data_6C1A
# 
_entry.id   6C1A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.294 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6C1A         
WWPDB D_1000231923 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6C1A 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-04 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Liu, K.'                              1 ? 
'Xu, C.'                               2 ? 
'Tempel, W.'                           3 ? 
'Arrowsmith, C.H.'                     4 ? 
'Bountra, C.'                          5 ? 
'Edwards, A.M.'                        6 ? 
'Min, J.'                              7 ? 
'Structural Genomics Consortium (SGC)' 8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                7344 
_citation.page_last                 7354 
_citation.title                     'Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.001785 
_citation.pdbx_database_id_PubMed   29567833 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, K.'      1 
primary 'Xu, C.'       2 
primary 'Lei, M.'      3 
primary 'Yang, A.'     4 
primary 'Loppnau, P.'  5 
primary 'Hughes, T.R.' 6 
primary 'Min, J.'      7 
# 
_cell.entry_id           6C1A 
_cell.length_a           36.533 
_cell.length_b           39.875 
_cell.length_c           105.151 
_cell.angle_alpha        83.970 
_cell.angle_beta         85.700 
_cell.angle_gamma        62.750 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6C1A 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.Int_Tables_number                1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Methyl-CpG-binding domain protein 2' 8791.171 4   ? ? ? ? 
2 polymer     syn 'dna strand 1'                        3727.441 2   ? ? ? ? 
3 polymer     syn 'complement to dna strand 1'          3612.382 2   ? ? ? ? 
4 non-polymer syn 'UNKNOWN ATOM OR ION'                 ?        52  ? ? ? ? 
5 water       nat water                                 18.015   115 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Demethylase,DMTase,Methyl-CpG-binding protein MBD2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK 
GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK A,B,E,F ? 
2 polydeoxyribonucleotide no no  '(DC)(DG)(DG)(DA)(DA)(DT)(DG)(DT)(DA)(DG)(DG)(DC)'                              CGGAATGTAGGC C,G 
? 
3 polydeoxyribonucleotide no yes '(DG)(DC)(DC)(DT)(DA)(5CM)(DA)(DT)(DT)(DC)(DC)(DG)'                             GCCTACATTCCG D,H 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  THR n 
1 4  GLU n 
1 5  SER n 
1 6  GLY n 
1 7  LYS n 
1 8  ARG n 
1 9  MET n 
1 10 ASP n 
1 11 CYS n 
1 12 PRO n 
1 13 ALA n 
1 14 LEU n 
1 15 PRO n 
1 16 PRO n 
1 17 GLY n 
1 18 TRP n 
1 19 LYS n 
1 20 LYS n 
1 21 GLU n 
1 22 GLU n 
1 23 VAL n 
1 24 ILE n 
1 25 ARG n 
1 26 LYS n 
1 27 SER n 
1 28 GLY n 
1 29 LEU n 
1 30 SER n 
1 31 ALA n 
1 32 GLY n 
1 33 LYS n 
1 34 SER n 
1 35 ASP n 
1 36 VAL n 
1 37 TYR n 
1 38 TYR n 
1 39 PHE n 
1 40 SER n 
1 41 PRO n 
1 42 SER n 
1 43 GLY n 
1 44 LYS n 
1 45 LYS n 
1 46 PHE n 
1 47 ARG n 
1 48 SER n 
1 49 LYS n 
1 50 PRO n 
1 51 GLN n 
1 52 LEU n 
1 53 ALA n 
1 54 ARG n 
1 55 TYR n 
1 56 LEU n 
1 57 GLY n 
1 58 ASN n 
1 59 THR n 
1 60 VAL n 
1 61 ASP n 
1 62 LEU n 
1 63 SER n 
1 64 SER n 
1 65 PHE n 
1 66 ASP n 
1 67 PHE n 
1 68 ARG n 
1 69 THR n 
1 70 GLY n 
1 71 LYS n 
1 72 MET n 
1 73 MET n 
1 74 PRO n 
1 75 SER n 
1 76 LYS n 
1 77 LEU n 
1 78 GLN n 
1 79 LYS n 
2 1  DC  n 
2 2  DG  n 
2 3  DG  n 
2 4  DA  n 
2 5  DA  n 
2 6  DT  n 
2 7  DG  n 
2 8  DT  n 
2 9  DA  n 
2 10 DG  n 
2 11 DG  n 
2 12 DC  n 
3 1  DG  n 
3 2  DC  n 
3 3  DC  n 
3 4  DT  n 
3 5  DA  n 
3 6  5CM n 
3 7  DA  n 
3 8  DT  n 
3 9  DT  n 
3 10 DC  n 
3 11 DC  n 
3 12 DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   79 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 MBD2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'synthetic construct' ? 32630 synthetic 
3 1 sample 1 12 'synthetic construct' ? 32630 synthetic 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MBD2_HUMAN Q9UBB5 ? 1 ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK 143 
2 PDB 6C1A       6C1A   ? 2 ?                                                                              1   
3 PDB 6C1A       6C1A   ? 3 ?                                                                              1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6C1A A 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
2 1 6C1A B 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
3 2 6C1A C 1 ? 12 ? 6C1A   1   ? 12  ? 1   12  
4 3 6C1A D 1 ? 12 ? 6C1A   1   ? 12  ? 1   12  
5 1 6C1A E 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
6 1 6C1A F 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
7 2 6C1A G 1 ? 12 ? 6C1A   1   ? 12  ? 1   12  
8 3 6C1A H 1 ? 12 ? 6C1A   1   ? 12  ? 1   12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6C1A GLY A 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 1 
2 6C1A GLY B 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 2 
5 6C1A GLY E 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 3 
6 6C1A GLY F 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5CM 'DNA linking'       n "5-METHYL-2'-DEOXY-CYTIDINE-5'-MONOPHOSPHATE" ? 'C10 H16 N3 O7 P' 321.224 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"           ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                  ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'      75.067  
HOH non-polymer         . WATER                                         ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'     181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                         ? ?                 ?       
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6C1A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.72 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.8 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% PEG-3350, 0.2 M ammonium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-08-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     6C1A 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.340 
_reflns.d_resolution_high            2.050 
_reflns.number_obs                   31675 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.200 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.600 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.200 
_reflns.pdbx_Rrim_I_all              0.090 
_reflns.pdbx_Rpim_I_all              0.060 
_reflns.pdbx_CC_half                 0.996 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     69361 
_reflns.pdbx_scaling_rejects         0 
_reflns.pdbx_chi_squared             ? 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1 2.050 2.110  ? 5524 2520 ? 0.663 ? ? ? 2.200 ? 1.400  ? ? ? ? ? ? 96.800 0.895 0.597 0.495 
1 2 8.940 35.340 ? 803  366  ? 0.022 ? ? ? 2.200 ? 30.400 ? ? ? ? ? ? 92.000 0.030 0.020 0.998 
# 
_refine.entry_id                                 6C1A 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.0500 
_refine.ls_d_res_low                             34.8400 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.1600 
_refine.ls_number_reflns_obs                     30448 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            'thin shells (sftools)' 
_refine.details                                  
;Arp/warp was used in atom update/map improvement mode. coot was used for interactive model building. Model geometry was assessed with molprobity.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2319 
_refine.ls_R_factor_R_work                       0.2305 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2652 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 3.9000 
_refine.ls_number_reflns_R_free                  1224 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               36.1970 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.0100 
_refine.aniso_B[2][2]                            -0.7100 
_refine.aniso_B[3][3]                            1.0800 
_refine.aniso_B[1][2]                            -0.0200 
_refine.aniso_B[1][3]                            0.2000 
_refine.aniso_B[2][3]                            0.1100 
_refine.correlation_coeff_Fo_to_Fc               0.9350 
_refine.correlation_coeff_Fo_to_Fc_free          0.9160 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.2070 
_refine.pdbx_overall_ESU_R_Free                  0.1810 
_refine.overall_SU_ML                            0.1570 
_refine.overall_SU_B                             11.0060 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'currently unpublished model' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                88.680 
_refine.B_iso_min                                13.470 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.0500 
_refine_hist.d_res_low                        34.8400 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             115 
_refine_hist.number_atoms_total               3178 
_refine_hist.pdbx_number_residues_total       320 
_refine_hist.pdbx_B_iso_mean_ligand           29.49 
_refine_hist.pdbx_B_iso_mean_solvent          29.27 
_refine_hist.pdbx_number_atoms_protein        2037 
_refine_hist.pdbx_number_atoms_nucleic_acid   974 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       3209 0.013  0.017  ? ? 
'X-RAY DIFFRACTION' r_bond_other_d         2468 0.003  0.020  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    4528 1.517  1.700  ? ? 
'X-RAY DIFFRACTION' r_angle_other_deg      5719 1.138  3.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 271  5.713  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 85   27.573 21.059 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 349  12.377 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 22   19.720 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         432  0.083  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   2937 0.010  0.021  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_other     713  0.001  0.020  ? ? 
'X-RAY DIFFRACTION' r_mcbond_it            1080 1.045  2.125  ? ? 
'X-RAY DIFFRACTION' r_mcbond_other         1077 1.039  2.121  ? ? 
'X-RAY DIFFRACTION' r_mcangle_it           1346 1.688  3.175  ? ? 
# 
_refine_ls_shell.d_res_high                       2.0500 
_refine_ls_shell.d_res_low                        2.1030 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.8300 
_refine_ls_shell.number_reflns_R_work             2264 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3200 
_refine_ls_shell.R_factor_R_free                  0.3010 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             150 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2414 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_obs                     ? 
# 
_struct.entry_id                     6C1A 
_struct.title                        'MBD2 in complex with methylated DNA' 
_struct.pdbx_descriptor              'Methyl-CpG-binding domain protein 2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6C1A 
_struct_keywords.text            
'dna methylation, dna binding, Structural Genomics, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 4 ? 
ZA N N 4 ? 
AB N N 4 ? 
BB N N 4 ? 
CB N N 4 ? 
DB N N 4 ? 
EB N N 4 ? 
FB N N 4 ? 
GB N N 4 ? 
HB N N 4 ? 
IB N N 5 ? 
JB N N 5 ? 
KB N N 5 ? 
LB N N 5 ? 
MB N N 5 ? 
NB N N 5 ? 
OB N N 5 ? 
PB N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 48 ? GLY A 57 ? SER A 189 GLY A 198 1 ? 10 
HELX_P HELX_P2 AA2 ASN A 58 ? VAL A 60 ? ASN A 199 VAL A 201 5 ? 3  
HELX_P HELX_P3 AA3 SER B 48 ? GLY B 57 ? SER B 189 GLY B 198 1 ? 10 
HELX_P HELX_P4 AA4 ASN B 58 ? VAL B 60 ? ASN B 199 VAL B 201 5 ? 3  
HELX_P HELX_P5 AA5 SER E 48 ? GLY E 57 ? SER E 189 GLY E 198 1 ? 10 
HELX_P HELX_P6 AA6 ASN E 58 ? VAL E 60 ? ASN E 199 VAL E 201 5 ? 3  
HELX_P HELX_P7 AA7 SER F 48 ? GLY F 57 ? SER F 189 GLY F 198 1 ? 10 
HELX_P HELX_P8 AA8 ASN F 58 ? VAL F 60 ? ASN F 199 VAL F 201 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? D DA  5  "O3'" ? ? ? 1_555 D 5CM 6  P  ? ? D DA  5  D 5CM 6  1_555 ? ? ? ? ? ? ?            1.616 ? 
covale2  covale both ? D 5CM 6  "O3'" ? ? ? 1_555 D DA  7  P  ? ? D 5CM 6  D DA  7  1_555 ? ? ? ? ? ? ?            1.577 ? 
covale3  covale both ? H DA  5  "O3'" ? ? ? 1_555 H 5CM 6  P  ? ? H DA  5  H 5CM 6  1_555 ? ? ? ? ? ? ?            1.637 ? 
covale4  covale both ? H 5CM 6  "O3'" ? ? ? 1_555 H DA  7  P  ? ? H 5CM 6  H DA  7  1_555 ? ? ? ? ? ? ?            1.573 ? 
hydrog1  hydrog ?    ? C DC  1  N3    ? ? ? 1_555 D DG  12 N1 ? ? C DC  1  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DC  1  N4    ? ? ? 1_555 D DG  12 O6 ? ? C DC  1  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DC  1  O2    ? ? ? 1_555 D DG  12 N2 ? ? C DC  1  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DG  2  N1    ? ? ? 1_555 D DC  11 N3 ? ? C DG  2  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DG  2  N2    ? ? ? 1_555 D DC  11 O2 ? ? C DG  2  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DG  2  O6    ? ? ? 1_555 D DC  11 N4 ? ? C DG  2  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DG  3  N1    ? ? ? 1_555 D DC  10 N3 ? ? C DG  3  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DG  3  N2    ? ? ? 1_555 D DC  10 O2 ? ? C DG  3  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DG  3  O6    ? ? ? 1_555 D DC  10 N4 ? ? C DG  3  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DA  4  N1    ? ? ? 1_555 D DT  9  N3 ? ? C DA  4  D DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DA  4  N6    ? ? ? 1_555 D DT  9  O4 ? ? C DA  4  D DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DA  5  N1    ? ? ? 1_555 D DT  8  N3 ? ? C DA  5  D DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DA  5  N6    ? ? ? 1_555 D DT  8  O4 ? ? C DA  5  D DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DT  6  N3    ? ? ? 1_555 D DA  7  N1 ? ? C DT  6  D DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DT  6  O4    ? ? ? 1_555 D DA  7  N6 ? ? C DT  6  D DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DG  7  N1    ? ? ? 1_555 D 5CM 6  N3 ? ? C DG  7  D 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DG  7  N2    ? ? ? 1_555 D 5CM 6  O2 ? ? C DG  7  D 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DG  7  O6    ? ? ? 1_555 D 5CM 6  N4 ? ? C DG  7  D 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DT  8  N3    ? ? ? 1_555 D DA  5  N1 ? ? C DT  8  D DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  8  O4    ? ? ? 1_555 D DA  5  N6 ? ? C DT  8  D DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DA  9  N1    ? ? ? 1_555 D DT  4  N3 ? ? C DA  9  D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DA  9  N6    ? ? ? 1_555 D DT  4  O4 ? ? C DA  9  D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DG  10 N1    ? ? ? 1_555 D DC  3  N3 ? ? C DG  10 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DG  10 N2    ? ? ? 1_555 D DC  3  O2 ? ? C DG  10 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DG  10 O6    ? ? ? 1_555 D DC  3  N4 ? ? C DG  10 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DG  11 N1    ? ? ? 1_555 D DC  2  N3 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DG  11 N2    ? ? ? 1_555 D DC  2  O2 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DG  11 O6    ? ? ? 1_555 D DC  2  N4 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DC  12 N3    ? ? ? 1_555 D DG  1  N1 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DC  12 N4    ? ? ? 1_555 D DG  1  O6 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DC  12 O2    ? ? ? 1_555 D DG  1  N2 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? G DC  1  N3    ? ? ? 1_555 H DG  12 N1 ? ? G DC  1  H DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? G DC  1  N4    ? ? ? 1_555 H DG  12 O6 ? ? G DC  1  H DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? G DC  1  O2    ? ? ? 1_555 H DG  12 N2 ? ? G DC  1  H DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? G DG  2  N1    ? ? ? 1_555 H DC  11 N3 ? ? G DG  2  H DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? G DG  2  N2    ? ? ? 1_555 H DC  11 O2 ? ? G DG  2  H DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? G DG  2  O6    ? ? ? 1_555 H DC  11 N4 ? ? G DG  2  H DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? G DG  3  N1    ? ? ? 1_555 H DC  10 N3 ? ? G DG  3  H DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? G DG  3  N2    ? ? ? 1_555 H DC  10 O2 ? ? G DG  3  H DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? G DG  3  O6    ? ? ? 1_555 H DC  10 N4 ? ? G DG  3  H DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? G DA  4  N1    ? ? ? 1_555 H DT  9  N3 ? ? G DA  4  H DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? G DA  4  N6    ? ? ? 1_555 H DT  9  O4 ? ? G DA  4  H DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? G DA  5  N1    ? ? ? 1_555 H DT  8  N3 ? ? G DA  5  H DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? G DA  5  N6    ? ? ? 1_555 H DT  8  O4 ? ? G DA  5  H DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? G DT  6  N3    ? ? ? 1_555 H DA  7  N1 ? ? G DT  6  H DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? G DT  6  O4    ? ? ? 1_555 H DA  7  N6 ? ? G DT  6  H DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? G DG  7  N1    ? ? ? 1_555 H 5CM 6  N3 ? ? G DG  7  H 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? G DG  7  N2    ? ? ? 1_555 H 5CM 6  O2 ? ? G DG  7  H 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? G DG  7  O6    ? ? ? 1_555 H 5CM 6  N4 ? ? G DG  7  H 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? G DT  8  N3    ? ? ? 1_555 H DA  5  N1 ? ? G DT  8  H DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? G DT  8  O4    ? ? ? 1_555 H DA  5  N6 ? ? G DT  8  H DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? G DA  9  N1    ? ? ? 1_555 H DT  4  N3 ? ? G DA  9  H DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? G DA  9  N6    ? ? ? 1_555 H DT  4  O4 ? ? G DA  9  H DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? G DG  10 N1    ? ? ? 1_555 H DC  3  N3 ? ? G DG  10 H DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? G DG  10 N2    ? ? ? 1_555 H DC  3  O2 ? ? G DG  10 H DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ?    ? G DG  10 O6    ? ? ? 1_555 H DC  3  N4 ? ? G DG  10 H DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ?    ? G DG  11 N1    ? ? ? 1_555 H DC  2  N3 ? ? G DG  11 H DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ?    ? G DG  11 N2    ? ? ? 1_555 H DC  2  O2 ? ? G DG  11 H DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ?    ? G DG  11 O6    ? ? ? 1_555 H DC  2  N4 ? ? G DG  11 H DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ?    ? G DC  12 N3    ? ? ? 1_555 H DG  1  N1 ? ? G DC  12 H DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ?    ? G DC  12 N4    ? ? ? 1_555 H DG  1  O6 ? ? G DC  12 H DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ?    ? G DC  12 O2    ? ? ? 1_555 H DG  1  N2 ? ? G DC  12 H DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 9  ? ASP A 10 ? MET A 150 ASP A 151 
AA1 2 LYS A 19 ? ILE A 24 ? LYS A 160 ILE A 165 
AA1 3 SER A 34 ? PHE A 39 ? SER A 175 PHE A 180 
AA1 4 LYS A 45 ? PHE A 46 ? LYS A 186 PHE A 187 
AA2 1 PHE A 65 ? ASP A 66 ? PHE A 206 ASP A 207 
AA2 2 LYS A 71 ? MET A 72 ? LYS A 212 MET A 213 
AA3 1 MET B 9  ? ASP B 10 ? MET B 150 ASP B 151 
AA3 2 LYS B 19 ? ILE B 24 ? LYS B 160 ILE B 165 
AA3 3 SER B 34 ? PHE B 39 ? SER B 175 PHE B 180 
AA3 4 LYS B 45 ? PHE B 46 ? LYS B 186 PHE B 187 
AA4 1 PHE B 65 ? ASP B 66 ? PHE B 206 ASP B 207 
AA4 2 LYS B 71 ? MET B 72 ? LYS B 212 MET B 213 
AA5 1 MET E 9  ? ASP E 10 ? MET E 150 ASP E 151 
AA5 2 LYS E 19 ? ILE E 24 ? LYS E 160 ILE E 165 
AA5 3 SER E 34 ? PHE E 39 ? SER E 175 PHE E 180 
AA5 4 LYS E 45 ? PHE E 46 ? LYS E 186 PHE E 187 
AA6 1 PHE E 65 ? ASP E 66 ? PHE E 206 ASP E 207 
AA6 2 LYS E 71 ? MET E 72 ? LYS E 212 MET E 213 
AA7 1 MET F 9  ? ASP F 10 ? MET F 150 ASP F 151 
AA7 2 LYS F 19 ? ILE F 24 ? LYS F 160 ILE F 165 
AA7 3 SER F 34 ? PHE F 39 ? SER F 175 PHE F 180 
AA7 4 LYS F 45 ? PHE F 46 ? LYS F 186 PHE F 187 
AA8 1 PHE F 65 ? ASP F 66 ? PHE F 206 ASP F 207 
AA8 2 LYS F 71 ? MET F 72 ? LYS F 212 MET F 213 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 9  ? N MET A 150 O LYS A 20 ? O LYS A 161 
AA1 2 3 N VAL A 23 ? N VAL A 164 O ASP A 35 ? O ASP A 176 
AA1 3 4 N TYR A 38 ? N TYR A 179 O PHE A 46 ? O PHE A 187 
AA2 1 2 N ASP A 66 ? N ASP A 207 O LYS A 71 ? O LYS A 212 
AA3 1 2 N MET B 9  ? N MET B 150 O LYS B 20 ? O LYS B 161 
AA3 2 3 N GLU B 21 ? N GLU B 162 O TYR B 37 ? O TYR B 178 
AA3 3 4 N TYR B 38 ? N TYR B 179 O PHE B 46 ? O PHE B 187 
AA4 1 2 N ASP B 66 ? N ASP B 207 O LYS B 71 ? O LYS B 212 
AA5 1 2 N MET E 9  ? N MET E 150 O LYS E 20 ? O LYS E 161 
AA5 2 3 N GLU E 21 ? N GLU E 162 O TYR E 37 ? O TYR E 178 
AA5 3 4 N TYR E 38 ? N TYR E 179 O PHE E 46 ? O PHE E 187 
AA6 1 2 N ASP E 66 ? N ASP E 207 O LYS E 71 ? O LYS E 212 
AA7 1 2 N MET F 9  ? N MET F 150 O LYS F 20 ? O LYS F 161 
AA7 2 3 N VAL F 23 ? N VAL F 164 O ASP F 35 ? O ASP F 176 
AA7 3 4 N TYR F 38 ? N TYR F 179 O PHE F 46 ? O PHE F 187 
AA8 1 2 N ASP F 66 ? N ASP F 207 O LYS F 71 ? O LYS F 212 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D DA  5 ? 13 'binding site for Di-nucleotide DA D 5 and 5CM D 6' 
AC2 Software D 5CM 6 ? 13 'binding site for Di-nucleotide 5CM D 6 and DA D 7' 
AC3 Software H DA  5 ? 14 'binding site for Di-nucleotide DA H 5 and 5CM H 6' 
AC4 Software H 5CM 6 ? 12 'binding site for Di-nucleotide 5CM H 6 and DA H 7' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ARG A  47 ? ARG A 188 . ? 1_555 ? 
2  AC1 13 SER A  48 ? SER A 189 . ? 1_555 ? 
3  AC1 13 PRO A  50 ? PRO A 191 . ? 1_555 ? 
4  AC1 13 ARG A  54 ? ARG A 195 . ? 1_555 ? 
5  AC1 13 HOH IB .  ? HOH A 409 . ? 1_555 ? 
6  AC1 13 HOH IB .  ? HOH A 411 . ? 1_555 ? 
7  AC1 13 DG  C  7  ? DG  C 7   . ? 1_555 ? 
8  AC1 13 DT  C  8  ? DT  C 8   . ? 1_555 ? 
9  AC1 13 DA  C  9  ? DA  C 9   . ? 1_555 ? 
10 AC1 13 DT  D  4  ? DT  D 4   . ? 1_555 ? 
11 AC1 13 DA  D  7  ? DA  D 7   . ? 1_555 ? 
12 AC1 13 HOH LB .  ? HOH D 203 . ? 1_555 ? 
13 AC1 13 HOH LB .  ? HOH D 205 . ? 1_555 ? 
14 AC2 13 ARG A  47 ? ARG A 188 . ? 1_555 ? 
15 AC2 13 SER A  48 ? SER A 189 . ? 1_555 ? 
16 AC2 13 ARG A  54 ? ARG A 195 . ? 1_555 ? 
17 AC2 13 HOH IB .  ? HOH A 411 . ? 1_555 ? 
18 AC2 13 DA  C  5  ? DA  C 5   . ? 1_555 ? 
19 AC2 13 DT  C  6  ? DT  C 6   . ? 1_555 ? 
20 AC2 13 DG  C  7  ? DG  C 7   . ? 1_555 ? 
21 AC2 13 DA  D  5  ? DA  D 5   . ? 1_555 ? 
22 AC2 13 DT  D  8  ? DT  D 8   . ? 1_555 ? 
23 AC2 13 HOH LB .  ? HOH D 203 . ? 1_555 ? 
24 AC2 13 HOH LB .  ? HOH D 205 . ? 1_555 ? 
25 AC2 13 HOH LB .  ? HOH D 206 . ? 1_555 ? 
26 AC2 13 HOH LB .  ? HOH D 210 . ? 1_555 ? 
27 AC3 14 ARG E  47 ? ARG E 188 . ? 1_555 ? 
28 AC3 14 SER E  48 ? SER E 189 . ? 1_555 ? 
29 AC3 14 LYS E  49 ? LYS E 190 . ? 1_555 ? 
30 AC3 14 PRO E  50 ? PRO E 191 . ? 1_555 ? 
31 AC3 14 ARG E  54 ? ARG E 195 . ? 1_555 ? 
32 AC3 14 HOH MB .  ? HOH E 409 . ? 1_555 ? 
33 AC3 14 DG  G  7  ? DG  G 7   . ? 1_555 ? 
34 AC3 14 DT  G  8  ? DT  G 8   . ? 1_555 ? 
35 AC3 14 DA  G  9  ? DA  G 9   . ? 1_555 ? 
36 AC3 14 DT  H  4  ? DT  H 4   . ? 1_555 ? 
37 AC3 14 DA  H  7  ? DA  H 7   . ? 1_555 ? 
38 AC3 14 HOH PB .  ? HOH H 203 . ? 1_555 ? 
39 AC3 14 HOH PB .  ? HOH H 207 . ? 1_555 ? 
40 AC3 14 HOH PB .  ? HOH H 211 . ? 1_555 ? 
41 AC4 12 ARG E  47 ? ARG E 188 . ? 1_555 ? 
42 AC4 12 SER E  48 ? SER E 189 . ? 1_555 ? 
43 AC4 12 ARG E  54 ? ARG E 195 . ? 1_555 ? 
44 AC4 12 HOH MB .  ? HOH E 409 . ? 1_555 ? 
45 AC4 12 DA  G  5  ? DA  G 5   . ? 1_555 ? 
46 AC4 12 DT  G  6  ? DT  G 6   . ? 1_555 ? 
47 AC4 12 DG  G  7  ? DG  G 7   . ? 1_555 ? 
48 AC4 12 DA  H  5  ? DA  H 5   . ? 1_555 ? 
49 AC4 12 DT  H  8  ? DT  H 8   . ? 1_555 ? 
50 AC4 12 HOH PB .  ? HOH H 203 . ? 1_555 ? 
51 AC4 12 HOH PB .  ? HOH H 209 . ? 1_555 ? 
52 AC4 12 HOH PB .  ? HOH H 211 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6C1A 
_atom_sites.fract_transf_matrix[1][1]   0.027373 
_atom_sites.fract_transf_matrix[1][2]   -0.014098 
_atom_sites.fract_transf_matrix[1][3]   -0.000935 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028209 
_atom_sites.fract_transf_matrix[2][3]   -0.002259 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009567 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    C CA    . GLY A  1 6  ? -22.711 3.338  -30.209 1.00 54.09 ? 147 GLY A CA    1 
ATOM   2    C C     . GLY A  1 6  ? -22.562 3.358  -28.688 1.00 56.14 ? 147 GLY A C     1 
ATOM   3    O O     . GLY A  1 6  ? -23.337 2.700  -27.964 1.00 56.30 ? 147 GLY A O     1 
ATOM   4    N N     . LYS A  1 7  ? -21.565 4.103  -28.198 1.00 54.84 ? 148 LYS A N     1 
ATOM   5    C CA    . LYS A  1 7  ? -21.277 4.184  -26.739 1.00 53.22 ? 148 LYS A CA    1 
ATOM   6    C C     . LYS A  1 7  ? -22.054 5.332  -26.085 1.00 47.78 ? 148 LYS A C     1 
ATOM   7    O O     . LYS A  1 7  ? -21.935 6.482  -26.503 1.00 45.99 ? 148 LYS A O     1 
ATOM   8    C CB    . LYS A  1 7  ? -19.770 4.366  -26.495 1.00 55.65 ? 148 LYS A CB    1 
ATOM   9    N N     . ARG A  1 8  ? -22.857 5.013  -25.071 1.00 45.49 ? 149 ARG A N     1 
ATOM   10   C CA    . ARG A  1 8  ? -23.545 6.026  -24.291 1.00 42.95 ? 149 ARG A CA    1 
ATOM   11   C C     . ARG A  1 8  ? -22.651 6.448  -23.127 1.00 41.33 ? 149 ARG A C     1 
ATOM   12   O O     . ARG A  1 8  ? -22.375 5.657  -22.216 1.00 42.66 ? 149 ARG A O     1 
ATOM   13   C CB    . ARG A  1 8  ? -24.907 5.533  -23.798 1.00 44.50 ? 149 ARG A CB    1 
ATOM   14   C CG    . ARG A  1 8  ? -25.917 5.388  -24.926 1.00 45.30 ? 149 ARG A CG    1 
ATOM   15   C CD    . ARG A  1 8  ? -27.317 5.104  -24.398 1.00 46.56 ? 149 ARG A CD    1 
ATOM   16   N NE    . ARG A  1 8  ? -28.247 4.748  -25.478 1.00 46.91 ? 149 ARG A NE    1 
ATOM   17   C CZ    . ARG A  1 8  ? -29.573 4.616  -25.338 1.00 46.67 ? 149 ARG A CZ    1 
ATOM   18   N NH1   . ARG A  1 8  ? -30.166 4.819  -24.161 1.00 47.46 ? 149 ARG A NH1   1 
ATOM   19   N NH2   . ARG A  1 8  ? -30.312 4.274  -26.386 1.00 47.82 ? 149 ARG A NH2   1 
ATOM   20   N N     . MET A  1 9  ? -22.202 7.701  -23.184 1.00 37.27 ? 150 MET A N     1 
ATOM   21   C CA    . MET A  1 9  ? -21.314 8.271  -22.172 1.00 36.36 ? 150 MET A CA    1 
ATOM   22   C C     . MET A  1 9  ? -22.116 9.000  -21.141 1.00 33.70 ? 150 MET A C     1 
ATOM   23   O O     . MET A  1 9  ? -22.925 9.837  -21.493 1.00 29.84 ? 150 MET A O     1 
ATOM   24   C CB    . MET A  1 9  ? -20.361 9.263  -22.814 1.00 35.84 ? 150 MET A CB    1 
ATOM   25   C CG    . MET A  1 9  ? -19.535 8.673  -23.926 1.00 37.52 ? 150 MET A CG    1 
ATOM   26   S SD    . MET A  1 9  ? -18.725 7.145  -23.454 1.00 41.91 ? 150 MET A SD    1 
ATOM   27   C CE    . MET A  1 9  ? -17.613 7.728  -22.175 1.00 44.51 ? 150 MET A CE    1 
ATOM   28   N N     . ASP A  1 10 ? -21.874 8.696  -19.857 1.00 33.55 ? 151 ASP A N     1 
ATOM   29   C CA    . ASP A  1 10 ? -22.340 9.556  -18.785 1.00 33.16 ? 151 ASP A CA    1 
ATOM   30   C C     . ASP A  1 10 ? -21.983 11.006 -19.093 1.00 31.95 ? 151 ASP A C     1 
ATOM   31   O O     . ASP A  1 10 ? -20.906 11.290 -19.660 1.00 31.50 ? 151 ASP A O     1 
ATOM   32   C CB    . ASP A  1 10 ? -21.722 9.138  -17.437 1.00 35.47 ? 151 ASP A CB    1 
ATOM   33   C CG    . ASP A  1 10 ? -22.304 7.844  -16.922 1.00 36.74 ? 151 ASP A CG    1 
ATOM   34   O OD1   . ASP A  1 10 ? -23.550 7.767  -16.787 1.00 35.85 ? 151 ASP A OD1   1 
ATOM   35   O OD2   . ASP A  1 10 ? -21.533 6.912  -16.682 1.00 39.41 ? 151 ASP A OD2   1 
ATOM   36   N N     . CYS A  1 11 ? -22.894 11.906 -18.749 1.00 31.14 ? 152 CYS A N     1 
ATOM   37   C CA    . CYS A  1 11 ? -22.671 13.314 -18.893 1.00 31.96 ? 152 CYS A CA    1 
ATOM   38   C C     . CYS A  1 11 ? -22.617 13.868 -17.484 1.00 34.71 ? 152 CYS A C     1 
ATOM   39   O O     . CYS A  1 11 ? -23.651 14.157 -16.889 1.00 34.60 ? 152 CYS A O     1 
ATOM   40   C CB    . CYS A  1 11 ? -23.775 13.961 -19.720 1.00 29.87 ? 152 CYS A CB    1 
ATOM   41   S SG    . CYS A  1 11 ? -23.465 15.701 -20.061 1.00 32.34 ? 152 CYS A SG    1 
ATOM   42   N N     . PRO A  1 12 ? -21.398 13.999 -16.925 1.00 38.16 ? 153 PRO A N     1 
ATOM   43   C CA    . PRO A  1 12 ? -21.275 14.436 -15.541 1.00 40.38 ? 153 PRO A CA    1 
ATOM   44   C C     . PRO A  1 12 ? -21.946 15.764 -15.228 1.00 39.91 ? 153 PRO A C     1 
ATOM   45   O O     . PRO A  1 12 ? -22.343 15.991 -14.075 1.00 41.28 ? 153 PRO A O     1 
ATOM   46   C CB    . PRO A  1 12 ? -19.752 14.554 -15.341 1.00 42.76 ? 153 PRO A CB    1 
ATOM   47   C CG    . PRO A  1 12 ? -19.178 13.620 -16.311 1.00 42.75 ? 153 PRO A CG    1 
ATOM   48   C CD    . PRO A  1 12 ? -20.082 13.638 -17.497 1.00 39.86 ? 153 PRO A CD    1 
ATOM   49   N N     . ALA A  1 13 ? -22.025 16.636 -16.232 1.00 37.81 ? 154 ALA A N     1 
ATOM   50   C CA    . ALA A  1 13 ? -22.545 17.991 -16.071 1.00 38.36 ? 154 ALA A CA    1 
ATOM   51   C C     . ALA A  1 13 ? -24.038 18.009 -15.805 1.00 36.72 ? 154 ALA A C     1 
ATOM   52   O O     . ALA A  1 13 ? -24.525 18.937 -15.178 1.00 37.82 ? 154 ALA A O     1 
ATOM   53   C CB    . ALA A  1 13 ? -22.203 18.846 -17.313 1.00 38.13 ? 154 ALA A CB    1 
ATOM   54   N N     . LEU A  1 14 ? -24.753 16.983 -16.283 1.00 34.81 ? 155 LEU A N     1 
ATOM   55   C CA    . LEU A  1 14 ? -26.204 16.802 -16.029 1.00 33.76 ? 155 LEU A CA    1 
ATOM   56   C C     . LEU A  1 14 ? -26.452 15.992 -14.742 1.00 35.08 ? 155 LEU A C     1 
ATOM   57   O O     . LEU A  1 14 ? -25.520 15.433 -14.200 1.00 35.92 ? 155 LEU A O     1 
ATOM   58   C CB    . LEU A  1 14 ? -26.841 16.070 -17.227 1.00 31.23 ? 155 LEU A CB    1 
ATOM   59   C CG    . LEU A  1 14 ? -26.774 16.896 -18.507 1.00 30.34 ? 155 LEU A CG    1 
ATOM   60   C CD1   . LEU A  1 14 ? -27.123 16.065 -19.725 1.00 29.82 ? 155 LEU A CD1   1 
ATOM   61   C CD2   . LEU A  1 14 ? -27.707 18.095 -18.416 1.00 30.86 ? 155 LEU A CD2   1 
ATOM   62   N N     . PRO A  1 15 ? -27.733 15.907 -14.272 1.00 34.60 ? 156 PRO A N     1 
ATOM   63   C CA    . PRO A  1 15 ? -28.041 15.101 -13.087 1.00 35.82 ? 156 PRO A CA    1 
ATOM   64   C C     . PRO A  1 15 ? -27.669 13.638 -13.279 1.00 36.10 ? 156 PRO A C     1 
ATOM   65   O O     . PRO A  1 15 ? -27.367 13.224 -14.459 1.00 34.04 ? 156 PRO A O     1 
ATOM   66   C CB    . PRO A  1 15 ? -29.547 15.244 -12.953 1.00 35.10 ? 156 PRO A CB    1 
ATOM   67   C CG    . PRO A  1 15 ? -29.818 16.598 -13.491 1.00 34.49 ? 156 PRO A CG    1 
ATOM   68   C CD    . PRO A  1 15 ? -28.906 16.684 -14.691 1.00 33.43 ? 156 PRO A CD    1 
ATOM   69   N N     . PRO A  1 16 ? -27.661 12.848 -12.163 1.00 37.29 ? 157 PRO A N     1 
ATOM   70   C CA    . PRO A  1 16 ? -27.208 11.444 -12.236 1.00 38.36 ? 157 PRO A CA    1 
ATOM   71   C C     . PRO A  1 16 ? -28.005 10.656 -13.267 1.00 36.69 ? 157 PRO A C     1 
ATOM   72   O O     . PRO A  1 16 ? -29.211 10.831 -13.349 1.00 35.98 ? 157 PRO A O     1 
ATOM   73   C CB    . PRO A  1 16 ? -27.471 10.893 -10.810 1.00 40.99 ? 157 PRO A CB    1 
ATOM   74   C CG    . PRO A  1 16 ? -27.429 12.097 -9.916  1.00 41.99 ? 157 PRO A CG    1 
ATOM   75   C CD    . PRO A  1 16 ? -27.865 13.291 -10.760 1.00 39.81 ? 157 PRO A CD    1 
ATOM   76   N N     . GLY A  1 17 ? -27.328 9.832  -14.058 1.00 36.28 ? 158 GLY A N     1 
ATOM   77   C CA    . GLY A  1 17 ? -27.980 8.901  -14.942 1.00 36.12 ? 158 GLY A CA    1 
ATOM   78   C C     . GLY A  1 17 ? -28.143 9.390  -16.385 1.00 33.93 ? 158 GLY A C     1 
ATOM   79   O O     . GLY A  1 17 ? -28.406 8.566  -17.254 1.00 34.48 ? 158 GLY A O     1 
ATOM   80   N N     . TRP A  1 18 ? -27.998 10.708 -16.621 1.00 32.04 ? 159 TRP A N     1 
ATOM   81   C CA    . TRP A  1 18 ? -28.055 11.307 -17.966 1.00 30.45 ? 159 TRP A CA    1 
ATOM   82   C C     . TRP A  1 18 ? -26.827 10.942 -18.764 1.00 30.67 ? 159 TRP A C     1 
ATOM   83   O O     . TRP A  1 18 ? -25.676 11.029 -18.241 1.00 30.65 ? 159 TRP A O     1 
ATOM   84   C CB    . TRP A  1 18 ? -28.192 12.844 -17.904 1.00 29.62 ? 159 TRP A CB    1 
ATOM   85   C CG    . TRP A  1 18 ? -29.613 13.283 -17.616 1.00 30.17 ? 159 TRP A CG    1 
ATOM   86   C CD1   . TRP A  1 18 ? -30.189 13.449 -16.387 1.00 31.96 ? 159 TRP A CD1   1 
ATOM   87   C CD2   . TRP A  1 18 ? -30.613 13.602 -18.575 1.00 28.73 ? 159 TRP A CD2   1 
ATOM   88   N NE1   . TRP A  1 18 ? -31.479 13.856 -16.527 1.00 32.07 ? 159 TRP A NE1   1 
ATOM   89   C CE2   . TRP A  1 18 ? -31.778 13.946 -17.861 1.00 29.83 ? 159 TRP A CE2   1 
ATOM   90   C CE3   . TRP A  1 18 ? -30.646 13.617 -19.983 1.00 27.45 ? 159 TRP A CE3   1 
ATOM   91   C CZ2   . TRP A  1 18 ? -32.967 14.312 -18.497 1.00 29.03 ? 159 TRP A CZ2   1 
ATOM   92   C CZ3   . TRP A  1 18 ? -31.835 13.989 -20.630 1.00 26.22 ? 159 TRP A CZ3   1 
ATOM   93   C CH2   . TRP A  1 18 ? -32.975 14.331 -19.895 1.00 27.73 ? 159 TRP A CH2   1 
ATOM   94   N N     . LYS A  1 19 ? -27.055 10.524 -20.021 1.00 28.94 ? 160 LYS A N     1 
ATOM   95   C CA    . LYS A  1 19 ? -25.984 10.072 -20.896 1.00 29.33 ? 160 LYS A CA    1 
ATOM   96   C C     . LYS A  1 19 ? -26.086 10.737 -22.261 1.00 28.08 ? 160 LYS A C     1 
ATOM   97   O O     . LYS A  1 19 ? -27.143 11.235 -22.627 1.00 26.70 ? 160 LYS A O     1 
ATOM   98   C CB    . LYS A  1 19 ? -25.967 8.543  -21.030 1.00 31.43 ? 160 LYS A CB    1 
ATOM   99   C CG    . LYS A  1 19 ? -25.812 7.772  -19.690 1.00 33.42 ? 160 LYS A CG    1 
ATOM   100  C CD    . LYS A  1 19 ? -25.702 6.263  -19.898 1.00 35.16 ? 160 LYS A CD    1 
ATOM   101  C CE    . LYS A  1 19 ? -25.652 5.478  -18.559 1.00 37.50 ? 160 LYS A CE    1 
ATOM   102  N N     . LYS A  1 20 ? -24.945 10.757 -22.959 1.00 28.62 ? 161 LYS A N     1 
ATOM   103  C CA    . LYS A  1 20 ? -24.713 11.475 -24.206 1.00 29.12 ? 161 LYS A CA    1 
ATOM   104  C C     . LYS A  1 20 ? -24.204 10.468 -25.233 1.00 30.46 ? 161 LYS A C     1 
