C   . THR A 1 237 ? -10.315 -16.497 18.814  1.00 46.52  ? 564 THR A C   1 
ATOM   1509 O  O   . THR A 1 237 ? -10.441 -17.486 19.554  1.00 46.30  ? 564 THR A O   1 
ATOM   1510 C  CB  . THR A 1 237 ? -10.747 -14.192 19.732  1.00 50.55  ? 564 THR A CB  1 
ATOM   1511 O  OG1 . THR A 1 237 ? -10.131 -13.003 20.244  1.00 52.97  ? 564 THR A OG1 1 
ATOM   1512 C  CG2 . THR A 1 237 ? -11.707 -14.755 20.785  1.00 51.89  ? 564 THR A CG2 1 
ATOM   1513 N  N   . LEU A 1 238 ? -10.704 -16.475 17.527  1.00 43.92  ? 565 LEU A N   1 
ATOM   1514 C  CA  . LEU A 1 238 ? -11.349 -17.626 16.895  1.00 41.56  ? 565 LEU A CA  1 
ATOM   1515 C  C   . LEU A 1 238 ? -10.417 -18.819 16.764  1.00 39.58  ? 565 LEU A C   1 
ATOM   1516 O  O   . LEU A 1 238 ? -10.844 -19.972 16.810  1.00 39.09  ? 565 LEU A O   1 
ATOM   1517 C  CB  . LEU A 1 238 ? -11.977 -17.248 15.554  1.00 40.69  ? 565 LEU A CB  1 
ATOM   1518 C  CG  . LEU A 1 238 ? -13.282 -16.453 15.725  1.00 42.74  ? 565 LEU A CG  1 
ATOM   1519 C  CD1 . LEU A 1 238 ? -13.477 -15.494 14.568  1.00 42.66  ? 565 LEU A CD1 1 
ATOM   1520 C  CD2 . LEU A 1 238 ? -14.490 -17.355 15.868  1.00 42.67  ? 565 LEU A CD2 1 
ATOM   1521 N  N   . CYS A 1 239 ? -9.138  -18.533 16.623  1.00 39.79  ? 566 CYS A N   1 
ATOM   1522 C  CA  . CYS A 1 239 ? -8.125  -19.562 16.562  1.00 40.32  ? 566 CYS A CA  1 
ATOM   1523 C  C   . CYS A 1 239 ? -7.945  -20.242 17.934  1.00 41.27  ? 566 CYS A C   1 
ATOM   1524 O  O   . CYS A 1 239 ? -7.957  -21.480 18.024  1.00 41.59  ? 566 CYS A O   1 
ATOM   1525 C  CB  . CYS A 1 239 ? -6.832  -18.951 16.034  1.00 41.62  ? 566 CYS A CB  1 
ATOM   1526 S  SG  . CYS A 1 239 ? -5.351  -19.904 16.381  1.00 46.91  ? 566 CYS A SG  1 
ATOM   1527 N  N   . THR A 1 240 ? -7.833  -19.438 18.991  1.00 41.62  ? 567 THR A N   1 
ATOM   1528 C  CA  . THR A 1 240 ? -7.799  -19.937 20.382  1.00 43.16  ? 567 THR A CA  1 
ATOM   1529 C  C   . THR A 1 240 ? -8.982  -20.879 20.656  1.00 42.74  ? 567 THR A C   1 
ATOM   1530 O  O   . THR A 1 240 ? -8.822  -21.935 21.267  1.00 42.73  ? 567 THR A O   1 
ATOM   1531 C  CB  . THR A 1 240 ? -7.755  -18.769 21.406  1.00 45.13  ? 567 THR A CB  1 
ATOM   1532 O  OG1 . THR A 1 240 ? -6.749  -17.828 21.019  1.00 45.54  ? 567 THR A OG1 1 
ATOM   1533 C  CG2 . THR A 1 240 ? -7.387  -19.256 22.785  1.00 47.72  ? 567 THR A CG2 1 
ATOM   1534 N  N   . GLN A 1 241 ? -10.152 -20.498 20.155  1.00 42.63  ? 568 GLN A N   1 
ATOM   1535 C  CA  . GLN A 1 241 ? -11.364 -21.297 20.278  1.00 42.58  ? 568 GLN A CA  1 
ATOM   1536 C  C   . GLN A 1 241 ? -11.290 -22.652 19.552  1.00 40.45  ? 568 GLN A C   1 
ATOM   1537 O  O   . GLN A 1 241 ? -11.726 -23.661 20.108  1.00 41.65  ? 568 GLN A O   1 
ATOM   1538 C  CB  . GLN A 1 241 ? -12.582 -20.479 19.842  1.00 43.82  ? 568 GLN A CB  1 
ATOM   1539 C  CG  . GLN A 1 241 ? -12.946 -19.378 20.827  1.00 46.95  ? 568 GLN A CG  1 
ATOM   1540 C  CD  . GLN A 1 241 ? -13.960 -18.375 20.292  1.00 48.16  ? 568 GLN A CD  1 
ATOM   1541 O  OE1 . GLN A 1 241 ? -13.979 -18.053 19.099  1.00 46.58  ? 568 GLN A OE1 1 
ATOM   1542 N  NE2 . GLN A 1 241 ? -14.782 -17.842 21.190  1.00 50.49  ? 568 GLN A NE2 1 
ATOM   1543 N  N   . GLY A 1 242 ? -10.730 -22.687 18.338  1.00 38.00  ? 569 GLY A N   1 
ATOM   1544 C  CA  . GLY A 1 242 ? -10.444 -23.970 17.648  1.00 36.53  ? 569 GLY A CA  1 
ATOM   1545 C  C   . GLY A 1 242 ? -9.486  -24.853 18.436  1.00 37.20  ? 569 GLY A C   1 
ATOM   1546 O  O   . GLY A 1 242 ? -9.732  -26.054 18.635  1.00 38.10  ? 569 GLY A O   1 
ATOM   1547 N  N   . LEU A 1 243 ? -8.408  -24.239 18.909  1.00 37.15  ? 570 LEU A N   1 
ATOM   1548 C  CA  . LEU A 1 243 ? -7.456  -24.888 19.816  1.00 38.72  ? 570 LEU A CA  1 
ATOM   1549 C  C   . LEU A 1 243 ? -8.103  -25.443 21.109  1.00 39.53  ? 570 LEU A C   1 
ATOM   1550 O  O   . LEU A 1 243 ? -7.789  -26.559 21.526  1.00 39.43  ? 570 LEU A O   1 
ATOM   1551 C  CB  . LEU A 1 243 ? -6.331  -23.916 20.152  1.00 39.54  ? 570 LEU A CB  1 
ATOM   1552 C  CG  . LEU A 1 243 ? -4.931  -24.379 19.792  1.00 39.97  ? 570 LEU A CG  1 
ATOM   1553 C  CD1 . LEU A 1 243 ? -4.867  -24.822 18.348  1.00 38.20  ? 570 LEU A CD1 1 
ATOM   1554 C  CD2 . LEU A 1 243 ? -3.968  -23.235 20.012  1.00 40.81  ? 570 LEU A CD2 1 
ATOM   1555 N  N   . GLN A 1 244 ? -9.021  -24.674 21.698  1.00 40.06  ? 571 GLN A N   1 
ATOM   1556 C  CA  . GLN A 1 244 ? -9.834  -25.108 22.858  1.00 41.87  ? 571 GLN A CA  1 
ATOM   1557 C  C   . GLN A 1 244 ? -10.673 -26.359 22.518  1.00 41.20  ? 571 GLN A C   1 
ATOM   1558 O  O   . GLN A 1 244 ? -10.797 -27.276 23.336  1.00 42.13  ? 571 GLN A O   1 
ATOM   1559 C  CB  . GLN A 1 244 ? -10.719 -23.948 23.347  1.00 43.31  ? 571 GLN A CB  1 
ATOM   1560 C  CG  . GLN A 1 244 ? -11.713 -24.292 24.447  1.00 46.54  ? 571 GLN A CG  1 
ATOM   1561 C  CD  . GLN A 1 244 ? -12.635 -23.143 24.849  1.00 48.28  ? 571 GLN A CD  1 
ATOM   1562 O  OE1 . GLN A 1 244 ? -13.154 -22.401 24.016  1.00 47.57  ? 571 GLN A OE1 1 
ATOM   1563 N  NE2 . GLN A 1 244 ? -12.855 -23.012 26.137  1.00 51.36  ? 571 GLN A NE2 1 
ATOM   1564 N  N   . ARG A 1 245 ? -11.202 -26.396 21.294  1.00 39.31  ? 572 ARG A N   1 
ATOM   1565 C  CA  . ARG A 1 245 ? -11.964 -27.542 20.815  1.00 39.04  ? 572 ARG A CA  1 
ATOM   1566 C  C   . ARG A 1 245 ? -11.111 -28.809 20.624  1.00 38.26  ? 572 ARG A C   1 
ATOM   1567 O  O   . ARG A 1 245 ? -11.510 -29.876 21.103  1.00 39.94  ? 572 ARG A O   1 
ATOM   1568 C  CB  . ARG A 1 245 ? -12.769 -27.185 19.547  1.00 38.60  ? 572 ARG A CB  1 
ATOM   1569 C  CG  . ARG A 1 245 ? -13.601 -28.326 18.959  1.00 39.20  ? 572 ARG A CG  1 
ATOM   1570 C  CD  . ARG A 1 245 ? -14.608 -28.809 19.982  1.00 42.25  ? 572 ARG A CD  1 
ATOM   1571 N  NE  . ARG A 1 245 ? -15.449 -29.890 19.491  1.00 44.01  ? 572 ARG A NE  1 
ATOM   1572 C  CZ  . ARG A 1 245 ? -16.282 -30.594 20.254  1.00 46.99  ? 572 ARG A CZ  1 
ATOM   1573 N  NH1 . ARG A 1 245 ? -16.384 -30.345 21.558  1.00 49.28  ? 572 ARG A NH1 1 
ATOM   1574 N  NH2 . ARG A 1 245 ? -17.014 -31.556 19.714  1.00 48.11  ? 572 ARG A NH2 1 
ATOM   1575 N  N   . ILE A 1 246 ? -9.965  -28.685 19.941  1.00 35.87  ? 573 ILE A N   1 
ATOM   1576 C  CA  . ILE A 1 246 ? -9.008  -29.794 19.767  1.00 35.60  ? 573 ILE A CA  1 
ATOM   1577 C  C   . ILE A 1 246 ? -8.501  -30.304 21.124  1.00 37.46  ? 573 ILE A C   1 
ATOM   1578 O  O   . ILE A 1 246 ? -8.449  -31.532 21.359  1.00 39.10  ? 573 ILE A O   1 
ATOM   1579 C  CB  . ILE A 1 246 ? -7.829  -29.409 18.826  1.00 34.17  ? 573 ILE A CB  1 
ATOM   1580 C  CG1 . ILE A 1 246 ? -8.334  -29.203 17.396  1.00 32.95  ? 573 ILE A CG1 1 
ATOM   1581 C  CG2 . ILE A 1 246 ? -6.765  -30.496 18.800  1.00 35.01  ? 573 ILE A CG2 1 
ATOM   1582 C  CD1 . ILE A 1 246 ? -7.436  -28.351 16.536  1.00 30.92  ? 573 ILE A CD1 1 
ATOM   1583 N  N   . PHE A 1 247 ? -8.158  -29.365 22.014  1.00 37.52  ? 574 PHE A N   1 
ATOM   1584 C  CA  . PHE A 1 247 ? -7.809  -29.671 23.408  1.00 39.49  ? 574 PHE A CA  1 
ATOM   1585 C  C   . PHE A 1 247 ? -8.853  -30.584 24.042  1.00 41.71  ? 574 PHE A C   1 
ATOM   1586 O  O   . PHE A 1 247 ? -8.502  -31.657 24.533  1.00 43.28  ? 574 PHE A O   1 
ATOM   1587 C  CB  . PHE A 1 247 ? -7.628  -28.387 24.229  1.00 39.42  ? 574 PHE A CB  1 
ATOM   1588 C  CG  . PHE A 1 247 ? -7.288  -28.623 25.685  1.00 42.03  ? 574 PHE A CG  1 
ATOM   1589 C  CD1 . PHE A 1 247 ? -5.961  -28.829 26.090  1.00 42.15  ? 574 PHE A CD1 1 
ATOM   1590 C  CD2 . PHE A 1 247 ? -8.291  -28.610 26.663  1.00 43.72  ? 574 PHE A CD2 1 
ATOM   1591 C  CE1 . PHE A 1 247 ? -5.651  -29.035 27.423  1.00 44.59  ? 574 PHE A CE1 1 
ATOM   1592 C  CE2 . PHE A 1 247 ? -7.973  -28.815 28.008  1.00 46.63  ? 574 PHE A CE2 1 
ATOM   1593 C  CZ  . PHE A 1 247 ? -6.654  -29.022 28.383  1.00 46.87  ? 574 PHE A CZ  1 
ATOM   1594 N  N   . TYR A 1 248 ? -10.123 -30.168 24.014  1.00 42.62  ? 575 TYR A N   1 
ATOM   1595 C  CA  . TYR A 1 248 ? -11.208 -30.951 24.613  1.00 45.80  ? 575 TYR A CA  1 
ATOM   1596 C  C   . TYR A 1 248 ? -11.235 -32.374 24.028  1.00 46.45  ? 575 TYR A C   1 
ATOM   1597 O  O   . TYR A 1 248 ? -11.102 -33.346 24.765  1.00 48.36  ? 575 TYR A O   1 
ATOM   1598 C  CB  . TYR A 1 248 ? -12.575 -30.251 24.444  1.00 46.58  ? 575 TYR A CB  1 
ATOM   1599 C  CG  . TYR A 1 248 ? -13.726 -30.992 25.096  1.00 49.64  ? 575 TYR A CG  1 
ATOM   1600 C  CD1 . TYR A 1 248 ? -14.064 -30.756 26.428  1.00 52.63  ? 575 TYR A CD1 1 
ATOM   1601 C  CD2 . TYR A 1 248 ? -14.470 -31.944 24.384  1.00 50.29  ? 575 TYR A CD2 1 
ATOM   1602 C  CE1 . TYR A 1 248 ? -15.108 -31.445 27.035  1.00 56.12  ? 575 TYR A CE1 1 
ATOM   1603 C  CE2 . TYR A 1 248 ? -15.514 -32.642 24.985  1.00 53.48  ? 575 TYR A CE2 1 
ATOM   1604 C  CZ  . TYR A 1 248 ? -15.826 -32.390 26.310  1.00 56.19  ? 575 TYR A CZ  1 
ATOM   1605 O  OH  . TYR A 1 248 ? -16.859 -33.072 26.920  1.00 59.91  ? 575 TYR A OH  1 
ATOM   1606 N  N   . LEU A 1 249 ? -11.360 -32.466 22.699  1.00 45.38  ? 576 LEU A N   1 
ATOM   1607 C  CA  . LEU A 1 249 ? -11.433 -33.746 21.968  1.00 46.05  ? 576 LEU A CA  1 
ATOM   1608 C  C   . LEU A 1 249 ? -10.301 -34.723 22.299  1.00 47.96  ? 576 LEU A C   1 
ATOM   1609 O  O   . LEU A 1 249 ? -10.555 -35.911 22.516  1.00 49.55  ? 576 LEU A O   1 
ATOM   1610 C  CB  . LEU A 1 249 ? -11.497 -33.503 20.454  1.00 42.73  ? 576 LEU A CB  1 
ATOM   1611 C  CG  . LEU A 1 249 ? -12.748 -32.794 19.918  1.00 42.09  ? 576 LEU A CG  1 
ATOM   1612 C  CD1 . LEU A 1 249 ? -12.546 -32.437 18.459  1.00 39.35  ? 576 LEU A CD1 1 
ATOM   1613 C  CD2 . LEU A 1 249 ? -14.041 -33.589 20.099  1.00 43.83  ? 576 LEU A CD2 1 
ATOM   1614 N  N   . LYS A 1 250 ? -9.070  -34.198 22.349  1.00 48.08  ? 577 LYS A N   1 
ATOM   1615 C  CA  . LYS A 1 250 ? -7.861  -34.973 22.650  1.00 49.93  ? 577 LYS A CA  1 
ATOM   1616 C  C   . LYS A 1 250 ? -7.894  -35.467 24.087  1.00 53.84  ? 577 LYS A C   1 
ATOM   1617 O  O   . LYS A 1 250 ? -7.478  -36.599 24.378  1.00 56.89  ? 577 LYS A O   1 
ATOM   1618 C  CB  . LYS A 1 250 ? -6.616  -34.111 22.381  1.00 48.57  ? 577 LYS A CB  1 
ATOM   1619 C  CG  . LYS A 1 250 ? -5.261  -34.788 22.528  1.00 49.27  ? 577 LYS A CG  1 
ATOM   1620 C  CD  . LYS A 1 250 ? -4.192  -33.956 21.824  1.00 46.89  ? 577 LYS A CD  1 
ATOM   1621 C  CE  . LYS A 1 250 ? -2.788  -34.384 22.223  1.00 48.55  ? 577 LYS A CE  1 
ATOM   1622 N  NZ  . LYS A 1 250 ? -2.425  -35.763 21.771  1.00 49.95  ? 577 LYS A NZ  1 
ATOM   1623 N  N   . LEU A 1 251 ? -8.402  -34.620 24.980  1.00 55.15  ? 578 LEU A N   1 
ATOM   1624 C  CA  . LEU A 1 251 ? -8.504  -34.954 26.399  1.00 58.66  ? 578 LEU A CA  1 
ATOM   1625 C  C   . LEU A 1 251 ? -9.582  -36.013 26.609  1.00 61.45  ? 578 LEU A C   1 
ATOM   1626 O  O   . LEU A 1 251 ? -9.356  -37.004 27.304  1.00 62.95  ? 578 LEU A O   1 
ATOM   1627 C  CB  . LEU A 1 251 ? -8.781  -33.689 27.201  1.00 58.96  ? 578 LEU A CB  1 
ATOM   1628 C  CG  . LEU A 1 251 ? -8.743  -33.635 28.726  1.00 62.80  ? 578 LEU A CG  1 
ATOM   1629 C  CD1 . LEU A 1 251 ? -7.567  -34.373 29.351  1.00 64.30  ? 578 LEU A CD1 1 
ATOM   1630 C  CD2 . LEU A 1 251 ? -8.709  -32.167 29.106  1.00 62.65  ? 578 LEU A CD2 1 
ATOM   1631 N  N   . GLU A 1 252 ? -10.731 -35.794 25.960  1.00 62.29  ? 579 GLU A N   1 
ATOM   1632 C  CA  . GLU A 1 252 ? -11.834 -36.756 25.870  1.00 65.80  ? 579 GLU A CA  1 
ATOM   1633 C  C   . GLU A 1 252 ? -11.355 -38.122 25.362  1.00 66.64  ? 579 GLU A C   1 
ATOM   1634 O  O   . GLU A 1 252 ? -11.671 -39.148 25.968  1.00 69.17  ? 579 GLU A O   1 
ATOM   1635 C  CB  . GLU A 1 252 ? -12.947 -36.197 24.967  1.00 65.25  ? 579 GLU A CB  1 
ATOM   1636 C  CG  . GLU A 1 252 ? -14.203 -37.053 24.872  1.00 68.80  ? 579 GLU A CG  1 
ATOM   1637 C  CD  . GLU A 1 252 ? -15.179 -36.569 23.802  1.00 69.06  ? 579 GLU A CD  1 
ATOM   1638 O  OE1 . GLU A 1 252 ? -16.370 -36.375 24.131  1.00 72.37  ? 579 GLU A OE1 1 
ATOM   1639 O  OE2 . GLU A 1 252 ? -14.771 -36.386 22.630  1.00 66.92  ? 579 GLU A OE2 1 
ATOM   1640 N  N   . ASP A 1 253 ? -10.599 -38.113 24.259  1.00 64.21  ? 580 ASP A N   1 
ATOM   1641 C  CA  . ASP A 1 253 ? -9.927  -39.305 23.725  1.00 65.70  ? 580 ASP A CA  1 
ATOM   1642 C  C   . ASP A 1 253 ? -10.912 -40.370 23.197  1.00 67.29  ? 580 ASP A C   1 
ATOM   1643 O  O   . ASP A 1 253 ? -10.724 -41.579 23.396  1.00 70.05  ? 580 ASP A O   1 
ATOM   1644 C  CB  . ASP A 1 253 ? -8.946  -39.889 24.767  1.00 67.98  ? 580 ASP A CB  1 
ATOM   1645 C  CG  . ASP A 1 253 ? -7.859  -40.739 24.142  1.00 69.08  ? 580 ASP A CG  1 
ATOM   1646 O  OD1 . ASP A 1 253 ? -7.283  -40.331 23.114  1.00 67.68  ? 580 ASP A OD1 1 
ATOM   1647 O  OD2 . ASP A 1 253 ? -7.570  -41.821 24.686  1.00 73.05  ? 580 ASP A OD2 1 
ATOM   1648 N  N   . LEU A 1 254 ? -11.973 -39.911 22.544  1.00 65.56  ? 581 LEU A N   1 
ATOM   1649 C  CA  . LEU A 1 254 ? -12.893 -40.815 21.866  1.00 67.16  ? 581 LEU A CA  1 
ATOM   1650 C  C   . LEU A 1 254 ? -12.311 -41.109 20.478  1.00 65.44  ? 581 LEU A C   1 
ATOM   1651 O  O   . LEU A 1 254 ? -12.147 -42.269 20.105  1.00 68.00  ? 581 LEU A O   1 
ATOM   1652 C  CB  . LEU A 1 254 ? -14.314 -40.224 21.798  1.00 67.03  ? 581 LEU A CB  1 
ATOM   1653 C  CG  . LEU A 1 254 ? -15.470 -41.125 21.317  1.00 69.75  ? 581 LEU A CG  1 
ATOM   1654 C  CD1 . LEU A 1 254 ? -15.869 -42.175 22.355  1.00 73.41  ? 581 LEU A CD1 1 
ATOM   1655 C  CD2 . LEU A 1 254 ? -16.680 -40.296 20.884  1.00 68.32  ? 581 LEU A CD2 1 
ATOM   1656 N  N   . VAL A 1 255 ? -11.988 -40.056 19.731  1.00 61.53  ? 582 VAL A N   1 
ATOM   1657 C  CA  . VAL A 1 255 ? -11.187 -40.190 18.521  1.00 59.77  ? 582 VAL A CA  1 
ATOM   1658 C  C   . VAL A 1 255 ? -9.918  -39.381 18.731  1.00 57.64  ? 582 VAL A C   1 
ATOM   1659 O  O   . VAL A 1 255 ? -9.995  -38.170 18.948  1.00 55.64  ? 582 VAL A O   1 
ATOM   1660 C  CB  . VAL A 1 255 ? -11.906 -39.688 17.246  1.00 57.72  ? 582 VAL A CB  1 
ATOM   1661 C  CG1 . VAL A 1 255 ? -11.091 -40.036 16.011  1.00 56.73  ? 582 VAL A CG1 1 
ATOM   1662 C  CG2 . VAL A 1 255 ? -13.306 -40.265 17.139  1.00 59.41  ? 582 VAL A CG2 1 
ATOM   1663 N  N   . PRO A 1 256 ? -8.746  -40.045 18.671  1.00 59.51  ? 583 PRO A N   1 
ATOM   1664 C  CA  . PRO A 1 256 ? -7.492  -39.290 18.761  1.00 58.55  ? 583 PRO A CA  1 
ATOM   1665 C  C   . PRO A 1 256 ? -7.284  -38.543 17.462  1.00 55.82  ? 583 PRO A C   1 
ATOM   1666 O  O   . PRO A 1 256 ? -7.656  -39.058 16.408  1.00 57.36  ? 583 PRO A O   1 
ATOM   1667 C  CB  . PRO A 1 256 ? -6.416  -40.377 18.931  1.00 61.54  ? 583 PRO A CB  1 
ATOM   1668 C  CG  . PRO A 1 256 ? -7.163  -41.649 19.209  1.00 64.02  ? 583 PRO A CG  1 
ATOM   1669 C  CD  . PRO A 1 256 ? -8.495  -41.493 18.544  1.00 62.64  ? 583 PRO A CD  1 
ATOM   1670 N  N   . PRO A 1 257 ? -6.732  -37.321 17.526  1.00 53.34  ? 584 PRO A N   1 
ATOM   1671 C  CA  . PRO A 1 257 ? -6.550  -36.562 16.285  1.00 49.58  ? 584 PRO A CA  1 
ATOM   1672 C  C   . PRO A 1 257 ? -5.510  -37.192 15.342  1.00 49.23  ? 584 PRO A C   1 
ATOM   1673 O  O   . PRO A 1 257 ? -4.561  -37.792 15.821  1.00 51.15  ? 584 PRO A O   1 
ATOM   1674 C  CB  . PRO A 1 257 ? -6.098  -35.182 16.774  1.00 48.34  ? 584 PRO A CB  1 
ATOM   1675 C  CG  . PRO A 1 257 ? -5.543  -35.408 18.142  1.00 51.03  ? 584 PRO A CG  1 
ATOM   1676 C  CD  . PRO A 1 257 ? -6.285  -36.576 18.721  1.00 53.05  ? 584 PRO A CD  1 
ATOM   1677 N  N   . PRO A 1 258 ? -5.694  -37.062 14.005  1.00 48.29  ? 585 PRO A N   1 
ATOM   1678 C  CA  . PRO A 1 258 ? -4.671  -37.554 13.063  1.00 48.69  ? 585 PRO A CA  1 
ATOM   1679 C  C   . PRO A 1 258 ? -3.314  -36.868 13.266  1.00 48.35  ? 585 PRO A C   1 
ATOM   1680 O  O   . PRO A 1 258 ? -3.268  -35.714 13.728  1.00 46.36  ? 585 PRO A O   1 
ATOM   1681 C  CB  . PRO A 1 258 ? -5.243  -37.180 11.687  1.00 45.88  ? 585 PRO A CB  1 
ATOM   1682 C  CG  . PRO A 1 258 ? -6.202  -36.087 11.949  1.00 43.78  ? 585 PRO A CG  1 
ATOM   1683 C  CD  . PRO A 1 258 ? -6.800  -36.392 13.285  1.00 45.32  ? 585 PRO A CD  1 
ATOM   1684 N  N   . ALA A 1 259 ? -2.249  -37.576 12.875  1.00 49.90  ? 586 ALA A N   1 
ATOM   1685 C  CA  . ALA A 1 259 ? -0.852  -37.201 13.127  1.00 50.26  ? 586 ALA A CA  1 
ATOM   1686 C  C   . ALA A 1 259 ? -0.526  -35.724 12.905  1.00 48.12  ? 586 ALA A C   1 
ATOM   1687 O  O   . ALA A 1 259 ? 0.061   -35.083 13.792  1.00 47.21  ? 586 ALA A O   1 
ATOM   1688 C  CB  . ALA A 1 259 ? 0.101   -38.091 12.331  1.00 51.76  ? 586 ALA A CB  1 
ATOM   1689 N  N   . ILE A 1 260 ? -0.935  -35.184 11.752  1.00 46.37  ? 587 ILE A N   1 
ATOM   1690 C  CA  . ILE A 1 260 ? -0.595  -33.802 11.390  1.00 44.73  ? 587 ILE A CA  1 
ATOM   1691 C  C   . ILE A 1 260 ? -1.251  -32.759 12.287  1.00 42.34  ? 587 ILE A C   1 
ATOM   1692 O  O   . ILE A 1 260 ? -0.597  -31.786 12.652  1.00 42.07  ? 587 ILE A O   1 
ATOM   1693 C  CB  . ILE A 1 260 ? -0.866  -33.468 9.916   1.00 44.99  ? 587 ILE A CB  1 
ATOM   1694 C  CG1 . ILE A 1 260 ? -2.312  -33.824 9.543   1.00 46.16  ? 587 ILE A CG1 1 
ATOM   1695 C  CG2 . ILE A 1 260 ? 0.149   -34.181 9.028   1.00 48.98  ? 587 ILE A CG2 1 
ATOM   1696 C  CD1 . ILE A 1 260 ? -2.802  -33.151 8.282   1.00 47.21  ? 587 ILE A CD1 1 
ATOM   1697 N  N   . ILE A 1 261 ? -2.526  -32.967 12.627  1.00 40.52  ? 588 ILE A N   1 
ATOM   1698 C  CA  . ILE A 1 261 ? -3.256  -32.102 13.554  1.00 39.14  ? 588 ILE A CA  1 
ATOM   1699 C  C   . ILE A 1 261 ? -2.610  -32.198 14.935  1.00 39.19  ? 588 ILE A C   1 
ATOM   1700 O  O   . ILE A 1 261 ? -2.295  -31.188 15.537  1.00 37.89  ? 588 ILE A O   1 
ATOM   1701 C  CB  . ILE A 1 261 ? -4.769  -32.452 13.617  1.00 39.37  ? 588 ILE A CB  1 
ATOM   1702 C  CG1 . ILE A 1 261 ? -5.460  -32.007 12.319  1.00 38.24  ? 588 ILE A CG1 1 
ATOM   1703 C  CG2 . ILE A 1 261 ? -5.424  -31.835 14.858  1.00 38.21  ? 588 ILE A CG2 1 
ATOM   1704 C  CD1 . ILE A 1 261 ? -6.944  -32.349 12.229  1.00 40.57  ? 588 ILE A CD1 1 
ATOM   1705 N  N   . ASP A 1 262 ? -2.383  -33.422 15.385  1.00 40.95  ? 589 ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 262 ? -1.701  -33.711 16.643  1.00 43.68  ? 589 ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 262 ? -0.348  -32.986 16.758  1.00 44.59  ? 589 ASP A C   1 
ATOM   1708 O  O   . ASP A 1 262 ? -0.119  -32.239 17.733  1.00 44.18  ? 589 ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 262 ? -1.511  -35.220 16.776  1.00 45.48  ? 589 ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 262 ? -1.444  -35.679 18.199  1.00 47.29  ? 589 ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 262 ? -1.980  -35.002 19.102  1.00 46.90  ? 589 ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 262 ? -0.869  -36.758 18.408  1.00 49.81  ? 589 ASP A OD2 1 
ATOM   1713 N  N   . LYS A 1 263 ? 0.511   -33.179 15.747  1.00 44.95  ? 590 LYS A N   1 
ATOM   1714 C  CA  . LYS A 1 263 ? 1.837   -32.558 15.694  1.00 45.58  ? 590 LYS A CA  1 
ATOM   1715 C  C   . LYS A 1 263 ? 1.708   -31.043 15.759  1.00 43.04  ? 590 LYS A C   1 
ATOM   1716 O  O   . LYS A 1 263 ? 2.359   -30.426 16.587  1.00 44.62  ? 590 LYS A O   1 
ATOM   1717 C  CB  . LYS A 1 263 ? 2.605   -32.992 14.437  1.00 47.93  ? 590 LYS A CB  1 
ATOM   1718 C  CG  . LYS A 1 263 ? 3.920   -32.275 14.180  1.00 49.63  ? 590 LYS A CG  1 
ATOM   1719 C  CD  . LYS A 1 263 ? 4.209   -32.187 12.683  1.00 50.54  ? 590 LYS A CD  1 
ATOM   1720 C  CE  . LYS A 1 263 ? 5.567   -31.553 12.384  1.00 52.07  ? 590 LYS A CE  1 
ATOM   1721 N  NZ  . LYS A 1 263 ? 6.682   -32.261 13.087  1.00 54.52  ? 590 LYS A NZ  1 
ATOM   1722 N  N   . LEU A 1 264 ? 0.846   -30.458 14.925  1.00 40.15  ? 591 LEU A N   1 
ATOM   1723 C  CA  . LEU A 1 264 ? 0.646   -29.000 14.895  1.00 37.92  ? 591 LEU A CA  1 
ATOM   1724 C  C   . LEU A 1 264 ? 0.065   -28.453 16.190  1.00 36.55  ? 591 LEU A C   1 
ATOM   1725 O  O   . LEU A 1 264 ? 0.441   -27.378 16.625  1.00 36.45  ? 591 LEU A O   1 
ATOM   1726 C  CB  . LEU A 1 264 ? -0.246  -28.560 13.729  1.00 36.89  ? 591 LEU A CB  1 
ATOM   1727 C  CG  . LEU A 1 264 ? 0.243   -28.490 12.278  1.00 38.83  ? 591 LEU A CG  1 
ATOM   1728 C  CD1 . LEU A 1 264 ? -0.688  -27.585 11.474  1.00 38.20  ? 591 LEU A CD1 1 
ATOM   1729 C  CD2 . LEU A 1 264 ? 1.679   -27.998 12.148  1.00 39.70  ? 591 LEU A CD2 1 
ATOM   1730 N  N   . PHE A 1 265 ? -0.872  -29.192 16.780  1.00 35.93  ? 592 PHE A N   1 
ATOM   1731 C  CA  . PHE A 1 265 ? -1.485  -28.803 18.036  1.00 35.23  ? 592 PHE A CA  1 
ATOM   1732 C  C   . PHE A 1 265 ? -0.418  -28.750 19.132  1.00 36.41  ? 592 PHE A C   1 
ATOM   1733 O  O   . PHE A 1 265 ? -0.239  -27.707 19.751  1.00 35.74  ? 592 PHE A O   1 
ATOM   1734 C  CB  . PHE A 1 265 ? -2.664  -29.720 18.397  1.00 34.91  ? 592 PHE A CB  1 
ATOM   1735 C  CG  . PHE A 1 265 ? -3.244  -29.457 19.761  1.00 35.61  ? 592 PHE A CG  1 
ATOM   1736 C  CD1 . PHE A 1 265 ? -4.145  -28.413 19.961  1.00 34.59  ? 592 PHE A CD1 1 
ATOM   1737 C  CD2 . PHE A 1 265 ? -2.876  -30.258 20.857  1.00 37.70  ? 592 PHE A CD2 1 
ATOM   1738 C  CE1 . PHE A 1 265 ? -4.681  -28.180 21.227  1.00 36.19  ? 592 PHE A CE1 1 
ATOM   1739 C  CE2 . PHE A 1 265 ? -3.399  -30.022 22.123  1.00 38.91  ? 592 PHE A CE2 1 
ATOM   1740 C  CZ  . PHE A 1 265 ? -4.303  -28.980 22.305  1.00 38.02  ? 592 PHE A CZ  1 
ATOM   1741 N  N   . LEU A 1 266 ? 0.295   -29.862 19.314  1.00 38.07  ? 593 LEU A N   1 
ATOM   1742 C  CA  . LEU A 1 266 ? 1.305   -30.009 20.354  1.00 40.66  ? 593 LEU A CA  1 
ATOM   1743 C  C   . LEU A 1 266 ? 2.435   -28.987 20.248  1.00 41.86  ? 593 LEU A C   1 
ATOM   1744 O  O   . LEU A 1 266 ? 2.779   -28.359 21.259  1.00 43.15  ? 593 LEU A O   1 
ATOM   1745 C  CB  . LEU A 1 266 ? 1.854   -31.441 20.395  1.00 41.90  ? 593 LEU A CB  1 
ATOM   1746 C  CG  . LEU A 1 266 ? 0.959   -32.596 20.892  1.00 43.31  ? 593 LEU A CG  1 
ATOM   1747 C  CD1 . LEU A 1 266 ? 1.591   -33.947 20.583  1.00 44.85  ? 593 LEU A CD1 1 
ATOM   1748 C  CD2 . LEU A 1 266 ? 0.615   -32.533 22.386  1.00 44.63  ? 593 LEU A CD2 1 
ATOM   1749 N  N   . ASP A 1 267 ? 2.983   -28.797 19.038  1.00 41.80  ? 594 ASP A N   1 
ATOM   1750 C  CA  . ASP A 1 267 ? 4.112   -27.870 18.806  1.00 43.05  ? 594 ASP A CA  1 
ATOM   1751 C  C   . ASP A 1 267 ? 3.787   -26.407 19.076  1.00 43.24  ? 594 ASP A C   1 
ATOM   1752 O  O   . ASP A 1 267 ? 4.620   -25.666 19.582  1.00 45.38  ? 594 ASP A O   1 
ATOM   1753 C  CB  . ASP A 1 267 ? 4.674   -27.998 17.378  1.00 42.30  ? 594 ASP A CB  1 
ATOM   1754 C  CG  . ASP A 1 267 ? 5.373   -29.323 17.132  1.00 43.82  ? 594 ASP A CG  1 
ATOM   1755 O  OD1 . ASP A 1 267 ? 5.579   -30.104 18.084  1.00 45.74  ? 594 ASP A OD1 1 
ATOM   1756 O  OD2 . ASP A 1 267 ? 5.702   -29.599 15.966  1.00 44.31  ? 594 ASP A OD2 1 
ATOM   1757 N  N   . THR A 1 268 ? 2.570   -26.010 18.747  1.00 42.99  ? 595 THR A N   1 
ATOM   1758 C  CA  . THR A 1 268 ? 2.118   -24.631 18.867  1.00 43.88  ? 595 THR A CA  1 
ATOM   1759 C  C   . THR A 1 268 ? 1.792   -24.198 20.322  1.00 43.87  ? 595 THR A C   1 
ATOM   1760 O  O   . THR A 1 268 ? 1.865   -23.012 20.655  1.00 44.47  ? 595 THR A O   1 
ATOM   1761 C  CB  . THR A 1 268 ? 0.976   -24.405 17.851  1.00 44.62  ? 595 THR A CB  1 
ATOM   1762 O  OG1 . THR A 1 268 ? 1.568   -24.391 16.541  1.00 48.91  ? 595 THR A OG1 1 
ATOM   1763 C  CG2 . THR A 1 268 ? 0.217   -23.100 18.073  1.00 44.98  ? 595 THR A CG2 1 
ATOM   1764 N  N   . LEU A 1 269 ? 1.475   -25.147 21.185  1.00 43.01  ? 596 LEU A N   1 
ATOM   1765 C  CA  . LEU A 1 269 ? 1.250   -24.807 22.575  1.00 44.81  ? 596 LEU A CA  1 
ATOM   1766 C  C   . LEU A 1 269 ? 2.532   -24.245 23.214  1.00 47.00  ? 596 LEU A C   1 
ATOM   1767 O  O   . LEU A 1 269 ? 3.591   -24.906 23.185  1.00 48.03  ? 596 LEU A O   1 
ATOM   1768 C  CB  . LEU A 1 269 ? 0.697   -25.998 23.370  1.00 45.73  ? 596 LEU A CB  1 
ATOM   1769 C  CG  . LEU A 1 269 ? -0.676  -26.601 23.016  1.00 45.06  ? 596 LEU A CG  1 
ATOM   1770 C  CD1 . LEU A 1 269 ? -1.142  -27.580 24.103  1.00 46.80  ? 596 LEU A CD1 1 
ATOM   1771 C  CD2 . LEU A 1 269 ? -1.741  -25.533 22.760  1.00 43.71  ? 596 LEU A CD2 1 
ATOM   1772 N  N   . PRO A 1 270 ? 2.446   -23.013 23.777  1.00 47.27  ? 597 PRO A N   1 
ATOM   1773 C  CA  . PRO A 1 270 ? 3.617   -22.421 24.442  1.00 48.21  ? 597 PRO A CA  1 
ATOM   1774 C  C   . PRO A 1 270 ? 3.889   -22.981 25.849  1.00 50.02  ? 597 PRO A C   1 
ATOM   1775 O  O   . PRO A 1 270 ? 4.841   -22.541 26.518  1.00 51.78  ? 597 PRO A O   1 
ATOM   1776 C  CB  . PRO A 1 270 ? 3.288   -20.925 24.479  1.00 48.57  ? 597 PRO A CB  1 
ATOM   1777 C  CG  . PRO A 1 270 ? 1.796   -20.848 24.423  1.00 47.58  ? 597 PRO A CG  1 
ATOM   1778 C  CD  . PRO A 1 270 ? 1.297   -22.080 23.722  1.00 45.91  ? 597 PRO A CD  1 
ATOM   1779 N  N   . PHE A 1 271 ? 3.089   -23.962 26.272  1.00 48.93  ? 598 PHE A N   1 
ATOM   1780 C  CA  . PHE A 1 271 ? 3.294   -24.677 27.565  1.00 51.06  ? 598 PHE A CA  1 
ATOM   1781 C  C   . PHE A 1 271 ? 3.009   -26.188 27.404  1.00 50.56  ? 598 PHE A C   1 
ATOM   1782 O  O   . PHE A 1 271 ? 3.328   -27.036 28.246  1.00 52.29  ? 598 PHE A O   1 
ATOM   1783 C  CB  . PHE A 1 271 ? 2.395   -24.076 28.661  1.00 51.60  ? 598 PHE A CB  1 
ATOM   1784 C  CG  . PHE A 1 271 ? 0.952   -23.919 28.232  1.00 49.48  ? 598 PHE A CG  1 
ATOM   1785 C  CD1 . PHE A 1 271 ? 0.070   -25.017 28.258  1.00 48.77  ? 598 PHE A CD1 1 
ATOM   1786 C  CD2 . PHE A 1 271 ? 0.479   -22.684 27.769  1.00 47.76  ? 598 PHE A CD2 1 
ATOM   1787 C  CE1 . PHE A 1 271 ? -1.245  -24.880 27.833  1.00 47.19  ? 598 PHE A CE1 1 
ATOM   1788 C  CE2 . PHE A 1 271 ? -0.839  -22.542 27.361  1.00 46.45  ? 598 PHE A CE2 1 
ATOM   1789 C  CZ  . PHE A 1 271 ? -1.701  -23.642 27.386  1.00 46.06  ? 598 PHE A CZ  1 
ATOM   1790 O  OXT . PHE A 1 271 ? 2.424   -26.605 26.395  1.00 48.56  ? 598 PHE A OXT 1 
ATOM   1791 N  N   . VAL B 1 35  ? -6.271  38.017  -14.227 1.00 80.69  ? 362 VAL B N   1 
ATOM   1792 C  CA  . VAL B 1 35  ? -7.380  37.748  -13.253 1.00 76.55  ? 362 VAL B CA  1 
ATOM   1793 C  C   . VAL B 1 35  ? -7.327  38.690  -12.035 1.00 74.37  ? 362 VAL B C   1 
ATOM   1794 O  O   . VAL B 1 35  ? -6.300  38.805  -11.346 1.00 73.60  ? 362 VAL B O   1 
ATOM   1795 C  CB  . VAL B 1 35  ? -7.483  36.231  -12.856 1.00 75.48  ? 362 VAL B CB  1 
ATOM   1796 C  CG1 . VAL B 1 35  ? -6.253  35.730  -12.080 1.00 75.86  ? 362 VAL B CG1 1 
ATOM   1797 C  CG2 . VAL B 1 35  ? -8.779  35.926  -12.100 1.00 72.09  ? 362 VAL B CG2 1 
ATOM   1798 N  N   . SER B 1 36  ? -8.449  39.376  -11.817 1.00 71.64  ? 363 SER B N   1 
ATOM   1799 C  CA  . SER B 1 36  ? -8.687  40.211  -10.643 1.00 69.37  ? 363 SER B CA  1 
ATOM   1800 C  C   . SER B 1 36  ? -8.648  39.362  -9.347  1.00 65.62  ? 363 SER B C   1 
ATOM   1801 O  O   . SER B 1 36  ? -8.879  38.137  -9.384  1.00 63.45  ? 363 SER B O   1 
ATOM   1802 C  CB  . SER B 1 36  ? -10.029 40.937  -10.844 1.00 69.60  ? 363 SER B CB  1 
ATOM   1803 O  OG  . SER B 1 36  ? -10.788 41.083  -9.655  1.00 68.48  ? 363 SER B OG  1 
ATOM   1804 N  N   . LEU B 1 37  ? -8.343  39.997  -8.212  1.00 63.79  ? 364 LEU B N   1 
ATOM   1805 C  CA  . LEU B 1 37  ? -8.340  39.264  -6.935  1.00 60.03  ? 364 LEU B CA  1 
ATOM   1806 C  C   . LEU B 1 37  ? -9.766  38.865  -6.482  1.00 56.77  ? 364 LEU B C   1 
ATOM   1807 O  O   . LEU B 1 37  ? -10.016 37.687  -6.162  1.00 54.30  ? 364 LEU B O   1 
ATOM   1808 C  CB  . LEU B 1 37  ? -7.541  39.979  -5.823  1.00 59.66  ? 364 LEU B CB  1 
ATOM   1809 C  CG  . LEU B 1 37  ? -7.573  39.402  -4.384  1.00 57.59  ? 364 LEU B CG  1 
ATOM   1810 C  CD1 . LEU B 1 37  ? -7.016  37.989  -4.256  1.00 55.77  ? 364 LEU B CD1 1 
ATOM   1811 C  CD2 . LEU B 1 37  ? -6.866  40.321  -3.397  1.00 59.22  ? 364 LEU B CD2 1 
ATOM   1812 N  N   . ILE B 1 38  ? -10.691 39.823  -6.471  1.00 56.40  ? 365 ILE B N   1 
ATOM   1813 C  CA  . ILE B 1 38  ? -12.078 39.526  -6.063  1.00 54.54  ? 365 ILE B CA  1 
ATOM   1814 C  C   . ILE B 1 38  ? -12.693 38.441  -6.959  1.00 52.93  ? 365 ILE B C   1 
ATOM   1815 O  O   . ILE B 1 38  ? -13.408 37.578  -6.461  1.00 50.97  ? 365 ILE B O   1 
ATOM   1816 C  CB  . ILE B 1 38  ? -12.956 40.806  -5.925  1.00 55.93  ? 365 ILE B CB  1 
ATOM   1817 C  CG1 . ILE B 1 38  ? -14.217 40.515  -5.096  1.00 53.79  ? 365 ILE B CG1 1 
ATOM   1818 C  CG2 . ILE B 1 38  ? -13.236 41.467  -7.285  1.00 57.38  ? 365 ILE B CG2 1 
ATOM   1819 C  CD1 . ILE B 1 38  ? -14.788 41.741  -4.414  1.00 54.93  ? 365 ILE B CD1 1 
ATOM   1820 N  N   . SER B 1 39  ? -12.331 38.468  -8.250  1.00 54.41  ? 366 SER B N   1 
ATOM   1821 C  CA  . SER B 1 39  ? -12.710 37.466  -9.259  1.00 54.17  ? 366 SER B CA  1 
ATOM   1822 C  C   . SER B 1 39  ? -12.368 36.039  -8.854  1.00 52.45  ? 366 SER B C   1 
ATOM   1823 O  O   . SER B 1 39  ? -13.251 35.170  -8.816  1.00 51.89  ? 366 SER B O   1 
ATOM   1824 C  CB  . SER B 1 39  ? -12.033 37.768  -10.602 1.00 56.45  ? 366 SER B CB  1 
ATOM   1825 O  OG  . SER B 1 39  ? -12.918 38.408  -11.484 1.00 58.26  ? 366 SER B OG  1 
ATOM   1826 N  N   . ALA B 1 40  ? -11.086 35.818  -8.561  1.00 52.10  ? 367 ALA B N   1 
ATOM   1827 C  CA  . ALA B 1 40  ? -10.565 34.522  -8.148  1.00 50.33  ? 367 ALA B CA  1 
ATOM   1828 C  C   . ALA B 1 40  ? -11.093 34.110  -6.778  1.00 47.47  ? 367 ALA B C   1 
ATOM   1829 O  O   . ALA B 1 40  ? -11.159 32.911  -6.483  1.00 46.29  ? 367 ALA B O   1 
ATOM   1830 C  CB  . ALA B 1 40  ? -9.034  34.525  -8.164  1.00 51.20  ? 367 ALA B CB  1 
ATOM   1831 N  N   . LEU B 1 41  ? -11.446 35.095  -5.945  1.00 46.74  ? 368 LEU B N   1 
ATOM   1832 C  CA  . LEU B 1 41  ? -12.114 34.818  -4.666  1.00 44.49  ? 368 LEU B CA  1 
ATOM   1833 C  C   . LEU B 1 41  ? -13.545 34.392  -4.908  1.00 43.63  ? 368 LEU B C   1 
ATOM   1834 O  O   . LEU B 1 41  ? -14.049 33.526  -4.188  1.00 43.03  ? 368 LEU B O   1 
ATOM   1835 C  CB  . LEU B 1 41  ? -12.057 36.004  -3.696  1.00 44.60  ? 368 LEU B CB  1 
ATOM   1836 C  CG  . LEU B 1 41  ? -10.683 36.362  -3.091  1.00 45.29  ? 368 LEU B CG  1 
ATOM   1837 C  CD1 . LEU B 1 41  ? -10.693 37.804  -2.597  1.00 46.29  ? 368 LEU B CD1 1 
ATOM   1838 C  CD2 . LEU B 1 41  ? -10.218 35.404  -1.987  1.00 42.97  ? 368 LEU B CD2 1 
ATOM   1839 N  N   . VAL B 1 42  ? -14.192 34.979  -5.922  1.00 44.44  ? 369 VAL B N   1 
ATOM   1840 C  CA  . VAL B 1 42  ? -15.540 34.540  -6.319  1.00 43.39  ? 369 VAL B CA  1 
ATOM   1841 C  C   . VAL B 1 42  ? -15.484 33.138  -6.945  1.00 42.74  ? 369 VAL B C   1 
ATOM   1842 O  O   . VAL B 1 42  ? -16.297 32.295  -6.574  1.00 42.07  ? 369 VAL B O   1 
ATOM   1843 C  CB  . VAL B 1 42  ? -16.312 35.554  -7.210  1.00 44.83  ? 369 VAL B CB  1 
ATOM   1844 C  CG1 . VAL B 1 42  ? -17.631 34.962  -7.706  1.00 44.19  ? 369 VAL B CG1 1 
ATOM   1845 C  CG2 . VAL B 1 42  ? -16.600 36.838  -6.444  1.00 44.76  ? 369 VAL B CG2 1 
ATOM   1846 N  N   . ARG B 1 43  ? -14.523 32.867  -7.839  1.00 43.34  ? 370 ARG B N   1 
ATOM   1847 C  CA  . ARG B 1 43  ? -14.438 31.521  -8.430  1.00 43.81  ? 370 ARG B CA  1 
ATOM   1848 C  C   . ARG B 1 43  ? -14.153 30.461  -7.387  1.00 41.70  ? 370 ARG B C   1 
ATOM   1849 O  O   . ARG B 1 43  ? -14.726 29.385  -7.478  1.00 41.48  ? 370 ARG B O   1 
ATOM   1850 C  CB  . ARG B 1 43  ? -13.429 31.373  -9.577  1.00 47.29  ? 370 ARG B CB  1 
ATOM   1851 C  CG  . ARG B 1 43  ? -13.464 32.419  -10.676 1.00 51.55  ? 370 ARG B CG  1 
ATOM   1852 C  CD  . ARG B 1 43  ? -14.707 32.449  -11.573 1.00 53.01  ? 370 ARG B CD  1 
ATOM   1853 N  NE  . ARG B 1 43  ? -14.604 33.603  -12.485 1.00 56.20  ? 370 ARG B NE  1 
ATOM   1854 C  CZ  . ARG B 1 43  ? -14.832 34.877  -12.135 1.00 55.96  ? 370 ARG B CZ  1 
ATOM   1855 N  NH1 . ARG B 1 43  ? -15.212 35.192  -10.886 1.00 53.85  ? 370 ARG B NH1 1 
ATOM   1856 N  NH2 . ARG B 1 43  ? -14.682 35.835  -13.032 1.00 56.12  ? 370 ARG B NH2 1 
ATOM   1857 N  N   . ALA B 1 44  ? -13.287 30.757  -6.411  1.00 40.00  ? 371 ALA B N   1 
ATOM   1858 C  CA  . ALA B 1 44  ? -13.008 29.823  -5.317  1.00 39.55  ? 371 ALA B CA  1 
ATOM   1859 C  C   . ALA B 1 44  ? -14.281 29.416  -4.557  1.00 38.13  ? 371 ALA B C   1 
ATOM   1860 O  O   . ALA B 1 44  ? -14.449 28.232  -4.252  1.00 38.23  ? 371 ALA B O   1 
ATOM   1861 C  CB  . ALA B 1 44  ? -11.944 30.368  -4.345  1.00 38.48  ? 371 ALA B CB  1 
ATOM   1862 N  N   . HIS B 1 45  ? -15.150 30.389  -4.257  1.00 37.88  ? 372 HIS B N   1 
ATOM   1863 C  CA  . HIS B 1 45  ? -16.428 30.150  -3.530  1.00 37.47  ? 372 HIS B CA  1 
ATOM   1864 C  C   . HIS B 1 45  ? -17.454 29.397  -4.399  1.00 38.03  ? 372 HIS B C   1 
ATOM   1865 O  O   . HIS B 1 45  ? -17.984 28.360  -3.986  1.00 36.90  ? 372 HIS B O   1 
ATOM   1866 C  CB  . HIS B 1 45  ? -17.016 31.483  -3.017  1.00 37.53  ? 372 HIS B CB  1 
ATOM   1867 C  CG  . HIS B 1 45  ? -18.414 31.375  -2.477  1.00 37.31  ? 372 HIS B CG  1 
ATOM   1868 N  ND1 . HIS B 1 45  ? -19.529 31.674  -3.231  1.00 38.26  ? 372 HIS B ND1 1 
ATOM   1869 C  CD2 . HIS B 1 45  ? -18.877 30.996  -1.264  1.00 35.96  ? 372 HIS B CD2 1 
ATOM   1870 C  CE1 . HIS B 1 45  ? -20.616 31.490  -2.504  1.00 37.22  ? 372 HIS B CE1 1 
ATOM   1871 N  NE2 . HIS B 1 45  ? -20.249 31.075  -1.308  1.00 36.39  ? 372 HIS B NE2 1 
ATOM   1872 N  N   . VAL B 1 46  ? -17.706 29.931  -5.599  1.00 40.04  ? 373 VAL B N   1 
ATOM   1873 C  CA  . VAL B 1 46  ? -18.618 29.336  -6.581  1.00 41.75  ? 373 VAL B CA  1 
ATOM   1874 C  C   . VAL B 1 46  ? -18.224 27.892  -6.930  1.00 42.27  ? 373 VAL B C   1 
ATOM   1875 O  O   . VAL B 1 46  ? -19.084 27.024  -6.928  1.00 42.94  ? 373 VAL B O   1 
ATOM   1876 C  CB  . VAL B 1 46  ? -18.771 30.235  -7.836  1.00 44.11  ? 373 VAL B CB  1 
ATOM   1877 C  CG1 . VAL B 1 46  ? -19.568 29.537  -8.938  1.00 46.11  ? 373 VAL B CG1 1 
ATOM   1878 C  CG2 . VAL B 1 46  ? -19.435 31.553  -7.466  1.00 43.89  ? 373 VAL B CG2 1 
ATOM   1879 N  N   . ASP B 1 47  ? -16.936 27.632  -7.178  1.00 43.45  ? 374 ASP B N   1 
ATOM   1880 C  CA  . ASP B 1 47  ? -16.448 26.265  -7.494  1.00 44.58  ? 374 ASP B CA  1 
ATOM   1881 C  C   . ASP B 1 47  ? -16.355 25.328  -6.291  1.00 43.51  ? 374 ASP B C   1 
ATOM   1882 O  O   . ASP B 1 47  ? -16.048 24.146  -6.441  1.00 46.05  ? 374 ASP B O   1 
ATOM   1883 C  CB  . ASP B 1 47  ? -15.080 26.275  -8.208  1.00 46.31  ? 374 ASP B CB  1 
ATOM   1884 C  CG  . ASP B 1 47  ? -15.119 26.940  -9.575  1.00 48.48  ? 374 ASP B CG  1 
ATOM   1885 O  OD1 . ASP B 1 47  ? -16.200 27.030  -10.193 1.00 48.64  ? 374 ASP B OD1 1 
ATOM   1886 O  OD2 . ASP B 1 47  ? -14.036 27.370  -10.034 1.00 50.00  ? 374 ASP B OD2 1 
ATOM   1887 N  N   . SER B 1 48  ? -16.590 25.837  -5.098  1.00 41.23  ? 375 SER B N   1 
ATOM   1888 C  CA  . SER B 1 48  ? -16.567 24.971  -3.925  1.00 39.83  ? 375 SER B CA  1 
ATOM   1889 C  C   . SER B 1 48  ? -17.943 24.857  -3.218  1.00 38.09  ? 375 SER B C   1 
ATOM   1890 O  O   . SER B 1 48  ? -18.024 24.402  -2.082  1.00 36.48  ? 375 SER B O   1 
ATOM   1891 C  CB  . SER B 1 48  ? -15.470 25.442  -2.970  1.00 38.55  ? 375 SER B CB  1 
ATOM   1892 O  OG  . SER B 1 48  ? -15.827 26.693  -2.409  1.00 37.79  ? 375 SER B OG  1 
ATOM   1893 N  N   . ASN B 1 49  ? -19.008 25.274  -3.901  1.00 38.59  ? 376 ASN B N   1 
ATOM   1894 C  CA  . ASN B 1 49  ? -20.375 25.155  -3.378  1.00 38.78  ? 376 ASN B CA  1 
ATOM   1895 C  C   . ASN B 1 49  ? -21.318 24.383  -4.311  1.00 39.56  ? 376 ASN B C   1 
ATOM   1896 O  O   . ASN B 1 49  ? -21.115 24.388  -5.529  1.00 40.39  ? 376 ASN B O   1 
ATOM   1897 C  CB  . ASN B 1 49  ? -20.934 26.536  -3.016  1.00 39.30  ? 376 ASN B CB  1 
ATOM   1898 C  CG  . ASN B 1 49  ? -20.367 27.060  -1.700  1.00 39.94  ? 376 ASN B CG  1 
ATOM   1899 O  OD1 . ASN B 1 49  ? -20.789 26.658  -0.612  1.00 39.91  ? 376 ASN B OD1 1 
ATOM   1900 N  ND2 . ASN B 1 49  ? -19.391 27.953  -1.796  1.00 41.02  ? 376 ASN B ND2 1 
ATOM   1901 N  N   . PRO B 1 50  ? -22.352 23.709  -3.748  1.00 39.51  ? 377 PRO B N   1 
ATOM   1902 C  CA  . PRO B 1 50  ? -23.207 22.905  -4.630  1.00 40.35  ? 377 PRO B CA  1 
ATOM   1903 C  C   . PRO B 1 50  ? -24.105 23.768  -5.507  1.00 41.07  ? 377 PRO B C   1 
ATOM   1904 O  O   . PRO B 1 50  ? -24.462 24.904  -5.124  1.00 38.55  ? 377 PRO B O   1 
ATOM   1905 C  CB  . PRO B 1 50  ? -24.040 22.068  -3.656  1.00 39.64  ? 377 PRO B CB  1 
ATOM   1906 C  CG  . PRO B 1 50  ? -24.153 22.937  -2.453  1.00 38.86  ? 377 PRO B CG  1 
ATOM   1907 C  CD  . PRO B 1 50  ? -22.816 23.639  -2.344  1.00 38.09  ? 377 PRO B CD  1 
ATOM   1908 N  N   . ALA B 1 51  ? -24.407 23.226  -6.692  1.00 43.63  ? 378 ALA B N   1 
ATOM   1909 C  CA  . ALA B 1 51  ? -25.348 23.828  -7.636  1.00 45.90  ? 378 ALA B CA  1 
ATOM   1910 C  C   . ALA B 1 51  ? -26.755 23.772  -7.050  1.00 47.21  ? 378 ALA B C   1 
ATOM   1911 O  O   . ALA B 1 51  ? -27.246 22.708  -6.657  1.00 46.80  ? 378 ALA B O   1 
ATOM   1912 C  CB  . ALA B 1 51  ? -25.289 23.130  -8.988  1.00 47.69  ? 378 ALA B CB  1 
ATOM   1913 N  N   . MET B 1 52  ? -27.385 24.941  -6.987  1.00 49.45  ? 379 MET B N   1 
ATOM   1914 C  CA  . MET B 1 52  ? -28.724 25.081  -6.437  1.00 51.73  ? 379 MET B CA  1 
ATOM   1915 C  C   . MET B 1 52  ? -29.799 24.477  -7.353  1.00 53.79  ? 379 MET B C   1 
ATOM   1916 O  O   . MET B 1 52  ? -30.931 24.250  -6.909  1.00 54.37  ? 379 MET B O   1 
ATOM   1917 C  CB  . MET B 1 52  ? -29.015 26.549  -6.101  1.00 54.09  ? 379 MET B CB  1 
ATOM   1918 C  CG  . MET B 1 52  ? -28.033 27.205  -5.113  1.00 56.17  ? 379 MET B CG  1 
ATOM   1919 S  SD  . MET B 1 52  ? -27.868 26.500  -3.439  1.00 57.30  ? 379 MET B SD  1 
ATOM   1920 C  CE  . MET B 1 52  ? -29.405 27.036  -2.681  1.00 57.37  ? 379 MET B CE  1 
ATOM   1921 N  N   . THR B 1 53  ? -29.418 24.188  -8.604  1.00 54.66  ? 380 THR B N   1 
ATOM   1922 C  CA  . THR B 1 53  ? -30.301 23.568  -9.616  1.00 57.20  ? 380 THR B CA  1 
ATOM   1923 C  C   . THR B 1 53  ? -30.328 22.041  -9.531  1.00 58.86  ? 380 THR B C   1 
ATOM   1924 O  O   . THR B 1 53  ? -31.279 21.413  -9.993  1.00 62.10  ? 380 THR B O   1 
ATOM   1925 C  CB  . THR B 1 53  ? -29.920 23.981  -11.056 1.00 57.91  ? 380 THR B CB  1 
ATOM   1926 O  OG1 . THR B 1 53  ? -28.525 23.741  -11.283 1.00 56.84  ? 380 THR B OG1 1 
ATOM   1927 C  CG2 . THR B 1 53  ? -30.206 25.448  -11.283 1.00 57.73  ? 380 THR B CG2 1 
ATOM   1928 N  N   . SER B 1 54  ? -29.281 21.455  -8.944  1.00 58.41  ? 381 SER B N   1 
ATOM   1929 C  CA  . SER B 1 54  ? -29.186 20.002  -8.739  1.00 58.82  ? 381 SER B CA  1 
ATOM   1930 C  C   . SER B 1 54  ? -28.971 19.686  -7.260  1.00 57.28  ? 381 SER B C   1 
ATOM   1931 O  O   . SER B 1 54  ? -27.922 19.133  -6.866  1.00 58.52  ? 381 SER B O   1 
ATOM   1932 C  CB  . SER B 1 54  ? -28.051 19.416  -9.581  1.00 59.23  ? 381 SER B CB  1 
ATOM   1933 O  OG  . SER B 1 54  ? -26.812 19.995  -9.211  1.00 56.09  ? 381 SER B OG  1 
ATOM   1934 N  N   . LEU B 1 55  ? -29.945 20.070  -6.434  1.00 55.19  ? 382 LEU B N   1 
ATOM   1935 C  CA  . LEU B 1 55  ? -29.889 19.748  -5.007  1.00 51.86  ? 382 LEU B CA  1 
ATOM   1936 C  C   . LEU B 1 55  ? -30.506 18.385  -4.757  1.00 52.97  ? 382 LEU B C   1 
ATOM   1937 O  O   . LEU B 1 55  ? -31.371 17.942  -5.508  1.00 53.79  ? 382 LEU B O   1 
ATOM   1938 C  CB  . LEU B 1 55  ? -30.567 20.814  -4.141  1.00 50.00  ? 382 LEU B CB  1 
ATOM   1939 C  CG  . LEU B 1 55  ? -29.920 22.199  -4.083  1.00 47.82  ? 382 LEU B CG  1 
ATOM   1940 C  CD1 . LEU B 1 55  ? -30.837 23.145  -3.322  1.00 47.22  ? 382 LEU B CD1 1 
ATOM   1941 C  CD2 . LEU B 1 55  ? -28.516 22.161  -3.483  1.00 45.20  ? 382 LEU B CD2 1 
ATOM   1942 N  N   . ASP B 1 56  ? -30.037 17.732  -3.694  1.00 51.52  ? 383 ASP B N   1 
ATOM   1943 C  CA  . ASP B 1 56  ? -30.493 16.399  -3.326  1.00 52.36  ? 383 ASP B CA  1 
ATOM   1944 C  C   . ASP B 1 56  ? -31.499 16.443  -2.175  1.00 51.72  ? 383 ASP B C   1 
ATOM   1945 O  O   . ASP B 1 56  ? -31.127 16.675  -1.014  1.00 48.94  ? 383 ASP B O   1 
ATOM   1946 C  CB  . ASP B 1 56  ? -29.281 15.537  -2.970  1.00 51.76  ? 383 ASP B CB  1 
ATOM   1947 C  CG  . ASP B 1 56  ? -29.627 14.078  -2.751  1.00 54.36  ? 383 ASP B CG  1 
ATOM   1948 O  OD1 . ASP B 1 56  ? -30.747 13.613  -3.063  1.00 56.70  ? 383 ASP B OD1 1 
ATOM   1949 O  OD2 . ASP B 1 56  ? -28.733 13.375  -2.262  1.00 55.26  ? 383 ASP B OD2 1 
ATOM   1950 N  N   . TYR B 1 57  ? -32.766 16.208  -2.520  1.00 53.94  ? 384 TYR B N   1 
ATOM   1951 C  CA  . TYR B 1 57  ? -33.874 16.156  -1.551  1.00 55.44  ? 384 TYR B CA  1 
ATOM   1952 C  C   . TYR B 1 57  ? -34.258 14.753  -1.108  1.00 57.36  ? 384 TYR B C   1 
ATOM   1953 O  O   . TYR B 1 57  ? -35.128 14.616  -0.252  1.00 59.57  ? 384 TYR B O   1 
ATOM   1954 C  CB  . TYR B 1 57  ? -35.122 16.873  -2.098  1.00 57.81  ? 384 TYR B CB  1 
ATOM   1955 C  CG  . TYR B 1 57  ? -35.091 18.373  -1.941  1.00 57.19  ? 384 TYR B CG  1 
ATOM   1956 C  CD1 . TYR B 1 57  ? -35.726 18.990  -0.846  1.00 57.18  ? 384 TYR B CD1 1 
ATOM   1957 C  CD2 . TYR B 1 57  ? -34.420 19.186  -2.880  1.00 55.61  ? 384 TYR B CD2 1 
ATOM   1958 C  CE1 . TYR B 1 57  ? -35.692 20.370  -0.686  1.00 56.24  ? 384 TYR B CE1 1 
ATOM   1959 C  CE2 . TYR B 1 57  ? -34.392 20.567  -2.735  1.00 55.10  ? 384 TYR B CE2 1 
ATOM   1960 C  CZ  . TYR B 1 57  ? -35.028 21.153  -1.636  1.00 55.85  ? 384 TYR B CZ  1 
ATOM   1961 O  OH  . TYR B 1 57  ? -34.994 22.520  -1.478  1.00 56.44  ? 384 TYR B OH  1 
ATOM   1962 N  N   . SER B 1 58  ? -33.611 13.726  -1.669  1.00 58.16  ? 385 SER B N   1 
ATOM   1963 C  CA  . SER B 1 58  ? -33.948 12.295  -1.426  1.00 60.95  ? 385 SER B CA  1 
ATOM   1964 C  C   . SER B 1 58  ? -34.069 11.873  0.047   1.00 60.92  ? 385 SER B C   1 
ATOM   1965 O  O   . SER B 1 58  ? -34.837 10.983  0.368   1.00 63.44  ? 385 SER B O   1 
ATOM   1966 C  CB  . SER B 1 58  ? -32.957 11.357  -2.140  1.00 61.72  ? 385 SER B CB  1 
ATOM   1967 O  OG  . SER B 1 58  ? -31.677 11.359  -1.509  1.00 60.24  ? 385 SER B OG  1 
ATOM   1968 N  N   . ARG B 1 59  ? -33.307 12.528  0.919   1.00 58.77  ? 386 ARG B N   1 
ATOM   1969 C  CA  . ARG B 1 59  ? -33.288 12.237  2.352   1.00 59.06  ? 386 ARG B CA  1 
ATOM   1970 C  C   . ARG B 1 59  ? -34.070 13.270  3.177   1.00 58.10  ? 386 ARG B C   1 
ATOM   1971 O  O   . ARG B 1 59  ? -34.242 13.091  4.390   1.00 58.41  ? 386 ARG B O   1 
ATOM   1972 C  CB  . ARG B 1 59  ? -31.833 12.186  2.863   1.00 58.05  ? 386 ARG B CB  1 
ATOM   1973 C  CG  . ARG B 1 59  ? -31.062 10.905  2.556   1.00 60.51  ? 386 ARG B CG  1 
ATOM   1974 C  CD  . ARG B 1 59  ? -29.881 10.733  3.511   1.00 60.03  ? 386 ARG B CD  1 
ATOM   1975 N  NE  . ARG B 1 59  ? -28.749 11.572  3.108   1.00 58.27  ? 386 ARG B NE  1 
ATOM   1976 C  CZ  . ARG B 1 59  ? -27.786 12.006  3.921   1.00 56.40  ? 386 ARG B CZ  1 
ATOM   1977 N  NH1 . ARG B 1 59  ? -27.794 11.708  5.219   1.00 56.05  ? 386 ARG B NH1 1 
ATOM   1978 N  NH2 . ARG B 1 59  ? -26.802 12.755  3.426   1.00 54.78  ? 386 ARG B NH2 1 
ATOM   1979 N  N   . PHE B 1 60  ? -34.521 14.351  2.533   1.00 56.30  ? 387 PHE B N   1 
ATOM   1980 C  CA  . PHE B 1 60  ? -35.220 15.435  3.240   1.00 55.43  ? 387 PHE B CA  1 
ATOM   1981 C  C   . PHE B 1 60  ? -36.598 15.017  3.797   1.00 58.80  ? 387 PHE B C   1 
ATOM   1982 O  O   . PHE B 1 60  ? -37.379 14.344  3.118   1.00 60.71  ? 387 PHE B O   1 
ATOM   1983 C  CB  . PHE B 1 60  ? -35.333 16.692  2.356   1.00 53.04  ? 387 PHE B CB  1 
ATOM   1984 C  CG  . PHE B 1 60  ? -36.035 17.846  3.023   1.00 52.06  ? 387 PHE B CG  1 
ATOM   1985 C  CD1 . PHE B 1 60  ? -35.358 18.661  3.945   1.00 49.05  ? 387 PHE B CD1 1 
ATOM   1986 C  CD2 . PHE B 1 60  ? -37.389 18.111  2.749   1.00 53.52  ? 387 PHE B CD2 1 
ATOM   1987 C  CE1 . PHE B 1 60  ? -36.014 19.716  4.570   1.00 49.07  ? 387 PHE B CE1 1 
ATOM   1988 C  CE2 . PHE B 1 60  ? -38.042 19.166  3.368   1.00 53.79  ? 387 PHE B CE2 1 
ATOM   1989 C  CZ  . PHE B 1 60  ? -37.354 19.969  4.283   1.00 52.31  ? 387 PHE B CZ  1 
ATOM   1990 N  N   . GLN B 1 61  ? -36.859 15.416  5.044   1.00 59.44  ? 388 GLN B N   1 
ATOM   1991 C  CA  . GLN B 1 61  ? -38.144 15.198  5.718   1.00 63.45  ? 388 GLN B CA  1 
ATOM   1992 C  C   . GLN B 1 61  ? -38.458 16.397  6.598   1.00 64.41  ? 388 GLN B C   1 
ATOM   1993 O  O   . GLN B 1 61  ? -37.710 16.695  7.533   1.00 63.06  ? 388 GLN B O   1 
ATOM   1994 C  CB  . GLN B 1 61  ? -38.119 13.929  6.571   1.00 64.22  ? 388 GLN B CB  1 
ATOM   1995 C  CG  . GLN B 1 61  ? -38.090 12.634  5.781   1.00 65.68  ? 388 GLN B CG  1 
ATOM   1996 C  CD  . GLN B 1 61  ? -38.238 11.409  6.647   1.00 67.96  ? 388 GLN B CD  1 
ATOM   1997 O  OE1 . GLN B 1 61  ? -37.832 11.396  7.811   1.00 67.09  ? 388 GLN B OE1 1 
ATOM   1998 N  NE2 . GLN B 1 61  ? -38.822 10.361  6.079   1.00 70.65  ? 388 GLN B NE2 1 
ATOM   1999 N  N   . ALA B 1 62  ? -39.558 17.081  6.295   1.00 68.16  ? 389 ALA B N   1 
ATOM   2000 C  CA  . ALA B 1 62  ? -39.978 18.263  7.055   1.00 70.58  ? 389 ALA B CA  1 
ATOM   2001 C  C   . ALA B 1 62  ? -40.464 17.949  8.478   1.00 74.08  ? 389 ALA B C   1 
ATOM   2002 O  O   . ALA B 1 62  ? -40.243 18.746  9.398   1.00 74.44  ? 389 ALA B O   1 
ATOM   2003 C  CB  . ALA B 1 62  ? -41.027 19.051  6.285   1.00 72.39  ? 389 ALA B CB  1 
ATOM   2004 N  N   . ASN B 1 63  ? -41.095 16.786  8.656   1.00 78.27  ? 390 ASN B N   1 
ATOM   2005 C  CA  . ASN B 1 63  ? -41.713 16.417  9.943   1.00 82.26  ? 390 ASN B CA  1 
ATOM   2006 C  C   . ASN B 1 63  ? -41.374 14.999  10.450  1.00 83.15  ? 390 ASN B C   1 
ATOM   2007 O  O   . ASN B 1 63  ? -42.282 14.169  10.616  1.00 85.99  ? 390 ASN B O   1 
ATOM   2008 C  CB  . ASN B 1 63  ? -43.235 16.621  9.868   1.00 86.91  ? 390 ASN B CB  1 
ATOM   2009 C  CG  . ASN B 1 63  ? -43.652 18.023  10.258  1.00 88.19  ? 390 ASN B CG  1 
ATOM   2010 O  OD1 . ASN B 1 63  ? -43.424 18.987  9.520   1.00 86.62  ? 390 ASN B OD1 1 
ATOM   2011 N  ND2 . ASN B 1 63  ? -44.276 18.143  11.428  1.00 91.31  ? 390 ASN B ND2 1 
ATOM   2012 N  N   . PRO B 1 64  ? -40.076 14.730  10.740  1.00 80.62  ? 391 PRO B N   1 
ATOM   2013 C  CA  . PRO B 1 64  ? -39.624 13.360  11.041  1.00 81.69  ? 391 PRO B CA  1 
ATOM   2014 C  C   . PRO B 1 64  ? -40.162 12.799  12.361  1.00 85.68  ? 391 PRO B C   1 
ATOM   2015 O  O   . PRO B 1 64  ? -40.401 13.566  13.304  1.00 86.45  ? 391 PRO B O   1 
ATOM   2016 C  CB  . PRO B 1 64  ? -38.102 13.511  11.131  1.00 77.53  ? 391 PRO B CB  1 
ATOM   2017 C  CG  . PRO B 1 64  ? -37.888 14.914  11.587  1.00 75.32  ? 391 PRO B CG  1 
ATOM   2018 C  CD  . PRO B 1 64  ? -39.021 15.728  11.023  1.00 76.69  ? 391 PRO B CD  1 
ATOM   2019 N  N   . ASP B 1 65  ? -40.361 11.479  12.409  1.00 89.30  ? 392 ASP B N   1 
ATOM   2020 C  CA  . ASP B 1 65  ? -40.604 10.763  13.669  1.00 92.75  ? 392 ASP B CA  1 
ATOM   2021 C  C   . ASP B 1 65  ? -39.253 10.338  14.259  1.00 91.34  ? 392 ASP B C   1 
ATOM   2022 O  O   . ASP B 1 65  ? -38.638 9.369   13.801  1.00 91.52  ? 392 ASP B O   1 
ATOM   2023 C  CB  . ASP B 1 65  ? -41.512 9.542   13.458  1.00 97.14  ? 392 ASP B CB  1 
ATOM   2024 C  CG  . ASP B 1 65  ? -42.000 8.914   14.779  1.00 101.87 ? 392 ASP B CG  1 
ATOM   2025 O  OD1 . ASP B 1 65  ? -43.179 8.486   14.811  1.00 106.00 ? 392 ASP B OD1 1 
ATOM   2026 O  OD2 . ASP B 1 65  ? -41.234 8.834   15.778  1.00 100.61 ? 392 ASP B OD2 1 
ATOM   2027 N  N   . ASP B 1 72  ? -29.327 8.364   19.099  1.00 72.85  ? 399 ASP B N   1 
ATOM   2028 C  CA  . ASP B 1 72  ? -29.275 7.502   17.876  1.00 73.20  ? 399 ASP B CA  1 
ATOM   2029 C  C   . ASP B 1 72  ? -27.914 7.556   17.142  1.00 69.37  ? 399 ASP B C   1 
ATOM   2030 O  O   . ASP B 1 72  ? -27.386 8.638   16.844  1.00 65.14  ? 399 ASP B O   1 
ATOM   2031 C  CB  . ASP B 1 72  ? -30.434 7.843   16.930  1.00 74.94  ? 399 ASP B CB  1 
ATOM   2032 C  CG  . ASP B 1 72  ? -30.500 6.920   15.721  1.00 77.03  ? 399 ASP B CG  1 
ATOM   2033 O  OD1 . ASP B 1 72  ? -31.149 5.850   15.815  1.00 81.12  ? 399 ASP B OD1 1 
ATOM   2034 O  OD2 . ASP B 1 72  ? -29.906 7.274   14.674  1.00 74.82  ? 399 ASP B OD2 1 
ATOM   2035 N  N   . THR B 1 73  ? -27.389 6.368   16.836  1.00 70.01  ? 400 THR B N   1 
ATOM   2036 C  CA  . THR B 1 73  ? -26.034 6.173   16.290  1.00 68.51  ? 400 THR B CA  1 
ATOM   2037 C  C   . THR B 1 73  ? -25.819 6.678   14.855  1.00 66.07  ? 400 THR B C   1 
ATOM   2038 O  O   . THR B 1 73  ? -24.776 7.260   14.551  1.00 63.28  ? 400 THR B O   1 
ATOM   2039 C  CB  . THR B 1 73  ? -25.612 4.691   16.356  1.00 71.06  ? 400 THR B CB  1 
ATOM   2040 O  OG1 . THR B 1 73  ? -26.605 3.894   15.701  1.00 74.78  ? 400 THR B OG1 1 
ATOM   2041 C  CG2 . THR B 1 73  ? -25.467 4.224   17.800  1.00 73.33  ? 400 THR B CG2 1 
ATOM   2042 N  N   . GLN B 1 74  ? -26.797 6.431   13.984  1.00 67.92  ? 401 GLN B N   1 
ATOM   2043 C  CA  . GLN B 1 74  ? -26.749 6.865   12.586  1.00 66.49  ? 401 GLN B CA  1 
ATOM   2044 C  C   . GLN B 1 74  ? -26.716 8.390   12.446  1.00 62.35  ? 401 GLN B C   1 
ATOM   2045 O  O   . GLN B 1 74  ? -25.969 8.915   11.623  1.00 59.63  ? 401 GLN B O   1 
ATOM   2046 C  CB  . GLN B 1 74  ? -27.915 6.269   11.786  1.00 69.80  ? 401 GLN B CB  1 
ATOM   2047 C  CG  . GLN B 1 74  ? -27.642 4.876   11.236  1.00 74.13  ? 401 GLN B CG  1 
ATOM   2048 C  CD  . GLN B 1 74  ? -28.381 3.764   11.979  1.00 79.57  ? 401 GLN B CD  1 
ATOM   2049 O  OE1 . GLN B 1 74  ? -28.199 3.561   13.192  1.00 81.73  ? 401 GLN B OE1 1 
ATOM   2050 N  NE2 . GLN B 1 74  ? -29.214 3.022   11.245  1.00 81.38  ? 401 GLN B NE2 1 
ATOM   2051 N  N   . HIS B 1 75  ? -27.510 9.085   13.261  1.00 61.65  ? 402 HIS B N   1 
ATOM   2052 C  CA  . HIS B 1 75  ? -27.535 10.551  13.267  1.00 58.90  ? 402 HIS B CA  1 
ATOM   2053 C  C   . HIS B 1 75  ? -26.230 11.194  13.762  1.00 56.03  ? 402 HIS B C   1 
ATOM   2054 O  O   . HIS B 1 75  ? -25.847 12.269  13.278  1.00 54.33  ? 402 HIS B O   1 
ATOM   2055 C  CB  . HIS B 1 75  ? -28.735 11.078  14.053  1.00 60.56  ? 402 HIS B CB  1 
ATOM   2056 C  CG  . HIS B 1 75  ? -30.051 10.790  13.401  1.00 63.85  ? 402 HIS B CG  1 
ATOM   2057 N  ND1 . HIS B 1 75  ? -30.979 9.928   13.947  1.00 67.10  ? 402 HIS B ND1 1 
ATOM   2058 C  CD2 . HIS B 1 75  ? -30.586 11.231  12.236  1.00 63.96  ? 402 HIS B CD2 1 
ATOM   2059 C  CE1 . HIS B 1 75  ? -32.033 9.858   13.153  1.00 69.11  ? 402 HIS B CE1 1 
ATOM   2060 N  NE2 . HIS B 1 75  ? -31.819 10.638  12.107  1.00 67.45  ? 402 HIS B NE2 1 
ATOM   2061 N  N   . ILE B 1 76  ? -25.561 10.544  14.715  1.00 55.02  ? 403 ILE B N   1 
ATOM   2062 C  CA  . ILE B 1 76  ? -24.247 10.989  15.157  1.00 52.84  ? 403 ILE B CA  1 
ATOM   2063 C  C   . ILE B 1 76  ? -23.220 10.745  14.041  1.00 52.56  ? 403 ILE B C   1 
ATOM   2064 O  O   . ILE B 1 76  ? -22.396 11.632  13.753  1.00 51.05  ? 403 ILE B O   1 
ATOM   2065 C  CB  . ILE B 1 76  ? -23.825 10.361  16.503  1.00 53.36  ? 403 ILE B CB  1 
ATOM   2066 C  CG1 . ILE B 1 76  ? -24.838 10.737  17.600  1.00 54.09  ? 403 ILE B CG1 1 
ATOM   2067 C  CG2 . ILE B 1 76  ? -22.426 10.826  16.899  1.00 51.54  ? 403 ILE B CG2 1 
ATOM   2068 C  CD1 . ILE B 1 76  ? -24.695 9.971   18.900  1.00 55.30  ? 403 ILE B CD1 1 
ATOM   2069 N  N   . GLN B 1 77  ? -23.301 9.578   13.394  1.00 54.13  ? 404 GLN B N   1 
ATOM   2070 C  CA  . GLN B 1 77  ? -22.407 9.232   12.286  1.00 54.32  ? 404 GLN B CA  1 
ATOM   2071 C  C   . GLN B 1 77  ? -22.540 10.202  11.108  1.00 52.99  ? 404 GLN B C   1 
ATOM   2072 O  O   . GLN B 1 77  ? -21.535 10.662  10.569  1.00 51.73  ? 404 GLN B O   1 
ATOM   2073 C  CB  . GLN B 1 77  ? -22.599 7.773   11.838  1.00 56.97  ? 404 GLN B CB  1 
ATOM   2074 C  CG  . GLN B 1 77  ? -21.588 7.276   10.799  1.00 57.66  ? 404 GLN B CG  1 
ATOM   2075 C  CD  . GLN B 1 77  ? -20.132 7.403   11.248  1.00 57.54  ? 404 GLN B CD  1 
ATOM   2076 O  OE1 . GLN B 1 77  ? -19.732 6.853   12.282  1.00 58.98  ? 404 GLN B OE1 1 
ATOM   2077 N  NE2 . GLN B 1 77  ? -19.332 8.135   10.468  1.00 55.73  ? 404 GLN B NE2 1 
ATOM   2078 N  N   . GLN B 1 78  ? -23.778 10.524  10.736  1.00 54.60  ? 405 GLN B N   1 
ATOM   2079 C  CA  . GLN B 1 78  ? -24.062 11.456  9.633   1.00 53.82  ? 405 GLN B CA  1 
ATOM   2080 C  C   . GLN B 1 78  ? -23.535 12.855  9.925   1.00 50.46  ? 405 GLN B C   1 
ATOM   2081 O  O   . GLN B 1 78  ? -23.060 13.532  9.017   1.00 49.16  ? 405 GLN B O   1 
ATOM   2082 C  CB  . GLN B 1 78  ? -25.565 11.517  9.327   1.00 56.40  ? 405 GLN B CB  1 
ATOM   2083 C  CG  . GLN B 1 78  ? -26.110 10.253  8.674   1.00 60.98  ? 405 GLN B CG  1 
ATOM   2084 C  CD  . GLN B 1 78  ? -27.598 10.321  8.342   1.00 63.83  ? 405 GLN B CD  1 
ATOM   2085 O  OE1 . GLN B 1 78  ? -28.209 11.398  8.290   1.00 64.62  ? 405 GLN B OE1 1 
ATOM   2086 N  NE2 . GLN B 1 78  ? -28.184 9.161   8.100   1.00 66.18  ? 405 GLN B NE2 1 
ATOM   2087 N  N   . PHE B 1 79  ? -23.634 13.268  11.193  1.00 48.57  ? 406 PHE B N   1 
ATOM   2088 C  CA  . PHE B 1 79  ? -23.096 14.534  11.671  1.00 45.11  ? 406 PHE B CA  1 
ATOM   2089 C  C   . PHE B 1 79  ? -21.581 14.573  11.440  1.00 44.04  ? 406 PHE B C   1 
ATOM   2090 O  O   . PHE B 1 79  ? -21.055 15.581  10.935  1.00 42.69  ? 406 PHE B O   1 
ATOM   2091 C  CB  . PHE B 1 79  ? -23.482 14.737  13.146  1.00 44.74  ? 406 PHE B CB  1 
ATOM   2092 C  CG  . PHE B 1 79  ? -22.636 15.743  13.881  1.00 42.58  ? 406 PHE B CG  1 
ATOM   2093 C  CD1 . PHE B 1 79  ? -22.908 17.107  13.780  1.00 40.91  ? 406 PHE B CD1 1 
ATOM   2094 C  CD2 . PHE B 1 79  ? -21.571 15.322  14.695  1.00 42.13  ? 406 PHE B CD2 1 
ATOM   2095 C  CE1 . PHE B 1 79  ? -22.135 18.033  14.473  1.00 40.14  ? 406 PHE B CE1 1 
ATOM   2096 C  CE2 . PHE B 1 79  ? -20.782 16.247  15.374  1.00 41.11  ? 406 PHE B CE2 1 
ATOM   2097 C  CZ  . PHE B 1 79  ? -21.067 17.603  15.267  1.00 40.14  ? 406 PHE B CZ  1 
ATOM   2098 N  N   . TYR B 1 80  ? -20.902 13.473  11.789  1.00 44.07  ? 407 TYR B N   1 
ATOM   2099 C  CA  . TYR B 1 80  ? -19.474 13.324  11.514  1.00 43.38  ? 407 TYR B CA  1 
ATOM   2100 C  C   . TYR B 1 80  ? -19.146 13.354  10.013  1.00 42.07  ? 407 TYR B C   1 
ATOM   2101 O  O   . TYR B 1 80  ? -18.200 14.050  9.604   1.00 40.91  ? 407 TYR B O   1 
ATOM   2102 C  CB  . TYR B 1 80  ? -18.886 12.065  12.165  1.00 45.62  ? 407 TYR B CB  1 
ATOM   2103 C  CG  . TYR B 1 80  ? -18.805 12.081  13.683  1.00 46.86  ? 407 TYR B CG  1 
ATOM   2104 C  CD1 . TYR B 1 80  ? -18.369 13.214  14.389  1.00 45.93  ? 407 TYR B CD1 1 
ATOM   2105 C  CD2 . TYR B 1 80  ? -19.118 10.933  14.416  1.00 49.63  ? 407 TYR B CD2 1 
ATOM   2106 C  CE1 . TYR B 1 80  ? -18.284 13.198  15.785  1.00 47.86  ? 407 TYR B CE1 1 
ATOM   2107 C  CE2 . TYR B 1 80  ? -19.035 10.913  15.804  1.00 50.91  ? 407 TYR B CE2 1 
ATOM   2108 C  CZ  . TYR B 1 80  ? -18.632 12.045  16.483  1.00 49.68  ? 407 TYR B CZ  1 
ATOM   2109 O  OH  . TYR B 1 80  ? -18.565 12.001  17.859  1.00 53.50  ? 407 TYR B OH  1 
ATOM   2110 N  N   . ASP B 1 81  ? -19.925 12.621  9.210   1.00 42.03  ? 408 ASP B N   1 
ATOM   2111 C  CA  . ASP B 1 81  ? -19.722 12.558  7.749   1.00 41.58  ? 408 ASP B CA  1 
ATOM   2112 C  C   . ASP B 1 81  ? -19.827 13.935  7.126   1.00 38.97  ? 408 ASP B C   1 
ATOM   2113 O  O   . ASP B 1 81  ? -18.977 14.314  6.317   1.00 37.80  ? 408 ASP B O   1 
ATOM   2114 C  CB  . ASP B 1 81  ? -20.714 11.613  7.077   1.00 43.83  ? 408 ASP B CB  1 
ATOM   2115 C  CG  . ASP B 1 81  ? -20.579 10.180  7.557   1.00 47.13  ? 408 ASP B CG  1 
ATOM   2116 O  OD1 . ASP B 1 81  ? -19.510 9.802   8.090   1.00 47.69  ? 408 ASP B OD1 1 
ATOM   2117 O  OD2 . ASP B 1 81  ? -21.561 9.418   7.402   1.00 49.84  ? 408 ASP B OD2 1 
ATOM   2118 N  N   . LEU B 1 82  ? -20.851 14.681  7.555   1.00 37.72  ? 409 LEU B N   1 
ATOM   2119 C  CA  . LEU B 1 82  ? -21.075 16.048  7.142   1.00 36.57  ? 409 LEU B CA  1 
ATOM   2120 C  C   . LEU B 1 82  ? -19.859 16.922  7.434   1.00 35.90  ? 409 LEU B C   1 
ATOM   2121 O  O   . LEU B 1 82  ? -19.386 17.632  6.551   1.00 34.24  ? 409 LEU B O   1 
ATOM   2122 C  CB  . LEU B 1 82  ? -22.368 16.606  7.755   1.00 36.28  ? 409 LEU B CB  1 
ATOM   2123 C  CG  . LEU B 1 82  ? -23.707 16.078  7.172   1.00 37.51  ? 409 LEU B CG  1 
ATOM   2124 C  CD1 . LEU B 1 82  ? -24.900 16.516  7.996   1.00 37.42  ? 409 LEU B CD1 1 
ATOM   2125 C  CD2 . LEU B 1 82  ? -23.924 16.428  5.704   1.00 36.99  ? 409 LEU B CD2 1 
ATOM   2126 N  N   . LEU B 1 83  ? -19.315 16.810  8.647   1.00 37.22  ? 410 LEU B N   1 
ATOM   2127 C  CA  . LEU B 1 83  ? -18.116 17.555  8.997   1.00 37.12  ? 410 LEU B CA  1 
ATOM   2128 C  C   . LEU B 1 83  ? -16.898 17.109  8.171   1.00 37.41  ? 410 LEU B C   1 
ATOM   2129 O  O   . LEU B 1 83  ? -16.162 17.978  7.671   1.00 36.70  ? 410 LEU B O   1 
ATOM   2130 C  CB  . LEU B 1 83  ? -17.820 17.514  10.513  1.00 37.81  ? 410 LEU B CB  1 
ATOM   2131 C  CG  . LEU B 1 83  ? -18.701 18.317  11.483  1.00 38.42  ? 410 LEU B CG  1 
ATOM   2132 C  CD1 . LEU B 1 83  ? -18.256 18.030  12.912  1.00 38.50  ? 410 LEU B CD1 1 
ATOM   2133 C  CD2 . LEU B 1 83  ? -18.657 19.820  11.207  1.00 37.46  ? 410 LEU B CD2 1 
ATOM   2134 N  N   . THR B 1 84  ? -16.697 15.791  8.016   1.00 38.27  ? 411 THR B N   1 
ATOM   2135 C  CA  . THR B 1 84  ? -15.539 15.293  7.252   1.00 39.75  ? 411 THR B CA  1 
ATOM   2136 C  C   . THR B 1 84  ? -15.632 15.646  5.770   1.00 40.03  ? 411 THR B C   1 
ATOM   2137 O  O   . THR B 1 84  ? -14.630 16.056  5.176   1.00 40.86  ? 411 THR B O   1 
ATOM   2138 C  CB  . THR B 1 84  ? -15.209 13.785  7.443   1.00 41.84  ? 411 THR B CB  1 
ATOM   2139 O  OG1 . THR B 1 84  ? -16.266 12.975  6.940   1.00 44.98  ? 411 THR B OG1 1 
ATOM   2140 C  CG2 . THR B 1 84  ? -14.986 13.432  8.895   1.00 41.98  ? 411 THR B CG2 1 
ATOM   2141 N  N   . GLY B 1 85  ? -16.825 15.514  5.186   1.00 40.47  ? 412 GLY B N   1 
ATOM   2142 C  CA  . GLY B 1 85  ? -17.039 15.823  3.758   1.00 42.44  ? 412 GLY B CA  1 
ATOM   2143 C  C   . GLY B 1 85  ? -16.849 17.299  3.407   1.00 41.76  ? 412 GLY B C   1 
ATOM   2144 O  O   . GLY B 1 85  ? -16.298 17.638  2.356   1.00 41.36  ? 412 GLY B O   1 
ATOM   2145 N  N   . SER B 1 86  ? -17.335 18.161  4.293   1.00 41.28  ? 413 SER B N   1 
ATOM   2146 C  CA  . SER B 1 86  ? -17.129 19.591  4.230   1.00 42.22  ? 413 SER B CA  1 
ATOM   2147 C  C   . SER B 1 86  ? -15.639 19.971  4.280   1.00 43.76  ? 413 SER B C   1 
ATOM   2148 O  O   . SER B 1 86  ? -15.214 20.936  3.635   1.00 42.78  ? 413 SER B O   1 
ATOM   2149 C  CB  . SER B 1 86  ? -17.886 20.241  5.394   1.00 42.25  ? 413 SER B CB  1 
ATOM   2150 O  OG  . SER B 1 86  ? -17.246 21.427  5.845   1.00 42.75  ? 413 SER B OG  1 
ATOM   2151 N  N   . MET B 1 87  ? -14.867 19.199  5.049   1.00 46.57  ? 414 MET B N   1 
ATOM   2152 C  CA  . MET B 1 87  ? -13.452 19.453  5.303   1.00 48.67  ? 414 MET B CA  1 
ATOM   2153 C  C   . MET B 1 87  ? -12.611 19.402  4.019   1.00 49.73  ? 414 MET B C   1 
ATOM   2154 O  O   . MET B 1 87  ? -11.757 20.267  3.795   1.00 49.37  ? 414 MET B O   1 
ATOM   2155 C  CB  . MET B 1 87  ? -12.937 18.458  6.341   1.00 51.03  ? 414 MET B CB  1 
ATOM   2156 C  CG  . MET B 1 87  ? -11.650 18.842  7.052   1.00 53.72  ? 414 MET B CG  1 
ATOM   2157 S  SD  . MET B 1 87  ? -11.223 17.695  8.385   1.00 58.36  ? 414 MET B SD  1 
ATOM   2158 C  CE  . MET B 1 87  ? -12.468 18.039  9.629   1.00 55.76  ? 414 MET B CE  1 
ATOM   2159 N  N   . GLU B 1 88  ? -12.879 18.414  3.170   1.00 51.08  ? 415 GLU B N   1 
ATOM   2160 C  CA  . GLU B 1 88  ? -12.162 18.269  1.911   1.00 52.67  ? 415 GLU B CA  1 
ATOM   2161 C  C   . GLU B 1 88  ? -12.512 19.382  0.935   1.00 51.26  ? 415 GLU B C   1 
ATOM   2162 O  O   . GLU B 1 88  ? -11.647 19.872  0.194   1.00 51.62  ? 415 GLU B O   1 
ATOM   2163 C  CB  . GLU B 1 88  ? -12.411 16.884  1.288   1.00 58.04  ? 415 GLU B CB  1 
ATOM   2164 C  CG  . GLU B 1 88  ? -11.172 16.264  0.624   1.00 63.82  ? 415 GLU B CG  1 
ATOM   2165 C  CD  . GLU B 1 88  ? -9.879  16.456  1.435   1.00 65.91  ? 415 GLU B CD  1 
ATOM   2166 O  OE1 . GLU B 1 88  ? -9.885  16.268  2.686   1.00 65.85  ? 415 GLU B OE1 1 
ATOM   2167 O  OE2 . GLU B 1 88  ? -8.850  16.815  0.819   1.00 67.81  ? 415 GLU B OE2 1 
ATOM   2168 N  N   . ILE B 1 89  ? -13.773 19.802  0.963   1.00 47.67  ? 416 ILE B N   1 
ATOM   2169 C  CA  . ILE B 1 89  ? -14.260 20.823  0.039   1.00 45.09  ? 416 ILE B CA  1 
ATOM   2170 C  C   . ILE B 1 89  ? -13.736 22.211  0.429   1.00 42.45  ? 416 ILE B C   1 
ATOM   2171 O  O   . ILE B 1 89  ? -13.339 22.985  -0.445  1.00 42.88  ? 416 ILE B O   1 
ATOM   2172 C  CB  . ILE B 1 89  ? -15.793 20.739  -0.123  1.00 44.59  ? 416 ILE B CB  1 
ATOM   2173 C  CG1 . ILE B 1 89  ? -16.126 19.569  -1.065  1.00 47.17  ? 416 ILE B CG1 1 
ATOM   2174 C  CG2 . ILE B 1 89  ? -16.348 22.015  -0.720  1.00 44.41  ? 416 ILE B CG2 1 
ATOM   2175 C  CD1 . ILE B 1 89  ? -17.541 19.033  -0.957  1.00 48.19  ? 416 ILE B CD1 1 
ATOM   2176 N  N   . ILE B 1 90  ? -13.695 22.493  1.734   1.00 39.51  ? 417 ILE B N   1 
ATOM   2177 C  CA  . ILE B 1 90  ? -13.184 23.768  2.238   1.00 37.92  ? 417 ILE B CA  1 
ATOM   2178 C  C   . ILE B 1 90  ? -11.673 23.859  2.003   1.00 38.19  ? 417 ILE B C   1 
ATOM   2179 O  O   . ILE B 1 90  ? -11.175 24.897  1.542   1.00 38.11  ? 417 ILE B O   1 
ATOM   2180 C  CB  . ILE B 1 90  ? -13.619 24.052  3.711   1.00 36.29  ? 417 ILE B CB  1 
ATOM   2181 C  CG1 . ILE B 1 90  ? -15.130 24.280  3.766   1.00 34.08  ? 417 ILE B CG1 1 
ATOM   2182 C  CG2 . ILE B 1 90  ? -12.897 25.276  4.290   1.00 35.58  ? 417 ILE B CG2 1 
ATOM   2183 C  CD1 . ILE B 1 90  ? -15.743 24.270  5.149   1.00 33.31  ? 417 ILE B CD1 1 
ATOM   2184 N  N   . ARG B 1 91  ? -10.956 22.765  2.259   1.00 40.27  ? 418 ARG B N   1 
ATOM   2185 C  CA  . ARG B 1 91  ? -9.521  22.694  1.897   1.00 42.70  ? 418 ARG B CA  1 
ATOM   2186 C  C   . ARG B 1 91  ? -9.323  23.021  0.404   1.00 42.95  ? 418 ARG B C   1 
ATOM   2187 O  O   . ARG B 1 91  ? -8.425  23.782  0.045   1.00 44.35  ? 418 ARG B O   1 
ATOM   2188 C  CB  . ARG B 1 91  ? -8.883  21.354  2.282   1.00 45.00  ? 418 ARG B CB  1 
ATOM   2189 C  CG  . ARG B 1 91  ? -7.361  21.422  2.342   1.00 49.59  ? 418 ARG B CG  1 
ATOM   2190 C  CD  . ARG B 1 91  ? -6.707  20.112  2.763   1.00 53.57  ? 418 ARG B CD  1 
ATOM   2191 N  NE  . ARG B 1 91  ? -6.168  20.134  4.130   1.00 54.98  ? 418 ARG B NE  1 
ATOM   2192 C  CZ  . ARG B 1 91  ? -6.719  19.513  5.175   1.00 56.91  ? 418 ARG B CZ  1 
ATOM   2193 N  NH1 . ARG B 1 91  ? -7.850  18.822  5.027   1.00 57.98  ? 418 ARG B NH1 1 
ATOM   2194 N  NH2 . ARG B 1 91  ? -6.152  19.592  6.379   1.00 56.54  ? 418 ARG B NH2 1 
ATOM   2195 N  N   . GLY B 1 92  ? -10.202 22.484  -0.441  1.00 42.46  ? 419 GLY B N   1 
ATOM   2196 C  CA  . GLY B 1 92  ? -10.232 22.791  -1.872  1.00 42.91  ? 419 GLY B CA  1 
ATOM   2197 C  C   . GLY B 1 92  ? -10.453 24.265  -2.148  1.00 42.96  ? 419 GLY B C   1 
ATOM   2198 O  O   . GLY B 1 92  ? -9.764  24.845  -2.999  1.00 45.92  ? 419 GLY B O   1 
ATOM   2199 N  N   . TRP B 1 93  ? -11.401 24.876  -1.431  1.00 39.41  ? 420 TRP B N   1 
ATOM   2200 C  CA  . TRP B 1 93  ? -11.647 26.311  -1.539  1.00 38.05  ? 420 TRP B CA  1 
ATOM   2201 C  C   . TRP B 1 93  ? -10.405 27.118  -1.132  1.00 38.85  ? 420 TRP B C   1 
ATOM   2202 O  O   . TRP B 1 93  ? -9.983  28.031  -1.862  1.00 38.75  ? 420 TRP B O   1 
ATOM   2203 C  CB  . TRP B 1 93  ? -12.845 26.690  -0.682  1.00 35.70  ? 420 TRP B CB  1 
ATOM   2204 C  CG  . TRP B 1 93  ? -12.982 28.136  -0.392  1.00 34.83  ? 420 TRP B CG  1 
ATOM   2205 C  CD1 . TRP B 1 93  ? -13.557 29.087  -1.194  1.00 35.57  ? 420 TRP B CD1 1 
ATOM   2206 C  CD2 . TRP B 1 93  ? -12.569 28.809  0.802   1.00 34.04  ? 420 TRP B CD2 1 
ATOM   2207 N  NE1 . TRP B 1 93  ? -13.522 30.318  -0.570  1.00 35.00  ? 420 TRP B NE1 1 
ATOM   2208 C  CE2 . TRP B 1 93  ? -12.921 30.175  0.654   1.00 34.12  ? 420 TRP B CE2 1 
ATOM   2209 C  CE3 . TRP B 1 93  ? -11.923 28.391  1.988   1.00 33.77  ? 420 TRP B CE3 1 
ATOM   2210 C  CZ2 . TRP B 1 93  ? -12.650 31.130  1.644   1.00 34.09  ? 420 TRP B CZ2 1 
ATOM   2211 C  CZ3 . TRP B 1 93  ? -11.662 29.340  2.985   1.00 33.33  ? 420 TRP B CZ3 1 
ATOM   2212 C  CH2 . TRP B 1 93  ? -12.025 30.697  2.802   1.00 34.27  ? 420 TRP B CH2 1 
ATOM   2213 N  N   . ALA B 1 94  ? -9.829  26.774  0.027   1.00 38.72  ? 421 ALA B N   1 
ATOM   2214 C  CA  . ALA B 1 94  ? -8.612  27.429  0.532   1.00 40.13  ? 421 ALA B CA  1 
ATOM   2215 C  C   . ALA B 1 94  ? -7.466  27.451  -0.511  1.00 42.78  ? 421 ALA B C   1 
ATOM   2216 O  O   . ALA B 1 94  ? -6.801  28.483  -0.694  1.00 42.72  ? 421 ALA B O   1 
ATOM   2217 C  CB  . ALA B 1 94  ? -8.157  26.769  1.822   1.00 39.13  ? 421 ALA B CB  1 
ATOM   2218 N  N   . GLU B 1 95  ? -7.289  26.335  -1.222  1.00 44.96  ? 422 GLU B N   1 
ATOM   2219 C  CA  . GLU B 1 95  ? -6.221  26.205  -2.225  1.00 49.76  ? 422 GLU B CA  1 
ATOM   2220 C  C   . GLU B 1 95  ? -6.405  27.074  -3.489  1.00 50.20  ? 422 GLU B C   1 
ATOM   2221 O  O   . GLU B 1 95  ? -5.455  27.256  -4.261  1.00 52.58  ? 422 GLU B O   1 
ATOM   2222 C  CB  . GLU B 1 95  ? -5.919  24.724  -2.541  1.00 52.67  ? 422 GLU B CB  1 
ATOM   2223 C  CG  . GLU B 1 95  ? -4.912  24.100  -1.567  1.00 54.80  ? 422 GLU B CG  1 
ATOM   2224 C  CD  . GLU B 1 95  ? -5.103  22.595  -1.333  1.00 57.51  ? 422 GLU B CD  1 
ATOM   2225 O  OE1 . GLU B 1 95  ? -5.515  21.846  -2.260  1.00 59.09  ? 422 GLU B OE1 1 
ATOM   2226 O  OE2 . GLU B 1 95  ? -4.811  22.142  -0.202  1.00 58.97  ? 422 GLU B OE2 1 
ATOM   2227 N  N   . LYS B 1 96  ? -7.598  27.643  -3.652  1.00 47.87  ? 423 LYS B N   1 
ATOM   2228 C  CA  . LYS B 1 96  ? -7.914  28.518  -4.786  1.00 48.45  ? 423 LYS B CA  1 
ATOM   2229 C  C   . LYS B 1 96  ? -7.863  30.029  -4.470  1.00 47.36  ? 423 LYS B C   1 
ATOM   2230 O  O   . LYS B 1 96  ? -8.075  30.861  -5.364  1.00 49.16  ? 423 LYS B O   1 
ATOM   2231 C  CB  . LYS B 1 96  ? -9.273  28.125  -5.392  1.00 48.45  ? 423 LYS B CB  1 
ATOM   2232 C  CG  . LYS B 1 96  ? -9.258  26.803  -6.138  1.00 51.02  ? 423 LYS B CG  1 
ATOM   2233 C  CD  . LYS B 1 96  ? -10.617 26.117  -6.044  1.00 51.28  ? 423 LYS B CD  1 
ATOM   2234 C  CE  . LYS B 1 96  ? -10.804 25.031  -7.102  1.00 52.82  ? 423 LYS B CE  1 
ATOM   2235 N  NZ  . LYS B 1 96  ? -11.066 25.626  -8.440  1.00 54.47  ? 423 LYS B NZ  1 
ATOM   2236 N  N   . ILE B 1 97  ? -7.582  30.393  -3.220  1.00 44.54  ? 424 ILE B N   1 
ATOM   2237 C  CA  . ILE B 1 97  ? -7.374  31.803  -2.868  1.00 44.00  ? 424 ILE B CA  1 
ATOM   2238 C  C   . ILE B 1 97  ? -5.968  32.172  -3.338  1.00 45.57  ? 424 ILE B C   1 
ATOM   2239 O  O   . ILE B 1 97  ? -4.995  31.553  -2.893  1.00 45.94  ? 424 ILE B O   1 
ATOM   2240 C  CB  . ILE B 1 97  ? -7.527  32.077  -1.343  1.00 42.74  ? 424 ILE B CB  1 
ATOM   2241 C  CG1 . ILE B 1 97  ? -8.974  31.825  -0.875  1.00 41.43  ? 424 ILE B CG1 1 
ATOM   2242 C  CG2 . ILE B 1 97  ? -7.084  33.497  -0.993  1.00 43.48  ? 424 ILE B CG2 1 
ATOM   2243 C  CD1 . ILE B 1 97  ? -9.107  31.707  0.630   1.00 40.52  ? 424 ILE B CD1 1 
ATOM   2244 N  N   . PRO B 1 98  ? -5.843  33.176  -4.235  1.00 46.79  ? 425 PRO B N   1 
ATOM   2245 C  CA  . PRO B 1 98  ? -4.482  33.527  -4.684  1.00 49.12  ? 425 PRO B CA  1 
ATOM   2246 C  C   . PRO B 1 98  ? -3.573  33.882  -3.495  1.00 48.88  ? 425 PRO B C   1 
ATOM   2247 O  O   . PRO B 1 98  ? -4.021  34.569  -2.567  1.00 47.41  ? 425 PRO B O   1 
ATOM   2248 C  CB  . PRO B 1 98  ? -4.705  34.742  -5.606  1.00 50.84  ? 425 PRO B CB  1 
ATOM   2249 C  CG  . PRO B 1 98  ? -6.152  34.697  -5.958  1.00 49.52  ? 425 PRO B CG  1 
ATOM   2250 C  CD  . PRO B 1 98  ? -6.841  34.133  -4.743  1.00 46.36  ? 425 PRO B CD  1 
ATOM   2251 N  N   . GLY B 1 99  ? -2.346  33.351  -3.500  1.00 50.05  ? 426 GLY B N   1 
ATOM   2252 C  CA  . GLY B 1 99  ? -1.383  33.560  -2.414  1.00 50.17  ? 426 GLY B CA  1 
ATOM   2253 C  C   . GLY B 1 99  ? -1.385  32.503  -1.317  1.00 48.94  ? 426 GLY B C   1 
ATOM   2254 O  O   . GLY B 1 99  ? -0.364  32.297  -0.634  1.00 50.30  ? 426 GLY B O   1 
ATOM   2255 N  N   . PHE B 1 100 ? -2.521  31.835  -1.123  1.00 46.42  ? 427 PHE B N   1 
ATOM   2256 C  CA  . PHE B 1 100 ? -2.639  30.850  -0.049  1.00 44.95  ? 427 PHE B CA  1 
ATOM   2257 C  C   . PHE B 1 100 ? -1.671  29.684  -0.235  1.00 46.36  ? 427 PHE B C   1 
ATOM   2258 O  O   . PHE B 1 100 ? -0.925  29.340  0.688   1.00 46.65  ? 427 PHE B O   1 
ATOM   2259 C  CB  . PHE B 1 100 ? -4.075  30.337  0.106   1.00 42.05  ? 427 PHE B CB  1 
ATOM   2260 C  CG  . PHE B 1 100 ? -4.258  29.402  1.274   1.00 40.44  ? 427 PHE B CG  1 
ATOM   2261 C  CD1 . PHE B 1 100 ? -4.482  29.904  2.556   1.00 39.62  ? 427 PHE B CD1 1 
ATOM   2262 C  CD2 . PHE B 1 100 ? -4.200  28.021  1.095   1.00 40.10  ? 427 PHE B CD2 1 
ATOM   2263 C  CE1 . PHE B 1 100 ? -4.643  29.048  3.641   1.00 38.35  ? 427 PHE B CE1 1 
ATOM   2264 C  CE2 . PHE B 1 100 ? -4.362  27.160  2.172   1.00 39.51  ? 427 PHE B CE2 1 
ATOM   2265 C  CZ  . PHE B 1 100 ? -4.581  27.675  3.450   1.00 38.33  ? 427 PHE B CZ  1 
ATOM   2266 N  N   . ALA B 1 101 ? -1.695  29.077  -1.425  1.00 47.18  ? 428 ALA B N   1 
ATOM   2267 C  CA  . ALA B 1 101 ? -0.821  27.946  -1.728  1.00 48.61  ? 428 ALA B CA  1 
ATOM   2268 C  C   . ALA B 1 101 ? 0.672   28.355  -1.780  1.00 51.43  ? 428 ALA B C   1 
ATOM   2269 O  O   . ALA B 1 101 ? 1.555   27.495  -1.862  1.00 53.20  ? 428 ALA B O   1 
ATOM   2270 C  CB  . ALA B 1 101 ? -1.269  27.255  -3.008  1.00 49.36  ? 428 ALA B CB  1 
ATOM   2271 N  N   . ASP B 1 102 ? 0.923   29.668  -1.707  1.00 51.62  ? 429 ASP B N   1 
ATOM   2272 C  CA  . ASP B 1 102 ? 2.260   30.242  -1.558  1.00 53.77  ? 429 ASP B CA  1 
ATOM   2273 C  C   . ASP B 1 102 ? 2.832   30.155  -0.135  1.00 53.53  ? 429 ASP B C   1 
ATOM   2274 O  O   . ASP B 1 102 ? 4.038   30.311  0.059   1.00 55.44  ? 429 ASP B O   1 
ATOM   2275 C  CB  . ASP B 1 102 ? 2.254   31.710  -1.994  1.00 54.77  ? 429 ASP B CB  1 
ATOM   2276 C  CG  . ASP B 1 102 ? 1.990   31.896  -3.476  1.00 56.20  ? 429 ASP B CG  1 
ATOM   2277 O  OD1 . ASP B 1 102 ? 1.791   30.896  -4.210  1.00 56.14  ? 429 ASP B OD1 1 
ATOM   2278 O  OD2 . ASP B 1 102 ? 1.986   33.075  -3.898  1.00 57.40  ? 429 ASP B OD2 1 
ATOM   2279 N  N   . LEU B 1 103 ? 1.969   29.941  0.854   1.00 51.26  ? 430 LEU B N   1 
ATOM   2280 C  CA  . LEU B 1 103 ? 2.407   29.793  2.241   1.00 51.88  ? 430 LEU B CA  1 
ATOM   2281 C  C   . LEU B 1 103 ? 3.028   28.417  2.474   1.00 53.72  ? 430 LEU B C   1 
ATOM   2282 O  O   . LEU B 1 103 ? 2.630   27.451  1.810   1.00 53.63  ? 430 LEU B O   1 
ATOM   2283 C  CB  . LEU B 1 103 ? 1.248   30.029  3.208   1.00 48.21  ? 430 LEU B CB  1 
ATOM   2284 C  CG  . LEU B 1 103 ? 0.519   31.358  3.005   1.00 47.64  ? 430 LEU B CG  1 
ATOM   2285 C  CD1 . LEU B 1 103 ? -0.814  31.353  3.735   1.00 45.16  ? 430 LEU B CD1 1 
ATOM   2286 C  CD2 . LEU B 1 103 ? 1.372   32.551  3.417   1.00 49.81  ? 430 LEU B CD2 1 
ATOM   2287 N  N   . PRO B 1 104 ? 4.016   28.315  3.402   1.00 56.09  ? 431 PRO B N   1 
ATOM   2288 C  CA  . PRO B 1 104 ? 4.503   26.975  3.780   1.00 57.41  ? 431 PRO B CA  1 
ATOM   2289 C  C   . PRO B 1 104 ? 3.322   26.073  4.144   1.00 55.56  ? 431 PRO B C   1 
ATOM   2290 O  O   . PRO B 1 104 ? 2.334   26.559  4.716   1.00 54.37  ? 431 PRO B O   1 
ATOM   2291 C  CB  . PRO B 1 104 ? 5.373   27.227  5.019   1.00 58.11  ? 431 PRO B CB  1 
ATOM   2292 C  CG  . PRO B 1 104 ? 5.502   28.706  5.169   1.00 58.25  ? 431 PRO B CG  1 
ATOM   2293 C  CD  . PRO B 1 104 ? 4.797   29.393  4.038   1.00 57.47  ? 431 PRO B CD  1 
ATOM   2294 N  N   . LYS B 1 105 ? 3.408   24.791  3.785   1.00 56.51  ? 432 LYS B N   1 
ATOM   2295 C  CA  . LYS B 1 105 ? 2.343   23.823  4.057   1.00 54.35  ? 432 LYS B CA  1 
ATOM   2296 C  C   . LYS B 1 105 ? 1.873   23.904  5.515   1.00 52.04  ? 432 LYS B C   1 
ATOM   2297 O  O   . LYS B 1 105 ? 0.682   23.844  5.770   1.00 49.84  ? 432 LYS B O   1 
ATOM   2298 C  CB  . LYS B 1 105 ? 2.784   22.393  3.671   1.00 56.80  ? 432 LYS B CB  1 
ATOM   2299 C  CG  . LYS B 1 105 ? 1.692   21.311  3.710   1.00 56.56  ? 432 LYS B CG  1 
ATOM   2300 C  CD  . LYS B 1 105 ? 0.492   21.623  2.811   1.00 55.09  ? 432 LYS B CD  1 
ATOM   2301 C  CE  . LYS B 1 105 ? -0.278  20.367  2.437   1.00 55.45  ? 432 LYS B CE  1 
ATOM   2302 N  NZ  . LYS B 1 105 ? -1.225  19.955  3.504   1.00 55.50  ? 432 LYS B NZ  1 
ATOM   2303 N  N   . ALA B 1 106 ? 2.819   24.087  6.442   1.00 53.13  ? 433 ALA B N   1 
ATOM   2304 C  CA  . ALA B 1 106 ? 2.551   24.207  7.885   1.00 51.79  ? 433 ALA B CA  1 
ATOM   2305 C  C   . ALA B 1 106 ? 1.673   25.409  8.237   1.00 50.08  ? 433 ALA B C   1 
ATOM   2306 O  O   . ALA B 1 106 ? 0.845   25.333  9.153   1.00 48.94  ? 433 ALA B O   1 
ATOM   2307 C  CB  . ALA B 1 106 ? 3.859   24.249  8.666   1.00 52.95  ? 433 ALA B CB  1 
ATOM   2308 N  N   . ASP B 1 107 ? 1.862   26.511  7.509   1.00 50.71  ? 434 ASP B N   1 
ATOM   2309 C  CA  . ASP B 1 107 ? 1.036   27.703  7.657   1.00 49.15  ? 434 ASP B CA  1 
ATOM   2310 C  C   . ASP B 1 107 ? -0.343  27.489  7.030   1.00 47.62  ? 434 ASP B C   1 
ATOM   2311 O  O   . ASP B 1 107 ? -1.357  27.927  7.587   1.00 46.45  ? 434 ASP B O   1 
ATOM   2312 C  CB  . ASP B 1 107 ? 1.743   28.935  7.083   1.00 50.56  ? 434 ASP B CB  1 
ATOM   2313 C  CG  . ASP B 1 107 ? 2.915   29.431  7.970   1.00 52.98  ? 434 ASP B CG  1 
ATOM   2314 O  OD1 . ASP B 1 107 ? 3.212   28.858  9.051   1.00 52.55  ? 434 ASP B OD1 1 
ATOM   2315 O  OD2 . ASP B 1 107 ? 3.552   30.430  7.582   1.00 54.84  ? 434 ASP B OD2 1 
ATOM   2316 N  N   . GLN B 1 108 ? -0.395  26.792  5.896   1.00 48.11  ? 435 GLN B N   1 
ATOM   2317 C  CA  . GLN B 1 108 ? -1.684  26.405  5.297   1.00 46.52  ? 435 GLN B CA  1 
ATOM   2318 C  C   . GLN B 1 108 ? -2.539  25.553  6.249   1.00 45.34  ? 435 GLN B C   1 
ATOM   2319 O  O   . GLN B 1 108 ? -3.715  25.858  6.468   1.00 42.21  ? 435 GLN B O   1 
ATOM   2320 C  CB  . GLN B 1 108 ? -1.480  25.670  3.973   1.00 47.14  ? 435 GLN B CB  1 
ATOM   2321 C  CG  . GLN B 1 108 ? -1.074  26.576  2.828   1.00 48.24  ? 435 GLN B CG  1 
ATOM   2322 C  CD  . GLN B 1 108 ? -0.754  25.805  1.573   1.00 49.14  ? 435 GLN B CD  1 
ATOM   2323 O  OE1 . GLN B 1 108 ? 0.407   25.751  1.148   1.00 51.95  ? 435 GLN B OE1 1 
ATOM   2324 N  NE2 . GLN B 1 108 ? -1.769  25.202  0.972   1.00 47.10  ? 435 GLN B NE2 1 
ATOM   2325 N  N   . ASP B 1 109 ? -1.926  24.496  6.796   1.00 46.49  ? 436 ASP B N   1 
ATOM   2326 C  CA  . ASP B 1 109 ? -2.558  23.628  7.787   1.00 46.06  ? 436 ASP B CA  1 
ATOM   2327 C  C   . ASP B 1 109 ? -3.053  24.449  8.962   1.00 45.18  ? 436 ASP B C   1 
ATOM   2328 O  O   . ASP B 1 109 ? -4.233  24.376  9.310   1.00 44.88  ? 436 ASP B O   1 
ATOM   2329 C  CB  . ASP B 1 109 ? -1.584  22.565  8.301   1.00 47.72  ? 436 ASP B CB  1 
ATOM   2330 C  CG  . ASP B 1 109 ? -1.261  21.504  7.269   1.00 49.18  ? 436 ASP B CG  1 
ATOM   2331 O  OD1 . ASP B 1 109 ? -1.929  21.454  6.204   1.00 48.16  ? 436 ASP B OD1 1 
ATOM   2332 O  OD2 . ASP B 1 109 ? -0.313  20.720  7.542   1.00 51.55  ? 436 ASP B OD2 1 
ATOM   2333 N  N   . LEU B 1 110 ? -2.157  25.243  9.546   1.00 45.06  ? 437 LEU B N   1 
ATOM   2334 C  CA  . LEU B 1 110 ? -2.514  26.100  10.673  1.00 43.87  ? 437 LEU B CA  1 
ATOM   2335 C  C   . LEU B 1 110 ? -3.738  27.008  10.392  1.00 41.94  ? 437 LEU B C   1 
ATOM   2336 O  O   . LEU B 1 110 ? -4.661  27.046  11.205  1.00 40.80  ? 437 LEU B O   1 
ATOM   2337 C  CB  . LEU B 1 110 ? -1.297  26.898  11.171  1.00 44.44  ? 437 LEU B CB  1 
ATOM   2338 C  CG  . LEU B 1 110 ? -1.451  27.837  12.376  1.00 44.89  ? 437 LEU B CG  1 
ATOM   2339 C  CD1 . LEU B 1 110 ? -2.082  27.147  13.590  1.00 43.82  ? 437 LEU B CD1 1 
ATOM   2340 C  CD2 . LEU B 1 110 ? -0.101  28.461  12.739  1.00 47.13  ? 437 LEU B CD2 1 
ATOM   2341 N  N   . LEU B 1 111 ? -3.728  27.713  9.258   1.00 41.92  ? 438 LEU B N   1 
ATOM   2342 C  CA  . LEU B 1 111 ? -4.826  28.612  8.862   1.00 41.55  ? 438 LEU B CA  1 
ATOM   2343 C  C   . LEU B 1 111 ? -6.129  27.855  8.624   1.00 40.15  ? 438 LEU B C   1 
ATOM   2344 O  O   . LEU B 1 111 ? -7.164  28.213  9.199   1.00 39.34  ? 438 LEU B O   1 
ATOM   2345 C  CB  . LEU B 1 111 ? -4.472  29.470  7.630   1.00 41.64  ? 438 LEU B CB  1 
ATOM   2346 C  CG  . LEU B 1 111 ? -3.341  30.515  7.741   1.00 44.29  ? 438 LEU B CG  1 
ATOM   2347 C  CD1 . LEU B 1 111 ? -3.117  31.188  6.403   1.00 44.55  ? 438 LEU B CD1 1 
ATOM   2348 C  CD2 . LEU B 1 111 ? -3.555  31.575  8.824   1.00 44.88  ? 438 LEU B CD2 1 
ATOM   2349 N  N   . PHE B 1 112 ? -6.069  26.809  7.802   1.00 40.89  ? 439 PHE B N   1 
ATOM   2350 C  CA  . PHE B 1 112 ? -7.260  26.026  7.478   1.00 42.09  ? 439 PHE B CA  1 
ATOM   2351 C  C   . PHE B 1 112 ? -7.911  25.411  8.719   1.00 41.85  ? 439 PHE B C   1 
ATOM   2352 O  O   . PHE B 1 112 ? -9.126  25.523  8.904   1.00 41.13  ? 439 PHE B O   1 
ATOM   2353 C  CB  . PHE B 1 112 ? -6.987  24.939  6.420   1.00 43.09  ? 439 PHE B CB  1 
ATOM   2354 C  CG  . PHE B 1 112 ? -8.077  23.909  6.341   1.00 42.79  ? 439 PHE B CG  1 
ATOM   2355 C  CD1 . PHE B 1 112 ? -9.228  24.156  5.597   1.00 41.28  ? 439 PHE B CD1 1 
ATOM   2356 C  CD2 . PHE B 1 112 ? -7.982  22.701  7.070   1.00 44.01  ? 439 PHE B CD2 1 
ATOM   2357 C  CE1 . PHE B 1 112 ? -10.251 23.214  5.547   1.00 40.84  ? 439 PHE B CE1 1 
ATOM   2358 C  CE2 . PHE B 1 112 ? -9.017  21.768  7.029   1.00 43.88  ? 439 PHE B CE2 1 
ATOM   2359 C  CZ  . PHE B 1 112 ? -10.152 22.028  6.252   1.00 41.29  ? 439 PHE B CZ  1 
ATOM   2360 N  N   . GLU B 1 113 ? -7.095  24.743  9.527   1.00 42.83  ? 440 GLU B N   1 
ATOM   2361 C  CA  . GLU B 1 113 ? -7.560  24.071  10.737  1.00 43.65  ? 440 GLU B CA  1 
ATOM   2362 C  C   . GLU B 1 113 ? -8.106  25.015  11.809  1.00 43.57  ? 440 GLU B C   1 
ATOM   2363 O  O   . GLU B 1 113 ? -9.087  24.677  12.467  1.00 44.45  ? 440 GLU B O   1 
ATOM   2364 C  CB  . GLU B 1 113 ? -6.447  23.231  11.346  1.00 44.69  ? 440 GLU B CB  1 
ATOM   2365 C  CG  . GLU B 1 113 ? -6.018  22.076  10.467  1.00 45.94  ? 440 GLU B CG  1 
ATOM   2366 C  CD  . GLU B 1 113 ? -4.704  21.448  10.900  1.00 48.23  ? 440 GLU B CD  1 
ATOM   2367 O  OE1 . GLU B 1 113 ? -4.207  21.717  12.029  1.00 49.54  ? 440 GLU B OE1 1 
ATOM   2368 O  OE2 . GLU B 1 113 ? -4.180  20.652  10.098  1.00 49.73  ? 440 GLU B OE2 1 
ATOM   2369 N  N   . SER B 1 114 ? -7.478  26.174  12.004  1.00 42.28  ? 441 SER B N   1 
ATOM   2370 C  CA  . SER B 1 114 ? -7.973  27.116  12.997  1.00 42.64  ? 441 SER B CA  1 
ATOM   2371 C  C   . SER B 1 114 ? -9.334  27.718  12.630  1.00 41.95  ? 441 SER B C   1 
ATOM   2372 O  O   . SER B 1 114 ? -10.094 28.110  13.507  1.00 41.63  ? 441 SER B O   1 
ATOM   2373 C  CB  . SER B 1 114 ? -6.960  28.215  13.224  1.00 44.18  ? 441 SER B CB  1 
ATOM   2374 O  OG  . SER B 1 114 ? -5.773  27.659  13.768  1.00 47.37  ? 441 SER B OG  1 
ATOM   2375 N  N   . ALA B 1 115 ? -9.629  27.750  11.329  1.00 41.27  ? 442 ALA B N   1 
ATOM   2376 C  CA  . ALA B 1 115 ? -10.810 28.399  10.789  1.00 40.34  ? 442 ALA B CA  1 
ATOM   2377 C  C   . ALA B 1 115 ? -11.868 27.413  10.304  1.00 39.14  ? 442 ALA B C   1 
ATOM   2378 O  O   . ALA B 1 115 ? -12.994 27.822  9.979   1.00 39.13  ? 442 ALA B O   1 
ATOM   2379 C  CB  . ALA B 1 115 ? -10.409 29.328  9.654   1.00 40.43  ? 442 ALA B CB  1 
ATOM   2380 N  N   . PHE B 1 116 ? -11.521 26.125  10.260  1.00 38.41  ? 443 PHE B N   1 
ATOM   2381 C  CA  . PHE B 1 116 ? -12.419 25.121  9.665   1.00 37.39  ? 443 PHE B CA  1 
ATOM   2382 C  C   . PHE B 1 116 ? -13.891 25.182  10.124  1.00 35.99  ? 443 PHE B C   1 
ATOM   2383 O  O   . PHE B 1 116 ? -14.785 25.157  9.277   1.00 36.16  ? 443 PHE B O   1 
ATOM   2384 C  CB  . PHE B 1 116 ? -11.903 23.677  9.784   1.00 36.50  ? 443 PHE B CB  1 
ATOM   2385 C  CG  . PHE B 1 116 ? -12.973 22.657  9.486   1.00 37.67  ? 443 PHE B CG  1 
ATOM   2386 C  CD1 . PHE B 1 116 ? -13.499 22.527  8.188   1.00 37.90  ? 443 PHE B CD1 1 
ATOM   2387 C  CD2 . PHE B 1 116 ? -13.511 21.874  10.503  1.00 38.04  ? 443 PHE B CD2 1 
ATOM   2388 C  CE1 . PHE B 1 116 ? -14.518 21.618  7.919   1.00 38.57  ? 443 PHE B CE1 1 
ATOM   2389 C  CE2 . PHE B 1 116 ? -14.514 20.955  10.233  1.00 38.67  ? 443 PHE B CE2 1 
ATOM   2390 C  CZ  . PHE B 1 116 ? -15.020 20.826  8.941   1.00 38.70  ? 443 PHE B CZ  1 
ATOM   2391 N  N   . LEU B 1 117 ? -14.122 25.203  11.435  1.00 35.82  ? 444 LEU B N   1 
ATOM   2392 C  CA  . LEU B 1 117 ? -15.477 25.154  11.979  1.00 37.10  ? 444 LEU B CA  1 
ATOM   2393 C  C   . LEU B 1 117 ? -16.233 26.425  11.673  1.00 37.27  ? 444 LEU B C   1 
ATOM   2394 O  O   . LEU B 1 117 ? -17.424 26.379  11.338  1.00 35.58  ? 444 LEU B O   1 
ATOM   2395 C  CB  . LEU B 1 117 ? -15.477 24.904  13.485  1.00 38.77  ? 444 LEU B CB  1 
ATOM   2396 C  CG  . LEU B 1 117 ? -15.450 23.441  13.934  1.00 40.55  ? 444 LEU B CG  1 
ATOM   2397 C  CD1 . LEU B 1 117 ? -15.540 23.375  15.458  1.00 41.55  ? 444 LEU B CD1 1 
ATOM   2398 C  CD2 . LEU B 1 117 ? -16.557 22.606  13.272  1.00 39.89  ? 444 LEU B CD2 1 
ATOM   2399 N  N   . GLU B 1 118 ? -15.512 27.544  11.771  1.00 37.29  ? 445 GLU B N   1 
ATOM   2400 C  CA  . GLU B 1 118 ? -16.017 28.844  11.381  1.00 38.30  ? 445 GLU B CA  1 
ATOM   2401 C  C   . GLU B 1 118 ? -16.449 28.864  9.924   1.00 38.02  ? 445 GLU B C   1 
ATOM   2402 O  O   . GLU B 1 118 ? -17.554 29.326  9.622   1.00 39.38  ? 445 GLU B O   1 
ATOM   2403 C  CB  . GLU B 1 118 ? -14.991 29.920  11.683  1.00 40.41  ? 445 GLU B CB  1 
ATOM   2404 C  CG  . GLU B 1 118 ? -14.900 30.187  13.170  1.00 43.93  ? 445 GLU B CG  1 
ATOM   2405 C  CD  . GLU B 1 118 ? -13.806 31.164  13.520  1.00 47.45  ? 445 GLU B CD  1 
ATOM   2406 O  OE1 . GLU B 1 118 ? -12.710 30.692  13.873  1.00 50.60  ? 445 GLU B OE1 1 
ATOM   2407 O  OE2 . GLU B 1 118 ? -14.030 32.391  13.436  1.00 48.78  ? 445 GLU B OE2 1 
ATOM   2408 N  N   . LEU B 1 119 ? -15.615 28.318  9.033   1.00 35.70  ? 446 LEU B N   1 
ATOM   2409 C  CA  . LEU B 1 119 ? -15.951 28.258  7.617   1.00 34.55  ? 446 LEU B CA  1 
ATOM   2410 C  C   . LEU B 1 119 ? -17.127 27.337  7.311   1.00 33.69  ? 446 LEU B C   1 
ATOM   2411 O  O   . LEU B 1 119 ? -17.981 27.666  6.459   1.00 33.07  ? 446 LEU B O   1 
ATOM   2412 C  CB  . LEU B 1 119 ? -14.726 27.895  6.764   1.00 34.69  ? 446 LEU B CB  1 
ATOM   2413 C  CG  . LEU B 1 119 ? -13.616 28.951  6.755   1.00 35.37  ? 446 LEU B CG  1 
ATOM   2414 C  CD1 . LEU B 1 119 ? -12.286 28.293  6.392   1.00 36.32  ? 446 LEU B CD1 1 
ATOM   2415 C  CD2 . LEU B 1 119 ? -13.951 30.096  5.820   1.00 35.72  ? 446 LEU B CD2 1 
ATOM   2416 N  N   . PHE B 1 120 ? -17.167 26.194  7.999   1.00 32.85  ? 447 PHE B N   1 
ATOM   2417 C  CA  . PHE B 1 120 ? -18.255 25.232  7.835   1.00 32.99  ? 447 PHE B CA  1 
ATOM   2418 C  C   . PHE B 1 120 ? -19.588 25.906  8.155   1.00 33.29  ? 447 PHE B C   1 
ATOM   2419 O  O   . PHE B 1 120 ? -20.542 25.772  7.422   1.00 33.74  ? 447 PHE B O   1 
ATOM   2420 C  CB  . PHE B 1 120 ? -18.045 23.988  8.721   1.00 32.88  ? 447 PHE B CB  1 
ATOM   2421 C  CG  . PHE B 1 120 ? -19.300 23.161  8.928   1.00 34.10  ? 447 PHE B CG  1 
ATOM   2422 C  CD1 . PHE B 1 120 ? -19.732 22.252  7.950   1.00 33.93  ? 447 PHE B CD1 1 
ATOM   2423 C  CD2 . PHE B 1 120 ? -20.059 23.284  10.113  1.00 34.47  ? 447 PHE B CD2 1 
ATOM   2424 C  CE1 . PHE B 1 120 ? -20.888 21.489  8.149   1.00 34.99  ? 447 PHE B CE1 1 
ATOM   2425 C  CE2 . PHE B 1 120 ? -21.215 22.522  10.307  1.00 35.07  ? 447 PHE B CE2 1 
ATOM   2426 C  CZ  . PHE B 1 120 ? -21.628 21.623  9.330   1.00 35.05  ? 447 PHE B CZ  1 
ATOM   2427 N  N   . VAL B 1 121 ? -19.606 26.659  9.248   1.00 33.47  ? 448 VAL B N   1 
ATOM   2428 C  CA  . VAL B 1 121 ? -20.792 27.324  9.726   1.00 33.80  ? 448 VAL B CA  1 
ATOM   2429 C  C   . VAL B 1 121 ? -21.153 28.488  8.807   1.00 34.03  ? 448 VAL B C   1 
ATOM   2430 O  O   . VAL B 1 121 ? -22.316 28.639  8.461   1.00 34.22  ? 448 VAL B O   1 
ATOM   2431 C  CB  . VAL B 1 121 ? -20.632 27.746  11.217  1.00 33.60  ? 448 VAL B CB  1 
ATOM   2432 C  CG1 . VAL B 1 121 ? -21.724 28.721  11.676  1.00 34.18  ? 448 VAL B CG1 1 
ATOM   2433 C  CG2 . VAL B 1 121 ? -20.637 26.506  12.087  1.00 33.08  ? 448 VAL B CG2 1 
ATOM   2434 N  N   . LEU B 1 122 ? -20.154 29.284  8.417   1.00 33.81  ? 449 LEU B N   1 
ATOM   2435 C  CA  . LEU B 1 122 ? -20.381 30.444  7.551   1.00 34.58  ? 449 LEU B CA  1 
ATOM   2436 C  C   . LEU B 1 122 ? -20.957 30.052  6.196   1.00 34.30  ? 449 LEU B C   1 
ATOM   2437 O  O   . LEU B 1 122 ? -21.972 30.610  5.774   1.00 35.74  ? 449 LEU B O   1 
ATOM   2438 C  CB  . LEU B 1 122 ? -19.105 31.277  7.369   1.00 34.34  ? 449 LEU B CB  1 
ATOM   2439 C  CG  . LEU B 1 122 ? -19.200 32.593  6.587   1.00 35.26  ? 449 LEU B CG  1 
ATOM   2440 C  CD1 . LEU B 1 122 ? -19.905 33.693  7.366   1.00 37.00  ? 449 LEU B CD1 1 
ATOM   2441 C  CD2 . LEU B 1 122 ? -17.816 33.055  6.192   1.00 35.00  ? 449 LEU B CD2 1 
ATOM   2442 N  N   . ARG B 1 123 ? -20.325 29.087  5.535   1.00 33.46  ? 450 ARG B N   1 
ATOM   2443 C  CA  . ARG B 1 123 ? -20.773 28.638  4.208   1.00 33.36  ? 450 ARG B CA  1 
ATOM   2444 C  C   . ARG B 1 123 ? -22.155 27.974  4.263   1.00 34.31  ? 450 ARG B C   1 
ATOM   2445 O  O   . ARG B 1 123 ? -22.981 28.181  3.357   1.00 36.14  ? 450 ARG B O   1 
ATOM   2446 C  CB  . ARG B 1 123 ? -19.734 27.719  3.563   1.00 32.41  ? 450 ARG B CB  1 
ATOM   2447 C  CG  . ARG B 1 123 ? -18.438 28.455  3.221   1.00 32.84  ? 450 ARG B CG  1 
ATOM   2448 C  CD  . ARG B 1 123 ? -17.214 27.563  3.178   1.00 32.09  ? 450 ARG B CD  1 
ATOM   2449 N  NE  . ARG B 1 123 ? -17.432 26.338  2.396   1.00 32.70  ? 450 ARG B NE  1 
ATOM   2450 C  CZ  . ARG B 1 123 ? -17.224 26.212  1.082   1.00 32.64  ? 450 ARG B CZ  1 
ATOM   2451 N  NH1 . ARG B 1 123 ? -16.819 27.249  0.338   1.00 32.56  ? 450 ARG B NH1 1 
ATOM   2452 N  NH2 . ARG B 1 123 ? -17.447 25.035  0.506   1.00 32.46  ? 450 ARG B NH2 1 
ATOM   2453 N  N   . LEU B 1 124 ? -22.412 27.204  5.326   1.00 33.88  ? 451 LEU B N   1 
ATOM   2454 C  CA  . LEU B 1 124 ? -23.705 26.531  5.515   1.00 34.59  ? 451 LEU B CA  1 
ATOM   2455 C  C   . LEU B 1 124 ? -24.800 27.563  5.734   1.00 35.07  ? 451 LEU B C   1 
ATOM   2456 O  O   . LEU B 1 124 ? -25.850 27.493  5.099   1.00 35.08  ? 451 LEU B O   1 
ATOM   2457 C  CB  . LEU B 1 124 ? -23.661 25.526  6.686   1.00 34.91  ? 451 LEU B CB  1 
ATOM   2458 C  CG  . LEU B 1 124 ? -24.921 24.790  7.171   1.00 36.10  ? 451 LEU B CG  1 
ATOM   2459 C  CD1 . LEU B 1 124 ? -25.515 23.878  6.104   1.00 35.14  ? 451 LEU B CD1 1 
ATOM   2460 C  CD2 . LEU B 1 124 ? -24.569 23.992  8.418   1.00 35.70  ? 451 LEU B CD2 1 
ATOM   2461 N  N   . ALA B 1 125 ? -24.521 28.522  6.621   1.00 34.68  ? 452 ALA B N   1 
ATOM   2462 C  CA  . ALA B 1 125 ? -25.433 29.615  6.930   1.00 35.81  ? 452 ALA B CA  1 
ATOM   2463 C  C   . ALA B 1 125 ? -25.845 30.412  5.682   1.00 36.41  ? 452 ALA B C   1 
ATOM   2464 O  O   . ALA B 1 125 ? -26.997 30.765  5.526   1.00 37.18  ? 452 ALA B O   1 
ATOM   2465 C  CB  . ALA B 1 125 ? -24.805 30.531  7.960   1.00 34.74  ? 452 ALA B CB  1 
ATOM   2466 N  N   . TYR B 1 126 ? -24.879 30.680  4.805   1.00 36.87  ? 453 TYR B N   1 
ATOM   2467 C  CA  . TYR B 1 126 ? -25.087 31.461  3.587   1.00 37.98  ? 453 TYR B CA  1 
ATOM   2468 C  C   . TYR B 1 126 ? -25.800 30.698  2.461   1.00 38.83  ? 453 TYR B C   1 
ATOM   2469 O  O   . TYR B 1 126 ? -26.421 31.313  1.593   1.00 39.97  ? 453 TYR B O   1 
ATOM   2470 C  CB  . TYR B 1 126 ? -23.743 31.953  3.089   1.00 36.44  ? 453 TYR B CB  1 
ATOM   2471 C  CG  . TYR B 1 126 ? -23.814 33.042  2.035   1.00 37.09  ? 453 TYR B CG  1 
ATOM   2472 C  CD1 . TYR B 1 126 ? -24.331 34.312  2.340   1.00 38.43  ? 453 TYR B CD1 1 
ATOM   2473 C  CD2 . TYR B 1 126 ? -23.330 32.811  0.746   1.00 35.94  ? 453 TYR B CD2 1 
ATOM   2474 C  CE1 . TYR B 1 126 ? -24.382 35.304  1.375   1.00 39.55  ? 453 TYR B CE1 1 
ATOM   2475 C  CE2 . TYR B 1 126 ? -23.368 33.793  -0.222  1.00 36.97  ? 453 TYR B CE2 1 
ATOM   2476 C  CZ  . TYR B 1 126 ? -23.889 35.036  0.097   1.00 38.79  ? 453 TYR B CZ  1 
ATOM   2477 O  OH  . TYR B 1 126 ? -23.933 36.003  -0.868  1.00 39.81  ? 453 TYR B OH  1 
ATOM   2478 N  N   . ARG B 1 127 ? -25.688 29.369  2.490   1.00 38.58  ? 454 ARG B N   1 
ATOM   2479 C  CA  . ARG B 1 127 ? -26.215 28.457  1.463   1.00 39.52  ? 454 ARG B CA  1 
ATOM   2480 C  C   . ARG B 1 127 ? -27.633 28.019  1.764   1.00 40.57  ? 454 ARG B C   1 
ATOM   2481 O  O   . ARG B 1 127 ? -28.396 27.739  0.858   1.00 42.56  ? 454 ARG B O   1 
ATOM   2482 C  CB  . ARG B 1 127 ? -25.372 27.193  1.512   1.00 38.87  ? 454 ARG B CB  1 
ATOM   2483 C  CG  . ARG B 1 127 ? -25.150 26.443  0.234   1.00 39.17  ? 454 ARG B CG  1 
ATOM   2484 C  CD  . ARG B 1 127 ? -23.753 25.826  0.309   1.00 38.28  ? 454 ARG B CD  1 
ATOM   2485 N  NE  . ARG B 1 127 ? -23.677 25.034  1.518   1.00 39.06  ? 454 ARG B NE  1 
ATOM   2486 C  CZ  . ARG B 1 127 ? -22.583 24.631  2.152   1.00 37.60  ? 454 ARG B CZ  1 
ATOM   2487 N  NH1 . ARG B 1 127 ? -21.351 24.907  1.725   1.00 37.41  ? 454 ARG B NH1 1 
ATOM   2488 N  NH2 . ARG B 1 127 ? -22.757 23.917  3.240   1.00 37.35  ? 454 ARG B NH2 1 
ATOM   2489 N  N   . SER B 1 128 ? -27.958 27.946  3.053   1.00 41.37  ? 455 SER B N   1 
ATOM   2490 C  CA  . SER B 1 128 ? -29.173 27.306  3.559   1.00 42.80  ? 455 SER B CA  1 
ATOM   2491 C  C   . SER B 1 128 ? -30.401 28.153  3.355   1.00 44.58  ? 455 SER B C   1 
ATOM   2492 O  O   . SER B 1 128 ? -30.294 29.283  2.880   1.00 44.71  ? 455 SER B O   1 
ATOM   2493 C  CB  . SER B 1 128 ? -28.999 26.990  5.043   1.00 42.91  ? 455 SER B CB  1 
ATOM   2494 O  OG  . SER B 1 128 ? -28.005 25.992  5.211   1.00 41.98  ? 455 SER B OG  1 
ATOM   2495 N  N   . ASN B 1 129 ? -31.565 27.601  3.714   1.00 46.80  ? 456 ASN B N   1 
ATOM   2496 C  CA  . ASN B 1 129 ? -32.822 28.353  3.716   1.00 49.11  ? 456 ASN B CA  1 
ATOM   2497 C  C   . ASN B 1 129 ? -33.394 28.345  5.137   1.00 50.32  ? 456 ASN B C   1 
ATOM   2498 O  O   . ASN B 1 129 ? -34.202 27.465  5.483   1.00 50.89  ? 456 ASN B O   1 
ATOM   2499 C  CB  . ASN B 1 129 ? -33.814 27.809  2.662   1.00 51.49  ? 456 ASN B CB  1 
ATOM   2500 C  CG  . ASN B 1 129 ? -35.030 28.717  2.463   1.00 55.09  ? 456 ASN B CG  1 
ATOM   2501 O  OD1 . ASN B 1 129 ? -35.357 29.562  3.309   1.00 57.17  ? 456 ASN B OD1 1 
ATOM   2502 N  ND2 . ASN B 1 129 ? -35.714 28.536  1.340   1.00 56.41  ? 456 ASN B ND2 1 
ATOM   2503 N  N   . PRO B 1 130 ? -32.952 29.317  5.973   1.00 50.52  ? 457 PRO B N   1 
ATOM   2504 C  CA  . PRO B 1 130 ? -33.310 29.378  7.400   1.00 52.06  ? 457 PRO B CA  1 
ATOM   2505 C  C   . PRO B 1 130 ? -34.796 29.646  7.688   1.00 55.75  ? 457 PRO B C   1 
ATOM   2506 O  O   . PRO B 1 130 ? -35.307 29.178  8.709   1.00 57.29  ? 457 PRO B O   1 
ATOM   2507 C  CB  . PRO B 1 130 ? -32.437 30.524  7.938   1.00 51.11  ? 457 PRO B CB  1 
ATOM   2508 C  CG  . PRO B 1 130 ? -32.124 31.361  6.753   1.00 50.24  ? 457 PRO B CG  1 
ATOM   2509 C  CD  . PRO B 1 130 ? -32.007 30.394  5.612   1.00 48.89  ? 457 PRO B CD  1 
ATOM   2510 N  N   . VAL B 1 131 ? -35.470 30.384  6.803   1.00 57.94  ? 458 VAL B N   1 
ATOM   2511 C  CA  . VAL B 1 131 ? -36.922 30.645  6.916   1.00 61.61  ? 458 VAL B CA  1 
ATOM   2512 C  C   . VAL B 1 131 ? -37.718 29.332  6.973   1.00 62.44  ? 458 VAL B C   1 
ATOM   2513 O  O   . VAL B 1 131 ? -38.670 29.207  7.753   1.00 64.18  ? 458 VAL B O   1 
ATOM   2514 C  CB  . VAL B 1 131 ? -37.459 31.531  5.756   1.00 62.81  ? 458 VAL B CB  1 
ATOM   2515 C  CG1 . VAL B 1 131 ? -38.888 31.967  6.023   1.00 66.42  ? 458 VAL B CG1 1 
ATOM   2516 C  CG2 . VAL B 1 131 ? -36.585 32.765  5.547   1.00 62.61  ? 458 VAL B CG2 1 
ATOM   2517 N  N   . GLU B 1 132 ? -37.286 28.357  6.170   1.00 60.82  ? 459 GLU B N   1 
ATOM   2518 C  CA  . GLU B 1 132 ? -38.011 27.094  5.988   1.00 62.36  ? 459 GLU B CA  1 
ATOM   2519 C  C   . GLU B 1 132 ? -37.422 25.943  6.815   1.00 60.37  ? 459 GLU B C   1 
ATOM   2520 O  O   . GLU B 1 132 ? -37.945 24.821  6.787   1.00 61.74  ? 459 GLU B O   1 
ATOM   2521 C  CB  . GLU B 1 132 ? -38.110 26.742  4.492   1.00 62.76  ? 459 GLU B CB  1 
ATOM   2522 C  CG  . GLU B 1 132 ? -38.343 27.971  3.605   1.00 65.56  ? 459 GLU B CG  1 
ATOM   2523 C  CD  . GLU B 1 132 ? -38.843 27.670  2.203   1.00 67.66  ? 459 GLU B CD  1 
ATOM   2524 O  OE1 . GLU B 1 132 ? -38.638 26.543  1.699   1.00 68.06  ? 459 GLU B OE1 1 
ATOM   2525 O  OE2 . GLU B 1 132 ? -39.447 28.584  1.595   1.00 70.29  ? 459 GLU B OE2 1 
ATOM   2526 N  N   . GLY B 1 133 ? -36.360 26.244  7.565   1.00 57.51  ? 460 GLY B N   1 
ATOM   2527 C  CA  . GLY B 1 133 ? -35.633 25.254  8.379   1.00 55.47  ? 460 GLY B CA  1 
ATOM   2528 C  C   . GLY B 1 133 ? -34.718 24.315  7.602   1.00 52.23  ? 460 GLY B C   1 
ATOM   2529 O  O   . GLY B 1 133 ? -34.348 23.250  8.107   1.00 51.09  ? 460 GLY B O   1 
ATOM   2530 N  N   . LYS B 1 134 ? -34.353 24.715  6.382   1.00 50.16  ? 461 LYS B N   1 
ATOM   2531 C  CA  . LYS B 1 134 ? -33.585 23.869  5.472   1.00 47.88  ? 461 LYS B CA  1 
ATOM   2532 C  C   . LYS B 1 134 ? -32.095 24.166  5.568   1.00 45.75  ? 461 LYS B C   1 
ATOM   2533 O  O   . LYS B 1 134 ? -31.638 25.312  5.382   1.00 45.29  ? 461 LYS B O   1 
ATOM   2534 C  CB  . LYS B 1 134 ? -34.070 24.021  4.021   1.00 48.66  ? 461 LYS B CB  1 
ATOM   2535 C  CG  . LYS B 1 134 ? -35.406 23.359  3.691   1.00 50.79  ? 461 LYS B CG  1 
ATOM   2536 C  CD  . LYS B 1 134 ? -35.814 23.677  2.254   1.00 52.15  ? 461 LYS B CD  1 
ATOM   2537 C  CE  . LYS B 1 134 ? -36.980 22.838  1.757   1.00 54.15  ? 461 LYS B CE  1 
ATOM   2538 N  NZ  . LYS B 1 134 ? -38.297 23.280  2.293   1.00 57.16  ? 461 LYS B NZ  1 
ATOM   2539 N  N   . LEU B 1 135 ? -31.342 23.123  5.885   1.00 43.52  ? 462 LEU B N   1 
ATOM   2540 C  CA  . LEU B 1 135 ? -29.901 23.189  5.821   1.00 40.41  ? 462 LEU B CA  1 
ATOM   2541 C  C   . LEU B 1 135 ? -29.451 22.547  4.524   1.00 39.45  ? 462 LEU B C   1 
ATOM   2542 O  O   . LEU B 1 135 ? -29.906 21.452  4.176   1.00 40.34  ? 462 LEU B O   1 
ATOM   2543 C  CB  . LEU B 1 135 ? -29.286 22.513  7.052   1.00 39.70  ? 462 LEU B CB  1 
ATOM   2544 C  CG  . LEU B 1 135 ? -29.703 23.416  8.216   1.00 40.35  ? 462 LEU B CG  1 
ATOM   2545 C  CD1 . LEU B 1 135 ? -30.451 22.650  9.297   1.00 41.05  ? 462 LEU B CD1 1 
ATOM   2546 C  CD2 . LEU B 1 135 ? -28.549 24.283  8.726   1.00 38.91  ? 462 LEU B CD2 1 
ATOM   2547 N  N   . ILE B 1 136 ? -28.589 23.254  3.797   1.00 37.27  ? 463 ILE B N   1 
ATOM   2548 C  CA  . ILE B 1 136 ? -28.064 22.760  2.531   1.00 36.87  ? 463 ILE B CA  1 
ATOM   2549 C  C   . ILE B 1 136 ? -26.537 22.572  2.698   1.00 35.46  ? 463 ILE B C   1 
ATOM   2550 O  O   . ILE B 1 136 ? -25.786 23.539  2.845   1.00 33.68  ? 463 ILE B O   1 
ATOM   2551 C  CB  . ILE B 1 136 ? -28.445 23.687  1.350   1.00 36.76  ? 463 ILE B CB  1 
ATOM   2552 C  CG1 . ILE B 1 136 ? -29.961 23.935  1.327   1.00 39.05  ? 463 ILE B CG1 1 
ATOM   2553 C  CG2 . ILE B 1 136 ? -27.983 23.074  0.032   1.00 37.02  ? 463 ILE B CG2 1 
ATOM   2554 C  CD1 . ILE B 1 136 ? -30.470 24.924  0.277   1.00 39.44  ? 463 ILE B CD1 1 
ATOM   2555 N  N   . PHE B 1 137 ? -26.099 21.318  2.715   1.00 36.14  ? 464 PHE B N   1 
ATOM   2556 C  CA  . PHE B 1 137 ? -24.700 20.999  3.006   1.00 36.21  ? 464 PHE B CA  1 
ATOM   2557 C  C   . PHE B 1 137 ? -23.864 21.047  1.731   1.00 37.80  ? 464 PHE B C   1 
ATOM   2558 O  O   . PHE B 1 137 ? -24.404 21.110  0.603   1.00 37.80  ? 464 PHE B O   1 
ATOM   2559 C  CB  . PHE B 1 137 ? -24.574 19.663  3.750   1.00 36.16  ? 464 PHE B CB  1 
ATOM   2560 C  CG  . PHE B 1 137 ? -25.227 19.674  5.116   1.00 36.55  ? 464 PHE B CG  1 
ATOM   2561 C  CD1 . PHE B 1 137 ? -24.532 20.139  6.234   1.00 35.07  ? 464 PHE B CD1 1 
ATOM   2562 C  CD2 . PHE B 1 137 ? -26.561 19.248  5.280   1.00 37.76  ? 464 PHE B CD2 1 
ATOM   2563 C  CE1 . PHE B 1 137 ? -25.136 20.176  7.491   1.00 35.86  ? 464 PHE B CE1 1 
ATOM   2564 C  CE2 . PHE B 1 137 ? -27.169 19.279  6.536   1.00 38.72  ? 464 PHE B CE2 1 
ATOM   2565 C  CZ  . PHE B 1 137 ? -26.453 19.742  7.643   1.00 37.64  ? 464 PHE B CZ  1 
ATOM   2566 N  N   . CYS B 1 138 ? -22.545 21.056  1.899   1.00 38.65  ? 465 CYS B N   1 
ATOM   2567 C  CA  . CYS B 1 138 ? -21.666 21.326  0.768   1.00 40.61  ? 465 CYS B CA  1 
ATOM   2568 C  C   . CYS B 1 138 ? -21.793 20.269  -0.356  1.00 40.46  ? 465 CYS B C   1 
ATOM   2569 O  O   . CYS B 1 138 ? -21.494 20.554  -1.492  1.00 41.21  ? 465 CYS B O   1 
ATOM   2570 C  CB  . CYS B 1 138 ? -20.227 21.482  1.244   1.00 42.30  ? 465 CYS B CB  1 
ATOM   2571 S  SG  . CYS B 1 138 ? -19.616 19.912  1.873   1.00 49.93  ? 465 CYS B SG  1 
ATOM   2572 N  N   . ASN B 1 139 ? -22.258 19.068  -0.016  1.00 40.37  ? 466 ASN B N   1 
ATOM   2573 C  CA  . ASN B 1 139 ? -22.470 17.989  -0.980  1.00 41.22  ? 466 ASN B CA  1 
ATOM   2574 C  C   . ASN B 1 139 ? -23.808 18.109  -1.698  1.00 41.53  ? 466 ASN B C   1 
ATOM   2575 O  O   . ASN B 1 139 ? -24.108 17.281  -2.539  1.00 44.21  ? 466 ASN B O   1 
ATOM   2576 C  CB  . ASN B 1 139 ? -22.385 16.621  -0.282  1.00 42.27  ? 466 ASN B CB  1 
ATOM   2577 C  CG  . ASN B 1 139 ? -23.441 16.444  0.809   1.00 42.97  ? 466 ASN B CG  1 
ATOM   2578 O  OD1 . ASN B 1 139 ? -24.180 17.378  1.154   1.00 41.91  ? 466 ASN B OD1 1 
ATOM   2579 N  ND2 . ASN B 1 139 ? -23.518 15.234  1.358   1.00 44.55  ? 466 ASN B ND2 1 
ATOM   2580 N  N   . GLY B 1 140 ? -24.611 19.108  -1.338  1.00 40.26  ? 467 GLY B N   1 
ATOM   2581 C  CA  . GLY B 1 140 ? -25.917 19.349  -1.949  1.00 41.27  ? 467 GLY B CA  1 
ATOM   2582 C  C   . GLY B 1 140 ? -27.081 18.598  -1.314  1.00 42.89  ? 467 GLY B C   1 
ATOM   2583 O  O   . GLY B 1 140 ? -28.205 18.645  -1.831  1.00 44.71  ? 467 GLY B O   1 
ATOM   2584 N  N   . VAL B 1 141 ? -26.822 17.898  -0.210  1.00 42.18  ? 468 VAL B N   1 
ATOM   2585 C  CA  . VAL B 1 141 ? -27.885 17.221  0.534   1.00 43.74  ? 468 VAL B CA  1 
ATOM   2586 C  C   . VAL B 1 141 ? -28.653 18.260  1.359   1.00 42.81  ? 468 VAL B C   1 
ATOM   2587 O  O   . VAL B 1 141 ? -28.061 19.102  2.032   1.00 42.12  ? 468 VAL B O   1 
ATOM   2588 C  CB  . VAL B 1 141 ? -27.354 16.054  1.416   1.00 44.50  ? 468 VAL B CB  1 
ATOM   2589 C  CG1 . VAL B 1 141 ? -28.422 15.547  2.382   1.00 45.58  ? 468 VAL B CG1 1 
ATOM   2590 C  CG2 . VAL B 1 141 ? -26.865 14.909  0.546   1.00 45.35  ? 468 VAL B CG2 1 
ATOM   2591 N  N   . VAL B 1 142 ? -29.972 18.211  1.251   1.00 43.75  ? 469 VAL B N   1 
ATOM   2592 C  CA  . VAL B 1 142 ? -30.855 19.100  1.981   1.00 42.92  ? 469 VAL B CA  1 
ATOM   2593 C  C   . VAL B 1 142 ? -31.464 18.295  3.127   1.00 43.91  ? 469 VAL B C   1 
ATOM   2594 O  O   . VAL B 1 142 ? -31.985 17.196  2.926   1.00 45.40  ? 469 VAL B O   1 
ATOM   2595 C  CB  . VAL B 1 142 ? -31.942 19.687  1.048   1.00 44.21  ? 469 VAL B CB  1 
ATOM   2596 C  CG1 . VAL B 1 142 ? -32.845 20.675  1.784   1.00 44.30  ? 469 VAL B CG1 1 
ATOM   2597 C  CG2 . VAL B 1 142 ? -31.296 20.355  -0.160  1.00 42.82  ? 469 VAL B CG2 1 
ATOM   2598 N  N   . LEU B 1 143 ? -31.363 18.841  4.328   1.00 42.92  ? 470 LEU B N   1 
ATOM   2599 C  CA  . LEU B 1 143 ? -31.975 18.246  5.506   1.00 44.78  ? 470 LEU B CA  1 
ATOM   2600 C  C   . LEU B 1 143 ? -32.664 19.334  6.321   1.00 45.46  ? 470 LEU B C   1 
ATOM   2601 O  O   . LEU B 1 143 ? -32.199 20.486  6.363   1.00 44.01  ? 470 LEU B O   1 
ATOM   2602 C  CB  . LEU B 1 143 ? -30.917 17.534  6.366   1.00 43.37  ? 470 LEU B CB  1 
ATOM   2603 C  CG  . LEU B 1 143 ? -30.209 16.265  5.860   1.00 43.31  ? 470 LEU B CG  1 
ATOM   2604 C  CD1 . LEU B 1 143 ? -29.068 15.871  6.797   1.00 41.81  ? 470 LEU B CD1 1 
ATOM   2605 C  CD2 . LEU B 1 143 ? -31.180 15.100  5.671   1.00 45.20  ? 470 LEU B CD2 1 
ATOM   2606 N  N   . HIS B 1 144 ? -33.773 18.968  6.957   1.00 48.13  ? 471 HIS B N   1 
ATOM   2607 C  CA  . HIS B 1 144 ? -34.455 19.860  7.896   1.00 50.58  ? 471 HIS B CA  1 
ATOM   2608 C  C   . HIS B 1 144 ? -33.692 19.973  9.231   1.00 49.81  ? 471 HIS B C   1 
ATOM   2609 O  O   . HIS B 1 144 ? -33.073 19.008  9.696   1.00 48.47  ? 471 HIS B O   1 
ATOM   2610 C  CB  . HIS B 1 144 ? -35.883 19.369  8.168   1.00 54.87  ? 471 HIS B CB  1 
ATOM   2611 C  CG  . HIS B 1 144 ? -36.790 20.424  8.723   1.00 57.53  ? 471 HIS B CG  1 
ATOM   2612 N  ND1 . HIS B 1 144 ? -36.820 20.754  10.061  1.00 58.35  ? 471 HIS B ND1 1 
ATOM   2613 C  CD2 . HIS B 1 144 ? -37.705 21.221  8.118   1.00 59.47  ? 471 HIS B CD2 1 
ATOM   2614 C  CE1 . HIS B 1 144 ? -37.709 21.712  10.257  1.00 60.94  ? 471 HIS B CE1 1 
ATOM   2615 N  NE2 . HIS B 1 144 ? -38.262 22.012  9.096   1.00 61.56  ? 471 HIS B NE2 1 
ATOM   2616 N  N   . ARG B 1 145 ? -33.756 21.164  9.822   1.00 50.50  ? 472 ARG B N   1 
ATOM   2617 C  CA  . ARG B 1 145 ? -33.360 21.423  11.210  1.00 51.85  ? 472 ARG B CA  1 
ATOM   2618 C  C   . ARG B 1 145 ? -33.676 20.261  12.154  1.00 53.04  ? 472 ARG B C   1 
ATOM   2619 O  O   . ARG B 1 145 ? -32.782 19.771  12.859  1.00 52.06  ? 472 ARG B O   1 
ATOM   2620 C  CB  . ARG B 1 145 ? -34.034 22.703  11.714  1.00 54.86  ? 472 ARG B CB  1 
ATOM   2621 C  CG  . ARG B 1 145 ? -33.459 23.237  13.019  1.00 56.98  ? 472 ARG B CG  1 
ATOM   2622 C  CD  . ARG B 1 145 ? -34.121 24.548  13.433  1.00 60.41  ? 472 ARG B CD  1 
ATOM   2623 N  NE  . ARG B 1 145 ? -35.588 24.466  13.489  1.00 65.08  ? 472 ARG B NE  1 
ATOM   2624 C  CZ  . ARG B 1 145 ? -36.288 23.961  14.511  1.00 68.13  ? 472 ARG B CZ  1 
ATOM   2625 N  NH1 . ARG B 1 145 ? -35.663 23.457  15.581  1.00 68.87  ? 472 ARG B NH1 1 
ATOM   2626 N  NH2 . ARG B 1 145 ? -37.615 23.950  14.457  1.00 69.29  ? 472 ARG B NH2 1 
ATOM   2627 N  N   . LEU B 1 146 ? -34.936 19.821  12.133  1.00 54.44  ? 473 LEU B N   1 
ATOM   2628 C  CA  . LEU B 1 146 ? -35.426 18.729  12.970  1.00 55.89  ? 473 LEU B CA  1 
ATOM   2629 C  C   . LEU B 1 146 ? -34.701 17.407  12.742  1.00 54.37  ? 473 LEU B C   1 
ATOM   2630 O  O   . LEU B 1 146 ? -34.553 16.621  13.677  1.00 55.63  ? 473 LEU B O   1 
ATOM   2631 C  CB  . LEU B 1 146 ? -36.933 18.549  12.790  1.00 59.23  ? 473 LEU B CB  1 
ATOM   2632 C  CG  . LEU B 1 146 ? -37.895 19.250  13.765  1.00 62.91  ? 473 LEU B CG  1 
ATOM   2633 C  CD1 . LEU B 1 146 ? -37.872 20.770  13.652  1.00 62.40  ? 473 LEU B CD1 1 
ATOM   2634 C  CD2 . LEU B 1 146 ? -39.320 18.740  13.572  1.00 66.22  ? 473 LEU B CD2 1 
ATOM   2635 N  N   . GLN B 1 147 ? -34.244 17.173  11.513  1.00 51.67  ? 474 GLN B N   1 
ATOM   2636 C  CA  . GLN B 1 147 ? -33.504 15.955  11.166  1.00 50.57  ? 474 GLN B CA  1 
ATOM   2637 C  C   . GLN B 1 147 ? -32.075 15.990  11.679  1.00 48.94  ? 474 GLN B C   1 
ATOM   2638 O  O   . GLN B 1 147 ? -31.439 14.942  11.774  1.00 48.96  ? 474 GLN B O   1 
ATOM   2639 C  CB  . GLN B 1 147 ? -33.444 15.758  9.654   1.00 49.20  ? 474 GLN B CB  1 
ATOM   2640 C  CG  . GLN B 1 147 ? -34.733 15.334  8.973   1.00 50.34  ? 474 GLN B CG  1 
ATOM   2641 C  CD  . GLN B 1 147 ? -34.554 15.251  7.478   1.00 48.62  ? 474 GLN B CD  1 
ATOM   2642 O  OE1 . GLN B 1 147 ? -34.350 16.265  6.817   1.00 46.86  ? 474 GLN B OE1 1 
ATOM   2643 N  NE2 . GLN B 1 147 ? -34.615 14.045  6.938   1.00 49.34  ? 474 GLN B NE2 1 
ATOM   2644 N  N   . CYS B 1 148 ? -31.580 17.195  11.976  1.00 48.41  ? 475 CYS B N   1 
ATOM   2645 C  CA  . CYS B 1 148 ? -30.196 17.431  12.373  1.00 48.00  ? 475 CYS B CA  1 
ATOM   2646 C  C   . CYS B 1 148 ? -30.020 17.469  13.887  1.00 49.97  ? 475 CYS B C   1 
ATOM   2647 O  O   . CYS B 1 148 ? -28.898 17.346  14.379  1.00 49.20  ? 475 CYS B O   1 
ATOM   2648 C  CB  . CYS B 1 148 ? -29.690 18.756  11.790  1.00 46.63  ? 475 CYS B CB  1 
ATOM   2649 S  SG  . CYS B 1 148 ? -29.406 18.768  10.005  1.00 46.22  ? 475 CYS B SG  1 
ATOM   2650 N  N   . VAL B 1 149 ? -31.122 17.642  14.616  1.00 53.18  ? 476 VAL B N   1 
ATOM   2651 C  CA  . VAL B 1 149 ? -31.082 17.832  16.065  1.00 55.23  ? 476 VAL B CA  1 
ATOM   2652 C  C   . VAL B 1 149 ? -30.364 16.710  16.841  1.00 56.73  ? 476 VAL B C   1 
ATOM   2653 O  O   . VAL B 1 149 ? -29.594 16.992  17.770  1.00 56.30  ? 476 VAL B O   1 
ATOM   2654 C  CB  . VAL B 1 149 ? -32.477 18.218  16.640  1.00 57.94  ? 476 VAL B CB  1 
ATOM   2655 C  CG1 . VAL B 1 149 ? -33.369 17.001  16.862  1.00 60.89  ? 476 VAL B CG1 1 
ATOM   2656 C  CG2 . VAL B 1 149 ? -32.321 19.029  17.919  1.00 59.21  ? 476 VAL B CG2 1 
ATOM   2657 N  N   . ARG B 1 150 ? -30.578 15.458  16.432  1.00 58.77  ? 477 ARG B N   1 
ATOM   2658 C  CA  . ARG B 1 150 ? -29.968 14.307  17.102  1.00 61.03  ? 477 ARG B CA  1 
ATOM   2659 C  C   . ARG B 1 150 ? -28.441 14.285  16.969  1.00 58.74  ? 477 ARG B C   1 
ATOM   2660 O  O   . ARG B 1 150 ? -27.735 14.059  17.959  1.00 60.29  ? 477 ARG B O   1 
ATOM   2661 C  CB  . ARG B 1 150 ? -30.599 12.992  16.635  1.00 65.19  ? 477 ARG B CB  1 
ATOM   2662 C  CG  . ARG B 1 150 ? -31.719 12.486  17.540  1.00 71.10  ? 477 ARG B CG  1 
ATOM   2663 C  CD  . ARG B 1 150 ? -32.535 11.377  16.875  1.00 76.16  ? 477 ARG B CD  1 
ATOM   2664 N  NE  . ARG B 1 150 ? -33.438 10.690  17.821  1.00 82.27  ? 477 ARG B NE  1 
ATOM   2665 C  CZ  . ARG B 1 150 ? -34.526 9.989   17.474  1.00 85.67  ? 477 ARG B CZ  1 
ATOM   2666 N  NH1 . ARG B 1 150 ? -34.893 9.860   16.188  1.00 86.23  ? 477 ARG B NH1 1 
ATOM   2667 N  NH2 . ARG B 1 150 ? -35.262 9.415   18.425  1.00 89.24  ? 477 ARG B NH2 1 
ATOM   2668 N  N   . GLY B 1 151 ? -27.941 14.559  15.766  1.00 55.94  ? 478 GLY B N   1 
ATOM   2669 C  CA  . GLY B 1 151 ? -26.503 14.641  15.509  1.00 53.09  ? 478 GLY B CA  1 
ATOM   2670 C  C   . GLY B 1 151 ? -25.855 15.925  16.014  1.00 51.61  ? 478 GLY B C   1 
ATOM   2671 O  O   . GLY B 1 151 ? -24.865 15.885  16.767  1.00 50.73  ? 478 GLY B O   1 
ATOM   2672 N  N   . PHE B 1 152 ? -26.416 17.060  15.597  1.00 50.08  ? 479 PHE B N   1 
ATOM   2673 C  CA  . PHE B 1 152 ? -25.839 18.377  15.870  1.00 48.46  ? 479 PHE B CA  1 
ATOM   2674 C  C   . PHE B 1 152 ? -26.088 18.897  17.287  1.00 50.52  ? 479 PHE B C   1 
ATOM   2675 O  O   . PHE B 1 152 ? -25.314 19.727  17.775  1.00 49.34  ? 479 PHE B O   1 
ATOM   2676 C  CB  . PHE B 1 152 ? -26.371 19.401  14.866  1.00 47.20  ? 479 PHE B CB  1 
ATOM   2677 C  CG  . PHE B 1 152 ? -25.728 19.326  13.517  1.00 45.15  ? 479 PHE B CG  1 
ATOM   2678 C  CD1 . PHE B 1 152 ? -24.722 20.231  13.165  1.00 43.29  ? 479 PHE B CD1 1 
ATOM   2679 C  CD2 . PHE B 1 152 ? -26.122 18.358  12.590  1.00 45.07  ? 479 PHE B CD2 1 
ATOM   2680 C  CE1 . PHE B 1 152 ? -24.113 20.165  11.916  1.00 41.74  ? 479 PHE B CE1 1 
ATOM   2681 C  CE2 . PHE B 1 152 ? -25.516 18.289  11.339  1.00 43.97  ? 479 PHE B CE2 1 
ATOM   2682 C  CZ  . PHE B 1 152 ? -24.511 19.193  11.004  1.00 42.22  ? 479 PHE B CZ  1 
ATOM   2683 N  N   . GLY B 1 153 ? -27.175 18.440  17.923  1.00 52.85  ? 480 GLY B N   1 
ATOM   2684 C  CA  . GLY B 1 153 ? -27.623 18.988  19.214  1.00 55.29  ? 480 GLY B CA  1 
ATOM   2685 C  C   . GLY B 1 153 ? -28.200 20.381  19.039  1.00 55.76  ? 480 GLY B C   1 
ATOM   2686 O  O   . GLY B 1 153 ? -28.612 20.741  17.939  1.00 55.81  ? 480 GLY B O   1 
ATOM   2687 N  N   . GLU B 1 154 ? -28.200 21.169  20.113  1.00 57.74  ? 481 GLU B N   1 
ATOM   2688 C  CA  . GLU B 1 154 ? -28.670 22.562  20.091  1.00 59.35  ? 481 GLU B CA  1 
ATOM   2689 C  C   . GLU B 1 154 ? -27.862 23.445  19.116  1.00 56.37  ? 481 GLU B C   1 
ATOM   2690 O  O   . GLU B 1 154 ? -28.339 24.499  18.693  1.00 58.46  ? 481 GLU B O   1 
ATOM   2691 C  CB  . GLU B 1 154 ? -28.685 23.163  21.519  1.00 63.37  ? 481 GLU B CB  1 
ATOM   2692 C  CG  . GLU B 1 154 ? -29.370 24.535  21.668  1.00 65.95  ? 481 GLU B CG  1 
ATOM   2693 C  CD  . GLU B 1 154 ? -30.802 24.478  22.200  1.00 70.47  ? 481 GLU B CD  1 
ATOM   2694 O  OE1 . GLU B 1 154 ? -31.741 24.919  21.477  1.00 71.14  ? 481 GLU B OE1 1 
ATOM   2695 O  OE2 . GLU B 1 154 ? -30.991 24.017  23.355  1.00 72.83  ? 481 GLU B OE2 1 
ATOM   2696 N  N   . TRP B 1 155 ? -26.668 22.996  18.736  1.00 52.79  ? 482 TRP B N   1 
ATOM   2697 C  CA  . TRP B 1 155 ? -25.808 23.738  17.817  1.00 49.37  ? 482 TRP B CA  1 
ATOM   2698 C  C   . TRP B 1 155 ? -26.465 24.140  16.479  1.00 49.83  ? 482 TRP B C   1 
ATOM   2699 O  O   . TRP B 1 155 ? -26.164 25.237  15.988  1.00 49.24  ? 482 TRP B O   1 
ATOM   2700 C  CB  . TRP B 1 155 ? -24.487 22.997  17.600  1.00 45.94  ? 482 TRP B CB  1 
ATOM   2701 C  CG  . TRP B 1 155 ? -23.419 23.750  16.801  1.00 42.74  ? 482 TRP B CG  1 
ATOM   2702 C  CD1 . TRP B 1 155 ? -23.139 25.100  16.843  1.00 42.32  ? 482 TRP B CD1 1 
ATOM   2703 C  CD2 . TRP B 1 155 ? -22.487 23.178  15.868  1.00 39.06  ? 482 TRP B CD2 1 
ATOM   2704 N  NE1 . TRP B 1 155 ? -22.097 25.393  15.978  1.00 39.56  ? 482 TRP B NE1 1 
ATOM   2705 C  CE2 . TRP B 1 155 ? -21.680 24.235  15.373  1.00 37.61  ? 482 TRP B CE2 1 
ATOM   2706 C  CE3 . TRP B 1 155 ? -22.254 21.876  15.401  1.00 38.39  ? 482 TRP B CE3 1 
ATOM   2707 C  CZ2 . TRP B 1 155 ? -20.647 24.027  14.444  1.00 35.63  ? 482 TRP B CZ2 1 
ATOM   2708 C  CZ3 . TRP B 1 155 ? -21.218 21.674  14.441  1.00 36.41  ? 482 TRP B CZ3 1 
ATOM   2709 C  CH2 . TRP B 1 155 ? -20.432 22.745  13.994  1.00 34.82  ? 482 TRP B CH2 1 
ATOM   2710 N  N   . ILE B 1 156 ? -27.348 23.298  15.901  1.00 50.68  ? 483 ILE B N   1 
ATOM   2711 C  CA  . ILE B 1 156 ? -28.056 23.695  14.647  1.00 50.39  ? 483 ILE B CA  1 
ATOM   2712 C  C   . ILE B 1 156 ? -28.974 24.878  14.832  1.00 51.47  ? 483 ILE B C   1 
ATOM   2713 O  O   . ILE B 1 156 ? -29.071 25.706  13.922  1.00 51.93  ? 483 ILE B O   1 
ATOM   2714 C  CB  . ILE B 1 156 ? -28.856 22.604  13.855  1.00 51.26  ? 483 ILE B CB  1 
ATOM   2715 C  CG1 . ILE B 1 156 ? -29.357 21.457  14.737  1.00 52.64  ? 483 ILE B CG1 1 
ATOM   2716 C  CG2 . ILE B 1 156 ? -28.088 22.152  12.608  1.00 49.18  ? 483 ILE B CG2 1 
ATOM   2717 C  CD1 . ILE B 1 156 ? -30.704 21.711  15.373  1.00 55.33  ? 483 ILE B CD1 1 
ATOM   2718 N  N   . ASP B 1 157 ? -29.625 24.967  15.992  1.00 52.62  ? 484 ASP B N   1 
ATOM   2719 C  CA  . ASP B 1 157 ? -30.513 26.102  16.277  1.00 54.28  ? 484 ASP B CA  1 
ATOM   2720 C  C   . ASP B 1 157 ? -29.722 27.424  16.258  1.00 53.81  ? 484 ASP B C   1 
ATOM   2721 O  O   . ASP B 1 157 ? -30.178 28.405  15.678  1.00 55.01  ? 484 ASP B O   1 
ATOM   2722 C  CB  . ASP B 1 157 ? -31.301 25.906  17.589  1.00 56.15  ? 484 ASP B CB  1 
ATOM   2723 C  CG  . ASP B 1 157 ? -32.208 24.660  17.573  1.00 56.77  ? 484 ASP B CG  1 
ATOM   2724 O  OD1 . ASP B 1 157 ? -32.695 24.242  16.498  1.00 55.75  ? 484 ASP B OD1 1 
ATOM   2725 O  OD2 . ASP B 1 157 ? -32.451 24.094  18.661  1.00 58.58  ? 484 ASP B OD2 1 
ATOM   2726 N  N   . SER B 1 158 ? -28.531 27.427  16.856  1.00 53.09  ? 485 SER B N   1 
ATOM   2727 C  CA  . SER B 1 158 ? -27.599 28.563  16.791  1.00 53.48  ? 485 SER B CA  1 
ATOM   2728 C  C   . SER B 1 158 ? -27.075 28.839  15.357  1.00 51.14  ? 485 SER B C   1 
ATOM   2729 O  O   . SER B 1 158 ? -26.833 29.993  14.982  1.00 52.12  ? 485 SER B O   1 
ATOM   2730 C  CB  . SER B 1 158 ? -26.410 28.320  17.721  1.00 53.02  ? 485 SER B CB  1 
ATOM   2731 O  OG  . SER B 1 158 ? -26.804 28.388  19.073  1.00 57.23  ? 485 SER B OG  1 
ATOM   2732 N  N   . ILE B 1 159 ? -26.894 27.778  14.578  1.00 47.79  ? 486 ILE B N   1 
ATOM   2733 C  CA  . ILE B 1 159 ? -26.507 27.893  13.165  1.00 45.55  ? 486 ILE B CA  1 
ATOM   2734 C  C   . ILE B 1 159 ? -27.651 28.522  12.335  1.00 46.27  ? 486 ILE B C   1 
ATOM   2735 O  O   . ILE B 1 159 ? -27.405 29.455  11.550  1.00 45.39  ? 486 ILE B O   1 
ATOM   2736 C  CB  . ILE B 1 159 ? -25.978 26.540  12.598  1.00 43.06  ? 486 ILE B CB  1 
ATOM   2737 C  CG1 . ILE B 1 159 ? -24.574 26.266  13.178  1.00 41.70  ? 486 ILE B CG1 1 
ATOM   2738 C  CG2 . ILE B 1 159 ? -25.946 26.552  11.070  1.00 42.15  ? 486 ILE B CG2 1 
ATOM   2739 C  CD1 . ILE B 1 159 ? -24.025 24.869  12.965  1.00 41.22  ? 486 ILE B CD1 1 
ATOM   2740 N  N   . VAL B 1 160 ? -28.880 28.028  12.546  1.00 46.68  ? 487 VAL B N   1 
ATOM   2741 C  CA  . VAL B 1 160 ? -30.072 28.475  11.816  1.00 47.81  ? 487 VAL B CA  1 
ATOM   2742 C  C   . VAL B 1 160 ? -30.345 29.957  12.095  1.00 50.27  ? 487 VAL B C   1 
ATOM   2743 O  O   . VAL B 1 160 ? -30.600 30.738  11.167  1.00 50.15  ? 487 VAL B O   1 
ATOM   2744 C  CB  . VAL B 1 160 ? -31.291 27.561  12.121  1.00 49.56  ? 487 VAL B CB  1 
ATOM   2745 C  CG1 . VAL B 1 160 ? -32.629 28.223  11.780  1.00 50.87  ? 487 VAL B CG1 1 
ATOM   2746 C  CG2 . VAL B 1 160 ? -31.155 26.238  11.373  1.00 47.87  ? 487 VAL B CG2 1 
ATOM   2747 N  N   . GLU B 1 161 ? -30.255 30.329  13.374  1.00 52.50  ? 488 GLU B N   1 
ATOM   2748 C  CA  . GLU B 1 161 ? -30.411 31.710  13.828  1.00 55.12  ? 488 GLU B CA  1 
ATOM   2749 C  C   . GLU B 1 161 ? -29.326 32.595  13.210  1.00 52.88  ? 488 GLU B C   1 
ATOM   2750 O  O   . GLU B 1 161 ? -29.620 33.704  12.758  1.00 54.18  ? 488 GLU B O   1 
ATOM   2751 C  CB  . GLU B 1 161 ? -30.358 31.770  15.356  1.00 58.55  ? 488 GLU B CB  1 
ATOM   2752 C  CG  . GLU B 1 161 ? -30.942 33.032  15.967  1.00 63.73  ? 488 GLU B CG  1 
ATOM   2753 C  CD  . GLU B 1 161 ? -30.254 33.430  17.267  1.00 66.37  ? 488 GLU B CD  1 
ATOM   2754 O  OE1 . GLU B 1 161 ? -30.946 33.497  18.307  1.00 70.13  ? 488 GLU B OE1 1 
ATOM   2755 O  OE2 . GLU B 1 161 ? -29.023 33.682  17.253  1.00 65.43  ? 488 GLU B OE2 1 
ATOM   2756 N  N   . PHE B 1 162 ? -28.088 32.090  13.173  1.00 49.74  ? 489 PHE B N   1 
ATOM   2757 C  CA  . PHE B 1 162 ? -26.988 32.785  12.504  1.00 47.71  ? 489 PHE B CA  1 
ATOM   2758 C  C   . PHE B 1 162 ? -27.236 32.943  11.006  1.00 47.01  ? 489 PHE B C   1 
ATOM   2759 O  O   . PHE B 1 162 ? -26.997 34.022  10.450  1.00 47.38  ? 489 PHE B O   1 
ATOM   2760 C  CB  . PHE B 1 162 ? -25.643 32.113  12.747  1.00 45.32  ? 489 PHE B CB  1 
ATOM   2761 C  CG  . PHE B 1 162 ? -24.498 32.825  12.093  1.00 44.35  ? 489 PHE B CG  1 
ATOM   2762 C  CD1 . PHE B 1 162 ? -24.043 34.049  12.588  1.00 46.04  ? 489 PHE B CD1 1 
ATOM   2763 C  CD2 . PHE B 1 162 ? -23.886 32.291  10.962  1.00 42.36  ? 489 PHE B CD2 1 
ATOM   2764 C  CE1 . PHE B 1 162 ? -22.990 34.716  11.964  1.00 45.72  ? 489 PHE B CE1 1 
ATOM   2765 C  CE2 . PHE B 1 162 ? -22.831 32.951  10.336  1.00 41.95  ? 489 PHE B CE2 1 
ATOM   2766 C  CZ  . PHE B 1 162 ? -22.385 34.166  10.835  1.00 43.18  ? 489 PHE B CZ  1 
ATOM   2767 N  N   . SER B 1 163 ? -27.728 31.875  10.375  1.00 46.16  ? 490 SER B N   1 
ATOM   2768 C  CA  . SER B 1 163 ? -28.139 31.902  8.970   1.00 46.83  ? 490 SER B CA  1 
ATOM   2769 C  C   . SER B 1 163 ? -29.192 32.991  8.665   1.00 50.35  ? 490 SER B C   1 
ATOM   2770 O  O   . SER B 1 163 ? -29.064 33.695  7.652   1.00 51.56  ? 490 SER B O   1 
ATOM   2771 C  CB  . SER B 1 163 ? -28.628 30.522  8.515   1.00 45.91  ? 490 SER B CB  1 
ATOM   2772 O  OG  . SER B 1 163 ? -28.931 30.509  7.128   1.00 45.02  ? 490 SER B OG  1 
ATOM   2773 N  N   . SER B 1 164 ? -30.200 33.139  9.534   1.00 52.19  ? 491 SER B N   1 
ATOM   2774 C  CA  . SER B 1 164 ? -31.232 34.170  9.362   1.00 55.08  ? 491 SER B CA  1 
ATOM   2775 C  C   . SER B 1 164 ? -30.628 35.571  9.418   1.00 56.50  ? 491 SER B C   1 
ATOM   2776 O  O   . SER B 1 164 ? -30.853 36.382  8.511   1.00 57.68  ? 491 SER B O   1 
ATOM   2777 C  CB  . SER B 1 164 ? -32.337 34.039  10.414  1.00 57.49  ? 491 SER B CB  1 
ATOM   2778 O  OG  . SER B 1 164 ? -32.686 32.684  10.619  1.00 56.91  ? 491 SER B OG  1 
ATOM   2779 N  N   . ASN B 1 165 ? -29.857 35.834  10.477  1.00 57.12  ? 492 ASN B N   1 
ATOM   2780 C  CA  . ASN B 1 165 ? -29.201 37.126  10.681  1.00 58.49  ? 492 ASN B CA  1 
ATOM   2781 C  C   . ASN B 1 165 ? -28.335 37.481  9.471   1.00 56.27  ? 492 ASN B C   1 
ATOM   2782 O  O   . ASN B 1 165 ? -28.485 38.566  8.903   1.00 58.08  ? 492 ASN B O   1 
ATOM   2783 C  CB  . ASN B 1 165 ? -28.355 37.139  11.975  1.00 60.06  ? 492 ASN B CB  1 
ATOM   2784 C  CG  . ASN B 1 165 ? -29.196 37.148  13.253  1.00 64.75  ? 492 ASN B CG  1 
ATOM   2785 O  OD1 . ASN B 1 165 ? -28.708 36.751  14.318  1.00 66.34  ? 492 ASN B OD1 1 
ATOM   2786 N  ND2 . ASN B 1 165 ? -30.448 37.615  13.166  1.00 67.87  ? 492 ASN B ND2 1 
ATOM   2787 N  N   . LEU B 1 166 ? -27.460 36.550  9.073   1.00 51.57  ? 493 LEU B N   1 
ATOM   2788 C  CA  . LEU B 1 166 ? -26.582 36.725  7.919   1.00 49.41  ? 493 LEU B CA  1 
ATOM   2789 C  C   . LEU B 1 166 ? -27.361 37.053  6.646   1.00 50.25  ? 493 LEU B C   1 
ATOM   2790 O  O   . LEU B 1 166 ? -27.030 38.011  5.931   1.00 50.26  ? 493 LEU B O   1 
ATOM   2791 C  CB  . LEU B 1 166 ? -25.731 35.472  7.695   1.00 45.97  ? 493 LEU B CB  1 
ATOM   2792 C  CG  . LEU B 1 166 ? -24.587 35.502  6.681   1.00 44.24  ? 493 LEU B CG  1 
ATOM   2793 C  CD1 . LEU B 1 166 ? -23.384 36.266  7.237   1.00 43.84  ? 493 LEU B CD1 1 
ATOM   2794 C  CD2 . LEU B 1 166 ? -24.211 34.069  6.316   1.00 41.64  ? 493 LEU B CD2 1 
ATOM   2795 N  N   . GLN B 1 167 ? -28.398 36.267  6.376   1.00 50.37  ? 494 GLN B N   1 
ATOM   2796 C  CA  . GLN B 1 167 ? -29.149 36.439  5.143   1.00 52.12  ? 494 GLN B CA  1 
ATOM   2797 C  C   . GLN B 1 167 ? -29.972 37.722  5.105   1.00 55.21  ? 494 GLN B C   1 
ATOM   2798 O  O   . GLN B 1 167 ? -30.154 38.283  4.029   1.00 56.37  ? 494 GLN B O   1 
ATOM   2799 C  CB  . GLN B 1 167 ? -29.942 35.185  4.790   1.00 51.59  ? 494 GLN B CB  1 
ATOM   2800 C  CG  . GLN B 1 167 ? -29.000 34.053  4.361   1.00 49.56  ? 494 GLN B CG  1 
ATOM   2801 C  CD  . GLN B 1 167 ? -29.704 32.819  3.823   1.00 49.11  ? 494 GLN B CD  1 
ATOM   2802 O  OE1 . GLN B 1 167 ? -29.053 31.802  3.553   1.00 47.24  ? 494 GLN B OE1 1 
ATOM   2803 N  NE2 . GLN B 1 167 ? -31.029 32.891  3.669   1.00 50.29  ? 494 GLN B NE2 1 
ATOM   2804 N  N   . ASN B 1 168 ? -30.396 38.207  6.277   1.00 57.90  ? 495 ASN B N   1 
ATOM   2805 C  CA  . ASN B 1 168 ? -31.063 39.520  6.405   1.00 61.90  ? 495 ASN B CA  1 
ATOM   2806 C  C   . ASN B 1 168 ? -30.188 40.706  5.983   1.00 61.87  ? 495 ASN B C   1 
ATOM   2807 O  O   . ASN B 1 168 ? -30.713 41.732  5.551   1.00 63.88  ? 495 ASN B O   1 
ATOM   2808 C  CB  . ASN B 1 168 ? -31.582 39.744  7.832   1.00 65.61  ? 495 ASN B CB  1 
ATOM   2809 C  CG  . ASN B 1 168 ? -32.920 39.056  8.106   1.00 67.45  ? 495 ASN B CG  1 
ATOM   2810 O  OD1 . ASN B 1 168 ? -33.360 38.987  9.257   1.00 69.97  ? 495 ASN B OD1 1 
ATOM   2811 N  ND2 . ASN B 1 168 ? -33.574 38.555  7.063   1.00 67.23  ? 495 ASN B ND2 1 
ATOM   2812 N  N   . MET B 1 169 ? -28.867 40.543  6.101   1.00 59.68  ? 496 MET B N   1 
ATOM   2813 C  CA  . MET B 1 169 ? -27.878 41.535  5.649   1.00 60.08  ? 496 MET B CA  1 
ATOM   2814 C  C   . MET B 1 169 ? -27.727 41.613  4.128   1.00 58.69  ? 496 MET B C   1 
ATOM   2815 O  O   . MET B 1 169 ? -27.158 42.580  3.611   1.00 59.31  ? 496 MET B O   1 
ATOM   2816 C  CB  . MET B 1 169 ? -26.501 41.230  6.233   1.00 59.13  ? 496 MET B CB  1 
ATOM   2817 C  CG  . MET B 1 169 ? -26.286 41.569  7.700   1.00 61.39  ? 496 MET B CG  1 
ATOM   2818 S  SD  . MET B 1 169 ? -24.530 41.358  8.083   1.00 61.40  ? 496 MET B SD  1 
ATOM   2819 C  CE  . MET B 1 169 ? -23.892 42.887  7.387   1.00 62.91  ? 496 MET B CE  1 
ATOM   2820 N  N   . ASN B 1 170 ? -28.202 40.577  3.431   1.00 56.58  ? 497 ASN B N   1 
ATOM   2821 C  CA  . ASN B 1 170 ? -28.138 40.474  1.964   1.00 55.53  ? 497 ASN B CA  1 
ATOM   2822 C  C   . ASN B 1 170 ? -26.734 40.755  1.396   1.00 53.47  ? 497 ASN B C   1 
ATOM   2823 O  O   . ASN B 1 170 ? -26.515 41.709  0.651   1.00 55.10  ? 497 ASN B O   1 
ATOM   2824 C  CB  . ASN B 1 170 ? -29.244 41.310  1.299   1.00 58.59  ? 497 ASN B CB  1 
ATOM   2825 C  CG  . ASN B 1 170 ? -30.637 40.903  1.765   1.00 60.55  ? 497 ASN B CG  1 
ATOM   2826 O  OD1 . ASN B 1 170 ? -31.059 39.751  1.614   1.00 59.05  ? 497 ASN B OD1 1 
ATOM   2827 N  ND2 . ASN B 1 170 ? -31.354 41.853  2.345   1.00 63.64  ? 497 ASN B ND2 1 
ATOM   2828 N  N   . ILE B 1 171 ? -25.787 39.916  1.793   1.00 50.11  ? 498 ILE B N   1 
ATOM   2829 C  CA  . ILE B 1 171 ? -24.399 40.033  1.365   1.00 48.58  ? 498 ILE B CA  1 
ATOM   2830 C  C   . ILE B 1 171 ? -24.310 39.438  -0.038  1.00 47.31  ? 498 ILE B C   1 
ATOM   2831 O  O   . ILE B 1 171 ? -24.706 38.291  -0.254  1.00 45.68  ? 498 ILE B O   1 
ATOM   2832 C  CB  . ILE B 1 171 ? -23.446 39.317  2.364   1.00 46.40  ? 498 ILE B CB  1 
ATOM   2833 C  CG1 . ILE B 1 171 ? -23.682 39.844  3.784   1.00 47.20  ? 498 ILE B CG1 1 
ATOM   2834 C  CG2 . ILE B 1 171 ? -21.985 39.475  1.957   1.00 45.07  ? 498 ILE B CG2 1 
ATOM   2835 C  CD1 . ILE B 1 171 ? -23.092 38.961  4.863   1.00 46.24  ? 498 ILE B CD1 1 
ATOM   2836 N  N   . ASP B 1 172 ? -23.831 40.228  -0.997  1.00 48.20  ? 499 ASP B N   1 
ATOM   2837 C  CA  . ASP B 1 172 ? -23.662 39.714  -2.349  1.00 47.63  ? 499 ASP B CA  1 
ATOM   2838 C  C   . ASP B 1 172 ? -22.520 38.703  -2.387  1.00 45.11  ? 499 ASP B C   1 
ATOM   2839 O  O   . ASP B 1 172 ? -21.696 38.647  -1.465  1.00 44.24  ? 499 ASP B O   1 
ATOM   2840 C  CB  . ASP B 1 172 ? -23.502 40.830  -3.404  1.00 50.39  ? 499 ASP B CB  1 
ATOM   2841 C  CG  . ASP B 1 172 ? -22.263 41.730  -3.188  1.00 52.17  ? 499 ASP B CG  1 
ATOM   2842 O  OD1 . ASP B 1 172 ? -22.415 42.956  -3.361  1.00 55.25  ? 499 ASP B OD1 1 
ATOM   2843 O  OD2 . ASP B 1 172 ? -21.143 41.247  -2.891  1.00 50.69  ? 499 ASP B OD2 1 
ATOM   2844 N  N   . ILE B 1 173 ? -22.484 37.913  -3.454  1.00 44.06  ? 500 ILE B N   1 
ATOM   2845 C  CA  . ILE B 1 173 ? -21.488 36.867  -3.620  1.00 42.52  ? 500 ILE B CA  1 
ATOM   2846 C  C   . ILE B 1 173 ? -20.039 37.383  -3.501  1.00 42.79  ? 500 ILE B C   1 
ATOM   2847 O  O   . ILE B 1 173 ? -19.189 36.704  -2.916  1.00 41.49  ? 500 ILE B O   1 
ATOM   2848 C  CB  . ILE B 1 173 ? -21.741 36.087  -4.920  1.00 42.69  ? 500 ILE B CB  1 
ATOM   2849 C  CG1 . ILE B 1 173 ? -23.027 35.257  -4.764  1.00 42.63  ? 500 ILE B CG1 1 
ATOM   2850 C  CG2 . ILE B 1 173 ? -20.569 35.170  -5.261  1.00 42.44  ? 500 ILE B CG2 1 
ATOM   2851 C  CD1 . ILE B 1 173 ? -23.672 34.822  -6.072  1.00 42.83  ? 500 ILE B CD1 1 
ATOM   2852 N  N   . SER B 1 174 ? -19.781 38.584  -4.023  1.00 43.99  ? 501 SER B N   1 
ATOM   2853 C  CA  . SER B 1 174 ? -18.442 39.179  -4.015  1.00 44.05  ? 501 SER B CA  1 
ATOM   2854 C  C   . SER B 1 174 ? -17.960 39.562  -2.614  1.00 43.56  ? 501 SER B C   1 
ATOM   2855 O  O   . SER B 1 174 ? -16.817 39.276  -2.251  1.00 42.45  ? 501 SER B O   1 
ATOM   2856 C  CB  . SER B 1 174 ? -18.385 40.381  -4.948  1.00 46.26  ? 501 SER B CB  1 
ATOM   2857 O  OG  . SER B 1 174 ? -18.452 39.944  -6.285  1.00 47.19  ? 501 SER B OG  1 
ATOM   2858 N  N   . ALA B 1 175 ? -18.842 40.202  -1.844  1.00 43.71  ? 502 ALA B N   1 
ATOM   2859 C  CA  . ALA B 1 175 ? -18.574 40.535  -0.455  1.00 42.88  ? 502 ALA B CA  1 
ATOM   2860 C  C   . ALA B 1 175 ? -18.370 39.284  0.395   1.00 40.45  ? 502 ALA B C   1 
ATOM   2861 O  O   . ALA B 1 175 ? -17.427 39.225  1.198   1.00 39.79  ? 502 ALA B O   1 
ATOM   2862 C  CB  . ALA B 1 175 ? -19.686 41.411  0.108   1.00 44.05  ? 502 ALA B CB  1 
ATOM   2863 N  N   . PHE B 1 176 ? -19.231 38.282  0.192   1.00 39.09  ? 503 PHE B N   1 
ATOM   2864 C  CA  . PHE B 1 176 ? -19.168 37.054  0.968   1.00 37.13  ? 503 PHE B CA  1 
ATOM   2865 C  C   . PHE B 1 176 ? -17.839 36.344  0.754   1.00 36.82  ? 503 PHE B C   1 
ATOM   2866 O  O   . PHE B 1 176 ? -17.168 35.962  1.722   1.00 36.17  ? 503 PHE B O   1 
ATOM   2867 C  CB  . PHE B 1 176 ? -20.335 36.113  0.649   1.00 35.51  ? 503 PHE B CB  1 
ATOM   2868 C  CG  . PHE B 1 176 ? -20.306 34.847  1.452   1.00 33.45  ? 503 PHE B CG  1 
ATOM   2869 C  CD1 . PHE B 1 176 ? -20.783 34.833  2.774   1.00 33.37  ? 503 PHE B CD1 1 
ATOM   2870 C  CD2 . PHE B 1 176 ? -19.758 33.673  0.920   1.00 31.89  ? 503 PHE B CD2 1 
ATOM   2871 C  CE1 . PHE B 1 176 ? -20.716 33.671  3.540   1.00 32.31  ? 503 PHE B CE1 1 
ATOM   2872 C  CE2 . PHE B 1 176 ? -19.691 32.507  1.686   1.00 30.69  ? 503 PHE B CE2 1 
ATOM   2873 C  CZ  . PHE B 1 176 ? -20.175 32.501  2.996   1.00 30.68  ? 503 PHE B CZ  1 
ATOM   2874 N  N   . SER B 1 177 ? -17.469 36.177  -0.517  1.00 37.95  ? 504 SER B N   1 
ATOM   2875 C  CA  . SER B 1 177 ? -16.225 35.516  -0.909  1.00 38.08  ? 504 SER B CA  1 
ATOM   2876 C  C   . SER B 1 177 ? -14.977 36.157  -0.275  1.00 39.63  ? 504 SER B C   1 
ATOM   2877 O  O   . SER B 1 177 ? -13.995 35.460  0.010   1.00 39.88  ? 504 SER B O   1 
ATOM   2878 C  CB  . SER B 1 177 ? -16.100 35.490  -2.423  1.00 39.26  ? 504 SER B CB  1 
ATOM   2879 O  OG  . SER B 1 177 ? -17.231 34.862  -3.014  1.00 40.44  ? 504 SER B OG  1 
ATOM   2880 N  N   . CYS B 1 178 ? -15.021 37.475  -0.070  1.00 41.30  ? 505 CYS B N   1 
ATOM   2881 C  CA  . CYS B 1 178 ? -14.013 38.197  0.715   1.00 42.18  ? 505 CYS B CA  1 
ATOM   2882 C  C   . CYS B 1 178 ? -14.084 37.832  2.202   1.00 41.82  ? 505 CYS B C   1 
ATOM   2883 O  O   . CYS B 1 178 ? -13.051 37.496  2.780   1.00 42.78  ? 505 CYS B O   1 
ATOM   2884 C  CB  . CYS B 1 178 ? -14.141 39.711  0.526   1.00 43.82  ? 505 CYS B CB  1 
ATOM   2885 S  SG  . CYS B 1 178 ? -13.783 40.306  -1.140  1.00 44.55  ? 505 CYS B SG  1 
ATOM   2886 N  N   . ILE B 1 179 ? -15.287 37.877  2.802   1.00 41.66  ? 506 ILE B N   1 
ATOM   2887 C  CA  . ILE B 1 179 ? -15.502 37.556  4.232   1.00 41.07  ? 506 ILE B CA  1 
ATOM   2888 C  C   . ILE B 1 179 ? -15.101 36.127  4.587   1.00 38.79  ? 506 ILE B C   1 
ATOM   2889 O  O   . ILE B 1 179 ? -14.441 35.905  5.615   1.00 38.74  ? 506 ILE B O   1 
ATOM   2890 C  CB  . ILE B 1 179 ? -16.968 37.798  4.722   1.00 42.18  ? 506 ILE B CB  1 
ATOM   2891 C  CG1 . ILE B 1 179 ? -17.448 39.211  4.402   1.00 44.80  ? 506 ILE B CG1 1 
ATOM   2892 C  CG2 . ILE B 1 179 ? -17.101 37.555  6.231   1.00 42.24  ? 506 ILE B CG2 1 
ATOM   2893 C  CD1 . ILE B 1 179 ? -16.702 40.304  5.142   1.00 48.68  ? 506 ILE B CD1 1 
ATOM   2894 N  N   . ALA B 1 180 ? -15.520 35.172  3.758   1.00 36.70  ? 507 ALA B N   1 
ATOM   2895 C  CA  . ALA B 1 180 ? -15.125 33.779  3.922   1.00 34.98  ? 507 ALA B CA  1 
ATOM   2896 C  C   . ALA B 1 180 ? -13.603 33.694  3.954   1.00 34.88  ? 507 ALA B C   1 
ATOM   2897 O  O   . ALA B 1 180 ? -13.038 33.004  4.801   1.00 34.80  ? 507 ALA B O   1 
ATOM   2898 C  CB  . ALA B 1 180 ? -15.694 32.908  2.799   1.00 34.07  ? 507 ALA B CB  1 
ATOM   2899 N  N   . ALA B 1 181 ? -12.946 34.425  3.049   1.00 35.09  ? 508 ALA B N   1 
ATOM   2900 C  CA  . ALA B 1 181 ? -11.498 34.377  2.936   1.00 35.42  ? 508 ALA B CA  1 
ATOM   2901 C  C   . ALA B 1 181 ? -10.824 34.909  4.218   1.00 35.93  ? 508 ALA B C   1 
ATOM   2902 O  O   . ALA B 1 181 ? -9.842  34.332  4.701   1.00 34.47  ? 508 ALA B O   1 
ATOM   2903 C  CB  . ALA B 1 181 ? -11.027 35.116  1.691   1.00 36.44  ? 508 ALA B CB  1 
ATOM   2904 N  N   . LEU B 1 182 ? -11.411 35.968  4.777   1.00 37.23  ? 509 LEU B N   1 
ATOM   2905 C  CA  . LEU B 1 182 ? -10.864 36.675  5.939   1.00 38.92  ? 509 LEU B CA  1 
ATOM   2906 C  C   . LEU B 1 182 ? -11.016 35.907  7.247   1.00 38.58  ? 509 LEU B C   1 
ATOM   2907 O  O   . LEU B 1 182 ? -10.228 36.104  8.162   1.00 40.25  ? 509 LEU B O   1 
ATOM   2908 C  CB  . LEU B 1 182 ? -11.445 38.086  6.046   1.00 40.16  ? 509 LEU B CB  1 
ATOM   2909 C  CG  . LEU B 1 182 ? -11.021 39.068  4.951   1.00 42.01  ? 509 LEU B CG  1 
ATOM   2910 C  CD1 . LEU B 1 182 ? -11.979 40.256  4.890   1.00 43.80  ? 509 LEU B CD1 1 
ATOM   2911 C  CD2 . LEU B 1 182 ? -9.574  39.537  5.113   1.00 42.98  ? 509 LEU B CD2 1 
ATOM   2912 N  N   . ALA B 1 183 ? -12.011 35.023  7.312   1.00 37.91  ? 510 ALA B N   1 
ATOM   2913 C  CA  . ALA B 1 183 ? -12.175 34.077  8.419   1.00 37.80  ? 510 ALA B CA  1 
ATOM   2914 C  C   . ALA B 1 183 ? -10.950 33.158  8.544   1.00 38.23  ? 510 ALA B C   1 
ATOM   2915 O  O   . ALA B 1 183 ? -10.613 32.714  9.650   1.00 38.35  ? 510 ALA B O   1 
ATOM   2916 C  CB  . ALA B 1 183 ? -13.442 33.244  8.228   1.00 35.32  ? 510 ALA B CB  1 
ATOM   2917 N  N   . MET B 1 184 ? -10.311 32.869  7.406   1.00 38.37  ? 511 MET B N   1 
ATOM   2918 C  CA  . MET B 1 184 ? -9.146  31.995  7.359   1.00 39.03  ? 511 MET B CA  1 
ATOM   2919 C  C   . MET B 1 184 ? -7.789  32.719  7.288   1.00 40.04  ? 511 MET B C   1 
ATOM   2920 O  O   . MET B 1 184 ? -6.844  32.321  7.971   1.00 40.83  ? 511 MET B O   1 
ATOM   2921 C  CB  . MET B 1 184 ? -9.266  31.012  6.212   1.00 39.51  ? 511 MET B CB  1 
ATOM   2922 C  CG  . MET B 1 184 ? -8.172  29.956  6.282   1.00 41.98  ? 511 MET B CG  1 
ATOM   2923 S  SD  . MET B 1 184 ? -8.335  28.737  4.997   1.00 44.82  ? 511 MET B SD  1 
ATOM   2924 C  CE  . MET B 1 184 ? -8.196  29.811  3.570   1.00 44.92  ? 511 MET B CE  1 
ATOM   2925 N  N   . VAL B 1 185 ? -7.711  33.760  6.458   1.00 40.18  ? 512 VAL B N   1 
ATOM   2926 C  CA  . VAL B 1 185 ? -6.492  34.530  6.250   1.00 41.92  ? 512 VAL B CA  1 
ATOM   2927 C  C   . VAL B 1 185 ? -6.477  35.618  7.324   1.00 43.45  ? 512 VAL B C   1 
ATOM   2928 O  O   . VAL B 1 185 ? -6.958  36.744  7.129   1.00 44.51  ? 512 VAL B O   1 
ATOM   2929 C  CB  . VAL B 1 185 ? -6.364  35.074  4.788   1.00 42.42  ? 512 VAL B CB  1 
ATOM   2930 C  CG1 . VAL B 1 185 ? -5.057  35.837  4.579   1.00 44.10  ? 512 VAL B CG1 1 
ATOM   2931 C  CG2 . VAL B 1 185 ? -6.472  33.937  3.767   1.00 41.01  ? 512 VAL B CG2 1 
ATOM   2932 N  N   . THR B 1 186 ? -5.944  35.222  8.475   1.00 43.79  ? 513 THR B N   1 
ATOM   2933 C  CA  . THR B 1 186 ? -5.890  36.039  9.692   1.00 45.98  ? 513 THR B CA  1 
ATOM   2934 C  C   . THR B 1 186 ? -4.718  35.566  10.595  1.00 46.84  ? 513 THR B C   1 
ATOM   2935 O  O   . THR B 1 186 ? -4.225  34.444  10.432  1.00 45.20  ? 513 THR B O   1 
ATOM   2936 C  CB  . THR B 1 186 ? -7.271  36.048  10.419  1.00 44.56  ? 513 THR B CB  1 
ATOM   2937 O  OG1 . THR B 1 186 ? -7.299  37.096  11.387  1.00 46.67  ? 513 THR B OG1 1 
ATOM   2938 C  CG2 . THR B 1 186 ? -7.584  34.711  11.093  1.00 43.05  ? 513 THR B CG2 1 
ATOM   2939 N  N   . GLU B 1 187 ? -4.260  36.427  11.511  1.00 50.89  ? 514 GLU B N   1 
ATOM   2940 C  CA  . GLU B 1 187 ? -3.189  36.070  12.472  1.00 52.84  ? 514 GLU B CA  1 
ATOM   2941 C  C   . GLU B 1 187 ? -3.556  34.874  13.347  1.00 51.01  ? 514 GLU B C   1 
ATOM   2942 O  O   . GLU B 1 187 ? -4.615  34.854  13.963  1.00 49.88  ? 514 GLU B O   1 
ATOM   2943 C  CB  . GLU B 1 187 ? -2.777  37.261  13.354  1.00 57.73  ? 514 GLU B CB  1 
ATOM   2944 C  CG  . GLU B 1 187 ? -2.127  36.862  14.698  1.00 61.04  ? 514 GLU B CG  1 
ATOM   2945 C  CD  . GLU B 1 187 ? -0.973  37.749  15.140  1.00 66.34  ? 514 GLU B CD  1 
ATOM   2946 O  OE1 . GLU B 1 187 ? 0.056   37.192  15.609  1.00 69.30  ? 514 GLU B OE1 1 
ATOM   2947 O  OE2 . GLU B 1 187 ? -1.085  38.997  15.042  1.00 68.73  ? 514 GLU B OE2 1 
ATOM   2948 N  N   . ARG B 1 188 ? -2.671  33.879  13.367  1.00 51.26  ? 515 ARG B N   1 
ATOM   2949 C  CA  . ARG B 1 188 ? -2.723  32.773  14.329  1.00 51.17  ? 515 ARG B CA  1 
ATOM   2950 C  C   . ARG B 1 188 ? -1.351  32.600  14.943  1.00 53.95  ? 515 ARG B C   1 
ATOM   2951 O  O   . ARG B 1 188 ? -0.327  32.843  14.288  1.00 55.99  ? 515 ARG B O   1 
ATOM   2952 C  CB  . ARG B 1 188 ? -3.113  31.457  13.655  1.00 48.65  ? 515 ARG B CB  1 
ATOM   2953 C  CG  . ARG B 1 188 ? -4.346  31.510  12.778  1.00 47.04  ? 515 ARG B CG  1 
ATOM   2954 C  CD  . ARG B 1 188 ? -5.605  31.663  13.601  1.00 45.96  ? 515 ARG B CD  1 
ATOM   2955 N  NE  . ARG B 1 188 ? -6.765  31.574  12.730  1.00 44.97  ? 515 ARG B NE  1 
ATOM   2956 C  CZ  . ARG B 1 188 ? -8.027  31.694  13.123  1.00 44.04  ? 515 ARG B CZ  1 
ATOM   2957 N  NH1 . ARG B 1 188 ? -8.311  31.924  14.397  1.00 45.00  ? 515 ARG B NH1 1 
ATOM   2958 N  NH2 . ARG B 1 188 ? -9.004  31.589  12.233  1.00 41.59  ? 515 ARG B NH2 1 
ATOM   2959 N  N   . HIS B 1 189 ? -1.321  32.156  16.192  1.00 55.33  ? 516 HIS B N   1 
ATOM   2960 C  CA  . HIS B 1 189 ? -0.063  31.925  16.862  1.00 57.26  ? 516 HIS B CA  1 
ATOM   2961 C  C   . HIS B 1 189 ? 0.660   30.751  16.215  1.00 56.46  ? 516 HIS B C   1 
ATOM   2962 O  O   . HIS B 1 189 ? 0.056   29.699  15.978  1.00 54.85  ? 516 HIS B O   1 
ATOM   2963 C  CB  . HIS B 1 189 ? -0.278  31.671  18.344  1.00 59.23  ? 516 HIS B CB  1 
ATOM   2964 C  CG  . HIS B 1 189 ? 0.968   31.829  19.157  1.00 64.15  ? 516 HIS B CG  1 
ATOM   2965 N  ND1 . HIS B 1 189 ? 1.637   30.757  19.708  1.00 65.59  ? 516 HIS B ND1 1 
ATOM   2966 C  CD2 . HIS B 1 189 ? 1.684   32.931  19.488  1.00 67.25  ? 516 HIS B CD2 1 
ATOM   2967 C  CE1 . HIS B 1 189 ? 2.697   31.193  20.367  1.00 69.45  ? 516 HIS B CE1 1 
ATOM   2968 N  NE2 . HIS B 1 189 ? 2.750   32.509  20.246  1.00 71.09  ? 516 HIS B NE2 1 
ATOM   2969 N  N   . GLY B 1 190 ? 1.943   30.965  15.911  1.00 58.15  ? 517 GLY B N   1 
ATOM   2970 C  CA  . GLY B 1 190 ? 2.842   29.932  15.366  1.00 57.87  ? 517 GLY B CA  1 
ATOM   2971 C  C   . GLY B 1 190 ? 2.953   29.850  13.844  1.00 56.88  ? 517 GLY B C   1 
ATOM   2972 O  O   . GLY B 1 190 ? 3.291   28.786  13.300  1.00 56.58  ? 517 GLY B O   1 
ATOM   2973 N  N   . LEU B 1 191 ? 2.642   30.954  13.159  1.00 55.38  ? 518 LEU B N   1 
ATOM   2974 C  CA  . LEU B 1 191 ? 2.826   31.063  11.717  1.00 54.92  ? 518 LEU B CA  1 
ATOM   2975 C  C   . LEU B 1 191 ? 4.306   31.259  11.412  1.00 58.99  ? 518 LEU B C   1 
ATOM   2976 O  O   . LEU B 1 191 ? 5.012   31.991  12.127  1.00 61.06  ? 518 LEU B O   1 
ATOM   2977 C  CB  . LEU B 1 191 ? 2.032   32.243  11.153  1.00 52.62  ? 518 LEU B CB  1 
ATOM   2978 C  CG  . LEU B 1 191 ? 0.535   32.129  10.867  1.00 48.71  ? 518 LEU B CG  1 
ATOM   2979 C  CD1 . LEU B 1 191 ? -0.047  33.520  10.735  1.00 48.31  ? 518 LEU B CD1 1 
ATOM   2980 C  CD2 . LEU B 1 191 ? 0.249   31.313  9.615   1.00 47.08  ? 518 LEU B CD2 1 
ATOM   2981 N  N   . LYS B 1 192 ? 4.774   30.596  10.360  1.00 60.46  ? 519 LYS B N   1 
ATOM   2982 C  CA  . LYS B 1 192 ? 6.164   30.746  9.919   1.00 64.96  ? 519 LYS B CA  1 
ATOM   2983 C  C   . LYS B 1 192 ? 6.385   32.038  9.120   1.00 66.73  ? 519 LYS B C   1 
ATOM   2984 O  O   . LYS B 1 192 ? 7.505   32.566  9.095   1.00 70.62  ? 519 LYS B O   1 
ATOM   2985 C  CB  . LYS B 1 192 ? 6.634   29.518  9.130   1.00 65.78  ? 519 LYS B CB  1 
ATOM   2986 C  CG  . LYS B 1 192 ? 6.787   28.264  9.974   1.00 66.26  ? 519 LYS B CG  1 
ATOM   2987 C  CD  . LYS B 1 192 ? 6.978   27.039  9.099   1.00 67.68  ? 519 LYS B CD  1 
ATOM   2988 C  CE  . LYS B 1 192 ? 7.136   25.786  9.946   1.00 68.78  ? 519 LYS B CE  1 
ATOM   2989 N  NZ  . LYS B 1 192 ? 7.581   24.612  9.138   1.00 70.51  ? 519 LYS B NZ  1 
ATOM   2990 N  N   . GLU B 1 193 ? 5.326   32.528  8.469   1.00 64.62  ? 520 GLU B N   1 
ATOM   2991 C  CA  . GLU B 1 193 ? 5.370   33.763  7.675   1.00 66.78  ? 520 GLU B CA  1 
ATOM   2992 C  C   . GLU B 1 193 ? 4.169   34.675  7.988   1.00 65.23  ? 520 GLU B C   1 
ATOM   2993 O  O   . GLU B 1 193 ? 3.328   34.912  7.104   1.00 63.45  ? 520 GLU B O   1 
ATOM   2994 C  CB  . GLU B 1 193 ? 5.419   33.465  6.162   1.00 68.10  ? 520 GLU B CB  1 
ATOM   2995 C  CG  . GLU B 1 193 ? 6.275   32.271  5.761   1.00 70.78  ? 520 GLU B CG  1 
ATOM   2996 C  CD  . GLU B 1 193 ? 7.177   32.523  4.566   1.00 74.24  ? 520 GLU B CD  1 
ATOM   2997 O  OE1 . GLU B 1 193 ? 6.695   33.017  3.519   1.00 75.43  ? 520 GLU B OE1 1 
ATOM   2998 O  OE2 . GLU B 1 193 ? 8.377   32.197  4.673   1.00 77.33  ? 520 GLU B OE2 1 
ATOM   2999 N  N   . PRO B 1 194 ? 4.090   35.209  9.236   1.00 65.75  ? 521 PRO B N   1 
ATOM   3000 C  CA  . PRO B 1 194 ? 2.911   36.026  9.597   1.00 64.19  ? 521 PRO B CA  1 
ATOM   3001 C  C   . PRO B 1 194 ? 2.750   37.298  8.739   1.00 65.19  ? 521 PRO B C   1 
ATOM   3002 O  O   . PRO B 1 194 ? 1.617   37.640  8.372   1.00 63.32  ? 521 PRO B O   1 
ATOM   3003 C  CB  . PRO B 1 194 ? 3.141   36.361  11.085  1.00 65.50  ? 521 PRO B CB  1 
ATOM   3004 C  CG  . PRO B 1 194 ? 4.607   36.193  11.310  1.00 67.67  ? 521 PRO B CG  1 
ATOM   3005 C  CD  . PRO B 1 194 ? 5.099   35.176  10.322  1.00 67.13  ? 521 PRO B CD  1 
ATOM   3006 N  N   . LYS B 1 195 ? 3.875   37.960  8.431   1.00 68.45  ? 522 LYS B N   1 
ATOM   3007 C  CA  . LYS B 1 195 ? 3.959   39.106  7.503   1.00 70.07  ? 522 LYS B CA  1 
ATOM   3008 C  C   . LYS B 1 195 ? 3.259   38.859  6.170   1.00 68.00  ? 522 LYS B C   1 
ATOM   3009 O  O   . LYS B 1 195 ? 2.504   39.716  5.709   1.00 68.00  ? 522 LYS B O   1 
ATOM   3010 C  CB  . LYS B 1 195 ? 5.424   39.492  7.224   1.00 74.30  ? 522 LYS B CB  1 
ATOM   3011 C  CG  . LYS B 1 195 ? 6.025   40.528  8.164   1.00 77.72  ? 522 LYS B CG  1 
ATOM   3012 C  CD  . LYS B 1 195 ? 7.518   40.693  7.908   1.00 81.54  ? 522 LYS B CD  1 
ATOM   3013 C  CE  . LYS B 1 195 ? 8.229   41.213  9.149   1.00 84.43  ? 522 LYS B CE  1 
ATOM   3014 N  NZ  . LYS B 1 195 ? 9.711   41.051  9.082   1.00 88.48  ? 522 LYS B NZ  1 
ATOM   3015 N  N   . ARG B 1 196 ? 3.519   37.705  5.551   1.00 66.41  ? 523 ARG B N   1 
ATOM   3016 C  CA  . ARG B 1 196 ? 2.899   37.376  4.270   1.00 64.89  ? 523 ARG B CA  1 
ATOM   3017 C  C   . ARG B 1 196 ? 1.426   37.027  4.408   1.00 60.28  ? 523 ARG B C   1 
ATOM   3018 O  O   . ARG B 1 196 ? 0.653   37.263  3.487   1.00 58.78  ? 523 ARG B O   1 
ATOM   3019 C  CB  . ARG B 1 196 ? 3.684   36.318  3.497   1.00 66.78  ? 523 ARG B CB  1 
ATOM   3020 C  CG  . ARG B 1 196 ? 4.680   36.964  2.544   1.00 71.95  ? 523 ARG B CG  1 
ATOM   3021 C  CD  . ARG B 1 196 ? 5.511   35.966  1.755   1.00 74.16  ? 523 ARG B CD  1 
ATOM   3022 N  NE  . ARG B 1 196 ? 4.721   35.186  0.799   1.00 73.49  ? 523 ARG B NE  1 
ATOM   3023 C  CZ  . ARG B 1 196 ? 4.453   35.543  -0.455  1.00 74.16  ? 523 ARG B CZ  1 
ATOM   3024 N  NH1 . ARG B 1 196 ? 4.888   36.690  -0.954  1.00 77.26  ? 523 ARG B NH1 1 
ATOM   3025 N  NH2 . ARG B 1 196 ? 3.734   34.738  -1.217  1.00 73.11  ? 523 ARG B NH2 1 
ATOM   3026 N  N   . VAL B 1 197 ? 1.045   36.494  5.567   1.00 57.94  ? 524 VAL B N   1 
ATOM   3027 C  CA  . VAL B 1 197 ? -0.366  36.234  5.877   1.00 55.25  ? 524 VAL B CA  1 
ATOM   3028 C  C   . VAL B 1 197 ? -1.118  37.564  6.047   1.00 55.56  ? 524 VAL B C   1 
ATOM   3029 O  O   . VAL B 1 197 ? -2.227  37.722  5.558   1.00 53.23  ? 524 VAL B O   1 
ATOM   3030 C  CB  . VAL B 1 197 ? -0.520  35.252  7.071   1.00 52.99  ? 524 VAL B CB  1 
ATOM   3031 C  CG1 . VAL B 1 197 ? -1.937  35.252  7.632   1.00 50.95  ? 524 VAL B CG1 1 
ATOM   3032 C  CG2 . VAL B 1 197 ? -0.156  33.841  6.632   1.00 51.10  ? 524 VAL B CG2 1 
ATOM   3033 N  N   . GLU B 1 198 ? -0.470  38.523  6.702   1.00 59.40  ? 525 GLU B N   1 
ATOM   3034 C  CA  . GLU B 1 198 ? -1.026  39.860  6.908   1.00 61.26  ? 525 GLU B CA  1 
ATOM   3035 C  C   . GLU B 1 198 ? -1.138  40.652  5.593   1.00 61.49  ? 525 GLU B C   1 
ATOM   3036 O  O   . GLU B 1 198 ? -2.092  41.402  5.416   1.00 60.98  ? 525 GLU B O   1 
ATOM   3037 C  CB  . GLU B 1 198 ? -0.192  40.638  7.939   1.00 65.38  ? 525 GLU B CB  1 
ATOM   3038 C  CG  . GLU B 1 198 ? -1.020  41.374  8.986   1.00 67.12  ? 525 GLU B CG  1 
ATOM   3039 C  CD  . GLU B 1 198 ? -0.451  42.742  9.333   1.00 72.38  ? 525 GLU B CD  1 
ATOM   3040 O  OE1 . GLU B 1 198 ? 0.578   42.824  10.052  1.00 74.70  ? 525 GLU B OE1 1 
ATOM   3041 O  OE2 . GLU B 1 198 ? -1.051  43.749  8.890   1.00 74.28  ? 525 GLU B OE2 1 
ATOM   3042 N  N   . GLU B 1 199 ? -0.158  40.475  4.697   1.00 62.25  ? 526 GLU B N   1 
ATOM   3043 C  CA  . GLU B 1 199 ? -0.127  41.112  3.371   1.00 63.16  ? 526 GLU B CA  1 
ATOM   3044 C  C   . GLU B 1 199 ? -1.274  40.605  2.497   1.00 60.27  ? 526 GLU B C   1 
ATOM   3045 O  O   . GLU B 1 199 ? -1.861  41.378  1.732   1.00 60.45  ? 526 GLU B O   1 
ATOM   3046 C  CB  . GLU B 1 199 ? 1.222   40.884  2.665   1.00 66.09  ? 526 GLU B CB  1 
ATOM   3047 C  CG  . GLU B 1 199 ? 2.291   41.949  2.950   1.00 71.43  ? 526 GLU B CG  1 
ATOM   3048 C  CD  . GLU B 1 199 ? 3.746   41.429  2.937   1.00 74.13  ? 526 GLU B CD  1 
ATOM   3049 O  OE1 . GLU B 1 199 ? 4.667   42.201  3.312   1.00 76.82  ? 526 GLU B OE1 1 
ATOM   3050 O  OE2 . GLU B 1 199 ? 3.991   40.254  2.562   1.00 73.36  ? 526 GLU B OE2 1 
ATOM   3051 N  N   . LEU B 1 200 ? -1.594  39.316  2.627   1.00 56.68  ? 527 LEU B N   1 
ATOM   3052 C  CA  . LEU B 1 200 ? -2.703  38.725  1.899   1.00 54.18  ? 527 LEU B CA  1 
ATOM   3053 C  C   . LEU B 1 200 ? -4.053  39.187  2.470   1.00 52.43  ? 527 LEU B C   1 
ATOM   3054 O  O   . LEU B 1 200 ? -4.963  39.514  1.707   1.00 51.45  ? 527 LEU B O   1 
ATOM   3055 C  CB  . LEU B 1 200 ? -2.603  37.184  1.834   1.00 52.04  ? 527 LEU B CB  1 
ATOM   3056 C  CG  . LEU B 1 200 ? -3.703  36.495  0.988   1.00 50.17  ? 527 LEU B CG  1 
ATOM   3057 C  CD1 . LEU B 1 200 ? -3.593  36.880  -0.481  1.00 51.61  ? 527 LEU B CD1 1 
ATOM   3058 C  CD2 . LEU B 1 200 ? -3.746  34.978  1.133   1.00 48.35  ? 527 LEU B CD2 1 
ATOM   3059 N  N   . GLN B 1 201 ? -4.153  39.208  3.801   1.00 51.83  ? 528 GLN B N   1 
ATOM   3060 C  CA  . GLN B 1 201 ? -5.348  39.640  4.519   1.00 51.08  ? 528 GLN B CA  1 
ATOM   3061 C  C   . GLN B 1 201 ? -5.750  41.055  4.104   1.00 53.62  ? 528 GLN B C   1 
ATOM   3062 O  O   . GLN B 1 201 ? -6.921  41.308  3.795   1.00 53.15  ? 528 GLN B O   1 
ATOM   3063 C  CB  . GLN B 1 201 ? -5.103  39.569  6.028   1.00 50.78  ? 528 GLN B CB  1 
ATOM   3064 C  CG  . GLN B 1 201 ? -6.211  40.156  6.896   1.00 50.67  ? 528 GLN B CG  1 
ATOM   3065 C  CD  . GLN B 1 201 ? -5.785  40.312  8.339   1.00 51.45  ? 528 GLN B CD  1 
ATOM   3066 O  OE1 . GLN B 1 201 ? -4.957  41.160  8.654   1.00 54.38  ? 528 GLN B OE1 1 
ATOM   3067 N  NE2 . GLN B 1 201 ? -6.344  39.494  9.223   1.00 49.59  ? 528 GLN B NE2 1 
ATOM   3068 N  N   . ASN B 1 202 ? -4.760  41.949  4.072   1.00 56.70  ? 529 ASN B N   1 
ATOM   3069 C  CA  . ASN B 1 202 ? -4.948  43.354  3.715   1.00 59.38  ? 529 ASN B CA  1 
ATOM   3070 C  C   . ASN B 1 202 ? -5.410  43.561  2.277   1.00 59.46  ? 529 ASN B C   1 
ATOM   3071 O  O   . ASN B 1 202 ? -6.315  44.360  2.041   1.00 60.07  ? 529 ASN B O   1 
ATOM   3072 C  CB  . ASN B 1 202 ? -3.682  44.164  4.026   1.00 62.96  ? 529 ASN B CB  1 
ATOM   3073 C  CG  . ASN B 1 202 ? -3.439  44.310  5.521   1.00 64.30  ? 529 ASN B CG  1 
ATOM   3074 O  OD1 . ASN B 1 202 ? -4.347  44.107  6.341   1.00 63.30  ? 529 ASN B OD1 1 
ATOM   3075 N  ND2 . ASN B 1 202 ? -2.208  44.656  5.888   1.00 66.98  ? 529 ASN B ND2 1 
ATOM   3076 N  N   . LYS B 1 203 ? -4.802  42.838  1.331   1.00 59.34  ? 530 LYS B N   1 
ATOM   3077 C  CA  . LYS B 1 203 ? -5.269  42.819  -0.063  1.00 59.72  ? 530 LYS B CA  1 
ATOM   3078 C  C   . LYS B 1 203 ? -6.736  42.421  -0.102  1.00 57.79  ? 530 LYS B C   1 
ATOM   3079 O  O   . LYS B 1 203 ? -7.504  43.031  -0.841  1.00 59.58  ? 530 LYS B O   1 
ATOM   3080 C  CB  . LYS B 1 203 ? -4.481  41.834  -0.934  1.00 59.44  ? 530 LYS B CB  1 
ATOM   3081 C  CG  . LYS B 1 203 ? -3.078  42.238  -1.355  1.00 62.43  ? 530 LYS B CG  1 
ATOM   3082 C  CD  . LYS B 1 203 ? -2.518  41.175  -2.291  1.00 62.20  ? 530 LYS B CD  1 
ATOM   3083 C  CE  . LYS B 1 203 ? -1.033  40.930  -2.068  1.00 64.27  ? 530 LYS B CE  1 
ATOM   3084 N  NZ  . LYS B 1 203 ? -0.190  41.834  -2.891  1.00 67.80  ? 530 LYS B NZ  1 
ATOM   3085 N  N   . ILE B 1 204 ? -7.112  41.411  0.698   1.00 55.54  ? 531 ILE B N   1 
ATOM   3086 C  CA  . ILE B 1 204 ? -8.506  40.918  0.751   1.00 53.30  ? 531 ILE B CA  1 
ATOM   3087 C  C   . ILE B 1 204 ? -9.440  41.963  1.379   1.00 53.61  ? 531 ILE B C   1 
ATOM   3088 O  O   . ILE B 1 204 ? -10.563 42.141  0.899   1.00 53.69  ? 531 ILE B O   1 
ATOM   3089 C  CB  . ILE B 1 204 ? -8.672  39.505  1.402   1.00 50.23  ? 531 ILE B CB  1 
ATOM   3090 C  CG1 . ILE B 1 204 ? -7.829  38.445  0.674   1.00 49.73  ? 531 ILE B CG1 1 
ATOM   3091 C  CG2 . ILE B 1 204 ? -10.128 39.052  1.316   1.00 48.70  ? 531 ILE B CG2 1 
ATOM   3092 C  CD1 . ILE B 1 204 ? -7.655  37.121  1.409   1.00 47.46  ? 531 ILE B CD1 1 
ATOM   3093 N  N   . VAL B 1 205 ? -8.966  42.647  2.421   1.00 54.43  ? 532 VAL B N   1 
ATOM   3094 C  CA  . VAL B 1 205 ? -9.677  43.796  3.007   1.00 56.60  ? 532 VAL B CA  1 
ATOM   3095 C  C   . VAL B 1 205 ? -9.830  44.929  1.984   1.00 59.45  ? 532 VAL B C   1 
ATOM   3096 O  O   . VAL B 1 205 ? -10.940 45.439  1.789   1.00 60.41  ? 532 VAL B O   1 
ATOM   3097 C  CB  . VAL B 1 205 ? -9.012  44.299  4.319   1.00 57.92  ? 532 VAL B CB  1 
ATOM   3098 C  CG1 . VAL B 1 205 ? -9.569  45.649  4.750   1.00 59.98  ? 532 VAL B CG1 1 
ATOM   3099 C  CG2 . VAL B 1 205 ? -9.202  43.280  5.439   1.00 55.32  ? 532 VAL B CG2 1 
ATOM   3100 N  N   . ASN B 1 206 ? -8.732  45.287  1.315   1.00 61.59  ? 533 ASN B N   1 
ATOM   3101 C  CA  . ASN B 1 206 ? -8.734  46.333  0.276   1.00 64.53  ? 533 ASN B CA  1 
ATOM   3102 C  C   . ASN B 1 206 ? -9.792  46.178  -0.807  1.00 64.10  ? 533 ASN B C   1 
ATOM   3103 O  O   . ASN B 1 206 ? -10.516 47.137  -1.091  1.00 66.00  ? 533 ASN B O   1 
ATOM   3104 C  CB  . ASN B 1 206 ? -7.363  46.489  -0.382  1.00 65.87  ? 533 ASN B CB  1 
ATOM   3105 C  CG  . ASN B 1 206 ? -6.418  47.333  0.437   1.00 68.93  ? 533 ASN B CG  1 
ATOM   3106 O  OD1 . ASN B 1 206 ? -6.832  48.085  1.329   1.00 70.34  ? 533 ASN B OD1 1 
ATOM   3107 N  ND2 . ASN B 1 206 ? -5.130  47.216  0.140   1.00 70.20  ? 533 ASN B ND2 1 
ATOM   3108 N  N   . CYS B 1 207 ? -9.889  44.997  -1.416  1.00 62.38  ? 534 CYS B N   1 
ATOM   3109 C  CA  . CYS B 1 207 ? -10.891 44.833  -2.477  1.00 63.02  ? 534 CYS B CA  1 
ATOM   3110 C  C   . CYS B 1 207 ? -12.325 44.608  -1.967  1.00 60.23  ? 534 CYS B C   1 
ATOM   3111 O  O   . CYS B 1 207 ? -13.271 44.757  -2.729  1.00 61.40  ? 534 CYS B O   1 
ATOM   3112 C  CB  . CYS B 1 207 ? -10.454 43.857  -3.576  1.00 63.55  ? 534 CYS B CB  1 
ATOM   3113 S  SG  . CYS B 1 207 ? -10.470 42.124  -3.114  1.00 64.34  ? 534 CYS B SG  1 
ATOM   3114 N  N   . LEU B 1 208 ? -12.477 44.285  -0.682  1.00 58.12  ? 535 LEU B N   1 
ATOM   3115 C  CA  . LEU B 1 208 ? -13.781 44.346  -0.024  1.00 57.04  ? 535 LEU B CA  1 
ATOM   3116 C  C   . LEU B 1 208 ? -14.229 45.795  0.167   1.00 60.34  ? 535 LEU B C   1 
ATOM   3117 O  O   . LEU B 1 208 ? -15.370 46.120  -0.140  1.00 60.99  ? 535 LEU B O   1 
ATOM   3118 C  CB  . LEU B 1 208 ? -13.785 43.584  1.311   1.00 54.81  ? 535 LEU B CB  1 
ATOM   3119 C  CG  . LEU B 1 208 ? -15.072 43.592  2.160   1.00 54.42  ? 535 LEU B CG  1 
ATOM   3120 C  CD1 . LEU B 1 208 ? -16.263 42.967  1.440   1.00 52.47  ? 535 LEU B CD1 1 
ATOM   3121 C  CD2 . LEU B 1 208 ? -14.841 42.894  3.492   1.00 52.74  ? 535 LEU B CD2 1 
ATOM   3122 N  N   . LYS B 1 209 ? -13.329 46.649  0.675   1.00 63.39  ? 536 LYS B N   1 
ATOM   3123 C  CA  . LYS B 1 209 ? -13.555 48.101  0.809   1.00 66.69  ? 536 LYS B CA  1 
ATOM   3124 C  C   . LYS B 1 209 ? -13.939 48.729  -0.528  1.00 67.85  ? 536 LYS B C   1 
ATOM   3125 O  O   . LYS B 1 209 ? -14.918 49.478  -0.607  1.00 69.17  ? 536 LYS B O   1 
ATOM   3126 C  CB  . LYS B 1 209 ? -12.318 48.822  1.376   1.00 69.72  ? 536 LYS B CB  1 
ATOM   3127 C  CG  . LYS B 1 209 ? -11.986 48.494  2.824   1.00 70.09  ? 536 LYS B CG  1 
ATOM   3128 C  CD  . LYS B 1 209 ? -11.017 49.497  3.448   1.00 73.30  ? 536 LYS B CD  1 
ATOM   3129 C  CE  . LYS B 1 209 ? -10.745 49.142  4.907   1.00 73.12  ? 536 LYS B CE  1 
ATOM   3130 N  NZ  . LYS B 1 209 ? -9.857  50.117  5.601   1.00 77.76  ? 536 LYS B NZ  1 
ATOM   3131 N  N   . ASP B 1 210 ? -13.161 48.402  -1.563  1.00 67.37  ? 537 ASP B N   1 
ATOM   3132 C  CA  . ASP B 1 210 ? -13.400 48.844  -2.939  1.00 69.16  ? 537 ASP B CA  1 
ATOM   3133 C  C   . ASP B 1 210 ? -14.751 48.384  -3.476  1.00 67.90  ? 537 ASP B C   1 
ATOM   3134 O  O   . ASP B 1 210 ? -15.436 49.151  -4.156  1.00 70.07  ? 537 ASP B O   1 
ATOM   3135 C  CB  . ASP B 1 210 ? -12.292 48.344  -3.879  1.00 69.04  ? 537 ASP B CB  1 
ATOM   3136 C  CG  . ASP B 1 210 ? -10.945 49.019  -3.635  1.00 71.45  ? 537 ASP B CG  1 
ATOM   3137 O  OD1 . ASP B 1 210 ? -10.903 50.168  -3.137  1.00 74.26  ? 537 ASP B OD1 1 
ATOM   3138 O  OD2 . ASP B 1 210 ? -9.921  48.383  -3.962  1.00 70.57  ? 537 ASP B OD2 1 
ATOM   3139 N  N   . HIS B 1 211 ? -15.120 47.131  -3.181  1.00 64.62  ? 538 HIS B N   1 
ATOM   3140 C  CA  . HIS B 1 211 ? -16.391 46.581  -3.640  1.00 62.58  ? 538 HIS B CA  1 
ATOM   3141 C  C   . HIS B 1 211 ? -17.610 47.195  -2.940  1.00 64.24  ? 538 HIS B C   1 
ATOM   3142 O  O   . HIS B 1 211 ? -18.627 47.445  -3.587  1.00 64.72  ? 538 HIS B O   1 
ATOM   3143 C  CB  . HIS B 1 211 ? -16.425 45.067  -3.536  1.00 57.74  ? 538 HIS B CB  1 
ATOM   3144 C  CG  . HIS B 1 211 ? -17.592 44.464  -4.243  1.00 56.20  ? 538 HIS B CG  1 
ATOM   3145 N  ND1 . HIS B 1 211 ? -18.735 44.066  -3.582  1.00 54.53  ? 538 HIS B ND1 1 
ATOM   3146 C  CD2 . HIS B 1 211 ? -17.826 44.264  -5.562  1.00 56.11  ? 538 HIS B CD2 1 
ATOM   3147 C  CE1 . HIS B 1 211 ? -19.605 43.604  -4.461  1.00 53.64  ? 538 HIS B CE1 1 
ATOM   3148 N  NE2 . HIS B 1 211 ? -19.075 43.705  -5.667  1.00 54.32  ? 538 HIS B NE2 1 
ATOM   3149 N  N   . VAL B 1 212 ? -17.497 47.428  -1.633  1.00 65.31  ? 539 VAL B N   1 
ATOM   3150 C  CA  . VAL B 1 212 ? -18.540 48.107  -0.860  1.00 68.36  ? 539 VAL B CA  1 
ATOM   3151 C  C   . VAL B 1 212 ? -18.713 49.555  -1.351  1.00 74.24  ? 539 VAL B C   1 
ATOM   3152 O  O   . VAL B 1 212 ? -19.842 50.045  -1.465  1.00 76.73  ? 539 VAL B O   1 
ATOM   3153 C  CB  . VAL B 1 212 ? -18.271 48.008  0.665   1.00 67.46  ? 539 VAL B CB  1 
ATOM   3154 C  CG1 . VAL B 1 212 ? -19.260 48.839  1.473   1.00 69.65  ? 539 VAL B CG1 1 
ATOM   3155 C  CG2 . VAL B 1 212 ? -18.332 46.555  1.121   1.00 63.15  ? 539 VAL B CG2 1 
ATOM   3156 N  N   . THR B 1 213 ? -17.594 50.209  -1.673  1.00 77.87  ? 540 THR B N   1 
ATOM   3157 C  CA  . THR B 1 213 ? -17.579 51.563  -2.247  1.00 83.55  ? 540 THR B CA  1 
ATOM   3158 C  C   . THR B 1 213 ? -18.286 51.628  -3.616  1.00 86.40  ? 540 THR B C   1 
ATOM   3159 O  O   . THR B 1 213 ? -19.119 52.514  -3.837  1.00 89.16  ? 540 THR B O   1 
ATOM   3160 C  CB  . THR B 1 213 ? -16.131 52.122  -2.325  1.00 84.87  ? 540 THR B CB  1 
ATOM   3161 O  OG1 . THR B 1 213 ? -15.532 52.057  -1.025  1.00 84.56  ? 540 THR B OG1 1 
ATOM   3162 C  CG2 . THR B 1 213 ? -16.083 53.578  -2.826  1.00 88.85  ? 540 THR B CG2 1 
ATOM   3163 N  N   . PHE B 1 214 ? -17.974 50.681  -4.509  1.00 87.01  ? 541 PHE B N   1 
ATOM   3164 C  CA  . PHE B 1 214 ? -18.488 50.712  -5.891  1.00 90.57  ? 541 PHE B CA  1 
ATOM   3165 C  C   . PHE B 1 214 ? -19.911 50.158  -6.085  1.00 90.05  ? 541 PHE B C   1 
ATOM   3166 O  O   . PHE B 1 214 ? -20.600 50.549  -7.032  1.00 91.76  ? 541 PHE B O   1 
ATOM   3167 C  CB  . PHE B 1 214 ? -17.498 50.083  -6.889  1.00 91.23  ? 541 PHE B CB  1 
ATOM   3168 C  CG  . PHE B 1 214 ? -17.517 50.739  -8.250  1.00 95.63  ? 541 PHE B CG  1 
ATOM   3169 C  CD1 . PHE B 1 214 ? -16.730 51.872  -8.510  1.00 100.20 ? 541 PHE B CD1 1 
ATOM   3170 C  CD2 . PHE B 1 214 ? -18.331 50.239  -9.272  1.00 96.13  ? 541 PHE B CD2 1 
ATOM   3171 C  CE1 . PHE B 1 214 ? -16.751 52.489  -9.763  1.00 104.42 ? 541 PHE B CE1 1 
ATOM   3172 C  CE2 . PHE B 1 214 ? -18.358 50.852  -10.524 1.00 100.28 ? 541 PHE B CE2 1 
ATOM   3173 C  CZ  . PHE B 1 214 ? -17.569 51.979  -10.772 1.00 104.05 ? 541 PHE B CZ  1 
ATOM   3174 N  N   . ASN B 1 215 ? -20.347 49.265  -5.192  1.00 87.75  ? 542 ASN B N   1 
ATOM   3175 C  CA  . ASN B 1 215 ? -21.732 48.757  -5.209  1.00 87.94  ? 542 ASN B CA  1 
ATOM   3176 C  C   . ASN B 1 215 ? -22.791 49.737  -4.650  1.00 91.60  ? 542 ASN B C   1 
ATOM   3177 O  O   . ASN B 1 215 ? -23.949 49.353  -4.446  1.00 91.75  ? 542 ASN B O   1 
ATOM   3178 C  CB  . ASN B 1 215 ? -21.830 47.375  -4.535  1.00 84.16  ? 542 ASN B CB  1 
ATOM   3179 C  CG  . ASN B 1 215 ? -22.013 46.233  -5.536  1.00 82.35  ? 542 ASN B CG  1 
ATOM   3180 O  OD1 . ASN B 1 215 ? -21.691 46.353  -6.722  1.00 83.58  ? 542 ASN B OD1 1 
ATOM   3181 N  ND2 . ASN B 1 215 ? -22.534 45.110  -5.051  1.00 79.41  ? 542 ASN B ND2 1 
ATOM   3182 N  N   . ASN B 1 216 ? -22.380 50.987  -4.400  1.00 95.67  ? 543 ASN B N   1 
ATOM   3183 C  CA  . ASN B 1 216 ? -23.290 52.117  -4.141  1.00 99.30  ? 543 ASN B CA  1 
ATOM   3184 C  C   . ASN B 1 216 ? -22.706 53.424  -4.703  1.00 102.99 ? 543 ASN B C   1 
ATOM   3185 O  O   . ASN B 1 216 ? -23.393 54.447  -4.793  1.00 106.48 ? 543 ASN B O   1 
ATOM   3186 C  CB  . ASN B 1 216 ? -23.639 52.238  -2.644  1.00 99.51  ? 543 ASN B CB  1 
ATOM   3187 C  CG  . ASN B 1 216 ? -22.495 52.784  -1.806  1.00 101.02 ? 543 ASN B CG  1 
ATOM   3188 O  OD1 . ASN B 1 216 ? -22.179 53.977  -1.861  1.00 105.23 ? 543 ASN B OD1 1 
ATOM   3189 N  ND2 . ASN B 1 216 ? -21.885 51.918  -1.003  1.00 97.83  ? 543 ASN B ND2 1 
ATOM   3190 N  N   . ASN B 1 223 ? -20.546 52.172  7.684   1.00 91.39  ? 550 ASN B N   1 
ATOM   3191 C  CA  . ASN B 1 223 ? -21.597 51.373  8.385   1.00 90.47  ? 550 ASN B CA  1 
ATOM   3192 C  C   . ASN B 1 223 ? -21.666 49.912  7.914   1.00 85.83  ? 550 ASN B C   1 
ATOM   3193 O  O   . ASN B 1 223 ? -21.531 48.989  8.726   1.00 83.75  ? 550 ASN B O   1 
ATOM   3194 C  CB  . ASN B 1 223 ? -22.977 52.051  8.291   1.00 94.18  ? 550 ASN B CB  1 
ATOM   3195 C  CG  . ASN B 1 223 ? -23.297 52.568  6.891   1.00 95.35  ? 550 ASN B CG  1 
ATOM   3196 O  OD1 . ASN B 1 223 ? -22.619 53.457  6.370   1.00 97.30  ? 550 ASN B OD1 1 
ATOM   3197 N  ND2 . ASN B 1 223 ? -24.346 52.020  6.283   1.00 94.20  ? 550 ASN B ND2 1 
ATOM   3198 N  N   . TYR B 1 224 ? -21.862 49.708  6.610   1.00 84.23  ? 551 TYR B N   1 
ATOM   3199 C  CA  . TYR B 1 224 ? -22.098 48.373  6.049   1.00 79.96  ? 551 TYR B CA  1 
ATOM   3200 C  C   . TYR B 1 224 ? -20.858 47.480  6.129   1.00 77.05  ? 551 TYR B C   1 
ATOM   3201 O  O   . TYR B 1 224 ? -20.976 46.282  6.421   1.00 75.06  ? 551 TYR B O   1 
ATOM   3202 C  CB  . TYR B 1 224 ? -22.631 48.467  4.610   1.00 79.40  ? 551 TYR B CB  1 
ATOM   3203 C  CG  . TYR B 1 224 ? -22.990 47.137  3.959   1.00 75.82  ? 551 TYR B CG  1 
ATOM   3204 C  CD1 . TYR B 1 224 ? -24.133 46.411  4.358   1.00 75.01  ? 551 TYR B CD1 1 
ATOM   3205 C  CD2 . TYR B 1 224 ? -22.199 46.610  2.927   1.00 73.33  ? 551 TYR B CD2 1 
ATOM   3206 C  CE1 . TYR B 1 224 ? -24.464 45.194  3.757   1.00 71.98  ? 551 TYR B CE1 1 
ATOM   3207 C  CE2 . TYR B 1 224 ? -22.526 45.399  2.316   1.00 71.01  ? 551 TYR B CE2 1 
ATOM   3208 C  CZ  . TYR B 1 224 ? -23.655 44.697  2.731   1.00 69.76  ? 551 TYR B CZ  1 
ATOM   3209 O  OH  . TYR B 1 224 ? -23.959 43.504  2.129   1.00 65.80  ? 551 TYR B OH  1 
ATOM   3210 N  N   . LEU B 1 225 ? -19.686 48.075  5.892   1.00 77.51  ? 552 LEU B N   1 
ATOM   3211 C  CA  . LEU B 1 225 ? -18.404 47.369  5.973   1.00 74.74  ? 552 LEU B CA  1 
ATOM   3212 C  C   . LEU B 1 225 ? -18.082 46.853  7.373   1.00 73.29  ? 552 LEU B C   1 
ATOM   3213 O  O   . LEU B 1 225 ? -17.508 45.774  7.502   1.00 71.19  ? 552 LEU B O   1 
ATOM   3214 C  CB  . LEU B 1 225 ? -17.248 48.230  5.435   1.00 76.68  ? 552 LEU B CB  1 
ATOM   3215 C  CG  . LEU B 1 225 ? -15.796 47.720  5.508   1.00 75.03  ? 552 LEU B CG  1 
ATOM   3216 C  CD1 . LEU B 1 225 ? -15.566 46.420  4.743   1.00 70.89  ? 552 LEU B CD1 1 
ATOM   3217 C  CD2 . LEU B 1 225 ? -14.858 48.806  5.014   1.00 77.44  ? 552 LEU B CD2 1 
ATOM   3218 N  N   . SER B 1 226 ? -18.454 47.607  8.405   1.00 75.32  ? 553 SER B N   1 
ATOM   3219 C  CA  . SER B 1 226 ? -18.167 47.194  9.782   1.00 75.39  ? 553 SER B CA  1 
ATOM   3220 C  C   . SER B 1 226 ? -19.155 46.143  10.301  1.00 73.47  ? 553 SER B C   1 
ATOM   3221 O  O   . SER B 1 226 ? -18.792 45.331  11.163  1.00 72.72  ? 553 SER B O   1 
ATOM   3222 C  CB  . SER B 1 226 ? -18.049 48.394  10.736  1.00 79.78  ? 553 SER B CB  1 
ATOM   3223 O  OG  . SER B 1 226 ? -19.299 48.748  11.302  1.00 82.82  ? 553 SER B OG  1 
ATOM   3224 N  N   . LYS B 1 227 ? -20.389 46.153  9.784   1.00 72.82  ? 554 LYS B N   1 
ATOM   3225 C  CA  . LYS B 1 227 ? -21.347 45.077  10.076  1.00 70.41  ? 554 LYS B CA  1 
ATOM   3226 C  C   . LYS B 1 227 ? -20.943 43.773  9.380   1.00 65.61  ? 554 LYS B C   1 
ATOM   3227 O  O   . LYS B 1 227 ? -21.180 42.684  9.896   1.00 63.11  ? 554 LYS B O   1 
ATOM   3228 C  CB  . LYS B 1 227 ? -22.778 45.486  9.721   1.00 72.43  ? 554 LYS B CB  1 
ATOM   3229 C  CG  . LYS B 1 227 ? -23.586 45.947  10.926  1.00 76.05  ? 554 LYS B CG  1 
ATOM   3230 C  CD  . LYS B 1 227 ? -25.065 46.127  10.605  1.00 77.55  ? 554 LYS B CD  1 
ATOM   3231 C  CE  . LYS B 1 227 ? -25.837 46.608  11.828  1.00 81.20  ? 554 LYS B CE  1 
ATOM   3232 N  NZ  . LYS B 1 227 ? -27.153 47.225  11.490  1.00 83.94  ? 554 LYS B NZ  1 
ATOM   3233 N  N   . LEU B 1 228 ? -20.317 43.915  8.215   1.00 64.53  ? 555 LEU B N   1 
ATOM   3234 C  CA  . LEU B 1 228 ? -19.783 42.812  7.431   1.00 62.28  ? 555 LEU B CA  1 
ATOM   3235 C  C   . LEU B 1 228 ? -18.625 42.120  8.178   1.00 60.07  ? 555 LEU B C   1 
ATOM   3236 O  O   . LEU B 1 228 ? -18.639 40.907  8.398   1.00 56.98  ? 555 LEU B O   1 
ATOM   3237 C  CB  . LEU B 1 228 ? -19.316 43.361  6.070   1.00 63.50  ? 555 LEU B CB  1 
ATOM   3238 C  CG  . LEU B 1 228 ? -19.776 42.804  4.715   1.00 62.55  ? 555 LEU B CG  1 
ATOM   3239 C  CD1 . LEU B 1 228 ? -21.265 42.485  4.688   1.00 62.67  ? 555 LEU B CD1 1 
ATOM   3240 C  CD2 . LEU B 1 228 ? -19.441 43.809  3.619   1.00 63.60  ? 555 LEU B CD2 1 
ATOM   3241 N  N   . LEU B 1 229 ? -17.643 42.916  8.584   1.00 61.48  ? 556 LEU B N   1 
ATOM   3242 C  CA  . LEU B 1 229 ? -16.519 42.436  9.375   1.00 61.20  ? 556 LEU B CA  1 
ATOM   3243 C  C   . LEU B 1 229 ? -16.943 41.986  10.780  1.00 60.69  ? 556 LEU B C   1 
ATOM   3244 O  O   . LEU B 1 229 ? -16.307 41.109  11.369  1.00 59.37  ? 556 LEU B O   1 
ATOM   3245 C  CB  . LEU B 1 229 ? -15.396 43.488  9.420   1.00 63.60  ? 556 LEU B CB  1 
ATOM   3246 C  CG  . LEU B 1 229 ? -14.751 43.887  8.077   1.00 64.01  ? 556 LEU B CG  1 
ATOM   3247 C  CD1 . LEU B 1 229 ? -13.740 45.010  8.268   1.00 66.96  ? 556 LEU B CD1 1 
ATOM   3248 C  CD2 . LEU B 1 229 ? -14.107 42.710  7.348   1.00 61.41  ? 556 LEU B CD2 1 
ATOM   3249 N  N   . GLY B 1 230 ? -18.029 42.567  11.287  1.00 61.94  ? 557 GLY B N   1 
ATOM   3250 C  CA  . GLY B 1 230 ? -18.613 42.187  12.571  1.00 62.82  ? 557 GLY B CA  1 
ATOM   3251 C  C   . GLY B 1 230 ? -19.153 40.770  12.640  1.00 60.83  ? 557 GLY B C   1 
ATOM   3252 O  O   . GLY B 1 230 ? -19.349 40.239  13.738  1.00 61.48  ? 557 GLY B O   1 
ATOM   3253 N  N   . LYS B 1 231 ? -19.404 40.162  11.475  1.00 58.87  ? 558 LYS B N   1 
ATOM   3254 C  CA  . LYS B 1 231 ? -19.794 38.745  11.392  1.00 56.32  ? 558 LYS B CA  1 
ATOM   3255 C  C   . LYS B 1 231 ? -18.657 37.783  11.746  1.00 54.06  ? 558 LYS B C   1 
ATOM   3256 O  O   . LYS B 1 231 ? -18.919 36.668  12.204  1.00 52.40  ? 558 LYS B O   1 
ATOM   3257 C  CB  . LYS B 1 231 ? -20.389 38.388  10.014  1.00 55.33  ? 558 LYS B CB  1 
ATOM   3258 C  CG  . LYS B 1 231 ? -21.811 38.880  9.775   1.00 57.23  ? 558 LYS B CG  1 
ATOM   3259 C  CD  . LYS B 1 231 ? -22.849 38.260  10.711  1.00 58.17  ? 558 LYS B CD  1 
ATOM   3260 C  CE  . LYS B 1 231 ? -23.882 39.309  11.126  1.00 62.39  ? 558 LYS B CE  1 
ATOM   3261 N  NZ  . LYS B 1 231 ? -25.125 38.723  11.709  1.00 63.94  ? 558 LYS B NZ  1 
ATOM   3262 N  N   . LEU B 1 232 ? -17.410 38.209  11.536  1.00 54.39  ? 559 LEU B N   1 
ATOM   3263 C  CA  . LEU B 1 232 ? -16.235 37.372  11.859  1.00 54.09  ? 559 LEU B CA  1 
ATOM   3264 C  C   . LEU B 1 232 ? -16.099 37.015  13.363  1.00 55.03  ? 559 LEU B C   1 
ATOM   3265 O  O   . LEU B 1 232 ? -15.845 35.842  13.659  1.00 54.00  ? 559 LEU B O   1 
ATOM   3266 C  CB  . LEU B 1 232 ? -14.917 37.916  11.237  1.00 54.13  ? 559 LEU B CB  1 
ATOM   3267 C  CG  . LEU B 1 232 ? -14.854 38.037  9.692   1.00 53.38  ? 559 LEU B CG  1 
ATOM   3268 C  CD1 . LEU B 1 232 ? -13.700 38.892  9.193   1.00 53.85  ? 559 LEU B CD1 1 
ATOM   3269 C  CD2 . LEU B 1 232 ? -14.811 36.676  9.019   1.00 50.95  ? 559 LEU B CD2 1 
ATOM   3270 N  N   . PRO B 1 233 ? -16.289 37.992  14.305  1.00 57.89  ? 560 PRO B N   1 
ATOM   3271 C  CA  . PRO B 1 233 ? -16.351 37.582  15.736  1.00 59.17  ? 560 PRO B CA  1 
ATOM   3272 C  C   . PRO B 1 233 ? -17.601 36.789  16.168  1.00 59.40  ? 560 PRO B C   1 
ATOM   3273 O  O   . PRO B 1 233 ? -17.535 36.079  17.172  1.00 60.72  ? 560 PRO B O   1 
ATOM   3274 C  CB  . PRO B 1 233 ? -16.279 38.913  16.505  1.00 61.70  ? 560 PRO B CB  1 
ATOM   3275 C  CG  . PRO B 1 233 ? -15.656 39.866  15.552  1.00 62.64  ? 560 PRO B CG  1 
ATOM   3276 C  CD  . PRO B 1 233 ? -16.161 39.462  14.194  1.00 59.98  ? 560 PRO B CD  1 
ATOM   3277 N  N   . GLU B 1 234 ? -18.719 36.901  15.447  1.00 58.93  ? 561 GLU B N   1 
ATOM   3278 C  CA  . GLU B 1 234 ? -19.890 36.061  15.745  1.00 58.35  ? 561 GLU B CA  1 
ATOM   3279 C  C   . GLU B 1 234 ? -19.611 34.587  15.432  1.00 54.36  ? 561 GLU B C   1 
ATOM   3280 O  O   . GLU B 1 234 ? -20.224 33.694  16.016  1.00 53.67  ? 561 GLU B O   1 
ATOM   3281 C  CB  . GLU B 1 234 ? -21.117 36.524  14.973  1.00 61.14  ? 561 GLU B CB  1 
ATOM   3282 C  CG  . GLU B 1 234 ? -21.741 37.830  15.452  1.00 66.45  ? 561 GLU B CG  1 
ATOM   3283 C  CD  . GLU B 1 234 ? -22.951 38.248  14.615  1.00 69.47  ? 561 GLU B CD  1 
ATOM   3284 O  OE1 . GLU B 1 234 ? -23.165 39.478  14.463  1.00 73.58  ? 561 GLU B OE1 1 
ATOM   3285 O  OE2 . GLU B 1 234 ? -23.694 37.360  14.109  1.00 66.96  ? 561 GLU B OE2 1 
ATOM   3286 N  N   . LEU B 1 235 ? -18.679 34.347  14.512  1.00 51.82  ? 562 LEU B N   1 
ATOM   3287 C  CA  . LEU B 1 235 ? -18.289 32.995  14.123  1.00 49.92  ? 562 LEU B CA  1 
ATOM   3288 C  C   . LEU B 1 235 ? -17.484 32.273  15.191  1.00 50.13  ? 562 LEU B C   1 
ATOM   3289 O  O   . LEU B 1 235 ? -17.578 31.048  15.300  1.00 49.15  ? 562 LEU B O   1 
ATOM   3290 C  CB  . LEU B 1 235 ? -17.533 32.995  12.791  1.00 47.92  ? 562 LEU B CB  1 
ATOM   3291 C  CG  . LEU B 1 235 ? -18.400 33.110  11.530  1.00 47.12  ? 562 LEU B CG  1 
ATOM   3292 C  CD1 . LEU B 1 235 ? -17.519 33.466  10.344  1.00 46.06  ? 562 LEU B CD1 1 
ATOM   3293 C  CD2 . LEU B 1 235 ? -19.194 31.837  11.261  1.00 45.21  ? 562 LEU B CD2 1 
ATOM   3294 N  N   . ARG B 1 236 ? -16.700 33.031  15.965  1.00 52.62  ? 563 ARG B N   1 
ATOM   3295 C  CA  . ARG B 1 236 ? -15.965 32.495  17.115  1.00 53.33  ? 563 ARG B CA  1 
ATOM   3296 C  C   . ARG B 1 236 ? -16.891 31.705  18.061  1.00 52.77  ? 563 ARG B C   1 
ATOM   3297 O  O   . ARG B 1 236 ? -16.566 30.574  18.420  1.00 52.51  ? 563 ARG B O   1 
ATOM   3298 C  CB  . ARG B 1 236 ? -15.152 33.590  17.848  1.00 57.08  ? 563 ARG B CB  1 
ATOM   3299 C  CG  . ARG B 1 236 ? -14.831 33.278  19.316  1.00 61.01  ? 563 ARG B CG  1 
ATOM   3300 C  CD  . ARG B 1 236 ? -13.401 33.595  19.722  1.00 63.24  ? 563 ARG B CD  1 
ATOM   3301 N  NE  . ARG B 1 236 ? -12.762 32.440  20.375  1.00 64.07  ? 563 ARG B NE  1 
ATOM   3302 C  CZ  . ARG B 1 236 ? -12.911 32.076  21.657  1.00 65.32  ? 563 ARG B CZ  1 
ATOM   3303 N  NH1 . ARG B 1 236 ? -13.691 32.764  22.492  1.00 66.47  ? 563 ARG B NH1 1 
ATOM   3304 N  NH2 . ARG B 1 236 ? -12.270 31.001  22.108  1.00 64.20  ? 563 ARG B NH2 1 
ATOM   3305 N  N   . THR B 1 237 ? -18.040 32.284  18.419  1.00 52.47  ? 564 THR B N   1 
ATOM   3306 C  CA  . THR B 1 237 ? -19.004 31.647  19.335  1.00 53.04  ? 564 THR B CA  1 
ATOM   3307 C  C   . THR B 1 237 ? -19.540 30.334  18.778  1.00 51.00  ? 564 THR B C   1 
ATOM   3308 O  O   . THR B 1 237 ? -19.674 29.347  19.506  1.00 50.60  ? 564 THR B O   1 
ATOM   3309 C  CB  . THR B 1 237 ? -20.171 32.599  19.681  1.00 55.12  ? 564 THR B CB  1 
ATOM   3310 O  OG1 . THR B 1 237 ? -19.645 33.750  20.348  1.00 58.32  ? 564 THR B OG1 1 
ATOM   3311 C  CG2 . THR B 1 237 ? -21.203 31.925  20.582  1.00 55.76  ? 564 THR B CG2 1 
ATOM   3312 N  N   . LEU B 1 238 ? -19.830 30.329  17.479  1.00 49.84  ? 565 LEU B N   1 
ATOM   3313 C  CA  . LEU B 1 238 ? -20.370 29.142  16.818  1.00 47.61  ? 565 LEU B CA  1 
ATOM   3314 C  C   . LEU B 1 238 ? -19.346 28.015  16.731  1.00 45.42  ? 565 LEU B C   1 
ATOM   3315 O  O   . LEU B 1 238 ? -19.694 26.849  16.879  1.00 45.32  ? 565 LEU B O   1 
ATOM   3316 C  CB  . LEU B 1 238 ? -20.967 29.514  15.459  1.00 47.06  ? 565 LEU B CB  1 
ATOM   3317 C  CG  . LEU B 1 238 ? -22.200 30.394  15.700  1.00 48.90  ? 565 LEU B CG  1 
ATOM   3318 C  CD1 . LEU B 1 238 ? -22.360 31.442  14.617  1.00 49.45  ? 565 LEU B CD1 1 
ATOM   3319 C  CD2 . LEU B 1 238 ? -23.453 29.553  15.852  1.00 49.54  ? 565 LEU B CD2 1 
ATOM   3320 N  N   . CYS B 1 239 ? -18.086 28.379  16.529  1.00 44.87  ? 566 CYS B N   1 
ATOM   3321 C  CA  . CYS B 1 239 ? -16.977 27.441  16.583  1.00 44.88  ? 566 CYS B CA  1 
ATOM   3322 C  C   . CYS B 1 239 ? -16.876 26.738  17.954  1.00 45.54  ? 566 CYS B C   1 
ATOM   3323 O  O   . CYS B 1 239 ? -16.889 25.511  18.010  1.00 45.70  ? 566 CYS B O   1 
ATOM   3324 C  CB  . CYS B 1 239 ? -15.685 28.161  16.227  1.00 46.70  ? 566 CYS B CB  1 
ATOM   3325 S  SG  . CYS B 1 239 ? -14.191 27.177  16.426  1.00 48.81  ? 566 CYS B SG  1 
ATOM   3326 N  N   . THR B 1 240 ? -16.808 27.518  19.037  1.00 45.86  ? 567 THR B N   1 
ATOM   3327 C  CA  . THR B 1 240 ? -16.851 27.015  20.424  1.00 47.27  ? 567 THR B CA  1 
ATOM   3328 C  C   . THR B 1 240 ? -18.085 26.149  20.687  1.00 47.75  ? 567 THR B C   1 
ATOM   3329 O  O   . THR B 1 240 ? -18.006 25.159  21.403  1.00 49.39  ? 567 THR B O   1 
ATOM   3330 C  CB  . THR B 1 240 ? -16.760 28.173  21.454  1.00 49.08  ? 567 THR B CB  1 
ATOM   3331 O  OG1 . THR B 1 240 ? -15.660 29.018  21.104  1.00 49.20  ? 567 THR B OG1 1 
ATOM   3332 C  CG2 . THR B 1 240 ? -16.508 27.666  22.880  1.00 51.06  ? 567 THR B CG2 1 
ATOM   3333 N  N   . GLN B 1 241 ? -19.216 26.496  20.088  1.00 47.52  ? 568 GLN B N   1 
ATOM   3334 C  CA  . GLN B 1 241 ? -20.410 25.676  20.243  1.00 48.17  ? 568 GLN B CA  1 
ATOM   3335 C  C   . GLN B 1 241 ? -20.291 24.308  19.523  1.00 45.71  ? 568 GLN B C   1 
ATOM   3336 O  O   . GLN B 1 241 ? -20.755 23.300  20.047  1.00 47.18  ? 568 GLN B O   1 
ATOM   3337 C  CB  . GLN B 1 241 ? -21.658 26.461  19.826  1.00 49.89  ? 568 GLN B CB  1 
ATOM   3338 C  CG  . GLN B 1 241 ? -22.960 25.868  20.346  1.00 52.09  ? 568 GLN B CG  1 
ATOM   3339 C  CD  . GLN B 1 241 ? -24.102 26.872  20.419  1.00 54.86  ? 568 GLN B CD  1 
ATOM   3340 O  OE1 . GLN B 1 241 ? -23.935 28.080  20.157  1.00 54.96  ? 568 GLN B OE1 1 
ATOM   3341 N  NE2 . GLN B 1 241 ? -25.280 26.375  20.797  1.00 56.31  ? 568 GLN B NE2 1 
ATOM   3342 N  N   . GLY B 1 242 ? -19.647 24.265  18.357  1.00 42.50  ? 569 GLY B N   1 
ATOM   3343 C  CA  . GLY B 1 242 ? -19.352 22.989  17.680  1.00 40.76  ? 569 GLY B CA  1 
ATOM   3344 C  C   . GLY B 1 242 ? -18.437 22.110  18.517  1.00 41.86  ? 569 GLY B C   1 
ATOM   3345 O  O   . GLY B 1 242 ? -18.760 20.962  18.805  1.00 42.77  ? 569 GLY B O   1 
ATOM   3346 N  N   . LEU B 1 243 ? -17.301 22.675  18.924  1.00 41.56  ? 570 LEU B N   1 
ATOM   3347 C  CA  . LEU B 1 243 ? -16.355 22.027  19.816  1.00 42.63  ? 570 LEU B CA  1 
ATOM   3348 C  C   . LEU B 1 243 ? -17.031 21.469  21.076  1.00 43.66  ? 570 LEU B C   1 
ATOM   3349 O  O   . LEU B 1 243 ? -16.714 20.356  21.498  1.00 43.77  ? 570 LEU B O   1 
ATOM   3350 C  CB  . LEU B 1 243 ? -15.256 23.018  20.199  1.00 44.19  ? 570 LEU B CB  1 
ATOM   3351 C  CG  . LEU B 1 243 ? -13.823 22.988  19.662  1.00 44.18  ? 570 LEU B CG  1 
ATOM   3352 C  CD1 . LEU B 1 243 ? -13.606 22.122  18.436  1.00 42.58  ? 570 LEU B CD1 1 
ATOM   3353 C  CD2 . LEU B 1 243 ? -13.393 24.427  19.401  1.00 45.39  ? 570 LEU B CD2 1 
ATOM   3354 N  N   . GLN B 1 244 ? -17.969 22.239  21.642  1.00 43.99  ? 571 GLN B N   1 
ATOM   3355 C  CA  . GLN B 1 244 ? -18.830 21.795  22.750  1.00 45.41  ? 571 GLN B CA  1 
ATOM   3356 C  C   . GLN B 1 244 ? -19.591 20.510  22.417  1.00 44.62  ? 571 GLN B C   1 
ATOM   3357 O  O   . GLN B 1 244 ? -19.656 19.590  23.247  1.00 45.42  ? 571 GLN B O   1 
ATOM   3358 C  CB  . GLN B 1 244 ? -19.812 22.897  23.169  1.00 47.64  ? 571 GLN B CB  1 
ATOM   3359 C  CG  . GLN B 1 244 ? -20.797 22.449  24.242  1.00 51.11  ? 571 GLN B CG  1 
ATOM   3360 C  CD  . GLN B 1 244 ? -21.669 23.557  24.798  1.00 53.76  ? 571 GLN B CD  1 
ATOM   3361 O  OE1 . GLN B 1 244 ? -21.440 24.028  25.908  1.00 56.79  ? 571 GLN B OE1 1 
ATOM   3362 N  NE2 . GLN B 1 244 ? -22.686 23.962  24.046  1.00 53.31  ? 571 GLN B NE2 1 
ATOM   3363 N  N   . ARG B 1 245 ? -20.145 20.453  21.200  1.00 42.08  ? 572 ARG B N   1 
ATOM   3364 C  CA  . ARG B 1 245 ? -20.880 19.278  20.742  1.00 41.19  ? 572 ARG B CA  1 
ATOM   3365 C  C   . ARG B 1 245 ? -19.981 18.025  20.594  1.00 40.50  ? 572 ARG B C   1 
ATOM   3366 O  O   . ARG B 1 245 ? -20.292 16.975  21.168  1.00 41.96  ? 572 ARG B O   1 
ATOM   3367 C  CB  . ARG B 1 245 ? -21.668 19.598  19.460  1.00 39.78  ? 572 ARG B CB  1 
ATOM   3368 C  CG  . ARG B 1 245 ? -22.494 18.443  18.927  1.00 39.84  ? 572 ARG B CG  1 
ATOM   3369 C  CD  . ARG B 1 245 ? -23.566 18.028  19.914  1.00 41.67  ? 572 ARG B CD  1 
ATOM   3370 N  NE  . ARG B 1 245 ? -24.278 16.858  19.421  1.00 42.74  ? 572 ARG B NE  1 
ATOM   3371 C  CZ  . ARG B 1 245 ? -25.154 16.148  20.121  1.00 45.22  ? 572 ARG B CZ  1 
ATOM   3372 N  NH1 . ARG B 1 245 ? -25.440 16.468  21.377  1.00 47.05  ? 572 ARG B NH1 1 
ATOM   3373 N  NH2 . ARG B 1 245 ? -25.738 15.101  19.556  1.00 46.34  ? 572 ARG B NH2 1 
ATOM   3374 N  N   . ILE B 1 246 ? -18.877 18.151  19.852  1.00 38.32  ? 573 ILE B N   1 
ATOM   3375 C  CA  . ILE B 1 246 ? -17.880 17.080  19.710  1.00 38.41  ? 573 ILE B CA  1 
ATOM   3376 C  C   . ILE B 1 246 ? -17.373 16.586  21.090  1.00 40.25  ? 573 ILE B C   1 
ATOM   3377 O  O   . ILE B 1 246 ? -17.280 15.368  21.313  1.00 40.90  ? 573 ILE B O   1 
ATOM   3378 C  CB  . ILE B 1 246 ? -16.703 17.506  18.785  1.00 37.24  ? 573 ILE B CB  1 
ATOM   3379 C  CG1 . ILE B 1 246 ? -17.215 17.829  17.357  1.00 35.95  ? 573 ILE B CG1 1 
ATOM   3380 C  CG2 . ILE B 1 246 ? -15.623 16.419  18.746  1.00 37.85  ? 573 ILE B CG2 1 
ATOM   3381 C  CD1 . ILE B 1 246 ? -16.290 18.697  16.515  1.00 34.17  ? 573 ILE B CD1 1 
ATOM   3382 N  N   . PHE B 1 247 ? -17.092 17.528  22.006  1.00 40.41  ? 574 PHE B N   1 
ATOM   3383 C  CA  . PHE B 1 247 ? -16.740 17.206  23.400  1.00 42.88  ? 574 PHE B CA  1 
ATOM   3384 C  C   . PHE B 1 247 ? -17.825 16.349  24.059  1.00 45.04  ? 574 PHE B C   1 
ATOM   3385 O  O   . PHE B 1 247 ? -17.507 15.325  24.665  1.00 46.65  ? 574 PHE B O   1 
ATOM   3386 C  CB  . PHE B 1 247 ? -16.444 18.473  24.249  1.00 42.71  ? 574 PHE B CB  1 
ATOM   3387 C  CG  . PHE B 1 247 ? -16.274 18.202  25.733  1.00 44.54  ? 574 PHE B CG  1 
ATOM   3388 C  CD1 . PHE B 1 247 ? -15.010 17.922  26.268  1.00 45.22  ? 574 PHE B CD1 1 
ATOM   3389 C  CD2 . PHE B 1 247 ? -17.372 18.233  26.599  1.00 46.13  ? 574 PHE B CD2 1 
ATOM   3390 C  CE1 . PHE B 1 247 ? -14.853 17.682  27.626  1.00 47.37  ? 574 PHE B CE1 1 
ATOM   3391 C  CE2 . PHE B 1 247 ? -17.224 17.981  27.958  1.00 48.38  ? 574 PHE B CE2 1 
ATOM   3392 C  CZ  . PHE B 1 247 ? -15.962 17.710  28.472  1.00 49.14  ? 574 PHE B CZ  1 
ATOM   3393 N  N   . TYR B 1 248 ? -19.085 16.768  23.949  1.00 45.53  ? 575 TYR B N   1 
ATOM   3394 C  CA  . TYR B 1 248 ? -20.187 15.987  24.508  1.00 48.47  ? 575 TYR B CA  1 
ATOM   3395 C  C   . TYR B 1 248 ? -20.204 14.558  23.948  1.00 48.57  ? 575 TYR B C   1 
ATOM   3396 O  O   . TYR B 1 248 ? -20.221 13.590  24.721  1.00 50.97  ? 575 TYR B O   1 
ATOM   3397 C  CB  . TYR B 1 248 ? -21.539 16.670  24.275  1.00 49.52  ? 575 TYR B CB  1 
ATOM   3398 C  CG  . TYR B 1 248 ? -22.712 15.931  24.882  1.00 52.92  ? 575 TYR B CG  1 
ATOM   3399 C  CD1 . TYR B 1 248 ? -23.078 16.145  26.207  1.00 56.25  ? 575 TYR B CD1 1 
ATOM   3400 C  CD2 . TYR B 1 248 ? -23.464 15.012  24.126  1.00 53.67  ? 575 TYR B CD2 1 
ATOM   3401 C  CE1 . TYR B 1 248 ? -24.157 15.469  26.771  1.00 59.66  ? 575 TYR B CE1 1 
ATOM   3402 C  CE2 . TYR B 1 248 ? -24.541 14.324  24.684  1.00 56.52  ? 575 TYR B CE2 1 
ATOM   3403 C  CZ  . TYR B 1 248 ? -24.878 14.558  26.004  1.00 59.56  ? 575 TYR B CZ  1 
ATOM   3404 O  OH  . TYR B 1 248 ? -25.935 13.898  26.577  1.00 63.17  ? 575 TYR B OH  1 
ATOM   3405 N  N   . LEU B 1 249 ? -20.181 14.446  22.619  1.00 46.15  ? 576 LEU B N   1 
ATOM   3406 C  CA  . LEU B 1 249 ? -20.284 13.161  21.915  1.00 46.51  ? 576 LEU B CA  1 
ATOM   3407 C  C   . LEU B 1 249 ? -19.152 12.220  22.270  1.00 47.64  ? 576 LEU B C   1 
ATOM   3408 O  O   . LEU B 1 249 ? -19.389 11.047  22.546  1.00 49.54  ? 576 LEU B O   1 
ATOM   3409 C  CB  . LEU B 1 249 ? -20.327 13.369  20.397  1.00 43.60  ? 576 LEU B CB  1 
ATOM   3410 C  CG  . LEU B 1 249 ? -21.564 14.022  19.782  1.00 42.79  ? 576 LEU B CG  1 
ATOM   3411 C  CD1 . LEU B 1 249 ? -21.314 14.326  18.311  1.00 40.31  ? 576 LEU B CD1 1 
ATOM   3412 C  CD2 . LEU B 1 249 ? -22.811 13.154  19.956  1.00 44.86  ? 576 LEU B CD2 1 
ATOM   3413 N  N   . LYS B 1 250 ? -17.933 12.763  22.295  1.00 47.76  ? 577 LYS B N   1 
ATOM   3414 C  CA  . LYS B 1 250 ? -16.713 12.010  22.609  1.00 49.74  ? 577 LYS B CA  1 
ATOM   3415 C  C   . LYS B 1 250 ? -16.730 11.512  24.055  1.00 52.74  ? 577 LYS B C   1 
ATOM   3416 O  O   . LYS B 1 250 ? -16.165 10.463  24.354  1.00 54.03  ? 577 LYS B O   1 
ATOM   3417 C  CB  . LYS B 1 250 ? -15.463 12.862  22.312  1.00 48.59  ? 577 LYS B CB  1 
ATOM   3418 C  CG  . LYS B 1 250 ? -14.183 12.073  22.058  1.00 49.55  ? 577 LYS B CG  1 
ATOM   3419 C  CD  . LYS B 1 250 ? -13.028 12.994  21.698  1.00 48.06  ? 577 LYS B CD  1 
ATOM   3420 C  CE  . LYS B 1 250 ? -11.744 12.580  22.421  1.00 50.28  ? 577 LYS B CE  1 
ATOM   3421 N  NZ  . LYS B 1 250 ? -11.069 11.308  22.004  1.00 50.94  ? 577 LYS B NZ  1 
ATOM   3422 N  N   . LEU B 1 251 ? -17.410 12.258  24.925  1.00 54.67  ? 578 LEU B N   1 
ATOM   3423 C  CA  . LEU B 1 251 ? -17.556 11.927  26.346  1.00 59.58  ? 578 LEU B CA  1 
ATOM   3424 C  C   . LEU B 1 251 ? -18.571 10.808  26.525  1.00 62.86  ? 578 LEU B C   1 
ATOM   3425 O  O   . LEU B 1 251 ? -18.308 9.820   27.215  1.00 63.17  ? 578 LEU B O   1 
ATOM   3426 C  CB  . LEU B 1 251 ? -17.976 13.182  27.108  1.00 59.82  ? 578 LEU B CB  1 
ATOM   3427 C  CG  . LEU B 1 251 ? -18.303 13.260  28.582  1.00 62.69  ? 578 LEU B CG  1 
ATOM   3428 C  CD1 . LEU B 1 251 ? -17.097 12.929  29.439  1.00 64.66  ? 578 LEU B CD1 1 
ATOM   3429 C  CD2 . LEU B 1 251 ? -18.742 14.696  28.809  1.00 62.70  ? 578 LEU B CD2 1 
ATOM   3430 N  N   . GLU B 1 252 ? -19.711 10.982  25.853  1.00 65.18  ? 579 GLU B N   1 
ATOM   3431 C  CA  . GLU B 1 252 ? -20.802 9.999   25.760  1.00 69.54  ? 579 GLU B CA  1 
ATOM   3432 C  C   . GLU B 1 252 ? -20.327 8.652   25.189  1.00 70.77  ? 579 GLU B C   1 
ATOM   3433 O  O   . GLU B 1 252 ? -20.777 7.602   25.639  1.00 73.72  ? 579 GLU B O   1 
ATOM   3434 C  CB  . GLU B 1 252 ? -21.933 10.595  24.910  1.00 68.58  ? 579 GLU B CB  1 
ATOM   3435 C  CG  . GLU B 1 252 ? -23.179 9.743   24.717  1.00 71.76  ? 579 GLU B CG  1 
ATOM   3436 C  CD  . GLU B 1 252 ? -24.091 10.305  23.628  1.00 71.81  ? 579 GLU B CD  1 
ATOM   3437 O  OE1 . GLU B 1 252 ? -25.210 10.748  23.960  1.00 74.23  ? 579 GLU B OE1 1 
ATOM   3438 O  OE2 . GLU B 1 252 ? -23.690 10.330  22.437  1.00 69.35  ? 579 GLU B OE2 1 
ATOM   3439 N  N   . ASP B 1 253 ? -19.426 8.707   24.204  1.00 69.63  ? 580 ASP B N   1 
ATOM   3440 C  CA  . ASP B 1 253 ? -18.776 7.527   23.616  1.00 71.63  ? 580 ASP B CA  1 
ATOM   3441 C  C   . ASP B 1 253 ? -19.762 6.488   23.058  1.00 73.25  ? 580 ASP B C   1 
ATOM   3442 O  O   . ASP B 1 253 ? -19.642 5.287   23.330  1.00 75.04  ? 580 ASP B O   1 
ATOM   3443 C  CB  . ASP B 1 253 ? -17.779 6.894   24.609  1.00 75.37  ? 580 ASP B CB  1 
ATOM   3444 C  CG  . ASP B 1 253 ? -16.703 6.047   23.918  1.00 77.26  ? 580 ASP B CG  1 
ATOM   3445 O  OD1 . ASP B 1 253 ? -16.335 6.344   22.751  1.00 76.33  ? 580 ASP B OD1 1 
ATOM   3446 O  OD2 . ASP B 1 253 ? -16.221 5.081   24.555  1.00 80.18  ? 580 ASP B OD2 1 
ATOM   3447 N  N   . LEU B 1 254 ? -20.742 6.975   22.291  1.00 72.01  ? 581 LEU B N   1 
ATOM   3448 C  CA  . LEU B 1 254 ? -21.690 6.120   21.568  1.00 73.59  ? 581 LEU B CA  1 
ATOM   3449 C  C   . LEU B 1 254 ? -21.183 5.884   20.139  1.00 72.09  ? 581 LEU B C   1 
ATOM   3450 O  O   . LEU B 1 254 ? -21.066 4.739   19.699  1.00 74.48  ? 581 LEU B O   1 
ATOM   3451 C  CB  . LEU B 1 254 ? -23.108 6.720   21.586  1.00 73.36  ? 581 LEU B CB  1 
ATOM   3452 C  CG  . LEU B 1 254 ? -24.315 5.853   21.188  1.00 76.16  ? 581 LEU B CG  1 
ATOM   3453 C  CD1 . LEU B 1 254 ? -24.545 4.678   22.143  1.00 80.26  ? 581 LEU B CD1 1 
ATOM   3454 C  CD2 . LEU B 1 254 ? -25.566 6.718   21.111  1.00 75.93  ? 581 LEU B CD2 1 
ATOM   3455 N  N   . VAL B 1 255 ? -20.891 6.967   19.422  1.00 68.08  ? 582 VAL B N   1 
ATOM   3456 C  CA  . VAL B 1 255 ? -20.108 6.882   18.195  1.00 65.72  ? 582 VAL B CA  1 
ATOM   3457 C  C   . VAL B 1 255 ? -18.823 7.678   18.423  1.00 63.60  ? 582 VAL B C   1 
ATOM   3458 O  O   . VAL B 1 255 ? -18.883 8.902   18.648  1.00 61.46  ? 582 VAL B O   1 
ATOM   3459 C  CB  . VAL B 1 255 ? -20.857 7.404   16.942  1.00 63.50  ? 582 VAL B CB  1 
ATOM   3460 C  CG1 . VAL B 1 255 ? -20.027 7.178   15.683  1.00 61.55  ? 582 VAL B CG1 1 
ATOM   3461 C  CG2 . VAL B 1 255 ? -22.224 6.746   16.802  1.00 65.29  ? 582 VAL B CG2 1 
ATOM   3462 N  N   . PRO B 1 256 ? -17.660 6.987   18.383  1.00 64.29  ? 583 PRO B N   1 
ATOM   3463 C  CA  . PRO B 1 256 ? -16.376 7.679   18.452  1.00 62.29  ? 583 PRO B CA  1 
ATOM   3464 C  C   . PRO B 1 256 ? -16.175 8.541   17.202  1.00 59.37  ? 583 PRO B C   1 
ATOM   3465 O  O   . PRO B 1 256 ? -16.646 8.164   16.118  1.00 59.34  ? 583 PRO B O   1 
ATOM   3466 C  CB  . PRO B 1 256 ? -15.355 6.532   18.491  1.00 65.36  ? 583 PRO B CB  1 
ATOM   3467 C  CG  . PRO B 1 256 ? -16.129 5.317   18.897  1.00 67.71  ? 583 PRO B CG  1 
ATOM   3468 C  CD  . PRO B 1 256 ? -17.474 5.527   18.271  1.00 67.30  ? 583 PRO B CD  1 
ATOM   3469 N  N   . PRO B 1 257 ? -15.504 9.703   17.343  1.00 56.94  ? 584 PRO B N   1 
ATOM   3470 C  CA  . PRO B 1 257 ? -15.281 10.536  16.151  1.00 54.15  ? 584 PRO B CA  1 
ATOM   3471 C  C   . PRO B 1 257 ? -14.275 9.888   15.193  1.00 53.37  ? 584 PRO B C   1 
ATOM   3472 O  O   . PRO B 1 257 ? -13.382 9.190   15.654  1.00 55.02  ? 584 PRO B O   1 
ATOM   3473 C  CB  . PRO B 1 257 ? -14.708 11.837  16.728  1.00 52.75  ? 584 PRO B CB  1 
ATOM   3474 C  CG  . PRO B 1 257 ? -14.080 11.440  18.024  1.00 55.01  ? 584 PRO B CG  1 
ATOM   3475 C  CD  . PRO B 1 257 ? -14.880 10.278  18.552  1.00 57.06  ? 584 PRO B CD  1 
ATOM   3476 N  N   . PRO B 1 258 ? -14.421 10.104  13.871  1.00 51.73  ? 585 PRO B N   1 
ATOM   3477 C  CA  . PRO B 1 258 ? -13.366 9.615   12.974  1.00 51.97  ? 585 PRO B CA  1 
ATOM   3478 C  C   . PRO B 1 258 ? -12.021 10.290  13.239  1.00 50.80  ? 585 PRO B C   1 
ATOM   3479 O  O   . PRO B 1 258 ? -11.977 11.452  13.679  1.00 48.81  ? 585 PRO B O   1 
ATOM   3480 C  CB  . PRO B 1 258 ? -13.872 9.983   11.574  1.00 50.11  ? 585 PRO B CB  1 
ATOM   3481 C  CG  . PRO B 1 258 ? -14.945 10.974  11.784  1.00 48.59  ? 585 PRO B CG  1 
ATOM   3482 C  CD  . PRO B 1 258 ? -15.543 10.695  13.126  1.00 49.48  ? 585 PRO B CD  1 
ATOM   3483 N  N   . ALA B 1 259 ? -10.957 9.539   12.948  1.00 51.53  ? 586 ALA B N   1 
ATOM   3484 C  CA  . ALA B 1 259 ? -9.555  9.928   13.117  1.00 50.83  ? 586 ALA B CA  1 
ATOM   3485 C  C   . ALA B 1 259 ? -9.262  11.412  12.894  1.00 48.53  ? 586 ALA B C   1 
ATOM   3486 O  O   . ALA B 1 259 ? -8.595  12.037  13.724  1.00 47.13  ? 586 ALA B O   1 
ATOM   3487 C  CB  . ALA B 1 259 ? -8.665  9.068   12.223  1.00 52.26  ? 586 ALA B CB  1 
ATOM   3488 N  N   . ILE B 1 260 ? -9.774  11.967  11.792  1.00 47.36  ? 587 ILE B N   1 
ATOM   3489 C  CA  . ILE B 1 260 ? -9.489  13.359  11.429  1.00 46.93  ? 587 ILE B CA  1 
ATOM   3490 C  C   . ILE B 1 260 ? -10.157 14.400  12.339  1.00 44.62  ? 587 ILE B C   1 
ATOM   3491 O  O   . ILE B 1 260 ? -9.555  15.436  12.607  1.00 43.79  ? 587 ILE B O   1 
ATOM   3492 C  CB  . ILE B 1 260 ? -9.760  13.681  9.941   1.00 47.11  ? 587 ILE B CB  1 
ATOM   3493 C  CG1 . ILE B 1 260 ? -11.246 13.521  9.602   1.00 47.59  ? 587 ILE B CG1 1 
ATOM   3494 C  CG2 . ILE B 1 260 ? -8.859  12.838  9.044   1.00 50.45  ? 587 ILE B CG2 1 
ATOM   3495 C  CD1 . ILE B 1 260 ? -11.646 14.191  8.305   1.00 48.94  ? 587 ILE B CD1 1 
ATOM   3496 N  N   . ILE B 1 261 ? -11.381 14.119  12.799  1.00 43.80  ? 588 ILE B N   1 
ATOM   3497 C  CA  . ILE B 1 261 ? -12.071 14.972  13.780  1.00 42.58  ? 588 ILE B CA  1 
ATOM   3498 C  C   . ILE B 1 261 ? -11.423 14.852  15.164  1.00 42.54  ? 588 ILE B C   1 
ATOM   3499 O  O   . ILE B 1 261 ? -11.148 15.859  15.799  1.00 41.34  ? 588 ILE B O   1 
ATOM   3500 C  CB  . ILE B 1 261 ? -13.592 14.705  13.830  1.00 42.50  ? 588 ILE B CB  1 
ATOM   3501 C  CG1 . ILE B 1 261 ? -14.232 15.169  12.523  1.00 41.64  ? 588 ILE B CG1 1 
ATOM   3502 C  CG2 . ILE B 1 261 ? -14.251 15.414  15.016  1.00 41.47  ? 588 ILE B CG2 1 
ATOM   3503 C  CD1 . ILE B 1 261 ? -15.613 14.592  12.304  1.00 44.04  ? 588 ILE B CD1 1 
ATOM   3504 N  N   . ASP B 1 262 ? -11.158 13.624  15.590  1.00 44.10  ? 589 ASP B N   1 
ATOM   3505 C  CA  . ASP B 1 262 ? -10.463 13.344  16.838  1.00 46.20  ? 589 ASP B CA  1 
ATOM   3506 C  C   . ASP B 1 262 ? -9.134  14.109  16.907  1.00 46.63  ? 589 ASP B C   1 
ATOM   3507 O  O   . ASP B 1 262 ? -8.881  14.795  17.896  1.00 45.93  ? 589 ASP B O   1 
ATOM   3508 C  CB  . ASP B 1 262 ? -10.244 11.838  16.981  1.00 48.38  ? 589 ASP B CB  1 
ATOM   3509 C  CG  . ASP B 1 262 ? -10.267 11.369  18.418  1.00 50.72  ? 589 ASP B CG  1 
ATOM   3510 O  OD1 . ASP B 1 262 ? -10.979 11.973  19.251  1.00 50.84  ? 589 ASP B OD1 1 
ATOM   3511 O  OD2 . ASP B 1 262 ? -9.578  10.367  18.717  1.00 52.89  ? 589 ASP B OD2 1 
ATOM   3512 N  N   . LYS B 1 263 ? -8.341  14.044  15.828  1.00 47.69  ? 590 LYS B N   1 
ATOM   3513 C  CA  . LYS B 1 263 ? -7.023  14.707  15.750  1.00 49.20  ? 590 LYS B CA  1 
ATOM   3514 C  C   . LYS B 1 263 ? -7.139  16.227  15.809  1.00 46.79  ? 590 LYS B C   1 
ATOM   3515 O  O   . LYS B 1 263 ? -6.449  16.862  16.608  1.00 47.88  ? 590 LYS B O   1 
ATOM   3516 C  CB  . LYS B 1 263 ? -6.226  14.279  14.497  1.00 51.72  ? 590 LYS B CB  1 
ATOM   3517 C  CG  . LYS B 1 263 ? -4.816  14.846  14.435  1.00 54.49  ? 590 LYS B CG  1 
ATOM   3518 C  CD  . LYS B 1 263 ? -4.126  14.553  13.114  1.00 57.46  ? 590 LYS B CD  1 
ATOM   3519 C  CE  . LYS B 1 263 ? -2.624  14.784  13.233  1.00 60.46  ? 590 LYS B CE  1 
ATOM   3520 N  NZ  . LYS B 1 263 ? -1.864  14.232  12.067  1.00 63.82  ? 590 LYS B NZ  1 
ATOM   3521 N  N   . LEU B 1 264 ? -8.001  16.792  14.964  1.00 43.88  ? 591 LEU B N   1 
ATOM   3522 C  CA  . LEU B 1 264 ? -8.225  18.243  14.925  1.00 42.01  ? 591 LEU B CA  1 
ATOM   3523 C  C   . LEU B 1 264 ? -8.789  18.751  16.246  1.00 40.51  ? 591 LEU B C   1 
ATOM   3524 O  O   . LEU B 1 264 ? -8.313  19.766  16.765  1.00 40.48  ? 591 LEU B O   1 
ATOM   3525 C  CB  . LEU B 1 264 ? -9.111  18.674  13.733  1.00 40.47  ? 591 LEU B CB  1 
ATOM   3526 C  CG  . LEU B 1 264 ? -8.519  18.627  12.313  1.00 42.35  ? 591 LEU B CG  1 
ATOM   3527 C  CD1 . LEU B 1 264 ? -9.348  19.458  11.334  1.00 41.43  ? 591 LEU B CD1 1 
ATOM   3528 C  CD2 . LEU B 1 264 ? -7.051  19.058  12.256  1.00 43.19  ? 591 LEU B CD2 1 
ATOM   3529 N  N   . PHE B 1 265 ? -9.770  18.024  16.784  1.00 38.93  ? 592 PHE B N   1 
ATOM   3530 C  CA  . PHE B 1 265 ? -10.358 18.326  18.090  1.00 38.55  ? 592 PHE B CA  1 
ATOM   3531 C  C   . PHE B 1 265 ? -9.292  18.344  19.201  1.00 39.45  ? 592 PHE B C   1 
ATOM   3532 O  O   . PHE B 1 265 ? -9.149  19.354  19.887  1.00 39.11  ? 592 PHE B O   1 
ATOM   3533 C  CB  . PHE B 1 265 ? -11.497 17.349  18.419  1.00 38.42  ? 592 PHE B CB  1 
ATOM   3534 C  CG  . PHE B 1 265 ? -12.123 17.580  19.758  1.00 39.27  ? 592 PHE B CG  1 
ATOM   3535 C  CD1 . PHE B 1 265 ? -13.088 18.591  19.936  1.00 38.51  ? 592 PHE B CD1 1 
ATOM   3536 C  CD2 . PHE B 1 265 ? -11.755 16.792  20.857  1.00 40.72  ? 592 PHE B CD2 1 
ATOM   3537 C  CE1 . PHE B 1 265 ? -13.662 18.807  21.189  1.00 39.76  ? 592 PHE B CE1 1 
ATOM   3538 C  CE2 . PHE B 1 265 ? -12.329 17.009  22.106  1.00 41.87  ? 592 PHE B CE2 1 
ATOM   3539 C  CZ  . PHE B 1 265 ? -13.281 18.014  22.271  1.00 41.05  ? 592 PHE B CZ  1 
ATOM   3540 N  N   . LEU B 1 266 ? -8.543  17.246  19.332  1.00 39.87  ? 593 LEU B N   1 
ATOM   3541 C  CA  . LEU B 1 266 ? -7.580  17.077  20.411  1.00 42.14  ? 593 LEU B CA  1 
ATOM   3542 C  C   . LEU B 1 266 ? -6.406  18.050  20.346  1.00 43.65  ? 593 LEU B C   1 
ATOM   3543 O  O   . LEU B 1 266 ? -5.977  18.569  21.392  1.00 44.40  ? 593 LEU B O   1 
ATOM   3544 C  CB  . LEU B 1 266 ? -7.088  15.630  20.492  1.00 42.94  ? 593 LEU B CB  1 
ATOM   3545 C  CG  . LEU B 1 266 ? -8.018  14.559  21.093  1.00 43.80  ? 593 LEU B CG  1 
ATOM   3546 C  CD1 . LEU B 1 266 ? -7.380  13.176  21.010  1.00 44.98  ? 593 LEU B CD1 1 
ATOM   3547 C  CD2 . LEU B 1 266 ? -8.432  14.854  22.541  1.00 44.90  ? 593 LEU B CD2 1 
ATOM   3548 N  N   . ASP B 1 267 ? -5.918  18.309  19.125  1.00 43.79  ? 594 ASP B N   1 
ATOM   3549 C  CA  . ASP B 1 267 ? -4.780  19.207  18.883  1.00 44.79  ? 594 ASP B CA  1 
ATOM   3550 C  C   . ASP B 1 267 ? -5.121  20.685  19.072  1.00 45.00  ? 594 ASP B C   1 
ATOM   3551 O  O   . ASP B 1 267 ? -4.251  21.471  19.458  1.00 46.48  ? 594 ASP B O   1 
ATOM   3552 C  CB  . ASP B 1 267 ? -4.202  19.008  17.469  1.00 44.46  ? 594 ASP B CB  1 
ATOM   3553 C  CG  . ASP B 1 267 ? -3.392  17.707  17.313  1.00 46.04  ? 594 ASP B CG  1 
ATOM   3554 O  OD1 . ASP B 1 267 ? -3.107  17.018  18.314  1.00 47.15  ? 594 ASP B OD1 1 
ATOM   3555 O  OD2 . ASP B 1 267 ? -3.036  17.371  16.159  1.00 46.39  ? 594 ASP B OD2 1 
ATOM   3556 N  N   . THR B 1 268 ? -6.372  21.053  18.792  1.00 44.06  ? 595 THR B N   1 
ATOM   3557 C  CA  . THR B 1 268 ? -6.847  22.443  18.854  1.00 44.34  ? 595 THR B CA  1 
ATOM   3558 C  C   . THR B 1 268 ? -7.104  22.933  20.292  1.00 44.80  ? 595 THR B C   1 
ATOM   3559 O  O   . THR B 1 268 ? -7.099  24.143  20.559  1.00 46.03  ? 595 THR B O   1 
ATOM   3560 C  CB  . THR B 1 268 ? -8.106  22.608  17.963  1.00 44.52  ? 595 THR B CB  1 
ATOM   3561 O  OG1 . THR B 1 268 ? -7.704  22.471  16.591  1.00 47.02  ? 595 THR B OG1 1 
ATOM   3562 C  CG2 . THR B 1 268 ? -8.798  23.961  18.139  1.00 44.45  ? 595 THR B CG2 1 
ATOM   3563 N  N   . LEU B 1 269 ? -7.319  22.004  21.212  1.00 43.62  ? 596 LEU B N   1 
ATOM   3564 C  CA  . LEU B 1 269 ? -7.675  22.389  22.565  1.00 43.99  ? 596 LEU B CA  1 
ATOM   3565 C  C   . LEU B 1 269 ? -6.485  23.018  23.307  1.00 45.24  ? 596 LEU B C   1 
ATOM   3566 O  O   . LEU B 1 269 ? -5.397  22.427  23.375  1.00 45.43  ? 596 LEU B O   1 
ATOM   3567 C  CB  . LEU B 1 269 ? -8.247  21.210  23.345  1.00 44.82  ? 596 LEU B CB  1 
ATOM   3568 C  CG  . LEU B 1 269 ? -9.510  20.503  22.860  1.00 43.82  ? 596 LEU B CG  1 
ATOM   3569 C  CD1 . LEU B 1 269 ? -9.766  19.293  23.760  1.00 45.51  ? 596 LEU B CD1 1 
ATOM   3570 C  CD2 . LEU B 1 269 ? -10.713 21.437  22.805  1.00 43.08  ? 596 LEU B CD2 1 
ATOM   3571 N  N   . PRO B 1 270 ? -6.689  24.231  23.860  1.00 45.28  ? 597 PRO B N   1 
ATOM   3572 C  CA  . PRO B 1 270 ? -5.590  24.878  24.564  1.00 46.33  ? 597 PRO B CA  1 
ATOM   3573 C  C   . PRO B 1 270 ? -5.344  24.310  25.969  1.00 47.78  ? 597 PRO B C   1 
ATOM   3574 O  O   . PRO B 1 270 ? -4.420  24.744  26.644  1.00 49.94  ? 597 PRO B O   1 
ATOM   3575 C  CB  . PRO B 1 270 ? -6.005  26.354  24.586  1.00 46.86  ? 597 PRO B CB  1 
ATOM   3576 C  CG  . PRO B 1 270 ? -7.488  26.340  24.506  1.00 46.02  ? 597 PRO B CG  1 
ATOM   3577 C  CD  . PRO B 1 270 ? -7.889  25.090  23.774  1.00 44.38  ? 597 PRO B CD  1 
ATOM   3578 N  N   . PHE B 1 271 ? -6.140  23.330  26.384  1.00 46.66  ? 598 PHE B N   1 
ATOM   3579 C  CA  . PHE B 1 271 ? -5.896  22.591  27.642  1.00 48.60  ? 598 PHE B CA  1 
ATOM   3580 C  C   . PHE B 1 271 ? -5.997  21.088  27.363  1.00 47.55  ? 598 PHE B C   1 
ATOM   3581 O  O   . PHE B 1 271 ? -5.659  20.236  28.175  1.00 48.84  ? 598 PHE B O   1 
ATOM   3582 C  CB  . PHE B 1 271 ? -6.883  23.026  28.760  1.00 49.46  ? 598 PHE B CB  1 
ATOM   3583 C  CG  . PHE B 1 271 ? -8.329  23.066  28.313  1.00 47.81  ? 598 PHE B CG  1 
ATOM   3584 C  CD1 . PHE B 1 271 ? -9.135  21.913  28.380  1.00 46.86  ? 598 PHE B CD1 1 
ATOM   3585 C  CD2 . PHE B 1 271 ? -8.886  24.248  27.794  1.00 46.62  ? 598 PHE B CD2 1 
ATOM   3586 C  CE1 . PHE B 1 271 ? -10.453 21.945  27.957  1.00 45.56  ? 598 PHE B CE1 1 
ATOM   3587 C  CE2 . PHE B 1 271 ? -10.215 24.281  27.375  1.00 45.30  ? 598 PHE B CE2 1 
ATOM   3588 C  CZ  . PHE B 1 271 ? -10.997 23.128  27.456  1.00 44.90  ? 598 PHE B CZ  1 
ATOM   3589 O  OXT . PHE B 1 271 ? -6.445  20.695  26.284  1.00 45.78  ? 598 PHE B OXT 1 
ATOM   3590 N  N   . PRO C 1 33  ? -23.417 -1.274  4.191   1.00 87.38  ? 360 PRO C N   1 
ATOM   3591 C  CA  . PRO C 1 33  ? -22.521 -0.431  3.406   1.00 87.28  ? 360 PRO C CA  1 
ATOM   3592 C  C   . PRO C 1 33  ? -22.344 -0.984  1.975   1.00 84.51  ? 360 PRO C C   1 
ATOM   3593 O  O   . PRO C 1 33  ? -22.161 -2.200  1.813   1.00 82.29  ? 360 PRO C O   1 
ATOM   3594 C  CB  . PRO C 1 33  ? -21.213 -0.493  4.195   1.00 88.08  ? 360 PRO C CB  1 
ATOM   3595 C  CG  . PRO C 1 33  ? -21.616 -0.824  5.603   1.00 90.54  ? 360 PRO C CG  1 
ATOM   3596 C  CD  . PRO C 1 33  ? -23.047 -1.296  5.615   1.00 90.01  ? 360 PRO C CD  1 
ATOM   3597 N  N   . PRO C 1 34  ? -22.391 -0.103  0.941   1.00 84.77  ? 361 PRO C N   1 
ATOM   3598 C  CA  . PRO C 1 34  ? -22.577 -0.583  -0.446  1.00 81.52  ? 361 PRO C CA  1 
ATOM   3599 C  C   . PRO C 1 34  ? -21.328 -1.185  -1.118  1.00 78.29  ? 361 PRO C C   1 
ATOM   3600 O  O   . PRO C 1 34  ? -20.215 -0.670  -0.948  1.00 79.72  ? 361 PRO C O   1 
ATOM   3601 C  CB  . PRO C 1 34  ? -23.044 0.679   -1.191  1.00 83.66  ? 361 PRO C CB  1 
ATOM   3602 C  CG  . PRO C 1 34  ? -22.449 1.824   -0.427  1.00 86.65  ? 361 PRO C CG  1 
ATOM   3603 C  CD  . PRO C 1 34  ? -22.158 1.359   0.984   1.00 87.70  ? 361 PRO C CD  1 
ATOM   3604 N  N   . VAL C 1 35  ? -21.533 -2.267  -1.866  1.00 73.94  ? 362 VAL C N   1 
ATOM   3605 C  CA  . VAL C 1 35  ? -20.499 -2.852  -2.726  1.00 71.24  ? 362 VAL C CA  1 
ATOM   3606 C  C   . VAL C 1 35  ? -20.256 -1.917  -3.920  1.00 70.34  ? 362 VAL C C   1 
ATOM   3607 O  O   . VAL C 1 35  ? -21.209 -1.345  -4.461  1.00 71.32  ? 362 VAL C O   1 
ATOM   3608 C  CB  . VAL C 1 35  ? -20.888 -4.262  -3.287  1.00 69.32  ? 362 VAL C CB  1 
ATOM   3609 C  CG1 . VAL C 1 35  ? -19.649 -5.149  -3.416  1.00 68.41  ? 362 VAL C CG1 1 
ATOM   3610 C  CG2 . VAL C 1 35  ? -21.951 -4.965  -2.435  1.00 69.40  ? 362 VAL C CG2 1 
ATOM   3611 N  N   . SER C 1 36  ? -18.992 -1.764  -4.323  1.00 68.07  ? 363 SER C N   1 
ATOM   3612 C  CA  . SER C 1 36  ? -18.619 -1.033  -5.544  1.00 66.70  ? 363 SER C CA  1 
ATOM   3613 C  C   . SER C 1 36  ? -19.148 -1.756  -6.797  1.00 63.84  ? 363 SER C C   1 
ATOM   3614 O  O   . SER C 1 36  ? -19.351 -2.976  -6.761  1.00 62.65  ? 363 SER C O   1 
ATOM   3615 C  CB  . SER C 1 36  ? -17.100 -0.899  -5.584  1.00 67.17  ? 363 SER C CB  1 
ATOM   3616 O  OG  . SER C 1 36  ? -16.621 -0.581  -6.866  1.00 66.90  ? 363 SER C OG  1 
ATOM   3617 N  N   . LEU C 1 37  ? -19.380 -1.029  -7.893  1.00 63.04  ? 364 LEU C N   1 
ATOM   3618 C  CA  . LEU C 1 37  ? -19.924 -1.655  -9.122  1.00 59.76  ? 364 LEU C CA  1 
ATOM   3619 C  C   . LEU C 1 37  ? -18.930 -2.585  -9.840  1.00 57.45  ? 364 LEU C C   1 
ATOM   3620 O  O   . LEU C 1 37  ? -19.318 -3.668  -10.331 1.00 54.92  ? 364 LEU C O   1 
ATOM   3621 C  CB  . LEU C 1 37  ? -20.536 -0.623  -10.091 1.00 61.13  ? 364 LEU C CB  1 
ATOM   3622 C  CG  . LEU C 1 37  ? -20.939 -0.967  -11.542 1.00 59.60  ? 364 LEU C CG  1 
ATOM   3623 C  CD1 . LEU C 1 37  ? -21.950 -2.101  -11.664 1.00 56.91  ? 364 LEU C CD1 1 
ATOM   3624 C  CD2 . LEU C 1 37  ? -21.467 0.275   -12.249 1.00 62.50  ? 364 LEU C CD2 1 
ATOM   3625 N  N   . ILE C 1 38  ? -17.666 -2.167  -9.905  1.00 57.62  ? 365 ILE C N   1 
ATOM   3626 C  CA  . ILE C 1 38  ? -16.602 -3.037  -10.417 1.00 55.59  ? 365 ILE C CA  1 
ATOM   3627 C  C   . ILE C 1 38  ? -16.424 -4.277  -9.512  1.00 53.63  ? 365 ILE C C   1 
ATOM   3628 O  O   . ILE C 1 38  ? -16.267 -5.401  -10.001 1.00 51.64  ? 365 ILE C O   1 
ATOM   3629 C  CB  . ILE C 1 38  ? -15.280 -2.262  -10.680 1.00 58.05  ? 365 ILE C CB  1 
ATOM   3630 C  CG1 . ILE C 1 38  ? -14.289 -3.146  -11.458 1.00 57.67  ? 365 ILE C CG1 1 
ATOM   3631 C  CG2 . ILE C 1 38  ? -14.682 -1.693  -9.395  1.00 59.61  ? 365 ILE C CG2 1 
ATOM   3632 C  CD1 . ILE C 1 38  ? -13.348 -2.398  -12.383 1.00 60.28  ? 365 ILE C CD1 1 
ATOM   3633 N  N   . SER C 1 39  ? -16.503 -4.065  -8.201  1.00 54.35  ? 366 SER C N   1 
ATOM   3634 C  CA  . SER C 1 39  ? -16.432 -5.146  -7.226  1.00 53.09  ? 366 SER C CA  1 
ATOM   3635 C  C   . SER C 1 39  ? -17.586 -6.135  -7.363  1.00 50.58  ? 366 SER C C   1 
ATOM   3636 O  O   . SER C 1 39  ? -17.418 -7.328  -7.106  1.00 50.05  ? 366 SER C O   1 
ATOM   3637 C  CB  . SER C 1 39  ? -16.379 -4.574  -5.817  1.00 55.04  ? 366 SER C CB  1 
ATOM   3638 O  OG  . SER C 1 39  ? -15.085 -4.065  -5.547  1.00 57.69  ? 366 SER C OG  1 
ATOM   3639 N  N   . ALA C 1 40  ? -18.747 -5.639  -7.781  1.00 49.77  ? 367 ALA C N   1 
ATOM   3640 C  CA  . ALA C 1 40  ? -19.908 -6.495  -8.041  1.00 47.32  ? 367 ALA C CA  1 
ATOM   3641 C  C   . ALA C 1 40  ? -19.718 -7.318  -9.310  1.00 44.95  ? 367 ALA C C   1 
ATOM   3642 O  O   . ALA C 1 40  ? -20.126 -8.481  -9.357  1.00 43.59  ? 367 ALA C O   1 
ATOM   3643 C  CB  . ALA C 1 40  ? -21.174 -5.668  -8.125  1.00 47.91  ? 367 ALA C CB  1 
ATOM   3644 N  N   . LEU C 1 41  ? -19.090 -6.713  -10.321 1.00 44.64  ? 368 LEU C N   1 
ATOM   3645 C  CA  . LEU C 1 41  ? -18.784 -7.393  -11.582 1.00 42.83  ? 368 LEU C CA  1 
ATOM   3646 C  C   . LEU C 1 41  ? -17.683 -8.450  -11.418 1.00 42.11  ? 368 LEU C C   1 
ATOM   3647 O  O   . LEU C 1 41  ? -17.747 -9.523  -12.031 1.00 40.56  ? 368 LEU C O   1 
ATOM   3648 C  CB  . LEU C 1 41  ? -18.449 -6.387  -12.696 1.00 43.81  ? 368 LEU C CB  1 
ATOM   3649 C  CG  . LEU C 1 41  ? -19.537 -5.410  -13.194 1.00 44.43  ? 368 LEU C CG  1 
ATOM   3650 C  CD1 . LEU C 1 41  ? -18.955 -4.448  -14.223 1.00 45.69  ? 368 LEU C CD1 1 
ATOM   3651 C  CD2 . LEU C 1 41  ? -20.771 -6.112  -13.760 1.00 42.53  ? 368 LEU C CD2 1 
ATOM   3652 N  N   . VAL C 1 42  ? -16.697 -8.161  -10.575 1.00 43.22  ? 369 VAL C N   1 
ATOM   3653 C  CA  . VAL C 1 42  ? -15.726 -9.185  -10.175 1.00 43.38  ? 369 VAL C CA  1 
ATOM   3654 C  C   . VAL C 1 42  ? -16.441 -10.359 -9.486  1.00 42.35  ? 369 VAL C C   1 
ATOM   3655 O  O   . VAL C 1 42  ? -16.232 -11.518 -9.857  1.00 41.26  ? 369 VAL C O   1 
ATOM   3656 C  CB  . VAL C 1 42  ? -14.574 -8.614  -9.311  1.00 45.29  ? 369 VAL C CB  1 
ATOM   3657 C  CG1 . VAL C 1 42  ? -13.661 -9.723  -8.808  1.00 45.05  ? 369 VAL C CG1 1 
ATOM   3658 C  CG2 . VAL C 1 42  ? -13.770 -7.620  -10.125 1.00 46.72  ? 369 VAL C CG2 1 
ATOM   3659 N  N   . ARG C 1 43  ? -17.311 -10.044 -8.527  1.00 42.91  ? 370 ARG C N   1 
ATOM   3660 C  CA  . ARG C 1 43  ? -18.048 -11.064 -7.776  1.00 42.47  ? 370 ARG C CA  1 
ATOM   3661 C  C   . ARG C 1 43  ? -18.915 -11.948 -8.695  1.00 40.54  ? 370 ARG C C   1 
ATOM   3662 O  O   . ARG C 1 43  ? -18.949 -13.164 -8.518  1.00 40.04  ? 370 ARG C O   1 
ATOM   3663 C  CB  . ARG C 1 43  ? -18.834 -10.402 -6.624  1.00 44.30  ? 370 ARG C CB  1 
ATOM   3664 C  CG  . ARG C 1 43  ? -19.997 -11.185 -6.015  1.00 44.98  ? 370 ARG C CG  1 
ATOM   3665 C  CD  . ARG C 1 43  ? -19.577 -12.367 -5.164  1.00 45.88  ? 370 ARG C CD  1 
ATOM   3666 N  NE  . ARG C 1 43  ? -18.862 -11.961 -3.965  1.00 49.31  ? 370 ARG C NE  1 
ATOM   3667 C  CZ  . ARG C 1 43  ? -18.143 -12.774 -3.185  1.00 50.40  ? 370 ARG C CZ  1 
ATOM   3668 N  NH1 . ARG C 1 43  ? -18.029 -14.071 -3.462  1.00 49.69  ? 370 ARG C NH1 1 
ATOM   3669 N  NH2 . ARG C 1 43  ? -17.526 -12.274 -2.124  1.00 51.74  ? 370 ARG C NH2 1 
ATOM   3670 N  N   . ALA C 1 44  ? -19.581 -11.331 -9.679  1.00 39.54  ? 371 ALA C N   1 
ATOM   3671 C  CA  . ALA C 1 44  ? -20.381 -12.035 -10.694 1.00 37.57  ? 371 ALA C CA  1 
ATOM   3672 C  C   . ALA C 1 44  ? -19.539 -13.010 -11.520 1.00 36.65  ? 371 ALA C C   1 
ATOM   3673 O  O   . ALA C 1 44  ? -19.923 -14.165 -11.713 1.00 36.00  ? 371 ALA C O   1 
ATOM   3674 C  CB  . ALA C 1 44  ? -21.115 -11.040 -11.600 1.00 37.10  ? 371 ALA C CB  1 
ATOM   3675 N  N   . HIS C 1 45  ? -18.388 -12.544 -11.988 1.00 37.70  ? 372 HIS C N   1 
ATOM   3676 C  CA  . HIS C 1 45  ? -17.435 -13.388 -12.699 1.00 37.94  ? 372 HIS C CA  1 
ATOM   3677 C  C   . HIS C 1 45  ? -16.870 -14.550 -11.829 1.00 38.60  ? 372 HIS C C   1 
ATOM   3678 O  O   . HIS C 1 45  ? -16.894 -15.719 -12.242 1.00 38.52  ? 372 HIS C O   1 
ATOM   3679 C  CB  . HIS C 1 45  ? -16.316 -12.513 -13.268 1.00 39.79  ? 372 HIS C CB  1 
ATOM   3680 C  CG  . HIS C 1 45  ? -15.231 -13.287 -13.939 1.00 40.49  ? 372 HIS C CG  1 
ATOM   3681 N  ND1 . HIS C 1 45  ? -14.035 -13.578 -13.317 1.00 41.76  ? 372 HIS C ND1 1 
ATOM   3682 C  CD2 . HIS C 1 45  ? -15.172 -13.861 -15.163 1.00 40.11  ? 372 HIS C CD2 1 
ATOM   3683 C  CE1 . HIS C 1 45  ? -13.277 -14.284 -14.136 1.00 42.20  ? 372 HIS C CE1 1 
ATOM   3684 N  NE2 . HIS C 1 45  ? -13.946 -14.480 -15.257 1.00 41.45  ? 372 HIS C NE2 1 
ATOM   3685 N  N   . VAL C 1 46  ? -16.392 -14.240 -10.631 1.00 39.12  ? 373 VAL C N   1 
ATOM   3686 C  CA  . VAL C 1 46  ? -15.808 -15.268 -9.778  1.00 40.72  ? 373 VAL C CA  1 
ATOM   3687 C  C   . VAL C 1 46  ? -16.810 -16.373 -9.407  1.00 40.73  ? 373 VAL C C   1 
ATOM   3688 O  O   . VAL C 1 46  ? -16.480 -17.555 -9.517  1.00 41.36  ? 373 VAL C O   1 
ATOM   3689 C  CB  . VAL C 1 46  ? -15.118 -14.679 -8.527  1.00 42.11  ? 373 VAL C CB  1 
ATOM   3690 C  CG1 . VAL C 1 46  ? -14.692 -15.780 -7.569  1.00 42.53  ? 373 VAL C CG1 1 
ATOM   3691 C  CG2 . VAL C 1 46  ? -13.916 -13.840 -8.940  1.00 42.69  ? 373 VAL C CG2 1 
ATOM   3692 N  N   . ASP C 1 47  ? -18.028 -15.990 -9.022  1.00 40.54  ? 374 ASP C N   1 
ATOM   3693 C  CA  . ASP C 1 47  ? -19.068 -16.950 -8.637  1.00 40.44  ? 374 ASP C CA  1 
ATOM   3694 C  C   . ASP C 1 47  ? -19.670 -17.727 -9.797  1.00 39.07  ? 374 ASP C C   1 
ATOM   3695 O  O   . ASP C 1 47  ? -20.460 -18.655 -9.577  1.00 39.05  ? 374 ASP C O   1 
ATOM   3696 C  CB  . ASP C 1 47  ? -20.197 -16.261 -7.871  1.00 41.18  ? 374 ASP C CB  1 
ATOM   3697 C  CG  . ASP C 1 47  ? -19.750 -15.694 -6.541  1.00 43.72  ? 374 ASP C CG  1 
ATOM   3698 O  OD1 . ASP C 1 47  ? -18.593 -15.905 -6.098  1.00 43.44  ? 374 ASP C OD1 1 
ATOM   3699 O  OD2 . ASP C 1 47  ? -20.602 -15.014 -5.935  1.00 46.17  ? 374 ASP C OD2 1 
ATOM   3700 N  N   . SER C 1 48  ? -19.319 -17.356 -11.020 1.00 37.75  ? 375 SER C N   1 
ATOM   3701 C  CA  . SER C 1 48  ? -19.831 -18.086 -12.172 1.00 37.50  ? 375 SER C CA  1 
ATOM   3702 C  C   . SER C 1 48  ? -18.732 -18.796 -12.967 1.00 38.60  ? 375 SER C C   1 
ATOM   3703 O  O   . SER C 1 48  ? -18.954 -19.171 -14.115 1.00 39.34  ? 375 SER C O   1 
ATOM   3704 C  CB  . SER C 1 48  ? -20.653 -17.174 -13.079 1.00 35.30  ? 375 SER C CB  1 
ATOM   3705 O  OG  . SER C 1 48  ? -19.844 -16.144 -13.596 1.00 35.13  ? 375 SER C OG  1 
ATOM   3706 N  N   . ASN C 1 49  ? -17.561 -18.985 -12.366 1.00 39.73  ? 376 ASN C N   1 
ATOM   3707 C  CA  . ASN C 1 49  ? -16.464 -19.642 -13.077 1.00 41.05  ? 376 ASN C CA  1 
ATOM   3708 C  C   . ASN C 1 49  ? -15.933 -20.868 -12.351 1.00 42.15  ? 376 ASN C C   1 
ATOM   3709 O  O   . ASN C 1 49  ? -16.047 -20.947 -11.138 1.00 41.65  ? 376 ASN C O   1 
ATOM   3710 C  CB  . ASN C 1 49  ? -15.359 -18.639 -13.422 1.00 42.31  ? 376 ASN C CB  1 
ATOM   3711 C  CG  . ASN C 1 49  ? -15.652 -17.906 -14.712 1.00 42.21  ? 376 ASN C CG  1 
ATOM   3712 O  OD1 . ASN C 1 49  ? -15.418 -18.426 -15.802 1.00 42.89  ? 376 ASN C OD1 1 
ATOM   3713 N  ND2 . ASN C 1 49  ? -16.202 -16.708 -14.600 1.00 42.27  ? 376 ASN C ND2 1 
ATOM   3714 N  N   . PRO C 1 50  ? -15.386 -21.853 -13.102 1.00 43.62  ? 377 PRO C N   1 
ATOM   3715 C  CA  . PRO C 1 50  ? -14.878 -23.059 -12.430 1.00 46.06  ? 377 PRO C CA  1 
ATOM   3716 C  C   . PRO C 1 50  ? -13.598 -22.794 -11.623 1.00 48.95  ? 377 PRO C C   1 
ATOM   3717 O  O   . PRO C 1 50  ? -12.909 -21.794 -11.849 1.00 47.71  ? 377 PRO C O   1 
ATOM   3718 C  CB  . PRO C 1 50  ? -14.604 -24.018 -13.595 1.00 45.76  ? 377 PRO C CB  1 
ATOM   3719 C  CG  . PRO C 1 50  ? -14.305 -23.119 -14.738 1.00 43.94  ? 377 PRO C CG  1 
ATOM   3720 C  CD  . PRO C 1 50  ? -15.221 -21.941 -14.566 1.00 41.72  ? 377 PRO C CD  1 
ATOM   3721 N  N   . ALA C 1 51  ? -13.318 -23.692 -10.679 1.00 53.81  ? 378 ALA C N   1 
ATOM   3722 C  CA  . ALA C 1 51  ? -12.139 -23.629 -9.814  1.00 59.03  ? 378 ALA C CA  1 
ATOM   3723 C  C   . ALA C 1 51  ? -10.877 -23.984 -10.599 1.00 62.52  ? 378 ALA C C   1 
ATOM   3724 O  O   . ALA C 1 51  ? -10.735 -25.124 -11.054 1.00 63.75  ? 378 ALA C O   1 
ATOM   3725 C  CB  . ALA C 1 51  ? -12.321 -24.586 -8.644  1.00 61.40  ? 378 ALA C CB  1 
ATOM   3726 N  N   . MET C 1 52  ? -9.964  -23.019 -10.736 1.00 66.04  ? 379 MET C N   1 
ATOM   3727 C  CA  . MET C 1 52  ? -8.817  -23.136 -11.662 1.00 70.79  ? 379 MET C CA  1 
ATOM   3728 C  C   . MET C 1 52  ? -7.687  -24.114 -11.294 1.00 76.61  ? 379 MET C C   1 
ATOM   3729 O  O   . MET C 1 52  ? -6.799  -24.376 -12.126 1.00 79.47  ? 379 MET C O   1 
ATOM   3730 C  CB  . MET C 1 52  ? -8.241  -21.755 -12.020 1.00 71.63  ? 379 MET C CB  1 
ATOM   3731 C  CG  . MET C 1 52  ? -9.045  -20.959 -13.042 1.00 71.23  ? 379 MET C CG  1 
ATOM   3732 S  SD  . MET C 1 52  ? -9.050  -21.662 -14.713 1.00 72.15  ? 379 MET C SD  1 
ATOM   3733 C  CE  . MET C 1 52  ? -10.530 -22.653 -14.650 1.00 68.72  ? 379 MET C CE  1 
ATOM   3734 N  N   . THR C 1 53  ? -7.704  -24.650 -10.074 1.00 78.85  ? 380 THR C N   1 
ATOM   3735 C  CA  . THR C 1 53  ? -6.702  -25.662 -9.688  1.00 83.89  ? 380 THR C CA  1 
ATOM   3736 C  C   . THR C 1 53  ? -7.317  -27.053 -9.449  1.00 85.91  ? 380 THR C C   1 
ATOM   3737 O  O   . THR C 1 53  ? -6.593  -28.061 -9.360  1.00 89.08  ? 380 THR C O   1 
ATOM   3738 C  CB  . THR C 1 53  ? -5.806  -25.216 -8.502  1.00 86.11  ? 380 THR C CB  1 
ATOM   3739 O  OG1 . THR C 1 53  ? -6.600  -25.010 -7.326  1.00 84.90  ? 380 THR C OG1 1 
ATOM   3740 C  CG2 . THR C 1 53  ? -5.028  -23.935 -8.845  1.00 85.94  ? 380 THR C CG2 1 
ATOM   3741 N  N   . SER C 1 54  ? -8.650  -27.092 -9.363  1.00 83.21  ? 381 SER C N   1 
ATOM   3742 C  CA  . SER C 1 54  ? -9.412  -28.338 -9.245  1.00 83.64  ? 381 SER C CA  1 
ATOM   3743 C  C   . SER C 1 54  ? -10.293 -28.510 -10.487 1.00 80.63  ? 381 SER C C   1 
ATOM   3744 O  O   . SER C 1 54  ? -11.501 -28.245 -10.454 1.00 80.44  ? 381 SER C O   1 
ATOM   3745 C  CB  . SER C 1 54  ? -10.235 -28.334 -7.948  1.00 83.55  ? 381 SER C CB  1 
ATOM   3746 O  OG  . SER C 1 54  ? -11.263 -29.305 -7.982  1.00 83.14  ? 381 SER C OG  1 
ATOM   3747 N  N   . LEU C 1 55  ? -9.666  -28.932 -11.586 1.00 80.14  ? 382 LEU C N   1 
ATOM   3748 C  CA  . LEU C 1 55  ? -10.324 -29.014 -12.904 1.00 76.00  ? 382 LEU C CA  1 
ATOM   3749 C  C   . LEU C 1 55  ? -10.564 -30.450 -13.334 1.00 76.42  ? 382 LEU C C   1 
ATOM   3750 O  O   . LEU C 1 55  ? -9.867  -31.370 -12.874 1.00 79.40  ? 382 LEU C O   1 
ATOM   3751 C  CB  . LEU C 1 55  ? -9.496  -28.289 -13.981 1.00 75.73  ? 382 LEU C CB  1 
ATOM   3752 C  CG  . LEU C 1 55  ? -9.434  -26.756 -13.964 1.00 73.88  ? 382 LEU C CG  1 
ATOM   3753 C  CD1 . LEU C 1 55  ? -8.352  -26.229 -14.893 1.00 74.93  ? 382 LEU C CD1 1 
ATOM   3754 C  CD2 . LEU C 1 55  ? -10.778 -26.163 -14.334 1.00 69.79  ? 382 LEU C CD2 1 
ATOM   3755 N  N   . ASP C 1 56  ? -11.545 -30.638 -14.219 1.00 72.67  ? 383 ASP C N   1 
ATOM   3756 C  CA  . ASP C 1 56  ? -11.849 -31.968 -14.743 1.00 73.11  ? 383 ASP C CA  1 
ATOM   3757 C  C   . ASP C 1 56  ? -11.020 -32.312 -15.987 1.00 74.19  ? 383 ASP C C   1 
ATOM   3758 O  O   . ASP C 1 56  ? -11.290 -31.828 -17.095 1.00 72.61  ? 383 ASP C O   1 
ATOM   3759 C  CB  . ASP C 1 56  ? -13.351 -32.154 -14.981 1.00 69.90  ? 383 ASP C CB  1 
ATOM   3760 C  CG  . ASP C 1 56  ? -13.727 -33.609 -15.234 1.00 71.91  ? 383 ASP C CG  1 
ATOM   3761 O  OD1 . ASP C 1 56  ? -12.930 -34.516 -14.916 1.00 75.66  ? 383 ASP C OD1 1 
ATOM   3762 O  OD2 . ASP C 1 56  ? -14.832 -33.854 -15.753 1.00 70.36  ? 383 ASP C OD2 1 
ATOM   3763 N  N   . TYR C 1 57  ? -10.010 -33.156 -15.770 1.00 77.60  ? 384 TYR C N   1 
ATOM   3764 C  CA  . TYR C 1 57  ? -9.094  -33.607 -16.815 1.00 79.84  ? 384 TYR C CA  1 
ATOM   3765 C  C   . TYR C 1 57  ? -9.465  -34.988 -17.350 1.00 80.94  ? 384 TYR C C   1 
ATOM   3766 O  O   . TYR C 1 57  ? -8.752  -35.536 -18.199 1.00 82.52  ? 384 TYR C O   1 
ATOM   3767 C  CB  . TYR C 1 57  ? -7.645  -33.613 -16.289 1.00 84.55  ? 384 TYR C CB  1 
ATOM   3768 C  CG  . TYR C 1 57  ? -6.951  -32.273 -16.444 1.00 84.81  ? 384 TYR C CG  1 
ATOM   3769 C  CD1 . TYR C 1 57  ? -6.382  -31.896 -17.678 1.00 85.69  ? 384 TYR C CD1 1 
ATOM   3770 C  CD2 . TYR C 1 57  ? -6.868  -31.374 -15.365 1.00 84.49  ? 384 TYR C CD2 1 
ATOM   3771 C  CE1 . TYR C 1 57  ? -5.736  -30.666 -17.836 1.00 86.46  ? 384 TYR C CE1 1 
ATOM   3772 C  CE2 . TYR C 1 57  ? -6.230  -30.136 -15.509 1.00 84.86  ? 384 TYR C CE2 1 
ATOM   3773 C  CZ  . TYR C 1 57  ? -5.666  -29.790 -16.744 1.00 86.29  ? 384 TYR C CZ  1 
ATOM   3774 O  OH  . TYR C 1 57  ? -4.984  -28.578 -16.899 1.00 87.67  ? 384 TYR C OH  1 
ATOM   3775 N  N   . SER C 1 58  ? -10.591 -35.526 -16.865 1.00 79.56  ? 385 SER C N   1 
ATOM   3776 C  CA  . SER C 1 58  ? -11.009 -36.917 -17.130 1.00 81.70  ? 385 SER C CA  1 
ATOM   3777 C  C   . SER C 1 58  ? -11.288 -37.248 -18.605 1.00 80.96  ? 385 SER C C   1 
ATOM   3778 O  O   . SER C 1 58  ? -11.224 -38.417 -19.005 1.00 84.51  ? 385 SER C O   1 
ATOM   3779 C  CB  . SER C 1 58  ? -12.218 -37.298 -16.264 1.00 80.77  ? 385 SER C CB  1 
ATOM   3780 O  OG  . SER C 1 58  ? -13.366 -36.538 -16.605 1.00 76.79  ? 385 SER C OG  1 
ATOM   3781 N  N   . ARG C 1 59  ? -11.595 -36.219 -19.393 1.00 76.71  ? 386 ARG C N   1 
ATOM   3782 C  CA  . ARG C 1 59  ? -11.872 -36.358 -20.816 1.00 75.65  ? 386 ARG C CA  1 
ATOM   3783 C  C   . ARG C 1 59  ? -10.679 -35.938 -21.677 1.00 76.04  ? 386 ARG C C   1 
ATOM   3784 O  O   . ARG C 1 59  ? -10.629 -36.267 -22.868 1.00 76.59  ? 386 ARG C O   1 
ATOM   3785 C  CB  . ARG C 1 59  ? -13.119 -35.546 -21.199 1.00 72.48  ? 386 ARG C CB  1 
ATOM   3786 C  CG  . ARG C 1 59  ? -14.441 -36.219 -20.848 1.00 72.77  ? 386 ARG C CG  1 
ATOM   3787 C  CD  . ARG C 1 59  ? -15.555 -35.745 -21.774 1.00 70.48  ? 386 ARG C CD  1 
ATOM   3788 N  NE  . ARG C 1 59  ? -16.413 -34.730 -21.162 1.00 67.01  ? 386 ARG C NE  1 
ATOM   3789 C  CZ  . ARG C 1 59  ? -17.151 -33.848 -21.835 1.00 64.82  ? 386 ARG C CZ  1 
ATOM   3790 N  NH1 . ARG C 1 59  ? -17.138 -33.813 -23.167 1.00 64.91  ? 386 ARG C NH1 1 
ATOM   3791 N  NH2 . ARG C 1 59  ? -17.899 -32.980 -21.165 1.00 62.97  ? 386 ARG C NH2 1 
ATOM   3792 N  N   . PHE C 1 60  ? -9.728  -35.228 -21.065 1.00 75.77  ? 387 PHE C N   1 
ATOM   3793 C  CA  . PHE C 1 60  ? -8.566  -34.659 -21.766 1.00 77.00  ? 387 PHE C CA  1 
ATOM   3794 C  C   . PHE C 1 60  ? -7.626  -35.702 -22.372 1.00 81.61  ? 387 PHE C C   1 
ATOM   3795 O  O   . PHE C 1 60  ? -6.982  -36.476 -21.656 1.00 83.81  ? 387 PHE C O   1 
ATOM   3796 C  CB  . PHE C 1 60  ? -7.784  -33.694 -20.860 1.00 76.28  ? 387 PHE C CB  1 
ATOM   3797 C  CG  . PHE C 1 60  ? -6.715  -32.913 -21.581 1.00 77.18  ? 387 PHE C CG  1 
ATOM   3798 C  CD1 . PHE C 1 60  ? -7.042  -31.778 -22.335 1.00 73.85  ? 387 PHE C CD1 1 
ATOM   3799 C  CD2 . PHE C 1 60  ? -5.373  -33.310 -21.508 1.00 81.36  ? 387 PHE C CD2 1 
ATOM   3800 C  CE1 . PHE C 1 60  ? -6.056  -31.056 -23.000 1.00 74.98  ? 387 PHE C CE1 1 
ATOM   3801 C  CE2 . PHE C 1 60  ? -4.387  -32.588 -22.175 1.00 82.80  ? 387 PHE C CE2 1 
ATOM   3802 C  CZ  . PHE C 1 60  ? -4.732  -31.460 -22.922 1.00 79.68  ? 387 PHE C CZ  1 
ATOM   3803 N  N   . GLN C 1 61  ? -7.574  -35.686 -23.703 1.00 82.93  ? 388 GLN C N   1 
ATOM   3804 C  CA  . GLN C 1 61  ? -6.662  -36.505 -24.496 1.00 88.38  ? 388 GLN C CA  1 
ATOM   3805 C  C   . GLN C 1 61  ? -5.716  -35.613 -25.314 1.00 89.68  ? 388 GLN C C   1 
ATOM   3806 O  O   . GLN C 1 61  ? -6.158  -34.820 -26.154 1.00 87.60  ? 388 GLN C O   1 
ATOM   3807 C  CB  . GLN C 1 61  ? -7.443  -37.483 -25.396 1.00 88.91  ? 388 GLN C CB  1 
ATOM   3808 C  CG  . GLN C 1 61  ? -6.610  -38.623 -25.980 1.00 94.70  ? 388 GLN C CG  1 
ATOM   3809 C  CD  . GLN C 1 61  ? -5.644  -39.238 -24.973 1.00 99.35  ? 388 GLN C CD  1 
ATOM   3810 O  OE1 . GLN C 1 61  ? -4.427  -39.089 -25.096 1.00 102.94 ? 388 GLN C OE1 1 
ATOM   3811 N  NE2 . GLN C 1 61  ? -6.184  -39.909 -23.958 1.00 99.67  ? 388 GLN C NE2 1 
ATOM   3812 N  N   . ALA C 1 62  ? -4.417  -35.748 -25.044 1.00 94.40  ? 389 ALA C N   1 
ATOM   3813 C  CA  . ALA C 1 62  ? -3.369  -34.933 -25.672 1.00 96.00  ? 389 ALA C CA  1 
ATOM   3814 C  C   . ALA C 1 62  ? -3.113  -35.276 -27.153 1.00 97.90  ? 389 ALA C C   1 
ATOM   3815 O  O   . ALA C 1 62  ? -3.109  -34.381 -28.005 1.00 96.30  ? 389 ALA C O   1 
ATOM   3816 C  CB  . ALA C 1 62  ? -2.076  -35.015 -24.857 1.00 99.72  ? 389 ALA C CB  1 
ATOM   3817 N  N   . ASN C 1 63  ? -2.940  -36.572 -27.439 1.00 101.06 ? 390 ASN C N   1 
ATOM   3818 C  CA  . ASN C 1 63  ? -2.449  -37.082 -28.737 1.00 104.56 ? 390 ASN C CA  1 
ATOM   3819 C  C   . ASN C 1 63  ? -1.052  -36.554 -29.087 1.00 108.20 ? 390 ASN C C   1 
ATOM   3820 O  O   . ASN C 1 63  ? -0.448  -36.963 -30.079 1.00 111.56 ? 390 ASN C O   1 
ATOM   3821 C  CB  . ASN C 1 63  ? -3.445  -36.827 -29.879 1.00 101.16 ? 390 ASN C CB  1 
ATOM   3822 C  CG  . ASN C 1 63  ? -4.145  -38.087 -30.330 1.00 101.86 ? 390 ASN C CG  1 
ATOM   3823 O  OD1 . ASN C 1 63  ? -5.028  -38.603 -29.643 1.00 99.60  ? 390 ASN C OD1 1 
ATOM   3824 N  ND2 . ASN C 1 63  ? -3.753  -38.586 -31.498 1.00 105.24 ? 390 ASN C ND2 1 
ATOM   3825 N  N   . ASP C 1 72  ? -18.541 -36.606 -36.674 1.00 70.75  ? 399 ASP C N   1 
ATOM   3826 C  CA  . ASP C 1 72  ? -19.260 -37.662 -35.905 1.00 70.73  ? 399 ASP C CA  1 
ATOM   3827 C  C   . ASP C 1 72  ? -20.324 -37.115 -34.952 1.00 66.54  ? 399 ASP C C   1 
ATOM   3828 O  O   . ASP C 1 72  ? -20.197 -36.006 -34.412 1.00 63.48  ? 399 ASP C O   1 
ATOM   3829 C  CB  . ASP C 1 72  ? -18.268 -38.512 -35.112 1.00 74.61  ? 399 ASP C CB  1 
ATOM   3830 C  CG  . ASP C 1 72  ? -18.514 -40.008 -35.263 1.00 78.98  ? 399 ASP C CG  1 
ATOM   3831 O  OD1 . ASP C 1 72  ? -18.264 -40.741 -34.276 1.00 80.94  ? 399 ASP C OD1 1 
ATOM   3832 O  OD2 . ASP C 1 72  ? -18.941 -40.454 -36.360 1.00 80.67  ? 399 ASP C OD2 1 
ATOM   3833 N  N   . THR C 1 73  ? -21.353 -37.939 -34.742 1.00 65.63  ? 400 THR C N   1 
ATOM   3834 C  CA  . THR C 1 73  ? -22.516 -37.649 -33.907 1.00 62.22  ? 400 THR C CA  1 
ATOM   3835 C  C   . THR C 1 73  ? -22.143 -37.237 -32.476 1.00 60.40  ? 400 THR C C   1 
ATOM   3836 O  O   . THR C 1 73  ? -22.626 -36.212 -31.982 1.00 57.22  ? 400 THR C O   1 
ATOM   3837 C  CB  . THR C 1 73  ? -23.479 -38.861 -33.921 1.00 64.04  ? 400 THR C CB  1 
ATOM   3838 O  OG1 . THR C 1 73  ? -23.945 -39.067 -35.258 1.00 65.20  ? 400 THR C OG1 1 
ATOM   3839 C  CG2 . THR C 1 73  ? -24.686 -38.668 -33.000 1.00 62.16  ? 400 THR C CG2 1 
ATOM   3840 N  N   . GLN C 1 74  ? -21.267 -38.024 -31.845 1.00 62.31  ? 401 GLN C N   1 
ATOM   3841 C  CA  . GLN C 1 74  ? -20.847 -37.817 -30.460 1.00 61.45  ? 401 GLN C CA  1 
ATOM   3842 C  C   . GLN C 1 74  ? -20.142 -36.492 -30.230 1.00 58.48  ? 401 GLN C C   1 
ATOM   3843 O  O   . GLN C 1 74  ? -20.341 -35.879 -29.187 1.00 57.59  ? 401 GLN C O   1 
ATOM   3844 C  CB  . GLN C 1 74  ? -19.986 -38.993 -29.963 1.00 66.18  ? 401 GLN C CB  1 
ATOM   3845 C  CG  . GLN C 1 74  ? -20.719 -40.028 -29.103 1.00 69.15  ? 401 GLN C CG  1 
ATOM   3846 C  CD  . GLN C 1 74  ? -22.091 -40.435 -29.641 1.00 70.38  ? 401 GLN C CD  1 
ATOM   3847 O  OE1 . GLN C 1 74  ? -23.128 -39.943 -29.171 1.00 69.22  ? 401 GLN C OE1 1 
ATOM   3848 N  NE2 . GLN C 1 74  ? -22.106 -41.325 -30.636 1.00 73.08  ? 401 GLN C NE2 1 
ATOM   3849 N  N   . HIS C 1 75  ? -19.343 -36.046 -31.201 1.00 57.78  ? 402 HIS C N   1 
ATOM   3850 C  CA  . HIS C 1 75  ? -18.635 -34.756 -31.115 1.00 55.13  ? 402 HIS C CA  1 
ATOM   3851 C  C   . HIS C 1 75  ? -19.563 -33.541 -31.216 1.00 50.88  ? 402 HIS C C   1 
ATOM   3852 O  O   . HIS C 1 75  ? -19.344 -32.532 -30.551 1.00 48.04  ? 402 HIS C O   1 
ATOM   3853 C  CB  . HIS C 1 75  ? -17.523 -34.671 -32.165 1.00 57.36  ? 402 HIS C CB  1 
ATOM   3854 C  CG  . HIS C 1 75  ? -16.293 -35.438 -31.796 1.00 60.74  ? 402 HIS C CG  1 
ATOM   3855 N  ND1 . HIS C 1 75  ? -16.002 -36.678 -32.322 1.00 63.91  ? 402 HIS C ND1 1 
ATOM   3856 C  CD2 . HIS C 1 75  ? -15.288 -35.149 -30.936 1.00 61.29  ? 402 HIS C CD2 1 
ATOM   3857 C  CE1 . HIS C 1 75  ? -14.866 -37.115 -31.808 1.00 66.53  ? 402 HIS C CE1 1 
ATOM   3858 N  NE2 . HIS C 1 75  ? -14.415 -36.207 -30.961 1.00 64.70  ? 402 HIS C NE2 1 
ATOM   3859 N  N   . ILE C 1 76  ? -20.586 -33.668 -32.061 1.00 50.24  ? 403 ILE C N   1 
ATOM   3860 C  CA  . ILE C 1 76  ? -21.605 -32.646 -32.290 1.00 47.86  ? 403 ILE C CA  1 
ATOM   3861 C  C   . ILE C 1 76  ? -22.549 -32.561 -31.073 1.00 46.51  ? 403 ILE C C   1 
ATOM   3862 O  O   . ILE C 1 76  ? -22.865 -31.466 -30.600 1.00 43.58  ? 403 ILE C O   1 
ATOM   3863 C  CB  . ILE C 1 76  ? -22.344 -32.913 -33.628 1.00 48.48  ? 403 ILE C CB  1 
ATOM   3864 C  CG1 . ILE C 1 76  ? -21.366 -32.735 -34.809 1.00 49.88  ? 403 ILE C CG1 1 
ATOM   3865 C  CG2 . ILE C 1 76  ? -23.553 -32.001 -33.794 1.00 46.10  ? 403 ILE C CG2 1 
ATOM   3866 C  CD1 . ILE C 1 76  ? -21.771 -33.428 -36.091 1.00 51.76  ? 403 ILE C CD1 1 
ATOM   3867 N  N   . GLN C 1 77  ? -22.953 -33.726 -30.563 1.00 48.55  ? 404 GLN C N   1 
ATOM   3868 C  CA  . GLN C 1 77  ? -23.696 -33.838 -29.309 1.00 48.48  ? 404 GLN C CA  1 
ATOM   3869 C  C   . GLN C 1 77  ? -22.956 -33.152 -28.164 1.00 47.44  ? 404 GLN C C   1 
ATOM   3870 O  O   . GLN C 1 77  ? -23.545 -32.338 -27.443 1.00 46.20  ? 404 GLN C O   1 
ATOM   3871 C  CB  . GLN C 1 77  ? -23.985 -35.310 -28.975 1.00 51.08  ? 404 GLN C CB  1 
ATOM   3872 C  CG  . GLN C 1 77  ? -24.940 -35.531 -27.801 1.00 52.39  ? 404 GLN C CG  1 
ATOM   3873 C  CD  . GLN C 1 77  ? -26.185 -34.652 -27.855 1.00 50.93  ? 404 GLN C CD  1 
ATOM   3874 O  OE1 . GLN C 1 77  ? -26.793 -34.475 -28.915 1.00 51.66  ? 404 GLN C OE1 1 
ATOM   3875 N  NE2 . GLN C 1 77  ? -26.560 -34.083 -26.711 1.00 49.63  ? 404 GLN C NE2 1 
ATOM   3876 N  N   . GLN C 1 78  ? -21.669 -33.463 -28.043 1.00 48.59  ? 405 GLN C N   1 
ATOM   3877 C  CA  . GLN C 1 78  ? -20.781 -32.913 -27.012 1.00 48.85  ? 405 GLN C CA  1 
ATOM   3878 C  C   . GLN C 1 78  ? -20.627 -31.395 -27.150 1.00 45.53  ? 405 GLN C C   1 
ATOM   3879 O  O   . GLN C 1 78  ? -20.599 -30.669 -26.145 1.00 44.59  ? 405 GLN C O   1 
ATOM   3880 C  CB  . GLN C 1 78  ? -19.417 -33.639 -27.076 1.00 52.96  ? 405 GLN C CB  1 
ATOM   3881 C  CG  . GLN C 1 78  ? -18.244 -32.956 -26.388 1.00 55.04  ? 405 GLN C CG  1 
ATOM   3882 C  CD  . GLN C 1 78  ? -16.913 -33.197 -27.093 1.00 59.26  ? 405 GLN C CD  1 
ATOM   3883 O  OE1 . GLN C 1 78  ? -16.095 -34.003 -26.621 1.00 62.59  ? 405 GLN C OE1 1 
ATOM   3884 N  NE2 . GLN C 1 78  ? -16.684 -32.495 -28.229 1.00 57.99  ? 405 GLN C NE2 1 
ATOM   3885 N  N   . PHE C 1 79  ? -20.522 -30.935 -28.398 1.00 43.85  ? 406 PHE C N   1 
ATOM   3886 C  CA  . PHE C 1 79  ? -20.483 -29.519 -28.731 1.00 41.18  ? 406 PHE C CA  1 
ATOM   3887 C  C   . PHE C 1 79  ? -21.748 -28.819 -28.226 1.00 38.69  ? 406 PHE C C   1 
ATOM   3888 O  O   . PHE C 1 79  ? -21.652 -27.802 -27.553 1.00 37.41  ? 406 PHE C O   1 
ATOM   3889 C  CB  . PHE C 1 79  ? -20.286 -29.351 -30.245 1.00 41.40  ? 406 PHE C CB  1 
ATOM   3890 C  CG  . PHE C 1 79  ? -20.572 -27.973 -30.765 1.00 39.71  ? 406 PHE C CG  1 
ATOM   3891 C  CD1 . PHE C 1 79  ? -19.762 -26.892 -30.428 1.00 39.24  ? 406 PHE C CD1 1 
ATOM   3892 C  CD2 . PHE C 1 79  ? -21.652 -27.761 -31.631 1.00 39.28  ? 406 PHE C CD2 1 
ATOM   3893 C  CE1 . PHE C 1 79  ? -20.026 -25.621 -30.929 1.00 38.73  ? 406 PHE C CE1 1 
ATOM   3894 C  CE2 . PHE C 1 79  ? -21.920 -26.492 -32.137 1.00 38.56  ? 406 PHE C CE2 1 
ATOM   3895 C  CZ  . PHE C 1 79  ? -21.100 -25.423 -31.786 1.00 38.57  ? 406 PHE C CZ  1 
ATOM   3896 N  N   . TYR C 1 80  ? -22.915 -29.384 -28.534 1.00 38.75  ? 407 TYR C N   1 
ATOM   3897 C  CA  . TYR C 1 80  ? -24.193 -28.897 -28.001 1.00 37.90  ? 407 TYR C CA  1 
ATOM   3898 C  C   . TYR C 1 80  ? -24.223 -28.827 -26.472 1.00 37.55  ? 407 TYR C C   1 