ATOM   105  O O     . LYS A  1 20 ? -23.456 9.527  -24.896 1.00 32.90 ? 161 LYS A O     1 
ATOM   106  C CB    . LYS A  1 20 ? -23.636 12.603 -24.010 1.00 30.46 ? 161 LYS A CB    1 
ATOM   107  C CG    . LYS A  1 20 ? -23.401 13.510 -25.240 1.00 30.49 ? 161 LYS A CG    1 
ATOM   108  C CD    . LYS A  1 20 ? -22.222 14.510 -25.078 1.00 31.59 ? 161 LYS A CD    1 
ATOM   109  C CE    . LYS A  1 20 ? -20.830 13.922 -25.427 1.00 32.48 ? 161 LYS A CE    1 
ATOM   110  N N     . GLU A  1 21 ? -24.604 10.657 -26.482 1.00 30.44 ? 162 GLU A N     1 
ATOM   111  C CA    . GLU A  1 21 ? -24.107 9.832  -27.610 1.00 30.93 ? 162 GLU A CA    1 
ATOM   112  C C     . GLU A  1 21 ? -23.959 10.747 -28.811 1.00 27.62 ? 162 GLU A C     1 
ATOM   113  O O     . GLU A  1 21 ? -24.807 11.604 -29.036 1.00 26.63 ? 162 GLU A O     1 
ATOM   114  C CB    . GLU A  1 21 ? -25.087 8.650  -27.927 1.00 34.15 ? 162 GLU A CB    1 
ATOM   115  C CG    . GLU A  1 21 ? -24.720 7.911  -29.208 1.00 36.40 ? 162 GLU A CG    1 
ATOM   116  C CD    . GLU A  1 21 ? -25.490 6.631  -29.470 1.00 40.40 ? 162 GLU A CD    1 
ATOM   117  O OE1   . GLU A  1 21 ? -26.701 6.544  -29.115 1.00 42.71 ? 162 GLU A OE1   1 
ATOM   118  O OE2   . GLU A  1 21 ? -24.869 5.723  -30.100 1.00 43.70 ? 162 GLU A OE2   1 
ATOM   119  N N     . GLU A  1 22 ? -22.881 10.566 -29.573 1.00 27.02 ? 163 GLU A N     1 
ATOM   120  C CA    . GLU A  1 22 ? -22.591 11.363 -30.757 1.00 26.40 ? 163 GLU A CA    1 
ATOM   121  C C     . GLU A  1 22 ? -22.566 10.369 -31.919 1.00 26.28 ? 163 GLU A C     1 
ATOM   122  O O     . GLU A  1 22 ? -21.853 9.419  -31.838 1.00 27.70 ? 163 GLU A O     1 
ATOM   123  C CB    . GLU A  1 22 ? -21.219 12.056 -30.634 1.00 28.54 ? 163 GLU A CB    1 
ATOM   124  C CG    . GLU A  1 22 ? -20.851 12.834 -31.868 1.00 29.76 ? 163 GLU A CG    1 
ATOM   125  C CD    . GLU A  1 22 ? -19.769 13.898 -31.666 1.00 32.68 ? 163 GLU A CD    1 
ATOM   126  O OE1   . GLU A  1 22 ? -19.535 14.623 -32.636 1.00 32.05 ? 163 GLU A OE1   1 
ATOM   127  O OE2   . GLU A  1 22 ? -19.172 14.038 -30.543 1.00 37.69 ? 163 GLU A OE2   1 
ATOM   128  N N     . VAL A  1 23 ? -23.354 10.600 -32.967 1.00 24.26 ? 164 VAL A N     1 
ATOM   129  C CA    . VAL A  1 23 ? -23.434 9.666  -34.118 1.00 24.49 ? 164 VAL A CA    1 
ATOM   130  C C     . VAL A  1 23 ? -22.988 10.376 -35.378 1.00 22.68 ? 164 VAL A C     1 
ATOM   131  O O     . VAL A  1 23 ? -23.499 11.424 -35.734 1.00 21.33 ? 164 VAL A O     1 
ATOM   132  C CB    . VAL A  1 23 ? -24.859 9.072  -34.336 1.00 24.74 ? 164 VAL A CB    1 
ATOM   133  C CG1   . VAL A  1 23 ? -24.856 8.060  -35.516 1.00 26.49 ? 164 VAL A CG1   1 
ATOM   134  C CG2   . VAL A  1 23 ? -25.370 8.403  -33.053 1.00 25.19 ? 164 VAL A CG2   1 
ATOM   135  N N     . ILE A  1 24 ? -22.098 9.733  -36.090 1.00 23.77 ? 165 ILE A N     1 
ATOM   136  C CA    . ILE A  1 24 ? -21.547 10.267 -37.384 1.00 23.56 ? 165 ILE A CA    1 
ATOM   137  C C     . ILE A  1 24 ? -22.510 9.948  -38.505 1.00 24.33 ? 165 ILE A C     1 
ATOM   138  O O     . ILE A  1 24 ? -22.858 8.788  -38.703 1.00 23.72 ? 165 ILE A O     1 
ATOM   139  C CB    . ILE A  1 24 ? -20.200 9.621  -37.720 1.00 24.52 ? 165 ILE A CB    1 
ATOM   140  C CG1   . ILE A  1 24 ? -19.243 9.661  -36.520 1.00 25.01 ? 165 ILE A CG1   1 
ATOM   141  C CG2   . ILE A  1 24 ? -19.593 10.248 -38.999 1.00 25.90 ? 165 ILE A CG2   1 
ATOM   142  C CD1   . ILE A  1 24 ? -19.034 11.032 -35.936 1.00 24.69 ? 165 ILE A CD1   1 
ATOM   143  N N     . ARG A  1 25 ? -22.914 10.968 -39.277 1.00 24.85 ? 166 ARG A N     1 
ATOM   144  C CA    . ARG A  1 25 ? -23.655 10.707 -40.527 1.00 25.29 ? 166 ARG A CA    1 
ATOM   145  C C     . ARG A  1 25 ? -22.759 9.972  -41.598 1.00 27.78 ? 166 ARG A C     1 
ATOM   146  O O     . ARG A  1 25 ? -21.676 10.431 -41.940 1.00 26.65 ? 166 ARG A O     1 
ATOM   147  C CB    . ARG A  1 25 ? -24.208 12.024 -41.103 1.00 25.06 ? 166 ARG A CB    1 
ATOM   148  C CG    . ARG A  1 25 ? -25.157 12.759 -40.160 1.00 24.78 ? 166 ARG A CG    1 
ATOM   149  C CD    . ARG A  1 25 ? -25.993 13.802 -40.863 1.00 24.58 ? 166 ARG A CD    1 
ATOM   150  N NE    . ARG A  1 25 ? -26.898 14.466 -39.943 1.00 23.66 ? 166 ARG A NE    1 
ATOM   151  C CZ    . ARG A  1 25 ? -27.958 15.190 -40.308 1.00 24.37 ? 166 ARG A CZ    1 
ATOM   152  N NH1   . ARG A  1 25 ? -28.260 15.366 -41.576 1.00 25.19 ? 166 ARG A NH1   1 
ATOM   153  N NH2   . ARG A  1 25 ? -28.732 15.758 -39.386 1.00 24.17 ? 166 ARG A NH2   1 
ATOM   154  N N     . LYS A  1 26 ? -23.259 8.842  -42.124 1.00 30.63 ? 167 LYS A N     1 
ATOM   155  C CA    . LYS A  1 26 ? -22.508 7.989  -43.028 1.00 33.98 ? 167 LYS A CA    1 
ATOM   156  C C     . LYS A  1 26 ? -22.608 8.403  -44.492 1.00 34.79 ? 167 LYS A C     1 
ATOM   157  O O     . LYS A  1 26 ? -21.721 8.107  -45.246 1.00 35.27 ? 167 LYS A O     1 
ATOM   158  C CB    . LYS A  1 26 ? -22.931 6.517  -42.870 1.00 36.14 ? 167 LYS A CB    1 
ATOM   159  C CG    . LYS A  1 26 ? -22.668 5.986  -41.467 1.00 37.51 ? 167 LYS A CG    1 
ATOM   160  N N     . SER A  1 27 ? -23.655 9.133  -44.859 1.00 36.40 ? 168 SER A N     1 
ATOM   161  C CA    . SER A  1 27 ? -23.986 9.407  -46.258 1.00 37.57 ? 168 SER A CA    1 
ATOM   162  C C     . SER A  1 27 ? -24.830 10.680 -46.424 1.00 39.35 ? 168 SER A C     1 
ATOM   163  O O     . SER A  1 27 ? -25.249 11.302 -45.473 1.00 36.62 ? 168 SER A O     1 
ATOM   164  C CB    . SER A  1 27 ? -24.772 8.224  -46.830 1.00 40.07 ? 168 SER A CB    1 
ATOM   165  O OG    . SER A  1 27 ? -26.032 8.117  -46.137 1.00 40.73 ? 168 SER A OG    1 
ATOM   166  N N     . GLY A  1 28 ? -25.081 11.043 -47.674 1.00 44.51 ? 169 GLY A N     1 
ATOM   167  C CA    . GLY A  1 28 ? -25.870 12.205 -47.980 1.00 45.66 ? 169 GLY A CA    1 
ATOM   168  C C     . GLY A  1 28 ? -25.097 13.504 -47.828 1.00 45.37 ? 169 GLY A C     1 
ATOM   169  O O     . GLY A  1 28 ? -23.881 13.520 -47.623 1.00 39.88 ? 169 GLY A O     1 
ATOM   170  N N     . LEU A  1 29 ? -25.858 14.590 -47.896 1.00 47.79 ? 170 LEU A N     1 
ATOM   171  C CA    . LEU A  1 29 ? -25.331 15.943 -48.028 1.00 48.25 ? 170 LEU A CA    1 
ATOM   172  C C     . LEU A  1 29 ? -24.397 16.289 -46.884 1.00 45.11 ? 170 LEU A C     1 
ATOM   173  O O     . LEU A  1 29 ? -23.285 16.771 -47.104 1.00 46.34 ? 170 LEU A O     1 
ATOM   174  C CB    . LEU A  1 29 ? -26.493 16.941 -48.089 1.00 51.56 ? 170 LEU A CB    1 
ATOM   175  C CG    . LEU A  1 29 ? -27.474 16.801 -49.293 1.00 53.97 ? 170 LEU A CG    1 
ATOM   176  C CD1   . LEU A  1 29 ? -28.797 17.524 -48.990 1.00 54.86 ? 170 LEU A CD1   1 
ATOM   177  C CD2   . LEU A  1 29 ? -26.857 17.302 -50.584 1.00 55.55 ? 170 LEU A CD2   1 
ATOM   178  N N     . SER A  1 30 ? -24.830 15.985 -45.660 1.00 40.30 ? 171 SER A N     1 
ATOM   179  C CA    . SER A  1 30 ? -24.052 16.299 -44.459 1.00 36.26 ? 171 SER A CA    1 
ATOM   180  C C     . SER A  1 30 ? -23.119 15.159 -44.005 1.00 34.42 ? 171 SER A C     1 
ATOM   181  O O     . SER A  1 30 ? -22.790 15.085 -42.829 1.00 31.76 ? 171 SER A O     1 
ATOM   182  C CB    . SER A  1 30 ? -25.005 16.704 -43.318 1.00 35.76 ? 171 SER A CB    1 
ATOM   183  N N     . ALA A  1 31 ? -22.650 14.309 -44.943 1.00 32.57 ? 172 ALA A N     1 
ATOM   184  C CA    . ALA A  1 31 ? -21.840 13.129 -44.611 1.00 31.42 ? 172 ALA A CA    1 
ATOM   185  C C     . ALA A  1 31 ? -20.577 13.577 -43.838 1.00 30.20 ? 172 ALA A C     1 
ATOM   186  O O     . ALA A  1 31 ? -19.915 14.445 -44.260 1.00 31.22 ? 172 ALA A O     1 
ATOM   187  C CB    . ALA A  1 31 ? -21.436 12.345 -45.889 1.00 31.65 ? 172 ALA A CB    1 
ATOM   188  N N     . GLY A  1 32 ? -20.261 12.929 -42.732 1.00 29.42 ? 173 GLY A N     1 
ATOM   189  C CA    . GLY A  1 32 ? -19.065 13.321 -41.923 1.00 30.44 ? 173 GLY A CA    1 
ATOM   190  C C     . GLY A  1 32 ? -19.402 14.188 -40.721 1.00 29.43 ? 173 GLY A C     1 
ATOM   191  O O     . GLY A  1 32 ? -18.708 14.152 -39.740 1.00 29.17 ? 173 GLY A O     1 
ATOM   192  N N     . LYS A  1 33 ? -20.456 14.993 -40.819 1.00 29.66 ? 174 LYS A N     1 
ATOM   193  C CA    . LYS A  1 33 ? -21.011 15.686 -39.650 1.00 30.41 ? 174 LYS A CA    1 
ATOM   194  C C     . LYS A  1 33 ? -21.609 14.743 -38.569 1.00 28.04 ? 174 LYS A C     1 
ATOM   195  O O     . LYS A  1 33 ? -21.873 13.570 -38.835 1.00 28.16 ? 174 LYS A O     1 
ATOM   196  C CB    . LYS A  1 33 ? -22.064 16.721 -40.088 1.00 30.93 ? 174 LYS A CB    1 
ATOM   197  C CG    . LYS A  1 33 ? -21.451 17.942 -40.794 1.00 33.72 ? 174 LYS A CG    1 
ATOM   198  C CD    . LYS A  1 33 ? -21.945 18.115 -42.241 1.00 34.37 ? 174 LYS A CD    1 
ATOM   199  N N     . SER A  1 34 ? -21.853 15.267 -37.366 1.00 26.73 ? 175 SER A N     1 
ATOM   200  C CA    . SER A  1 34 ? -22.429 14.450 -36.311 1.00 26.37 ? 175 SER A CA    1 
ATOM   201  C C     . SER A  1 34 ? -23.688 15.047 -35.723 1.00 24.97 ? 175 SER A C     1 
ATOM   202  O O     . SER A  1 34 ? -23.965 16.227 -35.874 1.00 26.52 ? 175 SER A O     1 
ATOM   203  C CB    . SER A  1 34 ? -21.422 14.174 -35.203 1.00 26.90 ? 175 SER A CB    1 
ATOM   204  O OG    . SER A  1 34 ? -20.844 15.363 -34.772 1.00 27.81 ? 175 SER A OG    1 
ATOM   205  N N     . ASP A  1 35 ? -24.444 14.186 -35.075 1.00 22.69 ? 176 ASP A N     1 
ATOM   206  C CA    . ASP A  1 35 ? -25.605 14.572 -34.333 1.00 22.82 ? 176 ASP A CA    1 
ATOM   207  C C     . ASP A  1 35 ? -25.355 14.070 -32.897 1.00 22.08 ? 176 ASP A C     1 
ATOM   208  O O     . ASP A  1 35 ? -24.788 13.008 -32.690 1.00 22.53 ? 176 ASP A O     1 
ATOM   209  C CB    . ASP A  1 35 ? -26.868 13.966 -34.928 1.00 22.10 ? 176 ASP A CB    1 
ATOM   210  C CG    . ASP A  1 35 ? -27.147 14.443 -36.340 1.00 23.52 ? 176 ASP A CG    1 
ATOM   211  O OD1   . ASP A  1 35 ? -26.582 13.851 -37.254 1.00 23.74 ? 176 ASP A OD1   1 
ATOM   212  O OD2   . ASP A  1 35 ? -27.959 15.392 -36.550 1.00 24.10 ? 176 ASP A OD2   1 
ATOM   213  N N     . VAL A  1 36 ? -25.741 14.875 -31.926 1.00 22.97 ? 177 VAL A N     1 
ATOM   214  C CA    . VAL A  1 36 ? -25.562 14.562 -30.501 1.00 22.39 ? 177 VAL A CA    1 
ATOM   215  C C     . VAL A  1 36 ? -26.932 14.330 -29.938 1.00 21.72 ? 177 VAL A C     1 
ATOM   216  O O     . VAL A  1 36 ? -27.898 15.048 -30.314 1.00 21.79 ? 177 VAL A O     1 
ATOM   217  C CB    . VAL A  1 36 ? -24.886 15.733 -29.794 1.00 23.12 ? 177 VAL A CB    1 
ATOM   218  C CG1   . VAL A  1 36 ? -24.721 15.450 -28.288 1.00 23.28 ? 177 VAL A CG1   1 
ATOM   219  C CG2   . VAL A  1 36 ? -23.562 15.985 -30.469 1.00 23.71 ? 177 VAL A CG2   1 
ATOM   220  N N     . TYR A  1 37 ? -27.046 13.303 -29.096 1.00 21.88 ? 178 TYR A N     1 
ATOM   221  C CA    . TYR A  1 37 ? -28.313 12.926 -28.477 1.00 22.70 ? 178 TYR A CA    1 
ATOM   222  C C     . TYR A  1 37 ? -28.069 12.722 -26.992 1.00 23.44 ? 178 TYR A C     1 
ATOM   223  O O     . TYR A  1 37 ? -26.978 12.267 -26.595 1.00 23.19 ? 178 TYR A O     1 
ATOM   224  C CB    . TYR A  1 37 ? -28.883 11.629 -29.078 1.00 22.81 ? 178 TYR A CB    1 
ATOM   225  C CG    . TYR A  1 37 ? -29.046 11.655 -30.594 1.00 24.47 ? 178 TYR A CG    1 
ATOM   226  C CD1   . TYR A  1 37 ? -30.032 12.426 -31.195 1.00 24.21 ? 178 TYR A CD1   1 
ATOM   227  C CD2   . TYR A  1 37 ? -28.219 10.895 -31.419 1.00 25.40 ? 178 TYR A CD2   1 
ATOM   228  C CE1   . TYR A  1 37 ? -30.188 12.461 -32.565 1.00 25.25 ? 178 TYR A CE1   1 
ATOM   229  C CE2   . TYR A  1 37 ? -28.379 10.902 -32.810 1.00 26.02 ? 178 TYR A CE2   1 
ATOM   230  C CZ    . TYR A  1 37 ? -29.350 11.696 -33.379 1.00 25.32 ? 178 TYR A CZ    1 
ATOM   231  O OH    . TYR A  1 37 ? -29.488 11.735 -34.734 1.00 23.76 ? 178 TYR A OH    1 
ATOM   232  N N     . TYR A  1 38 ? -29.077 13.035 -26.186 1.00 23.50 ? 179 TYR A N     1 
ATOM   233  C CA    . TYR A  1 38 ? -29.018 12.750 -24.726 1.00 24.77 ? 179 TYR A CA    1 
ATOM   234  C C     . TYR A  1 38 ? -30.065 11.762 -24.368 1.00 25.39 ? 179 TYR A C     1 
ATOM   235  O O     . TYR A  1 38 ? -31.057 11.636 -25.085 1.00 24.52 ? 179 TYR A O     1 
ATOM   236  C CB    . TYR A  1 38 ? -29.152 14.053 -23.900 1.00 25.27 ? 179 TYR A CB    1 
ATOM   237  C CG    . TYR A  1 38 ? -27.915 14.922 -24.035 1.00 25.03 ? 179 TYR A CG    1 
ATOM   238  C CD1   . TYR A  1 38 ? -27.770 15.804 -25.103 1.00 25.37 ? 179 TYR A CD1   1 
ATOM   239  C CD2   . TYR A  1 38 ? -26.880 14.833 -23.131 1.00 26.31 ? 179 TYR A CD2   1 
ATOM   240  C CE1   . TYR A  1 38 ? -26.628 16.594 -25.248 1.00 24.47 ? 179 TYR A CE1   1 
ATOM   241  C CE2   . TYR A  1 38 ? -25.722 15.606 -23.277 1.00 26.69 ? 179 TYR A CE2   1 
ATOM   242  C CZ    . TYR A  1 38 ? -25.610 16.471 -24.336 1.00 25.76 ? 179 TYR A CZ    1 
ATOM   243  O OH    . TYR A  1 38 ? -24.497 17.224 -24.452 1.00 27.09 ? 179 TYR A OH    1 
ATOM   244  N N     . PHE A  1 39 ? -29.827 11.024 -23.264 1.00 26.25 ? 180 PHE A N     1 
ATOM   245  C CA    . PHE A  1 39 ? -30.772 10.086 -22.761 1.00 27.80 ? 180 PHE A CA    1 
ATOM   246  C C     . PHE A  1 39 ? -31.004 10.326 -21.269 1.00 28.76 ? 180 PHE A C     1 
ATOM   247  O O     . PHE A  1 39 ? -30.061 10.553 -20.514 1.00 28.72 ? 180 PHE A O     1 
ATOM   248  C CB    . PHE A  1 39 ? -30.318 8.637  -23.044 1.00 28.82 ? 180 PHE A CB    1 
ATOM   249  C CG    . PHE A  1 39 ? -30.090 8.354  -24.515 1.00 28.57 ? 180 PHE A CG    1 
ATOM   250  C CD1   . PHE A  1 39 ? -28.889 8.679  -25.115 1.00 27.50 ? 180 PHE A CD1   1 
ATOM   251  C CD2   . PHE A  1 39 ? -31.092 7.779  -25.299 1.00 29.41 ? 180 PHE A CD2   1 
ATOM   252  C CE1   . PHE A  1 39 ? -28.675 8.435  -26.471 1.00 27.41 ? 180 PHE A CE1   1 
ATOM   253  C CE2   . PHE A  1 39 ? -30.873 7.521  -26.658 1.00 29.76 ? 180 PHE A CE2   1 
ATOM   254  C CZ    . PHE A  1 39 ? -29.664 7.855  -27.243 1.00 27.83 ? 180 PHE A CZ    1 
ATOM   255  N N     . SER A  1 40 ? -32.274 10.311 -20.861 1.00 28.96 ? 181 SER A N     1 
ATOM   256  C CA    . SER A  1 40 ? -32.653 10.433 -19.434 1.00 29.34 ? 181 SER A CA    1 
ATOM   257  C C     . SER A  1 40 ? -32.289 9.162  -18.732 1.00 31.25 ? 181 SER A C     1 
ATOM   258  O O     . SER A  1 40 ? -31.965 8.162  -19.370 1.00 33.46 ? 181 SER A O     1 
ATOM   259  C CB    . SER A  1 40 ? -34.158 10.690 -19.306 1.00 29.66 ? 181 SER A CB    1 
ATOM   260  O OG    . SER A  1 40 ? -34.916 9.543  -19.669 1.00 30.52 ? 181 SER A OG    1 
ATOM   261  N N     . PRO A  1 41 ? -32.356 9.154  -17.408 1.00 34.32 ? 182 PRO A N     1 
ATOM   262  C CA    . PRO A  1 41 ? -32.030 7.870  -16.795 1.00 36.61 ? 182 PRO A CA    1 
ATOM   263  C C     . PRO A  1 41 ? -33.023 6.765  -17.182 1.00 38.45 ? 182 PRO A C     1 
ATOM   264  O O     . PRO A  1 41 ? -32.629 5.601  -17.206 1.00 40.88 ? 182 PRO A O     1 
ATOM   265  C CB    . PRO A  1 41 ? -32.043 8.163  -15.283 1.00 38.66 ? 182 PRO A CB    1 
ATOM   266  C CG    . PRO A  1 41 ? -32.640 9.519  -15.120 1.00 37.56 ? 182 PRO A CG    1 
ATOM   267  C CD    . PRO A  1 41 ? -32.495 10.245 -16.430 1.00 34.12 ? 182 PRO A CD    1 
ATOM   268  N N     . SER A  1 42 ? -34.275 7.120  -17.496 1.00 38.67 ? 183 SER A N     1 
ATOM   269  C CA    . SER A  1 42 ? -35.275 6.134  -18.021 1.00 41.27 ? 183 SER A CA    1 
ATOM   270  C C     . SER A  1 42 ? -35.054 5.774  -19.476 1.00 41.54 ? 183 SER A C     1 
ATOM   271  O O     . SER A  1 42 ? -35.622 4.799  -19.941 1.00 44.69 ? 183 SER A O     1 
ATOM   272  C CB    . SER A  1 42 ? -36.723 6.636  -17.855 1.00 41.56 ? 183 SER A CB    1 
ATOM   273  N N     . GLY A  1 43 ? -34.258 6.561  -20.209 1.00 38.52 ? 184 GLY A N     1 
ATOM   274  C CA    . GLY A  1 43 ? -33.888 6.217  -21.596 1.00 37.51 ? 184 GLY A CA    1 
ATOM   275  C C     . GLY A  1 43 ? -34.572 6.995  -22.737 1.00 35.18 ? 184 GLY A C     1 
ATOM   276  O O     . GLY A  1 43 ? -34.390 6.634  -23.888 1.00 33.68 ? 184 GLY A O     1 
ATOM   277  N N     . LYS A  1 44 ? -35.336 8.057  -22.413 1.00 33.75 ? 185 LYS A N     1 
ATOM   278  C CA    . LYS A  1 44 ? -35.962 8.919  -23.425 1.00 31.75 ? 185 LYS A CA    1 
ATOM   279  C C     . LYS A  1 44 ? -34.868 9.695  -24.147 1.00 29.80 ? 185 LYS A C     1 
ATOM   280  O O     . LYS A  1 44 ? -33.894 10.161 -23.531 1.00 29.96 ? 185 LYS A O     1 
ATOM   281  C CB    . LYS A  1 44 ? -37.001 9.899  -22.850 1.00 31.87 ? 185 LYS A CB    1 
ATOM   282  C CG    . LYS A  1 44 ? -38.026 9.325  -21.825 1.00 34.43 ? 185 LYS A CG    1 
ATOM   283  N N     . LYS A  1 45 ? -35.028 9.812  -25.459 1.00 28.08 ? 186 LYS A N     1 
ATOM   284  C CA    . LYS A  1 45 ? -34.025 10.375 -26.348 1.00 26.57 ? 186 LYS A CA    1 
ATOM   285  C C     . LYS A  1 45 ? -34.311 11.866 -26.543 1.00 25.47 ? 186 LYS A C     1 
ATOM   286  O O     . LYS A  1 45 ? -35.452 12.234 -26.744 1.00 26.43 ? 186 LYS A O     1 
ATOM   287  C CB    . LYS A  1 45 ? -34.106 9.640  -27.690 1.00 28.03 ? 186 LYS A CB    1 
ATOM   288  C CG    . LYS A  1 45 ? -33.040 10.048 -28.675 1.00 27.30 ? 186 LYS A CG    1 
ATOM   289  C CD    . LYS A  1 45 ? -32.887 9.006  -29.777 1.00 28.56 ? 186 LYS A CD    1 
ATOM   290  C CE    . LYS A  1 45 ? -31.824 9.414  -30.778 1.00 27.92 ? 186 LYS A CE    1 
ATOM   291  N NZ    . LYS A  1 45 ? -31.589 8.362  -31.808 1.00 29.68 ? 186 LYS A NZ    1 
ATOM   292  N N     . PHE A  1 46 ? -33.293 12.723 -26.433 1.00 23.73 ? 187 PHE A N     1 
ATOM   293  C CA    . PHE A  1 46 ? -33.449 14.144 -26.706 1.00 24.23 ? 187 PHE A CA    1 
ATOM   294  C C     . PHE A  1 46 ? -32.514 14.549 -27.824 1.00 24.73 ? 187 PHE A C     1 
ATOM   295  O O     . PHE A  1 46 ? -31.401 14.017 -27.938 1.00 24.61 ? 187 PHE A O     1 
ATOM   296  C CB    . PHE A  1 46 ? -33.206 14.937 -25.438 1.00 25.72 ? 187 PHE A CB    1 
ATOM   297  C CG    . PHE A  1 46 ? -34.188 14.598 -24.351 1.00 26.62 ? 187 PHE A CG    1 
ATOM   298  C CD1   . PHE A  1 46 ? -33.991 13.491 -23.551 1.00 27.38 ? 187 PHE A CD1   1 
ATOM   299  C CD2   . PHE A  1 46 ? -35.341 15.356 -24.180 1.00 27.89 ? 187 PHE A CD2   1 
ATOM   300  C CE1   . PHE A  1 46 ? -34.919 13.146 -22.558 1.00 29.36 ? 187 PHE A CE1   1 
ATOM   301  C CE2   . PHE A  1 46 ? -36.275 15.027 -23.205 1.00 29.07 ? 187 PHE A CE2   1 
ATOM   302  C CZ    . PHE A  1 46 ? -36.058 13.915 -22.387 1.00 30.17 ? 187 PHE A CZ    1 
ATOM   303  N N     . ARG A  1 47 ? -32.951 15.478 -28.658 1.00 25.52 ? 188 ARG A N     1 
ATOM   304  C CA    . ARG A  1 47 ? -32.176 15.821 -29.863 1.00 26.79 ? 188 ARG A CA    1 
ATOM   305  C C     . ARG A  1 47 ? -31.758 17.290 -29.934 1.00 26.07 ? 188 ARG A C     1 
ATOM   306  O O     . ARG A  1 47 ? -31.031 17.663 -30.854 1.00 26.92 ? 188 ARG A O     1 
ATOM   307  C CB    . ARG A  1 47 ? -32.957 15.441 -31.118 1.00 28.64 ? 188 ARG A CB    1 
ATOM   308  C CG    . ARG A  1 47 ? -33.565 14.050 -31.061 1.00 31.26 ? 188 ARG A CG    1 
ATOM   309  C CD    A ARG A  1 47 ? -34.473 13.808 -32.283 0.70 33.82 ? 188 ARG A CD    1 
ATOM   310  C CD    B ARG A  1 47 ? -34.386 13.647 -32.297 0.30 30.64 ? 188 ARG A CD    1 
ATOM   311  N NE    A ARG A  1 47 ? -35.132 12.508 -32.172 0.70 36.83 ? 188 ARG A NE    1 
ATOM   312  N NE    B ARG A  1 47 ? -34.636 12.190 -32.305 0.30 30.42 ? 188 ARG A NE    1 
ATOM   313  C CZ    A ARG A  1 47 ? -36.098 12.217 -31.301 0.70 38.57 ? 188 ARG A CZ    1 
ATOM   314  C CZ    B ARG A  1 47 ? -34.163 11.331 -33.211 0.30 29.43 ? 188 ARG A CZ    1 
ATOM   315  N NH1   A ARG A  1 47 ? -36.564 13.130 -30.432 0.70 40.03 ? 188 ARG A NH1   1 
ATOM   316  N NH1   B ARG A  1 47 ? -33.415 11.762 -34.232 0.30 28.40 ? 188 ARG A NH1   1 
ATOM   317  N NH2   A ARG A  1 47 ? -36.592 10.992 -31.279 0.70 41.10 ? 188 ARG A NH2   1 
ATOM   318  N NH2   B ARG A  1 47 ? -34.453 10.033 -33.101 0.30 29.31 ? 188 ARG A NH2   1 
ATOM   319  N N     . SER A  1 48 ? -32.214 18.125 -28.998 1.00 24.76 ? 189 SER A N     1 
ATOM   320  C CA    . SER A  1 48 ? -31.806 19.525 -28.987 1.00 24.95 ? 189 SER A CA    1 
ATOM   321  C C     . SER A  1 48 ? -31.732 20.080 -27.563 1.00 25.26 ? 189 SER A C     1 
ATOM   322  O O     . SER A  1 48 ? -32.323 19.509 -26.603 1.00 23.58 ? 189 SER A O     1 
ATOM   323  C CB    . SER A  1 48 ? -32.771 20.367 -29.783 1.00 25.86 ? 189 SER A CB    1 
ATOM   324  O OG    . SER A  1 48 ? -34.010 20.540 -29.038 1.00 27.37 ? 189 SER A OG    1 
ATOM   325  N N     . LYS A  1 49 ? -31.061 21.219 -27.443 1.00 25.80 ? 190 LYS A N     1 
ATOM   326  C CA    . LYS A  1 49 ? -31.007 21.922 -26.174 1.00 27.73 ? 190 LYS A CA    1 
ATOM   327  C C     . LYS A  1 49 ? -32.397 22.383 -25.657 1.00 27.79 ? 190 LYS A C     1 
ATOM   328  O O     . LYS A  1 49 ? -32.741 22.108 -24.521 1.00 28.05 ? 190 LYS A O     1 
ATOM   329  C CB    . LYS A  1 49 ? -30.018 23.063 -26.221 1.00 29.81 ? 190 LYS A CB    1 
ATOM   330  C CG    . LYS A  1 49 ? -29.733 23.664 -24.834 1.00 30.74 ? 190 LYS A CG    1 
ATOM   331  C CD    . LYS A  1 49 ? -28.685 24.750 -24.959 1.00 33.05 ? 190 LYS A CD    1 
ATOM   332  C CE    . LYS A  1 49 ? -28.525 25.483 -23.669 1.00 34.90 ? 190 LYS A CE    1 
ATOM   333  N NZ    . LYS A  1 49 ? -27.470 26.526 -23.791 1.00 37.10 ? 190 LYS A NZ    1 
ATOM   334  N N     . PRO A  1 50 ? -33.199 23.053 -26.493 1.00 29.27 ? 191 PRO A N     1 
ATOM   335  C CA    . PRO A  1 50 ? -34.541 23.413 -25.968 1.00 30.01 ? 191 PRO A CA    1 
ATOM   336  C C     . PRO A  1 50 ? -35.439 22.224 -25.610 1.00 29.38 ? 191 PRO A C     1 
ATOM   337  O O     . PRO A  1 50 ? -36.227 22.339 -24.706 1.00 29.85 ? 191 PRO A O     1 
ATOM   338  C CB    . PRO A  1 50 ? -35.162 24.240 -27.092 1.00 31.64 ? 191 PRO A CB    1 
ATOM   339  C CG    . PRO A  1 50 ? -34.035 24.593 -28.016 1.00 32.09 ? 191 PRO A CG    1 
ATOM   340  C CD    . PRO A  1 50 ? -32.936 23.627 -27.828 1.00 29.79 ? 191 PRO A CD    1 
ATOM   341  N N     . GLN A  1 51 ? -35.311 21.099 -26.314 1.00 29.51 ? 192 GLN A N     1 
ATOM   342  C CA    . GLN A  1 51 ? -36.053 19.869 -25.959 1.00 30.54 ? 192 GLN A CA    1 
ATOM   343  C C     . GLN A  1 51 ? -35.622 19.384 -24.578 1.00 29.78 ? 192 GLN A C     1 
ATOM   344  O O     . GLN A  1 51 ? -36.448 18.990 -23.759 1.00 31.15 ? 192 GLN A O     1 
ATOM   345  C CB    . GLN A  1 51 ? -35.854 18.762 -26.988 1.00 30.75 ? 192 GLN A CB    1 
ATOM   346  C CG    . GLN A  1 51 ? -37.021 17.790 -27.069 1.00 34.01 ? 192 GLN A CG    1 
ATOM   347  C CD    . GLN A  1 51 ? -36.684 16.471 -27.767 1.00 34.14 ? 192 GLN A CD    1 
ATOM   348  O OE1   . GLN A  1 51 ? -35.675 16.352 -28.455 1.00 35.49 ? 192 GLN A OE1   1 
ATOM   349  N NE2   . GLN A  1 51 ? -37.539 15.476 -27.579 1.00 36.05 ? 192 GLN A NE2   1 
ATOM   350  N N     . LEU A  1 52 ? -34.332 19.438 -24.335 1.00 27.64 ? 193 LEU A N     1 
ATOM   351  C CA    . LEU A  1 52 ? -33.767 19.051 -23.071 1.00 29.93 ? 193 LEU A CA    1 
ATOM   352  C C     . LEU A  1 52 ? -34.177 20.055 -21.935 1.00 30.48 ? 193 LEU A C     1 
ATOM   353  O O     . LEU A  1 52 ? -34.527 19.646 -20.853 1.00 30.46 ? 193 LEU A O     1 
ATOM   354  C CB    . LEU A  1 52 ? -32.249 19.033 -23.223 1.00 30.59 ? 193 LEU A CB    1 
ATOM   355  C CG    . LEU A  1 52 ? -31.406 18.434 -22.144 1.00 31.81 ? 193 LEU A CG    1 
ATOM   356  C CD1   . LEU A  1 52 ? -31.699 16.960 -22.031 1.00 31.19 ? 193 LEU A CD1   1 
ATOM   357  C CD2   . LEU A  1 52 ? -29.938 18.668 -22.494 1.00 32.56 ? 193 LEU A CD2   1 
ATOM   358  N N     . ALA A  1 53 ? -34.130 21.357 -22.234 1.00 31.08 ? 194 ALA A N     1 
ATOM   359  C CA    . ALA A  1 53 ? -34.561 22.387 -21.287 1.00 32.62 ? 194 ALA A CA    1 
ATOM   360  C C     . ALA A  1 53 ? -36.037 22.282 -20.971 1.00 33.55 ? 194 ALA A C     1 
ATOM   361  O O     . ALA A  1 53 ? -36.423 22.434 -19.823 1.00 35.36 ? 194 ALA A O     1 
ATOM   362  C CB    . ALA A  1 53 ? -34.215 23.778 -21.795 1.00 33.53 ? 194 ALA A CB    1 
ATOM   363  N N     . ARG A  1 54 ? -36.863 21.980 -21.970 1.00 34.47 ? 195 ARG A N     1 
ATOM   364  C CA    . ARG A  1 54 ? -38.315 21.815 -21.726 1.00 36.38 ? 195 ARG A CA    1 
ATOM   365  C C     . ARG A  1 54 ? -38.576 20.628 -20.796 1.00 35.08 ? 195 ARG A C     1 
ATOM   366  O O     . ARG A  1 54 ? -39.464 20.703 -19.941 1.00 35.65 ? 195 ARG A O     1 
ATOM   367  C CB    . ARG A  1 54 ? -39.118 21.663 -23.013 1.00 38.83 ? 195 ARG A CB    1 
ATOM   368  C CG    . ARG A  1 54 ? -39.275 22.961 -23.795 1.00 43.11 ? 195 ARG A CG    1 
ATOM   369  C CD    . ARG A  1 54 ? -40.236 22.807 -24.986 1.00 45.75 ? 195 ARG A CD    1 
ATOM   370  N NE    . ARG A  1 54 ? -39.864 21.780 -25.963 1.00 45.49 ? 195 ARG A NE    1 
ATOM   371  C CZ    . ARG A  1 54 ? -39.069 21.955 -27.048 1.00 50.10 ? 195 ARG A CZ    1 
ATOM   372  N NH1   . ARG A  1 54 ? -38.478 23.131 -27.318 1.00 50.91 ? 195 ARG A NH1   1 
ATOM   373  N NH2   . ARG A  1 54 ? -38.850 20.928 -27.889 1.00 49.49 ? 195 ARG A NH2   1 
ATOM   374  N N     . TYR A  1 55 ? -37.788 19.558 -20.934 1.00 31.04 ? 196 TYR A N     1 
ATOM   375  C CA    . TYR A  1 55 ? -37.970 18.378 -20.088 1.00 29.57 ? 196 TYR A CA    1 
ATOM   376  C C     . TYR A  1 55 ? -37.527 18.565 -18.615 1.00 29.95 ? 196 TYR A C     1 
ATOM   377  O O     . TYR A  1 55 ? -38.248 18.207 -17.679 1.00 30.60 ? 196 TYR A O     1 
ATOM   378  C CB    . TYR A  1 55 ? -37.214 17.219 -20.682 1.00 27.66 ? 196 TYR A CB    1 
ATOM   379  C CG    . TYR A  1 55 ? -37.561 15.925 -20.041 1.00 27.85 ? 196 TYR A CG    1 
ATOM   380  C CD1   . TYR A  1 55 ? -38.804 15.326 -20.277 1.00 28.07 ? 196 TYR A CD1   1 
ATOM   381  C CD2   . TYR A  1 55 ? -36.654 15.292 -19.151 1.00 27.85 ? 196 TYR A CD2   1 
ATOM   382  C CE1   . TYR A  1 55 ? -39.136 14.134 -19.672 1.00 29.96 ? 196 TYR A CE1   1 
ATOM   383  C CE2   . TYR A  1 55 ? -36.989 14.098 -18.525 1.00 29.04 ? 196 TYR A CE2   1 
ATOM   384  C CZ    . TYR A  1 55 ? -38.226 13.530 -18.799 1.00 30.23 ? 196 TYR A CZ    1 
ATOM   385  O OH    . TYR A  1 55 ? -38.534 12.369 -18.249 1.00 33.79 ? 196 TYR A OH    1 
ATOM   386  N N     . LEU A  1 56 ? -36.324 19.092 -18.428 1.00 29.58 ? 197 LEU A N     1 
ATOM   387  C CA    . LEU A  1 56 ? -35.753 19.268 -17.079 1.00 30.59 ? 197 LEU A CA    1 
ATOM   388  C C     . LEU A  1 56 ? -36.388 20.421 -16.259 1.00 31.99 ? 197 LEU A C     1 
ATOM   389  O O     . LEU A  1 56 ? -36.364 20.377 -15.002 1.00 33.17 ? 197 LEU A O     1 
ATOM   390  C CB    . LEU A  1 56 ? -34.230 19.470 -17.167 1.00 30.14 ? 197 LEU A CB    1 
ATOM   391  C CG    . LEU A  1 56 ? -33.467 18.234 -17.697 1.00 29.94 ? 197 LEU A CG    1 
ATOM   392  C CD1   . LEU A  1 56 ? -32.106 18.609 -18.243 1.00 29.59 ? 197 LEU A CD1   1 
ATOM   393  C CD2   . LEU A  1 56 ? -33.341 17.196 -16.578 1.00 30.86 ? 197 LEU A CD2   1 
ATOM   394  N N     . GLY A  1 57 ? -36.896 21.442 -16.953 1.00 31.52 ? 198 GLY A N     1 
ATOM   395  C CA    . GLY A  1 57 ? -37.440 22.638 -16.320 1.00 33.54 ? 198 GLY A CA    1 
ATOM   396  C C     . GLY A  1 57 ? -36.440 23.351 -15.410 1.00 34.49 ? 198 GLY A C     1 
ATOM   397  O O     . GLY A  1 57 ? -35.291 23.588 -15.798 1.00 33.39 ? 198 GLY A O     1 
ATOM   398  N N     . ASN A  1 58 ? -36.857 23.618 -14.160 1.00 35.41 ? 199 ASN A N     1 
ATOM   399  C CA    . ASN A  1 58 ? -36.033 24.364 -13.218 1.00 36.14 ? 199 ASN A CA    1 
ATOM   400  C C     . ASN A  1 58 ? -35.149 23.465 -12.361 1.00 36.03 ? 199 ASN A C     1 
ATOM   401  O O     . ASN A  1 58 ? -34.508 23.936 -11.413 1.00 36.62 ? 199 ASN A O     1 
ATOM   402  C CB    . ASN A  1 58 ? -36.908 25.292 -12.356 1.00 38.13 ? 199 ASN A CB    1 
ATOM   403  C CG    . ASN A  1 58 ? -37.831 24.541 -11.406 1.00 38.57 ? 199 ASN A CG    1 
ATOM   404  O OD1   . ASN A  1 58 ? -37.806 23.298 -11.325 1.00 37.06 ? 199 ASN A OD1   1 
ATOM   405  N ND2   . ASN A  1 58 ? -38.659 25.290 -10.680 1.00 39.28 ? 199 ASN A ND2   1 
ATOM   406  N N     . THR A  1 59 ? -35.113 22.164 -12.684 1.00 34.57 ? 200 THR A N     1 
ATOM   407  C CA    . THR A  1 59 ? -34.264 21.232 -11.958 1.00 34.60 ? 200 THR A CA    1 
ATOM   408  C C     . THR A  1 59 ? -32.790 21.469 -12.245 1.00 35.66 ? 200 THR A C     1 
ATOM   409  O O     . THR A  1 59 ? -31.946 21.084 -11.440 1.00 37.33 ? 200 THR A O     1 
ATOM   410  C CB    . THR A  1 59 ? -34.600 19.768 -12.299 1.00 33.22 ? 200 THR A CB    1 
ATOM   411  O OG1   . THR A  1 59 ? -34.468 19.542 -13.739 1.00 30.35 ? 200 THR A OG1   1 
ATOM   412  C CG2   . THR A  1 59 ? -35.986 19.433 -11.807 1.00 33.21 ? 200 THR A CG2   1 
ATOM   413  N N     . VAL A  1 60 ? -32.501 22.099 -13.392 1.00 35.77 ? 201 VAL A N     1 
ATOM   414  C CA    . VAL A  1 60 ? -31.149 22.353 -13.870 1.00 37.31 ? 201 VAL A CA    1 
ATOM   415  C C     . VAL A  1 60 ? -31.153 23.679 -14.650 1.00 40.30 ? 201 VAL A C     1 
ATOM   416  O O     . VAL A  1 60 ? -32.088 23.965 -15.442 1.00 42.10 ? 201 VAL A O     1 
ATOM   417  C CB    . VAL A  1 60 ? -30.706 21.227 -14.867 1.00 35.40 ? 201 VAL A CB    1 
ATOM   418  C CG1   . VAL A  1 60 ? -29.294 21.480 -15.405 1.00 36.99 ? 201 VAL A CG1   1 
ATOM   419  C CG2   . VAL A  1 60 ? -30.753 19.850 -14.239 1.00 34.13 ? 201 VAL A CG2   1 
ATOM   420  N N     . ASP A  1 61 ? -30.109 24.472 -14.479 1.00 42.35 ? 202 ASP A N     1 
ATOM   421  C CA    . ASP A  1 61 ? -29.877 25.648 -15.328 1.00 42.81 ? 202 ASP A CA    1 
ATOM   422  C C     . ASP A  1 61 ? -28.956 25.274 -16.528 1.00 40.59 ? 202 ASP A C     1 
ATOM   423  O O     . ASP A  1 61 ? -27.801 24.912 -16.346 1.00 39.93 ? 202 ASP A O     1 
ATOM   424  C CB    . ASP A  1 61 ? -29.258 26.782 -14.491 1.00 47.31 ? 202 ASP A CB    1 
ATOM   425  C CG    . ASP A  1 61 ? -28.858 27.988 -15.331 1.00 49.79 ? 202 ASP A CG    1 
ATOM   426  O OD1   . ASP A  1 61 ? -29.513 28.277 -16.355 1.00 49.73 ? 202 ASP A OD1   1 
ATOM   427  O OD2   . ASP A  1 61 ? -27.872 28.646 -14.961 1.00 55.32 ? 202 ASP A OD2   1 
ATOM   428  N N     . LEU A  1 62 ? -29.501 25.370 -17.732 1.00 38.82 ? 203 LEU A N     1 
ATOM   429  C CA    . LEU A  1 62 ? -28.794 25.003 -18.955 1.00 38.06 ? 203 LEU A CA    1 
ATOM   430  C C     . LEU A  1 62 ? -28.295 26.191 -19.732 1.00 39.24 ? 203 LEU A C     1 
ATOM   431  O O     . LEU A  1 62 ? -27.781 26.001 -20.809 1.00 38.63 ? 203 LEU A O     1 
ATOM   432  C CB    . LEU A  1 62 ? -29.708 24.144 -19.870 1.00 36.08 ? 203 LEU A CB    1 
ATOM   433  C CG    . LEU A  1 62 ? -30.166 22.751 -19.388 1.00 35.16 ? 203 LEU A CG    1 
ATOM   434  C CD1   . LEU A  1 62 ? -30.855 22.008 -20.517 1.00 33.59 ? 203 LEU A CD1   1 
ATOM   435  C CD2   . LEU A  1 62 ? -29.033 21.897 -18.860 1.00 35.45 ? 203 LEU A CD2   1 
ATOM   436  N N     . SER A  1 63 ? -28.390 27.419 -19.186 1.00 42.27 ? 204 SER A N     1 
ATOM   437  C CA    . SER A  1 63 ? -27.968 28.624 -19.933 1.00 44.79 ? 204 SER A CA    1 
ATOM   438  C C     . SER A  1 63 ? -26.548 28.495 -20.527 1.00 45.06 ? 204 SER A C     1 
ATOM   439  O O     . SER A  1 63 ? -26.333 28.839 -21.695 1.00 46.00 ? 204 SER A O     1 
ATOM   440  C CB    . SER A  1 63 ? -28.070 29.864 -19.056 1.00 48.53 ? 204 SER A CB    1 
ATOM   441  O OG    . SER A  1 63 ? -27.384 29.654 -17.840 1.00 51.00 ? 204 SER A OG    1 
ATOM   442  N N     . SER A  1 64 ? -25.618 27.948 -19.735 1.00 44.68 ? 205 SER A N     1 
ATOM   443  C CA    . SER A  1 64 ? -24.193 27.790 -20.121 1.00 45.14 ? 205 SER A CA    1 
ATOM   444  C C     . SER A  1 64 ? -23.824 26.398 -20.721 1.00 41.70 ? 205 SER A C     1 
ATOM   445  O O     . SER A  1 64 ? -22.648 26.150 -21.071 1.00 40.50 ? 205 SER A O     1 
ATOM   446  C CB    . SER A  1 64 ? -23.330 28.022 -18.881 1.00 48.13 ? 205 SER A CB    1 
ATOM   447  O OG    . SER A  1 64 ? -23.289 26.835 -18.109 1.00 46.90 ? 205 SER A OG    1 
ATOM   448  N N     . PHE A  1 65 ? -24.816 25.500 -20.801 1.00 38.75 ? 206 PHE A N     1 
ATOM   449  C CA    . PHE A  1 65 ? -24.613 24.123 -21.258 1.00 36.83 ? 206 PHE A CA    1 
ATOM   450  C C     . PHE A  1 65 ? -24.357 24.097 -22.765 1.00 35.48 ? 206 PHE A C     1 
ATOM   451  O O     . PHE A  1 65 ? -25.158 24.588 -23.547 1.00 35.70 ? 206 PHE A O     1 
ATOM   452  C CB    . PHE A  1 65 ? -25.835 23.257 -20.925 1.00 34.82 ? 206 PHE A CB    1 
ATOM   453  C CG    . PHE A  1 65 ? -25.625 21.765 -21.153 1.00 33.09 ? 206 PHE A CG    1 
ATOM   454  C CD1   . PHE A  1 65 ? -24.749 21.042 -20.352 1.00 33.73 ? 206 PHE A CD1   1 
ATOM   455  C CD2   . PHE A  1 65 ? -26.324 21.086 -22.139 1.00 31.62 ? 206 PHE A CD2   1 
ATOM   456  C CE1   . PHE A  1 65 ? -24.556 19.682 -20.541 1.00 32.74 ? 206 PHE A CE1   1 
ATOM   457  C CE2   . PHE A  1 65 ? -26.151 19.715 -22.330 1.00 30.15 ? 206 PHE A CE2   1 
ATOM   458  C CZ    . PHE A  1 65 ? -25.258 19.012 -21.529 1.00 30.63 ? 206 PHE A CZ    1 
ATOM   459  N N     . ASP A  1 66 ? -23.227 23.525 -23.149 1.00 35.63 ? 207 ASP A N     1 
ATOM   460  C CA    . ASP A  1 66 ? -22.857 23.380 -24.519 1.00 34.84 ? 207 ASP A CA    1 
ATOM   461  C C     . ASP A  1 66 ? -23.343 21.997 -24.956 1.00 32.29 ? 207 ASP A C     1 
ATOM   462  O O     . ASP A  1 66 ? -22.775 20.940 -24.531 1.00 29.95 ? 207 ASP A O     1 
ATOM   463  C CB    . ASP A  1 66 ? -21.351 23.500 -24.693 1.00 37.67 ? 207 ASP A CB    1 
ATOM   464  C CG    . ASP A  1 66 ? -20.921 23.280 -26.128 1.00 38.97 ? 207 ASP A CG    1 
ATOM   465  O OD1   . ASP A  1 66 ? -21.302 24.073 -26.989 1.00 39.44 ? 207 ASP A OD1   1 
ATOM   466  O OD2   . ASP A  1 66 ? -20.231 22.303 -26.385 1.00 40.59 ? 207 ASP A OD2   1 
ATOM   467  N N     . PHE A  1 67 ? -24.404 22.013 -25.760 1.00 30.28 ? 208 PHE A N     1 
ATOM   468  C CA    . PHE A  1 67 ? -25.093 20.792 -26.194 1.00 29.24 ? 208 PHE A CA    1 
ATOM   469  C C     . PHE A  1 67 ? -24.189 19.782 -26.885 1.00 29.29 ? 208 PHE A C     1 
ATOM   470  O O     . PHE A  1 67 ? -24.300 18.579 -26.631 1.00 26.69 ? 208 PHE A O     1 
ATOM   471  C CB    . PHE A  1 67 ? -26.253 21.124 -27.148 1.00 28.66 ? 208 PHE A CB    1 
ATOM   472  C CG    . PHE A  1 67 ? -27.195 19.959 -27.378 1.00 26.19 ? 208 PHE A CG    1 
ATOM   473  C CD1   . PHE A  1 67 ? -28.165 19.626 -26.414 1.00 26.09 ? 208 PHE A CD1   1 
ATOM   474  C CD2   . PHE A  1 67 ? -27.118 19.196 -28.548 1.00 25.74 ? 208 PHE A CD2   1 
ATOM   475  C CE1   . PHE A  1 67 ? -29.038 18.556 -26.598 1.00 24.84 ? 208 PHE A CE1   1 
ATOM   476  C CE2   . PHE A  1 67 ? -27.980 18.120 -28.739 1.00 24.63 ? 208 PHE A CE2   1 
ATOM   477  C CZ    . PHE A  1 67 ? -28.942 17.799 -27.756 1.00 24.95 ? 208 PHE A CZ    1 
ATOM   478  N N     . ARG A  1 68 ? -23.326 20.286 -27.765 1.00 31.46 ? 209 ARG A N     1 
ATOM   479  C CA    . ARG A  1 68 ? -22.405 19.448 -28.543 1.00 33.44 ? 209 ARG A CA    1 
ATOM   480  C C     . ARG A  1 68 ? -21.442 18.637 -27.670 1.00 33.83 ? 209 ARG A C     1 
ATOM   481  O O     . ARG A  1 68 ? -21.210 17.457 -27.934 1.00 34.79 ? 209 ARG A O     1 
ATOM   482  C CB    A ARG A  1 68 ? -21.667 20.299 -29.580 0.50 35.02 ? 209 ARG A CB    1 
ATOM   483  C CB    B ARG A  1 68 ? -21.534 20.301 -29.498 0.50 36.41 ? 209 ARG A CB    1 
ATOM   484  C CG    A ARG A  1 68 ? -22.613 20.945 -30.611 0.50 35.59 ? 209 ARG A CG    1 
ATOM   485  C CG    B ARG A  1 68 ? -22.059 20.492 -30.915 0.50 38.15 ? 209 ARG A CG    1 
ATOM   486  C CD    A ARG A  1 68 ? -22.045 20.897 -32.035 0.50 36.04 ? 209 ARG A CD    1 
ATOM   487  C CD    B ARG A  1 68 ? -20.892 20.625 -31.909 0.50 39.73 ? 209 ARG A CD    1 
ATOM   488  N NE    A ARG A  1 68 ? -21.622 19.552 -32.384 0.50 35.29 ? 209 ARG A NE    1 
ATOM   489  N NE    B ARG A  1 68 ? -20.539 19.320 -32.450 0.50 40.89 ? 209 ARG A NE    1 
ATOM   490  C CZ    A ARG A  1 68 ? -22.244 18.740 -33.243 0.50 32.90 ? 209 ARG A CZ    1 
ATOM   491  C CZ    B ARG A  1 68 ? -19.450 18.619 -32.136 0.50 41.05 ? 209 ARG A CZ    1 
ATOM   492  N NH1   A ARG A  1 68 ? -21.756 17.543 -33.460 0.50 31.80 ? 209 ARG A NH1   1 
ATOM   493  N NH1   B ARG A  1 68 ? -18.549 19.109 -31.301 0.50 42.26 ? 209 ARG A NH1   1 
ATOM   494  N NH2   A ARG A  1 68 ? -23.335 19.116 -33.875 0.50 31.95 ? 209 ARG A NH2   1 
ATOM   495  N NH2   B ARG A  1 68 ? -19.265 17.419 -32.685 0.50 39.55 ? 209 ARG A NH2   1 
ATOM   496  N N     . THR A  1 69 ? -20.857 19.293 -26.674 1.00 34.80 ? 210 THR A N     1 
ATOM   497  C CA    . THR A  1 69 ? -19.808 18.697 -25.837 1.00 36.27 ? 210 THR A CA    1 
ATOM   498  C C     . THR A  1 69 ? -20.315 18.140 -24.519 1.00 36.56 ? 210 THR A C     1 
ATOM   499  O O     . THR A  1 69 ? -19.632 17.327 -23.880 1.00 40.11 ? 210 THR A O     1 
ATOM   500  C CB    . THR A  1 69 ? -18.755 19.744 -25.461 1.00 38.80 ? 210 THR A CB    1 
ATOM   501  O OG1   . THR A  1 69 ? -19.397 20.819 -24.769 1.00 37.57 ? 210 THR A OG1   1 
ATOM   502  C CG2   . THR A  1 69 ? -18.016 20.265 -26.721 1.00 39.26 ? 210 THR A CG2   1 
ATOM   503  N N     . GLY A  1 70 ? -21.474 18.608 -24.084 1.00 34.00 ? 211 GLY A N     1 
ATOM   504  C CA    . GLY A  1 70 ? -22.043 18.179 -22.831 1.00 33.62 ? 211 GLY A CA    1 
ATOM   505  C C     . GLY A  1 70 ? -21.412 18.890 -21.626 1.00 35.48 ? 211 GLY A C     1 
ATOM   506  O O     . GLY A  1 70 ? -21.523 18.410 -20.508 1.00 34.80 ? 211 GLY A O     1 
ATOM   507  N N     . LYS A  1 71 ? -20.783 20.043 -21.884 1.00 36.93 ? 212 LYS A N     1 
ATOM   508  C CA    . LYS A  1 71 ? -20.002 20.783 -20.934 1.00 39.58 ? 212 LYS A CA    1 
ATOM   509  C C     . LYS A  1 71 ? -20.663 22.136 -20.663 1.00 41.95 ? 212 LYS A C     1 
ATOM   510  O O     . LYS A  1 71 ? -21.127 22.798 -21.589 1.00 39.84 ? 212 LYS A O     1 
ATOM   511  C CB    . LYS A  1 71 ? -18.591 21.020 -21.491 1.00 40.74 ? 212 LYS A CB    1 
ATOM   512  C CG    . LYS A  1 71 ? -17.689 19.824 -21.349 1.00 41.20 ? 212 LYS A CG    1 
ATOM   513  C CD    . LYS A  1 71 ? -16.299 20.119 -21.893 1.00 43.42 ? 212 LYS A CD    1 
ATOM   514  N N     . MET A  1 72 ? -20.713 22.520 -19.385 1.00 45.61 ? 213 MET A N     1 
ATOM   515  C CA    . MET A  1 72 ? -21.018 23.878 -18.984 1.00 50.32 ? 213 MET A CA    1 
ATOM   516  C C     . MET A  1 72 ? -19.842 24.788 -19.361 1.00 55.29 ? 213 MET A C     1 
ATOM   517  O O     . MET A  1 72 ? -18.679 24.440 -19.116 1.00 57.75 ? 213 MET A O     1 
ATOM   518  C CB    . MET A  1 72 ? -21.248 23.949 -17.466 1.00 52.25 ? 213 MET A CB    1 
ATOM   519  C CG    . MET A  1 72 ? -22.495 23.220 -16.996 1.00 49.27 ? 213 MET A CG    1 
ATOM   520  S SD    . MET A  1 72 ? -24.023 23.972 -17.630 1.00 47.82 ? 213 MET A SD    1 
ATOM   521  C CE    . MET A  1 72 ? -25.240 22.981 -16.755 1.00 45.63 ? 213 MET A CE    1 
ATOM   522  N N     . MET A  1 73 ? -20.149 25.945 -19.945 1.00 58.58 ? 214 MET A N     1 
ATOM   523  C CA    . MET A  1 73 ? -19.134 26.856 -20.473 1.00 63.57 ? 214 MET A CA    1 
ATOM   524  C C     . MET A  1 73 ? -19.035 28.140 -19.648 1.00 67.00 ? 214 MET A C     1 
ATOM   525  O O     . MET A  1 73 ? -19.769 28.327 -18.688 1.00 67.50 ? 214 MET A O     1 
ATOM   526  C CB    . MET A  1 73 ? -19.460 27.194 -21.923 1.00 64.25 ? 214 MET A CB    1 
ATOM   527  C CG    . MET A  1 73 ? -19.426 26.006 -22.872 1.00 63.04 ? 214 MET A CG    1 
ATOM   528  S SD    . MET A  1 73 ? -17.786 25.266 -23.105 1.00 69.52 ? 214 MET A SD    1 
ATOM   529  C CE    . MET A  1 73 ? -18.036 24.298 -24.607 1.00 64.87 ? 214 MET A CE    1 
ATOM   530  N N     . LYS B  1 7  ? -57.977 4.826  -53.214 1.00 70.44 ? 148 LYS B N     1 
ATOM   531  C CA    . LYS B  1 7  ? -57.599 6.080  -53.936 1.00 69.13 ? 148 LYS B CA    1 
ATOM   532  C C     . LYS B  1 7  ? -56.310 5.865  -54.739 1.00 66.71 ? 148 LYS B C     1 
ATOM   533  O O     . LYS B  1 7  ? -55.352 6.628  -54.622 1.00 64.22 ? 148 LYS B O     1 
ATOM   534  C CB    . LYS B  1 7  ? -57.458 7.264  -52.952 1.00 66.77 ? 148 LYS B CB    1 
ATOM   535  N N     . ARG B  1 8  ? -56.308 4.807  -55.556 1.00 68.04 ? 149 ARG B N     1 
ATOM   536  C CA    . ARG B  1 8  ? -55.232 4.552  -56.520 1.00 65.62 ? 149 ARG B CA    1 
ATOM   537  C C     . ARG B  1 8  ? -55.538 5.372  -57.772 1.00 67.02 ? 149 ARG B C     1 
ATOM   538  O O     . ARG B  1 8  ? -56.300 4.942  -58.643 1.00 71.91 ? 149 ARG B O     1 
ATOM   539  C CB    . ARG B  1 8  ? -55.139 3.061  -56.821 1.00 68.07 ? 149 ARG B CB    1 
ATOM   540  C CG    . ARG B  1 8  ? -53.855 2.651  -57.520 1.00 68.94 ? 149 ARG B CG    1 
ATOM   541  C CD    . ARG B  1 8  ? -53.491 1.193  -57.269 1.00 69.73 ? 149 ARG B CD    1 
ATOM   542  N NE    . ARG B  1 8  ? -53.448 0.884  -55.837 1.00 67.87 ? 149 ARG B NE    1 
ATOM   543  C CZ    . ARG B  1 8  ? -53.086 -0.291 -55.314 1.00 67.59 ? 149 ARG B CZ    1 
ATOM   544  N NH1   . ARG B  1 8  ? -52.664 -1.302 -56.092 1.00 68.38 ? 149 ARG B NH1   1 
ATOM   545  N NH2   . ARG B  1 8  ? -53.114 -0.442 -53.978 1.00 64.88 ? 149 ARG B NH2   1 
ATOM   546  N N     . MET B  1 9  ? -54.973 6.575  -57.823 1.00 63.65 ? 150 MET B N     1 
ATOM   547  C CA    . MET B  1 9  ? -55.256 7.549  -58.875 1.00 66.45 ? 150 MET B CA    1 
ATOM   548  C C     . MET B  1 9  ? -54.086 7.622  -59.841 1.00 65.89 ? 150 MET B C     1 
ATOM   549  O O     . MET B  1 9  ? -52.933 7.422  -59.445 1.00 62.59 ? 150 MET B O     1 
ATOM   550  C CB    . MET B  1 9  ? -55.488 8.928  -58.264 1.00 65.63 ? 150 MET B CB    1 
ATOM   551  N N     . ASP B  1 10 ? -54.385 7.916  -61.104 1.00 69.20 ? 151 ASP B N     1 
ATOM   552  C CA    . ASP B  1 10 ? -53.363 8.038  -62.147 1.00 68.68 ? 151 ASP B CA    1 
ATOM   553  C C     . ASP B  1 10 ? -52.417 9.180  -61.787 1.00 65.49 ? 151 ASP B C     1 
ATOM   554  O O     . ASP B  1 10 ? -52.865 10.239 -61.304 1.00 65.23 ? 151 ASP B O     1 
ATOM   555  C CB    . ASP B  1 10 ? -54.003 8.297  -63.534 1.00 74.09 ? 151 ASP B CB    1 
ATOM   556  N N     . CYS B  1 11 ? -51.115 8.938  -61.992 1.00 62.18 ? 152 CYS B N     1 
ATOM   557  C CA    . CYS B  1 11 ? -50.069 9.931  -61.771 1.00 59.50 ? 152 CYS B CA    1 
ATOM   558  C C     . CYS B  1 11 ? -49.537 10.401 -63.130 1.00 62.44 ? 152 CYS B C     1 
ATOM   559  O O     . CYS B  1 11 ? -48.626 9.775  -63.700 1.00 62.23 ? 152 CYS B O     1 
ATOM   560  C CB    . CYS B  1 11 ? -48.940 9.322  -60.926 1.00 54.79 ? 152 CYS B CB    1 
ATOM   561  S SG    . CYS B  1 11 ? -47.582 10.455 -60.579 1.00 52.01 ? 152 CYS B SG    1 
ATOM   562  N N     . PRO B  1 12 ? -50.105 11.506 -63.660 1.00 65.38 ? 153 PRO B N     1 
ATOM   563  C CA    . PRO B  1 12 ? -49.753 12.092 -64.976 1.00 68.54 ? 153 PRO B CA    1 
ATOM   564  C C     . PRO B  1 12 ? -48.262 12.497 -65.145 1.00 66.96 ? 153 PRO B C     1 
ATOM   565  O O     . PRO B  1 12 ? -47.790 12.608 -66.277 1.00 68.12 ? 153 PRO B O     1 
ATOM   566  C CB    . PRO B  1 12 ? -50.650 13.320 -65.057 1.00 71.58 ? 153 PRO B CB    1 
ATOM   567  N N     . ALA B  1 13 ? -47.545 12.717 -64.030 1.00 63.05 ? 154 ALA B N     1 
ATOM   568  C CA    . ALA B  1 13 ? -46.097 13.054 -64.063 1.00 61.21 ? 154 ALA B CA    1 
ATOM   569  C C     . ALA B  1 13 ? -45.148 11.869 -64.398 1.00 59.16 ? 154 ALA B C     1 
ATOM   570  O O     . ALA B  1 13 ? -43.979 12.087 -64.742 1.00 56.99 ? 154 ALA B O     1 
ATOM   571  C CB    . ALA B  1 13 ? -45.686 13.669 -62.737 1.00 59.08 ? 154 ALA B CB    1 
ATOM   572  N N     . LEU B  1 14 ? -45.635 10.636 -64.238 1.00 58.94 ? 155 LEU B N     1 
ATOM   573  C CA    . LEU B  1 14 ? -44.875 9.433  -64.592 1.00 58.55 ? 155 LEU B CA    1 
ATOM   574  C C     . LEU B  1 14 ? -45.494 8.863  -65.878 1.00 62.67 ? 155 LEU B C     1 
ATOM   575  O O     . LEU B  1 14 ? -46.569 9.321  -66.296 1.00 65.53 ? 155 LEU B O     1 
ATOM   576  C CB    . LEU B  1 14 ? -44.922 8.410  -63.445 1.00 55.94 ? 155 LEU B CB    1 
ATOM   577  C CG    . LEU B  1 14 ? -44.269 8.825  -62.089 1.00 52.55 ? 155 LEU B CG    1 
ATOM   578  C CD1   . LEU B  1 14 ? -44.543 7.786  -61.009 1.00 50.25 ? 155 LEU B CD1   1 
ATOM   579  C CD2   . LEU B  1 14 ? -42.765 9.069  -62.203 1.00 50.99 ? 155 LEU B CD2   1 
ATOM   580  N N     . PRO B  1 15 ? -44.818 7.884  -66.526 1.00 63.31 ? 156 PRO B N     1 
ATOM   581  C CA    . PRO B  1 15 ? -45.392 7.211  -67.711 1.00 67.02 ? 156 PRO B CA    1 
ATOM   582  C C     . PRO B  1 15 ? -46.796 6.605  -67.493 1.00 68.41 ? 156 PRO B C     1 
ATOM   583  O O     . PRO B  1 15 ? -47.156 6.296  -66.371 1.00 65.30 ? 156 PRO B O     1 
ATOM   584  C CB    . PRO B  1 15 ? -44.364 6.117  -68.006 1.00 67.11 ? 156 PRO B CB    1 
ATOM   585  C CG    . PRO B  1 15 ? -43.069 6.724  -67.579 1.00 64.19 ? 156 PRO B CG    1 
ATOM   586  C CD    . PRO B  1 15 ? -43.396 7.515  -66.335 1.00 61.44 ? 156 PRO B CD    1 
ATOM   587  N N     . PRO B  1 16 ? -47.588 6.455  -68.578 1.00 72.18 ? 157 PRO B N     1 
ATOM   588  C CA    . PRO B  1 16 ? -48.936 5.855  -68.536 1.00 74.49 ? 157 PRO B CA    1 
ATOM   589  C C     . PRO B  1 16 ? -48.994 4.560  -67.703 1.00 72.35 ? 157 PRO B C     1 
ATOM   590  O O     . PRO B  1 16 ? -48.019 3.802  -67.647 1.00 70.48 ? 157 PRO B O     1 
ATOM   591  N N     . GLY B  1 17 ? -50.120 4.339  -67.035 1.00 73.01 ? 158 GLY B N     1 
ATOM   592  C CA    . GLY B  1 17 ? -50.294 3.178  -66.140 1.00 71.36 ? 158 GLY B CA    1 
ATOM   593  C C     . GLY B  1 17 ? -49.770 3.331  -64.714 1.00 66.31 ? 158 GLY B C     1 
ATOM   594  O O     . GLY B  1 17 ? -50.068 2.490  -63.862 1.00 66.29 ? 158 GLY B O     1 
ATOM   595  N N     . TRP B  1 18 ? -48.992 4.380  -64.436 1.00 62.35 ? 159 TRP B N     1 
ATOM   596  C CA    . TRP B  1 18 ? -48.416 4.563  -63.087 1.00 57.85 ? 159 TRP B CA    1 
ATOM   597  C C     . TRP B  1 18 ? -49.461 5.212  -62.164 1.00 56.83 ? 159 TRP B C     1 
ATOM   598  O O     . TRP B  1 18 ? -50.090 6.224  -62.537 1.00 58.28 ? 159 TRP B O     1 
ATOM   599  C CB    . TRP B  1 18 ? -47.117 5.400  -63.125 1.00 54.86 ? 159 TRP B CB    1 
ATOM   600  C CG    . TRP B  1 18 ? -45.878 4.591  -63.440 1.00 54.68 ? 159 TRP B CG    1 
ATOM   601  C CD1   . TRP B  1 18 ? -45.317 4.373  -64.672 1.00 57.16 ? 159 TRP B CD1   1 
ATOM   602  C CD2   . TRP B  1 18 ? -45.046 3.896  -62.500 1.00 52.41 ? 159 TRP B CD2   1 
ATOM   603  N NE1   . TRP B  1 18 ? -44.200 3.593  -64.555 1.00 56.12 ? 159 TRP B NE1   1 
ATOM   604  C CE2   . TRP B  1 18 ? -44.001 3.287  -63.237 1.00 53.50 ? 159 TRP B CE2   1 
ATOM   605  C CE3   . TRP B  1 18 ? -45.073 3.732  -61.104 1.00 49.48 ? 159 TRP B CE3   1 
ATOM   606  C CZ2   . TRP B  1 18 ? -42.988 2.515  -62.620 1.00 51.96 ? 159 TRP B CZ2   1 
ATOM   607  C CZ3   . TRP B  1 18 ? -44.067 2.954  -60.489 1.00 47.89 ? 159 TRP B CZ3   1 
ATOM   608  C CH2   . TRP B  1 18 ? -43.043 2.365  -61.247 1.00 49.41 ? 159 TRP B CH2   1 
ATOM   609  N N     . LYS B  1 19 ? -49.652 4.628  -60.975 1.00 54.24 ? 160 LYS B N     1 
ATOM   610  C CA    . LYS B  1 19 ? -50.661 5.111  -60.029 1.00 53.07 ? 160 LYS B CA    1 
ATOM   611  C C     . LYS B  1 19 ? -50.024 5.558  -58.731 1.00 48.77 ? 160 LYS B C     1 
ATOM   612  O O     . LYS B  1 19 ? -48.880 5.180  -58.424 1.00 45.81 ? 160 LYS B O     1 
ATOM   613  C CB    . LYS B  1 19 ? -51.712 4.035  -59.772 1.00 55.40 ? 160 LYS B CB    1 
ATOM   614  C CG    . LYS B  1 19 ? -52.477 3.601  -61.038 1.00 60.38 ? 160 LYS B CG    1 
ATOM   615  N N     . LYS B  1 20 ? -50.777 6.370  -57.980 1.00 48.26 ? 161 LYS B N     1 
ATOM   616  C CA    . LYS B  1 20 ? -50.352 6.909  -56.672 1.00 45.35 ? 161 LYS B CA    1 
ATOM   617  C C     . LYS B  1 20 ? -51.422 6.625  -55.612 1.00 44.67 ? 161 LYS B C     1 
ATOM   618  O O     . LYS B  1 20 ? -52.614 6.768  -55.867 1.00 45.95 ? 161 LYS B O     1 
ATOM   619  C CB    . LYS B  1 20 ? -50.119 8.421  -56.774 1.00 45.01 ? 161 LYS B CB    1 
ATOM   620  C CG    . LYS B  1 20 ? -49.566 9.069  -55.509 1.00 42.45 ? 161 LYS B CG    1 
ATOM   621  C CD    . LYS B  1 20 ? -49.384 10.574 -55.695 1.00 43.32 ? 161 LYS B CD    1 
ATOM   622  C CE    . LYS B  1 20 ? -48.376 11.123 -54.699 1.00 40.98 ? 161 LYS B CE    1 
ATOM   623  N N     . GLU B  1 21 ? -50.984 6.225  -54.426 1.00 41.55 ? 162 GLU B N     1 
ATOM   624  C CA    . GLU B  1 21 ? -51.886 6.063  -53.310 1.00 41.31 ? 162 GLU B CA    1 
ATOM   625  C C     . GLU B  1 21 ? -51.303 6.761  -52.078 1.00 37.05 ? 162 GLU B C     1 
ATOM   626  O O     . GLU B  1 21 ? -50.091 6.649  -51.804 1.00 33.73 ? 162 GLU B O     1 
ATOM   627  C CB    . GLU B  1 21 ? -52.117 4.591  -53.036 1.00 43.80 ? 162 GLU B CB    1 
ATOM   628  C CG    . GLU B  1 21 ? -53.157 4.301  -51.948 1.00 45.14 ? 162 GLU B CG    1 
ATOM   629  C CD    . GLU B  1 21 ? -53.443 2.821  -51.819 1.00 49.11 ? 162 GLU B CD    1 
ATOM   630  O OE1   . GLU B  1 21 ? -53.678 2.171  -52.855 1.00 56.40 ? 162 GLU B OE1   1 
ATOM   631  O OE2   . GLU B  1 21 ? -53.423 2.292  -50.689 1.00 53.05 ? 162 GLU B OE2   1 
ATOM   632  N N     . GLU B  1 22 ? -52.169 7.478  -51.352 1.00 36.16 ? 163 GLU B N     1 
ATOM   633  C CA    . GLU B  1 22 ? -51.821 8.120  -50.076 1.00 33.45 ? 163 GLU B CA    1 
ATOM   634  C C     . GLU B  1 22 ? -52.687 7.482  -49.035 1.00 32.62 ? 163 GLU B C     1 
ATOM   635  O O     . GLU B  1 22 ? -53.904 7.395  -49.228 1.00 33.46 ? 163 GLU B O     1 
ATOM   636  C CB    . GLU B  1 22 ? -52.062 9.613  -50.115 1.00 34.64 ? 163 GLU B CB    1 
ATOM   637  C CG    . GLU B  1 22 ? -51.694 10.297 -48.796 1.00 34.93 ? 163 GLU B CG    1 
ATOM   638  C CD    . GLU B  1 22 ? -51.363 11.774 -48.924 1.00 36.79 ? 163 GLU B CD    1 
ATOM   639  O OE1   . GLU B  1 22 ? -50.798 12.344 -47.966 1.00 38.55 ? 163 GLU B OE1   1 
ATOM   640  O OE2   . GLU B  1 22 ? -51.672 12.386 -49.952 1.00 41.14 ? 163 GLU B OE2   1 
ATOM   641  N N     . VAL B  1 23 ? -52.059 7.043  -47.940 1.00 29.45 ? 164 VAL B N     1 
ATOM   642  C CA    . VAL B  1 23 ? -52.731 6.292  -46.877 1.00 29.73 ? 164 VAL B CA    1 
ATOM   643  C C     . VAL B  1 23 ? -52.444 6.909  -45.501 1.00 26.35 ? 164 VAL B C     1 
ATOM   644  O O     . VAL B  1 23 ? -51.315 6.989  -45.101 1.00 24.83 ? 164 VAL B O     1 
ATOM   645  C CB    . VAL B  1 23 ? -52.300 4.806  -46.876 1.00 30.16 ? 164 VAL B CB    1 
ATOM   646  C CG1   . VAL B  1 23 ? -52.905 4.049  -45.679 1.00 30.61 ? 164 VAL B CG1   1 
ATOM   647  C CG2   . VAL B  1 23 ? -52.728 4.134  -48.170 1.00 32.21 ? 164 VAL B CG2   1 
ATOM   648  N N     . ILE B  1 24 ? -53.496 7.303  -44.788 1.00 26.46 ? 165 ILE B N     1 
ATOM   649  C CA    . ILE B  1 24 ? -53.369 8.021  -43.504 1.00 25.12 ? 165 ILE B CA    1 
ATOM   650  C C     . ILE B  1 24 ? -53.039 7.044  -42.425 1.00 24.65 ? 165 ILE B C     1 
ATOM   651  O O     . ILE B  1 24 ? -53.532 5.931  -42.459 1.00 25.63 ? 165 ILE B O     1 
ATOM   652  C CB    . ILE B  1 24 ? -54.652 8.766  -43.135 1.00 26.28 ? 165 ILE B CB    1 
ATOM   653  C CG1   . ILE B  1 24 ? -55.004 9.765  -44.240 1.00 28.18 ? 165 ILE B CG1   1 
ATOM   654  C CG2   . ILE B  1 24 ? -54.527 9.468  -41.750 1.00 25.84 ? 165 ILE B CG2   1 
ATOM   655  C CD1   . ILE B  1 24 ? -53.881 10.691 -44.696 1.00 27.23 ? 165 ILE B CD1   1 
ATOM   656  N N     . ARG B  1 25 ? -52.085 7.433  -41.554 1.00 24.09 ? 166 ARG B N     1 
ATOM   657  C CA    . ARG B  1 25 ? -51.669 6.675  -40.390 1.00 22.93 ? 166 ARG B CA    1 
ATOM   658  C C     . ARG B  1 25 ? -52.756 6.936  -39.346 1.00 23.46 ? 166 ARG B C     1 
ATOM   659  O O     . ARG B  1 25 ? -53.047 8.093  -39.042 1.00 22.21 ? 166 ARG B O     1 
ATOM   660  C CB    . ARG B  1 25 ? -50.298 7.151  -39.897 1.00 21.73 ? 166 ARG B CB    1 
ATOM   661  C CG    . ARG B  1 25 ? -49.117 6.718  -40.817 1.00 21.96 ? 166 ARG B CG    1 
ATOM   662  C CD    . ARG B  1 25 ? -47.769 7.407  -40.491 1.00 20.79 ? 166 ARG B CD    1 
ATOM   663  N NE    . ARG B  1 25 ? -46.668 6.852  -41.294 1.00 19.67 ? 166 ARG B NE    1 
ATOM   664  C CZ    . ARG B  1 25 ? -45.546 6.314  -40.828 1.00 20.32 ? 166 ARG B CZ    1 
ATOM   665  N NH1   . ARG B  1 25 ? -45.232 6.300  -39.502 1.00 20.10 ? 166 ARG B NH1   1 
ATOM   666  N NH2   . ARG B  1 25 ? -44.659 5.828  -41.699 1.00 20.98 ? 166 ARG B NH2   1 
ATOM   667  N N     . LYS B  1 26 ? -53.342 5.863  -38.806 1.00 24.16 ? 167 LYS B N     1 
ATOM   668  C CA    A LYS B  1 26 ? -54.575 5.962  -37.992 0.50 25.38 ? 167 LYS B CA    1 
ATOM   669  C CA    B LYS B  1 26 ? -54.564 5.977  -38.005 0.50 25.65 ? 167 LYS B CA    1 
ATOM   670  C C     . LYS B  1 26 ? -54.304 6.170  -36.507 1.00 25.02 ? 167 LYS B C     1 
ATOM   671  O O     . LYS B  1 26 ? -55.182 6.582  -35.783 1.00 25.61 ? 167 LYS B O     1 
ATOM   672  C CB    A LYS B  1 26 ? -55.539 4.751  -38.221 0.50 27.24 ? 167 LYS B CB    1 
ATOM   673  C CB    B LYS B  1 26 ? -55.470 4.769  -38.275 0.50 27.83 ? 167 LYS B CB    1 
ATOM   674  C CG    A LYS B  1 26 ? -54.962 3.347  -38.002 0.50 27.39 ? 167 LYS B CG    1 
ATOM   675  C CG    B LYS B  1 26 ? -55.828 4.632  -39.760 0.50 29.32 ? 167 LYS B CG    1 
ATOM   676  C CD    A LYS B  1 26 ? -56.051 2.259  -37.922 0.50 29.93 ? 167 LYS B CD    1 
ATOM   677  C CD    B LYS B  1 26 ? -56.654 3.392  -40.051 0.50 32.11 ? 167 LYS B CD    1 
ATOM   678  C CE    A LYS B  1 26 ? -56.251 1.538  -39.253 0.50 31.65 ? 167 LYS B CE    1 
ATOM   679  C CE    B LYS B  1 26 ? -55.842 2.117  -39.885 0.50 32.25 ? 167 LYS B CE    1 
ATOM   680  N NZ    A LYS B  1 26 ? -56.945 0.212  -39.124 0.50 34.02 ? 167 LYS B NZ    1 
ATOM   681  N NZ    B LYS B  1 26 ? -56.577 0.963  -40.481 0.50 35.06 ? 167 LYS B NZ    1 
ATOM   682  N N     . SER B  1 27 ? -53.088 5.902  -36.051 1.00 24.57 ? 168 SER B N     1 
ATOM   683  C CA    . SER B  1 27 ? -52.794 5.943  -34.605 1.00 24.98 ? 168 SER B CA    1 
ATOM   684  C C     . SER B  1 27 ? -51.296 6.158  -34.328 1.00 24.55 ? 168 SER B C     1 
ATOM   685  O O     . SER B  1 27 ? -50.463 6.227  -35.262 1.00 24.23 ? 168 SER B O     1 
ATOM   686  C CB    . SER B  1 27 ? -53.275 4.642  -33.967 1.00 26.17 ? 168 SER B CB    1 
ATOM   687  O OG    . SER B  1 27 ? -52.559 3.530  -34.444 1.00 27.06 ? 168 SER B OG    1 
ATOM   688  N N     . GLY B  1 28 ? -50.965 6.238  -33.058 1.00 24.15 ? 169 GLY B N     1 
ATOM   689  C CA    . GLY B  1 28 ? -49.596 6.408  -32.572 1.00 22.66 ? 169 GLY B CA    1 
ATOM   690  C C     . GLY B  1 28 ? -49.073 7.830  -32.615 1.00 22.51 ? 169 GLY B C     1 
ATOM   691  O O     . GLY B  1 28 ? -49.838 8.817  -32.856 1.00 22.83 ? 169 GLY B O     1 
ATOM   692  N N     . LEU B  1 29 ? -47.758 7.947  -32.363 1.00 23.76 ? 170 LEU B N     1 
ATOM   693  C CA    . LEU B  1 29 ? -47.038 9.222  -32.442 1.00 24.97 ? 170 LEU B CA    1 
ATOM   694  C C     . LEU B  1 29 ? -47.244 9.943  -33.791 1.00 24.49 ? 170 LEU B C     1 
ATOM   695  O O     . LEU B  1 29 ? -47.502 11.147 -33.827 1.00 24.32 ? 170 LEU B O     1 
ATOM   696  C CB    . LEU B  1 29 ? -45.546 9.000  -32.197 1.00 27.39 ? 170 LEU B CB    1 
ATOM   697  C CG    . LEU B  1 29 ? -45.151 8.429  -30.790 1.00 30.79 ? 170 LEU B CG    1 
ATOM   698  C CD1   . LEU B  1 29 ? -43.645 8.222  -30.646 1.00 33.15 ? 170 LEU B CD1   1 
ATOM   699  C CD2   . LEU B  1 29 ? -45.689 9.307  -29.677 1.00 31.30 ? 170 LEU B CD2   1 
ATOM   700  N N     . SER B  1 30 ? -47.169 9.192  -34.891 1.00 23.90 ? 171 SER B N     1 
ATOM   701  C CA    . SER B  1 30 ? -47.367 9.776  -36.270 1.00 23.86 ? 171 SER B CA    1 
ATOM   702  C C     . SER B  1 30 ? -48.812 9.772  -36.795 1.00 23.91 ? 171 SER B C     1 
ATOM   703  O O     . SER B  1 30 ? -49.039 9.953  -38.030 1.00 25.39 ? 171 SER B O     1 
ATOM   704  C CB    . SER B  1 30 ? -46.445 9.048  -37.253 1.00 23.14 ? 171 SER B CB    1 
ATOM   705  O OG    . SER B  1 30 ? -46.693 7.636  -37.299 1.00 21.55 ? 171 SER B OG    1 
ATOM   706  N N     . ALA B  1 31 ? -49.801 9.588  -35.901 1.00 22.32 ? 172 ALA B N     1 
ATOM   707  C CA    . ALA B  1 31 ? -51.226 9.652  -36.298 1.00 23.56 ? 172 ALA B CA    1 
ATOM   708  C C     . ALA B  1 31 ? -51.579 10.850 -37.214 1.00 23.25 ? 172 ALA B C     1 
ATOM   709  O O     . ALA B  1 31 ? -51.196 11.957 -36.949 1.00 22.11 ? 172 ALA B O     1 
ATOM   710  C CB    . ALA B  1 31 ? -52.138 9.723  -35.032 1.00 24.19 ? 172 ALA B CB    1 
ATOM   711  N N     . GLY B  1 32 ? -52.277 10.619 -38.308 1.00 23.55 ? 173 GLY B N     1 
ATOM   712  C CA    . GLY B  1 32 ? -52.650 11.768 -39.176 1.00 25.49 ? 173 GLY B CA    1 
ATOM   713  C C     . GLY B  1 32 ? -51.628 12.184 -40.250 1.00 25.13 ? 173 GLY B C     1 
ATOM   714  O O     . GLY B  1 32 ? -52.008 12.794 -41.266 1.00 25.88 ? 173 GLY B O     1 
ATOM   715  N N     . LYS B  1 33 ? -50.364 11.843 -40.058 1.00 23.55 ? 174 LYS B N     1 
ATOM   716  C CA    . LYS B  1 33 ? -49.379 11.862 -41.178 1.00 23.46 ? 174 LYS B CA    1 
ATOM   717  C C     . LYS B  1 33 ? -49.746 10.726 -42.108 1.00 23.20 ? 174 LYS B C     1 
ATOM   718  O O     . LYS B  1 33 ? -50.583 9.876  -41.745 1.00 24.06 ? 174 LYS B O     1 
ATOM   719  C CB    . LYS B  1 33 ? -47.942 11.661 -40.657 1.00 23.31 ? 174 LYS B CB    1 
ATOM   720  C CG    . LYS B  1 33 ? -47.496 12.706 -39.618 1.00 24.29 ? 174 LYS B CG    1 
ATOM   721  C CD    . LYS B  1 33 ? -47.557 14.121 -40.179 1.00 25.68 ? 174 LYS B CD    1 
ATOM   722  C CE    . LYS B  1 33 ? -46.987 15.127 -39.188 1.00 27.32 ? 174 LYS B CE    1 
ATOM   723  N NZ    . LYS B  1 33 ? -47.028 16.497 -39.723 1.00 29.80 ? 174 LYS B NZ    1 
ATOM   724  N N     . SER B  1 34 ? -49.176 10.719 -43.321 1.00 22.36 ? 175 SER B N     1 
ATOM   725  C CA    . SER B  1 34 ? -49.451 9.654  -44.312 1.00 22.88 ? 175 SER B CA    1 
ATOM   726  C C     . SER B  1 34 ? -48.211 9.045  -44.980 1.00 23.07 ? 175 SER B C     1 
ATOM   727  O O     . SER B  1 34 ? -47.091 9.634  -44.972 1.00 21.02 ? 175 SER B O     1 
ATOM   728  C CB    . SER B  1 34 ? -50.352 10.203 -45.428 1.00 24.22 ? 175 SER B CB    1 
ATOM   729  O OG    . SER B  1 34 ? -49.719 11.263 -46.057 1.00 24.95 ? 175 SER B OG    1 
ATOM   730  N N     . ASP B  1 35 ? -48.443 7.867  -45.573 1.00 23.55 ? 176 ASP B N     1 
ATOM   731  C CA    . ASP B  1 35 ? -47.492 7.188  -46.423 1.00 24.26 ? 176 ASP B CA    1 
ATOM   732  C C     . ASP B  1 35 ? -47.985 7.245  -47.882 1.00 26.78 ? 176 ASP B C     1 
ATOM   733  O O     . ASP B  1 35 ? -49.199 7.098  -48.166 1.00 25.62 ? 176 ASP B O     1 
ATOM   734  C CB    . ASP B  1 35 ? -47.351 5.751  -45.997 1.00 24.79 ? 176 ASP B CB    1 
ATOM   735  C CG    . ASP B  1 35 ? -46.757 5.631  -44.593 1.00 25.08 ? 176 ASP B CG    1 
ATOM   736  O OD1   . ASP B  1 35 ? -45.503 5.760  -44.444 1.00 23.49 ? 176 ASP B OD1   1 
ATOM   737  O OD2   . ASP B  1 35 ? -47.549 5.439  -43.662 1.00 22.77 ? 176 ASP B OD2   1 
ATOM   738  N N     . VAL B  1 36 ? -47.031 7.458  -48.781 1.00 26.81 ? 177 VAL B N     1 
ATOM   739  C CA    . VAL B  1 36 ? -47.297 7.611  -50.212 1.00 28.63 ? 177 VAL B CA    1 
ATOM   740  C C     . VAL B  1 36 ? -46.657 6.410  -50.905 1.00 29.64 ? 177 VAL B C     1 
ATOM   741  O O     . VAL B  1 36 ? -45.504 6.027  -50.579 1.00 28.42 ? 177 VAL B O     1 
ATOM   742  C CB    . VAL B  1 36 ? -46.763 8.945  -50.704 1.00 29.17 ? 177 VAL B CB    1 
ATOM   743  C CG1   . VAL B  1 36 ? -46.860 9.068  -52.230 1.00 32.45 ? 177 VAL B CG1   1 
ATOM   744  C CG2   . VAL B  1 36 ? -47.547 10.063 -50.028 1.00 29.28 ? 177 VAL B CG2   1 
ATOM   745  N N     . TYR B  1 37 ? -47.434 5.770  -51.779 1.00 32.09 ? 178 TYR B N     1 
ATOM   746  C CA    . TYR B  1 37 ? -47.023 4.554  -52.486 1.00 34.24 ? 178 TYR B CA    1 
ATOM   747  C C     . TYR B  1 37 ? -47.217 4.758  -53.959 1.00 35.70 ? 178 TYR B C     1 
ATOM   748  O O     . TYR B  1 37 ? -48.139 5.463  -54.380 1.00 37.97 ? 178 TYR B O     1 
ATOM   749  C CB    . TYR B  1 37 ? -47.857 3.327  -52.066 1.00 37.02 ? 178 TYR B CB    1 
ATOM   750  C CG    . TYR B  1 37 ? -47.827 3.030  -50.609 1.00 35.90 ? 178 TYR B CG    1 
ATOM   751  C CD1   . TYR B  1 37 ? -46.654 2.686  -49.985 1.00 35.36 ? 178 TYR B CD1   1 
ATOM   752  C CD2   . TYR B  1 37 ? -48.994 3.104  -49.835 1.00 37.94 ? 178 TYR B CD2   1 
ATOM   753  C CE1   . TYR B  1 37 ? -46.619 2.434  -48.601 1.00 35.44 ? 178 TYR B CE1   1 
ATOM   754  C CE2   . TYR B  1 37 ? -48.977 2.857  -48.465 1.00 36.66 ? 178 TYR B CE2   1 
ATOM   755  C CZ    . TYR B  1 37 ? -47.792 2.517  -47.854 1.00 35.06 ? 178 TYR B CZ    1 
ATOM   756  O OH    . TYR B  1 37 ? -47.777 2.280  -46.509 1.00 34.10 ? 178 TYR B OH    1 
ATOM   757  N N     . TYR B  1 38 ? -46.355 4.143  -54.748 1.00 36.18 ? 179 TYR B N     1 
ATOM   758  C CA    . TYR B  1 38 ? -46.517 4.146  -56.198 1.00 37.92 ? 179 TYR B CA    1 
ATOM   759  C C     . TYR B  1 38 ? -46.676 2.761  -56.705 1.00 40.76 ? 179 TYR B C     1 
ATOM   760  O O     . TYR B  1 38 ? -46.145 1.819  -56.112 1.00 41.80 ? 179 TYR B O     1 
ATOM   761  C CB    . TYR B  1 38 ? -45.357 4.826  -56.862 1.00 36.75 ? 179 TYR B CB    1 
ATOM   762  C CG    . TYR B  1 38 ? -45.403 6.305  -56.689 1.00 35.46 ? 179 TYR B CG    1 
ATOM   763  C CD1   . TYR B  1 38 ? -46.166 7.108  -57.528 1.00 37.70 ? 179 TYR B CD1   1 
ATOM   764  C CD2   . TYR B  1 38 ? -44.702 6.911  -55.663 1.00 32.81 ? 179 TYR B CD2   1 
ATOM   765  C CE1   . TYR B  1 38 ? -46.214 8.492  -57.352 1.00 37.38 ? 179 TYR B CE1   1 
ATOM   766  C CE2   . TYR B  1 38 ? -44.726 8.274  -55.491 1.00 32.32 ? 179 TYR B CE2   1 
ATOM   767  C CZ    . TYR B  1 38 ? -45.487 9.058  -56.316 1.00 34.01 ? 179 TYR B CZ    1 
ATOM   768  O OH    . TYR B  1 38 ? -45.495 10.397 -56.116 1.00 34.54 ? 179 TYR B OH    1 
ATOM   769  N N     . PHE B  1 39 ? -47.421 2.636  -57.809 1.00 43.78 ? 180 PHE B N     1 
ATOM   770  C CA    . PHE B  1 39 ? -47.665 1.365  -58.444 1.00 47.70 ? 180 PHE B CA    1 
ATOM   771  C C     . PHE B  1 39 ? -47.307 1.424  -59.957 1.00 50.67 ? 180 PHE B C     1 
ATOM   772  O O     . PHE B  1 39 ? -47.849 2.258  -60.699 1.00 51.33 ? 180 PHE B O     1 
ATOM   773  C CB    . PHE B  1 39 ? -49.127 0.959  -58.217 1.00 49.96 ? 180 PHE B CB    1 
ATOM   774  C CG    . PHE B  1 39 ? -49.442 0.681  -56.788 1.00 47.89 ? 180 PHE B CG    1 
ATOM   775  C CD1   . PHE B  1 39 ? -49.183 -0.574 -56.235 1.00 48.40 ? 180 PHE B CD1   1 
ATOM   776  C CD2   . PHE B  1 39 ? -49.949 1.697  -55.952 1.00 46.42 ? 180 PHE B CD2   1 
ATOM   777  C CE1   . PHE B  1 39 ? -49.445 -0.829 -54.883 1.00 46.76 ? 180 PHE B CE1   1 
ATOM   778  C CE2   . PHE B  1 39 ? -50.222 1.443  -54.595 1.00 43.36 ? 180 PHE B CE2   1 
ATOM   779  C CZ    . PHE B  1 39 ? -49.968 0.177  -54.064 1.00 43.79 ? 180 PHE B CZ    1 
ATOM   780  N N     . SER B  1 40 ? -46.386 0.544  -60.392 1.00 51.93 ? 181 SER B N     1 
ATOM   781  C CA    . SER B  1 40 ? -46.048 0.399  -61.821 1.00 55.93 ? 181 SER B CA    1 
ATOM   782  C C     . SER B  1 40 ? -47.241 -0.237 -62.557 1.00 60.83 ? 181 SER B C     1 
ATOM   783  O O     . SER B  1 40 ? -48.249 -0.578 -61.925 1.00 61.82 ? 181 SER B O     1 
ATOM   784  C CB    . SER B  1 40 ? -44.751 -0.436 -62.006 1.00 55.91 ? 181 SER B CB    1 
ATOM   785  O OG    . SER B  1 40 ? -44.980 -1.827 -61.896 1.00 57.67 ? 181 SER B OG    1 
ATOM   786  N N     . PRO B  1 41 ? -47.148 -0.380 -63.894 1.00 65.64 ? 182 PRO B N     1 
ATOM   787  C CA    . PRO B  1 41 ? -48.247 -1.060 -64.605 1.00 70.50 ? 182 PRO B CA    1 
ATOM   788  C C     . PRO B  1 41 ? -48.467 -2.520 -64.158 1.00 72.88 ? 182 PRO B C     1 
ATOM   789  O O     . PRO B  1 41 ? -49.617 -2.939 -63.964 1.00 75.18 ? 182 PRO B O     1 
ATOM   790  C CB    . PRO B  1 41 ? -47.799 -0.989 -66.074 1.00 73.39 ? 182 PRO B CB    1 
ATOM   791  C CG    . PRO B  1 41 ? -46.869 0.185  -66.129 1.00 69.78 ? 182 PRO B CG    1 
ATOM   792  C CD    . PRO B  1 41 ? -46.134 0.143  -64.838 1.00 65.44 ? 182 PRO B CD    1 
ATOM   793  N N     . SER B  1 42 ? -47.369 -3.269 -63.996 1.00 72.82 ? 183 SER B N     1 
ATOM   794  C CA    . SER B  1 42 ? -47.418 -4.648 -63.479 1.00 75.29 ? 183 SER B CA    1 
ATOM   795  C C     . SER B  1 42 ? -48.094 -4.714 -62.105 1.00 73.78 ? 183 SER B C     1 
ATOM   796  O O     . SER B  1 42 ? -48.782 -5.683 -61.796 1.00 77.02 ? 183 SER B O     1 
ATOM   797  C CB    . SER B  1 42 ? -46.006 -5.240 -63.385 1.00 74.64 ? 183 SER B CB    1 
ATOM   798  N N     . GLY B  1 43 ? -47.896 -3.669 -61.296 1.00 68.92 ? 184 GLY B N     1 
ATOM   799  C CA    . GLY B  1 43 ? -48.446 -3.587 -59.949 1.00 66.42 ? 184 GLY B CA    1 
ATOM   800  C C     . GLY B  1 43 ? -47.400 -3.648 -58.842 1.00 62.31 ? 184 GLY B C     1 
ATOM   801  O O     . GLY B  1 43 ? -47.760 -3.828 -57.680 1.00 59.80 ? 184 GLY B O     1 
ATOM   802  N N     . LYS B  1 44 ? -46.111 -3.526 -59.192 1.00 61.22 ? 185 LYS B N     1 
ATOM   803  C CA    . LYS B  1 44 ? -45.037 -3.426 -58.190 1.00 58.19 ? 185 LYS B CA    1 
ATOM   804  C C     . LYS B  1 44 ? -45.267 -2.188 -57.314 1.00 53.87 ? 185 LYS B C     1 
ATOM   805  O O     . LYS B  1 44 ? -45.530 -1.101 -57.837 1.00 53.93 ? 185 LYS B O     1 
ATOM   806  C CB    . LYS B  1 44 ? -43.660 -3.323 -58.867 1.00 58.01 ? 185 LYS B CB    1 
ATOM   807  N N     . LYS B  1 45 ? -45.177 -2.373 -55.995 1.00 50.82 ? 186 LYS B N     1 
ATOM   808  C CA    . LYS B  1 45 ? -45.397 -1.299 -55.012 1.00 47.12 ? 186 LYS B CA    1 
ATOM   809  C C     . LYS B  1 45 ? -44.048 -0.663 -54.666 1.00 43.05 ? 186 LYS B C     1 
ATOM   810  O O     . LYS B  1 45 ? -43.066 -1.367 -54.390 1.00 41.93 ? 186 LYS B O     1 
ATOM   811  C CB    . LYS B  1 45 ? -46.061 -1.867 -53.748 1.00 48.01 ? 186 LYS B CB    1 
ATOM   812  C CG    . LYS B  1 45 ? -46.450 -0.848 -52.673 1.00 46.93 ? 186 LYS B CG    1 
ATOM   813  C CD    . LYS B  1 45 ? -47.082 -1.558 -51.465 1.00 47.32 ? 186 LYS B CD    1 
ATOM   814  C CE    . LYS B  1 45 ? -47.835 -0.601 -50.557 1.00 45.35 ? 186 LYS B CE    1 
ATOM   815  N N     . PHE B  1 46 ? -44.005 0.662  -54.679 1.00 39.65 ? 187 PHE B N     1 
ATOM   816  C CA    . PHE B  1 46 ? -42.787 1.404  -54.376 1.00 36.87 ? 187 PHE B CA    1 
ATOM   817  C C     . PHE B  1 46 ? -43.064 2.345  -53.241 1.00 32.86 ? 187 PHE B C     1 
ATOM   818  O O     . PHE B  1 46 ? -44.097 3.031  -53.248 1.00 32.26 ? 187 PHE B O     1 
ATOM   819  C CB    . PHE B  1 46 ? -42.315 2.143  -55.630 1.00 37.71 ? 187 PHE B CB    1 
ATOM   820  C CG    . PHE B  1 46 ? -41.810 1.224  -56.679 1.00 40.74 ? 187 PHE B CG    1 
ATOM   821  C CD1   . PHE B  1 46 ? -42.679 0.685  -57.623 1.00 44.16 ? 187 PHE B CD1   1 
ATOM   822  C CD2   . PHE B  1 46 ? -40.478 0.822  -56.679 1.00 41.20 ? 187 PHE B CD2   1 
ATOM   823  C CE1   . PHE B  1 46 ? -42.213 -0.208 -58.592 1.00 47.02 ? 187 PHE B CE1   1 
ATOM   824  C CE2   . PHE B  1 46 ? -40.001 -0.066 -57.623 1.00 44.31 ? 187 PHE B CE2   1 
ATOM   825  C CZ    . PHE B  1 46 ? -40.871 -0.585 -58.592 1.00 47.21 ? 187 PHE B CZ    1 
ATOM   826  N N     . ARG B  1 47 ? -42.146 2.381  -52.273 1.00 30.85 ? 188 ARG B N     1 
ATOM   827  C CA    . ARG B  1 47 ? -42.341 3.131  -51.017 1.00 29.36 ? 188 ARG B CA    1 
ATOM   828  C C     . ARG B  1 47 ? -41.374 4.328  -50.807 1.00 28.56 ? 188 ARG B C     1 
ATOM   829  O O     . ARG B  1 47 ? -41.508 5.084  -49.809 1.00 28.60 ? 188 ARG B O     1 
ATOM   830  C CB    . ARG B  1 47 ? -42.237 2.151  -49.847 1.00 29.09 ? 188 ARG B CB    1 
ATOM   831  C CG    . ARG B  1 47 ? -43.192 0.978  -50.000 1.00 30.43 ? 188 ARG B CG    1 
ATOM   832  C CD    . ARG B  1 47 ? -43.476 0.331  -48.674 1.00 30.19 ? 188 ARG B CD    1 
ATOM   833  N NE    . ARG B  1 47 ? -42.246 -0.208 -48.122 1.00 30.56 ? 188 ARG B NE    1 
ATOM   834  C CZ    . ARG B  1 47 ? -41.952 -0.328 -46.837 1.00 29.09 ? 188 ARG B CZ    1 
ATOM   835  N NH1   . ARG B  1 47 ? -42.797 0.064  -45.886 1.00 27.36 ? 188 ARG B NH1   1 
ATOM   836  N NH2   . ARG B  1 47 ? -40.778 -0.852 -46.509 1.00 30.44 ? 188 ARG B NH2   1 
ATOM   837  N N     . SER B  1 48 ? -40.434 4.521  -51.740 1.00 28.09 ? 189 SER B N     1 
ATOM   838  C CA    . SER B  1 48 ? -39.494 5.625  -51.654 1.00 27.96 ? 189 SER B CA    1 
ATOM   839  C C     . SER B  1 48 ? -39.018 6.092  -53.010 1.00 30.04 ? 189 SER B C     1 
ATOM   840  O O     . SER B  1 48 ? -39.172 5.362  -54.031 1.00 30.55 ? 189 SER B O     1 
ATOM   841  C CB    . SER B  1 48 ? -38.309 5.217  -50.831 1.00 28.37 ? 189 SER B CB    1 
ATOM   842  O OG    . SER B  1 48 ? -37.463 4.359  -51.549 1.00 29.10 ? 189 SER B OG    1 
ATOM   843  N N     . LYS B  1 49 ? -38.446 7.296  -53.033 1.00 29.01 ? 190 LYS B N     1 
ATOM   844  C CA    . LYS B  1 49 ? -37.943 7.866  -54.260 1.00 31.32 ? 190 LYS B CA    1 
ATOM   845  C C     . LYS B  1 49 ? -36.685 7.115  -54.708 1.00 32.07 ? 190 LYS B C     1 
ATOM   846  O O     . LYS B  1 49 ? -36.577 6.800  -55.869 1.00 32.27 ? 190 LYS B O     1 
ATOM   847  C CB    . LYS B  1 49 ? -37.675 9.372  -54.154 1.00 32.18 ? 190 LYS B CB    1 
ATOM   848  C CG    . LYS B  1 49 ? -37.413 10.002 -55.521 1.00 34.52 ? 190 LYS B CG    1 
ATOM   849  C CD    . LYS B  1 49 ? -37.050 11.461 -55.427 1.00 36.30 ? 190 LYS B CD    1 
ATOM   850  C CE    . LYS B  1 49 ? -36.928 12.049 -56.826 1.00 39.02 ? 190 LYS B CE    1 