ATOM   3899 O  O   . TYR C 1 80  ? -24.653 -27.808 -25.928 1.00 36.16  ? 407 TYR C O   1 
ATOM   3900 C  CB  . TYR C 1 80  ? -25.389 -29.739 -28.482 1.00 37.82  ? 407 TYR C CB  1 
ATOM   3901 C  CG  . TYR C 1 80  ? -25.668 -29.697 -29.953 1.00 38.01  ? 407 TYR C CG  1 
ATOM   3902 C  CD1 . TYR C 1 80  ? -25.535 -28.514 -30.686 1.00 37.17  ? 407 TYR C CD1 1 
ATOM   3903 C  CD2 . TYR C 1 80  ? -26.099 -30.845 -30.621 1.00 39.94  ? 407 TYR C CD2 1 
ATOM   3904 C  CE1 . TYR C 1 80  ? -25.797 -28.486 -32.050 1.00 38.26  ? 407 TYR C CE1 1 
ATOM   3905 C  CE2 . TYR C 1 80  ? -26.364 -30.826 -31.989 1.00 40.59  ? 407 TYR C CE2 1 
ATOM   3906 C  CZ  . TYR C 1 80  ? -26.212 -29.644 -32.686 1.00 39.66  ? 407 TYR C CZ  1 
ATOM   3907 O  OH  . TYR C 1 80  ? -26.485 -29.624 -34.017 1.00 41.63  ? 407 TYR C OH  1 
ATOM   3908 N  N   . ASP C 1 81  ? -23.780 -29.906 -25.809 1.00 39.12  ? 408 ASP C N   1 
ATOM   3909 C  CA  . ASP C 1 81  ? -23.787 -30.022 -24.329 1.00 39.38  ? 408 ASP C CA  1 
ATOM   3910 C  C   . ASP C 1 81  ? -22.940 -28.949 -23.653 1.00 38.33  ? 408 ASP C C   1 
ATOM   3911 O  O   . ASP C 1 81  ? -23.363 -28.371 -22.648 1.00 37.08  ? 408 ASP C O   1 
ATOM   3912 C  CB  . ASP C 1 81  ? -23.343 -31.420 -23.850 1.00 41.61  ? 408 ASP C CB  1 
ATOM   3913 C  CG  . ASP C 1 81  ? -24.252 -32.549 -24.354 1.00 43.99  ? 408 ASP C CG  1 
ATOM   3914 O  OD1 . ASP C 1 81  ? -25.427 -32.297 -24.716 1.00 43.21  ? 408 ASP C OD1 1 
ATOM   3915 O  OD2 . ASP C 1 81  ? -23.779 -33.713 -24.400 1.00 46.91  ? 408 ASP C OD2 1 
ATOM   3916 N  N   . LEU C 1 82  ? -21.762 -28.672 -24.220 1.00 39.36  ? 409 LEU C N   1 
ATOM   3917 C  CA  . LEU C 1 82  ? -20.887 -27.597 -23.739 1.00 39.08  ? 409 LEU C CA  1 
ATOM   3918 C  C   . LEU C 1 82  ? -21.560 -26.243 -23.821 1.00 37.47  ? 409 LEU C C   1 
ATOM   3919 O  O   . LEU C 1 82  ? -21.417 -25.436 -22.905 1.00 38.07  ? 409 LEU C O   1 
ATOM   3920 C  CB  . LEU C 1 82  ? -19.549 -27.571 -24.482 1.00 40.90  ? 409 LEU C CB  1 
ATOM   3921 C  CG  . LEU C 1 82  ? -18.552 -28.677 -24.130 1.00 43.69  ? 409 LEU C CG  1 
ATOM   3922 C  CD1 . LEU C 1 82  ? -17.396 -28.739 -25.122 1.00 44.74  ? 409 LEU C CD1 1 
ATOM   3923 C  CD2 . LEU C 1 82  ? -18.048 -28.551 -22.693 1.00 43.72  ? 409 LEU C CD2 1 
ATOM   3924 N  N   . LEU C 1 83  ? -22.320 -26.014 -24.887 1.00 36.92  ? 410 LEU C N   1 
ATOM   3925 C  CA  . LEU C 1 83  ? -23.120 -24.792 -25.013 1.00 36.43  ? 410 LEU C CA  1 
ATOM   3926 C  C   . LEU C 1 83  ? -24.269 -24.755 -24.008 1.00 35.60  ? 410 LEU C C   1 
ATOM   3927 O  O   . LEU C 1 83  ? -24.394 -23.774 -23.264 1.00 35.77  ? 410 LEU C O   1 
ATOM   3928 C  CB  . LEU C 1 83  ? -23.652 -24.598 -26.451 1.00 36.51  ? 410 LEU C CB  1 
ATOM   3929 C  CG  . LEU C 1 83  ? -22.663 -24.420 -27.607 1.00 38.03  ? 410 LEU C CG  1 
ATOM   3930 C  CD1 . LEU C 1 83  ? -23.416 -24.434 -28.939 1.00 38.26  ? 410 LEU C CD1 1 
ATOM   3931 C  CD2 . LEU C 1 83  ? -21.837 -23.137 -27.467 1.00 37.66  ? 410 LEU C CD2 1 
ATOM   3932 N  N   . THR C 1 84  ? -25.100 -25.799 -23.985 1.00 36.20  ? 411 THR C N   1 
ATOM   3933 C  CA  . THR C 1 84  ? -26.276 -25.820 -23.086 1.00 37.39  ? 411 THR C CA  1 
ATOM   3934 C  C   . THR C 1 84  ? -25.876 -25.779 -21.620 1.00 38.37  ? 411 THR C C   1 
ATOM   3935 O  O   . THR C 1 84  ? -26.443 -24.999 -20.866 1.00 37.52  ? 411 THR C O   1 
ATOM   3936 C  CB  . THR C 1 84  ? -27.270 -26.981 -23.342 1.00 37.59  ? 411 THR C CB  1 
ATOM   3937 O  OG1 . THR C 1 84  ? -26.655 -28.245 -23.053 1.00 37.89  ? 411 THR C OG1 1 
ATOM   3938 C  CG2 . THR C 1 84  ? -27.772 -26.944 -24.786 1.00 36.87  ? 411 THR C CG2 1 
ATOM   3939 N  N   . GLY C 1 85  ? -24.856 -26.570 -21.253 1.00 40.96  ? 412 GLY C N   1 
ATOM   3940 C  CA  . GLY C 1 85  ? -24.318 -26.651 -19.872 1.00 41.43  ? 412 GLY C CA  1 
ATOM   3941 C  C   . GLY C 1 85  ? -23.808 -25.315 -19.370 1.00 40.69  ? 412 GLY C C   1 
ATOM   3942 O  O   . GLY C 1 85  ? -23.629 -25.100 -18.178 1.00 42.64  ? 412 GLY C O   1 
ATOM   3943 N  N   . SER C 1 86  ? -23.639 -24.393 -20.296 1.00 40.23  ? 413 SER C N   1 
ATOM   3944 C  CA  . SER C 1 86  ? -23.040 -23.117 -20.009 1.00 40.91  ? 413 SER C CA  1 
ATOM   3945 C  C   . SER C 1 86  ? -24.092 -22.011 -19.888 1.00 41.33  ? 413 SER C C   1 
ATOM   3946 O  O   . SER C 1 86  ? -23.817 -20.926 -19.388 1.00 41.86  ? 413 SER C O   1 
ATOM   3947 C  CB  . SER C 1 86  ? -22.025 -22.840 -21.109 1.00 40.39  ? 413 SER C CB  1 
ATOM   3948 O  OG  . SER C 1 86  ? -21.552 -21.532 -21.043 1.00 43.49  ? 413 SER C OG  1 
ATOM   3949 N  N   . MET C 1 87  ? -25.310 -22.306 -20.322 1.00 42.53  ? 414 MET C N   1 
ATOM   3950 C  CA  . MET C 1 87  ? -26.359 -21.301 -20.421 1.00 42.57  ? 414 MET C CA  1 
ATOM   3951 C  C   . MET C 1 87  ? -26.891 -20.810 -19.077 1.00 42.07  ? 414 MET C C   1 
ATOM   3952 O  O   . MET C 1 87  ? -27.011 -19.591 -18.892 1.00 41.78  ? 414 MET C O   1 
ATOM   3953 C  CB  . MET C 1 87  ? -27.494 -21.801 -21.299 1.00 43.96  ? 414 MET C CB  1 
ATOM   3954 C  CG  . MET C 1 87  ? -27.103 -21.947 -22.759 1.00 45.04  ? 414 MET C CG  1 
ATOM   3955 S  SD  . MET C 1 87  ? -28.435 -22.545 -23.816 1.00 46.80  ? 414 MET C SD  1 
ATOM   3956 C  CE  . MET C 1 87  ? -29.755 -21.544 -23.117 1.00 47.54  ? 414 MET C CE  1 
ATOM   3957 N  N   . GLU C 1 88  ? -27.201 -21.727 -18.153 1.00 41.24  ? 415 GLU C N   1 
ATOM   3958 C  CA  . GLU C 1 88  ? -27.661 -21.324 -16.809 1.00 42.68  ? 415 GLU C CA  1 
ATOM   3959 C  C   . GLU C 1 88  ? -26.589 -20.590 -16.001 1.00 41.01  ? 415 GLU C C   1 
ATOM   3960 O  O   . GLU C 1 88  ? -26.899 -19.625 -15.291 1.00 41.73  ? 415 GLU C O   1 
ATOM   3961 C  CB  . GLU C 1 88  ? -28.257 -22.490 -15.993 1.00 46.27  ? 415 GLU C CB  1 
ATOM   3962 C  CG  . GLU C 1 88  ? -29.643 -22.942 -16.469 1.00 51.27  ? 415 GLU C CG  1 
ATOM   3963 C  CD  . GLU C 1 88  ? -30.658 -21.797 -16.628 1.00 53.55  ? 415 GLU C CD  1 
ATOM   3964 O  OE1 . GLU C 1 88  ? -31.057 -21.215 -15.593 1.00 54.60  ? 415 GLU C OE1 1 
ATOM   3965 O  OE2 . GLU C 1 88  ? -31.047 -21.482 -17.792 1.00 55.04  ? 415 GLU C OE2 1 
ATOM   3966 N  N   . ILE C 1 89  ? -25.339 -21.022 -16.133 1.00 38.93  ? 416 ILE C N   1 
ATOM   3967 C  CA  . ILE C 1 89  ? -24.210 -20.336 -15.508 1.00 39.27  ? 416 ILE C CA  1 
ATOM   3968 C  C   . ILE C 1 89  ? -24.117 -18.853 -15.942 1.00 38.41  ? 416 ILE C C   1 
ATOM   3969 O  O   . ILE C 1 89  ? -24.055 -17.948 -15.085 1.00 39.34  ? 416 ILE C O   1 
ATOM   3970 C  CB  . ILE C 1 89  ? -22.886 -21.153 -15.676 1.00 39.45  ? 416 ILE C CB  1 
ATOM   3971 C  CG1 . ILE C 1 89  ? -22.897 -22.350 -14.706 1.00 40.48  ? 416 ILE C CG1 1 
ATOM   3972 C  CG2 . ILE C 1 89  ? -21.655 -20.294 -15.423 1.00 38.65  ? 416 ILE C CG2 1 
ATOM   3973 C  CD1 . ILE C 1 89  ? -22.009 -23.513 -15.098 1.00 41.91  ? 416 ILE C CD1 1 
ATOM   3974 N  N   . ILE C 1 90  ? -24.155 -18.610 -17.252 1.00 36.45  ? 417 ILE C N   1 
ATOM   3975 C  CA  . ILE C 1 90  ? -24.022 -17.254 -17.804 1.00 35.98  ? 417 ILE C CA  1 
ATOM   3976 C  C   . ILE C 1 90  ? -25.247 -16.437 -17.451 1.00 36.64  ? 417 ILE C C   1 
ATOM   3977 O  O   . ILE C 1 90  ? -25.119 -15.260 -17.109 1.00 37.34  ? 417 ILE C O   1 
ATOM   3978 C  CB  . ILE C 1 90  ? -23.729 -17.251 -19.341 1.00 34.95  ? 417 ILE C CB  1 
ATOM   3979 C  CG1 . ILE C 1 90  ? -22.353 -17.861 -19.589 1.00 34.79  ? 417 ILE C CG1 1 
ATOM   3980 C  CG2 . ILE C 1 90  ? -23.818 -15.846 -19.940 1.00 34.10  ? 417 ILE C CG2 1 
ATOM   3981 C  CD1 . ILE C 1 90  ? -22.093 -18.269 -21.030 1.00 35.47  ? 417 ILE C CD1 1 
ATOM   3982 N  N   . ARG C 1 91  ? -26.424 -17.059 -17.537 1.00 37.93  ? 418 ARG C N   1 
ATOM   3983 C  CA  . ARG C 1 91  ? -27.671 -16.416 -17.100 1.00 40.77  ? 418 ARG C CA  1 
ATOM   3984 C  C   . ARG C 1 91  ? -27.569 -15.983 -15.624 1.00 40.04  ? 418 ARG C C   1 
ATOM   3985 O  O   . ARG C 1 91  ? -27.916 -14.851 -15.298 1.00 40.05  ? 418 ARG C O   1 
ATOM   3986 C  CB  . ARG C 1 91  ? -28.886 -17.322 -17.353 1.00 43.72  ? 418 ARG C CB  1 
ATOM   3987 C  CG  . ARG C 1 91  ? -30.207 -16.579 -17.491 1.00 49.12  ? 418 ARG C CG  1 
ATOM   3988 C  CD  . ARG C 1 91  ? -31.084 -17.164 -18.601 1.00 52.08  ? 418 ARG C CD  1 
ATOM   3989 N  NE  . ARG C 1 91  ? -31.926 -18.275 -18.151 1.00 55.07  ? 418 ARG C NE  1 
ATOM   3990 C  CZ  . ARG C 1 91  ? -33.142 -18.156 -17.605 1.00 57.52  ? 418 ARG C CZ  1 
ATOM   3991 N  NH1 . ARG C 1 91  ? -33.703 -16.963 -17.419 1.00 59.38  ? 418 ARG C NH1 1 
ATOM   3992 N  NH2 . ARG C 1 91  ? -33.811 -19.248 -17.236 1.00 58.52  ? 418 ARG C NH2 1 
ATOM   3993 N  N   . GLY C 1 92  ? -27.044 -16.870 -14.768 1.00 39.39  ? 419 GLY C N   1 
ATOM   3994 C  CA  . GLY C 1 92  ? -26.763 -16.569 -13.349 1.00 39.40  ? 419 GLY C CA  1 
ATOM   3995 C  C   . GLY C 1 92  ? -25.789 -15.411 -13.125 1.00 39.46  ? 419 GLY C C   1 
ATOM   3996 O  O   . GLY C 1 92  ? -25.991 -14.581 -12.216 1.00 39.44  ? 419 GLY C O   1 
ATOM   3997 N  N   . TRP C 1 93  ? -24.738 -15.366 -13.956 1.00 38.27  ? 420 TRP C N   1 
ATOM   3998 C  CA  . TRP C 1 93  ? -23.770 -14.263 -13.976 1.00 38.66  ? 420 TRP C CA  1 
ATOM   3999 C  C   . TRP C 1 93  ? -24.465 -12.929 -14.311 1.00 40.16  ? 420 TRP C C   1 
ATOM   4000 O  O   . TRP C 1 93  ? -24.177 -11.895 -13.675 1.00 40.93  ? 420 TRP C O   1 
ATOM   4001 C  CB  . TRP C 1 93  ? -22.646 -14.552 -14.995 1.00 37.28  ? 420 TRP C CB  1 
ATOM   4002 C  CG  . TRP C 1 93  ? -21.886 -13.340 -15.434 1.00 37.06  ? 420 TRP C CG  1 
ATOM   4003 C  CD1 . TRP C 1 93  ? -20.858 -12.745 -14.773 1.00 37.83  ? 420 TRP C CD1 1 
ATOM   4004 C  CD2 . TRP C 1 93  ? -22.101 -12.565 -16.624 1.00 36.90  ? 420 TRP C CD2 1 
ATOM   4005 N  NE1 . TRP C 1 93  ? -20.417 -11.646 -15.463 1.00 38.08  ? 420 TRP C NE1 1 
ATOM   4006 C  CE2 . TRP C 1 93  ? -21.151 -11.514 -16.610 1.00 37.80  ? 420 TRP C CE2 1 
ATOM   4007 C  CE3 . TRP C 1 93  ? -22.998 -12.658 -17.706 1.00 36.37  ? 420 TRP C CE3 1 
ATOM   4008 C  CZ2 . TRP C 1 93  ? -21.069 -10.556 -17.634 1.00 38.80  ? 420 TRP C CZ2 1 
ATOM   4009 C  CZ3 . TRP C 1 93  ? -22.923 -11.693 -18.731 1.00 36.83  ? 420 TRP C CZ3 1 
ATOM   4010 C  CH2 . TRP C 1 93  ? -21.967 -10.657 -18.683 1.00 38.12  ? 420 TRP C CH2 1 
ATOM   4011 N  N   . ALA C 1 94  ? -25.354 -12.976 -15.315 1.00 39.73  ? 421 ALA C N   1 
ATOM   4012 C  CA  . ALA C 1 94  ? -26.056 -11.800 -15.816 1.00 41.68  ? 421 ALA C CA  1 
ATOM   4013 C  C   . ALA C 1 94  ? -26.939 -11.183 -14.733 1.00 43.61  ? 421 ALA C C   1 
ATOM   4014 O  O   . ALA C 1 94  ? -26.926 -9.967  -14.531 1.00 45.02  ? 421 ALA C O   1 
ATOM   4015 C  CB  . ALA C 1 94  ? -26.878 -12.144 -17.051 1.00 41.18  ? 421 ALA C CB  1 
ATOM   4016 N  N   . GLU C 1 95  ? -27.666 -12.040 -14.023 1.00 44.17  ? 422 GLU C N   1 
ATOM   4017 C  CA  . GLU C 1 95  ? -28.555 -11.630 -12.942 1.00 46.51  ? 422 GLU C CA  1 
ATOM   4018 C  C   . GLU C 1 95  ? -27.796 -11.108 -11.709 1.00 47.34  ? 422 GLU C C   1 
ATOM   4019 O  O   . GLU C 1 95  ? -28.401 -10.568 -10.780 1.00 49.18  ? 422 GLU C O   1 
ATOM   4020 C  CB  . GLU C 1 95  ? -29.522 -12.771 -12.610 1.00 48.46  ? 422 GLU C CB  1 
ATOM   4021 C  CG  . GLU C 1 95  ? -30.618 -12.939 -13.674 1.00 51.53  ? 422 GLU C CG  1 
ATOM   4022 C  CD  . GLU C 1 95  ? -31.175 -14.359 -13.828 1.00 53.08  ? 422 GLU C CD  1 
ATOM   4023 O  OE1 . GLU C 1 95  ? -30.947 -15.239 -12.954 1.00 54.90  ? 422 GLU C OE1 1 
ATOM   4024 O  OE2 . GLU C 1 95  ? -31.858 -14.597 -14.850 1.00 53.70  ? 422 GLU C OE2 1 
ATOM   4025 N  N   . LYS C 1 96  ? -26.470 -11.240 -11.713 1.00 45.71  ? 423 LYS C N   1 
ATOM   4026 C  CA  . LYS C 1 96  ? -25.666 -10.676 -10.636 1.00 46.69  ? 423 LYS C CA  1 
ATOM   4027 C  C   . LYS C 1 96  ? -25.022 -9.362  -11.048 1.00 46.30  ? 423 LYS C C   1 
ATOM   4028 O  O   . LYS C 1 96  ? -24.263 -8.771  -10.279 1.00 47.51  ? 423 LYS C O   1 
ATOM   4029 C  CB  . LYS C 1 96  ? -24.646 -11.694 -10.095 1.00 47.03  ? 423 LYS C CB  1 
ATOM   4030 C  CG  . LYS C 1 96  ? -25.314 -12.859 -9.376  1.00 49.10  ? 423 LYS C CG  1 
ATOM   4031 C  CD  . LYS C 1 96  ? -24.515 -13.340 -8.170  1.00 51.88  ? 423 LYS C CD  1 
ATOM   4032 C  CE  . LYS C 1 96  ? -23.818 -14.676 -8.410  1.00 51.09  ? 423 LYS C CE  1 
ATOM   4033 N  NZ  . LYS C 1 96  ? -24.609 -15.818 -7.871  1.00 51.13  ? 423 LYS C NZ  1 
ATOM   4034 N  N   . ILE C 1 97  ? -25.331 -8.900  -12.258 1.00 45.01  ? 424 ILE C N   1 
ATOM   4035 C  CA  . ILE C 1 97  ? -24.931 -7.557  -12.681 1.00 46.14  ? 424 ILE C CA  1 
ATOM   4036 C  C   . ILE C 1 97  ? -25.937 -6.543  -12.125 1.00 47.59  ? 424 ILE C C   1 
ATOM   4037 O  O   . ILE C 1 97  ? -27.110 -6.605  -12.474 1.00 47.29  ? 424 ILE C O   1 
ATOM   4038 C  CB  . ILE C 1 97  ? -24.793 -7.433  -14.208 1.00 45.38  ? 424 ILE C CB  1 
ATOM   4039 C  CG1 . ILE C 1 97  ? -23.687 -8.381  -14.702 1.00 44.70  ? 424 ILE C CG1 1 
ATOM   4040 C  CG2 . ILE C 1 97  ? -24.523 -5.982  -14.609 1.00 46.62  ? 424 ILE C CG2 1 
ATOM   4041 C  CD1 . ILE C 1 97  ? -23.810 -8.772  -16.164 1.00 44.83  ? 424 ILE C CD1 1 
ATOM   4042 N  N   . PRO C 1 98  ? -25.474 -5.613  -11.256 1.00 49.04  ? 425 PRO C N   1 
ATOM   4043 C  CA  . PRO C 1 98  ? -26.387 -4.646  -10.644 1.00 51.41  ? 425 PRO C CA  1 
ATOM   4044 C  C   . PRO C 1 98  ? -27.138 -3.862  -11.707 1.00 52.49  ? 425 PRO C C   1 
ATOM   4045 O  O   . PRO C 1 98  ? -26.546 -3.447  -12.709 1.00 52.17  ? 425 PRO C O   1 
ATOM   4046 C  CB  . PRO C 1 98  ? -25.454 -3.710  -9.863  1.00 53.32  ? 425 PRO C CB  1 
ATOM   4047 C  CG  . PRO C 1 98  ? -24.194 -4.478  -9.680  1.00 51.68  ? 425 PRO C CG  1 
ATOM   4048 C  CD  . PRO C 1 98  ? -24.069 -5.310  -10.922 1.00 49.02  ? 425 PRO C CD  1 
ATOM   4049 N  N   . GLY C 1 99  ? -28.441 -3.700  -11.495 1.00 53.90  ? 426 GLY C N   1 
ATOM   4050 C  CA  . GLY C 1 99  ? -29.303 -2.999  -12.445 1.00 55.15  ? 426 GLY C CA  1 
ATOM   4051 C  C   . GLY C 1 99  ? -29.904 -3.877  -13.532 1.00 53.12  ? 426 GLY C C   1 
ATOM   4052 O  O   . GLY C 1 99  ? -30.973 -3.545  -14.061 1.00 54.25  ? 426 GLY C O   1 
ATOM   4053 N  N   . PHE C 1 100 ? -29.224 -4.980  -13.875 1.00 50.28  ? 427 PHE C N   1 
ATOM   4054 C  CA  . PHE C 1 100 ? -29.697 -5.896  -14.926 1.00 48.77  ? 427 PHE C CA  1 
ATOM   4055 C  C   . PHE C 1 100 ? -31.054 -6.481  -14.573 1.00 49.29  ? 427 PHE C C   1 
ATOM   4056 O  O   . PHE C 1 100 ? -31.945 -6.522  -15.423 1.00 50.05  ? 427 PHE C O   1 
ATOM   4057 C  CB  . PHE C 1 100 ? -28.690 -7.022  -15.224 1.00 46.48  ? 427 PHE C CB  1 
ATOM   4058 C  CG  . PHE C 1 100 ? -29.111 -7.930  -16.359 1.00 45.48  ? 427 PHE C CG  1 
ATOM   4059 C  CD1 . PHE C 1 100 ? -28.778 -7.618  -17.678 1.00 45.12  ? 427 PHE C CD1 1 
ATOM   4060 C  CD2 . PHE C 1 100 ? -29.868 -9.088  -16.113 1.00 45.18  ? 427 PHE C CD2 1 
ATOM   4061 C  CE1 . PHE C 1 100 ? -29.182 -8.440  -18.724 1.00 44.51  ? 427 PHE C CE1 1 
ATOM   4062 C  CE2 . PHE C 1 100 ? -30.275 -9.916  -17.161 1.00 44.43  ? 427 PHE C CE2 1 
ATOM   4063 C  CZ  . PHE C 1 100 ? -29.925 -9.592  -18.470 1.00 43.80  ? 427 PHE C CZ  1 
ATOM   4064 N  N   . ALA C 1 101 ? -31.191 -6.922  -13.320 1.00 49.79  ? 428 ALA C N   1 
ATOM   4065 C  CA  . ALA C 1 101 ? -32.433 -7.490  -12.776 1.00 50.86  ? 428 ALA C CA  1 
ATOM   4066 C  C   . ALA C 1 101 ? -33.633 -6.524  -12.805 1.00 53.99  ? 428 ALA C C   1 
ATOM   4067 O  O   . ALA C 1 101 ? -34.777 -6.968  -12.920 1.00 55.59  ? 428 ALA C O   1 
ATOM   4068 C  CB  . ALA C 1 101 ? -32.202 -8.024  -11.371 1.00 50.64  ? 428 ALA C CB  1 
ATOM   4069 N  N   . ASP C 1 102 ? -33.364 -5.219  -12.734 1.00 55.51  ? 429 ASP C N   1 
ATOM   4070 C  CA  . ASP C 1 102 ? -34.410 -4.184  -12.798 1.00 58.20  ? 429 ASP C CA  1 
ATOM   4071 C  C   . ASP C 1 102 ? -34.848 -3.788  -14.211 1.00 58.47  ? 429 ASP C C   1 
ATOM   4072 O  O   . ASP C 1 102 ? -35.849 -3.076  -14.351 1.00 61.77  ? 429 ASP C O   1 
ATOM   4073 C  CB  . ASP C 1 102 ? -33.996 -2.936  -12.024 1.00 60.75  ? 429 ASP C CB  1 
ATOM   4074 C  CG  . ASP C 1 102 ? -33.626 -3.242  -10.598 1.00 61.40  ? 429 ASP C CG  1 
ATOM   4075 O  OD1 . ASP C 1 102 ? -34.312 -4.073  -9.957  1.00 61.54  ? 429 ASP C OD1 1 
ATOM   4076 O  OD2 . ASP C 1 102 ? -32.629 -2.659  -10.127 1.00 61.75  ? 429 ASP C OD2 1 
ATOM   4077 N  N   . LEU C 1 103 ? -34.106 -4.224  -15.239 1.00 54.58  ? 430 LEU C N   1 
ATOM   4078 C  CA  . LEU C 1 103 ? -34.523 -4.030  -16.629 1.00 54.34  ? 430 LEU C CA  1 
ATOM   4079 C  C   . LEU C 1 103 ? -35.756 -4.897  -16.921 1.00 54.20  ? 430 LEU C C   1 
ATOM   4080 O  O   . LEU C 1 103 ? -35.953 -5.907  -16.238 1.00 53.37  ? 430 LEU C O   1 
ATOM   4081 C  CB  . LEU C 1 103 ? -33.394 -4.374  -17.602 1.00 51.55  ? 430 LEU C CB  1 
ATOM   4082 C  CG  . LEU C 1 103 ? -32.118 -3.522  -17.591 1.00 51.85  ? 430 LEU C CG  1 
ATOM   4083 C  CD1 . LEU C 1 103 ? -31.001 -4.285  -18.305 1.00 48.54  ? 430 LEU C CD1 1 
ATOM   4084 C  CD2 . LEU C 1 103 ? -32.337 -2.135  -18.194 1.00 54.60  ? 430 LEU C CD2 1 
ATOM   4085 N  N   . PRO C 1 104 ? -36.594 -4.508  -17.919 1.00 55.23  ? 431 PRO C N   1 
ATOM   4086 C  CA  . PRO C 1 104 ? -37.729 -5.365  -18.273 1.00 54.89  ? 431 PRO C CA  1 
ATOM   4087 C  C   . PRO C 1 104 ? -37.340 -6.809  -18.616 1.00 51.02  ? 431 PRO C C   1 
ATOM   4088 O  O   . PRO C 1 104 ? -36.282 -7.063  -19.212 1.00 48.49  ? 431 PRO C O   1 
ATOM   4089 C  CB  . PRO C 1 104 ? -38.335 -4.656  -19.485 1.00 57.30  ? 431 PRO C CB  1 
ATOM   4090 C  CG  . PRO C 1 104 ? -37.996 -3.221  -19.267 1.00 59.82  ? 431 PRO C CG  1 
ATOM   4091 C  CD  . PRO C 1 104 ? -36.622 -3.236  -18.675 1.00 57.43  ? 431 PRO C CD  1 
ATOM   4092 N  N   . LYS C 1 105 ? -38.202 -7.738  -18.208 1.00 50.90  ? 432 LYS C N   1 
ATOM   4093 C  CA  . LYS C 1 105 ? -38.020 -9.180  -18.422 1.00 48.14  ? 432 LYS C CA  1 
ATOM   4094 C  C   . LYS C 1 105 ? -37.703 -9.529  -19.889 1.00 46.53  ? 432 LYS C C   1 
ATOM   4095 O  O   . LYS C 1 105 ? -36.859 -10.378 -20.161 1.00 43.90  ? 432 LYS C O   1 
ATOM   4096 C  CB  . LYS C 1 105 ? -39.271 -9.939  -17.907 1.00 49.13  ? 432 LYS C CB  1 
ATOM   4097 C  CG  . LYS C 1 105 ? -39.313 -11.458 -18.109 1.00 46.80  ? 432 LYS C CG  1 
ATOM   4098 C  CD  . LYS C 1 105 ? -38.120 -12.199 -17.518 1.00 43.78  ? 432 LYS C CD  1 
ATOM   4099 C  CE  . LYS C 1 105 ? -38.038 -13.632 -18.045 1.00 41.89  ? 432 LYS C CE  1 
ATOM   4100 N  NZ  . LYS C 1 105 ? -36.664 -14.215 -17.936 1.00 38.64  ? 432 LYS C NZ  1 
ATOM   4101 N  N   . ALA C 1 106 ? -38.397 -8.869  -20.816 1.00 48.71  ? 433 ALA C N   1 
ATOM   4102 C  CA  . ALA C 1 106 ? -38.173 -9.059  -22.252 1.00 47.67  ? 433 ALA C CA  1 
ATOM   4103 C  C   . ALA C 1 106 ? -36.789 -8.567  -22.665 1.00 45.76  ? 433 ALA C C   1 
ATOM   4104 O  O   . ALA C 1 106 ? -36.140 -9.218  -23.472 1.00 43.66  ? 433 ALA C O   1 
ATOM   4105 C  CB  . ALA C 1 106 ? -39.269 -8.379  -23.072 1.00 50.36  ? 433 ALA C CB  1 
ATOM   4106 N  N   . ASP C 1 107 ? -36.352 -7.439  -22.099 1.00 47.29  ? 434 ASP C N   1 
ATOM   4107 C  CA  . ASP C 1 107 ? -35.007 -6.886  -22.333 1.00 47.21  ? 434 ASP C CA  1 
ATOM   4108 C  C   . ASP C 1 107 ? -33.893 -7.755  -21.761 1.00 44.48  ? 434 ASP C C   1 
ATOM   4109 O  O   . ASP C 1 107 ? -32.896 -7.999  -22.441 1.00 43.03  ? 434 ASP C O   1 
ATOM   4110 C  CB  . ASP C 1 107 ? -34.889 -5.450  -21.801 1.00 50.18  ? 434 ASP C CB  1 
ATOM   4111 C  CG  . ASP C 1 107 ? -35.663 -4.442  -22.646 1.00 54.03  ? 434 ASP C CG  1 
ATOM   4112 O  OD1 . ASP C 1 107 ? -36.205 -4.816  -23.723 1.00 54.45  ? 434 ASP C OD1 1 
ATOM   4113 O  OD2 . ASP C 1 107 ? -35.718 -3.262  -22.237 1.00 56.88  ? 434 ASP C OD2 1 
ATOM   4114 N  N   . GLN C 1 108 ? -34.075 -8.232  -20.529 1.00 44.51  ? 435 GLN C N   1 
ATOM   4115 C  CA  . GLN C 1 108 ? -33.170 -9.221  -19.922 1.00 42.30  ? 435 GLN C CA  1 
ATOM   4116 C  C   . GLN C 1 108 ? -32.968 -10.430 -20.828 1.00 40.65  ? 435 GLN C C   1 
ATOM   4117 O  O   . GLN C 1 108 ? -31.826 -10.850 -21.051 1.00 38.83  ? 435 GLN C O   1 
ATOM   4118 C  CB  . GLN C 1 108 ? -33.693 -9.697  -18.552 1.00 42.61  ? 435 GLN C CB  1 
ATOM   4119 C  CG  . GLN C 1 108 ? -33.527 -8.709  -17.397 1.00 44.13  ? 435 GLN C CG  1 
ATOM   4120 C  CD  . GLN C 1 108 ? -34.093 -9.220  -16.075 1.00 44.61  ? 435 GLN C CD  1 
ATOM   4121 O  OE1 . GLN C 1 108 ? -34.924 -8.562  -15.459 1.00 47.53  ? 435 GLN C OE1 1 
ATOM   4122 N  NE2 . GLN C 1 108 ? -33.643 -10.385 -15.635 1.00 42.36  ? 435 GLN C NE2 1 
ATOM   4123 N  N   . ASP C 1 109 ? -34.071 -10.985 -21.345 1.00 41.59  ? 436 ASP C N   1 
ATOM   4124 C  CA  . ASP C 1 109 ? -34.009 -12.165 -22.238 1.00 40.89  ? 436 ASP C CA  1 
ATOM   4125 C  C   . ASP C 1 109 ? -33.330 -11.865 -23.567 1.00 40.30  ? 436 ASP C C   1 
ATOM   4126 O  O   . ASP C 1 109 ? -32.527 -12.674 -24.026 1.00 38.68  ? 436 ASP C O   1 
ATOM   4127 C  CB  . ASP C 1 109 ? -35.392 -12.786 -22.497 1.00 42.55  ? 436 ASP C CB  1 
ATOM   4128 C  CG  . ASP C 1 109 ? -36.023 -13.373 -21.243 1.00 43.85  ? 436 ASP C CG  1 
ATOM   4129 O  OD1 . ASP C 1 109 ? -35.309 -13.620 -20.240 1.00 43.48  ? 436 ASP C OD1 1 
ATOM   4130 O  OD2 . ASP C 1 109 ? -37.252 -13.585 -21.261 1.00 46.03  ? 436 ASP C OD2 1 
ATOM   4131 N  N   . LEU C 1 110 ? -33.647 -10.708 -24.159 1.00 41.89  ? 437 LEU C N   1 
ATOM   4132 C  CA  . LEU C 1 110 ? -33.023 -10.256 -25.406 1.00 42.48  ? 437 LEU C CA  1 
ATOM   4133 C  C   . LEU C 1 110 ? -31.507 -10.005 -25.255 1.00 41.45  ? 437 LEU C C   1 
ATOM   4134 O  O   . LEU C 1 110 ? -30.724 -10.486 -26.071 1.00 40.45  ? 437 LEU C O   1 
ATOM   4135 C  CB  . LEU C 1 110 ? -33.745 -9.025  -25.980 1.00 45.15  ? 437 LEU C CB  1 
ATOM   4136 C  CG  . LEU C 1 110 ? -33.314 -8.574  -27.377 1.00 46.13  ? 437 LEU C CG  1 
ATOM   4137 C  CD1 . LEU C 1 110 ? -33.636 -9.630  -28.428 1.00 45.13  ? 437 LEU C CD1 1 
ATOM   4138 C  CD2 . LEU C 1 110 ? -33.962 -7.246  -27.708 1.00 49.26  ? 437 LEU C CD2 1 
ATOM   4139 N  N   . LEU C 1 111 ? -31.111 -9.274  -24.212 1.00 41.92  ? 438 LEU C N   1 
ATOM   4140 C  CA  . LEU C 1 111 ? -29.691 -9.071  -23.886 1.00 41.42  ? 438 LEU C CA  1 
ATOM   4141 C  C   . LEU C 1 111 ? -28.947 -10.382 -23.684 1.00 39.78  ? 438 LEU C C   1 
ATOM   4142 O  O   . LEU C 1 111 ? -27.844 -10.561 -24.218 1.00 40.03  ? 438 LEU C O   1 
ATOM   4143 C  CB  . LEU C 1 111 ? -29.514 -8.183  -22.647 1.00 41.85  ? 438 LEU C CB  1 
ATOM   4144 C  CG  . LEU C 1 111 ? -29.942 -6.722  -22.763 1.00 44.96  ? 438 LEU C CG  1 
ATOM   4145 C  CD1 . LEU C 1 111 ? -29.861 -6.058  -21.406 1.00 45.43  ? 438 LEU C CD1 1 
ATOM   4146 C  CD2 . LEU C 1 111 ? -29.117 -5.959  -23.798 1.00 46.28  ? 438 LEU C CD2 1 
ATOM   4147 N  N   . PHE C 1 112 ? -29.535 -11.296 -22.914 1.00 38.81  ? 439 PHE C N   1 
ATOM   4148 C  CA  . PHE C 1 112 ? -28.860 -12.555 -22.612 1.00 36.97  ? 439 PHE C CA  1 
ATOM   4149 C  C   . PHE C 1 112 ? -28.644 -13.384 -23.885 1.00 36.48  ? 439 PHE C C   1 
ATOM   4150 O  O   . PHE C 1 112 ? -27.507 -13.763 -24.214 1.00 35.70  ? 439 PHE C O   1 
ATOM   4151 C  CB  . PHE C 1 112 ? -29.604 -13.357 -21.533 1.00 36.22  ? 439 PHE C CB  1 
ATOM   4152 C  CG  . PHE C 1 112 ? -29.235 -14.813 -21.508 1.00 35.37  ? 439 PHE C CG  1 
ATOM   4153 C  CD1 . PHE C 1 112 ? -27.965 -15.225 -21.040 1.00 34.71  ? 439 PHE C CD1 1 
ATOM   4154 C  CD2 . PHE C 1 112 ? -30.140 -15.788 -21.966 1.00 34.70  ? 439 PHE C CD2 1 
ATOM   4155 C  CE1 . PHE C 1 112 ? -27.615 -16.576 -21.035 1.00 33.87  ? 439 PHE C CE1 1 
ATOM   4156 C  CE2 . PHE C 1 112 ? -29.795 -17.140 -21.959 1.00 33.69  ? 439 PHE C CE2 1 
ATOM   4157 C  CZ  . PHE C 1 112 ? -28.536 -17.532 -21.490 1.00 34.02  ? 439 PHE C CZ  1 
ATOM   4158 N  N   . GLU C 1 113 ? -29.739 -13.647 -24.591 1.00 37.05  ? 440 GLU C N   1 
ATOM   4159 C  CA  . GLU C 1 113 ? -29.729 -14.518 -25.754 1.00 36.63  ? 440 GLU C CA  1 
ATOM   4160 C  C   . GLU C 1 113 ? -28.861 -13.945 -26.855 1.00 37.14  ? 440 GLU C C   1 
ATOM   4161 O  O   . GLU C 1 113 ? -28.154 -14.683 -27.519 1.00 37.29  ? 440 GLU C O   1 
ATOM   4162 C  CB  . GLU C 1 113 ? -31.152 -14.763 -26.252 1.00 38.23  ? 440 GLU C CB  1 
ATOM   4163 C  CG  . GLU C 1 113 ? -31.962 -15.635 -25.315 1.00 39.14  ? 440 GLU C CG  1 
ATOM   4164 C  CD  . GLU C 1 113 ? -33.395 -15.843 -25.765 1.00 41.02  ? 440 GLU C CD  1 
ATOM   4165 O  OE1 . GLU C 1 113 ? -33.610 -16.410 -26.851 1.00 41.99  ? 440 GLU C OE1 1 
ATOM   4166 O  OE2 . GLU C 1 113 ? -34.311 -15.464 -25.016 1.00 42.85  ? 440 GLU C OE2 1 
ATOM   4167 N  N   . SER C 1 114 ? -28.888 -12.627 -27.024 1.00 38.68  ? 441 SER C N   1 
ATOM   4168 C  CA  . SER C 1 114 ? -28.103 -11.974 -28.078 1.00 40.39  ? 441 SER C CA  1 
ATOM   4169 C  C   . SER C 1 114 ? -26.612 -12.097 -27.863 1.00 39.52  ? 441 SER C C   1 
ATOM   4170 O  O   . SER C 1 114 ? -25.871 -12.195 -28.826 1.00 42.14  ? 441 SER C O   1 
ATOM   4171 C  CB  . SER C 1 114 ? -28.466 -10.504 -28.211 1.00 41.84  ? 441 SER C CB  1 
ATOM   4172 O  OG  . SER C 1 114 ? -29.804 -10.363 -28.604 1.00 42.46  ? 441 SER C OG  1 
ATOM   4173 N  N   . ALA C 1 115 ? -26.195 -12.105 -26.602 1.00 38.75  ? 442 ALA C N   1 
ATOM   4174 C  CA  . ALA C 1 115 ? -24.788 -12.094 -26.213 1.00 38.24  ? 442 ALA C CA  1 
ATOM   4175 C  C   . ALA C 1 115 ? -24.280 -13.442 -25.738 1.00 36.60  ? 442 ALA C C   1 
ATOM   4176 O  O   . ALA C 1 115 ? -23.091 -13.580 -25.454 1.00 36.22  ? 442 ALA C O   1 
ATOM   4177 C  CB  . ALA C 1 115 ? -24.574 -11.058 -25.116 1.00 39.87  ? 442 ALA C CB  1 
ATOM   4178 N  N   . PHE C 1 116 ? -25.174 -14.429 -25.632 1.00 35.65  ? 443 PHE C N   1 
ATOM   4179 C  CA  . PHE C 1 116 ? -24.800 -15.725 -25.094 1.00 35.37  ? 443 PHE C CA  1 
ATOM   4180 C  C   . PHE C 1 116 ? -23.523 -16.278 -25.735 1.00 36.13  ? 443 PHE C C   1 
ATOM   4181 O  O   . PHE C 1 116 ? -22.533 -16.506 -25.038 1.00 37.58  ? 443 PHE C O   1 
ATOM   4182 C  CB  . PHE C 1 116 ? -25.941 -16.770 -25.149 1.00 34.53  ? 443 PHE C CB  1 
ATOM   4183 C  CG  . PHE C 1 116 ? -25.450 -18.173 -24.919 1.00 33.85  ? 443 PHE C CG  1 
ATOM   4184 C  CD1 . PHE C 1 116 ? -24.935 -18.549 -23.673 1.00 33.21  ? 443 PHE C CD1 1 
ATOM   4185 C  CD2 . PHE C 1 116 ? -25.401 -19.095 -25.977 1.00 34.19  ? 443 PHE C CD2 1 
ATOM   4186 C  CE1 . PHE C 1 116 ? -24.418 -19.826 -23.481 1.00 33.39  ? 443 PHE C CE1 1 
ATOM   4187 C  CE2 . PHE C 1 116 ? -24.896 -20.375 -25.788 1.00 33.88  ? 443 PHE C CE2 1 
ATOM   4188 C  CZ  . PHE C 1 116 ? -24.403 -20.741 -24.536 1.00 33.81  ? 443 PHE C CZ  1 
ATOM   4189 N  N   . LEU C 1 117 ? -23.551 -16.469 -27.052 1.00 36.51  ? 444 LEU C N   1 
ATOM   4190 C  CA  . LEU C 1 117 ? -22.437 -17.067 -27.780 1.00 37.19  ? 444 LEU C CA  1 
ATOM   4191 C  C   . LEU C 1 117 ? -21.152 -16.251 -27.648 1.00 38.24  ? 444 LEU C C   1 
ATOM   4192 O  O   . LEU C 1 117 ? -20.068 -16.824 -27.495 1.00 38.27  ? 444 LEU C O   1 
ATOM   4193 C  CB  . LEU C 1 117 ? -22.805 -17.324 -29.243 1.00 37.19  ? 444 LEU C CB  1 
ATOM   4194 C  CG  . LEU C 1 117 ? -22.055 -18.474 -29.919 1.00 37.97  ? 444 LEU C CG  1 
ATOM   4195 C  CD1 . LEU C 1 117 ? -22.342 -19.811 -29.248 1.00 36.18  ? 444 LEU C CD1 1 
ATOM   4196 C  CD2 . LEU C 1 117 ? -22.362 -18.518 -31.420 1.00 39.42  ? 444 LEU C CD2 1 
ATOM   4197 N  N   . GLU C 1 118 ? -21.298 -14.927 -27.662 1.00 39.43  ? 445 GLU C N   1 
ATOM   4198 C  CA  . GLU C 1 118 ? -20.206 -14.010 -27.355 1.00 41.78  ? 445 GLU C CA  1 
ATOM   4199 C  C   . GLU C 1 118 ? -19.614 -14.225 -25.960 1.00 40.99  ? 445 GLU C C   1 
ATOM   4200 O  O   . GLU C 1 118 ? -18.411 -14.344 -25.826 1.00 42.36  ? 445 GLU C O   1 
ATOM   4201 C  CB  . GLU C 1 118 ? -20.627 -12.552 -27.584 1.00 44.52  ? 445 GLU C CB  1 
ATOM   4202 C  CG  . GLU C 1 118 ? -20.483 -12.129 -29.047 1.00 48.27  ? 445 GLU C CG  1 
ATOM   4203 C  CD  . GLU C 1 118 ? -20.936 -10.708 -29.330 1.00 51.72  ? 445 GLU C CD  1 
ATOM   4204 O  OE1 . GLU C 1 118 ? -22.041 -10.544 -29.874 1.00 53.15  ? 445 GLU C OE1 1 
ATOM   4205 O  OE2 . GLU C 1 118 ? -20.188 -9.747  -29.031 1.00 55.55  ? 445 GLU C OE2 1 
ATOM   4206 N  N   . LEU C 1 119 ? -20.464 -14.331 -24.942 1.00 39.94  ? 446 LEU C N   1 
ATOM   4207 C  CA  . LEU C 1 119 ? -19.998 -14.574 -23.593 1.00 39.55  ? 446 LEU C CA  1 
ATOM   4208 C  C   . LEU C 1 119 ? -19.416 -15.961 -23.419 1.00 38.68  ? 446 LEU C C   1 
ATOM   4209 O  O   . LEU C 1 119 ? -18.395 -16.114 -22.749 1.00 38.05  ? 446 LEU C O   1 
ATOM   4210 C  CB  . LEU C 1 119 ? -21.095 -14.297 -22.554 1.00 39.42  ? 446 LEU C CB  1 
ATOM   4211 C  CG  . LEU C 1 119 ? -21.153 -12.919 -21.879 1.00 39.92  ? 446 LEU C CG  1 
ATOM   4212 C  CD1 . LEU C 1 119 ? -19.774 -12.437 -21.422 1.00 41.69  ? 446 LEU C CD1 1 
ATOM   4213 C  CD2 . LEU C 1 119 ? -21.807 -11.889 -22.772 1.00 41.01  ? 446 LEU C CD2 1 
ATOM   4214 N  N   . PHE C 1 120 ? -20.055 -16.961 -24.033 1.00 37.66  ? 447 PHE C N   1 
ATOM   4215 C  CA  . PHE C 1 120 ? -19.501 -18.322 -24.060 1.00 37.45  ? 447 PHE C CA  1 
ATOM   4216 C  C   . PHE C 1 120 ? -18.072 -18.341 -24.621 1.00 38.63  ? 447 PHE C C   1 
ATOM   4217 O  O   . PHE C 1 120 ? -17.205 -18.970 -24.035 1.00 39.40  ? 447 PHE C O   1 
ATOM   4218 C  CB  . PHE C 1 120 ? -20.397 -19.303 -24.850 1.00 36.80  ? 447 PHE C CB  1 
ATOM   4219 C  CG  . PHE C 1 120 ? -19.745 -20.643 -25.116 1.00 37.34  ? 447 PHE C CG  1 
ATOM   4220 C  CD1 . PHE C 1 120 ? -19.842 -21.678 -24.191 1.00 37.18  ? 447 PHE C CD1 1 
ATOM   4221 C  CD2 . PHE C 1 120 ? -19.014 -20.861 -26.288 1.00 38.71  ? 447 PHE C CD2 1 
ATOM   4222 C  CE1 . PHE C 1 120 ? -19.239 -22.907 -24.429 1.00 38.09  ? 447 PHE C CE1 1 
ATOM   4223 C  CE2 . PHE C 1 120 ? -18.405 -22.084 -26.529 1.00 39.60  ? 447 PHE C CE2 1 
ATOM   4224 C  CZ  . PHE C 1 120 ? -18.516 -23.108 -25.598 1.00 39.20  ? 447 PHE C CZ  1 
ATOM   4225 N  N   . VAL C 1 121 ? -17.856 -17.670 -25.761 1.00 38.70  ? 448 VAL C N   1 
ATOM   4226 C  CA  . VAL C 1 121 ? -16.544 -17.618 -26.423 1.00 39.78  ? 448 VAL C CA  1 
ATOM   4227 C  C   . VAL C 1 121 ? -15.548 -16.829 -25.588 1.00 40.29  ? 448 VAL C C   1 
ATOM   4228 O  O   . VAL C 1 121 ? -14.462 -17.317 -25.332 1.00 41.67  ? 448 VAL C O   1 
ATOM   4229 C  CB  . VAL C 1 121 ? -16.637 -17.038 -27.868 1.00 40.94  ? 448 VAL C CB  1 
ATOM   4230 C  CG1 . VAL C 1 121 ? -15.279 -16.578 -28.368 1.00 43.33  ? 448 VAL C CG1 1 
ATOM   4231 C  CG2 . VAL C 1 121 ? -17.200 -18.075 -28.817 1.00 40.13  ? 448 VAL C CG2 1 
ATOM   4232 N  N   . LEU C 1 122 ? -15.937 -15.623 -25.172 1.00 39.73  ? 449 LEU C N   1 
ATOM   4233 C  CA  . LEU C 1 122 ? -15.099 -14.738 -24.371 1.00 41.00  ? 449 LEU C CA  1 
ATOM   4234 C  C   . LEU C 1 122 ? -14.561 -15.378 -23.079 1.00 41.32  ? 449 LEU C C   1 
ATOM   4235 O  O   . LEU C 1 122 ? -13.349 -15.303 -22.796 1.00 43.23  ? 449 LEU C O   1 
ATOM   4236 C  CB  . LEU C 1 122 ? -15.860 -13.457 -24.045 1.00 40.19  ? 449 LEU C CB  1 
ATOM   4237 C  CG  . LEU C 1 122 ? -15.108 -12.349 -23.309 1.00 41.73  ? 449 LEU C CG  1 
ATOM   4238 C  CD1 . LEU C 1 122 ? -13.939 -11.787 -24.125 1.00 44.00  ? 449 LEU C CD1 1 
ATOM   4239 C  CD2 . LEU C 1 122 ? -16.099 -11.259 -22.937 1.00 40.81  ? 449 LEU C CD2 1 
ATOM   4240 N  N   . ARG C 1 123 ? -15.462 -16.012 -22.325 1.00 39.06  ? 450 ARG C N   1 
ATOM   4241 C  CA  . ARG C 1 123 ? -15.129 -16.609 -21.039 1.00 39.06  ? 450 ARG C CA  1 
ATOM   4242 C  C   . ARG C 1 123 ? -14.264 -17.846 -21.219 1.00 40.14  ? 450 ARG C C   1 
ATOM   4243 O  O   . ARG C 1 123 ? -13.336 -18.070 -20.431 1.00 42.58  ? 450 ARG C O   1 
ATOM   4244 C  CB  . ARG C 1 123 ? -16.394 -16.918 -20.220 1.00 37.14  ? 450 ARG C CB  1 
ATOM   4245 C  CG  . ARG C 1 123 ? -17.018 -15.681 -19.569 1.00 36.85  ? 450 ARG C CG  1 
ATOM   4246 C  CD  . ARG C 1 123 ? -18.532 -15.802 -19.381 1.00 35.84  ? 450 ARG C CD  1 
ATOM   4247 N  NE  . ARG C 1 123 ? -18.945 -16.992 -18.629 1.00 35.79  ? 450 ARG C NE  1 
ATOM   4248 C  CZ  . ARG C 1 123 ? -19.108 -17.047 -17.299 1.00 35.77  ? 450 ARG C CZ  1 
ATOM   4249 N  NH1 . ARG C 1 123 ? -18.911 -15.984 -16.526 1.00 35.67  ? 450 ARG C NH1 1 
ATOM   4250 N  NH2 . ARG C 1 123 ? -19.481 -18.189 -16.739 1.00 35.99  ? 450 ARG C NH2 1 
ATOM   4251 N  N   . LEU C 1 124 ? -14.568 -18.639 -22.252 1.00 39.95  ? 451 LEU C N   1 
ATOM   4252 C  CA  . LEU C 1 124 ? -13.730 -19.770 -22.686 1.00 40.96  ? 451 LEU C CA  1 
ATOM   4253 C  C   . LEU C 1 124 ? -12.290 -19.302 -22.971 1.00 43.60  ? 451 LEU C C   1 
ATOM   4254 O  O   . LEU C 1 124 ? -11.323 -19.911 -22.505 1.00 44.82  ? 451 LEU C O   1 
ATOM   4255 C  CB  . LEU C 1 124 ? -14.339 -20.456 -23.922 1.00 39.87  ? 451 LEU C CB  1 
ATOM   4256 C  CG  . LEU C 1 124 ? -13.603 -21.600 -24.627 1.00 42.09  ? 451 LEU C CG  1 
ATOM   4257 C  CD1 . LEU C 1 124 ? -13.342 -22.766 -23.683 1.00 42.19  ? 451 LEU C CD1 1 
ATOM   4258 C  CD2 . LEU C 1 124 ? -14.357 -22.072 -25.868 1.00 41.43  ? 451 LEU C CD2 1 
ATOM   4259 N  N   . ALA C 1 125 ? -12.183 -18.189 -23.697 1.00 44.17  ? 452 ALA C N   1 
ATOM   4260 C  CA  . ALA C 1 125 ? -10.922 -17.657 -24.182 1.00 46.70  ? 452 ALA C CA  1 
ATOM   4261 C  C   . ALA C 1 125 ? -10.036 -17.164 -23.044 1.00 48.27  ? 452 ALA C C   1 
ATOM   4262 O  O   . ALA C 1 125 ? -8.810  -17.308 -23.097 1.00 51.16  ? 452 ALA C O   1 
ATOM   4263 C  CB  . ALA C 1 125 ? -11.194 -16.538 -25.176 1.00 46.72  ? 452 ALA C CB  1 
ATOM   4264 N  N   . TYR C 1 126 ? -10.666 -16.596 -22.018 1.00 47.08  ? 453 TYR C N   1 
ATOM   4265 C  CA  . TYR C 1 126 ? -9.963  -15.977 -20.896 1.00 48.84  ? 453 TYR C CA  1 
ATOM   4266 C  C   . TYR C 1 126 ? -9.430  -17.014 -19.914 1.00 49.80  ? 453 TYR C C   1 
ATOM   4267 O  O   . TYR C 1 126 ? -8.431  -16.796 -19.249 1.00 51.80  ? 453 TYR C O   1 
ATOM   4268 C  CB  . TYR C 1 126 ? -10.919 -15.031 -20.169 1.00 46.81  ? 453 TYR C CB  1 
ATOM   4269 C  CG  . TYR C 1 126 ? -10.284 -14.179 -19.088 1.00 48.21  ? 453 TYR C CG  1 
ATOM   4270 C  CD1 . TYR C 1 126 ? -9.393  -13.151 -19.415 1.00 50.73  ? 453 TYR C CD1 1 
ATOM   4271 C  CD2 . TYR C 1 126 ? -10.584 -14.390 -17.739 1.00 47.16  ? 453 TYR C CD2 1 
ATOM   4272 C  CE1 . TYR C 1 126 ? -8.824  -12.356 -18.432 1.00 52.35  ? 453 TYR C CE1 1 
ATOM   4273 C  CE2 . TYR C 1 126 ? -10.013 -13.608 -16.742 1.00 48.18  ? 453 TYR C CE2 1 
ATOM   4274 C  CZ  . TYR C 1 126 ? -9.136  -12.595 -17.093 1.00 51.11  ? 453 TYR C CZ  1 
ATOM   4275 O  OH  . TYR C 1 126 ? -8.564  -11.799 -16.127 1.00 52.65  ? 453 TYR C OH  1 
ATOM   4276 N  N   . ARG C 1 127 ? -10.136 -18.133 -19.840 1.00 49.24  ? 454 ARG C N   1 
ATOM   4277 C  CA  . ARG C 1 127 ? -9.922  -19.195 -18.862 1.00 49.97  ? 454 ARG C CA  1 
ATOM   4278 C  C   . ARG C 1 127 ? -8.907  -20.217 -19.359 1.00 51.46  ? 454 ARG C C   1 
ATOM   4279 O  O   . ARG C 1 127 ? -8.197  -20.820 -18.570 1.00 52.51  ? 454 ARG C O   1 
ATOM   4280 C  CB  . ARG C 1 127 ? -11.264 -19.906 -18.680 1.00 48.23  ? 454 ARG C CB  1 
ATOM   4281 C  CG  . ARG C 1 127 ? -11.534 -20.544 -17.339 1.00 49.23  ? 454 ARG C CG  1 
ATOM   4282 C  CD  . ARG C 1 127 ? -13.041 -20.604 -17.108 1.00 47.70  ? 454 ARG C CD  1 
ATOM   4283 N  NE  . ARG C 1 127 ? -13.684 -21.198 -18.262 1.00 47.34  ? 454 ARG C NE  1 
ATOM   4284 C  CZ  . ARG C 1 127 ? -14.879 -20.882 -18.737 1.00 45.91  ? 454 ARG C CZ  1 
ATOM   4285 N  NH1 . ARG C 1 127 ? -15.658 -19.970 -18.157 1.00 45.48  ? 454 ARG C NH1 1 
ATOM   4286 N  NH2 . ARG C 1 127 ? -15.294 -21.504 -19.824 1.00 45.77  ? 454 ARG C NH2 1 
ATOM   4287 N  N   . SER C 1 128 ? -8.886  -20.428 -20.673 1.00 52.07  ? 455 SER C N   1 
ATOM   4288 C  CA  . SER C 1 128 ? -8.089  -21.483 -21.308 1.00 54.98  ? 455 SER C CA  1 
ATOM   4289 C  C   . SER C 1 128 ? -6.605  -21.124 -21.367 1.00 58.14  ? 455 SER C C   1 
ATOM   4290 O  O   . SER C 1 128 ? -6.231  -19.972 -21.152 1.00 58.21  ? 455 SER C O   1 
ATOM   4291 C  CB  . SER C 1 128 ? -8.606  -21.739 -22.725 1.00 54.67  ? 455 SER C CB  1 
ATOM   4292 O  OG  . SER C 1 128 ? -9.957  -22.162 -22.721 1.00 52.20  ? 455 SER C OG  1 
ATOM   4293 N  N   . ASN C 1 129 ? -5.768  -22.125 -21.631 1.00 61.29  ? 456 ASN C N   1 
ATOM   4294 C  CA  . ASN C 1 129 ? -4.378  -21.897 -22.009 1.00 64.98  ? 456 ASN C CA  1 
ATOM   4295 C  C   . ASN C 1 129 ? -4.208  -22.181 -23.513 1.00 66.67  ? 456 ASN C C   1 
ATOM   4296 O  O   . ASN C 1 129 ? -4.047  -23.350 -23.899 1.00 67.89  ? 456 ASN C O   1 
ATOM   4297 C  CB  . ASN C 1 129 ? -3.436  -22.763 -21.175 1.00 67.62  ? 456 ASN C CB  1 
ATOM   4298 C  CG  . ASN C 1 129 ? -1.994  -22.261 -21.198 1.00 71.28  ? 456 ASN C CG  1 
ATOM   4299 O  OD1 . ASN C 1 129 ? -1.558  -21.583 -22.133 1.00 72.40  ? 456 ASN C OD1 1 
ATOM   4300 N  ND2 . ASN C 1 129 ? -1.248  -22.600 -20.158 1.00 73.23  ? 456 ASN C ND2 1 
ATOM   4301 N  N   . PRO C 1 130 ? -4.276  -21.119 -24.366 1.00 67.07  ? 457 PRO C N   1 
ATOM   4302 C  CA  . PRO C 1 130 ? -4.098  -21.283 -25.816 1.00 69.41  ? 457 PRO C CA  1 
ATOM   4303 C  C   . PRO C 1 130 ? -2.775  -21.931 -26.252 1.00 74.65  ? 457 PRO C C   1 
ATOM   4304 O  O   . PRO C 1 130 ? -2.794  -22.746 -27.181 1.00 76.51  ? 457 PRO C O   1 
ATOM   4305 C  CB  . PRO C 1 130 ? -4.220  -19.850 -26.366 1.00 68.91  ? 457 PRO C CB  1 
ATOM   4306 C  CG  . PRO C 1 130 ? -4.136  -18.945 -25.186 1.00 67.91  ? 457 PRO C CG  1 
ATOM   4307 C  CD  . PRO C 1 130 ? -4.696  -19.739 -24.048 1.00 65.36  ? 457 PRO C CD  1 
ATOM   4308 N  N   . VAL C 1 131 ? -1.662  -21.588 -25.592 1.00 77.52  ? 458 VAL C N   1 
ATOM   4309 C  CA  . VAL C 1 131 ? -0.325  -22.144 -25.928 1.00 83.06  ? 458 VAL C CA  1 
ATOM   4310 C  C   . VAL C 1 131 ? -0.318  -23.685 -25.932 1.00 84.09  ? 458 VAL C C   1 
ATOM   4311 O  O   . VAL C 1 131 ? 0.228   -24.303 -26.849 1.00 87.27  ? 458 VAL C O   1 
ATOM   4312 C  CB  . VAL C 1 131 ? 0.811   -21.593 -25.003 1.00 85.75  ? 458 VAL C CB  1 
ATOM   4313 C  CG1 . VAL C 1 131 ? 2.165   -22.191 -25.357 1.00 90.95  ? 458 VAL C CG1 1 
ATOM   4314 C  CG2 . VAL C 1 131 ? 0.901   -20.073 -25.080 1.00 85.75  ? 458 VAL C CG2 1 
ATOM   4315 N  N   . GLU C 1 132 ? -0.950  -24.284 -24.922 1.00 81.71  ? 459 GLU C N   1 
ATOM   4316 C  CA  . GLU C 1 132 ? -0.967  -25.740 -24.756 1.00 82.81  ? 459 GLU C CA  1 
ATOM   4317 C  C   . GLU C 1 132 ? -2.100  -26.417 -25.529 1.00 79.52  ? 459 GLU C C   1 
ATOM   4318 O  O   . GLU C 1 132 ? -2.178  -27.655 -25.588 1.00 80.68  ? 459 GLU C O   1 
ATOM   4319 C  CB  . GLU C 1 132 ? -1.006  -26.102 -23.265 1.00 83.09  ? 459 GLU C CB  1 
ATOM   4320 C  CG  . GLU C 1 132 ? 0.360   -25.998 -22.577 1.00 87.94  ? 459 GLU C CG  1 
ATOM   4321 C  CD  . GLU C 1 132 ? 0.289   -25.788 -21.066 1.00 87.53  ? 459 GLU C CD  1 
ATOM   4322 O  OE1 . GLU C 1 132 ? -0.814  -25.799 -20.466 1.00 84.81  ? 459 GLU C OE1 1 
ATOM   4323 O  OE2 . GLU C 1 132 ? 1.360   -25.604 -20.462 1.00 91.55  ? 459 GLU C OE2 1 
ATOM   4324 N  N   . GLY C 1 133 ? -2.951  -25.588 -26.136 1.00 75.77  ? 460 GLY C N   1 
ATOM   4325 C  CA  . GLY C 1 133 ? -4.151  -26.038 -26.840 1.00 72.26  ? 460 GLY C CA  1 
ATOM   4326 C  C   . GLY C 1 133 ? -5.296  -26.476 -25.936 1.00 67.87  ? 460 GLY C C   1 
ATOM   4327 O  O   . GLY C 1 133 ? -6.218  -27.152 -26.400 1.00 65.87  ? 460 GLY C O   1 
ATOM   4328 N  N   . LYS C 1 134 ? -5.238  -26.090 -24.658 1.00 66.38  ? 461 LYS C N   1 
ATOM   4329 C  CA  . LYS C 1 134 ? -6.223  -26.501 -23.648 1.00 63.20  ? 461 LYS C CA  1 
ATOM   4330 C  C   . LYS C 1 134 ? -7.406  -25.545 -23.615 1.00 59.04  ? 461 LYS C C   1 
ATOM   4331 O  O   . LYS C 1 134 ? -7.232  -24.361 -23.316 1.00 58.30  ? 461 LYS C O   1 
ATOM   4332 C  CB  . LYS C 1 134 ? -5.584  -26.556 -22.257 1.00 64.10  ? 461 LYS C CB  1 
ATOM   4333 C  CG  . LYS C 1 134 ? -4.596  -27.689 -22.044 1.00 67.99  ? 461 LYS C CG  1 
ATOM   4334 C  CD  . LYS C 1 134 ? -3.788  -27.447 -20.772 1.00 69.84  ? 461 LYS C CD  1 
ATOM   4335 C  CE  . LYS C 1 134 ? -3.191  -28.724 -20.192 1.00 73.16  ? 461 LYS C CE  1 
ATOM   4336 N  NZ  . LYS C 1 134 ? -2.250  -29.425 -21.112 1.00 77.07  ? 461 LYS C NZ  1 
ATOM   4337 N  N   . LEU C 1 135 ? -8.596  -26.055 -23.932 1.00 56.50  ? 462 LEU C N   1 
ATOM   4338 C  CA  . LEU C 1 135 ? -9.840  -25.301 -23.728 1.00 53.13  ? 462 LEU C CA  1 
ATOM   4339 C  C   . LEU C 1 135 ? -10.489 -25.730 -22.421 1.00 51.61  ? 462 LEU C C   1 
ATOM   4340 O  O   . LEU C 1 135 ? -10.689 -26.920 -22.163 1.00 52.76  ? 462 LEU C O   1 
ATOM   4341 C  CB  . LEU C 1 135 ? -10.802 -25.425 -24.917 1.00 51.65  ? 462 LEU C CB  1 
ATOM   4342 C  CG  . LEU C 1 135 ? -10.219 -24.797 -26.190 1.00 53.76  ? 462 LEU C CG  1 
ATOM   4343 C  CD1 . LEU C 1 135 ? -10.620 -25.607 -27.407 1.00 54.92  ? 462 LEU C CD1 1 
ATOM   4344 C  CD2 . LEU C 1 135 ? -10.561 -23.322 -26.368 1.00 51.94  ? 462 LEU C CD2 1 
ATOM   4345 N  N   . ILE C 1 136 ? -10.762 -24.747 -21.579 1.00 49.75  ? 463 ILE C N   1 
ATOM   4346 C  CA  . ILE C 1 136 ? -11.286 -24.991 -20.244 1.00 48.76  ? 463 ILE C CA  1 
ATOM   4347 C  C   . ILE C 1 136 ? -12.707 -24.407 -20.191 1.00 46.00  ? 463 ILE C C   1 
ATOM   4348 O  O   . ILE C 1 136 ? -12.918 -23.198 -20.295 1.00 44.52  ? 463 ILE C O   1 
ATOM   4349 C  CB  . ILE C 1 136 ? -10.335 -24.453 -19.148 1.00 49.88  ? 463 ILE C CB  1 
ATOM   4350 C  CG1 . ILE C 1 136 ? -8.919  -25.047 -19.337 1.00 53.78  ? 463 ILE C CG1 1 
ATOM   4351 C  CG2 . ILE C 1 136 ? -10.879 -24.803 -17.776 1.00 49.41  ? 463 ILE C CG2 1 
ATOM   4352 C  CD1 . ILE C 1 136 ? -7.793  -24.331 -18.621 1.00 55.58  ? 463 ILE C CD1 1 
ATOM   4353 N  N   . PHE C 1 137 ? -13.674 -25.302 -20.077 1.00 45.64  ? 464 PHE C N   1 
ATOM   4354 C  CA  . PHE C 1 137 ? -15.072 -24.945 -20.169 1.00 44.78  ? 464 PHE C CA  1 
ATOM   4355 C  C   . PHE C 1 137 ? -15.631 -24.612 -18.795 1.00 45.23  ? 464 PHE C C   1 
ATOM   4356 O  O   . PHE C 1 137 ? -14.995 -24.885 -17.766 1.00 45.94  ? 464 PHE C O   1 
ATOM   4357 C  CB  . PHE C 1 137 ? -15.838 -26.055 -20.895 1.00 44.25  ? 464 PHE C CB  1 
ATOM   4358 C  CG  . PHE C 1 137 ? -15.455 -26.188 -22.351 1.00 44.43  ? 464 PHE C CG  1 
ATOM   4359 C  CD1 . PHE C 1 137 ? -16.079 -25.410 -23.325 1.00 43.10  ? 464 PHE C CD1 1 
ATOM   4360 C  CD2 . PHE C 1 137 ? -14.449 -27.069 -22.750 1.00 46.65  ? 464 PHE C CD2 1 
ATOM   4361 C  CE1 . PHE C 1 137 ? -15.715 -25.526 -24.671 1.00 44.09  ? 464 PHE C CE1 1 
ATOM   4362 C  CE2 . PHE C 1 137 ? -14.080 -27.180 -24.089 1.00 47.52  ? 464 PHE C CE2 1 
ATOM   4363 C  CZ  . PHE C 1 137 ? -14.715 -26.411 -25.051 1.00 45.36  ? 464 PHE C CZ  1 
ATOM   4364 N  N   . CYS C 1 138 ? -16.809 -24.005 -18.770 1.00 45.91  ? 465 CYS C N   1 
ATOM   4365 C  CA  . CYS C 1 138 ? -17.317 -23.413 -17.521 1.00 48.47  ? 465 CYS C CA  1 
ATOM   4366 C  C   . CYS C 1 138 ? -17.627 -24.416 -16.397 1.00 48.66  ? 465 CYS C C   1 
ATOM   4367 O  O   . CYS C 1 138 ? -17.798 -24.015 -15.251 1.00 49.01  ? 465 CYS C O   1 
ATOM   4368 C  CB  . CYS C 1 138 ? -18.524 -22.547 -17.801 1.00 49.05  ? 465 CYS C CB  1 
ATOM   4369 S  SG  . CYS C 1 138 ? -19.903 -23.624 -18.139 1.00 57.62  ? 465 CYS C SG  1 
ATOM   4370 N  N   . ASN C 1 139 ? -17.692 -25.703 -16.738 1.00 49.42  ? 466 ASN C N   1 
ATOM   4371 C  CA  . ASN C 1 139 ? -17.813 -26.784 -15.758 1.00 51.65  ? 466 ASN C CA  1 
ATOM   4372 C  C   . ASN C 1 139 ? -16.453 -27.336 -15.309 1.00 53.73  ? 466 ASN C C   1 
ATOM   4373 O  O   . ASN C 1 139 ? -16.389 -28.265 -14.490 1.00 54.54  ? 466 ASN C O   1 
ATOM   4374 C  CB  . ASN C 1 139 ? -18.710 -27.918 -16.294 1.00 54.27  ? 466 ASN C CB  1 
ATOM   4375 C  CG  . ASN C 1 139 ? -18.250 -28.466 -17.650 1.00 56.72  ? 466 ASN C CG  1 
ATOM   4376 O  OD1 . ASN C 1 139 ? -17.680 -27.747 -18.482 1.00 57.31  ? 466 ASN C OD1 1 
ATOM   4377 N  ND2 . ASN C 1 139 ? -18.536 -29.745 -17.889 1.00 58.49  ? 466 ASN C ND2 1 
ATOM   4378 N  N   . GLY C 1 140 ? -15.373 -26.772 -15.850 1.00 53.03  ? 467 GLY C N   1 
ATOM   4379 C  CA  . GLY C 1 140 ? -14.025 -27.209 -15.507 1.00 54.18  ? 467 GLY C CA  1 
ATOM   4380 C  C   . GLY C 1 140 ? -13.452 -28.307 -16.390 1.00 55.60  ? 467 GLY C C   1 
ATOM   4381 O  O   . GLY C 1 140 ? -12.258 -28.612 -16.301 1.00 57.67  ? 467 GLY C O   1 
ATOM   4382 N  N   . VAL C 1 141 ? -14.297 -28.898 -17.239 1.00 54.39  ? 468 VAL C N   1 
ATOM   4383 C  CA  . VAL C 1 141 ? -13.859 -29.898 -18.220 1.00 55.70  ? 468 VAL C CA  1 
ATOM   4384 C  C   . VAL C 1 141 ? -12.777 -29.303 -19.131 1.00 55.00  ? 468 VAL C C   1 
ATOM   4385 O  O   . VAL C 1 141 ? -12.950 -28.219 -19.697 1.00 52.72  ? 468 VAL C O   1 
ATOM   4386 C  CB  . VAL C 1 141 ? -15.061 -30.480 -19.018 1.00 55.26  ? 468 VAL C CB  1 
ATOM   4387 C  CG1 . VAL C 1 141 ? -14.634 -31.030 -20.380 1.00 55.93  ? 468 VAL C CG1 1 
ATOM   4388 C  CG2 . VAL C 1 141 ? -15.734 -31.575 -18.198 1.00 56.47  ? 468 VAL C CG2 1 
ATOM   4389 N  N   . VAL C 1 142 ? -11.652 -30.004 -19.211 1.00 57.01  ? 469 VAL C N   1 
ATOM   4390 C  CA  . VAL C 1 142 ? -10.521 -29.611 -20.049 1.00 57.73  ? 469 VAL C CA  1 
ATOM   4391 C  C   . VAL C 1 142 ? -10.512 -30.520 -21.292 1.00 58.68  ? 469 VAL C C   1 
ATOM   4392 O  O   . VAL C 1 142 ? -10.504 -31.755 -21.169 1.00 60.90  ? 469 VAL C O   1 
ATOM   4393 C  CB  . VAL C 1 142 ? -9.159  -29.729 -19.288 1.00 60.68  ? 469 VAL C CB  1 
ATOM   4394 C  CG1 . VAL C 1 142 ? -8.051  -29.020 -20.059 1.00 62.40  ? 469 VAL C CG1 1 
ATOM   4395 C  CG2 . VAL C 1 142 ? -9.237  -29.172 -17.857 1.00 59.46  ? 469 VAL C CG2 1 
ATOM   4396 N  N   . LEU C 1 143 ? -10.525 -29.912 -22.477 1.00 56.91  ? 470 LEU C N   1 
ATOM   4397 C  CA  . LEU C 1 143 ? -10.346 -30.655 -23.737 1.00 58.49  ? 470 LEU C CA  1 
ATOM   4398 C  C   . LEU C 1 143 ? -9.247  -30.028 -24.589 1.00 60.33  ? 470 LEU C C   1 
ATOM   4399 O  O   . LEU C 1 143 ? -9.075  -28.805 -24.581 1.00 59.19  ? 470 LEU C O   1 
ATOM   4400 C  CB  . LEU C 1 143 ? -11.652 -30.706 -24.551 1.00 55.39  ? 470 LEU C CB  1 
ATOM   4401 C  CG  . LEU C 1 143 ? -12.910 -31.391 -24.003 1.00 53.45  ? 470 LEU C CG  1 
ATOM   4402 C  CD1 . LEU C 1 143 ? -14.108 -30.946 -24.828 1.00 51.14  ? 470 LEU C CD1 1 
ATOM   4403 C  CD2 . LEU C 1 143 ? -12.800 -32.906 -23.973 1.00 55.73  ? 470 LEU C CD2 1 
ATOM   4404 N  N   . HIS C 1 144 ? -8.508  -30.858 -25.323 1.00 63.39  ? 471 HIS C N   1 
ATOM   4405 C  CA  . HIS C 1 144 ? -7.565  -30.331 -26.311 1.00 65.66  ? 471 HIS C CA  1 
ATOM   4406 C  C   . HIS C 1 144 ? -8.313  -29.767 -27.526 1.00 63.58  ? 471 HIS C C   1 
ATOM   4407 O  O   . HIS C 1 144 ? -9.395  -30.245 -27.878 1.00 61.35  ? 471 HIS C O   1 
ATOM   4408 C  CB  . HIS C 1 144 ? -6.533  -31.383 -26.738 1.00 70.23  ? 471 HIS C CB  1 
ATOM   4409 C  CG  . HIS C 1 144 ? -5.301  -30.796 -27.363 1.00 73.51  ? 471 HIS C CG  1 
ATOM   4410 N  ND1 . HIS C 1 144 ? -5.203  -30.530 -28.714 1.00 74.49  ? 471 HIS C ND1 1 
ATOM   4411 C  CD2 . HIS C 1 144 ? -4.119  -30.414 -26.817 1.00 76.18  ? 471 HIS C CD2 1 
ATOM   4412 C  CE1 . HIS C 1 144 ? -4.011  -30.018 -28.973 1.00 77.64  ? 471 HIS C CE1 1 
ATOM   4413 N  NE2 . HIS C 1 144 ? -3.336  -29.935 -27.839 1.00 78.51  ? 471 HIS C NE2 1 
ATOM   4414 N  N   . ARG C 1 145 ? -7.724  -28.738 -28.134 1.00 64.48  ? 472 ARG C N   1 
ATOM   4415 C  CA  . ARG C 1 145 ? -8.181  -28.136 -29.393 1.00 64.01  ? 472 ARG C CA  1 
ATOM   4416 C  C   . ARG C 1 145 ? -8.508  -29.179 -30.472 1.00 65.17  ? 472 ARG C C   1 
ATOM   4417 O  O   . ARG C 1 145 ? -9.519  -29.049 -31.165 1.00 62.81  ? 472 ARG C O   1 
ATOM   4418 C  CB  . ARG C 1 145 ? -7.115  -27.155 -29.892 1.00 67.06  ? 472 ARG C CB  1 
ATOM   4419 C  CG  . ARG C 1 145 ? -7.453  -26.362 -31.149 1.00 66.96  ? 472 ARG C CG  1 
ATOM   4420 C  CD  . ARG C 1 145 ? -6.225  -25.609 -31.663 1.00 70.50  ? 472 ARG C CD  1 
ATOM   4421 N  NE  . ARG C 1 145 ? -5.113  -26.498 -32.011 1.00 75.15  ? 472 ARG C NE  1 
ATOM   4422 C  CZ  . ARG C 1 145 ? -5.009  -27.195 -33.151 1.00 77.76  ? 472 ARG C CZ  1 
ATOM   4423 N  NH1 . ARG C 1 145 ? -5.957  -27.130 -34.092 1.00 76.34  ? 472 ARG C NH1 1 
ATOM   4424 N  NH2 . ARG C 1 145 ? -3.955  -27.976 -33.350 1.00 81.39  ? 472 ARG C NH2 1 
ATOM   4425 N  N   . LEU C 1 146 ? -7.651  -30.199 -30.591 1.00 69.02  ? 473 LEU C N   1 
ATOM   4426 C  CA  . LEU C 1 146 ? -7.864  -31.347 -31.487 1.00 71.03  ? 473 LEU C CA  1 
ATOM   4427 C  C   . LEU C 1 146 ? -9.160  -32.113 -31.198 1.00 68.38  ? 473 LEU C C   1 
ATOM   4428 O  O   . LEU C 1 146 ? -9.825  -32.566 -32.127 1.00 68.47  ? 473 LEU C O   1 
ATOM   4429 C  CB  . LEU C 1 146 ? -6.654  -32.307 -31.479 1.00 75.60  ? 473 LEU C CB  1 
ATOM   4430 C  CG  . LEU C 1 146 ? -5.640  -32.211 -32.631 1.00 80.11  ? 473 LEU C CG  1 
ATOM   4431 C  CD1 . LEU C 1 146 ? -4.509  -31.240 -32.309 1.00 82.10  ? 473 LEU C CD1 1 
ATOM   4432 C  CD2 . LEU C 1 146 ? -5.056  -33.577 -32.981 1.00 84.36  ? 473 LEU C CD2 1 
ATOM   4433 N  N   . GLN C 1 147 ? -9.516  -32.242 -29.920 1.00 66.83  ? 474 GLN C N   1 
ATOM   4434 C  CA  . GLN C 1 147 ? -10.747 -32.939 -29.505 1.00 64.89  ? 474 GLN C CA  1 
ATOM   4435 C  C   . GLN C 1 147 ? -12.016 -32.153 -29.854 1.00 61.36  ? 474 GLN C C   1 
ATOM   4436 O  O   . GLN C 1 147 ? -13.103 -32.728 -30.022 1.00 60.59  ? 474 GLN C O   1 
ATOM   4437 C  CB  . GLN C 1 147 ? -10.722 -33.234 -28.005 1.00 64.27  ? 474 GLN C CB  1 
ATOM   4438 C  CG  . GLN C 1 147 ? -9.530  -34.061 -27.536 1.00 68.41  ? 474 GLN C CG  1 
ATOM   4439 C  CD  . GLN C 1 147 ? -9.616  -34.383 -26.060 1.00 68.15  ? 474 GLN C CD  1 
ATOM   4440 O  OE1 . GLN C 1 147 ? -9.033  -33.686 -25.225 1.00 68.21  ? 474 GLN C OE1 1 
ATOM   4441 N  NE2 . GLN C 1 147 ? -10.373 -35.420 -25.724 1.00 68.29  ? 474 GLN C NE2 1 
ATOM   4442 N  N   . CYS C 1 148 ? -11.872 -30.838 -29.967 1.00 59.82  ? 475 CYS C N   1 
ATOM   4443 C  CA  . CYS C 1 148 ? -12.999 -29.963 -30.257 1.00 56.85  ? 475 CYS C CA  1 
ATOM   4444 C  C   . CYS C 1 148 ? -13.331 -29.811 -31.743 1.00 57.86  ? 475 CYS C C   1 
ATOM   4445 O  O   . CYS C 1 148 ? -14.454 -29.402 -32.066 1.00 55.95  ? 475 CYS C O   1 
ATOM   4446 C  CB  . CYS C 1 148 ? -12.751 -28.595 -29.641 1.00 55.23  ? 475 CYS C CB  1 
ATOM   4447 S  SG  . CYS C 1 148 ? -12.697 -28.651 -27.846 1.00 54.40  ? 475 CYS C SG  1 
ATOM   4448 N  N   . VAL C 1 149 ? -12.374 -30.156 -32.620 1.00 60.61  ? 476 VAL C N   1 
ATOM   4449 C  CA  . VAL C 1 149 ? -12.438 -29.850 -34.056 1.00 61.89  ? 476 VAL C CA  1 
ATOM   4450 C  C   . VAL C 1 149 ? -13.646 -30.442 -34.790 1.00 61.57  ? 476 VAL C C   1 
ATOM   4451 O  O   . VAL C 1 149 ? -14.330 -29.729 -35.524 1.00 60.96  ? 476 VAL C O   1 
ATOM   4452 C  CB  . VAL C 1 149 ? -11.073 -30.078 -34.795 1.00 66.13  ? 476 VAL C CB  1 
ATOM   4453 C  CG1 . VAL C 1 149 ? -10.793 -31.548 -35.092 1.00 68.86  ? 476 VAL C CG1 1 
ATOM   4454 C  CG2 . VAL C 1 149 ? -11.004 -29.252 -36.072 1.00 67.04  ? 476 VAL C CG2 1 
ATOM   4455 N  N   . ARG C 1 150 ? -13.930 -31.724 -34.560 1.00 62.77  ? 477 ARG C N   1 
ATOM   4456 C  CA  . ARG C 1 150 ? -15.059 -32.388 -35.212 1.00 62.53  ? 477 ARG C CA  1 
ATOM   4457 C  C   . ARG C 1 150 ? -16.416 -31.779 -34.833 1.00 58.51  ? 477 ARG C C   1 
ATOM   4458 O  O   . ARG C 1 150 ? -17.278 -31.605 -35.699 1.00 57.96  ? 477 ARG C O   1 
ATOM   4459 C  CB  . ARG C 1 150 ? -15.026 -33.903 -34.998 1.00 65.57  ? 477 ARG C CB  1 
ATOM   4460 C  CG  . ARG C 1 150 ? -14.093 -34.609 -35.972 1.00 71.05  ? 477 ARG C CG  1 
ATOM   4461 C  CD  . ARG C 1 150 ? -14.628 -35.972 -36.390 1.00 74.11  ? 477 ARG C CD  1 
ATOM   4462 N  NE  . ARG C 1 150 ? -14.013 -37.075 -35.644 1.00 77.26  ? 477 ARG C NE  1 
ATOM   4463 C  CZ  . ARG C 1 150 ? -14.360 -38.358 -35.753 1.00 80.16  ? 477 ARG C CZ  1 
ATOM   4464 N  NH1 . ARG C 1 150 ? -15.332 -38.732 -36.578 1.00 80.53  ? 477 ARG C NH1 1 
ATOM   4465 N  NH2 . ARG C 1 150 ? -13.726 -39.280 -35.035 1.00 83.39  ? 477 ARG C NH2 1 
ATOM   4466 N  N   . GLY C 1 151 ? -16.584 -31.431 -33.558 1.00 56.18  ? 478 GLY C N   1 
ATOM   4467 C  CA  . GLY C 1 151 ? -17.819 -30.803 -33.067 1.00 52.42  ? 478 GLY C CA  1 
ATOM   4468 C  C   . GLY C 1 151 ? -17.948 -29.323 -33.385 1.00 50.72  ? 478 GLY C C   1 
ATOM   4469 O  O   . GLY C 1 151 ? -18.956 -28.882 -33.951 1.00 49.85  ? 478 GLY C O   1 
ATOM   4470 N  N   . PHE C 1 152 ? -16.923 -28.557 -33.021 1.00 50.93  ? 479 PHE C N   1 
ATOM   4471 C  CA  . PHE C 1 152 ? -16.908 -27.111 -33.237 1.00 50.21  ? 479 PHE C CA  1 
ATOM   4472 C  C   . PHE C 1 152 ? -16.712 -26.698 -34.705 1.00 52.44  ? 479 PHE C C   1 
ATOM   4473 O  O   . PHE C 1 152 ? -17.212 -25.651 -35.123 1.00 51.18  ? 479 PHE C O   1 
ATOM   4474 C  CB  . PHE C 1 152 ? -15.826 -26.457 -32.370 1.00 50.26  ? 479 PHE C CB  1 
ATOM   4475 C  CG  . PHE C 1 152 ? -16.195 -26.328 -30.917 1.00 47.98  ? 479 PHE C CG  1 
ATOM   4476 C  CD1 . PHE C 1 152 ? -16.481 -25.083 -30.376 1.00 46.12  ? 479 PHE C CD1 1 
ATOM   4477 C  CD2 . PHE C 1 152 ? -16.238 -27.455 -30.074 1.00 48.53  ? 479 PHE C CD2 1 
ATOM   4478 C  CE1 . PHE C 1 152 ? -16.821 -24.958 -29.022 1.00 44.83  ? 479 PHE C CE1 1 
ATOM   4479 C  CE2 . PHE C 1 152 ? -16.576 -27.334 -28.725 1.00 46.86  ? 479 PHE C CE2 1 
ATOM   4480 C  CZ  . PHE C 1 152 ? -16.868 -26.079 -28.201 1.00 44.62  ? 479 PHE C CZ  1 
ATOM   4481 N  N   . GLY C 1 153 ? -15.991 -27.525 -35.470 1.00 55.78  ? 480 GLY C N   1 
ATOM   4482 C  CA  . GLY C 1 153 ? -15.469 -27.143 -36.782 1.00 58.73  ? 480 GLY C CA  1 
ATOM   4483 C  C   . GLY C 1 153 ? -14.200 -26.323 -36.614 1.00 61.04  ? 480 GLY C C   1 
ATOM   4484 O  O   . GLY C 1 153 ? -13.619 -26.273 -35.517 1.00 60.15  ? 480 GLY C O   1 
ATOM   4485 N  N   . GLU C 1 154 ? -13.790 -25.670 -37.704 1.00 63.91  ? 481 GLU C N   1 
ATOM   4486 C  CA  . GLU C 1 154 ? -12.631 -24.760 -37.764 1.00 66.61  ? 481 GLU C CA  1 
ATOM   4487 C  C   . GLU C 1 154 ? -12.753 -23.606 -36.754 1.00 63.57  ? 481 GLU C C   1 
ATOM   4488 O  O   . GLU C 1 154 ? -11.749 -23.001 -36.365 1.00 64.58  ? 481 GLU C O   1 
ATOM   4489 C  CB  . GLU C 1 154 ? -12.499 -24.219 -39.203 1.00 71.28  ? 481 GLU C CB  1 
ATOM   4490 C  CG  . GLU C 1 154 ? -11.297 -23.325 -39.511 1.00 76.17  ? 481 GLU C CG  1 
ATOM   4491 C  CD  . GLU C 1 154 ? -10.178 -24.035 -40.260 1.00 82.30  ? 481 GLU C CD  1 
ATOM   4492 O  OE1 . GLU C 1 154 ? -10.459 -24.781 -41.228 1.00 85.23  ? 481 GLU C OE1 1 
ATOM   4493 O  OE2 . GLU C 1 154 ? -8.999  -23.826 -39.897 1.00 85.21  ? 481 GLU C OE2 1 
ATOM   4494 N  N   . TRP C 1 155 ? -13.994 -23.328 -36.340 1.00 59.57  ? 482 TRP C N   1 
ATOM   4495 C  CA  . TRP C 1 155 ? -14.343 -22.293 -35.362 1.00 56.69  ? 482 TRP C CA  1 
ATOM   4496 C  C   . TRP C 1 155 ? -13.483 -22.264 -34.088 1.00 56.80  ? 482 TRP C C   1 
ATOM   4497 O  O   . TRP C 1 155 ? -13.228 -21.172 -33.568 1.00 56.35  ? 482 TRP C O   1 
ATOM   4498 C  CB  . TRP C 1 155 ? -15.843 -22.364 -35.004 1.00 52.88  ? 482 TRP C CB  1 
ATOM   4499 C  CG  . TRP C 1 155 ? -16.353 -21.197 -34.169 1.00 50.27  ? 482 TRP C CG  1 
ATOM   4500 C  CD1 . TRP C 1 155 ? -16.033 -19.875 -34.323 1.00 50.71  ? 482 TRP C CD1 1 
ATOM   4501 C  CD2 . TRP C 1 155 ? -17.279 -21.255 -33.072 1.00 46.77  ? 482 TRP C CD2 1 
ATOM   4502 N  NE1 . TRP C 1 155 ? -16.688 -19.114 -33.395 1.00 48.64  ? 482 TRP C NE1 1 
ATOM   4503 C  CE2 . TRP C 1 155 ? -17.457 -19.930 -32.609 1.00 46.00  ? 482 TRP C CE2 1 
ATOM   4504 C  CE3 . TRP C 1 155 ? -17.973 -22.290 -32.440 1.00 45.34  ? 482 TRP C CE3 1 
ATOM   4505 C  CZ2 . TRP C 1 155 ? -18.302 -19.613 -31.546 1.00 43.92  ? 482 TRP C CZ2 1 
ATOM   4506 C  CZ3 . TRP C 1 155 ? -18.822 -21.975 -31.364 1.00 43.38  ? 482 TRP C CZ3 1 
ATOM   4507 C  CH2 . TRP C 1 155 ? -18.979 -20.643 -30.936 1.00 42.72  ? 482 TRP C CH2 1 
ATOM   4508 N  N   . ILE C 1 156 ? -13.043 -23.435 -33.590 1.00 57.56  ? 483 ILE C N   1 
ATOM   4509 C  CA  . ILE C 1 156 ? -12.107 -23.476 -32.431 1.00 57.69  ? 483 ILE C CA  1 
ATOM   4510 C  C   . ILE C 1 156 ? -10.737 -22.892 -32.711 1.00 60.29  ? 483 ILE C C   1 
ATOM   4511 O  O   . ILE C 1 156 ? -10.118 -22.364 -31.791 1.00 60.74  ? 483 ILE C O   1 
ATOM   4512 C  CB  . ILE C 1 156 ? -11.904 -24.858 -31.729 1.00 58.46  ? 483 ILE C CB  1 
ATOM   4513 C  CG1 . ILE C 1 156 ? -12.057 -26.046 -32.683 1.00 60.22  ? 483 ILE C CG1 1 
ATOM   4514 C  CG2 . ILE C 1 156 ? -12.800 -24.974 -30.496 1.00 55.65  ? 483 ILE C CG2 1 
ATOM   4515 C  CD1 . ILE C 1 156 ? -10.815 -26.393 -33.463 1.00 64.21  ? 483 ILE C CD1 1 
ATOM   4516 N  N   . ASP C 1 157 ? -10.272 -22.971 -33.960 1.00 62.23  ? 484 ASP C N   1 
ATOM   4517 C  CA  . ASP C 1 157 ? -9.007  -22.330 -34.340 1.00 65.01  ? 484 ASP C CA  1 
ATOM   4518 C  C   . ASP C 1 157 ? -9.125  -20.807 -34.167 1.00 63.40  ? 484 ASP C C   1 
ATOM   4519 O  O   . ASP C 1 157 ? -8.263  -20.179 -33.549 1.00 64.17  ? 484 ASP C O   1 
ATOM   4520 C  CB  . ASP C 1 157 ? -8.563  -22.723 -35.766 1.00 68.97  ? 484 ASP C CB  1 
ATOM   4521 C  CG  . ASP C 1 157 ? -8.411  -24.250 -35.960 1.00 70.52  ? 484 ASP C CG  1 
ATOM   4522 O  OD1 . ASP C 1 157 ? -8.275  -25.000 -34.963 1.00 69.62  ? 484 ASP C OD1 1 
ATOM   4523 O  OD2 . ASP C 1 157 ? -8.414  -24.700 -37.132 1.00 72.56  ? 484 ASP C OD2 1 
ATOM   4524 N  N   . SER C 1 158 ? -10.224 -20.244 -34.670 1.00 60.83  ? 485 SER C N   1 
ATOM   4525 C  CA  . SER C 1 158 ? -10.575 -18.833 -34.474 1.00 60.19  ? 485 SER C CA  1 
ATOM   4526 C  C   . SER C 1 158 ? -10.697 -18.463 -32.988 1.00 57.97  ? 485 SER C C   1 
ATOM   4527 O  O   . SER C 1 158 ? -10.286 -17.374 -32.578 1.00 58.58  ? 485 SER C O   1 
ATOM   4528 C  CB  . SER C 1 158 ? -11.902 -18.519 -35.172 1.00 58.77  ? 485 SER C CB  1 
ATOM   4529 O  OG  . SER C 1 158 ? -11.871 -18.806 -36.558 1.00 60.48  ? 485 SER C OG  1 
ATOM   4530 N  N   . ILE C 1 159 ? -11.268 -19.380 -32.202 1.00 55.34  ? 486 ILE C N   1 
ATOM   4531 C  CA  . ILE C 1 159 ? -11.407 -19.233 -30.753 1.00 53.21  ? 486 ILE C CA  1 
ATOM   4532 C  C   . ILE C 1 159 ? -10.033 -19.259 -30.072 1.00 55.36  ? 486 ILE C C   1 
ATOM   4533 O  O   . ILE C 1 159 ? -9.720  -18.346 -29.302 1.00 56.07  ? 486 ILE C O   1 
ATOM   4534 C  CB  . ILE C 1 159 ? -12.404 -20.272 -30.148 1.00 50.48  ? 486 ILE C CB  1 
ATOM   4535 C  CG1 . ILE C 1 159 ? -13.859 -19.927 -30.552 1.00 48.04  ? 486 ILE C CG1 1 
ATOM   4536 C  CG2 . ILE C 1 159 ? -12.263 -20.348 -28.626 1.00 49.17  ? 486 ILE C CG2 1 
ATOM   4537 C  CD1 . ILE C 1 159 ? -14.885 -21.040 -30.370 1.00 45.86  ? 486 ILE C CD1 1 
ATOM   4538 N  N   . VAL C 1 160 ? -9.215  -20.270 -30.377 1.00 57.32  ? 487 VAL C N   1 
ATOM   4539 C  CA  . VAL C 1 160 ? -7.883  -20.428 -29.764 1.00 59.87  ? 487 VAL C CA  1 
ATOM   4540 C  C   . VAL C 1 160 ? -7.007  -19.216 -30.086 1.00 62.84  ? 487 VAL C C   1 
ATOM   4541 O  O   . VAL C 1 160 ? -6.283  -18.717 -29.216 1.00 63.65  ? 487 VAL C O   1 
ATOM   4542 C  CB  . VAL C 1 160 ? -7.204  -21.766 -30.169 1.00 62.09  ? 487 VAL C CB  1 
ATOM   4543 C  CG1 . VAL C 1 160 ? -5.727  -21.789 -29.797 1.00 65.68  ? 487 VAL C CG1 1 
ATOM   4544 C  CG2 . VAL C 1 160 ? -7.898  -22.940 -29.496 1.00 59.80  ? 487 VAL C CG2 1 
ATOM   4545 N  N   . GLU C 1 161 ? -7.113  -18.740 -31.330 1.00 65.01  ? 488 GLU C N   1 
ATOM   4546 C  CA  . GLU C 1 161 ? -6.412  -17.543 -31.810 1.00 68.11  ? 488 GLU C CA  1 
ATOM   4547 C  C   . GLU C 1 161 ? -6.844  -16.299 -31.017 1.00 66.18  ? 488 GLU C C   1 
ATOM   4548 O  O   . GLU C 1 161 ? -5.989  -15.560 -30.519 1.00 68.13  ? 488 GLU C O   1 
ATOM   4549 C  CB  . GLU C 1 161 ? -6.669  -17.350 -33.312 1.00 70.14  ? 488 GLU C CB  1 
ATOM   4550 C  CG  . GLU C 1 161 ? -5.555  -16.669 -34.104 1.00 75.49  ? 488 GLU C CG  1 
ATOM   4551 C  CD  . GLU C 1 161 ? -5.992  -16.207 -35.497 1.00 77.32  ? 488 GLU C CD  1 
ATOM   4552 O  OE1 . GLU C 1 161 ? -7.195  -16.334 -35.866 1.00 74.64  ? 488 GLU C OE1 1 
ATOM   4553 O  OE2 . GLU C 1 161 ? -5.123  -15.692 -36.232 1.00 81.31  ? 488 GLU C OE2 1 
ATOM   4554 N  N   . PHE C 1 162 ? -8.162  -16.089 -30.896 1.00 62.43  ? 489 PHE C N   1 
ATOM   4555 C  CA  . PHE C 1 162 ? -8.729  -14.960 -30.142 1.00 60.46  ? 489 PHE C CA  1 
ATOM   4556 C  C   . PHE C 1 162 ? -8.337  -15.039 -28.667 1.00 59.45  ? 489 PHE C C   1 
ATOM   4557 O  O   . PHE C 1 162 ? -8.051  -14.014 -28.053 1.00 60.24  ? 489 PHE C O   1 
ATOM   4558 C  CB  . PHE C 1 162 ? -10.263 -14.899 -30.299 1.00 57.47  ? 489 PHE C CB  1 
ATOM   4559 C  CG  . PHE C 1 162 ? -10.939 -13.907 -29.377 1.00 55.52  ? 489 PHE C CG  1 
ATOM   4560 C  CD1 . PHE C 1 162 ? -11.128 -12.581 -29.774 1.00 56.68  ? 489 PHE C CD1 1 
ATOM   4561 C  CD2 . PHE C 1 162 ? -11.375 -14.294 -28.100 1.00 52.66  ? 489 PHE C CD2 1 
ATOM   4562 C  CE1 . PHE C 1 162 ? -11.731 -11.661 -28.924 1.00 55.28  ? 489 PHE C CE1 1 
ATOM   4563 C  CE2 . PHE C 1 162 ? -11.973 -13.374 -27.248 1.00 51.61  ? 489 PHE C CE2 1 
ATOM   4564 C  CZ  . PHE C 1 162 ? -12.152 -12.056 -27.660 1.00 52.68  ? 489 PHE C CZ  1 
ATOM   4565 N  N   . SER C 1 163 ? -8.349  -16.254 -28.115 1.00 58.32  ? 490 SER C N   1 
ATOM   4566 C  CA  . SER C 1 163 ? -7.860  -16.534 -26.760 1.00 58.43  ? 490 SER C CA  1 
ATOM   4567 C  C   . SER C 1 163 ? -6.420  -16.045 -26.526 1.00 62.42  ? 490 SER C C   1 
ATOM   4568 O  O   . SER C 1 163 ? -6.143  -15.384 -25.511 1.00 62.16  ? 490 SER C O   1 
ATOM   4569 C  CB  . SER C 1 163 ? -7.982  -18.029 -26.455 1.00 57.07  ? 490 SER C CB  1 
ATOM   4570 O  OG  . SER C 1 163 ? -7.620  -18.298 -25.117 1.00 56.88  ? 490 SER C OG  1 
ATOM   4571 N  N   . SER C 1 164 ? -5.528  -16.356 -27.476 1.00 66.51  ? 491 SER C N   1 
ATOM   4572 C  CA  . SER C 1 164 ? -4.138  -15.875 -27.465 1.00 71.08  ? 491 SER C CA  1 
ATOM   4573 C  C   . SER C 1 164 ? -4.049  -14.349 -27.431 1.00 72.27  ? 491 SER C C   1 
ATOM   4574 O  O   . SER C 1 164 ? -3.372  -13.762 -26.497 1.00 74.03  ? 491 SER C O   1 
ATOM   4575 C  CB  . SER C 1 164 ? -3.349  -16.407 -28.670 1.00 75.17  ? 491 SER C CB  1 
ATOM   4576 O  OG  . SER C 1 164 ? -3.116  -17.799 -28.554 1.00 76.11  ? 491 SER C OG  1 
ATOM   4577 N  N   . ASN C 1 165 ? -4.738  -13.716 -28.429 1.00 72.20  ? 492 ASN C N   1 
ATOM   4578 C  CA  . ASN C 1 165 ? -4.742  -12.256 -28.547 1.00 74.08  ? 492 ASN C CA  1 
ATOM   4579 C  C   . ASN C 1 165 ? -5.262  -11.567 -27.278 1.00 72.05  ? 492 ASN C C   1 
ATOM   4580 O  O   . ASN C 1 165 ? -4.680  -10.573 -26.819 1.00 73.65  ? 492 ASN C O   1 
ATOM   4581 C  CB  . ASN C 1 165 ? -5.528  -11.819 -29.793 1.00 74.06  ? 492 ASN C CB  1 
ATOM   4582 C  CG  . ASN C 1 165 ? -4.673  -11.814 -31.055 1.00 78.64  ? 492 ASN C CG  1 
ATOM   4583 O  OD1 . ASN C 1 165 ? -3.627  -11.161 -31.109 1.00 82.68  ? 492 ASN C OD1 1 
ATOM   4584 N  ND2 . ASN C 1 165 ? -5.119  -12.536 -32.082 1.00 78.05  ? 492 ASN C ND2 1 
ATOM   4585 N  N   . LEU C 1 166 ? -6.327  -12.135 -26.703 1.00 68.55  ? 493 LEU C N   1 
ATOM   4586 C  CA  . LEU C 1 166 ? -6.926  -11.641 -25.458 1.00 66.42  ? 493 LEU C CA  1 
ATOM   4587 C  C   . LEU C 1 166 ? -5.984  -11.758 -24.264 1.00 67.26  ? 493 LEU C C   1 
ATOM   4588 O  O   . LEU C 1 166 ? -5.827  -10.795 -23.510 1.00 67.85  ? 493 LEU C O   1 
ATOM   4589 C  CB  . LEU C 1 166 ? -8.250  -12.355 -25.161 1.00 62.56  ? 493 LEU C CB  1 
ATOM   4590 C  CG  . LEU C 1 166 ? -9.153  -11.800 -24.054 1.00 60.07  ? 493 LEU C CG  1 
ATOM   4591 C  CD1 . LEU C 1 166 ? -9.902  -10.572 -24.563 1.00 60.65  ? 493 LEU C CD1 1 
ATOM   4592 C  CD2 . LEU C 1 166 ? -10.117 -12.886 -23.578 1.00 56.35  ? 493 LEU C CD2 1 
ATOM   4593 N  N   . GLN C 1 167 ? -5.364  -12.926 -24.100 1.00 68.03  ? 494 GLN C N   1 
ATOM   4594 C  CA  . GLN C 1 167 ? -4.392  -13.126 -23.020 1.00 70.51  ? 494 GLN C CA  1 
ATOM   4595 C  C   . GLN C 1 167 ? -3.125  -12.285 -23.115 1.00 74.33  ? 494 GLN C C   1 
ATOM   4596 O  O   . GLN C 1 167 ? -2.641  -11.815 -22.087 1.00 74.90  ? 494 GLN C O   1 
ATOM   4597 C  CB  . GLN C 1 167 ? -4.063  -14.605 -22.822 1.00 71.18  ? 494 GLN C CB  1 
ATOM   4598 C  CG  . GLN C 1 167 ? -4.967  -15.226 -21.761 1.00 68.26  ? 494 GLN C CG  1 
ATOM   4599 C  CD  . GLN C 1 167 ? -4.904  -16.738 -21.704 1.00 68.01  ? 494 GLN C CD  1 
ATOM   4600 O  OE1 . GLN C 1 167 ? -5.914  -17.397 -21.927 1.00 65.99  ? 494 GLN C OE1 1 
ATOM   4601 N  NE2 . GLN C 1 167 ? -3.733  -17.294 -21.390 1.00 70.47  ? 494 GLN C NE2 1 
ATOM   4602 N  N   . ASN C 1 168 ? -2.631  -12.065 -24.340 1.00 77.64  ? 495 ASN C N   1 
ATOM   4603 C  CA  . ASN C 1 168 ? -1.460  -11.197 -24.611 1.00 82.48  ? 495 ASN C CA  1 
ATOM   4604 C  C   . ASN C 1 168 ? -1.578  -9.777  -24.049 1.00 83.07  ? 495 ASN C C   1 
ATOM   4605 O  O   . ASN C 1 168 ? -0.571  -9.138  -23.755 1.00 87.01  ? 495 ASN C O   1 
ATOM   4606 C  CB  . ASN C 1 168 ? -1.184  -11.108 -26.123 1.00 85.23  ? 495 ASN C CB  1 
ATOM   4607 C  CG  . ASN C 1 168 ? -0.788  -12.566 -26.797 1.00 86.22  ? 495 ASN C CG  1 
ATOM   4608 O  OD1 . ASN C 1 168 ? -0.634  -12.663 -28.021 1.00 88.16  ? 495 ASN C OD1 1 
ATOM   4609 N  ND2 . ASN C 1 168 ? -0.395  -13.664 -25.982 1.00 85.60  ? 495 ASN C ND2 1 
ATOM   4610 N  N   . MET C 1 169 ? -2.813  -9.299  -23.909 1.00 80.43  ? 496 MET C N   1 
ATOM   4611 C  CA  . MET C 1 169 ? -3.108  -7.976  -23.352 1.00 80.83  ? 496 MET C CA  1 
ATOM   4612 C  C   . MET C 1 169 ? -3.058  -7.888  -21.818 1.00 79.51  ? 496 MET C C   1 
ATOM   4613 O  O   . MET C 1 169 ? -3.208  -6.791  -21.273 1.00 80.65  ? 496 MET C O   1 
ATOM   4614 C  CB  . MET C 1 169 ? -4.468  -7.492  -23.845 1.00 78.72  ? 496 MET C CB  1 
ATOM   4615 C  CG  . MET C 1 169 ? -4.545  -7.223  -25.336 1.00 81.07  ? 496 MET C CG  1 
ATOM   4616 S  SD  . MET C 1 169 ? -6.213  -6.725  -25.799 1.00 79.51  ? 496 MET C SD  1 
ATOM   4617 C  CE  . MET C 1 169 ? -6.305  -5.093  -25.070 1.00 81.04  ? 496 MET C CE  1 
ATOM   4618 N  N   . ASN C 1 170 ? -2.849  -9.030  -21.145 1.00 77.87  ? 497 ASN C N   1 
ATOM   4619 C  CA  . ASN C 1 170 ? -2.697  -9.135  -19.672 1.00 76.94  ? 497 ASN C CA  1 
ATOM   4620 C  C   . ASN C 1 170 ? -3.819  -8.461  -18.871 1.00 73.94  ? 497 ASN C C   1 
ATOM   4621 O  O   . ASN C 1 170 ? -3.570  -7.673  -17.951 1.00 75.72  ? 497 ASN C O   1 
ATOM   4622 C  CB  . ASN C 1 170 ? -1.312  -8.643  -19.204 1.00 81.18  ? 497 ASN C CB  1 
ATOM   4623 C  CG  . ASN C 1 170 ? -0.161  -9.518  -19.694 1.00 84.60  ? 497 ASN C CG  1 
ATOM   4624 O  OD1 . ASN C 1 170 ? 0.985   -9.061  -19.746 1.00 89.16  ? 497 ASN C OD1 1 
ATOM   4625 N  ND2 . ASN C 1 170 ? -0.449  -10.772 -20.047 1.00 82.45  ? 497 ASN C ND2 1 
ATOM   4626 N  N   . ILE C 1 171 ? -5.053  -8.789  -19.240 1.00 70.09  ? 498 ILE C N   1 
ATOM   4627 C  CA  . ILE C 1 171 ? -6.246  -8.202  -18.645 1.00 67.02  ? 498 ILE C CA  1 
ATOM   4628 C  C   . ILE C 1 171 ? -6.496  -8.848  -17.286 1.00 64.56  ? 498 ILE C C   1 
ATOM   4629 O  O   . ILE C 1 171 ? -6.756  -10.053 -17.209 1.00 63.34  ? 498 ILE C O   1 
ATOM   4630 C  CB  . ILE C 1 171 ? -7.480  -8.410  -19.557 1.00 64.70  ? 498 ILE C CB  1 
ATOM   4631 C  CG1 . ILE C 1 171 ? -7.196  -7.925  -20.986 1.00 66.97  ? 498 ILE C CG1 1 
ATOM   4632 C  CG2 . ILE C 1 171 ? -8.704  -7.710  -18.985 1.00 62.47  ? 498 ILE C CG2 1 
ATOM   4633 C  CD1 . ILE C 1 171 ? -8.064  -8.585  -22.046 1.00 65.33  ? 498 ILE C CD1 1 
ATOM   4634 N  N   . ASP C 1 172 ? -6.416  -8.047  -16.223 1.00 64.38  ? 499 ASP C N   1 
ATOM   4635 C  CA  . ASP C 1 172 ? -6.771  -8.512  -14.881 1.00 62.46  ? 499 ASP C CA  1 
ATOM   4636 C  C   . ASP C 1 172 ? -8.285  -8.809  -14.737 1.00 58.88  ? 499 ASP C C   1 
ATOM   4637 O  O   . ASP C 1 172 ? -9.085  -8.483  -15.640 1.00 58.05  ? 499 ASP C O   1 
ATOM   4638 C  CB  . ASP C 1 172 ? -6.259  -7.542  -13.796 1.00 64.54  ? 499 ASP C CB  1 
ATOM   4639 C  CG  . ASP C 1 172 ? -6.938  -6.165  -13.823 1.00 64.87  ? 499 ASP C CG  1 
ATOM   4640 O  OD1 . ASP C 1 172 ? -8.008  -5.969  -14.441 1.00 63.51  ? 499 ASP C OD1 1 
ATOM   4641 O  OD2 . ASP C 1 172 ? -6.386  -5.252  -13.186 1.00 67.22  ? 499 ASP C OD2 1 
ATOM   4642 N  N   . ILE C 1 173 ? -8.653  -9.426  -13.610 1.00 56.64  ? 500 ILE C N   1 
ATOM   4643 C  CA  . ILE C 1 173 ? -10.031 -9.842  -13.313 1.00 53.05  ? 500 ILE C CA  1 
ATOM   4644 C  C   . ILE C 1 173 ? -11.015 -8.653  -13.320 1.00 51.81  ? 500 ILE C C   1 
ATOM   4645 O  O   . ILE C 1 173 ? -12.118 -8.769  -13.847 1.00 49.84  ? 500 ILE C O   1 
ATOM   4646 C  CB  . ILE C 1 173 ? -10.099 -10.720 -12.021 1.00 52.77  ? 500 ILE C CB  1 
ATOM   4647 C  CG1 . ILE C 1 173 ? -9.322  -12.025 -12.246 1.00 53.87  ? 500 ILE C CG1 1 
ATOM   4648 C  CG2 . ILE C 1 173 ? -11.527 -11.150 -11.691 1.00 50.03  ? 500 ILE C CG2 1 
ATOM   4649 C  CD1 . ILE C 1 173 ? -8.691  -12.663 -11.019 1.00 56.00  ? 500 ILE C CD1 1 
ATOM   4650 N  N   . SER C 1 174 ? -10.590 -7.509  -12.790 1.00 53.50  ? 501 SER C N   1 
ATOM   4651 C  CA  . SER C 1 174 ? -11.438 -6.318  -12.710 1.00 53.04  ? 501 SER C CA  1 
ATOM   4652 C  C   . SER C 1 174 ? -11.800 -5.767  -14.079 1.00 52.91  ? 501 SER C C   1 
ATOM   4653 O  O   . SER C 1 174 ? -12.972 -5.486  -14.332 1.00 51.34  ? 501 SER C O   1 
ATOM   4654 C  CB  . SER C 1 174 ? -10.796 -5.239  -11.840 1.00 55.82  ? 501 SER C CB  1 
ATOM   4655 O  OG  . SER C 1 174 ? -10.613 -5.695  -10.508 1.00 55.87  ? 501 SER C OG  1 
ATOM   4656 N  N   . ALA C 1 175 ? -10.804 -5.640  -14.960 1.00 54.62  ? 502 ALA C N   1 
ATOM   4657 C  CA  . ALA C 1 175 ? -11.035 -5.179  -16.331 1.00 54.99  ? 502 ALA C CA  1 
ATOM   4658 C  C   . ALA C 1 175 ? -11.876 -6.177  -17.123 1.00 52.50  ? 502 ALA C C   1 
ATOM   4659 O  O   . ALA C 1 175 ? -12.848 -5.785  -17.800 1.00 51.69  ? 502 ALA C O   1 
ATOM   4660 C  CB  . ALA C 1 175 ? -9.730  -4.893  -17.048 1.00 57.67  ? 502 ALA C CB  1 
ATOM   4661 N  N   . PHE C 1 176 ? -11.517 -7.459  -17.017 1.00 51.14  ? 503 PHE C N   1 
ATOM   4662 C  CA  . PHE C 1 176 ? -12.227 -8.502  -17.738 1.00 48.94  ? 503 PHE C CA  1 
ATOM   4663 C  C   . PHE C 1 176 ? -13.706 -8.507  -17.367 1.00 46.93  ? 503 PHE C C   1 
ATOM   4664 O  O   . PHE C 1 176 ? -14.584 -8.594  -18.245 1.00 46.01  ? 503 PHE C O   1 
ATOM   4665 C  CB  . PHE C 1 176 ? -11.620 -9.893  -17.528 1.00 48.31  ? 503 PHE C CB  1 
ATOM   4666 C  CG  . PHE C 1 176 ? -12.327 -10.957 -18.319 1.00 46.58  ? 503 PHE C CG  1 
ATOM   4667 C  CD1 . PHE C 1 176 ? -12.185 -11.018 -19.711 1.00 47.40  ? 503 PHE C CD1 1 
ATOM   4668 C  CD2 . PHE C 1 176 ? -13.194 -11.847 -17.698 1.00 44.17  ? 503 PHE C CD2 1 
ATOM   4669 C  CE1 . PHE C 1 176 ? -12.873 -11.975 -20.456 1.00 45.98  ? 503 PHE C CE1 1 
ATOM   4670 C  CE2 . PHE C 1 176 ? -13.883 -12.805 -18.440 1.00 42.44  ? 503 PHE C CE2 1 
ATOM   4671 C  CZ  . PHE C 1 176 ? -13.720 -12.872 -19.817 1.00 42.93  ? 503 PHE C CZ  1 
ATOM   4672 N  N   . SER C 1 177 ? -13.974 -8.392  -16.069 1.00 46.44  ? 504 SER C N   1 
ATOM   4673 C  CA  . SER C 1 177 ? -15.343 -8.415  -15.571 1.00 44.68  ? 504 SER C CA  1 
ATOM   4674 C  C   . SER C 1 177 ? -16.183 -7.348  -16.254 1.00 44.99  ? 504 SER C C   1 
ATOM   4675 O  O   . SER C 1 177 ? -17.343 -7.591  -16.534 1.00 43.99  ? 504 SER C O   1 
ATOM   4676 C  CB  . SER C 1 177 ? -15.376 -8.266  -14.055 1.00 44.30  ? 504 SER C CB  1 
ATOM   4677 O  OG  . SER C 1 177 ? -14.755 -9.380  -13.453 1.00 43.70  ? 504 SER C OG  1 
ATOM   4678 N  N   . CYS C 1 178 ? -15.572 -6.195  -16.538 1.00 47.43  ? 505 CYS C N   1 
ATOM   4679 C  CA  . CYS C 1 178 ? -16.215 -5.093  -17.251 1.00 48.82  ? 505 CYS C CA  1 
ATOM   4680 C  C   . CYS C 1 178 ? -16.428 -5.403  -18.723 1.00 48.56  ? 505 CYS C C   1 
ATOM   4681 O  O   . CYS C 1 178 ? -17.510 -5.156  -19.244 1.00 48.08  ? 505 CYS C O   1 
ATOM   4682 C  CB  . CYS C 1 178 ? -15.393 -3.820  -17.124 1.00 52.10  ? 505 CYS C CB  1 
ATOM   4683 S  SG  . CYS C 1 178 ? -15.208 -3.238  -15.433 1.00 52.95  ? 505 CYS C SG  1 
ATOM   4684 N  N   . ILE C 1 179 ? -15.397 -5.939  -19.384 1.00 49.02  ? 506 ILE C N   1 
ATOM   4685 C  CA  . ILE C 1 179 ? -15.487 -6.350  -20.797 1.00 48.40  ? 506 ILE C CA  1 
ATOM   4686 C  C   . ILE C 1 179 ? -16.622 -7.367  -20.998 1.00 45.21  ? 506 ILE C C   1 
ATOM   4687 O  O   . ILE C 1 179 ? -17.458 -7.201  -21.907 1.00 45.22  ? 506 ILE C O   1 
ATOM   4688 C  CB  . ILE C 1 179 ? -14.138 -6.891  -21.352 1.00 49.44  ? 506 ILE C CB  1 
ATOM   4689 C  CG1 . ILE C 1 179 ? -12.994 -5.882  -21.165 1.00 52.72  ? 506 ILE C CG1 1 
ATOM   4690 C  CG2 . ILE C 1 179 ? -14.266 -7.305  -22.816 1.00 49.67  ? 506 ILE C CG2 1 
ATOM   4691 C  CD1 . ILE C 1 179 ? -13.136 -4.575  -21.927 1.00 55.92  ? 506 ILE C CD1 1 
ATOM   4692 N  N   . ALA C 1 180 ? -16.663 -8.385  -20.136 1.00 42.56  ? 507 ALA C N   1 
ATOM   4693 C  CA  . ALA C 1 180 ? -17.707 -9.406  -20.189 1.00 40.50  ? 507 ALA C CA  1 
ATOM   4694 C  C   . ALA C 1 180 ? -19.097 -8.788  -20.041 1.00 40.47  ? 507 ALA C C   1 
ATOM   4695 O  O   . ALA C 1 180 ? -20.015 -9.131  -20.794 1.00 39.60  ? 507 ALA C O   1 
ATOM   4696 C  CB  . ALA C 1 180 ? -17.471 -10.483 -19.153 1.00 38.93  ? 507 ALA C CB  1 
ATOM   4697 N  N   . ALA C 1 181 ? -19.217 -7.841  -19.108 1.00 41.29  ? 508 ALA C N   1 
ATOM   4698 C  CA  . ALA C 1 181 ? -20.454 -7.105  -18.886 1.00 42.04  ? 508 ALA C CA  1 
ATOM   4699 C  C   . ALA C 1 181 ? -20.844 -6.270  -20.113 1.00 43.95  ? 508 ALA C C   1 
ATOM   4700 O  O   . ALA C 1 181 ? -22.014 -6.282  -20.523 1.00 44.43  ? 508 ALA C O   1 
ATOM   4701 C  CB  . ALA C 1 181 ? -20.345 -6.234  -17.638 1.00 42.96  ? 508 ALA C CB  1 
ATOM   4702 N  N   . LEU C 1 182 ? -19.864 -5.580  -20.703 1.00 45.82  ? 509 LEU C N   1 
ATOM   4703 C  CA  . LEU C 1 182 ? -20.074 -4.770  -21.910 1.00 48.07  ? 509 LEU C CA  1 
ATOM   4704 C  C   . LEU C 1 182 ? -20.484 -5.570  -23.134 1.00 47.73  ? 509 LEU C C   1 
ATOM   4705 O  O   . LEU C 1 182 ? -21.257 -5.080  -23.949 1.00 49.10  ? 509 LEU C O   1 
ATOM   4706 C  CB  . LEU C 1 182 ? -18.864 -3.884  -22.209 1.00 50.14  ? 509 LEU C CB  1 
ATOM   4707 C  CG  . LEU C 1 182 ? -18.614 -2.799  -21.149 1.00 51.55  ? 509 LEU C CG  1 
ATOM   4708 C  CD1 . LEU C 1 182 ? -17.241 -2.167  -21.314 1.00 53.69  ? 509 LEU C CD1 1 
ATOM   4709 C  CD2 . LEU C 1 182 ? -19.725 -1.759  -21.112 1.00 53.14  ? 509 LEU C CD2 1 
ATOM   4710 N  N   . ALA C 1 183 ? -19.999 -6.810  -23.240 1.00 47.19  ? 510 ALA C N   1 
ATOM   4711 C  CA  . ALA C 1 183 ? -20.456 -7.737  -24.275 1.00 46.45  ? 510 ALA C CA  1 
ATOM   4712 C  C   . ALA C 1 183 ? -21.963 -7.971  -24.186 1.00 46.54  ? 510 ALA C C   1 
ATOM   4713 O  O   . ALA C 1 183 ? -22.639 -8.176  -25.217 1.00 46.26  ? 510 ALA C O   1 
ATOM   4714 C  CB  . ALA C 1 183 ? -19.700 -9.050  -24.194 1.00 45.08  ? 510 ALA C CB  1 
ATOM   4715 N  N   . MET C 1 184 ? -22.496 -7.933  -22.963 1.00 46.64  ? 511 MET C N   1 
ATOM   4716 C  CA  . MET C 1 184 ? -23.932 -8.106  -22.794 1.00 46.51  ? 511 MET C CA  1 
ATOM   4717 C  C   . MET C 1 184 ? -24.764 -6.823  -22.726 1.00 47.47  ? 511 MET C C   1 
ATOM   4718 O  O   . MET C 1 184 ? -25.826 -6.740  -23.361 1.00 47.06  ? 511 MET C O   1 
ATOM   4719 C  CB  . MET C 1 184 ? -24.270 -9.030  -21.631 1.00 46.55  ? 511 MET C CB  1 
ATOM   4720 C  CG  . MET C 1 184 ? -25.687 -9.554  -21.815 1.00 48.11  ? 511 MET C CG  1 
ATOM   4721 S  SD  . MET C 1 184 ? -26.302 -10.484 -20.440 1.00 49.74  ? 511 MET C SD  1 
ATOM   4722 C  CE  . MET C 1 184 ? -25.987 -9.291  -19.130 1.00 49.93  ? 511 MET C CE  1 
ATOM   4723 N  N   . VAL C 1 185 ? -24.297 -5.851  -21.944 1.00 48.22  ? 512 VAL C N   1 
ATOM   4724 C  CA  . VAL C 1 185 ? -25.026 -4.601  -21.750 1.00 50.50  ? 512 VAL C CA  1 
ATOM   4725 C  C   . VAL C 1 185 ? -24.667 -3.699  -22.926 1.00 52.95  ? 512 VAL C C   1 
ATOM   4726 O  O   . VAL C 1 185 ? -23.697 -2.934  -22.889 1.00 54.08  ? 512 VAL C O   1 
ATOM   4727 C  CB  . VAL C 1 185 ? -24.757 -3.974  -20.360 1.00 51.36  ? 512 VAL C CB  1 
ATOM   4728 C  CG1 . VAL C 1 185 ? -25.651 -2.757  -20.111 1.00 53.23  ? 512 VAL C CG1 1 
ATOM   4729 C  CG2 . VAL C 1 185 ? -24.953 -5.026  -19.266 1.00 48.84  ? 512 VAL C CG2 1 
ATOM   4730 N  N   . THR C 1 186 ? -25.457 -3.860  -23.988 1.00 54.00  ? 513 THR C N   1 
ATOM   4731 C  CA  . THR C 1 186 ? -25.237 -3.217  -25.290 1.00 56.91  ? 513 THR C CA  1 
ATOM   4732 C  C   . THR C 1 186 ? -26.546 -3.000  -26.057 1.00 59.35  ? 513 THR C C   1 
ATOM   4733 O  O   . THR C 1 186 ? -27.550 -3.685  -25.803 1.00 58.22  ? 513 THR C O   1 
ATOM   4734 C  CB  . THR C 1 186 ? -24.240 -4.021  -26.165 1.00 55.03  ? 513 THR C CB  1 
ATOM   4735 O  OG1 . THR C 1 186 ? -23.875 -3.236  -27.299 1.00 57.87  ? 513 THR C OG1 1 
ATOM   4736 C  CG2 . THR C 1 186 ? -24.820 -5.367  -26.639 1.00 51.48  ? 513 THR C CG2 1 
ATOM   4737 N  N   . GLU C 1 187 ? -26.499 -2.063  -27.003 1.00 63.38  ? 514 GLU C N   1 
ATOM   4738 C  CA  . GLU C 1 187 ? -27.602 -1.712  -27.893 1.00 66.31  ? 514 GLU C CA  1 
ATOM   4739 C  C   . GLU C 1 187 ? -28.078 -2.930  -28.667 1.00 63.89  ? 514 GLU C C   1 
ATOM   4740 O  O   . GLU C 1 187 ? -27.278 -3.614  -29.308 1.00 62.10  ? 514 GLU C O   1 
ATOM   4741 C  CB  . GLU C 1 187 ? -27.141 -0.625  -28.879 1.00 72.20  ? 514 GLU C CB  1 
ATOM   4742 C  CG  . GLU C 1 187 ? -26.976 0.783   -28.296 1.00 77.82  ? 514 GLU C CG  1 
ATOM   4743 C  CD  . GLU C 1 187 ? -25.753 0.987   -27.376 1.00 78.30  ? 514 GLU C CD  1 
ATOM   4744 O  OE1 . GLU C 1 187 ? -24.999 0.026   -27.071 1.00 74.11  ? 514 GLU C OE1 1 
ATOM   4745 O  OE2 . GLU C 1 187 ? -25.547 2.152   -26.952 1.00 82.67  ? 514 GLU C OE2 1 
ATOM   4746 N  N   . ARG C 1 188 ? -29.374 -3.218  -28.575 1.00 63.95  ? 515 ARG C N   1 
ATOM   4747 C  CA  . ARG C 1 188 ? -29.992 -4.321  -29.323 1.00 62.99  ? 515 ARG C CA  1 
ATOM   4748 C  C   . ARG C 1 188 ? -31.325 -3.906  -29.915 1.00 66.16  ? 515 ARG C C   1 
ATOM   4749 O  O   . ARG C 1 188 ? -32.118 -3.215  -29.269 1.00 68.18  ? 515 ARG C O   1 
ATOM   4750 C  CB  . ARG C 1 188 ? -30.188 -5.577  -28.454 1.00 59.09  ? 515 ARG C CB  1 
ATOM   4751 C  CG  . ARG C 1 188 ? -28.924 -6.189  -27.852 1.00 56.40  ? 515 ARG C CG  1 
ATOM   4752 C  CD  . ARG C 1 188 ? -28.044 -6.895  -28.869 1.00 55.16  ? 515 ARG C CD  1 
ATOM   4753 N  NE  . ARG C 1 188 ? -26.939 -7.568  -28.199 1.00 53.30  ? 515 ARG C NE  1 
ATOM   4754 C  CZ  . ARG C 1 188 ? -25.890 -8.126  -28.801 1.00 52.83  ? 515 ARG C CZ  1 
ATOM   4755 N  NH1 . ARG C 1 188 ? -25.769 -8.110  -30.121 1.00 54.29  ? 515 ARG C NH1 1 
ATOM   4756 N  NH2 . ARG C 1 188 ? -24.955 -8.714  -28.071 1.00 51.06  ? 515 ARG C NH2 1 
ATOM   4757 N  N   . HIS C 1 189 ? -31.566 -4.333  -31.150 1.00 67.78  ? 516 HIS C N   1 
ATOM   4758 C  CA  . HIS C 1 189 ? -32.830 -4.063  -31.817 1.00 71.53  ? 516 HIS C CA  1 
ATOM   4759 C  C   . HIS C 1 189 ? -33.937 -4.845  -31.110 1.00 70.09  ? 516 HIS C C   1 
ATOM   4760 O  O   . HIS C 1 189 ? -33.814 -6.055  -30.891 1.00 67.05  ? 516 HIS C O   1 
ATOM   4761 C  CB  . HIS C 1 189 ? -32.752 -4.412  -33.306 1.00 72.99  ? 516 HIS C CB  1 
ATOM   4762 C  CG  . HIS C 1 189 ? -33.850 -3.810  -34.126 1.00 77.59  ? 516 HIS C CG  1 
ATOM   4763 N  ND1 . HIS C 1 189 ? -34.815 -4.571  -34.751 1.00 78.10  ? 516 HIS C ND1 1 
ATOM   4764 C  CD2 . HIS C 1 189 ? -34.142 -2.519  -34.417 1.00 82.16  ? 516 HIS C CD2 1 
ATOM   4765 C  CE1 . HIS C 1 189 ? -35.649 -3.776  -35.399 1.00 81.80  ? 516 HIS C CE1 1 
ATOM   4766 N  NE2 . HIS C 1 189 ? -35.265 -2.526  -35.210 1.00 84.59  ? 516 HIS C NE2 1 
ATOM   4767 N  N   . GLY C 1 190 ? -34.991 -4.129  -30.727 1.00 72.61  ? 517 GLY C N   1 
ATOM   4768 C  CA  . GLY C 1 190 ? -36.117 -4.715  -30.004 1.00 72.28  ? 517 GLY C CA  1 
ATOM   4769 C  C   . GLY C 1 190 ? -36.159 -4.438  -28.508 1.00 72.09  ? 517 GLY C C   1 
ATOM   4770 O  O   . GLY C 1 190 ? -37.040 -4.967  -27.820 1.00 71.94  ? 517 GLY C O   1 
ATOM   4771 N  N   . LEU C 1 191 ? -35.216 -3.627  -28.004 1.00 71.74  ? 518 LEU C N   1 
ATOM   4772 C  CA  . LEU C 1 191 ? -35.163 -3.238  -26.586 1.00 70.69  ? 518 LEU C CA  1 
ATOM   4773 C  C   . LEU C 1 191 ? -36.347 -2.364  -26.211 1.00 74.96  ? 518 LEU C C   1 
ATOM   4774 O  O   . LEU C 1 191 ? -36.669 -1.406  -26.923 1.00 77.95  ? 518 LEU C O   1 
ATOM   4775 C  CB  . LEU C 1 191 ? -33.860 -2.504  -26.240 1.00 69.28  ? 518 LEU C CB  1 
ATOM   4776 C  CG  . LEU C 1 191 ? -32.580 -3.277  -25.900 1.00 65.17  ? 518 LEU C CG  1 
ATOM   4777 C  CD1 . LEU C 1 191 ? -31.459 -2.285  -25.621 1.00 65.58  ? 518 LEU C CD1 1 
ATOM   4778 C  CD2 . LEU C 1 191 ? -32.753 -4.233  -24.722 1.00 61.75  ? 518 LEU C CD2 1 
ATOM   4779 N  N   . LYS C 1 192 ? -36.980 -2.703  -25.088 1.00 75.41  ? 519 LYS C N   1 
ATOM   4780 C  CA  . LYS C 1 192 ? -38.159 -1.980  -24.594 1.00 79.73  ? 519 LYS C CA  1 
ATOM   4781 C  C   . LYS C 1 192 ? -37.780 -0.661  -23.944 1.00 82.69  ? 519 LYS C C   1 
ATOM   4782 O  O   . LYS C 1 192 ? -38.314 0.384   -24.319 1.00 87.09  ? 519 LYS C O   1 
ATOM   4783 C  CB  . LYS C 1 192 ? -38.994 -2.843  -23.643 1.00 78.92  ? 519 LYS C CB  1 
ATOM   4784 C  CG  . LYS C 1 192 ? -39.740 -3.964  -24.346 1.00 78.14  ? 519 LYS C CG  1 
ATOM   4785 C  CD  . LYS C 1 192 ? -40.893 -4.460  -23.505 1.00 79.60  ? 519 LYS C CD  1 
ATOM   4786 C  CE  . LYS C 1 192 ? -41.630 -5.566  -24.232 1.00 79.05  ? 519 LYS C CE  1 
ATOM   4787 N  NZ  . LYS C 1 192 ? -42.889 -5.902  -23.509 1.00 82.03  ? 519 LYS C NZ  1 
ATOM   4788 N  N   . GLU C 1 193 ? -36.861 -0.712  -22.980 1.00 81.31  ? 520 GLU C N   1 
ATOM   4789 C  CA  . GLU C 1 193 ? -36.303 0.500   -22.378 1.00 83.70  ? 520 GLU C CA  1 
ATOM   4790 C  C   . GLU C 1 193 ? -34.811 0.638   -22.679 1.00 81.18  ? 520 GLU C C   1 
ATOM   4791 O  O   . GLU C 1 193 ? -33.981 0.385   -21.801 1.00 78.81  ? 520 GLU C O   1 
ATOM   4792 C  CB  . GLU C 1 193 ? -36.604 0.562   -20.883 1.00 84.99  ? 520 GLU C CB  1 
ATOM   4793 C  CG  . GLU C 1 193 ? -37.869 1.356   -20.585 1.00 90.92  ? 520 GLU C CG  1 
ATOM   4794 C  CD  . GLU C 1 193 ? -38.497 1.030   -19.240 1.00 92.34  ? 520 GLU C CD  1 
ATOM   4795 O  OE1 . GLU C 1 193 ? -37.802 0.504   -18.335 1.00 90.21  ? 520 GLU C OE1 1 
ATOM   4796 O  OE2 . GLU C 1 193 ? -39.705 1.315   -19.088 1.00 96.71  ? 520 GLU C OE2 1 
ATOM   4797 N  N   . PRO C 1 194 ? -34.471 1.059   -23.926 1.00 82.54  ? 521 PRO C N   1 
ATOM   4798 C  CA  . PRO C 1 194 ? -33.072 1.064   -24.371 1.00 80.73  ? 521 PRO C CA  1 
ATOM   4799 C  C   . PRO C 1 194 ? -32.211 2.115   -23.671 1.00 82.03  ? 521 PRO C C   1 
ATOM   4800 O  O   . PRO C 1 194 ? -30.981 1.970   -23.633 1.00 79.98  ? 521 PRO C O   1 
ATOM   4801 C  CB  . PRO C 1 194 ? -33.176 1.351   -25.875 1.00 82.59  ? 521 PRO C CB  1 
ATOM   4802 C  CG  . PRO C 1 194 ? -34.453 2.097   -26.042 1.00 86.31  ? 521 PRO C CG  1 
ATOM   4803 C  CD  . PRO C 1 194 ? -35.374 1.637   -24.951 1.00 85.54  ? 521 PRO C CD  1 
ATOM   4804 N  N   . LYS C 1 195 ? -32.864 3.138   -23.115 1.00 85.58  ? 522 LYS C N   1 
ATOM   4805 C  CA  . LYS C 1 195 ? -32.196 4.214   -22.377 1.00 88.30  ? 522 LYS C CA  1 
ATOM   4806 C  C   . LYS C 1 195 ? -31.474 3.713   -21.127 1.00 85.34  ? 522 LYS C C   1 
ATOM   4807 O  O   . LYS C 1 195 ? -30.303 4.051   -20.920 1.00 85.46  ? 522 LYS C O   1 
ATOM   4808 C  CB  . LYS C 1 195 ? -33.174 5.339   -22.010 1.00 92.61  ? 522 LYS C CB  1 
ATOM   4809 C  CG  . LYS C 1 195 ? -33.585 6.231   -23.175 1.00 96.87  ? 522 LYS C CG  1 
ATOM   4810 C  CD  . LYS C 1 195 ? -34.120 7.579   -22.699 1.00 102.15 ? 522 LYS C CD  1 
ATOM   4811 C  CE  . LYS C 1 195 ? -35.560 7.500   -22.196 1.00 103.86 ? 522 LYS C CE  1 
ATOM   4812 N  NZ  . LYS C 1 195 ? -36.101 8.843   -21.832 1.00 109.95 ? 522 LYS C NZ  1 
ATOM   4813 N  N   . ARG C 1 196 ? -32.165 2.906   -20.314 1.00 83.24  ? 523 ARG C N   1 
ATOM   4814 C  CA  . ARG C 1 196 ? -31.590 2.372   -19.071 1.00 80.12  ? 523 ARG C CA  1 
ATOM   4815 C  C   . ARG C 1 196 ? -30.556 1.268   -19.288 1.00 74.67  ? 523 ARG C C   1 
ATOM   4816 O  O   . ARG C 1 196 ? -29.742 1.013   -18.395 1.00 72.77  ? 523 ARG C O   1 
ATOM   4817 C  CB  . ARG C 1 196 ? -32.674 1.951   -18.073 1.00 81.58  ? 523 ARG C CB  1 
ATOM   4818 C  CG  . ARG C 1 196 ? -33.272 3.132   -17.306 1.00 87.23  ? 523 ARG C CG  1 
ATOM   4819 C  CD  . ARG C 1 196 ? -33.944 2.725   -15.995 1.00 88.49  ? 523 ARG C CD  1 
ATOM   4820 N  NE  . ARG C 1 196 ? -35.072 1.806   -16.198 1.00 88.60  ? 523 ARG C NE  1 
ATOM   4821 C  CZ  . ARG C 1 196 ? -35.082 0.514   -15.865 1.00 85.33  ? 523 ARG C CZ  1 
ATOM   4822 N  NH1 . ARG C 1 196 ? -34.025 -0.050  -15.283 1.00 81.96  ? 523 ARG C NH1 1 
ATOM   4823 N  NH2 . ARG C 1 196 ? -36.165 -0.220  -16.111 1.00 84.96  ? 523 ARG C NH2 1 
ATOM   4824 N  N   . VAL C 1 197 ? -30.589 0.635   -20.468 1.00 71.73  ? 524 VAL C N   1 
ATOM   4825 C  CA  . VAL C 1 197 ? -29.513 -0.256  -20.935 1.00 67.66  ? 524 VAL C CA  1 
ATOM   4826 C  C   . VAL C 1 197 ? -28.284 0.587   -21.263 1.00 69.06  ? 524 VAL C C   1 
ATOM   4827 O  O   . VAL C 1 197 ? -27.187 0.263   -20.813 1.00 67.97  ? 524 VAL C O   1 
ATOM   4828 C  CB  . VAL C 1 197 ? -29.925 -1.143  -22.151 1.00 65.77  ? 524 VAL C CB  1 
ATOM   4829 C  CG1 . VAL C 1 197 ? -28.744 -1.934  -22.711 1.00 61.80  ? 524 VAL C CG1 1 
ATOM   4830 C  CG2 . VAL C 1 197 ? -31.055 -2.098  -21.783 1.00 63.99  ? 524 VAL C CG2 1 
ATOM   4831 N  N   . GLU C 1 198 ? -28.480 1.661   -22.031 1.00 73.01  ? 525 GLU C N   1 
ATOM   4832 C  CA  . GLU C 1 198 ? -27.420 2.630   -22.351 1.00 75.73  ? 525 GLU C CA  1 
ATOM   4833 C  C   . GLU C 1 198 ? -26.777 3.242   -21.093 1.00 76.06  ? 525 GLU C C   1 
ATOM   4834 O  O   . GLU C 1 198 ? -25.554 3.330   -21.014 1.00 75.29  ? 525 GLU C O   1 
ATOM   4835 C  CB  . GLU C 1 198 ? -27.943 3.745   -23.274 1.00 80.55  ? 525 GLU C CB  1 
ATOM   4836 C  CG  . GLU C 1 198 ? -26.888 4.297   -24.231 1.00 83.46  ? 525 GLU C CG  1 
ATOM   4837 C  CD  . GLU C 1 198 ? -26.887 5.816   -24.340 1.00 89.66  ? 525 GLU C CD  1 
ATOM   4838 O  OE1 . GLU C 1 198 ? -27.901 6.407   -24.791 1.00 93.08  ? 525 GLU C OE1 1 
ATOM   4839 O  OE2 . GLU C 1 198 ? -25.852 6.428   -23.991 1.00 91.27  ? 525 GLU C OE2 1 
ATOM   4840 N  N   . GLU C 1 199 ? -27.608 3.645   -20.125 1.00 77.26  ? 526 GLU C N   1 
ATOM   4841 C  CA  . GLU C 1 199 ? -27.149 4.247   -18.859 1.00 78.75  ? 526 GLU C CA  1 
ATOM   4842 C  C   . GLU C 1 199 ? -26.371 3.285   -17.952 1.00 74.89  ? 526 GLU C C   1 
ATOM   4843 O  O   . GLU C 1 199 ? -25.460 3.709   -17.234 1.00 75.52  ? 526 GLU C O   1 
ATOM   4844 C  CB  . GLU C 1 199 ? -28.312 4.912   -18.097 1.00 81.74  ? 526 GLU C CB  1 
ATOM   4845 C  CG  . GLU C 1 199 ? -28.663 6.317   -18.602 1.00 87.46  ? 526 GLU C CG  1 
ATOM   4846 C  CD  . GLU C 1 199 ? -30.108 6.752   -18.327 1.00 90.61  ? 526 GLU C CD  1 
ATOM   4847 O  OE1 . GLU C 1 199 ? -30.611 7.649   -19.050 1.00 94.08  ? 526 GLU C OE1 1 
ATOM   4848 O  OE2 . GLU C 1 199 ? -30.747 6.205   -17.396 1.00 89.62  ? 526 GLU C OE2 1 
ATOM   4849 N  N   . LEU C 1 200 ? -26.721 1.999   -17.997 1.00 71.13  ? 527 LEU C N   1 
ATOM   4850 C  CA  . LEU C 1 200 ? -25.966 0.968   -17.270 1.00 67.62  ? 527 LEU C CA  1 
ATOM   4851 C  C   . LEU C 1 200 ? -24.648 0.648   -17.976 1.00 65.46  ? 527 LEU C C   1 
ATOM   4852 O  O   . LEU C 1 200 ? -23.617 0.511   -17.319 1.00 64.14  ? 527 LEU C O   1 
ATOM   4853 C  CB  . LEU C 1 200 ? -26.799 -0.305  -17.062 1.00 65.28  ? 527 LEU C CB  1 
ATOM   4854 C  CG  . LEU C 1 200 ? -26.256 -1.312  -16.035 1.00 63.74  ? 527 LEU C CG  1 
ATOM   4855 C  CD1 . LEU C 1 200 ? -26.282 -0.723  -14.626 1.00 66.15  ? 527 LEU C CD1 1 
ATOM   4856 C  CD2 . LEU C 1 200 ? -27.010 -2.637  -16.083 1.00 60.70  ? 527 LEU C CD2 1 
ATOM   4857 N  N   . GLN C 1 201 ? -24.707 0.533   -19.307 1.00 65.09  ? 528 GLN C N   1 
ATOM   4858 C  CA  . GLN C 1 201 ? -23.535 0.382   -20.175 1.00 64.84  ? 528 GLN C CA  1 
ATOM   4859 C  C   . GLN C 1 201 ? -22.470 1.417   -19.828 1.00 68.00  ? 528 GLN C C   1 
ATOM   4860 O  O   . GLN C 1 201 ? -21.351 1.044   -19.459 1.00 66.73  ? 528 GLN C O   1 
ATOM   4861 C  CB  . GLN C 1 201 ? -23.938 0.485   -21.657 1.00 65.42  ? 528 GLN C CB  1 
ATOM   4862 C  CG  . GLN C 1 201 ? -22.808 0.309   -22.672 1.00 65.73  ? 528 GLN C CG  1 
ATOM   4863 C  CD  . GLN C 1 201 ? -23.282 0.372   -24.123 1.00 66.72  ? 528 GLN C CD  1 
ATOM   4864 O  OE1 . GLN C 1 201 ? -24.005 1.289   -24.517 1.00 69.83  ? 528 GLN C OE1 1 
ATOM   4865 N  NE2 . GLN C 1 201 ? -22.866 -0.601  -24.927 1.00 64.48  ? 528 GLN C NE2 1 
ATOM   4866 N  N   . ASN C 1 202 ? -22.841 2.702   -19.910 1.00 71.49  ? 529 ASN C N   1 
ATOM   4867 C  CA  . ASN C 1 202 ? -21.922 3.801   -19.637 1.00 74.61  ? 529 ASN C CA  1 
ATOM   4868 C  C   . ASN C 1 202 ? -21.334 3.770   -18.225 1.00 74.37  ? 529 ASN C C   1 
ATOM   4869 O  O   . ASN C 1 202 ? -20.145 4.073   -18.054 1.00 75.90  ? 529 ASN C O   1 
ATOM   4870 C  CB  . ASN C 1 202 ? -22.572 5.152   -19.939 1.00 78.84  ? 529 ASN C CB  1 
ATOM   4871 C  CG  . ASN C 1 202 ? -22.707 5.421   -21.429 1.00 80.53  ? 529 ASN C CG  1 
ATOM   4872 O  OD1 . ASN C 1 202 ? -22.181 4.687   -22.271 1.00 78.68  ? 529 ASN C OD1 1 
ATOM   4873 N  ND2 . ASN C 1 202 ? -23.424 6.483   -21.761 1.00 84.49  ? 529 ASN C ND2 1 
ATOM   4874 N  N   . LYS C 1 203 ? -22.150 3.386   -17.233 1.00 72.62  ? 530 LYS C N   1 
ATOM   4875 C  CA  . LYS C 1 203 ? -21.680 3.187   -15.846 1.00 71.33  ? 530 LYS C CA  1 
ATOM   4876 C  C   . LYS C 1 203 ? -20.539 2.164   -15.784 1.00 68.33  ? 530 LYS C C   1 
ATOM   4877 O  O   . LYS C 1 203 ? -19.555 2.375   -15.071 1.00 69.01  ? 530 LYS C O   1 
ATOM   4878 C  CB  . LYS C 1 203 ? -22.828 2.786   -14.907 1.00 70.25  ? 530 LYS C CB  1 
ATOM   4879 C  CG  . LYS C 1 203 ? -23.695 3.951   -14.435 1.00 74.32  ? 530 LYS C CG  1 
ATOM   4880 C  CD  . LYS C 1 203 ? -24.565 3.587   -13.232 1.00 74.06  ? 530 LYS C CD  1 
ATOM   4881 C  CE  . LYS C 1 203 ? -23.882 3.872   -11.893 1.00 75.40  ? 530 LYS C CE  1 
ATOM   4882 N  NZ  . LYS C 1 203 ? -23.762 5.327   -11.566 1.00 79.43  ? 530 LYS C NZ  1 
ATOM   4883 N  N   . ILE C 1 204 ? -20.674 1.088   -16.565 1.00 65.26  ? 531 ILE C N   1 
ATOM   4884 C  CA  . ILE C 1 204 ? -19.665 0.024   -16.667 1.00 62.78  ? 531 ILE C CA  1 
ATOM   4885 C  C   . ILE C 1 204 ? -18.423 0.512   -17.422 1.00 64.58  ? 531 ILE C C   1 
ATOM   4886 O  O   . ILE C 1 204 ? -17.305 0.272   -16.968 1.00 65.14  ? 531 ILE C O   1 
ATOM   4887 C  CB  . ILE C 1 204 ? -20.246 -1.282  -17.290 1.00 59.20  ? 531 ILE C CB  1 
ATOM   4888 C  CG1 . ILE C 1 204 ? -21.412 -1.815  -16.442 1.00 57.16  ? 531 ILE C CG1 1 
ATOM   4889 C  CG2 . ILE C 1 204 ? -19.171 -2.356  -17.426 1.00 57.20  ? 531 ILE C CG2 1 
ATOM   4890 C  CD1 . ILE C 1 204 ? -22.404 -2.664  -17.209 1.00 55.08  ? 531 ILE C CD1 1 
ATOM   4891 N  N   . VAL C 1 205 ? -18.624 1.193   -18.556 1.00 66.66  ? 532 VAL C N   1 
ATOM   4892 C  CA  . VAL C 1 205 ? -17.531 1.826   -19.338 1.00 69.60  ? 532 VAL C CA  1 
ATOM   4893 C  C   . VAL C 1 205 ? -16.662 2.709   -18.424 1.00 72.03  ? 532 VAL C C   1 
ATOM   4894 O  O   . VAL C 1 205 ? -15.428 2.651   -18.493 1.00 72.39  ? 532 VAL C O   1 
ATOM   4895 C  CB  . VAL C 1 205 ? -18.076 2.653   -20.545 1.00 72.11  ? 532 VAL C CB  1 
ATOM   4896 C  CG1 . VAL C 1 205 ? -16.976 3.451   -21.235 1.00 75.69  ? 532 VAL C CG1 1 
ATOM   4897 C  CG2 . VAL C 1 205 ? -18.760 1.758   -21.566 1.00 69.81  ? 532 VAL C CG2 1 
ATOM   4898 N  N   . ASN C 1 206 ? -17.333 3.477   -17.555 1.00 73.54  ? 533 ASN C N   1 
ATOM   4899 C  CA  . ASN C 1 206 ? -16.707 4.412   -16.607 1.00 76.90  ? 533 ASN C CA  1 
ATOM   4900 C  C   . ASN C 1 206 ? -15.839 3.796   -15.520 1.00 75.96  ? 533 ASN C C   1 
ATOM   4901 O  O   . ASN C 1 206 ? -14.741 4.294   -15.260 1.00 78.33  ? 533 ASN C O   1 
ATOM   4902 C  CB  . ASN C 1 206 ? -17.754 5.302   -15.941 1.00 78.54  ? 533 ASN C CB  1 
ATOM   4903 C  CG  . ASN C 1 206 ? -18.262 6.385   -16.855 1.00 82.23  ? 533 ASN C CG  1 
ATOM   4904 O  OD1 . ASN C 1 206 ? -17.490 7.106   -17.497 1.00 85.25  ? 533 ASN C OD1 1 
ATOM   4905 N  ND2 . ASN C 1 206 ? -19.575 6.510   -16.918 1.00 82.71  ? 533 ASN C ND2 1 
ATOM   4906 N  N   . CYS C 1 207 ? -16.320 2.745   -14.856 1.00 72.60  ? 534 CYS C N   1 
ATOM   4907 C  CA  . CYS C 1 207 ? -15.464 2.112   -13.857 1.00 71.84  ? 534 CYS C CA  1 
ATOM   4908 C  C   . CYS C 1 207 ? -14.429 1.171   -14.489 1.00 69.85  ? 534 CYS C C   1 
ATOM   4909 O  O   . CYS C 1 207 ? -13.464 0.797   -13.828 1.00 69.98  ? 534 CYS C O   1 
ATOM   4910 C  CB  . CYS C 1 207 ? -16.246 1.498   -12.686 1.00 70.46  ? 534 CYS C CB  1 
ATOM   4911 S  SG  . CYS C 1 207 ? -17.498 0.288   -13.123 1.00 67.80  ? 534 CYS C SG  1 
ATOM   4912 N  N   . LEU C 1 208 ? -14.616 0.827   -15.768 1.00 68.43  ? 535 LEU C N   1 
ATOM   4913 C  CA  . LEU C 1 208 ? -13.533 0.243   -16.572 1.00 68.48  ? 535 LEU C CA  1 
ATOM   4914 C  C   . LEU C 1 208 ? -12.480 1.315   -16.847 1.00 73.24  ? 535 LEU C C   1 
ATOM   4915 O  O   . LEU C 1 208 ? -11.286 1.064   -16.639 1.00 74.35  ? 535 LEU C O   1 
ATOM   4916 C  CB  . LEU C 1 208 ? -14.041 -0.396  -17.878 1.00 65.94  ? 535 LEU C CB  1 
ATOM   4917 C  CG  . LEU C 1 208 ? -13.047 -0.765  -19.004 1.00 66.79  ? 535 LEU C CG  1 
ATOM   4918 C  CD1 . LEU C 1 208 ? -12.017 -1.829  -18.643 1.00 65.67  ? 535 LEU C CD1 1 
ATOM   4919 C  CD2 . LEU C 1 208 ? -13.788 -1.166  -20.269 1.00 65.80  ? 535 LEU C CD2 1 
ATOM   4920 N  N   . LYS C 1 209 ? -12.946 2.489   -17.306 1.00 76.10  ? 536 LYS C N   1 
ATOM   4921 C  CA  . LYS C 1 209 ? -12.140 3.709   -17.472 1.00 80.89  ? 536 LYS C CA  1 
ATOM   4922 C  C   . LYS C 1 209 ? -11.313 4.041   -16.226 1.00 82.16  ? 536 LYS C C   1 
ATOM   4923 O  O   . LYS C 1 209 ? -10.089 4.194   -16.315 1.00 83.81  ? 536 LYS C O   1 
ATOM   4924 C  CB  . LYS C 1 209 ? -13.035 4.925   -17.817 1.00 84.00  ? 536 LYS C CB  1 
ATOM   4925 C  CG  . LYS C 1 209 ? -12.967 5.461   -19.241 1.00 86.42  ? 536 LYS C CG  1 
ATOM   4926 C  CD  . LYS C 1 209 ? -13.364 6.929   -19.287 1.00 90.44  ? 536 LYS C CD  1 
ATOM   4927 C  CE  . LYS C 1 209 ? -13.192 7.501   -20.685 1.00 93.86  ? 536 LYS C CE  1 
ATOM   4928 N  NZ  . LYS C 1 209 ? -13.397 8.981   -20.739 1.00 98.66  ? 536 LYS C NZ  1 
ATOM   4929 N  N   . ASP C 1 210 ? -12.000 4.141   -15.082 1.00 81.22  ? 537 ASP C N   1 
ATOM   4930 C  CA  . ASP C 1 210 ? -11.404 4.537   -13.798 1.00 82.98  ? 537 ASP C CA  1 
ATOM   4931 C  C   . ASP C 1 210 ? -10.378 3.532   -13.288 1.00 81.60  ? 537 ASP C C   1 
ATOM   4932 O  O   . ASP C 1 210 ? -9.330  3.932   -12.771 1.00 84.45  ? 537 ASP C O   1 
ATOM   4933 C  CB  . ASP C 1 210 ? -12.490 4.768   -12.735 1.00 82.45  ? 537 ASP C CB  1 
ATOM   4934 C  CG  . ASP C 1 210 ? -13.186 6.130   -12.867 1.00 86.43  ? 537 ASP C CG  1 
ATOM   4935 O  OD1 . ASP C 1 210 ? -13.128 6.775   -13.946 1.00 88.73  ? 537 ASP C OD1 1 
ATOM   4936 O  OD2 . ASP C 1 210 ? -13.806 6.562   -11.867 1.00 87.60  ? 537 ASP C OD2 1 
ATOM   4937 N  N   . HIS C 1 211 ? -10.682 2.240   -13.455 1.00 77.51  ? 538 HIS C N   1 
ATOM   4938 C  CA  . HIS C 1 211 ? -9.792  1.150   -13.035 1.00 75.98  ? 538 HIS C CA  1 
ATOM   4939 C  C   . HIS C 1 211 ? -8.509  1.031   -13.866 1.00 77.91  ? 538 HIS C C   1 
ATOM   4940 O  O   . HIS C 1 211 ? -7.451  0.760   -13.307 1.00 79.47  ? 538 HIS C O   1 
ATOM   4941 C  CB  . HIS C 1 211 ? -10.526 -0.195  -13.006 1.00 71.11  ? 538 HIS C CB  1 
ATOM   4942 C  CG  . HIS C 1 211 ? -9.655  -1.338  -12.590 1.00 69.89  ? 538 HIS C CG  1 
ATOM   4943 N  ND1 . HIS C 1 211 ? -9.087  -2.204  -13.499 1.00 69.02  ? 538 HIS C ND1 1 
ATOM   4944 C  CD2 . HIS C 1 211 ? -9.211  -1.725  -11.368 1.00 69.45  ? 538 HIS C CD2 1 
ATOM   4945 C  CE1 . HIS C 1 211 ? -8.352  -3.092  -12.853 1.00 68.59  ? 538 HIS C CE1 1 
ATOM   4946 N  NE2 . HIS C 1 211 ? -8.413  -2.826  -11.560 1.00 68.84  ? 538 HIS C NE2 1 
ATOM   4947 N  N   . VAL C 1 212 ? -8.616  1.198   -15.187 1.00 78.59  ? 539 VAL C N   1 
ATOM   4948 C  CA  . VAL C 1 212 ? -7.443  1.268   -16.077 1.00 81.78  ? 539 VAL C CA  1 
ATOM   4949 C  C   . VAL C 1 212 ? -6.529  2.447   -15.693 1.00 86.59  ? 539 VAL C C   1 
ATOM   4950 O  O   . VAL C 1 212 ? -5.303  2.289   -15.628 1.00 88.90  ? 539 VAL C O   1 
ATOM   4951 C  CB  . VAL C 1 212 ? -7.855  1.314   -17.575 1.00 81.59  ? 539 VAL C CB  1 
ATOM   4952 C  CG1 . VAL C 1 212 ? -6.689  1.715   -18.475 1.00 85.68  ? 539 VAL C CG1 1 
ATOM   4953 C  CG2 . VAL C 1 212 ? -8.405  -0.036  -18.011 1.00 77.41  ? 539 VAL C CG2 1 
ATOM   4954 N  N   . THR C 1 213 ? -7.149  3.601   -15.420 1.00 88.47  ? 540 THR C N   1 
ATOM   4955 C  CA  . THR C 1 213 ? -6.469  4.839   -14.992 1.00 93.59  ? 540 THR C CA  1 
ATOM   4956 C  C   . THR C 1 213 ? -5.717  4.631   -13.662 1.00 95.11  ? 540 THR C C   1 
ATOM   4957 O  O   . THR C 1 213 ? -4.599  5.130   -13.490 1.00 99.20  ? 540 THR C O   1 
ATOM   4958 C  CB  . THR C 1 213 ? -7.473  6.038   -14.941 1.00 94.27  ? 540 THR C CB  1 
ATOM   4959 O  OG1 . THR C 1 213 ? -7.819  6.443   -16.289 1.00 94.56  ? 540 THR C OG1 1 
ATOM   4960 C  CG2 . THR C 1 213 ? -6.910  7.259   -14.189 1.00 98.31  ? 540 THR C CG2 1 
ATOM   4961 N  N   . PHE C 1 214 ? -6.330  3.873   -12.751 1.00 92.68  ? 541 PHE C N   1 
ATOM   4962 C  CA  . PHE C 1 214 ? -5.726  3.509   -11.462 1.00 93.84  ? 541 PHE C CA  1 
ATOM   4963 C  C   . PHE C 1 214 ? -4.479  2.621   -11.631 1.00 94.61  ? 541 PHE C C   1 
ATOM   4964 O  O   . PHE C 1 214 ? -3.518  2.740   -10.865 1.00 96.77  ? 541 PHE C O   1 
ATOM   4965 C  CB  . PHE C 1 214 ? -6.784  2.844   -10.569 1.00 90.84  ? 541 PHE C CB  1 
ATOM   4966 C  CG  . PHE C 1 214 ? -6.354  2.636   -9.138  1.00 92.26  ? 541 PHE C CG  1 
ATOM   4967 C  CD1 . PHE C 1 214 ? -6.370  3.698   -8.221  1.00 95.39  ? 541 PHE C CD1 1 
ATOM   4968 C  CD2 . PHE C 1 214 ? -5.961  1.364   -8.692  1.00 90.83  ? 541 PHE C CD2 1 
ATOM   4969 C  CE1 . PHE C 1 214 ? -5.978  3.501   -6.897  1.00 96.47  ? 541 PHE C CE1 1 
ATOM   4970 C  CE2 . PHE C 1 214 ? -5.571  1.161   -7.369  1.00 91.67  ? 541 PHE C CE2 1 
ATOM   4971 C  CZ  . PHE C 1 214 ? -5.582  2.231   -6.474  1.00 94.58  ? 541 PHE C CZ  1 
ATOM   4972 N  N   . ASN C 1 215 ? -4.511  1.751   -12.645 1.00 93.28  ? 542 ASN C N   1 
ATOM   4973 C  CA  . ASN C 1 215 ? -3.368  0.912   -13.048 1.00 94.85  ? 542 ASN C CA  1 
ATOM   4974 C  C   . ASN C 1 215 ? -2.313  1.676   -13.859 1.00 99.64  ? 542 ASN C C   1 
ATOM   4975 O  O   . ASN C 1 215 ? -1.230  1.145   -14.109 1.00 101.51 ? 542 ASN C O   1 
ATOM   4976 C  CB  . ASN C 1 215 ? -3.855  -0.306  -13.852 1.00 91.49  ? 542 ASN C CB  1 
ATOM   4977 C  CG  . ASN C 1 215 ? -4.615  -1.316  -13.003 1.00 87.71  ? 542 ASN C CG  1 
ATOM   4978 O  OD1 . ASN C 1 215 ? -4.850  -1.102  -11.808 1.00 88.14  ? 542 ASN C OD1 1 
ATOM   4979 N  ND2 . ASN C 1 215 ? -5.007  -2.432  -13.623 1.00 84.76  ? 542 ASN C ND2 1 
ATOM   4980 N  N   . ASN C 1 216 ? -2.658  2.905   -14.267 1.00 102.12 ? 543 ASN C N   1 
ATOM   4981 C  CA  . ASN C 1 216 ? -1.787  3.852   -14.998 1.00 107.56 ? 543 ASN C CA  1 
ATOM   4982 C  C   . ASN C 1 216 ? -1.225  3.357   -16.336 1.00 108.59 ? 543 ASN C C   1 
ATOM   4983 O  O   . ASN C 1 216 ? -0.971  4.160   -17.247 1.00 111.51 ? 543 ASN C O   1 
ATOM   4984 C  CB  . ASN C 1 216 ? -0.666  4.405   -14.097 1.00 111.91 ? 543 ASN C CB  1 
ATOM   4985 C  CG  . ASN C 1 216 ? -1.125  5.576   -13.233 1.00 113.65 ? 543 ASN C CG  1 
ATOM   4986 O  OD1 . ASN C 1 216 ? -1.773  6.514   -13.714 1.00 114.98 ? 543 ASN C OD1 1 
ATOM   4987 N  ND2 . ASN C 1 216 ? -0.771  5.536   -11.952 1.00 113.85 ? 543 ASN C ND2 1 
ATOM   4988 N  N   . PRO C 1 222 ? -5.239  4.619   -21.312 1.00 112.77 ? 549 PRO C N   1 
ATOM   4989 C  CA  . PRO C 1 222 ? -5.764  5.728   -22.116 1.00 116.10 ? 549 PRO C CA  1 
ATOM   4990 C  C   . PRO C 1 222 ? -5.990  5.342   -23.595 1.00 116.22 ? 549 PRO C C   1 
ATOM   4991 O  O   . PRO C 1 222 ? -7.146  5.251   -24.038 1.00 113.34 ? 549 PRO C O   1 
ATOM   4992 C  CB  . PRO C 1 222 ? -4.682  6.807   -21.958 1.00 121.64 ? 549 PRO C CB  1 
ATOM   4993 C  CG  . PRO C 1 222 ? -4.108  6.551   -20.600 1.00 120.63 ? 549 PRO C CG  1 
ATOM   4994 C  CD  . PRO C 1 222 ? -4.238  5.069   -20.325 1.00 115.13 ? 549 PRO C CD  1 
ATOM   4995 N  N   . ASN C 1 223 ? -4.897  5.125   -24.335 1.00 119.17 ? 550 ASN C N   1 
ATOM   4996 C  CA  . ASN C 1 223 ? -4.932  4.590   -25.703 1.00 118.74 ? 550 ASN C CA  1 
ATOM   4997 C  C   . ASN C 1 223 ? -5.222  3.085   -25.691 1.00 112.88 ? 550 ASN C C   1 
ATOM   4998 O  O   . ASN C 1 223 ? -5.914  2.572   -26.574 1.00 110.48 ? 550 ASN C O   1 
ATOM   4999 C  CB  . ASN C 1 223 ? -3.600  4.886   -26.417 1.00 124.94 ? 550 ASN C CB  1 
ATOM   5000 C  CG  . ASN C 1 223 ? -3.562  4.373   -27.852 1.00 125.91 ? 550 ASN C CG  1 
ATOM   5001 O  OD1 . ASN C 1 223 ? -3.470  3.166   -28.097 1.00 123.43 ? 550 ASN C OD1 1 
ATOM   5002 N  ND2 . ASN C 1 223 ? -3.610  5.293   -28.807 1.00 129.43 ? 550 ASN C ND2 1 
ATOM   5003 N  N   . TYR C 1 224 ? -4.670  2.401   -24.683 1.00 110.88 ? 551 TYR C N   1 
ATOM   5004 C  CA  . TYR C 1 224 ? -4.826  0.956   -24.448 1.00 105.49 ? 551 TYR C CA  1 
ATOM   5005 C  C   . TYR C 1 224 ? -6.291  0.569   -24.208 1.00 100.83 ? 551 TYR C C   1 
ATOM   5006 O  O   . TYR C 1 224 ? -6.739  -0.504  -24.625 1.00 97.91  ? 551 TYR C O   1 
ATOM   5007 C  CB  . TYR C 1 224 ? -3.919  0.542   -23.272 1.00 105.21 ? 551 TYR C CB  1 
ATOM   5008 C  CG  . TYR C 1 224 ? -4.233  -0.785  -22.621 1.00 100.53 ? 551 TYR C CG  1 
ATOM   5009 C  CD1 . TYR C 1 224 ? -3.877  -1.995  -23.233 1.00 99.57  ? 551 TYR C CD1 1 
ATOM   5010 C  CD2 . TYR C 1 224 ? -4.876  -0.832  -21.376 1.00 97.83  ? 551 TYR C CD2 1 
ATOM   5011 C  CE1 . TYR C 1 224 ? -4.170  -3.216  -22.630 1.00 95.58  ? 551 TYR C CE1 1 
ATOM   5012 C  CE2 . TYR C 1 224 ? -5.171  -2.045  -20.763 1.00 93.56  ? 551 TYR C CE2 1 
ATOM   5013 C  CZ  . TYR C 1 224 ? -4.821  -3.232  -21.391 1.00 92.70  ? 551 TYR C CZ  1 
ATOM   5014 O  OH  . TYR C 1 224 ? -5.119  -4.431  -20.782 1.00 88.99  ? 551 TYR C OH  1 
ATOM   5015 N  N   . LEU C 1 225 ? -7.014  1.466   -23.536 1.00 100.32 ? 552 LEU C N   1 
ATOM   5016 C  CA  . LEU C 1 225 ? -8.461  1.395   -23.310 1.00 95.87  ? 552 LEU C CA  1 
ATOM   5017 C  C   . LEU C 1 225 ? -9.275  1.161   -24.591 1.00 94.54  ? 552 LEU C C   1 
ATOM   5018 O  O   . LEU C 1 225 ? -10.325 0.498   -24.550 1.00 90.94  ? 552 LEU C O   1 
ATOM   5019 C  CB  . LEU C 1 225 ? -8.908  2.685   -22.614 1.00 98.30  ? 552 LEU C CB  1 
ATOM   5020 C  CG  . LEU C 1 225 ? -10.352 2.928   -22.177 1.00 96.29  ? 552 LEU C CG  1 
ATOM   5021 C  CD1 . LEU C 1 225 ? -10.331 3.544   -20.790 1.00 96.93  ? 552 LEU C CD1 1 
ATOM   5022 C  CD2 . LEU C 1 225 ? -11.093 3.817   -23.173 1.00 98.77  ? 552 LEU C CD2 1 
ATOM   5023 N  N   . SER C 1 226 ? -8.790  1.720   -25.704 1.00 96.62  ? 553 SER C N   1 
ATOM   5024 C  CA  . SER C 1 226 ? -9.364  1.502   -27.031 1.00 95.40  ? 553 SER C CA  1 
ATOM   5025 C  C   . SER C 1 226 ? -9.159  0.061   -27.536 1.00 92.11  ? 553 SER C C   1 
ATOM   5026 O  O   . SER C 1 226 ? -10.063 -0.500  -28.164 1.00 89.54  ? 553 SER C O   1 
ATOM   5027 C  CB  . SER C 1 226 ? -8.802  2.518   -28.029 1.00 100.73 ? 553 SER C CB  1 
ATOM   5028 O  OG  . SER C 1 226 ? -9.309  2.307   -29.334 1.00 100.80 ? 553 SER C OG  1 
ATOM   5029 N  N   . LYS C 1 227 ? -7.984  -0.519  -27.261 1.00 91.97  ? 554 LYS C N   1 
ATOM   5030 C  CA  . LYS C 1 227 ? -7.659  -1.909  -27.646 1.00 89.43  ? 554 LYS C CA  1 
ATOM   5031 C  C   . LYS C 1 227 ? -8.558  -2.924  -26.922 1.00 83.80  ? 554 LYS C C   1 
ATOM   5032 O  O   . LYS C 1 227 ? -9.049  -3.884  -27.536 1.00 80.46  ? 554 LYS C O   1 
ATOM   5033 C  CB  . LYS C 1 227 ? -6.177  -2.240  -27.387 1.00 92.00  ? 554 LYS C CB  1 
ATOM   5034 C  CG  . LYS C 1 227 ? -5.156  -1.476  -28.220 1.00 97.82  ? 554 LYS C CG  1 
ATOM   5035 C  CD  . LYS C 1 227 ? -4.855  -2.171  -29.542 1.00 99.36  ? 554 LYS C CD  1 
ATOM   5036 C  CE  . LYS C 1 227 ? -3.870  -1.354  -30.362 1.00 105.78 ? 554 LYS C CE  1 
ATOM   5037 N  NZ  . LYS C 1 227 ? -3.818  -1.806  -31.784 1.00 107.69 ? 554 LYS C NZ  1 
ATOM   5038 N  N   . LEU C 1 228 ? -8.760  -2.688  -25.622 1.00 81.78  ? 555 LEU C N   1 
ATOM   5039 C  CA  . LEU C 1 228 ? -9.653  -3.487  -24.776 1.00 77.12  ? 555 LEU C CA  1 
ATOM   5040 C  C   . LEU C 1 228 ? -11.079 -3.510  -25.309 1.00 74.37  ? 555 LEU C C   1 
ATOM   5041 O  O   . LEU C 1 228 ? -11.683 -4.587  -25.403 1.00 71.56  ? 555 LEU C O   1 
ATOM   5042 C  CB  . LEU C 1 228 ? -9.645  -2.978  -23.325 1.00 76.98  ? 555 LEU C CB  1 
ATOM   5043 C  CG  . LEU C 1 228 ? -8.757  -3.631  -22.261 1.00 76.31  ? 555 LEU C CG  1 
ATOM   5044 C  CD1 . LEU C 1 228 ? -8.643  -2.712  -21.058 1.00 77.50  ? 555 LEU C CD1 1 
ATOM   5045 C  CD2 . LEU C 1 228 ? -9.314  -4.975  -21.828 1.00 72.16  ? 555 LEU C CD2 1 
ATOM   5046 N  N   . LEU C 1 229 ? -11.597 -2.327  -25.654 1.00 75.28  ? 556 LEU C N   1 
ATOM   5047 C  CA  . LEU C 1 229 ? -12.935 -2.186  -26.238 1.00 74.31  ? 556 LEU C CA  1 
ATOM   5048 C  C   . LEU C 1 229 ? -13.001 -2.688  -27.678 1.00 75.15  ? 556 LEU C C   1 
ATOM   5049 O  O   . LEU C 1 229 ? -14.073 -3.113  -28.122 1.00 73.65  ? 556 LEU C O   1 
ATOM   5050 C  CB  . LEU C 1 229 ? -13.450 -0.745  -26.149 1.00 76.51  ? 556 LEU C CB  1 
ATOM   5051 C  CG  . LEU C 1 229 ? -13.701 -0.124  -24.771 1.00 76.16  ? 556 LEU C CG  1 
ATOM   5052 C  CD1 . LEU C 1 229 ? -14.021 1.354   -24.922 1.00 79.46  ? 556 LEU C CD1 1 
ATOM   5053 C  CD2 . LEU C 1 229 ? -14.787 -0.839  -23.977 1.00 71.33  ? 556 LEU C CD2 1 
ATOM   5054 N  N   . GLY C 1 230 ? -11.861 -2.639  -28.383 1.00 77.74  ? 557 GLY C N   1 
ATOM   5055 C  CA  . GLY C 1 230 ? -11.697 -3.200  -29.734 1.00 78.20  ? 557 GLY C CA  1 
ATOM   5056 C  C   . GLY C 1 230 ? -11.808 -4.716  -29.819 1.00 75.34  ? 557 GLY C C   1 
ATOM   5057 O  O   . GLY C 1 230 ? -12.079 -5.264  -30.892 1.00 75.52  ? 557 GLY C O   1 
ATOM   5058 N  N   . LYS C 1 231 ? -11.601 -5.390  -28.685 1.00 72.76  ? 558 LYS C N   1 
ATOM   5059 C  CA  . LYS C 1 231 ? -11.817 -6.832  -28.562 1.00 69.48  ? 558 LYS C CA  1 
ATOM   5060 C  C   . LYS C 1 231 ? -13.293 -7.214  -28.704 1.00 66.28  ? 558 LYS C C   1 
ATOM   5061 O  O   . LYS C 1 231 ? -13.613 -8.351  -29.084 1.00 63.64  ? 558 LYS C O   1 
ATOM   5062 C  CB  . LYS C 1 231 ? -11.278 -7.350  -27.216 1.00 68.63  ? 558 LYS C CB  1 
ATOM   5063 C  CG  . LYS C 1 231 ? -9.771  -7.539  -27.145 1.00 71.29  ? 558 LYS C CG  1 
ATOM   5064 C  CD  . LYS C 1 231 ? -9.328  -8.781  -27.903 1.00 71.84  ? 558 LYS C CD  1 
ATOM   5065 C  CE  . LYS C 1 231 ? -7.907  -8.606  -28.399 1.00 76.83  ? 558 LYS C CE  1 
ATOM   5066 N  NZ  . LYS C 1 231 ? -7.719  -9.120  -29.781 1.00 79.20  ? 558 LYS C NZ  1 
ATOM   5067 N  N   . LEU C 1 232 ? -14.185 -6.271  -28.394 1.00 65.89  ? 559 LEU C N   1 
ATOM   5068 C  CA  . LEU C 1 232 ? -15.623 -6.544  -28.443 1.00 63.94  ? 559 LEU C CA  1 
ATOM   5069 C  C   . LEU C 1 232 ? -16.191 -6.714  -29.867 1.00 64.73  ? 559 LEU C C   1 
ATOM   5070 O  O   . LEU C 1 232 ? -16.935 -7.679  -30.094 1.00 62.47  ? 559 LEU C O   1 
ATOM   5071 C  CB  . LEU C 1 232 ? -16.433 -5.552  -27.590 1.00 64.23  ? 559 LEU C CB  1 
ATOM   5072 C  CG  . LEU C 1 232 ? -16.300 -5.662  -26.062 1.00 62.66  ? 559 LEU C CG  1 
ATOM   5073 C  CD1 . LEU C 1 232 ? -16.914 -4.443  -25.390 1.00 63.60  ? 559 LEU C CD1 1 
ATOM   5074 C  CD2 . LEU C 1 232 ? -16.909 -6.944  -25.502 1.00 58.90  ? 559 LEU C CD2 1 
ATOM   5075 N  N   . PRO C 1 233 ? -15.839 -5.810  -30.827 1.00 67.94  ? 560 PRO C N   1 
ATOM   5076 C  CA  . PRO C 1 233 ? -16.180 -6.156  -32.216 1.00 68.84  ? 560 PRO C CA  1 
ATOM   5077 C  C   . PRO C 1 233 ? -15.524 -7.455  -32.750 1.00 67.84  ? 560 PRO C C   1 
ATOM   5078 O  O   . PRO C 1 233 ? -16.180 -8.190  -33.496 1.00 66.85  ? 560 PRO C O   1 
ATOM   5079 C  CB  . PRO C 1 233 ? -15.735 -4.917  -33.010 1.00 73.66  ? 560 PRO C CB  1 
ATOM   5080 C  CG  . PRO C 1 233 ? -15.865 -3.798  -32.034 1.00 74.03  ? 560 PRO C CG  1 
ATOM   5081 C  CD  . PRO C 1 233 ? -15.426 -4.392  -30.726 1.00 71.25  ? 560 PRO C CD  1 
ATOM   5082 N  N   . GLU C 1 234 ? -14.276 -7.742  -32.366 1.00 68.07  ? 561 GLU C N   1 
ATOM   5083 C  CA  . GLU C 1 234 ? -13.633 -9.027  -32.717 1.00 67.77  ? 561 GLU C CA  1 
ATOM   5084 C  C   . GLU C 1 234 ? -14.480 -10.228 -32.264 1.00 63.91  ? 561 GLU C C   1 
ATOM   5085 O  O   . GLU C 1 234 ? -14.665 -11.194 -33.012 1.00 63.32  ? 561 GLU C O   1 
ATOM   5086 C  CB  . GLU C 1 234 ? -12.232 -9.135  -32.110 1.00 69.49  ? 561 GLU C CB  1 
ATOM   5087 C  CG  . GLU C 1 234 ? -11.189 -8.218  -32.731 1.00 74.33  ? 561 GLU C CG  1 
ATOM   5088 C  CD  . GLU C 1 234 ? -9.758  -8.687  -32.485 1.00 76.81  ? 561 GLU C CD  1 
ATOM   5089 O  OE1 . GLU C 1 234 ? -8.829  -8.083  -33.081 1.00 80.73  ? 561 GLU C OE1 1 
ATOM   5090 O  OE2 . GLU C 1 234 ? -9.552  -9.660  -31.714 1.00 74.07  ? 561 GLU C OE2 1 
ATOM   5091 N  N   . LEU C 1 235 ? -15.000 -10.129 -31.040 1.00 61.13  ? 562 LEU C N   1 
ATOM   5092 C  CA  . LEU C 1 235 ? -15.858 -11.141 -30.425 1.00 57.56  ? 562 LEU C CA  1 
ATOM   5093 C  C   . LEU C 1 235 ? -17.164 -11.343 -31.221 1.00 56.17  ? 562 LEU C C   1 