ATOM   851  N NZ    . LYS B  1 49 ? -36.812 13.530 -56.802 1.00 40.77 ? 190 LYS B NZ    1 
ATOM   852  N N     . PRO B  1 50 ? -35.740 6.807  -53.779 1.00 32.16 ? 191 PRO B N     1 
ATOM   853  C CA    . PRO B  1 50 ? -34.605 5.975  -54.268 1.00 34.00 ? 191 PRO B CA    1 
ATOM   854  C C     . PRO B  1 50 ? -35.023 4.613  -54.848 1.00 35.38 ? 191 PRO B C     1 
ATOM   855  O O     . PRO B  1 50 ? -34.459 4.177  -55.875 1.00 36.28 ? 191 PRO B O     1 
ATOM   856  C CB    . PRO B  1 50 ? -33.707 5.811  -53.033 1.00 34.20 ? 191 PRO B CB    1 
ATOM   857  C CG    . PRO B  1 50 ? -34.088 6.949  -52.107 1.00 32.86 ? 191 PRO B CG    1 
ATOM   858  C CD    . PRO B  1 50 ? -35.561 7.212  -52.366 1.00 31.76 ? 191 PRO B CD    1 
ATOM   859  N N     . GLN B  1 51 ? -36.013 3.964  -54.241 1.00 34.75 ? 192 GLN B N     1 
ATOM   860  C CA    . GLN B  1 51 ? -36.474 2.638  -54.738 1.00 37.33 ? 192 GLN B CA    1 
ATOM   861  C C     . GLN B  1 51 ? -37.120 2.754  -56.124 1.00 38.10 ? 192 GLN B C     1 
ATOM   862  O O     . GLN B  1 51 ? -36.952 1.878  -56.997 1.00 39.10 ? 192 GLN B O     1 
ATOM   863  C CB    . GLN B  1 51 ? -37.469 2.012  -53.756 1.00 38.68 ? 192 GLN B CB    1 
ATOM   864  C CG    . GLN B  1 51 ? -37.825 0.547  -54.057 1.00 41.27 ? 192 GLN B CG    1 
ATOM   865  C CD    . GLN B  1 51 ? -39.121 0.069  -53.362 1.00 42.33 ? 192 GLN B CD    1 
ATOM   866  O OE1   . GLN B  1 51 ? -39.676 0.735  -52.433 1.00 37.39 ? 192 GLN B OE1   1 
ATOM   867  N NE2   . GLN B  1 51 ? -39.613 -1.116 -53.811 1.00 44.48 ? 192 GLN B NE2   1 
ATOM   868  N N     . LEU B  1 52 ? -37.865 3.840  -56.303 1.00 35.73 ? 193 LEU B N     1 
ATOM   869  C CA    . LEU B  1 52 ? -38.529 4.144  -57.538 1.00 37.18 ? 193 LEU B CA    1 
ATOM   870  C C     . LEU B  1 52 ? -37.503 4.469  -58.614 1.00 38.49 ? 193 LEU B C     1 
ATOM   871  O O     . LEU B  1 52 ? -37.641 4.037  -59.749 1.00 40.03 ? 193 LEU B O     1 
ATOM   872  C CB    . LEU B  1 52 ? -39.455 5.337  -57.328 1.00 35.83 ? 193 LEU B CB    1 
ATOM   873  C CG    . LEU B  1 52 ? -40.319 5.840  -58.468 1.00 37.49 ? 193 LEU B CG    1 
ATOM   874  C CD1   . LEU B  1 52 ? -41.215 4.733  -58.995 1.00 38.98 ? 193 LEU B CD1   1 
ATOM   875  C CD2   . LEU B  1 52 ? -41.149 7.024  -57.965 1.00 36.49 ? 193 LEU B CD2   1 
ATOM   876  N N     . ALA B  1 53 ? -36.488 5.247  -58.232 1.00 38.17 ? 194 ALA B N     1 
ATOM   877  C CA    . ALA B  1 53 ? -35.427 5.641  -59.134 1.00 40.22 ? 194 ALA B CA    1 
ATOM   878  C C     . ALA B  1 53 ? -34.628 4.437  -59.610 1.00 43.45 ? 194 ALA B C     1 
ATOM   879  O O     . ALA B  1 53 ? -34.196 4.417  -60.756 1.00 46.17 ? 194 ALA B O     1 
ATOM   880  C CB    . ALA B  1 53 ? -34.511 6.683  -58.482 1.00 38.53 ? 194 ALA B CB    1 
ATOM   881  N N     . ARG B  1 54 ? -34.440 3.441  -58.739 1.00 44.50 ? 195 ARG B N     1 
ATOM   882  C CA    . ARG B  1 54 ? -33.710 2.208  -59.107 1.00 48.60 ? 195 ARG B CA    1 
ATOM   883  C C     . ARG B  1 54 ? -34.445 1.337  -60.125 1.00 49.40 ? 195 ARG B C     1 
ATOM   884  O O     . ARG B  1 54 ? -33.801 0.814  -61.038 1.00 50.83 ? 195 ARG B O     1 
ATOM   885  C CB    . ARG B  1 54 ? -33.310 1.359  -57.867 1.00 50.47 ? 195 ARG B CB    1 
ATOM   886  C CG    . ARG B  1 54 ? -31.916 1.672  -57.333 1.00 53.25 ? 195 ARG B CG    1 
ATOM   887  C CD    . ARG B  1 54 ? -31.359 0.566  -56.439 1.00 56.37 ? 195 ARG B CD    1 
ATOM   888  N NE    . ARG B  1 54 ? -32.368 0.066  -55.503 1.00 57.83 ? 195 ARG B NE    1 
ATOM   889  C CZ    . ARG B  1 54 ? -32.840 0.731  -54.438 1.00 56.56 ? 195 ARG B CZ    1 
ATOM   890  N NH1   . ARG B  1 54 ? -33.774 0.161  -53.667 1.00 56.63 ? 195 ARG B NH1   1 
ATOM   891  N NH2   . ARG B  1 54 ? -32.398 1.957  -54.129 1.00 56.32 ? 195 ARG B NH2   1 
ATOM   892  N N     . TYR B  1 55 ? -35.765 1.170  -59.972 1.00 47.65 ? 196 TYR B N     1 
ATOM   893  C CA    . TYR B  1 55 ? -36.538 0.340  -60.920 1.00 50.84 ? 196 TYR B CA    1 
ATOM   894  C C     . TYR B  1 55 ? -36.557 0.995  -62.308 1.00 52.24 ? 196 TYR B C     1 
ATOM   895  O O     . TYR B  1 55 ? -36.369 0.312  -63.330 1.00 53.47 ? 196 TYR B O     1 
ATOM   896  C CB    . TYR B  1 55 ? -37.967 0.097  -60.433 1.00 50.65 ? 196 TYR B CB    1 
ATOM   897  C CG    . TYR B  1 55 ? -38.808 -0.830 -61.323 1.00 54.30 ? 196 TYR B CG    1 
ATOM   898  C CD1   . TYR B  1 55 ? -38.513 -2.198 -61.425 1.00 57.30 ? 196 TYR B CD1   1 
ATOM   899  C CD2   . TYR B  1 55 ? -39.921 -0.345 -62.031 1.00 55.55 ? 196 TYR B CD2   1 
ATOM   900  C CE1   . TYR B  1 55 ? -39.286 -3.052 -62.222 1.00 61.37 ? 196 TYR B CE1   1 
ATOM   901  C CE2   . TYR B  1 55 ? -40.698 -1.195 -62.843 1.00 59.34 ? 196 TYR B CE2   1 
ATOM   902  C CZ    . TYR B  1 55 ? -40.380 -2.548 -62.936 1.00 62.24 ? 196 TYR B CZ    1 
ATOM   903  O OH    . TYR B  1 55 ? -41.138 -3.403 -63.742 1.00 66.03 ? 196 TYR B OH    1 
ATOM   904  N N     . LEU B  1 56 ? -36.749 2.319  -62.328 1.00 50.26 ? 197 LEU B N     1 
ATOM   905  C CA    . LEU B  1 56 ? -36.812 3.072  -63.590 1.00 51.78 ? 197 LEU B CA    1 
ATOM   906  C C     . LEU B  1 56 ? -35.431 3.363  -64.234 1.00 52.27 ? 197 LEU B C     1 
ATOM   907  O O     . LEU B  1 56 ? -35.324 3.383  -65.474 1.00 52.43 ? 197 LEU B O     1 
ATOM   908  C CB    . LEU B  1 56 ? -37.634 4.363  -63.406 1.00 50.46 ? 197 LEU B CB    1 
ATOM   909  C CG    . LEU B  1 56 ? -39.160 4.094  -63.334 1.00 50.60 ? 197 LEU B CG    1 
ATOM   910  C CD1   . LEU B  1 56 ? -39.896 5.272  -62.736 1.00 48.18 ? 197 LEU B CD1   1 
ATOM   911  C CD2   . LEU B  1 56 ? -39.734 3.736  -64.717 1.00 54.09 ? 197 LEU B CD2   1 
ATOM   912  N N     . GLY B  1 57 ? -34.400 3.610  -63.404 1.00 49.66 ? 198 GLY B N     1 
ATOM   913  C CA    . GLY B  1 57 ? -33.050 3.938  -63.909 1.00 50.17 ? 198 GLY B CA    1 
ATOM   914  C C     . GLY B  1 57 ? -33.028 5.139  -64.875 1.00 49.96 ? 198 GLY B C     1 
ATOM   915  O O     . GLY B  1 57 ? -33.733 6.153  -64.655 1.00 47.87 ? 198 GLY B O     1 
ATOM   916  N N     . ASN B  1 58 ? -32.254 5.003  -65.958 1.00 51.28 ? 199 ASN B N     1 
ATOM   917  C CA    A ASN B  1 58 ? -32.095 6.061  -66.980 0.50 52.41 ? 199 ASN B CA    1 
ATOM   918  C CA    B ASN B  1 58 ? -32.105 6.087  -66.953 0.50 52.00 ? 199 ASN B CA    1 
ATOM   919  C C     . ASN B  1 58 ? -33.332 6.291  -67.869 1.00 53.41 ? 199 ASN B C     1 
ATOM   920  O O     . ASN B  1 58 ? -33.325 7.198  -68.739 1.00 54.27 ? 199 ASN B O     1 
ATOM   921  C CB    A ASN B  1 58 ? -30.868 5.764  -67.889 0.50 55.09 ? 199 ASN B CB    1 
ATOM   922  C CB    B ASN B  1 58 ? -30.833 5.886  -67.813 0.50 54.19 ? 199 ASN B CB    1 
ATOM   923  C CG    A ASN B  1 58 ? -29.641 6.552  -67.483 0.50 55.09 ? 199 ASN B CG    1 
ATOM   924  C CG    B ASN B  1 58 ? -30.776 4.529  -68.484 0.50 55.64 ? 199 ASN B CG    1 
ATOM   925  O OD1   A ASN B  1 58 ? -29.612 7.167  -66.414 0.50 52.90 ? 199 ASN B OD1   1 
ATOM   926  O OD1   B ASN B  1 58 ? -31.800 3.935  -68.810 0.50 55.79 ? 199 ASN B OD1   1 
ATOM   927  N ND2   A ASN B  1 58 ? -28.624 6.548  -68.336 0.50 57.32 ? 199 ASN B ND2   1 
ATOM   928  N ND2   B ASN B  1 58 ? -29.572 4.025  -68.669 0.50 57.02 ? 199 ASN B ND2   1 
ATOM   929  N N     . THR B  1 59 ? -34.380 5.472  -67.704 1.00 52.57 ? 200 THR B N     1 
ATOM   930  C CA    . THR B  1 59 ? -35.556 5.575  -68.588 1.00 54.17 ? 200 THR B CA    1 
ATOM   931  C C     . THR B  1 59 ? -36.415 6.792  -68.248 1.00 53.39 ? 200 THR B C     1 
ATOM   932  O O     . THR B  1 59 ? -37.181 7.261  -69.098 1.00 54.16 ? 200 THR B O     1 
ATOM   933  C CB    . THR B  1 59 ? -36.447 4.308  -68.568 1.00 54.71 ? 200 THR B CB    1 
ATOM   934  O OG1   . THR B  1 59 ? -37.109 4.192  -67.299 1.00 51.51 ? 200 THR B OG1   1 
ATOM   935  C CG2   . THR B  1 59 ? -35.625 3.039  -68.863 1.00 55.96 ? 200 THR B CG2   1 
ATOM   936  N N     . VAL B  1 60 ? -36.313 7.282  -67.002 1.00 50.30 ? 201 VAL B N     1 
ATOM   937  C CA    . VAL B  1 60 ? -37.082 8.444  -66.555 1.00 50.26 ? 201 VAL B CA    1 
ATOM   938  C C     . VAL B  1 60 ? -36.210 9.331  -65.658 1.00 49.36 ? 201 VAL B C     1 
ATOM   939  O O     . VAL B  1 60 ? -35.617 8.843  -64.689 1.00 47.71 ? 201 VAL B O     1 
ATOM   940  C CB    . VAL B  1 60 ? -38.381 8.006  -65.810 1.00 49.34 ? 201 VAL B CB    1 
ATOM   941  C CG1   . VAL B  1 60 ? -39.109 9.204  -65.203 1.00 48.22 ? 201 VAL B CG1   1 
ATOM   942  C CG2   . VAL B  1 60 ? -39.306 7.233  -66.760 1.00 51.93 ? 201 VAL B CG2   1 
ATOM   943  N N     . ASP B  1 61 ? -36.130 10.625 -65.981 1.00 50.92 ? 202 ASP B N     1 
ATOM   944  C CA    . ASP B  1 61 ? -35.401 11.583 -65.140 1.00 51.15 ? 202 ASP B CA    1 
ATOM   945  C C     . ASP B  1 61 ? -36.289 11.996 -63.954 1.00 49.25 ? 202 ASP B C     1 
ATOM   946  O O     . ASP B  1 61 ? -37.235 12.763 -64.111 1.00 49.66 ? 202 ASP B O     1 
ATOM   947  C CB    . ASP B  1 61 ? -34.966 12.814 -65.959 1.00 53.94 ? 202 ASP B CB    1 
ATOM   948  C CG    . ASP B  1 61 ? -34.116 13.810 -65.149 1.00 53.83 ? 202 ASP B CG    1 
ATOM   949  O OD1   . ASP B  1 61 ? -34.016 13.673 -63.900 1.00 51.69 ? 202 ASP B OD1   1 
ATOM   950  O OD2   . ASP B  1 61 ? -33.561 14.747 -65.769 1.00 55.98 ? 202 ASP B OD2   1 
ATOM   951  N N     . LEU B  1 62 ? -35.950 11.497 -62.778 1.00 48.63 ? 203 LEU B N     1 
ATOM   952  C CA    . LEU B  1 62 ? -36.685 11.812 -61.554 1.00 47.59 ? 203 LEU B CA    1 
ATOM   953  C C     . LEU B  1 62 ? -36.073 12.913 -60.705 1.00 49.15 ? 203 LEU B C     1 
ATOM   954  O O     . LEU B  1 62 ? -36.570 13.176 -59.602 1.00 48.99 ? 203 LEU B O     1 
ATOM   955  C CB    . LEU B  1 62 ? -36.833 10.545 -60.709 1.00 44.98 ? 203 LEU B CB    1 
ATOM   956  C CG    . LEU B  1 62 ? -37.744 9.470  -61.285 1.00 44.84 ? 203 LEU B CG    1 
ATOM   957  C CD1   . LEU B  1 62 ? -37.762 8.277  -60.344 1.00 43.68 ? 203 LEU B CD1   1 
ATOM   958  C CD2   . LEU B  1 62 ? -39.157 9.987  -61.492 1.00 45.13 ? 203 LEU B CD2   1 
ATOM   959  N N     . SER B  1 63 ? -35.037 13.589 -61.208 1.00 52.33 ? 204 SER B N     1 
ATOM   960  C CA    . SER B  1 63 ? -34.370 14.686 -60.461 1.00 53.11 ? 204 SER B CA    1 
ATOM   961  C C     . SER B  1 63 ? -35.360 15.705 -59.879 1.00 53.63 ? 204 SER B C     1 
ATOM   962  O O     . SER B  1 63 ? -35.294 16.010 -58.701 1.00 56.58 ? 204 SER B O     1 
ATOM   963  C CB    . SER B  1 63 ? -33.347 15.398 -61.353 1.00 55.74 ? 204 SER B CB    1 
ATOM   964  O OG    . SER B  1 63 ? -33.975 15.912 -62.516 1.00 57.37 ? 204 SER B OG    1 
ATOM   965  N N     . SER B  1 64 ? -36.296 16.191 -60.691 1.00 53.87 ? 205 SER B N     1 
ATOM   966  C CA    . SER B  1 64 ? -37.309 17.175 -60.220 1.00 53.61 ? 205 SER B CA    1 
ATOM   967  C C     . SER B  1 64 ? -38.574 16.543 -59.566 1.00 50.53 ? 205 SER B C     1 
ATOM   968  O O     . SER B  1 64 ? -39.473 17.273 -59.144 1.00 52.11 ? 205 SER B O     1 
ATOM   969  C CB    . SER B  1 64 ? -37.740 18.085 -61.388 1.00 55.71 ? 205 SER B CB    1 
ATOM   970  N N     . PHE B  1 65 ? -38.646 15.209 -59.500 1.00 47.23 ? 206 PHE B N     1 
ATOM   971  C CA    . PHE B  1 65 ? -39.867 14.516 -59.076 1.00 45.19 ? 206 PHE B CA    1 
ATOM   972  C C     . PHE B  1 65 ? -40.086 14.632 -57.569 1.00 41.71 ? 206 PHE B C     1 
ATOM   973  O O     . PHE B  1 65 ? -39.278 14.165 -56.799 1.00 39.52 ? 206 PHE B O     1 
ATOM   974  C CB    . PHE B  1 65 ? -39.817 13.037 -59.461 1.00 43.55 ? 206 PHE B CB    1 
ATOM   975  C CG    . PHE B  1 65 ? -41.101 12.299 -59.191 1.00 42.48 ? 206 PHE B CG    1 
ATOM   976  C CD1   . PHE B  1 65 ? -42.232 12.556 -59.947 1.00 43.70 ? 206 PHE B CD1   1 
ATOM   977  C CD2   . PHE B  1 65 ? -41.180 11.342 -58.181 1.00 40.35 ? 206 PHE B CD2   1 
ATOM   978  C CE1   . PHE B  1 65 ? -43.417 11.885 -59.700 1.00 43.34 ? 206 PHE B CE1   1 
ATOM   979  C CE2   . PHE B  1 65 ? -42.373 10.658 -57.932 1.00 39.48 ? 206 PHE B CE2   1 
ATOM   980  C CZ    . PHE B  1 65 ? -43.492 10.932 -58.696 1.00 41.11 ? 206 PHE B CZ    1 
ATOM   981  N N     . ASP B  1 66 ? -41.184 15.253 -57.166 1.00 42.21 ? 207 ASP B N     1 
ATOM   982  C CA    . ASP B  1 66 ? -41.563 15.291 -55.748 1.00 40.65 ? 207 ASP B CA    1 
ATOM   983  C C     . ASP B  1 66 ? -42.364 14.037 -55.382 1.00 38.13 ? 207 ASP B C     1 
ATOM   984  O O     . ASP B  1 66 ? -43.533 13.909 -55.788 1.00 39.30 ? 207 ASP B O     1 
ATOM   985  C CB    . ASP B  1 66 ? -42.393 16.522 -55.430 1.00 42.89 ? 207 ASP B CB    1 
ATOM   986  C CG    . ASP B  1 66 ? -42.704 16.608 -53.956 1.00 41.28 ? 207 ASP B CG    1 
ATOM   987  O OD1   . ASP B  1 66 ? -41.783 16.863 -53.194 1.00 40.31 ? 207 ASP B OD1   1 
ATOM   988  O OD2   . ASP B  1 66 ? -43.842 16.349 -53.562 1.00 43.14 ? 207 ASP B OD2   1 
ATOM   989  N N     . PHE B  1 67 ? -41.744 13.122 -54.622 1.00 34.62 ? 208 PHE B N     1 
ATOM   990  C CA    . PHE B  1 67 ? -42.327 11.796 -54.371 1.00 33.36 ? 208 PHE B CA    1 
ATOM   991  C C     . PHE B  1 67 ? -43.636 11.900 -53.574 1.00 33.69 ? 208 PHE B C     1 
ATOM   992  O O     . PHE B  1 67 ? -44.591 11.111 -53.788 1.00 32.65 ? 208 PHE B O     1 
ATOM   993  C CB    . PHE B  1 67 ? -41.320 10.911 -53.600 1.00 32.39 ? 208 PHE B CB    1 
ATOM   994  C CG    . PHE B  1 67 ? -41.806 9.512  -53.338 1.00 31.03 ? 208 PHE B CG    1 
ATOM   995  C CD1   . PHE B  1 67 ? -42.625 9.228  -52.229 1.00 28.76 ? 208 PHE B CD1   1 
ATOM   996  C CD2   . PHE B  1 67 ? -41.455 8.465  -54.198 1.00 30.67 ? 208 PHE B CD2   1 
ATOM   997  C CE1   . PHE B  1 67 ? -43.088 7.937  -52.012 1.00 28.65 ? 208 PHE B CE1   1 
ATOM   998  C CE2   . PHE B  1 67 ? -41.908 7.178  -53.968 1.00 30.19 ? 208 PHE B CE2   1 
ATOM   999  C CZ    . PHE B  1 67 ? -42.715 6.907  -52.873 1.00 29.58 ? 208 PHE B CZ    1 
ATOM   1000 N N     . ARG B  1 68 ? -43.667 12.834 -52.634 1.00 33.35 ? 209 ARG B N     1 
ATOM   1001 C CA    . ARG B  1 68 ? -44.832 12.971 -51.760 1.00 33.38 ? 209 ARG B CA    1 
ATOM   1002 C C     . ARG B  1 68 ? -46.084 13.420 -52.536 1.00 35.91 ? 209 ARG B C     1 
ATOM   1003 O O     . ARG B  1 68 ? -47.154 12.866 -52.309 1.00 35.87 ? 209 ARG B O     1 
ATOM   1004 C CB    . ARG B  1 68 ? -44.555 13.932 -50.602 1.00 31.50 ? 209 ARG B CB    1 
ATOM   1005 C CG    . ARG B  1 68 ? -45.808 14.188 -49.749 1.00 32.02 ? 209 ARG B CG    1 
ATOM   1006 C CD    . ARG B  1 68 ? -45.494 14.561 -48.309 1.00 29.53 ? 209 ARG B CD    1 
ATOM   1007 N NE    . ARG B  1 68 ? -45.044 13.438 -47.508 1.00 26.06 ? 209 ARG B NE    1 
ATOM   1008 C CZ    . ARG B  1 68 ? -45.837 12.540 -46.945 1.00 25.38 ? 209 ARG B CZ    1 
ATOM   1009 N NH1   . ARG B  1 68 ? -47.177 12.575 -47.125 1.00 26.36 ? 209 ARG B NH1   1 
ATOM   1010 N NH2   . ARG B  1 68 ? -45.307 11.581 -46.198 1.00 22.41 ? 209 ARG B NH2   1 
ATOM   1011 N N     . THR B  1 69 ? -45.952 14.442 -53.391 1.00 38.58 ? 210 THR B N     1 
ATOM   1012 C CA    . THR B  1 69 ? -47.110 14.965 -54.179 1.00 42.40 ? 210 THR B CA    1 
ATOM   1013 C C     . THR B  1 69 ? -47.253 14.293 -55.557 1.00 45.61 ? 210 THR B C     1 
ATOM   1014 O O     . THR B  1 69 ? -48.319 14.392 -56.194 1.00 48.16 ? 210 THR B O     1 
ATOM   1015 C CB    . THR B  1 69 ? -47.024 16.499 -54.441 1.00 45.11 ? 210 THR B CB    1 
ATOM   1016 O OG1   . THR B  1 69 ? -45.844 16.806 -55.214 1.00 46.40 ? 210 THR B OG1   1 
ATOM   1017 C CG2   . THR B  1 69 ? -47.021 17.305 -53.135 1.00 44.21 ? 210 THR B CG2   1 
ATOM   1018 N N     . GLY B  1 70 ? -46.183 13.652 -56.031 1.00 44.84 ? 211 GLY B N     1 
ATOM   1019 C CA    . GLY B  1 70 ? -46.169 13.066 -57.380 1.00 47.73 ? 211 GLY B CA    1 
ATOM   1020 C C     . GLY B  1 70 ? -45.986 14.040 -58.534 1.00 50.31 ? 211 GLY B C     1 
ATOM   1021 O O     . GLY B  1 70 ? -46.284 13.681 -59.672 1.00 55.19 ? 211 GLY B O     1 
ATOM   1022 N N     . LYS B  1 71 ? -45.466 15.246 -58.258 1.00 50.59 ? 212 LYS B N     1 
ATOM   1023 C CA    . LYS B  1 71 ? -45.356 16.324 -59.258 1.00 53.59 ? 212 LYS B CA    1 
ATOM   1024 C C     . LYS B  1 71 ? -43.902 16.804 -59.448 1.00 54.85 ? 212 LYS B C     1 
ATOM   1025 O O     . LYS B  1 71 ? -43.079 16.686 -58.541 1.00 50.97 ? 212 LYS B O     1 
ATOM   1026 C CB    . LYS B  1 71 ? -46.251 17.495 -58.861 1.00 55.88 ? 212 LYS B CB    1 
ATOM   1027 C CG    . LYS B  1 71 ? -47.738 17.155 -58.821 1.00 56.62 ? 212 LYS B CG    1 
ATOM   1028 N N     . MET B  1 72 ? -43.593 17.311 -60.653 1.00 58.81 ? 213 MET B N     1 
ATOM   1029 C CA    . MET B  1 72 ? -42.259 17.855 -60.980 1.00 60.94 ? 213 MET B CA    1 
ATOM   1030 C C     . MET B  1 72 ? -42.120 19.295 -60.478 1.00 64.62 ? 213 MET B C     1 
ATOM   1031 O O     . MET B  1 72 ? -43.010 20.111 -60.706 1.00 69.30 ? 213 MET B O     1 
ATOM   1032 C CB    . MET B  1 72 ? -42.018 17.833 -62.497 1.00 63.09 ? 213 MET B CB    1 
ATOM   1033 C CG    . MET B  1 72 ? -41.996 16.443 -63.128 1.00 62.05 ? 213 MET B CG    1 
ATOM   1034 S SD    . MET B  1 72 ? -40.687 15.366 -62.497 1.00 58.79 ? 213 MET B SD    1 
ATOM   1035 C CE    . MET B  1 72 ? -40.872 13.940 -63.570 1.00 58.37 ? 213 MET B CE    1 
ATOM   1036 N N     . MET B  1 73 ? -40.988 19.609 -59.833 1.00 65.38 ? 214 MET B N     1 
ATOM   1037 C CA    . MET B  1 73 ? -40.769 20.919 -59.184 1.00 68.52 ? 214 MET B CA    1 
ATOM   1038 C C     . MET B  1 73 ? -39.924 21.875 -60.050 1.00 73.56 ? 214 MET B C     1 
ATOM   1039 O O     . MET B  1 73 ? -38.963 21.449 -60.698 1.00 74.62 ? 214 MET B O     1 
ATOM   1040 C CB    . MET B  1 73 ? -40.096 20.707 -57.822 1.00 66.59 ? 214 MET B CB    1 
ATOM   1041 N N     . PRO B  1 74 ? -40.284 23.173 -60.064 1.00 77.00 ? 215 PRO B N     1 
ATOM   1042 O "O5'" . DC  C  2 1  ? -49.698 4.031  -38.234 1.00 26.42 ? 1   DC  C "O5'" 1 
ATOM   1043 C "C5'" . DC  C  2 1  ? -49.842 3.313  -37.004 1.00 27.77 ? 1   DC  C "C5'" 1 
ATOM   1044 C "C4'" . DC  C  2 1  ? -48.512 3.140  -36.303 1.00 25.50 ? 1   DC  C "C4'" 1 
ATOM   1045 O "O4'" . DC  C  2 1  ? -47.655 2.291  -37.102 1.00 24.74 ? 1   DC  C "O4'" 1 
ATOM   1046 C "C3'" . DC  C  2 1  ? -47.706 4.405  -36.012 1.00 25.50 ? 1   DC  C "C3'" 1 
ATOM   1047 O "O3'" . DC  C  2 1  ? -47.119 4.226  -34.719 1.00 26.46 ? 1   DC  C "O3'" 1 
ATOM   1048 C "C2'" . DC  C  2 1  ? -46.681 4.439  -37.133 1.00 23.59 ? 1   DC  C "C2'" 1 
ATOM   1049 C "C1'" . DC  C  2 1  ? -46.437 2.963  -37.420 1.00 23.25 ? 1   DC  C "C1'" 1 
ATOM   1050 N N1    . DC  C  2 1  ? -46.095 2.676  -38.842 1.00 22.04 ? 1   DC  C N1    1 
ATOM   1051 C C2    . DC  C  2 1  ? -44.910 1.989  -39.135 1.00 22.06 ? 1   DC  C C2    1 
ATOM   1052 O O2    . DC  C  2 1  ? -44.188 1.613  -38.202 1.00 24.49 ? 1   DC  C O2    1 
ATOM   1053 N N3    . DC  C  2 1  ? -44.572 1.772  -40.433 1.00 21.35 ? 1   DC  C N3    1 
ATOM   1054 C C4    . DC  C  2 1  ? -45.365 2.218  -41.411 1.00 21.74 ? 1   DC  C C4    1 
ATOM   1055 N N4    . DC  C  2 1  ? -44.991 1.999  -42.672 1.00 22.26 ? 1   DC  C N4    1 
ATOM   1056 C C5    . DC  C  2 1  ? -46.585 2.900  -41.139 1.00 22.57 ? 1   DC  C C5    1 
ATOM   1057 C C6    . DC  C  2 1  ? -46.906 3.111  -39.853 1.00 22.88 ? 1   DC  C C6    1 
ATOM   1058 P P     . DG  C  2 2  ? -46.115 5.262  -34.127 1.00 26.98 ? 2   DG  C P     1 
ATOM   1059 O OP1   . DG  C  2 2  ? -46.404 5.399  -32.674 1.00 29.80 ? 2   DG  C OP1   1 
ATOM   1060 O OP2   . DG  C  2 2  ? -46.135 6.499  -34.968 1.00 28.64 ? 2   DG  C OP2   1 
ATOM   1061 O "O5'" . DG  C  2 2  ? -44.707 4.538  -34.264 1.00 26.10 ? 2   DG  C "O5'" 1 
ATOM   1062 C "C5'" . DG  C  2 2  ? -44.522 3.157  -33.876 1.00 26.42 ? 2   DG  C "C5'" 1 
ATOM   1063 C "C4'" . DG  C  2 2  ? -43.050 2.824  -33.736 1.00 25.79 ? 2   DG  C "C4'" 1 
ATOM   1064 O "O4'" . DG  C  2 2  ? -42.451 2.577  -35.026 1.00 24.87 ? 2   DG  C "O4'" 1 
ATOM   1065 C "C3'" . DG  C  2 2  ? -42.176 3.900  -33.089 1.00 25.43 ? 2   DG  C "C3'" 1 
ATOM   1066 O "O3'" . DG  C  2 2  ? -41.161 3.230  -32.350 1.00 26.35 ? 2   DG  C "O3'" 1 
ATOM   1067 C "C2'" . DG  C  2 2  ? -41.618 4.659  -34.274 1.00 22.76 ? 2   DG  C "C2'" 1 
ATOM   1068 C "C1'" . DG  C  2 2  ? -41.529 3.622  -35.383 1.00 22.58 ? 2   DG  C "C1'" 1 
ATOM   1069 N N9    . DG  C  2 2  ? -41.901 4.056  -36.731 1.00 20.68 ? 2   DG  C N9    1 
ATOM   1070 C C8    . DG  C  2 2  ? -43.024 4.774  -37.070 1.00 21.42 ? 2   DG  C C8    1 
ATOM   1071 N N7    . DG  C  2 2  ? -43.205 4.866  -38.362 1.00 20.37 ? 2   DG  C N7    1 
ATOM   1072 C C5    . DG  C  2 2  ? -42.170 4.122  -38.907 1.00 19.37 ? 2   DG  C C5    1 
ATOM   1073 C C6    . DG  C  2 2  ? -41.839 3.870  -40.264 1.00 19.55 ? 2   DG  C C6    1 
ATOM   1074 O O6    . DG  C  2 2  ? -42.426 4.255  -41.277 1.00 18.95 ? 2   DG  C O6    1 
ATOM   1075 N N1    . DG  C  2 2  ? -40.685 3.097  -40.377 1.00 19.49 ? 2   DG  C N1    1 
ATOM   1076 C C2    . DG  C  2 2  ? -39.965 2.591  -39.314 1.00 20.20 ? 2   DG  C C2    1 
ATOM   1077 N N2    . DG  C  2 2  ? -38.894 1.831  -39.623 1.00 20.44 ? 2   DG  C N2    1 
ATOM   1078 N N3    . DG  C  2 2  ? -40.272 2.815  -38.040 1.00 19.61 ? 2   DG  C N3    1 
ATOM   1079 C C4    . DG  C  2 2  ? -41.369 3.593  -37.912 1.00 19.80 ? 2   DG  C C4    1 
ATOM   1080 P P     . DG  C  2 3  ? -40.244 4.001  -31.322 1.00 28.02 ? 3   DG  C P     1 
ATOM   1081 O OP1   . DG  C  2 3  ? -39.810 3.017  -30.322 1.00 29.54 ? 3   DG  C OP1   1 
ATOM   1082 O OP2   . DG  C  2 3  ? -40.913 5.275  -30.930 1.00 28.19 ? 3   DG  C OP2   1 
ATOM   1083 O "O5'" . DG  C  2 3  ? -38.969 4.406  -32.190 1.00 26.04 ? 3   DG  C "O5'" 1 
ATOM   1084 C "C5'" . DG  C  2 3  ? -38.092 3.386  -32.738 1.00 26.06 ? 3   DG  C "C5'" 1 
ATOM   1085 C "C4'" . DG  C  2 3  ? -37.153 3.992  -33.758 1.00 24.57 ? 3   DG  C "C4'" 1 
ATOM   1086 O "O4'" . DG  C  2 3  ? -37.893 4.368  -34.939 1.00 23.38 ? 3   DG  C "O4'" 1 
ATOM   1087 C "C3'" . DG  C  2 3  ? -36.463 5.277  -33.282 1.00 24.28 ? 3   DG  C "C3'" 1 
ATOM   1088 O "O3'" . DG  C  2 3  ? -35.124 5.290  -33.732 1.00 26.06 ? 3   DG  C "O3'" 1 
ATOM   1089 C "C2'" . DG  C  2 3  ? -37.235 6.374  -33.982 1.00 23.32 ? 3   DG  C "C2'" 1 
ATOM   1090 C "C1'" . DG  C  2 3  ? -37.495 5.689  -35.299 1.00 22.18 ? 3   DG  C "C1'" 1 
ATOM   1091 N N9    . DG  C  2 3  ? -38.515 6.244  -36.174 1.00 20.59 ? 3   DG  C N9    1 
ATOM   1092 C C8    . DG  C  2 3  ? -39.610 7.010  -35.852 1.00 19.49 ? 3   DG  C C8    1 
ATOM   1093 N N7    . DG  C  2 3  ? -40.332 7.329  -36.890 1.00 19.37 ? 3   DG  C N7    1 
ATOM   1094 C C5    . DG  C  2 3  ? -39.706 6.690  -37.954 1.00 19.23 ? 3   DG  C C5    1 
ATOM   1095 C C6    . DG  C  2 3  ? -40.012 6.690  -39.346 1.00 19.42 ? 3   DG  C C6    1 
ATOM   1096 O O6    . DG  C  2 3  ? -40.958 7.229  -39.931 1.00 18.46 ? 3   DG  C O6    1 
ATOM   1097 N N1    . DG  C  2 3  ? -39.088 5.939  -40.072 1.00 20.71 ? 3   DG  C N1    1 
ATOM   1098 C C2    . DG  C  2 3  ? -37.999 5.293  -39.535 1.00 21.31 ? 3   DG  C C2    1 
ATOM   1099 N N2    . DG  C  2 3  ? -37.206 4.637  -40.396 1.00 22.00 ? 3   DG  C N2    1 
ATOM   1100 N N3    . DG  C  2 3  ? -37.681 5.328  -38.253 1.00 21.00 ? 3   DG  C N3    1 
ATOM   1101 C C4    . DG  C  2 3  ? -38.573 6.032  -37.528 1.00 20.49 ? 3   DG  C C4    1 
ATOM   1102 P P     . DA  C  2 4  ? -33.894 5.493  -32.685 1.00 28.89 ? 4   DA  C P     1 
ATOM   1103 O OP1   . DA  C  2 4  ? -34.095 4.595  -31.595 1.00 30.39 ? 4   DA  C OP1   1 
ATOM   1104 O OP2   . DA  C  2 4  ? -33.725 6.941  -32.418 1.00 29.06 ? 4   DA  C OP2   1 
ATOM   1105 O "O5'" . DA  C  2 4  ? -32.634 5.061  -33.572 1.00 31.14 ? 4   DA  C "O5'" 1 
ATOM   1106 C "C5'" . DA  C  2 4  ? -32.534 3.781  -34.226 1.00 30.67 ? 4   DA  C "C5'" 1 
ATOM   1107 C "C4'" . DA  C  2 4  ? -32.099 3.938  -35.668 1.00 30.94 ? 4   DA  C "C4'" 1 
ATOM   1108 O "O4'" . DA  C  2 4  ? -33.113 4.606  -36.456 1.00 29.35 ? 4   DA  C "O4'" 1 
ATOM   1109 C "C3'" . DA  C  2 4  ? -30.819 4.722  -35.925 1.00 32.48 ? 4   DA  C "C3'" 1 
ATOM   1110 O "O3'" . DA  C  2 4  ? -30.217 4.086  -37.052 1.00 32.84 ? 4   DA  C "O3'" 1 
ATOM   1111 C "C2'" . DA  C  2 4  ? -31.336 6.127  -36.232 1.00 29.85 ? 4   DA  C "C2'" 1 
ATOM   1112 C "C1'" . DA  C  2 4  ? -32.613 5.827  -36.998 1.00 27.39 ? 4   DA  C "C1'" 1 
ATOM   1113 N N9    . DA  C  2 4  ? -33.696 6.810  -36.923 1.00 24.87 ? 4   DA  C N9    1 
ATOM   1114 C C8    . DA  C  2 4  ? -34.155 7.490  -35.821 1.00 23.12 ? 4   DA  C C8    1 
ATOM   1115 N N7    . DA  C  2 4  ? -35.176 8.274  -36.072 1.00 22.90 ? 4   DA  C N7    1 
ATOM   1116 C C5    . DA  C  2 4  ? -35.425 8.077  -37.423 1.00 21.54 ? 4   DA  C C5    1 
ATOM   1117 C C6    . DA  C  2 4  ? -36.396 8.612  -38.298 1.00 21.89 ? 4   DA  C C6    1 
ATOM   1118 N N6    . DA  C  2 4  ? -37.333 9.485  -37.923 1.00 21.37 ? 4   DA  C N6    1 
ATOM   1119 N N1    . DA  C  2 4  ? -36.355 8.228  -39.593 1.00 21.15 ? 4   DA  C N1    1 
ATOM   1120 C C2    . DA  C  2 4  ? -35.405 7.355  -39.973 1.00 22.99 ? 4   DA  C C2    1 
ATOM   1121 N N3    . DA  C  2 4  ? -34.442 6.787  -39.244 1.00 23.71 ? 4   DA  C N3    1 
ATOM   1122 C C4    . DA  C  2 4  ? -34.518 7.182  -37.962 1.00 23.21 ? 4   DA  C C4    1 
ATOM   1123 P P     . DA  C  2 5  ? -28.759 4.510  -37.582 1.00 37.97 ? 5   DA  C P     1 
ATOM   1124 O OP1   . DA  C  2 5  ? -28.083 3.280  -38.057 1.00 38.31 ? 5   DA  C OP1   1 
ATOM   1125 O OP2   . DA  C  2 5  ? -28.105 5.405  -36.585 1.00 36.13 ? 5   DA  C OP2   1 
ATOM   1126 O "O5'" . DA  C  2 5  ? -29.091 5.507  -38.764 1.00 35.17 ? 5   DA  C "O5'" 1 
ATOM   1127 C "C5'" . DA  C  2 5  ? -29.767 5.045  -39.932 1.00 34.52 ? 5   DA  C "C5'" 1 
ATOM   1128 C "C4'" . DA  C  2 5  ? -30.012 6.212  -40.857 1.00 31.96 ? 5   DA  C "C4'" 1 
ATOM   1129 O "O4'" . DA  C  2 5  ? -31.130 6.977  -40.395 1.00 26.79 ? 5   DA  C "O4'" 1 
ATOM   1130 C "C3'" . DA  C  2 5  ? -28.836 7.199  -41.015 1.00 33.70 ? 5   DA  C "C3'" 1 
ATOM   1131 O "O3'" . DA  C  2 5  ? -28.680 7.169  -42.422 1.00 38.69 ? 5   DA  C "O3'" 1 
ATOM   1132 C "C2'" . DA  C  2 5  ? -29.364 8.515  -40.453 1.00 29.20 ? 5   DA  C "C2'" 1 
ATOM   1133 C "C1'" . DA  C  2 5  ? -30.877 8.351  -40.596 1.00 27.39 ? 5   DA  C "C1'" 1 
ATOM   1134 N N9    . DA  C  2 5  ? -31.689 9.092  -39.632 1.00 23.09 ? 5   DA  C N9    1 
ATOM   1135 C C8    . DA  C  2 5  ? -31.488 9.190  -38.276 1.00 24.56 ? 5   DA  C C8    1 
ATOM   1136 N N7    . DA  C  2 5  ? -32.404 9.891  -37.653 1.00 21.50 ? 5   DA  C N7    1 
ATOM   1137 C C5    . DA  C  2 5  ? -33.253 10.301 -38.665 1.00 19.88 ? 5   DA  C C5    1 
ATOM   1138 C C6    . DA  C  2 5  ? -34.422 11.072 -38.654 1.00 19.50 ? 5   DA  C C6    1 
ATOM   1139 N N6    . DA  C  2 5  ? -34.941 11.613 -37.537 1.00 19.75 ? 5   DA  C N6    1 
ATOM   1140 N N1    . DA  C  2 5  ? -35.051 11.282 -39.835 1.00 18.57 ? 5   DA  C N1    1 
ATOM   1141 C C2    . DA  C  2 5  ? -34.511 10.757 -40.955 1.00 19.65 ? 5   DA  C C2    1 
ATOM   1142 N N3    . DA  C  2 5  ? -33.433 9.980  -41.085 1.00 20.48 ? 5   DA  C N3    1 
ATOM   1143 C C4    . DA  C  2 5  ? -32.830 9.807  -39.893 1.00 21.69 ? 5   DA  C C4    1 
ATOM   1144 P P     . DT  C  2 6  ? -27.595 8.019  -43.183 1.00 44.09 ? 6   DT  C P     1 
ATOM   1145 O OP1   . DT  C  2 6  ? -27.307 7.281  -44.432 1.00 45.85 ? 6   DT  C OP1   1 
ATOM   1146 O OP2   . DT  C  2 6  ? -26.483 8.381  -42.241 1.00 42.98 ? 6   DT  C OP2   1 
ATOM   1147 O "O5'" . DT  C  2 6  ? -28.420 9.323  -43.585 1.00 38.08 ? 6   DT  C "O5'" 1 
ATOM   1148 C "C5'" . DT  C  2 6  ? -29.470 9.209  -44.551 1.00 35.19 ? 6   DT  C "C5'" 1 
ATOM   1149 C "C4'" . DT  C  2 6  ? -30.227 10.513 -44.644 1.00 32.05 ? 6   DT  C "C4'" 1 
ATOM   1150 O "O4'" . DT  C  2 6  ? -30.856 10.818 -43.371 1.00 27.81 ? 6   DT  C "O4'" 1 
ATOM   1151 C "C3'" . DT  C  2 6  ? -29.374 11.743 -45.002 1.00 30.73 ? 6   DT  C "C3'" 1 
ATOM   1152 O "O3'" . DT  C  2 6  ? -29.837 12.184 -46.286 1.00 30.37 ? 6   DT  C "O3'" 1 
ATOM   1153 C "C2'" . DT  C  2 6  ? -29.594 12.688 -43.822 1.00 27.43 ? 6   DT  C "C2'" 1 
ATOM   1154 C "C1'" . DT  C  2 6  ? -30.921 12.214 -43.275 1.00 25.33 ? 6   DT  C "C1'" 1 
ATOM   1155 N N1    . DT  C  2 6  ? -31.201 12.573 -41.841 1.00 22.59 ? 6   DT  C N1    1 
ATOM   1156 C C2    . DT  C  2 6  ? -32.381 13.216 -41.575 1.00 20.70 ? 6   DT  C C2    1 
ATOM   1157 O O2    . DT  C  2 6  ? -33.185 13.517 -42.444 1.00 19.48 ? 6   DT  C O2    1 
ATOM   1158 N N3    . DT  C  2 6  ? -32.567 13.549 -40.254 1.00 18.98 ? 6   DT  C N3    1 
ATOM   1159 C C4    . DT  C  2 6  ? -31.731 13.268 -39.200 1.00 18.97 ? 6   DT  C C4    1 
ATOM   1160 O O4    . DT  C  2 6  ? -32.057 13.588 -38.066 1.00 19.10 ? 6   DT  C O4    1 
ATOM   1161 C C5    . DT  C  2 6  ? -30.513 12.572 -39.548 1.00 21.53 ? 6   DT  C C5    1 
ATOM   1162 C C7    . DT  C  2 6  ? -29.533 12.235 -38.468 1.00 23.52 ? 6   DT  C C7    1 
ATOM   1163 C C6    . DT  C  2 6  ? -30.311 12.265 -40.833 1.00 22.24 ? 6   DT  C C6    1 
ATOM   1164 P P     . DG  C  2 7  ? -29.527 13.634 -46.886 1.00 31.61 ? 7   DG  C P     1 
ATOM   1165 O OP1   . DG  C  2 7  ? -29.427 13.472 -48.317 1.00 34.87 ? 7   DG  C OP1   1 
ATOM   1166 O OP2   . DG  C  2 7  ? -28.401 14.300 -46.139 1.00 30.49 ? 7   DG  C OP2   1 
ATOM   1167 O "O5'" . DG  C  2 7  ? -30.858 14.457 -46.615 1.00 29.06 ? 7   DG  C "O5'" 1 
ATOM   1168 C "C5'" . DG  C  2 7  ? -32.152 13.915 -46.999 1.00 29.14 ? 7   DG  C "C5'" 1 
ATOM   1169 C "C4'" . DG  C  2 7  ? -33.203 14.998 -46.929 1.00 28.50 ? 7   DG  C "C4'" 1 
ATOM   1170 O "O4'" . DG  C  2 7  ? -33.495 15.334 -45.543 1.00 25.67 ? 7   DG  C "O4'" 1 
ATOM   1171 C "C3'" . DG  C  2 7  ? -32.827 16.315 -47.594 1.00 29.93 ? 7   DG  C "C3'" 1 
ATOM   1172 O "O3'" . DG  C  2 7  ? -34.052 16.873 -48.063 1.00 31.60 ? 7   DG  C "O3'" 1 
ATOM   1173 C "C2'" . DG  C  2 7  ? -32.219 17.118 -46.453 1.00 28.21 ? 7   DG  C "C2'" 1 
ATOM   1174 C "C1'" . DG  C  2 7  ? -33.042 16.678 -45.252 1.00 25.93 ? 7   DG  C "C1'" 1 
ATOM   1175 N N9    . DG  C  2 7  ? -32.340 16.636 -43.969 1.00 23.84 ? 7   DG  C N9    1 
ATOM   1176 C C8    . DG  C  2 7  ? -31.187 15.946 -43.698 1.00 24.30 ? 7   DG  C C8    1 
ATOM   1177 N N7    . DG  C  2 7  ? -30.848 15.988 -42.436 1.00 23.99 ? 7   DG  C N7    1 
ATOM   1178 C C5    . DG  C  2 7  ? -31.855 16.725 -41.832 1.00 21.26 ? 7   DG  C C5    1 
ATOM   1179 C C6    . DG  C  2 7  ? -32.023 17.106 -40.479 1.00 20.69 ? 7   DG  C C6    1 
ATOM   1180 O O6    . DG  C  2 7  ? -31.291 16.864 -39.522 1.00 20.17 ? 7   DG  C O6    1 
ATOM   1181 N N1    . DG  C  2 7  ? -33.163 17.883 -40.301 1.00 20.45 ? 7   DG  C N1    1 
ATOM   1182 C C2    . DG  C  2 7  ? -34.050 18.219 -41.293 1.00 21.24 ? 7   DG  C C2    1 
ATOM   1183 N N2    . DG  C  2 7  ? -35.118 18.944 -40.917 1.00 21.01 ? 7   DG  C N2    1 
ATOM   1184 N N3    . DG  C  2 7  ? -33.916 17.849 -42.562 1.00 22.09 ? 7   DG  C N3    1 
ATOM   1185 C C4    . DG  C  2 7  ? -32.789 17.130 -42.760 1.00 22.66 ? 7   DG  C C4    1 
ATOM   1186 P P     . DT  C  2 8  ? -34.088 18.213 -48.893 1.00 35.56 ? 8   DT  C P     1 
ATOM   1187 O OP1   . DT  C  2 8  ? -35.372 18.220 -49.664 1.00 38.36 ? 8   DT  C OP1   1 
ATOM   1188 O OP2   . DT  C  2 8  ? -32.787 18.391 -49.606 1.00 37.30 ? 8   DT  C OP2   1 
ATOM   1189 O "O5'" . DT  C  2 8  ? -34.156 19.362 -47.792 1.00 36.58 ? 8   DT  C "O5'" 1 
ATOM   1190 C "C5'" . DT  C  2 8  ? -35.327 19.568 -46.970 1.00 36.98 ? 8   DT  C "C5'" 1 
ATOM   1191 C "C4'" . DT  C  2 8  ? -35.139 20.792 -46.095 1.00 38.16 ? 8   DT  C "C4'" 1 
ATOM   1192 O "O4'" . DT  C  2 8  ? -34.386 20.472 -44.886 1.00 35.77 ? 8   DT  C "O4'" 1 
ATOM   1193 C "C3'" . DT  C  2 8  ? -34.379 21.945 -46.751 1.00 40.58 ? 8   DT  C "C3'" 1 
ATOM   1194 O "O3'" . DT  C  2 8  ? -34.939 23.181 -46.307 1.00 44.64 ? 8   DT  C "O3'" 1 
ATOM   1195 C "C2'" . DT  C  2 8  ? -32.988 21.833 -46.156 1.00 38.47 ? 8   DT  C "C2'" 1 
ATOM   1196 C "C1'" . DT  C  2 8  ? -33.363 21.458 -44.727 1.00 33.45 ? 8   DT  C "C1'" 1 
ATOM   1197 N N1    . DT  C  2 8  ? -32.318 20.899 -43.829 1.00 29.69 ? 8   DT  C N1    1 
ATOM   1198 C C2    . DT  C  2 8  ? -32.487 21.084 -42.466 1.00 26.41 ? 8   DT  C C2    1 
ATOM   1199 O O2    . DT  C  2 8  ? -33.419 21.712 -41.987 1.00 25.73 ? 8   DT  C O2    1 
ATOM   1200 N N3    . DT  C  2 8  ? -31.526 20.500 -41.686 1.00 23.35 ? 8   DT  C N3    1 
ATOM   1201 C C4    . DT  C  2 8  ? -30.437 19.770 -42.108 1.00 25.72 ? 8   DT  C C4    1 
ATOM   1202 O O4    . DT  C  2 8  ? -29.655 19.307 -41.279 1.00 24.47 ? 8   DT  C O4    1 
ATOM   1203 C C5    . DT  C  2 8  ? -30.310 19.622 -43.551 1.00 27.09 ? 8   DT  C C5    1 
ATOM   1204 C C7    . DT  C  2 8  ? -29.158 18.848 -44.105 1.00 28.67 ? 8   DT  C C7    1 
ATOM   1205 C C6    . DT  C  2 8  ? -31.247 20.183 -44.325 1.00 28.77 ? 8   DT  C C6    1 
ATOM   1206 P P     . DA  C  2 9  ? -35.622 24.171 -47.351 1.00 48.02 ? 9   DA  C P     1 
ATOM   1207 O OP1   . DA  C  2 9  ? -36.583 23.381 -48.158 1.00 48.41 ? 9   DA  C OP1   1 
ATOM   1208 O OP2   . DA  C  2 9  ? -34.529 24.937 -48.023 1.00 47.71 ? 9   DA  C OP2   1 
ATOM   1209 O "O5'" . DA  C  2 9  ? -36.448 25.147 -46.409 1.00 45.03 ? 9   DA  C "O5'" 1 
ATOM   1210 C "C5'" . DA  C  2 9  ? -37.358 24.645 -45.417 1.00 43.60 ? 9   DA  C "C5'" 1 
ATOM   1211 C "C4'" . DA  C  2 9  ? -37.352 25.542 -44.199 1.00 41.76 ? 9   DA  C "C4'" 1 
ATOM   1212 O "O4'" . DA  C  2 9  ? -36.251 25.205 -43.323 1.00 38.01 ? 9   DA  C "O4'" 1 
ATOM   1213 C "C3'" . DA  C  2 9  ? -37.203 27.030 -44.487 1.00 43.43 ? 9   DA  C "C3'" 1 
ATOM   1214 O "O3'" . DA  C  2 9  ? -38.074 27.712 -43.577 1.00 43.87 ? 9   DA  C "O3'" 1 
ATOM   1215 C "C2'" . DA  C  2 9  ? -35.707 27.267 -44.310 1.00 40.67 ? 9   DA  C "C2'" 1 
ATOM   1216 C "C1'" . DA  C  2 9  ? -35.349 26.298 -43.202 1.00 36.65 ? 9   DA  C "C1'" 1 
ATOM   1217 N N9    . DA  C  2 9  ? -34.003 25.738 -43.212 1.00 34.24 ? 9   DA  C N9    1 
ATOM   1218 C C8    . DA  C  2 9  ? -33.253 25.337 -44.288 1.00 34.95 ? 9   DA  C C8    1 
ATOM   1219 N N7    . DA  C  2 9  ? -32.112 24.783 -43.959 1.00 33.15 ? 9   DA  C N7    1 
ATOM   1220 C C5    . DA  C  2 9  ? -32.119 24.803 -42.574 1.00 30.02 ? 9   DA  C C5    1 
ATOM   1221 C C6    . DA  C  2 9  ? -31.198 24.349 -41.621 1.00 28.54 ? 9   DA  C C6    1 
ATOM   1222 N N6    . DA  C  2 9  ? -30.043 23.760 -41.933 1.00 28.06 ? 9   DA  C N6    1 
ATOM   1223 N N1    . DA  C  2 9  ? -31.522 24.491 -40.315 1.00 27.17 ? 9   DA  C N1    1 
ATOM   1224 C C2    . DA  C  2 9  ? -32.686 25.077 -40.004 1.00 27.77 ? 9   DA  C C2    1 
ATOM   1225 N N3    . DA  C  2 9  ? -33.640 25.532 -40.811 1.00 29.93 ? 9   DA  C N3    1 
ATOM   1226 C C4    . DA  C  2 9  ? -33.289 25.367 -42.099 1.00 30.84 ? 9   DA  C C4    1 
ATOM   1227 P P     . DG  C  2 10 ? -38.329 29.283 -43.705 1.00 48.66 ? 10  DG  C P     1 
ATOM   1228 O OP1   . DG  C  2 10 ? -39.701 29.559 -43.221 1.00 50.42 ? 10  DG  C OP1   1 
ATOM   1229 O OP2   . DG  C  2 10 ? -37.888 29.770 -45.054 1.00 47.69 ? 10  DG  C OP2   1 
ATOM   1230 O "O5'" . DG  C  2 10 ? -37.336 29.864 -42.607 1.00 45.56 ? 10  DG  C "O5'" 1 
ATOM   1231 C "C5'" . DG  C  2 10 ? -37.535 29.509 -41.247 1.00 42.20 ? 10  DG  C "C5'" 1 
ATOM   1232 C "C4'" . DG  C  2 10 ? -36.344 29.938 -40.438 1.00 40.72 ? 10  DG  C "C4'" 1 
ATOM   1233 O "O4'" . DG  C  2 10 ? -35.177 29.149 -40.783 1.00 37.74 ? 10  DG  C "O4'" 1 
ATOM   1234 C "C3'" . DG  C  2 10 ? -35.940 31.407 -40.622 1.00 42.59 ? 10  DG  C "C3'" 1 
ATOM   1235 O "O3'" . DG  C  2 10 ? -35.680 31.821 -39.299 1.00 43.51 ? 10  DG  C "O3'" 1 
ATOM   1236 C "C2'" . DG  C  2 10 ? -34.655 31.319 -41.426 1.00 40.91 ? 10  DG  C "C2'" 1 
ATOM   1237 C "C1'" . DG  C  2 10 ? -34.079 30.016 -40.898 1.00 38.23 ? 10  DG  C "C1'" 1 
ATOM   1238 N N9    . DG  C  2 10 ? -33.080 29.367 -41.733 1.00 37.05 ? 10  DG  C N9    1 
ATOM   1239 C C8    . DG  C  2 10 ? -33.029 29.329 -43.106 1.00 37.69 ? 10  DG  C C8    1 
ATOM   1240 N N7    . DG  C  2 10 ? -31.995 28.672 -43.560 1.00 37.33 ? 10  DG  C N7    1 
ATOM   1241 C C5    . DG  C  2 10 ? -31.315 28.267 -42.420 1.00 35.12 ? 10  DG  C C5    1 
ATOM   1242 C C6    . DG  C  2 10 ? -30.114 27.530 -42.281 1.00 34.24 ? 10  DG  C C6    1 
ATOM   1243 O O6    . DG  C  2 10 ? -29.390 27.066 -43.168 1.00 35.76 ? 10  DG  C O6    1 
ATOM   1244 N N1    . DG  C  2 10 ? -29.784 27.333 -40.939 1.00 32.01 ? 10  DG  C N1    1 
ATOM   1245 C C2    . DG  C  2 10 ? -30.514 27.797 -39.873 1.00 31.22 ? 10  DG  C C2    1 
ATOM   1246 N N2    . DG  C  2 10 ? -30.032 27.519 -38.653 1.00 30.94 ? 10  DG  C N2    1 
ATOM   1247 N N3    . DG  C  2 10 ? -31.627 28.498 -39.993 1.00 32.88 ? 10  DG  C N3    1 
ATOM   1248 C C4    . DG  C  2 10 ? -31.969 28.690 -41.284 1.00 34.41 ? 10  DG  C C4    1 
ATOM   1249 P P     . DG  C  2 11 ? -35.847 33.286 -38.820 1.00 47.45 ? 11  DG  C P     1 
ATOM   1250 O OP1   . DG  C  2 11 ? -37.209 33.404 -38.237 1.00 51.71 ? 11  DG  C OP1   1 
ATOM   1251 O OP2   . DG  C  2 11 ? -35.411 34.208 -39.900 1.00 47.11 ? 11  DG  C OP2   1 
ATOM   1252 O "O5'" . DG  C  2 11 ? -34.808 33.328 -37.618 1.00 44.09 ? 11  DG  C "O5'" 1 
ATOM   1253 C "C5'" . DG  C  2 11 ? -34.693 32.211 -36.695 1.00 39.78 ? 11  DG  C "C5'" 1 
ATOM   1254 C "C4'" . DG  C  2 11 ? -33.293 32.119 -36.125 1.00 37.52 ? 11  DG  C "C4'" 1 
ATOM   1255 O "O4'" . DG  C  2 11 ? -32.419 31.469 -37.070 1.00 35.01 ? 11  DG  C "O4'" 1 
ATOM   1256 C "C3'" . DG  C  2 11 ? -32.641 33.454 -35.780 1.00 38.68 ? 11  DG  C "C3'" 1 
ATOM   1257 O "O3'" . DG  C  2 11 ? -32.036 33.355 -34.491 1.00 38.66 ? 11  DG  C "O3'" 1 
ATOM   1258 C "C2'" . DG  C  2 11 ? -31.651 33.674 -36.912 1.00 37.91 ? 11  DG  C "C2'" 1 
ATOM   1259 C "C1'" . DG  C  2 11 ? -31.259 32.252 -37.289 1.00 35.02 ? 11  DG  C "C1'" 1 
ATOM   1260 N N9    . DG  C  2 11 ? -30.855 32.060 -38.683 1.00 34.66 ? 11  DG  C N9    1 
ATOM   1261 C C8    . DG  C  2 11 ? -31.533 32.490 -39.798 1.00 35.92 ? 11  DG  C C8    1 
ATOM   1262 N N7    . DG  C  2 11 ? -30.962 32.131 -40.916 1.00 35.45 ? 11  DG  C N7    1 
ATOM   1263 C C5    . DG  C  2 11 ? -29.853 31.399 -40.517 1.00 33.14 ? 11  DG  C C5    1 
ATOM   1264 C C6    . DG  C  2 11 ? -28.841 30.773 -41.287 1.00 32.46 ? 11  DG  C C6    1 
ATOM   1265 O O6    . DG  C  2 11 ? -28.720 30.737 -42.515 1.00 33.59 ? 11  DG  C O6    1 
ATOM   1266 N N1    . DG  C  2 11 ? -27.885 30.166 -40.482 1.00 31.54 ? 11  DG  C N1    1 
ATOM   1267 C C2    . DG  C  2 11 ? -27.905 30.152 -39.111 1.00 31.90 ? 11  DG  C C2    1 
ATOM   1268 N N2    . DG  C  2 11 ? -26.904 29.494 -38.512 1.00 32.55 ? 11  DG  C N2    1 
ATOM   1269 N N3    . DG  C  2 11 ? -28.839 30.740 -38.378 1.00 32.21 ? 11  DG  C N3    1 
ATOM   1270 C C4    . DG  C  2 11 ? -29.771 31.346 -39.141 1.00 33.10 ? 11  DG  C C4    1 
ATOM   1271 P P     . DC  C  2 12 ? -31.606 34.660 -33.706 1.00 41.65 ? 12  DC  C P     1 
ATOM   1272 O OP1   . DC  C  2 12 ? -31.589 34.329 -32.267 1.00 47.50 ? 12  DC  C OP1   1 
ATOM   1273 O OP2   . DC  C  2 12 ? -32.426 35.803 -34.168 1.00 42.79 ? 12  DC  C OP2   1 
ATOM   1274 O "O5'" . DC  C  2 12 ? -30.060 34.802 -34.064 1.00 42.49 ? 12  DC  C "O5'" 1 
ATOM   1275 C "C5'" . DC  C  2 12 ? -29.189 33.700 -33.702 1.00 40.19 ? 12  DC  C "C5'" 1 
ATOM   1276 C "C4'" . DC  C  2 12 ? -27.944 33.670 -34.556 1.00 38.42 ? 12  DC  C "C4'" 1 
ATOM   1277 O "O4'" . DC  C  2 12 ? -28.256 33.402 -35.930 1.00 35.87 ? 12  DC  C "O4'" 1 
ATOM   1278 C "C3'" . DC  C  2 12 ? -27.142 34.957 -34.595 1.00 39.33 ? 12  DC  C "C3'" 1 
ATOM   1279 O "O3'" . DC  C  2 12 ? -26.251 35.002 -33.486 1.00 41.98 ? 12  DC  C "O3'" 1 
ATOM   1280 C "C2'" . DC  C  2 12 ? -26.410 34.870 -35.929 1.00 37.78 ? 12  DC  C "C2'" 1 
ATOM   1281 C "C1'" . DC  C  2 12 ? -27.086 33.713 -36.663 1.00 34.86 ? 12  DC  C "C1'" 1 
ATOM   1282 N N1    . DC  C  2 12 ? -27.484 33.987 -38.053 1.00 34.07 ? 12  DC  C N1    1 
ATOM   1283 C C2    . DC  C  2 12 ? -26.777 33.369 -39.095 1.00 32.56 ? 12  DC  C C2    1 
ATOM   1284 O O2    . DC  C  2 12 ? -25.825 32.629 -38.817 1.00 31.91 ? 12  DC  C O2    1 
ATOM   1285 N N3    . DC  C  2 12 ? -27.156 33.586 -40.372 1.00 32.37 ? 12  DC  C N3    1 
ATOM   1286 C C4    . DC  C  2 12 ? -28.185 34.392 -40.632 1.00 34.77 ? 12  DC  C C4    1 
ATOM   1287 N N4    . DC  C  2 12 ? -28.519 34.587 -41.912 1.00 36.71 ? 12  DC  C N4    1 
ATOM   1288 C C5    . DC  C  2 12 ? -28.914 35.047 -39.593 1.00 35.24 ? 12  DC  C C5    1 
ATOM   1289 C C6    . DC  C  2 12 ? -28.534 34.817 -38.331 1.00 34.45 ? 12  DC  C C6    1 
ATOM   1290 O "O5'" . DG  D  3 1  ? -19.743 32.392 -47.884 1.00 59.35 ? 1   DG  D "O5'" 1 
ATOM   1291 C "C5'" . DG  D  3 1  ? -20.145 31.016 -47.905 1.00 55.23 ? 1   DG  D "C5'" 1 
ATOM   1292 C "C4'" . DG  D  3 1  ? -19.900 30.400 -46.548 1.00 53.41 ? 1   DG  D "C4'" 1 
ATOM   1293 O "O4'" . DG  D  3 1  ? -20.722 31.054 -45.552 1.00 49.02 ? 1   DG  D "O4'" 1 
ATOM   1294 C "C3'" . DG  D  3 1  ? -20.264 28.928 -46.442 1.00 51.49 ? 1   DG  D "C3'" 1 
ATOM   1295 O "O3'" . DG  D  3 1  ? -19.522 28.414 -45.348 1.00 54.66 ? 1   DG  D "O3'" 1 
ATOM   1296 C "C2'" . DG  D  3 1  ? -21.736 28.980 -46.097 1.00 47.06 ? 1   DG  D "C2'" 1 
ATOM   1297 C "C1'" . DG  D  3 1  ? -21.771 30.177 -45.150 1.00 45.18 ? 1   DG  D "C1'" 1 
ATOM   1298 N N9    . DG  D  3 1  ? -23.019 30.925 -45.169 1.00 42.03 ? 1   DG  D N9    1 
ATOM   1299 C C8    . DG  D  3 1  ? -23.734 31.326 -46.271 1.00 42.04 ? 1   DG  D C8    1 
ATOM   1300 N N7    . DG  D  3 1  ? -24.817 31.983 -45.965 1.00 40.79 ? 1   DG  D N7    1 
ATOM   1301 C C5    . DG  D  3 1  ? -24.823 32.008 -44.577 1.00 39.24 ? 1   DG  D C5    1 
ATOM   1302 C C6    . DG  D  3 1  ? -25.757 32.576 -43.673 1.00 37.02 ? 1   DG  D C6    1 
ATOM   1303 O O6    . DG  D  3 1  ? -26.795 33.186 -43.927 1.00 35.94 ? 1   DG  D O6    1 
ATOM   1304 N N1    . DG  D  3 1  ? -25.378 32.371 -42.349 1.00 36.40 ? 1   DG  D N1    1 
ATOM   1305 C C2    . DG  D  3 1  ? -24.240 31.710 -41.947 1.00 37.24 ? 1   DG  D C2    1 
ATOM   1306 N N2    . DG  D  3 1  ? -24.032 31.624 -40.623 1.00 36.96 ? 1   DG  D N2    1 
ATOM   1307 N N3    . DG  D  3 1  ? -23.365 31.176 -42.782 1.00 37.96 ? 1   DG  D N3    1 
ATOM   1308 C C4    . DG  D  3 1  ? -23.722 31.355 -44.072 1.00 39.58 ? 1   DG  D C4    1 
ATOM   1309 P P     . DC  D  3 2  ? -19.459 26.857 -45.076 1.00 58.28 ? 2   DC  D P     1 
ATOM   1310 O OP1   . DC  D  3 2  ? -18.016 26.481 -45.024 1.00 59.73 ? 2   DC  D OP1   1 
ATOM   1311 O OP2   . DC  D  3 2  ? -20.420 26.156 -45.991 1.00 58.03 ? 2   DC  D OP2   1 
ATOM   1312 O "O5'" . DC  D  3 2  ? -20.059 26.719 -43.613 1.00 53.87 ? 2   DC  D "O5'" 1 
ATOM   1313 C "C5'" . DC  D  3 2  ? -19.387 27.350 -42.524 1.00 57.17 ? 2   DC  D "C5'" 1 
ATOM   1314 C "C4'" . DC  D  3 2  ? -20.224 27.209 -41.282 1.00 55.39 ? 2   DC  D "C4'" 1 
ATOM   1315 O "O4'" . DC  D  3 2  ? -21.469 27.932 -41.453 1.00 52.44 ? 2   DC  D "O4'" 1 
ATOM   1316 C "C3'" . DC  D  3 2  ? -20.603 25.760 -40.983 1.00 55.16 ? 2   DC  D "C3'" 1 
ATOM   1317 O "O3'" . DC  D  3 2  ? -20.223 25.504 -39.627 1.00 57.45 ? 2   DC  D "O3'" 1 
ATOM   1318 C "C2'" . DC  D  3 2  ? -22.078 25.687 -41.361 1.00 50.66 ? 2   DC  D "C2'" 1 
ATOM   1319 C "C1'" . DC  D  3 2  ? -22.561 27.109 -41.119 1.00 48.36 ? 2   DC  D "C1'" 1 
ATOM   1320 N N1    . DC  D  3 2  ? -23.730 27.578 -41.908 1.00 43.19 ? 2   DC  D N1    1 
ATOM   1321 C C2    . DC  D  3 2  ? -24.783 28.243 -41.250 1.00 39.58 ? 2   DC  D C2    1 
ATOM   1322 O O2    . DC  D  3 2  ? -24.732 28.383 -40.014 1.00 38.27 ? 2   DC  D O2    1 
ATOM   1323 N N3    . DC  D  3 2  ? -25.823 28.712 -41.976 1.00 36.80 ? 2   DC  D N3    1 
ATOM   1324 C C4    . DC  D  3 2  ? -25.839 28.550 -43.301 1.00 38.93 ? 2   DC  D C4    1 
ATOM   1325 N N4    . DC  D  3 2  ? -26.891 29.023 -43.978 1.00 39.02 ? 2   DC  D N4    1 
ATOM   1326 C C5    . DC  D  3 2  ? -24.786 27.880 -43.994 1.00 40.32 ? 2   DC  D C5    1 
ATOM   1327 C C6    . DC  D  3 2  ? -23.753 27.432 -43.267 1.00 41.93 ? 2   DC  D C6    1 
ATOM   1328 P P     . DC  D  3 3  ? -20.525 24.097 -38.949 1.00 55.92 ? 3   DC  D P     1 
ATOM   1329 O OP1   . DC  D  3 3  ? -19.350 23.751 -38.105 1.00 58.76 ? 3   DC  D OP1   1 
ATOM   1330 O OP2   . DC  D  3 3  ? -21.067 23.161 -39.973 1.00 50.80 ? 3   DC  D OP2   1 
ATOM   1331 O "O5'" . DC  D  3 3  ? -21.733 24.438 -37.997 1.00 48.91 ? 3   DC  D "O5'" 1 
ATOM   1332 C "C5'" . DC  D  3 3  ? -21.671 25.591 -37.155 1.00 47.87 ? 3   DC  D "C5'" 1 
ATOM   1333 C "C4'" . DC  D  3 3  ? -23.005 25.742 -36.480 1.00 43.67 ? 3   DC  D "C4'" 1 
ATOM   1334 O "O4'" . DC  D  3 3  ? -23.982 26.149 -37.466 1.00 40.04 ? 3   DC  D "O4'" 1 
ATOM   1335 C "C3'" . DC  D  3 3  ? -23.516 24.436 -35.873 1.00 42.90 ? 3   DC  D "C3'" 1 
ATOM   1336 O "O3'" . DC  D  3 3  ? -23.860 24.744 -34.532 1.00 45.39 ? 3   DC  D "O3'" 1 
ATOM   1337 C "C2'" . DC  D  3 3  ? -24.637 24.001 -36.813 1.00 38.76 ? 3   DC  D "C2'" 1 
ATOM   1338 C "C1'" . DC  D  3 3  ? -25.118 25.307 -37.419 1.00 37.31 ? 3   DC  D "C1'" 1 
ATOM   1339 N N1    . DC  D  3 3  ? -25.681 25.239 -38.789 1.00 34.34 ? 3   DC  D N1    1 
ATOM   1340 C C2    . DC  D  3 3  ? -26.943 25.798 -39.041 1.00 32.21 ? 3   DC  D C2    1 
ATOM   1341 O O2    . DC  D  3 3  ? -27.584 26.289 -38.100 1.00 30.81 ? 3   DC  D O2    1 
ATOM   1342 N N3    . DC  D  3 3  ? -27.438 25.772 -40.300 1.00 31.41 ? 3   DC  D N3    1 
ATOM   1343 C C4    . DC  D  3 3  ? -26.735 25.210 -41.282 1.00 32.56 ? 3   DC  D C4    1 
ATOM   1344 N N4    . DC  D  3 3  ? -27.268 25.203 -42.504 1.00 32.96 ? 3   DC  D N4    1 
ATOM   1345 C C5    . DC  D  3 3  ? -25.457 24.621 -41.053 1.00 35.16 ? 3   DC  D C5    1 
ATOM   1346 C C6    . DC  D  3 3  ? -24.966 24.673 -39.805 1.00 35.33 ? 3   DC  D C6    1 
ATOM   1347 P P     . DT  D  3 4  ? -24.472 23.648 -33.582 1.00 49.48 ? 4   DT  D P     1 
ATOM   1348 O OP1   . DT  D  3 4  ? -23.848 23.837 -32.224 1.00 51.74 ? 4   DT  D OP1   1 
ATOM   1349 O OP2   . DT  D  3 4  ? -24.418 22.317 -34.259 1.00 45.85 ? 4   DT  D OP2   1 
ATOM   1350 O "O5'" . DT  D  3 4  ? -25.996 24.101 -33.504 1.00 43.21 ? 4   DT  D "O5'" 1 
ATOM   1351 C "C5'" . DT  D  3 4  ? -26.310 25.479 -33.271 1.00 41.58 ? 4   DT  D "C5'" 1 
ATOM   1352 C "C4'" . DT  D  3 4  ? -27.805 25.667 -33.255 1.00 39.12 ? 4   DT  D "C4'" 1 
ATOM   1353 O "O4'" . DT  D  3 4  ? -28.321 25.490 -34.601 1.00 36.52 ? 4   DT  D "O4'" 1 
ATOM   1354 C "C3'" . DT  D  3 4  ? -28.583 24.694 -32.363 1.00 37.64 ? 4   DT  D "C3'" 1 
ATOM   1355 O "O3'" . DT  D  3 4  ? -29.545 25.515 -31.686 1.00 38.48 ? 4   DT  D "O3'" 1 
ATOM   1356 C "C2'" . DT  D  3 4  ? -29.129 23.662 -33.347 1.00 34.28 ? 4   DT  D "C2'" 1 
ATOM   1357 C "C1'" . DT  D  3 4  ? -29.311 24.468 -34.641 1.00 33.10 ? 4   DT  D "C1'" 1 
ATOM   1358 N N1    . DT  D  3 4  ? -29.172 23.802 -35.969 1.00 30.21 ? 4   DT  D N1    1 
ATOM   1359 C C2    . DT  D  3 4  ? -30.011 24.232 -36.976 1.00 28.61 ? 4   DT  D C2    1 
ATOM   1360 O O2    . DT  D  3 4  ? -30.946 24.988 -36.789 1.00 27.78 ? 4   DT  D O2    1 
ATOM   1361 N N3    . DT  D  3 4  ? -29.740 23.703 -38.211 1.00 28.52 ? 4   DT  D N3    1 
ATOM   1362 C C4    . DT  D  3 4  ? -28.730 22.821 -38.539 1.00 29.54 ? 4   DT  D C4    1 
ATOM   1363 O O4    . DT  D  3 4  ? -28.617 22.424 -39.696 1.00 30.94 ? 4   DT  D O4    1 
ATOM   1364 C C5    . DT  D  3 4  ? -27.867 22.440 -37.448 1.00 31.08 ? 4   DT  D C5    1 
ATOM   1365 C C7    . DT  D  3 4  ? -26.743 21.487 -37.714 1.00 32.03 ? 4   DT  D C7    1 
ATOM   1366 C C6    . DT  D  3 4  ? -28.106 22.972 -36.238 1.00 30.52 ? 4   DT  D C6    1 
ATOM   1367 P P     . DA  D  3 5  ? -30.415 24.965 -30.444 1.00 38.51 ? 5   DA  D P     1 
ATOM   1368 O OP1   . DA  D  3 5  ? -30.792 26.139 -29.618 1.00 41.07 ? 5   DA  D OP1   1 
ATOM   1369 O OP2   . DA  D  3 5  ? -29.743 23.794 -29.839 1.00 39.90 ? 5   DA  D OP2   1 
ATOM   1370 O "O5'" . DA  D  3 5  ? -31.696 24.313 -31.136 1.00 34.28 ? 5   DA  D "O5'" 1 
ATOM   1371 C "C5'" . DA  D  3 5  ? -32.598 25.116 -31.910 1.00 32.59 ? 5   DA  D "C5'" 1 
ATOM   1372 C "C4'" . DA  D  3 5  ? -33.483 24.252 -32.782 1.00 29.69 ? 5   DA  D "C4'" 1 
ATOM   1373 O "O4'" . DA  D  3 5  ? -32.730 23.733 -33.893 1.00 28.03 ? 5   DA  D "O4'" 1 
ATOM   1374 C "C3'" . DA  D  3 5  ? -34.114 23.032 -32.095 1.00 29.94 ? 5   DA  D "C3'" 1 
ATOM   1375 O "O3'" . DA  D  3 5  ? -35.450 23.397 -31.705 1.00 31.01 ? 5   DA  D "O3'" 1 
ATOM   1376 C "C2'" . DA  D  3 5  ? -33.966 21.904 -33.120 1.00 26.66 ? 5   DA  D "C2'" 1 
ATOM   1377 C "C1'" . DA  D  3 5  ? -33.375 22.566 -34.358 1.00 26.15 ? 5   DA  D "C1'" 1 
ATOM   1378 N N9    . DA  D  3 5  ? -32.389 21.761 -35.088 1.00 24.39 ? 5   DA  D N9    1 
ATOM   1379 C C8    . DA  D  3 5  ? -31.331 21.055 -34.571 1.00 25.19 ? 5   DA  D C8    1 
ATOM   1380 N N7    . DA  D  3 5  ? -30.612 20.438 -35.477 1.00 23.81 ? 5   DA  D N7    1 
ATOM   1381 C C5    . DA  D  3 5  ? -31.224 20.777 -36.675 1.00 23.90 ? 5   DA  D C5    1 
ATOM   1382 C C6    . DA  D  3 5  ? -30.963 20.409 -38.014 1.00 23.64 ? 5   DA  D C6    1 
ATOM   1383 N N6    . DA  D  3 5  ? -29.957 19.613 -38.383 1.00 23.63 ? 5   DA  D N6    1 
ATOM   1384 N N1    . DA  D  3 5  ? -31.774 20.906 -38.968 1.00 22.93 ? 5   DA  D N1    1 
ATOM   1385 C C2    . DA  D  3 5  ? -32.800 21.689 -38.596 1.00 23.33 ? 5   DA  D C2    1 
ATOM   1386 N N3    . DA  D  3 5  ? -33.156 22.091 -37.376 1.00 23.25 ? 5   DA  D N3    1 
ATOM   1387 C C4    . DA  D  3 5  ? -32.331 21.578 -36.448 1.00 24.03 ? 5   DA  D C4    1 
HETATM 1388 N N1    . 5CM D  3 6  ? -35.462 19.469 -36.017 1.00 23.92 ? 6   5CM D N1    1 
HETATM 1389 C C2    . 5CM D  3 6  ? -34.970 19.278 -37.347 1.00 22.70 ? 6   5CM D C2    1 
HETATM 1390 N N3    . 5CM D  3 6  ? -33.819 18.608 -37.574 1.00 21.52 ? 6   5CM D N3    1 
HETATM 1391 C C4    . 5CM D  3 6  ? -33.084 18.120 -36.547 1.00 21.26 ? 6   5CM D C4    1 
HETATM 1392 C C5    . 5CM D  3 6  ? -33.571 18.318 -35.167 1.00 23.52 ? 6   5CM D C5    1 
HETATM 1393 C C5A   . 5CM D  3 6  ? -32.801 17.746 -33.995 1.00 25.46 ? 6   5CM D C5A   1 
HETATM 1394 C C6    . 5CM D  3 6  ? -34.764 18.996 -34.969 1.00 23.78 ? 6   5CM D C6    1 
HETATM 1395 O O2    . 5CM D  3 6  ? -35.602 19.767 -38.333 1.00 22.19 ? 6   5CM D O2    1 
HETATM 1396 N N4    . 5CM D  3 6  ? -31.969 17.442 -36.791 1.00 20.43 ? 6   5CM D N4    1 
HETATM 1397 C "C1'" . 5CM D  3 6  ? -36.727 20.216 -35.838 1.00 25.66 ? 6   5CM D "C1'" 1 
HETATM 1398 C "C2'" . 5CM D  3 6  ? -37.803 19.559 -34.970 1.00 27.92 ? 6   5CM D "C2'" 1 
HETATM 1399 C "C3'" . 5CM D  3 6  ? -38.718 20.730 -34.717 1.00 29.73 ? 6   5CM D "C3'" 1 
HETATM 1400 C "C4'" . 5CM D  3 6  ? -37.809 21.960 -34.774 1.00 28.92 ? 6   5CM D "C4'" 1 
HETATM 1401 O "O4'" . 5CM D  3 6  ? -36.526 21.507 -35.241 1.00 27.45 ? 6   5CM D "O4'" 1 
HETATM 1402 O "O3'" . 5CM D  3 6  ? -39.508 20.926 -35.851 1.00 32.64 ? 6   5CM D "O3'" 1 
HETATM 1403 C "C5'" . 5CM D  3 6  ? -37.679 22.671 -33.459 1.00 31.04 ? 6   5CM D "C5'" 1 
HETATM 1404 O "O5'" . 5CM D  3 6  ? -37.114 21.754 -32.544 1.00 30.70 ? 6   5CM D "O5'" 1 
HETATM 1405 P P     . 5CM D  3 6  ? -36.539 22.310 -31.212 1.00 32.52 ? 6   5CM D P     1 
HETATM 1406 O OP1   . 5CM D  3 6  ? -37.700 23.020 -30.620 1.00 35.60 ? 6   5CM D OP1   1 
HETATM 1407 O OP2   . 5CM D  3 6  ? -35.851 21.215 -30.430 1.00 33.11 ? 6   5CM D OP2   1 
ATOM   1408 P P     . DA  D  3 7  ? -40.918 20.247 -36.043 1.00 32.23 ? 7   DA  D P     1 
ATOM   1409 O OP1   . DA  D  3 7  ? -41.886 21.330 -35.911 1.00 38.31 ? 7   DA  D OP1   1 
ATOM   1410 O OP2   . DA  D  3 7  ? -41.019 19.058 -35.203 1.00 31.42 ? 7   DA  D OP2   1 
ATOM   1411 O "O5'" . DA  D  3 7  ? -40.849 19.813 -37.570 1.00 30.92 ? 7   DA  D "O5'" 1 
ATOM   1412 C "C5'" . DA  D  3 7  ? -40.335 20.758 -38.532 1.00 29.86 ? 7   DA  D "C5'" 1 
ATOM   1413 C "C4'" . DA  D  3 7  ? -40.175 20.108 -39.881 1.00 28.16 ? 7   DA  D "C4'" 1 
ATOM   1414 O "O4'" . DA  D  3 7  ? -38.943 19.361 -39.935 1.00 26.15 ? 7   DA  D "O4'" 1 
ATOM   1415 C "C3'" . DA  D  3 7  ? -41.278 19.123 -40.262 1.00 27.24 ? 7   DA  D "C3'" 1 
ATOM   1416 O "O3'" . DA  D  3 7  ? -41.449 19.299 -41.665 1.00 28.17 ? 7   DA  D "O3'" 1 
ATOM   1417 C "C2'" . DA  D  3 7  ? -40.694 17.772 -39.893 1.00 24.96 ? 7   DA  D "C2'" 1 
ATOM   1418 C "C1'" . DA  D  3 7  ? -39.203 17.966 -40.153 1.00 24.46 ? 7   DA  D "C1'" 1 
ATOM   1419 N N9    . DA  D  3 7  ? -38.283 17.232 -39.284 1.00 22.59 ? 7   DA  D N9    1 
ATOM   1420 C C8    . DA  D  3 7  ? -38.252 17.295 -37.914 1.00 21.38 ? 7   DA  D C8    1 
ATOM   1421 N N7    . DA  D  3 7  ? -37.240 16.657 -37.379 1.00 22.67 ? 7   DA  D N7    1 
ATOM   1422 C C5    . DA  D  3 7  ? -36.543 16.161 -38.472 1.00 19.99 ? 7   DA  D C5    1 
ATOM   1423 C C6    . DA  D  3 7  ? -35.379 15.375 -38.575 1.00 20.03 ? 7   DA  D C6    1 
ATOM   1424 N N6    . DA  D  3 7  ? -34.658 14.973 -37.519 1.00 19.72 ? 7   DA  D N6    1 
ATOM   1425 N N1    . DA  D  3 7  ? -34.954 15.040 -39.817 1.00 19.27 ? 7   DA  D N1    1 
ATOM   1426 C C2    . DA  D  3 7  ? -35.671 15.458 -40.872 1.00 19.04 ? 7   DA  D C2    1 
ATOM   1427 N N3    . DA  D  3 7  ? -36.770 16.214 -40.900 1.00 18.88 ? 7   DA  D N3    1 
ATOM   1428 C C4    . DA  D  3 7  ? -37.163 16.527 -39.653 1.00 19.81 ? 7   DA  D C4    1 
ATOM   1429 P P     . DT  D  3 8  ? -42.628 18.547 -42.435 1.00 30.96 ? 8   DT  D P     1 
ATOM   1430 O OP1   . DT  D  3 8  ? -42.995 19.401 -43.571 1.00 31.31 ? 8   DT  D OP1   1 
ATOM   1431 O OP2   . DT  D  3 8  ? -43.639 18.104 -41.461 1.00 29.67 ? 8   DT  D OP2   1 
ATOM   1432 O "O5'" . DT  D  3 8  ? -41.947 17.184 -42.929 1.00 26.96 ? 8   DT  D "O5'" 1 
ATOM   1433 C "C5'" . DT  D  3 8  ? -40.842 17.215 -43.838 1.00 25.47 ? 8   DT  D "C5'" 1 
ATOM   1434 C "C4'" . DT  D  3 8  ? -40.250 15.845 -44.056 1.00 24.33 ? 8   DT  D "C4'" 1 
ATOM   1435 O "O4'" . DT  D  3 8  ? -39.422 15.478 -42.938 1.00 23.07 ? 8   DT  D "O4'" 1 
ATOM   1436 C "C3'" . DT  D  3 8  ? -41.246 14.690 -44.255 1.00 23.81 ? 8   DT  D "C3'" 1 
ATOM   1437 O "O3'" . DT  D  3 8  ? -41.381 14.511 -45.691 1.00 24.34 ? 8   DT  D "O3'" 1 
ATOM   1438 C "C2'" . DT  D  3 8  ? -40.680 13.561 -43.405 1.00 21.71 ? 8   DT  D "C2'" 1 
ATOM   1439 C "C1'" . DT  D  3 8  ? -39.327 14.075 -42.897 1.00 22.16 ? 8   DT  D "C1'" 1 
ATOM   1440 N N1    . DT  D  3 8  ? -38.938 13.698 -41.511 1.00 20.46 ? 8   DT  D N1    1 
ATOM   1441 C C2    . DT  D  3 8  ? -37.740 13.043 -41.319 1.00 20.29 ? 8   DT  D C2    1 
ATOM   1442 O O2    . DT  D  3 8  ? -37.017 12.685 -42.230 1.00 21.03 ? 8   DT  D O2    1 
ATOM   1443 N N3    . DT  D  3 8  ? -37.432 12.788 -40.007 1.00 20.22 ? 8   DT  D N3    1 
ATOM   1444 C C4    . DT  D  3 8  ? -38.153 13.146 -38.895 1.00 18.96 ? 8   DT  D C4    1 
ATOM   1445 O O4    . DT  D  3 8  ? -37.730 12.852 -37.786 1.00 20.03 ? 8   DT  D O4    1 
ATOM   1446 C C5    . DT  D  3 8  ? -39.402 13.827 -39.159 1.00 18.97 ? 8   DT  D C5    1 
ATOM   1447 C C7    . DT  D  3 8  ? -40.279 14.216 -38.006 1.00 19.31 ? 8   DT  D C7    1 
ATOM   1448 C C6    . DT  D  3 8  ? -39.726 14.074 -40.439 1.00 20.36 ? 8   DT  D C6    1 
ATOM   1449 P P     . DT  D  3 9  ? -41.821 13.105 -46.337 1.00 23.70 ? 9   DT  D P     1 
ATOM   1450 O OP1   . DT  D  3 9  ? -42.302 13.388 -47.721 1.00 24.74 ? 9   DT  D OP1   1 
ATOM   1451 O OP2   . DT  D  3 9  ? -42.701 12.386 -45.357 1.00 24.07 ? 9   DT  D OP2   1 
ATOM   1452 O "O5'" . DT  D  3 9  ? -40.482 12.248 -46.338 1.00 22.40 ? 9   DT  D "O5'" 1 
ATOM   1453 C "C5'" . DT  D  3 9  ? -39.259 12.800 -46.904 1.00 24.10 ? 9   DT  D "C5'" 1 
ATOM   1454 C "C4'" . DT  D  3 9  ? -38.107 11.811 -46.836 1.00 23.73 ? 9   DT  D "C4'" 1 
ATOM   1455 O "O4'" . DT  D  3 9  ? -37.760 11.449 -45.473 1.00 21.56 ? 9   DT  D "O4'" 1 
ATOM   1456 C "C3'" . DT  D  3 9  ? -38.328 10.485 -47.567 1.00 24.65 ? 9   DT  D "C3'" 1 
ATOM   1457 O "O3'" . DT  D  3 9  ? -37.049 10.193 -48.134 1.00 26.97 ? 9   DT  D "O3'" 1 
ATOM   1458 C "C2'" . DT  D  3 9  ? -38.742 9.534  -46.451 1.00 23.63 ? 9   DT  D "C2'" 1 
ATOM   1459 C "C1'" . DT  D  3 9  ? -37.901 10.019 -45.276 1.00 22.57 ? 9   DT  D "C1'" 1 
ATOM   1460 N N1    . DT  D  3 9  ? -38.391 9.819  -43.879 1.00 20.67 ? 9   DT  D N1    1 
ATOM   1461 C C2    . DT  D  3 9  ? -37.462 9.486  -42.911 1.00 20.76 ? 9   DT  D C2    1 
ATOM   1462 O O2    . DT  D  3 9  ? -36.315 9.167  -43.164 1.00 20.56 ? 9   DT  D O2    1 
ATOM   1463 N N3    . DT  D  3 9  ? -37.950 9.471  -41.634 1.00 19.39 ? 9   DT  D N3    1 
ATOM   1464 C C4    . DT  D  3 9  ? -39.223 9.794  -41.221 1.00 19.58 ? 9   DT  D C4    1 
ATOM   1465 O O4    . DT  D  3 9  ? -39.502 9.762  -40.017 1.00 23.82 ? 9   DT  D O4    1 
ATOM   1466 C C5    . DT  D  3 9  ? -40.145 10.140 -42.277 1.00 20.62 ? 9   DT  D C5    1 
ATOM   1467 C C7    . DT  D  3 9  ? -41.568 10.461 -41.926 1.00 19.87 ? 9   DT  D C7    1 
ATOM   1468 C C6    . DT  D  3 9  ? -39.680 10.161 -43.537 1.00 20.06 ? 9   DT  D C6    1 
ATOM   1469 P P     . DC  D  3 10 ? -36.860 9.164  -49.360 1.00 30.46 ? 10  DC  D P     1 
ATOM   1470 O OP1   . DC  D  3 10 ? -35.652 9.547  -50.057 1.00 31.27 ? 10  DC  D OP1   1 
ATOM   1471 O OP2   . DC  D  3 10 ? -38.148 9.007  -50.128 1.00 31.93 ? 10  DC  D OP2   1 
ATOM   1472 O "O5'" . DC  D  3 10 ? -36.640 7.792  -48.597 1.00 29.22 ? 10  DC  D "O5'" 1 
ATOM   1473 C "C5'" . DC  D  3 10 ? -35.434 7.567  -47.856 1.00 29.54 ? 10  DC  D "C5'" 1 
ATOM   1474 C "C4'" . DC  D  3 10 ? -35.521 6.255  -47.106 1.00 29.62 ? 10  DC  D "C4'" 1 
ATOM   1475 O "O4'" . DC  D  3 10 ? -36.364 6.404  -45.924 1.00 26.45 ? 10  DC  D "O4'" 1 
ATOM   1476 C "C3'" . DC  D  3 10 ? -36.080 5.076  -47.910 1.00 31.17 ? 10  DC  D "C3'" 1 
ATOM   1477 O "O3'" . DC  D  3 10 ? -35.168 3.985  -47.799 1.00 36.00 ? 10  DC  D "O3'" 1 
ATOM   1478 C "C2'" . DC  D  3 10 ? -37.416 4.771  -47.244 1.00 29.89 ? 10  DC  D "C2'" 1 
ATOM   1479 C "C1'" . DC  D  3 10 ? -37.212 5.272  -45.813 1.00 26.29 ? 10  DC  D "C1'" 1 
ATOM   1480 N N1    . DC  D  3 10 ? -38.405 5.688  -45.056 1.00 23.10 ? 10  DC  D N1    1 
ATOM   1481 C C2    . DC  D  3 10 ? -38.371 5.610  -43.652 1.00 22.61 ? 10  DC  D C2    1 
ATOM   1482 O O2    . DC  D  3 10 ? -37.385 5.111  -43.105 1.00 23.31 ? 10  DC  D O2    1 
ATOM   1483 N N3    . DC  D  3 10 ? -39.447 6.016  -42.944 1.00 20.14 ? 10  DC  D N3    1 
ATOM   1484 C C4    . DC  D  3 10 ? -40.491 6.559  -43.575 1.00 19.59 ? 10  DC  D C4    1 
ATOM   1485 N N4    . DC  D  3 10 ? -41.516 6.976  -42.840 1.00 19.30 ? 10  DC  D N4    1 
ATOM   1486 C C5    . DC  D  3 10 ? -40.526 6.699  -44.996 1.00 19.89 ? 10  DC  D C5    1 
ATOM   1487 C C6    . DC  D  3 10 ? -39.482 6.244  -45.687 1.00 21.69 ? 10  DC  D C6    1 
ATOM   1488 P P     . DC  D  3 11 ? -35.072 2.844  -48.913 1.00 39.16 ? 11  DC  D P     1 
ATOM   1489 O OP1   . DC  D  3 11 ? -33.738 2.902  -49.488 1.00 45.67 ? 11  DC  D OP1   1 
ATOM   1490 O OP2   . DC  D  3 11 ? -36.289 2.857  -49.777 1.00 39.49 ? 11  DC  D OP2   1 
ATOM   1491 O "O5'" . DC  D  3 11 ? -35.250 1.514  -48.075 1.00 41.24 ? 11  DC  D "O5'" 1 
ATOM   1492 C "C5'" . DC  D  3 11 ? -34.345 1.270  -47.007 1.00 42.64 ? 11  DC  D "C5'" 1 
ATOM   1493 C "C4'" . DC  D  3 11 ? -35.091 0.811  -45.786 1.00 39.37 ? 11  DC  D "C4'" 1 
ATOM   1494 O "O4'" . DC  D  3 11 ? -36.230 1.653  -45.490 1.00 37.40 ? 11  DC  D "O4'" 1 
ATOM   1495 C "C3'" . DC  D  3 11 ? -35.639 -0.608 -45.893 1.00 40.86 ? 11  DC  D "C3'" 1 
ATOM   1496 O "O3'" . DC  D  3 11 ? -34.918 -1.314 -44.885 1.00 45.64 ? 11  DC  D "O3'" 1 
ATOM   1497 C "C2'" . DC  D  3 11 ? -37.123 -0.451 -45.584 1.00 37.58 ? 11  DC  D "C2'" 1 
ATOM   1498 C "C1'" . DC  D  3 11 ? -37.121 0.831  -44.790 1.00 33.66 ? 11  DC  D "C1'" 1 
ATOM   1499 N N1    . DC  D  3 11 ? -38.392 1.558  -44.633 1.00 29.47 ? 11  DC  D N1    1 
ATOM   1500 C C2    . DC  D  3 11 ? -38.829 1.885  -43.333 1.00 27.14 ? 11  DC  D C2    1 
ATOM   1501 O O2    . DC  D  3 11 ? -38.145 1.524  -42.361 1.00 25.36 ? 11  DC  D O2    1 
ATOM   1502 N N3    . DC  D  3 11 ? -39.998 2.562  -43.176 1.00 23.86 ? 11  DC  D N3    1 
ATOM   1503 C C4    . DC  D  3 11 ? -40.712 2.917  -44.248 1.00 24.93 ? 11  DC  D C4    1 
ATOM   1504 N N4    . DC  D  3 11 ? -41.840 3.597  -44.050 1.00 24.49 ? 11  DC  D N4    1 
ATOM   1505 C C5    . DC  D  3 11 ? -40.285 2.606  -45.580 1.00 27.24 ? 11  DC  D C5    1 
ATOM   1506 C C6    . DC  D  3 11 ? -39.131 1.932  -45.723 1.00 28.99 ? 11  DC  D C6    1 
ATOM   1507 P P     . DG  D  3 12 ? -34.515 -2.849 -45.045 1.00 45.43 ? 12  DG  D P     1 
ATOM   1508 O OP1   . DG  D  3 12 ? -33.045 -2.930 -44.966 1.00 50.15 ? 12  DG  D OP1   1 
ATOM   1509 O OP2   . DG  D  3 12 ? -35.216 -3.417 -46.226 1.00 46.97 ? 12  DG  D OP2   1 
ATOM   1510 O "O5'" . DG  D  3 12 ? -35.148 -3.490 -43.729 1.00 43.88 ? 12  DG  D "O5'" 1 
ATOM   1511 C "C5'" . DG  D  3 12 ? -34.865 -2.965 -42.407 1.00 41.93 ? 12  DG  D "C5'" 1 
ATOM   1512 C "C4'" . DG  D  3 12 ? -35.925 -3.388 -41.409 1.00 40.10 ? 12  DG  D "C4'" 1 
ATOM   1513 O "O4'" . DG  D  3 12 ? -36.904 -2.335 -41.309 1.00 36.34 ? 12  DG  D "O4'" 1 
ATOM   1514 C "C3'" . DG  D  3 12 ? -36.711 -4.648 -41.766 1.00 40.61 ? 12  DG  D "C3'" 1 
ATOM   1515 O "O3'" . DG  D  3 12 ? -36.189 -5.814 -41.117 1.00 46.60 ? 12  DG  D "O3'" 1 
ATOM   1516 C "C2'" . DG  D  3 12 ? -38.116 -4.371 -41.265 1.00 37.89 ? 12  DG  D "C2'" 1 
ATOM   1517 C "C1'" . DG  D  3 12 ? -38.174 -2.873 -40.996 1.00 34.67 ? 12  DG  D "C1'" 1 
ATOM   1518 N N9    . DG  D  3 12 ? -39.166 -2.153 -41.786 1.00 31.26 ? 12  DG  D N9    1 
ATOM   1519 C C8    . DG  D  3 12 ? -39.280 -2.114 -43.155 1.00 29.92 ? 12  DG  D C8    1 
ATOM   1520 N N7    . DG  D  3 12 ? -40.264 -1.360 -43.565 1.00 27.41 ? 12  DG  D N7    1 
ATOM   1521 C C5    . DG  D  3 12 ? -40.831 -0.874 -42.398 1.00 26.16 ? 12  DG  D C5    1 
ATOM   1522 C C6    . DG  D  3 12 ? -41.940 -0.020 -42.207 1.00 24.29 ? 12  DG  D C6    1 
ATOM   1523 O O6    . DG  D  3 12 ? -42.667 0.493  -43.060 1.00 24.65 ? 12  DG  D O6    1 
ATOM   1524 N N1    . DG  D  3 12 ? -42.185 0.210  -40.854 1.00 24.08 ? 12  DG  D N1    1 
ATOM   1525 C C2    . DG  D  3 12 ? -41.459 -0.330 -39.817 1.00 25.63 ? 12  DG  D C2    1 
ATOM   1526 N N2    . DG  D  3 12 ? -41.834 0.017  -38.576 1.00 25.33 ? 12  DG  D N2    1 
ATOM   1527 N N3    . DG  D  3 12 ? -40.430 -1.142 -39.985 1.00 27.31 ? 12  DG  D N3    1 
ATOM   1528 C C4    . DG  D  3 12 ? -40.164 -1.356 -41.291 1.00 27.42 ? 12  DG  D C4    1 
ATOM   1529 N N     . LYS E  1 7  ? -40.387 26.693 -2.927  1.00 50.53 ? 148 LYS E N     1 
ATOM   1530 C CA    . LYS E  1 7  ? -39.519 25.593 -3.476  1.00 49.65 ? 148 LYS E CA    1 
ATOM   1531 C C     . LYS E  1 7  ? -40.310 24.617 -4.362  1.00 45.47 ? 148 LYS E C     1 
ATOM   1532 O O     . LYS E  1 7  ? -40.290 23.398 -4.126  1.00 44.42 ? 148 LYS E O     1 
ATOM   1533 C CB    . LYS E  1 7  ? -38.834 24.815 -2.329  1.00 49.33 ? 148 LYS E CB    1 
ATOM   1534 N N     . ARG E  1 8  ? -40.991 25.154 -5.376  1.00 44.28 ? 149 ARG E N     1 
ATOM   1535 C CA    . ARG E  1 8  ? -41.775 24.338 -6.315  1.00 42.90 ? 149 ARG E CA    1 
ATOM   1536 C C     . ARG E  1 8  ? -40.908 23.950 -7.507  1.00 41.17 ? 149 ARG E C     1 
ATOM   1537 O O     . ARG E  1 8  ? -40.664 24.767 -8.411  1.00 40.86 ? 149 ARG E O     1 
ATOM   1538 C CB    . ARG E  1 8  ? -43.067 25.063 -6.779  1.00 45.85 ? 149 ARG E CB    1 
ATOM   1539 C CG    . ARG E  1 8  ? -44.166 25.103 -5.711  1.00 46.48 ? 149 ARG E CG    1 
ATOM   1540 C CD    . ARG E  1 8  ? -45.550 25.345 -6.300  1.00 49.05 ? 149 ARG E CD    1 
ATOM   1541 N NE    . ARG E  1 8  ? -46.548 25.563 -5.246  1.00 48.94 ? 149 ARG E NE    1 
ATOM   1542 C CZ    . ARG E  1 8  ? -47.864 25.718 -5.444  1.00 50.91 ? 149 ARG E CZ    1 
ATOM   1543 N NH1   . ARG E  1 8  ? -48.396 25.664 -6.667  1.00 50.78 ? 149 ARG E NH1   1 
ATOM   1544 N NH2   . ARG E  1 8  ? -48.667 25.924 -4.395  1.00 52.35 ? 149 ARG E NH2   1 
ATOM   1545 N N     . MET E  1 9  ? -40.436 22.703 -7.487  1.00 37.60 ? 150 MET E N     1 
ATOM   1546 C CA    . MET E  1 9  ? -39.579 22.169 -8.547  1.00 36.43 ? 150 MET E CA    1 
ATOM   1547 C C     . MET E  1 9  ? -40.402 21.444 -9.568  1.00 33.29 ? 150 MET E C     1 
ATOM   1548 O O     . MET E  1 9  ? -41.249 20.630 -9.227  1.00 29.65 ? 150 MET E O     1 
ATOM   1549 C CB    . MET E  1 9  ? -38.586 21.173 -7.966  1.00 37.24 ? 150 MET E CB    1 
ATOM   1550 C CG    . MET E  1 9  ? -37.750 21.701 -6.794  1.00 39.01 ? 150 MET E CG    1 
ATOM   1551 S SD    . MET E  1 9  ? -36.993 23.327 -7.047  1.00 42.76 ? 150 MET E SD    1 
ATOM   1552 C CE    . MET E  1 9  ? -35.967 22.999 -8.479  1.00 45.33 ? 150 MET E CE    1 
ATOM   1553 N N     . ASP E  1 10 ? -40.129 21.726 -10.835 1.00 33.75 ? 151 ASP E N     1 
ATOM   1554 C CA    . ASP E  1 10 ? -40.512 20.851 -11.904 1.00 33.61 ? 151 ASP E CA    1 
ATOM   1555 C C     . ASP E  1 10 ? -40.167 19.363 -11.565 1.00 32.90 ? 151 ASP E C     1 
ATOM   1556 O O     . ASP E  1 10 ? -39.093 19.058 -10.964 1.00 32.82 ? 151 ASP E O     1 
ATOM   1557 C CB    . ASP E  1 10 ? -39.837 21.300 -13.207 1.00 36.04 ? 151 ASP E CB    1 
ATOM   1558 C CG    . ASP E  1 10 ? -40.521 22.523 -13.828 1.00 37.34 ? 151 ASP E CG    1 
ATOM   1559 O OD1   . ASP E  1 10 ? -41.768 22.500 -13.987 1.00 37.56 ? 151 ASP E OD1   1 
ATOM   1560 O OD2   . ASP E  1 10 ? -39.833 23.484 -14.188 1.00 39.17 ? 151 ASP E OD2   1 
ATOM   1561 N N     . CYS E  1 11 ? -41.102 18.466 -11.900 1.00 31.71 ? 152 CYS E N     1 
ATOM   1562 C CA    . CYS E  1 11 ? -40.896 17.046 -11.774 1.00 31.97 ? 152 CYS E CA    1 
ATOM   1563 C C     . CYS E  1 11 ? -40.867 16.445 -13.196 1.00 33.42 ? 152 CYS E C     1 
ATOM   1564 O O     . CYS E  1 11 ? -41.924 16.101 -13.776 1.00 32.90 ? 152 CYS E O     1 
ATOM   1565 C CB    . CYS E  1 11 ? -41.958 16.401 -10.900 1.00 30.47 ? 152 CYS E CB    1 
ATOM   1566 S SG    . CYS E  1 11 ? -41.614 14.660 -10.578 1.00 32.71 ? 152 CYS E SG    1 
ATOM   1567 N N     . PRO E  1 12 ? -39.653 16.310 -13.771 1.00 35.91 ? 153 PRO E N     1 
ATOM   1568 C CA    . PRO E  1 12 ? -39.519 15.864 -15.186 1.00 37.42 ? 153 PRO E CA    1 
ATOM   1569 C C     . PRO E  1 12 ? -40.225 14.540 -15.508 1.00 37.35 ? 153 PRO E C     1 
ATOM   1570 O O     . PRO E  1 12 ? -40.673 14.354 -16.634 1.00 39.53 ? 153 PRO E O     1 
ATOM   1571 C CB    . PRO E  1 12 ? -38.003 15.717 -15.382 1.00 39.30 ? 153 PRO E CB    1 
ATOM   1572 C CG    . PRO E  1 12 ? -37.369 16.445 -14.273 1.00 39.24 ? 153 PRO E CG    1 
ATOM   1573 C CD    . PRO E  1 12 ? -38.346 16.599 -13.152 1.00 36.86 ? 153 PRO E CD    1 
ATOM   1574 N N     . ALA E  1 13 ? -40.319 13.643 -14.527 1.00 35.95 ? 154 ALA E N     1 
ATOM   1575 C CA    . ALA E  1 13 ? -40.898 12.314 -14.720 1.00 36.80 ? 154 ALA E CA    1 
ATOM   1576 C C     . ALA E  1 13 ? -42.405 12.355 -14.870 1.00 35.67 ? 154 ALA E C     1 
ATOM   1577 O O     . ALA E  1 13 ? -42.992 11.420 -15.387 1.00 36.47 ? 154 ALA E O     1 
ATOM   1578 C CB    . ALA E  1 13 ? -40.517 11.395 -13.543 1.00 37.91 ? 154 ALA E CB    1 
ATOM   1579 N N     . LEU E  1 14 ? -43.038 13.424 -14.391 1.00 34.44 ? 155 LEU E N     1 
ATOM   1580 C CA    . LEU E  1 14 ? -44.469 13.604 -14.577 1.00 33.46 ? 155 LEU E CA    1 
ATOM   1581 C C     . LEU E  1 14 ? -44.713 14.385 -15.869 1.00 34.60 ? 155 LEU E C     1 
ATOM   1582 O O     . LEU E  1 14 ? -43.765 14.910 -16.478 1.00 35.50 ? 155 LEU E O     1 
ATOM   1583 C CB    . LEU E  1 14 ? -45.074 14.314 -13.349 1.00 31.33 ? 155 LEU E CB    1 
ATOM   1584 C CG    . LEU E  1 14 ? -45.072 13.423 -12.097 1.00 30.86 ? 155 LEU E CG    1 
ATOM   1585 C CD1   . LEU E  1 14 ? -45.459 14.191 -10.830 1.00 30.17 ? 155 LEU E CD1   1 
ATOM   1586 C CD2   . LEU E  1 14 ? -45.997 12.210 -12.251 1.00 30.97 ? 155 LEU E CD2   1 
ATOM   1587 N N     . PRO E  1 15 ? -45.980 14.465 -16.306 1.00 34.24 ? 156 PRO E N     1 
ATOM   1588 C CA    . PRO E  1 15 ? -46.289 15.290 -17.466 1.00 35.13 ? 156 PRO E CA    1 
ATOM   1589 C C     . PRO E  1 15 ? -45.916 16.771 -17.317 1.00 35.48 ? 156 PRO E C     1 
ATOM   1590 O O     . PRO E  1 15 ? -45.574 17.223 -16.195 1.00 33.86 ? 156 PRO E O     1 
ATOM   1591 C CB    . PRO E  1 15 ? -47.797 15.103 -17.620 1.00 34.43 ? 156 PRO E CB    1 
ATOM   1592 C CG    . PRO E  1 15 ? -47.995 13.701 -17.202 1.00 34.03 ? 156 PRO E CG    1 
ATOM   1593 C CD    . PRO E  1 15 ? -47.132 13.612 -15.957 1.00 33.39 ? 156 PRO E CD    1 
ATOM   1594 N N     . PRO E  1 16 ? -45.925 17.525 -18.456 1.00 37.60 ? 157 PRO E N     1 
ATOM   1595 C CA    . PRO E  1 16 ? -45.452 18.921 -18.411 1.00 38.24 ? 157 PRO E CA    1 