ATOM   5094 O  O   . LEU C 1 235 ? -17.590 -12.481 -31.444 1.00 53.08  ? 562 LEU C O   1 
ATOM   5095 C  CB  . LEU C 1 235 ? -16.113 -10.764 -28.952 1.00 55.68  ? 562 LEU C CB  1 
ATOM   5096 C  CG  . LEU C 1 235 ? -16.877 -11.685 -27.999 1.00 53.83  ? 562 LEU C CG  1 
ATOM   5097 C  CD1 . LEU C 1 235 ? -16.206 -13.046 -27.843 1.00 52.39  ? 562 LEU C CD1 1 
ATOM   5098 C  CD2 . LEU C 1 235 ? -17.059 -10.993 -26.652 1.00 52.94  ? 562 LEU C CD2 1 
ATOM   5099 N  N   . ARG C 1 236 ? -17.760 -10.233 -31.659 1.00 57.76  ? 563 ARG C N   1 
ATOM   5100 C  CA  . ARG C 1 236 ? -18.929 -10.232 -32.534 1.00 58.75  ? 563 ARG C CA  1 
ATOM   5101 C  C   . ARG C 1 236 ? -18.659 -11.002 -33.838 1.00 60.09  ? 563 ARG C C   1 
ATOM   5102 O  O   . ARG C 1 236 ? -19.470 -11.838 -34.240 1.00 59.33  ? 563 ARG C O   1 
ATOM   5103 C  CB  . ARG C 1 236 ? -19.383 -8.786  -32.803 1.00 61.49  ? 563 ARG C CB  1 
ATOM   5104 C  CG  . ARG C 1 236 ? -20.688 -8.586  -33.582 1.00 63.31  ? 563 ARG C CG  1 
ATOM   5105 C  CD  . ARG C 1 236 ? -21.959 -9.004  -32.831 1.00 62.46  ? 563 ARG C CD  1 
ATOM   5106 N  NE  . ARG C 1 236 ? -22.120 -8.346  -31.527 1.00 62.09  ? 563 ARG C NE  1 
ATOM   5107 C  CZ  . ARG C 1 236 ? -22.641 -7.134  -31.343 1.00 63.95  ? 563 ARG C CZ  1 
ATOM   5108 N  NH1 . ARG C 1 236 ? -23.068 -6.404  -32.377 1.00 65.71  ? 563 ARG C NH1 1 
ATOM   5109 N  NH2 . ARG C 1 236 ? -22.727 -6.649  -30.111 1.00 63.39  ? 563 ARG C NH2 1 
ATOM   5110 N  N   . THR C 1 237 ? -17.516 -10.751 -34.472 1.00 62.89  ? 564 THR C N   1 
ATOM   5111 C  CA  . THR C 1 237 ? -17.151 -11.464 -35.707 1.00 64.80  ? 564 THR C CA  1 
ATOM   5112 C  C   . THR C 1 237 ? -16.917 -12.961 -35.452 1.00 62.86  ? 564 THR C C   1 
ATOM   5113 O  O   . THR C 1 237 ? -17.323 -13.806 -36.250 1.00 63.09  ? 564 THR C O   1 
ATOM   5114 C  CB  . THR C 1 237 ? -15.944 -10.816 -36.412 1.00 68.82  ? 564 THR C CB  1 
ATOM   5115 O  OG1 . THR C 1 237 ? -16.129 -9.394  -36.456 1.00 71.22  ? 564 THR C OG1 1 
ATOM   5116 C  CG2 . THR C 1 237 ? -15.794 -11.341 -37.846 1.00 71.68  ? 564 THR C CG2 1 
ATOM   5117 N  N   . LEU C 1 238 ? -16.287 -13.277 -34.325 1.00 61.07  ? 565 LEU C N   1 
ATOM   5118 C  CA  . LEU C 1 238 ? -16.058 -14.654 -33.919 1.00 60.06  ? 565 LEU C CA  1 
ATOM   5119 C  C   . LEU C 1 238 ? -17.375 -15.382 -33.603 1.00 57.12  ? 565 LEU C C   1 
ATOM   5120 O  O   . LEU C 1 238 ? -17.507 -16.585 -33.846 1.00 56.32  ? 565 LEU C O   1 
ATOM   5121 C  CB  . LEU C 1 238 ? -15.155 -14.663 -32.700 1.00 60.18  ? 565 LEU C CB  1 
ATOM   5122 C  CG  . LEU C 1 238 ? -14.118 -15.755 -32.576 1.00 60.75  ? 565 LEU C CG  1 
ATOM   5123 C  CD1 . LEU C 1 238 ? -12.923 -15.446 -33.451 1.00 64.11  ? 565 LEU C CD1 1 
ATOM   5124 C  CD2 . LEU C 1 238 ? -13.696 -15.774 -31.127 1.00 59.68  ? 565 LEU C CD2 1 
ATOM   5125 N  N   . CYS C 1 239 ? -18.338 -14.634 -33.069 1.00 55.77  ? 566 CYS C N   1 
ATOM   5126 C  CA  . CYS C 1 239 ? -19.687 -15.120 -32.826 1.00 53.72  ? 566 CYS C CA  1 
ATOM   5127 C  C   . CYS C 1 239 ? -20.342 -15.552 -34.138 1.00 53.37  ? 566 CYS C C   1 
ATOM   5128 O  O   . CYS C 1 239 ? -20.861 -16.663 -34.257 1.00 51.46  ? 566 CYS C O   1 
ATOM   5129 C  CB  . CYS C 1 239 ? -20.499 -14.023 -32.150 1.00 54.71  ? 566 CYS C CB  1 
ATOM   5130 S  SG  . CYS C 1 239 ? -22.247 -14.393 -31.987 1.00 59.76  ? 566 CYS C SG  1 
ATOM   5131 N  N   . THR C 1 240 ? -20.289 -14.653 -35.115 1.00 54.49  ? 567 THR C N   1 
ATOM   5132 C  CA  . THR C 1 240 ? -20.749 -14.872 -36.480 1.00 55.27  ? 567 THR C CA  1 
ATOM   5133 C  C   . THR C 1 240 ? -20.325 -16.242 -37.049 1.00 54.58  ? 567 THR C C   1 
ATOM   5134 O  O   . THR C 1 240 ? -21.155 -16.956 -37.626 1.00 54.53  ? 567 THR C O   1 
ATOM   5135 C  CB  . THR C 1 240 ? -20.331 -13.652 -37.338 1.00 58.76  ? 567 THR C CB  1 
ATOM   5136 O  OG1 . THR C 1 240 ? -21.389 -12.695 -37.296 1.00 59.61  ? 567 THR C OG1 1 
ATOM   5137 C  CG2 . THR C 1 240 ? -20.013 -13.989 -38.787 1.00 61.47  ? 567 THR C CG2 1 
ATOM   5138 N  N   . GLN C 1 241 ? -19.062 -16.612 -36.836 1.00 53.88  ? 568 GLN C N   1 
ATOM   5139 C  CA  . GLN C 1 241 ? -18.561 -17.942 -37.173 1.00 53.64  ? 568 GLN C CA  1 
ATOM   5140 C  C   . GLN C 1 241 ? -19.313 -19.092 -36.464 1.00 50.28  ? 568 GLN C C   1 
ATOM   5141 O  O   . GLN C 1 241 ? -19.696 -20.073 -37.107 1.00 50.64  ? 568 GLN C O   1 
ATOM   5142 C  CB  . GLN C 1 241 ? -17.066 -18.015 -36.892 1.00 55.91  ? 568 GLN C CB  1 
ATOM   5143 C  CG  . GLN C 1 241 ? -16.322 -18.993 -37.792 1.00 59.32  ? 568 GLN C CG  1 
ATOM   5144 C  CD  . GLN C 1 241 ? -14.810 -18.827 -37.745 1.00 62.49  ? 568 GLN C CD  1 
ATOM   5145 O  OE1 . GLN C 1 241 ? -14.285 -17.801 -37.294 1.00 63.64  ? 568 GLN C OE1 1 
ATOM   5146 N  NE2 . GLN C 1 241 ? -14.101 -19.836 -38.227 1.00 64.67  ? 568 GLN C NE2 1 
ATOM   5147 N  N   . GLY C 1 242 ? -19.539 -18.958 -35.156 1.00 46.97  ? 569 GLY C N   1 
ATOM   5148 C  CA  . GLY C 1 242 ? -20.296 -19.941 -34.393 1.00 43.77  ? 569 GLY C CA  1 
ATOM   5149 C  C   . GLY C 1 242 ? -21.724 -20.088 -34.867 1.00 42.81  ? 569 GLY C C   1 
ATOM   5150 O  O   . GLY C 1 242 ? -22.194 -21.220 -35.071 1.00 42.39  ? 569 GLY C O   1 
ATOM   5151 N  N   . LEU C 1 243 ? -22.401 -18.949 -35.055 1.00 42.31  ? 570 LEU C N   1 
ATOM   5152 C  CA  . LEU C 1 243 ? -23.780 -18.920 -35.550 1.00 42.60  ? 570 LEU C CA  1 
ATOM   5153 C  C   . LEU C 1 243 ? -23.925 -19.726 -36.847 1.00 43.86  ? 570 LEU C C   1 
ATOM   5154 O  O   . LEU C 1 243 ? -24.881 -20.469 -36.994 1.00 43.44  ? 570 LEU C O   1 
ATOM   5155 C  CB  . LEU C 1 243 ? -24.310 -17.475 -35.727 1.00 43.74  ? 570 LEU C CB  1 
ATOM   5156 C  CG  . LEU C 1 243 ? -25.851 -17.310 -35.729 1.00 43.40  ? 570 LEU C CG  1 
ATOM   5157 C  CD1 . LEU C 1 243 ? -26.472 -17.779 -34.415 1.00 41.56  ? 570 LEU C CD1 1 
ATOM   5158 C  CD2 . LEU C 1 243 ? -26.282 -15.886 -36.027 1.00 44.26  ? 570 LEU C CD2 1 
ATOM   5159 N  N   . GLN C 1 244 ? -22.936 -19.602 -37.738 1.00 46.33  ? 571 GLN C N   1 
ATOM   5160 C  CA  . GLN C 1 244 ? -22.857 -20.320 -39.016 1.00 48.43  ? 571 GLN C CA  1 
ATOM   5161 C  C   . GLN C 1 244 ? -22.789 -21.854 -38.869 1.00 47.64  ? 571 GLN C C   1 
ATOM   5162 O  O   . GLN C 1 244 ? -23.459 -22.586 -39.620 1.00 47.57  ? 571 GLN C O   1 
ATOM   5163 C  CB  . GLN C 1 244 ? -21.664 -19.778 -39.816 1.00 51.49  ? 571 GLN C CB  1 
ATOM   5164 C  CG  . GLN C 1 244 ? -21.176 -20.692 -40.913 1.00 54.66  ? 571 GLN C CG  1 
ATOM   5165 C  CD  . GLN C 1 244 ? -20.022 -20.112 -41.686 1.00 57.95  ? 571 GLN C CD  1 
ATOM   5166 O  OE1 . GLN C 1 244 ? -18.887 -20.100 -41.217 1.00 59.68  ? 571 GLN C OE1 1 
ATOM   5167 N  NE2 . GLN C 1 244 ? -20.303 -19.634 -42.882 1.00 60.06  ? 571 GLN C NE2 1 
ATOM   5168 N  N   . ARG C 1 245 ? -21.980 -22.315 -37.910 1.00 46.27  ? 572 ARG C N   1 
ATOM   5169 C  CA  . ARG C 1 245 ? -21.845 -23.732 -37.575 1.00 46.27  ? 572 ARG C CA  1 
ATOM   5170 C  C   . ARG C 1 245 ? -23.161 -24.365 -37.061 1.00 44.72  ? 572 ARG C C   1 
ATOM   5171 O  O   . ARG C 1 245 ? -23.545 -25.465 -37.476 1.00 45.31  ? 572 ARG C O   1 
ATOM   5172 C  CB  . ARG C 1 245 ? -20.712 -23.899 -36.552 1.00 46.73  ? 572 ARG C CB  1 
ATOM   5173 C  CG  . ARG C 1 245 ? -20.411 -25.321 -36.079 1.00 46.60  ? 572 ARG C CG  1 
ATOM   5174 C  CD  . ARG C 1 245 ? -20.013 -26.267 -37.197 1.00 48.75  ? 572 ARG C CD  1 
ATOM   5175 N  NE  . ARG C 1 245 ? -19.628 -27.556 -36.636 1.00 49.88  ? 572 ARG C NE  1 
ATOM   5176 C  CZ  . ARG C 1 245 ? -19.679 -28.725 -37.270 1.00 51.32  ? 572 ARG C CZ  1 
ATOM   5177 N  NH1 . ARG C 1 245 ? -20.122 -28.816 -38.520 1.00 52.18  ? 572 ARG C NH1 1 
ATOM   5178 N  NH2 . ARG C 1 245 ? -19.289 -29.815 -36.631 1.00 51.86  ? 572 ARG C NH2 1 
ATOM   5179 N  N   . ILE C 1 246 ? -23.848 -23.659 -36.171 1.00 42.41  ? 573 ILE C N   1 
ATOM   5180 C  CA  . ILE C 1 246 ? -25.153 -24.083 -35.691 1.00 40.99  ? 573 ILE C CA  1 
ATOM   5181 C  C   . ILE C 1 246 ? -26.193 -24.106 -36.825 1.00 41.94  ? 573 ILE C C   1 
ATOM   5182 O  O   . ILE C 1 246 ? -26.991 -25.062 -36.939 1.00 42.01  ? 573 ILE C O   1 
ATOM   5183 C  CB  . ILE C 1 246 ? -25.602 -23.193 -34.520 1.00 39.78  ? 573 ILE C CB  1 
ATOM   5184 C  CG1 . ILE C 1 246 ? -24.656 -23.442 -33.326 1.00 39.70  ? 573 ILE C CG1 1 
ATOM   5185 C  CG2 . ILE C 1 246 ? -27.053 -23.477 -34.147 1.00 37.99  ? 573 ILE C CG2 1 
ATOM   5186 C  CD1 . ILE C 1 246 ? -24.519 -22.272 -32.372 1.00 39.55  ? 573 ILE C CD1 1 
ATOM   5187 N  N   . PHE C 1 247 ? -26.174 -23.062 -37.662 1.00 41.82  ? 574 PHE C N   1 
ATOM   5188 C  CA  . PHE C 1 247 ? -27.013 -23.006 -38.849 1.00 42.41  ? 574 PHE C CA  1 
ATOM   5189 C  C   . PHE C 1 247 ? -26.760 -24.223 -39.731 1.00 44.12  ? 574 PHE C C   1 
ATOM   5190 O  O   . PHE C 1 247 ? -27.719 -24.853 -40.182 1.00 45.07  ? 574 PHE C O   1 
ATOM   5191 C  CB  . PHE C 1 247 ? -26.786 -21.714 -39.633 1.00 43.59  ? 574 PHE C CB  1 
ATOM   5192 C  CG  . PHE C 1 247 ? -27.461 -21.688 -40.981 1.00 45.22  ? 574 PHE C CG  1 
ATOM   5193 C  CD1 . PHE C 1 247 ? -28.802 -21.328 -41.098 1.00 45.21  ? 574 PHE C CD1 1 
ATOM   5194 C  CD2 . PHE C 1 247 ? -26.756 -22.023 -42.136 1.00 47.18  ? 574 PHE C CD2 1 
ATOM   5195 C  CE1 . PHE C 1 247 ? -29.427 -21.295 -42.339 1.00 47.44  ? 574 PHE C CE1 1 
ATOM   5196 C  CE2 . PHE C 1 247 ? -27.379 -21.987 -43.384 1.00 49.63  ? 574 PHE C CE2 1 
ATOM   5197 C  CZ  . PHE C 1 247 ? -28.718 -21.621 -43.485 1.00 49.44  ? 574 PHE C CZ  1 
ATOM   5198 N  N   . TYR C 1 248 ? -25.483 -24.554 -39.958 1.00 44.73  ? 575 TYR C N   1 
ATOM   5199 C  CA  . TYR C 1 248 ? -25.127 -25.674 -40.813 1.00 46.36  ? 575 TYR C CA  1 
ATOM   5200 C  C   . TYR C 1 248 ? -25.714 -26.964 -40.287 1.00 45.80  ? 575 TYR C C   1 
ATOM   5201 O  O   . TYR C 1 248 ? -26.370 -27.696 -41.027 1.00 46.92  ? 575 TYR C O   1 
ATOM   5202 C  CB  . TYR C 1 248 ? -23.612 -25.816 -40.964 1.00 47.78  ? 575 TYR C CB  1 
ATOM   5203 C  CG  . TYR C 1 248 ? -23.239 -27.000 -41.835 1.00 50.36  ? 575 TYR C CG  1 
ATOM   5204 C  CD1 . TYR C 1 248 ? -23.267 -26.903 -43.243 1.00 52.55  ? 575 TYR C CD1 1 
ATOM   5205 C  CD2 . TYR C 1 248 ? -22.901 -28.235 -41.256 1.00 50.10  ? 575 TYR C CD2 1 
ATOM   5206 C  CE1 . TYR C 1 248 ? -22.961 -27.997 -44.035 1.00 55.04  ? 575 TYR C CE1 1 
ATOM   5207 C  CE2 . TYR C 1 248 ? -22.594 -29.329 -42.043 1.00 52.59  ? 575 TYR C CE2 1 
ATOM   5208 C  CZ  . TYR C 1 248 ? -22.628 -29.208 -43.422 1.00 55.28  ? 575 TYR C CZ  1 
ATOM   5209 O  OH  . TYR C 1 248 ? -22.314 -30.305 -44.184 1.00 58.65  ? 575 TYR C OH  1 
ATOM   5210 N  N   . LEU C 1 249 ? -25.484 -27.211 -39.000 1.00 44.57  ? 576 LEU C N   1 
ATOM   5211 C  CA  . LEU C 1 249 ? -25.852 -28.452 -38.339 1.00 44.51  ? 576 LEU C CA  1 
ATOM   5212 C  C   . LEU C 1 249 ? -27.333 -28.630 -38.335 1.00 44.87  ? 576 LEU C C   1 
ATOM   5213 O  O   . LEU C 1 249 ? -27.816 -29.737 -38.572 1.00 46.24  ? 576 LEU C O   1 
ATOM   5214 C  CB  . LEU C 1 249 ? -25.325 -28.474 -36.901 1.00 43.12  ? 576 LEU C CB  1 
ATOM   5215 C  CG  . LEU C 1 249 ? -23.824 -28.718 -36.723 1.00 43.80  ? 576 LEU C CG  1 
ATOM   5216 C  CD1 . LEU C 1 249 ? -23.404 -28.346 -35.312 1.00 41.94  ? 576 LEU C CD1 1 
ATOM   5217 C  CD2 . LEU C 1 249 ? -23.422 -30.149 -37.073 1.00 45.77  ? 576 LEU C CD2 1 
ATOM   5218 N  N   . LYS C 1 250 ? -28.046 -27.530 -38.086 1.00 45.10  ? 577 LYS C N   1 
ATOM   5219 C  CA  . LYS C 1 250 ? -29.504 -27.526 -38.044 1.00 46.38  ? 577 LYS C CA  1 
ATOM   5220 C  C   . LYS C 1 250 ? -30.077 -27.818 -39.420 1.00 49.30  ? 577 LYS C C   1 
ATOM   5221 O  O   . LYS C 1 250 ? -31.056 -28.552 -39.544 1.00 51.21  ? 577 LYS C O   1 
ATOM   5222 C  CB  . LYS C 1 250 ? -30.038 -26.198 -37.501 1.00 45.39  ? 577 LYS C CB  1 
ATOM   5223 C  CG  . LYS C 1 250 ? -31.549 -26.171 -37.319 1.00 46.32  ? 577 LYS C CG  1 
ATOM   5224 C  CD  . LYS C 1 250 ? -32.023 -24.985 -36.495 1.00 44.73  ? 577 LYS C CD  1 
ATOM   5225 C  CE  . LYS C 1 250 ? -33.532 -24.840 -36.618 1.00 45.74  ? 577 LYS C CE  1 
ATOM   5226 N  NZ  . LYS C 1 250 ? -34.325 -25.839 -35.843 1.00 46.23  ? 577 LYS C NZ  1 
ATOM   5227 N  N   . LEU C 1 251 ? -29.443 -27.255 -40.445 1.00 51.06  ? 578 LEU C N   1 
ATOM   5228 C  CA  . LEU C 1 251 ? -29.885 -27.419 -41.824 1.00 53.28  ? 578 LEU C CA  1 
ATOM   5229 C  C   . LEU C 1 251 ? -29.536 -28.813 -42.329 1.00 55.01  ? 578 LEU C C   1 
ATOM   5230 O  O   . LEU C 1 251 ? -30.372 -29.459 -42.976 1.00 56.24  ? 578 LEU C O   1 
ATOM   5231 C  CB  . LEU C 1 251 ? -29.262 -26.337 -42.711 1.00 54.66  ? 578 LEU C CB  1 
ATOM   5232 C  CG  . LEU C 1 251 ? -29.972 -25.954 -44.007 1.00 57.00  ? 578 LEU C CG  1 
ATOM   5233 C  CD1 . LEU C 1 251 ? -31.303 -25.264 -43.740 1.00 56.75  ? 578 LEU C CD1 1 
ATOM   5234 C  CD2 . LEU C 1 251 ? -29.054 -25.041 -44.793 1.00 58.56  ? 578 LEU C CD2 1 
ATOM   5235 N  N   . GLU C 1 252 ? -28.314 -29.270 -42.022 1.00 55.07  ? 579 GLU C N   1 
ATOM   5236 C  CA  . GLU C 1 252 ? -27.866 -30.633 -42.340 1.00 56.73  ? 579 GLU C CA  1 
ATOM   5237 C  C   . GLU C 1 252 ? -28.867 -31.628 -41.756 1.00 56.72  ? 579 GLU C C   1 
ATOM   5238 O  O   . GLU C 1 252 ? -29.314 -32.541 -42.460 1.00 58.60  ? 579 GLU C O   1 
ATOM   5239 C  CB  . GLU C 1 252 ? -26.448 -30.896 -41.807 1.00 56.97  ? 579 GLU C CB  1 
ATOM   5240 C  CG  . GLU C 1 252 ? -26.033 -32.362 -41.807 1.00 59.11  ? 579 GLU C CG  1 
ATOM   5241 C  CD  . GLU C 1 252 ? -24.571 -32.582 -41.458 1.00 60.86  ? 579 GLU C CD  1 
ATOM   5242 O  OE1 . GLU C 1 252 ? -24.184 -32.428 -40.267 1.00 59.30  ? 579 GLU C OE1 1 
ATOM   5243 O  OE2 . GLU C 1 252 ? -23.808 -32.939 -42.389 1.00 63.67  ? 579 GLU C OE2 1 
ATOM   5244 N  N   . ASP C 1 253 ? -29.217 -31.414 -40.477 1.00 54.13  ? 580 ASP C N   1 
ATOM   5245 C  CA  . ASP C 1 253 ? -30.288 -32.126 -39.778 1.00 53.58  ? 580 ASP C CA  1 
ATOM   5246 C  C   . ASP C 1 253 ? -29.985 -33.605 -39.586 1.00 54.36  ? 580 ASP C C   1 
ATOM   5247 O  O   . ASP C 1 253 ? -30.888 -34.443 -39.573 1.00 55.56  ? 580 ASP C O   1 
ATOM   5248 C  CB  . ASP C 1 253 ? -31.655 -31.895 -40.465 1.00 55.68  ? 580 ASP C CB  1 
ATOM   5249 C  CG  . ASP C 1 253 ? -32.843 -32.261 -39.577 1.00 56.24  ? 580 ASP C CG  1 
ATOM   5250 O  OD1 . ASP C 1 253 ? -33.852 -32.744 -40.139 1.00 58.51  ? 580 ASP C OD1 1 
ATOM   5251 O  OD2 . ASP C 1 253 ? -32.770 -32.069 -38.337 1.00 54.21  ? 580 ASP C OD2 1 
ATOM   5252 N  N   . LEU C 1 254 ? -28.703 -33.918 -39.416 1.00 54.08  ? 581 LEU C N   1 
ATOM   5253 C  CA  . LEU C 1 254 ? -28.293 -35.283 -39.119 1.00 55.09  ? 581 LEU C CA  1 
ATOM   5254 C  C   . LEU C 1 254 ? -28.133 -35.503 -37.617 1.00 53.35  ? 581 LEU C C   1 
ATOM   5255 O  O   . LEU C 1 254 ? -28.480 -36.564 -37.108 1.00 54.67  ? 581 LEU C O   1 
ATOM   5256 C  CB  . LEU C 1 254 ? -27.050 -35.685 -39.930 1.00 57.19  ? 581 LEU C CB  1 
ATOM   5257 C  CG  . LEU C 1 254 ? -27.232 -35.803 -41.467 1.00 59.49  ? 581 LEU C CG  1 
ATOM   5258 C  CD1 . LEU C 1 254 ? -25.967 -36.294 -42.170 1.00 61.57  ? 581 LEU C CD1 1 
ATOM   5259 C  CD2 . LEU C 1 254 ? -28.424 -36.663 -41.892 1.00 61.13  ? 581 LEU C CD2 1 
ATOM   5260 N  N   . VAL C 1 255 ? -27.617 -34.497 -36.917 1.00 50.77  ? 582 VAL C N   1 
ATOM   5261 C  CA  . VAL C 1 255 ? -27.674 -34.445 -35.455 1.00 49.03  ? 582 VAL C CA  1 
ATOM   5262 C  C   . VAL C 1 255 ? -28.351 -33.123 -35.051 1.00 47.07  ? 582 VAL C C   1 
ATOM   5263 O  O   . VAL C 1 255 ? -27.673 -32.108 -34.853 1.00 45.74  ? 582 VAL C O   1 
ATOM   5264 C  CB  . VAL C 1 255 ? -26.287 -34.569 -34.783 1.00 48.92  ? 582 VAL C CB  1 
ATOM   5265 C  CG1 . VAL C 1 255 ? -26.451 -34.971 -33.327 1.00 48.07  ? 582 VAL C CG1 1 
ATOM   5266 C  CG2 . VAL C 1 255 ? -25.404 -35.587 -35.493 1.00 51.91  ? 582 VAL C CG2 1 
ATOM   5267 N  N   . PRO C 1 256 ? -29.695 -33.123 -34.932 1.00 47.18  ? 583 PRO C N   1 
ATOM   5268 C  CA  . PRO C 1 256 ? -30.397 -31.864 -34.667 1.00 45.16  ? 583 PRO C CA  1 
ATOM   5269 C  C   . PRO C 1 256 ? -30.035 -31.308 -33.297 1.00 43.52  ? 583 PRO C C   1 
ATOM   5270 O  O   . PRO C 1 256 ? -29.809 -32.094 -32.374 1.00 43.64  ? 583 PRO C O   1 
ATOM   5271 C  CB  . PRO C 1 256 ? -31.887 -32.247 -34.726 1.00 46.23  ? 583 PRO C CB  1 
ATOM   5272 C  CG  . PRO C 1 256 ? -31.929 -33.590 -35.372 1.00 48.99  ? 583 PRO C CG  1 
ATOM   5273 C  CD  . PRO C 1 256 ? -30.630 -34.260 -35.024 1.00 49.25  ? 583 PRO C CD  1 
ATOM   5274 N  N   . PRO C 1 257 ? -29.966 -29.959 -33.167 1.00 42.22  ? 584 PRO C N   1 
ATOM   5275 C  CA  . PRO C 1 257 ? -29.663 -29.353 -31.873 1.00 40.21  ? 584 PRO C CA  1 
ATOM   5276 C  C   . PRO C 1 257 ? -30.791 -29.551 -30.852 1.00 40.25  ? 584 PRO C C   1 
ATOM   5277 O  O   . PRO C 1 257 ? -31.936 -29.791 -31.251 1.00 41.25  ? 584 PRO C O   1 
ATOM   5278 C  CB  . PRO C 1 257 ? -29.475 -27.869 -32.201 1.00 39.10  ? 584 PRO C CB  1 
ATOM   5279 C  CG  . PRO C 1 257 ? -30.204 -27.644 -33.460 1.00 40.72  ? 584 PRO C CG  1 
ATOM   5280 C  CD  . PRO C 1 257 ? -30.181 -28.942 -34.219 1.00 42.34  ? 584 PRO C CD  1 
ATOM   5281 N  N   . PRO C 1 258 ? -30.468 -29.466 -29.540 1.00 39.24  ? 585 PRO C N   1 
ATOM   5282 C  CA  . PRO C 1 258 ? -31.518 -29.544 -28.516 1.00 39.76  ? 585 PRO C CA  1 
ATOM   5283 C  C   . PRO C 1 258 ? -32.470 -28.350 -28.590 1.00 39.78  ? 585 PRO C C   1 
ATOM   5284 O  O   . PRO C 1 258 ? -32.152 -27.338 -29.239 1.00 39.30  ? 585 PRO C O   1 
ATOM   5285 C  CB  . PRO C 1 258 ? -30.736 -29.504 -27.201 1.00 38.49  ? 585 PRO C CB  1 
ATOM   5286 C  CG  . PRO C 1 258 ? -29.445 -28.854 -27.551 1.00 37.56  ? 585 PRO C CG  1 
ATOM   5287 C  CD  . PRO C 1 258 ? -29.133 -29.323 -28.935 1.00 37.79  ? 585 PRO C CD  1 
ATOM   5288 N  N   . ALA C 1 259 ? -33.610 -28.473 -27.907 1.00 40.68  ? 586 ALA C N   1 
ATOM   5289 C  CA  . ALA C 1 259 ? -34.688 -27.491 -27.957 1.00 40.65  ? 586 ALA C CA  1 
ATOM   5290 C  C   . ALA C 1 259 ? -34.212 -26.089 -27.601 1.00 39.58  ? 586 ALA C C   1 
ATOM   5291 O  O   . ALA C 1 259 ? -34.586 -25.112 -28.261 1.00 39.82  ? 586 ALA C O   1 
ATOM   5292 C  CB  . ALA C 1 259 ? -35.835 -27.926 -27.057 1.00 42.11  ? 586 ALA C CB  1 
ATOM   5293 N  N   . ILE C 1 260 ? -33.339 -26.001 -26.597 1.00 39.14  ? 587 ILE C N   1 
ATOM   5294 C  CA  . ILE C 1 260 ? -32.872 -24.712 -26.084 1.00 37.61  ? 587 ILE C CA  1 
ATOM   5295 C  C   . ILE C 1 260 ? -31.946 -23.968 -27.055 1.00 36.70  ? 587 ILE C C   1 
ATOM   5296 O  O   . ILE C 1 260 ? -31.907 -22.741 -27.046 1.00 37.59  ? 587 ILE C O   1 
ATOM   5297 C  CB  . ILE C 1 260 ? -32.311 -24.832 -24.624 1.00 37.70  ? 587 ILE C CB  1 
ATOM   5298 C  CG1 . ILE C 1 260 ? -32.193 -23.461 -23.954 1.00 36.79  ? 587 ILE C CG1 1 
ATOM   5299 C  CG2 . ILE C 1 260 ? -30.967 -25.553 -24.554 1.00 36.26  ? 587 ILE C CG2 1 
ATOM   5300 C  CD1 . ILE C 1 260 ? -33.440 -22.978 -23.275 1.00 38.58  ? 587 ILE C CD1 1 
ATOM   5301 N  N   . ILE C 1 261 ? -31.203 -24.687 -27.891 1.00 36.47  ? 588 ILE C N   1 
ATOM   5302 C  CA  . ILE C 1 261 ? -30.365 -24.016 -28.890 1.00 35.71  ? 588 ILE C CA  1 
ATOM   5303 C  C   . ILE C 1 261 ? -31.280 -23.467 -29.995 1.00 37.04  ? 588 ILE C C   1 
ATOM   5304 O  O   . ILE C 1 261 ? -31.115 -22.322 -30.425 1.00 37.15  ? 588 ILE C O   1 
ATOM   5305 C  CB  . ILE C 1 261 ? -29.189 -24.904 -29.387 1.00 35.43  ? 588 ILE C CB  1 
ATOM   5306 C  CG1 . ILE C 1 261 ? -28.134 -25.002 -28.272 1.00 34.58  ? 588 ILE C CG1 1 
ATOM   5307 C  CG2 . ILE C 1 261 ? -28.551 -24.366 -30.677 1.00 34.67  ? 588 ILE C CG2 1 
ATOM   5308 C  CD1 . ILE C 1 261 ? -27.092 -26.084 -28.467 1.00 34.81  ? 588 ILE C CD1 1 
ATOM   5309 N  N   . ASP C 1 262 ? -32.260 -24.280 -30.409 1.00 38.52  ? 589 ASP C N   1 
ATOM   5310 C  CA  . ASP C 1 262 ? -33.303 -23.863 -31.361 1.00 40.11  ? 589 ASP C CA  1 
ATOM   5311 C  C   . ASP C 1 262 ? -33.976 -22.582 -30.937 1.00 40.24  ? 589 ASP C C   1 
ATOM   5312 O  O   . ASP C 1 262 ? -34.099 -21.669 -31.761 1.00 40.29  ? 589 ASP C O   1 
ATOM   5313 C  CB  . ASP C 1 262 ? -34.357 -24.946 -31.556 1.00 41.47  ? 589 ASP C CB  1 
ATOM   5314 C  CG  . ASP C 1 262 ? -33.905 -26.015 -32.501 1.00 43.47  ? 589 ASP C CG  1 
ATOM   5315 O  OD1 . ASP C 1 262 ? -32.998 -25.742 -33.323 1.00 43.31  ? 589 ASP C OD1 1 
ATOM   5316 O  OD2 . ASP C 1 262 ? -34.469 -27.131 -32.437 1.00 45.59  ? 589 ASP C OD2 1 
ATOM   5317 N  N   . LYS C 1 263 ? -34.352 -22.514 -29.645 1.00 39.92  ? 590 LYS C N   1 
ATOM   5318 C  CA  . LYS C 1 263 ? -34.991 -21.344 -29.064 1.00 40.10  ? 590 LYS C CA  1 
ATOM   5319 C  C   . LYS C 1 263 ? -34.102 -20.127 -29.212 1.00 39.25  ? 590 LYS C C   1 
ATOM   5320 O  O   . LYS C 1 263 ? -34.557 -19.132 -29.789 1.00 39.92  ? 590 LYS C O   1 
ATOM   5321 C  CB  . LYS C 1 263 ? -35.390 -21.547 -27.596 1.00 40.30  ? 590 LYS C CB  1 
ATOM   5322 C  CG  . LYS C 1 263 ? -36.429 -20.535 -27.093 1.00 42.02  ? 590 LYS C CG  1 
ATOM   5323 C  CD  . LYS C 1 263 ? -36.871 -20.763 -25.637 1.00 42.85  ? 590 LYS C CD  1 
ATOM   5324 C  CE  . LYS C 1 263 ? -35.860 -20.191 -24.641 1.00 42.37  ? 590 LYS C CE  1 
ATOM   5325 N  NZ  . LYS C 1 263 ? -36.095 -20.578 -23.220 1.00 43.03  ? 590 LYS C NZ  1 
ATOM   5326 N  N   . LEU C 1 264 ? -32.851 -20.206 -28.734 1.00 37.29  ? 591 LEU C N   1 
ATOM   5327 C  CA  . LEU C 1 264 ? -32.000 -19.018 -28.723 1.00 37.45  ? 591 LEU C CA  1 
ATOM   5328 C  C   . LEU C 1 264 ? -31.634 -18.609 -30.139 1.00 37.76  ? 591 LEU C C   1 
ATOM   5329 O  O   . LEU C 1 264 ? -31.630 -17.421 -30.445 1.00 38.62  ? 591 LEU C O   1 
ATOM   5330 C  CB  . LEU C 1 264 ? -30.743 -19.150 -27.831 1.00 36.85  ? 591 LEU C CB  1 
ATOM   5331 C  CG  . LEU C 1 264 ? -30.675 -19.409 -26.305 1.00 37.71  ? 591 LEU C CG  1 
ATOM   5332 C  CD1 . LEU C 1 264 ? -29.499 -18.638 -25.673 1.00 37.00  ? 591 LEU C CD1 1 
ATOM   5333 C  CD2 . LEU C 1 264 ? -31.945 -19.170 -25.502 1.00 37.72  ? 591 LEU C CD2 1 
ATOM   5334 N  N   . PHE C 1 265 ? -31.352 -19.595 -30.997 1.00 37.80  ? 592 PHE C N   1 
ATOM   5335 C  CA  . PHE C 1 265 ? -31.058 -19.365 -32.416 1.00 38.66  ? 592 PHE C CA  1 
ATOM   5336 C  C   . PHE C 1 265 ? -32.163 -18.606 -33.166 1.00 40.53  ? 592 PHE C C   1 
ATOM   5337 O  O   . PHE C 1 265 ? -31.884 -17.625 -33.855 1.00 41.53  ? 592 PHE C O   1 
ATOM   5338 C  CB  . PHE C 1 265 ? -30.778 -20.702 -33.092 1.00 38.40  ? 592 PHE C CB  1 
ATOM   5339 C  CG  . PHE C 1 265 ? -30.439 -20.596 -34.535 1.00 38.77  ? 592 PHE C CG  1 
ATOM   5340 C  CD1 . PHE C 1 265 ? -29.130 -20.327 -34.935 1.00 38.79  ? 592 PHE C CD1 1 
ATOM   5341 C  CD2 . PHE C 1 265 ? -31.417 -20.791 -35.509 1.00 39.86  ? 592 PHE C CD2 1 
ATOM   5342 C  CE1 . PHE C 1 265 ? -28.799 -20.232 -36.283 1.00 40.12  ? 592 PHE C CE1 1 
ATOM   5343 C  CE2 . PHE C 1 265 ? -31.091 -20.685 -36.866 1.00 41.48  ? 592 PHE C CE2 1 
ATOM   5344 C  CZ  . PHE C 1 265 ? -29.780 -20.414 -37.249 1.00 41.32  ? 592 PHE C CZ  1 
ATOM   5345 N  N   . LEU C 1 266 ? -33.407 -19.066 -33.023 1.00 41.92  ? 593 LEU C N   1 
ATOM   5346 C  CA  . LEU C 1 266 ? -34.551 -18.498 -33.767 1.00 44.35  ? 593 LEU C CA  1 
ATOM   5347 C  C   . LEU C 1 266 ? -35.004 -17.155 -33.222 1.00 45.11  ? 593 LEU C C   1 
ATOM   5348 O  O   . LEU C 1 266 ? -35.400 -16.285 -34.003 1.00 45.82  ? 593 LEU C O   1 
ATOM   5349 C  CB  . LEU C 1 266 ? -35.732 -19.472 -33.833 1.00 45.62  ? 593 LEU C CB  1 
ATOM   5350 C  CG  . LEU C 1 266 ? -35.524 -20.833 -34.511 1.00 45.80  ? 593 LEU C CG  1 
ATOM   5351 C  CD1 . LEU C 1 266 ? -36.680 -21.730 -34.093 1.00 46.42  ? 593 LEU C CD1 1 
ATOM   5352 C  CD2 . LEU C 1 266 ? -35.386 -20.737 -36.030 1.00 46.94  ? 593 LEU C CD2 1 
ATOM   5353 N  N   . ASP C 1 267 ? -34.924 -16.996 -31.892 1.00 44.79  ? 594 ASP C N   1 
ATOM   5354 C  CA  . ASP C 1 267 ? -35.184 -15.713 -31.212 1.00 46.83  ? 594 ASP C CA  1 
ATOM   5355 C  C   . ASP C 1 267 ? -34.257 -14.610 -31.701 1.00 47.95  ? 594 ASP C C   1 
ATOM   5356 O  O   . ASP C 1 267 ? -34.656 -13.457 -31.794 1.00 50.25  ? 594 ASP C O   1 
ATOM   5357 C  CB  . ASP C 1 267 ? -35.004 -15.837 -29.689 1.00 45.70  ? 594 ASP C CB  1 
ATOM   5358 C  CG  . ASP C 1 267 ? -36.161 -16.572 -29.004 1.00 47.07  ? 594 ASP C CG  1 
ATOM   5359 O  OD1 . ASP C 1 267 ? -37.207 -16.816 -29.653 1.00 48.68  ? 594 ASP C OD1 1 
ATOM   5360 O  OD2 . ASP C 1 267 ? -36.020 -16.914 -27.804 1.00 45.59  ? 594 ASP C OD2 1 
ATOM   5361 N  N   . THR C 1 268 ? -33.035 -14.997 -32.044 1.00 47.15  ? 595 THR C N   1 
ATOM   5362 C  CA  . THR C 1 268 ? -31.913 -14.084 -32.233 1.00 47.85  ? 595 THR C CA  1 
ATOM   5363 C  C   . THR C 1 268 ? -31.655 -13.669 -33.704 1.00 49.17  ? 595 THR C C   1 
ATOM   5364 O  O   . THR C 1 268 ? -31.235 -12.538 -33.975 1.00 50.24  ? 595 THR C O   1 
ATOM   5365 C  CB  . THR C 1 268 ? -30.686 -14.714 -31.539 1.00 45.85  ? 595 THR C CB  1 
ATOM   5366 O  OG1 . THR C 1 268 ? -30.668 -14.295 -30.170 1.00 47.07  ? 595 THR C OG1 1 
ATOM   5367 C  CG2 . THR C 1 268 ? -29.405 -14.346 -32.180 1.00 48.67  ? 595 THR C CG2 1 
ATOM   5368 N  N   . LEU C 1 269 ? -31.918 -14.582 -34.635 1.00 49.25  ? 596 LEU C N   1 
ATOM   5369 C  CA  . LEU C 1 269 ? -31.693 -14.345 -36.068 1.00 51.07  ? 596 LEU C CA  1 
ATOM   5370 C  C   . LEU C 1 269 ? -32.121 -12.948 -36.535 1.00 52.90  ? 596 LEU C C   1 
ATOM   5371 O  O   . LEU C 1 269 ? -33.292 -12.602 -36.405 1.00 54.64  ? 596 LEU C O   1 
ATOM   5372 C  CB  . LEU C 1 269 ? -32.422 -15.402 -36.905 1.00 51.76  ? 596 LEU C CB  1 
ATOM   5373 C  CG  . LEU C 1 269 ? -31.762 -16.691 -37.390 1.00 51.65  ? 596 LEU C CG  1 
ATOM   5374 C  CD1 . LEU C 1 269 ? -32.487 -17.111 -38.666 1.00 53.02  ? 596 LEU C CD1 1 
ATOM   5375 C  CD2 . LEU C 1 269 ? -30.255 -16.540 -37.640 1.00 51.55  ? 596 LEU C CD2 1 
ATOM   5376 N  N   . PRO C 1 270 ? -31.175 -12.137 -37.066 1.00 53.80  ? 597 PRO C N   1 
ATOM   5377 C  CA  . PRO C 1 270 ? -31.498 -10.791 -37.579 1.00 56.37  ? 597 PRO C CA  1 
ATOM   5378 C  C   . PRO C 1 270 ? -32.412 -10.752 -38.824 1.00 58.12  ? 597 PRO C C   1 
ATOM   5379 O  O   . PRO C 1 270 ? -32.876 -9.671  -39.200 1.00 61.45  ? 597 PRO C O   1 
ATOM   5380 C  CB  . PRO C 1 270 ? -30.119 -10.223 -37.929 1.00 57.31  ? 597 PRO C CB  1 
ATOM   5381 C  CG  . PRO C 1 270 ? -29.310 -11.438 -38.261 1.00 55.95  ? 597 PRO C CG  1 
ATOM   5382 C  CD  . PRO C 1 270 ? -29.730 -12.406 -37.190 1.00 53.04  ? 597 PRO C CD  1 
ATOM   5383 N  N   . PHE C 1 271 ? -32.659 -11.904 -39.449 1.00 56.43  ? 598 PHE C N   1 
ATOM   5384 C  CA  . PHE C 1 271 ? -33.526 -11.995 -40.645 1.00 59.21  ? 598 PHE C CA  1 
ATOM   5385 C  C   . PHE C 1 271 ? -34.277 -13.337 -40.663 1.00 57.94  ? 598 PHE C C   1 
ATOM   5386 O  O   . PHE C 1 271 ? -35.180 -13.562 -41.477 1.00 59.55  ? 598 PHE C O   1 
ATOM   5387 C  CB  . PHE C 1 271 ? -32.706 -11.801 -41.949 1.00 60.61  ? 598 PHE C CB  1 
ATOM   5388 C  CG  . PHE C 1 271 ? -31.433 -12.631 -42.001 1.00 58.94  ? 598 PHE C CG  1 
ATOM   5389 C  CD1 . PHE C 1 271 ? -31.473 -14.022 -42.236 1.00 57.27  ? 598 PHE C CD1 1 
ATOM   5390 C  CD2 . PHE C 1 271 ? -30.188 -12.032 -41.794 1.00 58.80  ? 598 PHE C CD2 1 
ATOM   5391 C  CE1 . PHE C 1 271 ? -30.296 -14.785 -42.262 1.00 55.87  ? 598 PHE C CE1 1 
ATOM   5392 C  CE2 . PHE C 1 271 ? -29.011 -12.791 -41.825 1.00 57.33  ? 598 PHE C CE2 1 
ATOM   5393 C  CZ  . PHE C 1 271 ? -29.063 -14.166 -42.058 1.00 55.97  ? 598 PHE C CZ  1 
ATOM   5394 O  OXT . PHE C 1 271 ? -33.987 -14.245 -39.863 1.00 55.02  ? 598 PHE C OXT 1 
ATOM   5395 N  N   . PRO D 1 33  ? -31.224 46.351  3.603   1.00 86.59  ? 360 PRO D N   1 
ATOM   5396 C  CA  . PRO D 1 33  ? -31.507 45.208  2.751   1.00 84.41  ? 360 PRO D CA  1 
ATOM   5397 C  C   . PRO D 1 33  ? -31.373 45.342  1.194   1.00 81.96  ? 360 PRO D C   1 
ATOM   5398 O  O   . PRO D 1 33  ? -31.602 44.340  0.499   1.00 79.74  ? 360 PRO D O   1 
ATOM   5399 C  CB  . PRO D 1 33  ? -32.942 44.852  3.159   1.00 85.34  ? 360 PRO D CB  1 
ATOM   5400 C  CG  . PRO D 1 33  ? -32.971 45.159  4.628   1.00 88.57  ? 360 PRO D CG  1 
ATOM   5401 C  CD  . PRO D 1 33  ? -31.954 46.249  4.882   1.00 90.23  ? 360 PRO D CD  1 
ATOM   5402 N  N   . PRO D 1 34  ? -30.964 46.524  0.646   1.00 82.27  ? 361 PRO D N   1 
ATOM   5403 C  CA  . PRO D 1 34  ? -31.057 46.642  -0.831  1.00 78.97  ? 361 PRO D CA  1 
ATOM   5404 C  C   . PRO D 1 34  ? -29.912 45.958  -1.616  1.00 74.50  ? 361 PRO D C   1 
ATOM   5405 O  O   . PRO D 1 34  ? -28.736 46.287  -1.422  1.00 74.73  ? 361 PRO D O   1 
ATOM   5406 C  CB  . PRO D 1 34  ? -31.045 48.163  -1.060  1.00 81.68  ? 361 PRO D CB  1 
ATOM   5407 C  CG  . PRO D 1 34  ? -30.320 48.733  0.127   1.00 84.16  ? 361 PRO D CG  1 
ATOM   5408 C  CD  . PRO D 1 34  ? -30.284 47.703  1.231   1.00 84.32  ? 361 PRO D CD  1 
ATOM   5409 N  N   . VAL D 1 35  ? -30.269 45.019  -2.490  1.00 69.39  ? 362 VAL D N   1 
ATOM   5410 C  CA  . VAL D 1 35  ? -29.308 44.339  -3.371  1.00 65.06  ? 362 VAL D CA  1 
ATOM   5411 C  C   . VAL D 1 35  ? -29.093 45.194  -4.633  1.00 62.25  ? 362 VAL D C   1 
ATOM   5412 O  O   . VAL D 1 35  ? -30.063 45.611  -5.266  1.00 62.20  ? 362 VAL D O   1 
ATOM   5413 C  CB  . VAL D 1 35  ? -29.812 42.907  -3.755  1.00 64.80  ? 362 VAL D CB  1 
ATOM   5414 C  CG1 . VAL D 1 35  ? -28.837 42.176  -4.684  1.00 61.98  ? 362 VAL D CG1 1 
ATOM   5415 C  CG2 . VAL D 1 35  ? -30.094 42.065  -2.507  1.00 66.53  ? 362 VAL D CG2 1 
ATOM   5416 N  N   . SER D 1 36  ? -27.833 45.458  -4.997  1.00 59.44  ? 363 SER D N   1 
ATOM   5417 C  CA  . SER D 1 36  ? -27.517 46.193  -6.242  1.00 56.66  ? 363 SER D CA  1 
ATOM   5418 C  C   . SER D 1 36  ? -27.863 45.362  -7.484  1.00 52.91  ? 363 SER D C   1 
ATOM   5419 O  O   . SER D 1 36  ? -28.008 44.137  -7.403  1.00 51.37  ? 363 SER D O   1 
ATOM   5420 C  CB  . SER D 1 36  ? -26.051 46.673  -6.272  1.00 57.21  ? 363 SER D CB  1 
ATOM   5421 O  OG  . SER D 1 36  ? -25.174 45.754  -6.911  1.00 55.23  ? 363 SER D OG  1 
ATOM   5422 N  N   . LEU D 1 37  ? -27.990 46.029  -8.626  1.00 51.44  ? 364 LEU D N   1 
ATOM   5423 C  CA  . LEU D 1 37  ? -28.431 45.371  -9.850  1.00 48.11  ? 364 LEU D CA  1 
ATOM   5424 C  C   . LEU D 1 37  ? -27.444 44.313  -10.359 1.00 45.98  ? 364 LEU D C   1 
ATOM   5425 O  O   . LEU D 1 37  ? -27.855 43.189  -10.686 1.00 44.67  ? 364 LEU D O   1 
ATOM   5426 C  CB  . LEU D 1 37  ? -28.782 46.395  -10.938 1.00 48.23  ? 364 LEU D CB  1 
ATOM   5427 C  CG  . LEU D 1 37  ? -29.199 45.897  -12.339 1.00 46.69  ? 364 LEU D CG  1 
ATOM   5428 C  CD1 . LEU D 1 37  ? -30.285 44.820  -12.345 1.00 44.60  ? 364 LEU D CD1 1 
ATOM   5429 C  CD2 . LEU D 1 37  ? -29.622 47.090  -13.179 1.00 48.41  ? 364 LEU D CD2 1 
ATOM   5430 N  N   . ILE D 1 38  ? -26.162 44.663  -10.412 1.00 46.24  ? 365 ILE D N   1 
ATOM   5431 C  CA  . ILE D 1 38  ? -25.139 43.727  -10.883 1.00 44.83  ? 365 ILE D CA  1 
ATOM   5432 C  C   . ILE D 1 38  ? -24.961 42.525  -9.939  1.00 43.81  ? 365 ILE D C   1 
ATOM   5433 O  O   . ILE D 1 38  ? -24.785 41.399  -10.405 1.00 42.48  ? 365 ILE D O   1 
ATOM   5434 C  CB  . ILE D 1 38  ? -23.801 44.429  -11.240 1.00 46.64  ? 365 ILE D CB  1 
ATOM   5435 C  CG1 . ILE D 1 38  ? -23.000 43.565  -12.239 1.00 46.07  ? 365 ILE D CG1 1 
ATOM   5436 C  CG2 . ILE D 1 38  ? -23.013 44.834  -9.986  1.00 48.13  ? 365 ILE D CG2 1 
ATOM   5437 C  CD1 . ILE D 1 38  ? -21.856 44.286  -12.936 1.00 48.22  ? 365 ILE D CD1 1 
ATOM   5438 N  N   . SER D 1 39  ? -25.042 42.760  -8.629  1.00 44.93  ? 366 SER D N   1 
ATOM   5439 C  CA  . SER D 1 39  ? -25.041 41.674  -7.644  1.00 44.52  ? 366 SER D CA  1 
ATOM   5440 C  C   . SER D 1 39  ? -26.154 40.688  -7.924  1.00 42.66  ? 366 SER D C   1 
ATOM   5441 O  O   . SER D 1 39  ? -25.916 39.475  -7.912  1.00 41.88  ? 366 SER D O   1 
ATOM   5442 C  CB  . SER D 1 39  ? -25.188 42.219  -6.232  1.00 46.24  ? 366 SER D CB  1 
ATOM   5443 O  OG  . SER D 1 39  ? -24.024 42.907  -5.879  1.00 48.62  ? 366 SER D OG  1 
ATOM   5444 N  N   . ALA D 1 40  ? -27.351 41.219  -8.201  1.00 42.34  ? 367 ALA D N   1 
ATOM   5445 C  CA  . ALA D 1 40  ? -28.516 40.401  -8.546  1.00 41.31  ? 367 ALA D CA  1 
ATOM   5446 C  C   . ALA D 1 40  ? -28.296 39.572  -9.817  1.00 39.03  ? 367 ALA D C   1 
ATOM   5447 O  O   . ALA D 1 40  ? -28.678 38.410  -9.871  1.00 38.22  ? 367 ALA D O   1 
ATOM   5448 C  CB  . ALA D 1 40  ? -29.760 41.263  -8.658  1.00 41.71  ? 367 ALA D CB  1 
ATOM   5449 N  N   . LEU D 1 41  ? -27.651 40.173  -10.811 1.00 39.16  ? 368 LEU D N   1 
ATOM   5450 C  CA  . LEU D 1 41  ? -27.324 39.487  -12.063 1.00 38.46  ? 368 LEU D CA  1 
ATOM   5451 C  C   . LEU D 1 41  ? -26.281 38.374  -11.860 1.00 38.72  ? 368 LEU D C   1 
ATOM   5452 O  O   . LEU D 1 41  ? -26.442 37.272  -12.405 1.00 37.70  ? 368 LEU D O   1 
ATOM   5453 C  CB  . LEU D 1 41  ? -26.874 40.484  -13.140 1.00 38.70  ? 368 LEU D CB  1 
ATOM   5454 C  CG  . LEU D 1 41  ? -27.802 41.626  -13.604 1.00 39.63  ? 368 LEU D CG  1 
ATOM   5455 C  CD1 . LEU D 1 41  ? -27.273 42.248  -14.889 1.00 39.98  ? 368 LEU D CD1 1 
ATOM   5456 C  CD2 . LEU D 1 41  ? -29.252 41.196  -13.791 1.00 38.85  ? 368 LEU D CD2 1 
ATOM   5457 N  N   . VAL D 1 42  ? -25.235 38.674  -11.078 1.00 39.97  ? 369 VAL D N   1 
ATOM   5458 C  CA  . VAL D 1 42  ? -24.241 37.681  -10.648 1.00 41.11  ? 369 VAL D CA  1 
ATOM   5459 C  C   . VAL D 1 42  ? -24.927 36.496  -9.927  1.00 41.58  ? 369 VAL D C   1 
ATOM   5460 O  O   . VAL D 1 42  ? -24.668 35.339  -10.270 1.00 41.75  ? 369 VAL D O   1 
ATOM   5461 C  CB  . VAL D 1 42  ? -23.097 38.310  -9.797  1.00 42.47  ? 369 VAL D CB  1 
ATOM   5462 C  CG1 . VAL D 1 42  ? -22.250 37.236  -9.137  1.00 43.00  ? 369 VAL D CG1 1 
ATOM   5463 C  CG2 . VAL D 1 42  ? -22.211 39.220  -10.645 1.00 42.53  ? 369 VAL D CG2 1 
ATOM   5464 N  N   . ARG D 1 43  ? -25.819 36.794  -8.975  1.00 41.96  ? 370 ARG D N   1 
ATOM   5465 C  CA  . ARG D 1 43  ? -26.559 35.773  -8.222  1.00 42.42  ? 370 ARG D CA  1 
ATOM   5466 C  C   . ARG D 1 43  ? -27.432 34.884  -9.134  1.00 41.32  ? 370 ARG D C   1 
ATOM   5467 O  O   . ARG D 1 43  ? -27.415 33.653  -9.000  1.00 41.86  ? 370 ARG D O   1 
ATOM   5468 C  CB  . ARG D 1 43  ? -27.355 36.450  -7.084  1.00 44.30  ? 370 ARG D CB  1 
ATOM   5469 C  CG  . ARG D 1 43  ? -28.585 35.738  -6.529  1.00 45.18  ? 370 ARG D CG  1 
ATOM   5470 C  CD  . ARG D 1 43  ? -28.283 34.633  -5.534  1.00 47.77  ? 370 ARG D CD  1 
ATOM   5471 N  NE  . ARG D 1 43  ? -27.382 35.000  -4.436  1.00 51.21  ? 370 ARG D NE  1 
ATOM   5472 C  CZ  . ARG D 1 43  ? -26.850 34.126  -3.576  1.00 53.40  ? 370 ARG D CZ  1 
ATOM   5473 N  NH1 . ARG D 1 43  ? -27.119 32.824  -3.671  1.00 54.41  ? 370 ARG D NH1 1 
ATOM   5474 N  NH2 . ARG D 1 43  ? -26.046 34.547  -2.617  1.00 54.64  ? 370 ARG D NH2 1 
ATOM   5475 N  N   . ALA D 1 44  ? -28.168 35.508  -10.057 1.00 39.33  ? 371 ALA D N   1 
ATOM   5476 C  CA  . ALA D 1 44  ? -29.017 34.778  -11.008 1.00 37.97  ? 371 ALA D CA  1 
ATOM   5477 C  C   . ALA D 1 44  ? -28.184 33.815  -11.832 1.00 37.21  ? 371 ALA D C   1 
ATOM   5478 O  O   . ALA D 1 44  ? -28.513 32.640  -11.935 1.00 37.66  ? 371 ALA D O   1 
ATOM   5479 C  CB  . ALA D 1 44  ? -29.784 35.742  -11.909 1.00 36.72  ? 371 ALA D CB  1 
ATOM   5480 N  N   . HIS D 1 45  ? -27.081 34.312  -12.388 1.00 37.53  ? 372 HIS D N   1 
ATOM   5481 C  CA  . HIS D 1 45  ? -26.095 33.461  -13.041 1.00 37.73  ? 372 HIS D CA  1 
ATOM   5482 C  C   . HIS D 1 45  ? -25.581 32.289  -12.162 1.00 39.20  ? 372 HIS D C   1 
ATOM   5483 O  O   . HIS D 1 45  ? -25.739 31.122  -12.539 1.00 39.23  ? 372 HIS D O   1 
ATOM   5484 C  CB  . HIS D 1 45  ? -24.921 34.282  -13.551 1.00 38.15  ? 372 HIS D CB  1 
ATOM   5485 C  CG  . HIS D 1 45  ? -23.976 33.477  -14.369 1.00 38.96  ? 372 HIS D CG  1 
ATOM   5486 N  ND1 . HIS D 1 45  ? -22.793 32.984  -13.862 1.00 40.73  ? 372 HIS D ND1 1 
ATOM   5487 C  CD2 . HIS D 1 45  ? -24.077 33.002  -15.630 1.00 38.20  ? 372 HIS D CD2 1 
ATOM   5488 C  CE1 . HIS D 1 45  ? -22.180 32.280  -14.796 1.00 41.06  ? 372 HIS D CE1 1 
ATOM   5489 N  NE2 . HIS D 1 45  ? -22.940 32.273  -15.876 1.00 39.97  ? 372 HIS D NE2 1 
ATOM   5490 N  N   . VAL D 1 46  ? -25.008 32.600  -10.995 1.00 39.59  ? 373 VAL D N   1 
ATOM   5491 C  CA  . VAL D 1 46  ? -24.473 31.563  -10.107 1.00 41.82  ? 373 VAL D CA  1 
ATOM   5492 C  C   . VAL D 1 46  ? -25.534 30.502  -9.752  1.00 42.64  ? 373 VAL D C   1 
ATOM   5493 O  O   . VAL D 1 46  ? -25.249 29.294  -9.848  1.00 43.45  ? 373 VAL D O   1 
ATOM   5494 C  CB  . VAL D 1 46  ? -23.758 32.144  -8.844  1.00 43.31  ? 373 VAL D CB  1 
ATOM   5495 C  CG1 . VAL D 1 46  ? -23.284 31.041  -7.901  1.00 44.69  ? 373 VAL D CG1 1 
ATOM   5496 C  CG2 . VAL D 1 46  ? -22.571 33.023  -9.240  1.00 43.19  ? 373 VAL D CG2 1 
ATOM   5497 N  N   . ASP D 1 47  ? -26.750 30.940  -9.401  1.00 42.34  ? 374 ASP D N   1 
ATOM   5498 C  CA  . ASP D 1 47  ? -27.800 30.012  -8.953  1.00 43.46  ? 374 ASP D CA  1 
ATOM   5499 C  C   . ASP D 1 47  ? -28.432 29.175  -10.058 1.00 42.55  ? 374 ASP D C   1 
ATOM   5500 O  O   . ASP D 1 47  ? -29.246 28.290  -9.772  1.00 43.41  ? 374 ASP D O   1 
ATOM   5501 C  CB  . ASP D 1 47  ? -28.891 30.746  -8.171  1.00 44.75  ? 374 ASP D CB  1 
ATOM   5502 C  CG  . ASP D 1 47  ? -28.464 31.113  -6.761  1.00 48.00  ? 374 ASP D CG  1 
ATOM   5503 O  OD1 . ASP D 1 47  ? -27.396 30.674  -6.270  1.00 49.20  ? 374 ASP D OD1 1 
ATOM   5504 O  OD2 . ASP D 1 47  ? -29.236 31.847  -6.122  1.00 50.14  ? 374 ASP D OD2 1 
ATOM   5505 N  N   . SER D 1 48  ? -28.065 29.454  -11.307 1.00 40.84  ? 375 SER D N   1 
ATOM   5506 C  CA  . SER D 1 48  ? -28.578 28.700  -12.445 1.00 40.35  ? 375 SER D CA  1 
ATOM   5507 C  C   . SER D 1 48  ? -27.461 28.012  -13.253 1.00 40.50  ? 375 SER D C   1 
ATOM   5508 O  O   . SER D 1 48  ? -27.642 27.704  -14.422 1.00 40.27  ? 375 SER D O   1 
ATOM   5509 C  CB  . SER D 1 48  ? -29.412 29.623  -13.336 1.00 38.57  ? 375 SER D CB  1 
ATOM   5510 O  OG  . SER D 1 48  ? -28.581 30.607  -13.939 1.00 38.36  ? 375 SER D OG  1 
ATOM   5511 N  N   . ASN D 1 49  ? -26.313 27.772  -12.630 1.00 41.91  ? 376 ASN D N   1 
ATOM   5512 C  CA  . ASN D 1 49  ? -25.198 27.103  -13.304 1.00 43.06  ? 376 ASN D CA  1 
ATOM   5513 C  C   . ASN D 1 49  ? -24.628 25.920  -12.532 1.00 45.04  ? 376 ASN D C   1 
ATOM   5514 O  O   . ASN D 1 49  ? -24.652 25.914  -11.303 1.00 45.32  ? 376 ASN D O   1 
ATOM   5515 C  CB  . ASN D 1 49  ? -24.109 28.105  -13.726 1.00 43.34  ? 376 ASN D CB  1 
ATOM   5516 C  CG  . ASN D 1 49  ? -24.465 28.822  -15.025 1.00 42.21  ? 376 ASN D CG  1 
ATOM   5517 O  OD1 . ASN D 1 49  ? -24.085 28.388  -16.114 1.00 42.37  ? 376 ASN D OD1 1 
ATOM   5518 N  ND2 . ASN D 1 49  ? -25.218 29.906  -14.915 1.00 41.22  ? 376 ASN D ND2 1 
ATOM   5519 N  N   . PRO D 1 50  ? -24.140 24.896  -13.260 1.00 46.50  ? 377 PRO D N   1 
ATOM   5520 C  CA  . PRO D 1 50  ? -23.687 23.682  -12.586 1.00 49.87  ? 377 PRO D CA  1 
ATOM   5521 C  C   . PRO D 1 50  ? -22.404 23.882  -11.756 1.00 53.32  ? 377 PRO D C   1 
ATOM   5522 O  O   . PRO D 1 50  ? -21.643 24.848  -11.964 1.00 51.28  ? 377 PRO D O   1 
ATOM   5523 C  CB  . PRO D 1 50  ? -23.445 22.709  -13.741 1.00 49.85  ? 377 PRO D CB  1 
ATOM   5524 C  CG  . PRO D 1 50  ? -23.130 23.593  -14.901 1.00 47.83  ? 377 PRO D CG  1 
ATOM   5525 C  CD  . PRO D 1 50  ? -24.035 24.771  -14.726 1.00 45.14  ? 377 PRO D CD  1 
ATOM   5526 N  N   . ALA D 1 51  ? -22.204 22.973  -10.806 1.00 57.70  ? 378 ALA D N   1 
ATOM   5527 C  CA  . ALA D 1 51  ? -21.050 23.009  -9.956  1.00 63.34  ? 378 ALA D CA  1 
ATOM   5528 C  C   . ALA D 1 51  ? -19.898 22.506  -10.805 1.00 67.08  ? 378 ALA D C   1 
ATOM   5529 O  O   . ALA D 1 51  ? -19.917 21.361  -11.280 1.00 69.28  ? 378 ALA D O   1 
ATOM   5530 C  CB  . ALA D 1 51  ? -21.264 22.122  -8.726  1.00 66.75  ? 378 ALA D CB  1 
ATOM   5531 N  N   . MET D 1 52  ? -18.904 23.363  -11.018 1.00 69.16  ? 379 MET D N   1 
ATOM   5532 C  CA  . MET D 1 52  ? -17.732 22.961  -11.796 1.00 74.36  ? 379 MET D CA  1 
ATOM   5533 C  C   . MET D 1 52  ? -16.827 21.975  -11.018 1.00 80.66  ? 379 MET D C   1 
ATOM   5534 O  O   . MET D 1 52  ? -15.797 21.531  -11.532 1.00 84.42  ? 379 MET D O   1 
ATOM   5535 C  CB  . MET D 1 52  ? -16.977 24.180  -12.362 1.00 73.80  ? 379 MET D CB  1 
ATOM   5536 C  CG  . MET D 1 52  ? -17.849 25.175  -13.132 1.00 70.55  ? 379 MET D CG  1 
ATOM   5537 S  SD  . MET D 1 52  ? -18.498 24.637  -14.735 1.00 70.47  ? 379 MET D SD  1 
ATOM   5538 C  CE  . MET D 1 52  ? -17.152 25.151  -15.802 1.00 71.85  ? 379 MET D CE  1 
ATOM   5539 N  N   . THR D 1 53  ? -17.233 21.632  -9.790  1.00 83.80  ? 380 THR D N   1 
ATOM   5540 C  CA  . THR D 1 53  ? -16.713 20.451  -9.086  1.00 90.72  ? 380 THR D CA  1 
ATOM   5541 C  C   . THR D 1 53  ? -17.511 19.198  -9.445  1.00 93.18  ? 380 THR D C   1 
ATOM   5542 O  O   . THR D 1 53  ? -16.926 18.142  -9.710  1.00 97.41  ? 380 THR D O   1 
ATOM   5543 C  CB  . THR D 1 53  ? -16.702 20.600  -7.542  1.00 92.20  ? 380 THR D CB  1 
ATOM   5544 O  OG1 . THR D 1 53  ? -17.897 21.253  -7.080  1.00 89.04  ? 380 THR D OG1 1 
ATOM   5545 C  CG2 . THR D 1 53  ? -15.474 21.351  -7.078  1.00 93.44  ? 380 THR D CG2 1 
ATOM   5546 N  N   . SER D 1 54  ? -18.840 19.329  -9.448  1.00 92.26  ? 381 SER D N   1 
ATOM   5547 C  CA  . SER D 1 54  ? -19.750 18.201  -9.675  1.00 93.67  ? 381 SER D CA  1 
ATOM   5548 C  C   . SER D 1 54  ? -20.365 18.223  -11.089 1.00 90.71  ? 381 SER D C   1 
ATOM   5549 O  O   . SER D 1 54  ? -21.544 18.570  -11.297 1.00 86.91  ? 381 SER D O   1 
ATOM   5550 C  CB  . SER D 1 54  ? -20.809 18.134  -8.567  1.00 94.17  ? 381 SER D CB  1 
ATOM   5551 O  OG  . SER D 1 54  ? -21.429 16.860  -8.540  1.00 96.17  ? 381 SER D OG  1 
ATOM   5552 N  N   . LEU D 1 55  ? -19.515 17.868  -12.051 1.00 90.96  ? 382 LEU D N   1 
ATOM   5553 C  CA  . LEU D 1 55  ? -19.883 17.766  -13.456 1.00 87.56  ? 382 LEU D CA  1 
ATOM   5554 C  C   . LEU D 1 55  ? -19.975 16.293  -13.822 1.00 90.89  ? 382 LEU D C   1 
ATOM   5555 O  O   . LEU D 1 55  ? -19.060 15.496  -13.517 1.00 94.16  ? 382 LEU D O   1 
ATOM   5556 C  CB  . LEU D 1 55  ? -18.844 18.459  -14.353 1.00 86.26  ? 382 LEU D CB  1 
ATOM   5557 C  CG  . LEU D 1 55  ? -18.533 19.956  -14.238 1.00 82.99  ? 382 LEU D CG  1 
ATOM   5558 C  CD1 . LEU D 1 55  ? -17.258 20.271  -15.004 1.00 83.89  ? 382 LEU D CD1 1 
ATOM   5559 C  CD2 . LEU D 1 55  ? -19.684 20.824  -14.726 1.00 77.88  ? 382 LEU D CD2 1 
ATOM   5560 N  N   . ASP D 1 56  ? -21.085 15.942  -14.474 1.00 88.51  ? 383 ASP D N   1 
ATOM   5561 C  CA  . ASP D 1 56  ? -21.345 14.574  -14.900 1.00 90.83  ? 383 ASP D CA  1 
ATOM   5562 C  C   . ASP D 1 56  ? -20.502 14.241  -16.151 1.00 91.23  ? 383 ASP D C   1 
ATOM   5563 O  O   . ASP D 1 56  ? -20.871 14.591  -17.285 1.00 89.66  ? 383 ASP D O   1 
ATOM   5564 C  CB  . ASP D 1 56  ? -22.859 14.392  -15.154 1.00 89.70  ? 383 ASP D CB  1 
ATOM   5565 C  CG  . ASP D 1 56  ? -23.240 12.923  -15.324 1.00 93.69  ? 383 ASP D CG  1 
ATOM   5566 O  OD1 . ASP D 1 56  ? -22.458 12.028  -14.933 1.00 98.81  ? 383 ASP D OD1 1 
ATOM   5567 O  OD2 . ASP D 1 56  ? -24.343 12.659  -15.850 1.00 93.00  ? 383 ASP D OD2 1 
ATOM   5568 N  N   . TYR D 1 57  ? -19.355 13.581  -15.931 1.00 94.38  ? 384 TYR D N   1 
ATOM   5569 C  CA  . TYR D 1 57  ? -18.432 13.214  -17.040 1.00 96.36  ? 384 TYR D CA  1 
ATOM   5570 C  C   . TYR D 1 57  ? -18.702 11.759  -17.547 1.00 98.90  ? 384 TYR D C   1 
ATOM   5571 O  O   . TYR D 1 57  ? -17.937 11.218  -18.367 1.00 101.41 ? 384 TYR D O   1 
ATOM   5572 C  CB  . TYR D 1 57  ? -16.880 13.407  -16.602 1.00 100.71 ? 384 TYR D CB  1 
ATOM   5573 C  CG  . TYR D 1 57  ? -16.330 14.698  -16.830 1.00 99.44  ? 384 TYR D CG  1 
ATOM   5574 C  CD1 . TYR D 1 57  ? -15.589 14.858  -18.011 1.00 100.83 ? 384 TYR D CD1 1 
ATOM   5575 C  CD2 . TYR D 1 57  ? -16.153 15.572  -15.841 1.00 98.31  ? 384 TYR D CD2 1 
ATOM   5576 C  CE1 . TYR D 1 57  ? -14.678 15.969  -18.206 1.00 100.54 ? 384 TYR D CE1 1 
ATOM   5577 C  CE2 . TYR D 1 57  ? -15.488 16.617  -15.995 1.00 97.35  ? 384 TYR D CE2 1 
ATOM   5578 C  CZ  . TYR D 1 57  ? -14.776 16.867  -17.178 1.00 98.30  ? 384 TYR D CZ  1 
ATOM   5579 O  OH  . TYR D 1 57  ? -14.168 18.083  -17.369 1.00 96.96  ? 384 TYR D OH  1 
ATOM   5580 N  N   . SER D 1 58  ? -19.822 11.177  -17.099 1.00 98.10  ? 385 SER D N   1 
ATOM   5581 C  CA  . SER D 1 58  ? -20.200 9.765   -17.348 1.00 100.94 ? 385 SER D CA  1 
ATOM   5582 C  C   . SER D 1 58  ? -20.421 9.340   -18.817 1.00 100.42 ? 385 SER D C   1 
ATOM   5583 O  O   . SER D 1 58  ? -20.396 8.136   -19.128 1.00 104.21 ? 385 SER D O   1 
ATOM   5584 C  CB  . SER D 1 58  ? -21.431 9.387   -16.508 1.00 100.32 ? 385 SER D CB  1 
ATOM   5585 O  OG  . SER D 1 58  ? -22.555 10.181  -16.851 1.00 95.16  ? 385 SER D OG  1 
ATOM   5586 N  N   . ARG D 1 59  ? -20.632 10.316  -19.703 1.00 95.18  ? 386 ARG D N   1 
ATOM   5587 C  CA  . ARG D 1 59  ? -20.907 10.039  -21.122 1.00 94.13  ? 386 ARG D CA  1 
ATOM   5588 C  C   . ARG D 1 59  ? -19.776 10.509  -22.061 1.00 93.75  ? 386 ARG D C   1 
ATOM   5589 O  O   . ARG D 1 59  ? -19.721 10.099  -23.219 1.00 95.09  ? 386 ARG D O   1 
ATOM   5590 C  CB  . ARG D 1 59  ? -22.288 10.593  -21.545 1.00 90.08  ? 386 ARG D CB  1 
ATOM   5591 C  CG  . ARG D 1 59  ? -23.421 10.310  -20.550 1.00 89.85  ? 386 ARG D CG  1 
ATOM   5592 C  CD  . ARG D 1 59  ? -24.820 10.349  -21.158 1.00 88.04  ? 386 ARG D CD  1 
ATOM   5593 N  NE  . ARG D 1 59  ? -25.337 11.704  -21.410 1.00 82.87  ? 386 ARG D NE  1 
ATOM   5594 C  CZ  . ARG D 1 59  ? -25.875 12.113  -22.563 1.00 80.79  ? 386 ARG D CZ  1 
ATOM   5595 N  NH1 . ARG D 1 59  ? -25.983 11.279  -23.598 1.00 82.52  ? 386 ARG D NH1 1 
ATOM   5596 N  NH2 . ARG D 1 59  ? -26.317 13.363  -22.687 1.00 76.42  ? 386 ARG D NH2 1 
ATOM   5597 N  N   . PHE D 1 60  ? -18.876 11.345  -21.536 1.00 92.35  ? 387 PHE D N   1 
ATOM   5598 C  CA  . PHE D 1 60  ? -17.726 11.913  -22.266 1.00 92.78  ? 387 PHE D CA  1 
ATOM   5599 C  C   . PHE D 1 60  ? -16.734 10.871  -22.820 1.00 98.34  ? 387 PHE D C   1 
ATOM   5600 O  O   . PHE D 1 60  ? -16.324 9.959   -22.097 1.00 102.52 ? 387 PHE D O   1 
ATOM   5601 C  CB  . PHE D 1 60  ? -16.990 12.893  -21.335 1.00 91.38  ? 387 PHE D CB  1 
ATOM   5602 C  CG  . PHE D 1 60  ? -15.837 13.612  -21.979 1.00 92.44  ? 387 PHE D CG  1 
ATOM   5603 C  CD1 . PHE D 1 60  ? -16.057 14.727  -22.800 1.00 88.48  ? 387 PHE D CD1 1 
ATOM   5604 C  CD2 . PHE D 1 60  ? -14.517 13.188  -21.754 1.00 97.38  ? 387 PHE D CD2 1 
ATOM   5605 C  CE1 . PHE D 1 60  ? -14.990 15.397  -23.393 1.00 89.85  ? 387 PHE D CE1 1 
ATOM   5606 C  CE2 . PHE D 1 60  ? -13.444 13.853  -22.346 1.00 98.79  ? 387 PHE D CE2 1 
ATOM   5607 C  CZ  . PHE D 1 60  ? -13.683 14.962  -23.165 1.00 95.46  ? 387 PHE D CZ  1 
ATOM   5608 N  N   . GLN D 1 61  ? -16.364 11.022  -24.098 1.00 98.78  ? 388 GLN D N   1 
ATOM   5609 C  CA  . GLN D 1 61  ? -15.271 10.258  -24.738 1.00 104.48 ? 388 GLN D CA  1 
ATOM   5610 C  C   . GLN D 1 61  ? -14.795 10.902  -26.053 1.00 103.92 ? 388 GLN D C   1 
ATOM   5611 O  O   . GLN D 1 61  ? -15.557 10.989  -27.023 1.00 101.24 ? 388 GLN D O   1 
ATOM   5612 C  CB  . GLN D 1 61  ? -15.638 8.769   -24.950 1.00 109.02 ? 388 GLN D CB  1 
ATOM   5613 C  CG  . GLN D 1 61  ? -14.443 7.858   -25.269 1.00 115.93 ? 388 GLN D CG  1 
ATOM   5614 C  CD  . GLN D 1 61  ? -14.559 6.433   -24.724 1.00 121.06 ? 388 GLN D CD  1 
ATOM   5615 O  OE1 . GLN D 1 61  ? -15.365 6.152   -23.823 1.00 120.00 ? 388 GLN D OE1 1 
ATOM   5616 N  NE2 . GLN D 1 61  ? -13.736 5.523   -25.271 1.00 127.62 ? 388 GLN D NE2 1 
ATOM   5617 N  N   . ALA D 1 62  ? -13.530 11.336  -26.065 1.00 106.78 ? 389 ALA D N   1 
ATOM   5618 C  CA  . ALA D 1 62  ? -12.856 11.875  -27.261 1.00 107.99 ? 389 ALA D CA  1 
ATOM   5619 C  C   . ALA D 1 62  ? -12.202 10.768  -28.111 1.00 114.12 ? 389 ALA D C   1 
ATOM   5620 O  O   . ALA D 1 62  ? -11.117 10.270  -27.764 1.00 119.89 ? 389 ALA D O   1 
ATOM   5621 C  CB  . ALA D 1 62  ? -11.819 12.919  -26.857 1.00 107.91 ? 389 ALA D CB  1 
ATOM   5622 N  N   . ASN D 1 63  ? -12.876 10.388  -29.206 1.00 113.28 ? 390 ASN D N   1 
ATOM   5623 C  CA  . ASN D 1 63  ? -12.401 9.382   -30.180 1.00 117.85 ? 390 ASN D CA  1 
ATOM   5624 C  C   . ASN D 1 63  ? -13.239 9.364   -31.453 1.00 115.95 ? 390 ASN D C   1 
ATOM   5625 O  O   . ASN D 1 63  ? -14.420 9.005   -31.426 1.00 113.29 ? 390 ASN D O   1 
ATOM   5626 C  CB  . ASN D 1 63  ? -12.356 7.970   -29.572 1.00 122.23 ? 390 ASN D CB  1 
ATOM   5627 C  CG  . ASN D 1 63  ? -10.944 7.406   -29.490 1.00 128.92 ? 390 ASN D CG  1 
ATOM   5628 O  OD1 . ASN D 1 63  ? -10.703 6.270   -29.894 1.00 133.70 ? 390 ASN D OD1 1 
ATOM   5629 N  ND2 . ASN D 1 63  ? -10.004 8.194   -28.968 1.00 129.22 ? 390 ASN D ND2 1 
ATOM   5630 N  N   . ASP D 1 72  ? -28.351 9.772   -36.970 1.00 79.75  ? 399 ASP D N   1 
ATOM   5631 C  CA  . ASP D 1 72  ? -28.844 8.822   -35.929 1.00 81.25  ? 399 ASP D CA  1 
ATOM   5632 C  C   . ASP D 1 72  ? -29.938 9.454   -35.063 1.00 77.25  ? 399 ASP D C   1 
ATOM   5633 O  O   . ASP D 1 72  ? -29.851 10.633  -34.693 1.00 73.63  ? 399 ASP D O   1 
ATOM   5634 C  CB  . ASP D 1 72  ? -27.681 8.343   -35.046 1.00 83.90  ? 399 ASP D CB  1 
ATOM   5635 C  CG  . ASP D 1 72  ? -27.964 7.014   -34.343 1.00 87.45  ? 399 ASP D CG  1 
ATOM   5636 O  OD1 . ASP D 1 72  ? -28.570 6.097   -34.947 1.00 89.72  ? 399 ASP D OD1 1 
ATOM   5637 O  OD2 . ASP D 1 72  ? -27.547 6.882   -33.174 1.00 88.03  ? 399 ASP D OD2 1 
ATOM   5638 N  N   . THR D 1 73  ? -30.953 8.646   -34.748 1.00 77.92  ? 400 THR D N   1 
ATOM   5639 C  CA  . THR D 1 73  ? -32.097 9.036   -33.918 1.00 75.29  ? 400 THR D CA  1 
ATOM   5640 C  C   . THR D 1 73  ? -31.675 9.446   -32.493 1.00 74.07  ? 400 THR D C   1 
ATOM   5641 O  O   . THR D 1 73  ? -32.131 10.476  -31.988 1.00 71.06  ? 400 THR D O   1 
ATOM   5642 C  CB  . THR D 1 73  ? -33.167 7.914   -33.878 1.00 77.43  ? 400 THR D CB  1 
ATOM   5643 O  OG1 . THR D 1 73  ? -33.370 7.394   -35.198 1.00 79.48  ? 400 THR D OG1 1 
ATOM   5644 C  CG2 . THR D 1 73  ? -34.501 8.429   -33.344 1.00 74.93  ? 400 THR D CG2 1 
ATOM   5645 N  N   . GLN D 1 74  ? -30.789 8.655   -31.881 1.00 77.48  ? 401 GLN D N   1 
ATOM   5646 C  CA  . GLN D 1 74  ? -30.298 8.873   -30.506 1.00 76.76  ? 401 GLN D CA  1 
ATOM   5647 C  C   . GLN D 1 74  ? -29.570 10.208  -30.322 1.00 73.00  ? 401 GLN D C   1 
ATOM   5648 O  O   . GLN D 1 74  ? -29.750 10.864  -29.297 1.00 72.13  ? 401 GLN D O   1 
ATOM   5649 C  CB  . GLN D 1 74  ? -29.383 7.723   -30.053 1.00 82.04  ? 401 GLN D CB  1 
ATOM   5650 C  CG  . GLN D 1 74  ? -30.063 6.371   -29.889 1.00 86.65  ? 401 GLN D CG  1 
ATOM   5651 C  CD  . GLN D 1 74  ? -29.117 5.198   -30.128 1.00 93.06  ? 401 GLN D CD  1 
ATOM   5652 O  OE1 . GLN D 1 74  ? -28.494 5.085   -31.194 1.00 94.95  ? 401 GLN D OE1 1 
ATOM   5653 N  NE2 . GLN D 1 74  ? -29.017 4.303   -29.140 1.00 97.01  ? 401 GLN D NE2 1 
ATOM   5654 N  N   . HIS D 1 75  ? -28.763 10.607  -31.309 1.00 71.74  ? 402 HIS D N   1 
ATOM   5655 C  CA  . HIS D 1 75  ? -28.020 11.877  -31.267 1.00 68.21  ? 402 HIS D CA  1 
ATOM   5656 C  C   . HIS D 1 75  ? -28.895 13.122  -31.419 1.00 63.63  ? 402 HIS D C   1 
ATOM   5657 O  O   . HIS D 1 75  ? -28.597 14.166  -30.831 1.00 60.95  ? 402 HIS D O   1 
ATOM   5658 C  CB  . HIS D 1 75  ? -26.902 11.890  -32.309 1.00 70.30  ? 402 HIS D CB  1 
ATOM   5659 C  CG  . HIS D 1 75  ? -25.731 11.038  -31.936 1.00 74.32  ? 402 HIS D CG  1 
ATOM   5660 N  ND1 . HIS D 1 75  ? -25.453 9.840   -32.557 1.00 78.08  ? 402 HIS D ND1 1 
ATOM   5661 C  CD2 . HIS D 1 75  ? -24.783 11.199  -30.982 1.00 74.78  ? 402 HIS D CD2 1 
ATOM   5662 C  CE1 . HIS D 1 75  ? -24.374 9.308   -32.011 1.00 81.60  ? 402 HIS D CE1 1 
ATOM   5663 N  NE2 . HIS D 1 75  ? -23.950 10.113  -31.053 1.00 79.07  ? 402 HIS D NE2 1 
ATOM   5664 N  N   . ILE D 1 76  ? -29.958 12.992  -32.215 1.00 62.43  ? 403 ILE D N   1 
ATOM   5665 C  CA  . ILE D 1 76  ? -30.954 14.046  -32.428 1.00 58.33  ? 403 ILE D CA  1 
ATOM   5666 C  C   . ILE D 1 76  ? -31.845 14.153  -31.184 1.00 56.39  ? 403 ILE D C   1 
ATOM   5667 O  O   . ILE D 1 76  ? -32.254 15.248  -30.813 1.00 53.07  ? 403 ILE D O   1 
ATOM   5668 C  CB  . ILE D 1 76  ? -31.763 13.829  -33.753 1.00 58.21  ? 403 ILE D CB  1 
ATOM   5669 C  CG1 . ILE D 1 76  ? -30.842 13.979  -34.982 1.00 59.54  ? 403 ILE D CG1 1 
ATOM   5670 C  CG2 . ILE D 1 76  ? -32.925 14.803  -33.875 1.00 54.47  ? 403 ILE D CG2 1 
ATOM   5671 C  CD1 . ILE D 1 76  ? -31.343 13.327  -36.262 1.00 61.06  ? 403 ILE D CD1 1 
ATOM   5672 N  N   . GLN D 1 77  ? -32.127 13.023  -30.539 1.00 58.87  ? 404 GLN D N   1 
ATOM   5673 C  CA  . GLN D 1 77  ? -32.881 13.032  -29.276 1.00 59.07  ? 404 GLN D CA  1 
ATOM   5674 C  C   . GLN D 1 77  ? -32.086 13.689  -28.138 1.00 57.30  ? 404 GLN D C   1 
ATOM   5675 O  O   . GLN D 1 77  ? -32.617 14.550  -27.432 1.00 53.94  ? 404 GLN D O   1 
ATOM   5676 C  CB  . GLN D 1 77  ? -33.380 11.624  -28.893 1.00 63.21  ? 404 GLN D CB  1 
ATOM   5677 C  CG  . GLN D 1 77  ? -34.539 11.613  -27.883 1.00 64.27  ? 404 GLN D CG  1 
ATOM   5678 C  CD  . GLN D 1 77  ? -35.718 12.514  -28.273 1.00 62.22  ? 404 GLN D CD  1 
ATOM   5679 O  OE1 . GLN D 1 77  ? -36.230 12.448  -29.392 1.00 62.76  ? 404 GLN D OE1 1 
ATOM   5680 N  NE2 . GLN D 1 77  ? -36.151 13.355  -27.341 1.00 60.35  ? 404 GLN D NE2 1 
ATOM   5681 N  N   . GLN D 1 78  ? -30.813 13.307  -28.009 1.00 59.28  ? 405 GLN D N   1 
ATOM   5682 C  CA  . GLN D 1 78  ? -29.864 13.939  -27.079 1.00 59.25  ? 405 GLN D CA  1 
ATOM   5683 C  C   . GLN D 1 78  ? -29.735 15.439  -27.325 1.00 55.89  ? 405 GLN D C   1 
ATOM   5684 O  O   . GLN D 1 78  ? -29.597 16.211  -26.372 1.00 55.04  ? 405 GLN D O   1 
ATOM   5685 C  CB  . GLN D 1 78  ? -28.485 13.268  -27.149 1.00 62.72  ? 405 GLN D CB  1 
ATOM   5686 C  CG  . GLN D 1 78  ? -28.339 12.063  -26.229 1.00 67.20  ? 405 GLN D CG  1 
ATOM   5687 C  CD  . GLN D 1 78  ? -27.581 10.901  -26.857 1.00 72.29  ? 405 GLN D CD  1 
ATOM   5688 O  OE1 . GLN D 1 78  ? -27.063 11.000  -27.976 1.00 73.65  ? 405 GLN D OE1 1 
ATOM   5689 N  NE2 . GLN D 1 78  ? -27.512 9.783   -26.135 1.00 75.54  ? 405 GLN D NE2 1 
ATOM   5690 N  N   . PHE D 1 79  ? -29.799 15.843  -28.596 1.00 54.47  ? 406 PHE D N   1 
ATOM   5691 C  CA  . PHE D 1 79  ? -29.810 17.262  -28.975 1.00 51.35  ? 406 PHE D CA  1 
ATOM   5692 C  C   . PHE D 1 79  ? -31.025 18.023  -28.420 1.00 47.53  ? 406 PHE D C   1 
ATOM   5693 O  O   . PHE D 1 79  ? -30.873 19.102  -27.848 1.00 45.27  ? 406 PHE D O   1 
ATOM   5694 C  CB  . PHE D 1 79  ? -29.698 17.430  -30.502 1.00 52.08  ? 406 PHE D CB  1 
ATOM   5695 C  CG  . PHE D 1 79  ? -29.874 18.853  -30.981 1.00 50.47  ? 406 PHE D CG  1 
ATOM   5696 C  CD1 . PHE D 1 79  ? -28.971 19.854  -30.612 1.00 49.80  ? 406 PHE D CD1 1 
ATOM   5697 C  CD2 . PHE D 1 79  ? -30.950 19.192  -31.811 1.00 49.81  ? 406 PHE D CD2 1 
ATOM   5698 C  CE1 . PHE D 1 79  ? -29.146 21.164  -31.056 1.00 49.21  ? 406 PHE D CE1 1 
ATOM   5699 C  CE2 . PHE D 1 79  ? -31.125 20.499  -32.263 1.00 48.48  ? 406 PHE D CE2 1 
ATOM   5700 C  CZ  . PHE D 1 79  ? -30.218 21.485  -31.889 1.00 48.23  ? 406 PHE D CZ  1 
ATOM   5701 N  N   . TYR D 1 80  ? -32.214 17.455  -28.613 1.00 47.33  ? 407 TYR D N   1 
ATOM   5702 C  CA  . TYR D 1 80  ? -33.456 18.002  -28.066 1.00 45.11  ? 407 TYR D CA  1 
ATOM   5703 C  C   . TYR D 1 80  ? -33.410 18.060  -26.532 1.00 44.97  ? 407 TYR D C   1 
ATOM   5704 O  O   . TYR D 1 80  ? -33.704 19.103  -25.959 1.00 43.18  ? 407 TYR D O   1 
ATOM   5705 C  CB  . TYR D 1 80  ? -34.666 17.178  -28.529 1.00 45.45  ? 407 TYR D CB  1 
ATOM   5706 C  CG  . TYR D 1 80  ? -34.933 17.180  -30.018 1.00 45.02  ? 407 TYR D CG  1 
ATOM   5707 C  CD1 . TYR D 1 80  ? -34.784 18.349  -30.779 1.00 43.33  ? 407 TYR D CD1 1 
ATOM   5708 C  CD2 . TYR D 1 80  ? -35.384 16.026  -30.665 1.00 46.98  ? 407 TYR D CD2 1 
ATOM   5709 C  CE1 . TYR D 1 80  ? -35.037 18.358  -32.149 1.00 43.50  ? 407 TYR D CE1 1 
ATOM   5710 C  CE2 . TYR D 1 80  ? -35.646 16.027  -32.039 1.00 47.54  ? 407 TYR D CE2 1 
ATOM   5711 C  CZ  . TYR D 1 80  ? -35.468 17.200  -32.770 1.00 45.44  ? 407 TYR D CZ  1 
ATOM   5712 O  OH  . TYR D 1 80  ? -35.726 17.234  -34.108 1.00 46.34  ? 407 TYR D OH  1 
ATOM   5713 N  N   . ASP D 1 81  ? -33.006 16.959  -25.888 1.00 47.27  ? 408 ASP D N   1 
ATOM   5714 C  CA  . ASP D 1 81  ? -32.949 16.863  -24.419 1.00 48.58  ? 408 ASP D CA  1 
ATOM   5715 C  C   . ASP D 1 81  ? -32.042 17.904  -23.770 1.00 47.00  ? 408 ASP D C   1 
ATOM   5716 O  O   . ASP D 1 81  ? -32.407 18.490  -22.749 1.00 46.69  ? 408 ASP D O   1 
ATOM   5717 C  CB  . ASP D 1 81  ? -32.520 15.458  -23.967 1.00 52.44  ? 408 ASP D CB  1 
ATOM   5718 C  CG  . ASP D 1 81  ? -33.458 14.368  -24.450 1.00 55.26  ? 408 ASP D CG  1 
ATOM   5719 O  OD1 . ASP D 1 81  ? -34.600 14.683  -24.871 1.00 54.91  ? 408 ASP D OD1 1 
ATOM   5720 O  OD2 . ASP D 1 81  ? -33.040 13.185  -24.420 1.00 58.92  ? 408 ASP D OD2 1 
ATOM   5721 N  N   . LEU D 1 82  ? -30.875 18.140  -24.369 1.00 46.34  ? 409 LEU D N   1 
ATOM   5722 C  CA  . LEU D 1 82  ? -29.983 19.191  -23.904 1.00 44.94  ? 409 LEU D CA  1 
ATOM   5723 C  C   . LEU D 1 82  ? -30.601 20.576  -23.975 1.00 42.34  ? 409 LEU D C   1 
ATOM   5724 O  O   . LEU D 1 82  ? -30.349 21.401  -23.097 1.00 41.91  ? 409 LEU D O   1 
ATOM   5725 C  CB  . LEU D 1 82  ? -28.636 19.140  -24.624 1.00 46.22  ? 409 LEU D CB  1 
ATOM   5726 C  CG  . LEU D 1 82  ? -27.726 17.963  -24.244 1.00 49.29  ? 409 LEU D CG  1 
ATOM   5727 C  CD1 . LEU D 1 82  ? -26.566 17.826  -25.224 1.00 50.07  ? 409 LEU D CD1 1 
ATOM   5728 C  CD2 . LEU D 1 82  ? -27.239 18.030  -22.789 1.00 49.60  ? 409 LEU D CD2 1 
ATOM   5729 N  N   . LEU D 1 83  ? -31.432 20.812  -24.987 1.00 41.84  ? 410 LEU D N   1 
ATOM   5730 C  CA  . LEU D 1 83  ? -32.192 22.070  -25.116 1.00 40.37  ? 410 LEU D CA  1 
ATOM   5731 C  C   . LEU D 1 83  ? -33.372 22.169  -24.132 1.00 39.55  ? 410 LEU D C   1 
ATOM   5732 O  O   . LEU D 1 83  ? -33.539 23.195  -23.481 1.00 38.61  ? 410 LEU D O   1 
ATOM   5733 C  CB  . LEU D 1 83  ? -32.676 22.298  -26.564 1.00 40.30  ? 410 LEU D CB  1 
ATOM   5734 C  CG  . LEU D 1 83  ? -31.631 22.501  -27.660 1.00 41.13  ? 410 LEU D CG  1 
ATOM   5735 C  CD1 . LEU D 1 83  ? -32.217 22.207  -29.039 1.00 42.56  ? 410 LEU D CD1 1 
ATOM   5736 C  CD2 . LEU D 1 83  ? -31.074 23.919  -27.603 1.00 39.61  ? 410 LEU D CD2 1 
ATOM   5737 N  N   . THR D 1 84  ? -34.181 21.120  -24.030 1.00 40.95  ? 411 THR D N   1 
ATOM   5738 C  CA  . THR D 1 84  ? -35.355 21.141  -23.141 1.00 42.15  ? 411 THR D CA  1 
ATOM   5739 C  C   . THR D 1 84  ? -34.927 21.147  -21.670 1.00 43.79  ? 411 THR D C   1 
ATOM   5740 O  O   . THR D 1 84  ? -35.523 21.867  -20.863 1.00 43.04  ? 411 THR D O   1 
ATOM   5741 C  CB  . THR D 1 84  ? -36.359 19.987  -23.407 1.00 43.36  ? 411 THR D CB  1 
ATOM   5742 O  OG1 . THR D 1 84  ? -35.757 18.727  -23.086 1.00 44.79  ? 411 THR D OG1 1 
ATOM   5743 C  CG2 . THR D 1 84  ? -36.814 19.985  -24.860 1.00 42.33  ? 411 THR D CG2 1 
ATOM   5744 N  N   . GLY D 1 85  ? -33.875 20.369  -21.355 1.00 46.21  ? 412 GLY D N   1 
ATOM   5745 C  CA  . GLY D 1 85  ? -33.234 20.316  -20.022 1.00 47.85  ? 412 GLY D CA  1 
ATOM   5746 C  C   . GLY D 1 85  ? -32.675 21.640  -19.534 1.00 47.29  ? 412 GLY D C   1 
ATOM   5747 O  O   . GLY D 1 85  ? -32.517 21.848  -18.331 1.00 49.54  ? 412 GLY D O   1 
ATOM   5748 N  N   . SER D 1 86  ? -32.403 22.546  -20.468 1.00 45.93  ? 413 SER D N   1 
ATOM   5749 C  CA  . SER D 1 86  ? -31.915 23.890  -20.163 1.00 45.62  ? 413 SER D CA  1 
ATOM   5750 C  C   . SER D 1 86  ? -33.013 24.932  -20.003 1.00 44.97  ? 413 SER D C   1 
ATOM   5751 O  O   . SER D 1 86  ? -32.734 26.042  -19.544 1.00 44.45  ? 413 SER D O   1 
ATOM   5752 C  CB  . SER D 1 86  ? -30.936 24.363  -21.247 1.00 44.71  ? 413 SER D CB  1 
ATOM   5753 O  OG  . SER D 1 86  ? -29.859 23.448  -21.359 1.00 47.25  ? 413 SER D OG  1 
ATOM   5754 N  N   . MET D 1 87  ? -34.243 24.581  -20.383 1.00 45.33  ? 414 MET D N   1 
ATOM   5755 C  CA  . MET D 1 87  ? -35.325 25.564  -20.510 1.00 45.39  ? 414 MET D CA  1 
ATOM   5756 C  C   . MET D 1 87  ? -35.840 26.133  -19.196 1.00 45.22  ? 414 MET D C   1 
ATOM   5757 O  O   . MET D 1 87  ? -35.898 27.358  -19.064 1.00 44.86  ? 414 MET D O   1 
ATOM   5758 C  CB  . MET D 1 87  ? -36.481 25.043  -21.372 1.00 46.57  ? 414 MET D CB  1 
ATOM   5759 C  CG  . MET D 1 87  ? -36.214 25.172  -22.865 1.00 45.89  ? 414 MET D CG  1 
ATOM   5760 S  SD  . MET D 1 87  ? -37.420 24.385  -23.962 1.00 46.45  ? 414 MET D SD  1 
ATOM   5761 C  CE  . MET D 1 87  ? -38.871 25.262  -23.383 1.00 47.47  ? 414 MET D CE  1 
ATOM   5762 N  N   . GLU D 1 88  ? -36.204 25.270  -18.244 1.00 46.83  ? 415 GLU D N   1 
ATOM   5763 C  CA  . GLU D 1 88  ? -36.626 25.726  -16.902 1.00 48.05  ? 415 GLU D CA  1 
ATOM   5764 C  C   . GLU D 1 88  ? -35.513 26.452  -16.142 1.00 45.28  ? 415 GLU D C   1 
ATOM   5765 O  O   . GLU D 1 88  ? -35.791 27.448  -15.478 1.00 44.84  ? 415 GLU D O   1 
ATOM   5766 C  CB  . GLU D 1 88  ? -37.207 24.589  -16.035 1.00 52.77  ? 415 GLU D CB  1 
ATOM   5767 C  CG  . GLU D 1 88  ? -38.535 23.993  -16.514 1.00 57.43  ? 415 GLU D CG  1 
ATOM   5768 C  CD  . GLU D 1 88  ? -39.677 25.005  -16.642 1.00 59.35  ? 415 GLU D CD  1 
ATOM   5769 O  OE1 . GLU D 1 88  ? -40.185 25.478  -15.607 1.00 61.33  ? 415 GLU D OE1 1 
ATOM   5770 O  OE2 . GLU D 1 88  ? -40.088 25.308  -17.789 1.00 60.56  ? 415 GLU D OE2 1 
ATOM   5771 N  N   . ILE D 1 89  ? -34.274 25.964  -16.261 1.00 43.61  ? 416 ILE D N   1 
ATOM   5772 C  CA  . ILE D 1 89  ? -33.092 26.590  -15.620 1.00 43.24  ? 416 ILE D CA  1 
ATOM   5773 C  C   . ILE D 1 89  ? -32.846 28.030  -16.127 1.00 40.99  ? 416 ILE D C   1 
ATOM   5774 O  O   . ILE D 1 89  ? -32.658 28.958  -15.322 1.00 40.13  ? 416 ILE D O   1 
ATOM   5775 C  CB  . ILE D 1 89  ? -31.815 25.693  -15.724 1.00 43.71  ? 416 ILE D CB  1 
ATOM   5776 C  CG1 . ILE D 1 89  ? -31.990 24.428  -14.856 1.00 45.26  ? 416 ILE D CG1 1 
ATOM   5777 C  CG2 . ILE D 1 89  ? -30.554 26.469  -15.326 1.00 42.34  ? 416 ILE D CG2 1 
ATOM   5778 C  CD1 . ILE D 1 89  ? -30.965 23.328  -15.065 1.00 45.53  ? 416 ILE D CD1 1 
ATOM   5779 N  N   . ILE D 1 90  ? -32.876 28.198  -17.450 1.00 39.59  ? 417 ILE D N   1 
ATOM   5780 C  CA  . ILE D 1 90  ? -32.797 29.518  -18.097 1.00 38.83  ? 417 ILE D CA  1 
ATOM   5781 C  C   . ILE D 1 90  ? -34.006 30.392  -17.746 1.00 39.18  ? 417 ILE D C   1 
ATOM   5782 O  O   . ILE D 1 90  ? -33.868 31.602  -17.516 1.00 38.47  ? 417 ILE D O   1 
ATOM   5783 C  CB  . ILE D 1 90  ? -32.566 29.414  -19.625 1.00 37.16  ? 417 ILE D CB  1 
ATOM   5784 C  CG1 . ILE D 1 90  ? -31.129 28.941  -19.871 1.00 38.79  ? 417 ILE D CG1 1 
ATOM   5785 C  CG2 . ILE D 1 90  ? -32.790 30.765  -20.292 1.00 36.10  ? 417 ILE D CG2 1 
ATOM   5786 C  CD1 . ILE D 1 90  ? -30.760 28.615  -21.313 1.00 39.02  ? 417 ILE D CD1 1 
ATOM   5787 N  N   . ARG D 1 91  ? -35.181 29.776  -17.688 1.00 40.90  ? 418 ARG D N   1 
ATOM   5788 C  CA  . ARG D 1 91  ? -36.377 30.493  -17.247 1.00 43.19  ? 418 ARG D CA  1 
ATOM   5789 C  C   . ARG D 1 91  ? -36.224 30.968  -15.791 1.00 42.83  ? 418 ARG D C   1 
ATOM   5790 O  O   . ARG D 1 91  ? -36.541 32.120  -15.482 1.00 43.48  ? 418 ARG D O   1 
ATOM   5791 C  CB  . ARG D 1 91  ? -37.618 29.626  -17.437 1.00 46.69  ? 418 ARG D CB  1 
ATOM   5792 C  CG  . ARG D 1 91  ? -38.901 30.227  -16.900 1.00 51.74  ? 418 ARG D CG  1 
ATOM   5793 C  CD  . ARG D 1 91  ? -39.796 30.717  -18.012 1.00 55.28  ? 418 ARG D CD  1 
ATOM   5794 N  NE  . ARG D 1 91  ? -41.095 30.095  -17.824 1.00 59.82  ? 418 ARG D NE  1 
ATOM   5795 C  CZ  . ARG D 1 91  ? -41.453 28.934  -18.362 1.00 62.45  ? 418 ARG D CZ  1 
ATOM   5796 N  NH1 . ARG D 1 91  ? -40.620 28.273  -19.175 1.00 62.87  ? 418 ARG D NH1 1 
ATOM   5797 N  NH2 . ARG D 1 91  ? -42.656 28.437  -18.093 1.00 64.71  ? 418 ARG D NH2 1 
ATOM   5798 N  N   . GLY D 1 92  ? -35.727 30.082  -14.920 1.00 42.08  ? 419 GLY D N   1 
ATOM   5799 C  CA  . GLY D 1 92  ? -35.431 30.410  -13.522 1.00 41.38  ? 419 GLY D CA  1 
ATOM   5800 C  C   . GLY D 1 92  ? -34.478 31.590  -13.378 1.00 39.86  ? 419 GLY D C   1 
ATOM   5801 O  O   . GLY D 1 92  ? -34.644 32.403  -12.492 1.00 40.78  ? 419 GLY D O   1 
ATOM   5802 N  N   . TRP D 1 93  ? -33.490 31.672  -14.271 1.00 38.32  ? 420 TRP D N   1 
ATOM   5803 C  CA  . TRP D 1 93  ? -32.504 32.749  -14.321 1.00 37.47  ? 420 TRP D CA  1 
ATOM   5804 C  C   . TRP D 1 93  ? -33.119 34.106  -14.690 1.00 38.25  ? 420 TRP D C   1 
ATOM   5805 O  O   . TRP D 1 93  ? -32.783 35.136  -14.065 1.00 39.02  ? 420 TRP D O   1 
ATOM   5806 C  CB  . TRP D 1 93  ? -31.367 32.366  -15.279 1.00 36.33  ? 420 TRP D CB  1 
ATOM   5807 C  CG  . TRP D 1 93  ? -30.548 33.514  -15.726 1.00 35.76  ? 420 TRP D CG  1 
ATOM   5808 C  CD1 . TRP D 1 93  ? -29.436 34.021  -15.113 1.00 36.41  ? 420 TRP D CD1 1 
ATOM   5809 C  CD2 . TRP D 1 93  ? -30.772 34.318  -16.883 1.00 35.06  ? 420 TRP D CD2 1 
ATOM   5810 N  NE1 . TRP D 1 93  ? -28.944 35.090  -15.824 1.00 35.81  ? 420 TRP D NE1 1 
ATOM   5811 C  CE2 . TRP D 1 93  ? -29.749 35.302  -16.912 1.00 35.44  ? 420 TRP D CE2 1 
ATOM   5812 C  CE3 . TRP D 1 93  ? -31.738 34.307  -17.909 1.00 34.42  ? 420 TRP D CE3 1 
ATOM   5813 C  CZ2 . TRP D 1 93  ? -29.670 36.270  -17.923 1.00 35.53  ? 420 TRP D CZ2 1 
ATOM   5814 C  CZ3 . TRP D 1 93  ? -31.665 35.273  -18.912 1.00 34.03  ? 420 TRP D CZ3 1 
ATOM   5815 C  CH2 . TRP D 1 93  ? -30.637 36.242  -18.910 1.00 34.91  ? 420 TRP D CH2 1 
ATOM   5816 N  N   . ALA D 1 94  ? -33.989 34.091  -15.711 1.00 37.53  ? 421 ALA D N   1 
ATOM   5817 C  CA  . ALA D 1 94  ? -34.776 35.247  -16.180 1.00 38.33  ? 421 ALA D CA  1 
ATOM   5818 C  C   . ALA D 1 94  ? -35.598 35.892  -15.059 1.00 40.04  ? 421 ALA D C   1 
ATOM   5819 O  O   . ALA D 1 94  ? -35.559 37.111  -14.861 1.00 40.32  ? 421 ALA D O   1 
ATOM   5820 C  CB  . ALA D 1 94  ? -35.702 34.817  -17.329 1.00 37.52  ? 421 ALA D CB  1 
ATOM   5821 N  N   . GLU D 1 95  ? -36.317 35.059  -14.315 1.00 41.60  ? 422 GLU D N   1 
ATOM   5822 C  CA  . GLU D 1 95  ? -37.149 35.519  -13.203 1.00 45.21  ? 422 GLU D CA  1 
ATOM   5823 C  C   . GLU D 1 95  ? -36.340 36.121  -12.033 1.00 45.24  ? 422 GLU D C   1 
ATOM   5824 O  O   . GLU D 1 95  ? -36.908 36.756  -11.144 1.00 46.00  ? 422 GLU D O   1 
ATOM   5825 C  CB  . GLU D 1 95  ? -38.082 34.389  -12.746 1.00 47.93  ? 422 GLU D CB  1 
ATOM   5826 C  CG  . GLU D 1 95  ? -39.137 34.053  -13.802 1.00 50.93  ? 422 GLU D CG  1 
ATOM   5827 C  CD  . GLU D 1 95  ? -39.733 32.650  -13.699 1.00 53.69  ? 422 GLU D CD  1 
ATOM   5828 O  OE1 . GLU D 1 95  ? -39.361 31.873  -12.796 1.00 56.58  ? 422 GLU D OE1 1 
ATOM   5829 O  OE2 . GLU D 1 95  ? -40.603 32.314  -14.531 1.00 55.71  ? 422 GLU D OE2 1 
ATOM   5830 N  N   . LYS D 1 96  ? -35.016 35.962  -12.065 1.00 43.88  ? 423 LYS D N   1 
ATOM   5831 C  CA  . LYS D 1 96  ? -34.155 36.541  -11.013 1.00 45.19  ? 423 LYS D CA  1 
ATOM   5832 C  C   . LYS D 1 96  ? -33.508 37.866  -11.418 1.00 44.39  ? 423 LYS D C   1 
ATOM   5833 O  O   . LYS D 1 96  ? -32.797 38.482  -10.612 1.00 44.88  ? 423 LYS D O   1 
ATOM   5834 C  CB  . LYS D 1 96  ? -33.122 35.526  -10.494 1.00 44.70  ? 423 LYS D CB  1 
ATOM   5835 C  CG  . LYS D 1 96  ? -33.760 34.420  -9.673  1.00 46.97  ? 423 LYS D CG  1 
ATOM   5836 C  CD  . LYS D 1 96  ? -32.775 33.302  -9.374  1.00 48.82  ? 423 LYS D CD  1 
ATOM   5837 C  CE  . LYS D 1 96  ? -33.336 32.342  -8.328  1.00 50.34  ? 423 LYS D CE  1 
ATOM   5838 N  NZ  . LYS D 1 96  ? -32.337 32.089  -7.254  1.00 53.01  ? 423 LYS D NZ  1 
ATOM   5839 N  N   . ILE D 1 97  ? -33.776 38.310  -12.650 1.00 42.79  ? 424 ILE D N   1 
ATOM   5840 C  CA  . ILE D 1 97  ? -33.391 39.656  -13.092 1.00 43.58  ? 424 ILE D CA  1 
ATOM   5841 C  C   . ILE D 1 97  ? -34.398 40.660  -12.503 1.00 45.57  ? 424 ILE D C   1 
ATOM   5842 O  O   . ILE D 1 97  ? -35.567 40.638  -12.886 1.00 46.39  ? 424 ILE D O   1 
ATOM   5843 C  CB  . ILE D 1 97  ? -33.300 39.774  -14.635 1.00 42.39  ? 424 ILE D CB  1 
ATOM   5844 C  CG1 . ILE D 1 97  ? -32.379 38.691  -15.208 1.00 40.79  ? 424 ILE D CG1 1 
ATOM   5845 C  CG2 . ILE D 1 97  ? -32.814 41.163  -15.057 1.00 43.65  ? 424 ILE D CG2 1 
ATOM   5846 C  CD1 . ILE D 1 97  ? -32.485 38.558  -16.719 1.00 40.40  ? 424 ILE D CD1 1 
ATOM   5847 N  N   . PRO D 1 98  ? -33.951 41.532  -11.562 1.00 46.74  ? 425 PRO D N   1 
ATOM   5848 C  CA  . PRO D 1 98  ? -34.902 42.447  -10.897 1.00 49.13  ? 425 PRO D CA  1 
ATOM   5849 C  C   . PRO D 1 98  ? -35.664 43.275  -11.931 1.00 50.12  ? 425 PRO D C   1 
ATOM   5850 O  O   . PRO D 1 98  ? -35.052 43.875  -12.824 1.00 50.07  ? 425 PRO D O   1 
ATOM   5851 C  CB  . PRO D 1 98  ? -34.016 43.362  -10.030 1.00 50.14  ? 425 PRO D CB  1 
ATOM   5852 C  CG  . PRO D 1 98  ? -32.640 42.807  -10.096 1.00 48.12  ? 425 PRO D CG  1 
ATOM   5853 C  CD  . PRO D 1 98  ? -32.545 41.851  -11.244 1.00 46.06  ? 425 PRO D CD  1 
ATOM   5854 N  N   . GLY D 1 99  ? -36.988 43.258  -11.838 1.00 51.12  ? 426 GLY D N   1 
ATOM   5855 C  CA  . GLY D 1 99  ? -37.808 43.942  -12.824 1.00 51.97  ? 426 GLY D CA  1 
ATOM   5856 C  C   . GLY D 1 99  ? -38.386 43.087  -13.938 1.00 49.59  ? 426 GLY D C   1 
ATOM   5857 O  O   . GLY D 1 99  ? -39.362 43.503  -14.548 1.00 50.66  ? 426 GLY D O   1 
ATOM   5858 N  N   . PHE D 1 100 ? -37.801 41.911  -14.203 1.00 46.83  ? 427 PHE D N   1 
ATOM   5859 C  CA  . PHE D 1 100 ? -38.352 40.971  -15.201 1.00 45.73  ? 427 PHE D CA  1 
ATOM   5860 C  C   . PHE D 1 100 ? -39.761 40.515  -14.813 1.00 47.29  ? 427 PHE D C   1 
ATOM   5861 O  O   . PHE D 1 100 ? -40.665 40.573  -15.634 1.00 48.69  ? 427 PHE D O   1 
ATOM   5862 C  CB  . PHE D 1 100 ? -37.408 39.771  -15.465 1.00 42.50  ? 427 PHE D CB  1 
ATOM   5863 C  CG  . PHE D 1 100 ? -37.841 38.869  -16.613 1.00 40.64  ? 427 PHE D CG  1 
ATOM   5864 C  CD1 . PHE D 1 100 ? -37.512 39.180  -17.939 1.00 40.31  ? 427 PHE D CD1 1 
ATOM   5865 C  CD2 . PHE D 1 100 ? -38.561 37.699  -16.368 1.00 40.17  ? 427 PHE D CD2 1 
ATOM   5866 C  CE1 . PHE D 1 100 ? -37.907 38.353  -18.992 1.00 38.93  ? 427 PHE D CE1 1 
ATOM   5867 C  CE2 . PHE D 1 100 ? -38.958 36.864  -17.410 1.00 39.43  ? 427 PHE D CE2 1 
ATOM   5868 C  CZ  . PHE D 1 100 ? -38.626 37.193  -18.728 1.00 38.84  ? 427 PHE D CZ  1 
ATOM   5869 N  N   . ALA D 1 101 ? -39.941 40.093  -13.563 1.00 48.65  ? 428 ALA D N   1 
ATOM   5870 C  CA  . ALA D 1 101 ? -41.253 39.675  -13.022 1.00 51.46  ? 428 ALA D CA  1 
ATOM   5871 C  C   . ALA D 1 101 ? -42.342 40.765  -12.994 1.00 55.04  ? 428 ALA D C   1 
ATOM   5872 O  O   . ALA D 1 101 ? -43.540 40.446  -12.943 1.00 57.12  ? 428 ALA D O   1 
ATOM   5873 C  CB  . ALA D 1 101 ? -41.088 39.058  -11.638 1.00 51.72  ? 428 ALA D CB  1 
ATOM   5874 N  N   . ASP D 1 102 ? -41.923 42.033  -13.030 1.00 56.35  ? 429 ASP D N   1 
ATOM   5875 C  CA  . ASP D 1 102 ? -42.843 43.183  -13.091 1.00 60.01  ? 429 ASP D CA  1 
ATOM   5876 C  C   . ASP D 1 102 ? -43.371 43.477  -14.494 1.00 59.79  ? 429 ASP D C   1 
ATOM   5877 O  O   . ASP D 1 102 ? -44.307 44.263  -14.653 1.00 62.84  ? 429 ASP D O   1 
ATOM   5878 C  CB  . ASP D 1 102 ? -42.175 44.443  -12.535 1.00 62.52  ? 429 ASP D CB  1 
ATOM   5879 C  CG  . ASP D 1 102 ? -41.739 44.292  -11.084 1.00 63.74  ? 429 ASP D CG  1 
ATOM   5880 O  OD1 . ASP D 1 102 ? -42.368 43.498  -10.333 1.00 64.85  ? 429 ASP D OD1 1 
ATOM   5881 O  OD2 . ASP D 1 102 ? -40.765 44.984  -10.703 1.00 64.03  ? 429 ASP D OD2 1 
ATOM   5882 N  N   . LEU D 1 103 ? -42.749 42.871  -15.504 1.00 55.97  ? 430 LEU D N   1 
ATOM   5883 C  CA  . LEU D 1 103 ? -43.214 42.980  -16.884 1.00 55.78  ? 430 LEU D CA  1 
ATOM   5884 C  C   . LEU D 1 103 ? -44.523 42.183  -17.051 1.00 56.10  ? 430 LEU D C   1 
ATOM   5885 O  O   . LEU D 1 103 ? -44.745 41.217  -16.301 1.00 56.17  ? 430 LEU D O   1 
ATOM   5886 C  CB  . LEU D 1 103 ? -42.126 42.490  -17.868 1.00 52.45  ? 430 LEU D CB  1 
ATOM   5887 C  CG  . LEU D 1 103 ? -40.760 43.204  -17.894 1.00 51.85  ? 430 LEU D CG  1 
ATOM   5888 C  CD1 . LEU D 1 103 ? -39.820 42.503  -18.861 1.00 49.13  ? 430 LEU D CD1 1 
ATOM   5889 C  CD2 . LEU D 1 103 ? -40.853 44.682  -18.239 1.00 53.91  ? 430 LEU D CD2 1 
ATOM   5890 N  N   . PRO D 1 104 ? -45.397 42.580  -18.016 1.00 56.72  ? 431 PRO D N   1 
ATOM   5891 C  CA  . PRO D 1 104 ? -46.573 41.738  -18.309 1.00 56.87  ? 431 PRO D CA  1 
ATOM   5892 C  C   . PRO D 1 104 ? -46.144 40.336  -18.732 1.00 52.92  ? 431 PRO D C   1 
ATOM   5893 O  O   . PRO D 1 104 ? -45.102 40.177  -19.384 1.00 50.10  ? 431 PRO D O   1 
ATOM   5894 C  CB  . PRO D 1 104 ? -47.244 42.455  -19.482 1.00 58.82  ? 431 PRO D CB  1 
ATOM   5895 C  CG  . PRO D 1 104 ? -46.779 43.863  -19.375 1.00 60.77  ? 431 PRO D CG  1 
ATOM   5896 C  CD  . PRO D 1 104 ? -45.361 43.770  -18.888 1.00 58.00  ? 431 PRO D CD  1 
ATOM   5897 N  N   . LYS D 1 105 ? -46.935 39.340  -18.343 1.00 52.94  ? 432 LYS D N   1 
ATOM   5898 C  CA  . LYS D 1 105 ? -46.642 37.930  -18.593 1.00 50.74  ? 432 LYS D CA  1 
ATOM   5899 C  C   . LYS D 1 105 ? -46.293 37.641  -20.071 1.00 49.50  ? 432 LYS D C   1 
ATOM   5900 O  O   . LYS D 1 105 ? -45.324 36.915  -20.352 1.00 47.21  ? 432 LYS D O   1 
ATOM   5901 C  CB  . LYS D 1 105 ? -47.803 37.059  -18.076 1.00 52.56  ? 432 LYS D CB  1 
ATOM   5902 C  CG  . LYS D 1 105 ? -47.804 35.584  -18.474 1.00 50.76  ? 432 LYS D CG  1 
ATOM   5903 C  CD  . LYS D 1 105 ? -46.705 34.754  -17.810 1.00 47.86  ? 432 LYS D CD  1 
ATOM   5904 C  CE  . LYS D 1 105 ? -46.807 33.319  -18.314 1.00 46.87  ? 432 LYS D CE  1 
ATOM   5905 N  NZ  . LYS D 1 105 ? -45.591 32.488  -18.137 1.00 43.69  ? 432 LYS D NZ  1 
ATOM   5906 N  N   . ALA D 1 106 ? -47.060 38.233  -20.993 1.00 51.60  ? 433 ALA D N   1 
ATOM   5907 C  CA  . ALA D 1 106 ? -46.814 38.112  -22.442 1.00 50.50  ? 433 ALA D CA  1 
ATOM   5908 C  C   . ALA D 1 106 ? -45.410 38.561  -22.844 1.00 48.14  ? 433 ALA D C   1 
ATOM   5909 O  O   . ALA D 1 106 ? -44.741 37.845  -23.593 1.00 46.10  ? 433 ALA D O   1 
ATOM   5910 C  CB  . ALA D 1 106 ? -47.887 38.838  -23.258 1.00 53.25  ? 433 ALA D CB  1 
ATOM   5911 N  N   . ASP D 1 107 ? -44.951 39.711  -22.327 1.00 48.86  ? 434 ASP D N   1 
ATOM   5912 C  CA  . ASP D 1 107 ? -43.567 40.185  -22.597 1.00 47.24  ? 434 ASP D CA  1 
ATOM   5913 C  C   . ASP D 1 107 ? -42.509 39.277  -21.991 1.00 44.84  ? 434 ASP D C   1 
ATOM   5914 O  O   . ASP D 1 107 ? -41.477 39.039  -22.609 1.00 43.98  ? 434 ASP D O   1 
ATOM   5915 C  CB  . ASP D 1 107 ? -43.342 41.629  -22.137 1.00 48.90  ? 434 ASP D CB  1 
ATOM   5916 C  CG  . ASP D 1 107 ? -44.154 42.640  -22.942 1.00 51.71  ? 434 ASP D CG  1 
ATOM   5917 O  OD1 . ASP D 1 107 ? -44.826 42.243  -23.922 1.00 51.28  ? 434 ASP D OD1 1 
ATOM   5918 O  OD2 . ASP D 1 107 ? -44.120 43.842  -22.578 1.00 53.97  ? 434 ASP D OD2 1 
ATOM   5919 N  N   . GLN D 1 108 ? -42.770 38.768  -20.790 1.00 45.10  ? 435 GLN D N   1 
ATOM   5920 C  CA  . GLN D 1 108 ? -41.882 37.792  -20.153 1.00 42.95  ? 435 GLN D CA  1 
ATOM   5921 C  C   . GLN D 1 108 ? -41.658 36.579  -21.073 1.00 41.00  ? 435 GLN D C   1 
ATOM   5922 O  O   . GLN D 1 108 ? -40.507 36.248  -21.404 1.00 39.50  ? 435 GLN D O   1 
ATOM   5923 C  CB  . GLN D 1 108 ? -42.443 37.349  -18.786 1.00 43.42  ? 435 GLN D CB  1 
ATOM   5924 C  CG  . GLN D 1 108 ? -42.210 38.330  -17.652 1.00 44.23  ? 435 GLN D CG  1 
ATOM   5925 C  CD  . GLN D 1 108 ? -42.689 37.786  -16.313 1.00 45.58  ? 435 GLN D CD  1 
ATOM   5926 O  OE1 . GLN D 1 108 ? -43.710 38.234  -15.794 1.00 47.85  ? 435 GLN D OE1 1 
ATOM   5927 N  NE2 . GLN D 1 108 ? -41.959 36.814  -15.751 1.00 43.41  ? 435 GLN D NE2 1 
ATOM   5928 N  N   . ASP D 1 109 ? -42.760 35.951  -21.492 1.00 41.20  ? 436 ASP D N   1 
ATOM   5929 C  CA  . ASP D 1 109 ? -42.733 34.788  -22.378 1.00 40.41  ? 436 ASP D CA  1 
ATOM   5930 C  C   . ASP D 1 109 ? -42.032 35.159  -23.676 1.00 39.79  ? 436 ASP D C   1 
ATOM   5931 O  O   . ASP D 1 109 ? -41.046 34.502  -24.048 1.00 37.75  ? 436 ASP D O   1 
ATOM   5932 C  CB  . ASP D 1 109 ? -44.156 34.244  -22.653 1.00 42.21  ? 436 ASP D CB  1 
ATOM   5933 C  CG  . ASP D 1 109 ? -44.827 33.633  -21.404 1.00 44.16  ? 436 ASP D CG  1 
ATOM   5934 O  OD1 . ASP D 1 109 ? -44.157 33.402  -20.362 1.00 44.01  ? 436 ASP D OD1 1 
ATOM   5935 O  OD2 . ASP D 1 109 ? -46.043 33.379  -21.458 1.00 46.20  ? 436 ASP D OD2 1 
ATOM   5936 N  N   . LEU D 1 110 ? -42.511 36.237  -24.315 1.00 40.89  ? 437 LEU D N   1 
ATOM   5937 C  CA  . LEU D 1 110 ? -41.907 36.777  -25.524 1.00 40.84  ? 437 LEU D CA  1 
ATOM   5938 C  C   . LEU D 1 110 ? -40.394 36.961  -25.394 1.00 39.37  ? 437 LEU D C   1 
ATOM   5939 O  O   . LEU D 1 110 ? -39.639 36.420  -26.222 1.00 38.23  ? 437 LEU D O   1 
ATOM   5940 C  CB  . LEU D 1 110 ? -42.589 38.075  -25.992 1.00 43.39  ? 437 LEU D CB  1 
ATOM   5941 C  CG  . LEU D 1 110 ? -42.029 38.589  -27.333 1.00 44.44  ? 437 LEU D CG  1 
ATOM   5942 C  CD1 . LEU D 1 110 ? -42.414 37.695  -28.505 1.00 44.17  ? 437 LEU D CD1 1 
ATOM   5943 C  CD2 . LEU D 1 110 ? -42.449 40.021  -27.600 1.00 47.17  ? 437 LEU D CD2 1 
ATOM   5944 N  N   . LEU D 1 111 ? -39.956 37.693  -24.363 1.00 39.73  ? 438 LEU D N   1 
ATOM   5945 C  CA  . LEU D 1 111 ? -38.505 37.877  -24.098 1.00 38.89  ? 438 LEU D CA  1 
ATOM   5946 C  C   . LEU D 1 111 ? -37.756 36.563  -23.882 1.00 36.56  ? 438 LEU D C   1 
ATOM   5947 O  O   . LEU D 1 111 ? -36.702 36.341  -24.511 1.00 34.73  ? 438 LEU D O   1 
ATOM   5948 C  CB  . LEU D 1 111 ? -38.220 38.847  -22.935 1.00 39.91  ? 438 LEU D CB  1 
ATOM   5949 C  CG  . LEU D 1 111 ? -38.586 40.338  -23.066 1.00 43.08  ? 438 LEU D CG  1 
ATOM   5950 C  CD1 . LEU D 1 111 ? -38.244 41.039  -21.756 1.00 43.81  ? 438 LEU D CD1 1 
ATOM   5951 C  CD2 . LEU D 1 111 ? -37.896 41.025  -24.244 1.00 43.32  ? 438 LEU D CD2 1 
ATOM   5952 N  N   . PHE D 1 112 ? -38.303 35.705  -23.008 1.00 36.48  ? 439 PHE D N   1 
ATOM   5953 C  CA  . PHE D 1 112 ? -37.672 34.412  -22.691 1.00 34.97  ? 439 PHE D CA  1 
ATOM   5954 C  C   . PHE D 1 112 ? -37.529 33.559  -23.962 1.00 34.51  ? 439 PHE D C   1 
ATOM   5955 O  O   . PHE D 1 112 ? -36.440 33.059  -24.272 1.00 34.00  ? 439 PHE D O   1 
ATOM   5956 C  CB  . PHE D 1 112 ? -38.425 33.636  -21.584 1.00 35.08  ? 439 PHE D CB  1 
ATOM   5957 C  CG  . PHE D 1 112 ? -38.049 32.177  -21.526 1.00 35.05  ? 439 PHE D CG  1 
ATOM   5958 C  CD1 . PHE D 1 112 ? -36.747 31.784  -21.144 1.00 34.98  ? 439 PHE D CD1 1 
ATOM   5959 C  CD2 . PHE D 1 112 ? -38.965 31.189  -21.901 1.00 35.47  ? 439 PHE D CD2 1 
ATOM   5960 C  CE1 . PHE D 1 112 ? -36.370 30.441  -21.125 1.00 35.00  ? 439 PHE D CE1 1 
ATOM   5961 C  CE2 . PHE D 1 112 ? -38.598 29.846  -21.889 1.00 35.87  ? 439 PHE D CE2 1 
ATOM   5962 C  CZ  . PHE D 1 112 ? -37.301 29.468  -21.498 1.00 35.91  ? 439 PHE D CZ  1 
ATOM   5963 N  N   . GLU D 1 113 ? -38.632 33.428  -24.699 1.00 34.58  ? 440 GLU D N   1 
ATOM   5964 C  CA  . GLU D 1 113 ? -38.693 32.563  -25.863 1.00 34.36  ? 440 GLU D CA  1 
ATOM   5965 C  C   . GLU D 1 113 ? -37.794 33.029  -27.000 1.00 33.92  ? 440 GLU D C   1 
ATOM   5966 O  O   . GLU D 1 113 ? -37.095 32.217  -27.597 1.00 32.66  ? 440 GLU D O   1 
ATOM   5967 C  CB  . GLU D 1 113 ? -40.140 32.389  -26.337 1.00 35.56  ? 440 GLU D CB  1 
ATOM   5968 C  CG  . GLU D 1 113 ? -40.969 31.597  -25.341 1.00 36.85  ? 440 GLU D CG  1 
ATOM   5969 C  CD  . GLU D 1 113 ? -42.335 31.223  -25.859 1.00 38.47  ? 440 GLU D CD  1 
ATOM   5970 O  OE1 . GLU D 1 113 ? -42.427 30.716  -26.994 1.00 39.14  ? 440 GLU D OE1 1 
ATOM   5971 O  OE2 . GLU D 1 113 ? -43.310 31.411  -25.118 1.00 39.68  ? 440 GLU D OE2 1 
ATOM   5972 N  N   . SER D 1 114 ? -37.810 34.333  -27.275 1.00 34.87  ? 441 SER D N   1 
ATOM   5973 C  CA  . SER D 1 114 ? -37.006 34.921  -28.351 1.00 35.87  ? 441 SER D CA  1 
ATOM   5974 C  C   . SER D 1 114 ? -35.515 34.853  -28.071 1.00 35.83  ? 441 SER D C   1 
ATOM   5975 O  O   . SER D 1 114 ? -34.717 34.811  -29.007 1.00 38.22  ? 441 SER D O   1 
ATOM   5976 C  CB  . SER D 1 114 ? -37.376 36.380  -28.566 1.00 36.79  ? 441 SER D CB  1 
ATOM   5977 O  OG  . SER D 1 114 ? -38.758 36.535  -28.729 1.00 37.84  ? 441 SER D OG  1 
ATOM   5978 N  N   . ALA D 1 115 ? -35.140 34.853  -26.792 1.00 35.09  ? 442 ALA D N   1 
ATOM   5979 C  CA  . ALA D 1 115 ? -33.734 34.822  -26.410 1.00 34.39  ? 442 ALA D CA  1 
ATOM   5980 C  C   . ALA D 1 115 ? -33.244 33.450  -25.965 1.00 33.75  ? 442 ALA D C   1 
ATOM   5981 O  O   . ALA D 1 115 ? -32.026 33.264  -25.795 1.00 33.28  ? 442 ALA D O   1 
ATOM   5982 C  CB  . ALA D 1 115 ? -33.456 35.843  -25.328 1.00 35.13  ? 442 ALA D CB  1 
ATOM   5983 N  N   . PHE D 1 116 ? -34.163 32.494  -25.798 1.00 32.93  ? 443 PHE D N   1 
ATOM   5984 C  CA  . PHE D 1 116 ? -33.783 31.211  -25.232 1.00 33.88  ? 443 PHE D CA  1 
ATOM   5985 C  C   . PHE D 1 116 ? -32.501 30.610  -25.829 1.00 35.00  ? 443 PHE D C   1 
ATOM   5986 O  O   . PHE D 1 116 ? -31.547 30.315  -25.102 1.00 36.50  ? 443 PHE D O   1 
ATOM   5987 C  CB  . PHE D 1 116 ? -34.927 30.194  -25.238 1.00 34.22  ? 443 PHE D CB  1 
ATOM   5988 C  CG  . PHE D 1 116 ? -34.450 28.791  -25.046 1.00 35.35  ? 443 PHE D CG  1 
ATOM   5989 C  CD1 . PHE D 1 116 ? -33.925 28.381  -23.810 1.00 35.08  ? 443 PHE D CD1 1 
ATOM   5990 C  CD2 . PHE D 1 116 ? -34.428 27.893  -26.127 1.00 36.12  ? 443 PHE D CD2 1 
ATOM   5991 C  CE1 . PHE D 1 116 ? -33.425 27.094  -23.651 1.00 36.02  ? 443 PHE D CE1 1 
ATOM   5992 C  CE2 . PHE D 1 116 ? -33.932 26.606  -25.966 1.00 36.74  ? 443 PHE D CE2 1 
ATOM   5993 C  CZ  . PHE D 1 116 ? -33.432 26.204  -24.729 1.00 36.16  ? 443 PHE D CZ  1 
ATOM   5994 N  N   . LEU D 1 117 ? -32.478 30.440  -27.144 1.00 36.25  ? 444 LEU D N   1 
ATOM   5995 C  CA  . LEU D 1 117 ? -31.377 29.762  -27.826 1.00 37.48  ? 444 LEU D CA  1 
ATOM   5996 C  C   . LEU D 1 117 ? -30.056 30.532  -27.733 1.00 37.68  ? 444 LEU D C   1 
ATOM   5997 O  O   . LEU D 1 117 ? -28.985 29.931  -27.654 1.00 37.88  ? 444 LEU D O   1 
ATOM   5998 C  CB  . LEU D 1 117 ? -31.761 29.491  -29.284 1.00 38.57  ? 444 LEU D CB  1 
ATOM   5999 C  CG  . LEU D 1 117 ? -31.164 28.257  -29.945 1.00 40.56  ? 444 LEU D CG  1 
ATOM   6000 C  CD1 . LEU D 1 117 ? -31.827 26.992  -29.419 1.00 40.47  ? 444 LEU D CD1 1 
ATOM   6001 C  CD2 . LEU D 1 117 ? -31.332 28.367  -31.455 1.00 41.91  ? 444 LEU D CD2 1 
ATOM   6002 N  N   . GLU D 1 118 ? -30.155 31.857  -27.741 1.00 37.76  ? 445 GLU D N   1 
ATOM   6003 C  CA  . GLU D 1 118 ? -29.029 32.733  -27.516 1.00 39.39  ? 445 GLU D CA  1 
ATOM   6004 C  C   . GLU D 1 118 ? -28.465 32.519  -26.110 1.00 39.18  ? 445 GLU D C   1 
ATOM   6005 O  O   . GLU D 1 118 ? -27.244 32.451  -25.921 1.00 40.65  ? 445 GLU D O   1 
ATOM   6006 C  CB  . GLU D 1 118 ? -29.440 34.194  -27.724 1.00 41.82  ? 445 GLU D CB  1 
ATOM   6007 C  CG  . GLU D 1 118 ? -29.654 34.597  -29.180 1.00 45.44  ? 445 GLU D CG  1 
ATOM   6008 C  CD  . GLU D 1 118 ? -30.012 36.069  -29.337 1.00 49.40  ? 445 GLU D CD  1 
ATOM   6009 O  OE1 . GLU D 1 118 ? -31.088 36.366  -29.880 1.00 51.94  ? 445 GLU D OE1 1 
ATOM   6010 O  OE2 . GLU D 1 118 ? -29.234 36.951  -28.904 1.00 53.73  ? 445 GLU D OE2 1 
ATOM   6011 N  N   . LEU D 1 119 ? -29.357 32.394  -25.132 1.00 37.42  ? 446 LEU D N   1 
ATOM   6012 C  CA  . LEU D 1 119 ? -28.965 32.140  -23.761 1.00 37.04  ? 446 LEU D CA  1 
ATOM   6013 C  C   . LEU D 1 119 ? -28.341 30.758  -23.599 1.00 37.32  ? 446 LEU D C   1 
ATOM   6014 O  O   . LEU D 1 119 ? -27.316 30.613  -22.917 1.00 37.28  ? 446 LEU D O   1 
ATOM   6015 C  CB  . LEU D 1 119 ? -30.153 32.348  -22.811 1.00 37.06  ? 446 LEU D CB  1 
ATOM   6016 C  CG  . LEU D 1 119 ? -30.465 33.831  -22.632 1.00 36.94  ? 446 LEU D CG  1 
ATOM   6017 C  CD1 . LEU D 1 119 ? -31.907 34.038  -22.234 1.00 37.42  ? 446 LEU D CD1 1 
ATOM   6018 C  CD2 . LEU D 1 119 ? -29.514 34.441  -21.617 1.00 37.59  ? 446 LEU D CD2 1 
ATOM   6019 N  N   . PHE D 1 120 ? -28.936 29.756  -24.246 1.00 36.42  ? 447 PHE D N   1 
ATOM   6020 C  CA  . PHE D 1 120 ? -28.362 28.408  -24.282 1.00 37.32  ? 447 PHE D CA  1 
ATOM   6021 C  C   . PHE D 1 120 ? -26.927 28.410  -24.854 1.00 38.93  ? 447 PHE D C   1 
ATOM   6022 O  O   . PHE D 1 120 ? -26.035 27.755  -24.302 1.00 40.13  ? 447 PHE D O   1 
ATOM   6023 C  CB  . PHE D 1 120 ? -29.293 27.475  -25.068 1.00 37.59  ? 447 PHE D CB  1 
ATOM   6024 C  CG  . PHE D 1 120 ? -28.753 26.089  -25.273 1.00 38.38  ? 447 PHE D CG  1 
ATOM   6025 C  CD1 . PHE D 1 120 ? -28.986 25.087  -24.326 1.00 39.18  ? 447 PHE D CD1 1 
ATOM   6026 C  CD2 . PHE D 1 120 ? -28.051 25.769  -26.433 1.00 39.24  ? 447 PHE D CD2 1 
ATOM   6027 C  CE1 . PHE D 1 120 ? -28.500 23.793  -24.518 1.00 40.50  ? 447 PHE D CE1 1 
ATOM   6028 C  CE2 . PHE D 1 120 ? -27.559 24.485  -26.625 1.00 41.08  ? 447 PHE D CE2 1 
ATOM   6029 C  CZ  . PHE D 1 120 ? -27.785 23.496  -25.670 1.00 41.28  ? 447 PHE D CZ  1 
ATOM   6030 N  N   . VAL D 1 121 ? -26.708 29.166  -25.930 1.00 38.06  ? 448 VAL D N   1 
ATOM   6031 C  CA  . VAL D 1 121 ? -25.416 29.158  -26.628 1.00 39.61  ? 448 VAL D CA  1 
ATOM   6032 C  C   . VAL D 1 121 ? -24.358 29.937  -25.847 1.00 40.15  ? 448 VAL D C   1 
ATOM   6033 O  O   . VAL D 1 121 ? -23.197 29.506  -25.765 1.00 42.04  ? 448 VAL D O   1 
ATOM   6034 C  CB  . VAL D 1 121 ? -25.533 29.663  -28.103 1.00 40.02  ? 448 VAL D CB  1 
ATOM   6035 C  CG1 . VAL D 1 121 ? -24.178 30.008  -28.692 1.00 42.23  ? 448 VAL D CG1 1 
ATOM   6036 C  CG2 . VAL D 1 121 ? -26.209 28.619  -28.982 1.00 39.63  ? 448 VAL D CG2 1 
ATOM   6037 N  N   . LEU D 1 122 ? -24.762 31.067  -25.271 1.00 38.50  ? 449 LEU D N   1 
ATOM   6038 C  CA  . LEU D 1 122 ? -23.851 31.919  -24.518 1.00 38.73  ? 449 LEU D CA  1 
ATOM   6039 C  C   . LEU D 1 122 ? -23.341 31.230  -23.252 1.00 38.84  ? 449 LEU D C   1 
ATOM   6040 O  O   . LEU D 1 122 ? -22.129 31.132  -23.025 1.00 40.96  ? 449 LEU D O   1 
ATOM   6041 C  CB  . LEU D 1 122 ? -24.542 33.224  -24.171 1.00 37.62  ? 449 LEU D CB  1 
ATOM   6042 C  CG  . LEU D 1 122 ? -23.775 34.382  -23.557 1.00 38.16  ? 449 LEU D CG  1 
ATOM   6043 C  CD1 . LEU D 1 122 ? -22.612 34.867  -24.421 1.00 39.86  ? 449 LEU D CD1 1 
ATOM   6044 C  CD2 . LEU D 1 122 ? -24.787 35.486  -23.296 1.00 37.32  ? 449 LEU D CD2 1 
ATOM   6045 N  N   . ARG D 1 123 ? -24.271 30.738  -22.451 1.00 36.92  ? 450 ARG D N   1 
ATOM   6046 C  CA  . ARG D 1 123 ? -23.952 30.054  -21.201 1.00 37.03  ? 450 ARG D CA  1 
ATOM   6047 C  C   . ARG D 1 123 ? -23.100 28.804  -21.444 1.00 38.50  ? 450 ARG D C   1 
ATOM   6048 O  O   . ARG D 1 123 ? -22.177 28.529  -20.672 1.00 39.96  ? 450 ARG D O   1 
ATOM   6049 C  CB  . ARG D 1 123 ? -25.242 29.767  -20.403 1.00 35.46  ? 450 ARG D CB  1 
ATOM   6050 C  CG  . ARG D 1 123 ? -25.923 31.067  -19.944 1.00 34.45  ? 450 ARG D CG  1 
ATOM   6051 C  CD  . ARG D 1 123 ? -27.396 30.979  -19.597 1.00 32.93  ? 450 ARG D CD  1 
ATOM   6052 N  NE  . ARG D 1 123 ? -27.724 29.761  -18.866 1.00 34.60  ? 450 ARG D NE  1 
ATOM   6053 C  CZ  . ARG D 1 123 ? -27.774 29.637  -17.536 1.00 35.06  ? 450 ARG D CZ  1 
ATOM   6054 N  NH1 . ARG D 1 123 ? -27.539 30.661  -16.720 1.00 34.31  ? 450 ARG D NH1 1 
ATOM   6055 N  NH2 . ARG D 1 123 ? -28.083 28.458  -17.024 1.00 36.15  ? 450 ARG D NH2 1 
ATOM   6056 N  N   . LEU D 1 124 ? -23.391 28.085  -22.532 1.00 38.47  ? 451 LEU D N   1 
ATOM   6057 C  CA  . LEU D 1 124 ? -22.599 26.940  -22.965 1.00 40.64  ? 451 LEU D CA  1 
ATOM   6058 C  C   . LEU D 1 124 ? -21.201 27.369  -23.405 1.00 43.70  ? 451 LEU D C   1 
ATOM   6059 O  O   . LEU D 1 124 ? -20.197 26.719  -23.048 1.00 46.69  ? 451 LEU D O   1 
ATOM   6060 C  CB  . LEU D 1 124 ? -23.305 26.183  -24.087 1.00 40.57  ? 451 LEU D CB  1 
ATOM   6061 C  CG  . LEU D 1 124 ? -22.582 24.998  -24.737 1.00 43.15  ? 451 LEU D CG  1 
ATOM   6062 C  CD1 . LEU D 1 124 ? -22.376 23.862  -23.746 1.00 43.87  ? 451 LEU D CD1 1 
ATOM   6063 C  CD2 . LEU D 1 124 ? -23.357 24.520  -25.955 1.00 42.67  ? 451 LEU D CD2 1 
ATOM   6064 N  N   . ALA D 1 125 ? -21.129 28.468  -24.157 1.00 43.05  ? 452 ALA D N   1 
ATOM   6065 C  CA  . ALA D 1 125 ? -19.849 29.019  -24.589 1.00 44.75  ? 452 ALA D CA  1 
ATOM   6066 C  C   . ALA D 1 125 ? -18.975 29.459  -23.413 1.00 45.89  ? 452 ALA D C   1 
ATOM   6067 O  O   . ALA D 1 125 ? -17.752 29.303  -23.461 1.00 48.60  ? 452 ALA D O   1 
ATOM   6068 C  CB  . ALA D 1 125 ? -20.066 30.177  -25.541 1.00 44.11  ? 452 ALA D CB  1 
ATOM   6069 N  N   . TYR D 1 126 ? -19.606 29.992  -22.365 1.00 44.11  ? 453 TYR D N   1 
ATOM   6070 C  CA  . TYR D 1 126 ? -18.885 30.580  -21.242 1.00 45.19  ? 453 TYR D CA  1 
ATOM   6071 C  C   . TYR D 1 126 ? -18.326 29.526  -20.300 1.00 47.29  ? 453 TYR D C   1 
ATOM   6072 O  O   . TYR D 1 126 ? -17.245 29.708  -19.742 1.00 49.18  ? 453 TYR D O   1 
ATOM   6073 C  CB  . TYR D 1 126 ? -19.793 31.530  -20.475 1.00 42.66  ? 453 TYR D CB  1 
ATOM   6074 C  CG  . TYR D 1 126 ? -19.090 32.367  -19.423 1.00 43.31  ? 453 TYR D CG  1 
ATOM   6075 C  CD1 . TYR D 1 126 ? -18.024 33.220  -19.760 1.00 44.91  ? 453 TYR D CD1 1 
ATOM   6076 C  CD2 . TYR D 1 126 ? -19.506 32.325  -18.090 1.00 42.40  ? 453 TYR D CD2 1 
ATOM   6077 C  CE1 . TYR D 1 126 ? -17.393 33.997  -18.791 1.00 46.03  ? 453 TYR D CE1 1 
ATOM   6078 C  CE2 . TYR D 1 126 ? -18.892 33.099  -17.113 1.00 43.11  ? 453 TYR D CE2 1 
ATOM   6079 C  CZ  . TYR D 1 126 ? -17.834 33.926  -17.461 1.00 45.06  ? 453 TYR D CZ  1 
ATOM   6080 O  OH  . TYR D 1 126 ? -17.226 34.681  -16.488 1.00 46.13  ? 453 TYR D OH  1 
ATOM   6081 N  N   . ARG D 1 127 ? -19.072 28.426  -20.172 1.00 47.44  ? 454 ARG D N   1 
ATOM   6082 C  CA  . ARG D 1 127 ? -18.830 27.319  -19.247 1.00 48.93  ? 454 ARG D CA  1 
ATOM   6083 C  C   . ARG D 1 127 ? -17.824 26.329  -19.805 1.00 52.06  ? 454 ARG D C   1 
ATOM   6084 O  O   . ARG D 1 127 ? -16.972 25.834  -19.078 1.00 55.46  ? 454 ARG D O   1 
ATOM   6085 C  CB  . ARG D 1 127 ? -20.158 26.587  -19.063 1.00 48.06  ? 454 ARG D CB  1 
ATOM   6086 C  CG  . ARG D 1 127 ? -20.419 25.898  -17.735 1.00 49.29  ? 454 ARG D CG  1 
ATOM   6087 C  CD  . ARG D 1 127 ? -21.916 25.955  -17.424 1.00 46.81  ? 454 ARG D CD  1 
ATOM   6088 N  NE  . ARG D 1 127 ? -22.710 25.499  -18.559 1.00 46.24  ? 454 ARG D NE  1 
ATOM   6089 C  CZ  . ARG D 1 127 ? -23.936 25.913  -18.869 1.00 44.59  ? 454 ARG D CZ  1 
ATOM   6090 N  NH1 . ARG D 1 127 ? -24.579 26.798  -18.123 1.00 43.70  ? 454 ARG D NH1 1 
ATOM   6091 N  NH2 . ARG D 1 127 ? -24.532 25.427  -19.943 1.00 44.22  ? 454 ARG D NH2 1 
ATOM   6092 N  N   . SER D 1 128 ? -17.932 26.040  -21.103 1.00 52.02  ? 455 SER D N   1 
ATOM   6093 C  CA  . SER D 1 128 ? -17.193 24.954  -21.752 1.00 54.20  ? 455 SER D CA  1 
ATOM   6094 C  C   . SER D 1 128 ? -15.686 25.161  -21.792 1.00 57.28  ? 455 SER D C   1 
ATOM   6095 O  O   . SER D 1 128 ? -15.173 26.208  -21.400 1.00 56.90  ? 455 SER D O   1 
ATOM   6096 C  CB  . SER D 1 128 ? -17.711 24.761  -23.183 1.00 53.51  ? 455 SER D CB  1 
ATOM   6097 O  OG  . SER D 1 128 ? -19.028 24.266  -23.180 1.00 50.93  ? 455 SER D OG  1 
ATOM   6098 N  N   . ASN D 1 129 ? -14.994 24.141  -22.285 1.00 60.73  ? 456 ASN D N   1 
ATOM   6099 C  CA  . ASN D 1 129 ? -13.552 24.154  -22.469 1.00 64.49  ? 456 ASN D CA  1 
ATOM   6100 C  C   . ASN D 1 129 ? -13.269 23.982  -23.970 1.00 66.03  ? 456 ASN D C   1 
ATOM   6101 O  O   . ASN D 1 129 ? -13.046 22.847  -24.427 1.00 68.32  ? 456 ASN D O   1 
ATOM   6102 C  CB  . ASN D 1 129 ? -12.920 23.024  -21.650 1.00 67.55  ? 456 ASN D CB  1 
ATOM   6103 C  CG  . ASN D 1 129 ? -11.439 23.238  -21.384 1.00 71.55  ? 456 ASN D CG  1 
ATOM   6104 O  OD1 . ASN D 1 129 ? -10.749 23.976  -22.095 1.00 72.63  ? 456 ASN D OD1 1 
ATOM   6105 N  ND2 . ASN D 1 129 ? -10.943 22.580  -20.345 1.00 73.92  ? 456 ASN D ND2 1 
ATOM   6106 N  N   . PRO D 1 130 ? -13.306 25.102  -24.746 1.00 64.91  ? 457 PRO D N   1 
ATOM   6107 C  CA  . PRO D 1 130 ? -13.141 25.003  -26.206 1.00 66.90  ? 457 PRO D CA  1 
ATOM   6108 C  C   . PRO D 1 130 ? -11.817 24.374  -26.661 1.00 72.37  ? 457 PRO D C   1 
ATOM   6109 O  O   . PRO D 1 130 ? -11.805 23.674  -27.675 1.00 73.91  ? 457 PRO D O   1 
ATOM   6110 C  CB  . PRO D 1 130 ? -13.260 26.460  -26.695 1.00 65.38  ? 457 PRO D CB  1 
ATOM   6111 C  CG  . PRO D 1 130 ? -13.192 27.327  -25.475 1.00 63.51  ? 457 PRO D CG  1 
ATOM   6112 C  CD  . PRO D 1 130 ? -13.645 26.485  -24.331 1.00 62.15  ? 457 PRO D CD  1 
ATOM   6113 N  N   . VAL D 1 131 ? -10.743 24.613  -25.897 1.00 75.57  ? 458 VAL D N   1 
ATOM   6114 C  CA  . VAL D 1 131 ? -9.382  24.130  -26.204 1.00 81.56  ? 458 VAL D CA  1 
ATOM   6115 C  C   . VAL D 1 131 ? -9.263  22.599  -26.173 1.00 84.59  ? 458 VAL D C   1 
ATOM   6116 O  O   . VAL D 1 131 ? -8.486  22.022  -26.945 1.00 88.73  ? 458 VAL D O   1 
ATOM   6117 C  CB  . VAL D 1 131 ? -8.289  24.726  -25.269 1.00 83.81  ? 458 VAL D CB  1 
ATOM   6118 C  CG1 . VAL D 1 131 ? -7.043  25.046  -26.074 1.00 88.39  ? 458 VAL D CG1 1 
ATOM   6119 C  CG2 . VAL D 1 131 ? -8.760  25.982  -24.544 1.00 80.54  ? 458 VAL D CG2 1 
ATOM   6120 N  N   . GLU D 1 132 ? -10.034 21.962  -25.284 1.00 83.01  ? 459 GLU D N   1 
ATOM   6121 C  CA  . GLU D 1 132 ? -10.051 20.499  -25.126 1.00 85.91  ? 459 GLU D CA  1 
ATOM   6122 C  C   . GLU D 1 132 ? -11.252 19.835  -25.803 1.00 83.90  ? 459 GLU D C   1 
ATOM   6123 O  O   . GLU D 1 132 ? -11.520 18.646  -25.588 1.00 85.98  ? 459 GLU D O   1 
ATOM   6124 C  CB  . GLU D 1 132 ? -10.031 20.123  -23.645 1.00 86.28  ? 459 GLU D CB  1 
ATOM   6125 C  CG  . GLU D 1 132 ? -8.772  20.559  -22.916 1.00 90.24  ? 459 GLU D CG  1 
ATOM   6126 C  CD  . GLU D 1 132 ? -8.594  19.862  -21.584 1.00 92.11  ? 459 GLU D CD  1 
ATOM   6127 O  OE1 . GLU D 1 132 ? -9.528  19.918  -20.745 1.00 89.21  ? 459 GLU D OE1 1 
ATOM   6128 O  OE2 . GLU D 1 132 ? -7.513  19.268  -21.381 1.00 96.73  ? 459 GLU D OE2 1 
ATOM   6129 N  N   . GLY D 1 133 ? -11.974 20.610  -26.611 1.00 80.31  ? 460 GLY D N   1 
ATOM   6130 C  CA  . GLY D 1 133 ? -13.176 20.140  -27.291 1.00 77.74  ? 460 GLY D CA  1 
ATOM   6131 C  C   . GLY D 1 133 ? -14.337 19.776  -26.379 1.00 74.25  ? 460 GLY D C   1 
ATOM   6132 O  O   . GLY D 1 133 ? -15.280 19.116  -26.831 1.00 73.13  ? 460 GLY D O   1 
ATOM   6133 N  N   . LYS D 1 134 ? -14.273 20.217  -25.113 1.00 72.28  ? 461 LYS D N   1 
ATOM   6134 C  CA  . LYS D 1 134 ? -15.271 19.882  -24.085 1.00 69.13  ? 461 LYS D CA  1 
ATOM   6135 C  C   . LYS D 1 134 ? -16.412 20.896  -24.046 1.00 64.00  ? 461 LYS D C   1 
ATOM   6136 O  O   . LYS D 1 134 ? -16.195 22.065  -23.721 1.00 62.46  ? 461 LYS D O   1 
ATOM   6137 C  CB  . LYS D 1 134 ? -14.626 19.785  -22.692 1.00 70.62  ? 461 LYS D CB  1 
ATOM   6138 C  CG  . LYS D 1 134 ? -13.537 18.736  -22.568 1.00 76.21  ? 461 LYS D CG  1 
ATOM   6139 C  CD  . LYS D 1 134 ? -12.942 18.676  -21.168 1.00 77.89  ? 461 LYS D CD  1 
ATOM   6140 C  CE  . LYS D 1 134 ? -11.939 17.535  -21.085 1.00 83.80  ? 461 LYS D CE  1 
ATOM   6141 N  NZ  . LYS D 1 134 ? -11.424 17.348  -19.705 1.00 85.91  ? 461 LYS D NZ  1 
ATOM   6142 N  N   . LEU D 1 135 ? -17.618 20.445  -24.386 1.00 61.38  ? 462 LEU D N   1 
ATOM   6143 C  CA  . LEU D 1 135 ? -18.832 21.215  -24.128 1.00 56.93  ? 462 LEU D CA  1 
ATOM   6144 C  C   . LEU D 1 135 ? -19.412 20.768  -22.817 1.00 55.77  ? 462 LEU D C   1 
ATOM   6145 O  O   . LEU D 1 135 ? -19.490 19.573  -22.542 1.00 57.33  ? 462 LEU D O   1 
ATOM   6146 C  CB  . LEU D 1 135 ? -19.865 21.054  -25.238 1.00 55.84  ? 462 LEU D CB  1 
ATOM   6147 C  CG  . LEU D 1 135 ? -19.397 21.626  -26.573 1.00 56.76  ? 462 LEU D CG  1 
ATOM   6148 C  CD1 . LEU D 1 135 ? -19.153 20.459  -27.519 1.00 60.20  ? 462 LEU D CD1 1 
ATOM   6149 C  CD2 . LEU D 1 135 ? -20.400 22.619  -27.156 1.00 53.21  ? 462 LEU D CD2 1 
ATOM   6150 N  N   . ILE D 1 136 ? -19.802 21.749  -22.012 1.00 53.25  ? 463 ILE D N   1 
ATOM   6151 C  CA  . ILE D 1 136 ? -20.288 21.534  -20.649 1.00 53.01  ? 463 ILE D CA  1 
ATOM   6152 C  C   . ILE D 1 136 ? -21.690 22.147  -20.539 1.00 50.39  ? 463 ILE D C   1 
ATOM   6153 O  O   . ILE D 1 136 ? -21.875 23.368  -20.514 1.00 47.83  ? 463 ILE D O   1 
ATOM   6154 C  CB  . ILE D 1 136 ? -19.303 22.086  -19.573 1.00 53.02  ? 463 ILE D CB  1 
ATOM   6155 C  CG1 . ILE D 1 136 ? -17.949 21.369  -19.652 1.00 56.92  ? 463 ILE D CG1 1 
ATOM   6156 C  CG2 . ILE D 1 136 ? -19.915 21.989  -18.184 1.00 51.76  ? 463 ILE D CG2 1 
ATOM   6157 C  CD1 . ILE D 1 136 ? -16.833 21.948  -18.780 1.00 58.86  ? 463 ILE D CD1 1 
ATOM   6158 N  N   . PHE D 1 137 ? -22.681 21.273  -20.486 1.00 51.91  ? 464 PHE D N   1 
ATOM   6159 C  CA  . PHE D 1 137 ? -24.061 21.703  -20.560 1.00 50.84  ? 464 PHE D CA  1 
ATOM   6160 C  C   . PHE D 1 137 ? -24.538 22.068  -19.160 1.00 52.84  ? 464 PHE D C   1 
ATOM   6161 O  O   . PHE D 1 137 ? -23.754 21.970  -18.191 1.00 54.82  ? 464 PHE D O   1 
ATOM   6162 C  CB  . PHE D 1 137 ? -24.899 20.638  -21.275 1.00 50.40  ? 464 PHE D CB  1 
ATOM   6163 C  CG  . PHE D 1 137 ? -24.502 20.441  -22.717 1.00 50.10  ? 464 PHE D CG  1 
ATOM   6164 C  CD1 . PHE D 1 137 ? -25.106 21.189  -23.727 1.00 48.11  ? 464 PHE D CD1 1 
ATOM   6165 C  CD2 . PHE D 1 137 ? -23.499 19.535  -23.068 1.00 52.80  ? 464 PHE D CD2 1 
ATOM   6166 C  CE1 . PHE D 1 137 ? -24.731 21.028  -25.054 1.00 48.38  ? 464 PHE D CE1 1 
ATOM   6167 C  CE2 . PHE D 1 137 ? -23.122 19.367  -24.397 1.00 53.87  ? 464 PHE D CE2 1 
ATOM   6168 C  CZ  . PHE D 1 137 ? -23.740 20.114  -25.391 1.00 51.36  ? 464 PHE D CZ  1 
ATOM   6169 N  N   . CYS D 1 138 ? -25.783 22.522  -19.042 1.00 53.01  ? 465 CYS D N   1 
ATOM   6170 C  CA  . CYS D 1 138 ? -26.218 23.171  -17.807 1.00 56.23  ? 465 CYS D CA  1 
ATOM   6171 C  C   . CYS D 1 138 ? -26.565 22.237  -16.640 1.00 58.09  ? 465 CYS D C   1 
ATOM   6172 O  O   . CYS D 1 138 ? -26.651 22.684  -15.495 1.00 58.88  ? 465 CYS D O   1 
ATOM   6173 C  CB  . CYS D 1 138 ? -27.359 24.150  -18.078 1.00 57.20  ? 465 CYS D CB  1 
ATOM   6174 S  SG  . CYS D 1 138 ? -28.943 23.321  -18.082 1.00 65.09  ? 465 CYS D SG  1 
ATOM   6175 N  N   . ASN D 1 139 ? -26.774 20.956  -16.936 1.00 59.68  ? 466 ASN D N   1 
ATOM   6176 C  CA  . ASN D 1 139 ? -26.972 19.936  -15.911 1.00 61.11  ? 466 ASN D CA  1 
ATOM   6177 C  C   . ASN D 1 139 ? -25.637 19.357  -15.428 1.00 63.48  ? 466 ASN D C   1 
ATOM   6178 O  O   . ASN D 1 139 ? -25.609 18.497  -14.524 1.00 65.94  ? 466 ASN D O   1 
ATOM   6179 C  CB  . ASN D 1 139 ? -27.896 18.823  -16.425 1.00 63.89  ? 466 ASN D CB  1 
ATOM   6180 C  CG  . ASN D 1 139 ? -27.327 18.071  -17.632 1.00 66.92  ? 466 ASN D CG  1 
ATOM   6181 O  OD1 . ASN D 1 139 ? -26.487 18.582  -18.379 1.00 67.91  ? 466 ASN D OD1 1 
ATOM   6182 N  ND2 . ASN D 1 139 ? -27.805 16.849  -17.833 1.00 69.20  ? 466 ASN D ND2 1 
ATOM   6183 N  N   . GLY D 1 140 ? -24.542 19.824  -16.038 1.00 61.48  ? 467 GLY D N   1 
ATOM   6184 C  CA  . GLY D 1 140 ? -23.187 19.372  -15.714 1.00 62.51  ? 467 GLY D CA  1 
ATOM   6185 C  C   . GLY D 1 140 ? -22.579 18.323  -16.634 1.00 63.98  ? 467 GLY D C   1 
ATOM   6186 O  O   . GLY D 1 140 ? -21.390 18.017  -16.518 1.00 66.53  ? 467 GLY D O   1 
ATOM   6187 N  N   . VAL D 1 141 ? -23.388 17.773  -17.541 1.00 62.83  ? 468 VAL D N   1 
ATOM   6188 C  CA  . VAL D 1 141 ? -22.935 16.809  -18.568 1.00 64.05  ? 468 VAL D CA  1 
ATOM   6189 C  C   . VAL D 1 141 ? -21.849 17.409  -19.478 1.00 62.99  ? 468 VAL D C   1 
ATOM   6190 O  O   . VAL D 1 141 ? -22.034 18.498  -20.047 1.00 59.83  ? 468 VAL D O   1 
ATOM   6191 C  CB  . VAL D 1 141 ? -24.138 16.265  -19.387 1.00 63.23  ? 468 VAL D CB  1 
ATOM   6192 C  CG1 . VAL D 1 141 ? -23.704 15.649  -20.710 1.00 64.63  ? 468 VAL D CG1 1 
ATOM   6193 C  CG2 . VAL D 1 141 ? -24.896 15.234  -18.565 1.00 65.76  ? 468 VAL D CG2 1 
ATOM   6194 N  N   . VAL D 1 142 ? -20.716 16.710  -19.567 1.00 65.25  ? 469 VAL D N   1 
ATOM   6195 C  CA  . VAL D 1 142 ? -19.602 17.095  -20.444 1.00 65.76  ? 469 VAL D CA  1 
ATOM   6196 C  C   . VAL D 1 142 ? -19.587 16.169  -21.664 1.00 67.45  ? 469 VAL D C   1 
ATOM   6197 O  O   . VAL D 1 142 ? -19.625 14.941  -21.525 1.00 69.96  ? 469 VAL D O   1 
ATOM   6198 C  CB  . VAL D 1 142 ? -18.214 17.073  -19.724 1.00 68.94  ? 469 VAL D CB  1 
ATOM   6199 C  CG1 . VAL D 1 142 ? -17.125 17.702  -20.594 1.00 69.34  ? 469 VAL D CG1 1 
ATOM   6200 C  CG2 . VAL D 1 142 ? -18.258 17.789  -18.373 1.00 67.84  ? 469 VAL D CG2 1 
ATOM   6201 N  N   . LEU D 1 143 ? -19.546 16.766  -22.854 1.00 65.89  ? 470 LEU D N   1 
ATOM   6202 C  CA  . LEU D 1 143 ? -19.446 16.013  -24.109 1.00 68.15  ? 470 LEU D CA  1 
ATOM   6203 C  C   . LEU D 1 143 ? -18.397 16.616  -25.032 1.00 69.84  ? 470 LEU D C   1 
ATOM   6204 O  O   . LEU D 1 143 ? -18.140 17.819  -24.971 1.00 68.35  ? 470 LEU D O   1 
ATOM   6205 C  CB  . LEU D 1 143 ? -20.799 15.964  -24.826 1.00 64.96  ? 470 LEU D CB  1 
ATOM   6206 C  CG  . LEU D 1 143 ? -22.005 15.310  -24.141 1.00 63.95  ? 470 LEU D CG  1 
ATOM   6207 C  CD1 . LEU D 1 143 ? -23.240 15.495  -25.003 1.00 61.10  ? 470 LEU D CD1 1 
ATOM   6208 C  CD2 . LEU D 1 143 ? -21.782 13.830  -23.833 1.00 67.94  ? 470 LEU D CD2 1 
ATOM   6209 N  N   . HIS D 1 144 ? -17.791 15.784  -25.879 1.00 73.91  ? 471 HIS D N   1 
ATOM   6210 C  CA  . HIS D 1 144 ? -16.827 16.270  -26.868 1.00 75.74  ? 471 HIS D CA  1 
ATOM   6211 C  C   . HIS D 1 144 ? -17.512 16.874  -28.098 1.00 73.02  ? 471 HIS D C   1 
ATOM   6212 O  O   . HIS D 1 144 ? -18.595 16.447  -28.492 1.00 70.71  ? 471 HIS D O   1 
ATOM   6213 C  CB  . HIS D 1 144 ? -15.838 15.175  -27.283 1.00 81.86  ? 471 HIS D CB  1 
ATOM   6214 C  CG  . HIS D 1 144 ? -14.572 15.702  -27.893 1.00 85.22  ? 471 HIS D CG  1 
ATOM   6215 N  ND1 . HIS D 1 144 ? -14.469 16.042  -29.227 1.00 85.99  ? 471 HIS D ND1 1 
ATOM   6216 C  CD2 . HIS D 1 144 ? -13.358 15.955  -27.349 1.00 88.05  ? 471 HIS D CD2 1 
ATOM   6217 C  CE1 . HIS D 1 144 ? -13.247 16.478  -29.477 1.00 88.79  ? 471 HIS D CE1 1 
ATOM   6218 N  NE2 . HIS D 1 144 ? -12.552 16.434  -28.355 1.00 90.29  ? 471 HIS D NE2 1 
ATOM   6219 N  N   . ARG D 1 145 ? -16.852 17.879  -28.672 1.00 73.35  ? 472 ARG D N   1 
ATOM   6220 C  CA  . ARG D 1 145 ? -17.201 18.513  -29.944 1.00 72.71  ? 472 ARG D CA  1 
ATOM   6221 C  C   . ARG D 1 145 ? -17.604 17.506  -31.038 1.00 74.59  ? 472 ARG D C   1 
ATOM   6222 O  O   . ARG D 1 145 ? -18.592 17.721  -31.750 1.00 72.07  ? 472 ARG D O   1 
ATOM   6223 C  CB  . ARG D 1 145 ? -16.015 19.380  -30.395 1.00 75.33  ? 472 ARG D CB  1 
ATOM   6224 C  CG  . ARG D 1 145 ? -16.225 20.207  -31.656 1.00 75.58  ? 472 ARG D CG  1 
ATOM   6225 C  CD  . ARG D 1 145 ? -14.980 21.007  -32.028 1.00 78.75  ? 472 ARG D CD  1 
ATOM   6226 N  NE  . ARG D 1 145 ? -13.763 20.182  -32.089 1.00 85.18  ? 472 ARG D NE  1 
ATOM   6227 C  CZ  . ARG D 1 145 ? -13.346 19.483  -33.152 1.00 89.00  ? 472 ARG D CZ  1 
ATOM   6228 N  NH1 . ARG D 1 145 ? -14.039 19.482  -34.290 1.00 88.55  ? 472 ARG D NH1 1 
ATOM   6229 N  NH2 . ARG D 1 145 ? -12.222 18.774  -33.074 1.00 93.39  ? 472 ARG D NH2 1 
ATOM   6230 N  N   . LEU D 1 146 ? -16.835 16.420  -31.148 1.00 78.38  ? 473 LEU D N   1 
ATOM   6231 C  CA  . LEU D 1 146 ? -17.104 15.320  -32.081 1.00 80.75  ? 473 LEU D CA  1 
ATOM   6232 C  C   . LEU D 1 146 ? -18.344 14.489  -31.721 1.00 79.03  ? 473 LEU D C   1 
ATOM   6233 O  O   . LEU D 1 146 ? -19.009 13.956  -32.615 1.00 78.89  ? 473 LEU D O   1 
ATOM   6234 C  CB  . LEU D 1 146 ? -15.862 14.415  -32.213 1.00 86.09  ? 473 LEU D CB  1 
ATOM   6235 C  CG  . LEU D 1 146 ? -14.881 14.520  -33.398 1.00 89.66  ? 473 LEU D CG  1 
ATOM   6236 C  CD1 . LEU D 1 146 ? -14.442 15.942  -33.740 1.00 88.06  ? 473 LEU D CD1 1 
ATOM   6237 C  CD2 . LEU D 1 146 ? -13.659 13.651  -33.123 1.00 95.15  ? 473 LEU D CD2 1 
ATOM   6238 N  N   . GLN D 1 147 ? -18.640 14.378  -30.421 1.00 77.95  ? 474 GLN D N   1 
ATOM   6239 C  CA  . GLN D 1 147 ? -19.832 13.661  -29.923 1.00 76.63  ? 474 GLN D CA  1 
ATOM   6240 C  C   . GLN D 1 147 ? -21.125 14.427  -30.177 1.00 72.09  ? 474 GLN D C   1 
ATOM   6241 O  O   . GLN D 1 147 ? -22.204 13.833  -30.222 1.00 71.37  ? 474 GLN D O   1 
ATOM   6242 C  CB  . GLN D 1 147 ? -19.729 13.395  -28.421 1.00 76.24  ? 474 GLN D CB  1 
ATOM   6243 C  CG  . GLN D 1 147 ? -18.818 12.251  -28.019 1.00 80.76  ? 474 GLN D CG  1 
ATOM   6244 C  CD  . GLN D 1 147 ? -18.765 12.072  -26.514 1.00 80.39  ? 474 GLN D CD  1 
ATOM   6245 O  OE1 . GLN D 1 147 ? -18.431 13.000  -25.771 1.00 77.84  ? 474 GLN D OE1 1 
ATOM   6246 N  NE2 . GLN D 1 147 ? -19.090 10.872  -26.057 1.00 83.23  ? 474 GLN D NE2 1 
ATOM   6247 N  N   . CYS D 1 148 ? -21.007 15.745  -30.310 1.00 69.69  ? 475 CYS D N   1 
ATOM   6248 C  CA  . CYS D 1 148 ? -22.151 16.611  -30.529 1.00 66.99  ? 475 CYS D CA  1 
ATOM   6249 C  C   . CYS D 1 148 ? -22.521 16.769  -32.016 1.00 67.91  ? 475 CYS D C   1 
ATOM   6250 O  O   . CYS D 1 148 ? -23.621 17.235  -32.336 1.00 65.04  ? 475 CYS D O   1 
ATOM   6251 C  CB  . CYS D 1 148 ? -21.883 17.972  -29.891 1.00 64.65  ? 475 CYS D CB  1 
ATOM   6252 S  SG  . CYS D 1 148 ? -21.904 17.948  -28.078 1.00 63.81  ? 475 CYS D SG  1 
ATOM   6253 N  N   . VAL D 1 149 ? -21.609 16.346  -32.900 1.00 71.45  ? 476 VAL D N   1 
ATOM   6254 C  CA  . VAL D 1 149 ? -21.653 16.662  -34.332 1.00 72.57  ? 476 VAL D CA  1 
ATOM   6255 C  C   . VAL D 1 149 ? -22.877 16.132  -35.084 1.00 72.67  ? 476 VAL D C   1 
ATOM   6256 O  O   . VAL D 1 149 ? -23.420 16.836  -35.931 1.00 72.43  ? 476 VAL D O   1 
ATOM   6257 C  CB  . VAL D 1 149 ? -20.312 16.319  -35.052 1.00 77.21  ? 476 VAL D CB  1 
ATOM   6258 C  CG1 . VAL D 1 149 ? -20.257 14.866  -35.527 1.00 80.46  ? 476 VAL D CG1 1 
ATOM   6259 C  CG2 . VAL D 1 149 ? -20.067 17.272  -36.216 1.00 77.24  ? 476 VAL D CG2 1 
ATOM   6260 N  N   . ARG D 1 150 ? -23.311 14.912  -34.761 1.00 74.12  ? 477 ARG D N   1 
ATOM   6261 C  CA  . ARG D 1 150 ? -24.399 14.266  -35.500 1.00 74.09  ? 477 ARG D CA  1 
ATOM   6262 C  C   . ARG D 1 150 ? -25.782 14.785  -35.109 1.00 69.66  ? 477 ARG D C   1 
ATOM   6263 O  O   . ARG D 1 150 ? -26.717 14.685  -35.899 1.00 70.04  ? 477 ARG D O   1 
ATOM   6264 C  CB  . ARG D 1 150 ? -24.331 12.735  -35.391 1.00 78.25  ? 477 ARG D CB  1 
ATOM   6265 C  CG  . ARG D 1 150 ? -24.766 12.026  -36.671 1.00 81.31  ? 477 ARG D CG  1 
ATOM   6266 C  CD  . ARG D 1 150 ? -25.011 10.534  -36.483 1.00 85.09  ? 477 ARG D CD  1 
ATOM   6267 N  NE  . ARG D 1 150 ? -23.775 9.755   -36.369 1.00 89.45  ? 477 ARG D NE  1 
ATOM   6268 C  CZ  . ARG D 1 150 ? -23.712 8.425   -36.334 1.00 93.48  ? 477 ARG D CZ  1 
ATOM   6269 N  NH1 . ARG D 1 150 ? -24.814 7.689   -36.407 1.00 93.65  ? 477 ARG D NH1 1 
ATOM   6270 N  NH2 . ARG D 1 150 ? -22.534 7.824   -36.236 1.00 97.99  ? 477 ARG D NH2 1 
ATOM   6271 N  N   . GLY D 1 151 ? -25.900 15.341  -33.905 1.00 66.63  ? 478 GLY D N   1 
ATOM   6272 C  CA  . GLY D 1 151 ? -27.171 15.881  -33.393 1.00 62.47  ? 478 GLY D CA  1 
ATOM   6273 C  C   . GLY D 1 151 ? -27.349 17.377  -33.580 1.00 58.85  ? 478 GLY D C   1 
ATOM   6274 O  O   . GLY D 1 151 ? -28.423 17.835  -33.988 1.00 57.29  ? 478 GLY D O   1 
ATOM   6275 N  N   . PHE D 1 152 ? -26.299 18.134  -33.268 1.00 58.26  ? 479 PHE D N   1 
ATOM   6276 C  CA  . PHE D 1 152 ? -26.286 19.598  -33.430 1.00 56.46  ? 479 PHE D CA  1 
ATOM   6277 C  C   . PHE D 1 152 ? -26.030 20.010  -34.891 1.00 57.71  ? 479 PHE D C   1 
ATOM   6278 O  O   . PHE D 1 152 ? -26.354 21.135  -35.295 1.00 55.90  ? 479 PHE D O   1 
ATOM   6279 C  CB  . PHE D 1 152 ? -25.196 20.241  -32.543 1.00 55.43  ? 479 PHE D CB  1 
ATOM   6280 C  CG  . PHE D 1 152 ? -25.505 20.256  -31.061 1.00 53.70  ? 479 PHE D CG  1 
ATOM   6281 C  CD1 . PHE D 1 152 ? -25.776 21.464  -30.412 1.00 50.85  ? 479 PHE D CD1 1 
ATOM   6282 C  CD2 . PHE D 1 152 ? -25.457 19.077  -30.293 1.00 54.90  ? 479 PHE D CD2 1 
ATOM   6283 C  CE1 . PHE D 1 152 ? -26.038 21.493  -29.046 1.00 50.08  ? 479 PHE D CE1 1 
ATOM   6284 C  CE2 . PHE D 1 152 ? -25.714 19.100  -28.926 1.00 53.70  ? 479 PHE D CE2 1 
ATOM   6285 C  CZ  . PHE D 1 152 ? -26.007 20.310  -28.301 1.00 51.42  ? 479 PHE D CZ  1 
ATOM   6286 N  N   . GLY D 1 153 ? -25.419 19.106  -35.661 1.00 61.14  ? 480 GLY D N   1 
ATOM   6287 C  CA  . GLY D 1 153 ? -24.919 19.419  -36.997 1.00 63.21  ? 480 GLY D CA  1 
ATOM   6288 C  C   . GLY D 1 153 ? -23.659 20.268  -36.915 1.00 64.37  ? 480 GLY D C   1 
ATOM   6289 O  O   . GLY D 1 153 ? -23.056 20.395  -35.838 1.00 64.01  ? 480 GLY D O   1 
ATOM   6290 N  N   . GLU D 1 154 ? -23.285 20.864  -38.050 1.00 65.63  ? 481 GLU D N   1 
ATOM   6291 C  CA  . GLU D 1 154 ? -22.122 21.765  -38.192 1.00 67.26  ? 481 GLU D CA  1 
ATOM   6292 C  C   . GLU D 1 154 ? -22.077 22.881  -37.137 1.00 63.40  ? 481 GLU D C   1 
ATOM   6293 O  O   . GLU D 1 154 ? -21.024 23.473  -36.881 1.00 64.52  ? 481 GLU D O   1 
ATOM   6294 C  CB  . GLU D 1 154 ? -22.139 22.388  -39.600 1.00 70.32  ? 481 GLU D CB  1 
ATOM   6295 C  CG  . GLU D 1 154 ? -20.852 23.086  -40.036 1.00 74.48  ? 481 GLU D CG  1 
ATOM   6296 C  CD  . GLU D 1 154 ? -21.105 24.335  -40.876 1.00 75.02  ? 481 GLU D CD  1 
ATOM   6297 O  OE1 . GLU D 1 154 ? -20.402 24.508  -41.903 1.00 78.41  ? 481 GLU D OE1 1 
ATOM   6298 O  OE2 . GLU D 1 154 ? -21.999 25.143  -40.516 1.00 71.52  ? 481 GLU D OE2 1 
ATOM   6299 N  N   . TRP D 1 155 ? -23.230 23.133  -36.528 1.00 58.73  ? 482 TRP D N   1 
ATOM   6300 C  CA  . TRP D 1 155 ? -23.452 24.234  -35.602 1.00 55.69  ? 482 TRP D CA  1 
ATOM   6301 C  C   . TRP D 1 155 ? -22.540 24.269  -34.355 1.00 56.61  ? 482 TRP D C   1 
ATOM   6302 O  O   . TRP D 1 155 ? -22.068 25.355  -33.992 1.00 55.95  ? 482 TRP D O   1 
ATOM   6303 C  CB  . TRP D 1 155 ? -24.929 24.265  -35.222 1.00 50.54  ? 482 TRP D CB  1 
ATOM   6304 C  CG  . TRP D 1 155 ? -25.362 25.422  -34.379 1.00 47.02  ? 482 TRP D CG  1 
ATOM   6305 C  CD1 . TRP D 1 155 ? -24.954 26.731  -34.480 1.00 46.50  ? 482 TRP D CD1 1 
ATOM   6306 C  CD2 . TRP D 1 155 ? -26.348 25.389  -33.336 1.00 43.35  ? 482 TRP D CD2 1 
ATOM   6307 N  NE1 . TRP D 1 155 ? -25.610 27.501  -33.549 1.00 43.34  ? 482 TRP D NE1 1 
ATOM   6308 C  CE2 . TRP D 1 155 ? -26.469 26.704  -32.834 1.00 41.68  ? 482 TRP D CE2 1 
ATOM   6309 C  CE3 . TRP D 1 155 ? -27.134 24.373  -32.776 1.00 42.43  ? 482 TRP D CE3 1 
ATOM   6310 C  CZ2 . TRP D 1 155 ? -27.348 27.032  -31.789 1.00 39.85  ? 482 TRP D CZ2 1 
ATOM   6311 C  CZ3 . TRP D 1 155 ? -28.012 24.697  -31.734 1.00 40.86  ? 482 TRP D CZ3 1 
ATOM   6312 C  CH2 . TRP D 1 155 ? -28.105 26.017  -31.247 1.00 39.34  ? 482 TRP D CH2 1 
ATOM   6313 N  N   . ILE D 1 156 ? -22.274 23.110  -33.725 1.00 58.23  ? 483 ILE D N   1 
ATOM   6314 C  CA  . ILE D 1 156 ? -21.358 23.072  -32.553 1.00 59.39  ? 483 ILE D CA  1 
ATOM   6315 C  C   . ILE D 1 156 ? -19.971 23.588  -32.873 1.00 61.82  ? 483 ILE D C   1 
ATOM   6316 O  O   . ILE D 1 156 ? -19.349 24.206  -32.011 1.00 61.91  ? 483 ILE D O   1 
ATOM   6317 C  CB  . ILE D 1 156 ? -21.203 21.703  -31.824 1.00 61.21  ? 483 ILE D CB  1 
ATOM   6318 C  CG1 . ILE D 1 156 ? -21.525 20.520  -32.734 1.00 63.61  ? 483 ILE D CG1 1 
ATOM   6319 C  CG2 . ILE D 1 156 ? -21.994 21.680  -30.516 1.00 59.20  ? 483 ILE D CG2 1 
ATOM   6320 C  CD1 . ILE D 1 156 ? -20.351 20.058  -33.566 1.00 67.96  ? 483 ILE D CD1 1 
ATOM   6321 N  N   . ASP D 1 157 ? -19.505 23.353  -34.103 1.00 63.82  ? 484 ASP D N   1 
ATOM   6322 C  CA  . ASP D 1 157 ? -18.240 23.914  -34.573 1.00 66.51  ? 484 ASP D CA  1 
ATOM   6323 C  C   . ASP D 1 157 ? -18.277 25.442  -34.495 1.00 64.46  ? 484 ASP D C   1 
ATOM   6324 O  O   . ASP D 1 157 ? -17.314 26.063  -34.044 1.00 66.23  ? 484 ASP D O   1 
ATOM   6325 C  CB  . ASP D 1 157 ? -17.926 23.454  -36.002 1.00 70.02  ? 484 ASP D CB  1 
ATOM   6326 C  CG  . ASP D 1 157 ? -17.412 22.021  -36.076 1.00 73.03  ? 484 ASP D CG  1 
ATOM   6327 O  OD1 . ASP D 1 157 ? -17.793 21.173  -35.239 1.00 71.85  ? 484 ASP D OD1 1 
ATOM   6328 O  OD2 . ASP D 1 157 ? -16.621 21.742  -37.000 1.00 77.04  ? 484 ASP D OD2 1 
ATOM   6329 N  N   . SER D 1 158 ? -19.403 26.029  -34.903 1.00 61.16  ? 485 SER D N   1 
ATOM   6330 C  CA  . SER D 1 158 ? -19.629 27.471  -34.797 1.00 58.88  ? 485 SER D CA  1 
ATOM   6331 C  C   . SER D 1 158 ? -19.765 27.924  -33.343 1.00 55.67  ? 485 SER D C   1 
ATOM   6332 O  O   . SER D 1 158 ? -19.319 29.013  -32.996 1.00 55.61  ? 485 SER D O   1 
ATOM   6333 C  CB  . SER D 1 158 ? -20.877 27.870  -35.582 1.00 57.34  ? 485 SER D CB  1 
ATOM   6334 O  OG  . SER D 1 158 ? -20.682 27.745  -36.977 1.00 60.41  ? 485 SER D OG  1 
ATOM   6335 N  N   . ILE D 1 159 ? -20.394 27.088  -32.517 1.00 52.66  ? 486 ILE D N   1 
ATOM   6336 C  CA  . ILE D 1 159 ? -20.498 27.310  -31.074 1.00 50.41  ? 486 ILE D CA  1 
ATOM   6337 C  C   . ILE D 1 159 ? -19.119 27.298  -30.382 1.00 52.61  ? 486 ILE D C   1 
ATOM   6338 O  O   . ILE D 1 159 ? -18.773 28.241  -29.669 1.00 52.40  ? 486 ILE D O   1 
ATOM   6339 C  CB  . ILE D 1 159 ? -21.471 26.301  -30.422 1.00 47.93  ? 486 ILE D CB  1 
ATOM   6340 C  CG1 . ILE D 1 159 ? -22.916 26.576  -30.895 1.00 45.44  ? 486 ILE D CG1 1 
ATOM   6341 C  CG2 . ILE D 1 159 ? -21.355 26.336  -28.897 1.00 46.48  ? 486 ILE D CG2 1 
ATOM   6342 C  CD1 . ILE D 1 159 ? -23.864 25.399  -30.755 1.00 44.36  ? 486 ILE D CD1 1 
ATOM   6343 N  N   . VAL D 1 160 ? -18.357 26.226  -30.600 1.00 54.98  ? 487 VAL D N   1 
ATOM   6344 C  CA  . VAL D 1 160 ? -16.978 26.082  -30.125 1.00 58.28  ? 487 VAL D CA  1 
ATOM   6345 C  C   . VAL D 1 160 ? -16.097 27.273  -30.557 1.00 60.39  ? 487 VAL D C   1 
ATOM   6346 O  O   . VAL D 1 160 ? -15.356 27.820  -29.728 1.00 61.39  ? 487 VAL D O   1 
ATOM   6347 C  CB  . VAL D 1 160 ? -16.378 24.706  -30.548 1.00 61.11  ? 487 VAL D CB  1 
ATOM   6348 C  CG1 . VAL D 1 160 ? -14.864 24.685  -30.468 1.00 65.18  ? 487 VAL D CG1 1 
ATOM   6349 C  CG2 . VAL D 1 160 ? -16.949 23.587  -29.686 1.00 59.89  ? 487 VAL D CG2 1 
ATOM   6350 N  N   . GLU D 1 161 ? -16.201 27.683  -31.826 1.00 61.07  ? 488 GLU D N   1 
ATOM   6351 C  CA  . GLU D 1 161 ? -15.502 28.884  -32.314 1.00 63.42  ? 488 GLU D CA  1 
ATOM   6352 C  C   . GLU D 1 161 ? -15.843 30.150  -31.512 1.00 61.13  ? 488 GLU D C   1 
ATOM   6353 O  O   . GLU D 1 161 ? -14.946 30.891  -31.104 1.00 62.92  ? 488 GLU D O   1 
ATOM   6354 C  CB  . GLU D 1 161 ? -15.714 29.114  -33.822 1.00 64.87  ? 488 GLU D CB  1 
ATOM   6355 C  CG  . GLU D 1 161 ? -14.761 30.156  -34.404 1.00 68.85  ? 488 GLU D CG  1 
ATOM   6356 C  CD  . GLU D 1 161 ? -15.055 30.559  -35.843 1.00 70.88  ? 488 GLU D CD  1 
ATOM   6357 O  OE1 . GLU D 1 161 ? -16.246 30.586  -36.255 1.00 68.21  ? 488 GLU D OE1 1 
ATOM   6358 O  OE2 . GLU D 1 161 ? -14.069 30.870  -36.558 1.00 74.64  ? 488 GLU D OE2 1 
ATOM   6359 N  N   . PHE D 1 162 ? -17.134 30.381  -31.286 1.00 57.84  ? 489 PHE D N   1 
ATOM   6360 C  CA  . PHE D 1 162 ? -17.611 31.528  -30.510 1.00 55.86  ? 489 PHE D CA  1 
ATOM   6361 C  C   . PHE D 1 162 ? -17.147 31.419  -29.054 1.00 55.39  ? 489 PHE D C   1 
ATOM   6362 O  O   . PHE D 1 162 ? -16.779 32.421  -28.448 1.00 55.56  ? 489 PHE D O   1 
ATOM   6363 C  CB  . PHE D 1 162 ? -19.137 31.633  -30.626 1.00 52.41  ? 489 PHE D CB  1 
ATOM   6364 C  CG  . PHE D 1 162 ? -19.773 32.636  -29.697 1.00 50.17  ? 489 PHE D CG  1 
ATOM   6365 C  CD1 . PHE D 1 162 ? -19.890 33.977  -30.066 1.00 50.64  ? 489 PHE D CD1 1 
ATOM   6366 C  CD2 . PHE D 1 162 ? -20.316 32.227  -28.472 1.00 47.75  ? 489 PHE D CD2 1 
ATOM   6367 C  CE1 . PHE D 1 162 ? -20.489 34.896  -29.212 1.00 48.77  ? 489 PHE D CE1 1 
ATOM   6368 C  CE2 . PHE D 1 162 ? -20.920 33.140  -27.615 1.00 45.64  ? 489 PHE D CE2 1 
ATOM   6369 C  CZ  . PHE D 1 162 ? -21.004 34.476  -27.984 1.00 46.50  ? 489 PHE D CZ  1 
ATOM   6370 N  N   . SER D 1 163 ? -17.162 30.201  -28.516 1.00 55.47  ? 490 SER D N   1 
ATOM   6371 C  CA  . SER D 1 163 ? -16.656 29.927  -27.173 1.00 55.92  ? 490 SER D CA  1 
ATOM   6372 C  C   . SER D 1 163 ? -15.167 30.281  -27.035 1.00 59.78  ? 490 SER D C   1 
ATOM   6373 O  O   . SER D 1 163 ? -14.793 30.945  -26.063 1.00 59.83  ? 490 SER D O   1 
ATOM   6374 C  CB  . SER D 1 163 ? -16.911 28.474  -26.794 1.00 55.65  ? 490 SER D CB  1 
ATOM   6375 O  OG  . SER D 1 163 ? -16.517 28.230  -25.452 1.00 56.33  ? 490 SER D OG  1 
ATOM   6376 N  N   . SER D 1 164 ? -14.345 29.854  -28.009 1.00 63.05  ? 491 SER D N   1 
ATOM   6377 C  CA  . SER D 1 164 ? -12.929 30.256  -28.120 1.00 67.23  ? 491 SER D CA  1 
ATOM   6378 C  C   . SER D 1 164 ? -12.787 31.776  -28.113 1.00 67.82  ? 491 SER D C   1 
ATOM   6379 O  O   . SER D 1 164 ? -11.991 32.331  -27.339 1.00 69.57  ? 491 SER D O   1 
ATOM   6380 C  CB  . SER D 1 164 ? -12.277 29.703  -29.405 1.00 70.49  ? 491 SER D CB  1 
ATOM   6381 O  OG  . SER D 1 164 ? -11.904 28.344  -29.280 1.00 72.19  ? 491 SER D OG  1 
ATOM   6382 N  N   . ASN D 1 165 ? -13.578 32.437  -28.968 1.00 66.85  ? 492 ASN D N   1 
ATOM   6383 C  CA  . ASN D 1 165 ? -13.525 33.889  -29.140 1.00 67.22  ? 492 ASN D CA  1 
ATOM   6384 C  C   . ASN D 1 165 ? -13.956 34.606  -27.869 1.00 64.76  ? 492 ASN D C   1 
ATOM   6385 O  O   . ASN D 1 165 ? -13.257 35.514  -27.412 1.00 66.57  ? 492 ASN D O   1 
ATOM   6386 C  CB  . ASN D 1 165 ? -14.335 34.333  -30.371 1.00 66.41  ? 492 ASN D CB  1 
ATOM   6387 C  CG  . ASN D 1 165 ? -13.678 33.918  -31.690 1.00 70.00  ? 492 ASN D CG  1 
ATOM   6388 O  OD1 . ASN D 1 165 ? -12.445 33.979  -31.846 1.00 73.26  ? 492 ASN D OD1 1 
ATOM   6389 N  ND2 . ASN D 1 165 ? -14.503 33.494  -32.650 1.00 68.48  ? 492 ASN D ND2 1 
ATOM   6390 N  N   . LEU D 1 166 ? -15.063 34.145  -27.286 1.00 61.07  ? 493 LEU D N   1 
ATOM   6391 C  CA  . LEU D 1 166 ? -15.610 34.674  -26.032 1.00 59.14  ? 493 LEU D CA  1 
ATOM   6392 C  C   . LEU D 1 166 ? -14.648 34.510  -24.846 1.00 60.30  ? 493 LEU D C   1 
ATOM   6393 O  O   . LEU D 1 166 ? -14.466 35.433  -24.041 1.00 60.15  ? 493 LEU D O   1 
ATOM   6394 C  CB  . LEU D 1 166 ? -16.963 34.017  -25.723 1.00 55.48  ? 493 LEU D CB  1 
ATOM   6395 C  CG  . LEU D 1 166 ? -17.808 34.552  -24.568 1.00 53.26  ? 493 LEU D CG  1 
ATOM   6396 C  CD1 . LEU D 1 166 ? -18.584 35.788  -25.015 1.00 52.32  ? 493 LEU D CD1 1 
ATOM   6397 C  CD2 . LEU D 1 166 ? -18.745 33.461  -24.060 1.00 50.12  ? 493 LEU D CD2 1 
ATOM   6398 N  N   . GLN D 1 167 ? -14.024 33.345  -24.754 1.00 62.01  ? 494 GLN D N   1 
ATOM   6399 C  CA  . GLN D 1 167 ? -13.113 33.072  -23.645 1.00 63.95  ? 494 GLN D CA  1 
ATOM   6400 C  C   . GLN D 1 167 ? -11.746 33.749  -23.749 1.00 67.82  ? 494 GLN D C   1 
ATOM   6401 O  O   . GLN D 1 167 ? -11.097 33.998  -22.725 1.00 68.57  ? 494 GLN D O   1 
ATOM   6402 C  CB  . GLN D 1 167 ? -12.994 31.574  -23.408 1.00 64.61  ? 494 GLN D CB  1 
ATOM   6403 C  CG  . GLN D 1 167 ? -14.232 31.015  -22.724 1.00 61.65  ? 494 GLN D CG  1 
ATOM   6404 C  CD  . GLN D 1 167 ? -14.121 29.553  -22.344 1.00 63.30  ? 494 GLN D CD  1 
ATOM   6405 O  OE1 . GLN D 1 167 ? -15.141 28.880  -22.205 1.00 62.30  ? 494 GLN D OE1 1 
ATOM   6406 N  NE2 . GLN D 1 167 ? -12.896 29.055  -22.157 1.00 66.51  ? 494 GLN D NE2 1 
ATOM   6407 N  N   . ASN D 1 168 ? -11.325 34.083  -24.968 1.00 70.50  ? 495 ASN D N   1 
ATOM   6408 C  CA  . ASN D 1 168 ? -10.102 34.893  -25.153 1.00 75.10  ? 495 ASN D CA  1 
ATOM   6409 C  C   . ASN D 1 168 ? -10.296 36.384  -24.823 1.00 74.93  ? 495 ASN D C   1 
ATOM   6410 O  O   . ASN D 1 168 ? -9.328  37.138  -24.742 1.00 77.74  ? 495 ASN D O   1 
ATOM   6411 C  CB  . ASN D 1 168 ? -9.502  34.696  -26.552 1.00 78.12  ? 495 ASN D CB  1 
ATOM   6412 C  CG  . ASN D 1 168 ? -8.928  33.300  -26.748 1.00 80.41  ? 495 ASN D CG  1 
ATOM   6413 O  OD1 . ASN D 1 168 ? -9.216  32.640  -27.747 1.00 81.04  ? 495 ASN D OD1 1 
ATOM   6414 N  ND2 . ASN D 1 168 ? -8.118  32.840  -25.791 1.00 82.01  ? 495 ASN D ND2 1 
ATOM   6415 N  N   . MET D 1 169 ? -11.550 36.792  -24.619 1.00 72.04  ? 496 MET D N   1 
ATOM   6416 C  CA  . MET D 1 169 ? -11.868 38.134  -24.121 1.00 71.80  ? 496 MET D CA  1 
ATOM   6417 C  C   . MET D 1 169 ? -11.721 38.244  -22.601 1.00 70.71  ? 496 MET D C   1 
ATOM   6418 O  O   . MET D 1 169 ? -11.729 39.353  -22.063 1.00 70.04  ? 496 MET D O   1 
ATOM   6419 C  CB  . MET D 1 169 ? -13.278 38.542  -24.537 1.00 69.58  ? 496 MET D CB  1 
ATOM   6420 C  CG  . MET D 1 169 ? -13.476 38.615  -26.039 1.00 70.92  ? 496 MET D CG  1 
ATOM   6421 S  SD  . MET D 1 169 ? -15.016 39.431  -26.473 1.00 69.82  ? 496 MET D SD  1 
ATOM   6422 C  CE  . MET D 1 169 ? -14.579 41.154  -26.260 1.00 72.14  ? 496 MET D CE  1 
ATOM   6423 N  N   . ASN D 1 170 ? -11.585 37.088  -21.933 1.00 70.64  ? 497 ASN D N   1 
ATOM   6424 C  CA  . ASN D 1 170 ? -11.397 36.968  -20.474 1.00 70.37  ? 497 ASN D CA  1 
ATOM   6425 C  C   . ASN D 1 170 ? -12.425 37.795  -19.735 1.00 67.00  ? 497 ASN D C   1 
ATOM   6426 O  O   . ASN D 1 170 ? -12.105 38.811  -19.114 1.00 68.75  ? 497 ASN D O   1 
ATOM   6427 C  CB  . ASN D 1 170 ? -9.975  37.355  -20.048 1.00 75.01  ? 497 ASN D CB  1 
ATOM   6428 C  CG  . ASN D 1 170 ? -8.922  36.455  -20.657 1.00 79.63  ? 497 ASN D CG  1 
ATOM   6429 O  OD1 . ASN D 1 170 ? -8.820  35.273  -20.311 1.00 80.21  ? 497 ASN D OD1 1 
ATOM   6430 N  ND2 . ASN D 1 170 ? -8.121  37.012  -21.569 1.00 83.28  ? 497 ASN D ND2 1 
ATOM   6431 N  N   . ILE D 1 171 ? -13.672 37.364  -19.850 1.00 62.90  ? 498 ILE D N   1 
ATOM   6432 C  CA  . ILE D 1 171 ? -14.796 38.078  -19.276 1.00 59.43  ? 498 ILE D CA  1 
ATOM   6433 C  C   . ILE D 1 171 ? -15.050 37.536  -17.876 1.00 57.42  ? 498 ILE D C   1 
ATOM   6434 O  O   . ILE D 1 171 ? -15.259 36.334  -17.713 1.00 56.75  ? 498 ILE D O   1 
ATOM   6435 C  CB  . ILE D 1 171 ? -16.053 37.901  -20.151 1.00 57.21  ? 498 ILE D CB  1 
ATOM   6436 C  CG1 . ILE D 1 171 ? -15.712 38.142  -21.635 1.00 58.17  ? 498 ILE D CG1 1 
ATOM   6437 C  CG2 . ILE D 1 171 ? -17.181 38.797  -19.647 1.00 55.01  ? 498 ILE D CG2 1 
ATOM   6438 C  CD1 . ILE D 1 171 ? -16.757 37.636  -22.610 1.00 56.30  ? 498 ILE D CD1 1 
ATOM   6439 N  N   . ASP D 1 172 ? -15.025 38.411  -16.872 1.00 56.86  ? 499 ASP D N   1 
ATOM   6440 C  CA  . ASP D 1 172 ? -15.333 37.992  -15.494 1.00 55.69  ? 499 ASP D CA  1 
ATOM   6441 C  C   . ASP D 1 172 ? -16.844 37.834  -15.260 1.00 52.44  ? 499 ASP D C   1 
ATOM   6442 O  O   . ASP D 1 172 ? -17.650 38.295  -16.094 1.00 51.74  ? 499 ASP D O   1 
ATOM   6443 C  CB  . ASP D 1 172 ? -14.630 38.882  -14.439 1.00 57.42  ? 499 ASP D CB  1 
ATOM   6444 C  CG  . ASP D 1 172 ? -15.220 40.295  -14.317 1.00 56.94  ? 499 ASP D CG  1 
ATOM   6445 O  OD1 . ASP D 1 172 ? -14.783 41.008  -13.393 1.00 58.32  ? 499 ASP D OD1 1 
ATOM   6446 O  OD2 . ASP D 1 172 ? -16.096 40.708  -15.107 1.00 55.25  ? 499 ASP D OD2 1 
ATOM   6447 N  N   . ILE D 1 173 ? -17.207 37.171  -14.153 1.00 51.38  ? 500 ILE D N   1 
ATOM   6448 C  CA  . ILE D 1 173 ? -18.608 36.800  -13.818 1.00 49.47  ? 500 ILE D CA  1 
ATOM   6449 C  C   . ILE D 1 173 ? -19.586 37.984  -13.830 1.00 47.26  ? 500 ILE D C   1 
ATOM   6450 O  O   . ILE D 1 173 ? -20.693 37.826  -14.296 1.00 46.24  ? 500 ILE D O   1 
ATOM   6451 C  CB  . ILE D 1 173 ? -18.733 35.931  -12.515 1.00 50.25  ? 500 ILE D CB  1 
ATOM   6452 C  CG1 . ILE D 1 173 ? -18.233 34.515  -12.793 1.00 52.35  ? 500 ILE D CG1 1 
ATOM   6453 C  CG2 . ILE D 1 173 ? -20.182 35.747  -12.052 1.00 47.97  ? 500 ILE D CG2 1 
ATOM   6454 C  CD1 . ILE D 1 173 ? -18.227 33.566  -11.597 1.00 53.72  ? 500 ILE D CD1 1 
ATOM   6455 N  N   . SER D 1 174 ? -19.157 39.148  -13.354 1.00 47.76  ? 501 SER D N   1 
ATOM   6456 C  CA  . SER D 1 174 ? -19.994 40.337  -13.295 1.00 47.51  ? 501 SER D CA  1 
ATOM   6457 C  C   . SER D 1 174 ? -20.335 40.869  -14.686 1.00 47.52  ? 501 SER D C   1 
ATOM   6458 O  O   . SER D 1 174 ? -21.504 41.161  -14.968 1.00 45.78  ? 501 SER D O   1 
ATOM   6459 C  CB  . SER D 1 174 ? -19.330 41.416  -12.444 1.00 49.04  ? 501 SER D CB  1 
ATOM   6460 O  OG  . SER D 1 174 ? -19.191 40.979  -11.104 1.00 48.96  ? 501 SER D OG  1 
ATOM   6461 N  N   . ALA D 1 175 ? -19.315 40.961  -15.547 1.00 49.44  ? 502 ALA D N   1 
ATOM   6462 C  CA  . ALA D 1 175 ? -19.486 41.350  -16.961 1.00 49.73  ? 502 ALA D CA  1 
ATOM   6463 C  C   . ALA D 1 175 ? -20.267 40.314  -17.763 1.00 47.66  ? 502 ALA D C   1 
ATOM   6464 O  O   . ALA D 1 175 ? -21.169 40.682  -18.516 1.00 48.14  ? 502 ALA D O   1 
ATOM   6465 C  CB  . ALA D 1 175 ? -18.153 41.659  -17.632 1.00 51.22  ? 502 ALA D CB  1 
ATOM   6466 N  N   . PHE D 1 176 ? -19.948 39.031  -17.601 1.00 46.55  ? 503 PHE D N   1 
ATOM   6467 C  CA  . PHE D 1 176 ? -20.741 38.011  -18.267 1.00 44.47  ? 503 PHE D CA  1 
ATOM   6468 C  C   . PHE D 1 176 ? -22.224 38.083  -17.865 1.00 42.61  ? 503 PHE D C   1 
ATOM   6469 O  O   . PHE D 1 176 ? -23.112 37.978  -18.736 1.00 41.79  ? 503 PHE D O   1 
ATOM   6470 C  CB  . PHE D 1 176 ? -20.206 36.589  -18.075 1.00 44.17  ? 503 PHE D CB  1 
ATOM   6471 C  CG  . PHE D 1 176 ? -21.032 35.558  -18.798 1.00 43.16  ? 503 PHE D CG  1 
ATOM   6472 C  CD1 . PHE D 1 176 ? -20.864 35.354  -20.176 1.00 44.15  ? 503 PHE D CD1 1 
ATOM   6473 C  CD2 . PHE D 1 176 ? -22.035 34.842  -18.131 1.00 41.23  ? 503 PHE D CD2 1 
ATOM   6474 C  CE1 . PHE D 1 176 ? -21.652 34.425  -20.855 1.00 42.75  ? 503 PHE D CE1 1 
ATOM   6475 C  CE2 . PHE D 1 176 ? -22.819 33.919  -18.806 1.00 40.07  ? 503 PHE D CE2 1 
ATOM   6476 C  CZ  . PHE D 1 176 ? -22.630 33.712  -20.168 1.00 40.90  ? 503 PHE D CZ  1 
ATOM   6477 N  N   . SER D 1 177 ? -22.481 38.260  -16.567 1.00 41.66  ? 504 SER D N   1 
ATOM   6478 C  CA  . SER D 1 177 ? -23.848 38.308  -16.043 1.00 40.41  ? 504 SER D CA  1 
ATOM   6479 C  C   . SER D 1 177 ? -24.689 39.404  -16.681 1.00 39.74  ? 504 SER D C   1 
ATOM   6480 O  O   . SER D 1 177 ? -25.892 39.212  -16.901 1.00 38.57  ? 504 SER D O   1 
ATOM   6481 C  CB  . SER D 1 177 ? -23.850 38.448  -14.520 1.00 40.92  ? 504 SER D CB  1 
ATOM   6482 O  OG  . SER D 1 177 ? -23.237 37.315  -13.921 1.00 40.97  ? 504 SER D OG  1 
ATOM   6483 N  N   . CYS D 1 178 ? -24.043 40.532  -16.978 1.00 41.25  ? 505 CYS D N   1 
ATOM   6484 C  CA  . CYS D 1 178 ? -24.665 41.647  -17.687 1.00 42.03  ? 505 CYS D CA  1 
ATOM   6485 C  C   . CYS D 1 178 ? -24.981 41.336  -19.148 1.00 41.53  ? 505 CYS D C   1 
ATOM   6486 O  O   . CYS D 1 178 ? -26.107 41.561  -19.597 1.00 41.61  ? 505 CYS D O   1 
ATOM   6487 C  CB  . CYS D 1 178 ? -23.779 42.877  -17.595 1.00 44.28  ? 505 CYS D CB  1 
ATOM   6488 S  SG  . CYS D 1 178 ? -23.627 43.508  -15.915 1.00 45.17  ? 505 CYS D SG  1 
ATOM   6489 N  N   . ILE D 1 179 ? -23.989 40.820  -19.873 1.00 41.82  ? 506 ILE D N   1 
ATOM   6490 C  CA  . ILE D 1 179 ? -24.134 40.416  -21.285 1.00 41.50  ? 506 ILE D CA  1 
ATOM   6491 C  C   . ILE D 1 179 ? -25.278 39.416  -21.489 1.00 38.77  ? 506 ILE D C   1 
ATOM   6492 O  O   . ILE D 1 179 ? -26.087 39.590  -22.396 1.00 38.25  ? 506 ILE D O   1 
ATOM   6493 C  CB  . ILE D 1 179 ? -22.784 39.883  -21.868 1.00 43.10  ? 506 ILE D CB  1 
ATOM   6494 C  CG1 . ILE D 1 179 ? -21.755 41.026  -22.023 1.00 45.82  ? 506 ILE D CG1 1 
ATOM   6495 C  CG2 . ILE D 1 179 ? -22.980 39.069  -23.161 1.00 42.84  ? 506 ILE D CG2 1 
ATOM   6496 C  CD1 . ILE D 1 179 ? -22.064 42.086  -23.076 1.00 47.48  ? 506 ILE D CD1 1 
ATOM   6497 N  N   . ALA D 1 180 ? -25.344 38.394  -20.631 1.00 37.61  ? 507 ALA D N   1 
ATOM   6498 C  CA  . ALA D 1 180 ? -26.480 37.444  -20.597 1.00 35.66  ? 507 ALA D CA  1 
ATOM   6499 C  C   . ALA D 1 180 ? -27.819 38.133  -20.386 1.00 35.55  ? 507 ALA D C   1 
ATOM   6500 O  O   . ALA D 1 180 ? -28.764 37.894  -21.159 1.00 35.50  ? 507 ALA D O   1 
ATOM   6501 C  CB  . ALA D 1 180 ? -26.263 36.366  -19.553 1.00 35.16  ? 507 ALA D CB  1 
ATOM   6502 N  N   . ALA D 1 181 ? -27.905 39.008  -19.380 1.00 36.13  ? 508 ALA D N   1 
ATOM   6503 C  CA  . ALA D 1 181 ? -29.144 39.778  -19.168 1.00 37.45  ? 508 ALA D CA  1 
ATOM   6504 C  C   . ALA D 1 181 ? -29.529 40.645  -20.380 1.00 38.83  ? 508 ALA D C   1 
ATOM   6505 O  O   . ALA D 1 181 ? -30.714 40.757  -20.706 1.00 39.50  ? 508 ALA D O   1 
ATOM   6506 C  CB  . ALA D 1 181 ? -29.069 40.622  -17.906 1.00 38.30  ? 508 ALA D CB  1 
ATOM   6507 N  N   . LEU D 1 182 ? -28.529 41.245  -21.035 1.00 40.06  ? 509 LEU D N   1 
ATOM   6508 C  CA  . LEU D 1 182 ? -28.736 42.033  -22.264 1.00 41.43  ? 509 LEU D CA  1 
ATOM   6509 C  C   . LEU D 1 182 ? -29.177 41.207  -23.479 1.00 41.09  ? 509 LEU D C   1 
ATOM   6510 O  O   . LEU D 1 182 ? -29.840 41.729  -24.360 1.00 42.74  ? 509 LEU D O   1 
ATOM   6511 C  CB  . LEU D 1 182 ? -27.479 42.820  -22.624 1.00 42.99  ? 509 LEU D CB  1 
ATOM   6512 C  CG  . LEU D 1 182 ? -27.036 43.935  -21.677 1.00 44.57  ? 509 LEU D CG  1 
ATOM   6513 C  CD1 . LEU D 1 182 ? -25.624 44.380  -22.011 1.00 45.79  ? 509 LEU D CD1 1 
ATOM   6514 C  CD2 . LEU D 1 182 ? -28.018 45.099  -21.714 1.00 45.99  ? 509 LEU D CD2 1 
ATOM   6515 N  N   . ALA D 1 183 ? -28.806 39.927  -23.526 1.00 40.15  ? 510 ALA D N   1 
ATOM   6516 C  CA  . ALA D 1 183 ? -29.291 39.019  -24.570 1.00 39.44  ? 510 ALA D CA  1 
ATOM   6517 C  C   . ALA D 1 183 ? -30.806 38.810  -24.474 1.00 39.04  ? 510 ALA D C   1 
ATOM   6518 O  O   . ALA D 1 183 ? -31.466 38.558  -25.482 1.00 38.49  ? 510 ALA D O   1 
ATOM   6519 C  CB  . ALA D 1 183 ? -28.561 37.688  -24.522 1.00 37.75  ? 510 ALA D CB  1 
ATOM   6520 N  N   . MET D 1 184 ? -31.354 38.940  -23.268 1.00 39.10  ? 511 MET D N   1 
ATOM   6521 C  CA  . MET D 1 184 ? -32.772 38.796  -23.114 1.00 39.91  ? 511 MET D CA  1 
ATOM   6522 C  C   . MET D 1 184 ? -33.576 40.083  -22.985 1.00 41.05  ? 511 MET D C   1 
ATOM   6523 O  O   . MET D 1 184 ? -34.654 40.208  -23.591 1.00 40.45  ? 511 MET D O   1 
ATOM   6524 C  CB  . MET D 1 184 ? -33.118 37.869  -21.983 1.00 41.09  ? 511 MET D CB  1 
ATOM   6525 C  CG  . MET D 1 184 ? -34.571 37.478  -22.117 1.00 42.49  ? 511 MET D CG  1 
ATOM   6526 S  SD  . MET D 1 184 ? -35.048 36.438  -20.792 1.00 45.65  ? 511 MET D SD  1 
ATOM   6527 C  CE  . MET D 1 184 ? -34.519 37.463  -19.416 1.00 44.03  ? 511 MET D CE  1 
ATOM   6528 N  N   . VAL D 1 185 ? -33.068 41.015  -22.186 1.00 41.74  ? 512 VAL D N   1 
ATOM   6529 C  CA  . VAL D 1 185 ? -33.710 42.311  -22.039 1.00 43.75  ? 512 VAL D CA  1 
ATOM   6530 C  C   . VAL D 1 185 ? -33.294 43.192  -23.237 1.00 45.87  ? 512 VAL D C   1 
ATOM   6531 O  O   . VAL D 1 185 ? -32.328 43.969  -23.178 1.00 47.01  ? 512 VAL D O   1 
ATOM   6532 C  CB  . VAL D 1 185 ? -33.428 42.923  -20.652 1.00 44.13  ? 512 VAL D CB  1 
ATOM   6533 C  CG1 . VAL D 1 185 ? -34.313 44.143  -20.401 1.00 45.67  ? 512 VAL D CG1 1 
ATOM   6534 C  CG2 . VAL D 1 185 ? -33.630 41.865  -19.568 1.00 42.02  ? 512 VAL D CG2 1 
ATOM   6535 N  N   . THR D 1 186 ? -34.023 43.005  -24.336 1.00 46.42  ? 513 THR D N   1 
ATOM   6536 C  CA  . THR D 1 186 ? -33.805 43.716  -25.607 1.00 49.42  ? 513 THR D CA  1 
ATOM   6537 C  C   . THR D 1 186 ? -35.125 43.901  -26.368 1.00 50.88  ? 513 THR D C   1 
ATOM   6538 O  O   . THR D 1 186 ? -36.106 43.230  -26.081 1.00 49.19  ? 513 THR D O   1 
ATOM   6539 C  CB  . THR D 1 186 ? -32.742 43.021  -26.511 1.00 48.20  ? 513 THR D CB  1 
ATOM   6540 O  OG1 . THR D 1 186 ? -32.475 43.847  -27.648 1.00 50.71  ? 513 THR D OG1 1 
ATOM   6541 C  CG2 . THR D 1 186 ? -33.205 41.631  -26.996 1.00 46.06  ? 513 THR D CG2 1 
ATOM   6542 N  N   . GLU D 1 187 ? -35.129 44.803  -27.341 1.00 55.50  ? 514 GLU D N   1 
ATOM   6543 C  CA  . GLU D 1 187 ? -36.334 45.099  -28.113 1.00 59.68  ? 514 GLU D CA  1 
ATOM   6544 C  C   . GLU D 1 187 ? -36.776 43.903  -28.967 1.00 57.88  ? 514 GLU D C   1 
ATOM   6545 O  O   . GLU D 1 187 ? -35.954 43.230  -29.615 1.00 55.58  ? 514 GLU D O   1 
ATOM   6546 C  CB  . GLU D 1 187 ? -36.170 46.364  -28.966 1.00 65.63  ? 514 GLU D CB  1 
ATOM   6547 C  CG  . GLU D 1 187 ? -35.421 47.535  -28.298 1.00 71.89  ? 514 GLU D CG  1 
ATOM   6548 C  CD  . GLU D 1 187 ? -35.933 47.965  -26.909 1.00 73.83  ? 514 GLU D CD  1 
ATOM   6549 O  OE1 . GLU D 1 187 ? -37.173 48.124  -26.707 1.00 75.67  ? 514 GLU D OE1 1 
ATOM   6550 O  OE2 . GLU D 1 187 ? -35.067 48.170  -26.019 1.00 72.85  ? 514 GLU D OE2 1 
ATOM   6551 N  N   . ARG D 1 188 ? -38.076 43.623  -28.897 1.00 57.40  ? 515 ARG D N   1 
ATOM   6552 C  CA  . ARG D 1 188 ? -38.707 42.557  -29.671 1.00 56.60  ? 515 ARG D CA  1 
ATOM   6553 C  C   . ARG D 1 188 ? -39.989 43.108  -30.233 1.00 59.21  ? 515 ARG D C   1 
ATOM   6554 O  O   . ARG D 1 188 ? -40.690 43.865  -29.560 1.00 61.33  ? 515 ARG D O   1 
ATOM   6555 C  CB  . ARG D 1 188 ? -39.022 41.322  -28.808 1.00 53.63  ? 515 ARG D CB  1 
ATOM   6556 C  CG  . ARG D 1 188 ? -37.839 40.651  -28.123 1.00 50.84  ? 515 ARG D CG  1 
ATOM   6557 C  CD  . ARG D 1 188 ? -36.903 39.927  -29.084 1.00 49.63  ? 515 ARG D CD  1 
ATOM   6558 N  NE  . ARG D 1 188 ? -35.854 39.246  -28.330 1.00 48.48  ? 515 ARG D NE  1 
ATOM   6559 C  CZ  . ARG D 1 188 ? -34.785 38.651  -28.851 1.00 48.48  ? 515 ARG D CZ  1 
ATOM   6560 N  NH1 . ARG D 1 188 ? -34.600 38.638  -30.170 1.00 48.83  ? 515 ARG D NH1 1 
ATOM   6561 N  NH2 . ARG D 1 188 ? -33.899 38.054  -28.041 1.00 46.72  ? 515 ARG D NH2 1 
ATOM   6562 N  N   . HIS D 1 189 ? -40.290 42.742  -31.475 1.00 60.88  ? 516 HIS D N   1 
ATOM   6563 C  CA  . HIS D 1 189 ? -41.531 43.161  -32.106 1.00 63.26  ? 516 HIS D CA  1 
ATOM   6564 C  C   . HIS D 1 189 ? -42.692 42.453  -31.426 1.00 61.67  ? 516 HIS D C   1 
ATOM   6565 O  O   . HIS D 1 189 ? -42.699 41.220  -31.313 1.00 59.15  ? 516 HIS D O   1 
ATOM   6566 C  CB  . HIS D 1 189 ? -41.521 42.876  -33.608 1.00 66.01  ? 516 HIS D CB  1 
ATOM   6567 C  CG  . HIS D 1 189 ? -42.615 43.577  -34.357 1.00 71.66  ? 516 HIS D CG  1 
ATOM   6568 N  ND1 . HIS D 1 189 ? -43.659 42.903  -34.956 1.00 72.95  ? 516 HIS D ND1 1 
ATOM   6569 C  CD2 . HIS D 1 189 ? -42.840 44.896  -34.579 1.00 75.96  ? 516 HIS D CD2 1 
ATOM   6570 C  CE1 . HIS D 1 189 ? -44.467 43.774  -35.538 1.00 77.28  ? 516 HIS D CE1 1 
ATOM   6571 N  NE2 . HIS D 1 189 ? -43.995 44.991  -35.319 1.00 79.72  ? 516 HIS D NE2 1 
ATOM   6572 N  N   . GLY D 1 190 ? -43.645 43.246  -30.946 1.00 63.08  ? 517 GLY D N   1 
ATOM   6573 C  CA  . GLY D 1 190 ? -44.827 42.710  -30.286 1.00 62.61  ? 517 GLY D CA  1 
ATOM   6574 C  C   . GLY D 1 190 ? -44.785 42.735  -28.770 1.00 61.69  ? 517 GLY D C   1 
ATOM   6575 O  O   . GLY D 1 190 ? -45.594 42.061  -28.126 1.00 61.66  ? 517 GLY D O   1 
ATOM   6576 N  N   . LEU D 1 191 ? -43.838 43.486  -28.193 1.00 60.57  ? 518 LEU D N   1 
ATOM   6577 C  CA  . LEU D 1 191 ? -43.847 43.774  -26.756 1.00 60.03  ? 518 LEU D CA  1 
ATOM   6578 C  C   . LEU D 1 191 ? -45.029 44.706  -26.466 1.00 64.52  ? 518 LEU D C   1 
ATOM   6579 O  O   . LEU D 1 191 ? -45.360 45.553  -27.287 1.00 66.71  ? 518 LEU D O   1 
ATOM   6580 C  CB  . LEU D 1 191 ? -42.525 44.414  -26.286 1.00 57.73  ? 518 LEU D CB  1 
ATOM   6581 C  CG  . LEU D 1 191 ? -41.196 43.633  -26.215 1.00 53.52  ? 518 LEU D CG  1 
ATOM   6582 C  CD1 . LEU D 1 191 ? -40.018 44.584  -26.091 1.00 52.98  ? 518 LEU D CD1 1 
ATOM   6583 C  CD2 . LEU D 1 191 ? -41.178 42.607  -25.092 1.00 50.84  ? 518 LEU D CD2 1 
ATOM   6584 N  N   . LYS D 1 192 ? -45.662 44.523  -25.310 1.00 66.47  ? 519 LYS D N   1 
ATOM   6585 C  CA  . LYS D 1 192 ? -46.779 45.356  -24.857 1.00 71.68  ? 519 LYS D CA  1 
ATOM   6586 C  C   . LYS D 1 192 ? -46.306 46.639  -24.171 1.00 74.38  ? 519 LYS D C   1 
ATOM   6587 O  O   . LYS D 1 192 ? -46.994 47.665  -24.210 1.00 78.64  ? 519 LYS D O   1 
ATOM   6588 C  CB  . LYS D 1 192 ? -47.663 44.563  -23.899 1.00 72.78  ? 519 LYS D CB  1 
ATOM   6589 C  CG  . LYS D 1 192 ? -48.351 43.359  -24.528 1.00 73.51  ? 519 LYS D CG  1 
ATOM   6590 C  CD  . LYS D 1 192 ? -49.153 42.602  -23.482 1.00 75.18  ? 519 LYS D CD  1 
ATOM   6591 C  CE  . LYS D 1 192 ? -50.373 41.929  -24.089 1.00 77.59  ? 519 LYS D CE  1 
ATOM   6592 N  NZ  . LYS D 1 192 ? -51.587 42.167  -23.249 1.00 81.71  ? 519 LYS D NZ  1 
ATOM   6593 N  N   . GLU D 1 193 ? -45.140 46.557  -23.530 1.00 72.31  ? 520 GLU D N   1 
ATOM   6594 C  CA  . GLU D 1 193 ? -44.506 47.678  -22.823 1.00 74.04  ? 520 GLU D CA  1 
ATOM   6595 C  C   . GLU D 1 193 ? -43.025 47.796  -23.249 1.00 71.33  ? 520 GLU D C   1 
ATOM   6596 O  O   . GLU D 1 193 ? -42.137 47.504  -22.438 1.00 69.15  ? 520 GLU D O   1 
ATOM   6597 C  CB  . GLU D 1 193 ? -44.595 47.476  -21.297 1.00 74.22  ? 520 GLU D CB  1 
ATOM   6598 C  CG  . GLU D 1 193 ? -46.001 47.428  -20.706 1.00 77.87  ? 520 GLU D CG  1 
ATOM   6599 C  CD  . GLU D 1 193 ? -46.584 48.797  -20.380 1.00 83.35  ? 520 GLU D CD  1 
ATOM   6600 O  OE1 . GLU D 1 193 ? -47.830 48.918  -20.410 1.00 87.22  ? 520 GLU D OE1 1 
ATOM   6601 O  OE2 . GLU D 1 193 ? -45.819 49.749  -20.079 1.00 84.50  ? 520 GLU D OE2 1 
ATOM   6602 N  N   . PRO D 1 194 ? -42.748 48.217  -24.517 1.00 72.12  ? 521 PRO D N   1 
ATOM   6603 C  CA  . PRO D 1 194 ? -41.348 48.254  -24.998 1.00 69.65  ? 521 PRO D CA  1 
ATOM   6604 C  C   . PRO D 1 194 ? -40.457 49.278  -24.283 1.00 70.55  ? 521 PRO D C   1 
ATOM   6605 O  O   . PRO D 1 194 ? -39.229 49.137  -24.307 1.00 68.36  ? 521 PRO D O   1 
ATOM   6606 C  CB  . PRO D 1 194 ? -41.488 48.591  -26.489 1.00 71.20  ? 521 PRO D CB  1 
ATOM   6607 C  CG  . PRO D 1 194 ? -42.790 49.306  -26.596 1.00 75.35  ? 521 PRO D CG  1 
ATOM   6608 C  CD  . PRO D 1 194 ? -43.688 48.680  -25.565 1.00 74.98  ? 521 PRO D CD  1 
ATOM   6609 N  N   . LYS D 1 195 ? -41.088 50.277  -23.661 1.00 73.79  ? 522 LYS D N   1 
ATOM   6610 C  CA  . LYS D 1 195 ? -40.429 51.258  -22.795 1.00 75.64  ? 522 LYS D CA  1 
ATOM   6611 C  C   . LYS D 1 195 ? -39.798 50.651  -21.538 1.00 72.28  ? 522 LYS D C   1 
ATOM   6612 O  O   . LYS D 1 195 ? -38.648 50.957  -21.218 1.00 70.89  ? 522 LYS D O   1 
ATOM   6613 C  CB  . LYS D 1 195 ? -41.418 52.362  -22.397 1.00 81.33  ? 522 LYS D CB  1 
ATOM   6614 C  CG  . LYS D 1 195 ? -41.122 53.729  -22.997 1.00 86.04  ? 522 LYS D CG  1 
ATOM   6615 C  CD  . LYS D 1 195 ? -40.206 54.537  -22.080 1.00 87.68  ? 522 LYS D CD  1 
ATOM   6616 C  CE  . LYS D 1 195 ? -39.508 55.671  -22.824 1.00 90.95  ? 522 LYS D CE  1 
ATOM   6617 N  NZ  . LYS D 1 195 ? -40.451 56.741  -23.263 1.00 96.22  ? 522 LYS D NZ  1 
ATOM   6618 N  N   . ARG D 1 196 ? -40.556 49.797  -20.842 1.00 70.75  ? 523 ARG D N   1 
ATOM   6619 C  CA  . ARG D 1 196 ? -40.101 49.126  -19.613 1.00 67.46  ? 523 ARG D CA  1 
ATOM   6620 C  C   . ARG D 1 196 ? -38.868 48.255  -19.854 1.00 62.87  ? 523 ARG D C   1 
ATOM   6621 O  O   . ARG D 1 196 ? -37.943 48.219  -19.013 1.00 61.02  ? 523 ARG D O   1 
ATOM   6622 C  CB  . ARG D 1 196 ? -41.230 48.305  -18.968 1.00 68.24  ? 523 ARG D CB  1 
ATOM   6623 C  CG  . ARG D 1 196 ? -42.338 49.139  -18.312 1.00 74.00  ? 523 ARG D CG  1 
ATOM   6624 C  CD  . ARG D 1 196 ? -42.971 48.439  -17.103 1.00 75.19  ? 523 ARG D CD  1 
ATOM   6625 N  NE  . ARG D 1 196 ? -42.111 48.455  -15.898 1.00 75.69  ? 523 ARG D NE  1 
ATOM   6626 C  CZ  . ARG D 1 196 ? -42.216 49.317  -14.872 1.00 79.05  ? 523 ARG D CZ  1 
ATOM   6627 N  NH1 . ARG D 1 196 ? -43.153 50.267  -14.853 1.00 83.35  ? 523 ARG D NH1 1 
ATOM   6628 N  NH2 . ARG D 1 196 ? -41.381 49.228  -13.841 1.00 77.72  ? 523 ARG D NH2 1 
ATOM   6629 N  N   . VAL D 1 197 ? -38.858 47.582  -21.008 1.00 59.86  ? 524 VAL D N   1 
ATOM   6630 C  CA  . VAL D 1 197 ? -37.724 46.758  -21.458 1.00 56.19  ? 524 VAL D CA  1 
ATOM   6631 C  C   . VAL D 1 197 ? -36.476 47.620  -21.753 1.00 57.25  ? 524 VAL D C   1 
ATOM   6632 O  O   . VAL D 1 197 ? -35.390 47.309  -21.262 1.00 55.33  ? 524 VAL D O   1 
ATOM   6633 C  CB  . VAL D 1 197 ? -38.117 45.846  -22.659 1.00 54.24  ? 524 VAL D CB  1 
ATOM   6634 C  CG1 . VAL D 1 197 ? -36.927 45.064  -23.200 1.00 51.28  ? 524 VAL D CG1 1 
ATOM   6635 C  CG2 . VAL D 1 197 ? -39.228 44.875  -22.269 1.00 53.38  ? 524 VAL D CG2 1 
ATOM   6636 N  N   . GLU D 1 198 ? -36.642 48.696  -22.532 1.00 60.95  ? 525 GLU D N   1 
ATOM   6637 C  CA  . GLU D 1 198 ? -35.554 49.638  -22.866 1.00 63.25  ? 525 GLU D CA  1 
ATOM   6638 C  C   . GLU D 1 198 ? -34.980 50.311  -21.614 1.00 64.32  ? 525 GLU D C   1 
ATOM   6639 O  O   . GLU D 1 198 ? -33.777 50.552  -21.535 1.00 63.91  ? 525 GLU D O   1 
ATOM   6640 C  CB  . GLU D 1 198 ? -36.025 50.710  -23.864 1.00 67.62  ? 525 GLU D CB  1 
ATOM   6641 C  CG  . GLU D 1 198 ? -34.912 51.307  -24.728 1.00 70.07  ? 525 GLU D CG  1 
ATOM   6642 C  CD  . GLU D 1 198 ? -35.097 52.790  -25.065 1.00 76.39  ? 525 GLU D CD  1 
ATOM   6643 O  OE1 . GLU D 1 198 ? -36.236 53.248  -25.320 1.00 79.07  ? 525 GLU D OE1 1 
ATOM   6644 O  OE2 . GLU D 1 198 ? -34.079 53.520  -25.091 1.00 79.11  ? 525 GLU D OE2 1 
ATOM   6645 N  N   . GLU D 1 199 ? -35.850 50.606  -20.648 1.00 65.88  ? 526 GLU D N   1 
ATOM   6646 C  CA  . GLU D 1 199 ? -35.441 51.156  -19.364 1.00 67.34  ? 526 GLU D CA  1 
ATOM   6647 C  C   . GLU D 1 199 ? -34.497 50.216  -18.606 1.00 63.55  ? 526 GLU D C   1 
ATOM   6648 O  O   . GLU D 1 199 ? -33.428 50.656  -18.149 1.00 64.29  ? 526 GLU D O   1 
ATOM   6649 C  CB  . GLU D 1 199 ? -36.662 51.554  -18.521 1.00 71.46  ? 526 GLU D CB  1 
ATOM   6650 C  CG  . GLU D 1 199 ? -36.957 53.060  -18.551 1.00 78.36  ? 526 GLU D CG  1 
ATOM   6651 C  CD  . GLU D 1 199 ? -38.440 53.423  -18.429 1.00 82.96  ? 526 GLU D CD  1 
ATOM   6652 O  OE1 . GLU D 1 199 ? -38.802 54.569  -18.797 1.00 87.45  ? 526 GLU D OE1 1 
ATOM   6653 O  OE2 . GLU D 1 199 ? -39.254 52.580  -17.976 1.00 82.74  ? 526 GLU D OE2 1 
ATOM   6654 N  N   . LEU D 1 200 ? -34.873 48.933  -18.515 1.00 58.90  ? 527 LEU D N   1 
ATOM   6655 C  CA  . LEU D 1 200 ? -34.065 47.919  -17.842 1.00 54.91  ? 527 LEU D CA  1 
ATOM   6656 C  C   . LEU D 1 200 ? -32.775 47.597  -18.617 1.00 53.33  ? 527 LEU D C   1 
ATOM   6657 O  O   . LEU D 1 200 ? -31.710 47.407  -18.007 1.00 52.04  ? 527 LEU D O   1 
ATOM   6658 C  CB  . LEU D 1 200 ? -34.891 46.658  -17.551 1.00 52.59  ? 527 LEU D CB  1 
ATOM   6659 C  CG  . LEU D 1 200 ? -34.280 45.461  -16.785 1.00 50.46  ? 527 LEU D CG  1 
ATOM   6660 C  CD1 . LEU D 1 200 ? -33.779 45.805  -15.381 1.00 50.81  ? 527 LEU D CD1 1 
ATOM   6661 C  CD2 . LEU D 1 200 ? -35.263 44.295  -16.727 1.00 49.05  ? 527 LEU D CD2 1 
ATOM   6662 N  N   . GLN D 1 201 ? -32.878 47.567  -19.950 1.00 52.91  ? 528 GLN D N   1 
ATOM   6663 C  CA  . GLN D 1 201 ? -31.732 47.341  -20.841 1.00 51.94  ? 528 GLN D CA  1 
ATOM   6664 C  C   . GLN D 1 201 ? -30.634 48.376  -20.587 1.00 54.26  ? 528 GLN D C   1 
ATOM   6665 O  O   . GLN D 1 201 ? -29.462 48.016  -20.458 1.00 53.01  ? 528 GLN D O   1 
ATOM   6666 C  CB  . GLN D 1 201 ? -32.169 47.369  -22.307 1.00 52.12  ? 528 GLN D CB  1 
ATOM   6667 C  CG  . GLN D 1 201 ? -31.065 47.100  -23.323 1.00 51.84  ? 528 GLN D CG  1 
ATOM   6668 C  CD  . GLN D 1 201 ? -31.459 47.501  -24.735 1.00 53.33  ? 528 GLN D CD  1 
ATOM   6669 O  OE1 . GLN D 1 201 ? -31.573 48.681  -25.044 1.00 56.78  ? 528 GLN D OE1 1 
ATOM   6670 N  NE2 . GLN D 1 201 ? -31.666 46.517  -25.598 1.00 51.67  ? 528 GLN D NE2 1 
ATOM   6671 N  N   . ASN D 1 202 ? -31.025 49.650  -20.498 1.00 57.47  ? 529 ASN D N   1 
ATOM   6672 C  CA  . ASN D 1 202 ? -30.072 50.739  -20.284 1.00 59.94  ? 529 ASN D CA  1 
ATOM   6673 C  C   . ASN D 1 202 ? -29.411 50.710  -18.898 1.00 59.51  ? 529 ASN D C   1 
ATOM   6674 O  O   . ASN D 1 202 ? -28.230 51.034  -18.784 1.00 60.25  ? 529 ASN D O   1 
ATOM   6675 C  CB  . ASN D 1 202 ? -30.693 52.103  -20.630 1.00 63.87  ? 529 ASN D CB  1 
ATOM   6676 C  CG  . ASN D 1 202 ? -30.852 52.311  -22.139 1.00 65.34  ? 529 ASN D CG  1 
ATOM   6677 O  OD1 . ASN D 1 202 ? -30.107 51.743  -22.950 1.00 64.08  ? 529 ASN D OD1 1 
ATOM   6678 N  ND2 . ASN D 1 202 ? -31.830 53.133  -22.524 1.00 67.89  ? 529 ASN D ND2 1 
ATOM   6679 N  N   . LYS D 1 203 ? -30.155 50.281  -17.873 1.00 58.14  ? 530 LYS D N   1 
ATOM   6680 C  CA  . LYS D 1 203 ? -29.612 50.100  -16.515 1.00 57.08  ? 530 LYS D CA  1 
ATOM   6681 C  C   . LYS D 1 203 ? -28.573 48.980  -16.477 1.00 54.35  ? 530 LYS D C   1 
ATOM   6682 O  O   . LYS D 1 203 ? -27.542 49.135  -15.826 1.00 55.61  ? 530 LYS D O   1 
ATOM   6683 C  CB  . LYS D 1 203 ? -30.710 49.774  -15.502 1.00 56.76  ? 530 LYS D CB  1 
ATOM   6684 C  CG  . LYS D 1 203 ? -31.781 50.823  -15.289 1.00 59.91  ? 530 LYS D CG  1 
ATOM   6685 C  CD  . LYS D 1 203 ? -32.767 50.325  -14.250 1.00 59.54  ? 530 LYS D CD  1 
ATOM   6686 C  CE  . LYS D 1 203 ? -33.613 51.465  -13.717 1.00 63.74  ? 530 LYS D CE  1 
ATOM   6687 N  NZ  . LYS D 1 203 ? -34.214 51.074  -12.412 1.00 64.39  ? 530 LYS D NZ  1 
ATOM   6688 N  N   . ILE D 1 204 ? -28.856 47.864  -17.159 1.00 51.12  ? 531 ILE D N   1 
ATOM   6689 C  CA  . ILE D 1 204 ? -27.917 46.730  -17.276 1.00 48.68  ? 531 ILE D CA  1 
ATOM   6690 C  C   . ILE D 1 204 ? -26.635 47.137  -18.042 1.00 50.10  ? 531 ILE D C   1 
ATOM   6691 O  O   . ILE D 1 204 ? -25.514 46.775  -17.622 1.00 50.36  ? 531 ILE D O   1 
ATOM   6692 C  CB  . ILE D 1 204 ? -28.587 45.464  -17.905 1.00 45.97  ? 531 ILE D CB  1 
ATOM   6693 C  CG1 . ILE D 1 204 ? -29.752 44.966  -17.037 1.00 44.58  ? 531 ILE D CG1 1 
ATOM   6694 C  CG2 . ILE D 1 204 ? -27.586 44.325  -18.077 1.00 44.25  ? 531 ILE D CG2 1 
ATOM   6695 C  CD1 . ILE D 1 204 ? -30.779 44.125  -17.772 1.00 42.42  ? 531 ILE D CD1 1 
ATOM   6696 N  N   . VAL D 1 205 ? -26.802 47.903  -19.133 1.00 51.21  ? 532 VAL D N   1 
ATOM   6697 C  CA  . VAL D 1 205 ? -25.681 48.448  -19.925 1.00 52.86  ? 532 VAL D CA  1 
ATOM   6698 C  C   . VAL D 1 205 ? -24.827 49.338  -19.028 1.00 55.54  ? 532 VAL D C   1 
ATOM   6699 O  O   . VAL D 1 205 ? -23.608 49.242  -19.052 1.00 56.12  ? 532 VAL D O   1 
ATOM   6700 C  CB  . VAL D 1 205 ? -26.161 49.215  -21.202 1.00 54.68  ? 532 VAL D CB  1 
ATOM   6701 C  CG1 . VAL D 1 205 ? -25.092 50.138  -21.763 1.00 56.97  ? 532 VAL D CG1 1 
ATOM   6702 C  CG2 . VAL D 1 205 ? -26.594 48.251  -22.295 1.00 52.56  ? 532 VAL D CG2 1 
ATOM   6703 N  N   . ASN D 1 206 ? -25.484 50.174  -18.222 1.00 57.89  ? 533 ASN D N   1 
ATOM   6704 C  CA  . ASN D 1 206 ? -24.809 51.132  -17.341 1.00 61.10  ? 533 ASN D CA  1 
ATOM   6705 C  C   . ASN D 1 206 ? -23.920 50.493  -16.287 1.00 60.53  ? 533 ASN D C   1 
ATOM   6706 O  O   . ASN D 1 206 ? -22.774 50.929  -16.105 1.00 62.35  ? 533 ASN D O   1 
ATOM   6707 C  CB  . ASN D 1 206 ? -25.801 52.107  -16.690 1.00 63.03  ? 533 ASN D CB  1 
ATOM   6708 C  CG  . ASN D 1 206 ? -26.050 53.348  -17.538 1.00 66.78  ? 533 ASN D CG  1 
ATOM   6709 O  OD1 . ASN D 1 206 ? -25.167 53.808  -18.272 1.00 69.21  ? 533 ASN D OD1 1 
ATOM   6710 N  ND2 . ASN D 1 206 ? -27.255 53.908  -17.427 1.00 67.74  ? 533 ASN D ND2 1 
ATOM   6711 N  N   . CYS D 1 207 ? -24.421 49.465  -15.599 1.00 58.44  ? 534 CYS D N   1 
ATOM   6712 C  CA  . CYS D 1 207 ? -23.566 48.806  -14.612 1.00 58.20  ? 534 CYS D CA  1 
ATOM   6713 C  C   . CYS D 1 207 ? -22.526 47.880  -15.252 1.00 56.93  ? 534 CYS D C   1 
ATOM   6714 O  O   . CYS D 1 207 ? -21.473 47.654  -14.665 1.00 57.51  ? 534 CYS D O   1 
ATOM   6715 C  CB  . CYS D 1 207 ? -24.336 48.189  -13.438 1.00 57.11  ? 534 CYS D CB  1 
ATOM   6716 S  SG  . CYS D 1 207 ? -25.619 46.999  -13.842 1.00 55.26  ? 534 CYS D SG  1 
ATOM   6717 N  N   . LEU D 1 208 ? -22.795 47.406  -16.471 1.00 56.00  ? 535 LEU D N   1 
ATOM   6718 C  CA  . LEU D 1 208 ? -21.736 46.816  -17.301 1.00 56.60  ? 535 LEU D CA  1 
ATOM   6719 C  C   . LEU D 1 208 ? -20.599 47.815  -17.598 1.00 60.42  ? 535 LEU D C   1 
ATOM   6720 O  O   . LEU D 1 208 ? -19.419 47.454  -17.466 1.00 60.80  ? 535 LEU D O   1 
ATOM   6721 C  CB  . LEU D 1 208 ? -22.278 46.214  -18.606 1.00 54.66  ? 535 LEU D CB  1 
ATOM   6722 C  CG  . LEU D 1 208 ? -21.240 45.656  -19.598 1.00 55.03  ? 535 LEU D CG  1 
ATOM   6723 C  CD1 . LEU D 1 208 ? -20.435 44.482  -19.032 1.00 54.10  ? 535 LEU D CD1 1 
ATOM   6724 C  CD2 . LEU D 1 208 ? -21.892 45.269  -20.912 1.00 54.48  ? 535 LEU D CD2 1 
ATOM   6725 N  N   . LYS D 1 209 ? -20.964 49.047  -17.987 1.00 63.56  ? 536 LYS D N   1 
ATOM   6726 C  CA  . LYS D 1 209 ? -20.005 50.139  -18.261 1.00 68.52  ? 536 LYS D CA  1 
ATOM   6727 C  C   . LYS D 1 209 ? -19.171 50.471  -17.021 1.00 69.84  ? 536 LYS D C   1 
ATOM   6728 O  O   . LYS D 1 209 ? -17.932 50.422  -17.072 1.00 70.65  ? 536 LYS D O   1 
ATOM   6729 C  CB  . LYS D 1 209 ? -20.703 51.414  -18.777 1.00 72.10  ? 536 LYS D CB  1 
ATOM   6730 C  CG  . LYS D 1 209 ? -21.196 51.379  -20.222 1.00 73.29  ? 536 LYS D CG  1 
ATOM   6731 C  CD  . LYS D 1 209 ? -21.767 52.737  -20.648 1.00 77.42  ? 536 LYS D CD  1 
ATOM   6732 C  CE  . LYS D 1 209 ? -22.370 52.687  -22.050 1.00 78.47  ? 536 LYS D CE  1 
ATOM   6733 N  NZ  . LYS D 1 209 ? -22.871 54.009  -22.527 1.00 82.12  ? 536 LYS D NZ  1 
ATOM   6734 N  N   . ASP D 1 210 ? -19.869 50.791  -15.924 1.00 69.85  ? 537 ASP D N   1 
ATOM   6735 C  CA  . ASP D 1 210 ? -19.265 51.055  -14.610 1.00 71.53  ? 537 ASP D CA  1 
ATOM   6736 C  C   . ASP D 1 210 ? -18.268 49.972  -14.202 1.00 70.44  ? 537 ASP D C   1 
ATOM   6737 O  O   . ASP D 1 210 ? -17.120 50.292  -13.848 1.00 73.52  ? 537 ASP D O   1 
ATOM   6738 C  CB  . ASP D 1 210 ? -20.339 51.187  -13.520 1.00 70.94  ? 537 ASP D CB  1 
ATOM   6739 C  CG  . ASP D 1 210 ? -21.223 52.407  -13.691 1.00 73.50  ? 537 ASP D CG  1 
ATOM   6740 O  OD1 . ASP D 1 210 ? -20.737 53.474  -14.139 1.00 77.19  ? 537 ASP D OD1 1 
ATOM   6741 O  OD2 . ASP D 1 210 ? -22.419 52.294  -13.344 1.00 72.74  ? 537 ASP D OD2 1 
ATOM   6742 N  N   . HIS D 1 211 ? -18.701 48.709  -14.282 1.00 66.42  ? 538 HIS D N   1 
ATOM   6743 C  CA  . HIS D 1 211 ? -17.884 47.571  -13.860 1.00 65.59  ? 538 HIS D CA  1 
ATOM   6744 C  C   . HIS D 1 211 ? -16.623 47.360  -14.696 1.00 66.74  ? 538 HIS D C   1 
ATOM   6745 O  O   . HIS D 1 211 ? -15.587 46.979  -14.149 1.00 67.97  ? 538 HIS D O   1 
ATOM   6746 C  CB  . HIS D 1 211 ? -18.692 46.263  -13.795 1.00 62.31  ? 538 HIS D CB  1 
ATOM   6747 C  CG  . HIS D 1 211 ? -17.898 45.107  -13.269 1.00 61.80  ? 538 HIS D CG  1 
ATOM   6748 N  ND1 . HIS D 1 211 ? -17.236 44.224  -14.095 1.00 61.65  ? 538 HIS D ND1 1 
ATOM   6749 C  CD2 . HIS D 1 211 ? -17.610 44.725  -12.002 1.00 61.91  ? 538 HIS D CD2 1 
ATOM   6750 C  CE1 . HIS D 1 211 ? -16.591 43.338  -13.358 1.00 61.78  ? 538 HIS D CE1 1 
ATOM   6751 N  NE2 . HIS D 1 211 ? -16.802 43.618  -12.085 1.00 61.73  ? 538 HIS D NE2 1 
ATOM   6752 N  N   . VAL D 1 212 ? -16.713 47.580  -16.007 1.00 67.24  ? 539 VAL D N   1 
ATOM   6753 C  CA  . VAL D 1 212 ? -15.539 47.460  -16.875 1.00 69.72  ? 539 VAL D CA  1 
ATOM   6754 C  C   . VAL D 1 212 ? -14.508 48.549  -16.529 1.00 74.19  ? 539 VAL D C   1 
ATOM   6755 O  O   . VAL D 1 212 ? -13.311 48.275  -16.578 1.00 75.08  ? 539 VAL D O   1 
ATOM   6756 C  CB  . VAL D 1 212 ? -15.895 47.383  -18.390 1.00 69.58  ? 539 VAL D CB  1 
ATOM   6757 C  CG1 . VAL D 1 212 ? -14.656 47.509  -19.280 1.00 73.25  ? 539 VAL D CG1 1 
ATOM   6758 C  CG2 . VAL D 1 212 ? -16.599 46.070  -18.711 1.00 66.06  ? 539 VAL D CG2 1 
ATOM   6759 N  N   . THR D 1 213 ? -14.978 49.743  -16.143 1.00 76.71  ? 540 THR D N   1 
ATOM   6760 C  CA  . THR D 1 213 ? -14.099 50.835  -15.684 1.00 83.08  ? 540 THR D CA  1 
ATOM   6761 C  C   . THR D 1 213 ? -13.447 50.521  -14.327 1.00 85.27  ? 540 THR D C   1 
ATOM   6762 O  O   . THR D 1 213 ? -12.260 50.834  -14.116 1.00 87.78  ? 540 THR D O   1 
ATOM   6763 C  CB  . THR D 1 213 ? -14.821 52.205  -15.601 1.00 84.63  ? 540 THR D CB  1 
ATOM   6764 O  OG1 . THR D 1 213 ? -15.771 52.327  -16.666 1.00 83.75  ? 540 THR D OG1 1 
ATOM   6765 C  CG2 . THR D 1 213 ? -13.816 53.359  -15.690 1.00 88.15  ? 540 THR D CG2 1 
ATOM   6766 N  N   . PHE D 1 214 ? -14.224 49.900  -13.430 1.00 84.47  ? 541 PHE D N   1 
ATOM   6767 C  CA  . PHE D 1 214 ? -13.754 49.478  -12.097 1.00 87.10  ? 541 PHE D CA  1 
ATOM   6768 C  C   . PHE D 1 214 ? -12.608 48.451  -12.163 1.00 89.07  ? 541 PHE D C   1 
ATOM   6769 O  O   . PHE D 1 214 ? -11.774 48.395  -11.257 1.00 91.85  ? 541 PHE D O   1 
ATOM   6770 C  CB  . PHE D 1 214 ? -14.936 48.985  -11.237 1.00 84.66  ? 541 PHE D CB  1 
ATOM   6771 C  CG  . PHE D 1 214 ? -14.547 48.462  -9.869  1.00 85.08  ? 541 PHE D CG  1 
ATOM   6772 C  CD1 . PHE D 1 214 ? -14.212 49.342  -8.828  1.00 87.25  ? 541 PHE D CD1 1 
ATOM   6773 C  CD2 . PHE D 1 214 ? -14.536 47.076  -9.612  1.00 82.96  ? 541 PHE D CD2 1 
ATOM   6774 C  CE1 . PHE D 1 214 ? -13.865 48.852  -7.572  1.00 87.62  ? 541 PHE D CE1 1 
ATOM   6775 C  CE2 . PHE D 1 214 ? -14.189 46.585  -8.353  1.00 82.99  ? 541 PHE D CE2 1 
ATOM   6776 C  CZ  . PHE D 1 214 ? -13.855 47.475  -7.334  1.00 85.21  ? 541 PHE D CZ  1 
ATOM   6777 N  N   . ASN D 1 215 ? -12.569 47.666  -13.243 1.00 89.19  ? 542 ASN D N   1 
ATOM   6778 C  CA  . ASN D 1 215 ? -11.398 46.853  -13.612 1.00 91.76  ? 542 ASN D CA  1 
ATOM   6779 C  C   . ASN D 1 215 ? -10.226 47.691  -14.187 1.00 96.29  ? 542 ASN D C   1 
ATOM   6780 O  O   . ASN D 1 215 ? -9.638  47.320  -15.210 1.00 96.80  ? 542 ASN D O   1 
ATOM   6781 C  CB  . ASN D 1 215 ? -11.812 45.748  -14.599 1.00 90.44  ? 542 ASN D CB  1 
ATOM   6782 C  CG  . ASN D 1 215 ? -12.352 44.512  -13.907 1.00 88.20  ? 542 ASN D CG  1 
ATOM   6783 O  OD1 . ASN D 1 215 ? -13.364 44.565  -13.205 1.00 87.33  ? 542 ASN D OD1 1 
ATOM   6784 N  ND2 . ASN D 1 215 ? -11.681 43.382  -14.114 1.00 88.27  ? 542 ASN D ND2 1 
ATOM   6785 N  N   . ASN D 1 216 ? -9.923  48.818  -13.526 1.00 99.90  ? 543 ASN D N   1 
ATOM   6786 C  CA  . ASN D 1 216 ? -8.750  49.677  -13.785 1.00 104.83 ? 543 ASN D CA  1 
ATOM   6787 C  C   . ASN D 1 216 ? -8.396  50.493  -12.542 1.00 106.95 ? 543 ASN D C   1 
ATOM   6788 O  O   . ASN D 1 216 ? -9.221  51.252  -12.022 1.00 105.75 ? 543 ASN D O   1 
ATOM   6789 C  CB  . ASN D 1 216 ? -8.972  50.626  -14.974 1.00 107.77 ? 543 ASN D CB  1 
ATOM   6790 C  CG  . ASN D 1 216 ? -8.503  50.042  -16.301 1.00 109.82 ? 543 ASN D CG  1 
ATOM   6791 O  OD1 . ASN D 1 216 ? -7.779  49.043  -16.346 1.00 110.29 ? 543 ASN D OD1 1 
ATOM   6792 N  ND2 . ASN D 1 216 ? -8.911  50.676  -17.398 1.00 111.23 ? 543 ASN D ND2 1 
ATOM   6793 N  N   . PRO D 1 222 ? -12.446 50.381  -22.854 1.00 89.53  ? 549 PRO D N   1 
ATOM   6794 C  CA  . PRO D 1 222 ? -12.978 51.302  -23.865 1.00 91.79  ? 549 PRO D CA  1 
ATOM   6795 C  C   . PRO D 1 222 ? -13.349 50.632  -25.214 1.00 90.98  ? 549 PRO D C   1 
ATOM   6796 O  O   . PRO D 1 222 ? -14.541 50.501  -25.506 1.00 88.19  ? 549 PRO D O   1 
ATOM   6797 C  CB  . PRO D 1 222 ? -11.866 52.342  -23.984 1.00 96.18  ? 549 PRO D CB  1 
ATOM   6798 C  CG  . PRO D 1 222 ? -11.317 52.411  -22.585 1.00 96.46  ? 549 PRO D CG  1 
ATOM   6799 C  CD  . PRO D 1 222 ? -11.578 51.088  -21.897 1.00 91.78  ? 549 PRO D CD  1 
ATOM   6800 N  N   . ASN D 1 223 ? -12.361 50.209  -26.011 1.00 93.51  ? 550 ASN D N   1 
ATOM   6801 C  CA  . ASN D 1 223 ? -12.611 49.371  -27.202 1.00 92.45  ? 550 ASN D CA  1 
ATOM   6802 C  C   . ASN D 1 223 ? -13.077 47.952  -26.829 1.00 88.12  ? 550 ASN D C   1 
ATOM   6803 O  O   . ASN D 1 223 ? -13.750 47.282  -27.624 1.00 86.06  ? 550 ASN D O   1 
ATOM   6804 C  CB  . ASN D 1 223 ? -11.372 49.297  -28.105 1.00 96.58  ? 550 ASN D CB  1 
ATOM   6805 C  CG  . ASN D 1 223 ? -11.253 50.486  -29.052 1.00 101.29 ? 550 ASN D CG  1 
ATOM   6806 O  OD1 . ASN D 1 223 ? -10.358 51.324  -28.910 1.00 104.98 ? 550 ASN D OD1 1 
ATOM   6807 N  ND2 . ASN D 1 223 ? -12.149 50.556  -30.031 1.00 100.98 ? 550 ASN D ND2 1 
ATOM   6808 N  N   . TYR D 1 224 ? -12.705 47.513  -25.622 1.00 86.77  ? 551 TYR D N   1 
ATOM   6809 C  CA  . TYR D 1 224 ? -13.078 46.203  -25.061 1.00 82.78  ? 551 TYR D CA  1 
ATOM   6810 C  C   . TYR D 1 224 ? -14.604 46.061  -24.894 1.00 78.32  ? 551 TYR D C   1 
ATOM   6811 O  O   . TYR D 1 224 ? -15.182 45.038  -25.281 1.00 74.86  ? 551 TYR D O   1 
ATOM   6812 C  CB  . TYR D 1 224 ? -12.325 45.961  -23.729 1.00 83.16  ? 551 TYR D CB  1 
ATOM   6813 C  CG  . TYR D 1 224 ? -12.652 44.659  -23.015 1.00 80.05  ? 551 TYR D CG  1 
ATOM   6814 C  CD1 . TYR D 1 224 ? -12.184 43.429  -23.504 1.00 80.14  ? 551 TYR D CD1 1 
ATOM   6815 C  CD2 . TYR D 1 224 ? -13.424 44.656  -21.840 1.00 77.31  ? 551 TYR D CD2 1 
ATOM   6816 C  CE1 . TYR D 1 224 ? -12.488 42.237  -22.853 1.00 77.09  ? 551 TYR D CE1 1 
ATOM   6817 C  CE2 . TYR D 1 224 ? -13.727 43.467  -21.178 1.00 74.45  ? 551 TYR D CE2 1 
ATOM   6818 C  CZ  . TYR D 1 224 ? -13.256 42.262  -21.688 1.00 74.37  ? 551 TYR D CZ  1 
ATOM   6819 O  OH  . TYR D 1 224 ? -13.556 41.085  -21.043 1.00 71.21  ? 551 TYR D OH  1 
ATOM   6820 N  N   . LEU D 1 225 ? -15.225 47.104  -24.334 1.00 77.99  ? 552 LEU D N   1 
ATOM   6821 C  CA  . LEU D 1 225 ? -16.674 47.229  -24.182 1.00 74.83  ? 552 LEU D CA  1 
ATOM   6822 C  C   . LEU D 1 225 ? -17.405 47.025  -25.510 1.00 74.00  ? 552 LEU D C   1 
ATOM   6823 O  O   . LEU D 1 225 ? -18.364 46.256  -25.577 1.00 70.04  ? 552 LEU D O   1 
ATOM   6824 C  CB  . LEU D 1 225 ? -17.022 48.609  -23.601 1.00 76.71  ? 552 LEU D CB  1 
ATOM   6825 C  CG  . LEU D 1 225 ? -18.255 48.835  -22.709 1.00 74.75  ? 552 LEU D CG  1 
ATOM   6826 C  CD1 . LEU D 1 225 ? -18.028 50.091  -21.875 1.00 77.40  ? 552 LEU D CD1 1 
ATOM   6827 C  CD2 . LEU D 1 225 ? -19.553 48.959  -23.490 1.00 73.15  ? 552 LEU D CD2 1 
ATOM   6828 N  N   . SER D 1 226 ? -16.940 47.708  -26.556 1.00 76.92  ? 553 SER D N   1 
ATOM   6829 C  CA  . SER D 1 226 ? -17.606 47.677  -27.856 1.00 77.60  ? 553 SER D CA  1 
ATOM   6830 C  C   . SER D 1 226 ? -17.546 46.285  -28.518 1.00 76.06  ? 553 SER D C   1 
ATOM   6831 O  O   . SER D 1 226 ? -18.513 45.863  -29.167 1.00 74.54  ? 553 SER D O   1 
ATOM   6832 C  CB  . SER D 1 226 ? -17.082 48.789  -28.781 1.00 81.50  ? 553 SER D CB  1 
ATOM   6833 O  OG  . SER D 1 226 ? -15.805 48.479  -29.301 1.00 83.83  ? 553 SER D OG  1 
ATOM   6834 N  N   . LYS D 1 227 ? -16.423 45.587  -28.336 1.00 77.14  ? 554 LYS D N   1 
ATOM   6835 C  CA  . LYS D 1 227 ? -16.259 44.203  -28.809 1.00 75.69  ? 554 LYS D CA  1 
ATOM   6836 C  C   . LYS D 1 227 ? -17.039 43.237  -27.929 1.00 71.30  ? 554 LYS D C   1 
ATOM   6837 O  O   . LYS D 1 227 ? -17.470 42.178  -28.403 1.00 70.01  ? 554 LYS D O   1 
ATOM   6838 C  CB  . LYS D 1 227 ? -14.781 43.796  -28.863 1.00 78.90  ? 554 LYS D CB  1 
ATOM   6839 C  CG  . LYS D 1 227 ? -13.992 44.413  -30.011 1.00 84.13  ? 554 LYS D CG  1 
ATOM   6840 C  CD  . LYS D 1 227 ? -12.527 43.997  -29.971 1.00 87.40  ? 554 LYS D CD  1 
ATOM   6841 C  CE  . LYS D 1 227 ? -11.676 44.885  -30.863 1.00 92.41  ? 554 LYS D CE  1 
ATOM   6842 N  NZ  . LYS D 1 227 ? -10.229 44.596  -30.680 1.00 96.12  ? 554 LYS D NZ  1 
ATOM   6843 N  N   . LEU D 1 228 ? -17.206 43.612  -26.655 1.00 69.27  ? 555 LEU D N   1 
ATOM   6844 C  CA  . LEU D 1 228 ? -18.001 42.858  -25.675 1.00 64.98  ? 555 LEU D CA  1 
ATOM   6845 C  C   . LEU D 1 228 ? -19.507 42.894  -25.997 1.00 61.51  ? 555 LEU D C   1 
ATOM   6846 O  O   . LEU D 1 228 ? -20.164 41.849  -25.989 1.00 59.15  ? 555 LEU D O   1 
ATOM   6847 C  CB  . LEU D 1 228 ? -17.722 43.372  -24.255 1.00 65.44  ? 555 LEU D CB  1 
ATOM   6848 C  CG  . LEU D 1 228 ? -17.937 42.516  -23.011 1.00 63.85  ? 555 LEU D CG  1 
ATOM   6849 C  CD1 . LEU D 1 228 ? -17.014 41.312  -23.013 1.00 64.73  ? 555 LEU D CD1 1 
ATOM   6850 C  CD2 . LEU D 1 228 ? -17.702 43.353  -21.759 1.00 64.51  ? 555 LEU D CD2 1 
ATOM   6851 N  N   . LEU D 1 229 ? -20.040 44.085  -26.289 1.00 61.43  ? 556 LEU D N   1 
ATOM   6852 C  CA  . LEU D 1 229 ? -21.417 44.224  -26.795 1.00 59.54  ? 556 LEU D CA  1 
ATOM   6853 C  C   . LEU D 1 229 ? -21.550 43.718  -28.232 1.00 59.66  ? 556 LEU D C   1 
ATOM   6854 O  O   . LEU D 1 229 ? -22.627 43.290  -28.645 1.00 57.25  ? 556 LEU D O   1 
ATOM   6855 C  CB  . LEU D 1 229 ? -21.910 45.667  -26.702 1.00 61.03  ? 556 LEU D CB  1 
ATOM   6856 C  CG  . LEU D 1 229 ? -22.016 46.349  -25.335 1.00 60.77  ? 556 LEU D CG  1 
ATOM   6857 C  CD1 . LEU D 1 229 ? -22.454 47.791  -25.530 1.00 62.71  ? 556 LEU D CD1 1 
ATOM   6858 C  CD2 . LEU D 1 229 ? -22.966 45.620  -24.394 1.00 57.49  ? 556 LEU D CD2 1 
ATOM   6859 N  N   . GLY D 1 230 ? -20.441 43.765  -28.976 1.00 61.86  ? 557 GLY D N   1 
ATOM   6860 C  CA  . GLY D 1 230 ? -20.321 43.113  -30.280 1.00 62.26  ? 557 GLY D CA  1 
ATOM   6861 C  C   . GLY D 1 230 ? -20.535 41.607  -30.248 1.00 59.88  ? 557 GLY D C   1 
ATOM   6862 O  O   . GLY D 1 230 ? -20.767 40.992  -31.287 1.00 60.02  ? 557 GLY D O   1 
ATOM   6863 N  N   . LYS D 1 231 ? -20.462 41.007  -29.059 1.00 57.88  ? 558 LYS D N   1 
ATOM   6864 C  CA  . LYS D 1 231 ? -20.726 39.583  -28.910 1.00 56.13  ? 558 LYS D CA  1 
ATOM   6865 C  C   . LYS D 1 231 ? -22.218 39.257  -29.009 1.00 54.01  ? 558 LYS D C   1 
ATOM   6866 O  O   . LYS D 1 231 ? -22.580 38.105  -29.274 1.00 53.29  ? 558 LYS D O   1 
ATOM   6867 C  CB  . LYS D 1 231 ? -20.127 39.036  -27.603 1.00 56.06  ? 558 LYS D CB  1 
ATOM   6868 C  CG  . LYS D 1 231 ? -18.605 38.926  -27.606 1.00 57.98  ? 558 LYS D CG  1 
ATOM   6869 C  CD  . LYS D 1 231 ? -18.131 37.755  -28.450 1.00 58.97  ? 558 LYS D CD  1 
ATOM   6870 C  CE  . LYS D 1 231 ? -16.944 38.181  -29.301 1.00 63.54  ? 558 LYS D CE  1 
ATOM   6871 N  NZ  . LYS D 1 231 ? -16.498 37.080  -30.190 1.00 65.29  ? 558 LYS D NZ  1 
ATOM   6872 N  N   . LEU D 1 232 ? -23.079 40.258  -28.809 1.00 53.61  ? 559 LEU D N   1 
ATOM   6873 C  CA  . LEU D 1 232 ? -24.527 40.064  -28.960 1.00 51.91  ? 559 LEU D CA  1 
ATOM   6874 C  C   . LEU D 1 232 ? -24.976 39.816  -30.415 1.00 53.14  ? 559 LEU D C   1 
ATOM   6875 O  O   . LEU D 1 232 ? -25.615 38.793  -30.669 1.00 50.89  ? 559 LEU D O   1 
ATOM   6876 C  CB  . LEU D 1 232 ? -25.338 41.175  -28.273 1.00 51.69  ? 559 LEU D CB  1 
ATOM   6877 C  CG  . LEU D 1 232 ? -25.217 41.265  -26.741 1.00 50.00  ? 559 LEU D CG  1 
ATOM   6878 C  CD1 . LEU D 1 232 ? -25.928 42.509  -26.244 1.00 50.32  ? 559 LEU D CD1 1 
ATOM   6879 C  CD2 . LEU D 1 232 ? -25.737 40.018  -26.033 1.00 46.79  ? 559 LEU D CD2 1 
ATOM   6880 N  N   . PRO D 1 233 ? -24.611 40.712  -31.379 1.00 56.33  ? 560 PRO D N   1 
ATOM   6881 C  CA  . PRO D 1 233 ? -24.967 40.390  -32.770 1.00 57.22  ? 560 PRO D CA  1 
ATOM   6882 C  C   . PRO D 1 233 ? -24.334 39.079  -33.275 1.00 57.13  ? 560 PRO D C   1 
ATOM   6883 O  O   . PRO D 1 233 ? -24.945 38.382  -34.088 1.00 57.27  ? 560 PRO D O   1 
ATOM   6884 C  CB  . PRO D 1 233 ? -24.429 41.590  -33.566 1.00 61.35  ? 560 PRO D CB  1 
ATOM   6885 C  CG  . PRO D 1 233 ? -24.270 42.692  -32.569 1.00 61.57  ? 560 PRO D CG  1 
ATOM   6886 C  CD  . PRO D 1 233 ? -23.880 41.995  -31.305 1.00 58.96  ? 560 PRO D CD  1 
ATOM   6887 N  N   . GLU D 1 234 ? -23.137 38.742  -32.785 1.00 57.52  ? 561 GLU D N   1 
ATOM   6888 C  CA  . GLU D 1 234 ? -22.504 37.446  -33.086 1.00 56.59  ? 561 GLU D CA  1 
ATOM   6889 C  C   . GLU D 1 234 ? -23.309 36.290  -32.517 1.00 53.13  ? 561 GLU D C   1 
ATOM   6890 O  O   . GLU D 1 234 ? -23.426 35.237  -33.159 1.00 53.07  ? 561 GLU D O   1 
ATOM   6891 C  CB  . GLU D 1 234 ? -21.066 37.391  -32.575 1.00 58.85  ? 561 GLU D CB  1 
ATOM   6892 C  CG  . GLU D 1 234 ? -20.053 38.121  -33.457 1.00 62.61  ? 561 GLU D CG  1 
ATOM   6893 C  CD  . GLU D 1 234 ? -18.603 37.916  -33.020 1.00 64.73  ? 561 GLU D CD  1 
ATOM   6894 O  OE1 . GLU D 1 234 ? -17.738 38.680  -33.510 1.00 68.20  ? 561 GLU D OE1 1 
ATOM   6895 O  OE2 . GLU D 1 234 ? -18.318 36.997  -32.205 1.00 62.70  ? 561 GLU D OE2 1 
ATOM   6896 N  N   . LEU D 1 235 ? -23.876 36.503  -31.325 1.00 50.26  ? 562 LEU D N   1 
ATOM   6897 C  CA  . LEU D 1 235 ? -24.773 35.533  -30.683 1.00 47.42  ? 562 LEU D CA  1 
ATOM   6898 C  C   . LEU D 1 235 ? -26.062 35.314  -31.503 1.00 46.02  ? 562 LEU D C   1 
ATOM   6899 O  O   . LEU D 1 235 ? -26.505 34.170  -31.680 1.00 44.28  ? 562 LEU D O   1 
ATOM   6900 C  CB  . LEU D 1 235 ? -25.076 35.958  -29.227 1.00 45.76  ? 562 LEU D CB  1 
ATOM   6901 C  CG  . LEU D 1 235 ? -25.852 35.069  -28.254 1.00 43.15  ? 562 LEU D CG  1 
ATOM   6902 C  CD1 . LEU D 1 235 ? -25.327 33.641  -28.246 1.00 43.13  ? 562 LEU D CD1 1 
ATOM   6903 C  CD2 . LEU D 1 235 ? -25.792 35.673  -26.858 1.00 42.57  ? 562 LEU D CD2 1 
ATOM   6904 N  N   . ARG D 1 236 ? -26.617 36.414  -32.017 1.00 46.93  ? 563 ARG D N   1 
ATOM   6905 C  CA  . ARG D 1 236 ? -27.812 36.400  -32.854 1.00 48.00  ? 563 ARG D CA  1 
ATOM   6906 C  C   . ARG D 1 236 ? -27.594 35.569  -34.127 1.00 49.07  ? 563 ARG D C   1 
ATOM   6907 O  O   . ARG D 1 236 ? -28.445 34.739  -34.472 1.00 47.18  ? 563 ARG D O   1 
ATOM   6908 C  CB  . ARG D 1 236 ? -28.259 37.845  -33.155 1.00 51.03  ? 563 ARG D CB  1 
ATOM   6909 C  CG  . ARG D 1 236 ? -29.629 38.047  -33.823 1.00 52.82  ? 563 ARG D CG  1 
ATOM   6910 C  CD  . ARG D 1 236 ? -30.849 37.717  -32.956 1.00 53.00  ? 563 ARG D CD  1 
ATOM   6911 N  NE  . ARG D 1 236 ? -30.905 38.442  -31.674 1.00 54.11  ? 563 ARG D NE  1 
ATOM   6912 C  CZ  . ARG D 1 236 ? -31.497 39.623  -31.473 1.00 55.79  ? 563 ARG D CZ  1 
ATOM   6913 N  NH1 . ARG D 1 236 ? -32.104 40.273  -32.462 1.00 58.13  ? 563 ARG D NH1 1 
ATOM   6914 N  NH2 . ARG D 1 236 ? -31.473 40.169  -30.264 1.00 55.70  ? 563 ARG D NH2 1 
ATOM   6915 N  N   . THR D 1 237 ? -26.445 35.769  -34.786 1.00 51.77  ? 564 THR D N   1 
ATOM   6916 C  CA  . THR D 1 237 ? -26.032 34.966  -35.953 1.00 54.52  ? 564 THR D CA  1 
ATOM   6917 C  C   . THR D 1 237 ? -25.975 33.462  -35.606 1.00 53.59  ? 564 THR D C   1 
ATOM   6918 O  O   . THR D 1 237 ? -26.514 32.632  -36.344 1.00 53.85  ? 564 THR D O   1 
ATOM   6919 C  CB  . THR D 1 237 ? -24.673 35.442  -36.543 1.00 58.14  ? 564 THR D CB  1 
ATOM   6920 O  OG1 . THR D 1 237 ? -24.744 36.834  -36.893 1.00 60.75  ? 564 THR D OG1 1 
ATOM   6921 C  CG2 . THR D 1 237 ? -24.277 34.637  -37.790 1.00 59.86  ? 564 THR D CG2 1 
ATOM   6922 N  N   . LEU D 1 238 ? -25.334 33.125  -34.486 1.00 53.14  ? 565 LEU D N   1 
ATOM   6923 C  CA  . LEU D 1 238 ? -25.289 31.741  -33.997 1.00 52.96  ? 565 LEU D CA  1 
ATOM   6924 C  C   . LEU D 1 238 ? -26.650 31.144  -33.706 1.00 50.45  ? 565 LEU D C   1 
ATOM   6925 O  O   . LEU D 1 238 ? -26.846 29.951  -33.898 1.00 50.53  ? 565 LEU D O   1 
ATOM   6926 C  CB  . LEU D 1 238 ? -24.466 31.644  -32.721 1.00 53.77  ? 565 LEU D CB  1 
ATOM   6927 C  CG  . LEU D 1 238 ? -22.970 31.496  -32.849 1.00 57.32  ? 565 LEU D CG  1 
ATOM   6928 C  CD1 . LEU D 1 238 ? -22.471 31.624  -31.431 1.00 57.76  ? 565 LEU D CD1 1 
ATOM   6929 C  CD2 . LEU D 1 238 ? -22.563 30.153  -33.446 1.00 58.95  ? 565 LEU D CD2 1 
ATOM   6930 N  N   . CYS D 1 239 ? -27.564 31.971  -33.206 1.00 49.51  ? 566 CYS D N   1 
ATOM   6931 C  CA  . CYS D 1 239 ? -28.937 31.563  -32.984 1.00 48.74  ? 566 CYS D CA  1 
ATOM   6932 C  C   . CYS D 1 239 ? -29.610 31.114  -34.277 1.00 48.14  ? 566 CYS D C   1 
ATOM   6933 O  O   . CYS D 1 239 ? -30.210 30.037  -34.334 1.00 45.43  ? 566 CYS D O   1 
ATOM   6934 C  CB  . CYS D 1 239 ? -29.722 32.709  -32.366 1.00 49.99  ? 566 CYS D CB  1 
ATOM   6935 S  SG  . CYS D 1 239 ? -31.470 32.327  -32.136 1.00 53.60  ? 566 CYS D SG  1 
ATOM   6936 N  N   . THR D 1 240 ? -29.474 31.947  -35.310 1.00 49.53  ? 567 THR D N   1 
ATOM   6937 C  CA  . THR D 1 240 ? -30.062 31.704  -36.624 1.00 50.96  ? 567 THR D CA  1 
ATOM   6938 C  C   . THR D 1 240 ? -29.578 30.357  -37.176 1.00 51.87  ? 567 THR D C   1 
ATOM   6939 O  O   . THR D 1 240 ? -30.376 29.587  -37.731 1.00 51.20  ? 567 THR D O   1 
ATOM   6940 C  CB  . THR D 1 240 ? -29.703 32.848  -37.587 1.00 53.86  ? 567 THR D CB  1 
ATOM   6941 O  OG1 . THR D 1 240 ? -30.001 34.096  -36.957 1.00 54.24  ? 567 THR D OG1 1 
ATOM   6942 C  CG2 . THR D 1 240 ? -30.491 32.756  -38.889 1.00 56.70  ? 567 THR D CG2 1 
ATOM   6943 N  N   . GLN D 1 241 ? -28.287 30.071  -36.979 1.00 51.53  ? 568 GLN D N   1 
ATOM   6944 C  CA  . GLN D 1 241 ? -27.686 28.806  -37.392 1.00 53.15  ? 568 GLN D CA  1 
ATOM   6945 C  C   . GLN D 1 241 ? -28.302 27.597  -36.695 1.00 50.03  ? 568 GLN D C   1 
ATOM   6946 O  O   . GLN D 1 241 ? -28.465 26.547  -37.317 1.00 51.26  ? 568 GLN D O   1 
ATOM   6947 C  CB  . GLN D 1 241 ? -26.170 28.831  -37.184 1.00 56.21  ? 568 GLN D CB  1 
ATOM   6948 C  CG  . GLN D 1 241 ? -25.432 27.711  -37.898 1.00 60.39  ? 568 GLN D CG  1 
ATOM   6949 C  CD  . GLN D 1 241 ? -23.932 27.922  -37.906 1.00 65.34  ? 568 GLN D CD  1 
ATOM   6950 O  OE1 . GLN D 1 241 ? -23.405 28.806  -37.211 1.00 66.42  ? 568 GLN D OE1 1 
ATOM   6951 N  NE2 . GLN D 1 241 ? -23.232 27.115  -38.696 1.00 67.83  ? 568 GLN D NE2 1 
ATOM   6952 N  N   . GLY D 1 242 ? -28.636 27.758  -35.418 1.00 47.06  ? 569 GLY D N   1 
ATOM   6953 C  CA  . GLY D 1 242 ? -29.325 26.731  -34.636 1.00 44.93  ? 569 GLY D CA  1 
ATOM   6954 C  C   . GLY D 1 242 ? -30.794 26.579  -34.955 1.00 43.34  ? 569 GLY D C   1 
ATOM   6955 O  O   . GLY D 1 242 ? -31.281 25.451  -35.103 1.00 43.24  ? 569 GLY D O   1 
ATOM   6956 N  N   . LEU D 1 243 ? -31.500 27.710  -35.043 1.00 42.02  ? 570 LEU D N   1 
ATOM   6957 C  CA  . LEU D 1 243 ? -32.894 27.735  -35.518 1.00 42.05  ? 570 LEU D CA  1 
ATOM   6958 C  C   . LEU D 1 243 ? -33.044 27.005  -36.869 1.00 43.16  ? 570 LEU D C   1 
ATOM   6959 O  O   . LEU D 1 243 ? -34.010 26.259  -37.072 1.00 43.35  ? 570 LEU D O   1 
ATOM   6960 C  CB  . LEU D 1 243 ? -33.404 29.177  -35.644 1.00 42.16  ? 570 LEU D CB  1 
ATOM   6961 C  CG  . LEU D 1 243 ? -34.914 29.397  -35.463 1.00 41.37  ? 570 LEU D CG  1 
ATOM   6962 C  CD1 . LEU D 1 243 ? -35.323 29.031  -34.047 1.00 40.02  ? 570 LEU D CD1 1 
ATOM   6963 C  CD2 . LEU D 1 243 ? -35.284 30.845  -35.767 1.00 41.37  ? 570 LEU D CD2 1 
ATOM   6964 N  N   . GLN D 1 244 ? -32.047 27.195  -37.741 1.00 43.37  ? 571 GLN D N   1 
ATOM   6965 C  CA  . GLN D 1 244 ? -31.940 26.545  -39.044 1.00 44.84  ? 571 GLN D CA  1 
ATOM   6966 C  C   . GLN D 1 244 ? -31.867 25.018  -38.970 1.00 45.61  ? 571 GLN D C   1 
ATOM   6967 O  O   . GLN D 1 244 ? -32.524 24.327  -39.772 1.00 46.71  ? 571 GLN D O   1 
ATOM   6968 C  CB  . GLN D 1 244 ? -30.740 27.105  -39.794 1.00 46.39  ? 571 GLN D CB  1 
ATOM   6969 C  CG  . GLN D 1 244 ? -30.432 26.389  -41.091 1.00 48.83  ? 571 GLN D CG  1 
ATOM   6970 C  CD  . GLN D 1 244 ? -29.094 26.756  -41.634 1.00 50.31  ? 571 GLN D CD  1 
ATOM   6971 O  OE1 . GLN D 1 244 ? -28.992 27.266  -42.742 1.00 52.08  ? 571 GLN D OE1 1 
ATOM   6972 N  NE2 . GLN D 1 244 ? -28.055 26.536  -40.847 1.00 50.38  ? 571 GLN D NE2 1 
ATOM   6973 N  N   . ARG D 1 245 ? -31.078 24.508  -38.014 1.00 45.15  ? 572 ARG D N   1 
ATOM   6974 C  CA  . ARG D 1 245 ? -30.980 23.066  -37.716 1.00 45.31  ? 572 ARG D CA  1 
ATOM   6975 C  C   . ARG D 1 245 ? -32.313 22.486  -37.217 1.00 43.52  ? 572 ARG D C   1 
ATOM   6976 O  O   . ARG D 1 245 ? -32.725 21.391  -37.634 1.00 44.37  ? 572 ARG D O   1 
ATOM   6977 C  CB  . ARG D 1 245 ? -29.844 22.810  -36.709 1.00 45.85  ? 572 ARG D CB  1 
ATOM   6978 C  CG  . ARG D 1 245 ? -29.688 21.371  -36.208 1.00 46.93  ? 572 ARG D CG  1 
ATOM   6979 C  CD  . ARG D 1 245 ? -29.083 20.426  -37.246 1.00 49.77  ? 572 ARG D CD  1 
ATOM   6980 N  NE  . ARG D 1 245 ? -28.922 19.082  -36.684 1.00 51.48  ? 572 ARG D NE  1 
ATOM   6981 C  CZ  . ARG D 1 245 ? -28.915 17.939  -37.368 1.00 53.84  ? 572 ARG D CZ  1 
ATOM   6982 N  NH1 . ARG D 1 245 ? -29.082 17.911  -38.696 1.00 55.36  ? 572 ARG D NH1 1 
ATOM   6983 N  NH2 . ARG D 1 245 ? -28.754 16.803  -36.702 1.00 55.04  ? 572 ARG D NH2 1 
ATOM   6984 N  N   . ILE D 1 246 ? -32.981 23.239  -36.346 1.00 41.20  ? 573 ILE D N   1 
ATOM   6985 C  CA  . ILE D 1 246 ? -34.286 22.855  -35.800 1.00 40.26  ? 573 ILE D CA  1 
ATOM   6986 C  C   . ILE D 1 246 ? -35.321 22.782  -36.910 1.00 40.90  ? 573 ILE D C   1 
ATOM   6987 O  O   . ILE D 1 246 ? -36.087 21.817  -36.969 1.00 42.37  ? 573 ILE D O   1 
ATOM   6988 C  CB  . ILE D 1 246 ? -34.728 23.814  -34.670 1.00 38.54  ? 573 ILE D CB  1 
ATOM   6989 C  CG1 . ILE D 1 246 ? -33.901 23.521  -33.417 1.00 38.70  ? 573 ILE D CG1 1 
ATOM   6990 C  CG2 . ILE D 1 246 ? -36.213 23.692  -34.354 1.00 37.22  ? 573 ILE D CG2 1 
ATOM   6991 C  CD1 . ILE D 1 246 ? -33.761 24.712  -32.488 1.00 38.19  ? 573 ILE D CD1 1 
ATOM   6992 N  N   . PHE D 1 247 ? -35.310 23.786  -37.797 1.00 40.38  ? 574 PHE D N   1 
ATOM   6993 C  CA  . PHE D 1 247 ? -36.219 23.848  -38.940 1.00 40.26  ? 574 PHE D CA  1 
ATOM   6994 C  C   . PHE D 1 247 ? -36.014 22.629  -39.833 1.00 41.99  ? 574 PHE D C   1 
ATOM   6995 O  O   . PHE D 1 247 ? -36.992 21.960  -40.196 1.00 42.29  ? 574 PHE D O   1 
ATOM   6996 C  CB  . PHE D 1 247 ? -36.053 25.175  -39.697 1.00 40.56  ? 574 PHE D CB  1 
ATOM   6997 C  CG  . PHE D 1 247 ? -36.725 25.213  -41.054 1.00 42.27  ? 574 PHE D CG  1 
ATOM   6998 C  CD1 . PHE D 1 247 ? -38.073 25.560  -41.180 1.00 42.24  ? 574 PHE D CD1 1 
ATOM   6999 C  CD2 . PHE D 1 247 ? -35.998 24.935  -42.218 1.00 44.08  ? 574 PHE D CD2 1 
ATOM   7000 C  CE1 . PHE D 1 247 ? -38.680 25.616  -42.433 1.00 44.24  ? 574 PHE D CE1 1 
ATOM   7001 C  CE2 . PHE D 1 247 ? -36.605 24.988  -43.478 1.00 46.00  ? 574 PHE D CE2 1 
ATOM   7002 C  CZ  . PHE D 1 247 ? -37.948 25.330  -43.585 1.00 45.91  ? 574 PHE D CZ  1 
ATOM   7003 N  N   . TYR D 1 248 ? -34.747 22.324  -40.141 1.00 42.57  ? 575 TYR D N   1 
ATOM   7004 C  CA  . TYR D 1 248 ? -34.417 21.175  -40.969 1.00 44.68  ? 575 TYR D CA  1 
ATOM   7005 C  C   . TYR D 1 248 ? -34.958 19.876  -40.407 1.00 45.10  ? 575 TYR D C   1 
ATOM   7006 O  O   . TYR D 1 248 ? -35.540 19.094  -41.145 1.00 46.77  ? 575 TYR D O   1 
ATOM   7007 C  CB  . TYR D 1 248 ? -32.908 21.040  -41.209 1.00 46.41  ? 575 TYR D CB  1 
ATOM   7008 C  CG  . TYR D 1 248 ? -32.581 19.771  -41.963 1.00 49.31  ? 575 TYR D CG  1 
ATOM   7009 C  CD1 . TYR D 1 248 ? -32.627 19.733  -43.365 1.00 51.15  ? 575 TYR D CD1 1 
ATOM   7010 C  CD2 . TYR D 1 248 ? -32.288 18.578  -41.274 1.00 50.08  ? 575 TYR D CD2 1 
ATOM   7011 C  CE1 . TYR D 1 248 ? -32.359 18.560  -44.050 1.00 54.18  ? 575 TYR D CE1 1 
ATOM   7012 C  CE2 . TYR D 1 248 ? -32.025 17.396  -41.961 1.00 52.90  ? 575 TYR D CE2 1 
ATOM   7013 C  CZ  . TYR D 1 248 ? -32.061 17.397  -43.340 1.00 55.18  ? 575 TYR D CZ  1 
ATOM   7014 O  OH  . TYR D 1 248 ? -31.798 16.228  -44.011 1.00 59.11  ? 575 TYR D OH  1 
ATOM   7015 N  N   . LEU D 1 249 ? -34.750 19.650  -39.111 1.00 44.23  ? 576 LEU D N   1 
ATOM   7016 C  CA  . LEU D 1 249 ? -35.142 18.406  -38.448 1.00 45.21  ? 576 LEU D CA  1 
ATOM   7017 C  C   . LEU D 1 249 ? -36.649 18.185  -38.442 1.00 45.39  ? 576 LEU D C   1 
ATOM   7018 O  O   . LEU D 1 249 ? -37.115 17.049  -38.590 1.00 46.76  ? 576 LEU D O   1 
ATOM   7019 C  CB  . LEU D 1 249 ? -34.590 18.354  -37.013 1.00 43.85  ? 576 LEU D CB  1 
ATOM   7020 C  CG  . LEU D 1 249 ? -33.083 18.146  -36.864 1.00 44.54  ? 576 LEU D CG  1 
ATOM   7021 C  CD1 . LEU D 1 249 ? -32.669 18.376  -35.425 1.00 42.71  ? 576 LEU D CD1 1 
ATOM   7022 C  CD2 . LEU D 1 249 ? -32.644 16.770  -37.357 1.00 47.38  ? 576 LEU D CD2 1 
ATOM   7023 N  N   . LYS D 1 250 ? -37.383 19.283  -38.271 1.00 44.82  ? 577 LYS D N   1 
ATOM   7024 C  CA  . LYS D 1 250 ? -38.845 19.302  -38.215 1.00 45.86  ? 577 LYS D CA  1 
ATOM   7025 C  C   . LYS D 1 250 ? -39.422 18.998  -39.584 1.00 48.61  ? 577 LYS D C   1 
ATOM   7026 O  O   . LYS D 1 250 ? -40.362 18.206  -39.714 1.00 50.71  ? 577 LYS D O   1 
ATOM   7027 C  CB  . LYS D 1 250 ? -39.306 20.675  -37.723 1.00 44.39  ? 577 LYS D CB  1 
ATOM   7028 C  CG  . LYS D 1 250 ? -40.787 20.807  -37.420 1.00 44.97  ? 577 LYS D CG  1 
ATOM   7029 C  CD  . LYS D 1 250 ? -41.061 22.036  -36.559 1.00 42.96  ? 577 LYS D CD  1 
ATOM   7030 C  CE  . LYS D 1 250 ? -42.525 22.442  -36.641 1.00 43.55  ? 577 LYS D CE  1 
ATOM   7031 N  NZ  . LYS D 1 250 ? -43.455 21.500  -35.939 1.00 44.50  ? 577 LYS D NZ  1 
ATOM   7032 N  N   . LEU D 1 251 ? -38.826 19.614  -40.605 1.00 49.90  ? 578 LEU D N   1 
ATOM   7033 C  CA  . LEU D 1 251 ? -39.237 19.438  -41.989 1.00 52.18  ? 578 LEU D CA  1 
ATOM   7034 C  C   . LEU D 1 251 ? -38.940 18.014  -42.486 1.00 55.29  ? 578 LEU D C   1 
ATOM   7035 O  O   . LEU D 1 251 ? -39.837 17.355  -43.024 1.00 57.21  ? 578 LEU D O   1 
ATOM   7036 C  CB  . LEU D 1 251 ? -38.581 20.506  -42.871 1.00 52.14  ? 578 LEU D CB  1 
ATOM   7037 C  CG  . LEU D 1 251 ? -39.247 20.852  -44.199 1.00 54.28  ? 578 LEU D CG  1 
ATOM   7038 C  CD1 . LEU D 1 251 ? -40.659 21.402  -44.017 1.00 54.04  ? 578 LEU D CD1 1 
ATOM   7039 C  CD2 . LEU D 1 251 ? -38.375 21.855  -44.934 1.00 54.99  ? 578 LEU D CD2 1 
ATOM   7040 N  N   . GLU D 1 252 ? -37.696 17.553  -42.288 1.00 56.41  ? 579 GLU D N   1 
ATOM   7041 C  CA  . GLU D 1 252 ? -37.269 16.154  -42.515 1.00 59.39  ? 579 GLU D CA  1 
ATOM   7042 C  C   . GLU D 1 252 ? -38.257 15.152  -41.889 1.00 59.94  ? 579 GLU D C   1 
ATOM   7043 O  O   . GLU D 1 252 ? -38.589 14.139  -42.520 1.00 61.94  ? 579 GLU D O   1 
ATOM   7044 C  CB  . GLU D 1 252 ? -35.843 15.953  -41.967 1.00 60.62  ? 579 GLU D CB  1 
ATOM   7045 C  CG  . GLU D 1 252 ? -35.333 14.520  -41.800 1.00 64.32  ? 579 GLU D CG  1 
ATOM   7046 C  CD  . GLU D 1 252 ? -34.526 14.348  -40.508 1.00 65.01  ? 579 GLU D CD  1 
ATOM   7047 O  OE1 . GLU D 1 252 ? -35.094 14.552  -39.392 1.00 64.21  ? 579 GLU D OE1 1 
ATOM   7048 O  OE2 . GLU D 1 252 ? -33.322 14.004  -40.598 1.00 66.97  ? 579 GLU D OE2 1 
ATOM   7049 N  N   . ASP D 1 253 ? -38.708 15.461  -40.659 1.00 57.18  ? 580 ASP D N   1 
ATOM   7050 C  CA  . ASP D 1 253 ? -39.815 14.779  -39.955 1.00 57.55  ? 580 ASP D CA  1 
ATOM   7051 C  C   . ASP D 1 253 ? -39.592 13.277  -39.735 1.00 59.74  ? 580 ASP D C   1 
ATOM   7052 O  O   . ASP D 1 253 ? -40.543 12.487  -39.710 1.00 61.30  ? 580 ASP D O   1 
ATOM   7053 C  CB  . ASP D 1 253 ? -41.184 15.078  -40.631 1.00 58.50  ? 580 ASP D CB  1 
ATOM   7054 C  CG  . ASP D 1 253 ? -42.395 14.660  -39.774 1.00 58.91  ? 580 ASP D CG  1 
ATOM   7055 O  OD1 . ASP D 1 253 ? -42.308 14.636  -38.526 1.00 58.87  ? 580 ASP D OD1 1 
ATOM   7056 O  OD2 . ASP D 1 253 ? -43.452 14.362  -40.359 1.00 60.36  ? 580 ASP D OD2 1 
ATOM   7057 N  N   . LEU D 1 254 ? -38.330 12.885  -39.581 1.00 60.22  ? 581 LEU D N   1 
ATOM   7058 C  CA  . LEU D 1 254 ? -38.029 11.512  -39.216 1.00 62.90  ? 581 LEU D CA  1 
ATOM   7059 C  C   . LEU D 1 254 ? -37.890 11.362  -37.711 1.00 61.92  ? 581 LEU D C   1 
ATOM   7060 O  O   . LEU D 1 254 ? -38.386 10.393  -37.146 1.00 63.97  ? 581 LEU D O   1 
ATOM   7061 C  CB  . LEU D 1 254 ? -36.835 10.951  -39.993 1.00 65.48  ? 581 LEU D CB  1 
ATOM   7062 C  CG  . LEU D 1 254 ? -37.244 10.274  -41.329 1.00 67.97  ? 581 LEU D CG  1 
ATOM   7063 C  CD1 . LEU D 1 254 ? -37.143 11.220  -42.513 1.00 66.55  ? 581 LEU D CD1 1 
ATOM   7064 C  CD2 . LEU D 1 254 ? -36.448 9.002   -41.605 1.00 71.57  ? 581 LEU D CD2 1 
ATOM   7065 N  N   . VAL D 1 255 ? -37.243 12.338  -37.075 1.00 59.57  ? 582 VAL D N   1 
ATOM   7066 C  CA  . VAL D 1 255 ? -37.185 12.464  -35.613 1.00 57.99  ? 582 VAL D CA  1 
ATOM   7067 C  C   . VAL D 1 255 ? -37.817 13.820  -35.250 1.00 54.70  ? 582 VAL D C   1 
ATOM   7068 O  O   . VAL D 1 255 ? -37.102 14.817  -35.132 1.00 52.80  ? 582 VAL D O   1 
ATOM   7069 C  CB  . VAL D 1 255 ? -35.732 12.395  -35.068 1.00 58.32  ? 582 VAL D CB  1 
ATOM   7070 C  CG1 . VAL D 1 255 ? -35.718 12.201  -33.549 1.00 57.97  ? 582 VAL D CG1 1 
ATOM   7071 C  CG2 . VAL D 1 255 ? -34.936 11.290  -35.750 1.00 61.96  ? 582 VAL D CG2 1 
ATOM   7072 N  N   . PRO D 1 256 ? -39.158 13.867  -35.084 1.00 54.65  ? 583 PRO D N   1 
ATOM   7073 C  CA  . PRO D 1 256 ? -39.847 15.120  -34.754 1.00 51.73  ? 583 PRO D CA  1 
ATOM   7074 C  C   . PRO D 1 256 ? -39.371 15.673  -33.423 1.00 50.71  ? 583 PRO D C   1 
ATOM   7075 O  O   . PRO D 1 256 ? -39.060 14.895  -32.512 1.00 51.42  ? 583 PRO D O   1 
ATOM   7076 C  CB  . PRO D 1 256 ? -41.316 14.708  -34.613 1.00 53.03  ? 583 PRO D CB  1 
ATOM   7077 C  CG  . PRO D 1 256 ? -41.427 13.381  -35.269 1.00 56.67  ? 583 PRO D CG  1 
ATOM   7078 C  CD  . PRO D 1 256 ? -40.091 12.724  -35.090 1.00 57.49  ? 583 PRO D CD  1 
ATOM   7079 N  N   . PRO D 1 257 ? -39.304 17.013  -33.307 1.00 48.63  ? 584 PRO D N   1 
ATOM   7080 C  CA  . PRO D 1 257 ? -38.920 17.607  -32.042 1.00 46.65  ? 584 PRO D CA  1 
ATOM   7081 C  C   . PRO D 1 257 ? -40.039 17.454  -31.005 1.00 47.13  ? 584 PRO D C   1 
ATOM   7082 O  O   . PRO D 1 257 ? -41.181 17.275  -31.393 1.00 48.04  ? 584 PRO D O   1 
ATOM   7083 C  CB  . PRO D 1 257 ? -38.692 19.075  -32.409 1.00 44.75  ? 584 PRO D CB  1 
ATOM   7084 C  CG  . PRO D 1 257 ? -39.583 19.308  -33.571 1.00 45.91  ? 584 PRO D CG  1 
ATOM   7085 C  CD  . PRO D 1 257 ? -39.481 18.034  -34.363 1.00 47.64  ? 584 PRO D CD  1 
ATOM   7086 N  N   . PRO D 1 258 ? -39.709 17.518  -29.695 1.00 46.50  ? 585 PRO D N   1 
ATOM   7087 C  CA  . PRO D 1 258 ? -40.748 17.494  -28.676 1.00 47.08  ? 585 PRO D CA  1 
ATOM   7088 C  C   . PRO D 1 258 ? -41.678 18.701  -28.779 1.00 46.23  ? 585 PRO D C   1 
ATOM   7089 O  O   . PRO D 1 258 ? -41.288 19.728  -29.359 1.00 45.01  ? 585 PRO D O   1 
ATOM   7090 C  CB  . PRO D 1 258 ? -39.953 17.588  -27.357 1.00 46.46  ? 585 PRO D CB  1 
ATOM   7091 C  CG  . PRO D 1 258 ? -38.672 18.233  -27.717 1.00 44.86  ? 585 PRO D CG  1 
ATOM   7092 C  CD  . PRO D 1 258 ? -38.370 17.708  -29.098 1.00 45.66  ? 585 PRO D CD  1 
ATOM   7093 N  N   . ALA D 1 259 ? -42.866 18.566  -28.173 1.00 47.22  ? 586 ALA D N   1 
ATOM   7094 C  CA  . ALA D 1 259 ? -43.907 19.596  -28.111 1.00 46.50  ? 586 ALA D CA  1 
ATOM   7095 C  C   . ALA D 1 259 ? -43.412 20.970  -27.686 1.00 44.74  ? 586 ALA D C   1 
ATOM   7096 O  O   . ALA D 1 259 ? -43.851 21.970  -28.243 1.00 44.61  ? 586 ALA D O   1 
ATOM   7097 C  CB  . ALA D 1 259 ? -45.042 19.145  -27.202 1.00 47.76  ? 586 ALA D CB  1 
ATOM   7098 N  N   . ILE D 1 260 ? -42.503 21.019  -26.712 1.00 44.57  ? 587 ILE D N   1 
ATOM   7099 C  CA  . ILE D 1 260 ? -42.065 22.289  -26.147 1.00 43.63  ? 587 ILE D CA  1 
ATOM   7100 C  C   . ILE D 1 260 ? -41.099 23.029  -27.082 1.00 42.53  ? 587 ILE D C   1 
ATOM   7101 O  O   . ILE D 1 260 ? -41.088 24.264  -27.118 1.00 43.17  ? 587 ILE D O   1 
ATOM   7102 C  CB  . ILE D 1 260 ? -41.538 22.133  -24.675 1.00 45.10  ? 587 ILE D CB  1 
ATOM   7103 C  CG1 . ILE D 1 260 ? -41.597 23.465  -23.895 1.00 43.78  ? 587 ILE D CG1 1 
ATOM   7104 C  CG2 . ILE D 1 260 ? -40.157 21.476  -24.597 1.00 44.04  ? 587 ILE D CG2 1 
ATOM   7105 C  CD1 . ILE D 1 260 ? -42.963 23.787  -23.306 1.00 45.99  ? 587 ILE D CD1 1 
ATOM   7106 N  N   . ILE D 1 261 ? -40.295 22.278  -27.835 1.00 41.94  ? 588 ILE D N   1 
ATOM   7107 C  CA  . ILE D 1 261 ? -39.418 22.860  -28.831 1.00 40.40  ? 588 ILE D CA  1 
ATOM   7108 C  C   . ILE D 1 261 ? -40.261 23.355  -29.998 1.00 40.45  ? 588 ILE D C   1 
ATOM   7109 O  O   . ILE D 1 261 ? -40.009 24.449  -30.496 1.00 40.24  ? 588 ILE D O   1 
ATOM   7110 C  CB  . ILE D 1 261 ? -38.315 21.876  -29.279 1.00 41.47  ? 588 ILE D CB  1 
ATOM   7111 C  CG1 . ILE D 1 261 ? -37.255 21.780  -28.176 1.00 40.18  ? 588 ILE D CG1 1 
ATOM   7112 C  CG2 . ILE D 1 261 ? -37.722 22.264  -30.653 1.00 40.49  ? 588 ILE D CG2 1 
ATOM   7113 C  CD1 . ILE D 1 261 ? -36.058 20.917  -28.514 1.00 41.58  ? 588 ILE D CD1 1 
ATOM   7114 N  N   . ASP D 1 262 ? -41.260 22.564  -30.406 1.00 41.46  ? 589 ASP D N   1 
ATOM   7115 C  CA  . ASP D 1 262 ? -42.286 23.002  -31.366 1.00 41.98  ? 589 ASP D CA  1 
ATOM   7116 C  C   . ASP D 1 262 ? -42.865 24.341  -30.976 1.00 41.31  ? 589 ASP D C   1 
ATOM   7117 O  O   . ASP D 1 262 ? -42.908 25.263  -31.801 1.00 41.63  ? 589 ASP D O   1 
ATOM   7118 C  CB  . ASP D 1 262 ? -43.427 21.986  -31.474 1.00 43.92  ? 589 ASP D CB  1 
ATOM   7119 C  CG  . ASP D 1 262 ? -43.242 21.013  -32.610 1.00 45.28  ? 589 ASP D CG  1 
ATOM   7120 O  OD1 . ASP D 1 262 ? -42.387 21.276  -33.486 1.00 45.21  ? 589 ASP D OD1 1 
ATOM   7121 O  OD2 . ASP D 1 262 ? -43.950 19.978  -32.635 1.00 46.76  ? 589 ASP D OD2 1 
ATOM   7122 N  N   . LYS D 1 263 ? -43.278 24.435  -29.709 1.00 41.12  ? 590 LYS D N   1 
ATOM   7123 C  CA  . LYS D 1 263 ? -43.963 25.601  -29.168 1.00 41.17  ? 590 LYS D CA  1 
ATOM   7124 C  C   . LYS D 1 263 ? -43.117 26.863  -29.272 1.00 39.43  ? 590 LYS D C   1 
ATOM   7125 O  O   . LYS D 1 263 ? -43.544 27.804  -29.930 1.00 39.60  ? 590 LYS D O   1 
ATOM   7126 C  CB  . LYS D 1 263 ? -44.431 25.366  -27.732 1.00 42.16  ? 590 LYS D CB  1 
ATOM   7127 C  CG  . LYS D 1 263 ? -45.353 26.467  -27.205 1.00 44.05  ? 590 LYS D CG  1 
ATOM   7128 C  CD  . LYS D 1 263 ? -45.688 26.326  -25.722 1.00 45.33  ? 590 LYS D CD  1 
ATOM   7129 C  CE  . LYS D 1 263 ? -44.568 26.888  -24.855 1.00 45.02  ? 590 LYS D CE  1 
ATOM   7130 N  NZ  . LYS D 1 263 ? -44.795 26.813  -23.372 1.00 47.70  ? 590 LYS D NZ  1 
ATOM   7131 N  N   . LEU D 1 264 ? -41.917 26.883  -28.674 1.00 37.81  ? 591 LEU D N   1 
ATOM   7132 C  CA  . LEU D 1 264 ? -41.102 28.096  -28.753 1.00 36.50  ? 591 LEU D CA  1 
ATOM   7133 C  C   . LEU D 1 264 ? -40.664 28.386  -30.177 1.00 35.82  ? 591 LEU D C   1 
ATOM   7134 O  O   . LEU D 1 264 ? -40.524 29.542  -30.543 1.00 35.78  ? 591 LEU D O   1 
ATOM   7135 C  CB  . LEU D 1 264 ? -39.890 28.103  -27.819 1.00 36.29  ? 591 LEU D CB  1 
ATOM   7136 C  CG  . LEU D 1 264 ? -39.811 27.680  -26.344 1.00 37.00  ? 591 LEU D CG  1 
ATOM   7137 C  CD1 . LEU D 1 264 ? -38.559 28.315  -25.722 1.00 36.20  ? 591 LEU D CD1 1 
ATOM   7138 C  CD2 . LEU D 1 264 ? -41.051 27.936  -25.508 1.00 37.34  ? 591 LEU D CD2 1 
ATOM   7139 N  N   . PHE D 1 265 ? -40.471 27.346  -30.983 1.00 35.39  ? 592 PHE D N   1 
ATOM   7140 C  CA  . PHE D 1 265 ? -40.149 27.548  -32.378 1.00 35.85  ? 592 PHE D CA  1 
ATOM   7141 C  C   . PHE D 1 265 ? -41.233 28.350  -33.125 1.00 37.31  ? 592 PHE D C   1 
ATOM   7142 O  O   . PHE D 1 265 ? -40.913 29.330  -33.791 1.00 37.26  ? 592 PHE D O   1 
ATOM   7143 C  CB  . PHE D 1 265 ? -39.820 26.225  -33.091 1.00 36.04  ? 592 PHE D CB  1 
ATOM   7144 C  CG  . PHE D 1 265 ? -39.433 26.392  -34.543 1.00 35.98  ? 592 PHE D CG  1 
ATOM   7145 C  CD1 . PHE D 1 265 ? -38.138 26.795  -34.897 1.00 35.47  ? 592 PHE D CD1 1 
ATOM   7146 C  CD2 . PHE D 1 265 ? -40.354 26.131  -35.554 1.00 36.65  ? 592 PHE D CD2 1 
ATOM   7147 C  CE1 . PHE D 1 265 ? -37.773 26.940  -36.239 1.00 36.37  ? 592 PHE D CE1 1 
ATOM   7148 C  CE2 . PHE D 1 265 ? -39.993 26.282  -36.895 1.00 38.06  ? 592 PHE D CE2 1 
ATOM   7149 C  CZ  . PHE D 1 265 ? -38.704 26.684  -37.237 1.00 37.53  ? 592 PHE D CZ  1 
ATOM   7150 N  N   . LEU D 1 266 ? -42.499 27.940  -32.984 1.00 38.85  ? 593 LEU D N   1 
ATOM   7151 C  CA  . LEU D 1 266 ? -43.599 28.546  -33.733 1.00 40.48  ? 593 LEU D CA  1 
ATOM   7152 C  C   . LEU D 1 266 ? -43.985 29.929  -33.234 1.00 40.97  ? 593 LEU D C   1 
ATOM   7153 O  O   . LEU D 1 266 ? -44.279 30.816  -34.041 1.00 41.58  ? 593 LEU D O   1 
ATOM   7154 C  CB  . LEU D 1 266 ? -44.810 27.595  -33.799 1.00 42.45  ? 593 LEU D CB  1 
ATOM   7155 C  CG  . LEU D 1 266 ? -44.624 26.224  -34.490 1.00 43.00  ? 593 LEU D CG  1 
ATOM   7156 C  CD1 . LEU D 1 266 ? -45.935 25.445  -34.525 1.00 44.97  ? 593 LEU D CD1 1 
ATOM   7157 C  CD2 . LEU D 1 266 ? -44.031 26.318  -35.894 1.00 42.60  ? 593 LEU D CD2 1 
ATOM   7158 N  N   . ASP D 1 267 ? -43.951 30.105  -31.907 1.00 41.83  ? 594 ASP D N   1 
ATOM   7159 C  CA  . ASP D 1 267 ? -44.223 31.389  -31.217 1.00 42.97  ? 594 ASP D CA  1 
ATOM   7160 C  C   . ASP D 1 267 ? -43.335 32.545  -31.677 1.00 42.78  ? 594 ASP D C   1 
ATOM   7161 O  O   . ASP D 1 267 ? -43.739 33.706  -31.679 1.00 44.39  ? 594 ASP D O   1 
ATOM   7162 C  CB  . ASP D 1 267 ? -43.976 31.248  -29.711 1.00 42.40  ? 594 ASP D CB  1 
ATOM   7163 C  CG  . ASP D 1 267 ? -45.048 30.438  -28.988 1.00 43.38  ? 594 ASP D CG  1 
ATOM   7164 O  OD1 . ASP D 1 267 ? -46.099 30.126  -29.589 1.00 45.42  ? 594 ASP D OD1 1 
ATOM   7165 O  OD2 . ASP D 1 267 ? -44.817 30.106  -27.796 1.00 42.32  ? 594 ASP D OD2 1 
ATOM   7166 N  N   . THR D 1 268 ? -42.141 32.187  -32.105 1.00 41.42  ? 595 THR D N   1 
ATOM   7167 C  CA  . THR D 1 268 ? -41.003 33.069  -32.169 1.00 41.04  ? 595 THR D CA  1 
ATOM   7168 C  C   . THR D 1 268 ? -40.633 33.407  -33.614 1.00 41.40  ? 595 THR D C   1 
ATOM   7169 O  O   . THR D 1 268 ? -40.035 34.444  -33.904 1.00 42.13  ? 595 THR D O   1 
ATOM   7170 C  CB  . THR D 1 268 ? -39.904 32.331  -31.402 1.00 39.95  ? 595 THR D CB  1 
ATOM   7171 O  OG1 . THR D 1 268 ? -39.888 32.795  -30.037 1.00 41.56  ? 595 THR D OG1 1 
ATOM   7172 C  CG2 . THR D 1 268 ? -38.578 32.423  -32.032 1.00 40.55  ? 595 THR D CG2 1 
ATOM   7173 N  N   . LEU D 1 269 ? -41.016 32.517  -34.513 1.00 41.17  ? 596 LEU D N   1 
ATOM   7174 C  CA  . LEU D 1 269 ? -40.700 32.627  -35.917 1.00 42.58  ? 596 LEU D CA  1 
ATOM   7175 C  C   . LEU D 1 269 ? -41.236 33.966  -36.473 1.00 43.45  ? 596 LEU D C   1 
ATOM   7176 O  O   . LEU D 1 269 ? -42.392 34.296  -36.239 1.00 44.62  ? 596 LEU D O   1 
ATOM   7177 C  CB  . LEU D 1 269 ? -41.295 31.417  -36.626 1.00 43.48  ? 596 LEU D CB  1 
ATOM   7178 C  CG  . LEU D 1 269 ? -40.548 30.778  -37.789 1.00 45.13  ? 596 LEU D CG  1 
ATOM   7179 C  CD1 . LEU D 1 269 ? -39.164 30.232  -37.407 1.00 43.89  ? 596 LEU D CD1 1 
ATOM   7180 C  CD2 . LEU D 1 269 ? -41.459 29.682  -38.319 1.00 46.22  ? 596 LEU D CD2 1 
ATOM   7181 N  N   . PRO D 1 270 ? -40.376 34.776  -37.137 1.00 43.77  ? 597 PRO D N   1 
ATOM   7182 C  CA  . PRO D 1 270 ? -40.828 36.114  -37.584 1.00 45.29  ? 597 PRO D CA  1 
ATOM   7183 C  C   . PRO D 1 270 ? -41.627 36.154  -38.905 1.00 46.89  ? 597 PRO D C   1 
ATOM   7184 O  O   . PRO D 1 270 ? -42.025 37.237  -39.335 1.00 49.56  ? 597 PRO D O   1 
ATOM   7185 C  CB  . PRO D 1 270 ? -39.513 36.899  -37.709 1.00 45.39  ? 597 PRO D CB  1 
ATOM   7186 C  CG  . PRO D 1 270 ? -38.519 35.862  -38.091 1.00 44.26  ? 597 PRO D CG  1 
ATOM   7187 C  CD  . PRO D 1 270 ? -38.913 34.624  -37.309 1.00 42.56  ? 597 PRO D CD  1 
ATOM   7188 N  N   . PHE D 1 271 ? -41.862 35.002  -39.528 1.00 45.94  ? 598 PHE D N   1 
ATOM   7189 C  CA  . PHE D 1 271 ? -42.668 34.929  -40.756 1.00 48.61  ? 598 PHE D CA  1 
ATOM   7190 C  C   . PHE D 1 271 ? -43.453 33.619  -40.774 1.00 48.24  ? 598 PHE D C   1 
ATOM   7191 O  O   . PHE D 1 271 ? -44.279 33.324  -41.646 1.00 50.62  ? 598 PHE D O   1 
ATOM   7192 C  CB  . PHE D 1 271 ? -41.788 35.077  -42.017 1.00 49.80  ? 598 PHE D CB  1 
ATOM   7193 C  CG  . PHE D 1 271 ? -40.595 34.170  -42.025 1.00 48.70  ? 598 PHE D CG  1 
ATOM   7194 C  CD1 . PHE D 1 271 ? -40.733 32.806  -42.322 1.00 47.90  ? 598 PHE D CD1 1 
ATOM   7195 C  CD2 . PHE D 1 271 ? -39.328 34.662  -41.685 1.00 48.62  ? 598 PHE D CD2 1 
ATOM   7196 C  CE1 . PHE D 1 271 ? -39.632 31.950  -42.280 1.00 47.24  ? 598 PHE D CE1 1 
ATOM   7197 C  CE2 . PHE D 1 271 ? -38.220 33.811  -41.641 1.00 47.88  ? 598 PHE D CE2 1 
ATOM   7198 C  CZ  . PHE D 1 271 ? -38.370 32.452  -41.946 1.00 47.13  ? 598 PHE D CZ  1 
ATOM   7199 O  OXT . PHE D 1 271 ? -43.273 32.786  -39.889 1.00 46.49  ? 598 PHE D OXT 1 
HETATM 7200 O  O9  . 8SU E 2 .   ? -3.906  -19.484 20.223  1.00 63.70  ? 601 8SU A O9  1 
HETATM 7201 C  C9  . 8SU E 2 .   ? -3.643  -19.292 19.045  1.00 60.16  ? 601 8SU A C9  1 
HETATM 7202 C  C10 . 8SU E 2 .   ? -4.527  -18.597 18.107  1.00 58.16  ? 601 8SU A C10 1 
HETATM 7203 C  C11 . 8SU E 2 .   ? -4.139  -18.922 16.876  1.00 52.91  ? 601 8SU A C11 1 
HETATM 7204 C  C12 . 8SU E 2 .   ? -2.754  -19.547 16.886  1.00 57.46  ? 601 8SU A C12 1 
HETATM 7205 C  C13 . 8SU E 2 .   ? -2.899  -20.846 16.151  1.00 57.01  ? 601 8SU A C13 1 
HETATM 7206 C  C14 . 8SU E 2 .   ? -1.973  -21.560 15.540  1.00 56.92  ? 601 8SU A C14 1 
HETATM 7207 C  C15 . 8SU E 2 .   ? -2.563  -22.787 14.896  1.00 56.24  ? 601 8SU A C15 1 
HETATM 7208 C  C16 . 8SU E 2 .   ? -1.594  -23.962 14.960  1.00 55.17  ? 601 8SU A C16 1 
HETATM 7209 C  C17 . 8SU E 2 .   ? -2.210  -25.248 14.420  1.00 52.74  ? 601 8SU A C17 1 
HETATM 7210 C  C18 . 8SU E 2 .   ? -3.105  -25.906 15.465  1.00 49.63  ? 601 8SU A C18 1 
HETATM 7211 C  C19 . 8SU E 2 .   ? -3.395  -27.370 15.174  1.00 48.22  ? 601 8SU A C19 1 
HETATM 7212 C  C20 . 8SU E 2 .   ? -4.612  -27.556 14.305  1.00 47.10  ? 601 8SU A C20 1 
HETATM 7213 O  O15 . 8SU E 2 .   ? -2.908  -22.459 13.536  1.00 57.47  ? 601 8SU A O15 1 
HETATM 7214 C  C8  . 8SU E 2 .   ? -2.406  -19.763 18.359  1.00 62.43  ? 601 8SU A C8  1 
HETATM 7215 C  C7  . 8SU E 2 .   ? -1.246  -18.877 18.792  1.00 69.10  ? 601 8SU A C7  1 
HETATM 7216 C  C6  . 8SU E 2 .   ? -0.132  -19.696 19.415  1.00 74.61  ? 601 8SU A C6  1 
HETATM 7217 C  C5  . 8SU E 2 .   ? 1.141   -19.274 19.476  1.00 78.95  ? 601 8SU A C5  1 
HETATM 7218 C  C4  . 8SU E 2 .   ? 1.619   -17.933 18.943  1.00 83.93  ? 601 8SU A C4  1 
HETATM 7219 C  C3  . 8SU E 2 .   ? 2.153   -18.074 17.520  1.00 84.48  ? 601 8SU A C3  1 
HETATM 7220 C  C2  . 8SU E 2 .   ? 2.688   -16.739 16.999  1.00 84.59  ? 601 8SU A C2  1 
HETATM 7221 C  C1  . 8SU E 2 .   ? 4.198   -16.759 16.859  1.00 84.03  ? 601 8SU A C1  1 
HETATM 7222 O  O1  . 8SU E 2 .   ? 4.844   -15.783 17.306  1.00 79.21  ? 601 8SU A O1  1 
HETATM 7223 O  O2  . 8SU E 2 .   ? 4.750   -17.736 16.296  1.00 84.50  ? 601 8SU A O2  1 
HETATM 7224 MG MG  . MG  F 3 .   ? 3.240   -30.450 26.182  1.00 58.59  ? 602 MG  A MG  1 
HETATM 7225 MG MG  . MG  G 3 .   ? -5.431  16.888  25.855  1.00 63.83  ? 602 MG  B MG  1 
HETATM 7226 O  O9  . 8SU H 2 .   ? -12.049 27.624  20.368  1.00 73.16  ? 601 8SU B O9  1 
HETATM 7227 C  C9  . 8SU H 2 .   ? -12.035 27.731  19.150  1.00 68.62  ? 601 8SU B C9  1 
HETATM 7228 C  C10 . 8SU H 2 .   ? -13.184 28.150  18.335  1.00 64.90  ? 601 8SU B C10 1 
HETATM 7229 C  C11 . 8SU H 2 .   ? -12.881 27.913  17.055  1.00 57.23  ? 601 8SU B C11 1 
HETATM 7230 C  C12 . 8SU H 2 .   ? -11.467 27.349  16.909  1.00 62.47  ? 601 8SU B C12 1 
HETATM 7231 C  C13 . 8SU H 2 .   ? -11.654 25.924  16.443  1.00 61.81  ? 601 8SU B C13 1 
HETATM 7232 C  C14 . 8SU H 2 .   ? -11.397 25.587  15.183  1.00 58.14  ? 601 8SU B C14 1 
HETATM 7233 C  C15 . 8SU H 2 .   ? -11.662 24.189  14.683  1.00 57.05  ? 601 8SU B C15 1 
HETATM 7234 C  C16 . 8SU H 2 .   ? -10.585 23.164  15.037  1.00 55.07  ? 601 8SU B C16 1 
HETATM 7235 C  C17 . 8SU H 2 .   ? -10.931 21.748  14.567  1.00 52.37  ? 601 8SU B C17 1 
HETATM 7236 C  C18 . 8SU H 2 .   ? -12.266 21.233  15.103  1.00 49.92  ? 601 8SU B C18 1 
HETATM 7237 C  C19 . 8SU H 2 .   ? -12.337 19.716  15.188  1.00 48.80  ? 601 8SU B C19 1 
HETATM 7238 C  C20 . 8SU H 2 .   ? -13.183 19.145  14.077  1.00 47.65  ? 601 8SU B C20 1 
HETATM 7239 O  O15 . 8SU H 2 .   ? -11.848 24.272  13.258  1.00 58.34  ? 601 8SU B O15 1 
HETATM 7240 C  C8  . 8SU H 2 .   ? -10.844 27.434  18.298  1.00 68.42  ? 601 8SU B C8  1 
HETATM 7241 C  C7  . 8SU H 2 .   ? -9.874  28.608  18.408  1.00 74.86  ? 601 8SU B C7  1 
HETATM 7242 C  C6  . 8SU H 2 .   ? -8.593  28.178  19.098  1.00 78.32  ? 601 8SU B C6  1 
HETATM 7243 C  C5  . 8SU H 2 .   ? -7.380  28.370  18.565  1.00 79.86  ? 601 8SU B C5  1 
HETATM 7244 C  C4  . 8SU H 2 .   ? -7.160  29.043  17.222  1.00 80.04  ? 601 8SU B C4  1 
HETATM 7245 C  C3  . 8SU H 2 .   ? -6.477  30.390  17.436  1.00 82.42  ? 601 8SU B C3  1 
HETATM 7246 C  C2  . 8SU H 2 .   ? -7.493  31.511  17.679  1.00 83.33  ? 601 8SU B C2  1 
HETATM 7247 C  C1  . 8SU H 2 .   ? -6.809  32.824  18.009  1.00 83.75  ? 601 8SU B C1  1 
HETATM 7248 O  O1  . 8SU H 2 .   ? -7.227  33.464  19.001  1.00 85.23  ? 601 8SU B O1  1 
HETATM 7249 O  O2  . 8SU H 2 .   ? -5.868  33.237  17.290  1.00 80.27  ? 601 8SU B O2  1 
HETATM 7250 O  O9  . 8SU I 2 .   ? -25.061 -12.023 -35.182 1.00 71.15  ? 601 8SU C O9  1 
HETATM 7251 C  C9  . 8SU I 2 .   ? -24.790 -12.571 -34.122 1.00 67.74  ? 601 8SU C C9  1 
HETATM 7252 C  C10 . 8SU I 2 .   ? -23.419 -12.862 -33.679 1.00 64.68  ? 601 8SU C C10 1 
HETATM 7253 C  C11 . 8SU I 2 .   ? -23.484 -13.498 -32.517 1.00 56.75  ? 601 8SU C C11 1 
HETATM 7254 C  C12 . 8SU I 2 .   ? -24.912 -13.570 -32.008 1.00 61.20  ? 601 8SU C C12 1 
HETATM 7255 C  C13 . 8SU I 2 .   ? -25.288 -14.979 -31.627 1.00 56.51  ? 601 8SU C C13 1 
HETATM 7256 C  C14 . 8SU I 2 .   ? -25.849 -15.167 -30.438 1.00 52.28  ? 601 8SU C C14 1 
HETATM 7257 C  C15 . 8SU I 2 .   ? -26.238 -16.543 -29.963 1.00 50.12  ? 601 8SU C C15 1 
HETATM 7258 C  C16 . 8SU I 2 .   ? -27.574 -16.982 -30.565 1.00 48.98  ? 601 8SU C C16 1 
HETATM 7259 C  C17 . 8SU I 2 .   ? -28.007 -18.380 -30.145 1.00 47.96  ? 601 8SU C C17 1 
HETATM 7260 C  C18 . 8SU I 2 .   ? -27.209 -19.490 -30.822 1.00 48.73  ? 601 8SU C C18 1 
HETATM 7261 C  C19 . 8SU I 2 .   ? -27.497 -20.827 -30.152 1.00 50.19  ? 601 8SU C C19 1 
HETATM 7262 C  C20 . 8SU I 2 .   ? -26.425 -21.213 -29.156 1.00 49.28  ? 601 8SU C C20 1 
HETATM 7263 O  O15 . 8SU I 2 .   ? -26.285 -16.490 -28.532 1.00 47.72  ? 601 8SU C O15 1 
HETATM 7264 C  C8  . 8SU I 2 .   ? -25.805 -13.030 -33.122 1.00 67.14  ? 601 8SU C C8  1 
HETATM 7265 C  C7  . 8SU I 2 .   ? -26.645 -11.869 -32.591 1.00 73.75  ? 601 8SU C C7  1 
HETATM 7266 C  C6  . 8SU I 2 .   ? -27.786 -11.583 -33.545 1.00 77.34  ? 601 8SU C C6  1 
HETATM 7267 C  C5  . 8SU I 2 .   ? -27.988 -10.393 -34.120 1.00 80.47  ? 601 8SU C C5  1 
HETATM 7268 C  C4  . 8SU I 2 .   ? -27.118 -9.170  -33.887 1.00 80.48  ? 601 8SU C C4  1 
HETATM 7269 C  C3  . 8SU I 2 .   ? -27.771 -7.924  -34.491 1.00 80.65  ? 601 8SU C C3  1 
HETATM 7270 C  C2  . 8SU I 2 .   ? -29.108 -7.582  -33.820 1.00 79.67  ? 601 8SU C C2  1 
HETATM 7271 C  C1  . 8SU I 2 .   ? -28.977 -6.727  -32.570 1.00 79.17  ? 601 8SU C C1  1 
HETATM 7272 O  O1  . 8SU I 2 .   ? -27.861 -6.288  -32.195 1.00 77.81  ? 601 8SU C O1  1 
HETATM 7273 O  O2  . 8SU I 2 .   ? -30.033 -6.490  -31.942 1.00 76.93  ? 601 8SU C O2  1 
HETATM 7274 O  O9  . 8SU J 2 .   ? -34.374 34.105  -35.334 1.00 59.63  ? 601 8SU D O9  1 
HETATM 7275 C  C9  . 8SU J 2 .   ? -33.988 33.968  -34.191 1.00 56.42  ? 601 8SU D C9  1 
HETATM 7276 C  C10 . 8SU J 2 .   ? -32.578 33.804  -33.826 1.00 55.85  ? 601 8SU D C10 1 
HETATM 7277 C  C11 . 8SU J 2 .   ? -32.534 33.474  -32.540 1.00 51.03  ? 601 8SU D C11 1 
HETATM 7278 C  C12 . 8SU J 2 .   ? -33.922 33.444  -31.925 1.00 52.59  ? 601 8SU D C12 1 
HETATM 7279 C  C13 . 8SU J 2 .   ? -34.233 32.049  -31.459 1.00 49.01  ? 601 8SU D C13 1 
HETATM 7280 C  C14 . 8SU J 2 .   ? -35.053 31.824  -30.444 1.00 45.09  ? 601 8SU D C14 1 
HETATM 7281 C  C15 . 8SU J 2 .   ? -35.256 30.393  -30.033 1.00 42.31  ? 601 8SU D C15 1 
HETATM 7282 C  C16 . 8SU J 2 .   ? -36.559 29.813  -30.584 1.00 39.71  ? 601 8SU D C16 1 
HETATM 7283 C  C17 . 8SU J 2 .   ? -37.012 28.529  -29.901 1.00 36.83  ? 601 8SU D C17 1 
HETATM 7284 C  C18 . 8SU J 2 .   ? -36.238 27.271  -30.277 1.00 35.72  ? 601 8SU D C18 1 
HETATM 7285 C  C19 . 8SU J 2 .   ? -36.525 26.209  -29.222 1.00 35.69  ? 601 8SU D C19 1 
HETATM 7286 C  C20 . 8SU J 2 .   ? -35.461 25.137  -29.162 1.00 33.76  ? 601 8SU D C20 1 
HETATM 7287 O  O15 . 8SU J 2 .   ? -35.199 30.393  -28.601 1.00 41.97  ? 601 8SU D O15 1 
HETATM 7288 C  C8  . 8SU J 2 .   ? -34.887 33.924  -33.000 1.00 57.31  ? 601 8SU D C8  1 
HETATM 7289 C  C7  . 8SU J 2 .   ? -35.342 35.326  -32.612 1.00 62.21  ? 601 8SU D C7  1 
HETATM 7290 C  C6  . 8SU J 2 .   ? -36.817 35.547  -32.864 1.00 63.84  ? 601 8SU D C6  1 
HETATM 7291 C  C5  . 8SU J 2 .   ? -37.255 36.357  -33.836 1.00 69.40  ? 601 8SU D C5  1 
HETATM 7292 C  C4  . 8SU J 2 .   ? -36.319 37.106  -34.771 1.00 72.12  ? 601 8SU D C4  1 
HETATM 7293 C  C3  . 8SU J 2 .   ? -36.382 38.609  -34.517 1.00 74.40  ? 601 8SU D C3  1 
HETATM 7294 C  C2  . 8SU J 2 .   ? -35.363 39.042  -33.464 1.00 75.37  ? 601 8SU D C2  1 
HETATM 7295 C  C1  . 8SU J 2 .   ? -35.688 40.408  -32.891 1.00 76.06  ? 601 8SU D C1  1 
HETATM 7296 O  O1  . 8SU J 2 .   ? -36.835 40.628  -32.427 1.00 76.97  ? 601 8SU D O1  1 
HETATM 7297 O  O2  . 8SU J 2 .   ? -34.783 41.274  -32.893 1.00 75.12  ? 601 8SU D O2  1 
HETATM 7298 O  O   . HOH K 4 .   ? 2.053   -2.181  -2.330  1.00 58.20  ? 701 HOH A O   1 
HETATM 7299 O  O   . HOH K 4 .   ? -12.156 -37.534 21.269  1.00 56.73  ? 702 HOH A O   1 
HETATM 7300 O  O   . HOH K 4 .   ? -2.390  -13.403 12.052  1.00 42.99  ? 703 HOH A O   1 
HETATM 7301 O  O   . HOH K 4 .   ? 2.266   -10.735 14.046  1.00 44.91  ? 704 HOH A O   1 
HETATM 7302 O  O   . HOH K 4 .   ? 13.660  -15.073 1.200   1.00 49.07  ? 705 HOH A O   1 
HETATM 7303 O  O   . HOH K 4 .   ? -23.437 -31.588 1.548   1.00 36.88  ? 706 HOH A O   1 
HETATM 7304 O  O   . HOH K 4 .   ? -28.729 -23.673 -1.970  1.00 50.94  ? 707 HOH A O   1 
HETATM 7305 O  O   . HOH K 4 .   ? -14.325 -21.159 27.316  1.00 48.88  ? 708 HOH A O   1 
HETATM 7306 O  O   . HOH K 4 .   ? 9.809   -26.575 9.302   1.00 62.14  ? 709 HOH A O   1 
HETATM 7307 O  O   . HOH K 4 .   ? 4.824   -7.238  11.054  1.00 52.00  ? 710 HOH A O   1 
HETATM 7308 O  O   . HOH K 4 .   ? -23.591 -25.104 -6.862  1.00 49.09  ? 711 HOH A O   1 
HETATM 7309 O  O   . HOH K 4 .   ? 4.555   -28.181 13.992  1.00 63.81  ? 712 HOH A O   1 
HETATM 7310 O  O   . HOH K 4 .   ? -15.021 -37.218 5.884   1.00 47.60  ? 713 HOH A O   1 
HETATM 7311 O  O   . HOH K 4 .   ? -20.425 -32.263 13.565  1.00 48.13  ? 714 HOH A O   1 
HETATM 7312 O  O   . HOH K 4 .   ? -15.613 -20.409 -2.772  1.00 47.04  ? 715 HOH A O   1 
HETATM 7313 O  O   . HOH K 4 .   ? 1.467   -16.308 10.047  1.00 29.57  ? 716 HOH A O   1 
HETATM 7314 O  O   . HOH K 4 .   ? 4.593   -26.286 30.518  1.00 44.05  ? 717 HOH A O   1 
HETATM 7315 O  O   . HOH K 4 .   ? -13.687 -5.439  14.276  1.00 55.67  ? 718 HOH A O   1 
HETATM 7316 O  O   . HOH K 4 .   ? -12.274 -22.868 5.252   1.00 33.77  ? 719 HOH A O   1 
HETATM 7317 O  O   . HOH K 4 .   ? -14.834 -26.082 -7.077  1.00 59.89  ? 720 HOH A O   1 
HETATM 7318 O  O   . HOH K 4 .   ? -5.311  -13.549 -1.127  1.00 40.44  ? 721 HOH A O   1 
HETATM 7319 O  O   . HOH K 4 .   ? -1.721  5.730   4.864   1.00 59.55  ? 722 HOH A O   1 
HETATM 7320 O  O   . HOH K 4 .   ? 0.050   -36.564 22.716  1.00 55.05  ? 723 HOH A O   1 
HETATM 7321 O  O   . HOH K 4 .   ? -30.394 -23.815 5.505   1.00 52.92  ? 724 HOH A O   1 
HETATM 7322 O  O   . HOH K 4 .   ? -13.116 -17.995 1.089   1.00 32.06  ? 725 HOH A O   1 
HETATM 7323 O  O   . HOH K 4 .   ? -17.549 -9.166  3.519   1.00 48.28  ? 726 HOH A O   1 
HETATM 7324 O  O   . HOH K 4 .   ? 3.999   -0.414  -0.740  1.00 54.39  ? 727 HOH A O   1 
HETATM 7325 O  O   . HOH K 4 .   ? -19.272 -27.086 22.768  1.00 50.20  ? 728 HOH A O   1 
HETATM 7326 O  O   . HOH K 4 .   ? -12.035 -10.992 19.672  1.00 62.47  ? 729 HOH A O   1 
HETATM 7327 O  O   . HOH K 4 .   ? -15.310 -33.746 4.000   1.00 42.36  ? 730 HOH A O   1 
HETATM 7328 O  O   . HOH K 4 .   ? -13.722 -13.456 17.464  1.00 49.38  ? 731 HOH A O   1 
HETATM 7329 O  O   . HOH K 4 .   ? 4.738   -24.395 4.181   1.00 59.08  ? 732 HOH A O   1 
HETATM 7330 O  O   . HOH K 4 .   ? 12.255  -21.431 -0.653  1.00 38.19  ? 733 HOH A O   1 
HETATM 7331 O  O   . HOH K 4 .   ? -12.972 -25.355 4.722   1.00 35.23  ? 734 HOH A O   1 
HETATM 7332 O  O   . HOH K 4 .   ? 11.648  -20.229 10.852  1.00 45.88  ? 735 HOH A O   1 
HETATM 7333 O  O   . HOH K 4 .   ? -10.085 -23.071 3.279   1.00 17.84  ? 736 HOH A O   1 
HETATM 7334 O  O   . HOH K 4 .   ? -17.381 -14.271 16.382  1.00 46.88  ? 737 HOH A O   1 
HETATM 7335 O  O   . HOH K 4 .   ? -4.214  -19.630 13.292  1.00 43.18  ? 738 HOH A O   1 
HETATM 7336 O  O   . HOH K 4 .   ? -24.747 -11.715 7.289   1.00 55.47  ? 739 HOH A O   1 
HETATM 7337 O  O   . HOH K 4 .   ? -8.008  -16.659 0.712   1.00 29.62  ? 740 HOH A O   1 
HETATM 7338 O  O   . HOH K 4 .   ? -25.811 -24.541 19.001  1.00 61.76  ? 741 HOH A O   1 
HETATM 7339 O  O   . HOH K 4 .   ? 9.410   -11.617 -0.467  1.00 47.50  ? 742 HOH A O   1 
HETATM 7340 O  O   . HOH K 4 .   ? -27.532 -30.596 16.302  1.00 61.13  ? 743 HOH A O   1 
HETATM 7341 O  O   . HOH K 4 .   ? -17.477 -23.220 26.270  1.00 51.19  ? 744 HOH A O   1 
HETATM 7342 O  O   . HOH K 4 .   ? -1.452  -3.858  -6.260  1.00 49.89  ? 745 HOH A O   1 
HETATM 7343 O  O   . HOH K 4 .   ? -2.359  -14.127 15.208  1.00 53.73  ? 746 HOH A O   1 
HETATM 7344 O  O   . HOH K 4 .   ? -31.527 -22.124 8.882   1.00 48.22  ? 747 HOH A O   1 
HETATM 7345 O  O   . HOH K 4 .   ? -8.851  -35.131 4.501   1.00 57.24  ? 748 HOH A O   1 
HETATM 7346 O  O   . HOH K 4 .   ? -18.207 -32.199 12.107  1.00 52.26  ? 749 HOH A O   1 
HETATM 7347 O  O   . HOH K 4 .   ? 7.086   -22.003 24.569  1.00 45.67  ? 750 HOH A O   1 
HETATM 7348 O  O   . HOH K 4 .   ? 14.476  -23.666 5.629   1.00 43.06  ? 751 HOH A O   1 
HETATM 7349 O  O   . HOH K 4 .   ? -2.470  -40.066 11.036  1.00 58.80  ? 752 HOH A O   1 
HETATM 7350 O  O   . HOH K 4 .   ? 9.855   -23.884 11.162  1.00 57.80  ? 753 HOH A O   1 
HETATM 7351 O  O   . HOH K 4 .   ? -13.001 -6.720  -6.032  1.00 25.35  ? 754 HOH A O   1 
HETATM 7352 O  O   . HOH K 4 .   ? -18.750 -34.549 20.821  1.00 52.91  ? 755 HOH A O   1 
HETATM 7353 O  O   . HOH K 4 .   ? -4.484  -38.166 21.683  1.00 44.15  ? 756 HOH A O   1 
HETATM 7354 O  O   . HOH K 4 .   ? 3.527   -30.401 23.566  1.00 42.51  ? 757 HOH A O   1 
HETATM 7355 O  O   . HOH K 4 .   ? -20.983 -29.982 21.253  1.00 53.04  ? 758 HOH A O   1 
HETATM 7356 O  O   . HOH K 4 .   ? 15.605  -9.988  7.857   1.00 62.05  ? 759 HOH A O   1 
HETATM 7357 O  O   . HOH K 4 .   ? -25.867 -23.593 -4.416  1.00 57.47  ? 760 HOH A O   1 
HETATM 7358 O  O   . HOH K 4 .   ? -1.132  -23.502 -6.040  1.00 54.28  ? 761 HOH A O   1 
HETATM 7359 O  O   . HOH K 4 .   ? -27.358 -20.230 11.903  1.00 57.93  ? 762 HOH A O   1 
HETATM 7360 O  O   . HOH K 4 .   ? -25.294 -15.433 13.364  1.00 53.22  ? 763 HOH A O   1 
HETATM 7361 O  O   . HOH K 4 .   ? -32.598 -16.379 3.801   1.00 60.20  ? 764 HOH A O   1 
HETATM 7362 O  O   . HOH K 4 .   ? 6.328   -9.461  -3.062  1.00 59.20  ? 765 HOH A O   1 
HETATM 7363 O  O   . HOH K 4 .   ? -19.794 -25.979 -12.502 1.00 49.89  ? 766 HOH A O   1 
HETATM 7364 O  O   . HOH K 4 .   ? -29.803 -24.073 18.223  1.00 58.78  ? 767 HOH A O   1 
HETATM 7365 O  O   . HOH K 4 .   ? -5.135  -37.688 26.638  1.00 74.96  ? 768 HOH A O   1 
HETATM 7366 O  O   . HOH K 4 .   ? -22.027 -35.343 7.062   1.00 45.23  ? 769 HOH A O   1 
HETATM 7367 O  O   . HOH K 4 .   ? -25.907 -11.097 13.057  1.00 59.91  ? 770 HOH A O   1 
HETATM 7368 O  O   . HOH K 4 .   ? -19.792 -42.717 19.611  1.00 55.29  ? 771 HOH A O   1 
HETATM 7369 O  O   . HOH K 4 .   ? -20.380 -17.103 19.770  1.00 54.98  ? 772 HOH A O   1 
HETATM 7370 O  O   . HOH K 4 .   ? -17.553 -39.141 4.839   1.00 62.83  ? 773 HOH A O   1 
HETATM 7371 O  O   . HOH K 4 .   ? -3.798  -37.795 24.431  1.00 61.47  ? 774 HOH A O   1 
HETATM 7372 O  O   . HOH K 4 .   ? 2.580   -35.650 10.933  1.00 50.26  ? 775 HOH A O   1 
HETATM 7373 O  O   . HOH K 4 .   ? -15.560 -21.580 21.144  1.00 43.49  ? 776 HOH A O   1 
HETATM 7374 O  O   . HOH K 4 .   ? 0.115   6.045   -2.371  1.00 54.31  ? 777 HOH A O   1 
HETATM 7375 O  O   . HOH K 4 .   ? -15.493 -36.293 28.259  1.00 51.68  ? 778 HOH A O   1 
HETATM 7376 O  O   . HOH K 4 .   ? -10.777 -25.875 -5.754  1.00 62.61  ? 779 HOH A O   1 
HETATM 7377 O  O   . HOH K 4 .   ? 6.631   -23.183 -2.815  1.00 61.88  ? 780 HOH A O   1 
HETATM 7378 O  O   . HOH K 4 .   ? -12.961 -27.623 -4.912  1.00 56.77  ? 781 HOH A O   1 
HETATM 7379 O  O   . HOH K 4 .   ? -25.017 -8.478  14.342  1.00 66.19  ? 782 HOH A O   1 
HETATM 7380 O  O   . HOH K 4 .   ? 3.122   -16.654 -7.654  1.00 58.47  ? 783 HOH A O   1 
HETATM 7381 O  O   . HOH K 4 .   ? -20.081 -31.661 -6.710  1.00 48.78  ? 784 HOH A O   1 
HETATM 7382 O  O   . HOH K 4 .   ? -7.346  -2.032  -6.591  1.00 45.73  ? 785 HOH A O   1 
HETATM 7383 O  O   . HOH K 4 .   ? 8.300   -28.890 11.167  1.00 51.99  ? 786 HOH A O   1 
HETATM 7384 O  O   . HOH K 4 .   ? -4.671  -41.038 12.947  1.00 54.03  ? 787 HOH A O   1 
HETATM 7385 O  O   . HOH K 4 .   ? -19.259 -10.928 1.983   1.00 38.78  ? 788 HOH A O   1 
HETATM 7386 O  O   . HOH K 4 .   ? -10.421 -38.472 31.293  1.00 53.86  ? 789 HOH A O   1 
HETATM 7387 O  O   . HOH K 4 .   ? 5.343   -17.882 24.495  1.00 55.81  ? 790 HOH A O   1 
HETATM 7388 O  O   . HOH L 4 .   ? -10.599 30.920  15.153  1.00 45.23  ? 701 HOH B O   1 
HETATM 7389 O  O   . HOH L 4 .   ? -31.870 15.241  1.358   1.00 47.18  ? 702 HOH B O   1 
HETATM 7390 O  O   . HOH L 4 .   ? -4.255  18.625  14.254  1.00 47.03  ? 703 HOH B O   1 
HETATM 7391 O  O   . HOH L 4 .   ? -37.245 23.640  -2.152  1.00 51.48  ? 704 HOH B O   1 
HETATM 7392 O  O   . HOH L 4 .   ? 5.243   32.272  1.460   1.00 56.64  ? 705 HOH B O   1 
HETATM 7393 O  O   . HOH L 4 .   ? -4.615  19.920  23.287  1.00 51.84  ? 706 HOH B O   1 
HETATM 7394 O  O   . HOH L 4 .   ? -26.392 37.665  3.050   1.00 40.60  ? 707 HOH B O   1 
HETATM 7395 O  O   . HOH L 4 .   ? -7.326  30.714  10.057  1.00 31.10  ? 708 HOH B O   1 
HETATM 7396 O  O   . HOH L 4 .   ? -11.426 33.226  12.128  1.00 43.66  ? 709 HOH B O   1 
HETATM 7397 O  O   . HOH L 4 .   ? -39.385 23.148  5.288   1.00 50.98  ? 710 HOH B O   1 
HETATM 7398 O  O   . HOH L 4 .   ? -9.671  30.949  -7.533  1.00 46.41  ? 711 HOH B O   1 
HETATM 7399 O  O   . HOH L 4 .   ? -3.878  29.137  -3.179  1.00 47.24  ? 712 HOH B O   1 
HETATM 7400 O  O   . HOH L 4 .   ? -18.798 26.377  -10.298 1.00 52.34  ? 713 HOH B O   1 
HETATM 7401 O  O   . HOH L 4 .   ? 3.218   26.943  10.953  1.00 47.81  ? 714 HOH B O   1 
HETATM 7402 O  O   . HOH L 4 .   ? -8.853  38.696  8.599   1.00 49.13  ? 715 HOH B O   1 
HETATM 7403 O  O   . HOH L 4 .   ? -15.441 8.730   21.813  1.00 50.65  ? 716 HOH B O   1 
HETATM 7404 O  O   . HOH L 4 .   ? -21.337 9.589   21.296  1.00 58.02  ? 717 HOH B O   1 
HETATM 7405 O  O   . HOH L 4 .   ? -20.937 23.929  5.262   1.00 38.03  ? 718 HOH B O   1 
HETATM 7406 O  O   . HOH L 4 .   ? -33.841 24.981  -1.252  1.00 50.60  ? 719 HOH B O   1 
HETATM 7407 O  O   . HOH L 4 .   ? -40.777 22.495  3.114   1.00 61.60  ? 720 HOH B O   1 
HETATM 7408 O  O   . HOH L 4 .   ? -13.951 33.051  -1.294  1.00 35.91  ? 721 HOH B O   1 
HETATM 7409 O  O   . HOH L 4 .   ? -24.680 26.485  -2.878  1.00 46.35  ? 722 HOH B O   1 
HETATM 7410 O  O   . HOH L 4 .   ? -21.864 28.959  0.956   1.00 33.08  ? 723 HOH B O   1 
HETATM 7411 O  O   . HOH L 4 .   ? -3.733  46.280  -2.091  1.00 57.92  ? 724 HOH B O   1 
HETATM 7412 O  O   . HOH L 4 .   ? -6.461  10.566  14.857  1.00 48.50  ? 725 HOH B O   1 
HETATM 7413 O  O   . HOH L 4 .   ? -23.440 25.415  27.389  1.00 54.60  ? 726 HOH B O   1 
HETATM 7414 O  O   . HOH L 4 .   ? -33.745 23.685  24.012  1.00 64.71  ? 727 HOH B O   1 
HETATM 7415 O  O   . HOH L 4 .   ? -3.805  42.908  10.621  1.00 59.88  ? 728 HOH B O   1 
HETATM 7416 O  O   . HOH L 4 .   ? -12.858 27.381  13.215  1.00 45.82  ? 729 HOH B O   1 
HETATM 7417 O  O   . HOH L 4 .   ? -25.044 12.085  5.965   1.00 46.48  ? 730 HOH B O   1 
HETATM 7418 O  O   . HOH L 4 .   ? -4.132  20.650  30.599  1.00 37.55  ? 731 HOH B O   1 
HETATM 7419 O  O   . HOH L 4 .   ? -4.475  39.879  11.410  1.00 49.81  ? 732 HOH B O   1 
HETATM 7420 O  O   . HOH L 4 .   ? -23.901 12.958  3.675   1.00 55.42  ? 733 HOH B O   1 
HETATM 7421 O  O   . HOH L 4 .   ? 6.254   36.635  5.559   1.00 80.50  ? 734 HOH B O   1 
HETATM 7422 O  O   . HOH L 4 .   ? -23.161 49.309  -0.557  1.00 54.32  ? 735 HOH B O   1 
HETATM 7423 O  O   . HOH L 4 .   ? -16.358 30.152  0.404   1.00 35.68  ? 736 HOH B O   1 
HETATM 7424 O  O   . HOH L 4 .   ? -21.411 40.037  -6.590  1.00 23.79  ? 737 HOH B O   1 
HETATM 7425 O  O   . HOH L 4 .   ? -26.206 14.246  -3.571  1.00 65.01  ? 738 HOH B O   1 
HETATM 7426 O  O   . HOH L 4 .   ? -7.444  19.719  -1.473  1.00 49.81  ? 739 HOH B O   1 
HETATM 7427 O  O   . HOH L 4 .   ? -24.982 44.670  -3.392  1.00 42.18  ? 740 HOH B O   1 
HETATM 7428 O  O   . HOH L 4 .   ? -9.800  42.667  -6.776  1.00 58.71  ? 741 HOH B O   1 
HETATM 7429 O  O   . HOH L 4 .   ? -27.079 14.459  11.633  1.00 46.59  ? 742 HOH B O   1 
HETATM 7430 O  O   . HOH L 4 .   ? -26.360 32.711  16.241  1.00 46.74  ? 743 HOH B O   1 
HETATM 7431 O  O   . HOH L 4 .   ? -18.753 23.824  3.436   1.00 20.11  ? 744 HOH B O   1 
HETATM 7432 O  O   . HOH L 4 .   ? -21.368 36.075  19.379  1.00 61.03  ? 745 HOH B O   1 
HETATM 7433 O  O   . HOH L 4 .   ? -25.728 31.177  -1.387  1.00 41.02  ? 746 HOH B O   1 
HETATM 7434 O  O   . HOH L 4 .   ? -26.163 20.856  -12.109 1.00 60.20  ? 747 HOH B O   1 
HETATM 7435 O  O   . HOH L 4 .   ? 0.932   32.828  -6.809  1.00 56.39  ? 748 HOH B O   1 
HETATM 7436 O  O   . HOH L 4 .   ? -23.598 20.236  -7.016  1.00 47.57  ? 749 HOH B O   1 
HETATM 7437 O  O   . HOH L 4 .   ? -22.169 27.507  -6.894  1.00 36.96  ? 750 HOH B O   1 
HETATM 7438 O  O   . HOH L 4 .   ? 8.291   35.429  4.772   1.00 55.53  ? 751 HOH B O   1 
HETATM 7439 O  O   . HOH L 4 .   ? -30.922 11.407  6.656   1.00 45.94  ? 752 HOH B O   1 
HETATM 7440 O  O   . HOH L 4 .   ? 10.795  32.736  6.677   1.00 64.95  ? 753 HOH B O   1 
HETATM 7441 O  O   . HOH L 4 .   ? -9.667  52.619  3.588   1.00 67.31  ? 754 HOH B O   1 
HETATM 7442 O  O   . HOH L 4 .   ? -30.253 16.656  20.926  1.00 49.64  ? 755 HOH B O   1 
HETATM 7443 O  O   . HOH L 4 .   ? -21.103 19.542  4.567   1.00 62.77  ? 756 HOH B O   1 
HETATM 7444 O  O   . HOH L 4 .   ? -8.731  22.972  -5.480  1.00 47.46  ? 757 HOH B O   1 
HETATM 7445 O  O   . HOH L 4 .   ? -6.858  42.863  -7.554  1.00 61.56  ? 758 HOH B O   1 
HETATM 7446 O  O   . HOH L 4 .   ? -27.010 26.845  23.566  1.00 61.51  ? 759 HOH B O   1 
HETATM 7447 O  O   . HOH L 4 .   ? -11.406 7.776   10.186  1.00 46.26  ? 760 HOH B O   1 
HETATM 7448 O  O   . HOH L 4 .   ? 6.223   23.898  6.182   1.00 34.67  ? 761 HOH B O   1 
HETATM 7449 O  O   . HOH L 4 .   ? -16.606 39.581  -9.041  1.00 48.92  ? 762 HOH B O   1 
HETATM 7450 O  O   . HOH L 4 .   ? -0.956  19.747  10.735  1.00 61.55  ? 763 HOH B O   1 
HETATM 7451 O  O   . HOH L 4 .   ? -15.082 8.714   27.076  1.00 65.10  ? 764 HOH B O   1 
HETATM 7452 O  O   . HOH L 4 .   ? -24.187 26.915  24.926  1.00 59.25  ? 765 HOH B O   1 
HETATM 7453 O  O   . HOH L 4 .   ? -20.801 16.538  3.041   1.00 63.85  ? 766 HOH B O   1 
HETATM 7454 O  O   . HOH L 4 .   ? -5.021  24.059  -5.592  1.00 58.18  ? 767 HOH B O   1 
HETATM 7455 O  O   . HOH L 4 .   ? -26.112 16.347  -5.730  1.00 57.97  ? 768 HOH B O   1 
HETATM 7456 O  O   . HOH L 4 .   ? -10.525 19.143  -3.096  1.00 51.70  ? 769 HOH B O   1 
HETATM 7457 O  O   . HOH L 4 .   ? -31.042 7.664   10.235  1.00 66.72  ? 770 HOH B O   1 
HETATM 7458 O  O   . HOH L 4 .   ? 7.218   36.674  8.009   1.00 49.39  ? 771 HOH B O   1 
HETATM 7459 O  O   . HOH L 4 .   ? -41.327 22.178  11.110  1.00 61.75  ? 772 HOH B O   1 
HETATM 7460 O  O   . HOH L 4 .   ? -23.536 31.384  -2.943  1.00 50.08  ? 773 HOH B O   1 
HETATM 7461 O  O   . HOH L 4 .   ? -21.910 19.507  -5.045  1.00 57.86  ? 774 HOH B O   1 
HETATM 7462 O  O   . HOH L 4 .   ? -27.020 11.693  20.776  1.00 56.83  ? 775 HOH B O   1 
HETATM 7463 O  O   . HOH L 4 .   ? -14.660 12.767  3.274   1.00 52.97  ? 776 HOH B O   1 
HETATM 7464 O  O   . HOH L 4 .   ? -22.612 11.537  1.672   1.00 52.09  ? 777 HOH B O   1 
HETATM 7465 O  O   . HOH L 4 .   ? -6.090  11.863  10.787  1.00 61.41  ? 778 HOH B O   1 
HETATM 7466 O  O   . HOH L 4 .   ? -1.620  34.489  19.228  1.00 72.61  ? 779 HOH B O   1 
HETATM 7467 O  O   . HOH L 4 .   ? -10.499 52.003  8.904   1.00 58.09  ? 780 HOH B O   1 
HETATM 7468 O  O   . HOH L 4 .   ? 1.881   43.676  6.298   1.00 55.30  ? 781 HOH B O   1 
HETATM 7469 O  O   . HOH L 4 .   ? -4.762  29.934  -7.550  1.00 51.67  ? 782 HOH B O   1 
HETATM 7470 O  O   . HOH L 4 .   ? -27.847 35.811  1.667   1.00 46.48  ? 783 HOH B O   1 
HETATM 7471 O  O   . HOH L 4 .   ? -31.659 28.077  -5.474  1.00 52.98  ? 784 HOH B O   1 
HETATM 7472 O  O   . HOH L 4 .   ? -19.229 46.640  -10.151 1.00 54.60  ? 785 HOH B O   1 
HETATM 7473 O  O   . HOH L 4 .   ? -23.031 29.588  -4.793  1.00 45.93  ? 786 HOH B O   1 
HETATM 7474 O  O   . HOH L 4 .   ? -13.835 16.468  -2.214  1.00 51.98  ? 787 HOH B O   1 
HETATM 7475 O  O   . HOH L 4 .   ? -2.492  28.542  19.762  1.00 48.88  ? 788 HOH B O   1 
HETATM 7476 O  O   . HOH L 4 .   ? -10.702 41.183  9.811   1.00 53.23  ? 789 HOH B O   1 
HETATM 7477 O  O   . HOH L 4 .   ? -5.421  29.397  26.025  1.00 57.71  ? 790 HOH B O   1 
HETATM 7478 O  O   . HOH M 4 .   ? -37.248 -6.498  -25.799 1.00 49.68  ? 701 HOH C O   1 
HETATM 7479 O  O   . HOH M 4 .   ? -38.266 -18.289 -31.437 1.00 35.32  ? 702 HOH C O   1 
HETATM 7480 O  O   . HOH M 4 .   ? -21.330 -2.650  -24.935 1.00 50.06  ? 703 HOH C O   1 
HETATM 7481 O  O   . HOH M 4 .   ? -27.200 -24.752 -18.415 1.00 45.07  ? 704 HOH C O   1 
HETATM 7482 O  O   . HOH M 4 .   ? -33.873 -29.534 -33.325 1.00 44.53  ? 705 HOH C O   1 
HETATM 7483 O  O   . HOH M 4 .   ? -18.455 -9.691  -14.584 1.00 54.63  ? 706 HOH C O   1 
HETATM 7484 O  O   . HOH M 4 .   ? -31.616 -0.968  -14.322 1.00 43.10  ? 707 HOH C O   1 