ATOM   1596 C C     . PRO E  1 16 ? -46.256 19.733 -17.405 1.00 36.19 ? 157 PRO E C     1 
ATOM   1597 O O     . PRO E  1 16 ? -47.466 19.587 -17.337 1.00 34.99 ? 157 PRO E O     1 
ATOM   1598 C CB    . PRO E  1 16 ? -45.712 19.444 -19.824 1.00 40.63 ? 157 PRO E CB    1 
ATOM   1599 C CG    . PRO E  1 16 ? -45.811 18.229 -20.691 1.00 41.67 ? 157 PRO E CG    1 
ATOM   1600 C CD    . PRO E  1 16 ? -46.283 17.099 -19.827 1.00 39.18 ? 157 PRO E CD    1 
ATOM   1601 N N     . GLY E  1 17 ? -45.570 20.542 -16.619 1.00 35.68 ? 158 GLY E N     1 
ATOM   1602 C CA    . GLY E  1 17 ? -46.207 21.481 -15.751 1.00 35.54 ? 158 GLY E CA    1 
ATOM   1603 C C     . GLY E  1 17 ? -46.415 20.975 -14.335 1.00 33.21 ? 158 GLY E C     1 
ATOM   1604 O O     . GLY E  1 17 ? -46.706 21.781 -13.467 1.00 32.73 ? 158 GLY E O     1 
ATOM   1605 N N     . TRP E  1 18 ? -46.297 19.662 -14.113 1.00 32.11 ? 159 TRP E N     1 
ATOM   1606 C CA    . TRP E  1 18 ? -46.334 19.077 -12.749 1.00 31.48 ? 159 TRP E CA    1 
ATOM   1607 C C     . TRP E  1 18 ? -45.127 19.464 -11.923 1.00 32.13 ? 159 TRP E C     1 
ATOM   1608 O O     . TRP E  1 18 ? -43.973 19.337 -12.401 1.00 33.96 ? 159 TRP E O     1 
ATOM   1609 C CB    . TRP E  1 18 ? -46.419 17.555 -12.801 1.00 31.02 ? 159 TRP E CB    1 
ATOM   1610 C CG    . TRP E  1 18 ? -47.797 17.074 -13.080 1.00 31.17 ? 159 TRP E CG    1 
ATOM   1611 C CD1   . TRP E  1 18 ? -48.356 16.857 -14.295 1.00 32.19 ? 159 TRP E CD1   1 
ATOM   1612 C CD2   . TRP E  1 18 ? -48.797 16.762 -12.110 1.00 30.63 ? 159 TRP E CD2   1 
ATOM   1613 N NE1   . TRP E  1 18 ? -49.651 16.430 -14.155 1.00 31.73 ? 159 TRP E NE1   1 
ATOM   1614 C CE2   . TRP E  1 18 ? -49.952 16.364 -12.820 1.00 30.92 ? 159 TRP E CE2   1 
ATOM   1615 C CE3   . TRP E  1 18 ? -48.834 16.790 -10.701 1.00 28.77 ? 159 TRP E CE3   1 
ATOM   1616 C CZ2   . TRP E  1 18 ? -51.127 15.986 -12.180 1.00 30.20 ? 159 TRP E CZ2   1 
ATOM   1617 C CZ3   . TRP E  1 18 ? -49.996 16.418 -10.062 1.00 28.36 ? 159 TRP E CZ3   1 
ATOM   1618 C CH2   . TRP E  1 18 ? -51.136 16.031 -10.791 1.00 29.39 ? 159 TRP E CH2   1 
ATOM   1619 N N     . LYS E  1 19 ? -45.370 19.917 -10.679 1.00 30.97 ? 160 LYS E N     1 
ATOM   1620 C CA    . LYS E  1 19 ? -44.286 20.314 -9.761  1.00 31.02 ? 160 LYS E CA    1 
ATOM   1621 C C     . LYS E  1 19 ? -44.339 19.523 -8.431  1.00 30.44 ? 160 LYS E C     1 
ATOM   1622 O O     . LYS E  1 19 ? -45.307 18.798 -8.160  1.00 30.29 ? 160 LYS E O     1 
ATOM   1623 C CB    . LYS E  1 19 ? -44.292 21.839 -9.532  1.00 32.40 ? 160 LYS E CB    1 
ATOM   1624 C CG    . LYS E  1 19 ? -43.828 22.647 -10.761 1.00 35.10 ? 160 LYS E CG    1 
ATOM   1625 C CD    . LYS E  1 19 ? -44.269 24.099 -10.754 1.00 36.58 ? 160 LYS E CD    1 
ATOM   1626 C CE    . LYS E  1 19 ? -44.022 24.783 -12.111 1.00 38.63 ? 160 LYS E CE    1 
ATOM   1627 N N     . LYS E  1 20 ? -43.266 19.645 -7.655  1.00 30.13 ? 161 LYS E N     1 
ATOM   1628 C CA    . LYS E  1 20 ? -43.018 18.885 -6.437  1.00 29.41 ? 161 LYS E CA    1 
ATOM   1629 C C     . LYS E  1 20 ? -42.465 19.891 -5.423  1.00 31.29 ? 161 LYS E C     1 
ATOM   1630 O O     . LYS E  1 20 ? -41.627 20.733 -5.783  1.00 32.09 ? 161 LYS E O     1 
ATOM   1631 C CB    . LYS E  1 20 ? -41.979 17.748 -6.674  1.00 30.19 ? 161 LYS E CB    1 
ATOM   1632 C CG    . LYS E  1 20 ? -41.741 16.822 -5.470  1.00 29.92 ? 161 LYS E CG    1 
ATOM   1633 C CD    . LYS E  1 20 ? -40.619 15.776 -5.652  1.00 31.00 ? 161 LYS E CD    1 
ATOM   1634 C CE    . LYS E  1 20 ? -39.230 16.331 -5.325  1.00 32.54 ? 161 LYS E CE    1 
ATOM   1635 N N     . GLU E  1 21 ? -42.950 19.807 -4.171  1.00 30.73 ? 162 GLU E N     1 
ATOM   1636 C CA    . GLU E  1 21 ? -42.418 20.587 -3.069  1.00 33.46 ? 162 GLU E CA    1 
ATOM   1637 C C     . GLU E  1 21 ? -42.209 19.660 -1.903  1.00 32.69 ? 162 GLU E C     1 
ATOM   1638 O O     . GLU E  1 21 ? -43.045 18.767 -1.645  1.00 32.44 ? 162 GLU E O     1 
ATOM   1639 C CB    . GLU E  1 21 ? -43.389 21.717 -2.654  1.00 36.00 ? 162 GLU E CB    1 
ATOM   1640 C CG    . GLU E  1 21 ? -42.751 22.740 -1.712  1.00 38.17 ? 162 GLU E CG    1 
ATOM   1641 C CD    . GLU E  1 21 ? -43.718 23.819 -1.228  1.00 40.94 ? 162 GLU E CD    1 
ATOM   1642 O OE1   . GLU E  1 21 ? -44.934 23.785 -1.593  1.00 42.53 ? 162 GLU E OE1   1 
ATOM   1643 O OE2   . GLU E  1 21 ? -43.249 24.707 -0.475  1.00 42.26 ? 162 GLU E OE2   1 
ATOM   1644 N N     . GLU E  1 22 ? -41.106 19.856 -1.194  1.00 31.89 ? 163 GLU E N     1 
ATOM   1645 C CA    . GLU E  1 22 ? -40.829 19.099 0.005   1.00 31.30 ? 163 GLU E CA    1 
ATOM   1646 C C     . GLU E  1 22 ? -40.774 20.098 1.154   1.00 30.71 ? 163 GLU E C     1 
ATOM   1647 O O     . GLU E  1 22 ? -40.101 21.107 1.043   1.00 31.85 ? 163 GLU E O     1 
ATOM   1648 C CB    . GLU E  1 22 ? -39.524 18.290 -0.119  1.00 33.19 ? 163 GLU E CB    1 
ATOM   1649 C CG    . GLU E  1 22 ? -39.298 17.365 1.069   1.00 35.71 ? 163 GLU E CG    1 
ATOM   1650 C CD    . GLU E  1 22 ? -38.081 16.473 0.966   1.00 37.84 ? 163 GLU E CD    1 
ATOM   1651 O OE1   . GLU E  1 22 ? -37.623 15.989 2.019   1.00 40.20 ? 163 GLU E OE1   1 
ATOM   1652 O OE2   . GLU E  1 22 ? -37.581 16.246 -0.141  1.00 41.92 ? 163 GLU E OE2   1 
ATOM   1653 N N     . VAL E  1 23 ? -41.500 19.801 2.243   1.00 28.10 ? 164 VAL E N     1 
ATOM   1654 C CA    . VAL E  1 23 ? -41.602 20.691 3.398   1.00 27.59 ? 164 VAL E CA    1 
ATOM   1655 C C     . VAL E  1 23 ? -41.241 19.948 4.674   1.00 26.41 ? 164 VAL E C     1 
ATOM   1656 O O     . VAL E  1 23 ? -41.813 18.914 5.027   1.00 25.09 ? 164 VAL E O     1 
ATOM   1657 C CB    . VAL E  1 23 ? -43.036 21.294 3.573   1.00 28.31 ? 164 VAL E CB    1 
ATOM   1658 C CG1   . VAL E  1 23 ? -43.068 22.267 4.765   1.00 30.16 ? 164 VAL E CG1   1 
ATOM   1659 C CG2   . VAL E  1 23 ? -43.523 21.951 2.271   1.00 27.14 ? 164 VAL E CG2   1 
ATOM   1660 N N     . ILE E  1 24 ? -40.357 20.574 5.414   1.00 27.63 ? 165 ILE E N     1 
ATOM   1661 C CA    . ILE E  1 24 ? -39.782 20.057 6.639   1.00 27.35 ? 165 ILE E CA    1 
ATOM   1662 C C     . ILE E  1 24 ? -40.693 20.396 7.756   1.00 28.16 ? 165 ILE E C     1 
ATOM   1663 O O     . ILE E  1 24 ? -41.059 21.563 7.918   1.00 28.51 ? 165 ILE E O     1 
ATOM   1664 C CB    . ILE E  1 24 ? -38.438 20.750 6.936   1.00 28.58 ? 165 ILE E CB    1 
ATOM   1665 C CG1   . ILE E  1 24 ? -37.500 20.654 5.713   1.00 29.13 ? 165 ILE E CG1   1 
ATOM   1666 C CG2   . ILE E  1 24 ? -37.827 20.210 8.245   1.00 28.82 ? 165 ILE E CG2   1 
ATOM   1667 C CD1   . ILE E  1 24 ? -37.271 19.246 5.214   1.00 29.52 ? 165 ILE E CD1   1 
ATOM   1668 N N     . ARG E  1 25 ? -41.040 19.394 8.576   1.00 28.49 ? 166 ARG E N     1 
ATOM   1669 C CA    . ARG E  1 25 ? -41.863 19.664 9.757   1.00 29.01 ? 166 ARG E CA    1 
ATOM   1670 C C     . ARG E  1 25 ? -41.021 20.401 10.805  1.00 31.51 ? 166 ARG E C     1 
ATOM   1671 O O     . ARG E  1 25 ? -39.964 19.923 11.169  1.00 32.11 ? 166 ARG E O     1 
ATOM   1672 C CB    . ARG E  1 25 ? -42.379 18.371 10.339  1.00 28.01 ? 166 ARG E CB    1 
ATOM   1673 C CG    . ARG E  1 25 ? -43.392 17.683 9.456   1.00 25.87 ? 166 ARG E CG    1 
ATOM   1674 C CD    . ARG E  1 25 ? -44.111 16.558 10.159  1.00 25.46 ? 166 ARG E CD    1 
ATOM   1675 N NE    . ARG E  1 25 ? -45.032 15.888 9.249   1.00 24.45 ? 166 ARG E NE    1 
ATOM   1676 C CZ    . ARG E  1 25 ? -46.131 15.221 9.600   1.00 24.76 ? 166 ARG E CZ    1 
ATOM   1677 N NH1   . ARG E  1 25 ? -46.500 15.079 10.875  1.00 24.91 ? 166 ARG E NH1   1 
ATOM   1678 N NH2   . ARG E  1 25 ? -46.886 14.687 8.646   1.00 24.63 ? 166 ARG E NH2   1 
ATOM   1679 N N     . LYS E  1 26 ? -41.503 21.553 11.281  1.00 33.35 ? 167 LYS E N     1 
ATOM   1680 C CA    . LYS E  1 26 ? -40.738 22.406 12.217  1.00 35.95 ? 167 LYS E CA    1 
ATOM   1681 C C     . LYS E  1 26 ? -40.840 21.957 13.653  1.00 36.57 ? 167 LYS E C     1 
ATOM   1682 O O     . LYS E  1 26 ? -39.949 22.257 14.454  1.00 37.68 ? 167 LYS E O     1 
ATOM   1683 C CB    . LYS E  1 26 ? -41.197 23.876 12.122  1.00 37.53 ? 167 LYS E CB    1 
ATOM   1684 C CG    . LYS E  1 26 ? -41.143 24.443 10.694  1.00 38.39 ? 167 LYS E CG    1 
ATOM   1685 N N     . SER E  1 27 ? -41.917 21.246 13.982  1.00 37.92 ? 168 SER E N     1 
ATOM   1686 C CA    . SER E  1 27 ? -42.229 20.849 15.378  1.00 40.00 ? 168 SER E CA    1 
ATOM   1687 C C     . SER E  1 27 ? -43.159 19.618 15.471  1.00 40.31 ? 168 SER E C     1 
ATOM   1688 O O     . SER E  1 27 ? -43.842 19.265 14.533  1.00 41.21 ? 168 SER E O     1 
ATOM   1689 C CB    . SER E  1 27 ? -42.927 21.993 16.078  1.00 42.05 ? 168 SER E CB    1 
ATOM   1690 O OG    . SER E  1 27 ? -44.174 22.252 15.423  1.00 42.11 ? 168 SER E OG    1 
ATOM   1691 N N     . GLY E  1 28 ? -43.212 19.035 16.647  1.00 43.38 ? 169 GLY E N     1 
ATOM   1692 C CA    . GLY E  1 28 ? -44.072 17.912 16.930  1.00 44.09 ? 169 GLY E CA    1 
ATOM   1693 C C     . GLY E  1 28 ? -43.247 16.674 17.134  1.00 45.53 ? 169 GLY E C     1 
ATOM   1694 O O     . GLY E  1 28 ? -42.021 16.672 16.951  1.00 42.16 ? 169 GLY E O     1 
ATOM   1695 N N     . LEU E  1 29 ? -43.939 15.609 17.508  1.00 48.19 ? 170 LEU E N     1 
ATOM   1696 C CA    . LEU E  1 29 ? -43.375 14.270 17.526  1.00 48.54 ? 170 LEU E CA    1 
ATOM   1697 C C     . LEU E  1 29 ? -42.582 13.942 16.222  1.00 46.98 ? 170 LEU E C     1 
ATOM   1698 O O     . LEU E  1 29 ? -41.503 13.343 16.292  1.00 48.98 ? 170 LEU E O     1 
ATOM   1699 C CB    . LEU E  1 29 ? -44.494 13.250 17.767  1.00 51.36 ? 170 LEU E CB    1 
ATOM   1700 C CG    . LEU E  1 29 ? -45.095 13.240 19.193  1.00 52.59 ? 170 LEU E CG    1 
ATOM   1701 N N     . SER E  1 30 ? -43.073 14.389 15.056  1.00 42.31 ? 171 SER E N     1 
ATOM   1702 C CA    . SER E  1 30 ? -42.335 14.161 13.767  1.00 39.43 ? 171 SER E CA    1 
ATOM   1703 C C     . SER E  1 30 ? -41.412 15.313 13.268  1.00 36.73 ? 171 SER E C     1 
ATOM   1704 O O     . SER E  1 30 ? -41.121 15.379 12.079  1.00 35.36 ? 171 SER E O     1 
ATOM   1705 C CB    . SER E  1 30 ? -43.321 13.717 12.655  1.00 39.40 ? 171 SER E CB    1 
ATOM   1706 O OG    . SER E  1 30 ? -43.377 12.309 12.593  1.00 41.47 ? 171 SER E OG    1 
ATOM   1707 N N     . ALA E  1 31 ? -40.911 16.169 14.179  1.00 34.78 ? 172 ALA E N     1 
ATOM   1708 C CA    . ALA E  1 31 ? -40.117 17.370 13.792  1.00 33.74 ? 172 ALA E CA    1 
ATOM   1709 C C     . ALA E  1 31 ? -38.804 16.999 13.014  1.00 32.96 ? 172 ALA E C     1 
ATOM   1710 O O     . ALA E  1 31 ? -38.068 16.142 13.411  1.00 32.46 ? 172 ALA E O     1 
ATOM   1711 C CB    . ALA E  1 31 ? -39.797 18.249 15.033  1.00 34.10 ? 172 ALA E CB    1 
ATOM   1712 N N     . GLY E  1 32 ? -38.556 17.652 11.892  1.00 33.23 ? 173 GLY E N     1 
ATOM   1713 C CA    . GLY E  1 32 ? -37.375 17.318 11.060  1.00 34.01 ? 173 GLY E CA    1 
ATOM   1714 C C     . GLY E  1 32 ? -37.649 16.292 9.969   1.00 32.86 ? 173 GLY E C     1 
ATOM   1715 O O     . GLY E  1 32 ? -36.907 16.227 9.007   1.00 32.63 ? 173 GLY E O     1 
ATOM   1716 N N     . LYS E  1 33 ? -38.690 15.473 10.115  1.00 32.73 ? 174 LYS E N     1 
ATOM   1717 C CA    . LYS E  1 33 ? -39.203 14.721 8.957   1.00 33.08 ? 174 LYS E CA    1 
ATOM   1718 C C     . LYS E  1 33 ? -39.835 15.672 7.907   1.00 31.27 ? 174 LYS E C     1 
ATOM   1719 O O     . LYS E  1 33 ? -40.106 16.858 8.188   1.00 31.17 ? 174 LYS E O     1 
ATOM   1720 C CB    . LYS E  1 33 ? -40.205 13.653 9.400   1.00 33.94 ? 174 LYS E CB    1 
ATOM   1721 C CG    . LYS E  1 33 ? -39.547 12.556 10.262  1.00 35.57 ? 174 LYS E CG    1 
ATOM   1722 N N     . SER E  1 34 ? -40.066 15.155 6.715   1.00 29.32 ? 175 SER E N     1 
ATOM   1723 C CA    . SER E  1 34 ? -40.663 15.942 5.672   1.00 28.77 ? 175 SER E CA    1 
ATOM   1724 C C     . SER E  1 34 ? -41.919 15.306 5.072   1.00 27.47 ? 175 SER E C     1 
ATOM   1725 O O     . SER E  1 34 ? -42.181 14.102 5.213   1.00 28.19 ? 175 SER E O     1 
ATOM   1726 C CB    . SER E  1 34 ? -39.651 16.251 4.568   1.00 29.37 ? 175 SER E CB    1 
ATOM   1727 O OG    . SER E  1 34 ? -38.973 15.089 4.146   1.00 28.75 ? 175 SER E OG    1 
ATOM   1728 N N     . ASP E  1 35 ? -42.707 16.161 4.457   1.00 25.14 ? 176 ASP E N     1 
ATOM   1729 C CA    . ASP E  1 35 ? -43.835 15.762 3.718   1.00 24.59 ? 176 ASP E CA    1 
ATOM   1730 C C     . ASP E  1 35 ? -43.560 16.257 2.315   1.00 23.94 ? 176 ASP E C     1 
ATOM   1731 O O     . ASP E  1 35 ? -42.954 17.310 2.144   1.00 25.33 ? 176 ASP E O     1 
ATOM   1732 C CB    . ASP E  1 35 ? -45.089 16.373 4.273   1.00 23.38 ? 176 ASP E CB    1 
ATOM   1733 C CG    . ASP E  1 35 ? -45.406 15.885 5.690   1.00 24.56 ? 176 ASP E CG    1 
ATOM   1734 O OD1   . ASP E  1 35 ? -44.835 16.434 6.634   1.00 24.37 ? 176 ASP E OD1   1 
ATOM   1735 O OD2   . ASP E  1 35 ? -46.241 14.970 5.854   1.00 25.42 ? 176 ASP E OD2   1 
ATOM   1736 N N     . VAL E  1 36 ? -43.992 15.481 1.332   1.00 23.99 ? 177 VAL E N     1 
ATOM   1737 C CA    . VAL E  1 36 ? -43.807 15.792 -0.090  1.00 23.68 ? 177 VAL E CA    1 
ATOM   1738 C C     . VAL E  1 36 ? -45.166 16.039 -0.699  1.00 22.86 ? 177 VAL E C     1 
ATOM   1739 O O     . VAL E  1 36 ? -46.142 15.320 -0.394  1.00 21.90 ? 177 VAL E O     1 
ATOM   1740 C CB    . VAL E  1 36 ? -43.079 14.650 -0.812  1.00 24.17 ? 177 VAL E CB    1 
ATOM   1741 C CG1   . VAL E  1 36 ? -42.928 14.968 -2.312  1.00 24.81 ? 177 VAL E CG1   1 
ATOM   1742 C CG2   . VAL E  1 36 ? -41.730 14.464 -0.185  1.00 25.40 ? 177 VAL E CG2   1 
ATOM   1743 N N     . TYR E  1 37 ? -45.252 17.098 -1.507  1.00 23.25 ? 178 TYR E N     1 
ATOM   1744 C CA    . TYR E  1 37 ? -46.488 17.464 -2.180  1.00 23.25 ? 178 TYR E CA    1 
ATOM   1745 C C     . TYR E  1 37 ? -46.240 17.691 -3.653  1.00 23.37 ? 178 TYR E C     1 
ATOM   1746 O O     . TYR E  1 37 ? -45.170 18.146 -4.038  1.00 23.40 ? 178 TYR E O     1 
ATOM   1747 C CB    . TYR E  1 37 ? -47.085 18.728 -1.591  1.00 23.93 ? 178 TYR E CB    1 
ATOM   1748 C CG    . TYR E  1 37 ? -47.254 18.686 -0.068  1.00 24.30 ? 178 TYR E CG    1 
ATOM   1749 C CD1   . TYR E  1 37 ? -48.247 17.934 0.513   1.00 24.00 ? 178 TYR E CD1   1 
ATOM   1750 C CD2   . TYR E  1 37 ? -46.440 19.434 0.756   1.00 24.46 ? 178 TYR E CD2   1 
ATOM   1751 C CE1   . TYR E  1 37 ? -48.411 17.891 1.877   1.00 25.01 ? 178 TYR E CE1   1 
ATOM   1752 C CE2   . TYR E  1 37 ? -46.600 19.420 2.142   1.00 24.91 ? 178 TYR E CE2   1 
ATOM   1753 C CZ    . TYR E  1 37 ? -47.574 18.638 2.707   1.00 24.93 ? 178 TYR E CZ    1 
ATOM   1754 O OH    . TYR E  1 37 ? -47.719 18.588 4.094   1.00 23.91 ? 178 TYR E OH    1 
ATOM   1755 N N     . TYR E  1 38 ? -47.244 17.390 -4.467  1.00 24.13 ? 179 TYR E N     1 
ATOM   1756 C CA    . TYR E  1 38 ? -47.213 17.669 -5.908  1.00 25.88 ? 179 TYR E CA    1 
ATOM   1757 C C     . TYR E  1 38 ? -48.300 18.627 -6.306  1.00 27.21 ? 179 TYR E C     1 
ATOM   1758 O O     . TYR E  1 38 ? -49.376 18.631 -5.702  1.00 28.17 ? 179 TYR E O     1 
ATOM   1759 C CB    . TYR E  1 38 ? -47.362 16.362 -6.713  1.00 26.16 ? 179 TYR E CB    1 
ATOM   1760 C CG    . TYR E  1 38 ? -46.164 15.491 -6.620  1.00 25.93 ? 179 TYR E CG    1 
ATOM   1761 C CD1   . TYR E  1 38 ? -45.992 14.646 -5.548  1.00 26.27 ? 179 TYR E CD1   1 
ATOM   1762 C CD2   . TYR E  1 38 ? -45.155 15.544 -7.585  1.00 27.22 ? 179 TYR E CD2   1 
ATOM   1763 C CE1   . TYR E  1 38 ? -44.864 13.838 -5.432  1.00 26.50 ? 179 TYR E CE1   1 
ATOM   1764 C CE2   . TYR E  1 38 ? -44.023 14.745 -7.482  1.00 27.85 ? 179 TYR E CE2   1 
ATOM   1765 C CZ    . TYR E  1 38 ? -43.890 13.890 -6.396  1.00 28.31 ? 179 TYR E CZ    1 
ATOM   1766 O OH    . TYR E  1 38 ? -42.785 13.103 -6.261  1.00 29.64 ? 179 TYR E OH    1 
ATOM   1767 N N     . PHE E  1 39 ? -48.021 19.421 -7.352  1.00 29.01 ? 180 PHE E N     1 
ATOM   1768 C CA    . PHE E  1 39 ? -48.973 20.353 -7.907  1.00 30.31 ? 180 PHE E CA    1 
ATOM   1769 C C     . PHE E  1 39 ? -49.227 20.108 -9.420  1.00 30.84 ? 180 PHE E C     1 
ATOM   1770 O O     . PHE E  1 39 ? -48.295 19.993 -10.220 1.00 29.38 ? 180 PHE E O     1 
ATOM   1771 C CB    . PHE E  1 39 ? -48.528 21.789 -7.639  1.00 31.48 ? 180 PHE E CB    1 
ATOM   1772 C CG    . PHE E  1 39 ? -48.256 22.056 -6.180  1.00 31.93 ? 180 PHE E CG    1 
ATOM   1773 C CD1   . PHE E  1 39 ? -47.029 21.760 -5.628  1.00 32.25 ? 180 PHE E CD1   1 
ATOM   1774 C CD2   . PHE E  1 39 ? -49.245 22.569 -5.360  1.00 33.07 ? 180 PHE E CD2   1 
ATOM   1775 C CE1   . PHE E  1 39 ? -46.788 21.973 -4.273  1.00 32.11 ? 180 PHE E CE1   1 
ATOM   1776 C CE2   . PHE E  1 39 ? -49.003 22.802 -4.014  1.00 33.30 ? 180 PHE E CE2   1 
ATOM   1777 C CZ    . PHE E  1 39 ? -47.771 22.491 -3.473  1.00 31.90 ? 180 PHE E CZ    1 
ATOM   1778 N N     . SER E  1 40 ? -50.512 20.024 -9.782  1.00 30.48 ? 181 SER E N     1 
ATOM   1779 C CA    . SER E  1 40 ? -50.927 19.911 -11.166 1.00 31.75 ? 181 SER E CA    1 
ATOM   1780 C C     . SER E  1 40 ? -50.558 21.185 -11.924 1.00 32.99 ? 181 SER E C     1 
ATOM   1781 O O     . SER E  1 40 ? -50.193 22.175 -11.330 1.00 33.50 ? 181 SER E O     1 
ATOM   1782 C CB    . SER E  1 40 ? -52.444 19.718 -11.272 1.00 31.58 ? 181 SER E CB    1 
ATOM   1783 O OG    . SER E  1 40 ? -53.127 20.947 -11.090 1.00 32.27 ? 181 SER E OG    1 
ATOM   1784 N N     . PRO E  1 41 ? -50.676 21.160 -13.243 1.00 36.17 ? 182 PRO E N     1 
ATOM   1785 C CA    . PRO E  1 41 ? -50.487 22.426 -13.971 1.00 39.20 ? 182 PRO E CA    1 
ATOM   1786 C C     . PRO E  1 41 ? -51.423 23.530 -13.464 1.00 40.91 ? 182 PRO E C     1 
ATOM   1787 O O     . PRO E  1 41 ? -50.953 24.625 -13.154 1.00 44.02 ? 182 PRO E O     1 
ATOM   1788 C CB    . PRO E  1 41 ? -50.765 22.035 -15.410 1.00 38.99 ? 182 PRO E CB    1 
ATOM   1789 C CG    . PRO E  1 41 ? -50.328 20.615 -15.477 1.00 37.80 ? 182 PRO E CG    1 
ATOM   1790 C CD    . PRO E  1 41 ? -50.720 20.006 -14.154 1.00 35.35 ? 182 PRO E CD    1 
ATOM   1791 N N     . SER E  1 42 ? -52.708 23.226 -13.313 1.00 41.78 ? 183 SER E N     1 
ATOM   1792 C CA    . SER E  1 42 ? -53.676 24.171 -12.652 1.00 43.99 ? 183 SER E CA    1 
ATOM   1793 C C     . SER E  1 42 ? -53.346 24.493 -11.192 1.00 44.52 ? 183 SER E C     1 
ATOM   1794 O O     . SER E  1 42 ? -53.844 25.483 -10.654 1.00 48.56 ? 183 SER E O     1 
ATOM   1795 C CB    . SER E  1 42 ? -55.107 23.618 -12.705 1.00 44.89 ? 183 SER E CB    1 
ATOM   1796 N N     . GLY E  1 43 ? -52.529 23.662 -10.540 1.00 40.60 ? 184 GLY E N     1 
ATOM   1797 C CA    . GLY E  1 43 ? -52.062 23.944 -9.182  1.00 38.47 ? 184 GLY E CA    1 
ATOM   1798 C C     . GLY E  1 43 ? -52.842 23.259 -8.053  1.00 35.56 ? 184 GLY E C     1 
ATOM   1799 O O     . GLY E  1 43 ? -52.699 23.656 -6.893  1.00 33.36 ? 184 GLY E O     1 
ATOM   1800 N N     . LYS E  1 44 ? -53.640 22.226 -8.402  1.00 34.12 ? 185 LYS E N     1 
ATOM   1801 C CA    . LYS E  1 44 ? -54.309 21.331 -7.438  1.00 32.62 ? 185 LYS E CA    1 
ATOM   1802 C C     . LYS E  1 44 ? -53.207 20.605 -6.667  1.00 30.93 ? 185 LYS E C     1 
ATOM   1803 O O     . LYS E  1 44 ? -52.226 20.192 -7.265  1.00 30.64 ? 185 LYS E O     1 
ATOM   1804 C CB    . LYS E  1 44 ? -55.229 20.293 -8.134  1.00 33.10 ? 185 LYS E CB    1 
ATOM   1805 C CG    . LYS E  1 44 ? -56.313 20.809 -9.105  1.00 34.26 ? 185 LYS E CG    1 
ATOM   1806 N N     . LYS E  1 45 ? -53.349 20.496 -5.341  1.00 30.47 ? 186 LYS E N     1 
ATOM   1807 C CA    . LYS E  1 45 ? -52.301 19.948 -4.451  1.00 28.81 ? 186 LYS E CA    1 
ATOM   1808 C C     . LYS E  1 45 ? -52.572 18.477 -4.188  1.00 28.82 ? 186 LYS E C     1 
ATOM   1809 O O     . LYS E  1 45 ? -53.703 18.111 -3.917  1.00 30.22 ? 186 LYS E O     1 
ATOM   1810 C CB    . LYS E  1 45 ? -52.286 20.721 -3.122  1.00 29.70 ? 186 LYS E CB    1 
ATOM   1811 C CG    . LYS E  1 45 ? -51.103 20.449 -2.183  1.00 28.23 ? 186 LYS E CG    1 
ATOM   1812 C CD    . LYS E  1 45 ? -51.032 21.540 -1.077  1.00 29.88 ? 186 LYS E CD    1 
ATOM   1813 C CE    . LYS E  1 45 ? -50.058 21.162 0.052   1.00 30.17 ? 186 LYS E CE    1 
ATOM   1814 N NZ    . LYS E  1 45 ? -49.754 22.247 1.035   1.00 31.39 ? 186 LYS E NZ    1 
ATOM   1815 N N     . PHE E  1 46 ? -51.542 17.634 -4.269  1.00 27.09 ? 187 PHE E N     1 
ATOM   1816 C CA    . PHE E  1 46 ? -51.691 16.206 -3.995  1.00 28.25 ? 187 PHE E CA    1 
ATOM   1817 C C     . PHE E  1 46 ? -50.733 15.796 -2.898  1.00 27.87 ? 187 PHE E C     1 
ATOM   1818 O O     . PHE E  1 46 ? -49.569 16.249 -2.871  1.00 29.05 ? 187 PHE E O     1 
ATOM   1819 C CB    . PHE E  1 46 ? -51.452 15.390 -5.272  1.00 28.70 ? 187 PHE E CB    1 
ATOM   1820 C CG    . PHE E  1 46 ? -52.427 15.726 -6.344  1.00 30.73 ? 187 PHE E CG    1 
ATOM   1821 C CD1   . PHE E  1 46 ? -52.264 16.878 -7.100  1.00 31.37 ? 187 PHE E CD1   1 
ATOM   1822 C CD2   . PHE E  1 46 ? -53.563 14.949 -6.533  1.00 31.81 ? 187 PHE E CD2   1 
ATOM   1823 C CE1   . PHE E  1 46 ? -53.191 17.222 -8.090  1.00 34.39 ? 187 PHE E CE1   1 
ATOM   1824 C CE2   . PHE E  1 46 ? -54.497 15.283 -7.502  1.00 34.15 ? 187 PHE E CE2   1 
ATOM   1825 C CZ    . PHE E  1 46 ? -54.315 16.427 -8.285  1.00 35.34 ? 187 PHE E CZ    1 
ATOM   1826 N N     . ARG E  1 47 ? -51.215 14.935 -2.016  1.00 27.19 ? 188 ARG E N     1 
ATOM   1827 C CA    . ARG E  1 47 ? -50.502 14.575 -0.770  1.00 28.44 ? 188 ARG E CA    1 
ATOM   1828 C C     . ARG E  1 47 ? -50.103 13.112 -0.685  1.00 27.78 ? 188 ARG E C     1 
ATOM   1829 O O     . ARG E  1 47 ? -49.476 12.710 0.311   1.00 30.05 ? 188 ARG E O     1 
ATOM   1830 C CB    . ARG E  1 47 ? -51.374 14.929 0.444   1.00 29.87 ? 188 ARG E CB    1 
ATOM   1831 C CG    . ARG E  1 47 ? -51.953 16.327 0.368   1.00 31.54 ? 188 ARG E CG    1 
ATOM   1832 C CD    A ARG E  1 47 ? -52.757 16.725 1.615   0.70 33.77 ? 188 ARG E CD    1 
ATOM   1833 C CD    B ARG E  1 47 ? -52.802 16.692 1.570   0.30 32.49 ? 188 ARG E CD    1 
ATOM   1834 N NE    A ARG E  1 47 ? -53.060 18.187 1.641   0.70 35.88 ? 188 ARG E NE    1 
ATOM   1835 N NE    B ARG E  1 47 ? -53.217 18.091 1.486   0.30 33.37 ? 188 ARG E NE    1 
ATOM   1836 C CZ    A ARG E  1 47 ? -52.603 19.090 2.535   0.70 35.63 ? 188 ARG E CZ    1 
ATOM   1837 C CZ    B ARG E  1 47 ? -54.210 18.535 0.727   0.30 33.42 ? 188 ARG E CZ    1 
ATOM   1838 N NH1   A ARG E  1 47 ? -51.794 18.749 3.555   0.70 34.93 ? 188 ARG E NH1   1 
ATOM   1839 N NH1   B ARG E  1 47 ? -54.914 17.694 -0.019  0.30 33.56 ? 188 ARG E NH1   1 
ATOM   1840 N NH2   A ARG E  1 47 ? -52.973 20.374 2.409   0.70 35.61 ? 188 ARG E NH2   1 
ATOM   1841 N NH2   B ARG E  1 47 ? -54.493 19.820 0.717   0.30 34.61 ? 188 ARG E NH2   1 
ATOM   1842 N N     . SER E  1 48 ? -50.488 12.292 -1.664  1.00 26.67 ? 189 SER E N     1 
ATOM   1843 C CA    . SER E  1 48 ? -50.005 10.901 -1.698  1.00 26.89 ? 189 SER E CA    1 
ATOM   1844 C C     . SER E  1 48 ? -49.989 10.335 -3.110  1.00 26.87 ? 189 SER E C     1 
ATOM   1845 O O     . SER E  1 48 ? -50.566 10.941 -4.065  1.00 25.17 ? 189 SER E O     1 
ATOM   1846 C CB    . SER E  1 48 ? -50.899 10.024 -0.835  1.00 28.79 ? 189 SER E CB    1 
ATOM   1847 O OG    . SER E  1 48 ? -52.182 9.841  -1.478  1.00 31.00 ? 189 SER E OG    1 
ATOM   1848 N N     . LYS E  1 49 ? -49.394 9.150  -3.243  1.00 27.11 ? 190 LYS E N     1 
ATOM   1849 C CA    . LYS E  1 49 ? -49.424 8.424  -4.512  1.00 28.57 ? 190 LYS E CA    1 
ATOM   1850 C C     . LYS E  1 49 ? -50.812 7.970  -4.939  1.00 28.58 ? 190 LYS E C     1 
ATOM   1851 O O     . LYS E  1 49 ? -51.185 8.126  -6.126  1.00 27.42 ? 190 LYS E O     1 
ATOM   1852 C CB    . LYS E  1 49 ? -48.455 7.249  -4.495  1.00 31.22 ? 190 LYS E CB    1 
ATOM   1853 C CG    . LYS E  1 49 ? -48.064 6.759  -5.880  1.00 33.15 ? 190 LYS E CG    1 
ATOM   1854 C CD    . LYS E  1 49 ? -46.881 5.811  -5.737  1.00 35.09 ? 190 LYS E CD    1 
ATOM   1855 C CE    . LYS E  1 49 ? -46.624 5.042  -6.966  1.00 36.53 ? 190 LYS E CE    1 
ATOM   1856 N NZ    . LYS E  1 49 ? -45.605 4.009  -6.715  1.00 39.43 ? 190 LYS E NZ    1 
ATOM   1857 N N     . PRO E  1 50 ? -51.596 7.374  -4.023  1.00 29.68 ? 191 PRO E N     1 
ATOM   1858 C CA    . PRO E  1 50 ? -52.919 6.959  -4.589  1.00 31.28 ? 191 PRO E CA    1 
ATOM   1859 C C     . PRO E  1 50 ? -53.797 8.153  -5.048  1.00 31.00 ? 191 PRO E C     1 
ATOM   1860 O O     . PRO E  1 50 ? -54.499 8.056  -6.070  1.00 31.58 ? 191 PRO E O     1 
ATOM   1861 C CB    . PRO E  1 50 ? -53.561 6.149  -3.466  1.00 33.22 ? 191 PRO E CB    1 
ATOM   1862 C CG    . PRO E  1 50 ? -52.413 5.738  -2.572  1.00 33.16 ? 191 PRO E CG    1 
ATOM   1863 C CD    . PRO E  1 50 ? -51.326 6.760  -2.714  1.00 30.83 ? 191 PRO E CD    1 
ATOM   1864 N N     . GLN E  1 51 ? -53.666 9.277  -4.361  1.00 30.62 ? 192 GLN E N     1 
ATOM   1865 C CA    . GLN E  1 51 ? -54.350 10.510 -4.708  1.00 31.53 ? 192 GLN E CA    1 
ATOM   1866 C C     . GLN E  1 51 ? -53.939 10.985 -6.094  1.00 31.13 ? 192 GLN E C     1 
ATOM   1867 O O     . GLN E  1 51 ? -54.766 11.395 -6.875  1.00 31.59 ? 192 GLN E O     1 
ATOM   1868 C CB    . GLN E  1 51 ? -54.046 11.597 -3.684  1.00 32.29 ? 192 GLN E CB    1 
ATOM   1869 C CG    . GLN E  1 51 ? -55.020 12.758 -3.754  1.00 35.28 ? 192 GLN E CG    1 
ATOM   1870 C CD    . GLN E  1 51 ? -54.748 13.852 -2.726  1.00 35.58 ? 192 GLN E CD    1 
ATOM   1871 O OE1   . GLN E  1 51 ? -53.736 13.858 -2.046  1.00 33.43 ? 192 GLN E OE1   1 
ATOM   1872 N NE2   . GLN E  1 51 ? -55.672 14.791 -2.633  1.00 39.52 ? 192 GLN E NE2   1 
ATOM   1873 N N     . LEU E  1 52 ? -52.656 10.896 -6.364  1.00 29.61 ? 193 LEU E N     1 
ATOM   1874 C CA    . LEU E  1 52 ? -52.074 11.259 -7.634  1.00 30.85 ? 193 LEU E CA    1 
ATOM   1875 C C     . LEU E  1 52 ? -52.451 10.272 -8.761  1.00 31.38 ? 193 LEU E C     1 
ATOM   1876 O O     . LEU E  1 52 ? -52.789 10.692 -9.836  1.00 29.77 ? 193 LEU E O     1 
ATOM   1877 C CB    . LEU E  1 52 ? -50.556 11.312 -7.485  1.00 31.35 ? 193 LEU E CB    1 
ATOM   1878 C CG    . LEU E  1 52 ? -49.739 11.961 -8.574  1.00 32.09 ? 193 LEU E CG    1 
ATOM   1879 C CD1   . LEU E  1 52 ? -50.120 13.424 -8.714  1.00 32.14 ? 193 LEU E CD1   1 
ATOM   1880 C CD2   . LEU E  1 52 ? -48.264 11.824 -8.216  1.00 32.15 ? 193 LEU E CD2   1 
ATOM   1881 N N     . ALA E  1 53 ? -52.404 8.973  -8.464  1.00 32.18 ? 194 ALA E N     1 
ATOM   1882 C CA    . ALA E  1 53 ? -52.887 7.931  -9.384  1.00 34.06 ? 194 ALA E CA    1 
ATOM   1883 C C     . ALA E  1 53 ? -54.373 8.078  -9.743  1.00 35.51 ? 194 ALA E C     1 
ATOM   1884 O O     . ALA E  1 53 ? -54.730 7.907  -10.900 1.00 37.35 ? 194 ALA E O     1 
ATOM   1885 C CB    . ALA E  1 53 ? -52.611 6.535  -8.823  1.00 34.91 ? 194 ALA E CB    1 
ATOM   1886 N N     . ARG E  1 54 ? -55.216 8.401  -8.762  1.00 36.63 ? 195 ARG E N     1 
ATOM   1887 C CA    . ARG E  1 54 ? -56.671 8.562  -8.976  1.00 39.82 ? 195 ARG E CA    1 
ATOM   1888 C C     . ARG E  1 54 ? -56.969 9.785  -9.841  1.00 39.33 ? 195 ARG E C     1 
ATOM   1889 O O     . ARG E  1 54 ? -57.972 9.792  -10.574 1.00 42.58 ? 195 ARG E O     1 
ATOM   1890 C CB    . ARG E  1 54 ? -57.444 8.708  -7.650  1.00 43.12 ? 195 ARG E CB    1 
ATOM   1891 C CG    . ARG E  1 54 ? -57.616 7.432  -6.847  1.00 47.36 ? 195 ARG E CG    1 
ATOM   1892 C CD    . ARG E  1 54 ? -58.554 7.642  -5.642  1.00 49.55 ? 195 ARG E CD    1 
ATOM   1893 N NE    . ARG E  1 54 ? -58.130 8.697  -4.716  1.00 49.11 ? 195 ARG E NE    1 
ATOM   1894 C CZ    . ARG E  1 54 ? -57.363 8.537  -3.622  1.00 50.90 ? 195 ARG E CZ    1 
ATOM   1895 N NH1   . ARG E  1 54 ? -56.855 7.344  -3.279  1.00 50.80 ? 195 ARG E NH1   1 
ATOM   1896 N NH2   . ARG E  1 54 ? -57.071 9.603  -2.861  1.00 49.50 ? 195 ARG E NH2   1 
ATOM   1897 N N     . TYR E  1 55 ? -56.118 10.821 -9.757  1.00 34.48 ? 196 TYR E N     1 
ATOM   1898 C CA    . TYR E  1 55 ? -56.312 12.010 -10.576 1.00 32.31 ? 196 TYR E CA    1 
ATOM   1899 C C     . TYR E  1 55 ? -55.863 11.789 -12.031 1.00 32.28 ? 196 TYR E C     1 
ATOM   1900 O O     . TYR E  1 55 ? -56.577 12.150 -12.963 1.00 32.46 ? 196 TYR E O     1 
ATOM   1901 C CB    . TYR E  1 55 ? -55.552 13.181 -9.992  1.00 29.95 ? 196 TYR E CB    1 
ATOM   1902 C CG    . TYR E  1 55 ? -55.875 14.493 -10.665 1.00 30.14 ? 196 TYR E CG    1 
ATOM   1903 C CD1   . TYR E  1 55 ? -57.083 15.137 -10.434 1.00 30.91 ? 196 TYR E CD1   1 
ATOM   1904 C CD2   . TYR E  1 55 ? -54.978 15.082 -11.568 1.00 30.01 ? 196 TYR E CD2   1 
ATOM   1905 C CE1   . TYR E  1 55 ? -57.383 16.351 -11.045 1.00 32.24 ? 196 TYR E CE1   1 
ATOM   1906 C CE2   . TYR E  1 55 ? -55.276 16.285 -12.184 1.00 30.86 ? 196 TYR E CE2   1 
ATOM   1907 C CZ    . TYR E  1 55 ? -56.476 16.908 -11.922 1.00 32.28 ? 196 TYR E CZ    1 
ATOM   1908 O OH    . TYR E  1 55 ? -56.761 18.082 -12.535 1.00 36.42 ? 196 TYR E OH    1 
ATOM   1909 N N     . LEU E  1 56 ? -54.670 11.220 -12.205 1.00 31.23 ? 197 LEU E N     1 
ATOM   1910 C CA    . LEU E  1 56 ? -54.090 11.024 -13.561 1.00 32.28 ? 197 LEU E CA    1 
ATOM   1911 C C     . LEU E  1 56 ? -54.716 9.869  -14.345 1.00 32.68 ? 197 LEU E C     1 
ATOM   1912 O O     . LEU E  1 56 ? -54.708 9.885  -15.593 1.00 33.01 ? 197 LEU E O     1 
ATOM   1913 C CB    . LEU E  1 56 ? -52.561 10.855 -13.468 1.00 31.61 ? 197 LEU E CB    1 
ATOM   1914 C CG    . LEU E  1 56 ? -51.821 12.159 -13.025 1.00 30.92 ? 197 LEU E CG    1 
ATOM   1915 C CD1   . LEU E  1 56 ? -50.416 11.883 -12.539 1.00 30.42 ? 197 LEU E CD1   1 
ATOM   1916 C CD2   . LEU E  1 56 ? -51.784 13.162 -14.175 1.00 31.28 ? 197 LEU E CD2   1 
ATOM   1917 N N     . GLY E  1 57 ? -55.228 8.867  -13.630 1.00 32.43 ? 198 GLY E N     1 
ATOM   1918 C CA    . GLY E  1 57 ? -55.792 7.666  -14.251 1.00 34.27 ? 198 GLY E CA    1 
ATOM   1919 C C     . GLY E  1 57 ? -54.765 6.994  -15.170 1.00 34.66 ? 198 GLY E C     1 
ATOM   1920 O O     . GLY E  1 57 ? -53.570 6.857  -14.801 1.00 33.15 ? 198 GLY E O     1 
ATOM   1921 N N     . ASN E  1 58 ? -55.209 6.670  -16.399 1.00 35.70 ? 199 ASN E N     1 
ATOM   1922 C CA    . ASN E  1 58 ? -54.381 5.952  -17.369 1.00 36.23 ? 199 ASN E CA    1 
ATOM   1923 C C     . ASN E  1 58 ? -53.493 6.851  -18.222 1.00 36.14 ? 199 ASN E C     1 
ATOM   1924 O O     . ASN E  1 58 ? -52.834 6.367  -19.174 1.00 37.18 ? 199 ASN E O     1 
ATOM   1925 C CB    . ASN E  1 58 ? -55.258 5.035  -18.264 1.00 38.01 ? 199 ASN E CB    1 
ATOM   1926 C CG    . ASN E  1 58 ? -56.202 5.805  -19.212 1.00 38.21 ? 199 ASN E CG    1 
ATOM   1927 O OD1   . ASN E  1 58 ? -56.195 7.037  -19.291 1.00 36.03 ? 199 ASN E OD1   1 
ATOM   1928 N ND2   . ASN E  1 58 ? -57.023 5.049  -19.949 1.00 40.33 ? 199 ASN E ND2   1 
ATOM   1929 N N     . THR E  1 59 ? -53.472 8.156  -17.947 1.00 35.01 ? 200 THR E N     1 
ATOM   1930 C CA    . THR E  1 59 ? -52.598 9.031  -18.729 1.00 34.86 ? 200 THR E CA    1 
ATOM   1931 C C     . THR E  1 59 ? -51.159 8.778  -18.387 1.00 35.81 ? 200 THR E C     1 
ATOM   1932 O O     . THR E  1 59 ? -50.305 9.096  -19.166 1.00 36.10 ? 200 THR E O     1 
ATOM   1933 C CB    . THR E  1 59 ? -52.890 10.511 -18.514 1.00 33.82 ? 200 THR E CB    1 
ATOM   1934 O OG1   . THR E  1 59 ? -52.775 10.827 -17.104 1.00 32.40 ? 200 THR E OG1   1 
ATOM   1935 C CG2   . THR E  1 59 ? -54.254 10.848 -19.029 1.00 33.98 ? 200 THR E CG2   1 
ATOM   1936 N N     . VAL E  1 60 ? -50.889 8.235  -17.187 1.00 37.40 ? 201 VAL E N     1 
ATOM   1937 C CA    . VAL E  1 60 ? -49.530 7.856  -16.818 1.00 38.93 ? 201 VAL E CA    1 
ATOM   1938 C C     . VAL E  1 60 ? -49.529 6.563  -15.996 1.00 41.90 ? 201 VAL E C     1 
ATOM   1939 O O     . VAL E  1 60 ? -50.505 6.249  -15.291 1.00 43.92 ? 201 VAL E O     1 
ATOM   1940 C CB    . VAL E  1 60 ? -48.776 8.977  -16.019 1.00 36.44 ? 201 VAL E CB    1 
ATOM   1941 C CG1   . VAL E  1 60 ? -49.096 10.383 -16.502 1.00 34.78 ? 201 VAL E CG1   1 
ATOM   1942 C CG2   . VAL E  1 60 ? -49.023 8.863  -14.553 1.00 36.04 ? 201 VAL E CG2   1 
ATOM   1943 N N     . ASP E  1 61 ? -48.414 5.843  -16.070 1.00 43.44 ? 202 ASP E N     1 
ATOM   1944 C CA    . ASP E  1 61 ? -48.196 4.628  -15.295 1.00 43.72 ? 202 ASP E CA    1 
ATOM   1945 C C     . ASP E  1 61 ? -47.249 4.996  -14.146 1.00 41.68 ? 202 ASP E C     1 
ATOM   1946 O O     . ASP E  1 61 ? -46.085 5.262  -14.372 1.00 41.76 ? 202 ASP E O     1 
ATOM   1947 C CB    . ASP E  1 61 ? -47.597 3.547  -16.230 1.00 46.94 ? 202 ASP E CB    1 
ATOM   1948 C CG    . ASP E  1 61 ? -47.252 2.231  -15.512 1.00 49.37 ? 202 ASP E CG    1 
ATOM   1949 O OD1   . ASP E  1 61 ? -47.650 2.019  -14.341 1.00 50.81 ? 202 ASP E OD1   1 
ATOM   1950 O OD2   . ASP E  1 61 ? -46.557 1.398  -16.139 1.00 53.27 ? 202 ASP E OD2   1 
ATOM   1951 N N     . LEU E  1 62 ? -47.768 5.013  -12.924 1.00 40.51 ? 203 LEU E N     1 
ATOM   1952 C CA    . LEU E  1 62 ? -46.992 5.377  -11.734 1.00 39.25 ? 203 LEU E CA    1 
ATOM   1953 C C     . LEU E  1 62 ? -46.559 4.165  -10.908 1.00 41.34 ? 203 LEU E C     1 
ATOM   1954 O O     . LEU E  1 62 ? -46.102 4.332  -9.777  1.00 40.03 ? 203 LEU E O     1 
ATOM   1955 C CB    . LEU E  1 62 ? -47.829 6.288  -10.828 1.00 37.95 ? 203 LEU E CB    1 
ATOM   1956 C CG    . LEU E  1 62 ? -48.303 7.626  -11.353 1.00 36.58 ? 203 LEU E CG    1 
ATOM   1957 C CD1   . LEU E  1 62 ? -49.039 8.329  -10.242 1.00 35.93 ? 203 LEU E CD1   1 
ATOM   1958 C CD2   . LEU E  1 62 ? -47.153 8.480  -11.835 1.00 36.31 ? 203 LEU E CD2   1 
ATOM   1959 N N     . SER E  1 63 ? -46.699 2.951  -11.457 1.00 44.28 ? 204 SER E N     1 
ATOM   1960 C CA    . SER E  1 63 ? -46.230 1.717  -10.799 1.00 46.69 ? 204 SER E CA    1 
ATOM   1961 C C     . SER E  1 63 ? -44.812 1.816  -10.214 1.00 46.80 ? 204 SER E C     1 
ATOM   1962 O O     . SER E  1 63 ? -44.591 1.417  -9.060  1.00 47.77 ? 204 SER E O     1 
ATOM   1963 C CB    . SER E  1 63 ? -46.263 0.587  -11.801 1.00 50.29 ? 204 SER E CB    1 
ATOM   1964 O OG    . SER E  1 63 ? -45.607 1.014  -12.975 1.00 50.96 ? 204 SER E OG    1 
ATOM   1965 N N     . SER E  1 64 ? -43.879 2.363  -11.005 1.00 45.49 ? 205 SER E N     1 
ATOM   1966 C CA    . SER E  1 64 ? -42.451 2.499  -10.620 1.00 45.91 ? 205 SER E CA    1 
ATOM   1967 C C     . SER E  1 64 ? -42.069 3.887  -10.045 1.00 42.77 ? 205 SER E C     1 
ATOM   1968 O O     . SER E  1 64 ? -40.877 4.148  -9.737  1.00 42.27 ? 205 SER E O     1 