HETATM 7485 O  O   . HOH M 4 .   ? -24.674 -3.399  -29.881 1.00 46.07  ? 708 HOH C O   1 
HETATM 7486 O  O   . HOH M 4 .   ? -22.532 -9.225  -8.287  1.00 45.38  ? 709 HOH C O   1 
HETATM 7487 O  O   . HOH M 4 .   ? -8.168  -5.452  -29.530 1.00 76.63  ? 710 HOH C O   1 
HETATM 7488 O  O   . HOH M 4 .   ? -24.130 -18.563 -12.461 1.00 42.72  ? 711 HOH C O   1 
HETATM 7489 O  O   . HOH M 4 .   ? -36.543 -27.806 -30.850 1.00 54.28  ? 712 HOH C O   1 
HETATM 7490 O  O   . HOH M 4 .   ? -14.638 -26.046 -10.868 1.00 44.96  ? 713 HOH C O   1 
HETATM 7491 O  O   . HOH M 4 .   ? -26.737 -29.202 -20.523 1.00 48.61  ? 714 HOH C O   1 
HETATM 7492 O  O   . HOH M 4 .   ? -32.348 -29.693 -37.092 1.00 54.08  ? 715 HOH C O   1 
HETATM 7493 O  O   . HOH M 4 .   ? -41.306 2.884   -20.633 1.00 66.50  ? 716 HOH C O   1 
HETATM 7494 O  O   . HOH M 4 .   ? -20.684 -40.638 -33.029 1.00 60.58  ? 717 HOH C O   1 
HETATM 7495 O  O   . HOH M 4 .   ? -19.945 -31.187 -21.007 1.00 50.97  ? 718 HOH C O   1 
HETATM 7496 O  O   . HOH M 4 .   ? -29.081 -33.035 -29.286 1.00 50.32  ? 719 HOH C O   1 
HETATM 7497 O  O   . HOH M 4 .   ? -17.993 -21.887 -38.237 1.00 49.96  ? 720 HOH C O   1 
HETATM 7498 O  O   . HOH M 4 .   ? -35.426 -13.504 -15.600 1.00 53.28  ? 721 HOH C O   1 
HETATM 7499 O  O   . HOH M 4 .   ? -37.285 -17.352 -25.407 1.00 35.44  ? 722 HOH C O   1 
HETATM 7500 O  O   . HOH M 4 .   ? -36.379 -12.093 -43.472 1.00 43.84  ? 723 HOH C O   1 
HETATM 7501 O  O   . HOH M 4 .   ? -26.726 -8.260  -25.479 1.00 48.80  ? 724 HOH C O   1 
HETATM 7502 O  O   . HOH M 4 .   ? -27.257 -30.236 -24.981 1.00 35.91  ? 725 HOH C O   1 
HETATM 7503 O  O   . HOH M 4 .   ? -14.117 -16.811 -17.660 1.00 41.83  ? 726 HOH C O   1 
HETATM 7504 O  O   . HOH M 4 .   ? -33.224 -28.125 -24.796 1.00 35.57  ? 727 HOH C O   1 
HETATM 7505 O  O   . HOH M 4 .   ? -43.012 -8.517  -24.512 1.00 45.20  ? 728 HOH C O   1 
HETATM 7506 O  O   . HOH M 4 .   ? -1.632  -17.529 -23.246 1.00 55.95  ? 729 HOH C O   1 
HETATM 7507 O  O   . HOH M 4 .   ? -5.749  -23.914 -34.316 1.00 65.07  ? 730 HOH C O   1 
HETATM 7508 O  O   . HOH M 4 .   ? -37.256 -24.960 -29.182 1.00 42.48  ? 731 HOH C O   1 
HETATM 7509 O  O   . HOH M 4 .   ? -36.273 -16.961 -36.621 1.00 47.48  ? 732 HOH C O   1 
HETATM 7510 O  O   . HOH M 4 .   ? -17.349 -20.847 -21.685 1.00 44.45  ? 733 HOH C O   1 
HETATM 7511 O  O   . HOH M 4 .   ? -12.167 9.346   -23.306 1.00 75.47  ? 734 HOH C O   1 
HETATM 7512 O  O   . HOH M 4 .   ? -16.775 -8.450  -4.438  1.00 54.45  ? 735 HOH C O   1 
HETATM 7513 O  O   . HOH M 4 .   ? -40.823 -7.385  -19.977 1.00 41.13  ? 736 HOH C O   1 
HETATM 7514 O  O   . HOH M 4 .   ? -18.005 -23.431 -21.442 1.00 41.06  ? 737 HOH C O   1 
HETATM 7515 O  O   . HOH M 4 .   ? -20.013 -26.803 -20.126 1.00 60.69  ? 738 HOH C O   1 
HETATM 7516 O  O   . HOH M 4 .   ? -8.055  -7.282  -10.061 1.00 38.87  ? 739 HOH C O   1 
HETATM 7517 O  O   . HOH M 4 .   ? -19.033 -19.896 -19.600 1.00 21.53  ? 740 HOH C O   1 
HETATM 7518 O  O   . HOH M 4 .   ? -6.595  4.690   -29.342 1.00 62.35  ? 741 HOH C O   1 
HETATM 7519 O  O   . HOH M 4 .   ? -30.252 -18.760 -13.839 1.00 56.69  ? 742 HOH C O   1 
HETATM 7520 O  O   . HOH M 4 .   ? -25.535 -38.048 -29.894 1.00 55.97  ? 743 HOH C O   1 
HETATM 7521 O  O   . HOH M 4 .   ? -33.499 -19.062 -22.238 1.00 49.47  ? 744 HOH C O   1 
HETATM 7522 O  O   . HOH M 4 .   ? -6.714  -35.938 -30.101 1.00 64.14  ? 745 HOH C O   1 
HETATM 7523 O  O   . HOH M 4 .   ? -21.707 -29.328 -20.082 1.00 49.08  ? 746 HOH C O   1 
HETATM 7524 O  O   . HOH M 4 .   ? -32.250 -36.557 -37.553 1.00 56.45  ? 747 HOH C O   1 
HETATM 7525 O  O   . HOH M 4 .   ? -17.858 -34.480 -18.288 1.00 55.06  ? 748 HOH C O   1 
HETATM 7526 O  O   . HOH M 4 .   ? -30.635 4.760   -25.440 1.00 50.54  ? 749 HOH C O   1 
HETATM 7527 O  O   . HOH M 4 .   ? -5.775  -3.752  -9.863  1.00 57.79  ? 750 HOH C O   1 
HETATM 7528 O  O   . HOH M 4 .   ? -13.740 -0.836  -5.293  1.00 56.18  ? 751 HOH C O   1 
HETATM 7529 O  O   . HOH M 4 .   ? -32.265 -14.181 -19.063 1.00 46.19  ? 752 HOH C O   1 
HETATM 7530 O  O   . HOH M 4 .   ? -17.598 -12.944 -16.714 1.00 41.34  ? 753 HOH C O   1 
HETATM 7531 O  O   . HOH M 4 .   ? -38.164 -14.793 -40.617 1.00 52.91  ? 754 HOH C O   1 
HETATM 7532 O  O   . HOH M 4 .   ? -35.269 -9.145  -36.889 1.00 50.23  ? 755 HOH C O   1 
HETATM 7533 O  O   . HOH M 4 .   ? -12.806 -30.357 -5.165  1.00 59.01  ? 756 HOH C O   1 
HETATM 7534 O  O   . HOH M 4 .   ? -12.302 -19.513 -14.327 1.00 50.80  ? 757 HOH C O   1 
HETATM 7535 O  O   . HOH M 4 .   ? -5.113  -21.446 -33.996 1.00 45.66  ? 758 HOH C O   1 
HETATM 7536 O  O   . HOH M 4 .   ? -36.083 -12.982 -26.627 1.00 51.05  ? 759 HOH C O   1 
HETATM 7537 O  O   . HOH M 4 .   ? -38.684 -6.284  -14.083 1.00 51.53  ? 760 HOH C O   1 
HETATM 7538 O  O   . HOH M 4 .   ? -13.886 -19.486 -8.039  1.00 39.70  ? 761 HOH C O   1 
HETATM 7539 O  O   . HOH M 4 .   ? -5.326  -7.531  -32.318 1.00 56.08  ? 762 HOH C O   1 
HETATM 7540 O  O   . HOH M 4 .   ? -14.865 1.820   -8.964  1.00 48.43  ? 763 HOH C O   1 
HETATM 7541 O  O   . HOH M 4 .   ? -34.820 -30.323 -42.847 1.00 52.27  ? 764 HOH C O   1 
HETATM 7542 O  O   . HOH M 4 .   ? -37.069 -11.974 -34.293 1.00 50.60  ? 765 HOH C O   1 
HETATM 7543 O  O   . HOH M 4 .   ? -37.868 -12.138 -39.222 1.00 61.65  ? 766 HOH C O   1 
HETATM 7544 O  O   . HOH M 4 .   ? -26.885 0.123   -11.337 1.00 54.23  ? 767 HOH C O   1 
HETATM 7545 O  O   . HOH M 4 .   ? -2.387  -2.713  -18.323 1.00 63.08  ? 768 HOH C O   1 
HETATM 7546 O  O   . HOH M 4 .   ? -5.349  -14.188 -18.622 1.00 50.46  ? 769 HOH C O   1 
HETATM 7547 O  O   . HOH M 4 .   ? -14.921 -16.678 -4.065  1.00 54.21  ? 770 HOH C O   1 
HETATM 7548 O  O   . HOH M 4 .   ? -35.553 -27.455 -23.416 1.00 46.93  ? 771 HOH C O   1 
HETATM 7549 O  O   . HOH M 4 .   ? -21.022 -8.300  -3.730  1.00 50.68  ? 772 HOH C O   1 
HETATM 7550 O  O   . HOH M 4 .   ? -11.145 -0.219  -9.545  1.00 60.81  ? 773 HOH C O   1 
HETATM 7551 O  O   . HOH M 4 .   ? -28.197 -13.209 -7.404  1.00 53.28  ? 774 HOH C O   1 
HETATM 7552 O  O   . HOH M 4 .   ? -29.990 -30.891 -24.039 1.00 49.84  ? 775 HOH C O   1 
HETATM 7553 O  O   . HOH M 4 .   ? -30.894 -25.521 -20.455 1.00 51.45  ? 776 HOH C O   1 
HETATM 7554 O  O   . HOH M 4 .   ? -23.299 -11.005 -6.493  1.00 38.16  ? 777 HOH C O   1 
HETATM 7555 O  O   . HOH M 4 .   ? -27.578 2.586   -9.891  1.00 63.85  ? 778 HOH C O   1 
HETATM 7556 O  O   . HOH N 4 .   ? -47.606 33.426  -23.393 1.00 50.95  ? 701 HOH D O   1 
HETATM 7557 O  O   . HOH N 4 .   ? -45.475 34.574  -43.449 1.00 49.96  ? 702 HOH D O   1 
HETATM 7558 O  O   . HOH N 4 .   ? -37.630 39.752  -11.753 1.00 37.03  ? 703 HOH D O   1 
HETATM 7559 O  O   . HOH N 4 .   ? -27.574 27.874  -44.735 1.00 40.47  ? 704 HOH D O   1 
HETATM 7560 O  O   . HOH N 4 .   ? -47.132 28.797  -31.482 1.00 38.84  ? 705 HOH D O   1 
HETATM 7561 O  O   . HOH N 4 .   ? -16.903 6.850   -21.932 1.00 48.99  ? 706 HOH D O   1 
HETATM 7562 O  O   . HOH N 4 .   ? -39.915 24.595  -20.230 1.00 56.73  ? 707 HOH D O   1 
HETATM 7563 O  O   . HOH N 4 .   ? -35.557 38.460  -25.467 1.00 37.68  ? 708 HOH D O   1 
HETATM 7564 O  O   . HOH N 4 .   ? -46.326 22.019  -29.016 1.00 44.51  ? 709 HOH D O   1 
HETATM 7565 O  O   . HOH N 4 .   ? -30.685 39.052  -27.977 1.00 47.29  ? 710 HOH D O   1 
HETATM 7566 O  O   . HOH N 4 .   ? -35.869 22.337  -18.261 1.00 46.33  ? 711 HOH D O   1 
HETATM 7567 O  O   . HOH N 4 .   ? -26.278 25.959  -21.899 1.00 49.14  ? 712 HOH D O   1 
HETATM 7568 O  O   . HOH N 4 .   ? -20.674 13.094  -19.501 1.00 49.19  ? 713 HOH D O   1 
HETATM 7569 O  O   . HOH N 4 .   ? -45.264 31.007  -39.480 1.00 71.67  ? 714 HOH D O   1 
HETATM 7570 O  O   . HOH N 4 .   ? -26.820 14.134  -38.554 1.00 56.04  ? 715 HOH D O   1 
HETATM 7571 O  O   . HOH N 4 .   ? -31.446 44.102  -7.067  1.00 56.14  ? 716 HOH D O   1 
HETATM 7572 O  O   . HOH N 4 .   ? -27.027 37.331  -15.077 1.00 44.45  ? 717 HOH D O   1 
HETATM 7573 O  O   . HOH N 4 .   ? -22.269 29.825  -18.256 1.00 35.83  ? 718 HOH D O   1 
HETATM 7574 O  O   . HOH N 4 .   ? -39.983 47.239  -12.078 1.00 51.83  ? 719 HOH D O   1 
HETATM 7575 O  O   . HOH N 4 .   ? -49.333 39.689  -20.313 1.00 42.26  ? 720 HOH D O   1 
HETATM 7576 O  O   . HOH N 4 .   ? -26.317 15.220  -29.598 1.00 57.01  ? 721 HOH D O   1 
HETATM 7577 O  O   . HOH N 4 .   ? -36.007 18.074  -20.328 1.00 57.42  ? 722 HOH D O   1 
HETATM 7578 O  O   . HOH N 4 .   ? -23.793 20.611  -10.787 1.00 56.64  ? 723 HOH D O   1 
HETATM 7579 O  O   . HOH N 4 .   ? -17.158 40.674  -31.554 1.00 66.55  ? 724 HOH D O   1 
HETATM 7580 O  O   . HOH N 4 .   ? -24.005 38.453  -6.025  1.00 41.08  ? 725 HOH D O   1 
HETATM 7581 O  O   . HOH N 4 .   ? -9.861  49.098  -25.113 1.00 54.48  ? 726 HOH D O   1 
HETATM 7582 O  O   . HOH N 4 .   ? -46.131 40.436  -25.804 1.00 50.98  ? 727 HOH D O   1 
HETATM 7583 O  O   . HOH N 4 .   ? -49.464 40.247  -17.224 1.00 51.58  ? 728 HOH D O   1 
HETATM 7584 O  O   . HOH N 4 .   ? -32.277 46.668  -28.467 1.00 67.59  ? 729 HOH D O   1 
HETATM 7585 O  O   . HOH N 4 .   ? -42.702 28.621  -22.383 1.00 40.62  ? 730 HOH D O   1 
HETATM 7586 O  O   . HOH N 4 .   ? -26.768 33.615  -17.178 1.00 50.92  ? 731 HOH D O   1 
HETATM 7587 O  O   . HOH N 4 .   ? -14.554 23.438  -38.278 1.00 55.76  ? 732 HOH D O   1 
HETATM 7588 O  O   . HOH N 4 .   ? -42.305 18.773  -24.774 1.00 48.35  ? 733 HOH D O   1 
HETATM 7589 O  O   . HOH N 4 .   ? -32.295 28.435  -12.409 1.00 51.79  ? 734 HOH D O   1 
HETATM 7590 O  O   . HOH N 4 .   ? -23.944 18.432  -8.983  1.00 49.69  ? 735 HOH D O   1 
HETATM 7591 O  O   . HOH N 4 .   ? -37.176 11.456  -25.253 1.00 70.48  ? 736 HOH D O   1 
HETATM 7592 O  O   . HOH N 4 .   ? -43.152 16.119  -26.436 1.00 46.99  ? 737 HOH D O   1 
HETATM 7593 O  O   . HOH N 4 .   ? -27.797 26.830  -19.724 1.00 24.91  ? 738 HOH D O   1 
HETATM 7594 O  O   . HOH N 4 .   ? -21.296 34.212  -35.119 1.00 40.04  ? 739 HOH D O   1 
HETATM 7595 O  O   . HOH N 4 .   ? -25.369 47.624  -10.094 1.00 41.57  ? 740 HOH D O   1 
HETATM 7596 O  O   . HOH N 4 .   ? -22.599 39.051  -36.342 1.00 46.90  ? 741 HOH D O   1 
HETATM 7597 O  O   . HOH N 4 .   ? -14.076 24.872  -17.904 1.00 58.81  ? 742 HOH D O   1 
HETATM 7598 O  O   . HOH N 4 .   ? -48.504 32.348  -29.768 1.00 53.19  ? 743 HOH D O   1 
HETATM 7599 O  O   . HOH N 4 .   ? -45.287 14.012  -37.186 1.00 56.72  ? 744 HOH D O   1 
HETATM 7600 O  O   . HOH N 4 .   ? -42.833 18.353  -36.859 1.00 52.66  ? 745 HOH D O   1 
HETATM 7601 O  O   . HOH N 4 .   ? -29.602 41.495  -27.690 1.00 53.96  ? 746 HOH D O   1 
HETATM 7602 O  O   . HOH N 4 .   ? -41.017 33.185  -19.180 1.00 44.75  ? 747 HOH D O   1 
HETATM 7603 O  O   . HOH N 4 .   ? -8.189  40.303  -22.281 1.00 48.37  ? 748 HOH D O   1 
HETATM 7604 O  O   . HOH N 4 .   ? -42.208 10.775  -37.324 1.00 72.75  ? 749 HOH D O   1 
HETATM 7605 O  O   . HOH N 4 .   ? -26.740 38.198  -3.448  1.00 73.07  ? 750 HOH D O   1 
HETATM 7606 O  O   . HOH N 4 .   ? -42.456 53.365  -18.868 1.00 65.16  ? 751 HOH D O   1 
HETATM 7607 O  O   . HOH N 4 .   ? -44.373 51.492  -23.877 1.00 59.47  ? 752 HOH D O   1 
HETATM 7608 O  O   . HOH N 4 .   ? -16.349 18.222  -36.819 1.00 49.88  ? 753 HOH D O   1 
HETATM 7609 O  O   . HOH N 4 .   ? -27.796 42.250  -30.917 1.00 60.02  ? 754 HOH D O   1 
HETATM 7610 O  O   . HOH N 4 .   ? -44.950 34.334  -26.392 1.00 57.02  ? 755 HOH D O   1 
HETATM 7611 O  O   . HOH N 4 .   ? -47.198 33.020  -34.184 1.00 50.00  ? 756 HOH D O   1 
HETATM 7612 O  O   . HOH N 4 .   ? -44.585 46.399  -9.559  1.00 54.97  ? 757 HOH D O   1 
HETATM 7613 O  O   . HOH N 4 .   ? -6.536  47.282  -12.828 1.00 50.54  ? 758 HOH D O   1 
HETATM 7614 O  O   . HOH N 4 .   ? -46.804 23.671  -31.025 1.00 39.19  ? 759 HOH D O   1 
HETATM 7615 O  O   . HOH N 4 .   ? -35.049 39.010  -7.519  1.00 57.05  ? 760 HOH D O   1 
HETATM 7616 O  O   . HOH N 4 .   ? -6.171  35.250  -28.136 1.00 63.86  ? 761 HOH D O   1 
HETATM 7617 O  O   . HOH N 4 .   ? -29.433 15.272  -21.232 1.00 58.03  ? 762 HOH D O   1 
HETATM 7618 O  O   . HOH N 4 .   ? -13.445 33.173  -19.327 1.00 53.64  ? 763 HOH D O   1 
HETATM 7619 O  O   . HOH N 4 .   ? -29.408 38.437  -3.844  1.00 59.39  ? 764 HOH D O   1 
HETATM 7620 O  O   . HOH N 4 .   ? -10.603 47.452  -20.649 1.00 51.88  ? 765 HOH D O   1 
HETATM 7621 O  O   . HOH N 4 .   ? -27.583 41.767  -35.154 1.00 55.55  ? 766 HOH D O   1 
HETATM 7622 O  O   . HOH N 4 .   ? -31.023 39.485  -6.047  1.00 46.78  ? 767 HOH D O   1 
HETATM 7623 O  O   . HOH N 4 .   ? -26.945 46.861  -25.784 1.00 57.09  ? 768 HOH D O   1 
HETATM 7624 O  O   . HOH N 4 .   ? -26.904 44.448  -34.927 1.00 52.95  ? 769 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 35  ? 0.8785 1.2996 0.8542 -0.2153 -0.0285 0.3345  362 VAL A N   
2    C CA  . VAL A 35  ? 0.8436 1.2877 0.8382 -0.2129 -0.0141 0.3200  362 VAL A CA  
3    C C   . VAL A 35  ? 0.8251 1.2148 0.8549 -0.2201 -0.0304 0.3207  362 VAL A C   
4    O O   . VAL A 35  ? 0.8222 1.2200 0.8699 -0.2181 -0.0234 0.3070  362 VAL A O   
5    C CB  . VAL A 35  ? 0.8785 1.3975 0.8685 -0.2330 0.0004  0.3439  362 VAL A CB  
6    C CG1 . VAL A 35  ? 0.8508 1.4127 0.8480 -0.2155 0.0232  0.3173  362 VAL A CG1 
7    C CG2 . VAL A 35  ? 0.9066 1.4703 0.8598 -0.2403 0.0069  0.3619  362 VAL A CG2 
8    N N   . SER A 36  ? 0.8026 1.1371 0.8411 -0.2272 -0.0527 0.3358  363 SER A N   
9    C CA  . SER A 36  ? 0.7733 1.0448 0.8404 -0.2291 -0.0693 0.3308  363 SER A CA  
10   C C   . SER A 36  ? 0.7123 0.9649 0.7880 -0.2042 -0.0599 0.2888  363 SER A C   
11   O O   . SER A 36  ? 0.6817 0.9471 0.7423 -0.1808 -0.0471 0.2637  363 SER A O   
12   C CB  . SER A 36  ? 0.7947 1.0111 0.8665 -0.2275 -0.0910 0.3444  363 SER A CB  
13   O OG  . SER A 36  ? 0.8026 0.9561 0.8972 -0.2160 -0.1021 0.3253  363 SER A OG  
14   N N   . LEU A 37  ? 0.6778 0.8994 0.7754 -0.2114 -0.0673 0.2824  364 LEU A N   
15   C CA  . LEU A 37  ? 0.6215 0.8272 0.7258 -0.1916 -0.0598 0.2460  364 LEU A CA  
16   C C   . LEU A 37  ? 0.6014 0.7619 0.7042 -0.1660 -0.0632 0.2219  364 LEU A C   
17   O O   . LEU A 37  ? 0.5719 0.7439 0.6658 -0.1448 -0.0505 0.1957  364 LEU A O   
18   C CB  . LEU A 37  ? 0.6177 0.8043 0.7416 -0.2081 -0.0680 0.2448  364 LEU A CB  
19   C CG  . LEU A 37  ? 0.5876 0.7588 0.7170 -0.1920 -0.0625 0.2100  364 LEU A CG  
20   C CD1 . LEU A 37  ? 0.5309 0.7499 0.6503 -0.1721 -0.0421 0.1906  364 LEU A CD1 
21   C CD2 . LEU A 37  ? 0.5979 0.7573 0.7426 -0.2151 -0.0730 0.2142  364 LEU A CD2 
22   N N   . ILE A 38  ? 0.6171 0.7284 0.7301 -0.1677 -0.0805 0.2318  365 ILE A N   
23   C CA  . ILE A 38  ? 0.5995 0.6758 0.7157 -0.1433 -0.0835 0.2120  365 ILE A CA  
24   C C   . ILE A 38  ? 0.5735 0.6812 0.6706 -0.1294 -0.0749 0.2089  365 ILE A C   
25   O O   . ILE A 38  ? 0.5555 0.6588 0.6501 -0.1092 -0.0679 0.1833  365 ILE A O   
26   C CB  . ILE A 38  ? 0.6399 0.6570 0.7752 -0.1439 -0.1039 0.2224  365 ILE A CB  
27   C CG1 . ILE A 38  ? 0.6174 0.6030 0.7626 -0.1162 -0.1028 0.1936  365 ILE A CG1 
28   C CG2 . ILE A 38  ? 0.6655 0.6836 0.7992 -0.1563 -0.1179 0.2596  365 ILE A CG2 
29   C CD1 . ILE A 38  ? 0.6476 0.5724 0.8137 -0.1119 -0.1171 0.1888  365 ILE A CD1 
30   N N   . SER A 39  ? 0.5868 0.7274 0.6684 -0.1424 -0.0756 0.2347  366 SER A N   
31   C CA  . SER A 39  ? 0.5644 0.7414 0.6198 -0.1340 -0.0667 0.2317  366 SER A CA  
32   C C   . SER A 39  ? 0.5280 0.7328 0.5695 -0.1198 -0.0470 0.2020  366 SER A C   
33   O O   . SER A 39  ? 0.5269 0.7292 0.5569 -0.1031 -0.0431 0.1823  366 SER A O   
34   C CB  . SER A 39  ? 0.5906 0.8067 0.6277 -0.1545 -0.0674 0.2638  366 SER A CB  
35   O OG  . SER A 39  ? 0.6318 0.8257 0.6740 -0.1642 -0.0871 0.2927  366 SER A OG  
36   N N   . ALA A 40  ? 0.5070 0.7379 0.5513 -0.1271 -0.0362 0.2005  367 ALA A N   
37   C CA  . ALA A 40  ? 0.4718 0.7288 0.5070 -0.1125 -0.0186 0.1750  367 ALA A CA  
38   C C   . ALA A 40  ? 0.4364 0.6594 0.4817 -0.0946 -0.0184 0.1461  367 ALA A C   
39   O O   . ALA A 40  ? 0.4208 0.6521 0.4531 -0.0782 -0.0085 0.1245  367 ALA A O   
40   C CB  . ALA A 40  ? 0.4542 0.7498 0.4973 -0.1246 -0.0095 0.1838  367 ALA A CB  
41   N N   . LEU A 41  ? 0.4309 0.6147 0.4973 -0.0981 -0.0296 0.1458  368 LEU A N   
42   C CA  . LEU A 41  ? 0.4152 0.5691 0.4902 -0.0829 -0.0293 0.1201  368 LEU A CA  
43   C C   . LEU A 41  ? 0.4196 0.5577 0.4889 -0.0685 -0.0323 0.1112  368 LEU A C   
44   O O   . LEU A 41  ? 0.4009 0.5371 0.4649 -0.0547 -0.0257 0.0898  368 LEU A O   
45   C CB  . LEU A 41  ? 0.4181 0.5350 0.5138 -0.0901 -0.0396 0.1199  368 LEU A CB  
46   C CG  . LEU A 41  ? 0.4262 0.5523 0.5304 -0.1070 -0.0402 0.1259  368 LEU A CG  
47   C CD1 . LEU A 41  ? 0.4496 0.5280 0.5696 -0.1164 -0.0549 0.1277  368 LEU A CD1 
48   C CD2 . LEU A 41  ? 0.3944 0.5427 0.4956 -0.0992 -0.0286 0.1061  368 LEU A CD2 
49   N N   . VAL A 42  ? 0.4462 0.5743 0.5179 -0.0733 -0.0438 0.1301  369 VAL A N   
50   C CA  . VAL A 42  ? 0.4466 0.5684 0.5144 -0.0627 -0.0492 0.1276  369 VAL A CA  
51   C C   . VAL A 42  ? 0.4427 0.5938 0.4825 -0.0581 -0.0393 0.1174  369 VAL A C   
52   O O   . VAL A 42  ? 0.4302 0.5757 0.4657 -0.0468 -0.0377 0.1001  369 VAL A O   
53   C CB  . VAL A 42  ? 0.4712 0.5836 0.5459 -0.0704 -0.0652 0.1553  369 VAL A CB  
54   C CG1 . VAL A 42  ? 0.4702 0.5875 0.5388 -0.0617 -0.0714 0.1551  369 VAL A CG1 
55   C CG2 . VAL A 42  ? 0.4786 0.5514 0.5820 -0.0703 -0.0767 0.1616  369 VAL A CG2 
56   N N   . ARG A 43  ? 0.4547 0.6368 0.4756 -0.0671 -0.0326 0.1274  370 ARG A N   
57   C CA  . ARG A 43  ? 0.4592 0.6678 0.4499 -0.0613 -0.0221 0.1155  370 ARG A CA  
58   C C   . ARG A 43  ? 0.4280 0.6323 0.4171 -0.0468 -0.0111 0.0878  370 ARG A C   
59   O O   . ARG A 43  ? 0.4256 0.6249 0.3980 -0.0376 -0.0099 0.0718  370 ARG A O   
60   C CB  . ARG A 43  ? 0.5007 0.7485 0.4739 -0.0723 -0.0142 0.1310  370 ARG A CB  
61   C CG  . ARG A 43  ? 0.5373 0.8121 0.4746 -0.0654 -0.0037 0.1187  370 ARG A CG  
62   C CD  . ARG A 43  ? 0.5990 0.9172 0.5175 -0.0784 0.0027  0.1389  370 ARG A CD  
63   N NE  . ARG A 43  ? 0.6527 0.9697 0.5670 -0.0952 -0.0125 0.1677  370 ARG A NE  
64   C CZ  . ARG A 43  ? 0.6735 1.0021 0.6001 -0.1141 -0.0185 0.1991  370 ARG A CZ  
65   N NH1 . ARG A 43  ? 0.6798 1.0257 0.6238 -0.1213 -0.0102 0.2062  370 ARG A NH1 
66   N NH2 . ARG A 43  ? 0.7025 1.0261 0.6243 -0.1276 -0.0345 0.2258  370 ARG A NH2 
67   N N   . ALA A 44  ? 0.4045 0.6094 0.4103 -0.0467 -0.0053 0.0839  371 ALA A N   
68   C CA  . ALA A 44  ? 0.3925 0.5896 0.4015 -0.0339 0.0018  0.0613  371 ALA A CA  
69   C C   . ALA A 44  ? 0.3731 0.5401 0.3863 -0.0262 -0.0045 0.0480  371 ALA A C   
70   O O   . ALA A 44  ? 0.3706 0.5335 0.3708 -0.0166 -0.0009 0.0318  371 ALA A O   
71   C CB  . ALA A 44  ? 0.3774 0.5767 0.4072 -0.0387 0.0040  0.0628  371 ALA A CB  
72   N N   . HIS A 45  ? 0.3741 0.5208 0.4062 -0.0302 -0.0140 0.0553  372 HIS A N   
73   C CA  . HIS A 45  ? 0.3795 0.5058 0.4205 -0.0227 -0.0187 0.0445  372 HIS A CA  
74   C C   . HIS A 45  ? 0.3866 0.5171 0.4113 -0.0207 -0.0233 0.0437  372 HIS A C   
75   O O   . HIS A 45  ? 0.3860 0.5117 0.4027 -0.0151 -0.0214 0.0290  372 HIS A O   
76   C CB  . HIS A 45  ? 0.3877 0.4943 0.4539 -0.0239 -0.0270 0.0520  372 HIS A CB  
77   C CG  . HIS A 45  ? 0.3937 0.4890 0.4719 -0.0149 -0.0299 0.0425  372 HIS A CG  
78   N ND1 . HIS A 45  ? 0.4058 0.5023 0.4908 -0.0131 -0.0392 0.0522  372 HIS A ND1 
79   C CD2 . HIS A 45  ? 0.3749 0.4636 0.4597 -0.0081 -0.0245 0.0256  372 HIS A CD2 
80   C CE1 . HIS A 45  ? 0.3914 0.4850 0.4897 -0.0050 -0.0386 0.0415  372 HIS A CE1 
81   N NE2 . HIS A 45  ? 0.3829 0.4717 0.4798 -0.0023 -0.0291 0.0253  372 HIS A NE2 
82   N N   . VAL A 46  ? 0.4008 0.5402 0.4188 -0.0276 -0.0309 0.0606  373 VAL A N   
83   C CA  . VAL A 46  ? 0.4132 0.5584 0.4134 -0.0291 -0.0382 0.0619  373 VAL A CA  
84   C C   . VAL A 46  ? 0.4241 0.5751 0.3926 -0.0259 -0.0310 0.0445  373 VAL A C   
85   O O   . VAL A 46  ? 0.4298 0.5726 0.3894 -0.0247 -0.0360 0.0344  373 VAL A O   
86   C CB  . VAL A 46  ? 0.4267 0.5835 0.4219 -0.0389 -0.0486 0.0859  373 VAL A CB  
87   C CG1 . VAL A 46  ? 0.4472 0.6112 0.4224 -0.0422 -0.0583 0.0866  373 VAL A CG1 
88   C CG2 . VAL A 46  ? 0.4206 0.5635 0.4491 -0.0393 -0.0585 0.1028  373 VAL A CG2 
89   N N   . ASP A 47  ? 0.4382 0.6030 0.3918 -0.0243 -0.0197 0.0410  374 ASP A N   
90   C CA  . ASP A 47  ? 0.4662 0.6348 0.3896 -0.0172 -0.0118 0.0229  374 ASP A CA  
91   C C   . ASP A 47  ? 0.4645 0.6137 0.3912 -0.0067 -0.0074 0.0028  374 ASP A C   
92   O O   . ASP A 47  ? 0.5134 0.6570 0.4159 0.0009  -0.0032 -0.0134 374 ASP A O   
93   C CB  . ASP A 47  ? 0.4830 0.6799 0.3926 -0.0159 0.0006  0.0261  374 ASP A CB  
94   C CG  . ASP A 47  ? 0.5145 0.7341 0.4063 -0.0274 -0.0028 0.0440  374 ASP A CG  
95   O OD1 . ASP A 47  ? 0.5279 0.7397 0.4154 -0.0355 -0.0163 0.0533  374 ASP A OD1 
96   O OD2 . ASP A 47  ? 0.5323 0.7819 0.4152 -0.0290 0.0078  0.0507  374 ASP A OD2 
97   N N   . SER A 48  ? 0.4251 0.5630 0.3795 -0.0060 -0.0086 0.0037  375 SER A N   
98   C CA  . SER A 48  ? 0.4131 0.5352 0.3706 0.0014  -0.0055 -0.0112 375 SER A CA  
99   C C   . SER A 48  ? 0.4162 0.5224 0.3873 -0.0021 -0.0137 -0.0126 375 SER A C   
100  O O   . SER A 48  ? 0.4124 0.5083 0.3914 0.0009  -0.0115 -0.0203 375 SER A O   
101  C CB  . SER A 48  ? 0.3933 0.5230 0.3678 0.0055  0.0027  -0.0107 375 SER A CB  
102  O OG  . SER A 48  ? 0.3733 0.5024 0.3719 -0.0011 -0.0004 -0.0004 375 SER A OG  
103  N N   . ASN A 49  ? 0.4164 0.5252 0.3912 -0.0091 -0.0231 -0.0034 376 ASN A N   
104  C CA  . ASN A 49  ? 0.4122 0.5153 0.4028 -0.0124 -0.0306 -0.0030 376 ASN A CA  
105  C C   . ASN A 49  ? 0.4230 0.5241 0.3952 -0.0198 -0.0415 -0.0038 376 ASN A C   
106  O O   . ASN A 49  ? 0.4446 0.5507 0.3947 -0.0231 -0.0451 -0.0010 376 ASN A O   
107  C CB  . ASN A 49  ? 0.4133 0.5233 0.4347 -0.0122 -0.0332 0.0092  376 ASN A CB  
108  C CG  . ASN A 49  ? 0.4113 0.5162 0.4512 -0.0068 -0.0247 0.0040  376 ASN A CG  
109  O OD1 . ASN A 49  ? 0.3973 0.4990 0.4459 -0.0049 -0.0218 -0.0041 376 ASN A OD1 
110  N ND2 . ASN A 49  ? 0.4142 0.5196 0.4577 -0.0066 -0.0212 0.0093  376 ASN A ND2 
111  N N   . PRO A 50  ? 0.4147 0.5099 0.3938 -0.0244 -0.0472 -0.0076 377 PRO A N   
112  C CA  . PRO A 50  ? 0.4290 0.5211 0.3898 -0.0350 -0.0601 -0.0083 377 PRO A CA  
113  C C   . PRO A 50  ? 0.4350 0.5470 0.4067 -0.0413 -0.0714 0.0077  377 PRO A C   
114  O O   . PRO A 50  ? 0.4105 0.5365 0.4131 -0.0364 -0.0701 0.0197  377 PRO A O   
115  C CB  . PRO A 50  ? 0.4159 0.5010 0.3875 -0.0407 -0.0632 -0.0123 377 PRO A CB  
116  C CG  . PRO A 50  ? 0.3818 0.4774 0.3849 -0.0330 -0.0528 -0.0091 377 PRO A CG  
117  C CD  . PRO A 50  ? 0.3840 0.4759 0.3826 -0.0224 -0.0422 -0.0118 377 PRO A CD  
118  N N   . ALA A 51  ? 0.4677 0.5791 0.4122 -0.0513 -0.0831 0.0076  378 ALA A N   
119  C CA  . ALA A 51  ? 0.4965 0.6287 0.4488 -0.0595 -0.0973 0.0248  378 ALA A CA  
120  C C   . ALA A 51  ? 0.5016 0.6487 0.4863 -0.0658 -0.1075 0.0335  378 ALA A C   
121  O O   . ALA A 51  ? 0.5097 0.6488 0.4881 -0.0751 -0.1124 0.0252  378 ALA A O   
122  C CB  . ALA A 51  ? 0.5246 0.6532 0.4328 -0.0700 -0.1072 0.0206  378 ALA A CB  
123  N N   . MET A 52  ? 0.5224 0.6919 0.5439 -0.0604 -0.1109 0.0510  379 MET A N   
124  C CA  . MET A 52  ? 0.5399 0.7339 0.5979 -0.0636 -0.1197 0.0613  379 MET A CA  
125  C C   . MET A 52  ? 0.5626 0.7689 0.6055 -0.0825 -0.1402 0.0681  379 MET A C   
126  O O   . MET A 52  ? 0.5626 0.7896 0.6289 -0.0908 -0.1486 0.0740  379 MET A O   
127  C CB  . MET A 52  ? 0.5640 0.7769 0.6653 -0.0492 -0.1188 0.0773  379 MET A CB  
128  C CG  . MET A 52  ? 0.5978 0.8157 0.7353 -0.0352 -0.1043 0.0708  379 MET A CG  
129  S SD  . MET A 52  ? 0.6604 0.8517 0.7808 -0.0308 -0.0836 0.0479  379 MET A SD  
130  C CE  . MET A 52  ? 0.6299 0.7969 0.7277 -0.0244 -0.0780 0.0469  379 MET A CE  
131  N N   . THR A 53  ? 0.5848 0.7804 0.5867 -0.0907 -0.1479 0.0666  380 THR A N   
132  C CA  . THR A 53  ? 0.6216 0.8239 0.5981 -0.1109 -0.1689 0.0700  380 THR A CA  
133  C C   . THR A 53  ? 0.6538 0.8288 0.5966 -0.1247 -0.1720 0.0492  380 THR A C   
134  O O   . THR A 53  ? 0.6930 0.8721 0.6213 -0.1449 -0.1915 0.0509  380 THR A O   
135  C CB  . THR A 53  ? 0.6386 0.8434 0.5807 -0.1148 -0.1766 0.0772  380 THR A CB  
136  O OG1 . THR A 53  ? 0.6281 0.8103 0.5409 -0.1044 -0.1588 0.0628  380 THR A OG1 
137  C CG2 . THR A 53  ? 0.6209 0.8553 0.5999 -0.1083 -0.1841 0.1053  380 THR A CG2 
138  N N   . SER A 54  ? 0.6363 0.7825 0.5683 -0.1148 -0.1549 0.0309  381 SER A N   
139  C CA  . SER A 54  ? 0.6618 0.7743 0.5644 -0.1247 -0.1574 0.0117  381 SER A CA  
140  C C   . SER A 54  ? 0.6371 0.7401 0.5643 -0.1158 -0.1426 0.0066  381 SER A C   
141  O O   . SER A 54  ? 0.6578 0.7352 0.5700 -0.1028 -0.1280 -0.0075 381 SER A O   
142  C CB  . SER A 54  ? 0.6913 0.7716 0.5398 -0.1211 -0.1538 -0.0084 381 SER A CB  
143  O OG  . SER A 54  ? 0.6649 0.7409 0.5166 -0.1000 -0.1325 -0.0137 381 SER A OG  
144  N N   . LEU A 55  ? 0.5951 0.7244 0.5618 -0.1223 -0.1461 0.0198  382 LEU A N   
145  C CA  . LEU A 55  ? 0.5501 0.6766 0.5379 -0.1182 -0.1340 0.0171  382 LEU A CA  
146  C C   . LEU A 55  ? 0.5644 0.6753 0.5408 -0.1404 -0.1467 0.0147  382 LEU A C   
147  O O   . LEU A 55  ? 0.5817 0.6973 0.5492 -0.1606 -0.1662 0.0199  382 LEU A O   
148  C CB  . LEU A 55  ? 0.5048 0.6729 0.5437 -0.1081 -0.1252 0.0315  382 LEU A CB  
149  C CG  . LEU A 55  ? 0.4747 0.6489 0.5271 -0.0860 -0.1120 0.0329  382 LEU A CG  
150  C CD1 . LEU A 55  ? 0.4510 0.6620 0.5530 -0.0757 -0.1059 0.0447  382 LEU A CD1 
151  C CD2 . LEU A 55  ? 0.4707 0.6154 0.5046 -0.0737 -0.0957 0.0181  382 LEU A CD2 
152  N N   . ASP A 56  ? 0.5508 0.6414 0.5260 -0.1383 -0.1373 0.0081  383 ASP A N   
153  C CA  . ASP A 56  ? 0.5698 0.6358 0.5307 -0.1594 -0.1493 0.0065  383 ASP A CA  
154  C C   . ASP A 56  ? 0.5447 0.6505 0.5468 -0.1700 -0.1467 0.0236  383 ASP A C   
155  O O   . ASP A 56  ? 0.5165 0.6284 0.5338 -0.1599 -0.1306 0.0241  383 ASP A O   
156  C CB  . ASP A 56  ? 0.5913 0.6072 0.5221 -0.1489 -0.1416 -0.0099 383 ASP A CB  
157  C CG  . ASP A 56  ? 0.6433 0.6180 0.5513 -0.1695 -0.1571 -0.0133 383 ASP A CG  
158  O OD1 . ASP A 56  ? 0.6635 0.6462 0.5751 -0.1959 -0.1753 -0.0035 383 ASP A OD1 
159  O OD2 . ASP A 56  ? 0.6623 0.5955 0.5497 -0.1593 -0.1521 -0.0249 383 ASP A OD2 
160  N N   . TYR A 57  ? 0.5497 0.6873 0.5695 -0.1905 -0.1623 0.0378  384 TYR A N   
161  C CA  . TYR A 57  ? 0.5479 0.7313 0.6072 -0.2048 -0.1617 0.0557  384 TYR A CA  
162  C C   . TYR A 57  ? 0.5798 0.7405 0.6244 -0.2352 -0.1763 0.0605  384 TYR A C   
163  O O   . TYR A 57  ? 0.5752 0.7777 0.6510 -0.2518 -0.1770 0.0778  384 TYR A O   
164  C CB  . TYR A 57  ? 0.5506 0.7917 0.6461 -0.2106 -0.1711 0.0726  384 TYR A CB  
165  C CG  . TYR A 57  ? 0.5220 0.8014 0.6529 -0.1814 -0.1542 0.0759  384 TYR A CG  
166  C CD1 . TYR A 57  ? 0.4948 0.8277 0.6735 -0.1729 -0.1399 0.0866  384 TYR A CD1 
167  C CD2 . TYR A 57  ? 0.5188 0.7809 0.6349 -0.1627 -0.1527 0.0685  384 TYR A CD2 
168  C CE1 . TYR A 57  ? 0.4727 0.8331 0.6828 -0.1444 -0.1256 0.0872  384 TYR A CE1 
169  C CE2 . TYR A 57  ? 0.5009 0.7910 0.6492 -0.1377 -0.1401 0.0729  384 TYR A CE2 
170  C CZ  . TYR A 57  ? 0.4788 0.8145 0.6738 -0.1278 -0.1272 0.0811  384 TYR A CZ  
171  O OH  . TYR A 57  ? 0.4800 0.8354 0.7053 -0.1012 -0.1156 0.0828  384 TYR A OH  
172  N N   . SER A 58  ? 0.6208 0.7164 0.6189 -0.2423 -0.1877 0.0458  385 SER A N   
173  C CA  . SER A 58  ? 0.6664 0.7272 0.6454 -0.2734 -0.2069 0.0499  385 SER A CA  
174  C C   . SER A 58  ? 0.6566 0.7228 0.6512 -0.2811 -0.1980 0.0618  385 SER A C   
175  O O   . SER A 58  ? 0.6980 0.7485 0.6867 -0.3114 -0.2146 0.0728  385 SER A O   
176  C CB  . SER A 58  ? 0.7144 0.6969 0.6387 -0.2725 -0.2189 0.0274  385 SER A CB  
177  O OG  . SER A 58  ? 0.7100 0.6570 0.6210 -0.2496 -0.2029 0.0159  385 SER A OG  
178  N N   . ARG A 59  ? 0.6181 0.7055 0.6302 -0.2560 -0.1735 0.0605  386 ARG A N   
179  C CA  . ARG A 59  ? 0.6190 0.7186 0.6442 -0.2624 -0.1634 0.0724  386 ARG A CA  
180  C C   . ARG A 59  ? 0.5624 0.7410 0.6342 -0.2569 -0.1452 0.0861  386 ARG A C   
181  O O   . ARG A 59  ? 0.5583 0.7599 0.6424 -0.2630 -0.1345 0.0969  386 ARG A O   
182  C CB  . ARG A 59  ? 0.6291 0.6859 0.6316 -0.2384 -0.1501 0.0584  386 ARG A CB  
183  C CG  . ARG A 59  ? 0.7019 0.6807 0.6621 -0.2435 -0.1662 0.0476  386 ARG A CG  
184  C CD  . ARG A 59  ? 0.7120 0.6631 0.6611 -0.2248 -0.1540 0.0427  386 ARG A CD  
185  N NE  . ARG A 59  ? 0.7036 0.6387 0.6406 -0.1920 -0.1418 0.0223  386 ARG A NE  
186  C CZ  . ARG A 59  ? 0.7011 0.6385 0.6409 -0.1697 -0.1253 0.0180  386 ARG A CZ  
187  N NH1 . ARG A 59  ? 0.6957 0.6503 0.6475 -0.1753 -0.1184 0.0315  386 ARG A NH1 
188  N NH2 . ARG A 59  ? 0.6973 0.6235 0.6273 -0.1435 -0.1160 0.0012  386 ARG A NH2 
189  N N   . PHE A 60  ? 0.5145 0.7340 0.6109 -0.2442 -0.1414 0.0854  387 PHE A N   
190  C CA  . PHE A 60  ? 0.4633 0.7527 0.6044 -0.2301 -0.1221 0.0933  387 PHE A CA  
191  C C   . PHE A 60  ? 0.4671 0.8158 0.6409 -0.2562 -0.1251 0.1160  387 PHE A C   
192  O O   . PHE A 60  ? 0.4885 0.8457 0.6663 -0.2831 -0.1463 0.1284  387 PHE A O   
193  C CB  . PHE A 60  ? 0.4202 0.7326 0.5804 -0.2081 -0.1199 0.0884  387 PHE A CB  
194  C CG  . PHE A 60  ? 0.3762 0.7552 0.5837 -0.1902 -0.1012 0.0946  387 PHE A CG  
195  C CD1 . PHE A 60  ? 0.3417 0.7224 0.5533 -0.1643 -0.0776 0.0829  387 PHE A CD1 
196  C CD2 . PHE A 60  ? 0.3586 0.8001 0.6072 -0.1994 -0.1076 0.1118  387 PHE A CD2 
197  C CE1 . PHE A 60  ? 0.3150 0.7529 0.5678 -0.1459 -0.0600 0.0850  387 PHE A CE1 
198  C CE2 . PHE A 60  ? 0.3288 0.8325 0.6232 -0.1789 -0.0890 0.1157  387 PHE A CE2 
199  C CZ  . PHE A 60  ? 0.3120 0.8114 0.6071 -0.1513 -0.0648 0.1008  387 PHE A CZ  
200  N N   . GLN A 61  ? 0.4574 0.8499 0.6537 -0.2490 -0.1037 0.1211  388 GLN A N   
201  C CA  . GLN A 61  ? 0.4752 0.9391 0.7074 -0.2705 -0.1004 0.1432  388 GLN A CA  
202  C C   . GLN A 61  ? 0.4569 0.9882 0.7274 -0.2435 -0.0719 0.1405  388 GLN A C   
203  O O   . GLN A 61  ? 0.4468 0.9725 0.7060 -0.2291 -0.0525 0.1308  388 GLN A O   
204  C CB  . GLN A 61  ? 0.4991 0.9448 0.7100 -0.2995 -0.1046 0.1556  388 GLN A CB  
205  C CG  . GLN A 61  ? 0.5451 0.9418 0.7300 -0.3359 -0.1351 0.1659  388 GLN A CG  
206  C CD  . GLN A 61  ? 0.5769 0.9696 0.7512 -0.3666 -0.1388 0.1848  388 GLN A CD  
207  O OE1 . GLN A 61  ? 0.5790 1.0311 0.7810 -0.3942 -0.1408 0.2086  388 GLN A OE1 
208  N NE2 . GLN A 61  ? 0.6010 0.9287 0.7378 -0.3613 -0.1388 0.1764  388 GLN A NE2 
209  N N   . ALA A 62  ? 0.4671 1.0617 0.7823 -0.2367 -0.0704 0.1488  389 ALA A N   
210  C CA  . ALA A 62  ? 0.4720 1.1307 0.8275 -0.2067 -0.0440 0.1439  389 ALA A CA  
211  C C   . ALA A 62  ? 0.4989 1.2135 0.8675 -0.2162 -0.0237 0.1526  389 ALA A C   
212  O O   . ALA A 62  ? 0.5022 1.2441 0.8820 -0.1889 0.0021  0.1392  389 ALA A O   
213  C CB  . ALA A 62  ? 0.4621 1.1764 0.8657 -0.1970 -0.0499 0.1534  389 ALA A CB  
214  N N   . ASN A 63  ? 0.5410 1.2713 0.9058 -0.2560 -0.0359 0.1749  390 ASN A N   
215  C CA  . ASN A 63  ? 0.5669 1.3498 0.9386 -0.2710 -0.0184 0.1872  390 ASN A CA  
216  C C   . ASN A 63  ? 0.6092 1.3457 0.9421 -0.3122 -0.0367 0.2032  390 ASN A C   
217  O O   . ASN A 63  ? 0.6358 1.3972 0.9807 -0.3499 -0.0541 0.2284  390 ASN A O   
218  C CB  . ASN A 63  ? 0.5771 1.4660 1.0069 -0.2770 -0.0099 0.2065  390 ASN A CB  
219  C CG  . ASN A 63  ? 0.5795 1.5414 1.0265 -0.2674 0.0227  0.2066  390 ASN A CG  
220  O OD1 . ASN A 63  ? 0.5874 1.5214 1.0035 -0.2518 0.0403  0.1892  390 ASN A OD1 
221  N ND2 . ASN A 63  ? 0.5781 1.6385 1.0747 -0.2768 0.0313  0.2261  390 ASN A ND2 
222  N N   . PRO A 64  ? 0.6278 1.2949 0.9152 -0.3056 -0.0346 0.1898  391 PRO A N   
223  C CA  . PRO A 64  ? 0.6762 1.2875 0.9256 -0.3401 -0.0541 0.2042  391 PRO A CA  
224  C C   . PRO A 64  ? 0.7199 1.3795 0.9712 -0.3685 -0.0451 0.2283  391 PRO A C   
225  O O   . PRO A 64  ? 0.7049 1.4292 0.9731 -0.3535 -0.0172 0.2255  391 PRO A O   
226  C CB  . PRO A 64  ? 0.6498 1.1806 0.8575 -0.3158 -0.0525 0.1808  391 PRO A CB  
227  C CG  . PRO A 64  ? 0.6126 1.1773 0.8350 -0.2767 -0.0243 0.1599  391 PRO A CG  
228  C CD  . PRO A 64  ? 0.5941 1.2255 0.8639 -0.2657 -0.0178 0.1611  391 PRO A CD  
229  N N   . ASP A 65  ? 0.7843 1.4096 1.0161 -0.4096 -0.0693 0.2513  392 ASP A N   
230  C CA  . ASP A 65  ? 0.8309 1.4870 1.0563 -0.4428 -0.0663 0.2788  392 ASP A CA  
231  C C   . ASP A 65  ? 0.8389 1.4485 1.0241 -0.4308 -0.0575 0.2708  392 ASP A C   
232  O O   . ASP A 65  ? 0.8709 1.5060 1.0460 -0.4540 -0.0523 0.2925  392 ASP A O   
233  C CB  . ASP A 65  ? 0.8934 1.5203 1.1116 -0.4932 -0.0995 0.3080  392 ASP A CB  
234  C CG  . ASP A 65  ? 0.9153 1.6362 1.1798 -0.5236 -0.1007 0.3348  392 ASP A CG  
235  O OD1 . ASP A 65  ? 0.9087 1.7242 1.2011 -0.5236 -0.0745 0.3466  392 ASP A OD1 
236  O OD2 . ASP A 65  ? 0.9407 1.6431 1.2131 -0.5485 -0.1281 0.3443  392 ASP A OD2 
237  N N   . ASP A 72  ? 0.8244 1.0286 0.7509 -0.3426 -0.0838 0.2435  399 ASP A N   
238  C CA  . ASP A 72  ? 0.8550 0.9879 0.7810 -0.3502 -0.1101 0.2482  399 ASP A CA  
239  C C   . ASP A 72  ? 0.8378 0.9009 0.7537 -0.3168 -0.1192 0.2253  399 ASP A C   
240  O O   . ASP A 72  ? 0.7984 0.8741 0.7212 -0.2865 -0.1034 0.1975  399 ASP A O   
241  C CB  . ASP A 72  ? 0.8508 1.0091 0.8008 -0.3608 -0.1082 0.2429  399 ASP A CB  
242  C CG  . ASP A 72  ? 0.8997 0.9846 0.8448 -0.3702 -0.1357 0.2440  399 ASP A CG  
243  O OD1 . ASP A 72  ? 0.9263 1.0005 0.8696 -0.4069 -0.1541 0.2712  399 ASP A OD1 
244  O OD2 . ASP A 72  ? 0.8885 0.9272 0.8299 -0.3421 -0.1390 0.2173  399 ASP A OD2 
245  N N   . THR A 73  ? 0.8763 0.8672 0.7770 -0.3231 -0.1450 0.2382  400 THR A N   
246  C CA  . THR A 73  ? 0.8829 0.8062 0.7734 -0.2924 -0.1555 0.2207  400 THR A CA  
247  C C   . THR A 73  ? 0.8576 0.7659 0.7571 -0.2669 -0.1491 0.1872  400 THR A C   
248  O O   . THR A 73  ? 0.8279 0.7332 0.7282 -0.2346 -0.1386 0.1651  400 THR A O   
249  C CB  . THR A 73  ? 0.9509 0.7968 0.8252 -0.3062 -0.1860 0.2419  400 THR A CB  
250  O OG1 . THR A 73  ? 0.9859 0.8422 0.8498 -0.3215 -0.1919 0.2724  400 THR A OG1 
251  C CG2 . THR A 73  ? 0.9583 0.7315 0.8249 -0.2722 -0.1970 0.2200  400 THR A CG2 
252  N N   . GLN A 74  ? 0.8727 0.7747 0.7784 -0.2833 -0.1564 0.1854  401 GLN A N   
253  C CA  . GLN A 74  ? 0.8615 0.7457 0.7713 -0.2623 -0.1537 0.1565  401 GLN A CA  
254  C C   . GLN A 74  ? 0.7834 0.7307 0.7123 -0.2443 -0.1282 0.1376  401 GLN A C   
255  O O   . GLN A 74  ? 0.7591 0.6922 0.6886 -0.2191 -0.1231 0.1136  401 GLN A O   
256  C CB  . GLN A 74  ? 0.9290 0.7745 0.8342 -0.2844 -0.1743 0.1584  401 GLN A CB  
257  C CG  . GLN A 74  ? 1.0100 0.7643 0.8916 -0.2728 -0.1960 0.1477  401 GLN A CG  
258  C CD  . GLN A 74  ? 1.0143 0.7490 0.8907 -0.2291 -0.1849 0.1187  401 GLN A CD  
259  O OE1 . GLN A 74  ? 0.9785 0.7268 0.8588 -0.2131 -0.1748 0.0954  401 GLN A OE1 
260  N NE2 . GLN A 74  ? 1.0254 0.7309 0.8939 -0.2109 -0.1876 0.1225  401 GLN A NE2 
261  N N   . HIS A 75  ? 0.7436 0.7589 0.6869 -0.2560 -0.1121 0.1482  402 HIS A N   
262  C CA  . HIS A 75  ? 0.6787 0.7483 0.6393 -0.2356 -0.0879 0.1294  402 HIS A CA  
263  C C   . HIS A 75  ? 0.6472 0.7084 0.5993 -0.2069 -0.0777 0.1144  402 HIS A C   
264  O O   . HIS A 75  ? 0.6018 0.6687 0.5618 -0.1831 -0.0670 0.0925  402 HIS A O   
265  C CB  . HIS A 75  ? 0.6697 0.8138 0.6475 -0.2526 -0.0722 0.1416  402 HIS A CB  
266  C CG  . HIS A 75  ? 0.6885 0.8595 0.6859 -0.2734 -0.0768 0.1503  402 HIS A CG  
267  N ND1 . HIS A 75  ? 0.7174 0.9033 0.7165 -0.3093 -0.0876 0.1781  402 HIS A ND1 
268  C CD2 . HIS A 75  ? 0.6634 0.8504 0.6804 -0.2651 -0.0741 0.1371  402 HIS A CD2 
269  C CE1 . HIS A 75  ? 0.7131 0.9261 0.7338 -0.3223 -0.0909 0.1809  402 HIS A CE1 
270  N NE2 . HIS A 75  ? 0.6769 0.8908 0.7085 -0.2952 -0.0832 0.1563  402 HIS A NE2 
271  N N   . ILE A 76  ? 0.6512 0.6993 0.5878 -0.2115 -0.0832 0.1287  403 ILE A N   
272  C CA  . ILE A 76  ? 0.6350 0.6740 0.5633 -0.1878 -0.0781 0.1185  403 ILE A CA  
273  C C   . ILE A 76  ? 0.6446 0.6295 0.5692 -0.1639 -0.0873 0.1025  403 ILE A C   
274  O O   . ILE A 76  ? 0.6072 0.6001 0.5373 -0.1405 -0.0764 0.0832  403 ILE A O   
275  C CB  . ILE A 76  ? 0.6515 0.6905 0.5641 -0.1999 -0.0850 0.1410  403 ILE A CB  
276  C CG1 . ILE A 76  ? 0.6366 0.7377 0.5499 -0.2229 -0.0723 0.1548  403 ILE A CG1 
277  C CG2 . ILE A 76  ? 0.6349 0.6676 0.5416 -0.1760 -0.0819 0.1309  403 ILE A CG2 
278  C CD1 . ILE A 76  ? 0.6750 0.7783 0.5701 -0.2441 -0.0822 0.1840  403 ILE A CD1 
279  N N   . GLN A 77  ? 0.7026 0.6337 0.6176 -0.1705 -0.1069 0.1099  404 GLN A N   
280  C CA  . GLN A 77  ? 0.7286 0.6089 0.6377 -0.1473 -0.1145 0.0922  404 GLN A CA  
281  C C   . GLN A 77  ? 0.6992 0.5944 0.6176 -0.1347 -0.1035 0.0691  404 GLN A C   
282  O O   . GLN A 77  ? 0.7038 0.5861 0.6211 -0.1094 -0.0988 0.0517  404 GLN A O   
283  C CB  . GLN A 77  ? 0.7961 0.6114 0.6906 -0.1576 -0.1382 0.1014  404 GLN A CB  
284  C CG  . GLN A 77  ? 0.8298 0.5898 0.7146 -0.1290 -0.1455 0.0825  404 GLN A CG  
285  C CD  . GLN A 77  ? 0.8357 0.5962 0.7230 -0.1028 -0.1412 0.0818  404 GLN A CD  
286  O OE1 . GLN A 77  ? 0.8725 0.6225 0.7567 -0.1082 -0.1511 0.1025  404 GLN A OE1 
287  N NE2 . GLN A 77  ? 0.8062 0.5824 0.7003 -0.0758 -0.1274 0.0604  404 GLN A NE2 
288  N N   . GLN A 78  ? 0.6933 0.6199 0.6221 -0.1523 -0.0994 0.0711  405 GLN A N   
289  C CA  . GLN A 78  ? 0.6609 0.6091 0.6012 -0.1417 -0.0894 0.0532  405 GLN A CA  
290  C C   . GLN A 78  ? 0.5876 0.5689 0.5383 -0.1198 -0.0707 0.0406  405 GLN A C   
291  O O   . GLN A 78  ? 0.5448 0.5191 0.4964 -0.1010 -0.0663 0.0245  405 GLN A O   
292  C CB  . GLN A 78  ? 0.6978 0.6863 0.6542 -0.1634 -0.0874 0.0612  405 GLN A CB  
293  C CG  . GLN A 78  ? 0.7971 0.7616 0.7474 -0.1910 -0.1068 0.0744  405 GLN A CG  
294  C CD  . GLN A 78  ? 0.8626 0.7664 0.7934 -0.1856 -0.1233 0.0615  405 GLN A CD  
295  O OE1 . GLN A 78  ? 0.9125 0.8073 0.8394 -0.1624 -0.1174 0.0415  405 GLN A OE1 
296  N NE2 . GLN A 78  ? 0.9017 0.7628 0.8181 -0.2082 -0.1444 0.0726  405 GLN A NE2 
297  N N   . PHE A 79  ? 0.5534 0.5707 0.5097 -0.1247 -0.0607 0.0487  406 PHE A N   
298  C CA  . PHE A 79  ? 0.5128 0.5596 0.4761 -0.1085 -0.0448 0.0376  406 PHE A CA  
299  C C   . PHE A 79  ? 0.5013 0.5207 0.4569 -0.0874 -0.0470 0.0286  406 PHE A C   
300  O O   . PHE A 79  ? 0.4729 0.5013 0.4359 -0.0715 -0.0383 0.0144  406 PHE A O   
301  C CB  . PHE A 79  ? 0.5043 0.5882 0.4668 -0.1206 -0.0366 0.0481  406 PHE A CB  
302  C CG  . PHE A 79  ? 0.4762 0.5800 0.4382 -0.1067 -0.0246 0.0371  406 PHE A CG  
303  C CD1 . PHE A 79  ? 0.4472 0.5787 0.4226 -0.0965 -0.0100 0.0210  406 PHE A CD1 
304  C CD2 . PHE A 79  ? 0.4868 0.5808 0.4349 -0.1051 -0.0298 0.0439  406 PHE A CD2 
305  C CE1 . PHE A 79  ? 0.4283 0.5729 0.4009 -0.0865 -0.0012 0.0100  406 PHE A CE1 
306  C CE2 . PHE A 79  ? 0.4639 0.5767 0.4101 -0.0957 -0.0211 0.0339  406 PHE A CE2 
307  C CZ  . PHE A 79  ? 0.4375 0.5736 0.3947 -0.0874 -0.0070 0.0161  406 PHE A CZ  
308  N N   . TYR A 80  ? 0.5248 0.5121 0.4676 -0.0876 -0.0594 0.0385  407 TYR A N   
309  C CA  . TYR A 80  ? 0.5295 0.4937 0.4685 -0.0662 -0.0624 0.0320  407 TYR A CA  
310  C C   . TYR A 80  ? 0.5184 0.4594 0.4570 -0.0506 -0.0630 0.0161  407 TYR A C   
311  O O   . TYR A 80  ? 0.5019 0.4522 0.4459 -0.0324 -0.0551 0.0049  407 TYR A O   
312  C CB  . TYR A 80  ? 0.5790 0.5111 0.5070 -0.0679 -0.0776 0.0478  407 TYR A CB  
313  C CG  . TYR A 80  ? 0.5956 0.5524 0.5203 -0.0807 -0.0780 0.0653  407 TYR A CG  
314  C CD1 . TYR A 80  ? 0.5803 0.5793 0.5098 -0.0778 -0.0653 0.0602  407 TYR A CD1 
315  C CD2 . TYR A 80  ? 0.6441 0.5794 0.5583 -0.0970 -0.0930 0.0875  407 TYR A CD2 
316  C CE1 . TYR A 80  ? 0.6011 0.6231 0.5221 -0.0908 -0.0664 0.0750  407 TYR A CE1 
317  C CE2 . TYR A 80  ? 0.6604 0.6204 0.5681 -0.1105 -0.0943 0.1057  407 TYR A CE2 
318  C CZ  . TYR A 80  ? 0.6441 0.6490 0.5539 -0.1073 -0.0806 0.0986  407 TYR A CZ  
319  O OH  . TYR A 80  ? 0.6993 0.7291 0.5974 -0.1224 -0.0827 0.1162  407 TYR A OH  
320  N N   . ASP A 81  ? 0.5389 0.4521 0.4696 -0.0600 -0.0726 0.0158  408 ASP A N   
321  C CA  . ASP A 81  ? 0.5561 0.4459 0.4800 -0.0485 -0.0745 0.0000  408 ASP A CA  
322  C C   . ASP A 81  ? 0.5205 0.4453 0.4558 -0.0420 -0.0609 -0.0111 408 ASP A C   
323  O O   . ASP A 81  ? 0.5221 0.4414 0.4539 -0.0253 -0.0569 -0.0237 408 ASP A O   
324  C CB  . ASP A 81  ? 0.5876 0.4449 0.4993 -0.0663 -0.0892 0.0023  408 ASP A CB  
325  C CG  . ASP A 81  ? 0.6401 0.4455 0.5366 -0.0700 -0.1065 0.0108  408 ASP A CG  
326  O OD1 . ASP A 81  ? 0.6450 0.4360 0.5402 -0.0537 -0.1076 0.0133  408 ASP A OD1 
327  O OD2 . ASP A 81  ? 0.6823 0.4598 0.5689 -0.0903 -0.1210 0.0164  408 ASP A OD2 
328  N N   . LEU A 82  ? 0.4924 0.4537 0.4417 -0.0547 -0.0539 -0.0057 409 LEU A N   
329  C CA  . LEU A 82  ? 0.4710 0.4627 0.4339 -0.0487 -0.0427 -0.0136 409 LEU A CA  
330  C C   . LEU A 82  ? 0.4610 0.4665 0.4295 -0.0327 -0.0326 -0.0195 409 LEU A C   
331  O O   . LEU A 82  ? 0.4437 0.4557 0.4161 -0.0225 -0.0274 -0.0275 409 LEU A O   
332  C CB  . LEU A 82  ? 0.4623 0.4889 0.4412 -0.0627 -0.0374 -0.0071 409 LEU A CB  
333  C CG  . LEU A 82  ? 0.4968 0.5201 0.4763 -0.0795 -0.0473 -0.0011 409 LEU A CG  
334  C CD1 . LEU A 82  ? 0.4834 0.5474 0.4811 -0.0938 -0.0415 0.0088  409 LEU A CD1 
335  C CD2 . LEU A 82  ? 0.4837 0.5010 0.4623 -0.0740 -0.0508 -0.0097 409 LEU A CD2 
336  N N   . LEU A 83  ? 0.4604 0.4712 0.4284 -0.0328 -0.0314 -0.0135 410 LEU A N   
337  C CA  . LEU A 83  ? 0.4487 0.4726 0.4216 -0.0207 -0.0249 -0.0173 410 LEU A CA  
338  C C   . LEU A 83  ? 0.4528 0.4589 0.4209 -0.0037 -0.0274 -0.0227 410 LEU A C   
339  O O   . LEU A 83  ? 0.4295 0.4498 0.4044 0.0056  -0.0204 -0.0291 410 LEU A O   
340  C CB  . LEU A 83  ? 0.4596 0.4948 0.4303 -0.0267 -0.0257 -0.0086 410 LEU A CB  
341  C CG  . LEU A 83  ? 0.4619 0.5256 0.4361 -0.0400 -0.0184 -0.0070 410 LEU A CG  
342  C CD1 . LEU A 83  ? 0.4666 0.5406 0.4328 -0.0445 -0.0203 0.0004  410 LEU A CD1 
343  C CD2 . LEU A 83  ? 0.4336 0.5174 0.4200 -0.0356 -0.0074 -0.0191 410 LEU A CD2 
344  N N   . THR A 84  ? 0.4870 0.4626 0.4439 0.0004  -0.0371 -0.0198 411 THR A N   
345  C CA  . THR A 84  ? 0.5233 0.4830 0.4760 0.0208  -0.0379 -0.0269 411 THR A CA  
346  C C   . THR A 84  ? 0.5341 0.4913 0.4812 0.0269  -0.0333 -0.0396 411 THR A C   
347  O O   . THR A 84  ? 0.5258 0.4982 0.4769 0.0411  -0.0256 -0.0457 411 THR A O   
348  C CB  . THR A 84  ? 0.5644 0.4855 0.5066 0.0281  -0.0503 -0.0227 411 THR A CB  
349  O OG1 . THR A 84  ? 0.6130 0.4981 0.5398 0.0194  -0.0595 -0.0261 411 THR A OG1 
350  C CG2 . THR A 84  ? 0.5667 0.4910 0.5122 0.0186  -0.0570 -0.0061 411 THR A CG2 
351  N N   . GLY A 85  ? 0.5502 0.4937 0.4885 0.0139  -0.0383 -0.0416 412 GLY A N   
352  C CA  . GLY A 85  ? 0.5818 0.5247 0.5117 0.0160  -0.0362 -0.0518 412 GLY A CA  
353  C C   . GLY A 85  ? 0.5696 0.5485 0.5129 0.0180  -0.0252 -0.0520 412 GLY A C   
354  O O   . GLY A 85  ? 0.5840 0.5687 0.5208 0.0265  -0.0208 -0.0588 412 GLY A O   
355  N N   . SER A 86  ? 0.5633 0.5651 0.5236 0.0096  -0.0213 -0.0444 413 SER A N   
356  C CA  . SER A 86  ? 0.5649 0.5945 0.5399 0.0104  -0.0128 -0.0434 413 SER A CA  
357  C C   . SER A 86  ? 0.5816 0.6250 0.5614 0.0223  -0.0065 -0.0441 413 SER A C   
358  O O   . SER A 86  ? 0.5474 0.6086 0.5344 0.0236  -0.0011 -0.0435 413 SER A O   
359  C CB  . SER A 86  ? 0.5754 0.6195 0.5641 -0.0002 -0.0109 -0.0384 413 SER A CB  
360  O OG  . SER A 86  ? 0.6103 0.6734 0.6116 0.0016  -0.0041 -0.0386 413 SER A OG  
361  N N   . MET A 87  ? 0.5926 0.6295 0.5704 0.0300  -0.0084 -0.0431 414 MET A N   
362  C CA  . MET A 87  ? 0.5961 0.6531 0.5833 0.0405  -0.0037 -0.0412 414 MET A CA  
363  C C   . MET A 87  ? 0.5787 0.6469 0.5634 0.0524  0.0027  -0.0460 414 MET A C   
364  O O   . MET A 87  ? 0.5544 0.6497 0.5506 0.0509  0.0086  -0.0421 414 MET A O   
365  C CB  . MET A 87  ? 0.6308 0.6790 0.6179 0.0486  -0.0091 -0.0373 414 MET A CB  
366  C CG  . MET A 87  ? 0.6494 0.7048 0.6421 0.0364  -0.0130 -0.0290 414 MET A CG  
367  S SD  . MET A 87  ? 0.7327 0.7774 0.7242 0.0436  -0.0228 -0.0193 414 MET A SD  
368  C CE  . MET A 87  ? 0.7220 0.7968 0.7305 0.0621  -0.0183 -0.0183 414 MET A CE  
369  N N   . GLU A 88  ? 0.6012 0.6485 0.5694 0.0627  0.0012  -0.0544 415 GLU A N   
370  C CA  . GLU A 88  ? 0.6260 0.6854 0.5863 0.0752  0.0089  -0.0614 415 GLU A CA  
371  C C   . GLU A 88  ? 0.6032 0.6784 0.5612 0.0640  0.0126  -0.0592 415 GLU A C   
372  O O   . GLU A 88  ? 0.6147 0.7165 0.5737 0.0691  0.0209  -0.0581 415 GLU A O   
373  C CB  . GLU A 88  ? 0.7147 0.7420 0.6527 0.0893  0.0059  -0.0749 415 GLU A CB  
374  C CG  . GLU A 88  ? 0.8063 0.8367 0.7504 0.1128  0.0093  -0.0784 415 GLU A CG  
375  C CD  . GLU A 88  ? 0.9024 0.8922 0.8240 0.1303  0.0054  -0.0945 415 GLU A CD  
376  O OE1 . GLU A 88  ? 0.9505 0.9152 0.8470 0.1245  0.0021  -0.1058 415 GLU A OE1 
377  O OE2 . GLU A 88  ? 0.9343 0.9156 0.8633 0.1503  0.0042  -0.0960 415 GLU A OE2 
378  N N   . ILE A 89  ? 0.5459 0.6087 0.5029 0.0488  0.0062  -0.0564 416 ILE A N   
379  C CA  . ILE A 89  ? 0.5168 0.5928 0.4741 0.0391  0.0071  -0.0517 416 ILE A CA  
380  C C   . ILE A 89  ? 0.4830 0.5841 0.4619 0.0329  0.0113  -0.0410 416 ILE A C   
381  O O   . ILE A 89  ? 0.4996 0.6190 0.4795 0.0301  0.0148  -0.0349 416 ILE A O   
382  C CB  . ILE A 89  ? 0.5298 0.5873 0.4804 0.0275  -0.0019 -0.0520 416 ILE A CB  
383  C CG1 . ILE A 89  ? 0.5582 0.5950 0.4809 0.0312  -0.0065 -0.0629 416 ILE A CG1 
384  C CG2 . ILE A 89  ? 0.5013 0.5747 0.4629 0.0176  -0.0029 -0.0425 416 ILE A CG2 
385  C CD1 . ILE A 89  ? 0.5899 0.6008 0.5052 0.0202  -0.0183 -0.0649 416 ILE A CD1 
386  N N   . ILE A 90  ? 0.4485 0.5494 0.4421 0.0294  0.0101  -0.0385 417 ILE A N   
387  C CA  . ILE A 90  ? 0.4176 0.5360 0.4288 0.0224  0.0122  -0.0310 417 ILE A CA  
388  C C   . ILE A 90  ? 0.4190 0.5634 0.4359 0.0277  0.0178  -0.0265 417 ILE A C   
389  O O   . ILE A 90  ? 0.4057 0.5674 0.4317 0.0202  0.0195  -0.0181 417 ILE A O   
390  C CB  . ILE A 90  ? 0.3963 0.5077 0.4168 0.0161  0.0092  -0.0321 417 ILE A CB  
391  C CG1 . ILE A 90  ? 0.3838 0.4805 0.4041 0.0102  0.0060  -0.0345 417 ILE A CG1 
392  C CG2 . ILE A 90  ? 0.3746 0.4998 0.4093 0.0085  0.0098  -0.0274 417 ILE A CG2 
393  C CD1 . ILE A 90  ? 0.3805 0.4724 0.4036 0.0058  0.0050  -0.0376 417 ILE A CD1 
394  N N   . ARG A 91  ? 0.4508 0.5990 0.4645 0.0406  0.0200  -0.0307 418 ARG A N   
395  C CA  . ARG A 91  ? 0.4900 0.6706 0.5123 0.0491  0.0268  -0.0265 418 ARG A CA  
396  C C   . ARG A 91  ? 0.4872 0.6857 0.5011 0.0501  0.0339  -0.0245 418 ARG A C   
397  O O   . ARG A 91  ? 0.5007 0.7315 0.5261 0.0442  0.0385  -0.0140 418 ARG A O   
398  C CB  . ARG A 91  ? 0.5394 0.7168 0.5596 0.0679  0.0274  -0.0327 418 ARG A CB  
399  C CG  . ARG A 91  ? 0.5968 0.8139 0.6313 0.0808  0.0350  -0.0283 418 ARG A CG  
400  C CD  . ARG A 91  ? 0.6488 0.8617 0.6898 0.0986  0.0319  -0.0307 418 ARG A CD  
401  N NE  . ARG A 91  ? 0.7168 0.8838 0.7375 0.1080  0.0266  -0.0422 418 ARG A NE  
402  C CZ  . ARG A 91  ? 0.7468 0.8856 0.7659 0.1059  0.0162  -0.0406 418 ARG A CZ  
403  N NH1 . ARG A 91  ? 0.7561 0.9089 0.7906 0.0967  0.0104  -0.0296 418 ARG A NH1 
404  N NH2 . ARG A 91  ? 0.7710 0.8675 0.7712 0.1115  0.0105  -0.0494 418 ARG A NH2 
405  N N   . GLY A 92  ? 0.4751 0.6531 0.4675 0.0543  0.0335  -0.0332 419 GLY A N   
406  C CA  . GLY A 92  ? 0.4671 0.6599 0.4453 0.0526  0.0386  -0.0314 419 GLY A CA  
407  C C   . GLY A 92  ? 0.4421 0.6448 0.4289 0.0339  0.0354  -0.0162 419 GLY A C   
408  O O   . GLY A 92  ? 0.4701 0.7001 0.4533 0.0298  0.0408  -0.0071 419 GLY A O   
409  N N   . TRP A 93  ? 0.3875 0.5682 0.3851 0.0233  0.0266  -0.0131 420 TRP A N   
410  C CA  . TRP A 93  ? 0.3597 0.5431 0.3706 0.0079  0.0219  0.0006  420 TRP A CA  
411  C C   . TRP A 93  ? 0.3504 0.5582 0.3797 0.0007  0.0244  0.0112  420 TRP A C   
412  O O   . TRP A 93  ? 0.3294 0.5525 0.3643 -0.0113 0.0236  0.0263  420 TRP A O   
413  C CB  . TRP A 93  ? 0.3336 0.4877 0.3527 0.0030  0.0135  -0.0026 420 TRP A CB  
414  C CG  . TRP A 93  ? 0.3187 0.4678 0.3558 -0.0085 0.0083  0.0073  420 TRP A CG  
415  C CD1 . TRP A 93  ? 0.3196 0.4629 0.3608 -0.0157 0.0025  0.0184  420 TRP A CD1 
416  C CD2 . TRP A 93  ? 0.3069 0.4520 0.3588 -0.0140 0.0068  0.0061  420 TRP A CD2 
417  N NE1 . TRP A 93  ? 0.3170 0.4488 0.3754 -0.0238 -0.0023 0.0235  420 TRP A NE1 
418  C CE2 . TRP A 93  ? 0.3101 0.4425 0.3736 -0.0237 0.0003  0.0147  420 TRP A CE2 
419  C CE3 . TRP A 93  ? 0.3050 0.4552 0.3601 -0.0120 0.0089  -0.0008 420 TRP A CE3 
420  C CZ2 . TRP A 93  ? 0.3194 0.4401 0.3950 -0.0318 -0.0037 0.0133  420 TRP A CZ2 
421  C CZ3 . TRP A 93  ? 0.3026 0.4466 0.3692 -0.0219 0.0045  -0.0007 420 TRP A CZ3 
422  C CH2 . TRP A 93  ? 0.3120 0.4396 0.3876 -0.0317 -0.0014 0.0046  420 TRP A CH2 
423  N N   . ALA A 94  ? 0.3403 0.5518 0.3787 0.0059  0.0257  0.0053  421 ALA A N   
424  C CA  . ALA A 94  ? 0.3496 0.5852 0.4065 -0.0027 0.0255  0.0148  421 ALA A CA  
425  C C   . ALA A 94  ? 0.3676 0.6462 0.4273 -0.0029 0.0339  0.0263  421 ALA A C   
426  O O   . ALA A 94  ? 0.3616 0.6587 0.4334 -0.0194 0.0318  0.0420  421 ALA A O   
427  C CB  . ALA A 94  ? 0.3340 0.5699 0.3977 0.0042  0.0242  0.0074  421 ALA A CB  
428  N N   . GLU A 95  ? 0.3943 0.6872 0.4412 0.0149  0.0433  0.0182  422 GLU A N   
429  C CA  . GLU A 95  ? 0.4337 0.7732 0.4806 0.0192  0.0549  0.0257  422 GLU A CA  
430  C C   . GLU A 95  ? 0.4426 0.7956 0.4810 0.0038  0.0560  0.0404  422 GLU A C   
431  O O   . GLU A 95  ? 0.4493 0.8487 0.4944 -0.0016 0.0641  0.0540  422 GLU A O   
432  C CB  . GLU A 95  ? 0.4791 0.8231 0.5108 0.0454  0.0648  0.0087  422 GLU A CB  
433  C CG  . GLU A 95  ? 0.5197 0.8761 0.5699 0.0602  0.0661  0.0043  422 GLU A CG  
434  C CD  . GLU A 95  ? 0.5736 0.9006 0.6086 0.0846  0.0671  -0.0153 422 GLU A CD  
435  O OE1 . GLU A 95  ? 0.6147 0.9182 0.6227 0.0916  0.0693  -0.0278 422 GLU A OE1 
436  O OE2 . GLU A 95  ? 0.5835 0.9096 0.6331 0.0954  0.0638  -0.0172 422 GLU A OE2 
437  N N   . LYS A 96  ? 0.4401 0.7563 0.4661 -0.0037 0.0472  0.0400  423 LYS A N   
438  C CA  . LYS A 96  ? 0.4463 0.7677 0.4645 -0.0195 0.0439  0.0567  423 LYS A CA  
439  C C   . LYS A 96  ? 0.4287 0.7411 0.4678 -0.0419 0.0327  0.0760  423 LYS A C   
440  O O   . LYS A 96  ? 0.4496 0.7600 0.4852 -0.0562 0.0268  0.0931  423 LYS A O   
441  C CB  . LYS A 96  ? 0.4715 0.7595 0.4683 -0.0158 0.0377  0.0486  423 LYS A CB  
442  C CG  . LYS A 96  ? 0.5145 0.8108 0.4817 -0.0008 0.0463  0.0339  423 LYS A CG  
443  C CD  . LYS A 96  ? 0.5419 0.7997 0.4929 0.0000  0.0359  0.0249  423 LYS A CD  
444  C CE  . LYS A 96  ? 0.5823 0.8464 0.4978 0.0067  0.0401  0.0147  423 LYS A CE  
445  N NZ  . LYS A 96  ? 0.5999 0.8784 0.5029 -0.0089 0.0349  0.0335  423 LYS A NZ  
446  N N   . ILE A 97  ? 0.3951 0.6983 0.4540 -0.0456 0.0281  0.0732  424 ILE A N   
447  C CA  . ILE A 97  ? 0.3944 0.6888 0.4717 -0.0678 0.0173  0.0893  424 ILE A CA  
448  C C   . ILE A 97  ? 0.3941 0.7413 0.4824 -0.0807 0.0231  0.1084  424 ILE A C   
449  O O   . ILE A 97  ? 0.3822 0.7644 0.4774 -0.0710 0.0323  0.1030  424 ILE A O   
450  C CB  . ILE A 97  ? 0.3810 0.6439 0.4705 -0.0688 0.0091  0.0766  424 ILE A CB  
451  C CG1 . ILE A 97  ? 0.3747 0.5955 0.4545 -0.0558 0.0060  0.0589  424 ILE A CG1 
452  C CG2 . ILE A 97  ? 0.3874 0.6343 0.4919 -0.0921 -0.0034 0.0900  424 ILE A CG2 
453  C CD1 . ILE A 97  ? 0.3829 0.5808 0.4693 -0.0541 0.0016  0.0442  424 ILE A CD1 
454  N N   . PRO A 98  ? 0.4141 0.7702 0.5051 -0.1023 0.0176  0.1328  425 PRO A N   
455  C CA  . PRO A 98  ? 0.4167 0.8288 0.5197 -0.1185 0.0231  0.1549  425 PRO A CA  
456  C C   . PRO A 98  ? 0.4110 0.8328 0.5378 -0.1287 0.0178  0.1557  425 PRO A C   
457  O O   . PRO A 98  ? 0.4253 0.8014 0.5592 -0.1385 0.0033  0.1510  425 PRO A O   
458  C CB  . PRO A 98  ? 0.4431 0.8431 0.5457 -0.1444 0.0115  0.1822  425 PRO A CB  
459  C CG  . PRO A 98  ? 0.4497 0.8077 0.5330 -0.1328 0.0072  0.1738  425 PRO A CG  
460  C CD  . PRO A 98  ? 0.4322 0.7521 0.5151 -0.1115 0.0066  0.1435  425 PRO A CD  
461  N N   . GLY A 99  ? 0.4013 0.8840 0.5402 -0.1248 0.0295  0.1602  426 GLY A N   
462  C CA  . GLY A 99  ? 0.3826 0.8855 0.5461 -0.1351 0.0238  0.1634  426 GLY A CA  
463  C C   . GLY A 99  ? 0.3621 0.8557 0.5264 -0.1100 0.0269  0.1386  426 GLY A C   
464  O O   . GLY A 99  ? 0.3587 0.8921 0.5430 -0.1094 0.0280  0.1414  426 GLY A O   
465  N N   . PHE A 100 ? 0.3436 0.7878 0.4878 -0.0907 0.0270  0.1168  427 PHE A N   
466  C CA  . PHE A 100 ? 0.3205 0.7509 0.4632 -0.0689 0.0283  0.0955  427 PHE A CA  
467  C C   . PHE A 100 ? 0.3141 0.7958 0.4635 -0.0455 0.0429  0.0920  427 PHE A C   
468  O O   . PHE A 100 ? 0.3133 0.8125 0.4785 -0.0391 0.0406  0.0894  427 PHE A O   
469  C CB  . PHE A 100 ? 0.3070 0.6799 0.4276 -0.0550 0.0261  0.0757  427 PHE A CB  
470  C CG  . PHE A 100 ? 0.2900 0.6459 0.4086 -0.0380 0.0251  0.0577  427 PHE A CG  
471  C CD1 . PHE A 100 ? 0.2862 0.6173 0.4099 -0.0484 0.0136  0.0529  427 PHE A CD1 
472  C CD2 . PHE A 100 ? 0.2813 0.6451 0.3908 -0.0124 0.0349  0.0460  427 PHE A CD2 
473  C CE1 . PHE A 100 ? 0.2786 0.5982 0.3989 -0.0353 0.0119  0.0398  427 PHE A CE1 
474  C CE2 . PHE A 100 ? 0.2781 0.6245 0.3863 0.0011  0.0318  0.0333  427 PHE A CE2 
475  C CZ  . PHE A 100 ? 0.2742 0.6011 0.3879 -0.0111 0.0204  0.0318  427 PHE A CZ  
476  N N   . ALA A 101 ? 0.3173 0.8216 0.4538 -0.0321 0.0571  0.0914  428 ALA A N   
477  C CA  . ALA A 101 ? 0.3179 0.8685 0.4574 -0.0053 0.0735  0.0847  428 ALA A CA  
478  C C   . ALA A 101 ? 0.3130 0.9366 0.4845 -0.0117 0.0790  0.1032  428 ALA A C   
479  O O   . ALA A 101 ? 0.3145 0.9828 0.4979 0.0128  0.0917  0.0983  428 ALA A O   
480  C CB  . ALA A 101 ? 0.3291 0.8853 0.4420 0.0062  0.0869  0.0788  428 ALA A CB  
481  N N   . ASP A 102 ? 0.3109 0.9462 0.4974 -0.0449 0.0686  0.1249  429 ASP A N   
482  C CA  . ASP A 102 ? 0.3090 1.0160 0.5271 -0.0597 0.0711  0.1476  429 ASP A CA  
483  C C   . ASP A 102 ? 0.2953 1.0103 0.5393 -0.0637 0.0586  0.1489  429 ASP A C   
484  O O   . ASP A 102 ? 0.2840 1.0649 0.5586 -0.0713 0.0602  0.1660  429 ASP A O   
485  C CB  . ASP A 102 ? 0.3253 1.0382 0.5455 -0.0978 0.0634  0.1731  429 ASP A CB  
486  C CG  . ASP A 102 ? 0.3474 1.0747 0.5452 -0.0962 0.0771  0.1793  429 ASP A CG  
487  O OD1 . ASP A 102 ? 0.3490 1.1010 0.5334 -0.0664 0.0959  0.1650  429 ASP A OD1 
488  O OD2 . ASP A 102 ? 0.3659 1.0788 0.5583 -0.1257 0.0680  0.1989  429 ASP A OD2 
489  N N   . LEU A 103 ? 0.2929 0.9443 0.5241 -0.0601 0.0458  0.1318  430 LEU A N   
490  C CA  . LEU A 103 ? 0.2940 0.9468 0.5427 -0.0647 0.0321  0.1315  430 LEU A CA  
491  C C   . LEU A 103 ? 0.2976 0.9843 0.5591 -0.0298 0.0416  0.1233  430 LEU A C   
492  O O   . LEU A 103 ? 0.2966 0.9747 0.5429 -0.0006 0.0558  0.1090  430 LEU A O   
493  C CB  . LEU A 103 ? 0.2892 0.8646 0.5159 -0.0729 0.0169  0.1157  430 LEU A CB  
494  C CG  . LEU A 103 ? 0.2995 0.8295 0.5134 -0.1022 0.0062  0.1197  430 LEU A CG  
495  C CD1 . LEU A 103 ? 0.2926 0.7519 0.4841 -0.0993 -0.0028 0.0991  430 LEU A CD1 
496  C CD2 . LEU A 103 ? 0.3160 0.8704 0.5503 -0.1379 -0.0075 0.1402  430 LEU A CD2 
497  N N   . PRO A 104 ? 0.3047 1.0280 0.5937 -0.0325 0.0321  0.1325  431 PRO A N   
498  C CA  . PRO A 104 ? 0.3112 1.0546 0.6128 0.0025  0.0367  0.1249  431 PRO A CA  
499  C C   . PRO A 104 ? 0.3264 0.9972 0.5972 0.0233  0.0347  0.1015  431 PRO A C   
500  O O   . PRO A 104 ? 0.3268 0.9384 0.5741 0.0059  0.0240  0.0934  431 PRO A O   
501  C CB  . PRO A 104 ? 0.3076 1.0802 0.6358 -0.0138 0.0186  0.1388  431 PRO A CB  
502  C CG  . PRO A 104 ? 0.3129 1.1030 0.6499 -0.0563 0.0089  0.1565  431 PRO A CG  
503  C CD  . PRO A 104 ? 0.3098 1.0482 0.6165 -0.0690 0.0136  0.1492  431 PRO A CD  
504  N N   . LYS A 105 ? 0.3417 1.0182 0.6140 0.0604  0.0449  0.0912  432 LYS A N   
505  C CA  . LYS A 105 ? 0.3528 0.9640 0.5975 0.0804  0.0431  0.0712  432 LYS A CA  
506  C C   . LYS A 105 ? 0.3474 0.9182 0.5850 0.0654  0.0234  0.0709  432 LYS A C   
507  O O   . LYS A 105 ? 0.3599 0.8698 0.5688 0.0621  0.0193  0.0577  432 LYS A O   
508  C CB  . LYS A 105 ? 0.3859 1.0136 0.6392 0.1226  0.0541  0.0626  432 LYS A CB  
509  C CG  . LYS A 105 ? 0.4109 0.9699 0.6354 0.1439  0.0521  0.0427  432 LYS A CG  
510  C CD  . LYS A 105 ? 0.4254 0.9421 0.6148 0.1397  0.0606  0.0275  432 LYS A CD  
511  C CE  . LYS A 105 ? 0.4345 0.8771 0.5953 0.1409  0.0507  0.0137  432 LYS A CE  
512  N NZ  . LYS A 105 ? 0.4316 0.8393 0.5621 0.1314  0.0560  0.0025  432 LYS A NZ  
513  N N   . ALA A 106 ? 0.3345 0.9439 0.5976 0.0545  0.0116  0.0861  433 ALA A N   
514  C CA  . ALA A 106 ? 0.3353 0.9165 0.5903 0.0366  -0.0074 0.0873  433 ALA A CA  
515  C C   . ALA A 106 ? 0.3375 0.8734 0.5671 0.0050  -0.0136 0.0803  433 ALA A C   
516  O O   . ALA A 106 ? 0.3342 0.8218 0.5403 -0.0005 -0.0216 0.0699  433 ALA A O   
517  C CB  . ALA A 106 ? 0.3247 0.9641 0.6122 0.0268  -0.0198 0.1066  433 ALA A CB  
518  N N   . ASP A 107 ? 0.3413 0.8940 0.5765 -0.0145 -0.0095 0.0867  434 ASP A N   
519  C CA  . ASP A 107 ? 0.3420 0.8516 0.5573 -0.0423 -0.0159 0.0811  434 ASP A CA  
520  C C   . ASP A 107 ? 0.3398 0.7947 0.5272 -0.0314 -0.0074 0.0646  434 ASP A C   
521  O O   . ASP A 107 ? 0.3421 0.7484 0.5089 -0.0420 -0.0140 0.0533  434 ASP A O   
522  C CB  . ASP A 107 ? 0.3479 0.8905 0.5796 -0.0677 -0.0168 0.0969  434 ASP A CB  
523  C CG  . ASP A 107 ? 0.3573 0.9384 0.6108 -0.0920 -0.0326 0.1118  434 ASP A CG  
524  O OD1 . ASP A 107 ? 0.3573 0.9491 0.6160 -0.0863 -0.0419 0.1117  434 ASP A OD1 
525  O OD2 . ASP A 107 ? 0.3743 0.9742 0.6391 -0.1195 -0.0376 0.1253  434 ASP A OD2 
526  N N   . GLN A 108 ? 0.3370 0.8024 0.5235 -0.0098 0.0073  0.0624  435 GLN A N   
527  C CA  . GLN A 108 ? 0.3398 0.7587 0.5006 0.0022  0.0144  0.0475  435 GLN A CA  
528  C C   . GLN A 108 ? 0.3517 0.7283 0.4963 0.0119  0.0080  0.0347  435 GLN A C   
529  O O   . GLN A 108 ? 0.3436 0.6768 0.4695 0.0032  0.0047  0.0253  435 GLN A O   
530  C CB  . GLN A 108 ? 0.3430 0.7841 0.5032 0.0254  0.0300  0.0455  435 GLN A CB  
531  C CG  . GLN A 108 ? 0.3373 0.8152 0.5050 0.0135  0.0384  0.0579  435 GLN A CG  
532  C CD  . GLN A 108 ? 0.3574 0.8628 0.5208 0.0380  0.0555  0.0535  435 GLN A CD  
533  O OE1 . GLN A 108 ? 0.3661 0.9317 0.5491 0.0416  0.0651  0.0649  435 GLN A OE1 
534  N NE2 . GLN A 108 ? 0.3638 0.8278 0.5009 0.0545  0.0597  0.0364  435 GLN A NE2 
535  N N   . ASP A 109 ? 0.3564 0.7487 0.5103 0.0290  0.0057  0.0366  436 ASP A N   
536  C CA  . ASP A 109 ? 0.3647 0.7217 0.5044 0.0361  -0.0017 0.0294  436 ASP A CA  
537  C C   . ASP A 109 ? 0.3666 0.7044 0.4967 0.0111  -0.0134 0.0283  436 ASP A C   
538  O O   . ASP A 109 ? 0.3731 0.6705 0.4822 0.0078  -0.0145 0.0180  436 ASP A O   
539  C CB  . ASP A 109 ? 0.3859 0.7668 0.5416 0.0571  -0.0053 0.0365  436 ASP A CB  
540  C CG  . ASP A 109 ? 0.4005 0.7924 0.5621 0.0878  0.0070  0.0321  436 ASP A CG  
541  O OD1 . ASP A 109 ? 0.4174 0.7904 0.5632 0.0922  0.0175  0.0215  436 ASP A OD1 
542  O OD2 . ASP A 109 ? 0.4075 0.8272 0.5891 0.1085  0.0058  0.0388  436 ASP A OD2 
543  N N   . LEU A 110 ? 0.3501 0.7185 0.4948 -0.0067 -0.0217 0.0382  437 LEU A N   
544  C CA  . LEU A 110 ? 0.3521 0.7019 0.4842 -0.0312 -0.0330 0.0341  437 LEU A CA  
545  C C   . LEU A 110 ? 0.3604 0.6675 0.4737 -0.0419 -0.0290 0.0208  437 LEU A C   
546  O O   . LEU A 110 ? 0.3540 0.6294 0.4476 -0.0458 -0.0315 0.0096  437 LEU A O   
547  C CB  . LEU A 110 ? 0.3459 0.7340 0.4961 -0.0522 -0.0436 0.0463  437 LEU A CB  
548  C CG  . LEU A 110 ? 0.3609 0.7358 0.4977 -0.0791 -0.0584 0.0419  437 LEU A CG  
549  C CD1 . LEU A 110 ? 0.3592 0.7103 0.4723 -0.0769 -0.0641 0.0331  437 LEU A CD1 
550  C CD2 . LEU A 110 ? 0.3651 0.7898 0.5254 -0.0952 -0.0705 0.0585  437 LEU A CD2 
551  N N   . LEU A 111 ? 0.3574 0.6674 0.4779 -0.0457 -0.0228 0.0235  438 LEU A N   
552  C CA  . LEU A 111 ? 0.3634 0.6351 0.4710 -0.0539 -0.0204 0.0140  438 LEU A CA  
553  C C   . LEU A 111 ? 0.3602 0.6008 0.4517 -0.0374 -0.0130 0.0027  438 LEU A C   
554  O O   . LEU A 111 ? 0.3742 0.5833 0.4523 -0.0423 -0.0144 -0.0085 438 LEU A O   
555  C CB  . LEU A 111 ? 0.3546 0.6384 0.4737 -0.0615 -0.0167 0.0241  438 LEU A CB  
556  C CG  . LEU A 111 ? 0.3661 0.6774 0.5022 -0.0845 -0.0250 0.0381  438 LEU A CG  
557  C CD1 . LEU A 111 ? 0.3565 0.6767 0.5002 -0.0904 -0.0197 0.0500  438 LEU A CD1 
558  C CD2 . LEU A 111 ? 0.3795 0.6622 0.5075 -0.1071 -0.0387 0.0306  438 LEU A CD2 
559  N N   . PHE A 112 ? 0.3519 0.6028 0.4449 -0.0184 -0.0055 0.0050  439 PHE A N   
560  C CA  . PHE A 112 ? 0.3508 0.5740 0.4290 -0.0051 -0.0005 -0.0039 439 PHE A CA  
561  C C   . PHE A 112 ? 0.3698 0.5733 0.4359 -0.0052 -0.0056 -0.0104 439 PHE A C   
562  O O   . PHE A 112 ? 0.3702 0.5481 0.4248 -0.0097 -0.0048 -0.0189 439 PHE A O   
563  C CB  . PHE A 112 ? 0.3461 0.5817 0.4255 0.0148  0.0066  -0.0022 439 PHE A CB  
564  C CG  . PHE A 112 ? 0.3540 0.5586 0.4168 0.0269  0.0080  -0.0113 439 PHE A CG  
565  C CD1 . PHE A 112 ? 0.3422 0.5227 0.3935 0.0235  0.0103  -0.0175 439 PHE A CD1 
566  C CD2 . PHE A 112 ? 0.3603 0.5589 0.4200 0.0400  0.0048  -0.0118 439 PHE A CD2 
567  C CE1 . PHE A 112 ? 0.3559 0.5099 0.3928 0.0308  0.0096  -0.0244 439 PHE A CE1 
568  C CE2 . PHE A 112 ? 0.3723 0.5387 0.4163 0.0473  0.0037  -0.0187 439 PHE A CE2 
569  C CZ  . PHE A 112 ? 0.3673 0.5125 0.3996 0.0415  0.0062  -0.0252 439 PHE A CZ  
570  N N   . GLU A 113 ? 0.3846 0.6043 0.4547 -0.0007 -0.0107 -0.0045 440 GLU A N   
571  C CA  . GLU A 113 ? 0.3960 0.6024 0.4535 -0.0022 -0.0168 -0.0061 440 GLU A CA  
572  C C   . GLU A 113 ? 0.4017 0.5982 0.4480 -0.0206 -0.0203 -0.0133 440 GLU A C   
573  O O   . GLU A 113 ? 0.4051 0.5844 0.4363 -0.0226 -0.0200 -0.0188 440 GLU A O   
574  C CB  . GLU A 113 ? 0.4047 0.6345 0.4717 0.0050  -0.0243 0.0052  440 GLU A CB  
575  C CG  . GLU A 113 ? 0.4279 0.6631 0.5046 0.0283  -0.0196 0.0088  440 GLU A CG  
576  C CD  . GLU A 113 ? 0.4488 0.7095 0.5411 0.0410  -0.0265 0.0209  440 GLU A CD  
577  O OE1 . GLU A 113 ? 0.4760 0.7592 0.5750 0.0294  -0.0362 0.0298  440 GLU A OE1 
578  O OE2 . GLU A 113 ? 0.4689 0.7263 0.5666 0.0640  -0.0229 0.0209  440 GLU A OE2 
579  N N   . SER A 114 ? 0.3954 0.6029 0.4481 -0.0343 -0.0236 -0.0138 441 SER A N   
580  C CA  . SER A 114 ? 0.4111 0.6047 0.4506 -0.0507 -0.0271 -0.0248 441 SER A CA  
581  C C   . SER A 114 ? 0.4013 0.5662 0.4336 -0.0491 -0.0192 -0.0376 441 SER A C   
582  O O   . SER A 114 ? 0.4155 0.5671 0.4337 -0.0548 -0.0183 -0.0495 441 SER A O   
583  C CB  . SER A 114 ? 0.4240 0.6302 0.4720 -0.0674 -0.0349 -0.0226 441 SER A CB  
584  O OG  . SER A 114 ? 0.4445 0.6844 0.5031 -0.0700 -0.0433 -0.0091 441 SER A OG  
585  N N   . ALA A 115 ? 0.3803 0.5393 0.4227 -0.0408 -0.0134 -0.0349 442 ALA A N   
586  C CA  . ALA A 115 ? 0.3689 0.5046 0.4101 -0.0393 -0.0082 -0.0438 442 ALA A CA  
587  C C   . ALA A 115 ? 0.3577 0.4858 0.3952 -0.0271 -0.0021 -0.0443 442 ALA A C   
588  O O   . ALA A 115 ? 0.3558 0.4698 0.3949 -0.0244 0.0016  -0.0496 442 ALA A O   
589  C CB  . ALA A 115 ? 0.3556 0.4892 0.4098 -0.0435 -0.0092 -0.0381 442 ALA A CB  
590  N N   . PHE A 116 ? 0.3612 0.4975 0.3946 -0.0200 -0.0027 -0.0382 443 PHE A N   
591  C CA  . PHE A 116 ? 0.3657 0.4920 0.3952 -0.0103 0.0004  -0.0373 443 PHE A CA  
592  C C   . PHE A 116 ? 0.3769 0.4912 0.4007 -0.0132 0.0036  -0.0444 443 PHE A C   
593  O O   . PHE A 116 ? 0.3740 0.4805 0.4015 -0.0096 0.0062  -0.0456 443 PHE A O   
594  C CB  . PHE A 116 ? 0.3673 0.4967 0.3922 -0.0022 -0.0028 -0.0305 443 PHE A CB  
595  C CG  . PHE A 116 ? 0.3997 0.5113 0.4153 0.0018  -0.0028 -0.0312 443 PHE A CG  
596  C CD1 . PHE A 116 ? 0.4014 0.5022 0.4165 0.0072  -0.0001 -0.0337 443 PHE A CD1 
597  C CD2 . PHE A 116 ? 0.4159 0.5221 0.4219 -0.0026 -0.0068 -0.0279 443 PHE A CD2 
598  C CE1 . PHE A 116 ? 0.4225 0.5062 0.4287 0.0074  -0.0024 -0.0341 443 PHE A CE1 
599  C CE2 . PHE A 116 ? 0.4354 0.5246 0.4336 -0.0029 -0.0084 -0.0264 443 PHE A CE2 
600  C CZ  . PHE A 116 ? 0.4416 0.5188 0.4403 0.0016  -0.0067 -0.0301 443 PHE A CZ  
601  N N   . LEU A 117 ? 0.3834 0.5012 0.3984 -0.0199 0.0033  -0.0482 444 LEU A N   
602  C CA  . LEU A 117 ? 0.3842 0.4999 0.3948 -0.0225 0.0083  -0.0542 444 LEU A CA  
603  C C   . LEU A 117 ? 0.3770 0.4878 0.3967 -0.0212 0.0134  -0.0647 444 LEU A C   
604  O O   . LEU A 117 ? 0.3765 0.4870 0.4026 -0.0175 0.0179  -0.0668 444 LEU A O   
605  C CB  . LEU A 117 ? 0.4006 0.5263 0.3965 -0.0308 0.0078  -0.0550 444 LEU A CB  
606  C CG  . LEU A 117 ? 0.4180 0.5442 0.4056 -0.0319 0.0020  -0.0418 444 LEU A CG  
607  C CD1 . LEU A 117 ? 0.4430 0.5821 0.4150 -0.0420 -0.0010 -0.0393 444 LEU A CD1 
608  C CD2 . LEU A 117 ? 0.4235 0.5442 0.4114 -0.0322 0.0042  -0.0380 444 LEU A CD2 
609  N N   . GLU A 118 ? 0.3690 0.4755 0.3913 -0.0243 0.0112  -0.0699 445 GLU A N   
610  C CA  . GLU A 118 ? 0.3906 0.4840 0.4234 -0.0219 0.0130  -0.0778 445 GLU A CA  
611  C C   . GLU A 118 ? 0.3780 0.4665 0.4244 -0.0149 0.0126  -0.0691 445 GLU A C   
612  O O   . GLU A 118 ? 0.3832 0.4661 0.4396 -0.0090 0.0154  -0.0729 445 GLU A O   
613  C CB  . GLU A 118 ? 0.4314 0.5167 0.4634 -0.0303 0.0070  -0.0813 445 GLU A CB  
614  C CG  . GLU A 118 ? 0.4837 0.5703 0.4992 -0.0385 0.0064  -0.0940 445 GLU A CG  
615  C CD  . GLU A 118 ? 0.5483 0.6306 0.5609 -0.0513 -0.0030 -0.0946 445 GLU A CD  
616  O OE1 . GLU A 118 ? 0.5864 0.6848 0.5885 -0.0599 -0.0082 -0.0905 445 GLU A OE1 
617  O OE2 . GLU A 118 ? 0.5899 0.6526 0.6112 -0.0544 -0.0070 -0.0974 445 GLU A OE2 
618  N N   . LEU A 119 ? 0.3473 0.4409 0.3935 -0.0145 0.0092  -0.0578 446 LEU A N   
619  C CA  . LEU A 119 ? 0.3479 0.4394 0.4010 -0.0095 0.0084  -0.0499 446 LEU A CA  
620  C C   . LEU A 119 ? 0.3369 0.4294 0.3884 -0.0051 0.0101  -0.0494 446 LEU A C   
621  O O   . LEU A 119 ? 0.3250 0.4150 0.3854 -0.0021 0.0093  -0.0470 446 LEU A O   
622  C CB  . LEU A 119 ? 0.3498 0.4497 0.4007 -0.0093 0.0064  -0.0403 446 LEU A CB  
623  C CG  . LEU A 119 ? 0.3733 0.4742 0.4322 -0.0169 0.0034  -0.0367 446 LEU A CG  
624  C CD1 . LEU A 119 ? 0.3735 0.4942 0.4321 -0.0191 0.0026  -0.0292 446 LEU A CD1 
625  C CD2 . LEU A 119 ? 0.3785 0.4704 0.4467 -0.0181 0.0012  -0.0302 446 LEU A CD2 
626  N N   . PHE A 120 ? 0.3360 0.4325 0.3771 -0.0064 0.0106  -0.0498 447 PHE A N   
627  C CA  . PHE A 120 ? 0.3415 0.4387 0.3800 -0.0068 0.0103  -0.0480 447 PHE A CA  
628  C C   . PHE A 120 ? 0.3417 0.4461 0.3932 -0.0062 0.0145  -0.0523 447 PHE A C   
629  O O   . PHE A 120 ? 0.3413 0.4483 0.4011 -0.0048 0.0125  -0.0483 447 PHE A O   
630  C CB  . PHE A 120 ? 0.3539 0.4523 0.3797 -0.0111 0.0091  -0.0461 447 PHE A CB  
631  C CG  . PHE A 120 ? 0.3652 0.4653 0.3887 -0.0164 0.0080  -0.0424 447 PHE A CG  
632  C CD1 . PHE A 120 ? 0.3824 0.4707 0.4010 -0.0168 0.0017  -0.0374 447 PHE A CD1 
633  C CD2 . PHE A 120 ? 0.3665 0.4817 0.3915 -0.0226 0.0131  -0.0442 447 PHE A CD2 
634  C CE1 . PHE A 120 ? 0.3963 0.4859 0.4136 -0.0258 -0.0016 -0.0323 447 PHE A CE1 
635  C CE2 . PHE A 120 ? 0.3753 0.4980 0.4006 -0.0305 0.0119  -0.0378 447 PHE A CE2 
636  C CZ  . PHE A 120 ? 0.3764 0.4852 0.3987 -0.0334 0.0035  -0.0309 447 PHE A CZ  
637  N N   . VAL A 121 ? 0.3359 0.4444 0.3891 -0.0064 0.0198  -0.0613 448 VAL A N   
638  C CA  . VAL A 121 ? 0.3380 0.4564 0.4032 -0.0024 0.0264  -0.0689 448 VAL A CA  
639  C C   . VAL A 121 ? 0.3439 0.4540 0.4278 0.0062  0.0247  -0.0691 448 VAL A C   
640  O O   . VAL A 121 ? 0.3437 0.4650 0.4439 0.0116  0.0259  -0.0666 448 VAL A O   
641  C CB  . VAL A 121 ? 0.3424 0.4659 0.3979 -0.0043 0.0332  -0.0819 448 VAL A CB  
642  C CG1 . VAL A 121 ? 0.3580 0.4876 0.4269 0.0050  0.0417  -0.0950 448 VAL A CG1 
643  C CG2 . VAL A 121 ? 0.3416 0.4808 0.3821 -0.0133 0.0352  -0.0778 448 VAL A CG2 
644  N N   . LEU A 122 ? 0.3450 0.4378 0.4283 0.0063  0.0205  -0.0694 449 LEU A N   
645  C CA  . LEU A 122 ? 0.3510 0.4312 0.4510 0.0126  0.0165  -0.0665 449 LEU A CA  
646  C C   . LEU A 122 ? 0.3318 0.4185 0.4396 0.0141  0.0110  -0.0524 449 LEU A C   
647  O O   . LEU A 122 ? 0.3474 0.4380 0.4735 0.0216  0.0096  -0.0496 449 LEU A O   
648  C CB  . LEU A 122 ? 0.3597 0.4210 0.4557 0.0072  0.0111  -0.0654 449 LEU A CB  
649  C CG  . LEU A 122 ? 0.3798 0.4215 0.4905 0.0099  0.0042  -0.0592 449 LEU A CG  
650  C CD1 . LEU A 122 ? 0.3943 0.4201 0.5194 0.0211  0.0062  -0.0721 449 LEU A CD1 
651  C CD2 . LEU A 122 ? 0.3753 0.4060 0.4790 -0.0017 -0.0018 -0.0530 449 LEU A CD2 
652  N N   . ARG A 123 ? 0.3207 0.4098 0.4142 0.0077  0.0075  -0.0445 450 ARG A N   
653  C CA  . ARG A 123 ? 0.3237 0.4172 0.4169 0.0069  0.0014  -0.0333 450 ARG A CA  
654  C C   . ARG A 123 ? 0.3246 0.4325 0.4253 0.0073  0.0011  -0.0325 450 ARG A C   
655  O O   . ARG A 123 ? 0.3221 0.4365 0.4341 0.0088  -0.0048 -0.0241 450 ARG A O   
656  C CB  . ARG A 123 ? 0.3194 0.4112 0.3922 0.0022  -0.0002 -0.0297 450 ARG A CB  
657  C CG  . ARG A 123 ? 0.3260 0.4137 0.3959 0.0005  -0.0005 -0.0256 450 ARG A CG  
658  C CD  . ARG A 123 ? 0.3159 0.4083 0.3696 -0.0004 0.0018  -0.0266 450 ARG A CD  
659  N NE  . ARG A 123 ? 0.3344 0.4278 0.3738 0.0014  0.0000  -0.0256 450 ARG A NE  
660  C CZ  . ARG A 123 ? 0.3350 0.4326 0.3655 0.0015  -0.0019 -0.0196 450 ARG A CZ  
661  N NH1 . ARG A 123 ? 0.3299 0.4340 0.3663 -0.0013 -0.0025 -0.0102 450 ARG A NH1 
662  N NH2 . ARG A 123 ? 0.3357 0.4296 0.3492 0.0030  -0.0042 -0.0228 450 ARG A NH2 
663  N N   . LEU A 124 ? 0.3191 0.4347 0.4145 0.0044  0.0067  -0.0391 451 LEU A N   
664  C CA  . LEU A 124 ? 0.3157 0.4500 0.4197 0.0015  0.0073  -0.0369 451 LEU A CA  
665  C C   . LEU A 124 ? 0.3263 0.4758 0.4579 0.0115  0.0110  -0.0385 451 LEU A C   
666  O O   . LEU A 124 ? 0.3201 0.4855 0.4683 0.0122  0.0059  -0.0299 451 LEU A O   
667  C CB  . LEU A 124 ? 0.3121 0.4527 0.4037 -0.0057 0.0126  -0.0410 451 LEU A CB  
668  C CG  . LEU A 124 ? 0.3117 0.4756 0.4104 -0.0136 0.0135  -0.0360 451 LEU A CG  
669  C CD1 . LEU A 124 ? 0.3051 0.4657 0.3999 -0.0230 0.0017  -0.0255 451 LEU A CD1 
670  C CD2 . LEU A 124 ? 0.3100 0.4781 0.3936 -0.0218 0.0187  -0.0380 451 LEU A CD2 
671  N N   . ALA A 125 ? 0.3277 0.4712 0.4642 0.0197  0.0186  -0.0499 452 ALA A N   
672  C CA  . ALA A 125 ? 0.3333 0.4867 0.4953 0.0337  0.0240  -0.0559 452 ALA A CA  
673  C C   . ALA A 125 ? 0.3355 0.4828 0.5177 0.0415  0.0144  -0.0450 452 ALA A C   
674  O O   . ALA A 125 ? 0.3297 0.4958 0.5390 0.0524  0.0150  -0.0424 452 ALA A O   
675  C CB  . ALA A 125 ? 0.3481 0.4857 0.5047 0.0403  0.0318  -0.0731 452 ALA A CB  
676  N N   . TYR A 126 ? 0.3485 0.4733 0.5186 0.0361  0.0055  -0.0371 453 TYR A N   
677  C CA  . TYR A 126 ? 0.3659 0.4830 0.5508 0.0409  -0.0050 -0.0236 453 TYR A CA  
678  C C   . TYR A 126 ? 0.3600 0.4976 0.5486 0.0353  -0.0139 -0.0088 453 TYR A C   
679  O O   . TYR A 126 ? 0.3704 0.5155 0.5807 0.0421  -0.0219 0.0024  453 TYR A O   
680  C CB  . TYR A 126 ? 0.3674 0.4593 0.5361 0.0340  -0.0106 -0.0182 453 TYR A CB  
681  C CG  . TYR A 126 ? 0.3796 0.4577 0.5640 0.0387  -0.0214 -0.0040 453 TYR A CG  
682  C CD1 . TYR A 126 ? 0.3947 0.4593 0.6048 0.0535  -0.0222 -0.0078 453 TYR A CD1 
683  C CD2 . TYR A 126 ? 0.3737 0.4504 0.5455 0.0286  -0.0308 0.0130  453 TYR A CD2 
684  C CE1 . TYR A 126 ? 0.4129 0.4598 0.6378 0.0574  -0.0343 0.0077  453 TYR A CE1 
685  C CE2 . TYR A 126 ? 0.3935 0.4582 0.5776 0.0302  -0.0419 0.0296  453 TYR A CE2 
686  C CZ  . TYR A 126 ? 0.4231 0.4710 0.6347 0.0441  -0.0447 0.0283  453 TYR A CZ  
687  O OH  . TYR A 126 ? 0.4633 0.4947 0.6878 0.0454  -0.0582 0.0476  453 TYR A OH  
688  N N   . ARG A 127 ? 0.3574 0.5015 0.5241 0.0227  -0.0139 -0.0091 454 ARG A N   
689  C CA  . ARG A 127 ? 0.3706 0.5280 0.5317 0.0131  -0.0241 0.0020  454 ARG A CA  
690  C C   . ARG A 127 ? 0.3653 0.5539 0.5495 0.0130  -0.0247 0.0055  454 ARG A C   
691  O O   . ARG A 127 ? 0.3727 0.5766 0.5652 0.0081  -0.0362 0.0180  454 ARG A O   
692  C CB  . ARG A 127 ? 0.3744 0.5206 0.5029 0.0012  -0.0234 -0.0031 454 ARG A CB  
693  C CG  . ARG A 127 ? 0.4000 0.5410 0.5074 -0.0079 -0.0343 0.0040  454 ARG A CG  
694  C CD  . ARG A 127 ? 0.4119 0.5328 0.4893 -0.0104 -0.0302 -0.0038 454 ARG A CD  
695  N NE  . ARG A 127 ? 0.4285 0.5452 0.4996 -0.0125 -0.0237 -0.0130 454 ARG A NE  
696  C CZ  . ARG A 127 ? 0.4389 0.5429 0.4961 -0.0102 -0.0172 -0.0204 454 ARG A CZ  
697  N NH1 . ARG A 127 ? 0.4279 0.5247 0.4768 -0.0058 -0.0148 -0.0207 454 ARG A NH1 
698  N NH2 . ARG A 127 ? 0.4351 0.5373 0.4880 -0.0135 -0.0138 -0.0253 454 ARG A NH2 
699  N N   . SER A 128 ? 0.3574 0.5590 0.5515 0.0171  -0.0125 -0.0045 455 SER A N   
700  C CA  . SER A 128 ? 0.3618 0.5988 0.5725 0.0122  -0.0101 -0.0014 455 SER A CA  
701  C C   . SER A 128 ? 0.3648 0.6347 0.6169 0.0258  -0.0104 0.0052  455 SER A C   
702  O O   . SER A 128 ? 0.3730 0.6322 0.6405 0.0404  -0.0140 0.0077  455 SER A O   
703  C CB  . SER A 128 ? 0.3582 0.5996 0.5592 0.0102  0.0041  -0.0138 455 SER A CB  
704  O OG  . SER A 128 ? 0.3636 0.5818 0.5311 -0.0040 0.0009  -0.0151 455 SER A OG  
705  N N   . ASN A 129 ? 0.3650 0.6760 0.6370 0.0212  -0.0073 0.0098  456 ASN A N   
706  C CA  . ASN A 129 ? 0.3781 0.7303 0.6956 0.0369  -0.0054 0.0162  456 ASN A CA  
707  C C   . ASN A 129 ? 0.3710 0.7575 0.7037 0.0445  0.0144  0.0048  456 ASN A C   
708  O O   . ASN A 129 ? 0.3685 0.7948 0.7092 0.0303  0.0166  0.0124  456 ASN A O   
709  C CB  . ASN A 129 ? 0.3872 0.7704 0.7211 0.0235  -0.0225 0.0370  456 ASN A CB  
710  C CG  . ASN A 129 ? 0.4181 0.8418 0.8028 0.0428  -0.0252 0.0476  456 ASN A CG  
711  O OD1 . ASN A 129 ? 0.4394 0.8769 0.8517 0.0675  -0.0108 0.0377  456 ASN A OD1 
712  N ND2 . ASN A 129 ? 0.4172 0.8606 0.8144 0.0324  -0.0446 0.0675  456 ASN A ND2 
713  N N   . PRO A 130 ? 0.3725 0.7435 0.7067 0.0649  0.0287  -0.0135 457 PRO A N   
714  C CA  . PRO A 130 ? 0.3808 0.7800 0.7186 0.0714  0.0495  -0.0285 457 PRO A CA  
715  C C   . PRO A 130 ? 0.3863 0.8499 0.7700 0.0846  0.0586  -0.0237 457 PRO A C   
716  O O   . PRO A 130 ? 0.3789 0.8849 0.7645 0.0772  0.0724  -0.0258 457 PRO A O   
717  C CB  . PRO A 130 ? 0.3925 0.7511 0.7182 0.0901  0.0582  -0.0504 457 PRO A CB  
718  C CG  . PRO A 130 ? 0.3908 0.7164 0.7290 0.1017  0.0434  -0.0432 457 PRO A CG  
719  C CD  . PRO A 130 ? 0.3790 0.7041 0.7089 0.0808  0.0251  -0.0211 457 PRO A CD  
720  N N   . VAL A 131 ? 0.3910 0.8649 0.8120 0.1029  0.0501  -0.0149 458 VAL A N   
721  C CA  . VAL A 131 ? 0.3973 0.9376 0.8693 0.1165  0.0550  -0.0055 458 VAL A CA  
722  C C   . VAL A 131 ? 0.3861 0.9784 0.8624 0.0874  0.0510  0.0135  458 VAL A C   
723  O O   . VAL A 131 ? 0.3937 1.0503 0.8990 0.0908  0.0654  0.0152  458 VAL A O   
724  C CB  . VAL A 131 ? 0.4077 0.9459 0.9168 0.1354  0.0385  0.0086  458 VAL A CB  
725  C CG1 . VAL A 131 ? 0.4031 1.0170 0.9697 0.1491  0.0414  0.0217  458 VAL A CG1 
726  C CG2 . VAL A 131 ? 0.4283 0.9151 0.9382 0.1643  0.0413  -0.0080 458 VAL A CG2 
727  N N   . GLU A 132 ? 0.3701 0.9346 0.8172 0.0585  0.0318  0.0271  459 GLU A N   
728  C CA  . GLU A 132 ? 0.3600 0.9610 0.8073 0.0272  0.0226  0.0460  459 GLU A CA  
729  C C   . GLU A 132 ? 0.3444 0.9303 0.7508 0.0015  0.0285  0.0417  459 GLU A C   
730  O O   . GLU A 132 ? 0.3542 0.9596 0.7556 -0.0275 0.0187  0.0576  459 GLU A O   
731  C CB  . GLU A 132 ? 0.3710 0.9547 0.8142 0.0113  -0.0046 0.0643  459 GLU A CB  
732  C CG  . GLU A 132 ? 0.3963 1.0250 0.8911 0.0265  -0.0140 0.0800  459 GLU A CG  
733  C CD  . GLU A 132 ? 0.4157 1.0192 0.9000 0.0143  -0.0414 0.0956  459 GLU A CD  
734  O OE1 . GLU A 132 ? 0.4368 0.9972 0.8751 -0.0101 -0.0532 0.0951  459 GLU A OE1 
735  O OE2 . GLU A 132 ? 0.4307 1.0583 0.9524 0.0304  -0.0513 0.1084  459 GLU A OE2 
736  N N   . GLY A 133 ? 0.3265 0.8772 0.7043 0.0110  0.0425  0.0217  460 GLY A N   
737  C CA  . GLY A 133 ? 0.3186 0.8473 0.6550 -0.0110 0.0457  0.0185  460 GLY A CA  
738  C C   . GLY A 133 ? 0.3034 0.7786 0.6028 -0.0331 0.0255  0.0255  460 GLY A C   
739  O O   . GLY A 133 ? 0.2989 0.7626 0.5715 -0.0553 0.0229  0.0300  460 GLY A O   
740  N N   . LYS A 134 ? 0.2939 0.7373 0.5918 -0.0263 0.0112  0.0270  461 LYS A N   
741  C CA  . LYS A 134 ? 0.2952 0.6919 0.5589 -0.0441 -0.0071 0.0316  461 LYS A CA  
742  C C   . LYS A 134 ? 0.2878 0.6315 0.5191 -0.0343 -0.0032 0.0166  461 LYS A C   
743  O O   . LYS A 134 ? 0.2876 0.6180 0.5267 -0.0138 0.0011  0.0083  461 LYS A O   
744  C CB  . LYS A 134 ? 0.2896 0.6877 0.5660 -0.0456 -0.0258 0.0435  461 LYS A CB  
745  C CG  . LYS A 134 ? 0.2960 0.7402 0.5965 -0.0646 -0.0374 0.0619  461 LYS A CG  
746  C CD  . LYS A 134 ? 0.3020 0.7493 0.6148 -0.0638 -0.0564 0.0732  461 LYS A CD  
747  C CE  . LYS A 134 ? 0.3157 0.8026 0.6453 -0.0888 -0.0730 0.0921  461 LYS A CE  
748  N NZ  . LYS A 134 ? 0.3169 0.8767 0.7013 -0.0804 -0.0644 0.1034  461 LYS A NZ  
749  N N   . LEU A 135 ? 0.2856 0.5999 0.4829 -0.0496 -0.0060 0.0147  462 LEU A N   
750  C CA  . LEU A 135 ? 0.2739 0.5415 0.4409 -0.0434 -0.0052 0.0035  462 LEU A CA  
751  C C   . LEU A 135 ? 0.2829 0.5185 0.4277 -0.0532 -0.0218 0.0078  462 LEU A C   
752  O O   . LEU A 135 ? 0.2930 0.5276 0.4288 -0.0721 -0.0331 0.0161  462 LEU A O   
753  C CB  . LEU A 135 ? 0.2763 0.5361 0.4227 -0.0503 0.0032  -0.0013 462 LEU A CB  
754  C CG  . LEU A 135 ? 0.2746 0.5665 0.4400 -0.0372 0.0211  -0.0098 462 LEU A CG  
755  C CD1 . LEU A 135 ? 0.2738 0.6031 0.4433 -0.0517 0.0282  -0.0024 462 LEU A CD1 
756  C CD2 . LEU A 135 ? 0.2674 0.5337 0.4182 -0.0231 0.0298  -0.0256 462 LEU A CD2 
757  N N   . ILE A 136 ? 0.2766 0.4880 0.4128 -0.0413 -0.0237 0.0026  463 ILE A N   
758  C CA  . ILE A 136 ? 0.2922 0.4760 0.4043 -0.0475 -0.0371 0.0042  463 ILE A CA  
759  C C   . ILE A 136 ? 0.3016 0.4514 0.3861 -0.0419 -0.0323 -0.0060 463 ILE A C   
760  O O   . ILE A 136 ? 0.2875 0.4327 0.3756 -0.0290 -0.0242 -0.0112 463 ILE A O   
761  C CB  . ILE A 136 ? 0.2873 0.4787 0.4118 -0.0405 -0.0446 0.0106  463 ILE A CB  
762  C CG1 . ILE A 136 ? 0.2911 0.5219 0.4482 -0.0447 -0.0510 0.0229  463 ILE A CG1 
763  C CG2 . ILE A 136 ? 0.3062 0.4711 0.3987 -0.0477 -0.0563 0.0100  463 ILE A CG2 
764  C CD1 . ILE A 136 ? 0.2835 0.5279 0.4619 -0.0346 -0.0582 0.0325  463 ILE A CD1 
765  N N   . PHE A 137 ? 0.3217 0.4480 0.3806 -0.0517 -0.0382 -0.0082 464 PHE A N   
766  C CA  . PHE A 137 ? 0.3422 0.4417 0.3795 -0.0449 -0.0335 -0.0167 464 PHE A CA  
767  C C   . PHE A 137 ? 0.3670 0.4479 0.3855 -0.0382 -0.0372 -0.0213 464 PHE A C   
768  O O   . PHE A 137 ? 0.3630 0.4466 0.3780 -0.0425 -0.0460 -0.0180 464 PHE A O   
769  C CB  . PHE A 137 ? 0.3612 0.4429 0.3825 -0.0553 -0.0376 -0.0162 464 PHE A CB  
770  C CG  . PHE A 137 ? 0.3586 0.4620 0.3942 -0.0610 -0.0304 -0.0112 464 PHE A CG  
771  C CD1 . PHE A 137 ? 0.3453 0.4513 0.3808 -0.0524 -0.0195 -0.0158 464 PHE A CD1 
772  C CD2 . PHE A 137 ? 0.3590 0.4851 0.4079 -0.0762 -0.0344 -0.0014 464 PHE A CD2 
773  C CE1 . PHE A 137 ? 0.3350 0.4637 0.3789 -0.0582 -0.0120 -0.0124 464 PHE A CE1 
774  C CE2 . PHE A 137 ? 0.3588 0.5116 0.4194 -0.0816 -0.0254 0.0033  464 PHE A CE2 
775  C CZ  . PHE A 137 ? 0.3472 0.5005 0.4033 -0.0722 -0.0138 -0.0030 464 PHE A CZ  
776  N N   . CYS A 138 ? 0.3778 0.4448 0.3844 -0.0283 -0.0306 -0.0279 465 CYS A N   
777  C CA  . CYS A 138 ? 0.3973 0.4564 0.3891 -0.0203 -0.0300 -0.0317 465 CYS A CA  
778  C C   . CYS A 138 ? 0.4154 0.4553 0.3802 -0.0243 -0.0394 -0.0367 465 CYS A C   
779  O O   . CYS A 138 ? 0.4248 0.4672 0.3779 -0.0214 -0.0404 -0.0378 465 CYS A O   
780  C CB  . CYS A 138 ? 0.4189 0.4747 0.4080 -0.0096 -0.0207 -0.0362 465 CYS A CB  
781  S SG  . CYS A 138 ? 0.4982 0.5284 0.4667 -0.0056 -0.0226 -0.0435 465 CYS A SG  
782  N N   . ASN A 139 ? 0.4422 0.4617 0.3950 -0.0323 -0.0471 -0.0397 466 ASN A N   
783  C CA  . ASN A 139 ? 0.4862 0.4812 0.4112 -0.0387 -0.0588 -0.0467 466 ASN A CA  
784  C C   . ASN A 139 ? 0.4895 0.4972 0.4182 -0.0548 -0.0712 -0.0393 466 ASN A C   
785  O O   . ASN A 139 ? 0.5233 0.5108 0.4273 -0.0641 -0.0834 -0.0452 466 ASN A O   
786  C CB  . ASN A 139 ? 0.5270 0.4875 0.4370 -0.0423 -0.0652 -0.0520 466 ASN A CB  
787  C CG  . ASN A 139 ? 0.5431 0.5118 0.4721 -0.0576 -0.0694 -0.0401 466 ASN A CG  
788  O OD1 . ASN A 139 ? 0.5275 0.5310 0.4830 -0.0619 -0.0644 -0.0303 466 ASN A OD1 
789  N ND2 . ASN A 139 ? 0.5778 0.5148 0.4935 -0.0655 -0.0784 -0.0405 466 ASN A ND2 
790  N N   . GLY A 140 ? 0.4559 0.4969 0.4157 -0.0576 -0.0687 -0.0271 467 GLY A N   
791  C CA  . GLY A 140 ? 0.4493 0.5107 0.4206 -0.0708 -0.0804 -0.0171 467 GLY A CA  
792  C C   . GLY A 140 ? 0.4571 0.5272 0.4430 -0.0879 -0.0885 -0.0093 467 GLY A C   
793  O O   . GLY A 140 ? 0.4630 0.5564 0.4628 -0.1002 -0.0994 0.0009  467 GLY A O   
794  N N   . VAL A 141 ? 0.4433 0.4986 0.4270 -0.0901 -0.0842 -0.0117 468 VAL A N   
795  C CA  . VAL A 141 ? 0.4518 0.5180 0.4487 -0.1088 -0.0907 -0.0015 468 VAL A CA  
796  C C   . VAL A 141 ? 0.4108 0.5260 0.4476 -0.1053 -0.0797 0.0088  468 VAL A C   
797  O O   . VAL A 141 ? 0.3915 0.5162 0.4396 -0.0888 -0.0647 0.0050  468 VAL A O   
798  C CB  . VAL A 141 ? 0.4840 0.5152 0.4621 -0.1147 -0.0924 -0.0046 468 VAL A CB  
799  C CG1 . VAL A 141 ? 0.4783 0.5280 0.4727 -0.1361 -0.0971 0.0101  468 VAL A CG1 
800  C CG2 . VAL A 141 ? 0.5224 0.5024 0.4625 -0.1185 -0.1062 -0.0161 468 VAL A CG2 
801  N N   . VAL A 142 ? 0.4109 0.5579 0.4689 -0.1206 -0.0880 0.0212  469 VAL A N   
802  C CA  . VAL A 142 ? 0.3779 0.5765 0.4765 -0.1160 -0.0777 0.0306  469 VAL A CA  
803  C C   . VAL A 142 ? 0.3854 0.6012 0.4923 -0.1333 -0.0758 0.0394  469 VAL A C   
804  O O   . VAL A 142 ? 0.4089 0.6177 0.5070 -0.1576 -0.0911 0.0479  469 VAL A O   
805  C CB  . VAL A 142 ? 0.3702 0.6045 0.4944 -0.1189 -0.0877 0.0415  469 VAL A CB  
806  C CG1 . VAL A 142 ? 0.3401 0.6266 0.5093 -0.1054 -0.0740 0.0480  469 VAL A CG1 
807  C CG2 . VAL A 142 ? 0.3632 0.5765 0.4708 -0.1089 -0.0946 0.0365  469 VAL A CG2 
808  N N   . LEU A 143 ? 0.3624 0.5999 0.4839 -0.1224 -0.0578 0.0376  470 LEU A N   
809  C CA  . LEU A 143 ? 0.3590 0.6228 0.4894 -0.1379 -0.0527 0.0475  470 LEU A CA  
810  C C   . LEU A 143 ? 0.3320 0.6537 0.4991 -0.1251 -0.0348 0.0490  470 LEU A C   
811  O O   . LEU A 143 ? 0.3087 0.6316 0.4842 -0.1006 -0.0229 0.0371  470 LEU A O   
812  C CB  . LEU A 143 ? 0.3665 0.5944 0.4681 -0.1386 -0.0482 0.0423  470 LEU A CB  
813  C CG  . LEU A 143 ? 0.3943 0.5636 0.4604 -0.1503 -0.0649 0.0412  470 LEU A CG  
814  C CD1 . LEU A 143 ? 0.3988 0.5435 0.4456 -0.1454 -0.0580 0.0381  470 LEU A CD1 
815  C CD2 . LEU A 143 ? 0.4233 0.5897 0.4866 -0.1807 -0.0832 0.0559  470 LEU A CD2 
816  N N   . HIS A 144 ? 0.3404 0.7099 0.5294 -0.1417 -0.0329 0.0633  471 HIS A N   
817  C CA  . HIS A 144 ? 0.3357 0.7642 0.5572 -0.1284 -0.0122 0.0626  471 HIS A CA  
818  C C   . HIS A 144 ? 0.3383 0.7584 0.5405 -0.1210 0.0049  0.0521  471 HIS A C   
819  O O   . HIS A 144 ? 0.3412 0.7265 0.5121 -0.1357 -0.0010 0.0549  471 HIS A O   
820  C CB  . HIS A 144 ? 0.3467 0.8383 0.5986 -0.1490 -0.0133 0.0823  471 HIS A CB  
821  C CG  . HIS A 144 ? 0.3365 0.8959 0.6310 -0.1287 0.0067  0.0802  471 HIS A CG  
822  N ND1 . HIS A 144 ? 0.3377 0.9341 0.6366 -0.1228 0.0294  0.0754  471 HIS A ND1 
823  C CD2 . HIS A 144 ? 0.3256 0.9216 0.6596 -0.1106 0.0076  0.0812  471 HIS A CD2 
824  C CE1 . HIS A 144 ? 0.3298 0.9821 0.6690 -0.1003 0.0448  0.0710  471 HIS A CE1 
825  N NE2 . HIS A 144 ? 0.3238 0.9764 0.6871 -0.0918 0.0314  0.0755  471 HIS A NE2 
826  N N   . ARG A 145 ? 0.3404 0.7911 0.5609 -0.0978 0.0248  0.0399  472 ARG A N   
827  C CA  . ARG A 145 ? 0.3605 0.8132 0.5640 -0.0910 0.0423  0.0284  472 ARG A CA  
828  C C   . ARG A 145 ? 0.3757 0.8551 0.5680 -0.1173 0.0450  0.0437  472 ARG A C   
829  O O   . ARG A 145 ? 0.3904 0.8435 0.5512 -0.1242 0.0460  0.0419  472 ARG A O   
830  C CB  . ARG A 145 ? 0.3675 0.8539 0.5959 -0.0626 0.0625  0.0119  472 ARG A CB  
831  C CG  . ARG A 145 ? 0.3937 0.8871 0.6030 -0.0555 0.0813  -0.0030 472 ARG A CG  
832  C CD  . ARG A 145 ? 0.4080 0.9430 0.6449 -0.0290 0.1020  -0.0195 472 ARG A CD  
833  N NE  . ARG A 145 ? 0.4181 1.0252 0.6891 -0.0329 0.1119  -0.0078 472 ARG A NE  
834  C CZ  . ARG A 145 ? 0.4523 1.1095 0.7188 -0.0485 0.1252  -0.0004 472 ARG A CZ  
835  N NH1 . ARG A 145 ? 0.4680 1.1073 0.6943 -0.0631 0.1284  -0.0022 472 ARG A NH1 
836  N NH2 . ARG A 145 ? 0.4398 1.1699 0.7433 -0.0509 0.1348  0.0114  472 ARG A NH2 
837  N N   . LEU A 146 ? 0.3738 0.9064 0.5928 -0.1336 0.0444  0.0612  473 LEU A N   
838  C CA  . LEU A 146 ? 0.3872 0.9503 0.5992 -0.1641 0.0445  0.0815  473 LEU A CA  
839  C C   . LEU A 146 ? 0.3956 0.8975 0.5723 -0.1892 0.0221  0.0937  473 LEU A C   
840  O O   . LEU A 146 ? 0.4179 0.9208 0.5746 -0.2093 0.0222  0.1062  473 LEU A O   
841  C CB  . LEU A 146 ? 0.3986 1.0311 0.6505 -0.1795 0.0443  0.1009  473 LEU A CB  
842  C CG  . LEU A 146 ? 0.4103 1.1320 0.6949 -0.1724 0.0698  0.1025  473 LEU A CG  
843  C CD1 . LEU A 146 ? 0.4023 1.1468 0.7163 -0.1316 0.0868  0.0797  473 LEU A CD1 
844  C CD2 . LEU A 146 ? 0.4167 1.2002 0.7338 -0.2011 0.0622  0.1308  473 LEU A CD2 
845  N N   . GLN A 147 ? 0.3806 0.8296 0.5492 -0.1870 0.0032  0.0900  474 GLN A N   
846  C CA  . GLN A 147 ? 0.4017 0.7854 0.5369 -0.2043 -0.0178 0.0963  474 GLN A CA  
847  C C   . GLN A 147 ? 0.4090 0.7473 0.5135 -0.1887 -0.0130 0.0827  474 GLN A C   
848  O O   . GLN A 147 ? 0.4327 0.7250 0.5101 -0.2011 -0.0263 0.0896  474 GLN A O   
849  C CB  . GLN A 147 ? 0.3938 0.7386 0.5273 -0.2041 -0.0374 0.0927  474 GLN A CB  
850  C CG  . GLN A 147 ? 0.3923 0.7610 0.5438 -0.2311 -0.0537 0.1110  474 GLN A CG  
851  C CD  . GLN A 147 ? 0.3889 0.7224 0.5353 -0.2279 -0.0716 0.1037  474 GLN A CD  
852  O OE1 . GLN A 147 ? 0.3561 0.6979 0.5155 -0.2036 -0.0653 0.0913  474 GLN A OE1 
853  N NE2 . GLN A 147 ? 0.4183 0.7105 0.5435 -0.2535 -0.0951 0.1116  474 GLN A NE2 
854  N N   . CYS A 148 ? 0.3981 0.7490 0.5083 -0.1617 0.0044  0.0640  475 CYS A N   
855  C CA  . CYS A 148 ? 0.4139 0.7278 0.4989 -0.1468 0.0084  0.0507  475 CYS A CA  
856  C C   . CYS A 148 ? 0.4318 0.7721 0.5045 -0.1517 0.0220  0.0531  475 CYS A C   
857  O O   . CYS A 148 ? 0.4233 0.7341 0.4725 -0.1455 0.0216  0.0469  475 CYS A O   
858  C CB  . CYS A 148 ? 0.3971 0.7022 0.4915 -0.1181 0.0163  0.0297  475 CYS A CB  
859  S SG  . CYS A 148 ? 0.4012 0.6702 0.5002 -0.1115 0.0000  0.0267  475 CYS A SG  
860  N N   . VAL A 149 ? 0.4531 0.8527 0.5416 -0.1633 0.0338  0.0627  476 VAL A N   
861  C CA  . VAL A 149 ? 0.4770 0.9133 0.5527 -0.1681 0.0500  0.0637  476 VAL A CA  
862  C C   . VAL A 149 ? 0.5123 0.9200 0.5551 -0.1883 0.0385  0.0800  476 VAL A C   
863  O O   . VAL A 149 ? 0.5152 0.9205 0.5363 -0.1824 0.0458  0.0725  476 VAL A O   
864  C CB  . VAL A 149 ? 0.4838 0.9980 0.5848 -0.1763 0.0668  0.0715  476 VAL A CB  
865  C CG1 . VAL A 149 ? 0.5105 1.0637 0.5912 -0.1899 0.0806  0.0788  476 VAL A CG1 
866  C CG2 . VAL A 149 ? 0.4667 1.0109 0.5967 -0.1465 0.0839  0.0490  476 VAL A CG2 
867  N N   . ARG A 150 ? 0.5561 0.9393 0.5944 -0.2123 0.0188  0.1025  477 ARG A N   
868  C CA  . ARG A 150 ? 0.6073 0.9583 0.6166 -0.2313 0.0049  0.1214  477 ARG A CA  
869  C C   . ARG A 150 ? 0.6029 0.8946 0.5903 -0.2129 -0.0038 0.1094  477 ARG A C   
870  O O   . ARG A 150 ? 0.6261 0.9122 0.5915 -0.2171 -0.0049 0.1165  477 ARG A O   
871  C CB  . ARG A 150 ? 0.6663 0.9957 0.6762 -0.2609 -0.0166 0.1474  477 ARG A CB  
872  C CG  . ARG A 150 ? 0.7217 1.1142 0.7450 -0.2906 -0.0109 0.1712  477 ARG A CG  
873  C CD  . ARG A 150 ? 0.7966 1.1543 0.8136 -0.3245 -0.0371 0.1996  477 ARG A CD  
874  N NE  . ARG A 150 ? 0.8452 1.2651 0.8829 -0.3555 -0.0345 0.2235  477 ARG A NE  
875  C CZ  . ARG A 150 ? 0.8972 1.2986 0.9393 -0.3875 -0.0569 0.2466  477 ARG A CZ  
876  N NH1 . ARG A 150 ? 0.9409 1.2576 0.9654 -0.3905 -0.0833 0.2460  477 ARG A NH1 
877  N NH2 . ARG A 150 ? 0.9092 1.3781 0.9737 -0.4167 -0.0528 0.2697  477 ARG A NH2 
878  N N   . GLY A 151 ? 0.5715 0.8250 0.5658 -0.1934 -0.0098 0.0929  478 GLY A N   
879  C CA  . GLY A 151 ? 0.5598 0.7652 0.5388 -0.1740 -0.0162 0.0807  478 GLY A CA  
880  C C   . GLY A 151 ? 0.5336 0.7581 0.5111 -0.1536 0.0000  0.0609  478 GLY A C   
881  O O   . GLY A 151 ? 0.5399 0.7549 0.4993 -0.1514 -0.0014 0.0619  478 GLY A O   
882  N N   . PHE A 152 ? 0.5012 0.7513 0.4980 -0.1396 0.0137  0.0438  479 PHE A N   
883  C CA  . PHE A 152 ? 0.4814 0.7390 0.4779 -0.1194 0.0267  0.0221  479 PHE A CA  
884  C C   . PHE A 152 ? 0.4921 0.7935 0.4807 -0.1236 0.0427  0.0182  479 PHE A C   
885  O O   . PHE A 152 ? 0.5005 0.8014 0.4783 -0.1123 0.0500  0.0021  479 PHE A O   
886  C CB  . PHE A 152 ? 0.4543 0.7162 0.4752 -0.1018 0.0331  0.0064  479 PHE A CB  
887  C CG  . PHE A 152 ? 0.4427 0.6626 0.4664 -0.0936 0.0198  0.0047  479 PHE A CG  
888  C CD1 . PHE A 152 ? 0.4280 0.6263 0.4506 -0.0757 0.0209  -0.0099 479 PHE A CD1 
889  C CD2 . PHE A 152 ? 0.4514 0.6544 0.4769 -0.1052 0.0061  0.0174  479 PHE A CD2 
890  C CE1 . PHE A 152 ? 0.4241 0.5902 0.4474 -0.0684 0.0108  -0.0112 479 PHE A CE1 
891  C CE2 . PHE A 152 ? 0.4548 0.6206 0.4781 -0.0969 -0.0046 0.0129  479 PHE A CE2 
892  C CZ  . PHE A 152 ? 0.4332 0.5835 0.4554 -0.0779 -0.0011 -0.0010 479 PHE A CZ  
893  N N   . GLY A 153 ? 0.5096 0.8511 0.5025 -0.1409 0.0484  0.0323  480 GLY A N   
894  C CA  . GLY A 153 ? 0.5187 0.9129 0.5057 -0.1438 0.0678  0.0267  480 GLY A CA  
895  C C   . GLY A 153 ? 0.5071 0.9231 0.5121 -0.1197 0.0860  -0.0005 480 GLY A C   
896  O O   . GLY A 153 ? 0.4848 0.8897 0.5154 -0.1057 0.0842  -0.0077 480 GLY A O   
897  N N   . GLU A 154 ? 0.5252 0.9688 0.5144 -0.1148 0.1022  -0.0159 481 GLU A N   
898  C CA  . GLU A 154 ? 0.5250 0.9844 0.5254 -0.0906 0.1200  -0.0453 481 GLU A CA  
899  C C   . GLU A 154 ? 0.4964 0.9055 0.5070 -0.0699 0.1116  -0.0619 481 GLU A C   
900  O O   . GLU A 154 ? 0.4937 0.9063 0.5238 -0.0488 0.1214  -0.0816 481 GLU A O   
901  C CB  . GLU A 154 ? 0.5696 1.0526 0.5381 -0.0923 0.1341  -0.0604 481 GLU A CB  
902  C CG  . GLU A 154 ? 0.5927 1.1078 0.5692 -0.0705 0.1576  -0.0904 481 GLU A CG  
903  C CD  . GLU A 154 ? 0.6411 1.1861 0.5795 -0.0770 0.1720  -0.1037 481 GLU A CD  
904  O OE1 . GLU A 154 ? 0.6577 1.2572 0.5891 -0.0927 0.1833  -0.0898 481 GLU A OE1 
905  O OE2 . GLU A 154 ? 0.6510 1.1671 0.5648 -0.0687 0.1714  -0.1273 481 GLU A OE2 
906  N N   . TRP A 155 ? 0.4727 0.8366 0.4718 -0.0757 0.0932  -0.0523 482 TRP A N   
907  C CA  . TRP A 155 ? 0.4476 0.7689 0.4546 -0.0599 0.0850  -0.0640 482 TRP A CA  
908  C C   . TRP A 155 ? 0.4436 0.7606 0.4844 -0.0469 0.0836  -0.0644 482 TRP A C   
909  O O   . TRP A 155 ? 0.4490 0.7515 0.5015 -0.0291 0.0868  -0.0810 482 TRP A O   
910  C CB  . TRP A 155 ? 0.4240 0.7073 0.4124 -0.0681 0.0679  -0.0531 482 TRP A CB  
911  C CG  . TRP A 155 ? 0.4026 0.6495 0.3940 -0.0549 0.0610  -0.0644 482 TRP A CG  
912  C CD1 . TRP A 155 ? 0.3991 0.6387 0.3929 -0.0420 0.0675  -0.0856 482 TRP A CD1 
913  C CD2 . TRP A 155 ? 0.3752 0.5890 0.3675 -0.0543 0.0463  -0.0547 482 TRP A CD2 
914  N NE1 . TRP A 155 ? 0.3766 0.5831 0.3738 -0.0364 0.0569  -0.0863 482 TRP A NE1 
915  C CE2 . TRP A 155 ? 0.3638 0.5578 0.3604 -0.0426 0.0453  -0.0681 482 TRP A CE2 
916  C CE3 . TRP A 155 ? 0.3718 0.5698 0.3609 -0.0620 0.0340  -0.0365 482 TRP A CE3 
917  C CZ2 . TRP A 155 ? 0.3540 0.5216 0.3527 -0.0390 0.0344  -0.0627 482 TRP A CZ2 
918  C CZ3 . TRP A 155 ? 0.3576 0.5252 0.3478 -0.0548 0.0236  -0.0348 482 TRP A CZ3 
919  C CH2 . TRP A 155 ? 0.3508 0.5079 0.3464 -0.0437 0.0250  -0.0471 482 TRP A CH2 
920  N N   . ILE A 156 ? 0.4363 0.7652 0.4923 -0.0568 0.0774  -0.0459 483 ILE A N   
921  C CA  . ILE A 156 ? 0.4255 0.7565 0.5129 -0.0456 0.0751  -0.0455 483 ILE A CA  
922  C C   . ILE A 156 ? 0.4182 0.7843 0.5306 -0.0277 0.0915  -0.0599 483 ILE A C   
923  O O   . ILE A 156 ? 0.4065 0.7629 0.5420 -0.0116 0.0891  -0.0652 483 ILE A O   
924  C CB  . ILE A 156 ? 0.4291 0.7674 0.5294 -0.0608 0.0633  -0.0241 483 ILE A CB  
925  C CG1 . ILE A 156 ? 0.4514 0.8147 0.5403 -0.0847 0.0630  -0.0066 483 ILE A CG1 
926  C CG2 . ILE A 156 ? 0.4213 0.7124 0.5154 -0.0608 0.0456  -0.0195 483 ILE A CG2 
927  C CD1 . ILE A 156 ? 0.4667 0.8930 0.5769 -0.0873 0.0787  -0.0038 483 ILE A CD1 
928  N N   . ASP A 157 ? 0.4254 0.8324 0.5331 -0.0294 0.1079  -0.0659 484 ASP A N   
929  C CA  . ASP A 157 ? 0.4292 0.8691 0.5581 -0.0076 0.1265  -0.0848 484 ASP A CA  
930  C C   . ASP A 157 ? 0.4306 0.8298 0.5530 0.0136  0.1279  -0.1100 484 ASP A C   
931  O O   . ASP A 157 ? 0.4213 0.8197 0.5709 0.0358  0.1321  -0.1212 484 ASP A O   
932  C CB  . ASP A 157 ? 0.4539 0.9485 0.5729 -0.0144 0.1457  -0.0879 484 ASP A CB  
933  C CG  . ASP A 157 ? 0.4620 1.0100 0.6009 -0.0324 0.1471  -0.0628 484 ASP A CG  
934  O OD1 . ASP A 157 ? 0.4424 0.9868 0.6062 -0.0369 0.1338  -0.0461 484 ASP A OD1 
935  O OD2 . ASP A 157 ? 0.4909 1.0875 0.6194 -0.0440 0.1614  -0.0590 484 ASP A OD2 
936  N N   . SER A 158 ? 0.4335 0.7986 0.5218 0.0056  0.1225  -0.1168 485 SER A N   
937  C CA  . SER A 158 ? 0.4467 0.7684 0.5260 0.0191  0.1195  -0.1373 485 SER A CA  
938  C C   . SER A 158 ? 0.4184 0.7030 0.5174 0.0257  0.1041  -0.1287 485 SER A C   
939  O O   . SER A 158 ? 0.4179 0.6796 0.5309 0.0432  0.1037  -0.1417 485 SER A O   
940  C CB  . SER A 158 ? 0.4586 0.7582 0.4987 0.0044  0.1139  -0.1410 485 SER A CB  
941  O OG  . SER A 158 ? 0.4966 0.8309 0.5129 -0.0060 0.1255  -0.1445 485 SER A OG  
942  N N   . ILE A 159 ? 0.3914 0.6696 0.4896 0.0113  0.0911  -0.1068 486 ILE A N   
943  C CA  . ILE A 159 ? 0.3879 0.6374 0.4997 0.0144  0.0769  -0.0967 486 ILE A CA  
944  C C   . ILE A 159 ? 0.3846 0.6497 0.5322 0.0297  0.0786  -0.0949 486 ILE A C   
945  O O   . ILE A 159 ? 0.3892 0.6287 0.5493 0.0427  0.0731  -0.0990 486 ILE A O   
946  C CB  . ILE A 159 ? 0.3692 0.6091 0.4685 -0.0031 0.0639  -0.0769 486 ILE A CB  
947  C CG1 . ILE A 159 ? 0.3725 0.5888 0.4420 -0.0121 0.0592  -0.0785 486 ILE A CG1 
948  C CG2 . ILE A 159 ? 0.3591 0.5804 0.4727 0.0003  0.0517  -0.0670 486 ILE A CG2 
949  C CD1 . ILE A 159 ? 0.3625 0.5709 0.4172 -0.0272 0.0487  -0.0616 486 ILE A CD1 
950  N N   . VAL A 160 ? 0.3812 0.6900 0.5462 0.0270  0.0849  -0.0865 487 VAL A N   
951  C CA  . VAL A 160 ? 0.3853 0.7212 0.5892 0.0413  0.0865  -0.0821 487 VAL A CA  
952  C C   . VAL A 160 ? 0.4116 0.7462 0.6328 0.0683  0.0982  -0.1033 487 VAL A C   
953  O O   . VAL A 160 ? 0.4131 0.7358 0.6605 0.0845  0.0918  -0.1016 487 VAL A O   
954  C CB  . VAL A 160 ? 0.3830 0.7737 0.6030 0.0293  0.0911  -0.0672 487 VAL A CB  
955  C CG1 . VAL A 160 ? 0.3878 0.8205 0.6522 0.0480  0.0977  -0.0661 487 VAL A CG1 
956  C CG2 . VAL A 160 ? 0.3683 0.7477 0.5785 0.0059  0.0734  -0.0454 487 VAL A CG2 
957  N N   . GLU A 161 ? 0.4360 0.7791 0.6403 0.0729  0.1138  -0.1234 488 GLU A N   
958  C CA  . GLU A 161 ? 0.4800 0.8102 0.6921 0.0985  0.1243  -0.1491 488 GLU A CA  
959  C C   . GLU A 161 ? 0.4843 0.7525 0.6904 0.1044  0.1102  -0.1545 488 GLU A C   
960  O O   . GLU A 161 ? 0.5098 0.7615 0.7405 0.1263  0.1089  -0.1618 488 GLU A O   
961  C CB  . GLU A 161 ? 0.5276 0.8719 0.7114 0.0982  0.1418  -0.1719 488 GLU A CB  
962  C CG  . GLU A 161 ? 0.5956 0.9339 0.7898 0.1280  0.1557  -0.2022 488 GLU A CG  
963  C CD  . GLU A 161 ? 0.6387 0.9649 0.7922 0.1261  0.1669  -0.2302 488 GLU A CD  
964  O OE1 . GLU A 161 ? 0.6505 0.9355 0.7712 0.1092  0.1550  -0.2315 488 GLU A OE1 
965  O OE2 . GLU A 161 ? 0.6679 1.0284 0.8224 0.1422  0.1877  -0.2516 488 GLU A OE2 
966  N N   . PHE A 162 ? 0.4671 0.7033 0.6423 0.0849  0.0995  -0.1493 489 PHE A N   
967  C CA  . PHE A 162 ? 0.4708 0.6544 0.6392 0.0851  0.0856  -0.1503 489 PHE A CA  
968  C C   . PHE A 162 ? 0.4553 0.6298 0.6510 0.0900  0.0723  -0.1306 489 PHE A C   
969  O O   . PHE A 162 ? 0.4701 0.6131 0.6796 0.1029  0.0655  -0.1337 489 PHE A O   
970  C CB  . PHE A 162 ? 0.4521 0.6162 0.5863 0.0628  0.0777  -0.1454 489 PHE A CB  
971  C CG  . PHE A 162 ? 0.4628 0.5819 0.5920 0.0599  0.0640  -0.1431 489 PHE A CG  
972  C CD1 . PHE A 162 ? 0.4956 0.5815 0.6180 0.0664  0.0635  -0.1623 489 PHE A CD1 
973  C CD2 . PHE A 162 ? 0.4403 0.5508 0.5705 0.0494  0.0513  -0.1218 489 PHE A CD2 
974  C CE1 . PHE A 162 ? 0.5117 0.5589 0.6314 0.0600  0.0497  -0.1567 489 PHE A CE1 
975  C CE2 . PHE A 162 ? 0.4470 0.5240 0.5739 0.0452  0.0400  -0.1172 489 PHE A CE2 
976  C CZ  . PHE A 162 ? 0.4826 0.5289 0.6056 0.0491  0.0386  -0.1329 489 PHE A CZ  
977  N N   . SER A 163 ? 0.4213 0.6219 0.6228 0.0786  0.0674  -0.1102 490 SER A N   
978  C CA  . SER A 163 ? 0.4166 0.6178 0.6416 0.0812  0.0547  -0.0908 490 SER A CA  
979  C C   . SER A 163 ? 0.4421 0.6542 0.7054 0.1056  0.0571  -0.0935 490 SER A C   
980  O O   . SER A 163 ? 0.4538 0.6441 0.7324 0.1127  0.0446  -0.0831 490 SER A O   
981  C CB  . SER A 163 ? 0.3857 0.6165 0.6095 0.0646  0.0500  -0.0725 490 SER A CB  
982  O OG  . SER A 163 ? 0.3693 0.6008 0.6112 0.0652  0.0364  -0.0549 490 SER A OG  
983  N N   . SER A 164 ? 0.4621 0.7093 0.7407 0.1192  0.0732  -0.1066 491 SER A N   
984  C CA  . SER A 164 ? 0.4922 0.7521 0.8098 0.1482  0.0785  -0.1135 491 SER A CA  
985  C C   . SER A 164 ? 0.5354 0.7403 0.8529 0.1658  0.0744  -0.1289 491 SER A C   
986  O O   . SER A 164 ? 0.5510 0.7420 0.8984 0.1826  0.0643  -0.1201 491 SER A O   
987  C CB  . SER A 164 ? 0.5077 0.8195 0.8377 0.1603  0.1003  -0.1285 491 SER A CB  
988  O OG  . SER A 164 ? 0.4938 0.8636 0.8557 0.1591  0.1011  -0.1097 491 SER A OG  
989  N N   . ASN A 165 ? 0.5600 0.7336 0.8440 0.1603  0.0802  -0.1502 492 ASN A N   
990  C CA  . ASN A 165 ? 0.5955 0.7109 0.8726 0.1715  0.0751  -0.1674 492 ASN A CA  
991  C C   . ASN A 165 ? 0.5750 0.6477 0.8504 0.1596  0.0535  -0.1466 492 ASN A C   
992  O O   . ASN A 165 ? 0.5985 0.6363 0.8935 0.1743  0.0434  -0.1444 492 ASN A O   
993  C CB  . ASN A 165 ? 0.6355 0.7320 0.8722 0.1613  0.0838  -0.1927 492 ASN A CB  
994  C CG  . ASN A 165 ? 0.6912 0.8185 0.9263 0.1784  0.1061  -0.2204 492 ASN A CG  
995  O OD1 . ASN A 165 ? 0.7257 0.8576 0.9258 0.1660  0.1150  -0.2364 492 ASN A OD1 
996  N ND2 . ASN A 165 ? 0.7094 0.8610 0.9819 0.2074  0.1153  -0.2259 492 ASN A ND2 
997  N N   . LEU A 166 ? 0.5239 0.6009 0.7757 0.1334  0.0467  -0.1307 493 LEU A N   
998  C CA  . LEU A 166 ? 0.5076 0.5567 0.7546 0.1194  0.0289  -0.1094 493 LEU A CA  
999  C C   . LEU A 166 ? 0.5056 0.5596 0.7852 0.1302  0.0174  -0.0878 493 LEU A C   
1000 O O   . LEU A 166 ? 0.5230 0.5404 0.8100 0.1325  0.0039  -0.0779 493 LEU A O   
1001 C CB  . LEU A 166 ? 0.4596 0.5256 0.6806 0.0948  0.0270  -0.0969 493 LEU A CB  
1002 C CG  . LEU A 166 ? 0.4499 0.4915 0.6584 0.0789  0.0126  -0.0790 493 LEU A CG  
1003 C CD1 . LEU A 166 ? 0.4612 0.4641 0.6526 0.0716  0.0092  -0.0894 493 LEU A CD1 
1004 C CD2 . LEU A 166 ? 0.4050 0.4706 0.5947 0.0618  0.0123  -0.0674 493 LEU A CD2 
1005 N N   . GLN A 167 ? 0.4895 0.5898 0.7883 0.1350  0.0215  -0.0788 494 GLN A N   
1006 C CA  . GLN A 167 ? 0.4968 0.6112 0.8271 0.1433  0.0092  -0.0560 494 GLN A CA  
1007 C C   . GLN A 167 ? 0.5399 0.6445 0.9083 0.1735  0.0081  -0.0607 494 GLN A C   
1008 O O   . GLN A 167 ? 0.5603 0.6541 0.9500 0.1795  -0.0077 -0.0400 494 GLN A O   
1009 C CB  . GLN A 167 ? 0.4537 0.6208 0.7909 0.1339  0.0103  -0.0426 494 GLN A CB  
1010 C CG  . GLN A 167 ? 0.4234 0.5861 0.7281 0.1065  0.0016  -0.0292 494 GLN A CG  
1011 C CD  . GLN A 167 ? 0.3986 0.6033 0.7045 0.0936  0.0000  -0.0172 494 GLN A CD  
1012 O OE1 . GLN A 167 ? 0.3891 0.5930 0.6651 0.0742  0.0001  -0.0169 494 GLN A OE1 
1013 N NE2 . GLN A 167 ? 0.3948 0.6354 0.7359 0.1039  -0.0034 -0.0066 494 GLN A NE2 
1014 N N   . ASN A 168 ? 0.5692 0.6756 0.9442 0.1929  0.0245  -0.0877 495 ASN A N   
1015 C CA  . ASN A 168 ? 0.6249 0.7149 1.0349 0.2263  0.0251  -0.0978 495 ASN A CA  
1016 C C   . ASN A 168 ? 0.6731 0.6912 1.0768 0.2287  0.0095  -0.0976 495 ASN A C   
1017 O O   . ASN A 168 ? 0.7201 0.7151 1.1558 0.2537  0.0015  -0.0949 495 ASN A O   
1018 C CB  . ASN A 168 ? 0.6493 0.7598 1.0631 0.2474  0.0488  -0.1310 495 ASN A CB  
1019 C CG  . ASN A 168 ? 0.6250 0.8130 1.0640 0.2539  0.0629  -0.1265 495 ASN A CG  
1020 O OD1 . ASN A 168 ? 0.6419 0.8589 1.0865 0.2708  0.0838  -0.1503 495 ASN A OD1 
1021 N ND2 . ASN A 168 ? 0.5908 0.8144 1.0435 0.2391  0.0516  -0.0963 495 ASN A ND2 
1022 N N   . MET A 169 ? 0.6782 0.6628 1.0429 0.2022  0.0044  -0.0983 496 MET A N   
1023 C CA  . MET A 169 ? 0.7187 0.6392 1.0738 0.1948  -0.0127 -0.0919 496 MET A CA  
1024 C C   . MET A 169 ? 0.7001 0.6151 1.0659 0.1832  -0.0338 -0.0542 496 MET A C   
1025 O O   . MET A 169 ? 0.7297 0.5950 1.0957 0.1794  -0.0497 -0.0435 496 MET A O   
1026 C CB  . MET A 169 ? 0.7396 0.6362 1.0517 0.1687  -0.0104 -0.1044 496 MET A CB  
1027 C CG  . MET A 169 ? 0.7810 0.6660 1.0750 0.1765  0.0052  -0.1419 496 MET A CG  
1028 S SD  . MET A 169 ? 0.8047 0.6694 1.0507 0.1420  0.0032  -0.1492 496 MET A SD  
1029 C CE  . MET A 169 ? 0.8469 0.6359 1.0935 0.1353  -0.0189 -0.1428 496 MET A CE  
1030 N N   . ASN A 170 ? 0.6551 0.6205 1.0270 0.1754  -0.0347 -0.0339 497 ASN A N   
1031 C CA  . ASN A 170 ? 0.6361 0.6067 1.0146 0.1639  -0.0537 0.0012  497 ASN A CA  
1032 C C   . ASN A 170 ? 0.6263 0.5601 0.9760 0.1384  -0.0658 0.0155  497 ASN A C   
1033 O O   . ASN A 170 ? 0.6498 0.5545 1.0097 0.1373  -0.0834 0.0375  497 ASN A O   
1034 C CB  . ASN A 170 ? 0.6816 0.6495 1.1044 0.1895  -0.0662 0.0170  497 ASN A CB  
1035 C CG  . ASN A 170 ? 0.6789 0.7052 1.1338 0.2085  -0.0573 0.0150  497 ASN A CG  
1036 O OD1 . ASN A 170 ? 0.7250 0.7524 1.2178 0.2396  -0.0551 0.0077  497 ASN A OD1 
1037 N ND2 . ASN A 170 ? 0.6368 0.7120 1.0786 0.1902  -0.0529 0.0222  497 ASN A ND2 
1038 N N   . ILE A 171 ? 0.5950 0.5340 0.9104 0.1179  -0.0564 0.0043  498 ILE A N   
1039 C CA  . ILE A 171 ? 0.5789 0.4955 0.8665 0.0925  -0.0637 0.0153  498 ILE A CA  
1040 C C   . ILE A 171 ? 0.5496 0.4943 0.8283 0.0766  -0.0725 0.0438  498 ILE A C   
1041 O O   . ILE A 171 ? 0.5081 0.4922 0.7793 0.0735  -0.0660 0.0435  498 ILE A O   
1042 C CB  . ILE A 171 ? 0.5578 0.4786 0.8161 0.0798  -0.0498 -0.0070 498 ILE A CB  
1043 C CG1 . ILE A 171 ? 0.5799 0.4761 0.8429 0.0954  -0.0408 -0.0374 498 ILE A CG1 
1044 C CG2 . ILE A 171 ? 0.5547 0.4623 0.7885 0.0541  -0.0562 0.0050  498 ILE A CG2 
1045 C CD1 . ILE A 171 ? 0.5665 0.4857 0.8074 0.0903  -0.0242 -0.0605 498 ILE A CD1 
1046 N N   . ASP A 172 ? 0.5730 0.4961 0.8507 0.0657  -0.0880 0.0685  499 ASP A N   
1047 C CA  . ASP A 172 ? 0.5617 0.5109 0.8263 0.0496  -0.0967 0.0958  499 ASP A CA  
1048 C C   . ASP A 172 ? 0.5279 0.4978 0.7575 0.0291  -0.0865 0.0906  499 ASP A C   
1049 O O   . ASP A 172 ? 0.5181 0.4782 0.7363 0.0255  -0.0761 0.0709  499 ASP A O   
1050 C CB  . ASP A 172 ? 0.6080 0.5297 0.8803 0.0422  -0.1159 0.1257  499 ASP A CB  
1051 C CG  . ASP A 172 ? 0.6474 0.5266 0.9124 0.0306  -0.1187 0.1228  499 ASP A CG  
1052 O OD1 . ASP A 172 ? 0.6938 0.5289 0.9800 0.0431  -0.1268 0.1191  499 ASP A OD1 
1053 O OD2 . ASP A 172 ? 0.6346 0.5248 0.8735 0.0096  -0.1128 0.1232  499 ASP A OD2 
1054 N N   . ILE A 173 ? 0.5115 0.5103 0.7239 0.0171  -0.0900 0.1077  500 ILE A N   
1055 C CA  . ILE A 173 ? 0.4943 0.5149 0.6744 0.0017  -0.0802 0.1027  500 ILE A CA  
1056 C C   . ILE A 173 ? 0.4993 0.5049 0.6676 -0.0130 -0.0786 0.1060  500 ILE A C   
1057 O O   . ILE A 173 ? 0.4730 0.4870 0.6265 -0.0176 -0.0669 0.0901  500 ILE A O   
1058 C CB  . ILE A 173 ? 0.4822 0.5338 0.6436 -0.0067 -0.0848 0.1182  500 ILE A CB  
1059 C CG1 . ILE A 173 ? 0.4662 0.5371 0.6348 0.0038  -0.0833 0.1078  500 ILE A CG1 
1060 C CG2 . ILE A 173 ? 0.4691 0.5389 0.5974 -0.0205 -0.0750 0.1143  500 ILE A CG2 
1061 C CD1 . ILE A 173 ? 0.4762 0.5719 0.6321 -0.0033 -0.0936 0.1242  500 ILE A CD1 
1062 N N   . SER A 174 ? 0.5320 0.5160 0.7092 -0.0209 -0.0918 0.1281  501 SER A N   
1063 C CA  . SER A 174 ? 0.5484 0.5196 0.7177 -0.0392 -0.0933 0.1364  501 SER A CA  
1064 C C   . SER A 174 ? 0.5468 0.4924 0.7212 -0.0368 -0.0873 0.1122  501 SER A C   
1065 O O   . SER A 174 ? 0.5357 0.4931 0.6963 -0.0496 -0.0800 0.1064  501 SER A O   
1066 C CB  . SER A 174 ? 0.5904 0.5379 0.7707 -0.0493 -0.1117 0.1674  501 SER A CB  
1067 O OG  . SER A 174 ? 0.5955 0.5743 0.7620 -0.0588 -0.1165 0.1926  501 SER A OG  
1068 N N   . ALA A 175 ? 0.5536 0.4673 0.7480 -0.0195 -0.0903 0.0979  502 ALA A N   
1069 C CA  . ALA A 175 ? 0.5520 0.4384 0.7486 -0.0151 -0.0851 0.0714  502 ALA A CA  
1070 C C   . ALA A 175 ? 0.5057 0.4213 0.6875 -0.0112 -0.0681 0.0471  502 ALA A C   
1071 O O   . ALA A 175 ? 0.5006 0.4116 0.6712 -0.0205 -0.0634 0.0336  502 ALA A O   
1072 C CB  . ALA A 175 ? 0.5801 0.4278 0.8005 0.0061  -0.0910 0.0604  502 ALA A CB  
1073 N N   . PHE A 176 ? 0.4702 0.4157 0.6518 0.0003  -0.0608 0.0436  503 PHE A N   
1074 C CA  . PHE A 176 ? 0.4292 0.4012 0.5967 0.0027  -0.0466 0.0247  503 PHE A CA  
1075 C C   . PHE A 176 ? 0.4199 0.4130 0.5658 -0.0134 -0.0424 0.0299  503 PHE A C   
1076 O O   . PHE A 176 ? 0.4178 0.4176 0.5532 -0.0158 -0.0343 0.0148  503 PHE A O   
1077 C CB  . PHE A 176 ? 0.4045 0.4028 0.5759 0.0141  -0.0427 0.0240  503 PHE A CB  
1078 C CG  . PHE A 176 ? 0.3724 0.3931 0.5288 0.0144  -0.0304 0.0075  503 PHE A CG  
1079 C CD1 . PHE A 176 ? 0.3678 0.3870 0.5295 0.0240  -0.0218 -0.0131 503 PHE A CD1 
1080 C CD2 . PHE A 176 ? 0.3442 0.3863 0.4798 0.0051  -0.0276 0.0126  503 PHE A CD2 
1081 C CE1 . PHE A 176 ? 0.3472 0.3857 0.4942 0.0217  -0.0123 -0.0245 503 PHE A CE1 
1082 C CE2 . PHE A 176 ? 0.3283 0.3843 0.4509 0.0055  -0.0185 -0.0009 503 PHE A CE2 
1083 C CZ  . PHE A 176 ? 0.3261 0.3803 0.4546 0.0125  -0.0118 -0.0176 503 PHE A CZ  
1084 N N   . SER A 177 ? 0.4234 0.4305 0.5629 -0.0233 -0.0475 0.0518  504 SER A N   
1085 C CA  . SER A 177 ? 0.4135 0.4460 0.5353 -0.0361 -0.0423 0.0581  504 SER A CA  
1086 C C   . SER A 177 ? 0.4286 0.4516 0.5516 -0.0491 -0.0432 0.0566  504 SER A C   
1087 O O   . SER A 177 ? 0.4156 0.4614 0.5285 -0.0542 -0.0358 0.0519  504 SER A O   
1088 C CB  . SER A 177 ? 0.4175 0.4677 0.5317 -0.0444 -0.0474 0.0823  504 SER A CB  
1089 O OG  . SER A 177 ? 0.4063 0.4665 0.5168 -0.0345 -0.0481 0.0821  504 SER A OG  
1090 N N   . CYS A 178 ? 0.4660 0.4540 0.6023 -0.0537 -0.0537 0.0603  505 CYS A N   
1091 C CA  . CYS A 178 ? 0.4910 0.4620 0.6285 -0.0683 -0.0581 0.0569  505 CYS A CA  
1092 C C   . CYS A 178 ? 0.4808 0.4452 0.6134 -0.0613 -0.0510 0.0286  505 CYS A C   
1093 O O   . CYS A 178 ? 0.4761 0.4567 0.6011 -0.0724 -0.0483 0.0249  505 CYS A O   
1094 C CB  . CYS A 178 ? 0.5397 0.4662 0.6906 -0.0757 -0.0739 0.0682  505 CYS A CB  
1095 S SG  . CYS A 178 ? 0.5805 0.5165 0.7344 -0.0935 -0.0852 0.1085  505 CYS A SG  
1096 N N   . ILE A 179 ? 0.4790 0.4254 0.6165 -0.0432 -0.0478 0.0105  506 ILE A N   
1097 C CA  . ILE A 179 ? 0.4723 0.4148 0.6026 -0.0362 -0.0402 -0.0161 506 ILE A CA  
1098 C C   . ILE A 179 ? 0.4315 0.4130 0.5482 -0.0364 -0.0297 -0.0196 506 ILE A C   
1099 O O   . ILE A 179 ? 0.4280 0.4154 0.5347 -0.0424 -0.0270 -0.0312 506 ILE A O   
1100 C CB  . ILE A 179 ? 0.4903 0.4164 0.6302 -0.0150 -0.0361 -0.0330 506 ILE A CB  
1101 C CG1 . ILE A 179 ? 0.5384 0.4218 0.6949 -0.0097 -0.0473 -0.0300 506 ILE A CG1 
1102 C CG2 . ILE A 179 ? 0.4886 0.4168 0.6171 -0.0096 -0.0265 -0.0598 506 ILE A CG2 
1103 C CD1 . ILE A 179 ? 0.5957 0.4374 0.7478 -0.0148 -0.0530 -0.0480 506 ILE A CD1 
1104 N N   . ALA A 180 ? 0.4014 0.4072 0.5169 -0.0304 -0.0254 -0.0092 507 ALA A N   
1105 C CA  . ALA A 180 ? 0.3775 0.4135 0.4802 -0.0290 -0.0171 -0.0118 507 ALA A CA  
1106 C C   . ALA A 180 ? 0.3774 0.4308 0.4748 -0.0420 -0.0178 -0.0043 507 ALA A C   
1107 O O   . ALA A 180 ? 0.3663 0.4325 0.4565 -0.0423 -0.0137 -0.0130 507 ALA A O   
1108 C CB  . ALA A 180 ? 0.3619 0.4148 0.4615 -0.0218 -0.0146 -0.0032 507 ALA A CB  
1109 N N   . ALA A 181 ? 0.3852 0.4413 0.4880 -0.0534 -0.0236 0.0137  508 ALA A N   
1110 C CA  . ALA A 181 ? 0.3956 0.4762 0.4981 -0.0672 -0.0240 0.0240  508 ALA A CA  
1111 C C   . ALA A 181 ? 0.4100 0.4785 0.5142 -0.0782 -0.0294 0.0143  508 ALA A C   
1112 O O   . ALA A 181 ? 0.4059 0.5004 0.5078 -0.0824 -0.0270 0.0134  508 ALA A O   
1113 C CB  . ALA A 181 ? 0.4008 0.4904 0.5087 -0.0801 -0.0290 0.0479  508 ALA A CB  
1114 N N   . LEU A 182 ? 0.4411 0.4701 0.5486 -0.0817 -0.0373 0.0059  509 LEU A N   
1115 C CA  . LEU A 182 ? 0.4652 0.4757 0.5691 -0.0933 -0.0441 -0.0072 509 LEU A CA  
1116 C C   . LEU A 182 ? 0.4519 0.4705 0.5434 -0.0851 -0.0375 -0.0280 509 LEU A C   
1117 O O   . LEU A 182 ? 0.4656 0.4869 0.5507 -0.0975 -0.0426 -0.0343 509 LEU A O   
1118 C CB  . LEU A 182 ? 0.5023 0.4617 0.6103 -0.0959 -0.0540 -0.0145 509 LEU A CB  