ATOM   1969 C CB    . SER E  1 64 ? -41.578 2.227  -11.845 1.00 49.47 ? 205 SER E CB    1 
ATOM   1970 O OG    . SER E  1 64 ? -41.772 3.252  -12.824 1.00 49.46 ? 205 SER E OG    1 
ATOM   1971 N N     . PHE E  1 65 ? -43.072 4.757  -9.884  1.00 39.34 ? 206 PHE E N     1 
ATOM   1972 C CA    . PHE E  1 65 ? -42.863 6.147  -9.542  1.00 36.76 ? 206 PHE E CA    1 
ATOM   1973 C C     . PHE E  1 65 ? -42.641 6.236  -8.047  1.00 36.05 ? 206 PHE E C     1 
ATOM   1974 O O     . PHE E  1 65 ? -43.434 5.691  -7.261  1.00 34.75 ? 206 PHE E O     1 
ATOM   1975 C CB    . PHE E  1 65 ? -44.068 6.992  -9.940  1.00 34.12 ? 206 PHE E CB    1 
ATOM   1976 C CG    . PHE E  1 65 ? -43.923 8.478  -9.624  1.00 32.36 ? 206 PHE E CG    1 
ATOM   1977 C CD1   . PHE E  1 65 ? -43.092 9.297  -10.395 1.00 32.24 ? 206 PHE E CD1   1 
ATOM   1978 C CD2   . PHE E  1 65 ? -44.649 9.067  -8.565  1.00 30.37 ? 206 PHE E CD2   1 
ATOM   1979 C CE1   . PHE E  1 65 ? -42.961 10.650 -10.137 1.00 31.04 ? 206 PHE E CE1   1 
ATOM   1980 C CE2   . PHE E  1 65 ? -44.543 10.438 -8.304  1.00 29.08 ? 206 PHE E CE2   1 
ATOM   1981 C CZ    . PHE E  1 65 ? -43.693 11.237 -9.080  1.00 29.59 ? 206 PHE E CZ    1 
ATOM   1982 N N     . ASP E  1 66 ? -41.559 6.908  -7.657  1.00 35.67 ? 207 ASP E N     1 
ATOM   1983 C CA    . ASP E  1 66 ? -41.212 7.047  -6.257  1.00 35.22 ? 207 ASP E CA    1 
ATOM   1984 C C     . ASP E  1 66 ? -41.671 8.420  -5.753  1.00 32.31 ? 207 ASP E C     1 
ATOM   1985 O O     . ASP E  1 66 ? -41.073 9.465  -6.069  1.00 30.49 ? 207 ASP E O     1 
ATOM   1986 C CB    . ASP E  1 66 ? -39.714 6.885  -6.023  1.00 38.24 ? 207 ASP E CB    1 
ATOM   1987 C CG    . ASP E  1 66 ? -39.365 6.885  -4.524  1.00 39.97 ? 207 ASP E CG    1 
ATOM   1988 O OD1   . ASP E  1 66 ? -40.040 6.168  -3.775  1.00 40.46 ? 207 ASP E OD1   1 
ATOM   1989 O OD2   . ASP E  1 66 ? -38.443 7.588  -4.113  1.00 42.74 ? 207 ASP E OD2   1 
ATOM   1990 N N     . PHE E  1 67 ? -42.721 8.396  -4.966  1.00 30.56 ? 208 PHE E N     1 
ATOM   1991 C CA    . PHE E  1 67 ? -43.385 9.604  -4.529  1.00 29.27 ? 208 PHE E CA    1 
ATOM   1992 C C     . PHE E  1 67 ? -42.457 10.594 -3.790  1.00 29.95 ? 208 PHE E C     1 
ATOM   1993 O O     . PHE E  1 67 ? -42.488 11.788 -4.045  1.00 28.15 ? 208 PHE E O     1 
ATOM   1994 C CB    . PHE E  1 67 ? -44.577 9.245  -3.634  1.00 28.34 ? 208 PHE E CB    1 
ATOM   1995 C CG    . PHE E  1 67 ? -45.480 10.405 -3.379  1.00 27.31 ? 208 PHE E CG    1 
ATOM   1996 C CD1   . PHE E  1 67 ? -46.433 10.774 -4.325  1.00 27.15 ? 208 PHE E CD1   1 
ATOM   1997 C CD2   . PHE E  1 67 ? -45.368 11.146 -2.223  1.00 26.93 ? 208 PHE E CD2   1 
ATOM   1998 C CE1   . PHE E  1 67 ? -47.273 11.858 -4.113  1.00 26.67 ? 208 PHE E CE1   1 
ATOM   1999 C CE2   . PHE E  1 67 ? -46.207 12.241 -1.999  1.00 26.61 ? 208 PHE E CE2   1 
ATOM   2000 C CZ    . PHE E  1 67 ? -47.155 12.596 -2.951  1.00 25.92 ? 208 PHE E CZ    1 
ATOM   2001 N N     . ARG E  1 68 ? -41.642 10.081 -2.881  1.00 33.08 ? 209 ARG E N     1 
ATOM   2002 C CA    . ARG E  1 68 ? -40.743 10.907 -2.078  1.00 34.76 ? 209 ARG E CA    1 
ATOM   2003 C C     . ARG E  1 68 ? -39.721 11.664 -2.918  1.00 35.00 ? 209 ARG E C     1 
ATOM   2004 O O     . ARG E  1 68 ? -39.454 12.844 -2.657  1.00 35.72 ? 209 ARG E O     1 
ATOM   2005 C CB    . ARG E  1 68 ? -40.029 10.048 -1.035  1.00 38.37 ? 209 ARG E CB    1 
ATOM   2006 C CG    . ARG E  1 68 ? -39.124 10.846 -0.076  1.00 41.39 ? 209 ARG E CG    1 
ATOM   2007 C CD    . ARG E  1 68 ? -39.025 10.197 1.297   1.00 43.07 ? 209 ARG E CD    1 
ATOM   2008 N NE    . ARG E  1 68 ? -40.257 10.435 2.063   1.00 44.12 ? 209 ARG E NE    1 
ATOM   2009 C CZ    . ARG E  1 68 ? -40.536 11.540 2.777   1.00 43.33 ? 209 ARG E CZ    1 
ATOM   2010 N NH1   . ARG E  1 68 ? -39.673 12.558 2.851   1.00 43.81 ? 209 ARG E NH1   1 
ATOM   2011 N NH2   . ARG E  1 68 ? -41.703 11.637 3.411   1.00 42.22 ? 209 ARG E NH2   1 
ATOM   2012 N N     . THR E  1 69 ? -39.171 10.998 -3.923  1.00 35.91 ? 210 THR E N     1 
ATOM   2013 C CA    . THR E  1 69 ? -38.098 11.566 -4.745  1.00 36.95 ? 210 THR E CA    1 
ATOM   2014 C C     . THR E  1 69 ? -38.579 12.163 -6.046  1.00 36.98 ? 210 THR E C     1 
ATOM   2015 O O     . THR E  1 69 ? -37.862 12.949 -6.648  1.00 39.47 ? 210 THR E O     1 
ATOM   2016 C CB    . THR E  1 69 ? -37.075 10.494 -5.146  1.00 38.56 ? 210 THR E CB    1 
ATOM   2017 O OG1   . THR E  1 69 ? -37.743 9.450  -5.850  1.00 37.69 ? 210 THR E OG1   1 
ATOM   2018 C CG2   . THR E  1 69 ? -36.336 9.943  -3.918  1.00 39.20 ? 210 THR E CG2   1 
ATOM   2019 N N     . GLY E  1 70 ? -39.759 11.758 -6.510  1.00 35.03 ? 211 GLY E N     1 
ATOM   2020 C CA    . GLY E  1 70 ? -40.278 12.222 -7.790  1.00 35.00 ? 211 GLY E CA    1 
ATOM   2021 C C     . GLY E  1 70 ? -39.695 11.534 -9.028  1.00 37.81 ? 211 GLY E C     1 
ATOM   2022 O O     . GLY E  1 70 ? -39.901 12.012 -10.169 1.00 36.71 ? 211 GLY E O     1 
ATOM   2023 N N     . LYS E  1 71 ? -39.006 10.405 -8.810  1.00 38.76 ? 212 LYS E N     1 
ATOM   2024 C CA    . LYS E  1 71 ? -38.286 9.675  -9.867  1.00 40.65 ? 212 LYS E CA    1 
ATOM   2025 C C     . LYS E  1 71 ? -38.931 8.321  -10.119 1.00 41.32 ? 212 LYS E C     1 
ATOM   2026 O O     . LYS E  1 71 ? -39.400 7.681  -9.192  1.00 39.89 ? 212 LYS E O     1 
ATOM   2027 C CB    . LYS E  1 71 ? -36.850 9.415  -9.422  1.00 43.28 ? 212 LYS E CB    1 
ATOM   2028 C CG    . LYS E  1 71 ? -35.955 10.630 -9.370  1.00 43.88 ? 212 LYS E CG    1 
ATOM   2029 C CD    . LYS E  1 71 ? -34.655 10.302 -8.628  1.00 45.80 ? 212 LYS E CD    1 
ATOM   2030 N N     . MET E  1 72 ? -38.923 7.880  -11.375 1.00 44.72 ? 213 MET E N     1 
ATOM   2031 C CA    . MET E  1 72 ? -39.235 6.486  -11.740 1.00 48.47 ? 213 MET E CA    1 
ATOM   2032 C C     . MET E  1 72 ? -38.047 5.583  -11.373 1.00 53.17 ? 213 MET E C     1 
ATOM   2033 O O     . MET E  1 72 ? -36.902 5.935  -11.677 1.00 55.44 ? 213 MET E O     1 
ATOM   2034 C CB    . MET E  1 72 ? -39.485 6.382  -13.256 1.00 50.07 ? 213 MET E CB    1 
ATOM   2035 C CG    . MET E  1 72 ? -40.684 7.167  -13.759 1.00 47.62 ? 213 MET E CG    1 
ATOM   2036 S SD    . MET E  1 72 ? -42.237 6.472  -13.161 1.00 47.95 ? 213 MET E SD    1 
ATOM   2037 C CE    . MET E  1 72 ? -43.435 7.413  -14.097 1.00 46.50 ? 213 MET E CE    1 
ATOM   2038 N N     . MET E  1 73 ? -38.307 4.427  -10.743 1.00 56.32 ? 214 MET E N     1 
ATOM   2039 C CA    . MET E  1 73 ? -37.222 3.522  -10.252 1.00 61.17 ? 214 MET E CA    1 
ATOM   2040 C C     . MET E  1 73 ? -37.020 2.236  -11.087 1.00 64.51 ? 214 MET E C     1 
ATOM   2041 O O     . MET E  1 73 ? -37.769 1.987  -12.024 1.00 63.60 ? 214 MET E O     1 
ATOM   2042 C CB    . MET E  1 73 ? -37.456 3.176  -8.779  1.00 62.03 ? 214 MET E CB    1 
ATOM   2043 C CG    . MET E  1 73 ? -37.453 4.379  -7.855  1.00 62.35 ? 214 MET E CG    1 
ATOM   2044 S SD    . MET E  1 73 ? -36.026 5.488  -8.052  1.00 67.86 ? 214 MET E SD    1 
ATOM   2045 C CE    . MET E  1 73 ? -36.103 6.431  -6.520  1.00 64.15 ? 214 MET E CE    1 
ATOM   2046 N N     . PRO E  1 74 ? -35.965 1.442  -10.750 1.00 67.56 ? 215 PRO E N     1 
ATOM   2047 C CA    . PRO E  1 74 ? -35.476 0.192  -11.354 1.00 71.87 ? 215 PRO E CA    1 
ATOM   2048 N N     . LYS F  1 7  ? -75.706 26.305 21.329  1.00 60.99 ? 148 LYS F N     1 
ATOM   2049 C CA    . LYS F  1 7  ? -75.871 26.564 22.812  1.00 62.15 ? 148 LYS F CA    1 
ATOM   2050 C C     . LYS F  1 7  ? -74.611 26.178 23.622  1.00 60.28 ? 148 LYS F C     1 
ATOM   2051 O O     . LYS F  1 7  ? -73.850 25.267 23.238  1.00 57.62 ? 148 LYS F O     1 
ATOM   2052 C CB    . LYS F  1 7  ? -77.117 25.843 23.355  1.00 62.54 ? 148 LYS F CB    1 
ATOM   2053 N N     . ARG F  1 8  ? -74.407 26.889 24.733  1.00 62.14 ? 149 ARG F N     1 
ATOM   2054 C CA    . ARG F  1 8  ? -73.209 26.770 25.559  1.00 61.92 ? 149 ARG F CA    1 
ATOM   2055 C C     . ARG F  1 8  ? -73.489 25.943 26.833  1.00 64.06 ? 149 ARG F C     1 
ATOM   2056 O O     . ARG F  1 8  ? -73.884 26.510 27.883  1.00 65.27 ? 149 ARG F O     1 
ATOM   2057 C CB    . ARG F  1 8  ? -72.701 28.168 25.983  1.00 66.52 ? 149 ARG F CB    1 
ATOM   2058 C CG    . ARG F  1 8  ? -72.086 29.062 24.905  1.00 67.03 ? 149 ARG F CG    1 
ATOM   2059 C CD    . ARG F  1 8  ? -71.527 30.317 25.583  1.00 71.38 ? 149 ARG F CD    1 
ATOM   2060 N NE    . ARG F  1 8  ? -71.103 31.369 24.655  1.00 72.54 ? 149 ARG F NE    1 
ATOM   2061 C CZ    . ARG F  1 8  ? -70.579 32.554 25.021  1.00 76.72 ? 149 ARG F CZ    1 
ATOM   2062 N NH1   . ARG F  1 8  ? -70.394 32.869 26.315  1.00 78.17 ? 149 ARG F NH1   1 
ATOM   2063 N NH2   . ARG F  1 8  ? -70.228 33.438 24.080  1.00 77.87 ? 149 ARG F NH2   1 
ATOM   2064 N N     . MET F  1 9  ? -73.266 24.628 26.757  1.00 60.67 ? 150 MET F N     1 
ATOM   2065 C CA    . MET F  1 9  ? -73.416 23.738 27.932  1.00 61.20 ? 150 MET F CA    1 
ATOM   2066 C C     . MET F  1 9  ? -72.221 23.878 28.902  1.00 60.87 ? 150 MET F C     1 
ATOM   2067 O O     . MET F  1 9  ? -71.079 24.066 28.461  1.00 57.22 ? 150 MET F O     1 
ATOM   2068 C CB    . MET F  1 9  ? -73.534 22.285 27.477  1.00 60.45 ? 150 MET F CB    1 
ATOM   2069 N N     . ASP F  1 10 ? -72.495 23.802 30.220  1.00 63.80 ? 151 ASP F N     1 
ATOM   2070 C CA    . ASP F  1 10 ? -71.438 23.689 31.270  1.00 62.75 ? 151 ASP F CA    1 
ATOM   2071 C C     . ASP F  1 10 ? -70.536 22.483 30.968  1.00 59.40 ? 151 ASP F C     1 
ATOM   2072 O O     . ASP F  1 10 ? -71.017 21.449 30.463  1.00 58.20 ? 151 ASP F O     1 
ATOM   2073 C CB    . ASP F  1 10 ? -72.047 23.508 32.689  1.00 67.36 ? 151 ASP F CB    1 
ATOM   2074 C CG    . ASP F  1 10 ? -72.382 24.833 33.388  1.00 70.44 ? 151 ASP F CG    1 
ATOM   2075 O OD1   . ASP F  1 10 ? -72.428 25.896 32.729  1.00 69.28 ? 151 ASP F OD1   1 
ATOM   2076 O OD2   . ASP F  1 10 ? -72.606 24.800 34.627  1.00 74.05 ? 151 ASP F OD2   1 
ATOM   2077 N N     . CYS F  1 11 ? -69.241 22.635 31.267  1.00 56.40 ? 152 CYS F N     1 
ATOM   2078 C CA    . CYS F  1 11 ? -68.252 21.568 31.147  1.00 52.97 ? 152 CYS F CA    1 
ATOM   2079 C C     . CYS F  1 11 ? -67.717 21.232 32.570  1.00 54.85 ? 152 CYS F C     1 
ATOM   2080 O O     . CYS F  1 11 ? -66.785 21.893 33.063  1.00 54.98 ? 152 CYS F O     1 
ATOM   2081 C CB    . CYS F  1 11 ? -67.115 21.998 30.216  1.00 49.38 ? 152 CYS F CB    1 
ATOM   2082 S SG    . CYS F  1 11 ? -65.866 20.720 29.969  1.00 48.04 ? 152 CYS F SG    1 
ATOM   2083 N N     . PRO F  1 12 ? -68.301 20.205 33.233  1.00 56.04 ? 153 PRO F N     1 
ATOM   2084 C CA    . PRO F  1 12 ? -67.931 19.947 34.640  1.00 59.48 ? 153 PRO F CA    1 
ATOM   2085 C C     . PRO F  1 12 ? -66.465 19.544 34.897  1.00 59.04 ? 153 PRO F C     1 
ATOM   2086 O O     . PRO F  1 12 ? -66.005 19.677 36.039  1.00 61.95 ? 153 PRO F O     1 
ATOM   2087 C CB    . PRO F  1 12 ? -68.882 18.807 35.050  1.00 61.36 ? 153 PRO F CB    1 
ATOM   2088 C CG    . PRO F  1 12 ? -69.271 18.155 33.769  1.00 58.38 ? 153 PRO F CG    1 
ATOM   2089 C CD    . PRO F  1 12 ? -69.362 19.281 32.788  1.00 55.78 ? 153 PRO F CD    1 
ATOM   2090 N N     . ALA F  1 13 ? -65.741 19.061 33.879  1.00 55.39 ? 154 ALA F N     1 
ATOM   2091 C CA    . ALA F  1 13 ? -64.321 18.691 34.058  1.00 55.62 ? 154 ALA F CA    1 
ATOM   2092 C C     . ALA F  1 13 ? -63.450 19.926 34.269  1.00 56.03 ? 154 ALA F C     1 
ATOM   2093 O O     . ALA F  1 13 ? -62.412 19.857 34.955  1.00 57.80 ? 154 ALA F O     1 
ATOM   2094 C CB    . ALA F  1 13 ? -63.817 17.864 32.896  1.00 53.12 ? 154 ALA F CB    1 
ATOM   2095 N N     . LEU F  1 14 ? -63.895 21.057 33.711  1.00 54.65 ? 155 LEU F N     1 
ATOM   2096 C CA    . LEU F  1 14 ? -63.274 22.368 33.954  1.00 55.80 ? 155 LEU F CA    1 
ATOM   2097 C C     . LEU F  1 14 ? -63.920 23.071 35.191  1.00 59.72 ? 155 LEU F C     1 
ATOM   2098 O O     . LEU F  1 14 ? -64.927 22.582 35.720  1.00 60.42 ? 155 LEU F O     1 
ATOM   2099 C CB    . LEU F  1 14 ? -63.403 23.220 32.690  1.00 53.36 ? 155 LEU F CB    1 
ATOM   2100 C CG    . LEU F  1 14 ? -62.739 22.584 31.453  1.00 50.53 ? 155 LEU F CG    1 
ATOM   2101 C CD1   . LEU F  1 14 ? -62.973 23.445 30.220  1.00 48.55 ? 155 LEU F CD1   1 
ATOM   2102 C CD2   . LEU F  1 14 ? -61.242 22.331 31.655  1.00 51.08 ? 155 LEU F CD2   1 
ATOM   2103 N N     . PRO F  1 15 ? -63.342 24.216 35.653  1.00 61.25 ? 156 PRO F N     1 
ATOM   2104 C CA    . PRO F  1 15 ? -63.960 24.914 36.788  1.00 65.55 ? 156 PRO F CA    1 
ATOM   2105 C C     . PRO F  1 15 ? -65.371 25.450 36.487  1.00 65.25 ? 156 PRO F C     1 
ATOM   2106 O O     . PRO F  1 15 ? -65.843 25.338 35.326  1.00 61.91 ? 156 PRO F O     1 
ATOM   2107 C CB    . PRO F  1 15 ? -62.970 26.065 37.093  1.00 67.38 ? 156 PRO F CB    1 
ATOM   2108 C CG    . PRO F  1 15 ? -61.677 25.631 36.484  1.00 64.78 ? 156 PRO F CG    1 
ATOM   2109 C CD    . PRO F  1 15 ? -62.046 24.817 35.286  1.00 61.09 ? 156 PRO F CD    1 
ATOM   2110 N N     . PRO F  1 16 ? -66.054 25.996 37.524  1.00 68.10 ? 157 PRO F N     1 
ATOM   2111 C CA    . PRO F  1 16 ? -67.405 26.533 37.321  1.00 68.75 ? 157 PRO F CA    1 
ATOM   2112 C C     . PRO F  1 16 ? -67.365 27.755 36.426  1.00 67.22 ? 157 PRO F C     1 
ATOM   2113 O O     . PRO F  1 16 ? -66.356 28.491 36.418  1.00 66.15 ? 157 PRO F O     1 
ATOM   2114 C CB    . PRO F  1 16 ? -67.898 26.904 38.756  1.00 74.26 ? 157 PRO F CB    1 
ATOM   2115 C CG    . PRO F  1 16 ? -66.845 26.454 39.699  1.00 75.54 ? 157 PRO F CG    1 
ATOM   2116 C CD    . PRO F  1 16 ? -65.604 26.111 38.932  1.00 72.28 ? 157 PRO F CD    1 
ATOM   2117 N N     . GLY F  1 17 ? -68.450 27.939 35.662  1.00 67.05 ? 158 GLY F N     1 
ATOM   2118 C CA    . GLY F  1 17 ? -68.573 29.023 34.693  1.00 66.21 ? 158 GLY F CA    1 
ATOM   2119 C C     . GLY F  1 17 ? -68.192 28.591 33.289  1.00 62.08 ? 158 GLY F C     1 
ATOM   2120 O O     . GLY F  1 17 ? -68.810 29.054 32.317  1.00 61.59 ? 158 GLY F O     1 
ATOM   2121 N N     . TRP F  1 18 ? -67.179 27.714 33.160  1.00 59.97 ? 159 TRP F N     1 
ATOM   2122 C CA    . TRP F  1 18 ? -66.703 27.274 31.829  1.00 55.51 ? 159 TRP F CA    1 
ATOM   2123 C C     . TRP F  1 18 ? -67.769 26.511 31.043  1.00 54.32 ? 159 TRP F C     1 
ATOM   2124 O O     . TRP F  1 18 ? -68.380 25.550 31.551  1.00 55.16 ? 159 TRP F O     1 
ATOM   2125 C CB    . TRP F  1 18 ? -65.426 26.423 31.914  1.00 53.48 ? 159 TRP F CB    1 
ATOM   2126 C CG    . TRP F  1 18 ? -64.217 27.204 32.263  1.00 54.42 ? 159 TRP F CG    1 
ATOM   2127 C CD1   . TRP F  1 18 ? -63.788 27.542 33.531  1.00 57.72 ? 159 TRP F CD1   1 
ATOM   2128 C CD2   . TRP F  1 18 ? -63.265 27.759 31.358  1.00 52.36 ? 159 TRP F CD2   1 
ATOM   2129 N NE1   . TRP F  1 18 ? -62.624 28.271 33.460  1.00 57.87 ? 159 TRP F NE1   1 
ATOM   2130 C CE2   . TRP F  1 18 ? -62.276 28.422 32.142  1.00 55.44 ? 159 TRP F CE2   1 
ATOM   2131 C CE3   . TRP F  1 18 ? -63.142 27.770 29.960  1.00 49.12 ? 159 TRP F CE3   1 
ATOM   2132 C CZ2   . TRP F  1 18 ? -61.175 29.093 31.564  1.00 54.63 ? 159 TRP F CZ2   1 
ATOM   2133 C CZ3   . TRP F  1 18 ? -62.042 28.433 29.381  1.00 48.49 ? 159 TRP F CZ3   1 
ATOM   2134 C CH2   . TRP F  1 18 ? -61.075 29.086 30.186  1.00 51.74 ? 159 TRP F CH2   1 
ATOM   2135 N N     . LYS F  1 19 ? -67.975 26.951 29.804  1.00 51.74 ? 160 LYS F N     1 
ATOM   2136 C CA    . LYS F  1 19 ? -68.930 26.348 28.901  1.00 50.16 ? 160 LYS F CA    1 
ATOM   2137 C C     . LYS F  1 19 ? -68.208 25.737 27.710  1.00 46.54 ? 160 LYS F C     1 
ATOM   2138 O O     . LYS F  1 19 ? -67.064 26.089 27.406  1.00 43.63 ? 160 LYS F O     1 
ATOM   2139 C CB    . LYS F  1 19 ? -69.946 27.387 28.423  1.00 51.24 ? 160 LYS F CB    1 
ATOM   2140 N N     . LYS F  1 20 ? -68.900 24.790 27.086  1.00 46.31 ? 161 LYS F N     1 
ATOM   2141 C CA    . LYS F  1 20 ? -68.517 24.154 25.843  1.00 44.16 ? 161 LYS F CA    1 
ATOM   2142 C C     . LYS F  1 20 ? -69.629 24.414 24.840  1.00 44.28 ? 161 LYS F C     1 
ATOM   2143 O O     . LYS F  1 20 ? -70.807 24.387 25.209  1.00 45.22 ? 161 LYS F O     1 
ATOM   2144 C CB    . LYS F  1 20 ? -68.386 22.637 26.059  1.00 43.62 ? 161 LYS F CB    1 
ATOM   2145 C CG    . LYS F  1 20 ? -68.086 21.817 24.809  1.00 41.25 ? 161 LYS F CG    1 
ATOM   2146 C CD    A LYS F  1 20 ? -68.152 20.307 25.089  0.50 41.70 ? 161 LYS F CD    1 
ATOM   2147 C CD    B LYS F  1 20 ? -68.020 20.323 25.121  0.50 41.93 ? 161 LYS F CD    1 
ATOM   2148 C CE    A LYS F  1 20 ? -68.983 19.570 24.027  0.50 40.41 ? 161 LYS F CE    1 
ATOM   2149 C CE    B LYS F  1 20 ? -67.088 19.594 24.154  0.50 39.97 ? 161 LYS F CE    1 
ATOM   2150 N N     . GLU F  1 21 ? -69.240 24.647 23.580  1.00 41.02 ? 162 GLU F N     1 
ATOM   2151 C CA    . GLU F  1 21 ? -70.162 24.809 22.471  1.00 41.52 ? 162 GLU F CA    1 
ATOM   2152 C C     . GLU F  1 21 ? -69.575 24.008 21.287  1.00 38.04 ? 162 GLU F C     1 
ATOM   2153 O O     . GLU F  1 21 ? -68.358 23.926 21.150  1.00 36.02 ? 162 GLU F O     1 
ATOM   2154 C CB    . GLU F  1 21 ? -70.283 26.304 22.102  1.00 44.84 ? 162 GLU F CB    1 
ATOM   2155 C CG    . GLU F  1 21 ? -71.331 26.651 21.009  1.00 47.58 ? 162 GLU F CG    1 
ATOM   2156 C CD    . GLU F  1 21 ? -71.312 28.134 20.553  1.00 51.49 ? 162 GLU F CD    1 
ATOM   2157 O OE1   . GLU F  1 21 ? -70.286 28.848 20.725  1.00 53.86 ? 162 GLU F OE1   1 
ATOM   2158 O OE2   . GLU F  1 21 ? -72.330 28.590 19.987  1.00 54.84 ? 162 GLU F OE2   1 
ATOM   2159 N N     . GLU F  1 22 ? -70.438 23.407 20.470  1.00 36.60 ? 163 GLU F N     1 
ATOM   2160 C CA    . GLU F  1 22 ? -70.020 22.704 19.221  1.00 34.90 ? 163 GLU F CA    1 
ATOM   2161 C C     . GLU F  1 22 ? -70.847 23.280 18.122  1.00 33.53 ? 163 GLU F C     1 
ATOM   2162 O O     . GLU F  1 22 ? -72.054 23.388 18.272  1.00 35.35 ? 163 GLU F O     1 
ATOM   2163 C CB    . GLU F  1 22 ? -70.246 21.203 19.321  1.00 34.71 ? 163 GLU F CB    1 
ATOM   2164 C CG    . GLU F  1 22 ? -69.774 20.421 18.102  1.00 34.76 ? 163 GLU F CG    1 
ATOM   2165 C CD    . GLU F  1 22 ? -69.656 18.933 18.364  1.00 35.66 ? 163 GLU F CD    1 
ATOM   2166 O OE1   . GLU F  1 22 ? -69.183 18.218 17.463  1.00 38.09 ? 163 GLU F OE1   1 
ATOM   2167 O OE2   . GLU F  1 22 ? -70.037 18.470 19.466  1.00 37.23 ? 163 GLU F OE2   1 
ATOM   2168 N N     . VAL F  1 23 ? -70.204 23.673 17.034  1.00 30.82 ? 164 VAL F N     1 
ATOM   2169 C CA    . VAL F  1 23 ? -70.880 24.365 15.953  1.00 30.64 ? 164 VAL F CA    1 
ATOM   2170 C C     . VAL F  1 23 ? -70.589 23.639 14.653  1.00 27.86 ? 164 VAL F C     1 
ATOM   2171 O O     . VAL F  1 23 ? -69.460 23.552 14.252  1.00 26.84 ? 164 VAL F O     1 
ATOM   2172 C CB    . VAL F  1 23 ? -70.429 25.825 15.860  1.00 30.66 ? 164 VAL F CB    1 
ATOM   2173 C CG1   . VAL F  1 23 ? -71.214 26.576 14.782  1.00 31.22 ? 164 VAL F CG1   1 
ATOM   2174 C CG2   . VAL F  1 23 ? -70.598 26.519 17.217  1.00 33.58 ? 164 VAL F CG2   1 
ATOM   2175 N N     . ILE F  1 24 ? -71.635 23.181 13.988  1.00 27.88 ? 165 ILE F N     1 
ATOM   2176 C CA    . ILE F  1 24 ? -71.510 22.399 12.753  1.00 27.47 ? 165 ILE F CA    1 
ATOM   2177 C C     . ILE F  1 24 ? -71.144 23.371 11.657  1.00 27.36 ? 165 ILE F C     1 
ATOM   2178 O O     . ILE F  1 24 ? -71.599 24.496 11.681  1.00 28.55 ? 165 ILE F O     1 
ATOM   2179 C CB    . ILE F  1 24 ? -72.831 21.710 12.395  1.00 29.08 ? 165 ILE F CB    1 
ATOM   2180 C CG1   . ILE F  1 24 ? -73.301 20.785 13.539  1.00 31.42 ? 165 ILE F CG1   1 
ATOM   2181 C CG2   . ILE F  1 24 ? -72.760 20.987 11.015  1.00 28.92 ? 165 ILE F CG2   1 
ATOM   2182 C CD1   . ILE F  1 24 ? -72.327 19.743 14.065  1.00 31.83 ? 165 ILE F CD1   1 
ATOM   2183 N N     . ARG F  1 25 ? -70.272 22.945 10.732  1.00 26.01 ? 166 ARG F N     1 
ATOM   2184 C CA    . ARG F  1 25 ? -69.888 23.733 9.555   1.00 24.56 ? 166 ARG F CA    1 
ATOM   2185 C C     . ARG F  1 25 ? -70.924 23.416 8.493   1.00 25.55 ? 166 ARG F C     1 
ATOM   2186 O O     . ARG F  1 25 ? -71.243 22.248 8.260   1.00 25.14 ? 166 ARG F O     1 
ATOM   2187 C CB    . ARG F  1 25 ? -68.491 23.336 9.079   1.00 24.12 ? 166 ARG F CB    1 
ATOM   2188 C CG    . ARG F  1 25 ? -67.348 23.729 10.043  1.00 23.69 ? 166 ARG F CG    1 
ATOM   2189 C CD    . ARG F  1 25 ? -65.978 23.192 9.577   1.00 23.90 ? 166 ARG F CD    1 
ATOM   2190 N NE    . ARG F  1 25 ? -64.891 23.717 10.420  1.00 23.39 ? 166 ARG F NE    1 
ATOM   2191 C CZ    . ARG F  1 25 ? -63.699 24.132 9.991   1.00 23.03 ? 166 ARG F CZ    1 
ATOM   2192 N NH1   . ARG F  1 25 ? -63.344 24.054 8.704   1.00 22.34 ? 166 ARG F NH1   1 
ATOM   2193 N NH2   . ARG F  1 25 ? -62.822 24.602 10.877  1.00 23.71 ? 166 ARG F NH2   1 
ATOM   2194 N N     . LYS F  1 26 ? -71.498 24.447 7.879   1.00 26.16 ? 167 LYS F N     1 
ATOM   2195 C CA    . LYS F  1 26 ? -72.735 24.262 7.122   1.00 28.51 ? 167 LYS F CA    1 
ATOM   2196 C C     . LYS F  1 26 ? -72.503 24.094 5.641   1.00 27.93 ? 167 LYS F C     1 
ATOM   2197 O O     . LYS F  1 26 ? -73.427 23.757 4.923   1.00 27.87 ? 167 LYS F O     1 
ATOM   2198 C CB    . LYS F  1 26 ? -73.707 25.427 7.365   1.00 32.69 ? 167 LYS F CB    1 
ATOM   2199 C CG    . LYS F  1 26 ? -73.964 25.703 8.859   1.00 34.95 ? 167 LYS F CG    1 
ATOM   2200 C CD    . LYS F  1 26 ? -74.685 27.017 9.089   1.00 38.33 ? 167 LYS F CD    1 
ATOM   2201 C CE    . LYS F  1 26 ? -73.853 28.248 8.706   1.00 38.62 ? 167 LYS F CE    1 
ATOM   2202 N NZ    . LYS F  1 26 ? -74.744 29.442 8.531   1.00 43.02 ? 167 LYS F NZ    1 
ATOM   2203 N N     . SER F  1 27 ? -71.285 24.345 5.171   1.00 26.02 ? 168 SER F N     1 
ATOM   2204 C CA    . SER F  1 27 ? -71.033 24.339 3.724   1.00 27.20 ? 168 SER F CA    1 
ATOM   2205 C C     . SER F  1 27 ? -69.535 24.161 3.438   1.00 25.91 ? 168 SER F C     1 
ATOM   2206 O O     . SER F  1 27 ? -68.733 24.022 4.367   1.00 26.34 ? 168 SER F O     1 
ATOM   2207 C CB    . SER F  1 27 ? -71.567 25.634 3.110   1.00 27.65 ? 168 SER F CB    1 
ATOM   2208 O OG    . SER F  1 27 ? -70.999 26.759 3.730   1.00 27.91 ? 168 SER F OG    1 
ATOM   2209 N N     . GLY F  1 28 ? -69.198 24.128 2.165   1.00 26.23 ? 169 GLY F N     1 
ATOM   2210 C CA    . GLY F  1 28 ? -67.844 23.950 1.681   1.00 24.99 ? 169 GLY F CA    1 
ATOM   2211 C C     . GLY F  1 28 ? -67.311 22.555 1.822   1.00 25.37 ? 169 GLY F C     1 
ATOM   2212 O O     . GLY F  1 28 ? -68.061 21.585 2.093   1.00 24.86 ? 169 GLY F O     1 
ATOM   2213 N N     . LEU F  1 29 ? -65.985 22.455 1.659   1.00 26.80 ? 170 LEU F N     1 
ATOM   2214 C CA    . LEU F  1 29 ? -65.254 21.186 1.722   1.00 28.72 ? 170 LEU F CA    1 
ATOM   2215 C C     . LEU F  1 29 ? -65.383 20.422 3.050   1.00 27.14 ? 170 LEU F C     1 
ATOM   2216 O O     . LEU F  1 29 ? -65.501 19.210 3.057   1.00 27.16 ? 170 LEU F O     1 
ATOM   2217 C CB    . LEU F  1 29 ? -63.755 21.419 1.417   1.00 29.99 ? 170 LEU F CB    1 
ATOM   2218 C CG    . LEU F  1 29 ? -63.329 21.971 0.041   1.00 33.20 ? 170 LEU F CG    1 
ATOM   2219 C CD1   . LEU F  1 29 ? -61.804 22.144 0.011   1.00 35.08 ? 170 LEU F CD1   1 
ATOM   2220 C CD2   . LEU F  1 29 ? -63.803 21.081 -1.103  1.00 35.08 ? 170 LEU F CD2   1 
ATOM   2221 N N     . SER F  1 30 ? -65.369 21.145 4.159   1.00 28.06 ? 171 SER F N     1 
ATOM   2222 C CA    . SER F  1 30 ? -65.545 20.557 5.531   1.00 26.57 ? 171 SER F CA    1 
ATOM   2223 C C     . SER F  1 30 ? -67.010 20.581 6.042   1.00 27.12 ? 171 SER F C     1 
ATOM   2224 O O     . SER F  1 30 ? -67.257 20.400 7.262   1.00 25.49 ? 171 SER F O     1 
ATOM   2225 C CB    . SER F  1 30 ? -64.652 21.325 6.514   1.00 24.83 ? 171 SER F CB    1 
ATOM   2226 O OG    . SER F  1 30 ? -64.901 22.744 6.470   1.00 23.91 ? 171 SER F OG    1 
ATOM   2227 N N     . ALA F  1 31 ? -67.975 20.774 5.142   1.00 25.59 ? 172 ALA F N     1 
ATOM   2228 C CA    . ALA F  1 31 ? -69.406 20.727 5.523   1.00 26.84 ? 172 ALA F CA    1 
ATOM   2229 C C     . ALA F  1 31 ? -69.755 19.517 6.417   1.00 26.97 ? 172 ALA F C     1 
ATOM   2230 O O     . ALA F  1 31 ? -69.344 18.439 6.150   1.00 25.79 ? 172 ALA F O     1 
ATOM   2231 C CB    . ALA F  1 31 ? -70.296 20.692 4.250   1.00 28.03 ? 172 ALA F CB    1 
ATOM   2232 N N     . GLY F  1 32 ? -70.484 19.714 7.508   1.00 27.84 ? 173 GLY F N     1 
ATOM   2233 C CA    . GLY F  1 32 ? -70.821 18.561 8.379   1.00 28.75 ? 173 GLY F CA    1 
ATOM   2234 C C     . GLY F  1 32 ? -69.800 18.237 9.478   1.00 26.78 ? 173 GLY F C     1 
ATOM   2235 O O     . GLY F  1 32 ? -70.153 17.621 10.476  1.00 27.95 ? 173 GLY F O     1 
ATOM   2236 N N     . LYS F  1 33 ? -68.558 18.655 9.318   1.00 24.87 ? 174 LYS F N     1 
ATOM   2237 C CA    . LYS F  1 33 ? -67.607 18.667 10.455  1.00 24.25 ? 174 LYS F CA    1 
ATOM   2238 C C     . LYS F  1 33 ? -68.034 19.779 11.395  1.00 23.16 ? 174 LYS F C     1 
ATOM   2239 O O     . LYS F  1 33 ? -68.868 20.577 11.047  1.00 22.74 ? 174 LYS F O     1 
ATOM   2240 C CB    . LYS F  1 33 ? -66.180 18.893 10.003  1.00 23.36 ? 174 LYS F CB    1 
ATOM   2241 C CG    . LYS F  1 33 ? -65.639 17.871 8.979   1.00 25.61 ? 174 LYS F CG    1 
ATOM   2242 C CD    . LYS F  1 33 ? -65.867 16.421 9.415   1.00 27.35 ? 174 LYS F CD    1 
ATOM   2243 C CE    . LYS F  1 33 ? -65.300 15.471 8.400   1.00 28.79 ? 174 LYS F CE    1 
ATOM   2244 N NZ    . LYS F  1 33 ? -65.237 14.086 8.927   1.00 30.31 ? 174 LYS F NZ    1 
ATOM   2245 N N     . SER F  1 34 ? -67.437 19.825 12.586  1.00 23.50 ? 175 SER F N     1 
ATOM   2246 C CA    . SER F  1 34 ? -67.687 20.884 13.546  1.00 23.49 ? 175 SER F CA    1 
ATOM   2247 C C     . SER F  1 34 ? -66.435 21.429 14.238  1.00 24.77 ? 175 SER F C     1 
ATOM   2248 O O     . SER F  1 34 ? -65.337 20.800 14.278  1.00 23.13 ? 175 SER F O     1 
ATOM   2249 C CB    . SER F  1 34 ? -68.583 20.339 14.640  1.00 25.39 ? 175 SER F CB    1 
ATOM   2250 O OG    . SER F  1 34 ? -67.914 19.317 15.319  1.00 24.61 ? 175 SER F OG    1 
ATOM   2251 N N     . ASP F  1 35 ? -66.645 22.606 14.814  1.00 24.81 ? 176 ASP F N     1 
ATOM   2252 C CA    . ASP F  1 35 ? -65.694 23.280 15.622  1.00 25.01 ? 176 ASP F CA    1 
ATOM   2253 C C     . ASP F  1 35 ? -66.198 23.260 17.044  1.00 26.91 ? 176 ASP F C     1 
ATOM   2254 O O     . ASP F  1 35 ? -67.415 23.400 17.274  1.00 28.02 ? 176 ASP F O     1 
ATOM   2255 C CB    . ASP F  1 35 ? -65.560 24.714 15.156  1.00 24.09 ? 176 ASP F CB    1 
ATOM   2256 C CG    . ASP F  1 35 ? -64.964 24.794 13.782  1.00 23.44 ? 176 ASP F CG    1 
ATOM   2257 O OD1   . ASP F  1 35 ? -63.726 24.631 13.674  1.00 22.77 ? 176 ASP F OD1   1 
ATOM   2258 O OD2   . ASP F  1 35 ? -65.735 24.988 12.825  1.00 21.76 ? 176 ASP F OD2   1 
ATOM   2259 N N     . VAL F  1 36 ? -65.256 23.115 17.984  1.00 27.25 ? 177 VAL F N     1 
ATOM   2260 C CA    . VAL F  1 36 ? -65.540 23.119 19.407  1.00 29.45 ? 177 VAL F CA    1 
ATOM   2261 C C     . VAL F  1 36 ? -64.852 24.357 19.991  1.00 31.27 ? 177 VAL F C     1 
ATOM   2262 O O     . VAL F  1 36 ? -63.664 24.637 19.667  1.00 29.74 ? 177 VAL F O     1 
ATOM   2263 C CB    . VAL F  1 36 ? -65.053 21.813 20.075  1.00 29.89 ? 177 VAL F CB    1 
ATOM   2264 C CG1   . VAL F  1 36 ? -65.194 21.858 21.610  1.00 32.57 ? 177 VAL F CG1   1 
ATOM   2265 C CG2   . VAL F  1 36 ? -65.823 20.650 19.519  1.00 30.08 ? 177 VAL F CG2   1 
ATOM   2266 N N     . TYR F  1 37 ? -65.618 25.098 20.812  1.00 32.89 ? 178 TYR F N     1 
ATOM   2267 C CA    . TYR F  1 37 ? -65.193 26.324 21.451  1.00 35.13 ? 178 TYR F CA    1 
ATOM   2268 C C     . TYR F  1 37 ? -65.418 26.198 22.954  1.00 36.97 ? 178 TYR F C     1 
ATOM   2269 O O     . TYR F  1 37 ? -66.378 25.565 23.390  1.00 37.99 ? 178 TYR F O     1 
ATOM   2270 C CB    . TYR F  1 37 ? -66.018 27.512 20.936  1.00 36.24 ? 178 TYR F CB    1 
ATOM   2271 C CG    . TYR F  1 37 ? -65.961 27.709 19.446  1.00 36.15 ? 178 TYR F CG    1 
ATOM   2272 C CD1   . TYR F  1 37 ? -64.764 28.014 18.815  1.00 35.72 ? 178 TYR F CD1   1 
ATOM   2273 C CD2   . TYR F  1 37 ? -67.112 27.578 18.646  1.00 36.33 ? 178 TYR F CD2   1 
ATOM   2274 C CE1   . TYR F  1 37 ? -64.701 28.183 17.431  1.00 34.99 ? 178 TYR F CE1   1 
ATOM   2275 C CE2   . TYR F  1 37 ? -67.054 27.755 17.261  1.00 35.44 ? 178 TYR F CE2   1 
ATOM   2276 C CZ    . TYR F  1 37 ? -65.848 28.067 16.668  1.00 33.79 ? 178 TYR F CZ    1 
ATOM   2277 O OH    . TYR F  1 37 ? -65.760 28.219 15.325  1.00 33.22 ? 178 TYR F OH    1 
ATOM   2278 N N     . TYR F  1 38 ? -64.540 26.801 23.747  1.00 37.33 ? 179 TYR F N     1 
ATOM   2279 C CA    . TYR F  1 38 ? -64.803 26.927 25.168  1.00 40.04 ? 179 TYR F CA    1 
ATOM   2280 C C     . TYR F  1 38 ? -64.884 28.384 25.538  1.00 43.22 ? 179 TYR F C     1 
ATOM   2281 O O     . TYR F  1 38 ? -64.217 29.234 24.916  1.00 43.22 ? 179 TYR F O     1 
ATOM   2282 C CB    . TYR F  1 38 ? -63.740 26.219 25.980  1.00 39.55 ? 179 TYR F CB    1 
ATOM   2283 C CG    . TYR F  1 38 ? -63.797 24.729 25.847  1.00 37.48 ? 179 TYR F CG    1 
ATOM   2284 C CD1   . TYR F  1 38 ? -63.102 24.073 24.829  1.00 35.63 ? 179 TYR F CD1   1 
ATOM   2285 C CD2   . TYR F  1 38 ? -64.542 23.958 26.736  1.00 38.66 ? 179 TYR F CD2   1 
ATOM   2286 C CE1   . TYR F  1 38 ? -63.148 22.691 24.702  1.00 34.42 ? 179 TYR F CE1   1 
ATOM   2287 C CE2   . TYR F  1 38 ? -64.590 22.579 26.621  1.00 37.66 ? 179 TYR F CE2   1 
ATOM   2288 C CZ    . TYR F  1 38 ? -63.896 21.952 25.592  1.00 35.23 ? 179 TYR F CZ    1 
ATOM   2289 O OH    . TYR F  1 38 ? -63.939 20.593 25.462  1.00 34.41 ? 179 TYR F OH    1 
ATOM   2290 N N     . PHE F  1 39 ? -65.707 28.680 26.548  1.00 46.82 ? 180 PHE F N     1 
ATOM   2291 C CA    . PHE F  1 39 ? -65.836 30.037 27.056  1.00 49.80 ? 180 PHE F CA    1 
ATOM   2292 C C     . PHE F  1 39 ? -65.510 30.042 28.518  1.00 51.90 ? 180 PHE F C     1 
ATOM   2293 O O     . PHE F  1 39 ? -65.897 29.134 29.232  1.00 52.41 ? 180 PHE F O     1 
ATOM   2294 C CB    . PHE F  1 39 ? -67.233 30.553 26.823  1.00 51.99 ? 180 PHE F CB    1 
ATOM   2295 C CG    . PHE F  1 39 ? -67.569 30.692 25.393  1.00 51.35 ? 180 PHE F CG    1 
ATOM   2296 C CD1   . PHE F  1 39 ? -67.165 31.827 24.678  1.00 53.40 ? 180 PHE F CD1   1 
ATOM   2297 C CD2   . PHE F  1 39 ? -68.257 29.680 24.724  1.00 50.36 ? 180 PHE F CD2   1 
ATOM   2298 C CE1   . PHE F  1 39 ? -67.466 31.963 23.325  1.00 50.89 ? 180 PHE F CE1   1 
ATOM   2299 C CE2   . PHE F  1 39 ? -68.563 29.805 23.368  1.00 49.24 ? 180 PHE F CE2   1 
ATOM   2300 C CZ    . PHE F  1 39 ? -68.167 30.952 22.669  1.00 49.83 ? 180 PHE F CZ    1 
ATOM   2301 N N     . SER F  1 40 ? -64.788 31.063 28.963  1.00 53.40 ? 181 SER F N     1 
ATOM   2302 C CA    . SER F  1 40 ? -64.462 31.214 30.393  1.00 56.37 ? 181 SER F CA    1 
ATOM   2303 C C     . SER F  1 40 ? -65.693 31.769 31.114  1.00 59.04 ? 181 SER F C     1 
ATOM   2304 O O     . SER F  1 40 ? -66.697 32.096 30.463  1.00 58.65 ? 181 SER F O     1 
ATOM   2305 C CB    . SER F  1 40 ? -63.238 32.132 30.573  1.00 57.25 ? 181 SER F CB    1 
ATOM   2306 O OG    . SER F  1 40 ? -63.514 33.448 30.126  1.00 58.90 ? 181 SER F OG    1 
ATOM   2307 N N     . PRO F  1 41 ? -65.638 31.859 32.455  1.00 62.57 ? 182 PRO F N     1 
ATOM   2308 C CA    . PRO F  1 41 ? -66.704 32.602 33.149  1.00 66.66 ? 182 PRO F CA    1 
ATOM   2309 C C     . PRO F  1 41 ? -66.769 34.090 32.728  1.00 68.56 ? 182 PRO F C     1 
ATOM   2310 O O     . PRO F  1 41 ? -67.870 34.645 32.591  1.00 70.18 ? 182 PRO F O     1 
ATOM   2311 C CB    . PRO F  1 41 ? -66.348 32.452 34.640  1.00 69.99 ? 182 PRO F CB    1 
ATOM   2312 C CG    . PRO F  1 41 ? -65.060 31.693 34.705  1.00 67.76 ? 182 PRO F CG    1 
ATOM   2313 C CD    . PRO F  1 41 ? -64.814 31.063 33.384  1.00 63.30 ? 182 PRO F CD    1 
ATOM   2314 N N     . SER F  1 42 ? -65.597 34.699 32.504  1.00 68.37 ? 183 SER F N     1 
ATOM   2315 C CA    . SER F  1 42 ? -65.506 36.078 32.000  1.00 70.45 ? 183 SER F CA    1 
ATOM   2316 C C     . SER F  1 42 ? -65.918 36.240 30.516  1.00 67.37 ? 183 SER F C     1 
ATOM   2317 O O     . SER F  1 42 ? -66.012 37.367 30.039  1.00 69.30 ? 183 SER F O     1 
ATOM   2318 C CB    . SER F  1 42 ? -64.091 36.625 32.200  1.00 71.86 ? 183 SER F CB    1 
ATOM   2319 N N     . GLY F  1 43 ? -66.115 35.125 29.796  1.00 62.67 ? 184 GLY F N     1 
ATOM   2320 C CA    . GLY F  1 43 ? -66.713 35.109 28.440  1.00 59.95 ? 184 GLY F CA    1 
ATOM   2321 C C     . GLY F  1 43 ? -65.716 34.955 27.292  1.00 56.08 ? 184 GLY F C     1 
ATOM   2322 O O     . GLY F  1 43 ? -66.105 34.992 26.128  1.00 53.77 ? 184 GLY F O     1 
ATOM   2323 N N     . LYS F  1 44 ? -64.433 34.783 27.627  1.00 55.84 ? 185 LYS F N     1 
ATOM   2324 C CA    . LYS F  1 44 ? -63.359 34.770 26.655  1.00 53.72 ? 185 LYS F CA    1 
ATOM   2325 C C     . LYS F  1 44 ? -63.378 33.445 25.902  1.00 50.28 ? 185 LYS F C     1 
ATOM   2326 O O     . LYS F  1 44 ? -63.526 32.388 26.508  1.00 49.20 ? 185 LYS F O     1 
ATOM   2327 C CB    . LYS F  1 44 ? -62.004 34.972 27.338  1.00 55.15 ? 185 LYS F CB    1 
ATOM   2328 N N     . LYS F  1 45 ? -63.232 33.526 24.580  1.00 48.94 ? 186 LYS F N     1 
ATOM   2329 C CA    . LYS F  1 45 ? -63.380 32.373 23.690  1.00 45.95 ? 186 LYS F CA    1 
ATOM   2330 C C     . LYS F  1 45 ? -62.051 31.640 23.515  1.00 43.68 ? 186 LYS F C     1 
ATOM   2331 O O     . LYS F  1 45 ? -61.008 32.273 23.323  1.00 43.90 ? 186 LYS F O     1 
ATOM   2332 C CB    . LYS F  1 45 ? -63.893 32.834 22.333  1.00 46.75 ? 186 LYS F CB    1 
ATOM   2333 C CG    . LYS F  1 45 ? -64.097 31.712 21.307  1.00 44.91 ? 186 LYS F CG    1 
ATOM   2334 C CD    . LYS F  1 45 ? -64.649 32.251 19.990  1.00 46.07 ? 186 LYS F CD    1 
ATOM   2335 C CE    . LYS F  1 45 ? -66.174 32.202 19.905  1.00 48.24 ? 186 LYS F CE    1 
ATOM   2336 N NZ    . LYS F  1 45 ? -66.642 32.230 18.482  1.00 47.59 ? 186 LYS F NZ    1 
ATOM   2337 N N     . PHE F  1 46 ? -62.100 30.301 23.557  1.00 41.49 ? 187 PHE F N     1 
ATOM   2338 C CA    . PHE F  1 46 ? -60.903 29.466 23.366  1.00 39.31 ? 187 PHE F CA    1 
ATOM   2339 C C     . PHE F  1 46 ? -61.148 28.419 22.305  1.00 35.54 ? 187 PHE F C     1 
ATOM   2340 O O     . PHE F  1 46 ? -62.174 27.752 22.321  1.00 34.95 ? 187 PHE F O     1 
ATOM   2341 C CB    . PHE F  1 46 ? -60.461 28.874 24.722  1.00 40.92 ? 187 PHE F CB    1 