1119 C CG  . LEU A 182 ? 0.5304 0.4728 0.6497 -0.1121 -0.0664 0.0080  509 LEU A CG  
1120 C CD1 . LEU A 182 ? 0.5767 0.4605 0.7005 -0.1081 -0.0764 -0.0019 509 LEU A CD1 
1121 C CD2 . LEU A 182 ? 0.5329 0.4934 0.6533 -0.1389 -0.0746 0.0216  509 LEU A CD2 
1122 N N   . ALA A 183 ? 0.4362 0.4605 0.5236 -0.0667 -0.0276 -0.0364 510 ALA A N   
1123 C CA  . ALA A 183 ? 0.4326 0.4704 0.5076 -0.0605 -0.0211 -0.0505 510 ALA A CA  
1124 C C   . ALA A 183 ? 0.4165 0.4897 0.4891 -0.0659 -0.0207 -0.0405 510 ALA A C   
1125 O O   . ALA A 183 ? 0.4101 0.4925 0.4733 -0.0695 -0.0217 -0.0481 510 ALA A O   
1126 C CB  . ALA A 183 ? 0.4070 0.4472 0.4806 -0.0429 -0.0118 -0.0565 510 ALA A CB  
1127 N N   . MET A 184 ? 0.4059 0.5006 0.4869 -0.0653 -0.0192 -0.0233 511 MET A N   
1128 C CA  . MET A 184 ? 0.3964 0.5278 0.4797 -0.0666 -0.0177 -0.0136 511 MET A CA  
1129 C C   . MET A 184 ? 0.3864 0.5368 0.4805 -0.0849 -0.0252 -0.0005 511 MET A C   
1130 O O   . MET A 184 ? 0.3632 0.5398 0.4601 -0.0895 -0.0278 0.0022  511 MET A O   
1131 C CB  . MET A 184 ? 0.3985 0.5489 0.4822 -0.0524 -0.0093 -0.0056 511 MET A CB  
1132 C CG  . MET A 184 ? 0.4200 0.6039 0.5056 -0.0467 -0.0065 -0.0011 511 MET A CG  
1133 S SD  . MET A 184 ? 0.4495 0.6538 0.5324 -0.0281 0.0034  0.0035  511 MET A SD  
1134 C CE  . MET A 184 ? 0.4585 0.6728 0.5475 -0.0377 0.0048  0.0177  511 MET A CE  
1135 N N   . VAL A 185 ? 0.3994 0.5393 0.5014 -0.0961 -0.0297 0.0099  512 VAL A N   
1136 C CA  . VAL A 185 ? 0.4298 0.5902 0.5438 -0.1172 -0.0376 0.0261  512 VAL A CA  
1137 C C   . VAL A 185 ? 0.4682 0.5961 0.5785 -0.1356 -0.0510 0.0164  512 VAL A C   
1138 O O   . VAL A 185 ? 0.5104 0.5996 0.6209 -0.1450 -0.0588 0.0157  512 VAL A O   
1139 C CB  . VAL A 185 ? 0.4231 0.5934 0.5462 -0.1234 -0.0365 0.0466  512 VAL A CB  
1140 C CG1 . VAL A 185 ? 0.4306 0.6313 0.5683 -0.1480 -0.0440 0.0667  512 VAL A CG1 
1141 C CG2 . VAL A 185 ? 0.3900 0.5884 0.5096 -0.1033 -0.0226 0.0502  512 VAL A CG2 
1142 N N   . THR A 186 ? 0.4786 0.6206 0.5839 -0.1398 -0.0544 0.0083  513 THR A N   
1143 C CA  . THR A 186 ? 0.5297 0.6438 0.6249 -0.1573 -0.0673 -0.0051 513 THR A CA  
1144 C C   . THR A 186 ? 0.5334 0.6894 0.6322 -0.1688 -0.0734 0.0014  513 THR A C   
1145 O O   . THR A 186 ? 0.5056 0.7016 0.6111 -0.1546 -0.0652 0.0090  513 THR A O   
1146 C CB  . THR A 186 ? 0.5358 0.6102 0.6108 -0.1429 -0.0629 -0.0320 513 THR A CB  
1147 O OG1 . THR A 186 ? 0.5800 0.6225 0.6411 -0.1594 -0.0748 -0.0484 513 THR A OG1 
1148 C CG2 . THR A 186 ? 0.4948 0.5934 0.5608 -0.1252 -0.0527 -0.0386 513 THR A CG2 
1149 N N   . GLU A 187 ? 0.5966 0.7431 0.6918 -0.1942 -0.0892 -0.0009 514 GLU A N   
1150 C CA  . GLU A 187 ? 0.6112 0.8004 0.7110 -0.2076 -0.0982 0.0065  514 GLU A CA  
1151 C C   . GLU A 187 ? 0.6067 0.8019 0.6884 -0.1938 -0.0949 -0.0081 514 GLU A C   
1152 O O   . GLU A 187 ? 0.6259 0.7822 0.6837 -0.1876 -0.0926 -0.0307 514 GLU A O   
1153 C CB  . GLU A 187 ? 0.6830 0.8597 0.7819 -0.2425 -0.1187 0.0085  514 GLU A CB  
1154 C CG  . GLU A 187 ? 0.7046 0.9226 0.8326 -0.2627 -0.1249 0.0383  514 GLU A CG  
1155 C CD  . GLU A 187 ? 0.7761 0.9588 0.9027 -0.2979 -0.1446 0.0409  514 GLU A CD  
1156 O OE1 . GLU A 187 ? 0.7945 1.0018 0.9271 -0.3263 -0.1615 0.0498  514 GLU A OE1 
1157 O OE2 . GLU A 187 ? 0.8082 0.9369 0.9282 -0.2976 -0.1448 0.0350  514 GLU A OE2 
1158 N N   . ARG A 188 ? 0.5803 0.8274 0.6754 -0.1876 -0.0940 0.0065  515 ARG A N   
1159 C CA  . ARG A 188 ? 0.5667 0.8264 0.6486 -0.1754 -0.0929 0.0001  515 ARG A CA  
1160 C C   . ARG A 188 ? 0.5821 0.8897 0.6772 -0.1911 -0.1073 0.0158  515 ARG A C   
1161 O O   . ARG A 188 ? 0.5878 0.9337 0.7107 -0.1995 -0.1106 0.0357  515 ARG A O   
1162 C CB  . ARG A 188 ? 0.5258 0.7997 0.6150 -0.1447 -0.0770 0.0053  515 ARG A CB  
1163 C CG  . ARG A 188 ? 0.5106 0.7483 0.5929 -0.1282 -0.0629 -0.0049 515 ARG A CG  
1164 C CD  . ARG A 188 ? 0.5203 0.7213 0.5761 -0.1223 -0.0594 -0.0259 515 ARG A CD  
1165 N NE  . ARG A 188 ? 0.5062 0.6804 0.5601 -0.1063 -0.0470 -0.0331 515 ARG A NE  
1166 C CZ  . ARG A 188 ? 0.5202 0.6630 0.5572 -0.1006 -0.0417 -0.0509 515 ARG A CZ  
1167 N NH1 . ARG A 188 ? 0.5328 0.6652 0.5493 -0.1092 -0.0461 -0.0657 515 ARG A NH1 
1168 N NH2 . ARG A 188 ? 0.4912 0.6167 0.5318 -0.0863 -0.0318 -0.0536 515 ARG A NH2 
1169 N N   . HIS A 189 ? 0.6032 0.9133 0.6790 -0.1960 -0.1163 0.0085  516 HIS A N   
1170 C CA  . HIS A 189 ? 0.5994 0.9585 0.6876 -0.2091 -0.1318 0.0251  516 HIS A CA  
1171 C C   . HIS A 189 ? 0.5474 0.9558 0.6665 -0.1841 -0.1236 0.0465  516 HIS A C   
1172 O O   . HIS A 189 ? 0.5274 0.9246 0.6414 -0.1573 -0.1106 0.0428  516 HIS A O   
1173 C CB  . HIS A 189 ? 0.6456 0.9955 0.7016 -0.2179 -0.1426 0.0130  516 HIS A CB  
1174 C CG  . HIS A 189 ? 0.6875 1.0815 0.7515 -0.2407 -0.1642 0.0280  516 HIS A CG  
1175 N ND1 . HIS A 189 ? 0.6768 1.1221 0.7602 -0.2290 -0.1694 0.0496  516 HIS A ND1 
1176 C CD2 . HIS A 189 ? 0.7249 1.1200 0.7823 -0.2749 -0.1837 0.0260  516 HIS A CD2 
1177 C CE1 . HIS A 189 ? 0.7002 1.1813 0.7899 -0.2550 -0.1910 0.0613  516 HIS A CE1 
1178 N NE2 . HIS A 189 ? 0.7389 1.1902 0.8117 -0.2847 -0.2004 0.0469  516 HIS A NE2 
1179 N N   . GLY A 190 ? 0.5276 0.9903 0.6792 -0.1929 -0.1316 0.0683  517 GLY A N   
1180 C CA  . GLY A 190 ? 0.4860 1.0004 0.6707 -0.1668 -0.1233 0.0877  517 GLY A CA  
1181 C C   . GLY A 190 ? 0.4572 0.9876 0.6659 -0.1533 -0.1064 0.0953  517 GLY A C   
1182 O O   . GLY A 190 ? 0.4447 1.0117 0.6765 -0.1264 -0.0959 0.1060  517 GLY A O   
1183 N N   . LEU A 191 ? 0.4419 0.9439 0.6436 -0.1709 -0.1039 0.0895  518 LEU A N   
1184 C CA  . LEU A 191 ? 0.4203 0.9440 0.6433 -0.1647 -0.0902 0.1006  518 LEU A CA  
1185 C C   . LEU A 191 ? 0.4242 1.0208 0.6852 -0.1793 -0.0961 0.1262  518 LEU A C   
1186 O O   . LEU A 191 ? 0.4445 1.0551 0.7112 -0.2117 -0.1149 0.1343  518 LEU A O   
1187 C CB  . LEU A 191 ? 0.4179 0.8889 0.6232 -0.1789 -0.0874 0.0905  518 LEU A CB  
1188 C CG  . LEU A 191 ? 0.3983 0.8086 0.5754 -0.1599 -0.0761 0.0691  518 LEU A CG  
1189 C CD1 . LEU A 191 ? 0.4142 0.7749 0.5777 -0.1802 -0.0809 0.0613  518 LEU A CD1 
1190 C CD2 . LEU A 191 ? 0.3671 0.7884 0.5497 -0.1285 -0.0567 0.0706  518 LEU A CD2 
1191 N N   . LYS A 192 ? 0.4075 1.0520 0.6939 -0.1554 -0.0798 0.1382  519 LYS A N   
1192 C CA  . LYS A 192 ? 0.4059 1.1301 0.7327 -0.1645 -0.0800 0.1637  519 LYS A CA  
1193 C C   . LYS A 192 ? 0.4166 1.1412 0.7472 -0.1955 -0.0806 0.1745  519 LYS A C   
1194 O O   . LYS A 192 ? 0.4290 1.2060 0.7867 -0.2225 -0.0906 0.1962  519 LYS A O   
1195 C CB  . LYS A 192 ? 0.3893 1.1628 0.7388 -0.1247 -0.0594 0.1692  519 LYS A CB  
1196 C CG  . LYS A 192 ? 0.3846 1.1570 0.7342 -0.0929 -0.0605 0.1621  519 LYS A CG  
1197 C CD  . LYS A 192 ? 0.3787 1.1661 0.7361 -0.0495 -0.0381 0.1570  519 LYS A CD  
1198 C CE  . LYS A 192 ? 0.3875 1.2209 0.7733 -0.0206 -0.0406 0.1657  519 LYS A CE  
1199 N NZ  . LYS A 192 ? 0.4037 1.3276 0.8362 -0.0318 -0.0457 0.1914  519 LYS A NZ  
1200 N N   . GLU A 193 ? 0.4211 1.0884 0.7260 -0.1931 -0.0716 0.1618  520 GLU A N   
1201 C CA  . GLU A 193 ? 0.4453 1.1057 0.7519 -0.2217 -0.0733 0.1742  520 GLU A CA  
1202 C C   . GLU A 193 ? 0.4530 1.0249 0.7261 -0.2380 -0.0830 0.1569  520 GLU A C   
1203 O O   . GLU A 193 ? 0.4444 0.9832 0.7044 -0.2312 -0.0731 0.1534  520 GLU A O   
1204 C CB  . GLU A 193 ? 0.4496 1.1526 0.7693 -0.2041 -0.0508 0.1864  520 GLU A CB  
1205 C CG  . GLU A 193 ? 0.4525 1.2434 0.8060 -0.1817 -0.0387 0.1995  520 GLU A CG  
1206 C CD  . GLU A 193 ? 0.4658 1.3266 0.8432 -0.1854 -0.0233 0.2222  520 GLU A CD  
1207 O OE1 . GLU A 193 ? 0.4823 1.3183 0.8411 -0.1850 -0.0123 0.2208  520 GLU A OE1 
1208 O OE2 . GLU A 193 ? 0.4573 1.4016 0.8724 -0.1878 -0.0222 0.2419  520 GLU A OE2 
1209 N N   . PRO A 194 ? 0.4714 1.0073 0.7309 -0.2597 -0.1032 0.1463  521 PRO A N   
1210 C CA  . PRO A 194 ? 0.4910 0.9418 0.7178 -0.2684 -0.1110 0.1245  521 PRO A CA  
1211 C C   . PRO A 194 ? 0.5149 0.9332 0.7412 -0.2933 -0.1170 0.1342  521 PRO A C   
1212 O O   . PRO A 194 ? 0.5285 0.8840 0.7338 -0.2850 -0.1138 0.1192  521 PRO A O   
1213 C CB  . PRO A 194 ? 0.5188 0.9536 0.7332 -0.2887 -0.1316 0.1132  521 PRO A CB  
1214 C CG  . PRO A 194 ? 0.5154 1.0262 0.7614 -0.3066 -0.1413 0.1379  521 PRO A CG  
1215 C CD  . PRO A 194 ? 0.4794 1.0553 0.7532 -0.2778 -0.1204 0.1543  521 PRO A CD  
1216 N N   . LYS A 195 ? 0.5274 0.9894 0.7783 -0.3238 -0.1264 0.1610  522 LYS A N   
1217 C CA  . LYS A 195 ? 0.5541 0.9915 0.8077 -0.3508 -0.1335 0.1772  522 LYS A CA  
1218 C C   . LYS A 195 ? 0.5280 0.9636 0.7793 -0.3276 -0.1134 0.1827  522 LYS A C   
1219 O O   . LYS A 195 ? 0.5472 0.9271 0.7859 -0.3359 -0.1181 0.1824  522 LYS A O   
1220 C CB  . LYS A 195 ? 0.5674 1.0655 0.8513 -0.3894 -0.1463 0.2098  522 LYS A CB  
1221 C CG  . LYS A 195 ? 0.6173 1.0858 0.8956 -0.4281 -0.1751 0.2059  522 LYS A CG  
1222 C CD  . LYS A 195 ? 0.6226 1.1731 0.9359 -0.4613 -0.1871 0.2371  522 LYS A CD  
1223 C CE  . LYS A 195 ? 0.6565 1.1866 0.9609 -0.4924 -0.2151 0.2272  522 LYS A CE  
1224 N NZ  . LYS A 195 ? 0.6703 1.2787 1.0104 -0.5310 -0.2309 0.2599  522 LYS A NZ  
1225 N N   . ARG A 196 ? 0.4926 0.9866 0.7548 -0.2982 -0.0923 0.1866  523 ARG A N   
1226 C CA  . ARG A 196 ? 0.4870 0.9816 0.7419 -0.2743 -0.0728 0.1883  523 ARG A CA  
1227 C C   . ARG A 196 ? 0.4736 0.8920 0.6992 -0.2522 -0.0701 0.1611  523 ARG A C   
1228 O O   . ARG A 196 ? 0.4798 0.8645 0.6951 -0.2516 -0.0678 0.1643  523 ARG A O   
1229 C CB  . ARG A 196 ? 0.4706 1.0378 0.7398 -0.2449 -0.0516 0.1920  523 ARG A CB  
1230 C CG  . ARG A 196 ? 0.4893 1.0937 0.7618 -0.2390 -0.0346 0.2089  523 ARG A CG  
1231 C CD  . ARG A 196 ? 0.4915 1.1889 0.7903 -0.2253 -0.0190 0.2215  523 ARG A CD  
1232 N NE  . ARG A 196 ? 0.5113 1.2655 0.8197 -0.2331 -0.0054 0.2457  523 ARG A NE  
1233 C CZ  . ARG A 196 ? 0.5088 1.2658 0.7994 -0.2109 0.0131  0.2411  523 ARG A CZ  
1234 N NH1 . ARG A 196 ? 0.4919 1.1953 0.7561 -0.1806 0.0189  0.2136  523 ARG A NH1 
1235 N NH2 . ARG A 196 ? 0.5242 1.3404 0.8221 -0.2211 0.0254  0.2648  523 ARG A NH2 
1236 N N   . VAL A 197 ? 0.4564 0.8522 0.6702 -0.2357 -0.0715 0.1370  524 VAL A N   
1237 C CA  . VAL A 197 ? 0.4539 0.7844 0.6422 -0.2162 -0.0693 0.1107  524 VAL A CA  
1238 C C   . VAL A 197 ? 0.4947 0.7583 0.6718 -0.2376 -0.0851 0.1050  524 VAL A C   
1239 O O   . VAL A 197 ? 0.4959 0.7151 0.6616 -0.2265 -0.0818 0.0976  524 VAL A O   
1240 C CB  . VAL A 197 ? 0.4321 0.7606 0.6106 -0.1983 -0.0680 0.0897  524 VAL A CB  
1241 C CG1 . VAL A 197 ? 0.4273 0.6959 0.5813 -0.1801 -0.0644 0.0646  524 VAL A CG1 
1242 C CG2 . VAL A 197 ? 0.3954 0.7820 0.5861 -0.1740 -0.0537 0.0954  524 VAL A CG2 
1243 N N   . GLU A 198 ? 0.5374 0.7944 0.7189 -0.2678 -0.1034 0.1088  525 GLU A N   
1244 C CA  . GLU A 198 ? 0.5912 0.7814 0.7627 -0.2907 -0.1212 0.1036  525 GLU A CA  
1245 C C   . GLU A 198 ? 0.6066 0.7831 0.7860 -0.3003 -0.1221 0.1257  525 GLU A C   
1246 O O   . GLU A 198 ? 0.6346 0.7472 0.8025 -0.2954 -0.1268 0.1157  525 GLU A O   
1247 C CB  . GLU A 198 ? 0.6296 0.8213 0.8049 -0.3269 -0.1428 0.1075  525 GLU A CB  
1248 C CG  . GLU A 198 ? 0.6941 0.8021 0.8497 -0.3435 -0.1613 0.0885  525 GLU A CG  
1249 C CD  . GLU A 198 ? 0.7588 0.8605 0.9196 -0.3878 -0.1865 0.0999  525 GLU A CD  
1250 O OE1 . GLU A 198 ? 0.7565 0.9104 0.9263 -0.4039 -0.1930 0.1072  525 GLU A OE1 
1251 O OE2 . GLU A 198 ? 0.8149 0.8560 0.9710 -0.4075 -0.2018 0.1022  525 GLU A OE2 
1252 N N   . GLU A 199 ? 0.5901 0.8293 0.7896 -0.3128 -0.1174 0.1561  526 GLU A N   
1253 C CA  . GLU A 199 ? 0.6106 0.8480 0.8168 -0.3254 -0.1182 0.1824  526 GLU A CA  
1254 C C   . GLU A 199 ? 0.5864 0.8019 0.7796 -0.2935 -0.1034 0.1740  526 GLU A C   
1255 O O   . GLU A 199 ? 0.6079 0.7717 0.7954 -0.2978 -0.1117 0.1790  526 GLU A O   
1256 C CB  . GLU A 199 ? 0.6168 0.9383 0.8462 -0.3440 -0.1127 0.2163  526 GLU A CB  
1257 C CG  . GLU A 199 ? 0.6818 1.0177 0.9278 -0.3878 -0.1336 0.2354  526 GLU A CG  
1258 C CD  . GLU A 199 ? 0.6777 1.1153 0.9519 -0.4015 -0.1256 0.2640  526 GLU A CD  
1259 O OE1 . GLU A 199 ? 0.7159 1.1739 1.0074 -0.4423 -0.1428 0.2878  526 GLU A OE1 
1260 O OE2 . GLU A 199 ? 0.6470 1.1454 0.9272 -0.3718 -0.1026 0.2627  526 GLU A OE2 
1261 N N   . LEU A 200 ? 0.5337 0.7852 0.7227 -0.2622 -0.0840 0.1612  527 LEU A N   
1262 C CA  . LEU A 200 ? 0.5148 0.7501 0.6906 -0.2333 -0.0709 0.1524  527 LEU A CA  
1263 C C   . LEU A 200 ? 0.5255 0.6862 0.6872 -0.2209 -0.0778 0.1283  527 LEU A C   
1264 O O   . LEU A 200 ? 0.5302 0.6609 0.6868 -0.2125 -0.0778 0.1316  527 LEU A O   
1265 C CB  . LEU A 200 ? 0.4766 0.7616 0.6495 -0.2043 -0.0505 0.1431  527 LEU A CB  
1266 C CG  . LEU A 200 ? 0.4686 0.7366 0.6253 -0.1762 -0.0385 0.1318  527 LEU A CG  
1267 C CD1 . LEU A 200 ? 0.4857 0.7548 0.6395 -0.1837 -0.0382 0.1534  527 LEU A CD1 
1268 C CD2 . LEU A 200 ? 0.4384 0.7466 0.5908 -0.1496 -0.0215 0.1202  527 LEU A CD2 
1269 N N   . GLN A 201 ? 0.5226 0.6582 0.6786 -0.2199 -0.0836 0.1053  528 GLN A N   
1270 C CA  . GLN A 201 ? 0.5411 0.6121 0.6840 -0.2077 -0.0884 0.0798  528 GLN A CA  
1271 C C   . GLN A 201 ? 0.5908 0.6045 0.7362 -0.2229 -0.1043 0.0876  528 GLN A C   
1272 O O   . GLN A 201 ? 0.6034 0.5802 0.7459 -0.2060 -0.1030 0.0816  528 GLN A O   
1273 C CB  . GLN A 201 ? 0.5508 0.6129 0.6844 -0.2097 -0.0926 0.0562  528 GLN A CB  
1274 C CG  . GLN A 201 ? 0.5812 0.5800 0.6997 -0.2004 -0.0974 0.0276  528 GLN A CG  
1275 C CD  . GLN A 201 ? 0.6022 0.5926 0.7081 -0.2121 -0.1056 0.0082  528 GLN A CD  
1276 O OE1 . GLN A 201 ? 0.6456 0.6317 0.7540 -0.2407 -0.1213 0.0155  528 GLN A OE1 
1277 N NE2 . GLN A 201 ? 0.5905 0.5809 0.6817 -0.1926 -0.0961 -0.0151 528 GLN A NE2 
1278 N N   . ASN A 202 ? 0.6263 0.6335 0.7789 -0.2553 -0.1206 0.1029  529 ASN A N   
1279 C CA  . ASN A 202 ? 0.6799 0.6263 0.8352 -0.2729 -0.1391 0.1126  529 ASN A CA  
1280 C C   . ASN A 202 ? 0.6773 0.6265 0.8407 -0.2708 -0.1378 0.1408  529 ASN A C   
1281 O O   . ASN A 202 ? 0.7110 0.6014 0.8748 -0.2676 -0.1486 0.1420  529 ASN A O   
1282 C CB  . ASN A 202 ? 0.7253 0.6648 0.8858 -0.3128 -0.1591 0.1244  529 ASN A CB  
1283 C CG  . ASN A 202 ? 0.7402 0.6666 0.8880 -0.3165 -0.1644 0.0946  529 ASN A CG  
1284 O OD1 . ASN A 202 ? 0.7316 0.6388 0.8646 -0.2898 -0.1550 0.0631  529 ASN A OD1 
1285 N ND2 . ASN A 202 ? 0.7657 0.7062 0.9186 -0.3517 -0.1800 0.1059  529 ASN A ND2 
1286 N N   . LYS A 203 ? 0.6329 0.6507 0.8017 -0.2711 -0.1246 0.1624  530 LYS A N   
1287 C CA  . LYS A 203 ? 0.6335 0.6651 0.8042 -0.2678 -0.1206 0.1875  530 LYS A CA  
1288 C C   . LYS A 203 ? 0.6223 0.6239 0.7846 -0.2341 -0.1132 0.1696  530 LYS A C   
1289 O O   . LYS A 203 ? 0.6435 0.6161 0.8079 -0.2330 -0.1211 0.1848  530 LYS A O   
1290 C CB  . LYS A 203 ? 0.5967 0.7121 0.7698 -0.2690 -0.1038 0.2054  530 LYS A CB  
1291 C CG  . LYS A 203 ? 0.6138 0.7734 0.7998 -0.3045 -0.1098 0.2390  530 LYS A CG  
1292 C CD  . LYS A 203 ? 0.5721 0.8167 0.7620 -0.2956 -0.0892 0.2403  530 LYS A CD  
1293 C CE  . LYS A 203 ? 0.5770 0.8856 0.7728 -0.3126 -0.0820 0.2759  530 LYS A CE  
1294 N NZ  . LYS A 203 ? 0.5846 0.9441 0.8006 -0.3437 -0.0867 0.2965  530 LYS A NZ  
1295 N N   . ILE A 204 ? 0.5910 0.6023 0.7455 -0.2084 -0.0995 0.1401  531 ILE A N   
1296 C CA  . ILE A 204 ? 0.5782 0.5658 0.7267 -0.1779 -0.0924 0.1210  531 ILE A CA  
1297 C C   . ILE A 204 ? 0.6257 0.5418 0.7773 -0.1727 -0.1055 0.1055  531 ILE A C   
1298 O O   . ILE A 204 ? 0.6347 0.5234 0.7905 -0.1567 -0.1080 0.1067  531 ILE A O   
1299 C CB  . ILE A 204 ? 0.5348 0.5539 0.6741 -0.1560 -0.0752 0.0965  531 ILE A CB  
1300 C CG1 . ILE A 204 ? 0.4993 0.5842 0.6364 -0.1573 -0.0624 0.1099  531 ILE A CG1 
1301 C CG2 . ILE A 204 ? 0.5154 0.5153 0.6503 -0.1281 -0.0685 0.0798  531 ILE A CG2 
1302 C CD1 . ILE A 204 ? 0.4601 0.5737 0.5911 -0.1420 -0.0499 0.0896  531 ILE A CD1 
1303 N N   . VAL A 205 ? 0.6602 0.5476 0.8099 -0.1856 -0.1144 0.0905  532 VAL A N   
1304 C CA  . VAL A 205 ? 0.7181 0.5336 0.8682 -0.1813 -0.1273 0.0722  532 VAL A CA  
1305 C C   . VAL A 205 ? 0.7732 0.5478 0.9352 -0.1904 -0.1438 0.0981  532 VAL A C   
1306 O O   . VAL A 205 ? 0.7905 0.5255 0.9586 -0.1689 -0.1467 0.0912  532 VAL A O   
1307 C CB  . VAL A 205 ? 0.7472 0.5390 0.8884 -0.1998 -0.1366 0.0532  532 VAL A CB  
1308 C CG1 . VAL A 205 ? 0.8082 0.5194 0.9474 -0.1978 -0.1518 0.0350  532 VAL A CG1 
1309 C CG2 . VAL A 205 ? 0.7065 0.5301 0.8345 -0.1861 -0.1216 0.0258  532 VAL A CG2 
1310 N N   . ASN A 206 ? 0.8026 0.5920 0.9696 -0.2220 -0.1547 0.1301  533 ASN A N   
1311 C CA  . ASN A 206 ? 0.8595 0.6140 1.0367 -0.2365 -0.1725 0.1617  533 ASN A CA  
1312 C C   . ASN A 206 ? 0.8489 0.6223 1.0308 -0.2178 -0.1666 0.1806  533 ASN A C   
1313 O O   . ASN A 206 ? 0.8891 0.6155 1.0803 -0.2147 -0.1815 0.1950  533 ASN A O   
1314 C CB  . ASN A 206 ? 0.8804 0.6559 1.0615 -0.2788 -0.1846 0.1943  533 ASN A CB  
1315 C CG  . ASN A 206 ? 0.9210 0.6642 1.0988 -0.3021 -0.1979 0.1788  533 ASN A CG  
1316 O OD1 . ASN A 206 ? 0.9474 0.6370 1.1178 -0.2882 -0.2017 0.1442  533 ASN A OD1 
1317 N ND2 . ASN A 206 ? 0.9280 0.7073 1.1106 -0.3389 -0.2050 0.2045  533 ASN A ND2 
1318 N N   . CYS A 207 ? 0.7989 0.6379 0.9737 -0.2058 -0.1469 0.1805  534 CYS A N   
1319 C CA  . CYS A 207 ? 0.7946 0.6542 0.9689 -0.1853 -0.1397 0.1901  534 CYS A CA  
1320 C C   . CYS A 207 ? 0.7893 0.6027 0.9713 -0.1549 -0.1420 0.1687  534 CYS A C   
1321 O O   . CYS A 207 ? 0.7958 0.5895 0.9870 -0.1465 -0.1516 0.1858  534 CYS A O   
1322 C CB  . CYS A 207 ? 0.7663 0.6924 0.9282 -0.1732 -0.1174 0.1796  534 CYS A CB  
1323 S SG  . CYS A 207 ? 0.8261 0.8246 0.9787 -0.1935 -0.1093 0.2128  534 CYS A SG  
1324 N N   . LEU A 208 ? 0.7711 0.5744 0.9498 -0.1383 -0.1325 0.1323  535 LEU A N   
1325 C CA  . LEU A 208 ? 0.7702 0.5389 0.9565 -0.1085 -0.1304 0.1067  535 LEU A CA  
1326 C C   . LEU A 208 ? 0.8418 0.5389 1.0417 -0.1084 -0.1502 0.1095  535 LEU A C   
1327 O O   . LEU A 208 ? 0.8576 0.5311 1.0725 -0.0868 -0.1553 0.1122  535 LEU A O   
1328 C CB  . LEU A 208 ? 0.7313 0.5095 0.9069 -0.0975 -0.1159 0.0696  535 LEU A CB  
1329 C CG  . LEU A 208 ? 0.7266 0.4855 0.9063 -0.0671 -0.1075 0.0378  535 LEU A CG  
1330 C CD1 . LEU A 208 ? 0.6974 0.4836 0.8870 -0.0448 -0.1000 0.0441  535 LEU A CD1 
1331 C CD2 . LEU A 208 ? 0.6912 0.4707 0.8546 -0.0660 -0.0939 0.0091  535 LEU A CD2 
1332 N N   . LYS A 209 ? 0.8975 0.5604 1.0932 -0.1332 -0.1628 0.1102  536 LYS A N   
1333 C CA  . LYS A 209 ? 0.9827 0.5677 1.1885 -0.1382 -0.1851 0.1137  536 LYS A CA  
1334 C C   . LYS A 209 ? 1.0117 0.5814 1.2332 -0.1402 -0.2006 0.1524  536 LYS A C   
1335 O O   . LYS A 209 ? 1.0470 0.5687 1.2843 -0.1170 -0.2098 0.1489  536 LYS A O   
1336 C CB  . LYS A 209 ? 1.0243 0.5833 1.2207 -0.1738 -0.1987 0.1156  536 LYS A CB  
1337 C CG  . LYS A 209 ? 1.0311 0.5826 1.2118 -0.1711 -0.1904 0.0743  536 LYS A CG  
1338 C CD  . LYS A 209 ? 1.0953 0.5993 1.2682 -0.2042 -0.2105 0.0726  536 LYS A CD  
1339 C CE  . LYS A 209 ? 1.0946 0.5999 1.2477 -0.2036 -0.2025 0.0325  536 LYS A CE  
1340 N NZ  . LYS A 209 ? 1.1713 0.6214 1.3139 -0.2351 -0.2245 0.0254  536 LYS A NZ  
1341 N N   . ASP A 210 ? 1.0064 0.6213 1.2235 -0.1666 -0.2025 0.1894  537 ASP A N   
1342 C CA  . ASP A 210 ? 1.0455 0.6579 1.2723 -0.1742 -0.2169 0.2317  537 ASP A CA  
1343 C C   . ASP A 210 ? 1.0248 0.6527 1.2612 -0.1403 -0.2105 0.2303  537 ASP A C   
1344 O O   . ASP A 210 ? 1.0654 0.6550 1.3183 -0.1309 -0.2275 0.2497  537 ASP A O   
1345 C CB  . ASP A 210 ? 1.0337 0.7083 1.2490 -0.2076 -0.2141 0.2675  537 ASP A CB  
1346 C CG  . ASP A 210 ? 1.0725 0.7403 1.2834 -0.2452 -0.2226 0.2760  537 ASP A CG  
1347 O OD1 . ASP A 210 ? 1.1340 0.7322 1.3507 -0.2540 -0.2404 0.2674  537 ASP A OD1 
1348 O OD2 . ASP A 210 ? 1.0411 0.7758 1.2427 -0.2661 -0.2115 0.2910  537 ASP A OD2 
1349 N N   . HIS A 211 ? 0.9636 0.6462 1.1909 -0.1229 -0.1879 0.2087  538 HIS A N   
1350 C CA  . HIS A 211 ? 0.9435 0.6460 1.1799 -0.0931 -0.1816 0.2051  538 HIS A CA  
1351 C C   . HIS A 211 ? 0.9762 0.6266 1.2346 -0.0607 -0.1863 0.1813  538 HIS A C   
1352 O O   . HIS A 211 ? 0.9867 0.6314 1.2637 -0.0415 -0.1944 0.1947  538 HIS A O   
1353 C CB  . HIS A 211 ? 0.8731 0.6406 1.0938 -0.0846 -0.1580 0.1865  538 HIS A CB  
1354 C CG  . HIS A 211 ? 0.8468 0.6408 1.0744 -0.0621 -0.1545 0.1894  538 HIS A CG  
1355 N ND1 . HIS A 211 ? 0.8341 0.6206 1.0761 -0.0321 -0.1474 0.1626  538 HIS A ND1 
1356 C CD2 . HIS A 211 ? 0.8376 0.6668 1.0599 -0.0670 -0.1585 0.2172  538 HIS A CD2 
1357 C CE1 . HIS A 211 ? 0.8136 0.6306 1.0616 -0.0205 -0.1482 0.1749  538 HIS A CE1 
1358 N NE2 . HIS A 211 ? 0.8209 0.6619 1.0552 -0.0413 -0.1555 0.2071  538 HIS A NE2 
1359 N N   . VAL A 212 ? 0.9922 0.6085 1.2482 -0.0544 -0.1812 0.1464  539 VAL A N   
1360 C CA  . VAL A 212 ? 1.0385 0.6059 1.3127 -0.0222 -0.1827 0.1183  539 VAL A CA  
1361 C C   . VAL A 212 ? 1.1320 0.6326 1.4274 -0.0193 -0.2085 0.1410  539 VAL A C   
1362 O O   . VAL A 212 ? 1.1595 0.6445 1.4799 0.0112  -0.2131 0.1414  539 VAL A O   
1363 C CB  . VAL A 212 ? 1.0416 0.5897 1.3013 -0.0193 -0.1711 0.0747  539 VAL A CB  
1364 C CG1 . VAL A 212 ? 1.1108 0.5866 1.3838 0.0042  -0.1791 0.0485  539 VAL A CG1 
1365 C CG2 . VAL A 212 ? 0.9776 0.5859 1.2276 -0.0048 -0.1459 0.0499  539 VAL A CG2 
1366 N N   . THR A 213 ? 1.1837 0.6490 1.4709 -0.0521 -0.2262 0.1630  540 THR A N   
1367 C CA  . THR A 213 ? 1.2651 0.6649 1.5694 -0.0578 -0.2544 0.1926  540 THR A CA  
1368 C C   . THR A 213 ? 1.2684 0.6984 1.5869 -0.0551 -0.2642 0.2364  540 THR A C   
1369 O O   . THR A 213 ? 1.3198 0.7016 1.6618 -0.0406 -0.2843 0.2548  540 THR A O   
1370 C CB  . THR A 213 ? 1.3076 0.6718 1.5973 -0.1012 -0.2710 0.2096  540 THR A CB  
1371 O OG1 . THR A 213 ? 1.2870 0.6478 1.5579 -0.1087 -0.2590 0.1709  540 THR A OG1 
1372 C CG2 . THR A 213 ? 1.3911 0.6624 1.6974 -0.1034 -0.3015 0.2264  540 THR A CG2 
1373 N N   . PHE A 214 ? 1.2290 0.7378 1.5322 -0.0673 -0.2500 0.2507  541 PHE A N   
1374 C CA  . PHE A 214 ? 1.2324 0.7847 1.5394 -0.0691 -0.2560 0.2895  541 PHE A CA  
1375 C C   . PHE A 214 ? 1.2792 0.7994 1.5924 -0.0922 -0.2840 0.3396  541 PHE A C   
1376 O O   . PHE A 214 ? 1.2656 0.8328 1.5679 -0.1101 -0.2874 0.3757  541 PHE A O   
1377 C CB  . PHE A 214 ? 1.2306 0.8071 1.5573 -0.0301 -0.2489 0.2772  541 PHE A CB  
1378 C CG  . PHE A 214 ? 1.3118 0.8258 1.6726 0.0035  -0.2622 0.2677  541 PHE A CG  
1379 C CD1 . PHE A 214 ? 1.3883 0.8602 1.7709 0.0052  -0.2900 0.3058  541 PHE A CD1 
1380 C CD2 . PHE A 214 ? 1.3180 0.8174 1.6896 0.0353  -0.2466 0.2209  541 PHE A CD2 
1381 C CE1 . PHE A 214 ? 1.4532 0.8657 1.8703 0.0406  -0.3023 0.2957  541 PHE A CE1 
1382 C CE2 . PHE A 214 ? 1.3788 0.8238 1.7829 0.0703  -0.2564 0.2089  541 PHE A CE2 
1383 C CZ  . PHE A 214 ? 1.4480 0.8480 1.8762 0.0746  -0.2843 0.2456  541 PHE A CZ  
1384 N N   . PRO A 222 ? 1.4496 0.6552 1.7232 0.0385  -0.2156 -0.0418 549 PRO A N   
1385 C CA  . PRO A 222 ? 1.4427 0.6494 1.6816 0.0155  -0.2084 -0.0716 549 PRO A CA  
1386 C C   . PRO A 222 ? 1.4051 0.6479 1.6317 0.0435  -0.1804 -0.1180 549 PRO A C   
1387 O O   . PRO A 222 ? 1.3525 0.6366 1.5525 0.0245  -0.1681 -0.1316 549 PRO A O   
1388 C CB  . PRO A 222 ? 1.5491 0.6537 1.7800 0.0044  -0.2331 -0.0847 549 PRO A CB  
1389 C CG  . PRO A 222 ? 1.5869 0.6519 1.8443 -0.0014 -0.2584 -0.0396 549 PRO A CG  
1390 C CD  . PRO A 222 ? 1.5356 0.6564 1.8225 0.0302  -0.2463 -0.0197 549 PRO A CD  
1391 N N   . ASN A 223 ? 1.4274 0.6577 1.6748 0.0881  -0.1710 -0.1392 550 ASN A N   
1392 C CA  . ASN A 223 ? 1.4145 0.6749 1.6537 0.1187  -0.1443 -0.1838 550 ASN A CA  
1393 C C   . ASN A 223 ? 1.3190 0.6780 1.5552 0.1162  -0.1213 -0.1750 550 ASN A C   
1394 O O   . ASN A 223 ? 1.2844 0.6772 1.4930 0.1078  -0.1052 -0.1993 550 ASN A O   
1395 C CB  . ASN A 223 ? 1.4629 0.6924 1.7341 0.1685  -0.1411 -0.2007 550 ASN A CB  
1396 C CG  . ASN A 223 ? 1.4776 0.7182 1.7369 0.2003  -0.1160 -0.2536 550 ASN A CG  
1397 O OD1 . ASN A 223 ? 1.4003 0.7185 1.6579 0.2092  -0.0915 -0.2611 550 ASN A OD1 
1398 N ND2 . ASN A 223 ? 1.5546 0.7163 1.8050 0.2179  -0.1222 -0.2905 550 ASN A ND2 
1399 N N   . TYR A 224 ? 1.2758 0.6761 1.5394 0.1220  -0.1224 -0.1390 551 TYR A N   
1400 C CA  . TYR A 224 ? 1.1783 0.6647 1.4446 0.1216  -0.1048 -0.1254 551 TYR A CA  
1401 C C   . TYR A 224 ? 1.1293 0.6546 1.3648 0.0842  -0.1010 -0.1167 551 TYR A C   
1402 O O   . TYR A 224 ? 1.0831 0.6693 1.3094 0.0849  -0.0827 -0.1230 551 TYR A O   
1403 C CB  . TYR A 224 ? 1.1738 0.6778 1.4725 0.1292  -0.1154 -0.0849 551 TYR A CB  
1404 C CG  . TYR A 224 ? 1.1142 0.6988 1.4214 0.1329  -0.1016 -0.0686 551 TYR A CG  
1405 C CD1 . TYR A 224 ? 1.0942 0.7209 1.4161 0.1626  -0.0822 -0.0888 551 TYR A CD1 
1406 C CD2 . TYR A 224 ? 1.0777 0.6961 1.3788 0.1064  -0.1088 -0.0320 551 TYR A CD2 
1407 C CE1 . TYR A 224 ? 1.0397 0.7359 1.3691 0.1624  -0.0726 -0.0724 551 TYR A CE1 
1408 C CE2 . TYR A 224 ? 1.0285 0.7135 1.3341 0.1087  -0.0985 -0.0188 551 TYR A CE2 
1409 C CZ  . TYR A 224 ? 1.0082 0.7294 1.3281 0.1354  -0.0818 -0.0384 551 TYR A CZ  
1410 O OH  . TYR A 224 ? 0.9494 0.7323 1.2729 0.1340  -0.0743 -0.0243 551 TYR A OH  
1411 N N   . LEU A 225 ? 1.1376 0.6276 1.3591 0.0520  -0.1188 -0.1021 552 LEU A N   
1412 C CA  . LEU A 225 ? 1.0827 0.6081 1.2795 0.0166  -0.1175 -0.0917 552 LEU A CA  
1413 C C   . LEU A 225 ? 1.0641 0.6077 1.2334 0.0142  -0.1024 -0.1271 552 LEU A C   
1414 O O   . LEU A 225 ? 1.0178 0.6189 1.1745 0.0027  -0.0908 -0.1222 552 LEU A O   
1415 C CB  . LEU A 225 ? 1.1236 0.6045 1.3148 -0.0170 -0.1410 -0.0705 552 LEU A CB  
1416 C CG  . LEU A 225 ? 1.0852 0.6055 1.2697 -0.0535 -0.1471 -0.0349 552 LEU A CG  
1417 C CD1 . LEU A 225 ? 1.1458 0.6109 1.3248 -0.0851 -0.1706 -0.0237 552 LEU A CD1 
1418 C CD2 . LEU A 225 ? 1.0217 0.6065 1.1870 -0.0651 -0.1306 -0.0423 552 LEU A CD2 
1419 N N   . SER A 226 ? 1.1139 0.6064 1.2721 0.0249  -0.1037 -0.1624 553 SER A N   
1420 C CA  . SER A 226 ? 1.1049 0.6104 1.2329 0.0227  -0.0906 -0.1982 553 SER A CA  
1421 C C   . SER A 226 ? 1.0402 0.6098 1.1701 0.0460  -0.0653 -0.2097 553 SER A C   
1422 O O   . SER A 226 ? 0.9943 0.6091 1.1032 0.0329  -0.0548 -0.2144 553 SER A O   
1423 C CB  . SER A 226 ? 1.1908 0.6239 1.3040 0.0318  -0.0973 -0.2364 553 SER A CB  
1424 O OG  . SER A 226 ? 1.2250 0.6255 1.3633 0.0693  -0.0948 -0.2473 553 SER A OG  
1425 N N   . LYS A 227 ? 1.0245 0.5991 1.1819 0.0789  -0.0573 -0.2107 554 LYS A N   
1426 C CA  . LYS A 227 ? 0.9667 0.6049 1.1327 0.0998  -0.0350 -0.2158 554 LYS A CA  
1427 C C   . LYS A 227 ? 0.8859 0.5844 1.0550 0.0832  -0.0323 -0.1831 554 LYS A C   
1428 O O   . LYS A 227 ? 0.8395 0.5903 1.0008 0.0856  -0.0161 -0.1883 554 LYS A O   
1429 C CB  . LYS A 227 ? 0.9859 0.6176 1.1859 0.1382  -0.0295 -0.2217 554 LYS A CB  
1430 C CG  . LYS A 227 ? 1.0530 0.6540 1.2461 0.1649  -0.0187 -0.2659 554 LYS A CG  
1431 C CD  . LYS A 227 ? 1.0632 0.6792 1.2943 0.2068  -0.0079 -0.2717 554 LYS A CD  
1432 C CE  . LYS A 227 ? 1.1288 0.6717 1.3837 0.2287  -0.0243 -0.2750 554 LYS A CE  
1433 N NZ  . LYS A 227 ? 1.1940 0.6848 1.4310 0.2482  -0.0184 -0.3225 554 LYS A NZ  
1434 N N   . LEU A 228 ? 0.8684 0.5574 1.0471 0.0661  -0.0483 -0.1501 555 LEU A N   
1435 C CA  . LEU A 228 ? 0.8098 0.5474 0.9855 0.0476  -0.0476 -0.1216 555 LEU A CA  
1436 C C   . LEU A 228 ? 0.7866 0.5450 0.9332 0.0235  -0.0439 -0.1277 555 LEU A C   
1437 O O   . LEU A 228 ? 0.7342 0.5401 0.8723 0.0228  -0.0316 -0.1276 555 LEU A O   
1438 C CB  . LEU A 228 ? 0.8209 0.5429 1.0105 0.0344  -0.0651 -0.0865 555 LEU A CB  
1439 C CG  . LEU A 228 ? 0.8294 0.5538 1.0484 0.0536  -0.0699 -0.0665 555 LEU A CG  
1440 C CD1 . LEU A 228 ? 0.8539 0.5562 1.0799 0.0355  -0.0895 -0.0322 555 LEU A CD1 
1441 C CD2 . LEU A 228 ? 0.7767 0.5621 1.0009 0.0619  -0.0572 -0.0583 555 LEU A CD2 
1442 N N   . LEU A 229 ? 0.8289 0.5508 0.9613 0.0034  -0.0562 -0.1324 556 LEU A N   
1443 C CA  . LEU A 229 ? 0.8208 0.5626 0.9280 -0.0197 -0.0554 -0.1378 556 LEU A CA  
1444 C C   . LEU A 229 ? 0.8248 0.5817 0.9113 -0.0102 -0.0408 -0.1697 556 LEU A C   
1445 O O   . LEU A 229 ? 0.8046 0.5927 0.8722 -0.0249 -0.0373 -0.1710 556 LEU A O   
1446 C CB  . LEU A 229 ? 0.8623 0.5624 0.9610 -0.0460 -0.0743 -0.1345 556 LEU A CB  
1447 C CG  . LEU A 229 ? 0.8580 0.5546 0.9712 -0.0663 -0.0892 -0.0982 556 LEU A CG  
1448 C CD1 . LEU A 229 ? 0.9035 0.5570 1.0077 -0.0944 -0.1085 -0.0981 556 LEU A CD1 
1449 C CD2 . LEU A 229 ? 0.7950 0.5548 0.9090 -0.0766 -0.0821 -0.0738 556 LEU A CD2 
1450 N N   . GLY A 230 ? 0.8474 0.5853 0.9387 0.0152  -0.0323 -0.1938 557 GLY A N   
1451 C CA  . GLY A 230 ? 0.8503 0.6076 0.9229 0.0268  -0.0159 -0.2238 557 GLY A CA  
1452 C C   . GLY A 230 ? 0.7975 0.6172 0.8730 0.0333  0.0000  -0.2142 557 GLY A C   
1453 O O   . GLY A 230 ? 0.7980 0.6438 0.8539 0.0348  0.0125  -0.2320 557 GLY A O   
1454 N N   . LYS A 231 ? 0.7557 0.5982 0.8536 0.0353  -0.0016 -0.1858 558 LYS A N   
1455 C CA  . LYS A 231 ? 0.7032 0.5991 0.8027 0.0372  0.0096  -0.1739 558 LYS A CA  
1456 C C   . LYS A 231 ? 0.6714 0.5916 0.7490 0.0148  0.0078  -0.1650 558 LYS A C   
1457 O O   . LYS A 231 ? 0.6460 0.6034 0.7162 0.0147  0.0172  -0.1627 558 LYS A O   
1458 C CB  . LYS A 231 ? 0.6725 0.5823 0.7993 0.0456  0.0068  -0.1485 558 LYS A CB  
1459 C CG  . LYS A 231 ? 0.6857 0.5863 0.8395 0.0714  0.0101  -0.1544 558 LYS A CG  
1460 C CD  . LYS A 231 ? 0.6569 0.6037 0.8206 0.0864  0.0258  -0.1590 558 LYS A CD  
1461 C CE  . LYS A 231 ? 0.6904 0.6412 0.8467 0.1012  0.0408  -0.1904 558 LYS A CE  
1462 N NZ  . LYS A 231 ? 0.7308 0.6486 0.9066 0.1263  0.0411  -0.2077 558 LYS A NZ  
1463 N N   . LEU A 232 ? 0.6930 0.5925 0.7618 -0.0042 -0.0050 -0.1592 559 LEU A N   
1464 C CA  . LEU A 232 ? 0.6743 0.5988 0.7274 -0.0241 -0.0085 -0.1488 559 LEU A CA  
1465 C C   . LEU A 232 ? 0.6901 0.6277 0.7162 -0.0306 -0.0034 -0.1679 559 LEU A C   
1466 O O   . LEU A 232 ? 0.6698 0.6421 0.6877 -0.0361 0.0000  -0.1584 559 LEU A O   
1467 C CB  . LEU A 232 ? 0.6822 0.5902 0.7391 -0.0436 -0.0239 -0.1327 559 LEU A CB  
1468 C CG  . LEU A 232 ? 0.6680 0.5728 0.7472 -0.0420 -0.0293 -0.1078 559 LEU A CG  
1469 C CD1 . LEU A 232 ? 0.6956 0.5763 0.7784 -0.0623 -0.0449 -0.0955 559 LEU A CD1 
1470 C CD2 . LEU A 232 ? 0.6154 0.5624 0.6985 -0.0406 -0.0234 -0.0882 559 LEU A CD2 
1471 N N   . PRO A 233 ? 0.7322 0.6409 0.7425 -0.0300 -0.0039 -0.1948 560 PRO A N   
1472 C CA  . PRO A 233 ? 0.7483 0.6761 0.7296 -0.0347 0.0030  -0.2132 560 PRO A CA  
1473 C C   . PRO A 233 ? 0.7310 0.6931 0.7123 -0.0181 0.0211  -0.2181 560 PRO A C   
1474 O O   . PRO A 233 ? 0.7302 0.7230 0.6916 -0.0256 0.0261  -0.2184 560 PRO A O   
1475 C CB  . PRO A 233 ? 0.8064 0.6911 0.7693 -0.0362 -0.0013 -0.2437 560 PRO A CB  
1476 C CG  . PRO A 233 ? 0.8230 0.6669 0.8024 -0.0445 -0.0176 -0.2332 560 PRO A CG  
1477 C CD  . PRO A 233 ? 0.7799 0.6362 0.7920 -0.0307 -0.0140 -0.2085 560 PRO A CD  
1478 N N   . GLU A 234 ? 0.7173 0.6765 0.7221 0.0026  0.0294  -0.2189 561 GLU A N   
1479 C CA  . GLU A 234 ? 0.6904 0.6875 0.7020 0.0164  0.0453  -0.2184 561 GLU A CA  
1480 C C   . GLU A 234 ? 0.6362 0.6688 0.6510 0.0070  0.0446  -0.1915 561 GLU A C   
1481 O O   . GLU A 234 ? 0.6181 0.6844 0.6253 0.0073  0.0547  -0.1903 561 GLU A O   
1482 C CB  . GLU A 234 ? 0.7068 0.6952 0.7487 0.0398  0.0510  -0.2210 561 GLU A CB  
1483 C CG  . GLU A 234 ? 0.7739 0.7301 0.8134 0.0559  0.0555  -0.2517 561 GLU A CG  
1484 C CD  . GLU A 234 ? 0.7939 0.7542 0.8664 0.0838  0.0643  -0.2546 561 GLU A CD  
1485 O OE1 . GLU A 234 ? 0.8448 0.7719 0.9223 0.1018  0.0661  -0.2779 561 GLU A OE1 
1486 O OE2 . GLU A 234 ? 0.7746 0.7711 0.8689 0.0882  0.0684  -0.2339 561 GLU A OE2 
1487 N N   . LEU A 235 ? 0.5996 0.6240 0.6246 -0.0012 0.0327  -0.1704 562 LEU A N   
1488 C CA  . LEU A 235 ? 0.5571 0.6073 0.5818 -0.0092 0.0304  -0.1482 562 LEU A CA  
1489 C C   . LEU A 235 ? 0.5595 0.6251 0.5597 -0.0238 0.0278  -0.1476 562 LEU A C   
1490 O O   . LEU A 235 ? 0.5492 0.6387 0.5445 -0.0266 0.0300  -0.1358 562 LEU A O   
1491 C CB  . LEU A 235 ? 0.5311 0.5714 0.5710 -0.0125 0.0202  -0.1285 562 LEU A CB  
1492 C CG  . LEU A 235 ? 0.5113 0.5468 0.5747 -0.0008 0.0204  -0.1185 562 LEU A CG  
1493 C CD1 . LEU A 235 ? 0.5065 0.5292 0.5781 -0.0076 0.0098  -0.1023 562 LEU A CD1 
1494 C CD2 . LEU A 235 ? 0.4808 0.5427 0.5491 0.0042  0.0262  -0.1085 562 LEU A CD2 
1495 N N   . ARG A 236 ? 0.6042 0.6548 0.5889 -0.0343 0.0210  -0.1591 563 ARG A N   
1496 C CA  . ARG A 236 ? 0.6134 0.6806 0.5743 -0.0491 0.0164  -0.1582 563 ARG A CA  
1497 C C   . ARG A 236 ? 0.5988 0.6896 0.5412 -0.0471 0.0280  -0.1671 563 ARG A C   
1498 O O   . ARG A 236 ? 0.5900 0.7045 0.5222 -0.0546 0.0264  -0.1534 563 ARG A O   
1499 C CB  . ARG A 236 ? 0.6851 0.7318 0.6317 -0.0631 0.0054  -0.1705 563 ARG A CB  
1500 C CG  . ARG A 236 ? 0.7264 0.7926 0.6619 -0.0806 -0.0064 -0.1567 563 ARG A CG  
1501 C CD  . ARG A 236 ? 0.8153 0.8702 0.7253 -0.0974 -0.0157 -0.1741 563 ARG A CD  
1502 N NE  . ARG A 236 ? 0.8611 0.9425 0.7607 -0.1142 -0.0279 -0.1594 563 ARG A NE  
1503 C CZ  . ARG A 236 ? 0.8855 0.9923 0.7618 -0.1201 -0.0275 -0.1583 563 ARG A CZ  
1504 N NH1 . ARG A 236 ? 0.9041 1.0172 0.7625 -0.1125 -0.0138 -0.1711 563 ARG A NH1 
1505 N NH2 . ARG A 236 ? 0.8987 1.0286 0.7708 -0.1342 -0.0414 -0.1419 563 ARG A NH2 
1506 N N   . THR A 237 ? 0.5941 0.6800 0.5340 -0.0361 0.0399  -0.1884 564 THR A N   
1507 C CA  . THR A 237 ? 0.5955 0.7113 0.5209 -0.0331 0.0541  -0.1960 564 THR A CA  
1508 C C   . THR A 237 ? 0.5612 0.7038 0.5025 -0.0307 0.0582  -0.1728 564 THR A C   
1509 O O   . THR A 237 ? 0.5547 0.7245 0.4800 -0.0400 0.0609  -0.1637 564 THR A O   
1510 C CB  . THR A 237 ? 0.6281 0.7375 0.5551 -0.0164 0.0684  -0.2237 564 THR A CB  
1511 O OG1 . THR A 237 ? 0.6758 0.7519 0.5847 -0.0194 0.0627  -0.2478 564 THR A OG1 
1512 C CG2 . THR A 237 ? 0.6369 0.7868 0.5478 -0.0148 0.0853  -0.2312 564 THR A CG2 
1513 N N   . LEU A 238 ? 0.5218 0.6547 0.4923 -0.0203 0.0568  -0.1622 565 LEU A N   
1514 C CA  . LEU A 238 ? 0.4806 0.6329 0.4654 -0.0193 0.0583  -0.1419 565 LEU A CA  
1515 C C   . LEU A 238 ? 0.4576 0.6125 0.4334 -0.0316 0.0473  -0.1212 565 LEU A C   
1516 O O   . LEU A 238 ? 0.4464 0.6179 0.4210 -0.0362 0.0478  -0.1066 565 LEU A O   
1517 C CB  . LEU A 238 ? 0.4633 0.6046 0.4779 -0.0063 0.0577  -0.1368 565 LEU A CB  
1518 C CG  . LEU A 238 ? 0.4809 0.6319 0.5109 0.0091  0.0704  -0.1520 565 LEU A CG  
1519 C CD1 . LEU A 238 ? 0.4795 0.6059 0.5352 0.0222  0.0654  -0.1520 565 LEU A CD1 
1520 C CD2 . LEU A 238 ? 0.4643 0.6532 0.5034 0.0094  0.0796  -0.1428 565 LEU A CD2 
1521 N N   . CYS A 239 ? 0.4674 0.6060 0.4382 -0.0368 0.0367  -0.1195 566 CYS A N   
1522 C CA  . CYS A 239 ? 0.4748 0.6174 0.4397 -0.0449 0.0263  -0.1016 566 CYS A CA  
1523 C C   . CYS A 239 ? 0.4887 0.6505 0.4286 -0.0567 0.0254  -0.0988 566 CYS A C   
1524 O O   . CYS A 239 ? 0.4907 0.6619 0.4273 -0.0606 0.0216  -0.0814 566 CYS A O   
1525 C CB  . CYS A 239 ? 0.4941 0.6222 0.4649 -0.0470 0.0164  -0.1000 566 CYS A CB  
1526 S SG  . CYS A 239 ? 0.5596 0.6999 0.5226 -0.0560 0.0036  -0.0828 566 CYS A SG  
1527 N N   . THR A 240 ? 0.4983 0.6637 0.4191 -0.0627 0.0281  -0.1159 567 THR A N   
1528 C CA  . THR A 240 ? 0.5200 0.7075 0.4121 -0.0754 0.0285  -0.1151 567 THR A CA  
1529 C C   . THR A 240 ? 0.5079 0.7176 0.3983 -0.0760 0.0381  -0.1054 567 THR A C   
1530 O O   . THR A 240 ? 0.5073 0.7323 0.3839 -0.0870 0.0328  -0.0878 567 THR A O   
1531 C CB  . THR A 240 ? 0.5533 0.7395 0.4217 -0.0801 0.0330  -0.1415 567 THR A CB  
1532 O OG1 . THR A 240 ? 0.5651 0.7265 0.4386 -0.0817 0.0225  -0.1495 567 THR A OG1 
1533 C CG2 . THR A 240 ? 0.5898 0.7991 0.4242 -0.0964 0.0292  -0.1386 567 THR A CG2 
1534 N N   . GLN A 241 ? 0.5001 0.7122 0.4074 -0.0648 0.0507  -0.1143 568 GLN A N   
1535 C CA  . GLN A 241 ? 0.4896 0.7268 0.4014 -0.0664 0.0598  -0.1043 568 GLN A CA  
1536 C C   . GLN A 241 ? 0.4609 0.6922 0.3836 -0.0712 0.0491  -0.0774 568 GLN A C   
1537 O O   . GLN A 241 ? 0.4732 0.7229 0.3862 -0.0830 0.0488  -0.0615 568 GLN A O   
1538 C CB  . GLN A 241 ? 0.4960 0.7401 0.4287 -0.0516 0.0743  -0.1197 568 GLN A CB  
1539 C CG  . GLN A 241 ? 0.5369 0.7924 0.4546 -0.0459 0.0882  -0.1474 568 GLN A CG  
1540 C CD  . GLN A 241 ? 0.5439 0.7984 0.4873 -0.0255 0.1004  -0.1649 568 GLN A CD  
1541 O OE1 . GLN A 241 ? 0.5227 0.7544 0.4926 -0.0152 0.0943  -0.1606 568 GLN A OE1 
1542 N NE2 . GLN A 241 ? 0.5676 0.8481 0.5025 -0.0183 0.1178  -0.1849 568 GLN A NE2 
1543 N N   . GLY A 242 ? 0.4327 0.6377 0.3732 -0.0631 0.0402  -0.0724 569 GLY A N   
1544 C CA  . GLY A 242 ? 0.4165 0.6089 0.3626 -0.0656 0.0287  -0.0510 569 GLY A CA  
1545 C C   . GLY A 242 ? 0.4311 0.6235 0.3586 -0.0756 0.0174  -0.0363 569 GLY A C   
1546 O O   . GLY A 242 ? 0.4442 0.6370 0.3663 -0.0838 0.0112  -0.0178 569 GLY A O   
1547 N N   . LEU A 243 ? 0.4338 0.6255 0.3522 -0.0762 0.0131  -0.0431 570 LEU A N   
1548 C CA  . LEU A 243 ? 0.4573 0.6554 0.3584 -0.0859 0.0015  -0.0295 570 LEU A CA  
1549 C C   . LEU A 243 ? 0.4675 0.6894 0.3449 -0.1016 0.0041  -0.0209 570 LEU A C   
1550 O O   . LEU A 243 ? 0.4689 0.6912 0.3379 -0.1096 -0.0071 0.0011  570 LEU A O   
1551 C CB  . LEU A 243 ? 0.4691 0.6683 0.3648 -0.0868 -0.0030 -0.0408 570 LEU A CB  
1552 C CG  . LEU A 243 ? 0.4735 0.6663 0.3788 -0.0832 -0.0179 -0.0267 570 LEU A CG  
1553 C CD1 . LEU A 243 ? 0.4493 0.6233 0.3789 -0.0683 -0.0183 -0.0212 570 LEU A CD1 
1554 C CD2 . LEU A 243 ? 0.4833 0.6800 0.3870 -0.0869 -0.0218 -0.0389 570 LEU A CD2 
1555 N N   . GLN A 244 ? 0.4708 0.7126 0.3384 -0.1048 0.0191  -0.0377 571 GLN A N   
1556 C CA  . GLN A 244 ? 0.4908 0.7637 0.3363 -0.1196 0.0263  -0.0312 571 GLN A CA  
1557 C C   . GLN A 244 ? 0.4783 0.7532 0.3337 -0.1260 0.0241  -0.0076 571 GLN A C   
1558 O O   . GLN A 244 ? 0.4910 0.7805 0.3291 -0.1424 0.0186  0.0132  571 GLN A O   
1559 C CB  . GLN A 244 ? 0.5042 0.7988 0.3426 -0.1159 0.0461  -0.0583 571 GLN A CB  
1560 C CG  . GLN A 244 ? 0.5381 0.8738 0.3563 -0.1291 0.0586  -0.0542 571 GLN A CG  
1561 C CD  . GLN A 244 ? 0.5535 0.9127 0.3683 -0.1198 0.0809  -0.0841 571 GLN A CD  
1562 O OE1 . GLN A 244 ? 0.5393 0.8876 0.3802 -0.1022 0.0893  -0.1002 571 GLN A OE1 
1563 N NE2 . GLN A 244 ? 0.5922 0.9848 0.3743 -0.1308 0.0904  -0.0912 571 GLN A NE2 
1564 N N   . ARG A 245 ? 0.4511 0.7092 0.3330 -0.1150 0.0262  -0.0096 572 ARG A N   
1565 C CA  . ARG A 245 ? 0.4459 0.6993 0.3380 -0.1223 0.0214  0.0108  572 ARG A CA  
1566 C C   . ARG A 245 ? 0.4473 0.6708 0.3355 -0.1264 0.0012  0.0341  572 ARG A C   
1567 O O   . ARG A 245 ? 0.4706 0.6971 0.3496 -0.1424 -0.0059 0.0566  572 ARG A O   
1568 C CB  . ARG A 245 ? 0.4340 0.6791 0.3534 -0.1104 0.0276  0.0011  572 ARG A CB  
1569 C CG  . ARG A 245 ? 0.4404 0.6787 0.3700 -0.1202 0.0206  0.0204  572 ARG A CG  
1570 C CD  . ARG A 245 ? 0.4694 0.7460 0.3897 -0.1403 0.0272  0.0345  572 ARG A CD  
1571 N NE  . ARG A 245 ? 0.4902 0.7615 0.4202 -0.1545 0.0188  0.0548  572 ARG A NE  
1572 C CZ  . ARG A 245 ? 0.5204 0.8212 0.4438 -0.1771 0.0199  0.0749  572 ARG A CZ  
1573 N NH1 . ARG A 245 ? 0.5423 0.8828 0.4472 -0.1869 0.0308  0.0769  572 ARG A NH1 
1574 N NH2 . ARG A 245 ? 0.5345 0.8257 0.4679 -0.1920 0.0096  0.0936  572 ARG A NH2 
1575 N N   . ILE A 246 ? 0.4236 0.6196 0.3196 -0.1119 -0.0077 0.0293  573 ILE A N   
1576 C CA  . ILE A 246 ? 0.4297 0.5981 0.3247 -0.1097 -0.0260 0.0482  573 ILE A CA  
1577 C C   . ILE A 246 ? 0.4557 0.6386 0.3288 -0.1239 -0.0353 0.0664  573 ILE A C   
1578 O O   . ILE A 246 ? 0.4835 0.6508 0.3512 -0.1318 -0.0493 0.0907  573 ILE A O   
1579 C CB  . ILE A 246 ? 0.4135 0.5615 0.3231 -0.0897 -0.0303 0.0378  573 ILE A CB  
1580 C CG1 . ILE A 246 ? 0.3980 0.5281 0.3257 -0.0779 -0.0247 0.0261  573 ILE A CG1 
1581 C CG2 . ILE A 246 ? 0.4311 0.5575 0.3413 -0.0837 -0.0476 0.0559  573 ILE A CG2 
1582 C CD1 . ILE A 246 ? 0.3698 0.4943 0.3107 -0.0616 -0.0222 0.0116  573 ILE A CD1 
1583 N N   . PHE A 247 ? 0.4521 0.6625 0.3109 -0.1281 -0.0289 0.0550  574 PHE A N   
1584 C CA  . PHE A 247 ? 0.4783 0.7109 0.3109 -0.1448 -0.0361 0.0701  574 PHE A CA  
1585 C C   . PHE A 247 ? 0.5066 0.7523 0.3259 -0.1644 -0.0359 0.0915  574 PHE A C   
1586 O O   . PHE A 247 ? 0.5324 0.7695 0.3423 -0.1746 -0.0524 0.1194  574 PHE A O   
1587 C CB  . PHE A 247 ? 0.4740 0.7353 0.2885 -0.1488 -0.0256 0.0480  574 PHE A CB  
1588 C CG  . PHE A 247 ? 0.5089 0.7970 0.2910 -0.1679 -0.0328 0.0615  574 PHE A CG  
1589 C CD1 . PHE A 247 ? 0.5132 0.7986 0.2896 -0.1690 -0.0514 0.0738  574 PHE A CD1 
1590 C CD2 . PHE A 247 ? 0.5274 0.8488 0.2846 -0.1851 -0.0208 0.0626  574 PHE A CD2 
1591 C CE1 . PHE A 247 ? 0.5458 0.8577 0.2905 -0.1880 -0.0600 0.0879  574 PHE A CE1 
1592 C CE2 . PHE A 247 ? 0.5667 0.9157 0.2893 -0.2044 -0.0275 0.0756  574 PHE A CE2 
1593 C CZ  . PHE A 247 ? 0.5742 0.9168 0.2897 -0.2064 -0.0481 0.0884  574 PHE A CZ  
1594 N N   . TYR A 248 ? 0.5103 0.7777 0.3311 -0.1697 -0.0181 0.0804  575 TYR A N   
1595 C CA  . TYR A 248 ? 0.5467 0.8360 0.3572 -0.1912 -0.0156 0.1013  575 TYR A CA  
1596 C C   . TYR A 248 ? 0.5640 0.8157 0.3851 -0.1964 -0.0345 0.1293  575 TYR A C   
1597 O O   . TYR A 248 ? 0.5939 0.8439 0.3994 -0.2137 -0.0485 0.1583  575 TYR A O   
1598 C CB  . TYR A 248 ? 0.5427 0.8640 0.3629 -0.1914 0.0071  0.0838  575 TYR A CB  
1599 C CG  . TYR A 248 ? 0.5730 0.9281 0.3850 -0.2157 0.0118  0.1064  575 TYR A CG  
1600 C CD1 . TYR A 248 ? 0.6036 1.0081 0.3880 -0.2317 0.0233  0.1089  575 TYR A CD1 
1601 C CD2 . TYR A 248 ? 0.5805 0.9197 0.4106 -0.2247 0.0040  0.1258  575 TYR A CD2 
1602 C CE1 . TYR A 248 ? 0.6375 1.0798 0.4148 -0.2562 0.0284  0.1325  575 TYR A CE1 
1603 C CE2 . TYR A 248 ? 0.6116 0.9845 0.4360 -0.2509 0.0067  0.1499  575 TYR A CE2 
1604 C CZ  . TYR A 248 ? 0.6363 1.0631 0.4354 -0.2665 0.0196  0.1544  575 TYR A CZ  
1605 O OH  . TYR A 248 ? 0.6717 1.1390 0.4654 -0.2944 0.0235  0.1807  575 TYR A OH  
1606 N N   . LEU A 249 ? 0.5533 0.7718 0.3989 -0.1814 -0.0362 0.1200  576 LEU A N   
1607 C CA  . LEU A 249 ? 0.5733 0.7480 0.4281 -0.1838 -0.0538 0.1396  576 LEU A CA  
1608 C C   . LEU A 249 ? 0.6112 0.7533 0.4575 -0.1821 -0.0762 0.1616  576 LEU A C   
1609 O O   . LEU A 249 ? 0.6407 0.7606 0.4811 -0.1970 -0.0919 0.1888  576 LEU A O   
1610 C CB  . LEU A 249 ? 0.5337 0.6785 0.4114 -0.1641 -0.0516 0.1200  576 LEU A CB  
1611 C CG  . LEU A 249 ? 0.5125 0.6822 0.4042 -0.1658 -0.0347 0.1044  576 LEU A CG  
1612 C CD1 . LEU A 249 ? 0.4813 0.6222 0.3916 -0.1450 -0.0344 0.0853  576 LEU A CD1 
1613 C CD2 . LEU A 249 ? 0.5302 0.7125 0.4225 -0.1905 -0.0367 0.1244  576 LEU A CD2 
1614 N N   . LYS A 250 ? 0.6128 0.7534 0.4604 -0.1644 -0.0785 0.1511  577 LYS A N   
1615 C CA  . LYS A 250 ? 0.6450 0.7620 0.4901 -0.1576 -0.0992 0.1702  577 LYS A CA  
1616 C C   . LYS A 250 ? 0.6950 0.8349 0.5157 -0.1814 -0.1086 0.1985  577 LYS A C   
1617 O O   . LYS A 250 ? 0.7436 0.8565 0.5612 -0.1853 -0.1298 0.2271  577 LYS A O   
1618 C CB  . LYS A 250 ? 0.6221 0.7456 0.4774 -0.1356 -0.0969 0.1515  577 LYS A CB  
1619 C CG  . LYS A 250 ? 0.6349 0.7406 0.4963 -0.1225 -0.1168 0.1684  577 LYS A CG  
1620 C CD  . LYS A 250 ? 0.5967 0.7075 0.4771 -0.0990 -0.1120 0.1471  577 LYS A CD  
1621 C CE  . LYS A 250 ? 0.6146 0.7272 0.5027 -0.0876 -0.1298 0.1640  577 LYS A CE  
1622 N NZ  . LYS A 250 ? 0.6425 0.7121 0.5430 -0.0723 -0.1469 0.1828  577 LYS A NZ  
1623 N N   . LEU A 251 ? 0.7014 0.8902 0.5038 -0.1968 -0.0932 0.1905  578 LEU A N   
1624 C CA  . LEU A 251 ? 0.7450 0.9652 0.5186 -0.2219 -0.0990 0.2152  578 LEU A CA  
1625 C C   . LEU A 251 ? 0.7840 0.9992 0.5517 -0.2458 -0.1042 0.2435  578 LEU A C   
1626 O O   . LEU A 251 ? 0.8105 1.0164 0.5647 -0.2617 -0.1236 0.2782  578 LEU A O   
1627 C CB  . LEU A 251 ? 0.7378 1.0110 0.4914 -0.2292 -0.0784 0.1926  578 LEU A CB  
1628 C CG  . LEU A 251 ? 0.7842 1.1010 0.5008 -0.2529 -0.0794 0.2074  578 LEU A CG  
1629 C CD1 . LEU A 251 ? 0.8106 1.1156 0.5167 -0.2570 -0.1062 0.2369  578 LEU A CD1 
1630 C CD2 . LEU A 251 ? 0.7753 1.1271 0.4780 -0.2480 -0.0594 0.1709  578 LEU A CD2 
1631 N N   . GLU A 252 ? 0.7885 1.0095 0.5685 -0.2486 -0.0887 0.2302  579 GLU A N   
1632 C CA  . GLU A 252 ? 0.8348 1.0483 0.6167 -0.2711 -0.0937 0.2541  579 GLU A CA  
1633 C C   . GLU A 252 ? 0.8648 1.0128 0.6544 -0.2695 -0.1220 0.2794  579 GLU A C   
1634 O O   . GLU A 252 ? 0.9038 1.0431 0.6811 -0.2943 -0.1377 0.3148  579 GLU A O   
1635 C CB  . GLU A 252 ? 0.8171 1.0427 0.6192 -0.2671 -0.0747 0.2309  579 GLU A CB  
1636 C CG  . GLU A 252 ? 0.8595 1.0882 0.6662 -0.2938 -0.0782 0.2542  579 GLU A CG  
1637 C CD  . GLU A 252 ? 0.8523 1.0876 0.6840 -0.2868 -0.0642 0.2324  579 GLU A CD  
1638 O OE1 . GLU A 252 ? 0.8763 1.1618 0.7116 -0.3053 -0.0497 0.2369  579 GLU A OE1 
1639 O OE2 . GLU A 252 ? 0.8331 1.0279 0.6816 -0.2632 -0.0677 0.2119  579 GLU A OE2 
1640 N N   . ASP A 253 ? 0.8428 0.9451 0.6517 -0.2403 -0.1279 0.2609  580 ASP A N   
1641 C CA  . ASP A 253 ? 0.8811 0.9174 0.6976 -0.2296 -0.1534 0.2774  580 ASP A CA  
1642 C C   . ASP A 253 ? 0.9136 0.9101 0.7330 -0.2477 -0.1652 0.2937  580 ASP A C   
1643 O O   . ASP A 253 ? 0.9655 0.9166 0.7795 -0.2569 -0.1896 0.3229  580 ASP A O   
1644 C CB  . ASP A 253 ? 0.9158 0.9482 0.7189 -0.2328 -0.1732 0.3068  580 ASP A CB  
1645 C CG  . ASP A 253 ? 0.9454 0.9159 0.7632 -0.2065 -0.1953 0.3127  580 ASP A CG  
1646 O OD1 . ASP A 253 ? 0.9274 0.8804 0.7637 -0.1764 -0.1886 0.2842  580 ASP A OD1 
1647 O OD2 . ASP A 253 ? 1.0080 0.9483 0.8190 -0.2151 -0.2193 0.3466  580 ASP A OD2 
1648 N N   . LEU A 254 ? 0.8830 0.8963 0.7115 -0.2541 -0.1495 0.2760  581 LEU A N   
1649 C CA  . LEU A 254 ? 0.9142 0.8899 0.7477 -0.2709 -0.1611 0.2867  581 LEU A CA  
1650 C C   . LEU A 254 ? 0.9094 0.8215 0.7555 -0.2418 -0.1699 0.2645  581 LEU A C   
1651 O O   . LEU A 254 ? 0.9640 0.8121 0.8073 -0.2430 -0.1928 0.2781  581 LEU A O   
1652 C CB  . LEU A 254 ? 0.8927 0.9211 0.7328 -0.2916 -0.1417 0.2803  581 LEU A CB  
1653 C CG  . LEU A 254 ? 0.9330 0.9392 0.7778 -0.3194 -0.1540 0.2975  581 LEU A CG  
1654 C CD1 . LEU A 254 ? 0.9846 0.9905 0.8140 -0.3567 -0.1710 0.3417  581 LEU A CD1 
1655 C CD2 . LEU A 254 ? 0.8916 0.9513 0.7527 -0.3268 -0.1325 0.2808  581 LEU A CD2 
1656 N N   . VAL A 255 ? 0.8503 0.7791 0.7083 -0.2157 -0.1520 0.2305  582 VAL A N   
1657 C CA  . VAL A 255 ? 0.8414 0.7209 0.7086 -0.1843 -0.1571 0.2082  582 VAL A CA  
1658 C C   . VAL A 255 ? 0.8055 0.7068 0.6778 -0.1570 -0.1481 0.1942  582 VAL A C   
1659 O O   . VAL A 255 ? 0.7619 0.7141 0.6377 -0.1547 -0.1284 0.1785  582 VAL A O   
1660 C CB  . VAL A 255 ? 0.8123 0.6907 0.6898 -0.1790 -0.1458 0.1816  582 VAL A CB  
1661 C CG1 . VAL A 255 ? 0.8168 0.6408 0.6979 -0.1494 -0.1531 0.1614  582 VAL A CG1 
1662 C CG2 . VAL A 255 ? 0.8356 0.7106 0.7110 -0.2111 -0.1524 0.1957  582 VAL A CG2 
1663 N N   . PRO A 256 ? 0.8414 0.7041 0.7155 -0.1361 -0.1634 0.2002  583 PRO A N   
1664 C CA  . PRO A 256 ? 0.8182 0.7048 0.7014 -0.1103 -0.1560 0.1876  583 PRO A CA  
1665 C C   . PRO A 256 ? 0.7795 0.6654 0.6759 -0.0869 -0.1412 0.1544  583 PRO A C   
1666 O O   . PRO A 256 ? 0.8120 0.6578 0.7096 -0.0810 -0.1448 0.1441  583 PRO A O   
1667 C CB  . PRO A 256 ? 0.8695 0.7131 0.7555 -0.0934 -0.1781 0.2054  583 PRO A CB  
1668 C CG  . PRO A 256 ? 0.9200 0.7185 0.7939 -0.1155 -0.1980 0.2315  583 PRO A CG  
1669 C CD  . PRO A 256 ? 0.9044 0.7012 0.7744 -0.1344 -0.1887 0.2193  583 PRO A CD  
1670 N N   . PRO A 257 ? 0.7310 0.6604 0.6352 -0.0762 -0.1255 0.1383  584 PRO A N   
1671 C CA  . PRO A 257 ? 0.6787 0.6099 0.5949 -0.0567 -0.1118 0.1100  584 PRO A CA  
1672 C C   . PRO A 257 ? 0.6836 0.5776 0.6092 -0.0270 -0.1193 0.1023  584 PRO A C   
1673 O O   . PRO A 257 ? 0.7099 0.5938 0.6395 -0.0151 -0.1313 0.1160  584 PRO A O   
1674 C CB  . PRO A 257 ? 0.6442 0.6270 0.5654 -0.0555 -0.0973 0.0998  584 PRO A CB  
1675 C CG  . PRO A 257 ? 0.6750 0.6758 0.5881 -0.0648 -0.1070 0.1210  584 PRO A CG  
1676 C CD  . PRO A 257 ? 0.7129 0.6899 0.6126 -0.0842 -0.1209 0.1454  584 PRO A CD  
1677 N N   . PRO A 258 ? 0.6765 0.5527 0.6055 -0.0141 -0.1120 0.0807  585 PRO A N   
1678 C CA  . PRO A 258 ? 0.6883 0.5369 0.6248 0.0168  -0.1149 0.0692  585 PRO A CA  
1679 C C   . PRO A 258 ? 0.6655 0.5524 0.6190 0.0364  -0.1082 0.0671  585 PRO A C   
1680 O O   . PRO A 258 ? 0.6235 0.5563 0.5817 0.0263  -0.0976 0.0653  585 PRO A O   
1681 C CB  . PRO A 258 ? 0.6567 0.4966 0.5898 0.0207  -0.1042 0.0455  585 PRO A CB  
1682 C CG  . PRO A 258 ? 0.6172 0.4957 0.5502 -0.0016 -0.0925 0.0436  585 PRO A CG  
1683 C CD  . PRO A 258 ? 0.6363 0.5227 0.5628 -0.0259 -0.1001 0.0656  585 PRO A CD  
1684 N N   . ALA A 259 ? 0.6883 0.5557 0.6518 0.0646  -0.1146 0.0663  586 ALA A N   
1685 C CA  . ALA A 259 ? 0.6739 0.5776 0.6581 0.0846  -0.1124 0.0696  586 ALA A CA  
1686 C C   . ALA A 259 ? 0.6254 0.5832 0.6197 0.0813  -0.0952 0.0577  586 ALA A C   
1687 O O   . ALA A 259 ? 0.5978 0.5953 0.6007 0.0741  -0.0961 0.0681  586 ALA A O   
1688 C CB  . ALA A 259 ? 0.6978 0.5749 0.6937 0.1206  -0.1163 0.0627  586 ALA A CB  
1689 N N   . ILE A 260 ? 0.6044 0.5615 0.5956 0.0840  -0.0816 0.0373  587 ILE A N   
1690 C CA  . ILE A 260 ? 0.5652 0.5673 0.5667 0.0817  -0.0667 0.0270  587 ILE A CA  
1691 C C   . ILE A 260 ? 0.5284 0.5561 0.5242 0.0544  -0.0634 0.0309  587 ILE A C   
1692 O O   . ILE A 260 ? 0.5090 0.5742 0.5151 0.0508  -0.0590 0.0315  587 ILE A O   
1693 C CB  . ILE A 260 ? 0.5716 0.5677 0.5700 0.0905  -0.0542 0.0070  587 ILE A CB  
1694 C CG1 . ILE A 260 ? 0.6052 0.5649 0.5835 0.0756  -0.0563 0.0010  587 ILE A CG1 
1695 C CG2 . ILE A 260 ? 0.6218 0.6103 0.6287 0.1218  -0.0525 -0.0004 587 ILE A CG2 
1696 C CD1 . ILE A 260 ? 0.6188 0.5827 0.5922 0.0752  -0.0448 -0.0156 587 ILE A CD1 
1697 N N   . ILE A 261 ? 0.5171 0.5255 0.4969 0.0355  -0.0656 0.0329  588 ILE A N   
1698 C CA  . ILE A 261 ? 0.4941 0.5261 0.4668 0.0119  -0.0613 0.0352  588 ILE A CA  
1699 C C   . ILE A 261 ? 0.4888 0.5404 0.4599 0.0046  -0.0704 0.0516  588 ILE A C   
1700 O O   . ILE A 261 ? 0.4612 0.5448 0.4335 -0.0039 -0.0661 0.0490  588 ILE A O   
1701 C CB  . ILE A 261 ? 0.5078 0.5210 0.4667 -0.0056 -0.0614 0.0362  588 ILE A CB  
1702 C CG1 . ILE A 261 ? 0.4954 0.5008 0.4565 -0.0022 -0.0520 0.0196  588 ILE A CG1 
1703 C CG2 . ILE A 261 ? 0.4869 0.5275 0.4374 -0.0275 -0.0579 0.0418  588 ILE A CG2 
1704 C CD1 . ILE A 261 ? 0.5324 0.5242 0.4847 -0.0192 -0.0530 0.0211  588 ILE A CD1 
1705 N N   . ASP A 262 ? 0.5195 0.5489 0.4872 0.0082  -0.0847 0.0684  589 ASP A N   
1706 C CA  . ASP A 262 ? 0.5493 0.5949 0.5152 0.0027  -0.0972 0.0884  589 ASP A CA  
1707 C C   . ASP A 262 ? 0.5429 0.6252 0.5260 0.0134  -0.0966 0.0871  589 ASP A C   
1708 O O   . ASP A 262 ? 0.5290 0.6436 0.5061 -0.0022 -0.0977 0.0910  589 ASP A O   
1709 C CB  . ASP A 262 ? 0.5850 0.5929 0.5502 0.0120  -0.1144 0.1069  589 ASP A CB  
1710 C CG  . ASP A 262 ? 0.6086 0.6252 0.5627 -0.0044 -0.1291 0.1328  589 ASP A CG  
1711 O OD1 . ASP A 262 ? 0.5992 0.6447 0.5379 -0.0284 -0.1245 0.1351  589 ASP A OD1 
1712 O OD2 . ASP A 262 ? 0.6466 0.6394 0.6063 0.0074  -0.1459 0.1511  589 ASP A OD2 
1713 N N   . LYS A 263 ? 0.5418 0.6211 0.5448 0.0388  -0.0944 0.0806  590 LYS A N   
1714 C CA  . LYS A 263 ? 0.5296 0.6483 0.5540 0.0497  -0.0936 0.0811  590 LYS A CA  
1715 C C   . LYS A 263 ? 0.4880 0.6374 0.5099 0.0322  -0.0824 0.0682  590 LYS A C   
1716 O O   . LYS A 263 ? 0.4962 0.6779 0.5209 0.0213  -0.0878 0.0748  590 LYS A O   
1717 C CB  . LYS A 263 ? 0.5540 0.6677 0.5993 0.0804  -0.0885 0.0734  590 LYS A CB  
1718 C CG  . LYS A 263 ? 0.5507 0.7129 0.6221 0.0909  -0.0844 0.0734  590 LYS A CG  
1719 C CD  . LYS A 263 ? 0.5578 0.7212 0.6411 0.1123  -0.0697 0.0572  590 LYS A CD  
1720 C CE  . LYS A 263 ? 0.5492 0.7673 0.6618 0.1225  -0.0651 0.0604  590 LYS A CE  
1721 N NZ  . LYS A 263 ? 0.5652 0.8059 0.7004 0.1383  -0.0787 0.0795  590 LYS A NZ  
1722 N N   . LEU A 264 ? 0.4576 0.5945 0.4734 0.0285  -0.0689 0.0508  591 LEU A N   
1723 C CA  . LEU A 264 ? 0.4229 0.5807 0.4371 0.0139  -0.0590 0.0380  591 LEU A CA  
1724 C C   . LEU A 264 ? 0.4090 0.5754 0.4041 -0.0096 -0.0615 0.0388  591 LEU A C   
1725 O O   . LEU A 264 ? 0.4005 0.5891 0.3951 -0.0210 -0.0605 0.0332  591 LEU A O   
1726 C CB  . LEU A 264 ? 0.4162 0.5567 0.4285 0.0161  -0.0460 0.0218  591 LEU A CB  
1727 C CG  . LEU A 264 ? 0.4357 0.5771 0.4623 0.0338  -0.0383 0.0144  591 LEU A CG  
1728 C CD1 . LEU A 264 ? 0.4318 0.5657 0.4536 0.0265  -0.0275 0.0009  591 LEU A CD1 
1729 C CD2 . LEU A 264 ? 0.4277 0.6054 0.4750 0.0407  -0.0387 0.0192  591 LEU A CD2 
1730 N N   . PHE A 265 ? 0.4129 0.5613 0.3908 -0.0176 -0.0645 0.0451  592 PHE A N   
1731 C CA  . PHE A 265 ? 0.4071 0.5675 0.3637 -0.0391 -0.0650 0.0460  592 PHE A CA  
1732 C C   . PHE A 265 ? 0.4146 0.6009 0.3678 -0.0464 -0.0778 0.0587  592 PHE A C   
1733 O O   . PHE A 265 ? 0.4022 0.6092 0.3463 -0.0599 -0.0761 0.0496  592 PHE A O   
1734 C CB  . PHE A 265 ? 0.4146 0.5562 0.3555 -0.0475 -0.0659 0.0545  592 PHE A CB  
1735 C CG  . PHE A 265 ? 0.4249 0.5859 0.3421 -0.0693 -0.0655 0.0581  592 PHE A CG  
1736 C CD1 . PHE A 265 ? 0.4111 0.5842 0.3186 -0.0792 -0.0510 0.0397  592 PHE A CD1 
1737 C CD2 . PHE A 265 ? 0.4533 0.6217 0.3572 -0.0788 -0.0796 0.0803  592 PHE A CD2 
1738 C CE1 . PHE A 265 ? 0.4325 0.6269 0.3156 -0.0975 -0.0482 0.0403  592 PHE A CE1 
1739 C CE2 . PHE A 265 ? 0.4700 0.6607 0.3478 -0.1002 -0.0784 0.0837  592 PHE A CE2 
1740 C CZ  . PHE A 265 ? 0.4576 0.6625 0.3241 -0.1091 -0.0614 0.0621  592 PHE A CZ  
1741 N N   . LEU A 266 ? 0.4340 0.6172 0.3952 -0.0366 -0.0918 0.0791  593 LEU A N   
1742 C CA  . LEU A 266 ? 0.4584 0.6675 0.4187 -0.0426 -0.1075 0.0965  593 LEU A CA  
1743 C C   . LEU A 266 ? 0.4577 0.6987 0.4338 -0.0424 -0.1085 0.0900  593 LEU A C   
1744 O O   . LEU A 266 ? 0.4705 0.7363 0.4327 -0.0610 -0.1156 0.0915  593 LEU A O   
1745 C CB  . LEU A 266 ? 0.4748 0.6703 0.4468 -0.0268 -0.1230 0.1206  593 LEU A CB  
1746 C CG  . LEU A 266 ? 0.5086 0.6745 0.4623 -0.0338 -0.1304 0.1368  593 LEU A CG  
1747 C CD1 . LEU A 266 ? 0.5305 0.6714 0.5020 -0.0113 -0.1454 0.1563  593 LEU A CD1 
1748 C CD2 . LEU A 266 ? 0.5284 0.7140 0.4531 -0.0610 -0.1384 0.1509  593 LEU A CD2 
1749 N N   . ASP A 267 ? 0.4479 0.6896 0.4504 -0.0240 -0.1017 0.0828  594 ASP A N   
1750 C CA  . ASP A 267 ? 0.4460 0.7213 0.4681 -0.0249 -0.1030 0.0800  594 ASP A CA  
1751 C C   . ASP A 267 ? 0.4511 0.7330 0.4586 -0.0471 -0.0966 0.0619  594 ASP A C   
1752 O O   . ASP A 267 ? 0.4682 0.7774 0.4786 -0.0604 -0.1050 0.0636  594 ASP A O   
1753 C CB  . ASP A 267 ? 0.4258 0.7035 0.4777 -0.0011 -0.0944 0.0766  594 ASP A CB  
1754 C CG  . ASP A 267 ? 0.4383 0.7163 0.5103 0.0247  -0.1023 0.0930  594 ASP A CG  
1755 O OD1 . ASP A 267 ? 0.4639 0.7425 0.5313 0.0238  -0.1174 0.1109  594 ASP A OD1 
1756 O OD2 . ASP A 267 ? 0.4385 0.7148 0.5299 0.0472  -0.0934 0.0877  594 ASP A OD2 
1757 N N   . THR A 268 ? 0.4619 0.7173 0.4541 -0.0507 -0.0830 0.0447  595 THR A N   
1758 C CA  . THR A 268 ? 0.4781 0.7308 0.4580 -0.0665 -0.0755 0.0248  595 THR A CA  
1759 C C   . THR A 268 ? 0.4863 0.7455 0.4349 -0.0884 -0.0807 0.0195  595 THR A C   
1760 O O   . THR A 268 ? 0.4964 0.7581 0.4348 -0.1027 -0.0802 0.0041  595 THR A O   
1761 C CB  . THR A 268 ? 0.4964 0.7215 0.4774 -0.0579 -0.0594 0.0102  595 THR A CB  
1762 O OG1 . THR A 268 ? 0.5415 0.7688 0.5481 -0.0429 -0.0557 0.0121  595 THR A OG1 
1763 C CG2 . THR A 268 ? 0.5089 0.7242 0.4757 -0.0708 -0.0511 -0.0106 595 THR A CG2 
1764 N N   . LEU A 269 ? 0.4804 0.7417 0.4122 -0.0918 -0.0867 0.0324  596 LEU A N   
1765 C CA  . LEU A 269 ? 0.5099 0.7835 0.4089 -0.1129 -0.0916 0.0288  596 LEU A CA  
1766 C C   . LEU A 269 ? 0.5289 0.8294 0.4274 -0.1265 -0.1078 0.0334  596 LEU A C   
1767 O O   . LEU A 269 ? 0.5287 0.8488 0.4474 -0.1203 -0.1221 0.0555  596 LEU A O   
1768 C CB  . LEU A 269 ? 0.5275 0.8018 0.4081 -0.1164 -0.0962 0.0468  596 LEU A CB  
1769 C CG  . LEU A 269 ? 0.5279 0.7803 0.4035 -0.1107 -0.0829 0.0450  596 LEU A CG  
1770 C CD1 . LEU A 269 ? 0.5556 0.8155 0.4069 -0.1233 -0.0899 0.0647  596 LEU A CD1 
1771 C CD2 . LEU A 269 ? 0.5166 0.7603 0.3839 -0.1133 -0.0640 0.0172  596 LEU A CD2 
1772 N N   . PRO A 270 ? 0.5393 0.8407 0.4160 -0.1445 -0.1064 0.0121  597 PRO A N   
1773 C CA  . PRO A 270 ? 0.5446 0.8702 0.4168 -0.1624 -0.1241 0.0151  597 PRO A CA  
1774 C C   . PRO A 270 ? 0.5691 0.9188 0.4124 -0.1786 -0.1397 0.0298  597 PRO A C   
1775 O O   . PRO A 270 ? 0.5862 0.9592 0.4220 -0.1965 -0.1571 0.0336  597 PRO A O   
1776 C CB  . PRO A 270 ? 0.5609 0.8680 0.4166 -0.1753 -0.1171 -0.0157 597 PRO A CB  
1777 C CG  . PRO A 270 ? 0.5626 0.8442 0.4009 -0.1673 -0.0968 -0.0345 597 PRO A CG  
1778 C CD  . PRO A 270 ? 0.5360 0.8140 0.3944 -0.1473 -0.0893 -0.0166 597 PRO A CD  
1779 N N   . PHE A 271 ? 0.5618 0.9077 0.3894 -0.1745 -0.1354 0.0405  598 PHE A N   
1780 C CA  . PHE A 271 ? 0.5900 0.9596 0.3902 -0.1896 -0.1509 0.0610  598 PHE A CA  
1781 C C   . PHE A 271 ? 0.5812 0.9454 0.3942 -0.1750 -0.1536 0.0899  598 PHE A C   
1782 O O   . PHE A 271 ? 0.6014 0.9825 0.4029 -0.1825 -0.1700 0.1164  598 PHE A O   
1783 C CB  . PHE A 271 ? 0.6135 0.9842 0.3628 -0.2100 -0.1425 0.0397  598 PHE A CB  
1784 C CG  . PHE A 271 ? 0.5967 0.9434 0.3397 -0.2004 -0.1170 0.0194  598 PHE A CG  
1785 C CD1 . PHE A 271 ? 0.5894 0.9332 0.3305 -0.1944 -0.1101 0.0362  598 PHE A CD1 
1786 C CD2 . PHE A 271 ? 0.5818 0.9086 0.3240 -0.1975 -0.1016 -0.0144 598 PHE A CD2 
1787 C CE1 . PHE A 271 ? 0.5749 0.9029 0.3149 -0.1866 -0.0878 0.0198  598 PHE A CE1 
1788 C CE2 . PHE A 271 ? 0.5712 0.8809 0.3126 -0.1868 -0.0793 -0.0310 598 PHE A CE2 
1789 C CZ  . PHE A 271 ? 0.5651 0.8785 0.3063 -0.1816 -0.0721 -0.0137 598 PHE A CZ  
1790 O OXT . PHE A 271 ? 0.5571 0.8963 0.3916 -0.1558 -0.1407 0.0878  598 PHE A OXT 
1791 N N   . VAL B 35  ? 0.8327 1.3500 0.8831 -0.2058 -0.0631 0.3718  362 VAL B N   
1792 C CA  . VAL B 35  ? 0.8019 1.2536 0.8528 -0.1886 -0.0763 0.3356  362 VAL B CA  
1793 C C   . VAL B 35  ? 0.7697 1.1852 0.8707 -0.1942 -0.1035 0.3377  362 VAL B C   
1794 O O   . VAL B 35  ? 0.7441 1.1778 0.8742 -0.1951 -0.1008 0.3418  362 VAL B O   
1795 C CB  . VAL B 35  ? 0.8014 1.2463 0.8199 -0.1579 -0.0486 0.2927  362 VAL B CB  
1796 C CG1 . VAL B 35  ? 0.7900 1.2626 0.8295 -0.1439 -0.0300 0.2848  362 VAL B CG1 
1797 C CG2 . VAL B 35  ? 0.7804 1.1655 0.7930 -0.1444 -0.0615 0.2609  362 VAL B CG2 
1798 N N   . SER B 36  ? 0.7490 1.1143 0.8587 -0.1980 -0.1302 0.3353  363 SER B N   
1799 C CA  . SER B 36  ? 0.7231 1.0412 0.8711 -0.1978 -0.1565 0.3283  363 SER B CA  
1800 C C   . SER B 36  ? 0.6817 0.9814 0.8300 -0.1725 -0.1441 0.2881  363 SER B C   
1801 O O   . SER B 36  ? 0.6618 0.9698 0.7790 -0.1533 -0.1200 0.2628  363 SER B O   
1802 C CB  . SER B 36  ? 0.7401 1.0131 0.8910 -0.2006 -0.1824 0.3313  363 SER B CB  
1803 O OG  . SER B 36  ? 0.7377 0.9598 0.9042 -0.1831 -0.1952 0.3020  363 SER B OG  
1804 N N   . LEU B 37  ? 0.6565 0.9296 0.8374 -0.1734 -0.1615 0.2826  364 LEU B N   
1805 C CA  . LEU B 37  ? 0.6150 0.8706 0.7953 -0.1511 -0.1523 0.2467  364 LEU B CA  
1806 C C   . LEU B 37  ? 0.5933 0.8069 0.7568 -0.1311 -0.1539 0.2155  364 LEU B C   
1807 O O   . LEU B 37  ? 0.5686 0.7854 0.7091 -0.1120 -0.1333 0.1895  364 LEU B O   
1808 C CB  . LEU B 37  ? 0.6031 0.8458 0.8175 -0.1585 -0.1699 0.2482  364 LEU B CB  
1809 C CG  . LEU B 37  ? 0.5842 0.8051 0.7986 -0.1380 -0.1659 0.2129  364 LEU B CG  
1810 C CD1 . LEU B 37  ? 0.5552 0.8124 0.7513 -0.1207 -0.1349 0.1984  364 LEU B CD1 
1811 C CD2 . LEU B 37  ? 0.6008 0.8036 0.8456 -0.1504 -0.1898 0.2170  364 LEU B CD2 
1812 N N   . ILE B 38  ? 0.5967 0.7729 0.7733 -0.1352 -0.1782 0.2199  365 ILE B N   
1813 C CA  . ILE B 38  ? 0.5873 0.7311 0.7538 -0.1164 -0.1801 0.1941  365 ILE B CA  
1814 C C   . ILE B 38  ? 0.5717 0.7363 0.7029 -0.1109 -0.1606 0.1892  365 ILE B C   
1815 O O   . ILE B 38  ? 0.5555 0.7097 0.6712 -0.0938 -0.1499 0.1626  365 ILE B O   
1816 C CB  . ILE B 38  ? 0.6107 0.7129 0.8016 -0.1187 -0.2097 0.2010  365 ILE B CB  
1817 C CG1 . ILE B 38  ? 0.5938 0.6673 0.7825 -0.0947 -0.2096 0.1699  365 ILE B CG1 
1818 C CG2 . ILE B 38  ? 0.6256 0.7366 0.8177 -0.1373 -0.2227 0.2359  365 ILE B CG2 
1819 C CD1 . ILE B 38  ? 0.6140 0.6420 0.8308 -0.0883 -0.2356 0.1657  365 ILE B CD1 
1820 N N   . SER B 39  ? 0.5851 0.7803 0.7019 -0.1270 -0.1561 0.2152  366 SER B N   
1821 C CA  . SER B 39  ? 0.5882 0.8050 0.6647 -0.1255 -0.1381 0.2124  366 SER B CA  
1822 C C   . SER B 39  ? 0.5717 0.7987 0.6222 -0.1080 -0.1109 0.1841  366 SER B C   
1823 O O   . SER B 39  ? 0.5773 0.7905 0.6037 -0.0970 -0.1040 0.1628  366 SER B O   
1824 C CB  . SER B 39  ? 0.6086 0.8634 0.6727 -0.1459 -0.1348 0.2455  366 SER B CB  
1825 O OG  . SER B 39  ? 0.6351 0.8828 0.6955 -0.1589 -0.1532 0.2660  366 SER B OG  
1826 N N   . ALA B 40  ? 0.5567 0.8082 0.6145 -0.1064 -0.0972 0.1863  367 ALA B N   
1827 C CA  . ALA B 40  ? 0.5372 0.7994 0.5756 -0.0884 -0.0720 0.1630  367 ALA B CA  
1828 C C   . ALA B 40  ? 0.5091 0.7382 0.5563 -0.0716 -0.0748 0.1344  367 ALA B C   
1829 O O   . ALA B 40  ? 0.5028 0.7283 0.5275 -0.0561 -0.0576 0.1123  367 ALA B O   
1830 C CB  . ALA B 40  ? 0.5300 0.8327 0.5824 -0.0906 -0.0590 0.1773  367 ALA B CB  
1831 N N   . LEU B 41  ? 0.4977 0.7021 0.5758 -0.0745 -0.0964 0.1351  368 LEU B N   
1832 C CA  . LEU B 41  ? 0.4773 0.6519 0.5611 -0.0591 -0.0998 0.1087  368 LEU B CA  
1833 C C   . LEU B 41  ? 0.4784 0.6350 0.5440 -0.0534 -0.1011 0.0966  368 LEU B C   
1834 O O   . LEU B 41  ? 0.4783 0.6235 0.5329 -0.0399 -0.0926 0.0743  368 LEU B O   
1835 C CB  . LEU B 41  ? 0.4749 0.6272 0.5925 -0.0618 -0.1217 0.1097  368 LEU B CB  
1836 C CG  . LEU B 41  ? 0.4724 0.6379 0.6105 -0.0677 -0.1241 0.1171  368 LEU B CG  
1837 C CD1 . LEU B 41  ? 0.4843 0.6225 0.6517 -0.0782 -0.1520 0.1252  368 LEU B CD1 
1838 C CD2 . LEU B 41  ? 0.4435 0.6130 0.5760 -0.0522 -0.1103 0.0954  368 LEU B CD2 
1839 N N   . VAL B 42  ? 0.4893 0.6462 0.5529 -0.0652 -0.1126 0.1139  369 VAL B N   
1840 C CA  . VAL B 42  ? 0.4851 0.6320 0.5315 -0.0628 -0.1150 0.1067  369 VAL B CA  
1841 C C   . VAL B 42  ? 0.4871 0.6453 0.4916 -0.0609 -0.0948 0.0961  369 VAL B C   
1842 O O   . VAL B 42  ? 0.4874 0.6328 0.4780 -0.0529 -0.0906 0.0778  369 VAL B O   
1843 C CB  . VAL B 42  ? 0.5006 0.6449 0.5578 -0.0756 -0.1357 0.1297  369 VAL B CB  
1844 C CG1 . VAL B 42  ? 0.4996 0.6415 0.5377 -0.0751 -0.1377 0.1243  369 VAL B CG1 
1845 C CG2 . VAL B 42  ? 0.4939 0.6153 0.5914 -0.0720 -0.1568 0.1336  369 VAL B CG2 
1846 N N   . ARG B 43  ? 0.4936 0.6751 0.4778 -0.0675 -0.0822 0.1068  370 ARG B N   
1847 C CA  . ARG B 43  ? 0.5126 0.6988 0.4528 -0.0625 -0.0626 0.0928  370 ARG B CA  
1848 C C   . ARG B 43  ? 0.4916 0.6652 0.4274 -0.0447 -0.0481 0.0678  370 ARG B C   
1849 O O   . ARG B 43  ? 0.5040 0.6620 0.4101 -0.0396 -0.0412 0.0507  370 ARG B O   
1850 C CB  . ARG B 43  ? 0.5547 0.7712 0.4706 -0.0687 -0.0480 0.1062  370 ARG B CB  
1851 C CG  . ARG B 43  ? 0.6013 0.8376 0.5196 -0.0887 -0.0605 0.1363  370 ARG B CG  
1852 C CD  . ARG B 43  ? 0.6311 0.8575 0.5254 -0.1006 -0.0742 0.1414  370 ARG B CD  
1853 N NE  . ARG B 43  ? 0.6614 0.9081 0.5658 -0.1201 -0.0885 0.1753  370 ARG B NE  
1854 C CZ  . ARG B 43  ? 0.6465 0.8855 0.5942 -0.1277 -0.1110 0.1951  370 ARG B CZ  
1855 N NH1 . ARG B 43  ? 0.6169 0.8291 0.5998 -0.1161 -0.1207 0.1818  370 ARG B NH1 
1856 N NH2 . ARG B 43  ? 0.6408 0.8970 0.5946 -0.1466 -0.1240 0.2280  370 ARG B NH2 
1857 N N   . ALA B 44  ? 0.4587 0.6378 0.4231 -0.0370 -0.0458 0.0671  371 ALA B N   
1858 C CA  . ALA B 44  ? 0.4569 0.6252 0.4205 -0.0205 -0.0347 0.0464  371 ALA B CA  
1859 C C   . ALA B 44  ? 0.4487 0.5895 0.4102 -0.0160 -0.0421 0.0298  371 ALA B C   
1860 O O   . ALA B 44  ? 0.4615 0.5893 0.4015 -0.0070 -0.0316 0.0135  371 ALA B O   
1861 C CB  . ALA B 44  ? 0.4282 0.6085 0.4253 -0.0162 -0.0359 0.0511  371 ALA B CB  
1862 N N   . HIS B 45  ? 0.4404 0.5735 0.4252 -0.0216 -0.0600 0.0351  372 HIS B N   
1863 C CA  . HIS B 45  ? 0.4395 0.5557 0.4283 -0.0170 -0.0668 0.0225  372 HIS B CA  
1864 C C   . HIS B 45  ? 0.4580 0.5687 0.4183 -0.0244 -0.0671 0.0207  372 HIS B C   
1865 O O   . HIS B 45  ? 0.4527 0.5519 0.3972 -0.0204 -0.0616 0.0069  372 HIS B O   
1866 C CB  . HIS B 45  ? 0.4302 0.5420 0.4538 -0.0173 -0.0848 0.0286  372 HIS B CB  
1867 C CG  . HIS B 45  ? 0.4275 0.5316 0.4582 -0.0121 -0.0910 0.0196  372 HIS B CG  
1868 N ND1 . HIS B 45  ? 0.4379 0.5447 0.4710 -0.0193 -0.1021 0.0293  372 HIS B ND1 
1869 C CD2 . HIS B 45  ? 0.4098 0.5092 0.4471 -0.0008 -0.0873 0.0041  372 HIS B CD2 
1870 C CE1 . HIS B 45  ? 0.4212 0.5276 0.4652 -0.0118 -0.1043 0.0204  372 HIS B CE1 
1871 N NE2 . HIS B 45  ? 0.4116 0.5139 0.4570 -0.0007 -0.0947 0.0049  372 HIS B NE2 
1872 N N   . VAL B 46  ? 0.4831 0.6019 0.4363 -0.0371 -0.0754 0.0364  373 VAL B N   
1873 C CA  . VAL B 46  ? 0.5158 0.6314 0.4392 -0.0480 -0.0792 0.0374  373 VAL B CA  
1874 C C   . VAL B 46  ? 0.5405 0.6453 0.4201 -0.0458 -0.0631 0.0219  373 VAL B C   
1875 O O   . VAL B 46  ? 0.5605 0.6503 0.4207 -0.0494 -0.0654 0.0118  373 VAL B O   
1876 C CB  . VAL B 46  ? 0.5417 0.6709 0.4634 -0.0630 -0.0915 0.0600  373 VAL B CB  
1877 C CG1 . VAL B 46  ? 0.5805 0.7077 0.4637 -0.0762 -0.0957 0.0606  373 VAL B CG1 
1878 C CG2 . VAL B 46  ? 0.5237 0.6549 0.4889 -0.0634 -0.1108 0.0738  373 VAL B CG2 
1879 N N   . ASP B 47  ? 0.5576 0.6694 0.4238 -0.0391 -0.0473 0.0200  374 ASP B N   
1880 C CA  . ASP B 47  ? 0.5902 0.6885 0.4150 -0.0317 -0.0303 0.0032  374 ASP B CA  
1881 C C   . ASP B 47  ? 0.5818 0.6605 0.4106 -0.0176 -0.0228 -0.0141 374 ASP B C   
1882 O O   . ASP B 47  ? 0.6310 0.6908 0.4277 -0.0100 -0.0111 -0.0289 374 ASP B O   
1883 C CB  . ASP B 47  ? 0.6101 0.7288 0.4207 -0.0257 -0.0134 0.0079  374 ASP B CB  
1884 C CG  . ASP B 47  ? 0.6366 0.7753 0.4302 -0.0410 -0.0180 0.0251  374 ASP B CG  
1885 O OD1 . ASP B 47  ? 0.6467 0.7767 0.4245 -0.0556 -0.0324 0.0287  374 ASP B OD1 
1886 O OD2 . ASP B 47  ? 0.6452 0.8122 0.4423 -0.0393 -0.0072 0.0372  374 ASP B OD2 
1887 N N   . SER B 48  ? 0.5397 0.6210 0.4057 -0.0134 -0.0295 -0.0127 375 SER B N   
1888 C CA  . SER B 48  ? 0.5262 0.5918 0.3950 -0.0022 -0.0237 -0.0263 375 SER B CA  
1889 C C   . SER B 48  ? 0.5037 0.5601 0.3832 -0.0082 -0.0357 -0.0291 375 SER B C   
1890 O O   . SER B 48  ? 0.4823 0.5323 0.3715 -0.0008 -0.0332 -0.0361 375 SER B O   
1891 C CB  . SER B 48  ? 0.4954 0.5755 0.3937 0.0100  -0.0180 -0.0241 375 SER B CB  
1892 O OG  . SER B 48  ? 0.4705 0.5620 0.4033 0.0060  -0.0310 -0.0157 375 SER B OG  
1893 N N   . ASN B 49  ? 0.5091 0.5693 0.3876 -0.0219 -0.0485 -0.0215 376 ASN B N   
1894 C CA  . ASN B 49  ? 0.5076 0.5673 0.3984 -0.0283 -0.0592 -0.0212 376 ASN B CA  
1895 C C   . ASN B 49  ? 0.5316 0.5795 0.3919 -0.0449 -0.0673 -0.0210 376 ASN B C   
1896 O O   . ASN B 49  ? 0.5520 0.5967 0.3857 -0.0533 -0.0689 -0.0180 376 ASN B O   
1897 C CB  . ASN B 49  ? 0.4937 0.5743 0.4251 -0.0269 -0.0704 -0.0105 376 ASN B CB  
1898 C CG  . ASN B 49  ? 0.4909 0.5764 0.4499 -0.0118 -0.0655 -0.0158 376 ASN B CG  
1899 O OD1 . ASN B 49  ? 0.4878 0.5736 0.4550 -0.0057 -0.0627 -0.0233 376 ASN B OD1 
1900 N ND2 . ASN B 49  ? 0.4987 0.5891 0.4705 -0.0075 -0.0653 -0.0110 376 ASN B ND2 
1901 N N   . PRO B 50  ? 0.5319 0.5748 0.3944 -0.0516 -0.0732 -0.0231 377 PRO B N   
1902 C CA  . PRO B 50  ? 0.5575 0.5863 0.3891 -0.0708 -0.0836 -0.0227 377 PRO B CA  
1903 C C   . PRO B 50  ? 0.5556 0.6062 0.3984 -0.0844 -0.0998 -0.0072 377 PRO B C   
1904 O O   . PRO B 50  ? 0.5010 0.5783 0.3851 -0.0782 -0.1048 0.0037  377 PRO B O   
1905 C CB  . PRO B 50  ? 0.5475 0.5715 0.3870 -0.0756 -0.0866 -0.0246 377 PRO B CB  
1906 C CG  . PRO B 50  ? 0.5130 0.5652 0.3981 -0.0616 -0.0827 -0.0199 377 PRO B CG  
1907 C CD  . PRO B 50  ? 0.5014 0.5536 0.3922 -0.0444 -0.0717 -0.0245 377 PRO B CD  
1908 N N   . ALA B 51  ? 0.6057 0.6423 0.4095 -0.1017 -0.1084 -0.0073 378 ALA B N   
1909 C CA  . ALA B 51  ? 0.6268 0.6826 0.4344 -0.1187 -0.1270 0.0089  378 ALA B CA  
1910 C C   . ALA B 51  ? 0.6262 0.7015 0.4659 -0.1282 -0.1406 0.0191  378 ALA B C   
1911 O O   . ALA B 51  ? 0.6299 0.6910 0.4571 -0.1377 -0.1428 0.0131  378 ALA B O   
1912 C CB  . ALA B 51  ? 0.6759 0.7095 0.4263 -0.1361 -0.1330 0.0038  378 ALA B CB  
1913 N N   . MET B 52  ? 0.6289 0.7380 0.5121 -0.1248 -0.1499 0.0361  379 MET B N   
1914 C CA  . MET B 52  ? 0.6348 0.7737 0.5571 -0.1293 -0.1611 0.0484  379 MET B CA  
1915 C C   . MET B 52  ? 0.6654 0.8091 0.5692 -0.1573 -0.1816 0.0595  379 MET B C   
1916 O O   . MET B 52  ? 0.6553 0.8240 0.5863 -0.1658 -0.1908 0.0699  379 MET B O   
1917 C CB  . MET B 52  ? 0.6366 0.8071 0.6115 -0.1125 -0.1642 0.0614  379 MET B CB  
1918 C CG  . MET B 52  ? 0.6586 0.8230 0.6527 -0.0870 -0.1476 0.0501  379 MET B CG  
1919 S SD  . MET B 52  ? 0.6706 0.8325 0.6740 -0.0726 -0.1297 0.0333  379 MET B SD  
1920 C CE  . MET B 52  ? 0.6388 0.8458 0.6951 -0.0660 -0.1364 0.0456  379 MET B CE  
1921 N N   . THR B 53  ? 0.6997 0.8212 0.5556 -0.1723 -0.1884 0.0571  380 THR B N   
1922 C CA  . THR B 53  ? 0.7427 0.8615 0.5688 -0.2020 -0.2102 0.0650  380 THR B CA  
1923 C C   . THR B 53  ? 0.7915 0.8715 0.5733 -0.2175 -0.2104 0.0482  380 THR B C   
1924 O O   . THR B 53  ? 0.8377 0.9167 0.6049 -0.2441 -0.2307 0.0553  380 THR B O   
1925 C CB  . THR B 53  ? 0.7662 0.8790 0.5548 -0.2123 -0.2189 0.0700  380 THR B CB  
1926 O OG1 . THR B 53  ? 0.7766 0.8580 0.5248 -0.1999 -0.1991 0.0507  380 THR B OG1 
1927 C CG2 . THR B 53  ? 0.7359 0.8871 0.5702 -0.2044 -0.2273 0.0936  380 THR B CG2 
1928 N N   . SER B 54  ? 0.8037 0.8504 0.5653 -0.2014 -0.1899 0.0273  381 SER B N   
1929 C CA  . SER B 54  ? 0.8368 0.8393 0.5587 -0.2116 -0.1890 0.0106  381 SER B CA  
1930 C C   . SER B 54  ? 0.8069 0.8099 0.5595 -0.1952 -0.1738 0.0061  381 SER B C   
1931 O O   . SER B 54  ? 0.8409 0.8107 0.5717 -0.1796 -0.1569 -0.0115 381 SER B O   
1932 C CB  . SER B 54  ? 0.8788 0.8343 0.5373 -0.2070 -0.1792 -0.0116 381 SER B CB  
1933 O OG  . SER B 54  ? 0.8338 0.7935 0.5037 -0.1783 -0.1558 -0.0189 381 SER B OG  
1934 N N   . LEU B 55  ? 0.7494 0.7940 0.5534 -0.1972 -0.1790 0.0231  382 LEU B N   
1935 C CA  . LEU B 55  ? 0.6960 0.7470 0.5272 -0.1848 -0.1659 0.0213  382 LEU B CA  
1936 C C   . LEU B 55  ? 0.7244 0.7517 0.5361 -0.2085 -0.1765 0.0222  382 LEU B C   
1937 O O   . LEU B 55  ? 0.7412 0.7652 0.5374 -0.2365 -0.1976 0.0306  382 LEU B O   
1938 C CB  . LEU B 55  ? 0.6325 0.7409 0.5263 -0.1718 -0.1627 0.0368  382 LEU B CB  
1939 C CG  . LEU B 55  ? 0.5903 0.7170 0.5094 -0.1457 -0.1522 0.0354  382 LEU B CG  
1940 C CD1 . LEU B 55  ? 0.5458 0.7250 0.5233 -0.1346 -0.1529 0.0498  382 LEU B CD1 
1941 C CD2 . LEU B 55  ? 0.5705 0.6706 0.4761 -0.1238 -0.1320 0.0175  382 LEU B CD2 
1942 N N   . ASP B 56  ? 0.7118 0.7217 0.5240 -0.1986 -0.1637 0.0150  383 ASP B N   
1943 C CA  . ASP B 56  ? 0.7379 0.7194 0.5321 -0.2201 -0.1732 0.0172  383 ASP B CA  
1944 C C   . ASP B 56  ? 0.6966 0.7284 0.5398 -0.2267 -0.1741 0.0382  383 ASP B C   
1945 O O   . ASP B 56  ? 0.6470 0.6974 0.5150 -0.2063 -0.1568 0.0378  383 ASP B O   
1946 C CB  . ASP B 56  ? 0.7606 0.6862 0.5198 -0.2056 -0.1599 -0.0024 383 ASP B CB  
1947 C CG  . ASP B 56  ? 0.8175 0.6981 0.5497 -0.2283 -0.1725 -0.0018 383 ASP B CG  
1948 O OD1 . ASP B 56  ? 0.8463 0.7307 0.5774 -0.2601 -0.1941 0.0117  383 ASP B OD1 
1949 O OD2 . ASP B 56  ? 0.8493 0.6886 0.5617 -0.2145 -0.1621 -0.0141 383 ASP B OD2 
1950 N N   . TYR B 57  ? 0.7125 0.7687 0.5681 -0.2560 -0.1946 0.0569  384 TYR B N   
1951 C CA  . TYR B 57  ? 0.6974 0.8091 0.6000 -0.2667 -0.1970 0.0807  384 TYR B CA  
1952 C C   . TYR B 57  ? 0.7364 0.8207 0.6221 -0.2948 -0.2081 0.0892  384 TYR B C   
1953 O O   . TYR B 57  ? 0.7358 0.8684 0.6592 -0.3055 -0.2087 0.1110  384 TYR B O   
1954 C CB  . TYR B 57  ? 0.6952 0.8662 0.6351 -0.2807 -0.2125 0.1023  384 TYR B CB  
1955 C CG  . TYR B 57  ? 0.6565 0.8774 0.6387 -0.2497 -0.1992 0.1036  384 TYR B CG  
1956 C CD1 . TYR B 57  ? 0.6164 0.9020 0.6539 -0.2339 -0.1869 0.1171  384 TYR B CD1 
1957 C CD2 . TYR B 57  ? 0.6482 0.8504 0.6140 -0.2357 -0.1988 0.0915  384 TYR B CD2 
1958 C CE1 . TYR B 57  ? 0.5798 0.9030 0.6540 -0.2035 -0.1759 0.1158  384 TYR B CE1 
1959 C CE2 . TYR B 57  ? 0.6158 0.8571 0.6206 -0.2087 -0.1895 0.0940  384 TYR B CE2 
1960 C CZ  . TYR B 57  ? 0.5885 0.8865 0.6468 -0.1919 -0.1787 0.1048  384 TYR B CZ  
1961 O OH  . TYR B 57  ? 0.5737 0.9025 0.6684 -0.1633 -0.1706 0.1047  384 TYR B OH  
1962 N N   . SER B 58  ? 0.7906 0.7984 0.6206 -0.3058 -0.2164 0.0725  385 SER B N   
1963 C CA  . SER B 58  ? 0.8483 0.8132 0.6543 -0.3362 -0.2326 0.0795  385 SER B CA  
1964 C C   . SER B 58  ? 0.8306 0.8186 0.6655 -0.3342 -0.2218 0.0950  385 SER B C   
1965 O O   . SER B 58  ? 0.8618 0.8481 0.7001 -0.3657 -0.2379 0.1145  385 SER B O   
1966 C CB  . SER B 58  ? 0.9116 0.7824 0.6511 -0.3359 -0.2374 0.0524  385 SER B CB  
1967 O OG  . SER B 58  ? 0.9042 0.7493 0.6351 -0.3012 -0.2133 0.0350  385 SER B OG  
1968 N N   . ARG B 59  ? 0.7894 0.7996 0.6437 -0.2989 -0.1958 0.0874  386 ARG B N   
1969 C CA  . ARG B 59  ? 0.7773 0.8119 0.6547 -0.2927 -0.1830 0.1001  386 ARG B CA  
1970 C C   . ARG B 59  ? 0.7152 0.8423 0.6498 -0.2818 -0.1699 0.1177  386 ARG B C   
1971 O O   . ARG B 59  ? 0.7010 0.8614 0.6567 -0.2790 -0.1590 0.1311  386 ARG B O   
1972 C CB  . ARG B 59  ? 0.7852 0.7790 0.6412 -0.2605 -0.1636 0.0788  386 ARG B CB  
1973 C CG  . ARG B 59  ? 0.8620 0.7685 0.6683 -0.2674 -0.1725 0.0662  386 ARG B CG  
1974 C CD  . ARG B 59  ? 0.8640 0.7511 0.6655 -0.2390 -0.1540 0.0574  386 ARG B CD  
1975 N NE  . ARG B 59  ? 0.8466 0.7269 0.6405 -0.2050 -0.1374 0.0336  386 ARG B NE  
1976 C CZ  . ARG B 59  ? 0.8152 0.7075 0.6200 -0.1757 -0.1185 0.0269  386 ARG B CZ  
1977 N NH1 . ARG B 59  ? 0.7987 0.7106 0.6201 -0.1740 -0.1125 0.0409  386 ARG B NH1 
1978 N NH2 . ARG B 59  ? 0.7986 0.6854 0.5973 -0.1497 -0.1064 0.0077  386 ARG B NH2 
1979 N N   . PHE B 60  ? 0.6709 0.8388 0.6291 -0.2739 -0.1705 0.1173  387 PHE B N   
1980 C CA  . PHE B 60  ? 0.6140 0.8659 0.6262 -0.2569 -0.1570 0.1299  387 PHE B CA  
1981 C C   . PHE B 60  ? 0.6238 0.9379 0.6725 -0.2834 -0.1648 0.1621  387 PHE B C   
1982 O O   . PHE B 60  ? 0.6511 0.9600 0.6956 -0.3191 -0.1882 0.1782  387 PHE B O   
1983 C CB  . PHE B 60  ? 0.5707 0.8448 0.5997 -0.2407 -0.1580 0.1227  387 PHE B CB  
1984 C CG  . PHE B 60  ? 0.5135 0.8670 0.5976 -0.2189 -0.1449 0.1329  387 PHE B CG  
1985 C CD1 . PHE B 60  ? 0.4672 0.8337 0.5628 -0.1826 -0.1216 0.1181  387 PHE B CD1 
1986 C CD2 . PHE B 60  ? 0.4975 0.9133 0.6223 -0.2340 -0.1564 0.1571  387 PHE B CD2 
1987 C CE1 . PHE B 60  ? 0.4292 0.8634 0.5717 -0.1600 -0.1093 0.1240  387 PHE B CE1 
1988 C CE2 . PHE B 60  ? 0.4593 0.9484 0.6360 -0.2094 -0.1428 0.1651  387 PHE B CE2 
1989 C CZ  . PHE B 60  ? 0.4362 0.9317 0.6197 -0.1714 -0.1187 0.1469  387 PHE B CZ  
1990 N N   . GLN B 61  ? 0.6007 0.9744 0.6834 -0.2662 -0.1450 0.1712  388 GLN B N   
1991 C CA  . GLN B 61  ? 0.6120 1.0622 0.7365 -0.2848 -0.1458 0.2029  388 GLN B CA  
1992 C C   . GLN B 61  ? 0.5838 1.1112 0.7522 -0.2492 -0.1210 0.2025  388 GLN B C   
1993 O O   . GLN B 61  ? 0.5707 1.0943 0.7308 -0.2220 -0.1002 0.1874  388 GLN B O   
1994 C CB  . GLN B 61  ? 0.6324 1.0667 0.7407 -0.3089 -0.1479 0.2188  388 GLN B CB  
1995 C CG  . GLN B 61  ? 0.6876 1.0502 0.7577 -0.3489 -0.1759 0.2242  388 GLN B CG  
1996 C CD  . GLN B 61  ? 0.7228 1.0749 0.7842 -0.3759 -0.1811 0.2461  388 GLN B CD  
1997 O OE1 . GLN B 61  ? 0.7046 1.0745 0.7697 -0.3589 -0.1615 0.2479  388 GLN B OE1 
1998 N NE2 . GLN B 61  ? 0.7716 1.0927 0.8198 -0.4201 -0.2095 0.2640  388 GLN B NE2 
1999 N N   . ALA B 62  ? 0.5933 1.1891 0.8074 -0.2487 -0.1241 0.2184  389 ALA B N   
2000 C CA  . ALA B 62  ? 0.5844 1.2545 0.8427 -0.2121 -0.1012 0.2170  389 ALA B CA  
2001 C C   . ALA B 62  ? 0.6006 1.3346 0.8792 -0.2101 -0.0818 0.2336  389 ALA B C   
2002 O O   . ALA B 62  ? 0.5911 1.3566 0.8807 -0.1739 -0.0573 0.2198  389 ALA B O   
2003 C CB  . ALA B 62  ? 0.5737 1.2991 0.8777 -0.2101 -0.1110 0.2310  389 ALA B CB  
2004 N N   . ASN B 63  ? 0.6478 1.3981 0.9280 -0.2501 -0.0936 0.2629  390 ASN B N   
2005 C CA  . ASN B 63  ? 0.6667 1.4889 0.9697 -0.2547 -0.0770 0.2864  390 ASN B CA  
2006 C C   . ASN B 63  ? 0.7028 1.4848 0.9715 -0.2894 -0.0854 0.3014  390 ASN B C   
2007 O O   . ASN B 63  ? 0.7191 1.5415 1.0067 -0.3268 -0.0966 0.3369  390 ASN B O   
2008 C CB  . ASN B 63  ? 0.6722 1.5950 1.0350 -0.2673 -0.0796 0.3199  390 ASN B CB  
2009 C CG  . ASN B 63  ? 0.6500 1.6452 1.0554 -0.2201 -0.0552 0.3095  390 ASN B CG  
2010 O OD1 . ASN B 63  ? 0.6354 1.6092 1.0465 -0.1948 -0.0581 0.2887  390 ASN B OD1 
2011 N ND2 . ASN B 63  ? 0.6511 1.7324 1.0859 -0.2075 -0.0311 0.3244  390 ASN B ND2 
2012 N N   . PRO B 64  ? 0.7120 1.4176 0.9334 -0.2770 -0.0806 0.2769  391 PRO B N   
2013 C CA  . PRO B 64  ? 0.7563 1.4059 0.9415 -0.3082 -0.0930 0.2889  391 PRO B CA  
2014 C C   . PRO B 64  ? 0.7806 1.4937 0.9810 -0.3219 -0.0810 0.3196  391 PRO B C   
2015 O O   . PRO B 64  ? 0.7585 1.5444 0.9817 -0.2937 -0.0546 0.3186  391 PRO B O   
2016 C CB  . PRO B 64  ? 0.7446 1.3152 0.8858 -0.2801 -0.0851 0.2539  391 PRO B CB  
2017 C CG  . PRO B 64  ? 0.6962 1.3101 0.8555 -0.2346 -0.0601 0.2316  391 PRO B CG  
2018 C CD  . PRO B 64  ? 0.6764 1.3560 0.8813 -0.2313 -0.0612 0.2404  391 PRO B CD  
2019 N N   . ASP B 65  ? 0.8407 1.5253 1.0268 -0.3652 -0.1008 0.3467  392 ASP B N   
2020 C CA  . ASP B 65  ? 0.8698 1.5953 1.0588 -0.3817 -0.0923 0.3767  392 ASP B CA  
2021 C C   . ASP B 65  ? 0.8924 1.5436 1.0343 -0.3672 -0.0873 0.3583  392 ASP B C   
2022 O O   . ASP B 65  ? 0.9363 1.4974 1.0435 -0.3878 -0.1089 0.3566  392 ASP B O   
2023 C CB  . ASP B 65  ? 0.9200 1.6510 1.1196 -0.4387 -0.1191 0.4194  392 ASP B CB  
2024 C CG  . ASP B 65  ? 0.9536 1.7502 1.1668 -0.4589 -0.1090 0.4587  392 ASP B CG  
2025 O OD1 . ASP B 65  ? 0.9720 1.8345 1.2209 -0.4959 -0.1191 0.4991  392 ASP B OD1 
2026 O OD2 . ASP B 65  ? 0.9491 1.7354 1.1382 -0.4402 -0.0922 0.4523  392 ASP B OD2 
2027 N N   . ASP B 72  ? 0.8673 1.1378 0.7626 -0.2252 -0.0583 0.2662  399 ASP B N   
2028 C CA  . ASP B 72  ? 0.9009 1.0915 0.7888 -0.2420 -0.0798 0.2649  399 ASP B CA  
2029 C C   . ASP B 72  ? 0.8839 0.9986 0.7529 -0.2149 -0.0834 0.2336  399 ASP B C   
2030 O O   . ASP B 72  ? 0.8252 0.9519 0.6979 -0.1861 -0.0705 0.2039  399 ASP B O   
2031 C CB  . ASP B 72  ? 0.9079 1.1230 0.8164 -0.2583 -0.0828 0.2633  399 ASP B CB  
2032 C CG  . ASP B 72  ? 0.9652 1.1005 0.8610 -0.2801 -0.1068 0.2628  399 ASP B CG  
2033 O OD1 . ASP B 72  ? 1.0225 1.1425 0.9170 -0.3161 -0.1245 0.2934  399 ASP B OD1 
2034 O OD2 . ASP B 72  ? 0.9565 1.0445 0.8417 -0.2621 -0.1085 0.2320  399 ASP B OD2 
2035 N N   . THR B 73  ? 0.9243 0.9615 0.7743 -0.2249 -0.1014 0.2418  400 THR B N   
2036 C CA  . THR B 73  ? 0.9352 0.9007 0.7670 -0.1988 -0.1046 0.2180  400 THR B CA  
2037 C C   . THR B 73  ? 0.9170 0.8482 0.7451 -0.1855 -0.1039 0.1848  400 THR B C   
2038 O O   . THR B 73  ? 0.8876 0.8047 0.7118 -0.1551 -0.0947 0.1595  400 THR B O   
2039 C CB  . THR B 73  ? 0.9994 0.8883 0.8122 -0.2118 -0.1248 0.2367  400 THR B CB  
2040 O OG1 . THR B 73  ? 1.0583 0.9155 0.8675 -0.2465 -0.1431 0.2505  400 THR B OG1 
2041 C CG2 . THR B 73  ? 1.0188 0.9351 0.8322 -0.2185 -0.1255 0.2687  400 THR B CG2 
2042 N N   . GLN B 74  ? 0.9437 0.8637 0.7729 -0.2101 -0.1149 0.1872  401 GLN B N   
2043 C CA  . GLN B 74  ? 0.9376 0.8285 0.7603 -0.2027 -0.1163 0.1592  401 GLN B CA  
2044 C C   . GLN B 74  ? 0.8588 0.8095 0.7006 -0.1797 -0.0974 0.1388  401 GLN B C   
2045 O O   . GLN B 74  ? 0.8351 0.7611 0.6693 -0.1579 -0.0924 0.1124  401 GLN B O   
2046 C CB  . GLN B 74  ? 0.9866 0.8593 0.8062 -0.2388 -0.1350 0.1703  401 GLN B CB  
2047 C CG  . GLN B 74  ? 1.0833 0.8611 0.8720 -0.2541 -0.1571 0.1723  401 GLN B CG  
2048 C CD  . GLN B 74  ? 1.1541 0.9245 0.9445 -0.2907 -0.1748 0.2099  401 GLN B CD  
2049 O OE1 . GLN B 74  ? 1.1690 0.9674 0.9687 -0.2895 -0.1695 0.2322  401 GLN B OE1 
2050 N NE2 . GLN B 74  ? 1.1936 0.9251 0.9732 -0.3256 -0.1978 0.2185  401 GLN B NE2 
2051 N N   . HIS B 75  ? 0.8159 0.8445 0.6820 -0.1840 -0.0871 0.1517  402 HIS B N   
2052 C CA  . HIS B 75  ? 0.7563 0.8400 0.6414 -0.1612 -0.0702 0.1333  402 HIS B CA  
2053 C C   . HIS B 75  ? 0.7228 0.8037 0.6024 -0.1282 -0.0577 0.1146  402 HIS B C   
2054 O O   . HIS B 75  ? 0.6956 0.7863 0.5821 -0.1075 -0.0495 0.0919  402 HIS B O   
2055 C CB  . HIS B 75  ? 0.7410 0.9075 0.6523 -0.1712 -0.0614 0.1507  402 HIS B CB  
2056 C CG  . HIS B 75  ? 0.7720 0.9559 0.6978 -0.2006 -0.0724 0.1666  402 HIS B CG  
2057 N ND1 . HIS B 75  ? 0.8027 1.0107 0.7359 -0.2322 -0.0805 0.1996  402 HIS B ND1 
2058 C CD2 . HIS B 75  ? 0.7710 0.9532 0.7059 -0.2054 -0.0786 0.1566  402 HIS B CD2 
2059 C CE1 . HIS B 75  ? 0.8186 1.0404 0.7666 -0.2556 -0.0916 0.2089  402 HIS B CE1 
2060 N NE2 . HIS B 75  ? 0.8027 1.0088 0.7512 -0.2394 -0.0909 0.1828  402 HIS B NE2 
2061 N N   . ILE B 76  ? 0.7180 0.7862 0.5863 -0.1252 -0.0584 0.1263  403 ILE B N   
2062 C CA  . ILE B 76  ? 0.6947 0.7556 0.5572 -0.0972 -0.0506 0.1117  403 ILE B CA  
2063 C C   . ILE B 76  ? 0.7168 0.7134 0.5667 -0.0831 -0.0554 0.0926  403 ILE B C   
2064 O O   . ILE B 76  ? 0.6949 0.6958 0.5488 -0.0600 -0.0473 0.0720  403 ILE B O   
2065 C CB  . ILE B 76  ? 0.7011 0.7705 0.5557 -0.0985 -0.0515 0.1323  403 ILE B CB  
2066 C CG1 . ILE B 76  ? 0.6827 0.8251 0.5474 -0.1100 -0.0430 0.1490  403 ILE B CG1 
2067 C CG2 . ILE B 76  ? 0.6819 0.7444 0.5319 -0.0708 -0.0463 0.1180  403 ILE B CG2 
2068 C CD1 . ILE B 76  ? 0.6970 0.8529 0.5513 -0.1196 -0.0457 0.1762  403 ILE B CD1 
2069 N N   . GLN B 77  ? 0.7613 0.6997 0.5955 -0.0972 -0.0686 0.0991  404 GLN B N   
2070 C CA  . GLN B 77  ? 0.7899 0.6660 0.6079 -0.0831 -0.0720 0.0800  404 GLN B CA  
2071 C C   . GLN B 77  ? 0.7690 0.6537 0.5906 -0.0763 -0.0664 0.0571  404 GLN B C   
2072 O O   . GLN B 77  ? 0.7584 0.6298 0.5772 -0.0535 -0.0592 0.0384  404 GLN B O   
2073 C CB  . GLN B 77  ? 0.8537 0.6609 0.6499 -0.1005 -0.0887 0.0895  404 GLN B CB  
2074 C CG  . GLN B 77  ? 0.8925 0.6310 0.6672 -0.0813 -0.0905 0.0684  404 GLN B CG  
2075 C CD  . GLN B 77  ? 0.8905 0.6260 0.6695 -0.0486 -0.0807 0.0620  404 GLN B CD  
2076 O OE1 . GLN B 77  ? 0.9082 0.6420 0.6906 -0.0456 -0.0841 0.0800  404 GLN B OE1 
2077 N NE2 . GLN B 77  ? 0.8662 0.6047 0.6464 -0.0252 -0.0694 0.0389  404 GLN B NE2 
2078 N N   . GLN B 78  ? 0.7775 0.6891 0.6078 -0.0966 -0.0700 0.0615  405 GLN B N   
2079 C CA  . GLN B 78  ? 0.7619 0.6855 0.5973 -0.0934 -0.0672 0.0443  405 GLN B CA  
2080 C C   . GLN B 78  ? 0.6981 0.6663 0.5525 -0.0696 -0.0529 0.0316  405 GLN B C   
2081 O O   . GLN B 78  ? 0.6847 0.6451 0.5379 -0.0573 -0.0494 0.0146  405 GLN B O   
2082 C CB  . GLN B 78  ? 0.7815 0.7334 0.6279 -0.1206 -0.0755 0.0565  405 GLN B CB  
2083 C CG  . GLN B 78  ? 0.8641 0.7640 0.6887 -0.1480 -0.0939 0.0652  405 GLN B CG  
2084 C CD  . GLN B 78  ? 0.8843 0.8174 0.7232 -0.1778 -0.1045 0.0800  405 GLN B CD  
2085 O OE1 . GLN B 78  ? 0.8663 0.8576 0.7311 -0.1742 -0.0974 0.0796  405 GLN B OE1 
2086 N NE2 . GLN B 78  ? 0.9320 0.8270 0.7554 -0.2074 -0.1230 0.0940  405 GLN B NE2 
2087 N N   . PHE B 79  ? 0.6541 0.6675 0.5236 -0.0648 -0.0457 0.0404  406 PHE B N   
2088 C CA  . PHE B 79  ? 0.5933 0.6434 0.4773 -0.0432 -0.0346 0.0281  406 PHE B CA  
2089 C C   . PHE B 79  ? 0.5932 0.6117 0.4682 -0.0225 -0.0319 0.0154  406 PHE B C   
2090 O O   . PHE B 79  ? 0.5708 0.5972 0.4538 -0.0084 -0.0272 0.0004  406 PHE B O   
2091 C CB  . PHE B 79  ? 0.5695 0.6676 0.4626 -0.0435 -0.0286 0.0399  406 PHE B CB  
2092 C CG  . PHE B 79  ? 0.5328 0.6540 0.4309 -0.0214 -0.0203 0.0272  406 PHE B CG  
2093 C CD1 . PHE B 79  ? 0.4959 0.6489 0.4095 -0.0101 -0.0143 0.0124  406 PHE B CD1 
2094 C CD2 . PHE B 79  ? 0.5346 0.6439 0.4220 -0.0126 -0.0207 0.0310  406 PHE B CD2 
2095 C CE1 . PHE B 79  ? 0.4804 0.6488 0.3959 0.0077  -0.0096 0.0000  406 PHE B CE1 
2096 C CE2 . PHE B 79  ? 0.5138 0.6438 0.4044 0.0045  -0.0161 0.0197  406 PHE B CE2 
2097 C CZ  . PHE B 79  ? 0.4881 0.6457 0.3912 0.0138  -0.0110 0.0033  406 PHE B CZ  
2098 N N   . TYR B 80  ? 0.6098 0.5940 0.4706 -0.0212 -0.0357 0.0236  407 TYR B N   
2099 C CA  . TYR B 80  ? 0.6128 0.5678 0.4676 -0.0008 -0.0333 0.0144  407 TYR B CA  
2100 C C   . TYR B 80  ? 0.6104 0.5322 0.4557 0.0044  -0.0326 -0.0012 407 TYR B C   
2101 O O   . TYR B 80  ? 0.5917 0.5194 0.4433 0.0219  -0.0260 -0.0129 407 TYR B O   
2102 C CB  . TYR B 80  ? 0.6556 0.5786 0.4990 0.0010  -0.0387 0.0282  407 TYR B CB  
2103 C CG  . TYR B 80  ? 0.6579 0.6148 0.5078 0.0005  -0.0386 0.0438  407 TYR B CG  
2104 C CD1 . TYR B 80  ? 0.6270 0.6286 0.4893 0.0123  -0.0321 0.0374  407 TYR B CD1 
2105 C CD2 . TYR B 80  ? 0.7012 0.6423 0.5419 -0.0127 -0.0468 0.0657  407 TYR B CD2 
2106 C CE1 . TYR B 80  ? 0.6416 0.6733 0.5036 0.0112  -0.0328 0.0505  407 TYR B CE1 
2107 C CE2 . TYR B 80  ? 0.7056 0.6800 0.5486 -0.0143 -0.0470 0.0820  407 TYR B CE2 
2108 C CZ  . TYR B 80  ? 0.6717 0.6922 0.5236 -0.0021 -0.0395 0.0734  407 TYR B CZ  
2109 O OH  . TYR B 80  ? 0.7104 0.7635 0.5588 -0.0047 -0.0404 0.0885  407 TYR B OH  
2110 N N   . ASP B 81  ? 0.6260 0.5154 0.4553 -0.0120 -0.0402 -0.0004 408 ASP B N   
2111 C CA  . ASP B 81  ? 0.6369 0.4930 0.4497 -0.0093 -0.0404 -0.0158 408 ASP B CA  
2112 C C   . ASP B 81  ? 0.5871 0.4792 0.4141 -0.0054 -0.0346 -0.0259 408 ASP B C   
2113 O O   . ASP B 81  ? 0.5765 0.4605 0.3990 0.0088  -0.0285 -0.0381 408 ASP B O   
2114 C CB  . ASP B 81  ? 0.6853 0.5032 0.4765 -0.0327 -0.0529 -0.0128 408 ASP B CB  
2115 C CG  . ASP B 81  ? 0.7487 0.5186 0.5231 -0.0378 -0.0616 -0.0028 408 ASP B CG  
2116 O OD1 . ASP B 81  ? 0.7606 0.5160 0.5353 -0.0178 -0.0567 -0.0021 408 ASP B OD1 
2117 O OD2 . ASP B 81  ? 0.7951 0.5413 0.5573 -0.0631 -0.0751 0.0062  408 ASP B OD2 
2118 N N   . LEU B 82  ? 0.5511 0.4851 0.3968 -0.0171 -0.0364 -0.0192 409 LEU B N   
2119 C CA  . LEU B 82  ? 0.5190 0.4880 0.3825 -0.0131 -0.0330 -0.0260 409 LEU B CA  
2120 C C   . LEU B 82  ? 0.5014 0.4854 0.3770 0.0081  -0.0247 -0.0339 409 LEU B C   
2121 O O   . LEU B 82  ? 0.4796 0.4642 0.3571 0.0149  -0.0222 -0.0423 409 LEU B O   
2122 C CB  . LEU B 82  ? 0.4939 0.5062 0.3780 -0.0248 -0.0353 -0.0168 409 LEU B CB  
2123 C CG  . LEU B 82  ? 0.5117 0.5216 0.3919 -0.0490 -0.0454 -0.0076 409 LEU B CG  
2124 C CD1 . LEU B 82  ? 0.4851 0.5465 0.3902 -0.0574 -0.0448 0.0046  409 LEU B CD1 
2125 C CD2 . LEU B 82  ? 0.5122 0.5085 0.3846 -0.0547 -0.0511 -0.0153 409 LEU B CD2 
2126 N N   . LEU B 83  ? 0.5122 0.5077 0.3942 0.0168  -0.0217 -0.0292 410 LEU B N   
2127 C CA  . LEU B 83  ? 0.5026 0.5118 0.3958 0.0342  -0.0168 -0.0347 410 LEU B CA  
2128 C C   . LEU B 83  ? 0.5187 0.5002 0.4023 0.0464  -0.0129 -0.0397 410 LEU B C   
2129 O O   . LEU B 83  ? 0.5021 0.4962 0.3959 0.0553  -0.0094 -0.0456 410 LEU B O   
2130 C CB  . LEU B 83  ? 0.5026 0.5318 0.4019 0.0390  -0.0165 -0.0280 410 LEU B CB  
2131 C CG  . LEU B 83  ? 0.4939 0.5615 0.4041 0.0346  -0.0164 -0.0273 410 LEU B CG  
2132 C CD1 . LEU B 83  ? 0.4913 0.5731 0.3983 0.0387  -0.0165 -0.0202 410 LEU B CD1 
2133 C CD2 . LEU B 83  ? 0.4696 0.5577 0.3958 0.0416  -0.0158 -0.0394 410 LEU B CD2 
2134 N N   . THR B 84  ? 0.5481 0.4929 0.4131 0.0473  -0.0136 -0.0368 411 THR B N   
2135 C CA  . THR B 84  ? 0.5785 0.4979 0.4338 0.0635  -0.0076 -0.0430 411 THR B CA  
2136 C C   . THR B 84  ? 0.5890 0.4992 0.4327 0.0618  -0.0043 -0.0540 411 THR B C   
2137 O O   . THR B 84  ? 0.5951 0.5140 0.4431 0.0758  0.0036  -0.0589 411 THR B O   
2138 C CB  . THR B 84  ? 0.6255 0.5013 0.4629 0.0696  -0.0094 -0.0391 411 THR B CB  
2139 O OG1 . THR B 84  ? 0.6849 0.5248 0.4993 0.0524  -0.0169 -0.0402 411 THR B OG1 
2140 C CG2 . THR B 84  ? 0.6197 0.5068 0.4683 0.0717  -0.0134 -0.0249 411 THR B CG2 
2141 N N   . GLY B 85  ? 0.6033 0.5011 0.4332 0.0436  -0.0109 -0.0558 412 GLY B N   
2142 C CA  . GLY B 85  ? 0.6361 0.5256 0.4508 0.0387  -0.0102 -0.0649 412 GLY B CA  
2143 C C   . GLY B 85  ? 0.6072 0.5363 0.4431 0.0405  -0.0073 -0.0649 412 GLY B C   
2144 O O   . GLY B 85  ? 0.6047 0.5342 0.4324 0.0457  -0.0019 -0.0703 412 GLY B O   
2145 N N   . SER B 86  ? 0.5818 0.5431 0.4434 0.0359  -0.0113 -0.0586 413 SER B N   
2146 C CA  . SER B 86  ? 0.5750 0.5690 0.4599 0.0386  -0.0112 -0.0580 413 SER B CA  
2147 C C   . SER B 86  ? 0.5876 0.5921 0.4828 0.0543  -0.0039 -0.0584 413 SER B C   
2148 O O   . SER B 86  ? 0.5663 0.5872 0.4718 0.0552  -0.0031 -0.0576 413 SER B O   
2149 C CB  . SER B 86  ? 0.5598 0.5795 0.4660 0.0348  -0.0161 -0.0541 413 SER B CB  
2150 O OG  . SER B 86  ? 0.5510 0.5941 0.4790 0.0433  -0.0160 -0.0552 413 SER B OG  
2151 N N   . MET B 87  ? 0.6260 0.6231 0.5202 0.0655  0.0000  -0.0569 414 MET B N   
2152 C CA  . MET B 87  ? 0.6425 0.6554 0.5514 0.0802  0.0056  -0.0541 414 MET B CA  
2153 C C   . MET B 87  ? 0.6591 0.6702 0.5602 0.0886  0.0150  -0.0566 414 MET B C   
2154 O O   . MET B 87  ? 0.6393 0.6776 0.5590 0.0925  0.0176  -0.0519 414 MET B O   
2155 C CB  . MET B 87  ? 0.6758 0.6790 0.5838 0.0902  0.0064  -0.0499 414 MET B CB  
2156 C CG  . MET B 87  ? 0.6938 0.7229 0.6241 0.1022  0.0074  -0.0433 414 MET B CG  
2157 S SD  . MET B 87  ? 0.7561 0.7757 0.6856 0.1116  0.0048  -0.0347 414 MET B SD  
2158 C CE  . MET B 87  ? 0.7208 0.7492 0.6483 0.0951  -0.0050 -0.0330 414 MET B CE  
2159 N N   . GLU B 88  ? 0.6963 0.6758 0.5686 0.0899  0.0196  -0.0636 415 GLU B N   
2160 C CA  . GLU B 88  ? 0.7222 0.6992 0.5797 0.0993  0.0308  -0.0685 415 GLU B CA  
2161 C C   . GLU B 88  ? 0.6972 0.6943 0.5560 0.0865  0.0287  -0.0667 415 GLU B C   
2162 O O   . GLU B 88  ? 0.6927 0.7122 0.5562 0.0927  0.0373  -0.0634 415 GLU B O   
2163 C CB  . GLU B 88  ? 0.8183 0.7487 0.6380 0.1045  0.0347  -0.0801 415 GLU B CB  
2164 C CG  . GLU B 88  ? 0.8971 0.8223 0.7054 0.1287  0.0508  -0.0863 415 GLU B CG  
2165 C CD  . GLU B 88  ? 0.9010 0.8592 0.7438 0.1473  0.0575  -0.0757 415 GLU B CD  
2166 O OE1 . GLU B 88  ? 0.8941 0.8527 0.7551 0.1475  0.0496  -0.0682 415 GLU B OE1 
2167 O OE2 . GLU B 88  ? 0.9119 0.9000 0.7642 0.1605  0.0702  -0.0732 415 GLU B OE2 
2168 N N   . ILE B 89  ? 0.6534 0.6465 0.5111 0.0686  0.0170  -0.0663 416 ILE B N   
2169 C CA  . ILE B 89  ? 0.6150 0.6236 0.4743 0.0556  0.0121  -0.0626 416 ILE B CA  
2170 C C   . ILE B 89  ? 0.5582 0.6017 0.4528 0.0553  0.0086  -0.0524 416 ILE B C   
2171 O O   . ILE B 89  ? 0.5565 0.6177 0.4551 0.0517  0.0099  -0.0459 416 ILE B O   
2172 C CB  . ILE B 89  ? 0.6173 0.6113 0.4656 0.0381  0.0001  -0.0640 416 ILE B CB  
2173 C CG1 . ILE B 89  ? 0.6755 0.6344 0.4821 0.0341  0.0018  -0.0735 416 ILE B CG1 
2174 C CG2 . ILE B 89  ? 0.6028 0.6190 0.4654 0.0261  -0.0084 -0.0561 416 ILE B CG2 
2175 C CD1 . ILE B 89  ? 0.6990 0.6380 0.4939 0.0166  -0.0109 -0.0742 416 ILE B CD1 
2176 N N   . ILE B 90  ? 0.5106 0.5624 0.4280 0.0581  0.0035  -0.0507 417 ILE B N   
2177 C CA  . ILE B 90  ? 0.4717 0.5491 0.4197 0.0572  -0.0025 -0.0436 417 ILE B CA  
2178 C C   . ILE B 90  ? 0.4651 0.5622 0.4236 0.0662  0.0056  -0.0367 417 ILE B C   
2179 O O   . ILE B 90  ? 0.4515 0.5695 0.4267 0.0604  0.0023  -0.0272 417 ILE B O   
2180 C CB  . ILE B 90  ? 0.4453 0.5247 0.4087 0.0576  -0.0108 -0.0465 417 ILE B CB  
2181 C CG1 . ILE B 90  ? 0.4206 0.4929 0.3811 0.0484  -0.0182 -0.0501 417 ILE B CG1 
2182 C CG2 . ILE B 90  ? 0.4209 0.5198 0.4109 0.0574  -0.0185 -0.0419 417 ILE B CG2 
2183 C CD1 . ILE B 90  ? 0.4074 0.4829 0.3750 0.0504  -0.0221 -0.0544 417 ILE B CD1 
2184 N N   . ARG B 91  ? 0.4961 0.5878 0.4462 0.0802  0.0159  -0.0393 418 ARG B N   
2185 C CA  . ARG B 91  ? 0.5152 0.6310 0.4761 0.0920  0.0267  -0.0317 418 ARG B CA  
2186 C C   . ARG B 91  ? 0.5182 0.6457 0.4679 0.0884  0.0349  -0.0280 418 ARG B C   
2187 O O   . ARG B 91  ? 0.5181 0.6789 0.4879 0.0867  0.0371  -0.0153 418 ARG B O   
2188 C CB  . ARG B 91  ? 0.5509 0.6555 0.5032 0.1113  0.0374  -0.0358 418 ARG B CB  
2189 C CG  . ARG B 91  ? 0.5892 0.7291 0.5658 0.1251  0.0459  -0.0247 418 ARG B CG  
2190 C CD  . ARG B 91  ? 0.6446 0.7737 0.6171 0.1477  0.0555  -0.0272 418 ARG B CD  
2191 N NE  . ARG B 91  ? 0.6490 0.7925 0.6474 0.1510  0.0464  -0.0183 418 ARG B NE  
2192 C CZ  . ARG B 91  ? 0.6844 0.8026 0.6750 0.1509  0.0381  -0.0218 418 ARG B CZ  
2193 N NH1 . ARG B 91  ? 0.7214 0.7989 0.6824 0.1465  0.0374  -0.0331 418 ARG B NH1 
2194 N NH2 . ARG B 91  ? 0.6666 0.8026 0.6788 0.1530  0.0294  -0.0123 418 ARG B NH2 
2195 N N   . GLY B 92  ? 0.5315 0.6331 0.4485 0.0845  0.0374  -0.0375 419 GLY B N   
2196 C CA  . GLY B 92  ? 0.5405 0.6506 0.4393 0.0781  0.0430  -0.0349 419 GLY B CA  
2197 C C   . GLY B 92  ? 0.5262 0.6591 0.4469 0.0604  0.0308  -0.0206 419 GLY B C   
2198 O O   . GLY B 92  ? 0.5528 0.7138 0.4781 0.0571  0.0362  -0.0085 419 GLY B O   
2199 N N   . TRP B 93  ? 0.4803 0.6020 0.4151 0.0498  0.0146  -0.0211 420 TRP B N   
2200 C CA  . TRP B 93  ? 0.4503 0.5862 0.4090 0.0355  0.0004  -0.0086 420 TRP B CA  
2201 C C   . TRP B 93  ? 0.4404 0.6047 0.4309 0.0358  -0.0011 0.0044  420 TRP B C   
2202 O O   . TRP B 93  ? 0.4283 0.6132 0.4306 0.0253  -0.0048 0.0202  420 TRP B O   
2203 C CB  . TRP B 93  ? 0.4233 0.5413 0.3916 0.0304  -0.0140 -0.0150 420 TRP B CB  
2204 C CG  . TRP B 93  ? 0.4000 0.5257 0.3974 0.0218  -0.0296 -0.0060 420 TRP B CG  
2205 C CD1 . TRP B 93  ? 0.4070 0.5340 0.4102 0.0100  -0.0405 0.0041  420 TRP B CD1 
2206 C CD2 . TRP B 93  ? 0.3806 0.5091 0.4034 0.0244  -0.0382 -0.0071 420 TRP B CD2 
2207 N NE1 . TRP B 93  ? 0.3903 0.5169 0.4224 0.0065  -0.0554 0.0089  420 TRP B NE1 
2208 C CE2 . TRP B 93  ? 0.3756 0.5023 0.4182 0.0147  -0.0543 0.0007  420 TRP B CE2 
2209 C CE3 . TRP B 93  ? 0.3742 0.5051 0.4035 0.0336  -0.0354 -0.0136 420 TRP B CE3 
2210 C CZ2 . TRP B 93  ? 0.3689 0.4915 0.4345 0.0143  -0.0676 -0.0007 420 TRP B CZ2 
2211 C CZ3 . TRP B 93  ? 0.3611 0.4927 0.4123 0.0316  -0.0487 -0.0142 420 TRP B CZ3 
2212 C CH2 . TRP B 93  ? 0.3697 0.4949 0.4374 0.0222  -0.0646 -0.0093 420 TRP B CH2 
2213 N N   . ALA B 94  ? 0.4336 0.5997 0.4378 0.0458  -0.0002 0.0000  421 ALA B N   
2214 C CA  . ALA B 94  ? 0.4319 0.6259 0.4668 0.0448  -0.0039 0.0126  421 ALA B CA  
2215 C C   . ALA B 94  ? 0.4520 0.6816 0.4917 0.0457  0.0089  0.0283  421 ALA B C   
2216 O O   . ALA B 94  ? 0.4341 0.6896 0.4993 0.0333  0.0010  0.0462  421 ALA B O   
2217 C CB  . ALA B 94  ? 0.4174 0.6096 0.4596 0.0569  -0.0029 0.0056  421 ALA B CB  
2218 N N   . GLU B 95  ? 0.4881 0.7180 0.5021 0.0596  0.0283  0.0217  422 GLU B N   
2219 C CA  . GLU B 95  ? 0.5363 0.8037 0.5504 0.0653  0.0454  0.0339  422 GLU B CA  
2220 C C   . GLU B 95  ? 0.5386 0.8225 0.5463 0.0481  0.0437  0.0480  422 GLU B C   
2221 O O   . GLU B 95  ? 0.5528 0.8778 0.5671 0.0484  0.0559  0.0638  422 GLU B O   
2222 C CB  . GLU B 95  ? 0.5852 0.8444 0.5716 0.0896  0.0673  0.0194  422 GLU B CB  
2223 C CG  . GLU B 95  ? 0.5995 0.8735 0.6089 0.1085  0.0735  0.0205  422 GLU B CG  
2224 C CD  . GLU B 95  ? 0.6544 0.8938 0.6368 0.1313  0.0849  0.0010  422 GLU B CD  
2225 O OE1 . GLU B 95  ? 0.6950 0.9110 0.6389 0.1391  0.0969  -0.0127 422 GLU B OE1 
2226 O OE2 . GLU B 95  ? 0.6694 0.9029 0.6679 0.1410  0.0805  0.0000  422 GLU B OE2 
2227 N N   . LYS B 96  ? 0.5214 0.7777 0.5196 0.0332  0.0282  0.0450  423 LYS B N   
2228 C CA  . LYS B 96  ? 0.5268 0.7943 0.5195 0.0152  0.0222  0.0605  423 LYS B CA  
2229 C C   . LYS B 96  ? 0.4983 0.7733 0.5277 -0.0044 0.0000  0.0801  423 LYS B C   
2230 O O   . LYS B 96  ? 0.5179 0.8020 0.5477 -0.0209 -0.0080 0.0973  423 LYS B O   
2231 C CB  . LYS B 96  ? 0.5501 0.7840 0.5067 0.0115  0.0189  0.0472  423 LYS B CB  
2232 C CG  . LYS B 96  ? 0.5997 0.8259 0.5127 0.0253  0.0391  0.0316  423 LYS B CG  
2233 C CD  . LYS B 96  ? 0.6271 0.8094 0.5118 0.0242  0.0318  0.0124  423 LYS B CD  
2234 C CE  . LYS B 96  ? 0.6684 0.8362 0.5020 0.0302  0.0456  -0.0016 423 LYS B CE  
2235 N NZ  . LYS B 96  ? 0.6909 0.8747 0.5038 0.0142  0.0430  0.0108  423 LYS B NZ  
2236 N N   . ILE B 97  ? 0.4552 0.7239 0.5132 -0.0034 -0.0117 0.0778  424 ILE B N   
2237 C CA  . ILE B 97  ? 0.4364 0.7075 0.5277 -0.0215 -0.0340 0.0945  424 ILE B CA  
2238 C C   . ILE B 97  ? 0.4328 0.7523 0.5462 -0.0299 -0.0284 0.1201  424 ILE B C   
2239 O O   . ILE B 97  ? 0.4256 0.7707 0.5490 -0.0185 -0.0163 0.1199  424 ILE B O   
2240 C CB  . ILE B 97  ? 0.4226 0.6692 0.5319 -0.0181 -0.0493 0.0810  424 ILE B CB  
2241 C CG1 . ILE B 97  ? 0.4256 0.6317 0.5168 -0.0107 -0.0544 0.0587  424 ILE B CG1 
2242 C CG2 . ILE B 97  ? 0.4211 0.6682 0.5628 -0.0366 -0.0729 0.0973  424 ILE B CG2 
2243 C CD1 . ILE B 97  ? 0.4177 0.6056 0.5162 -0.0020 -0.0615 0.0417  424 ILE B CD1 
2244 N N   . PRO B 98  ? 0.4397 0.7752 0.5630 -0.0503 -0.0377 0.1450  425 PRO B N   
2245 C CA  . PRO B 98  ? 0.4434 0.8325 0.5905 -0.0607 -0.0318 0.1733  425 PRO B CA  
2246 C C   . PRO B 98  ? 0.4246 0.8238 0.6086 -0.0643 -0.0442 0.1782  425 PRO B C   
2247 O O   . PRO B 98  ? 0.4146 0.7759 0.6108 -0.0716 -0.0679 0.1700  425 PRO B O   
2248 C CB  . PRO B 98  ? 0.4612 0.8543 0.6161 -0.0867 -0.0481 0.2004  425 PRO B CB  
2249 C CG  . PRO B 98  ? 0.4685 0.8182 0.5948 -0.0841 -0.0540 0.1847  425 PRO B CG  
2250 C CD  . PRO B 98  ? 0.4440 0.7527 0.5647 -0.0662 -0.0569 0.1525  425 PRO B CD  
2251 N N   . GLY B 99  ? 0.4176 0.8672 0.6168 -0.0568 -0.0275 0.1893  426 GLY B N   
2252 C CA  . GLY B 99  ? 0.4013 0.8689 0.6358 -0.0603 -0.0386 0.1964  426 GLY B CA  
2253 C C   . GLY B 99  ? 0.3932 0.8456 0.6203 -0.0358 -0.0308 0.1707  426 GLY B C   
2254 O O   . GLY B 99  ? 0.3912 0.8753 0.6446 -0.0325 -0.0310 0.1790  426 GLY B O   
2255 N N   . PHE B 100 ? 0.3879 0.7942 0.5814 -0.0203 -0.0257 0.1423  427 PHE B N   
2256 C CA  . PHE B 100 ? 0.3787 0.7660 0.5632 0.0003  -0.0207 0.1198  427 PHE B CA  
2257 C C   . PHE B 100 ? 0.3826 0.8094 0.5694 0.0226  0.0045  0.1227  427 PHE B C   
2258 O O   . PHE B 100 ? 0.3740 0.8173 0.5811 0.0305  0.0024  0.1246  427 PHE B O   
2259 C CB  . PHE B 100 ? 0.3712 0.7059 0.5204 0.0101  -0.0196 0.0925  427 PHE B CB  
2260 C CG  . PHE B 100 ? 0.3605 0.6748 0.5010 0.0275  -0.0172 0.0727  427 PHE B CG  
2261 C CD1 . PHE B 100 ? 0.3536 0.6471 0.5043 0.0215  -0.0373 0.0649  427 PHE B CD1 
2262 C CD2 . PHE B 100 ? 0.3630 0.6773 0.4830 0.0498  0.0042  0.0619  427 PHE B CD2 
2263 C CE1 . PHE B 100 ? 0.3458 0.6245 0.4868 0.0358  -0.0353 0.0495  427 PHE B CE1 
2264 C CE2 . PHE B 100 ? 0.3644 0.6592 0.4775 0.0639  0.0046  0.0474  427 PHE B CE2 
2265 C CZ  . PHE B 100 ? 0.3507 0.6307 0.4747 0.0561  -0.0148 0.0426  427 PHE B CZ  
2266 N N   . ALA B 101 ? 0.3956 0.8366 0.5601 0.0337  0.0278  0.1225  428 ALA B N   
2267 C CA  . ALA B 101 ? 0.4028 0.8781 0.5659 0.0595  0.0544  0.1224  428 ALA B CA  
2268 C C   . ALA B 101 ? 0.4004 0.9457 0.6079 0.0554  0.0580  0.1523  428 ALA B C   
2269 O O   . ALA B 101 ? 0.4074 0.9895 0.6242 0.0791  0.0790  0.1553  428 ALA B O   
2270 C CB  . ALA B 101 ? 0.4283 0.8967 0.5504 0.0721  0.0773  0.1115  428 ALA B CB  
2271 N N   . ASP B 102 ? 0.3877 0.9496 0.6239 0.0255  0.0363  0.1748  429 ASP B N   
2272 C CA  . ASP B 102 ? 0.3779 1.0031 0.6619 0.0131  0.0312  0.2065  429 ASP B CA  
2273 C C   . ASP B 102 ? 0.3643 0.9922 0.6774 0.0145  0.0147  0.2066  429 ASP B C   
2274 O O   . ASP B 102 ? 0.3553 1.0418 0.7091 0.0104  0.0138  0.2317  429 ASP B O   
2275 C CB  . ASP B 102 ? 0.3819 1.0153 0.6838 -0.0235 0.0095  0.2314  429 ASP B CB  
2276 C CG  . ASP B 102 ? 0.4014 1.0516 0.6824 -0.0288 0.0253  0.2420  429 ASP B CG  
2277 O OD1 . ASP B 102 ? 0.4099 1.0644 0.6585 -0.0040 0.0538  0.2273  429 ASP B OD1 
2278 O OD2 . ASP B 102 ? 0.4094 1.0663 0.7051 -0.0591 0.0073  0.2656  429 ASP B OD2 
2279 N N   . LEU B 103 ? 0.3621 0.9308 0.6548 0.0186  0.0009  0.1808  430 LEU B N   
2280 C CA  . LEU B 103 ? 0.3640 0.9311 0.6760 0.0203  -0.0151 0.1786  430 LEU B CA  
2281 C C   . LEU B 103 ? 0.3778 0.9700 0.6931 0.0532  0.0071  0.1749  430 LEU B C   
2282 O O   . LEU B 103 ? 0.3906 0.9695 0.6774 0.0774  0.0317  0.1599  430 LEU B O   
2283 C CB  . LEU B 103 ? 0.3487 0.8480 0.6348 0.0145  -0.0353 0.1526  430 LEU B CB  
2284 C CG  . LEU B 103 ? 0.3541 0.8203 0.6355 -0.0126 -0.0572 0.1526  430 LEU B CG  
2285 C CD1 . LEU B 103 ? 0.3549 0.7565 0.6044 -0.0090 -0.0676 0.1227  430 LEU B CD1 
2286 C CD2 . LEU B 103 ? 0.3620 0.8505 0.6799 -0.0413 -0.0842 0.1756  430 LEU B CD2 
2287 N N   . PRO B 104 ? 0.3847 1.0118 0.7346 0.0543  -0.0030 0.1892  431 PRO B N   
2288 C CA  . PRO B 104 ? 0.3953 1.0375 0.7485 0.0878  0.0145  0.1847  431 PRO B CA  
2289 C C   . PRO B 104 ? 0.4099 0.9836 0.7172 0.1055  0.0198  0.1524  431 PRO B C   
2290 O O   . PRO B 104 ? 0.4191 0.9427 0.7040 0.0894  0.0013  0.1365  431 PRO B O   
2291 C CB  . PRO B 104 ? 0.3823 1.0531 0.7724 0.0778  -0.0086 0.2012  431 PRO B CB  
2292 C CG  . PRO B 104 ? 0.3759 1.0530 0.7844 0.0385  -0.0368 0.2158  431 PRO B CG  
2293 C CD  . PRO B 104 ? 0.3790 1.0365 0.7680 0.0249  -0.0311 0.2126  431 PRO B CD  
2294 N N   . LYS B 105 ? 0.4273 0.9989 0.7208 0.1383  0.0446  0.1431  432 LYS B N   
2295 C CA  . LYS B 105 ? 0.4351 0.9432 0.6865 0.1542  0.0498  0.1155  432 LYS B CA  
2296 C C   . LYS B 105 ? 0.4182 0.8934 0.6656 0.1437  0.0253  0.1082  432 LYS B C   
2297 O O   . LYS B 105 ? 0.4191 0.8415 0.6329 0.1378  0.0194  0.0882  432 LYS B O   
2298 C CB  . LYS B 105 ? 0.4669 0.9793 0.7118 0.1923  0.0757  0.1102  432 LYS B CB  
2299 C CG  . LYS B 105 ? 0.5022 0.9459 0.7007 0.2077  0.0823  0.0829  432 LYS B CG  
2300 C CD  . LYS B 105 ? 0.5106 0.9139 0.6685 0.1939  0.0854  0.0652  432 LYS B CD  
2301 C CE  . LYS B 105 ? 0.5478 0.8964 0.6626 0.2139  0.0986  0.0417  432 LYS B CE  
2302 N NZ  . LYS B 105 ? 0.5712 0.8689 0.6685 0.2076  0.0824  0.0300  432 LYS B NZ  
2303 N N   . ALA B 106 ? 0.4084 0.9198 0.6904 0.1401  0.0109  0.1259  433 ALA B N   
2304 C CA  . ALA B 106 ? 0.4000 0.8892 0.6784 0.1293  -0.0132 0.1215  433 ALA B CA  
2305 C C   . ALA B 106 ? 0.3947 0.8514 0.6565 0.0996  -0.0346 0.1103  433 ALA B C   
2306 O O   . ALA B 106 ? 0.4018 0.8189 0.6386 0.0956  -0.0462 0.0942  433 ALA B O   
2307 C CB  . ALA B 106 ? 0.3830 0.9251 0.7037 0.1289  -0.0256 0.1459  433 ALA B CB  
2308 N N   . ASP B 107 ? 0.3920 0.8665 0.6683 0.0798  -0.0395 0.1197  434 ASP B N   
2309 C CA  . ASP B 107 ? 0.3882 0.8285 0.6505 0.0544  -0.0588 0.1093  434 ASP B CA  
2310 C C   . ASP B 107 ? 0.3973 0.7899 0.6218 0.0602  -0.0468 0.0873  434 ASP B C   
2311 O O   . ASP B 107 ? 0.4034 0.7550 0.6062 0.0513  -0.0594 0.0699  434 ASP B O   
2312 C CB  . ASP B 107 ? 0.3850 0.8583 0.6778 0.0301  -0.0706 0.1306  434 ASP B CB  
2313 C CG  . ASP B 107 ? 0.3909 0.9025 0.7194 0.0145  -0.0934 0.1509  434 ASP B CG  
2314 O OD1 . ASP B 107 ? 0.3841 0.8989 0.7136 0.0228  -0.1007 0.1487  434 ASP B OD1 
2315 O OD2 . ASP B 107 ? 0.3959 0.9355 0.7522 -0.0086 -0.1062 0.1712  434 ASP B OD2 
2316 N N   . GLN B 108 ? 0.4043 0.8034 0.6199 0.0758  -0.0225 0.0874  435 GLN B N   
2317 C CA  . GLN B 108 ? 0.4113 0.7665 0.5895 0.0815  -0.0117 0.0673  435 GLN B CA  
2318 C C   . GLN B 108 ? 0.4184 0.7335 0.5707 0.0921  -0.0133 0.0483  435 GLN B C   
2319 O O   . GLN B 108 ? 0.3980 0.6769 0.5286 0.0838  -0.0206 0.0332  435 GLN B O   
2320 C CB  . GLN B 108 ? 0.4180 0.7865 0.5863 0.0977  0.0140  0.0692  435 GLN B CB  
2321 C CG  . GLN B 108 ? 0.4167 0.8172 0.5988 0.0838  0.0172  0.0854  435 GLN B CG  
2322 C CD  . GLN B 108 ? 0.4260 0.8458 0.5952 0.1020  0.0446  0.0866  435 GLN B CD  
2323 O OE1 . GLN B 108 ? 0.4355 0.9081 0.6300 0.1095  0.0567  0.1049  435 GLN B OE1 
2324 N NE2 . GLN B 108 ? 0.4269 0.8064 0.5562 0.1095  0.0546  0.0671  435 GLN B NE2 
2325 N N   . ASP B 109 ? 0.4279 0.7532 0.5850 0.1105  -0.0064 0.0517  436 ASP B N   
2326 C CA  . ASP B 109 ? 0.4401 0.7335 0.5764 0.1192  -0.0092 0.0397  436 ASP B CA  
2327 C C   . ASP B 109 ? 0.4340 0.7152 0.5674 0.1016  -0.0312 0.0338  436 ASP B C   
2328 O O   . ASP B 109 ? 0.4501 0.6973 0.5577 0.0982  -0.0336 0.0183  436 ASP B O   
2329 C CB  . ASP B 109 ? 0.4497 0.7626 0.6005 0.1397  -0.0035 0.0506  436 ASP B CB  
2330 C CG  . ASP B 109 ? 0.4700 0.7829 0.6155 0.1640  0.0201  0.0501  436 ASP B CG  
2331 O OD1 . ASP B 109 ? 0.4719 0.7636 0.5943 0.1639  0.0319  0.0387  436 ASP B OD1 
2332 O OD2 . ASP B 109 ? 0.4868 0.8210 0.6507 0.1841  0.0260  0.0612  436 ASP B OD2 
2333 N N   . LEU B 110 ? 0.4142 0.7245 0.5732 0.0902  -0.0472 0.0461  437 LEU B N   
2334 C CA  . LEU B 110 ? 0.4054 0.7028 0.5583 0.0737  -0.0695 0.0383  437 LEU B CA  
2335 C C   . LEU B 110 ? 0.3984 0.6623 0.5326 0.0617  -0.0744 0.0212  437 LEU B C   
2336 O O   . LEU B 110 ? 0.4001 0.6382 0.5118 0.0607  -0.0802 0.0055  437 LEU B O   
2337 C CB  . LEU B 110 ? 0.3909 0.7233 0.5743 0.0598  -0.0885 0.0547  437 LEU B CB  
2338 C CG  . LEU B 110 ? 0.4038 0.7226 0.5790 0.0419  -0.1148 0.0459  437 LEU B CG  
2339 C CD1 . LEU B 110 ? 0.4064 0.7054 0.5528 0.0499  -0.1169 0.0326  437 LEU B CD1 
2340 C CD2 . LEU B 110 ? 0.4088 0.7654 0.6164 0.0268  -0.1343 0.0659  437 LEU B CD2 
2341 N N   . LEU B 111 ? 0.3935 0.6612 0.5380 0.0538  -0.0717 0.0262  438 LEU B N   
2342 C CA  . LEU B 111 ? 0.4028 0.6410 0.5349 0.0437  -0.0773 0.0138  438 LEU B CA  
2343 C C   . LEU B 111 ? 0.4038 0.6139 0.5077 0.0546  -0.0635 -0.0014 438 LEU B C   
2344 O O   . LEU B 111 ? 0.4067 0.5925 0.4954 0.0522  -0.0703 -0.0165 438 LEU B O   
2345 C CB  . LEU B 111 ? 0.3936 0.6447 0.5437 0.0319  -0.0781 0.0274  438 LEU B CB  
2346 C CG  . LEU B 111 ? 0.4086 0.6848 0.5893 0.0137  -0.0964 0.0452  438 LEU B CG  
2347 C CD1 . LEU B 111 ? 0.4022 0.6926 0.5978 0.0023  -0.0937 0.0615  438 LEU B CD1 
2348 C CD2 . LEU B 111 ? 0.4250 0.6762 0.6040 -0.0004 -0.1230 0.0346  438 LEU B CD2 
2349 N N   . PHE B 112 ? 0.4141 0.6284 0.5110 0.0665  -0.0447 0.0022  439 PHE B N   
2350 C CA  . PHE B 112 ? 0.4473 0.6344 0.5176 0.0735  -0.0336 -0.0101 439 PHE B CA  
2351 C C   . PHE B 112 ? 0.4549 0.6259 0.5091 0.0782  -0.0366 -0.0203 439 PHE B C   
2352 O O   . PHE B 112 ? 0.4574 0.6088 0.4963 0.0750  -0.0381 -0.0317 439 PHE B O   
2353 C CB  . PHE B 112 ? 0.4624 0.6514 0.5234 0.0858  -0.0145 -0.0064 439 PHE B CB  
2354 C CG  . PHE B 112 ? 0.4785 0.6362 0.5109 0.0920  -0.0065 -0.0184 439 PHE B CG  
2355 C CD1 . PHE B 112 ? 0.4708 0.6098 0.4876 0.0839  -0.0061 -0.0260 439 PHE B CD1 
2356 C CD2 . PHE B 112 ? 0.5008 0.6478 0.5234 0.1038  -0.0021 -0.0199 439 PHE B CD2 
2357 C CE1 . PHE B 112 ? 0.4823 0.5946 0.4746 0.0858  -0.0015 -0.0349 439 PHE B CE1 
2358 C CE2 . PHE B 112 ? 0.5180 0.6342 0.5150 0.1055  0.0022  -0.0287 439 PHE B CE2 
2359 C CZ  . PHE B 112 ? 0.4956 0.5954 0.4777 0.0956  0.0024  -0.0363 439 PHE B CZ  
2360 N N   . GLU B 113 ? 0.4614 0.6450 0.5207 0.0859  -0.0371 -0.0138 440 GLU B N   
2361 C CA  . GLU B 113 ? 0.4805 0.6536 0.5242 0.0896  -0.0400 -0.0189 440 GLU B CA  
2362 C C   . GLU B 113 ? 0.4823 0.6526 0.5204 0.0798  -0.0545 -0.0290 440 GLU B C   
2363 O O   . GLU B 113 ? 0.5040 0.6620 0.5230 0.0804  -0.0533 -0.0377 440 GLU B O   
2364 C CB  . GLU B 113 ? 0.4848 0.6748 0.5381 0.0998  -0.0398 -0.0062 440 GLU B CB  
2365 C CG  . GLU B 113 ? 0.5017 0.6882 0.5554 0.1155  -0.0237 0.0002  440 GLU B CG  
2366 C CD  . GLU B 113 ? 0.5161 0.7266 0.5895 0.1285  -0.0238 0.0157  440 GLU B CD  
2367 O OE1 . GLU B 113 ? 0.5236 0.7518 0.6068 0.1238  -0.0378 0.0228  440 GLU B OE1 
2368 O OE2 . GLU B 113 ? 0.5334 0.7449 0.6112 0.1447  -0.0097 0.0204  440 GLU B OE2 
2369 N N   . SER B 114 ? 0.4570 0.6387 0.5107 0.0706  -0.0684 -0.0280 441 SER B N   
2370 C CA  . SER B 114 ? 0.4676 0.6406 0.5118 0.0632  -0.0828 -0.0415 441 SER B CA  
2371 C C   . SER B 114 ? 0.4693 0.6211 0.5031 0.0621  -0.0803 -0.0563 441 SER B C   
2372 O O   . SER B 114 ? 0.4731 0.6163 0.4920 0.0628  -0.0851 -0.0706 441 SER B O   
2373 C CB  . SER B 114 ? 0.4776 0.6611 0.5398 0.0518  -0.1011 -0.0371 441 SER B CB  
2374 O OG  . SER B 114 ? 0.5062 0.7144 0.5791 0.0527  -0.1055 -0.0226 441 SER B OG  
2375 N N   . ALA B 115 ? 0.4600 0.6066 0.5013 0.0616  -0.0720 -0.0521 442 ALA B N   
2376 C CA  . ALA B 115 ? 0.4548 0.5852 0.4927 0.0599  -0.0717 -0.0617 442 ALA B CA  
2377 C C   . ALA B 115 ? 0.4463 0.5703 0.4703 0.0650  -0.0571 -0.0630 442 ALA B C   
2378 O O   . ALA B 115 ? 0.4499 0.5651 0.4717 0.0644  -0.0567 -0.0699 442 ALA B O   
2379 C CB  . ALA B 115 ? 0.4499 0.5796 0.5064 0.0516  -0.0774 -0.0535 442 ALA B CB  
2380 N N   . PHE B 116 ? 0.4387 0.5661 0.4546 0.0700  -0.0469 -0.0558 443 PHE B N   
2381 C CA  . PHE B 116 ? 0.4343 0.5503 0.4357 0.0718  -0.0356 -0.0557 443 PHE B CA  
2382 C C   . PHE B 116 ? 0.4214 0.5329 0.4130 0.0698  -0.0355 -0.0644 443 PHE B C   
2383 O O   . PHE B 116 ? 0.4265 0.5312 0.4159 0.0662  -0.0324 -0.0650 443 PHE B O   
2384 C CB  . PHE B 116 ? 0.4278 0.5401 0.4189 0.0786  -0.0271 -0.0486 443 PHE B CB  
2385 C CG  . PHE B 116 ? 0.4545 0.5492 0.4273 0.0772  -0.0201 -0.0500 443 PHE B CG  
2386 C CD1 . PHE B 116 ? 0.4638 0.5459 0.4301 0.0733  -0.0155 -0.0513 443 PHE B CD1 
2387 C CD2 . PHE B 116 ? 0.4641 0.5560 0.4251 0.0770  -0.0199 -0.0488 443 PHE B CD2 
2388 C CE1 . PHE B 116 ? 0.4840 0.5486 0.4329 0.0684  -0.0124 -0.0522 443 PHE B CE1 
2389 C CE2 . PHE B 116 ? 0.4825 0.5584 0.4285 0.0718  -0.0160 -0.0475 443 PHE B CE2 
2390 C CZ  . PHE B 116 ? 0.4896 0.5507 0.4298 0.0671  -0.0130 -0.0498 443 PHE B CZ  
2391 N N   . LEU B 117 ? 0.4188 0.5378 0.4042 0.0722  -0.0383 -0.0696 444 LEU B N   
2392 C CA  . LEU B 117 ? 0.4364 0.5599 0.4134 0.0720  -0.0353 -0.0759 444 LEU B CA  
2393 C C   . LEU B 117 ? 0.4345 0.5585 0.4228 0.0729  -0.0400 -0.0857 444 LEU B C   
2394 O O   . LEU B 117 ? 0.4115 0.5391 0.4012 0.0721  -0.0360 -0.0864 444 LEU B O   
2395 C CB  . LEU B 117 ? 0.4573 0.5934 0.4221 0.0749  -0.0360 -0.0787 444 LEU B CB  
2396 C CG  . LEU B 117 ? 0.4842 0.6209 0.4353 0.0731  -0.0302 -0.0668 444 LEU B CG  
2397 C CD1 . LEU B 117 ? 0.4957 0.6498 0.4331 0.0745  -0.0318 -0.0684 444 LEU B CD1 
2398 C CD2 . LEU B 117 ? 0.4796 0.6095 0.4263 0.0671  -0.0230 -0.0608 444 LEU B CD2 
2399 N N   . GLU B 118 ? 0.4330 0.5528 0.4310 0.0741  -0.0500 -0.0914 445 GLU B N   
2400 C CA  . GLU B 118 ? 0.4438 0.5563 0.4549 0.0757  -0.0576 -0.0993 445 GLU B CA  
2401 C C   . GLU B 118 ? 0.4386 0.5459 0.4599 0.0705  -0.0558 -0.0902 445 GLU B C   
2402 O O   . GLU B 118 ? 0.4532 0.5613 0.4816 0.0731  -0.0563 -0.0934 445 GLU B O   
2403 C CB  . GLU B 118 ? 0.4711 0.5744 0.4898 0.0739  -0.0716 -0.1040 445 GLU B CB  
2404 C CG  . GLU B 118 ? 0.5196 0.6253 0.5241 0.0794  -0.0763 -0.1182 445 GLU B CG  
2405 C CD  . GLU B 118 ? 0.5665 0.6605 0.5758 0.0742  -0.0935 -0.1225 445 GLU B CD  
2406 O OE1 . GLU B 118 ? 0.6041 0.7071 0.6112 0.0684  -0.0968 -0.1140 445 GLU B OE1 
2407 O OE2 . GLU B 118 ? 0.5873 0.6623 0.6037 0.0754  -0.1051 -0.1330 445 GLU B OE2 
2408 N N   . LEU B 119 ? 0.4102 0.5149 0.4312 0.0643  -0.0531 -0.0785 446 LEU B N   
2409 C CA  . LEU B 119 ? 0.3959 0.4965 0.4201 0.0583  -0.0511 -0.0699 446 LEU B CA  
2410 C C   . LEU B 119 ? 0.3884 0.4900 0.4014 0.0565  -0.0435 -0.0688 446 LEU B C   
2411 O O   . LEU B 119 ? 0.3790 0.4801 0.3973 0.0522  -0.0462 -0.0656 446 LEU B O   
2412 C CB  . LEU B 119 ? 0.3979 0.4988 0.4212 0.0542  -0.0478 -0.0593 446 LEU B CB  
2413 C CG  . LEU B 119 ? 0.3995 0.5043 0.4398 0.0509  -0.0577 -0.0547 446 LEU B CG  
2414 C CD1 . LEU B 119 ? 0.4077 0.5240 0.4480 0.0509  -0.0506 -0.0443 446 LEU B CD1 
2415 C CD2 . LEU B 119 ? 0.4014 0.5007 0.4550 0.0438  -0.0671 -0.0493 446 LEU B CD2 
2416 N N   . PHE B 120 ? 0.3821 0.4853 0.3807 0.0580  -0.0361 -0.0692 447 PHE B N   
2417 C CA  . PHE B 120 ? 0.3874 0.4906 0.3753 0.0529  -0.0311 -0.0662 447 PHE B CA  
2418 C C   . PHE B 120 ? 0.3820 0.5005 0.3821 0.0541  -0.0337 -0.0698 447 PHE B C   
2419 O O   . PHE B 120 ? 0.3859 0.5074 0.3886 0.0475  -0.0348 -0.0647 447 PHE B O   
2420 C CB  . PHE B 120 ? 0.3918 0.4931 0.3644 0.0536  -0.0252 -0.0641 447 PHE B CB  
2421 C CG  . PHE B 120 ? 0.4082 0.5140 0.3733 0.0462  -0.0226 -0.0597 447 PHE B CG  
2422 C CD1 . PHE B 120 ? 0.4155 0.5049 0.3686 0.0357  -0.0225 -0.0537 447 PHE B CD1 
2423 C CD2 . PHE B 120 ? 0.4043 0.5324 0.3731 0.0484  -0.0207 -0.0610 447 PHE B CD2 
2424 C CE1 . PHE B 120 ? 0.4289 0.5233 0.3772 0.0249  -0.0229 -0.0470 447 PHE B CE1 
2425 C CE2 . PHE B 120 ? 0.4093 0.5485 0.3747 0.0392  -0.0183 -0.0531 447 PHE B CE2 
2426 C CZ  . PHE B 120 ? 0.4176 0.5396 0.3744 0.0260  -0.0206 -0.0449 447 PHE B CZ  
2427 N N   . VAL B 121 ? 0.3786 0.5074 0.3858 0.0636  -0.0351 -0.0789 448 VAL B N   
2428 C CA  . VAL B 121 ? 0.3730 0.5193 0.3920 0.0704  -0.0350 -0.0848 448 VAL B CA  
2429 C C   . VAL B 121 ? 0.3712 0.5122 0.4096 0.0726  -0.0435 -0.0850 448 VAL B C   
2430 O O   . VAL B 121 ? 0.3648 0.5197 0.4155 0.0732  -0.0436 -0.0814 448 VAL B O   
2431 C CB  . VAL B 121 ? 0.3687 0.5250 0.3828 0.0819  -0.0331 -0.0976 448 VAL B CB  
2432 C CG1 . VAL B 121 ? 0.3662 0.5386 0.3936 0.0949  -0.0324 -0.1083 448 VAL B CG1 
2433 C CG2 . VAL B 121 ? 0.3641 0.5323 0.3603 0.0778  -0.0248 -0.0923 448 VAL B CG2 
2434 N N   . LEU B 122 ? 0.3727 0.4959 0.4158 0.0727  -0.0517 -0.0866 449 LEU B N   
2435 C CA  . LEU B 122 ? 0.3791 0.4936 0.4409 0.0733  -0.0623 -0.0839 449 LEU B CA  
2436 C C   . LEU B 122 ? 0.3740 0.4915 0.4378 0.0625  -0.0631 -0.0697 449 LEU B C   
2437 O O   . LEU B 122 ? 0.3843 0.5093 0.4643 0.0649  -0.0683 -0.0661 449 LEU B O   
2438 C CB  . LEU B 122 ? 0.3809 0.4769 0.4468 0.0708  -0.0722 -0.0839 449 LEU B CB  
2439 C CG  . LEU B 122 ? 0.3904 0.4729 0.4762 0.0700  -0.0862 -0.0791 449 LEU B CG  
2440 C CD1 . LEU B 122 ? 0.4106 0.4854 0.5097 0.0855  -0.0934 -0.0934 449 LEU B CD1 
2441 C CD2 . LEU B 122 ? 0.3907 0.4605 0.4785 0.0602  -0.0945 -0.0717 449 LEU B CD2 
2442 N N   . ARG B 123 ? 0.3711 0.4828 0.4174 0.0515  -0.0584 -0.0622 450 ARG B N   
2443 C CA  . ARG B 123 ? 0.3723 0.4830 0.4121 0.0396  -0.0598 -0.0508 450 ARG B CA  
2444 C C   . ARG B 123 ? 0.3797 0.5047 0.4193 0.0358  -0.0580 -0.0481 450 ARG B C   
2445 O O   . ARG B 123 ? 0.3983 0.5295 0.4450 0.0286  -0.0649 -0.0391 450 ARG B O   
2446 C CB  . ARG B 123 ? 0.3719 0.4708 0.3887 0.0323  -0.0536 -0.0473 450 ARG B CB  
2447 C CG  . ARG B 123 ? 0.3771 0.4712 0.3994 0.0330  -0.0562 -0.0442 450 ARG B CG  
2448 C CD  . ARG B 123 ? 0.3744 0.4645 0.3801 0.0338  -0.0464 -0.0442 450 ARG B CD  
2449 N NE  . ARG B 123 ? 0.3934 0.4752 0.3738 0.0287  -0.0388 -0.0432 450 ARG B NE  
2450 C CZ  . ARG B 123 ? 0.3985 0.4770 0.3647 0.0218  -0.0374 -0.0373 450 ARG B CZ  
2451 N NH1 . ARG B 123 ? 0.3907 0.4781 0.3683 0.0175  -0.0429 -0.0280 450 ARG B NH1 
2452 N NH2 . ARG B 123 ? 0.4100 0.4748 0.3483 0.0183  -0.0315 -0.0405 450 ARG B NH2 
2453 N N   . LEU B 124 ? 0.3736 0.5069 0.4066 0.0388  -0.0500 -0.0533 451 LEU B N   
2454 C CA  . LEU B 124 ? 0.3755 0.5278 0.4109 0.0329  -0.0481 -0.0478 451 LEU B CA  
2455 C C   . LEU B 124 ? 0.3636 0.5408 0.4280 0.0426  -0.0519 -0.0474 451 LEU B C   
2456 O O   . LEU B 124 ? 0.3546 0.5477 0.4304 0.0352  -0.0570 -0.0370 451 LEU B O   
2457 C CB  . LEU B 124 ? 0.3819 0.5398 0.4044 0.0333  -0.0389 -0.0505 451 LEU B CB  
2458 C CG  . LEU B 124 ? 0.3872 0.5705 0.4137 0.0258  -0.0359 -0.0424 451 LEU B CG  
2459 C CD1 . LEU B 124 ? 0.3811 0.5560 0.3977 0.0056  -0.0424 -0.0306 451 LEU B CD1 
2460 C CD2 . LEU B 124 ? 0.3858 0.5720 0.3985 0.0275  -0.0275 -0.0442 451 LEU B CD2 
2461 N N   . ALA B 125 ? 0.3540 0.5335 0.4299 0.0599  -0.0504 -0.0592 452 ALA B N   
2462 C CA  . ALA B 125 ? 0.3532 0.5511 0.4562 0.0755  -0.0530 -0.0631 452 ALA B CA  
2463 C C   . ALA B 125 ? 0.3558 0.5493 0.4781 0.0729  -0.0658 -0.0526 452 ALA B C   
2464 O O   . ALA B 125 ? 0.3498 0.5672 0.4956 0.0785  -0.0685 -0.0463 452 ALA B O   
2465 C CB  . ALA B 125 ? 0.3430 0.5300 0.4468 0.0933  -0.0520 -0.0808 452 ALA B CB  
2466 N N   . TYR B 126 ? 0.3736 0.5402 0.4868 0.0642  -0.0735 -0.0487 453 TYR B N   
2467 C CA  . TYR B 126 ? 0.3850 0.5453 0.5125 0.0593  -0.0869 -0.0362 453 TYR B CA  
2468 C C   . TYR B 126 ? 0.3939 0.5662 0.5151 0.0412  -0.0910 -0.0201 453 TYR B C   
2469 O O   . TYR B 126 ? 0.4005 0.5793 0.5386 0.0385  -0.1027 -0.0074 453 TYR B O   
2470 C CB  . TYR B 126 ? 0.3780 0.5107 0.4957 0.0540  -0.0925 -0.0354 453 TYR B CB  
2471 C CG  . TYR B 126 ? 0.3834 0.5074 0.5183 0.0509  -0.1080 -0.0220 453 TYR B CG  
2472 C CD1 . TYR B 126 ? 0.3922 0.5118 0.5561 0.0667  -0.1181 -0.0242 453 TYR B CD1 
2473 C CD2 . TYR B 126 ? 0.3755 0.4940 0.4958 0.0331  -0.1125 -0.0072 453 TYR B CD2 
2474 C CE1 . TYR B 126 ? 0.4045 0.5130 0.5851 0.0630  -0.1343 -0.0090 453 TYR B CE1 
2475 C CE2 . TYR B 126 ? 0.3859 0.4985 0.5202 0.0280  -0.1274 0.0084  453 TYR B CE2 
2476 C CZ  . TYR B 126 ? 0.4004 0.5070 0.5662 0.0422  -0.1392 0.0088  453 TYR B CZ  
2477 O OH  . TYR B 126 ? 0.4111 0.5094 0.5920 0.0364  -0.1560 0.0272  453 TYR B OH  
2478 N N   . ARG B 127 ? 0.3994 0.5715 0.4950 0.0285  -0.0830 -0.0204 454 ARG B N   
2479 C CA  . ARG B 127 ? 0.4157 0.5904 0.4953 0.0082  -0.0878 -0.0086 454 ARG B CA  
2480 C C   . ARG B 127 ? 0.4132 0.6192 0.5090 0.0043  -0.0890 -0.0011 454 ARG B C   
2481 O O   . ARG B 127 ? 0.4352 0.6507 0.5311 -0.0110 -0.0991 0.0120  454 ARG B O   
2482 C CB  . ARG B 127 ? 0.4266 0.5798 0.4703 -0.0011 -0.0789 -0.0151 454 ARG B CB  
2483 C CG  . ARG B 127 ? 0.4466 0.5818 0.4599 -0.0192 -0.0834 -0.0097 454 ARG B CG  
2484 C CD  . ARG B 127 ? 0.4533 0.5624 0.4388 -0.0163 -0.0728 -0.0197 454 ARG B CD  
2485 N NE  . ARG B 127 ? 0.4647 0.5724 0.4470 -0.0108 -0.0637 -0.0272 454 ARG B NE  
2486 C CZ  . ARG B 127 ? 0.4545 0.5484 0.4255 -0.0022 -0.0541 -0.0356 454 ARG B CZ  
2487 N NH1 . ARG B 127 ? 0.4589 0.5406 0.4217 0.0031  -0.0504 -0.0385 454 ARG B NH1 
2488 N NH2 . ARG B 127 ? 0.4511 0.5475 0.4206 0.0002  -0.0485 -0.0386 454 ARG B NH2 
2489 N N   . SER B 128 ? 0.4129 0.6376 0.5211 0.0170  -0.0788 -0.0085 455 SER B N   
2490 C CA  . SER B 128 ? 0.4149 0.6750 0.5361 0.0118  -0.0759 -0.0004 455 SER B CA  
2491 C C   . SER B 128 ? 0.4119 0.7090 0.5726 0.0202  -0.0827 0.0102  455 SER B C   
2492 O O   . SER B 128 ? 0.4104 0.7005 0.5878 0.0318  -0.0904 0.0102  455 SER B O   
2493 C CB  . SER B 128 ? 0.4135 0.6845 0.5321 0.0237  -0.0609 -0.0112 455 SER B CB  
2494 O OG  . SER B 128 ? 0.4233 0.6639 0.5078 0.0137  -0.0562 -0.0166 455 SER B OG  
2495 N N   . ASN B 129 ? 0.4209 0.7587 0.5985 0.0139  -0.0807 0.0215  456 ASN B N   
2496 C CA  . ASN B 129 ? 0.4198 0.8043 0.6416 0.0259  -0.0843 0.0329  456 ASN B CA  
2497 C C   . ASN B 129 ? 0.4152 0.8409 0.6557 0.0440  -0.0671 0.0274  456 ASN B C   
2498 O O   . ASN B 129 ? 0.4079 0.8707 0.6547 0.0301  -0.0632 0.0405  456 ASN B O   
2499 C CB  . ASN B 129 ? 0.4394 0.8462 0.6706 0.0003  -0.1000 0.0564  456 ASN B CB  
2500 C CG  . ASN B 129 ? 0.4520 0.9073 0.7337 0.0141  -0.1068 0.0712  456 ASN B CG  
2501 O OD1 . ASN B 129 ? 0.4597 0.9405 0.7718 0.0442  -0.0960 0.0636  456 ASN B OD1 
2502 N ND2 . ASN B 129 ? 0.4615 0.9300 0.7518 -0.0068 -0.1252 0.0920  456 ASN B ND2 
2503 N N   . PRO B 130 ? 0.4179 0.8366 0.6646 0.0737  -0.0573 0.0080  457 PRO B N   
2504 C CA  . PRO B 130 ? 0.4234 0.8764 0.6783 0.0939  -0.0389 -0.0023 457 PRO B CA  
2505 C C   . PRO B 130 ? 0.4332 0.9532 0.7318 0.1069  -0.0331 0.0102  457 PRO B C   
2506 O O   . PRO B 130 ? 0.4373 0.9999 0.7395 0.1111  -0.0174 0.0113  457 PRO B O   
2507 C CB  . PRO B 130 ? 0.4249 0.8437 0.6732 0.1213  -0.0356 -0.0275 457 PRO B CB  
2508 C CG  . PRO B 130 ? 0.4220 0.8072 0.6797 0.1209  -0.0533 -0.0239 457 PRO B CG  
2509 C CD  . PRO B 130 ? 0.4140 0.7880 0.6555 0.0875  -0.0643 -0.0054 457 PRO B CD  
2510 N N   . VAL B 131 ? 0.4454 0.9782 0.7778 0.1132  -0.0457 0.0218  458 VAL B N   
2511 C CA  . VAL B 131 ? 0.4526 1.0545 0.8335 0.1257  -0.0423 0.0380  458 VAL B CA  
2512 C C   . VAL B 131 ? 0.4461 1.0958 0.8305 0.0957  -0.0404 0.0619  458 VAL B C   
2513 O O   . VAL B 131 ? 0.4372 1.1519 0.8495 0.1059  -0.0264 0.0702  458 VAL B O   
2514 C CB  . VAL B 131 ? 0.4555 1.0595 0.8716 0.1318  -0.0612 0.0520  458 VAL B CB  
2515 C CG1 . VAL B 131 ? 0.4580 1.1359 0.9297 0.1534  -0.0556 0.0663  458 VAL B CG1 
2516 C CG2 . VAL B 131 ? 0.4739 1.0210 0.8837 0.1544  -0.0679 0.0327  458 VAL B CG2 
2517 N N   . GLU B 132 ? 0.4470 1.0627 0.8010 0.0589  -0.0544 0.0721  459 GLU B N   
2518 C CA  . GLU B 132 ? 0.4557 1.1036 0.8102 0.0242  -0.0599 0.0964  459 GLU B CA  
2519 C C   . GLU B 132 ? 0.4490 1.0795 0.7651 0.0074  -0.0493 0.0912  459 GLU B C   
2520 O O   . GLU B 132 ? 0.4610 1.1111 0.7737 -0.0230 -0.0542 0.1110  459 GLU B O   
2521 C CB  . GLU B 132 ? 0.4716 1.0947 0.8181 -0.0065 -0.0853 0.1125  459 GLU B CB  
2522 C CG  . GLU B 132 ? 0.4976 1.1207 0.8724 0.0106  -0.0980 0.1155  459 GLU B CG  
2523 C CD  . GLU B 132 ? 0.5235 1.1466 0.9007 -0.0195 -0.1237 0.1381  459 GLU B CD  
2524 O OE1 . GLU B 132 ? 0.5489 1.1464 0.8904 -0.0548 -0.1339 0.1438  459 GLU B OE1 
2525 O OE2 . GLU B 132 ? 0.5366 1.1835 0.9505 -0.0072 -0.1349 0.1501  459 GLU B OE2 
2526 N N   . GLY B 133 ? 0.4338 1.0280 0.7230 0.0268  -0.0365 0.0663  460 GLY B N   
2527 C CA  . GLY B 133 ? 0.4279 1.0000 0.6795 0.0147  -0.0273 0.0603  460 GLY B CA  
2528 C C   . GLY B 133 ? 0.4219 0.9303 0.6323 -0.0132 -0.0407 0.0600  460 GLY B C   
2529 O O   . GLY B 133 ? 0.4213 0.9146 0.6052 -0.0295 -0.0375 0.0628  460 GLY B O   
2530 N N   . LYS B 134 ? 0.4099 0.8814 0.6144 -0.0172 -0.0555 0.0571  461 LYS B N   
2531 C CA  . LYS B 134 ? 0.4129 0.8277 0.5785 -0.0418 -0.0678 0.0563  461 LYS B CA  
2532 C C   . LYS B 134 ? 0.4134 0.7755 0.5492 -0.0274 -0.0622 0.0341  461 LYS B C   
2533 O O   . LYS B 134 ? 0.4079 0.7600 0.5528 -0.0068 -0.0617 0.0226  461 LYS B O   
2534 C CB  . LYS B 134 ? 0.4225 0.8321 0.5941 -0.0582 -0.0875 0.0682  461 LYS B CB  
2535 C CG  . LYS B 134 ? 0.4289 0.8801 0.6205 -0.0843 -0.0994 0.0935  461 LYS B CG  
2536 C CD  . LYS B 134 ? 0.4463 0.8925 0.6425 -0.0983 -0.1204 0.1040  461 LYS B CD  
2537 C CE  . LYS B 134 ? 0.4584 0.9344 0.6646 -0.1321 -0.1376 0.1291  461 LYS B CE  
2538 N NZ  . LYS B 134 ? 0.4509 1.0067 0.7142 -0.1246 -0.1346 0.1494  461 LYS B NZ  
2539 N N   . LEU B 135 ? 0.4074 0.7366 0.5096 -0.0389 -0.0590 0.0301  462 LEU B N   
2540 C CA  . LEU B 135 ? 0.3938 0.6743 0.4674 -0.0298 -0.0556 0.0130  462 LEU B CA  
2541 C C   . LEU B 135 ? 0.4055 0.6426 0.4505 -0.0488 -0.0675 0.0142  462 LEU B C   
2542 O O   . LEU B 135 ? 0.4250 0.6527 0.4549 -0.0721 -0.0753 0.0242  462 LEU B O   
2543 C CB  . LEU B 135 ? 0.3926 0.6665 0.4492 -0.0258 -0.0439 0.0076  462 LEU B CB  
2544 C CG  . LEU B 135 ? 0.3779 0.6955 0.4597 -0.0034 -0.0320 0.0024  462 LEU B CG  
2545 C CD1 . LEU B 135 ? 0.3724 0.7287 0.4584 -0.0107 -0.0235 0.0146  462 LEU B CD1 
2546 C CD2 . LEU B 135 ? 0.3694 0.6657 0.4432 0.0194  -0.0259 -0.0177 462 LEU B CD2 
2547 N N   . ILE B 136 ? 0.3892 0.6006 0.4261 -0.0394 -0.0695 0.0044  463 ILE B N   
2548 C CA  . ILE B 136 ? 0.4072 0.5802 0.4135 -0.0537 -0.0780 0.0031  463 ILE B CA  
2549 C C   . ILE B 136 ? 0.4098 0.5464 0.3911 -0.0423 -0.0686 -0.0111 463 ILE B C   
2550 O O   . ILE B 136 ? 0.3838 0.5209 0.3750 -0.0255 -0.0640 -0.0184 463 ILE B O   
2551 C CB  . ILE B 136 ? 0.3991 0.5804 0.4172 -0.0562 -0.0896 0.0094  463 ILE B CB  
2552 C CG1 . ILE B 136 ? 0.4025 0.6277 0.4533 -0.0639 -0.0986 0.0256  463 ILE B CG1 
2553 C CG2 . ILE B 136 ? 0.4272 0.5721 0.4072 -0.0728 -0.0977 0.0080  463 ILE B CG2 
2554 C CD1 . ILE B 136 ? 0.3963 0.6362 0.4661 -0.0647 -0.1118 0.0355  463 ILE B CD1 
2555 N N   . PHE B 137 ? 0.4387 0.5444 0.3899 -0.0515 -0.0670 -0.0139 464 PHE B N   
2556 C CA  . PHE B 137 ? 0.4557 0.5325 0.3875 -0.0389 -0.0573 -0.0252 464 PHE B CA  
2557 C C   . PHE B 137 ? 0.4930 0.5421 0.4012 -0.0389 -0.0585 -0.0316 464 PHE B C   
2558 O O   . PHE B 137 ? 0.4972 0.5431 0.3958 -0.0521 -0.0679 -0.0278 464 PHE B O   
2559 C CB  . PHE B 137 ? 0.4676 0.5246 0.3816 -0.0445 -0.0544 -0.0242 464 PHE B CB  
2560 C CG  . PHE B 137 ? 0.4542 0.5444 0.3899 -0.0430 -0.0505 -0.0166 464 PHE B CG  
2561 C CD1 . PHE B 137 ? 0.4279 0.5309 0.3735 -0.0248 -0.0406 -0.0222 464 PHE B CD1 
2562 C CD2 . PHE B 137 ? 0.4584 0.5715 0.4046 -0.0607 -0.0570 -0.0028 464 PHE B CD2 
2563 C CE1 . PHE B 137 ? 0.4217 0.5581 0.3825 -0.0227 -0.0357 -0.0164 464 PHE B CE1 
2564 C CE2 . PHE B 137 ? 0.4514 0.6024 0.4173 -0.0585 -0.0510 0.0053  464 PHE B CE2 
2565 C CZ  . PHE B 137 ? 0.4323 0.5944 0.4033 -0.0387 -0.0395 -0.0024 464 PHE B CZ  
2566 N N   . CYS B 138 ? 0.5116 0.5457 0.4112 -0.0243 -0.0489 -0.0401 465 CYS B N   
2567 C CA  . CYS B 138 ? 0.5466 0.5665 0.4296 -0.0210 -0.0467 -0.0446 465 CYS B CA  
2568 C C   . CYS B 138 ? 0.5687 0.5560 0.4124 -0.0337 -0.0504 -0.0486 465 CYS B C   
2569 O O   . CYS B 138 ? 0.5852 0.5676 0.4126 -0.0361 -0.0512 -0.0503 465 CYS B O   
2570 C CB  . CYS B 138 ? 0.5681 0.5851 0.4539 -0.0031 -0.0354 -0.0504 465 CYS B CB  
2571 S SG  . CYS B 138 ? 0.6829 0.6686 0.5453 0.0026  -0.0281 -0.0564 465 CYS B SG  
2572 N N   . ASN B 139 ? 0.5809 0.5450 0.4077 -0.0428 -0.0538 -0.0498 466 ASN B N   
2573 C CA  . ASN B 139 ? 0.6184 0.5434 0.4044 -0.0563 -0.0603 -0.0559 466 ASN B CA  
2574 C C   . ASN B 139 ? 0.6199 0.5542 0.4038 -0.0802 -0.0768 -0.0474 466 ASN B C   
2575 O O   . ASN B 139 ? 0.6767 0.5783 0.4246 -0.0953 -0.0858 -0.0524 466 ASN B O   
2576 C CB  . ASN B 139 ? 0.6491 0.5386 0.4182 -0.0576 -0.0601 -0.0592 466 ASN B CB  
2577 C CG  . ASN B 139 ? 0.6426 0.5530 0.4368 -0.0702 -0.0673 -0.0454 466 ASN B CG  
2578 O OD1 . ASN B 139 ? 0.6038 0.5581 0.4304 -0.0733 -0.0696 -0.0355 466 ASN B OD1 
2579 N ND2 . ASN B 139 ? 0.6780 0.5573 0.4574 -0.0767 -0.0706 -0.0438 466 ASN B ND2 
2580 N N   . GLY B 140 ? 0.5765 0.5543 0.3987 -0.0831 -0.0816 -0.0348 467 GLY B N   
2581 C CA  . GLY B 140 ? 0.5802 0.5775 0.4103 -0.1040 -0.0979 -0.0229 467 GLY B CA  
2582 C C   . GLY B 140 ? 0.5946 0.5999 0.4350 -0.1222 -0.1076 -0.0121 467 GLY B C   
2583 O O   . GLY B 140 ? 0.6095 0.6324 0.4569 -0.1424 -0.1230 -0.0002 467 GLY B O   
2584 N N   . VAL B 141 ? 0.5881 0.5838 0.4306 -0.1169 -0.0999 -0.0136 468 VAL B N   
2585 C CA  . VAL B 141 ? 0.5985 0.6086 0.4548 -0.1347 -0.1077 0.0003  468 VAL B CA  
2586 C C   . VAL B 141 ? 0.5493 0.6222 0.4551 -0.1269 -0.1033 0.0128  468 VAL B C   
2587 O O   . VAL B 141 ? 0.5280 0.6193 0.4531 -0.1033 -0.0900 0.0070  468 VAL B O   
2588 C CB  . VAL B 141 ? 0.6250 0.6016 0.4641 -0.1334 -0.1024 -0.0025 468 VAL B CB  
2589 C CG1 . VAL B 141 ? 0.6222 0.6263 0.4832 -0.1507 -0.1079 0.0164  468 VAL B CG1 
2590 C CG2 . VAL B 141 ? 0.6740 0.5849 0.4640 -0.1429 -0.1099 -0.0145 468 VAL B CG2 
2591 N N   . VAL B 142 ? 0.5436 0.6490 0.4694 -0.1466 -0.1155 0.0296  469 VAL B N   
2592 C CA  . VAL B 142 ? 0.4962 0.6646 0.4698 -0.1384 -0.1112 0.0422  469 VAL B CA  
2593 C C   . VAL B 142 ? 0.4977 0.6875 0.4829 -0.1489 -0.1083 0.0551  469 VAL B C   
2594 O O   . VAL B 142 ? 0.5271 0.7006 0.4970 -0.1765 -0.1210 0.0659  469 VAL B O   
2595 C CB  . VAL B 142 ? 0.4947 0.6954 0.4896 -0.1513 -0.1265 0.0557  469 VAL B CB  
2596 C CG1 . VAL B 142 ? 0.4557 0.7234 0.5037 -0.1370 -0.1204 0.0676  469 VAL B CG1 
2597 C CG2 . VAL B 142 ? 0.4916 0.6669 0.4682 -0.1451 -0.1311 0.0456  469 VAL B CG2 
2598 N N   . LEU B 143 ? 0.4655 0.6899 0.4750 -0.1279 -0.0922 0.0541  470 LEU B N   
2599 C CA  . LEU B 143 ? 0.4735 0.7307 0.4970 -0.1355 -0.0867 0.0686  470 LEU B CA  
2600 C C   . LEU B 143 ? 0.4452 0.7706 0.5115 -0.1156 -0.0742 0.0731  470 LEU B C   
2601 O O   . LEU B 143 ? 0.4215 0.7521 0.4985 -0.0888 -0.0659 0.0582  470 LEU B O   
2602 C CB  . LEU B 143 ? 0.4763 0.6979 0.4734 -0.1285 -0.0772 0.0604  470 LEU B CB  
2603 C CG  . LEU B 143 ? 0.5126 0.6652 0.4678 -0.1441 -0.0869 0.0562  470 LEU B CG  
2604 C CD1 . LEU B 143 ? 0.5077 0.6347 0.4462 -0.1282 -0.0754 0.0480  470 LEU B CD1 
2605 C CD2 . LEU B 143 ? 0.5406 0.6869 0.4898 -0.1794 -0.1035 0.0762  470 LEU B CD2 
2606 N N   . HIS B 144 ? 0.4536 0.8308 0.5442 -0.1287 -0.0733 0.0938  471 HIS B N   
2607 C CA  . HIS B 144 ? 0.4487 0.8951 0.5778 -0.1072 -0.0579 0.0976  471 HIS B CA  
2608 C C   . HIS B 144 ? 0.4425 0.8900 0.5598 -0.0858 -0.0389 0.0850  471 HIS B C   
2609 O O   . HIS B 144 ? 0.4456 0.8613 0.5344 -0.0970 -0.0387 0.0866  471 HIS B O   
2610 C CB  . HIS B 144 ? 0.4716 0.9815 0.6316 -0.1289 -0.0613 0.1266  471 HIS B CB  
2611 C CG  . HIS B 144 ? 0.4641 1.0512 0.6703 -0.1052 -0.0476 0.1312  471 HIS B CG  
2612 N ND1 . HIS B 144 ? 0.4576 1.0864 0.6729 -0.0829 -0.0256 0.1268  471 HIS B ND1 
2613 C CD2 . HIS B 144 ? 0.4613 1.0917 0.7066 -0.0984 -0.0527 0.1394  471 HIS B CD2 
2614 C CE1 . HIS B 144 ? 0.4551 1.1479 0.7122 -0.0612 -0.0163 0.1297  471 HIS B CE1 
2615 N NE2 . HIS B 144 ? 0.4549 1.1505 0.7336 -0.0697 -0.0327 0.1385  471 HIS B NE2 
2616 N N   . ARG B 145 ? 0.4328 0.9149 0.5711 -0.0548 -0.0249 0.0725  472 ARG B N   
2617 C CA  . ARG B 145 ? 0.4456 0.9468 0.5777 -0.0339 -0.0065 0.0621  472 ARG B CA  
2618 C C   . ARG B 145 ? 0.4558 0.9807 0.5785 -0.0536 -0.0014 0.0817  472 ARG B C   
2619 O O   . ARG B 145 ? 0.4626 0.9592 0.5562 -0.0528 0.0027  0.0760  472 ARG B O   
2620 C CB  . ARG B 145 ? 0.4544 1.0104 0.6193 -0.0036 0.0066  0.0538  472 ARG B CB  
2621 C CG  . ARG B 145 ? 0.4832 1.0474 0.6343 0.0228  0.0240  0.0345  472 ARG B CG  
2622 C CD  . ARG B 145 ? 0.5017 1.1114 0.6822 0.0561  0.0364  0.0218  472 ARG B CD  
2623 N NE  . ARG B 145 ? 0.5235 1.2067 0.7425 0.0532  0.0424  0.0434  472 ARG B NE  
2624 C CZ  . ARG B 145 ? 0.5396 1.2842 0.7647 0.0500  0.0577  0.0578  472 ARG B CZ  
2625 N NH1 . ARG B 145 ? 0.5620 1.3007 0.7539 0.0482  0.0677  0.0531  472 ARG B NH1 
2626 N NH2 . ARG B 145 ? 0.5169 1.3331 0.7826 0.0475  0.0626  0.0794  472 ARG B NH2 
2627 N N   . LEU B 146 ? 0.4474 1.0248 0.5961 -0.0728 -0.0036 0.1073  473 LEU B N   
2628 C CA  . LEU B 146 ? 0.4562 1.0650 0.6021 -0.0962 -0.0006 0.1324  473 LEU B CA  
2629 C C   . LEU B 146 ? 0.4711 1.0138 0.5807 -0.1242 -0.0153 0.1400  473 LEU B C   
2630 O O   . LEU B 146 ? 0.4901 1.0383 0.5852 -0.1349 -0.0108 0.1529  473 LEU B O   
2631 C CB  . LEU B 146 ? 0.4619 1.1407 0.6477 -0.1149 -0.0035 0.1613  473 LEU B CB  
2632 C CG  . LEU B 146 ? 0.4653 1.2380 0.6868 -0.0938 0.0185  0.1685  473 LEU B CG  
2633 C CD1 . LEU B 146 ? 0.4477 1.2346 0.6884 -0.0517 0.0296  0.1419  473 LEU B CD1 
2634 C CD2 . LEU B 146 ? 0.4710 1.3131 0.7317 -0.1212 0.0128  0.2048  473 LEU B CD2 
2635 N N   . GLN B 147 ? 0.4629 0.9433 0.5569 -0.1346 -0.0325 0.1318  474 GLN B N   
2636 C CA  . GLN B 147 ? 0.4848 0.8940 0.5424 -0.1564 -0.0467 0.1342  474 GLN B CA  
2637 C C   . GLN B 147 ? 0.4893 0.8527 0.5173 -0.1351 -0.0386 0.1139  474 GLN B C   
2638 O O   . GLN B 147 ? 0.5151 0.8293 0.5158 -0.1479 -0.0461 0.1183  474 GLN B O   
2639 C CB  . GLN B 147 ? 0.4884 0.8466 0.5343 -0.1708 -0.0659 0.1283  474 GLN B CB  
2640 C CG  . GLN B 147 ? 0.4876 0.8722 0.5530 -0.2026 -0.0825 0.1516  474 GLN B CG  
2641 C CD  . GLN B 147 ? 0.4898 0.8212 0.5364 -0.2138 -0.1011 0.1412  474 GLN B CD  
2642 O OE1 . GLN B 147 ? 0.4644 0.7975 0.5183 -0.1943 -0.0987 0.1256  474 GLN B OE1 
2643 N NE2 . GLN B 147 ? 0.5245 0.8060 0.5442 -0.2455 -0.1205 0.1498  474 GLN B NE2 
2644 N N   . CYS B 148 ? 0.4755 0.8536 0.5103 -0.1031 -0.0252 0.0924  475 CYS B N   
2645 C CA  . CYS B 148 ? 0.4909 0.8305 0.5021 -0.0821 -0.0191 0.0722  475 CYS B CA  
2646 C C   . CYS B 148 ? 0.5059 0.8796 0.5130 -0.0712 -0.0051 0.0748  475 CYS B C   
2647 O O   . CYS B 148 ? 0.5136 0.8566 0.4988 -0.0607 -0.0030 0.0649  475 CYS B O   
2648 C CB  . CYS B 148 ? 0.4740 0.8048 0.4929 -0.0567 -0.0161 0.0478  475 CYS B CB  
2649 S SG  . CYS B 148 ? 0.4884 0.7677 0.4999 -0.0654 -0.0316 0.0405  475 CYS B SG  
2650 N N   . VAL B 149 ? 0.5173 0.9579 0.5453 -0.0734 0.0045  0.0887  476 VAL B N   
2651 C CA  . VAL B 149 ? 0.5308 1.0140 0.5534 -0.0609 0.0202  0.0895  476 VAL B CA  
2652 C C   . VAL B 149 ? 0.5681 1.0254 0.5619 -0.0744 0.0169  0.1028  476 VAL B C   
2653 O O   . VAL B 149 ? 0.5682 1.0265 0.5443 -0.0581 0.0249  0.0921  476 VAL B O   
2654 C CB  . VAL B 149 ? 0.5274 1.0947 0.5793 -0.0593 0.0337  0.1029  476 VAL B CB  
2655 C CG1 . VAL B 149 ? 0.5523 1.1498 0.6114 -0.0936 0.0289  0.1393  476 VAL B CG1 
2656 C CG2 . VAL B 149 ? 0.5321 1.1405 0.5769 -0.0317 0.0533  0.0878  476 VAL B CG2 
2657 N N   . ARG B 150 ? 0.6049 1.0346 0.5931 -0.1042 0.0030  0.1256  477 ARG B N   
2658 C CA  . ARG B 150 ? 0.6516 1.0520 0.6153 -0.1184 -0.0029 0.1421  477 ARG B CA  
2659 C C   . ARG B 150 ? 0.6518 0.9887 0.5911 -0.1016 -0.0073 0.1225  477 ARG B C   
2660 O O   . ARG B 150 ? 0.6772 1.0136 0.5997 -0.0951 -0.0039 0.1255  477 ARG B O   
2661 C CB  . ARG B 150 ? 0.7113 1.0900 0.6753 -0.1548 -0.0195 0.1707  477 ARG B CB  
2662 C CG  . ARG B 150 ? 0.7598 1.2042 0.7374 -0.1776 -0.0151 0.2043  477 ARG B CG  
2663 C CD  . ARG B 150 ? 0.8275 1.2539 0.8121 -0.2169 -0.0346 0.2321  477 ARG B CD  
2664 N NE  . ARG B 150 ? 0.8823 1.3659 0.8775 -0.2437 -0.0330 0.2704  477 ARG B NE  
2665 C CZ  . ARG B 150 ? 0.9130 1.4156 0.9263 -0.2800 -0.0462 0.3005  477 ARG B CZ  
2666 N NH1 . ARG B 150 ? 0.9295 1.3967 0.9501 -0.2946 -0.0633 0.2955  477 ARG B NH1 
2667 N NH2 . ARG B 150 ? 0.9355 1.4959 0.9590 -0.3037 -0.0430 0.3373  477 ARG B NH2 
2668 N N   . GLY B 151 ? 0.6323 0.9220 0.5708 -0.0944 -0.0146 0.1037  478 GLY B N   
2669 C CA  . GLY B 151 ? 0.6197 0.8567 0.5405 -0.0768 -0.0173 0.0850  478 GLY B CA  
2670 C C   . GLY B 151 ? 0.5928 0.8518 0.5163 -0.0489 -0.0061 0.0626  478 GLY B C   
2671 O O   . GLY B 151 ? 0.5896 0.8390 0.4989 -0.0380 -0.0047 0.0590  478 GLY B O   
2672 N N   . PHE B 152 ? 0.5580 0.8447 0.5001 -0.0382 -0.0004 0.0485  479 PHE B N   
2673 C CA  . PHE B 152 ? 0.5328 0.8300 0.4781 -0.0127 0.0066  0.0247  479 PHE B CA  
2674 C C   . PHE B 152 ? 0.5436 0.8901 0.4858 -0.0014 0.0186  0.0222  479 PHE B C   
2675 O O   . PHE B 152 ? 0.5324 0.8759 0.4664 0.0171  0.0213  0.0034  479 PHE B O   
2676 C CB  . PHE B 152 ? 0.5077 0.8112 0.4744 -0.0049 0.0064  0.0117  479 PHE B CB  
2677 C CG  . PHE B 152 ? 0.4993 0.7529 0.4629 -0.0075 -0.0036 0.0050  479 PHE B CG  
2678 C CD1 . PHE B 152 ? 0.4834 0.7151 0.4462 0.0095  -0.0044 -0.0138 479 PHE B CD1 
2679 C CD2 . PHE B 152 ? 0.5080 0.7368 0.4677 -0.0281 -0.0127 0.0177  479 PHE B CD2 
2680 C CE1 . PHE B 152 ? 0.4783 0.6703 0.4372 0.0073  -0.0116 -0.0185 479 PHE B CE1 
2681 C CE2 . PHE B 152 ? 0.5116 0.6958 0.4631 -0.0290 -0.0204 0.0094  479 PHE B CE2 
2682 C CZ  . PHE B 152 ? 0.4945 0.6635 0.4461 -0.0106 -0.0185 -0.0080 479 PHE B CZ  
2683 N N   . GLY B 153 ? 0.5557 0.9487 0.5033 -0.0133 0.0253  0.0410  480 GLY B N   
2684 C CA  . GLY B 153 ? 0.5690 1.0187 0.5131 -0.0013 0.0399  0.0381  480 GLY B CA  
2685 C C   . GLY B 153 ? 0.5590 1.0372 0.5223 0.0213  0.0489  0.0161  480 GLY B C   
2686 O O   . GLY B 153 ? 0.5557 1.0235 0.5411 0.0213  0.0440  0.0128  480 GLY B O   
2687 N N   . GLU B 154 ? 0.5767 1.0875 0.5295 0.0412  0.0610  0.0004  481 GLU B N   
2688 C CA  . GLU B 154 ? 0.5851 1.1170 0.5527 0.0677  0.0696  -0.0242 481 GLU B CA  
2689 C C   . GLU B 154 ? 0.5635 1.0409 0.5372 0.0794  0.0574  -0.0462 481 GLU B C   
2690 O O   . GLU B 154 ? 0.5810 1.0650 0.5749 0.0970  0.0595  -0.0614 481 GLU B O   
2691 C CB  . GLU B 154 ? 0.6312 1.1999 0.5764 0.0874  0.0839  -0.0403 481 GLU B CB  
2692 C CG  . GLU B 154 ? 0.6501 1.2463 0.6092 0.1180  0.0956  -0.0660 481 GLU B CG  
2693 C CD  . GLU B 154 ? 0.6758 1.3495 0.6521 0.1240  0.1155  -0.0542 481 GLU B CD  
2694 O OE1 . GLU B 154 ? 0.6644 1.3607 0.6776 0.1321  0.1187  -0.0520 481 GLU B OE1 
2695 O OE2 . GLU B 154 ? 0.6988 1.4155 0.6528 0.1211  0.1282  -0.0457 481 GLU B OE2 
2696 N N   . TRP B 155 ? 0.5401 0.9664 0.4990 0.0696  0.0448  -0.0454 482 TRP B N   
2697 C CA  . TRP B 155 ? 0.5109 0.8896 0.4751 0.0773  0.0335  -0.0618 482 TRP B CA  
2698 C C   . TRP B 155 ? 0.5093 0.8815 0.5022 0.0763  0.0289  -0.0602 482 TRP B C   
2699 O O   . TRP B 155 ? 0.5054 0.8578 0.5078 0.0903  0.0238  -0.0773 482 TRP B O   
2700 C CB  . TRP B 155 ? 0.4879 0.8225 0.4349 0.0660  0.0229  -0.0561 482 TRP B CB  
2701 C CG  . TRP B 155 ? 0.4603 0.7526 0.4109 0.0732  0.0124  -0.0710 482 TRP B CG  
2702 C CD1 . TRP B 155 ? 0.4558 0.7409 0.4113 0.0898  0.0096  -0.0926 482 TRP B CD1 
2703 C CD2 . TRP B 155 ? 0.4273 0.6801 0.3765 0.0637  0.0034  -0.0640 482 TRP B CD2 
2704 N NE1 . TRP B 155 ? 0.4321 0.6792 0.3917 0.0880  -0.0011 -0.0960 482 TRP B NE1 
2705 C CE2 . TRP B 155 ? 0.4144 0.6444 0.3700 0.0735  -0.0035 -0.0793 482 TRP B CE2 
2706 C CE3 . TRP B 155 ? 0.4277 0.6608 0.3701 0.0487  0.0006  -0.0467 482 TRP B CE3 
2707 C CZ2 . TRP B 155 ? 0.3999 0.5970 0.3567 0.0690  -0.0108 -0.0762 482 TRP B CZ2 
2708 C CZ3 . TRP B 155 ? 0.4157 0.6105 0.3571 0.0474  -0.0063 -0.0474 482 TRP B CZ3 
2709 C CH2 . TRP B 155 ? 0.3973 0.5792 0.3465 0.0576  -0.0107 -0.0613 482 TRP B CH2 
2710 N N   . ILE B 156 ? 0.5105 0.8983 0.5165 0.0585  0.0285  -0.0389 483 ILE B N   
2711 C CA  . ILE B 156 ? 0.4983 0.8850 0.5309 0.0562  0.0225  -0.0357 483 ILE B CA  
2712 C C   . ILE B 156 ? 0.4912 0.9157 0.5486 0.0777  0.0300  -0.0462 483 ILE B C   
2713 O O   . ILE B 156 ? 0.4958 0.9055 0.5715 0.0856  0.0227  -0.0530 483 ILE B O   
2714 C CB  . ILE B 156 ? 0.5043 0.8973 0.5460 0.0301  0.0166  -0.0110 483 ILE B CB  
2715 C CG1 . ILE B 156 ? 0.5147 0.9374 0.5480 0.0133  0.0225  0.0093  483 ILE B CG1 
2716 C CG2 . ILE B 156 ? 0.5001 0.8375 0.5307 0.0168  0.0029  -0.0100 483 ILE B CG2 
2717 C CD1 . ILE B 156 ? 0.5176 1.0102 0.5743 0.0175  0.0346  0.0191  483 ILE B CD1 
2718 N N   . ASP B 157 ? 0.4895 0.9625 0.5472 0.0884  0.0445  -0.0472 484 ASP B N   
2719 C CA  . ASP B 157 ? 0.4900 1.0015 0.5709 0.1146  0.0543  -0.0598 484 ASP B CA  
2720 C C   . ASP B 157 ? 0.4992 0.9708 0.5743 0.1387  0.0490  -0.0892 484 ASP B C   
2721 O O   . ASP B 157 ? 0.5064 0.9770 0.6066 0.1549  0.0457  -0.0973 484 ASP B O   
2722 C CB  . ASP B 157 ? 0.4936 1.0683 0.5712 0.1232  0.0737  -0.0565 484 ASP B CB  
2723 C CG  . ASP B 157 ? 0.4826 1.1021 0.5722 0.0966  0.0774  -0.0229 484 ASP B CG  
2724 O OD1 . ASP B 157 ? 0.4634 1.0794 0.5752 0.0781  0.0666  -0.0047 484 ASP B OD1 
2725 O OD2 . ASP B 157 ? 0.4970 1.1564 0.5724 0.0923  0.0900  -0.0136 484 ASP B OD2 
2726 N N   . SER B 158 ? 0.5120 0.9497 0.5555 0.1391  0.0458  -0.1027 485 SER B N   
2727 C CA  . SER B 158 ? 0.5345 0.9274 0.5701 0.1546  0.0362  -0.1274 485 SER B CA  
2728 C C   . SER B 158 ? 0.5144 0.8634 0.5651 0.1451  0.0197  -0.1225 485 SER B C   
2729 O O   . SER B 158 ? 0.5323 0.8550 0.5930 0.1591  0.0112  -0.1373 485 SER B O   
2730 C CB  . SER B 158 ? 0.5478 0.9193 0.5472 0.1512  0.0341  -0.1372 485 SER B CB  
2731 O OG  . SER B 158 ? 0.5952 1.0030 0.5759 0.1641  0.0480  -0.1474 485 SER B OG  
2732 N N   . ILE B 159 ? 0.4754 0.8151 0.5253 0.1213  0.0148  -0.1019 486 ILE B N   
2733 C CA  . ILE B 159 ? 0.4548 0.7605 0.5155 0.1107  0.0015  -0.0950 486 ILE B CA  
2734 C C   . ILE B 159 ? 0.4468 0.7712 0.5400 0.1168  -0.0011 -0.0893 486 ILE B C   
2735 O O   . ILE B 159 ? 0.4397 0.7391 0.5457 0.1231  -0.0116 -0.0945 486 ILE B O   
2736 C CB  . ILE B 159 ? 0.4345 0.7220 0.4796 0.0861  -0.0020 -0.0779 486 ILE B CB  
2737 C CG1 . ILE B 159 ? 0.4349 0.6947 0.4545 0.0851  -0.0036 -0.0851 486 ILE B CG1 
2738 C CG2 . ILE B 159 ? 0.4272 0.6916 0.4825 0.0747  -0.0128 -0.0691 486 ILE B CG2 
2739 C CD1 . ILE B 159 ? 0.4400 0.6838 0.4423 0.0670  -0.0046 -0.0706 486 ILE B CD1 
2740 N N   . VAL B 160 ? 0.4314 0.8026 0.5396 0.1142  0.0075  -0.0764 487 VAL B N   
2741 C CA  . VAL B 160 ? 0.4247 0.8240 0.5677 0.1186  0.0049  -0.0663 487 VAL B CA  
2742 C C   . VAL B 160 ? 0.4484 0.8507 0.6108 0.1501  0.0062  -0.0850 487 VAL B C   
2743 O O   . VAL B 160 ? 0.4431 0.8335 0.6288 0.1559  -0.0047 -0.0825 487 VAL B O   
2744 C CB  . VAL B 160 ? 0.4235 0.8793 0.5800 0.1072  0.0141  -0.0459 487 VAL B CB  
2745 C CG1 . VAL B 160 ? 0.4108 0.9126 0.6092 0.1204  0.0154  -0.0379 487 VAL B CG1 
2746 C CG2 . VAL B 160 ? 0.4119 0.8516 0.5550 0.0735  0.0051  -0.0255 487 VAL B CG2 
2747 N N   . GLU B 161 ? 0.4769 0.8913 0.6265 0.1702  0.0184  -0.1040 488 GLU B N   
2748 C CA  . GLU B 161 ? 0.5087 0.9172 0.6683 0.2028  0.0201  -0.1277 488 GLU B CA  
2749 C C   . GLU B 161 ? 0.5035 0.8486 0.6569 0.2039  0.0021  -0.1397 488 GLU B C   
2750 O O   . GLU B 161 ? 0.5174 0.8476 0.6936 0.2215  -0.0061 -0.1465 488 GLU B O   
2751 C CB  . GLU B 161 ? 0.5537 0.9822 0.6887 0.2201  0.0362  -0.1476 488 GLU B CB  
2752 C CG  . GLU B 161 ? 0.6123 1.0506 0.7586 0.2581  0.0436  -0.1723 488 GLU B CG  
2753 C CD  . GLU B 161 ? 0.6645 1.0855 0.7716 0.2733  0.0496  -0.2019 488 GLU B CD  
2754 O OE1 . GLU B 161 ? 0.6997 1.1650 0.7998 0.2939  0.0688  -0.2134 488 GLU B OE1 
2755 O OE2 . GLU B 161 ? 0.6791 1.0452 0.7617 0.2641  0.0351  -0.2132 488 GLU B OE2 
2756 N N   . PHE B 162 ? 0.4849 0.7949 0.6101 0.1847  -0.0044 -0.1397 489 PHE B N   
2757 C CA  . PHE B 162 ? 0.4783 0.7350 0.5995 0.1799  -0.0216 -0.1451 489 PHE B CA  
2758 C C   . PHE B 162 ? 0.4647 0.7113 0.6099 0.1686  -0.0339 -0.1262 489 PHE B C   
2759 O O   . PHE B 162 ? 0.4748 0.6916 0.6336 0.1762  -0.0473 -0.1303 489 PHE B O   
2760 C CB  . PHE B 162 ? 0.4665 0.6982 0.5572 0.1619  -0.0246 -0.1452 489 PHE B CB  
2761 C CG  . PHE B 162 ? 0.4700 0.6553 0.5595 0.1557  -0.0412 -0.1479 489 PHE B CG  
2762 C CD1 . PHE B 162 ? 0.5018 0.6581 0.5891 0.1705  -0.0506 -0.1682 489 PHE B CD1 
2763 C CD2 . PHE B 162 ? 0.4494 0.6204 0.5394 0.1347  -0.0481 -0.1299 489 PHE B CD2 
2764 C CE1 . PHE B 162 ? 0.5106 0.6267 0.5998 0.1612  -0.0677 -0.1667 489 PHE B CE1 
2765 C CE2 . PHE B 162 ? 0.4555 0.5916 0.5466 0.1280  -0.0621 -0.1291 489 PHE B CE2 
2766 C CZ  . PHE B 162 ? 0.4793 0.5893 0.5720 0.1397  -0.0726 -0.1456 489 PHE B CZ  
2767 N N   . SER B 163 ? 0.4448 0.7152 0.5936 0.1495  -0.0308 -0.1052 490 SER B N   
2768 C CA  . SER B 163 ? 0.4475 0.7159 0.6156 0.1371  -0.0421 -0.0862 490 SER B CA  
2769 C C   . SER B 163 ? 0.4745 0.7590 0.6792 0.1573  -0.0471 -0.0849 490 SER B C   
2770 O O   . SER B 163 ? 0.4929 0.7545 0.7116 0.1551  -0.0621 -0.0773 490 SER B O   
2771 C CB  . SER B 163 ? 0.4300 0.7221 0.5922 0.1135  -0.0384 -0.0665 490 SER B CB  
2772 O OG  . SER B 163 ? 0.4167 0.7034 0.5902 0.0989  -0.0510 -0.0495 490 SER B OG  
2773 N N   . SER B 164 ? 0.4790 0.8040 0.6997 0.1777  -0.0345 -0.0912 491 SER B N   
2774 C CA  . SER B 164 ? 0.4965 0.8407 0.7553 0.2026  -0.0371 -0.0912 491 SER B CA  
2775 C C   . SER B 164 ? 0.5298 0.8257 0.7911 0.2235  -0.0483 -0.1103 491 SER B C   
2776 O O   . SER B 164 ? 0.5419 0.8214 0.8283 0.2280  -0.0635 -0.1011 491 SER B O   
2777 C CB  . SER B 164 ? 0.5030 0.9047 0.7764 0.2238  -0.0177 -0.0965 491 SER B CB  
2778 O OG  . SER B 164 ? 0.4858 0.9267 0.7497 0.2012  -0.0075 -0.0804 491 SER B OG  
2779 N N   . ASN B 165 ? 0.5547 0.8264 0.7889 0.2340  -0.0428 -0.1353 492 ASN B N   
2780 C CA  . ASN B 165 ? 0.5905 0.8103 0.8215 0.2512  -0.0553 -0.1560 492 ASN B CA  
2781 C C   . ASN B 165 ? 0.5764 0.7519 0.8098 0.2299  -0.0768 -0.1413 492 ASN B C   
2782 O O   . ASN B 165 ? 0.6006 0.7495 0.8566 0.2410  -0.0921 -0.1395 492 ASN B O   
2783 C CB  . ASN B 165 ? 0.6292 0.8297 0.8230 0.2570  -0.0485 -0.1828 492 ASN B CB  
2784 C CG  . ASN B 165 ? 0.6773 0.9164 0.8664 0.2846  -0.0281 -0.2024 492 ASN B CG  
2785 O OD1 . ASN B 165 ? 0.7075 0.9498 0.8631 0.2839  -0.0184 -0.2177 492 ASN B OD1 
2786 N ND2 . ASN B 165 ? 0.6948 0.9666 0.9174 0.3099  -0.0213 -0.2011 492 ASN B ND2 
2787 N N   . LEU B 166 ? 0.5263 0.6961 0.7370 0.2005  -0.0774 -0.1295 493 LEU B N   
2788 C CA  . LEU B 166 ? 0.5102 0.6473 0.7195 0.1786  -0.0940 -0.1138 493 LEU B CA  
2789 C C   . LEU B 166 ? 0.5081 0.6540 0.7468 0.1750  -0.1050 -0.0912 493 LEU B C   
2790 O O   . LEU B 166 ? 0.5146 0.6287 0.7661 0.1740  -0.1226 -0.0842 493 LEU B O   
2791 C CB  . LEU B 166 ? 0.4745 0.6156 0.6563 0.1519  -0.0878 -0.1045 493 LEU B CB  
2792 C CG  . LEU B 166 ? 0.4650 0.5777 0.6380 0.1299  -0.0999 -0.0912 493 LEU B CG  
2793 C CD1 . LEU B 166 ? 0.4755 0.5519 0.6384 0.1317  -0.1086 -0.1048 493 LEU B CD1 
2794 C CD2 . LEU B 166 ? 0.4344 0.5621 0.5853 0.1089  -0.0900 -0.0803 493 LEU B CD2 
2795 N N   . GLN B 167 ? 0.4914 0.6812 0.7411 0.1713  -0.0965 -0.0778 494 GLN B N   
2796 C CA  . GLN B 167 ? 0.5006 0.7038 0.7758 0.1640  -0.1083 -0.0538 494 GLN B CA  
2797 C C   . GLN B 167 ? 0.5276 0.7294 0.8406 0.1915  -0.1179 -0.0546 494 GLN B C   
2798 O O   . GLN B 167 ? 0.5391 0.7311 0.8713 0.1858  -0.1349 -0.0355 494 GLN B O   
2799 C CB  . GLN B 167 ? 0.4796 0.7269 0.7536 0.1469  -0.1003 -0.0375 494 GLN B CB  
2800 C CG  . GLN B 167 ? 0.4711 0.7039 0.7079 0.1174  -0.0980 -0.0325 494 GLN B CG  
2801 C CD  . GLN B 167 ? 0.4571 0.7207 0.6881 0.0960  -0.0954 -0.0158 494 GLN B CD  
2802 O OE1 . GLN B 167 ? 0.4480 0.6990 0.6478 0.0752  -0.0922 -0.0141 494 GLN B OE1 
2803 N NE2 . GLN B 167 ? 0.4485 0.7519 0.7102 0.1012  -0.0975 -0.0033 494 GLN B NE2 
2804 N N   . ASN B 168 ? 0.5566 0.7654 0.8780 0.2219  -0.1073 -0.0770 495 ASN B N   
2805 C CA  . ASN B 168 ? 0.5995 0.7978 0.9545 0.2548  -0.1153 -0.0842 495 ASN B CA  
2806 C C   . ASN B 168 ? 0.6207 0.7544 0.9754 0.2557  -0.1374 -0.0873 495 ASN B C   
2807 O O   . ASN B 168 ? 0.6405 0.7594 1.0271 0.2737  -0.1519 -0.0809 495 ASN B O   
2808 C CB  . ASN B 168 ? 0.6403 0.8568 0.9956 0.2889  -0.0967 -0.1126 495 ASN B CB  
2809 C CG  . ASN B 168 ? 0.6314 0.9213 1.0099 0.2989  -0.0787 -0.1031 495 ASN B CG  
2810 O OD1 . ASN B 168 ? 0.6550 0.9732 1.0301 0.3221  -0.0592 -0.1226 495 ASN B OD1 
2811 N ND2 . ASN B 168 ? 0.6098 0.9331 1.0112 0.2803  -0.0855 -0.0725 495 ASN B ND2 
2812 N N   . MET B 169 ? 0.6161 0.7137 0.9375 0.2354  -0.1410 -0.0944 496 MET B N   
2813 C CA  . MET B 169 ? 0.6414 0.6808 0.9604 0.2274  -0.1631 -0.0925 496 MET B CA  
2814 C C   . MET B 169 ? 0.6209 0.6566 0.9521 0.2024  -0.1801 -0.0587 496 MET B C   
2815 O O   . MET B 169 ? 0.6405 0.6336 0.9793 0.1972  -0.2009 -0.0503 496 MET B O   
2816 C CB  . MET B 169 ? 0.6503 0.6635 0.9326 0.2106  -0.1609 -0.1066 496 MET B CB  
2817 C CG  . MET B 169 ? 0.6909 0.6860 0.9554 0.2324  -0.1536 -0.1414 496 MET B CG  
2818 S SD  . MET B 169 ? 0.7144 0.6761 0.9424 0.2060  -0.1597 -0.1487 496 MET B SD  
2819 C CE  . MET B 169 ? 0.7490 0.6471 0.9942 0.2007  -0.1919 -0.1405 496 MET B CE  
2820 N N   . ASN B 170 ? 0.5802 0.6593 0.9101 0.1850  -0.1723 -0.0392 497 ASN B N   
2821 C CA  . ASN B 170 ? 0.5642 0.6471 0.8983 0.1597  -0.1862 -0.0077 497 ASN B CA  
2822 C C   . ASN B 170 ? 0.5575 0.6029 0.8713 0.1358  -0.1977 0.0005  497 ASN B C   
2823 O O   . ASN B 170 ? 0.5819 0.6009 0.9107 0.1309  -0.2180 0.0174  497 ASN B O   
2824 C CB  . ASN B 170 ? 0.5867 0.6777 0.9615 0.1742  -0.2018 0.0106  497 ASN B CB  
2825 C CG  . ASN B 170 ? 0.5869 0.7280 0.9853 0.1950  -0.1888 0.0074  497 ASN B CG  
2826 O OD1 . ASN B 170 ? 0.5573 0.7405 0.9457 0.1799  -0.1771 0.0148  497 ASN B OD1 
2827 N ND2 . ASN B 170 ? 0.6169 0.7536 1.0473 0.2302  -0.1911 -0.0035 497 ASN B ND2 
2828 N N   . ILE B 171 ? 0.5255 0.5714 0.8071 0.1216  -0.1846 -0.0099 498 ILE B N   
2829 C CA  . ILE B 171 ? 0.5205 0.5416 0.7836 0.0996  -0.1915 -0.0024 498 ILE B CA  
2830 C C   . ILE B 171 ? 0.5012 0.5420 0.7541 0.0741  -0.1935 0.0245  498 ILE B C   
2831 O O   . ILE B 171 ? 0.4758 0.5466 0.7130 0.0666  -0.1802 0.0258  498 ILE B O   
2832 C CB  . ILE B 171 ? 0.5028 0.5219 0.7380 0.0968  -0.1762 -0.0233 498 ILE B CB  
2833 C CG1 . ILE B 171 ? 0.5166 0.5202 0.7563 0.1225  -0.1735 -0.0519 498 ILE B CG1 
2834 C CG2 . ILE B 171 ? 0.4968 0.4968 0.7186 0.0753  -0.1831 -0.0138 498 ILE B CG2 
2835 C CD1 . ILE B 171 ? 0.5103 0.5235 0.7229 0.1222  -0.1566 -0.0715 498 ILE B CD1 
2836 N N   . ASP B 172 ? 0.5159 0.5392 0.7763 0.0602  -0.2111 0.0466  499 ASP B N   
2837 C CA  . ASP B 172 ? 0.5074 0.5499 0.7524 0.0356  -0.2127 0.0716  499 ASP B CA  
2838 C C   . ASP B 172 ? 0.4841 0.5351 0.6945 0.0194  -0.1963 0.0664  499 ASP B C   
2839 O O   . ASP B 172 ? 0.4794 0.5180 0.6834 0.0242  -0.1890 0.0493  499 ASP B O   
2840 C CB  . ASP B 172 ? 0.5420 0.5686 0.8036 0.0239  -0.2360 0.1005  499 ASP B CB  
2841 C CG  . ASP B 172 ? 0.5745 0.5677 0.8398 0.0167  -0.2468 0.1032  499 ASP B CG  
2842 O OD1 . ASP B 172 ? 0.6142 0.5792 0.9056 0.0203  -0.2688 0.1157  499 ASP B OD1 
2843 O OD2 . ASP B 172 ? 0.5621 0.5569 0.8067 0.0063  -0.2355 0.0954  499 ASP B OD2 
2844 N N   . ILE B 173 ? 0.4714 0.5434 0.6591 0.0014  -0.1912 0.0808  500 ILE B N   
2845 C CA  . ILE B 173 ? 0.4599 0.5414 0.6140 -0.0107 -0.1743 0.0759  500 ILE B CA  
2846 C C   . ILE B 173 ? 0.4675 0.5367 0.6213 -0.0178 -0.1754 0.0796  500 ILE B C   
2847 O O   . ILE B 173 ? 0.4551 0.5274 0.5938 -0.0165 -0.1608 0.0661  500 ILE B O   
2848 C CB  . ILE B 173 ? 0.4644 0.5656 0.5917 -0.0280 -0.1714 0.0905  500 ILE B CB  
2849 C CG1 . ILE B 173 ? 0.4604 0.5753 0.5840 -0.0230 -0.1676 0.0820  500 ILE B CG1 
2850 C CG2 . ILE B 173 ? 0.4706 0.5785 0.5632 -0.0384 -0.1546 0.0869  500 ILE B CG2 
2851 C CD1 . ILE B 173 ? 0.4640 0.5945 0.5688 -0.0403 -0.1744 0.0989  500 ILE B CD1 
2852 N N   . SER B 174 ? 0.4805 0.5369 0.6538 -0.0257 -0.1941 0.0999  501 SER B N   
2853 C CA  . SER B 174 ? 0.4827 0.5306 0.6601 -0.0371 -0.1990 0.1094  501 SER B CA  
2854 C C   . SER B 174 ? 0.4799 0.5049 0.6701 -0.0248 -0.2007 0.0880  501 SER B C   
2855 O O   . SER B 174 ? 0.4666 0.4972 0.6487 -0.0310 -0.1930 0.0845  501 SER B O   
2856 C CB  . SER B 174 ? 0.5079 0.5461 0.7037 -0.0515 -0.2216 0.1400  501 SER B CB  
2857 O OG  . SER B 174 ? 0.5174 0.5824 0.6932 -0.0678 -0.2178 0.1616  501 SER B OG  
2858 N N   . ALA B 175 ? 0.4833 0.4846 0.6925 -0.0066 -0.2108 0.0738  502 ALA B N   
2859 C CA  . ALA B 175 ? 0.4787 0.4567 0.6939 0.0075  -0.2122 0.0489  502 ALA B CA  
2860 C C   . ALA B 175 ? 0.4488 0.4463 0.6416 0.0152  -0.1893 0.0266  502 ALA B C   
2861 O O   . ALA B 175 ? 0.4445 0.4358 0.6315 0.0139  -0.1871 0.0158  502 ALA B O   
2862 C CB  . ALA B 175 ? 0.4949 0.4468 0.7318 0.0294  -0.2247 0.0366  502 ALA B CB  
2863 N N   . PHE B 176 ? 0.4278 0.4486 0.6085 0.0208  -0.1745 0.0224  503 PHE B N   
2864 C CA  . PHE B 176 ? 0.4045 0.4412 0.5647 0.0275  -0.1544 0.0040  503 PHE B CA  
2865 C C   . PHE B 176 ? 0.4030 0.4510 0.5448 0.0143  -0.1442 0.0092  503 PHE B C   
2866 O O   . PHE B 176 ? 0.3973 0.4448 0.5319 0.0190  -0.1370 -0.0045 503 PHE B O   
2867 C CB  . PHE B 176 ? 0.3799 0.4378 0.5312 0.0311  -0.1437 0.0031  503 PHE B CB  
2868 C CG  . PHE B 176 ? 0.3563 0.4271 0.4874 0.0361  -0.1253 -0.0130 503 PHE B CG  
2869 C CD1 . PHE B 176 ? 0.3540 0.4242 0.4895 0.0529  -0.1204 -0.0326 503 PHE B CD1 
2870 C CD2 . PHE B 176 ? 0.3413 0.4233 0.4471 0.0249  -0.1128 -0.0087 503 PHE B CD2 
2871 C CE1 . PHE B 176 ? 0.3428 0.4252 0.4595 0.0554  -0.1049 -0.0440 503 PHE B CE1 
2872 C CE2 . PHE B 176 ? 0.3297 0.4184 0.4179 0.0295  -0.0980 -0.0219 503 PHE B CE2 
2873 C CZ  . PHE B 176 ? 0.3271 0.4169 0.4215 0.0433  -0.0947 -0.0378 503 PHE B CZ  
2874 N N   . SER B 177 ? 0.4156 0.4763 0.5499 -0.0010 -0.1434 0.0297  504 SER B N   
2875 C CA  . SER B 177 ? 0.4170 0.4942 0.5353 -0.0113 -0.1316 0.0368  504 SER B CA  
2876 C C   . SER B 177 ? 0.4339 0.5057 0.5660 -0.0154 -0.1385 0.0385  504 SER B C   
2877 O O   . SER B 177 ? 0.4351 0.5220 0.5582 -0.0161 -0.1264 0.0360  504 SER B O   
2878 C CB  . SER B 177 ? 0.4302 0.5226 0.5386 -0.0265 -0.1315 0.0594  504 SER B CB  
2879 O OG  . SER B 177 ? 0.4489 0.5458 0.5418 -0.0254 -0.1277 0.0579  504 SER B OG  
2880 N N   . CYS B 178 ? 0.4550 0.5043 0.6098 -0.0184 -0.1593 0.0436  505 CYS B N   
2881 C CA  . CYS B 178 ? 0.4660 0.5022 0.6344 -0.0234 -0.1713 0.0420  505 CYS B CA  
2882 C C   . CYS B 178 ? 0.4670 0.4932 0.6286 -0.0077 -0.1665 0.0140  505 CYS B C   
2883 O O   . CYS B 178 ? 0.4768 0.5131 0.6352 -0.0114 -0.1628 0.0115  505 CYS B O   
2884 C CB  . CYS B 178 ? 0.4891 0.4947 0.6809 -0.0311 -0.1978 0.0535  505 CYS B CB  
2885 S SG  . CYS B 178 ? 0.4905 0.5098 0.6922 -0.0550 -0.2075 0.0931  505 CYS B SG  
2886 N N   . ILE B 179 ? 0.4706 0.4819 0.6302 0.0094  -0.1661 -0.0049 506 ILE B N   
2887 C CA  . ILE B 179 ? 0.4685 0.4733 0.6184 0.0251  -0.1606 -0.0314 506 ILE B CA  
2888 C C   . ILE B 179 ? 0.4374 0.4687 0.5675 0.0270  -0.1399 -0.0365 506 ILE B C   
2889 O O   . ILE B 179 ? 0.4389 0.4705 0.5622 0.0295  -0.1389 -0.0476 506 ILE B O   
2890 C CB  . ILE B 179 ? 0.4854 0.4793 0.6379 0.0450  -0.1601 -0.0486 506 ILE B CB  
2891 C CG1 . ILE B 179 ? 0.5215 0.4850 0.6956 0.0481  -0.1810 -0.0448 506 ILE B CG1 
2892 C CG2 . ILE B 179 ? 0.4916 0.4820 0.6313 0.0603  -0.1541 -0.0752 506 ILE B CG2 
2893 C CD1 . ILE B 179 ? 0.5806 0.5086 0.7603 0.0461  -0.2006 -0.0541 506 ILE B CD1 
2894 N N   . ALA B 180 ? 0.4080 0.4584 0.5277 0.0256  -0.1255 -0.0285 507 ALA B N   
2895 C CA  . ALA B 180 ? 0.3862 0.4557 0.4868 0.0272  -0.1073 -0.0312 507 ALA B CA  
2896 C C   . ALA B 180 ? 0.3806 0.4607 0.4837 0.0189  -0.1069 -0.0223 507 ALA B C   
2897 O O   . ALA B 180 ? 0.3797 0.4674 0.4750 0.0241  -0.0998 -0.0299 507 ALA B O   
2898 C CB  . ALA B 180 ? 0.3753 0.4565 0.4626 0.0237  -0.0960 -0.0226 507 ALA B CB  
2899 N N   . ALA B 181 ? 0.3778 0.4615 0.4939 0.0056  -0.1155 -0.0036 508 ALA B N   
2900 C CA  . ALA B 181 ? 0.3731 0.4760 0.4967 -0.0036 -0.1145 0.0096  508 ALA B CA  
2901 C C   . ALA B 181 ? 0.3791 0.4730 0.5129 -0.0043 -0.1277 0.0011  508 ALA B C   
2902 O O   . ALA B 181 ? 0.3543 0.4672 0.4881 -0.0041 -0.1220 0.0030  508 ALA B O   
2903 C CB  . ALA B 181 ? 0.3784 0.4913 0.5148 -0.0199 -0.1215 0.0344  508 ALA B CB  
2904 N N   . LEU B 182 ? 0.4034 0.4672 0.5440 -0.0034 -0.1454 -0.0093 509 LEU B N   
2905 C CA  . LEU B 182 ? 0.4286 0.4754 0.5745 -0.0060 -0.1625 -0.0198 509 LEU B CA  
2906 C C   . LEU B 182 ? 0.4298 0.4786 0.5573 0.0078  -0.1540 -0.0415 509 LEU B C   
2907 O O   . LEU B 182 ? 0.4515 0.4989 0.5788 0.0034  -0.1641 -0.0464 509 LEU B O   
2908 C CB  . LEU B 182 ? 0.4540 0.4616 0.6100 -0.0077 -0.1849 -0.0260 509 LEU B CB  
2909 C CG  . LEU B 182 ? 0.4725 0.4737 0.6499 -0.0268 -0.2008 -0.0004 509 LEU B CG  
2910 C CD1 . LEU B 182 ? 0.5066 0.4652 0.6923 -0.0220 -0.2194 -0.0072 509 LEU B CD1 
2911 C CD2 . LEU B 182 ? 0.4774 0.4864 0.6693 -0.0478 -0.2158 0.0152  509 LEU B CD2 
2912 N N   . ALA B 183 ? 0.4246 0.4788 0.5367 0.0221  -0.1368 -0.0519 510 ALA B N   
2913 C CA  . ALA B 183 ? 0.4266 0.4893 0.5202 0.0335  -0.1257 -0.0669 510 ALA B CA  
2914 C C   . ALA B 183 ? 0.4240 0.5119 0.5166 0.0292  -0.1183 -0.0556 510 ALA B C   
2915 O O   . ALA B 183 ? 0.4271 0.5203 0.5096 0.0336  -0.1181 -0.0639 510 ALA B O   
2916 C CB  . ALA B 183 ? 0.3977 0.4652 0.4789 0.0450  -0.1093 -0.0732 510 ALA B CB  
2917 N N   . MET B 184 ? 0.4166 0.5220 0.5193 0.0220  -0.1116 -0.0362 511 MET B N   
2918 C CA  . MET B 184 ? 0.4147 0.5475 0.5205 0.0217  -0.1022 -0.0240 511 MET B CA  
2919 C C   . MET B 184 ? 0.4142 0.5636 0.5433 0.0074  -0.1156 -0.0074 511 MET B C   
2920 O O   . MET B 184 ? 0.4161 0.5843 0.5506 0.0076  -0.1169 -0.0031 511 MET B O   
2921 C CB  . MET B 184 ? 0.4190 0.5649 0.5173 0.0266  -0.0826 -0.0154 511 MET B CB  
2922 C CG  . MET B 184 ? 0.4413 0.6127 0.5409 0.0331  -0.0702 -0.0068 511 MET B CG  
2923 S SD  . MET B 184 ? 0.4806 0.6586 0.5637 0.0424  -0.0468 -0.0026 511 MET B SD  
2924 C CE  . MET B 184 ? 0.4744 0.6625 0.5696 0.0277  -0.0510 0.0131  511 MET B CE  
2925 N N   . VAL B 185 ? 0.4126 0.5569 0.5570 -0.0060 -0.1266 0.0045  512 VAL B N   
2926 C CA  . VAL B 185 ? 0.4205 0.5821 0.5899 -0.0240 -0.1409 0.0248  512 VAL B CA  
2927 C C   . VAL B 185 ? 0.4489 0.5806 0.6213 -0.0330 -0.1675 0.0132  512 VAL B C   
2928 O O   . VAL B 185 ? 0.4711 0.5717 0.6482 -0.0412 -0.1845 0.0109  512 VAL B O   
2929 C CB  . VAL B 185 ? 0.4185 0.5914 0.6016 -0.0366 -0.1401 0.0472  512 VAL B CB  
2930 C CG1 . VAL B 185 ? 0.4218 0.6196 0.6339 -0.0580 -0.1547 0.0727  512 VAL B CG1 
2931 C CG2 . VAL B 185 ? 0.3964 0.5944 0.5672 -0.0254 -0.1130 0.0529  512 VAL B CG2 
2932 N N   . THR B 186 ? 0.4524 0.5916 0.6197 -0.0300 -0.1712 0.0050  513 THR B N   
2933 C CA  . THR B 186 ? 0.4916 0.6027 0.6524 -0.0363 -0.1951 -0.0109 513 THR B CA  
2934 C C   . THR B 186 ? 0.4915 0.6310 0.6571 -0.0415 -0.2010 -0.0044 513 THR B C   
2935 O O   . THR B 186 ? 0.4570 0.6331 0.6271 -0.0328 -0.1827 0.0069  513 THR B O   
2936 C CB  . THR B 186 ? 0.4947 0.5708 0.6273 -0.0188 -0.1918 -0.0414 513 THR B CB  
2937 O OG1 . THR B 186 ? 0.5358 0.5774 0.6600 -0.0246 -0.2162 -0.0590 513 THR B OG1 
2938 C CG2 . THR B 186 ? 0.4765 0.5704 0.5888 -0.0016 -0.1717 -0.0515 513 THR B CG2 
2939 N N   . GLU B 187 ? 0.5492 0.6705 0.7139 -0.0556 -0.2279 -0.0111 514 GLU B N   
2940 C CA  . GLU B 187 ? 0.5641 0.7114 0.7321 -0.0629 -0.2383 -0.0050 514 GLU B CA  
2941 C C   . GLU B 187 ? 0.5458 0.7034 0.6890 -0.0425 -0.2217 -0.0190 514 GLU B C   
2942 O O   . GLU B 187 ? 0.5510 0.6794 0.6646 -0.0299 -0.2179 -0.0445 514 GLU B O   
2943 C CB  . GLU B 187 ? 0.6374 0.7548 0.8012 -0.0832 -0.2735 -0.0141 514 GLU B CB  
2944 C CG  . GLU B 187 ? 0.6792 0.8108 0.8292 -0.0861 -0.2854 -0.0199 514 GLU B CG  
2945 C CD  . GLU B 187 ? 0.7405 0.8738 0.9063 -0.1157 -0.3203 -0.0077 514 GLU B CD  
2946 O OE1 . GLU B 187 ? 0.7591 0.9354 0.9385 -0.1229 -0.3253 0.0097  514 GLU B OE1 
2947 O OE2 . GLU B 187 ? 0.7850 0.8758 0.9505 -0.1324 -0.3445 -0.0146 514 GLU B OE2 
2948 N N   . ARG B 188 ? 0.5294 0.7311 0.6870 -0.0390 -0.2115 0.0000  515 ARG B N   
2949 C CA  . ARG B 188 ? 0.5304 0.7446 0.6690 -0.0244 -0.2023 -0.0067 515 ARG B CA  
2950 C C   . ARG B 188 ? 0.5470 0.7980 0.7049 -0.0354 -0.2174 0.0125  515 ARG B C   
2951 O O   . ARG B 188 ? 0.5504 0.8332 0.7435 -0.0474 -0.2224 0.0373  515 ARG B O   
2952 C CB  . ARG B 188 ? 0.4936 0.7236 0.6311 -0.0035 -0.1716 -0.0010 515 ARG B CB  
2953 C CG  . ARG B 188 ? 0.4860 0.6898 0.6115 0.0052  -0.1557 -0.0129 515 ARG B CG  
2954 C CD  . ARG B 188 ? 0.4942 0.6646 0.5874 0.0126  -0.1566 -0.0397 515 ARG B CD  
2955 N NE  . ARG B 188 ? 0.4896 0.6428 0.5761 0.0215  -0.1409 -0.0470 515 ARG B NE  
2956 C CZ  . ARG B 188 ? 0.4928 0.6226 0.5576 0.0300  -0.1370 -0.0673 515 ARG B CZ  
2957 N NH1 . ARG B 188 ? 0.5155 0.6351 0.5592 0.0323  -0.1459 -0.0845 515 ARG B NH1 
2958 N NH2 . ARG B 188 ? 0.4653 0.5855 0.5292 0.0363  -0.1242 -0.0695 515 ARG B NH2 
2959 N N   . HIS B 189 ? 0.5714 0.8232 0.7075 -0.0317 -0.2246 0.0035  516 HIS B N   
2960 C CA  . HIS B 189 ? 0.5778 0.8664 0.7312 -0.0417 -0.2407 0.0228  516 HIS B CA  
2961 C C   . HIS B 189 ? 0.5418 0.8773 0.7260 -0.0271 -0.2197 0.0494  516 HIS B C   
2962 O O   . HIS B 189 ? 0.5266 0.8586 0.6988 -0.0052 -0.1951 0.0452  516 HIS B O   
2963 C CB  . HIS B 189 ? 0.6178 0.8964 0.7360 -0.0404 -0.2526 0.0074  516 HIS B CB  
2964 C CG  . HIS B 189 ? 0.6656 0.9743 0.7973 -0.0581 -0.2794 0.0240  516 HIS B CG  
2965 N ND1 . HIS B 189 ? 0.6678 1.0157 0.8085 -0.0498 -0.2768 0.0429  516 HIS B ND1 
2966 C CD2 . HIS B 189 ? 0.7032 1.0088 0.8430 -0.0848 -0.3114 0.0266  516 HIS B CD2 
2967 C CE1 . HIS B 189 ? 0.7043 1.0759 0.8582 -0.0705 -0.3058 0.0567  516 HIS B CE1 
2968 N NE2 . HIS B 189 ? 0.7340 1.0801 0.8869 -0.0932 -0.3277 0.0468  516 HIS B NE2 
2969 N N   . GLY B 190 ? 0.5355 0.9140 0.7598 -0.0395 -0.2301 0.0767  517 GLY B N   
2970 C CA  . GLY B 190 ? 0.5030 0.9336 0.7620 -0.0241 -0.2122 0.1038  517 GLY B CA  
2971 C C   . GLY B 190 ? 0.4762 0.9248 0.7599 -0.0164 -0.1888 0.1162  517 GLY B C   
2972 O O   . GLY B 190 ? 0.4581 0.9350 0.7564 0.0060  -0.1650 0.1282  517 GLY B O   
2973 N N   . LEU B 191 ? 0.4632 0.8925 0.7486 -0.0338 -0.1956 0.1124  518 LEU B N   
2974 C CA  . LEU B 191 ? 0.4427 0.8932 0.7507 -0.0321 -0.1774 0.1273  518 LEU B CA  
2975 C C   . LEU B 191 ? 0.4561 0.9718 0.8134 -0.0442 -0.1841 0.1622  518 LEU B C   
2976 O O   . LEU B 191 ? 0.4723 1.0010 0.8464 -0.0684 -0.2135 0.1733  518 LEU B O   
2977 C CB  . LEU B 191 ? 0.4315 0.8408 0.7269 -0.0492 -0.1865 0.1158  518 LEU B CB  
2978 C CG  . LEU B 191 ? 0.4119 0.7690 0.6696 -0.0359 -0.1727 0.0881  518 LEU B CG  
2979 C CD1 . LEU B 191 ? 0.4228 0.7391 0.6735 -0.0562 -0.1932 0.0784  518 LEU B CD1 
2980 C CD2 . LEU B 191 ? 0.3870 0.7571 0.6444 -0.0171 -0.1411 0.0927  518 LEU B CD2 
2981 N N   . LYS B 192 ? 0.4533 1.0111 0.8328 -0.0273 -0.1569 0.1793  519 LYS B N   
2982 C CA  . LYS B 192 ? 0.4691 1.0993 0.8996 -0.0358 -0.1578 0.2151  519 LYS B CA  
2983 C C   . LYS B 192 ? 0.4819 1.1216 0.9319 -0.0666 -0.1704 0.2316  519 LYS B C   
2984 O O   . LYS B 192 ? 0.4992 1.1920 0.9917 -0.0876 -0.1853 0.2623  519 LYS B O   
2985 C CB  . LYS B 192 ? 0.4592 1.1345 0.9056 -0.0023 -0.1221 0.2263  519 LYS B CB  
2986 C CG  . LYS B 192 ? 0.4660 1.1440 0.9073 0.0253  -0.1149 0.2207  519 LYS B CG  
2987 C CD  . LYS B 192 ? 0.4746 1.1761 0.9205 0.0624  -0.0781 0.2232  519 LYS B CD  
2988 C CE  . LYS B 192 ? 0.4906 1.1895 0.9332 0.0902  -0.0734 0.2197  519 LYS B CE  
2989 N NZ  . LYS B 192 ? 0.4990 1.2260 0.9539 0.1282  -0.0402 0.2254  519 LYS B NZ  
2990 N N   . GLU B 193 ? 0.4811 1.0718 0.9023 -0.0702 -0.1655 0.2141  520 GLU B N   
2991 C CA  . GLU B 193 ? 0.5042 1.0938 0.9393 -0.0991 -0.1785 0.2292  520 GLU B CA  
2992 C C   . GLU B 193 ? 0.5227 1.0333 0.9224 -0.1123 -0.1987 0.2021  520 GLU B C   
2993 O O   . GLU B 193 ? 0.5150 0.9982 0.8975 -0.1094 -0.1873 0.1943  520 GLU B O   
2994 C CB  . GLU B 193 ? 0.5068 1.1307 0.9497 -0.0881 -0.1473 0.2439  520 GLU B CB  
2995 C CG  . GLU B 193 ? 0.5116 1.2016 0.9760 -0.0604 -0.1167 0.2589  520 GLU B CG  
2996 C CD  . GLU B 193 ? 0.5199 1.2806 1.0201 -0.0679 -0.1017 0.2936  520 GLU B CD  
2997 O OE1 . GLU B 193 ? 0.5426 1.2929 1.0303 -0.0768 -0.0938 0.2963  520 GLU B OE1 
2998 O OE2 . GLU B 193 ? 0.5217 1.3531 1.0634 -0.0641 -0.0970 0.3197  520 GLU B OE2 
2999 N N   . PRO B 194 ? 0.5447 1.0201 0.9333 -0.1263 -0.2290 0.1877  521 PRO B N   
3000 C CA  . PRO B 194 ? 0.5619 0.9616 0.9152 -0.1328 -0.2457 0.1582  521 PRO B CA  
3001 C C   . PRO B 194 ? 0.5779 0.9565 0.9425 -0.1578 -0.2610 0.1702  521 PRO B C   
3002 O O   . PRO B 194 ? 0.5789 0.9081 0.9187 -0.1512 -0.2574 0.1510  521 PRO B O   
3003 C CB  . PRO B 194 ? 0.5899 0.9670 0.9318 -0.1444 -0.2759 0.1444  521 PRO B CB  
3004 C CG  . PRO B 194 ? 0.5823 1.0243 0.9644 -0.1586 -0.2861 0.1764  521 PRO B CG  
3005 C CD  . PRO B 194 ? 0.5460 1.0506 0.9538 -0.1380 -0.2510 0.1989  521 PRO B CD  
3006 N N   . LYS B 195 ? 0.5928 1.0112 0.9966 -0.1864 -0.2786 0.2040  522 LYS B N   
3007 C CA  . LYS B 195 ? 0.6094 1.0209 1.0321 -0.2141 -0.2933 0.2261  522 LYS B CA  
3008 C C   . LYS B 195 ? 0.5851 0.9993 0.9993 -0.1996 -0.2643 0.2293  522 LYS B C   
3009 O O   . LYS B 195 ? 0.6043 0.9716 1.0077 -0.2097 -0.2758 0.2247  522 LYS B O   
3010 C CB  . LYS B 195 ? 0.6238 1.1026 1.0965 -0.2438 -0.3069 0.2702  522 LYS B CB  
3011 C CG  . LYS B 195 ? 0.6704 1.1269 1.1556 -0.2796 -0.3529 0.2760  522 LYS B CG  
3012 C CD  . LYS B 195 ? 0.6737 1.2112 1.2130 -0.3072 -0.3630 0.3231  522 LYS B CD  
3013 C CE  . LYS B 195 ? 0.7105 1.2387 1.2585 -0.3347 -0.4044 0.3243  522 LYS B CE  
3014 N NZ  . LYS B 195 ? 0.7125 1.3335 1.3157 -0.3548 -0.4100 0.3693  522 LYS B NZ  
3015 N N   . ARG B 196 ? 0.5457 1.0132 0.9641 -0.1758 -0.2285 0.2372  523 ARG B N   
3016 C CA  . ARG B 196 ? 0.5291 1.0017 0.9345 -0.1620 -0.2006 0.2391  523 ARG B CA  
3017 C C   . ARG B 196 ? 0.5062 0.9163 0.8679 -0.1392 -0.1910 0.2017  523 ARG B C   
3018 O O   . ARG B 196 ? 0.4982 0.8890 0.8461 -0.1380 -0.1831 0.2008  523 ARG B O   
3019 C CB  . ARG B 196 ? 0.5229 1.0700 0.9442 -0.1442 -0.1662 0.2584  523 ARG B CB  
3020 C CG  . ARG B 196 ? 0.5552 1.1632 1.0150 -0.1695 -0.1680 0.3015  523 ARG B CG  
3021 C CD  . ARG B 196 ? 0.5511 1.2389 1.0275 -0.1493 -0.1317 0.3206  523 ARG B CD  
3022 N NE  . ARG B 196 ? 0.5579 1.2356 0.9988 -0.1224 -0.0987 0.3039  523 ARG B NE  
3023 C CZ  . ARG B 196 ? 0.5655 1.2540 0.9981 -0.1305 -0.0878 0.3178  523 ARG B CZ  
3024 N NH1 . ARG B 196 ? 0.5889 1.2987 1.0479 -0.1652 -0.1065 0.3511  523 ARG B NH1 
3025 N NH2 . ARG B 196 ? 0.5685 1.2450 0.9643 -0.1054 -0.0596 0.2992  523 ARG B NH2 
3026 N N   . VAL B 197 ? 0.4926 0.8748 0.8339 -0.1230 -0.1932 0.1736  524 VAL B N   
3027 C CA  . VAL B 197 ? 0.4904 0.8158 0.7930 -0.1038 -0.1872 0.1391  524 VAL B CA  
3028 C C   . VAL B 197 ? 0.5162 0.7831 0.8115 -0.1204 -0.2149 0.1287  524 VAL B C   
3029 O O   . VAL B 197 ? 0.5042 0.7371 0.7809 -0.1120 -0.2091 0.1159  524 VAL B O   
3030 C CB  . VAL B 197 ? 0.4705 0.7890 0.7538 -0.0828 -0.1805 0.1157  524 VAL B CB  
3031 C CG1 . VAL B 197 ? 0.4758 0.7367 0.7233 -0.0695 -0.1814 0.0820  524 VAL B CG1 
3032 C CG2 . VAL B 197 ? 0.4322 0.7934 0.7160 -0.0595 -0.1487 0.1217  524 VAL B CG2 
3033 N N   . GLU B 198 ? 0.5631 0.8192 0.8746 -0.1444 -0.2462 0.1360  525 GLU B N   
3034 C CA  . GLU B 198 ? 0.6084 0.8043 0.9149 -0.1609 -0.2763 0.1267  525 GLU B CA  
3035 C C   . GLU B 198 ? 0.6060 0.8009 0.9294 -0.1775 -0.2804 0.1521  525 GLU B C   
3036 O O   . GLU B 198 ? 0.6211 0.7632 0.9327 -0.1771 -0.2920 0.1400  525 GLU B O   
3037 C CB  . GLU B 198 ? 0.6612 0.8442 0.9787 -0.1848 -0.3112 0.1285  525 GLU B CB  
3038 C CG  . GLU B 198 ? 0.7176 0.8269 1.0057 -0.1817 -0.3347 0.0926  525 GLU B CG  
3039 C CD  . GLU B 198 ? 0.7920 0.8653 1.0928 -0.2146 -0.3770 0.1004  525 GLU B CD  
3040 O OE1 . GLU B 198 ? 0.8113 0.9039 1.1229 -0.2337 -0.3964 0.1092  525 GLU B OE1 
3041 O OE2 . GLU B 198 ? 0.8331 0.8559 1.1331 -0.2220 -0.3930 0.0983  525 GLU B OE2 
3042 N N   . GLU B 199 ? 0.5860 0.8419 0.9374 -0.1911 -0.2706 0.1881  526 GLU B N   
3043 C CA  . GLU B 199 ? 0.5878 0.8566 0.9554 -0.2087 -0.2713 0.2183  526 GLU B CA  
3044 C C   . GLU B 199 ? 0.5635 0.8207 0.9057 -0.1863 -0.2460 0.2066  526 GLU B C   
3045 O O   . GLU B 199 ? 0.5744 0.8057 0.9165 -0.1964 -0.2558 0.2164  526 GLU B O   
3046 C CB  . GLU B 199 ? 0.5868 0.9358 0.9883 -0.2250 -0.2611 0.2592  526 GLU B CB  
3047 C CG  . GLU B 199 ? 0.6389 0.9988 1.0763 -0.2637 -0.2958 0.2887  526 GLU B CG  
3048 C CD  . GLU B 199 ? 0.6326 1.0785 1.1053 -0.2726 -0.2863 0.3193  526 GLU B CD  
3049 O OE1 . GLU B 199 ? 0.6517 1.1113 1.1555 -0.3053 -0.3161 0.3434  526 GLU B OE1 
3050 O OE2 . GLU B 199 ? 0.6054 1.1055 1.0763 -0.2470 -0.2502 0.3200  526 GLU B OE2 
3051 N N   . LEU B 200 ? 0.5193 0.7938 0.8404 -0.1572 -0.2161 0.1868  527 LEU B N   
3052 C CA  . LEU B 200 ? 0.5006 0.7628 0.7949 -0.1368 -0.1937 0.1731  527 LEU B CA  
3053 C C   . LEU B 200 ? 0.5078 0.7030 0.7813 -0.1269 -0.2073 0.1434  527 LEU B C   
3054 O O   . LEU B 200 ? 0.5054 0.6792 0.7703 -0.1254 -0.2068 0.1441  527 LEU B O   
3055 C CB  . LEU B 200 ? 0.4674 0.7647 0.7452 -0.1105 -0.1597 0.1622  527 LEU B CB  
3056 C CG  . LEU B 200 ? 0.4574 0.7433 0.7053 -0.0925 -0.1375 0.1495  527 LEU B CG  
3057 C CD1 . LEU B 200 ? 0.4659 0.7769 0.7180 -0.1061 -0.1318 0.1767  527 LEU B CD1 
3058 C CD2 . LEU B 200 ? 0.4357 0.7385 0.6628 -0.0661 -0.1090 0.1326  527 LEU B CD2 
3059 N N   . GLN B 201 ? 0.5121 0.6790 0.7782 -0.1199 -0.2188 0.1187  528 GLN B N   
3060 C CA  . GLN B 201 ? 0.5284 0.6371 0.7753 -0.1076 -0.2302 0.0883  528 GLN B CA  
3061 C C   . GLN B 201 ? 0.5708 0.6372 0.8293 -0.1235 -0.2568 0.0968  528 GLN B C   
3062 O O   . GLN B 201 ? 0.5788 0.6136 0.8269 -0.1116 -0.2561 0.0853  528 GLN B O   
3063 C CB  . GLN B 201 ? 0.5331 0.6252 0.7708 -0.1027 -0.2411 0.0650  528 GLN B CB  
3064 C CG  . GLN B 201 ? 0.5578 0.5918 0.7755 -0.0902 -0.2542 0.0325  528 GLN B CG  
3065 C CD  . GLN B 201 ? 0.5768 0.5942 0.7837 -0.0914 -0.2702 0.0127  528 GLN B CD  
3066 O OE1 . GLN B 201 ? 0.6135 0.6189 0.8335 -0.1135 -0.2969 0.0215  528 GLN B OE1 
3067 N NE2 . GLN B 201 ? 0.5617 0.5790 0.7435 -0.0698 -0.2553 -0.0127 528 GLN B NE2 
3068 N N   . ASN B 202 ? 0.6015 0.6691 0.8836 -0.1510 -0.2811 0.1194  529 ASN B N   
3069 C CA  . ASN B 202 ? 0.6453 0.6691 0.9417 -0.1704 -0.3114 0.1319  529 ASN B CA  
3070 C C   . ASN B 202 ? 0.6404 0.6749 0.9439 -0.1754 -0.3043 0.1569  529 ASN B C   
3071 O O   . ASN B 202 ? 0.6643 0.6514 0.9666 -0.1728 -0.3194 0.1525  529 ASN B O   
3072 C CB  . ASN B 202 ? 0.6815 0.7083 1.0025 -0.2030 -0.3403 0.1538  529 ASN B CB  
3073 C CG  . ASN B 202 ? 0.7127 0.7083 1.0218 -0.2009 -0.3580 0.1252  529 ASN B CG  
3074 O OD1 . ASN B 202 ? 0.7214 0.6803 1.0034 -0.1758 -0.3535 0.0879  529 ASN B OD1 
3075 N ND2 . ASN B 202 ? 0.7341 0.7480 1.0629 -0.2282 -0.3783 0.1438  529 ASN B ND2 
3076 N N   . LYS B 203 ? 0.6161 0.7128 0.9255 -0.1808 -0.2815 0.1825  530 LYS B N   
3077 C CA  . LYS B 203 ? 0.6156 0.7300 0.9232 -0.1832 -0.2698 0.2040  530 LYS B CA  
3078 C C   . LYS B 203 ? 0.6096 0.6935 0.8924 -0.1564 -0.2582 0.1767  530 LYS B C   
3079 O O   . LYS B 203 ? 0.6393 0.7009 0.9233 -0.1595 -0.2676 0.1868  530 LYS B O   
3080 C CB  . LYS B 203 ? 0.5879 0.7752 0.8952 -0.1845 -0.2399 0.2253  530 LYS B CB  
3081 C CG  . LYS B 203 ? 0.5997 0.8358 0.9366 -0.2131 -0.2466 0.2641  530 LYS B CG  
3082 C CD  . LYS B 203 ? 0.5748 0.8826 0.9056 -0.2057 -0.2112 0.2796  530 LYS B CD  
3083 C CE  . LYS B 203 ? 0.5719 0.9403 0.9295 -0.2169 -0.2058 0.3007  530 LYS B CE  
3084 N NZ  . LYS B 203 ? 0.5943 0.9999 0.9819 -0.2511 -0.2191 0.3470  530 LYS B NZ  
3085 N N   . ILE B 204 ? 0.5874 0.6728 0.8499 -0.1317 -0.2393 0.1452  531 ILE B N   
3086 C CA  . ILE B 204 ? 0.5737 0.6370 0.8142 -0.1070 -0.2270 0.1199  531 ILE B CA  
3087 C C   . ILE B 204 ? 0.5963 0.5999 0.8405 -0.1003 -0.2509 0.1022  531 ILE B C   
3088 O O   . ILE B 204 ? 0.6046 0.5905 0.8449 -0.0900 -0.2508 0.0991  531 ILE B O   
3089 C CB  . ILE B 204 ? 0.5358 0.6186 0.7540 -0.0844 -0.2004 0.0947  531 ILE B CB  
3090 C CG1 . ILE B 204 ? 0.5130 0.6499 0.7263 -0.0862 -0.1756 0.1104  531 ILE B CG1 
3091 C CG2 . ILE B 204 ? 0.5287 0.5937 0.7280 -0.0642 -0.1897 0.0749  531 ILE B CG2 
3092 C CD1 . ILE B 204 ? 0.4840 0.6380 0.6809 -0.0672 -0.1541 0.0903  531 ILE B CD1 
3093 N N   . VAL B 205 ? 0.6144 0.5880 0.8657 -0.1056 -0.2717 0.0910  532 VAL B N   
3094 C CA  . VAL B 205 ? 0.6613 0.5727 0.9162 -0.0999 -0.2975 0.0742  532 VAL B CA  
3095 C C   . VAL B 205 ? 0.6984 0.5865 0.9739 -0.1171 -0.3197 0.1025  532 VAL B C   
3096 O O   . VAL B 205 ? 0.7215 0.5754 0.9983 -0.1030 -0.3269 0.0951  532 VAL B O   
3097 C CB  . VAL B 205 ? 0.6887 0.5702 0.9418 -0.1051 -0.3175 0.0556  532 VAL B CB  
3098 C CG1 . VAL B 205 ? 0.7369 0.5480 0.9939 -0.1027 -0.3480 0.0415  532 VAL B CG1 
3099 C CG2 . VAL B 205 ? 0.6593 0.5543 0.8883 -0.0833 -0.2976 0.0237  532 VAL B CG2 
3100 N N   . ASN B 206 ? 0.7118 0.6229 1.0052 -0.1470 -0.3299 0.1375  533 ASN B N   
3101 C CA  . ASN B 206 ? 0.7476 0.6428 1.0613 -0.1686 -0.3518 0.1717  533 ASN B CA  
3102 C C   . ASN B 206 ? 0.7409 0.6439 1.0504 -0.1583 -0.3410 0.1823  533 ASN B C   
3103 O O   . ASN B 206 ? 0.7760 0.6349 1.0966 -0.1574 -0.3627 0.1883  533 ASN B O   
3104 C CB  . ASN B 206 ? 0.7439 0.6823 1.0763 -0.2031 -0.3568 0.2122  533 ASN B CB  
3105 C CG  . ASN B 206 ? 0.7868 0.6969 1.1353 -0.2253 -0.3870 0.2151  533 ASN B CG  
3106 O OD1 . ASN B 206 ? 0.8275 0.6721 1.1728 -0.2183 -0.4109 0.1900  533 ASN B OD1 
3107 N ND2 . ASN B 206 ? 0.7804 0.7410 1.1458 -0.2522 -0.3865 0.2456  533 ASN B ND2 
3108 N N   . CYS B 207 ? 0.7067 0.6629 1.0002 -0.1507 -0.3096 0.1850  534 CYS B N   
3109 C CA  . CYS B 207 ? 0.7143 0.6792 1.0010 -0.1440 -0.3017 0.1958  534 CYS B CA  
3110 C C   . CYS B 207 ? 0.6919 0.6280 0.9684 -0.1132 -0.2967 0.1637  534 CYS B C   
3111 O O   . CYS B 207 ? 0.7075 0.6403 0.9849 -0.1082 -0.2989 0.1733  534 CYS B O   
3112 C CB  . CYS B 207 ? 0.7049 0.7327 0.9769 -0.1526 -0.2754 0.2164  534 CYS B CB  
3113 S SG  . CYS B 207 ? 0.7124 0.7769 0.9552 -0.1293 -0.2376 0.1856  534 CYS B SG  
3114 N N   . LEU B 208 ? 0.6738 0.5926 0.9418 -0.0938 -0.2912 0.1282  535 LEU B N   
3115 C CA  . LEU B 208 ? 0.6715 0.5598 0.9356 -0.0654 -0.2908 0.0987  535 LEU B CA  
3116 C C   . LEU B 208 ? 0.7262 0.5558 1.0107 -0.0626 -0.3221 0.0990  535 LEU B C   
3117 O O   . LEU B 208 ? 0.7370 0.5508 1.0293 -0.0467 -0.3264 0.0975  535 LEU B O   
3118 C CB  . LEU B 208 ? 0.6484 0.5390 0.8951 -0.0464 -0.2750 0.0625  535 LEU B CB  
3119 C CG  . LEU B 208 ? 0.6531 0.5201 0.8945 -0.0158 -0.2713 0.0302  535 LEU B CG  
3120 C CD1 . LEU B 208 ? 0.6209 0.5125 0.8601 -0.0034 -0.2558 0.0342  535 LEU B CD1 
3121 C CD2 . LEU B 208 ? 0.6363 0.5089 0.8584 -0.0029 -0.2576 -0.0005 535 LEU B CD2 
3122 N N   . LYS B 209 ? 0.7726 0.5695 1.0665 -0.0780 -0.3449 0.1011  536 LYS B N   
3123 C CA  . LYS B 209 ? 0.8297 0.5618 1.1423 -0.0797 -0.3793 0.1036  536 LYS B CA  
3124 C C   . LYS B 209 ? 0.8388 0.5682 1.1708 -0.0922 -0.3934 0.1414  536 LYS B C   
3125 O O   . LYS B 209 ? 0.8647 0.5536 1.2096 -0.0754 -0.4087 0.1379  536 LYS B O   
3126 C CB  . LYS B 209 ? 0.8758 0.5789 1.1941 -0.1041 -0.4036 0.1076  536 LYS B CB  
3127 C CG  . LYS B 209 ? 0.8910 0.5822 1.1899 -0.0921 -0.3989 0.0689  536 LYS B CG  
3128 C CD  . LYS B 209 ? 0.9453 0.5893 1.2502 -0.1145 -0.4323 0.0691  536 LYS B CD  
3129 C CE  . LYS B 209 ? 0.9546 0.5882 1.2354 -0.1023 -0.4281 0.0295  536 LYS B CE  
3130 N NZ  . LYS B 209 ? 1.0298 0.6127 1.3118 -0.1244 -0.4635 0.0255  536 LYS B NZ  
3131 N N   . ASP B 210 ? 0.8167 0.5925 1.1505 -0.1204 -0.3874 0.1778  537 ASP B N   
3132 C CA  . ASP B 210 ? 0.8315 0.6178 1.1783 -0.1369 -0.3977 0.2186  537 ASP B CA  
3133 C C   . ASP B 210 ? 0.8126 0.6134 1.1538 -0.1143 -0.3842 0.2141  537 ASP B C   
3134 O O   . ASP B 210 ? 0.8420 0.6204 1.1998 -0.1144 -0.4034 0.2348  537 ASP B O   
3135 C CB  . ASP B 210 ? 0.8114 0.6580 1.1537 -0.1680 -0.3855 0.2538  537 ASP B CB  
3136 C CG  . ASP B 210 ? 0.8396 0.6780 1.1972 -0.1982 -0.4053 0.2728  537 ASP B CG  
3137 O OD1 . ASP B 210 ? 0.8899 0.6668 1.2648 -0.2041 -0.4379 0.2721  537 ASP B OD1 
3138 O OD2 . ASP B 210 ? 0.8113 0.7059 1.1641 -0.2161 -0.3883 0.2892  537 ASP B OD2 
3139 N N   . HIS B 211 ? 0.7658 0.6042 1.0851 -0.0964 -0.3531 0.1895  538 HIS B N   
3140 C CA  . HIS B 211 ? 0.7358 0.5927 1.0492 -0.0776 -0.3403 0.1849  538 HIS B CA  
3141 C C   . HIS B 211 ? 0.7658 0.5798 1.0951 -0.0469 -0.3518 0.1616  538 HIS B C   
3142 O O   . HIS B 211 ? 0.7677 0.5818 1.1093 -0.0381 -0.3587 0.1743  538 HIS B O   
3143 C CB  . HIS B 211 ? 0.6676 0.5730 0.9531 -0.0701 -0.3064 0.1671  538 HIS B CB  
3144 C CG  . HIS B 211 ? 0.6425 0.5723 0.9204 -0.0602 -0.2959 0.1703  538 HIS B CG  
3145 N ND1 . HIS B 211 ? 0.6223 0.5489 0.9004 -0.0332 -0.2870 0.1435  538 HIS B ND1 
3146 C CD2 . HIS B 211 ? 0.6343 0.5925 0.9049 -0.0753 -0.2956 0.1991  538 HIS B CD2 
3147 C CE1 . HIS B 211 ? 0.6039 0.5569 0.8771 -0.0334 -0.2823 0.1561  538 HIS B CE1 
3148 N NE2 . HIS B 211 ? 0.6090 0.5795 0.8752 -0.0586 -0.2877 0.1885  538 HIS B NE2 
3149 N N   . VAL B 212 ? 0.7907 0.5713 1.1192 -0.0301 -0.3536 0.1280  539 VAL B N   
3150 C CA  . VAL B 212 ? 0.8392 0.5766 1.1814 0.0018  -0.3638 0.1025  539 VAL B CA  
3151 C C   . VAL B 212 ? 0.9219 0.6064 1.2921 -0.0021 -0.3988 0.1247  539 VAL B C   
3152 O O   . VAL B 212 ? 0.9534 0.6195 1.3424 0.0215  -0.4071 0.1229  539 VAL B O   
3153 C CB  . VAL B 212 ? 0.8402 0.5548 1.1679 0.0190  -0.3572 0.0603  539 VAL B CB  
3154 C CG1 . VAL B 212 ? 0.8801 0.5465 1.2199 0.0535  -0.3682 0.0324  539 VAL B CG1 
3155 C CG2 . VAL B 212 ? 0.7765 0.5431 1.0796 0.0263  -0.3234 0.0412  539 VAL B CG2 
3156 N N   . THR B 213 ? 0.9734 0.6367 1.3485 -0.0329 -0.4196 0.1484  540 THR B N   
3157 C CA  . THR B 213 ? 1.0536 0.6661 1.4547 -0.0446 -0.4558 0.1769  540 THR B CA  
3158 C C   . THR B 213 ? 1.0762 0.7147 1.4916 -0.0508 -0.4602 0.2155  540 THR B C   
3159 O O   . THR B 213 ? 1.1163 0.7156 1.5558 -0.0353 -0.4820 0.2237  540 THR B O   
3160 C CB  . THR B 213 ? 1.0758 0.6702 1.4786 -0.0828 -0.4760 0.1988  540 THR B CB  
3161 O OG1 . THR B 213 ? 1.0846 0.6551 1.4731 -0.0771 -0.4741 0.1624  540 THR B OG1 
3162 C CG2 . THR B 213 ? 1.1376 0.6706 1.5676 -0.0974 -0.5174 0.2290  540 THR B CG2 
3163 N N   . PHE B 214 ? 1.0676 0.7712 1.4669 -0.0713 -0.4399 0.2377  541 PHE B N   
3164 C CA  . PHE B 214 ? 1.1009 0.8332 1.5068 -0.0837 -0.4454 0.2774  541 PHE B CA  
3165 C C   . PHE B 214 ? 1.0858 0.8426 1.4931 -0.0563 -0.4324 0.2669  541 PHE B C   
3166 O O   . PHE B 214 ? 1.1009 0.8624 1.5230 -0.0592 -0.4471 0.2969  541 PHE B O   
3167 C CB  . PHE B 214 ? 1.0974 0.8856 1.4832 -0.1198 -0.4328 0.3089  541 PHE B CB  
3168 C CG  . PHE B 214 ? 1.1470 0.9425 1.5439 -0.1452 -0.4539 0.3601  541 PHE B CG  
3169 C CD1 . PHE B 214 ? 1.2097 0.9713 1.6261 -0.1716 -0.4837 0.3923  541 PHE B CD1 
3170 C CD2 . PHE B 214 ? 1.1432 0.9788 1.5304 -0.1451 -0.4462 0.3782  541 PHE B CD2 
3171 C CE1 . PHE B 214 ? 1.2571 1.0269 1.6833 -0.1967 -0.5041 0.4431  541 PHE B CE1 
3172 C CE2 . PHE B 214 ? 1.1904 1.0345 1.5850 -0.1695 -0.4667 0.4270  541 PHE B CE2 
3173 C CZ  . PHE B 214 ? 1.2422 1.0544 1.6567 -0.1950 -0.4951 0.4605  541 PHE B CZ  
3174 N N   . ASN B 215 ? 1.0554 0.8298 1.4489 -0.0317 -0.4066 0.2274  542 ASN B N   
3175 C CA  . ASN B 215 ? 1.0479 0.8463 1.4468 -0.0052 -0.3950 0.2158  542 ASN B CA  
3176 C C   . ASN B 215 ? 1.0979 0.8521 1.5303 0.0291  -0.4128 0.2032  542 ASN B C   
3177 O O   . ASN B 215 ? 1.0893 0.8657 1.5311 0.0553  -0.4018 0.1898  542 ASN B O   
3178 C CB  . ASN B 215 ? 0.9955 0.8343 1.3675 0.0052  -0.3609 0.1832  542 ASN B CB  
3179 C CG  . ASN B 215 ? 0.9612 0.8575 1.3102 -0.0114 -0.3434 0.1997  542 ASN B CG  
3180 O OD1 . ASN B 215 ? 0.9734 0.8851 1.3168 -0.0368 -0.3525 0.2342  542 ASN B OD1 
3181 N ND2 . ASN B 215 ? 0.9190 0.8460 1.2520 0.0019  -0.3190 0.1748  542 ASN B ND2 
3182 N N   . ASN B 216 ? 1.1639 0.8562 1.6147 0.0290  -0.4404 0.2077  543 ASN B N   
3183 C CA  . ASN B 216 ? 1.2154 0.8568 1.7006 0.0594  -0.4636 0.2040  543 ASN B CA  
3184 C C   . ASN B 216 ? 1.2748 0.8590 1.7791 0.0390  -0.5015 0.2369  543 ASN B C   
3185 O O   . ASN B 216 ? 1.3238 0.8625 1.8593 0.0589  -0.5265 0.2452  543 ASN B O   
3186 C CB  . ASN B 216 ? 1.2289 0.8385 1.7133 0.0977  -0.4536 0.1528  543 ASN B CB  
3187 C CG  . ASN B 216 ? 1.2712 0.8259 1.7411 0.0874  -0.4649 0.1331  543 ASN B CG  
3188 O OD1 . ASN B 216 ? 1.3406 0.8307 1.8266 0.0829  -0.4967 0.1436  543 ASN B OD1 
3189 N ND2 . ASN B 216 ? 1.2329 0.8112 1.6727 0.0832  -0.4410 0.1051  543 ASN B ND2 
3190 N N   . ASN B 223 ? 1.2598 0.6657 1.5466 0.1952  -0.4043 -0.1750 550 ASN B N   
3191 C CA  . ASN B 223 ? 1.2349 0.6907 1.5116 0.2315  -0.3693 -0.2024 550 ASN B CA  
3192 C C   . ASN B 223 ? 1.1474 0.6906 1.4231 0.2159  -0.3390 -0.1805 550 ASN B C   
3193 O O   . ASN B 223 ? 1.1175 0.6983 1.3661 0.2180  -0.3157 -0.1996 550 ASN B O   
3194 C CB  . ASN B 223 ? 1.2784 0.7177 1.5821 0.2753  -0.3691 -0.2121 550 ASN B CB  
3195 C CG  . ASN B 223 ? 1.2817 0.7142 1.6270 0.2654  -0.3881 -0.1692 550 ASN B CG  
3196 O OD1 . ASN B 223 ? 1.3219 0.6980 1.6769 0.2433  -0.4205 -0.1504 550 ASN B OD1 
3197 N ND2 . ASN B 223 ? 1.2394 0.7303 1.6094 0.2802  -0.3694 -0.1518 550 ASN B ND2 
3198 N N   . TYR B 224 ? 1.1086 0.6807 1.4111 0.1995  -0.3408 -0.1405 551 TYR B N   
3199 C CA  . TYR B 224 ? 1.0292 0.6776 1.3310 0.1877  -0.3141 -0.1206 551 TYR B CA  
3200 C C   . TYR B 224 ? 0.9922 0.6667 1.2684 0.1544  -0.3057 -0.1135 551 TYR B C   
3201 O O   . TYR B 224 ? 0.9552 0.6814 1.2152 0.1546  -0.2793 -0.1190 551 TYR B O   
3202 C CB  . TYR B 224 ? 1.0054 0.6730 1.3383 0.1786  -0.3214 -0.0810 551 TYR B CB  
3203 C CG  . TYR B 224 ? 0.9368 0.6769 1.2668 0.1671  -0.2967 -0.0620 551 TYR B CG  
3204 C CD1 . TYR B 224 ? 0.9109 0.6957 1.2432 0.1921  -0.2728 -0.0757 551 TYR B CD1 
3205 C CD2 . TYR B 224 ? 0.8993 0.6630 1.2237 0.1310  -0.2979 -0.0300 551 TYR B CD2 
3206 C CE1 . TYR B 224 ? 0.8540 0.6986 1.1821 0.1788  -0.2538 -0.0584 551 TYR B CE1 
3207 C CE2 . TYR B 224 ? 0.8529 0.6749 1.1701 0.1211  -0.2772 -0.0157 551 TYR B CE2 
3208 C CZ  . TYR B 224 ? 0.8243 0.6832 1.1430 0.1437  -0.2568 -0.0300 551 TYR B CZ  
3209 O OH  . TYR B 224 ? 0.7601 0.6701 1.0697 0.1309  -0.2397 -0.0159 551 TYR B OH  
3210 N N   . LEU B 225 ? 1.0104 0.6492 1.2851 0.1264  -0.3290 -0.1003 552 LEU B N   
3211 C CA  . LEU B 225 ? 0.9737 0.6364 1.2296 0.0956  -0.3240 -0.0916 552 LEU B CA  
3212 C C   . LEU B 225 ? 0.9642 0.6311 1.1892 0.1053  -0.3111 -0.1265 552 LEU B C   
3213 O O   . LEU B 225 ? 0.9281 0.6389 1.1379 0.0918  -0.2933 -0.1220 552 LEU B O   
3214 C CB  . LEU B 225 ? 1.0068 0.6335 1.2730 0.0630  -0.3538 -0.0671 552 LEU B CB  
3215 C CG  . LEU B 225 ? 0.9824 0.6319 1.2362 0.0301  -0.3535 -0.0546 552 LEU B CG  
3216 C CD1 . LEU B 225 ? 0.9078 0.6270 1.1585 0.0173  -0.3270 -0.0320 552 LEU B CD1 
3217 C CD2 . LEU B 225 ? 1.0208 0.6303 1.2910 0.0002  -0.3871 -0.0296 552 LEU B CD2 
3218 N N   . SER B 226 ? 1.0086 0.6301 1.2231 0.1294  -0.3201 -0.1609 553 SER B N   
3219 C CA  . SER B 226 ? 1.0199 0.6440 1.2006 0.1385  -0.3097 -0.1949 553 SER B CA  
3220 C C   . SER B 226 ? 0.9817 0.6589 1.1510 0.1639  -0.2757 -0.2107 553 SER B C   
3221 O O   . SER B 226 ? 0.9722 0.6761 1.1147 0.1619  -0.2607 -0.2249 553 SER B O   
3222 C CB  . SER B 226 ? 1.1044 0.6567 1.2700 0.1516  -0.3336 -0.2281 553 SER B CB  
3223 O OG  . SER B 226 ? 1.1482 0.6872 1.3113 0.1935  -0.3236 -0.2583 553 SER B OG  
3224 N N   . LYS B 227 ? 0.9603 0.6550 1.1515 0.1860  -0.2650 -0.2054 554 LYS B N   
3225 C CA  . LYS B 227 ? 0.9115 0.6653 1.0984 0.2040  -0.2336 -0.2114 554 LYS B CA  
3226 C C   . LYS B 227 ? 0.8334 0.6405 1.0189 0.1776  -0.2182 -0.1833 554 LYS B C   
3227 O O   . LYS B 227 ? 0.7928 0.6429 0.9622 0.1810  -0.1952 -0.1896 554 LYS B O   
3228 C CB  . LYS B 227 ? 0.9253 0.6866 1.1400 0.2341  -0.2286 -0.2115 554 LYS B CB  
3229 C CG  . LYS B 227 ? 0.9786 0.7282 1.1825 0.2736  -0.2197 -0.2504 554 LYS B CG  
3230 C CD  . LYS B 227 ? 0.9783 0.7539 1.2141 0.3055  -0.2089 -0.2477 554 LYS B CD  
3231 C CE  . LYS B 227 ? 1.0309 0.7987 1.2554 0.3483  -0.1973 -0.2879 554 LYS B CE  
3232 N NZ  . LYS B 227 ? 1.0504 0.8257 1.3130 0.3843  -0.1949 -0.2868 554 LYS B NZ  
3233 N N   . LEU B 228 ? 0.8164 0.6178 1.0173 0.1516  -0.2317 -0.1526 555 LEU B N   
3234 C CA  . LEU B 228 ? 0.7751 0.6185 0.9728 0.1265  -0.2198 -0.1266 555 LEU B CA  
3235 C C   . LEU B 228 ? 0.7522 0.6057 0.9241 0.1117  -0.2137 -0.1342 555 LEU B C   
3236 O O   . LEU B 228 ? 0.7048 0.5979 0.8622 0.1100  -0.1927 -0.1341 555 LEU B O   
3237 C CB  . LEU B 228 ? 0.7879 0.6186 1.0061 0.1038  -0.2379 -0.0937 555 LEU B CB  
3238 C CG  . LEU B 228 ? 0.7602 0.6256 0.9908 0.0931  -0.2306 -0.0638 555 LEU B CG  
3239 C CD1 . LEU B 228 ? 0.7504 0.6397 0.9909 0.1162  -0.2179 -0.0694 555 LEU B CD1 
3240 C CD2 . LEU B 228 ? 0.7750 0.6146 1.0266 0.0765  -0.2547 -0.0361 555 LEU B CD2 
3241 N N   . LEU B 229 ? 0.7842 0.6001 0.9516 0.1007  -0.2343 -0.1399 556 LEU B N   
3242 C CA  . LEU B 229 ? 0.7854 0.6083 0.9314 0.0871  -0.2334 -0.1470 556 LEU B CA  
3243 C C   . LEU B 229 ? 0.7853 0.6163 0.9043 0.1078  -0.2193 -0.1790 556 LEU B C   
3244 O O   . LEU B 229 ? 0.7662 0.6227 0.8667 0.0998  -0.2093 -0.1809 556 LEU B O   
3245 C CB  . LEU B 229 ? 0.8284 0.6091 0.9791 0.0669  -0.2629 -0.1424 556 LEU B CB  
3246 C CG  . LEU B 229 ? 0.8252 0.6052 1.0013 0.0407  -0.2770 -0.1057 556 LEU B CG  
3247 C CD1 . LEU B 229 ? 0.8754 0.6111 1.0574 0.0201  -0.3089 -0.1019 556 LEU B CD1 
3248 C CD2 . LEU B 229 ? 0.7737 0.6083 0.9509 0.0236  -0.2584 -0.0801 556 LEU B CD2 
3249 N N   . GLY B 230 ? 0.8075 0.6203 0.9253 0.1352  -0.2178 -0.2024 557 GLY B N   
3250 C CA  . GLY B 230 ? 0.8228 0.6492 0.9148 0.1579  -0.2016 -0.2323 557 GLY B CA  
3251 C C   . GLY B 230 ? 0.7800 0.6651 0.8660 0.1610  -0.1729 -0.2245 557 GLY B C   
3252 O O   . GLY B 230 ? 0.7900 0.6944 0.8513 0.1717  -0.1591 -0.2430 557 GLY B O   
3253 N N   . LYS B 231 ? 0.7394 0.6513 0.8459 0.1505  -0.1651 -0.1969 558 LYS B N   
3254 C CA  . LYS B 231 ? 0.6927 0.6540 0.7932 0.1476  -0.1416 -0.1859 558 LYS B CA  
3255 C C   . LYS B 231 ? 0.6656 0.6421 0.7462 0.1292  -0.1369 -0.1795 558 LYS B C   
3256 O O   . LYS B 231 ? 0.6384 0.6473 0.7051 0.1309  -0.1191 -0.1794 558 LYS B O   
3257 C CB  . LYS B 231 ? 0.6660 0.6465 0.7896 0.1406  -0.1373 -0.1602 558 LYS B CB  
3258 C CG  . LYS B 231 ? 0.6810 0.6678 0.8255 0.1617  -0.1347 -0.1632 558 LYS B CG  
3259 C CD  . LYS B 231 ? 0.6837 0.7062 0.8201 0.1813  -0.1139 -0.1779 558 LYS B CD  
3260 C CE  . LYS B 231 ? 0.7353 0.7481 0.8871 0.2118  -0.1158 -0.1961 558 LYS B CE  
3261 N NZ  . LYS B 231 ? 0.7378 0.7987 0.8927 0.2308  -0.0940 -0.2021 558 LYS B NZ  
3262 N N   . LEU B 232 ? 0.6766 0.6313 0.7584 0.1114  -0.1536 -0.1721 559 LEU B N   
3263 C CA  . LEU B 232 ? 0.6719 0.6430 0.7400 0.0954  -0.1510 -0.1640 559 LEU B CA  
3264 C C   . LEU B 232 ? 0.6910 0.6688 0.7308 0.1033  -0.1462 -0.1852 559 LEU B C   
3265 O O   . LEU B 232 ? 0.6720 0.6793 0.7003 0.0992  -0.1326 -0.1777 559 LEU B O   
3266 C CB  . LEU B 232 ? 0.6734 0.6287 0.7546 0.0734  -0.1697 -0.1471 559 LEU B CB  
3267 C CG  . LEU B 232 ? 0.6547 0.6138 0.7596 0.0613  -0.1716 -0.1205 559 LEU B CG  
3268 C CD1 . LEU B 232 ? 0.6614 0.6030 0.7816 0.0406  -0.1929 -0.1047 559 LEU B CD1 
3269 C CD2 . LEU B 232 ? 0.6124 0.6087 0.7145 0.0567  -0.1510 -0.1039 559 LEU B CD2 
3270 N N   . PRO B 233 ? 0.7413 0.6906 0.7674 0.1153  -0.1576 -0.2115 560 PRO B N   
3271 C CA  . PRO B 233 ? 0.7642 0.7259 0.7581 0.1246  -0.1500 -0.2322 560 PRO B CA  
3272 C C   . PRO B 233 ? 0.7582 0.7554 0.7430 0.1429  -0.1248 -0.2383 560 PRO B C   
3273 O O   . PRO B 233 ? 0.7758 0.7956 0.7354 0.1446  -0.1152 -0.2447 560 PRO B O   
3274 C CB  . PRO B 233 ? 0.8160 0.7333 0.7948 0.1335  -0.1694 -0.2609 560 PRO B CB  
3275 C CG  . PRO B 233 ? 0.8318 0.7126 0.8354 0.1188  -0.1923 -0.2487 560 PRO B CG  
3276 C CD  . PRO B 233 ? 0.7810 0.6823 0.8153 0.1166  -0.1811 -0.2227 560 PRO B CD  
3277 N N   . GLU B 234 ? 0.7427 0.7479 0.7484 0.1548  -0.1154 -0.2339 561 GLU B N   
3278 C CA  . GLU B 234 ? 0.7226 0.7689 0.7254 0.1676  -0.0921 -0.2334 561 GLU B CA  
3279 C C   . GLU B 234 ? 0.6620 0.7401 0.6631 0.1506  -0.0801 -0.2094 561 GLU B C   
3280 O O   . GLU B 234 ? 0.6459 0.7575 0.6355 0.1547  -0.0636 -0.2078 561 GLU B O   
3281 C CB  . GLU B 234 ? 0.7471 0.7980 0.7776 0.1822  -0.0875 -0.2307 561 GLU B CB  
3282 C CG  . GLU B 234 ? 0.8222 0.8482 0.8544 0.2079  -0.0935 -0.2572 561 GLU B CG  
3283 C CD  . GLU B 234 ? 0.8463 0.8811 0.9120 0.2233  -0.0897 -0.2500 561 GLU B CD  
3284 O OE1 . GLU B 234 ? 0.9062 0.9048 0.9844 0.2389  -0.1032 -0.2629 561 GLU B OE1 
3285 O OE2 . GLU B 234 ? 0.7958 0.8722 0.8761 0.2194  -0.0753 -0.2306 561 GLU B OE2 
3286 N N   . LEU B 235 ? 0.6298 0.6970 0.6421 0.1321  -0.0887 -0.1905 562 LEU B N   
3287 C CA  . LEU B 235 ? 0.5993 0.6881 0.6092 0.1181  -0.0790 -0.1696 562 LEU B CA  
3288 C C   . LEU B 235 ? 0.6064 0.7057 0.5927 0.1132  -0.0772 -0.1712 562 LEU B C   
3289 O O   . LEU B 235 ? 0.5891 0.7102 0.5679 0.1086  -0.0652 -0.1589 562 LEU B O   
3290 C CB  . LEU B 235 ? 0.5720 0.6487 0.5998 0.1032  -0.0866 -0.1504 562 LEU B CB  
3291 C CG  . LEU B 235 ? 0.5549 0.6330 0.6025 0.1030  -0.0840 -0.1393 562 LEU B CG  
3292 C CD1 . LEU B 235 ? 0.5418 0.6050 0.6032 0.0890  -0.0946 -0.1236 562 LEU B CD1 
3293 C CD2 . LEU B 235 ? 0.5234 0.6274 0.5669 0.1010  -0.0680 -0.1287 562 LEU B CD2 
3294 N N   . ARG B 236 ? 0.6477 0.7294 0.6220 0.1130  -0.0911 -0.1851 563 ARG B N   
3295 C CA  . ARG B 236 ? 0.6613 0.7538 0.6110 0.1087  -0.0926 -0.1879 563 ARG B CA  
3296 C C   . ARG B 236 ? 0.6514 0.7733 0.5801 0.1183  -0.0753 -0.1927 563 ARG B C   
3297 O O   . ARG B 236 ? 0.6449 0.7866 0.5636 0.1111  -0.0688 -0.1786 563 ARG B O   
3298 C CB  . ARG B 236 ? 0.7216 0.7884 0.6586 0.1065  -0.1131 -0.2056 563 ARG B CB  
3299 C CG  . ARG B 236 ? 0.7787 0.8577 0.6816 0.1074  -0.1145 -0.2169 563 ARG B CG  
3300 C CD  . ARG B 236 ? 0.8131 0.8794 0.7100 0.0919  -0.1364 -0.2148 563 ARG B CD  
3301 N NE  . ARG B 236 ? 0.8184 0.9136 0.7025 0.0844  -0.1327 -0.1996 563 ARG B NE  
3302 C CZ  . ARG B 236 ? 0.8401 0.9512 0.6905 0.0880  -0.1301 -0.2089 563 ARG B CZ  
3303 N NH1 . ARG B 236 ? 0.8665 0.9700 0.6888 0.1006  -0.1283 -0.2368 563 ARG B NH1 
3304 N NH2 . ARG B 236 ? 0.8197 0.9556 0.6640 0.0799  -0.1288 -0.1897 563 ARG B NH2 
3305 N N   . THR B 237 ? 0.6475 0.7741 0.5721 0.1347  -0.0677 -0.2103 564 THR B N   
3306 C CA  . THR B 237 ? 0.6490 0.8107 0.5553 0.1442  -0.0498 -0.2140 564 THR B CA  
3307 C C   . THR B 237 ? 0.6101 0.7989 0.5286 0.1356  -0.0357 -0.1887 564 THR B C   
3308 O O   . THR B 237 ? 0.6019 0.8169 0.5036 0.1312  -0.0263 -0.1793 564 THR B O   
3309 C CB  . THR B 237 ? 0.6743 0.8398 0.5801 0.1668  -0.0427 -0.2372 564 THR B CB  
3310 O OG1 . THR B 237 ? 0.7317 0.8657 0.6184 0.1749  -0.0572 -0.2640 564 THR B OG1 
3311 C CG2 . THR B 237 ? 0.6722 0.8839 0.5623 0.1762  -0.0217 -0.2378 564 THR B CG2 
3312 N N   . LEU B 238 ? 0.5892 0.7693 0.5350 0.1316  -0.0360 -0.1769 565 LEU B N   
3313 C CA  . LEU B 238 ? 0.5516 0.7499 0.5074 0.1218  -0.0257 -0.1548 565 LEU B CA  
3314 C C   . LEU B 238 ? 0.5287 0.7213 0.4758 0.1069  -0.0280 -0.1375 565 LEU B C   
3315 O O   . LEU B 238 ? 0.5240 0.7329 0.4648 0.0998  -0.0195 -0.1227 565 LEU B O   
3316 C CB  . LEU B 238 ? 0.5384 0.7281 0.5216 0.1214  -0.0274 -0.1486 565 LEU B CB  
3317 C CG  . LEU B 238 ? 0.5529 0.7579 0.5471 0.1393  -0.0220 -0.1622 565 LEU B CG  
3318 C CD1 . LEU B 238 ? 0.5592 0.7413 0.5784 0.1440  -0.0324 -0.1645 565 LEU B CD1 
3319 C CD2 . LEU B 238 ? 0.5457 0.7917 0.5449 0.1390  -0.0068 -0.1505 565 LEU B CD2 
3320 N N   . CYS B 239 ? 0.5289 0.6989 0.4769 0.1026  -0.0403 -0.1386 566 CYS B N   
3321 C CA  . CYS B 239 ? 0.5321 0.6992 0.4738 0.0929  -0.0431 -0.1240 566 CYS B CA  
3322 C C   . CYS B 239 ? 0.5422 0.7283 0.4597 0.0926  -0.0399 -0.1220 566 CYS B C   
3323 O O   . CYS B 239 ? 0.5432 0.7372 0.4559 0.0866  -0.0339 -0.1051 566 CYS B O   
3324 C CB  . CYS B 239 ? 0.5584 0.7063 0.5094 0.0893  -0.0574 -0.1256 566 CYS B CB  
3325 S SG  . CYS B 239 ? 0.5849 0.7360 0.5333 0.0816  -0.0618 -0.1082 566 CYS B SG  
3326 N N   . THR B 240 ? 0.5502 0.7413 0.4507 0.0989  -0.0449 -0.1392 567 THR B N   
3327 C CA  . THR B 240 ? 0.5701 0.7835 0.4424 0.0990  -0.0417 -0.1393 567 THR B CA  
3328 C C   . THR B 240 ? 0.5684 0.8100 0.4356 0.0993  -0.0250 -0.1293 567 THR B C   
3329 O O   . THR B 240 ? 0.5888 0.8474 0.4404 0.0927  -0.0217 -0.1145 567 THR B O   
3330 C CB  . THR B 240 ? 0.6009 0.8125 0.4512 0.1075  -0.0492 -0.1652 567 THR B CB  
3331 O OG1 . THR B 240 ? 0.6090 0.7923 0.4680 0.1035  -0.0674 -0.1722 567 THR B OG1 
3332 C CG2 . THR B 240 ? 0.6299 0.8638 0.4464 0.1049  -0.0494 -0.1640 567 THR B CG2 
3333 N N   . GLN B 241 ? 0.5583 0.8063 0.4408 0.1055  -0.0159 -0.1342 568 GLN B N   
3334 C CA  . GLN B 241 ? 0.5560 0.8350 0.4390 0.1028  -0.0013 -0.1211 568 GLN B CA  
3335 C C   . GLN B 241 ? 0.5245 0.7956 0.4164 0.0870  -0.0011 -0.0947 568 GLN B C   
3336 O O   . GLN B 241 ? 0.5394 0.8311 0.4219 0.0786  0.0053  -0.0780 568 GLN B O   
3337 C CB  . GLN B 241 ? 0.5673 0.8604 0.4679 0.1144  0.0070  -0.1323 568 GLN B CB  
3338 C CG  . GLN B 241 ? 0.5802 0.9189 0.4799 0.1142  0.0231  -0.1219 568 GLN B CG  
3339 C CD  . GLN B 241 ? 0.6029 0.9660 0.5153 0.1333  0.0330  -0.1385 568 GLN B CD  
3340 O OE1 . GLN B 241 ? 0.6095 0.9499 0.5287 0.1484  0.0268  -0.1604 568 GLN B OE1 
3341 N NE2 . GLN B 241 ? 0.6036 1.0146 0.5211 0.1331  0.0480  -0.1267 568 GLN B NE2 
3342 N N   . GLY B 242 ? 0.4890 0.7291 0.3965 0.0831  -0.0086 -0.0910 569 GLY B N   
3343 C CA  . GLY B 242 ? 0.4713 0.6954 0.3818 0.0711  -0.0094 -0.0706 569 GLY B CA  
3344 C C   . GLY B 242 ? 0.4914 0.7136 0.3854 0.0670  -0.0134 -0.0584 569 GLY B C   
3345 O O   . GLY B 242 ? 0.5039 0.7308 0.3902 0.0581  -0.0105 -0.0405 569 GLY B O   
3346 N N   . LEU B 243 ? 0.4913 0.7068 0.3810 0.0724  -0.0220 -0.0665 570 LEU B N   
3347 C CA  . LEU B 243 ? 0.5086 0.7268 0.3844 0.0700  -0.0283 -0.0553 570 LEU B CA  
3348 C C   . LEU B 243 ? 0.5194 0.7660 0.3731 0.0656  -0.0231 -0.0467 570 LEU B C   
3349 O O   . LEU B 243 ? 0.5236 0.7700 0.3694 0.0589  -0.0254 -0.0262 570 LEU B O   
3350 C CB  . LEU B 243 ? 0.5297 0.7450 0.4043 0.0749  -0.0400 -0.0682 570 LEU B CB  
3351 C CG  . LEU B 243 ? 0.5299 0.7289 0.4196 0.0751  -0.0503 -0.0617 570 LEU B CG  
3352 C CD1 . LEU B 243 ? 0.5102 0.6904 0.4170 0.0750  -0.0453 -0.0484 570 LEU B CD1 
3353 C CD2 . LEU B 243 ? 0.5446 0.7367 0.4433 0.0775  -0.0592 -0.0801 570 LEU B CD2 
3354 N N   . GLN B 244 ? 0.5185 0.7897 0.3630 0.0704  -0.0157 -0.0614 571 GLN B N   
3355 C CA  . GLN B 244 ? 0.5312 0.8385 0.3556 0.0667  -0.0066 -0.0535 571 GLN B CA  
3356 C C   . GLN B 244 ? 0.5172 0.8295 0.3487 0.0537  -0.0005 -0.0277 571 GLN B C   
3357 O O   . GLN B 244 ? 0.5271 0.8554 0.3431 0.0441  -0.0001 -0.0073 571 GLN B O   
3358 C CB  . GLN B 244 ? 0.5525 0.8863 0.3711 0.0784  0.0034  -0.0760 571 GLN B CB  
3359 C CG  . GLN B 244 ? 0.5874 0.9674 0.3870 0.0756  0.0165  -0.0667 571 GLN B CG  
3360 C CD  . GLN B 244 ? 0.6140 1.0239 0.4047 0.0921  0.0285  -0.0916 571 GLN B CD  
3361 O OE1 . GLN B 244 ? 0.6573 1.0827 0.4175 0.0994  0.0291  -0.1059 571 GLN B OE1 
3362 N NE2 . GLN B 244 ? 0.5969 1.0157 0.4128 0.0992  0.0378  -0.0970 571 GLN B NE2 
3363 N N   . ARG B 245 ? 0.4827 0.7794 0.3365 0.0515  0.0022  -0.0273 572 ARG B N   
3364 C CA  . ARG B 245 ? 0.4699 0.7644 0.3306 0.0366  0.0047  -0.0045 572 ARG B CA  
3365 C C   . ARG B 245 ? 0.4741 0.7347 0.3298 0.0280  -0.0049 0.0153  572 ARG B C   
3366 O O   . ARG B 245 ? 0.4934 0.7612 0.3395 0.0153  -0.0056 0.0381  572 ARG B O   
3367 C CB  . ARG B 245 ? 0.4475 0.7331 0.3306 0.0357  0.0075  -0.0107 572 ARG B CB  
3368 C CG  . ARG B 245 ? 0.4478 0.7288 0.3369 0.0173  0.0072  0.0113  572 ARG B CG  
3369 C CD  . ARG B 245 ? 0.4570 0.7851 0.3411 0.0071  0.0154  0.0279  572 ARG B CD  
3370 N NE  . ARG B 245 ? 0.4715 0.7911 0.3614 -0.0146 0.0113  0.0520  572 ARG B NE  
3371 C CZ  . ARG B 245 ? 0.4921 0.8463 0.3797 -0.0310 0.0150  0.0756  572 ARG B CZ  
3372 N NH1 . ARG B 245 ? 0.5019 0.9062 0.3793 -0.0263 0.0254  0.0781  572 ARG B NH1 
3373 N NH2 . ARG B 245 ? 0.5097 0.8478 0.4032 -0.0536 0.0075  0.0973  572 ARG B NH2 
3374 N N   . ILE B 246 ? 0.4556 0.6813 0.3188 0.0356  -0.0121 0.0077  573 ILE B N   
3375 C CA  . ILE B 246 ? 0.4682 0.6621 0.3290 0.0341  -0.0204 0.0233  573 ILE B CA  
3376 C C   . ILE B 246 ? 0.4915 0.7023 0.3354 0.0320  -0.0255 0.0388  573 ILE B C   
3377 O O   . ILE B 246 ? 0.5065 0.7024 0.3450 0.0239  -0.0303 0.0617  573 ILE B O   
3378 C CB  . ILE B 246 ? 0.4582 0.6246 0.3319 0.0462  -0.0248 0.0111  573 ILE B CB  
3379 C CG1 . ILE B 246 ? 0.4436 0.5918 0.3302 0.0459  -0.0206 0.0000  573 ILE B CG1 
3380 C CG2 . ILE B 246 ? 0.4751 0.6144 0.3484 0.0496  -0.0317 0.0268  573 ILE B CG2 
3381 C CD1 . ILE B 246 ? 0.4206 0.5571 0.3203 0.0568  -0.0224 -0.0147 573 ILE B CD1 
3382 N N   . PHE B 247 ? 0.4873 0.7267 0.3210 0.0383  -0.0258 0.0266  574 PHE B N   
3383 C CA  . PHE B 247 ? 0.5180 0.7808 0.3304 0.0347  -0.0307 0.0398  574 PHE B CA  
3384 C C   . PHE B 247 ? 0.5418 0.8277 0.3415 0.0203  -0.0248 0.0615  574 PHE B C   
3385 O O   . PHE B 247 ? 0.5665 0.8493 0.3567 0.0120  -0.0319 0.0871  574 PHE B O   
3386 C CB  . PHE B 247 ? 0.5119 0.8011 0.3095 0.0426  -0.0320 0.0182  574 PHE B CB  
3387 C CG  . PHE B 247 ? 0.5348 0.8539 0.3036 0.0373  -0.0362 0.0303  574 PHE B CG  
3388 C CD1 . PHE B 247 ? 0.5472 0.8604 0.3102 0.0376  -0.0511 0.0411  574 PHE B CD1 
3389 C CD2 . PHE B 247 ? 0.5491 0.9070 0.2967 0.0319  -0.0251 0.0322  574 PHE B CD2 
3390 C CE1 . PHE B 247 ? 0.5745 0.9164 0.3086 0.0312  -0.0567 0.0536  574 PHE B CE1 
3391 C CE2 . PHE B 247 ? 0.5775 0.9660 0.2945 0.0260  -0.0283 0.0442  574 PHE B CE2 
3392 C CZ  . PHE B 247 ? 0.5932 0.9719 0.3018 0.0250  -0.0451 0.0547  574 PHE B CZ  
3393 N N   . TYR B 248 ? 0.5391 0.8501 0.3407 0.0171  -0.0126 0.0539  575 TYR B N   
3394 C CA  . TYR B 248 ? 0.5691 0.9092 0.3631 0.0012  -0.0061 0.0771  575 TYR B CA  
3395 C C   . TYR B 248 ? 0.5795 0.8837 0.3819 -0.0139 -0.0144 0.1048  575 TYR B C   
3396 O O   . TYR B 248 ? 0.6120 0.9224 0.4020 -0.0270 -0.0196 0.1328  575 TYR B O   
3397 C CB  . TYR B 248 ? 0.5678 0.9425 0.3711 0.0018  0.0085  0.0652  575 TYR B CB  
3398 C CG  . TYR B 248 ? 0.5986 1.0143 0.3976 -0.0156 0.0164  0.0914  575 TYR B CG  
3399 C CD1 . TYR B 248 ? 0.6304 1.0997 0.4069 -0.0156 0.0257  0.0958  575 TYR B CD1 
3400 C CD2 . TYR B 248 ? 0.6067 1.0094 0.4229 -0.0339 0.0140  0.1125  575 TYR B CD2 
3401 C CE1 . TYR B 248 ? 0.6593 1.1739 0.4335 -0.0331 0.0342  0.1232  575 TYR B CE1 
3402 C CE2 . TYR B 248 ? 0.6294 1.0731 0.4447 -0.0536 0.0196  0.1404  575 TYR B CE2 
3403 C CZ  . TYR B 248 ? 0.6549 1.1572 0.4509 -0.0530 0.0305  0.1469  575 TYR B CZ  
3404 O OH  . TYR B 248 ? 0.6845 1.2350 0.4807 -0.0734 0.0374  0.1772  575 TYR B OH  
3405 N N   . LEU B 249 ? 0.5561 0.8204 0.3769 -0.0121 -0.0168 0.0966  576 LEU B N   
3406 C CA  . LEU B 249 ? 0.5731 0.7947 0.3993 -0.0253 -0.0252 0.1167  576 LEU B CA  
3407 C C   . LEU B 249 ? 0.6012 0.7892 0.4197 -0.0230 -0.0375 0.1338  576 LEU B C   
3408 O O   . LEU B 249 ? 0.6325 0.8043 0.4454 -0.0380 -0.0452 0.1610  576 LEU B O   
3409 C CB  . LEU B 249 ? 0.5435 0.7281 0.3851 -0.0206 -0.0252 0.0991  576 LEU B CB  
3410 C CG  . LEU B 249 ? 0.5211 0.7295 0.3749 -0.0263 -0.0168 0.0885  576 LEU B CG  
3411 C CD1 . LEU B 249 ? 0.4986 0.6690 0.3636 -0.0192 -0.0189 0.0701  576 LEU B CD1 
3412 C CD2 . LEU B 249 ? 0.5419 0.7660 0.3965 -0.0508 -0.0176 0.1136  576 LEU B CD2 
3413 N N   . LYS B 250 ? 0.6047 0.7847 0.4251 -0.0045 -0.0404 0.1196  577 LYS B N   
3414 C CA  . LYS B 250 ? 0.6391 0.7928 0.4579 0.0026  -0.0521 0.1345  577 LYS B CA  
3415 C C   . LYS B 250 ? 0.6733 0.8559 0.4746 -0.0076 -0.0579 0.1606  577 LYS B C   
3416 O O   . LYS B 250 ? 0.6985 0.8561 0.4980 -0.0094 -0.0694 0.1849  577 LYS B O   
3417 C CB  . LYS B 250 ? 0.6221 0.7728 0.4511 0.0231  -0.0535 0.1141  577 LYS B CB  
3418 C CG  . LYS B 250 ? 0.6428 0.7583 0.4815 0.0357  -0.0634 0.1254  577 LYS B CG  
3419 C CD  . LYS B 250 ? 0.6168 0.7388 0.4702 0.0534  -0.0637 0.1070  577 LYS B CD  
3420 C CE  . LYS B 250 ? 0.6420 0.7681 0.5003 0.0629  -0.0757 0.1244  577 LYS B CE  
3421 N NZ  . LYS B 250 ? 0.6601 0.7458 0.5295 0.0736  -0.0816 0.1426  577 LYS B NZ  
3422 N N   . LEU B 251 ? 0.6849 0.9197 0.4724 -0.0135 -0.0497 0.1557  578 LEU B N   
3423 C CA  . LEU B 251 ? 0.7419 1.0146 0.5072 -0.0246 -0.0525 0.1789  578 LEU B CA  
3424 C C   . LEU B 251 ? 0.7842 1.0577 0.5463 -0.0473 -0.0531 0.2103  578 LEU B C   
3425 O O   . LEU B 251 ? 0.7934 1.0605 0.5462 -0.0579 -0.0643 0.2421  578 LEU B O   
3426 C CB  . LEU B 251 ? 0.7322 1.0593 0.4811 -0.0203 -0.0411 0.1575  578 LEU B CB  
3427 C CG  . LEU B 251 ? 0.7609 1.1410 0.4797 -0.0287 -0.0382 0.1702  578 LEU B CG  
3428 C CD1 . LEU B 251 ? 0.7919 1.1691 0.4957 -0.0271 -0.0542 0.1853  578 LEU B CD1 
3429 C CD2 . LEU B 251 ? 0.7524 1.1687 0.4609 -0.0169 -0.0245 0.1351  578 LEU B CD2 
3430 N N   . GLU B 252 ? 0.8080 1.0884 0.5801 -0.0555 -0.0428 0.2027  579 GLU B N   
3431 C CA  . GLU B 252 ? 0.8625 1.1420 0.6376 -0.0802 -0.0442 0.2306  579 GLU B CA  
3432 C C   . GLU B 252 ? 0.8989 1.1102 0.6798 -0.0877 -0.0615 0.2519  579 GLU B C   
3433 O O   . GLU B 252 ? 0.9397 1.1460 0.7152 -0.1095 -0.0702 0.2861  579 GLU B O   
3434 C CB  . GLU B 252 ? 0.8399 1.1352 0.6305 -0.0836 -0.0320 0.2130  579 GLU B CB  
3435 C CG  . GLU B 252 ? 0.8754 1.1776 0.6734 -0.1115 -0.0335 0.2400  579 GLU B CG  
3436 C CD  . GLU B 252 ? 0.8678 1.1749 0.6856 -0.1124 -0.0258 0.2211  579 GLU B CD  
3437 O OE1 . GLU B 252 ? 0.8762 1.2434 0.7007 -0.1203 -0.0132 0.2249  579 GLU B OE1 
3438 O OE2 . GLU B 252 ? 0.8511 1.1057 0.6780 -0.1042 -0.0317 0.2028  579 GLU B OE2 
3439 N N   . ASP B 253 ? 0.8982 1.0576 0.6896 -0.0691 -0.0662 0.2316  580 ASP B N   
3440 C CA  . ASP B 253 ? 0.9455 1.0351 0.7409 -0.0674 -0.0812 0.2446  580 ASP B CA  
3441 C C   . ASP B 253 ? 0.9777 1.0317 0.7738 -0.0919 -0.0888 0.2629  580 ASP B C   
3442 O O   . ASP B 253 ? 1.0147 1.0306 0.8056 -0.1036 -0.1039 0.2918  580 ASP B O   
3443 C CB  . ASP B 253 ? 0.9973 1.0810 0.7851 -0.0622 -0.0935 0.2691  580 ASP B CB  
3444 C CG  . ASP B 253 ? 1.0416 1.0553 0.8384 -0.0453 -0.1058 0.2707  580 ASP B CG  
3445 O OD1 . ASP B 253 ? 1.0371 1.0187 0.8444 -0.0286 -0.1009 0.2433  580 ASP B OD1 
3446 O OD2 . ASP B 253 ? 1.0869 1.0793 0.8802 -0.0476 -0.1201 0.3004  580 ASP B OD2 
3447 N N   . LEU B 254 ? 0.9555 1.0217 0.7588 -0.1006 -0.0803 0.2472  581 LEU B N   
3448 C CA  . LEU B 254 ? 0.9865 1.0178 0.7917 -0.1251 -0.0892 0.2599  581 LEU B CA  
3449 C C   . LEU B 254 ? 0.9906 0.9510 0.7973 -0.1118 -0.0945 0.2358  581 LEU B C   
3450 O O   . LEU B 254 ? 1.0451 0.9398 0.8448 -0.1198 -0.1097 0.2473  581 LEU B O   
3451 C CB  . LEU B 254 ? 0.9607 1.0520 0.7743 -0.1441 -0.0784 0.2609  581 LEU B CB  
3452 C CG  . LEU B 254 ? 0.9993 1.0776 0.8168 -0.1784 -0.0889 0.2844  581 LEU B CG  
3453 C CD1 . LEU B 254 ? 1.0551 1.1296 0.8645 -0.2043 -0.1024 0.3282  581 LEU B CD1 
3454 C CD2 . LEU B 254 ? 0.9680 1.1161 0.8006 -0.1886 -0.0749 0.2795  581 LEU B CD2 
3455 N N   . VAL B 255 ? 0.9333 0.9060 0.7472 -0.0917 -0.0824 0.2026  582 VAL B N   
3456 C CA  . VAL B 255 ? 0.9230 0.8378 0.7361 -0.0726 -0.0842 0.1784  582 VAL B CA  
3457 C C   . VAL B 255 ? 0.8886 0.8199 0.7077 -0.0422 -0.0759 0.1614  582 VAL B C   
3458 O O   . VAL B 255 ? 0.8419 0.8248 0.6685 -0.0349 -0.0644 0.1463  582 VAL B O   
3459 C CB  . VAL B 255 ? 0.8954 0.8056 0.7117 -0.0783 -0.0797 0.1563  582 VAL B CB  
3460 C CG1 . VAL B 255 ? 0.8934 0.7422 0.7030 -0.0597 -0.0815 0.1334  582 VAL B CG1 
3461 C CG2 . VAL B 255 ? 0.9199 0.8269 0.7339 -0.1122 -0.0890 0.1754  582 VAL B CG2 
3462 N N   . PRO B 256 ? 0.9126 0.8003 0.7299 -0.0244 -0.0828 0.1649  583 PRO B N   
3463 C CA  . PRO B 256 ? 0.8790 0.7815 0.7061 0.0035  -0.0766 0.1504  583 PRO B CA  
3464 C C   . PRO B 256 ? 0.8412 0.7397 0.6749 0.0171  -0.0661 0.1189  583 PRO B C   
3465 O O   . PRO B 256 ? 0.8560 0.7156 0.6828 0.0117  -0.0669 0.1090  583 PRO B O   
3466 C CB  . PRO B 256 ? 0.9354 0.7862 0.7617 0.0185  -0.0872 0.1638  583 PRO B CB  
3467 C CG  . PRO B 256 ? 0.9800 0.7985 0.7942 -0.0049 -0.1007 0.1913  583 PRO B CG  
3468 C CD  . PRO B 256 ? 0.9755 0.7978 0.7837 -0.0288 -0.0977 0.1834  583 PRO B CD  
3469 N N   . PRO B 257 ? 0.7933 0.7315 0.6385 0.0324  -0.0579 0.1041  584 PRO B N   
3470 C CA  . PRO B 257 ? 0.7564 0.6922 0.6088 0.0436  -0.0490 0.0779  584 PRO B CA  
3471 C C   . PRO B 257 ? 0.7621 0.6505 0.6151 0.0638  -0.0487 0.0706  584 PRO B C   
3472 O O   . PRO B 257 ? 0.7870 0.6601 0.6435 0.0771  -0.0537 0.0832  584 PRO B O   
3473 C CB  . PRO B 257 ? 0.7176 0.7042 0.5823 0.0531  -0.0440 0.0689  584 PRO B CB  
3474 C CG  . PRO B 257 ? 0.7415 0.7433 0.6054 0.0558  -0.0514 0.0886  584 PRO B CG  
3475 C CD  . PRO B 257 ? 0.7781 0.7613 0.6285 0.0385  -0.0586 0.1114  584 PRO B CD  
3476 N N   . PRO B 258 ? 0.7496 0.6168 0.5988 0.0671  -0.0426 0.0511  585 PRO B N   
3477 C CA  . PRO B 258 ? 0.7651 0.5957 0.6138 0.0905  -0.0387 0.0415  585 PRO B CA  
3478 C C   . PRO B 258 ? 0.7314 0.5968 0.6019 0.1128  -0.0329 0.0401  585 PRO B C   
3479 O O   . PRO B 258 ? 0.6859 0.5997 0.5691 0.1086  -0.0306 0.0373  585 PRO B O   
3480 C CB  . PRO B 258 ? 0.7502 0.5655 0.5883 0.0866  -0.0323 0.0204  585 PRO B CB  
3481 C CG  . PRO B 258 ? 0.7161 0.5715 0.5585 0.0658  -0.0320 0.0187  585 PRO B CG  
3482 C CD  . PRO B 258 ? 0.7205 0.5950 0.5643 0.0507  -0.0394 0.0386  585 PRO B CD  
3483 N N   . ALA B 259 ? 0.7481 0.5870 0.6229 0.1364  -0.0314 0.0420  586 ALA B N   
3484 C CA  . ALA B 259 ? 0.7208 0.5904 0.6200 0.1598  -0.0268 0.0447  586 ALA B CA  
3485 C C   . ALA B 259 ? 0.6691 0.5904 0.5844 0.1579  -0.0200 0.0341  586 ALA B C   
3486 O O   . ALA B 259 ? 0.6312 0.5940 0.5654 0.1600  -0.0240 0.0430  586 ALA B O   
3487 C CB  . ALA B 259 ? 0.7514 0.5835 0.6508 0.1878  -0.0198 0.0387  586 ALA B CB  
3488 N N   . ILE B 260 ? 0.6585 0.5753 0.5654 0.1520  -0.0120 0.0163  587 ILE B N   
3489 C CA  . ILE B 260 ? 0.6338 0.5929 0.5562 0.1500  -0.0066 0.0072  587 ILE B CA  
3490 C C   . ILE B 260 ? 0.5917 0.5854 0.5182 0.1308  -0.0137 0.0086  587 ILE B C   
3491 O O   . ILE B 260 ? 0.5631 0.5932 0.5072 0.1319  -0.0149 0.0079  587 ILE B O   
3492 C CB  . ILE B 260 ? 0.6437 0.5899 0.5561 0.1502  0.0032  -0.0098 587 ILE B CB  
3493 C CG1 . ILE B 260 ? 0.6663 0.5866 0.5552 0.1292  -0.0003 -0.0168 587 ILE B CG1 
3494 C CG2 . ILE B 260 ? 0.6957 0.6167 0.6044 0.1744  0.0132  -0.0142 587 ILE B CG2 
3495 C CD1 . ILE B 260 ? 0.6859 0.6065 0.5670 0.1236  0.0059  -0.0314 587 ILE B CD1 
3496 N N   . ILE B 261 ? 0.5904 0.5728 0.5006 0.1136  -0.0184 0.0107  588 ILE B N   
3497 C CA  . ILE B 261 ? 0.5637 0.5792 0.4749 0.0988  -0.0233 0.0116  588 ILE B CA  
3498 C C   . ILE B 261 ? 0.5542 0.5917 0.4704 0.1018  -0.0310 0.0259  588 ILE B C   
3499 O O   . ILE B 261 ? 0.5253 0.5961 0.4490 0.0998  -0.0344 0.0226  588 ILE B O   
3500 C CB  . ILE B 261 ? 0.5712 0.5770 0.4666 0.0803  -0.0242 0.0116  588 ILE B CB  
3501 C CG1 . ILE B 261 ? 0.5645 0.5599 0.4577 0.0754  -0.0190 -0.0028 588 ILE B CG1 
3502 C CG2 . ILE B 261 ? 0.5457 0.5889 0.4409 0.0696  -0.0269 0.0141  588 ILE B CG2 
3503 C CD1 . ILE B 261 ? 0.6051 0.5837 0.4842 0.0576  -0.0213 0.0000  588 ILE B CD1 
3504 N N   . ASP B 262 ? 0.5830 0.5986 0.4938 0.1064  -0.0353 0.0417  589 ASP B N   
3505 C CA  . ASP B 262 ? 0.6020 0.6361 0.5171 0.1098  -0.0444 0.0592  589 ASP B CA  
3506 C C   . ASP B 262 ? 0.5902 0.6541 0.5272 0.1229  -0.0462 0.0577  589 ASP B C   
3507 O O   . ASP B 262 ? 0.5696 0.6670 0.5084 0.1170  -0.0539 0.0609  589 ASP B O   
3508 C CB  . ASP B 262 ? 0.6437 0.6407 0.5536 0.1166  -0.0491 0.0771  589 ASP B CB  
3509 C CG  . ASP B 262 ? 0.6706 0.6822 0.5740 0.1087  -0.0604 0.0997  589 ASP B CG  
3510 O OD1 . ASP B 262 ? 0.6655 0.7081 0.5579 0.0923  -0.0622 0.1000  589 ASP B OD1 
3511 O OD2 . ASP B 262 ? 0.7030 0.6949 0.6113 0.1198  -0.0674 0.1179  589 ASP B OD2 
3512 N N   . LYS B 263 ? 0.6019 0.6559 0.5541 0.1390  -0.0390 0.0521  590 LYS B N   
3513 C CA  . LYS B 263 ? 0.6015 0.6878 0.5798 0.1508  -0.0400 0.0542  590 LYS B CA  
3514 C C   . LYS B 263 ? 0.5588 0.6767 0.5423 0.1380  -0.0425 0.0418  590 LYS B C   
3515 O O   . LYS B 263 ? 0.5583 0.7077 0.5530 0.1352  -0.0527 0.0476  590 LYS B O   
3516 C CB  . LYS B 263 ? 0.6331 0.7062 0.6257 0.1718  -0.0285 0.0511  590 LYS B CB  
3517 C CG  . LYS B 263 ? 0.6440 0.7577 0.6686 0.1841  -0.0290 0.0585  590 LYS B CG  
3518 C CD  . LYS B 263 ? 0.6791 0.7877 0.7163 0.2049  -0.0137 0.0536  590 LYS B CD  
3519 C CE  . LYS B 263 ? 0.6895 0.8434 0.7640 0.2203  -0.0147 0.0686  590 LYS B CE  
3520 N NZ  . LYS B 263 ? 0.7285 0.8804 0.8157 0.2470  0.0027  0.0668  590 LYS B NZ  
3521 N N   . LEU B 264 ? 0.5285 0.6353 0.5034 0.1301  -0.0350 0.0254  591 LEU B N   
3522 C CA  . LEU B 264 ? 0.4959 0.6245 0.4755 0.1190  -0.0379 0.0128  591 LEU B CA  
3523 C C   . LEU B 264 ? 0.4763 0.6200 0.4425 0.1067  -0.0477 0.0110  591 LEU B C   
3524 O O   . LEU B 264 ? 0.4661 0.6325 0.4392 0.1021  -0.0569 0.0071  591 LEU B O   
3525 C CB  . LEU B 264 ? 0.4839 0.5962 0.4574 0.1138  -0.0289 -0.0017 591 LEU B CB  
3526 C CG  . LEU B 264 ? 0.5064 0.6121 0.4905 0.1235  -0.0191 -0.0041 591 LEU B CG  
3527 C CD1 . LEU B 264 ? 0.4981 0.5983 0.4777 0.1138  -0.0152 -0.0171 591 LEU B CD1 
3528 C CD2 . LEU B 264 ? 0.4981 0.6336 0.5089 0.1324  -0.0210 0.0045  591 LEU B CD2 
3529 N N   . PHE B 265 ? 0.4672 0.5986 0.4132 0.1011  -0.0461 0.0142  592 PHE B N   
3530 C CA  . PHE B 265 ? 0.4621 0.6115 0.3911 0.0912  -0.0525 0.0141  592 PHE B CA  
3531 C C   . PHE B 265 ? 0.4652 0.6369 0.3967 0.0929  -0.0651 0.0257  592 PHE B C   
3532 O O   . PHE B 265 ? 0.4557 0.6479 0.3823 0.0872  -0.0732 0.0167  592 PHE B O   
3533 C CB  . PHE B 265 ? 0.4709 0.6077 0.3811 0.0840  -0.0480 0.0220  592 PHE B CB  
3534 C CG  . PHE B 265 ? 0.4799 0.6413 0.3708 0.0746  -0.0516 0.0237  592 PHE B CG  
3535 C CD1 . PHE B 265 ? 0.4676 0.6452 0.3503 0.0691  -0.0471 0.0063  592 PHE B CD1 
3536 C CD2 . PHE B 265 ? 0.4988 0.6691 0.3791 0.0726  -0.0592 0.0432  592 PHE B CD2 
3537 C CE1 . PHE B 265 ? 0.4816 0.6854 0.3435 0.0632  -0.0479 0.0061  592 PHE B CE1 
3538 C CE2 . PHE B 265 ? 0.5117 0.7089 0.3700 0.0636  -0.0613 0.0451  592 PHE B CE2 
3539 C CZ  . PHE B 265 ? 0.4989 0.7137 0.3468 0.0595  -0.0546 0.0253  592 PHE B CZ  
3540 N N   . LEU B 266 ? 0.4702 0.6355 0.4090 0.1014  -0.0679 0.0452  593 LEU B N   
3541 C CA  . LEU B 266 ? 0.4905 0.6781 0.4325 0.1027  -0.0815 0.0613  593 LEU B CA  
3542 C C   . LEU B 266 ? 0.4941 0.7064 0.4577 0.1048  -0.0905 0.0583  593 LEU B C   
3543 O O   . LEU B 266 ? 0.4978 0.7343 0.4549 0.0971  -0.1048 0.0611  593 LEU B O   
3544 C CB  . LEU B 266 ? 0.5036 0.6757 0.4520 0.1137  -0.0830 0.0847  593 LEU B CB  
3545 C CG  . LEU B 266 ? 0.5283 0.6820 0.4537 0.1065  -0.0828 0.0978  593 LEU B CG  
3546 C CD1 . LEU B 266 ? 0.5476 0.6773 0.4839 0.1201  -0.0862 0.1204  593 LEU B CD1 
3547 C CD2 . LEU B 266 ? 0.5408 0.7228 0.4423 0.0917  -0.0919 0.1036  593 LEU B CD2 
3548 N N   . ASP B 267 ? 0.4897 0.6970 0.4769 0.1132  -0.0829 0.0532  594 ASP B N   
3549 C CA  . ASP B 267 ? 0.4851 0.7183 0.4983 0.1134  -0.0907 0.0540  594 ASP B CA  
3550 C C   . ASP B 267 ? 0.4879 0.7287 0.4932 0.0981  -0.0983 0.0352  594 ASP B C   
3551 O O   . ASP B 267 ? 0.4948 0.7582 0.5127 0.0912  -0.1130 0.0378  594 ASP B O   
3552 C CB  . ASP B 267 ? 0.4735 0.7029 0.5129 0.1270  -0.0778 0.0559  594 ASP B CB  
3553 C CG  . ASP B 267 ? 0.4885 0.7166 0.5442 0.1472  -0.0732 0.0752  594 ASP B CG  
3554 O OD1 . ASP B 267 ? 0.5017 0.7351 0.5547 0.1498  -0.0831 0.0911  594 ASP B OD1 
3555 O OD2 . ASP B 267 ? 0.4901 0.7115 0.5608 0.1619  -0.0594 0.0744  594 ASP B OD2 
3556 N N   . THR B 268 ? 0.4890 0.7100 0.4750 0.0930  -0.0898 0.0172  595 THR B N   
3557 C CA  . THR B 268 ? 0.4952 0.7157 0.4736 0.0824  -0.0954 -0.0029 595 THR B CA  
3558 C C   . THR B 268 ? 0.5066 0.7368 0.4588 0.0736  -0.1082 -0.0110 595 THR B C   
3559 O O   . THR B 268 ? 0.5239 0.7543 0.4706 0.0658  -0.1187 -0.0268 595 THR B O   
3560 C CB  . THR B 268 ? 0.5074 0.7058 0.4785 0.0831  -0.0810 -0.0175 595 THR B CB  
3561 O OG1 . THR B 268 ? 0.5340 0.7257 0.5269 0.0888  -0.0723 -0.0130 595 THR B OG1 
3562 C CG2 . THR B 268 ? 0.5110 0.7053 0.4725 0.0757  -0.0861 -0.0387 595 THR B CG2 
3563 N N   . LEU B 269 ? 0.4957 0.7321 0.4293 0.0746  -0.1082 -0.0002 596 LEU B N   
3564 C CA  . LEU B 269 ? 0.5070 0.7551 0.4093 0.0668  -0.1175 -0.0083 596 LEU B CA  
3565 C C   . LEU B 269 ? 0.5161 0.7822 0.4206 0.0592  -0.1396 -0.0052 596 LEU B C   
3566 O O   . LEU B 269 ? 0.5068 0.7878 0.4313 0.0610  -0.1479 0.0168  596 LEU B O   
3567 C CB  . LEU B 269 ? 0.5228 0.7762 0.4038 0.0675  -0.1119 0.0061  596 LEU B CB  
3568 C CG  . LEU B 269 ? 0.5172 0.7559 0.3917 0.0701  -0.0937 0.0062  596 LEU B CG  
3569 C CD1 . LEU B 269 ? 0.5419 0.7886 0.3986 0.0671  -0.0937 0.0278  596 LEU B CD1 
3570 C CD2 . LEU B 269 ? 0.5132 0.7505 0.3730 0.0679  -0.0851 -0.0184 596 LEU B CD2 
3571 N N   . PRO B 270 ? 0.5241 0.7879 0.4084 0.0510  -0.1502 -0.0277 597 PRO B N   
3572 C CA  . PRO B 270 ? 0.5332 0.8105 0.4166 0.0401  -0.1745 -0.0261 597 PRO B CA  
3573 C C   . PRO B 270 ? 0.5542 0.8524 0.4087 0.0350  -0.1860 -0.0150 597 PRO B C   
3574 O O   . PRO B 270 ? 0.5782 0.8902 0.4290 0.0243  -0.2086 -0.0114 597 PRO B O   
3575 C CB  . PRO B 270 ? 0.5515 0.8090 0.4198 0.0339  -0.1820 -0.0568 597 PRO B CB  
3576 C CG  . PRO B 270 ? 0.5525 0.7962 0.3995 0.0432  -0.1617 -0.0748 597 PRO B CG  
3577 C CD  . PRO B 270 ? 0.5249 0.7716 0.3896 0.0523  -0.1415 -0.0556 597 PRO B CD  
3578 N N   . PHE B 271 ? 0.5452 0.8473 0.3803 0.0407  -0.1722 -0.0070 598 PHE B N   
3579 C CA  . PHE B 271 ? 0.5706 0.8952 0.3807 0.0357  -0.1821 0.0108  598 PHE B CA  
3580 C C   . PHE B 271 ? 0.5516 0.8774 0.3775 0.0442  -0.1702 0.0397  598 PHE B C   
3581 O O   . PHE B 271 ? 0.5656 0.9076 0.3823 0.0419  -0.1783 0.0634  598 PHE B O   
3582 C CB  . PHE B 271 ? 0.5973 0.9271 0.3549 0.0307  -0.1799 -0.0098 598 PHE B CB  
3583 C CG  . PHE B 271 ? 0.5836 0.9009 0.3321 0.0387  -0.1553 -0.0265 598 PHE B CG  
3584 C CD1 . PHE B 271 ? 0.5708 0.8952 0.3145 0.0417  -0.1389 -0.0086 598 PHE B CD1 
3585 C CD2 . PHE B 271 ? 0.5750 0.8734 0.3229 0.0425  -0.1501 -0.0577 598 PHE B CD2 
3586 C CE1 . PHE B 271 ? 0.5577 0.8761 0.2971 0.0469  -0.1180 -0.0210 598 PHE B CE1 
3587 C CE2 . PHE B 271 ? 0.5616 0.8536 0.3057 0.0507  -0.1283 -0.0705 598 PHE B CE2 
3588 C CZ  . PHE B 271 ? 0.5536 0.8582 0.2941 0.0523  -0.1122 -0.0518 598 PHE B CZ  
3589 O OXT . PHE B 271 ? 0.5283 0.8353 0.3756 0.0532  -0.1531 0.0399  598 PHE B OXT 
3590 N N   . PRO C 33  ? 1.1874 1.1733 0.9591 -0.0176 -0.1983 -0.3586 360 PRO C N   
3591 C CA  . PRO C 33  ? 1.1930 1.1246 0.9985 -0.0161 -0.2219 -0.3435 360 PRO C CA  
3592 C C   . PRO C 33  ? 1.1444 1.0767 0.9897 -0.0162 -0.2136 -0.3028 360 PRO C C   
3593 O O   . PRO C 33  ? 1.1061 1.0700 0.9503 -0.0297 -0.2005 -0.2741 360 PRO C O   
3594 C CB  . PRO C 33  ? 1.2144 1.1292 1.0028 -0.0423 -0.2437 -0.3322 360 PRO C CB  
3595 C CG  . PRO C 33  ? 1.2530 1.1972 0.9896 -0.0484 -0.2377 -0.3588 360 PRO C CG  
3596 C CD  . PRO C 33  ? 1.2349 1.2253 0.9596 -0.0338 -0.2069 -0.3767 360 PRO C CD  
3597 N N   . PRO C 34  ? 1.1506 1.0438 1.0263 -0.0014 -0.2223 -0.3003 361 PRO C N   
3598 C CA  . PRO C 34  ? 1.0968 0.9965 1.0041 0.0040  -0.2100 -0.2694 361 PRO C CA  
3599 C C   . PRO C 34  ? 1.0502 0.9449 0.9793 -0.0197 -0.2141 -0.2251 361 PRO C C   
3600 O O   . PRO C 34  ? 1.0764 0.9412 1.0114 -0.0368 -0.2339 -0.2175 361 PRO C O   
3601 C CB  . PRO C 34  ? 1.1346 0.9868 1.0572 0.0278  -0.2222 -0.2846 361 PRO C CB  
3602 C CG  . PRO C 34  ? 1.1940 0.9966 1.1017 0.0230  -0.2479 -0.3072 361 PRO C CG  
3603 C CD  . PRO C 34  ? 1.2069 1.0406 1.0847 0.0074  -0.2468 -0.3226 361 PRO C CD  
3604 N N   . VAL C 35  ? 0.9800 0.9071 0.9221 -0.0205 -0.1954 -0.1990 362 VAL C N   
3605 C CA  . VAL C 35  ? 0.9370 0.8644 0.9051 -0.0366 -0.1960 -0.1598 362 VAL C CA  
3606 C C   . VAL C 35  ? 0.9305 0.8171 0.9247 -0.0328 -0.2038 -0.1485 362 VAL C C   
3607 O O   . VAL C 35  ? 0.9482 0.8184 0.9429 -0.0117 -0.2008 -0.1611 362 VAL C O   
3608 C CB  . VAL C 35  ? 0.8978 0.8660 0.8699 -0.0357 -0.1738 -0.1377 362 VAL C CB  
3609 C CG1 . VAL C 35  ? 0.8782 0.8582 0.8629 -0.0545 -0.1778 -0.1070 362 VAL C CG1 
3610 C CG2 . VAL C 35  ? 0.8975 0.9012 0.8380 -0.0308 -0.1582 -0.1568 362 VAL C CG2 
3611 N N   . SER C 36  ? 0.8999 0.7717 0.9146 -0.0538 -0.2146 -0.1252 363 SER C N   
3612 C CA  . SER C 36  ? 0.8876 0.7232 0.9234 -0.0586 -0.2191 -0.1071 363 SER C CA  
3613 C C   . SER C 36  ? 0.8402 0.6960 0.8892 -0.0478 -0.1990 -0.0854 363 SER C C   
3614 O O   . SER C 36  ? 0.8099 0.7104 0.8600 -0.0452 -0.1831 -0.0770 363 SER C O   
3615 C CB  . SER C 36  ? 0.8877 0.7202 0.9442 -0.0886 -0.2311 -0.0884 363 SER C CB  
3616 O OG  . SER C 36  ? 0.8829 0.6979 0.9608 -0.1000 -0.2280 -0.0633 363 SER C OG  
3617 N N   . LEU C 37  ? 0.8405 0.6596 0.8951 -0.0422 -0.2011 -0.0762 364 LEU C N   
3618 C CA  . LEU C 37  ? 0.7904 0.6263 0.8539 -0.0313 -0.1838 -0.0571 364 LEU C CA  
3619 C C   . LEU C 37  ? 0.7429 0.6109 0.8288 -0.0510 -0.1715 -0.0253 364 LEU C C   
3620 O O   . LEU C 37  ? 0.6972 0.6017 0.7878 -0.0429 -0.1539 -0.0151 364 LEU C O   
3621 C CB  . LEU C 37  ? 0.8271 0.6118 0.8835 -0.0172 -0.1921 -0.0563 364 LEU C CB  
3622 C CG  . LEU C 37  ? 0.8052 0.5925 0.8669 -0.0094 -0.1802 -0.0335 364 LEU C CG  
3623 C CD1 . LEU C 37  ? 0.7526 0.5926 0.8168 0.0100  -0.1612 -0.0390 364 LEU C CD1 
3624 C CD2 . LEU C 37  ? 0.8688 0.5910 0.9147 0.0045  -0.1973 -0.0357 364 LEU C CD2 
3625 N N   . ILE C 38  ? 0.7441 0.6005 0.8446 -0.0767 -0.1807 -0.0123 365 ILE C N   
3626 C CA  . ILE C 38  ? 0.6962 0.5927 0.8232 -0.0944 -0.1702 0.0117  365 ILE C CA  
3627 C C   . ILE C 38  ? 0.6545 0.5990 0.7841 -0.0905 -0.1660 0.0069  365 ILE C C   
3628 O O   . ILE C 38  ? 0.6134 0.5938 0.7548 -0.0874 -0.1522 0.0213  365 ILE C O   
3629 C CB  . ILE C 38  ? 0.7259 0.6075 0.8721 -0.1255 -0.1804 0.0240  365 ILE C CB  
3630 C CG1 . ILE C 38  ? 0.6940 0.6249 0.8721 -0.1398 -0.1658 0.0470  365 ILE C CG1 
3631 C CG2 . ILE C 38  ? 0.7495 0.6210 0.8941 -0.1386 -0.2012 0.0059  365 ILE C CG2 
3632 C CD1 . ILE C 38  ? 0.7256 0.6443 0.9204 -0.1695 -0.1650 0.0651  365 ILE C CD1 
3633 N N   . SER C 39  ? 0.6706 0.6104 0.7838 -0.0898 -0.1792 -0.0139 366 SER C N   
3634 C CA  . SER C 39  ? 0.6464 0.6207 0.7500 -0.0868 -0.1787 -0.0188 366 SER C CA  
3635 C C   . SER C 39  ? 0.6143 0.6075 0.6999 -0.0686 -0.1607 -0.0198 366 SER C C   
3636 O O   . SER C 39  ? 0.5996 0.6205 0.6813 -0.0685 -0.1555 -0.0114 366 SER C O   
3637 C CB  . SER C 39  ? 0.6830 0.6433 0.7648 -0.0910 -0.1967 -0.0425 366 SER C CB  
3638 O OG  . SER C 39  ? 0.7110 0.6680 0.8126 -0.1120 -0.2145 -0.0390 366 SER C OG  
3639 N N   . ALA C 40  ? 0.6132 0.5900 0.6877 -0.0536 -0.1531 -0.0305 367 ALA C N   
3640 C CA  . ALA C 40  ? 0.5789 0.5779 0.6411 -0.0386 -0.1353 -0.0329 367 ALA C CA  
3641 C C   . ALA C 40  ? 0.5375 0.5522 0.6181 -0.0382 -0.1215 -0.0080 367 ALA C C   
3642 O O   . ALA C 40  ? 0.5145 0.5541 0.5874 -0.0347 -0.1092 -0.0029 367 ALA C O   
3643 C CB  . ALA C 40  ? 0.5952 0.5787 0.6461 -0.0202 -0.1339 -0.0552 367 ALA C CB  
3644 N N   . LEU C 41  ? 0.5322 0.5303 0.6335 -0.0439 -0.1237 0.0070  368 LEU C N   
3645 C CA  . LEU C 41  ? 0.4984 0.5122 0.6167 -0.0451 -0.1104 0.0295  368 LEU C CA  
3646 C C   . LEU C 41  ? 0.4735 0.5182 0.6080 -0.0549 -0.1089 0.0425  368 LEU C C   
3647 O O   . LEU C 41  ? 0.4455 0.5115 0.5840 -0.0493 -0.0965 0.0533  368 LEU C O   
3648 C CB  . LEU C 41  ? 0.5163 0.5026 0.6456 -0.0515 -0.1123 0.0418  368 LEU C CB  
3649 C CG  . LEU C 41  ? 0.5420 0.4913 0.6547 -0.0370 -0.1161 0.0335  368 LEU C CG  
3650 C CD1 . LEU C 41  ? 0.5684 0.4822 0.6851 -0.05