ATOM   2342 C CG    . PHE F  1 46 ? -59.927 29.920 25.649  1.00 44.08 ? 187 PHE F CG    1 
ATOM   2343 C CD1   . PHE F  1 46 ? -60.792 30.721 26.381  1.00 46.42 ? 187 PHE F CD1   1 
ATOM   2344 C CD2   . PHE F  1 46 ? -58.570 30.178 25.711  1.00 45.67 ? 187 PHE F CD2   1 
ATOM   2345 C CE1   . PHE F  1 46 ? -60.307 31.731 27.202  1.00 50.29 ? 187 PHE F CE1   1 
ATOM   2346 C CE2   . PHE F  1 46 ? -58.069 31.178 26.531  1.00 48.98 ? 187 PHE F CE2   1 
ATOM   2347 C CZ    . PHE F  1 46 ? -58.937 31.960 27.277  1.00 51.27 ? 187 PHE F CZ    1 
ATOM   2348 N N     . ARG F  1 47 ? -60.213 28.286 21.367  1.00 33.81 ? 188 ARG F N     1 
ATOM   2349 C CA    . ARG F  1 47 ? -60.453 27.479 20.178  1.00 32.07 ? 188 ARG F CA    1 
ATOM   2350 C C     . ARG F  1 47 ? -59.480 26.301 19.982  1.00 31.58 ? 188 ARG F C     1 
ATOM   2351 O O     . ARG F  1 47 ? -59.569 25.605 18.976  1.00 30.37 ? 188 ARG F O     1 
ATOM   2352 C CB    . ARG F  1 47 ? -60.415 28.379 18.957  1.00 31.26 ? 188 ARG F CB    1 
ATOM   2353 C CG    . ARG F  1 47 ? -61.280 29.618 19.117  1.00 32.46 ? 188 ARG F CG    1 
ATOM   2354 C CD    . ARG F  1 47 ? -61.562 30.223 17.761  1.00 31.63 ? 188 ARG F CD    1 
ATOM   2355 N NE    . ARG F  1 47 ? -60.349 30.772 17.175  1.00 31.85 ? 188 ARG F NE    1 
ATOM   2356 C CZ    . ARG F  1 47 ? -60.077 30.842 15.869  1.00 30.72 ? 188 ARG F CZ    1 
ATOM   2357 N NH1   . ARG F  1 47 ? -60.911 30.352 14.954  1.00 28.68 ? 188 ARG F NH1   1 
ATOM   2358 N NH2   . ARG F  1 47 ? -58.929 31.396 15.475  1.00 32.28 ? 188 ARG F NH2   1 
ATOM   2359 N N     . SER F  1 48 ? -58.565 26.091 20.933  1.00 32.64 ? 189 SER F N     1 
ATOM   2360 C CA    . SER F  1 48 ? -57.584 25.011 20.846  1.00 32.83 ? 189 SER F CA    1 
ATOM   2361 C C     . SER F  1 48 ? -57.160 24.544 22.229  1.00 35.40 ? 189 SER F C     1 
ATOM   2362 O O     . SER F  1 48 ? -57.220 25.314 23.206  1.00 35.47 ? 189 SER F O     1 
ATOM   2363 C CB    . SER F  1 48 ? -56.371 25.481 20.079  1.00 32.67 ? 189 SER F CB    1 
ATOM   2364 O OG    . SER F  1 48 ? -55.660 26.449 20.819  1.00 34.04 ? 189 SER F OG    1 
ATOM   2365 N N     . LYS F  1 49 ? -56.759 23.278 22.316  1.00 36.54 ? 190 LYS F N     1 
ATOM   2366 C CA    . LYS F  1 49 ? -56.240 22.737 23.581  1.00 38.92 ? 190 LYS F CA    1 
ATOM   2367 C C     . LYS F  1 49 ? -55.031 23.526 24.123  1.00 41.10 ? 190 LYS F C     1 
ATOM   2368 O O     . LYS F  1 49 ? -55.014 23.835 25.309  1.00 40.87 ? 190 LYS F O     1 
ATOM   2369 C CB    . LYS F  1 49 ? -55.900 21.251 23.471  1.00 39.19 ? 190 LYS F CB    1 
ATOM   2370 C CG    . LYS F  1 49 ? -55.699 20.612 24.827  1.00 41.68 ? 190 LYS F CG    1 
ATOM   2371 C CD    . LYS F  1 49 ? -55.434 19.124 24.749  1.00 42.25 ? 190 LYS F CD    1 
ATOM   2372 C CE    . LYS F  1 49 ? -55.103 18.617 26.130  1.00 44.51 ? 190 LYS F CE    1 
ATOM   2373 N NZ    . LYS F  1 49 ? -54.766 17.180 26.158  1.00 45.92 ? 190 LYS F NZ    1 
ATOM   2374 N N     . PRO F  1 50 ? -54.037 23.881 23.248  1.00 42.07 ? 191 PRO F N     1 
ATOM   2375 C CA    . PRO F  1 50 ? -52.874 24.645 23.792  1.00 45.14 ? 191 PRO F CA    1 
ATOM   2376 C C     . PRO F  1 50 ? -53.218 26.068 24.281  1.00 47.40 ? 191 PRO F C     1 
ATOM   2377 O O     . PRO F  1 50 ? -52.700 26.496 25.312  1.00 49.05 ? 191 PRO F O     1 
ATOM   2378 C CB    . PRO F  1 50 ? -51.873 24.679 22.620  1.00 45.10 ? 191 PRO F CB    1 
ATOM   2379 C CG    . PRO F  1 50 ? -52.377 23.663 21.613  1.00 42.38 ? 191 PRO F CG    1 
ATOM   2380 C CD    . PRO F  1 50 ? -53.864 23.585 21.812  1.00 40.69 ? 191 PRO F CD    1 
ATOM   2381 N N     . GLN F  1 51 ? -54.086 26.775 23.546  1.00 46.84 ? 192 GLN F N     1 
ATOM   2382 C CA    . GLN F  1 51 ? -54.611 28.109 23.976  1.00 48.75 ? 192 GLN F CA    1 
ATOM   2383 C C     . GLN F  1 51 ? -55.349 27.994 25.325  1.00 49.47 ? 192 GLN F C     1 
ATOM   2384 O O     . GLN F  1 51 ? -55.177 28.835 26.224  1.00 51.77 ? 192 GLN F O     1 
ATOM   2385 C CB    . GLN F  1 51 ? -55.554 28.687 22.889  1.00 49.00 ? 192 GLN F CB    1 
ATOM   2386 C CG    . GLN F  1 51 ? -55.958 30.156 23.040  1.00 51.62 ? 192 GLN F CG    1 
ATOM   2387 C CD    . GLN F  1 51 ? -56.970 30.643 21.960  1.00 50.24 ? 192 GLN F CD    1 
ATOM   2388 O OE1   . GLN F  1 51 ? -57.650 29.850 21.271  1.00 46.30 ? 192 GLN F OE1   1 
ATOM   2389 N NE2   . GLN F  1 51 ? -57.078 31.954 21.836  1.00 52.86 ? 192 GLN F NE2   1 
ATOM   2390 N N     . LEU F  1 52 ? -56.161 26.944 25.456  1.00 46.70 ? 193 LEU F N     1 
ATOM   2391 C CA    . LEU F  1 52 ? -56.874 26.646 26.700  1.00 47.45 ? 193 LEU F CA    1 
ATOM   2392 C C     . LEU F  1 52 ? -55.914 26.376 27.870  1.00 50.16 ? 193 LEU F C     1 
ATOM   2393 O O     . LEU F  1 52 ? -56.103 26.893 28.972  1.00 52.98 ? 193 LEU F O     1 
ATOM   2394 C CB    . LEU F  1 52 ? -57.773 25.438 26.484  1.00 45.26 ? 193 LEU F CB    1 
ATOM   2395 C CG    . LEU F  1 52 ? -58.697 24.982 27.600  1.00 46.33 ? 193 LEU F CG    1 
ATOM   2396 C CD1   . LEU F  1 52 ? -59.584 26.115 28.090  1.00 47.56 ? 193 LEU F CD1   1 
ATOM   2397 C CD2   . LEU F  1 52 ? -59.536 23.818 27.101  1.00 44.10 ? 193 LEU F CD2   1 
ATOM   2398 N N     . ALA F  1 53 ? -54.885 25.573 27.599  1.00 50.47 ? 194 ALA F N     1 
ATOM   2399 C CA    . ALA F  1 53 ? -53.877 25.187 28.588  1.00 53.93 ? 194 ALA F CA    1 
ATOM   2400 C C     . ALA F  1 53 ? -52.953 26.350 28.976  1.00 56.92 ? 194 ALA F C     1 
ATOM   2401 O O     . ALA F  1 53 ? -52.545 26.448 30.137  1.00 59.66 ? 194 ALA F O     1 
ATOM   2402 C CB    . ALA F  1 53 ? -53.058 24.006 28.057  1.00 53.52 ? 194 ALA F CB    1 
ATOM   2403 N N     . ARG F  1 54 ? -52.625 27.213 28.003  1.00 57.39 ? 195 ARG F N     1 
ATOM   2404 C CA    . ARG F  1 54 ? -51.801 28.420 28.246  1.00 62.21 ? 195 ARG F CA    1 
ATOM   2405 C C     . ARG F  1 54 ? -52.492 29.395 29.220  1.00 64.85 ? 195 ARG F C     1 
ATOM   2406 O O     . ARG F  1 54 ? -51.842 29.922 30.111  1.00 70.42 ? 195 ARG F O     1 
ATOM   2407 C CB    . ARG F  1 54 ? -51.438 29.131 26.922  1.00 60.65 ? 195 ARG F CB    1 
ATOM   2408 N N     . TYR F  1 55 ? -53.804 29.596 29.057  1.00 63.60 ? 196 TYR F N     1 
ATOM   2409 C CA    . TYR F  1 55 ? -54.607 30.477 29.941  1.00 66.78 ? 196 TYR F CA    1 
ATOM   2410 C C     . TYR F  1 55 ? -54.789 29.861 31.322  1.00 69.57 ? 196 TYR F C     1 
ATOM   2411 O O     . TYR F  1 55 ? -54.559 30.526 32.344  1.00 73.95 ? 196 TYR F O     1 
ATOM   2412 C CB    . TYR F  1 55 ? -55.989 30.748 29.324  1.00 64.70 ? 196 TYR F CB    1 
ATOM   2413 C CG    . TYR F  1 55 ? -56.847 31.793 30.056  1.00 67.05 ? 196 TYR F CG    1 
ATOM   2414 C CD1   . TYR F  1 55 ? -56.525 33.163 30.004  1.00 69.91 ? 196 TYR F CD1   1 
ATOM   2415 C CD2   . TYR F  1 55 ? -57.997 31.419 30.765  1.00 67.04 ? 196 TYR F CD2   1 
ATOM   2416 C CE1   . TYR F  1 55 ? -57.311 34.122 30.656  1.00 72.25 ? 196 TYR F CE1   1 
ATOM   2417 C CE2   . TYR F  1 55 ? -58.790 32.371 31.418  1.00 69.48 ? 196 TYR F CE2   1 
ATOM   2418 C CZ    . TYR F  1 55 ? -58.444 33.722 31.361  1.00 72.28 ? 196 TYR F CZ    1 
ATOM   2419 O OH    . TYR F  1 55 ? -59.221 34.669 32.009  1.00 75.42 ? 196 TYR F OH    1 
ATOM   2420 N N     . LEU F  1 56 ? -55.212 28.597 31.360  1.00 67.87 ? 197 LEU F N     1 
ATOM   2421 C CA    . LEU F  1 56 ? -55.394 27.903 32.644  1.00 70.53 ? 197 LEU F CA    1 
ATOM   2422 C C     . LEU F  1 56 ? -54.061 27.746 33.415  1.00 73.73 ? 197 LEU F C     1 
ATOM   2423 O O     . LEU F  1 56 ? -54.039 27.880 34.643  1.00 75.36 ? 197 LEU F O     1 
ATOM   2424 C CB    . LEU F  1 56 ? -56.102 26.548 32.453  1.00 67.97 ? 197 LEU F CB    1 
ATOM   2425 C CG    . LEU F  1 56 ? -57.611 26.623 32.168  1.00 66.12 ? 197 LEU F CG    1 
ATOM   2426 C CD1   . LEU F  1 56 ? -58.169 25.225 31.942  1.00 64.41 ? 197 LEU F CD1   1 
ATOM   2427 C CD2   . LEU F  1 56 ? -58.380 27.344 33.284  1.00 69.60 ? 197 LEU F CD2   1 
ATOM   2428 N N     . GLY F  1 57 ? -52.963 27.492 32.687  1.00 73.24 ? 198 GLY F N     1 
ATOM   2429 C CA    . GLY F  1 57 ? -51.619 27.424 33.288  1.00 75.19 ? 198 GLY F CA    1 
ATOM   2430 C C     . GLY F  1 57 ? -51.458 26.230 34.217  1.00 76.91 ? 198 GLY F C     1 
ATOM   2431 O O     . GLY F  1 57 ? -52.186 25.229 34.094  1.00 73.24 ? 198 GLY F O     1 
ATOM   2432 N N     . ASN F  1 58 ? -50.540 26.345 35.182  1.00 80.32 ? 199 ASN F N     1 
ATOM   2433 C CA    . ASN F  1 58 ? -50.247 25.241 36.095  1.00 82.97 ? 199 ASN F CA    1 
ATOM   2434 C C     . ASN F  1 58 ? -51.272 25.083 37.258  1.00 85.09 ? 199 ASN F C     1 
ATOM   2435 O O     . ASN F  1 58 ? -50.963 24.425 38.245  1.00 86.50 ? 199 ASN F O     1 
ATOM   2436 C CB    . ASN F  1 58 ? -48.830 25.405 36.669  1.00 88.68 ? 199 ASN F CB    1 
ATOM   2437 N N     . THR F  1 59 ? -52.466 25.691 37.143  1.00 83.63 ? 200 THR F N     1 
ATOM   2438 C CA    . THR F  1 59 ? -53.557 25.516 38.129  1.00 84.18 ? 200 THR F CA    1 
ATOM   2439 C C     . THR F  1 59 ? -54.609 24.451 37.710  1.00 81.07 ? 200 THR F C     1 
ATOM   2440 O O     . THR F  1 59 ? -55.379 23.999 38.562  1.00 81.53 ? 200 THR F O     1 
ATOM   2441 C CB    . THR F  1 59 ? -54.279 26.852 38.406  1.00 85.09 ? 200 THR F CB    1 
ATOM   2442 N N     . VAL F  1 60 ? -54.653 24.088 36.408  1.00 75.91 ? 201 VAL F N     1 
ATOM   2443 C CA    . VAL F  1 60 ? -55.401 22.905 35.915  1.00 72.96 ? 201 VAL F CA    1 
ATOM   2444 C C     . VAL F  1 60 ? -54.466 22.025 35.057  1.00 71.52 ? 201 VAL F C     1 
ATOM   2445 O O     . VAL F  1 60 ? -53.778 22.534 34.171  1.00 72.38 ? 201 VAL F O     1 
ATOM   2446 C CB    . VAL F  1 60 ? -56.628 23.295 35.029  1.00 70.14 ? 201 VAL F CB    1 
ATOM   2447 C CG1   . VAL F  1 60 ? -57.519 22.078 34.762  1.00 67.97 ? 201 VAL F CG1   1 
ATOM   2448 C CG2   . VAL F  1 60 ? -57.441 24.419 35.661  1.00 72.28 ? 201 VAL F CG2   1 
ATOM   2449 N N     . ASP F  1 61 ? -54.458 20.715 35.311  1.00 70.37 ? 202 ASP F N     1 
ATOM   2450 C CA    . ASP F  1 61 ? -53.722 19.751 34.483  1.00 68.69 ? 202 ASP F CA    1 
ATOM   2451 C C     . ASP F  1 61 ? -54.661 19.261 33.392  1.00 65.41 ? 202 ASP F C     1 
ATOM   2452 O O     . ASP F  1 61 ? -55.718 18.708 33.695  1.00 64.76 ? 202 ASP F O     1 
ATOM   2453 C CB    . ASP F  1 61 ? -53.246 18.569 35.335  1.00 71.43 ? 202 ASP F CB    1 
ATOM   2454 C CG    . ASP F  1 61 ? -52.230 17.672 34.612  1.00 71.15 ? 202 ASP F CG    1 
ATOM   2455 O OD1   . ASP F  1 61 ? -52.367 17.438 33.378  1.00 67.63 ? 202 ASP F OD1   1 
ATOM   2456 O OD2   . ASP F  1 61 ? -51.298 17.184 35.299  1.00 72.30 ? 202 ASP F OD2   1 
ATOM   2457 N N     . LEU F  1 62 ? -54.279 19.455 32.130  1.00 63.00 ? 203 LEU F N     1 
ATOM   2458 C CA    . LEU F  1 62 ? -55.152 19.086 30.989  1.00 60.03 ? 203 LEU F CA    1 
ATOM   2459 C C     . LEU F  1 62 ? -54.590 17.956 30.127  1.00 59.61 ? 203 LEU F C     1 
ATOM   2460 O O     . LEU F  1 62 ? -54.998 17.808 28.977  1.00 58.76 ? 203 LEU F O     1 
ATOM   2461 C CB    . LEU F  1 62 ? -55.407 20.319 30.108  1.00 57.84 ? 203 LEU F CB    1 
ATOM   2462 C CG    . LEU F  1 62 ? -56.107 21.523 30.726  1.00 57.90 ? 203 LEU F CG    1 
ATOM   2463 C CD1   . LEU F  1 62 ? -56.187 22.640 29.703  1.00 55.87 ? 203 LEU F CD1   1 
ATOM   2464 C CD2   . LEU F  1 62 ? -57.496 21.144 31.220  1.00 58.17 ? 203 LEU F CD2   1 
ATOM   2465 N N     . SER F  1 63 ? -53.693 17.138 30.676  1.00 62.31 ? 204 SER F N     1 
ATOM   2466 C CA    . SER F  1 63 ? -53.051 16.071 29.899  1.00 62.18 ? 204 SER F CA    1 
ATOM   2467 C C     . SER F  1 63 ? -54.079 15.111 29.359  1.00 59.97 ? 204 SER F C     1 
ATOM   2468 O O     . SER F  1 63 ? -54.135 14.885 28.165  1.00 62.04 ? 204 SER F O     1 
ATOM   2469 C CB    . SER F  1 63 ? -52.030 15.310 30.737  1.00 66.63 ? 204 SER F CB    1 
ATOM   2470 O OG    . SER F  1 63 ? -51.126 16.200 31.348  1.00 68.85 ? 204 SER F OG    1 
ATOM   2471 N N     . SER F  1 64 ? -54.939 14.600 30.222  1.00 59.11 ? 205 SER F N     1 
ATOM   2472 C CA    . SER F  1 64 ? -55.976 13.662 29.792  1.00 57.52 ? 205 SER F CA    1 
ATOM   2473 C C     . SER F  1 64 ? -57.265 14.357 29.294  1.00 54.09 ? 205 SER F C     1 
ATOM   2474 O O     . SER F  1 64 ? -58.268 13.677 29.017  1.00 53.47 ? 205 SER F O     1 
ATOM   2475 C CB    . SER F  1 64 ? -56.290 12.671 30.924  1.00 60.59 ? 205 SER F CB    1 
ATOM   2476 O OG    . SER F  1 64 ? -56.796 13.348 32.051  1.00 60.76 ? 205 SER F OG    1 
ATOM   2477 N N     . PHE F  1 65 ? -57.244 15.688 29.162  1.00 52.09 ? 206 PHE F N     1 
ATOM   2478 C CA    . PHE F  1 65 ? -58.391 16.430 28.645  1.00 49.58 ? 206 PHE F CA    1 
ATOM   2479 C C     . PHE F  1 65 ? -58.498 16.306 27.109  1.00 47.28 ? 206 PHE F C     1 
ATOM   2480 O O     . PHE F  1 65 ? -57.590 16.693 26.373  1.00 45.81 ? 206 PHE F O     1 
ATOM   2481 C CB    . PHE F  1 65 ? -58.310 17.902 29.039  1.00 49.60 ? 206 PHE F CB    1 
ATOM   2482 C CG    . PHE F  1 65 ? -59.596 18.648 28.833  1.00 48.53 ? 206 PHE F CG    1 
ATOM   2483 C CD1   . PHE F  1 65 ? -60.682 18.422 29.666  1.00 50.01 ? 206 PHE F CD1   1 
ATOM   2484 C CD2   . PHE F  1 65 ? -59.732 19.568 27.788  1.00 46.81 ? 206 PHE F CD2   1 
ATOM   2485 C CE1   . PHE F  1 65 ? -61.877 19.109 29.475  1.00 49.41 ? 206 PHE F CE1   1 
ATOM   2486 C CE2   . PHE F  1 65 ? -60.922 20.256 27.596  1.00 45.55 ? 206 PHE F CE2   1 
ATOM   2487 C CZ    . PHE F  1 65 ? -61.998 20.025 28.431  1.00 46.61 ? 206 PHE F CZ    1 
ATOM   2488 N N     . ASP F  1 66 ? -59.618 15.755 26.661  1.00 45.53 ? 207 ASP F N     1 
ATOM   2489 C CA    . ASP F  1 66 ? -59.921 15.603 25.278  1.00 43.90 ? 207 ASP F CA    1 
ATOM   2490 C C     . ASP F  1 66 ? -60.708 16.852 24.873  1.00 41.83 ? 207 ASP F C     1 
ATOM   2491 O O     . ASP F  1 66 ? -61.880 17.040 25.260  1.00 42.03 ? 207 ASP F O     1 
ATOM   2492 C CB    . ASP F  1 66 ? -60.738 14.346 25.053  1.00 45.40 ? 207 ASP F CB    1 
ATOM   2493 C CG    . ASP F  1 66 ? -61.086 14.143 23.610  1.00 43.79 ? 207 ASP F CG    1 
ATOM   2494 O OD1   . ASP F  1 66 ? -60.202 13.760 22.847  1.00 45.03 ? 207 ASP F OD1   1 
ATOM   2495 O OD2   . ASP F  1 66 ? -62.240 14.393 23.239  1.00 44.34 ? 207 ASP F OD2   1 
ATOM   2496 N N     . PHE F  1 67 ? -60.043 17.721 24.137  1.00 38.67 ? 208 PHE F N     1 
ATOM   2497 C CA    . PHE F  1 67 ? -60.621 18.984 23.740  1.00 37.16 ? 208 PHE F CA    1 
ATOM   2498 C C     . PHE F  1 67 ? -61.967 18.798 23.031  1.00 34.79 ? 208 PHE F C     1 
ATOM   2499 O O     . PHE F  1 67 ? -62.923 19.533 23.303  1.00 33.25 ? 208 PHE F O     1 
ATOM   2500 C CB    . PHE F  1 67 ? -59.658 19.731 22.798  1.00 36.20 ? 208 PHE F CB    1 
ATOM   2501 C CG    . PHE F  1 67 ? -60.087 21.114 22.490  1.00 35.46 ? 208 PHE F CG    1 
ATOM   2502 C CD1   . PHE F  1 67 ? -60.902 21.371 21.410  1.00 33.44 ? 208 PHE F CD1   1 
ATOM   2503 C CD2   . PHE F  1 67 ? -59.680 22.174 23.291  1.00 37.39 ? 208 PHE F CD2   1 
ATOM   2504 C CE1   . PHE F  1 67 ? -61.306 22.663 21.121  1.00 34.03 ? 208 PHE F CE1   1 
ATOM   2505 C CE2   . PHE F  1 67 ? -60.082 23.470 23.015  1.00 37.26 ? 208 PHE F CE2   1 
ATOM   2506 C CZ    . PHE F  1 67 ? -60.885 23.724 21.919  1.00 35.10 ? 208 PHE F CZ    1 
ATOM   2507 N N     . ARG F  1 68 ? -62.026 17.845 22.107  1.00 33.46 ? 209 ARG F N     1 
ATOM   2508 C CA    . ARG F  1 68 ? -63.227 17.696 21.280  1.00 32.80 ? 209 ARG F CA    1 
ATOM   2509 C C     . ARG F  1 68 ? -64.492 17.362 22.091  1.00 33.58 ? 209 ARG F C     1 
ATOM   2510 O O     . ARG F  1 68 ? -65.545 17.941 21.814  1.00 32.82 ? 209 ARG F O     1 
ATOM   2511 C CB    . ARG F  1 68 ? -63.026 16.673 20.158  1.00 32.30 ? 209 ARG F CB    1 
ATOM   2512 C CG    . ARG F  1 68 ? -64.283 16.473 19.272  1.00 32.20 ? 209 ARG F CG    1 
ATOM   2513 C CD    . ARG F  1 68 ? -63.935 16.080 17.821  1.00 30.21 ? 209 ARG F CD    1 
ATOM   2514 N NE    . ARG F  1 68 ? -63.432 17.173 16.983  1.00 27.92 ? 209 ARG F NE    1 
ATOM   2515 C CZ    . ARG F  1 68 ? -64.192 18.085 16.365  1.00 27.60 ? 209 ARG F CZ    1 
ATOM   2516 N NH1   . ARG F  1 68 ? -65.505 18.111 16.544  1.00 27.74 ? 209 ARG F NH1   1 
ATOM   2517 N NH2   . ARG F  1 68 ? -63.638 19.006 15.580  1.00 25.68 ? 209 ARG F NH2   1 
ATOM   2518 N N     . THR F  1 69 ? -64.385 16.439 23.069  1.00 35.56 ? 210 THR F N     1 
ATOM   2519 C CA    . THR F  1 69 ? -65.549 15.992 23.857  1.00 36.97 ? 210 THR F CA    1 
ATOM   2520 C C     . THR F  1 69 ? -65.709 16.741 25.163  1.00 39.35 ? 210 THR F C     1 
ATOM   2521 O O     . THR F  1 69 ? -66.788 16.718 25.770  1.00 40.20 ? 210 THR F O     1 
ATOM   2522 C CB    . THR F  1 69 ? -65.470 14.510 24.246  1.00 38.77 ? 210 THR F CB    1 
ATOM   2523 O OG1   . THR F  1 69 ? -64.267 14.260 24.999  1.00 40.09 ? 210 THR F OG1   1 
ATOM   2524 C CG2   . THR F  1 69 ? -65.529 13.624 23.035  1.00 37.88 ? 210 THR F CG2   1 
ATOM   2525 N N     . GLY F  1 70 ? -64.632 17.357 25.630  1.00 39.65 ? 211 GLY F N     1 
ATOM   2526 C CA    . GLY F  1 70 ? -64.638 18.015 26.923  1.00 40.97 ? 211 GLY F CA    1 
ATOM   2527 C C     . GLY F  1 70 ? -64.689 17.069 28.096  1.00 44.39 ? 211 GLY F C     1 
ATOM   2528 O O     . GLY F  1 70 ? -65.257 17.420 29.130  1.00 44.87 ? 211 GLY F O     1 
ATOM   2529 N N     . LYS F  1 71 ? -64.092 15.879 27.941  1.00 45.57 ? 212 LYS F N     1 
ATOM   2530 C CA    . LYS F  1 71 ? -64.049 14.851 29.012  1.00 49.04 ? 212 LYS F CA    1 
ATOM   2531 C C     . LYS F  1 71 ? -62.598 14.492 29.280  1.00 50.95 ? 212 LYS F C     1 
ATOM   2532 O O     . LYS F  1 71 ? -61.791 14.453 28.323  1.00 48.69 ? 212 LYS F O     1 
ATOM   2533 C CB    . LYS F  1 71 ? -64.800 13.596 28.582  1.00 49.45 ? 212 LYS F CB    1 
ATOM   2534 C CG    . LYS F  1 71 ? -66.266 13.808 28.204  1.00 48.93 ? 212 LYS F CG    1 
ATOM   2535 C CD    . LYS F  1 71 ? -67.146 14.160 29.396  1.00 51.36 ? 212 LYS F CD    1 
ATOM   2536 C CE    . LYS F  1 71 ? -68.631 14.053 29.064  1.00 51.51 ? 212 LYS F CE    1 
ATOM   2537 N N     . MET F  1 72 ? -62.255 14.273 30.563  1.00 54.83 ? 213 MET F N     1 
ATOM   2538 C CA    . MET F  1 72 ? -60.977 13.657 30.958  1.00 58.51 ? 213 MET F CA    1 
ATOM   2539 C C     . MET F  1 72 ? -60.975 12.162 30.643  1.00 62.97 ? 213 MET F C     1 
ATOM   2540 O O     . MET F  1 72 ? -61.881 11.431 31.071  1.00 64.89 ? 213 MET F O     1 
ATOM   2541 C CB    . MET F  1 72 ? -60.717 13.790 32.470  1.00 61.12 ? 213 MET F CB    1 
ATOM   2542 C CG    . MET F  1 72 ? -60.560 15.203 32.985  1.00 60.51 ? 213 MET F CG    1 
ATOM   2543 S SD    . MET F  1 72 ? -59.103 16.055 32.368  1.00 58.88 ? 213 MET F SD    1 
ATOM   2544 C CE    . MET F  1 72 ? -59.170 17.517 33.412  1.00 59.59 ? 213 MET F CE    1 
ATOM   2545 N N     . MET F  1 73 ? -59.936 11.708 29.937  1.00 66.59 ? 214 MET F N     1 
ATOM   2546 C CA    . MET F  1 73 ? -59.698 10.266 29.699  1.00 71.09 ? 214 MET F CA    1 
ATOM   2547 C C     . MET F  1 73 ? -59.188 9.562  30.955  1.00 75.19 ? 214 MET F C     1 
ATOM   2548 O O     . MET F  1 73 ? -58.471 10.164 31.749  1.00 78.07 ? 214 MET F O     1 
ATOM   2549 C CB    . MET F  1 73 ? -58.671 10.076 28.576  1.00 71.55 ? 214 MET F CB    1 
ATOM   2550 C CG    . MET F  1 73 ? -59.049 10.708 27.262  1.00 69.66 ? 214 MET F CG    1 
ATOM   2551 S SD    . MET F  1 73 ? -60.737 10.322 26.755  1.00 71.60 ? 214 MET F SD    1 
ATOM   2552 C CE    . MET F  1 73 ? -60.568 10.455 24.964  1.00 65.16 ? 214 MET F CE    1 
ATOM   2553 N N     . PRO F  1 74 ? -59.551 8.275  31.131  1.00 78.17 ? 215 PRO F N     1 
ATOM   2554 C CA    . PRO F  1 74 ? -59.137 7.476  32.285  1.00 79.00 ? 215 PRO F CA    1 
ATOM   2555 O "O5'" . DC  G  2 1  ? -67.883 26.435 7.464   1.00 27.00 ? 1   DC  G "O5'" 1 
ATOM   2556 C "C5'" . DC  G  2 1  ? -68.049 27.007 6.177   1.00 27.86 ? 1   DC  G "C5'" 1 
ATOM   2557 C "C4'" . DC  G  2 1  ? -66.702 27.244 5.532   1.00 26.57 ? 1   DC  G "C4'" 1 
ATOM   2558 O "O4'" . DC  G  2 1  ? -65.887 28.091 6.383   1.00 25.56 ? 1   DC  G "O4'" 1 
ATOM   2559 C "C3'" . DC  G  2 1  ? -65.871 25.998 5.243   1.00 26.40 ? 1   DC  G "C3'" 1 
ATOM   2560 O "O3'" . DC  G  2 1  ? -65.289 26.160 3.935   1.00 27.52 ? 1   DC  G "O3'" 1 
ATOM   2561 C "C2'" . DC  G  2 1  ? -64.840 25.985 6.352   1.00 24.02 ? 1   DC  G "C2'" 1 
ATOM   2562 C "C1'" . DC  G  2 1  ? -64.641 27.461 6.655   1.00 23.92 ? 1   DC  G "C1'" 1 
ATOM   2563 N N1    . DC  G  2 1  ? -64.296 27.728 8.065   1.00 22.24 ? 1   DC  G N1    1 
ATOM   2564 C C2    . DC  G  2 1  ? -63.135 28.437 8.366   1.00 21.81 ? 1   DC  G C2    1 
ATOM   2565 O O2    . DC  G  2 1  ? -62.425 28.848 7.442   1.00 23.40 ? 1   DC  G O2    1 
ATOM   2566 N N3    . DC  G  2 1  ? -62.811 28.658 9.660   1.00 21.86 ? 1   DC  G N3    1 
ATOM   2567 C C4    . DC  G  2 1  ? -63.588 28.185 10.631  1.00 22.63 ? 1   DC  G C4    1 
ATOM   2568 N N4    . DC  G  2 1  ? -63.216 28.400 11.888  1.00 22.98 ? 1   DC  G N4    1 
ATOM   2569 C C5    . DC  G  2 1  ? -64.784 27.464 10.353  1.00 23.91 ? 1   DC  G C5    1 
ATOM   2570 C C6    . DC  G  2 1  ? -65.095 27.256 9.068   1.00 23.29 ? 1   DC  G C6    1 
ATOM   2571 P P     . DG  G  2 2  ? -64.322 25.112 3.354   1.00 28.04 ? 2   DG  G P     1 
ATOM   2572 O OP1   . DG  G  2 2  ? -64.645 24.952 1.905   1.00 30.07 ? 2   DG  G OP1   1 
ATOM   2573 O OP2   . DG  G  2 2  ? -64.338 23.882 4.214   1.00 27.39 ? 2   DG  G OP2   1 
ATOM   2574 O "O5'" . DG  G  2 2  ? -62.892 25.816 3.463   1.00 25.93 ? 2   DG  G "O5'" 1 
ATOM   2575 C "C5'" . DG  G  2 2  ? -62.708 27.173 3.043   1.00 27.66 ? 2   DG  G "C5'" 1 
ATOM   2576 C "C4'" . DG  G  2 2  ? -61.244 27.517 2.890   1.00 27.10 ? 2   DG  G "C4'" 1 
ATOM   2577 O "O4'" . DG  G  2 2  ? -60.633 27.811 4.171   1.00 26.60 ? 2   DG  G "O4'" 1 
ATOM   2578 C "C3'" . DG  G  2 2  ? -60.372 26.442 2.255   1.00 27.39 ? 2   DG  G "C3'" 1 
ATOM   2579 O "O3'" . DG  G  2 2  ? -59.416 27.109 1.446   1.00 29.07 ? 2   DG  G "O3'" 1 
ATOM   2580 C "C2'" . DG  G  2 2  ? -59.752 25.734 3.450   1.00 24.59 ? 2   DG  G "C2'" 1 
ATOM   2581 C "C1'" . DG  G  2 2  ? -59.682 26.797 4.547   1.00 23.74 ? 2   DG  G "C1'" 1 
ATOM   2582 N N9    . DG  G  2 2  ? -60.044 26.362 5.898   1.00 21.32 ? 2   DG  G N9    1 
ATOM   2583 C C8    . DG  G  2 2  ? -61.157 25.627 6.234   1.00 22.14 ? 2   DG  G C8    1 
ATOM   2584 N N7    . DG  G  2 2  ? -61.325 25.510 7.528   1.00 21.50 ? 2   DG  G N7    1 
ATOM   2585 C C5    . DG  G  2 2  ? -60.296 26.259 8.078   1.00 20.19 ? 2   DG  G C5    1 
ATOM   2586 C C6    . DG  G  2 2  ? -59.952 26.487 9.440   1.00 20.24 ? 2   DG  G C6    1 
ATOM   2587 O O6    . DG  G  2 2  ? -60.532 26.086 10.456  1.00 20.46 ? 2   DG  G O6    1 
ATOM   2588 N N1    . DG  G  2 2  ? -58.807 27.272 9.556   1.00 19.36 ? 2   DG  G N1    1 
ATOM   2589 C C2    . DG  G  2 2  ? -58.096 27.796 8.493   1.00 20.55 ? 2   DG  G C2    1 
ATOM   2590 N N2    . DG  G  2 2  ? -57.041 28.563 8.800   1.00 20.66 ? 2   DG  G N2    1 
ATOM   2591 N N3    . DG  G  2 2  ? -58.403 27.581 7.220   1.00 20.28 ? 2   DG  G N3    1 
ATOM   2592 C C4    . DG  G  2 2  ? -59.504 26.809 7.086   1.00 20.97 ? 2   DG  G C4    1 
ATOM   2593 P P     . DG  G  2 3  ? -58.442 26.298 0.504   1.00 31.12 ? 3   DG  G P     1 
ATOM   2594 O OP1   . DG  G  2 3  ? -57.946 27.232 -0.503  1.00 32.69 ? 3   DG  G OP1   1 
ATOM   2595 O OP2   . DG  G  2 3  ? -59.116 25.005 0.102   1.00 30.54 ? 3   DG  G OP2   1 
ATOM   2596 O "O5'" . DG  G  2 3  ? -57.214 25.945 1.456   1.00 28.29 ? 3   DG  G "O5'" 1 
ATOM   2597 C "C5'" . DG  G  2 3  ? -56.328 26.973 1.910   1.00 27.53 ? 3   DG  G "C5'" 1 
ATOM   2598 C "C4'" . DG  G  2 3  ? -55.380 26.392 2.933   1.00 25.99 ? 3   DG  G "C4'" 1 
ATOM   2599 O "O4'" . DG  G  2 3  ? -56.125 26.041 4.119   1.00 24.17 ? 3   DG  G "O4'" 1 
ATOM   2600 C "C3'" . DG  G  2 3  ? -54.688 25.100 2.473   1.00 25.52 ? 3   DG  G "C3'" 1 
ATOM   2601 O "O3'" . DG  G  2 3  ? -53.370 25.057 2.959   1.00 27.16 ? 3   DG  G "O3'" 1 
ATOM   2602 C "C2'" . DG  G  2 3  ? -55.430 24.016 3.220   1.00 24.37 ? 3   DG  G "C2'" 1 
ATOM   2603 C "C1'" . DG  G  2 3  ? -55.710 24.749 4.517   1.00 23.32 ? 3   DG  G "C1'" 1 
ATOM   2604 N N9    . DG  G  2 3  ? -56.730 24.195 5.394   1.00 22.19 ? 3   DG  G N9    1 
ATOM   2605 C C8    . DG  G  2 3  ? -57.798 23.391 5.070   1.00 21.35 ? 3   DG  G C8    1 
ATOM   2606 N N7    . DG  G  2 3  ? -58.512 23.047 6.109   1.00 21.27 ? 3   DG  G N7    1 
ATOM   2607 C C5    . DG  G  2 3  ? -57.877 23.664 7.181   1.00 20.76 ? 3   DG  G C5    1 
ATOM   2608 C C6    . DG  G  2 3  ? -58.198 23.669 8.562   1.00 21.16 ? 3   DG  G C6    1 
ATOM   2609 O O6    . DG  G  2 3  ? -59.135 23.100 9.142   1.00 20.28 ? 3   DG  G O6    1 
ATOM   2610 N N1    . DG  G  2 3  ? -57.281 24.418 9.297   1.00 22.44 ? 3   DG  G N1    1 
ATOM   2611 C C2    . DG  G  2 3  ? -56.198 25.080 8.769   1.00 23.21 ? 3   DG  G C2    1 
ATOM   2612 N N2    . DG  G  2 3  ? -55.426 25.753 9.636   1.00 23.95 ? 3   DG  G N2    1 
ATOM   2613 N N3    . DG  G  2 3  ? -55.897 25.090 7.484   1.00 22.53 ? 3   DG  G N3    1 
ATOM   2614 C C4    . DG  G  2 3  ? -56.770 24.366 6.755   1.00 21.57 ? 3   DG  G C4    1 
ATOM   2615 P P     . DA  G  2 4  ? -52.143 24.871 1.977   1.00 29.65 ? 4   DA  G P     1 
ATOM   2616 O OP1   . DA  G  2 4  ? -52.296 25.810 0.899   1.00 31.83 ? 4   DA  G OP1   1 
ATOM   2617 O OP2   . DA  G  2 4  ? -51.996 23.422 1.691   1.00 30.21 ? 4   DA  G OP2   1 
ATOM   2618 O "O5'" . DA  G  2 4  ? -50.916 25.287 2.913   1.00 30.32 ? 4   DA  G "O5'" 1 
ATOM   2619 C "C5'" . DA  G  2 4  ? -50.857 26.556 3.592   1.00 30.48 ? 4   DA  G "C5'" 1 
ATOM   2620 C "C4'" . DA  G  2 4  ? -50.345 26.391 5.007   1.00 30.54 ? 4   DA  G "C4'" 1 
ATOM   2621 O "O4'" . DA  G  2 4  ? -51.322 25.734 5.852   1.00 28.64 ? 4   DA  G "O4'" 1 
ATOM   2622 C "C3'" . DA  G  2 4  ? -49.058 25.593 5.188   1.00 31.89 ? 4   DA  G "C3'" 1 
ATOM   2623 O "O3'" . DA  G  2 4  ? -48.436 26.259 6.302   1.00 32.89 ? 4   DA  G "O3'" 1 
ATOM   2624 C "C2'" . DA  G  2 4  ? -49.571 24.190 5.496   1.00 29.94 ? 4   DA  G "C2'" 1 
ATOM   2625 C "C1'" . DA  G  2 4  ? -50.834 24.482 6.321   1.00 27.76 ? 4   DA  G "C1'" 1 
ATOM   2626 N N9    . DA  G  2 4  ? -51.951 23.524 6.254   1.00 25.88 ? 4   DA  G N9    1 
ATOM   2627 C C8    . DA  G  2 4  ? -52.468 22.898 5.142   1.00 24.17 ? 4   DA  G C8    1 
ATOM   2628 N N7    . DA  G  2 4  ? -53.513 22.141 5.398   1.00 23.81 ? 4   DA  G N7    1 
ATOM   2629 C C5    . DA  G  2 4  ? -53.712 22.296 6.763   1.00 22.20 ? 4   DA  G C5    1 
ATOM   2630 C C6    . DA  G  2 4  ? -54.671 21.760 7.653   1.00 22.20 ? 4   DA  G C6    1 
ATOM   2631 N N6    . DA  G  2 4  ? -55.645 20.920 7.287   1.00 20.83 ? 4   DA  G N6    1 
ATOM   2632 N N1    . DA  G  2 4  ? -54.573 22.101 8.957   1.00 21.69 ? 4   DA  G N1    1 
ATOM   2633 C C2    . DA  G  2 4  ? -53.590 22.935 9.333   1.00 22.69 ? 4   DA  G C2    1 
ATOM   2634 N N3    . DA  G  2 4  ? -52.643 23.506 8.597   1.00 23.64 ? 4   DA  G N3    1 
ATOM   2635 C C4    . DA  G  2 4  ? -52.758 23.144 7.305   1.00 23.84 ? 4   DA  G C4    1 
ATOM   2636 P P     . DA  G  2 5  ? -46.970 25.902 6.794   1.00 36.75 ? 5   DA  G P     1 
ATOM   2637 O OP1   . DA  G  2 5  ? -46.323 27.163 7.292   1.00 38.00 ? 5   DA  G OP1   1 
ATOM   2638 O OP2   . DA  G  2 5  ? -46.301 25.054 5.759   1.00 35.62 ? 5   DA  G OP2   1 
ATOM   2639 O "O5'" . DA  G  2 5  ? -47.244 24.919 8.010   1.00 34.77 ? 5   DA  G "O5'" 1 
ATOM   2640 C "C5'" . DA  G  2 5  ? -48.020 25.310 9.148   1.00 33.54 ? 5   DA  G "C5'" 1 
ATOM   2641 C "C4'" . DA  G  2 5  ? -48.239 24.111 10.039  1.00 32.11 ? 5   DA  G "C4'" 1 
ATOM   2642 O "O4'" . DA  G  2 5  ? -49.381 23.350 9.598   1.00 28.23 ? 5   DA  G "O4'" 1 
ATOM   2643 C "C3'" . DA  G  2 5  ? -47.055 23.124 10.129  1.00 33.92 ? 5   DA  G "C3'" 1 
ATOM   2644 O "O3'" . DA  G  2 5  ? -46.730 23.275 11.492  1.00 37.78 ? 5   DA  G "O3'" 1 
ATOM   2645 C "C2'" . DA  G  2 5  ? -47.632 21.786 9.668   1.00 30.57 ? 5   DA  G "C2'" 1 
ATOM   2646 C "C1'" . DA  G  2 5  ? -49.149 21.983 9.813   1.00 28.03 ? 5   DA  G "C1'" 1 
ATOM   2647 N N9    . DA  G  2 5  ? -49.974 21.248 8.868   1.00 23.81 ? 5   DA  G N9    1 
ATOM   2648 C C8    . DA  G  2 5  ? -49.822 21.173 7.504   1.00 24.04 ? 5   DA  G C8    1 
ATOM   2649 N N7    . DA  G  2 5  ? -50.731 20.437 6.910   1.00 21.69 ? 5   DA  G N7    1 
ATOM   2650 C C5    . DA  G  2 5  ? -51.545 20.012 7.946   1.00 20.66 ? 5   DA  G C5    1 
ATOM   2651 C C6    . DA  G  2 5  ? -52.691 19.207 7.969   1.00 20.81 ? 5   DA  G C6    1 
ATOM   2652 N N6    . DA  G  2 5  ? -53.250 18.682 6.861   1.00 21.10 ? 5   DA  G N6    1 
ATOM   2653 N N1    . DA  G  2 5  ? -53.257 18.949 9.172   1.00 20.58 ? 5   DA  G N1    1 
ATOM   2654 C C2    . DA  G  2 5  ? -52.696 19.482 10.277  1.00 22.25 ? 5   DA  G C2    1 
ATOM   2655 N N3    . DA  G  2 5  ? -51.626 20.276 10.378  1.00 22.69 ? 5   DA  G N3    1 
ATOM   2656 C C4    . DA  G  2 5  ? -51.084 20.495 9.163   1.00 22.86 ? 5   DA  G C4    1 
ATOM   2657 P P     . DT  G  2 6  ? -45.687 22.352 12.274  1.00 41.76 ? 6   DT  G P     1 
ATOM   2658 O OP1   . DT  G  2 6  ? -45.324 23.111 13.461  1.00 41.11 ? 6   DT  G OP1   1 
ATOM   2659 O OP2   . DT  G  2 6  ? -44.631 21.850 11.316  1.00 42.78 ? 6   DT  G OP2   1 
ATOM   2660 O "O5'" . DT  G  2 6  ? -46.584 21.102 12.719  1.00 37.83 ? 6   DT  G "O5'" 1 
ATOM   2661 C "C5'" . DT  G  2 6  ? -47.552 21.251 13.780  1.00 35.87 ? 6   DT  G "C5'" 1 
ATOM   2662 C "C4'" . DT  G  2 6  ? -48.349 19.977 13.953  1.00 33.28 ? 6   DT  G "C4'" 1 
ATOM   2663 O "O4'" . DT  G  2 6  ? -49.006 19.630 12.706  1.00 30.38 ? 6   DT  G "O4'" 1 
ATOM   2664 C "C3'" . DT  G  2 6  ? -47.537 18.734 14.364  1.00 32.98 ? 6   DT  G "C3'" 1 
ATOM   2665 O "O3'" . DT  G  2 6  ? -48.066 18.295 15.620  1.00 32.41 ? 6   DT  G "O3'" 1 
ATOM   2666 C "C2'" . DT  G  2 6  ? -47.712 17.781 13.179  1.00 30.27 ? 6   DT  G "C2'" 1 
ATOM   2667 C "C1'" . DT  G  2 6  ? -49.052 18.219 12.634  1.00 28.88 ? 6   DT  G "C1'" 1 
ATOM   2668 N N1    . DT  G  2 6  ? -49.355 17.839 11.221  1.00 26.96 ? 6   DT  G N1    1 
ATOM   2669 C C2    . DT  G  2 6  ? -50.539 17.195 10.960  1.00 26.01 ? 6   DT  G C2    1 
ATOM   2670 O O2    . DT  G  2 6  ? -51.350 16.906 11.829  1.00 25.62 ? 6   DT  G O2    1 
ATOM   2671 N N3    . DT  G  2 6  ? -50.735 16.876 9.636   1.00 24.70 ? 6   DT  G N3    1 
ATOM   2672 C C4    . DT  G  2 6  ? -49.900 17.161 8.578   1.00 24.20 ? 6   DT  G C4    1 
ATOM   2673 O O4    . DT  G  2 6  ? -50.226 16.839 7.438   1.00 24.40 ? 6   DT  G O4    1 
ATOM   2674 C C5    . DT  G  2 6  ? -48.682 17.845 8.924   1.00 25.77 ? 6   DT  G C5    1 
ATOM   2675 C C7    . DT  G  2 6  ? -47.707 18.182 7.841   1.00 28.25 ? 6   DT  G C7    1 
ATOM   2676 C C6    . DT  G  2 6  ? -48.465 18.133 10.211  1.00 26.84 ? 6   DT  G C6    1 
ATOM   2677 P P     . DG  G  2 7  ? -47.734 16.839 16.245  1.00 35.47 ? 7   DG  G P     1 
ATOM   2678 O OP1   . DG  G  2 7  ? -47.645 17.006 17.678  1.00 36.31 ? 7   DG  G OP1   1 
ATOM   2679 O OP2   . DG  G  2 7  ? -46.586 16.222 15.514  1.00 34.74 ? 7   DG  G OP2   1 
ATOM   2680 O "O5'" . DG  G  2 7  ? -49.046 15.984 15.913  1.00 33.70 ? 7   DG  G "O5'" 1 
ATOM   2681 C "C5'" . DG  G  2 7  ? -50.360 16.443 16.363  1.00 33.56 ? 7   DG  G "C5'" 1 
ATOM   2682 C "C4'" . DG  G  2 7  ? -51.409 15.355 16.235  1.00 32.80 ? 7   DG  G "C4'" 1 
ATOM   2683 O "O4'" . DG  G  2 7  ? -51.660 15.039 14.843  1.00 29.55 ? 7   DG  G "O4'" 1 
ATOM   2684 C "C3'" . DG  G  2 7  ? -51.061 14.022 16.889  1.00 34.65 ? 7   DG  G "C3'" 1 
ATOM   2685 O "O3'" . DG  G  2 7  ? -52.283 13.417 17.331  1.00 36.44 ? 7   DG  G "O3'" 1 
ATOM   2686 C "C2'" . DG  G  2 7  ? -50.402 13.245 15.757  1.00 32.04 ? 7   DG  G "C2'" 1 
ATOM   2687 C "C1'" . DG  G  2 7  ? -51.207 13.705 14.547  1.00 29.36 ? 7   DG  G "C1'" 1 
ATOM   2688 N N9    . DG  G  2 7  ? -50.513 13.765 13.264  1.00 26.33 ? 7   DG  G N9    1 
ATOM   2689 C C8    . DG  G  2 7  ? -49.384 14.491 12.975  1.00 27.08 ? 7   DG  G C8    1 
ATOM   2690 N N7    . DG  G  2 7  ? -49.061 14.452 11.710  1.00 25.49 ? 7   DG  G N7    1 
ATOM   2691 C C5    . DG  G  2 7  ? -50.046 13.669 11.129  1.00 23.22 ? 7   DG  G C5    1 
ATOM   2692 C C6    . DG  G  2 7  ? -50.237 13.295 9.779   1.00 21.53 ? 7   DG  G C6    1 
ATOM   2693 O O6    . DG  G  2 7  ? -49.538 13.568 8.805   1.00 20.83 ? 7   DG  G O6    1 
ATOM   2694 N N1    . DG  G  2 7  ? -51.363 12.492 9.623   1.00 20.47 ? 7   DG  G N1    1 
ATOM   2695 C C2    . DG  G  2 7  ? -52.218 12.131 10.634  1.00 21.91 ? 7   DG  G C2    1 
ATOM   2696 N N2    . DG  G  2 7  ? -53.274 11.388 10.285  1.00 21.22 ? 7   DG  G N2    1 
ATOM   2697 N N3    . DG  G  2 7  ? -52.066 12.502 11.896  1.00 23.42 ? 7   DG  G N3    1 
ATOM   2698 C C4    . DG  G  2 7  ? -50.965 13.261 12.070  1.00 23.83 ? 7   DG  G C4    1 
ATOM   2699 P P     . DT  G  2 8  ? -52.256 12.094 18.233  1.00 43.93 ? 8   DT  G P     1 
ATOM   2700 O OP1   . DT  G  2 8  ? -53.501 12.089 19.057  1.00 46.67 ? 8   DT  G OP1   1 
ATOM   2701 O OP2   . DT  G  2 8  ? -50.921 11.974 18.872  1.00 43.73 ? 8   DT  G OP2   1 
ATOM   2702 O "O5'" . DT  G  2 8  ? -52.374 10.900 17.195  1.00 42.95 ? 8   DT  G "O5'" 1 
ATOM   2703 C "C5'" . DT  G  2 8  ? -53.488 10.799 16.279  1.00 43.59 ? 8   DT  G "C5'" 1 
ATOM   2704 C "C4'" . DT  G  2 8  ? -53.311 9.569  15.414  1.00 43.42 ? 8   DT  G "C4'" 1 
ATOM   2705 O "O4'" . DT  G  2 8  ? -52.559 9.908  14.218  1.00 39.78 ? 8   DT  G "O4'" 1 
ATOM   2706 C "C3'" . DT  G  2 8  ? -52.528 8.433  16.074  1.00 45.52 ? 8   DT  G "C3'" 1 
ATOM   2707 O "O3'" . DT  G  2 8  ? -53.030 7.175  15.634  1.00 51.13 ? 8   DT  G "O3'" 1 
ATOM   2708 C "C2'" . DT  G  2 8  ? -51.145 8.575  15.472  1.00 43.87 ? 8   DT  G "C2'" 1 
ATOM   2709 C "C1'" . DT  G  2 8  ? -51.542 8.936  14.055  1.00 38.55 ? 8   DT  G "C1'" 1 
ATOM   2710 N N1    . DT  G  2 8  ? -50.515 9.489  13.152  1.00 34.75 ? 8   DT  G N1    1 
ATOM   2711 C C2    . DT  G  2 8  ? -50.697 9.307  11.793  1.00 31.17 ? 8   DT  G C2    1 
ATOM   2712 O O2    . DT  G  2 8  ? -51.651 8.711  11.320  1.00 31.01 ? 8   DT  G O2    1 
ATOM   2713 N N3    . DT  G  2 8  ? -49.724 9.865  11.008  1.00 28.52 ? 8   DT  G N3    1 
ATOM   2714 C C4    . DT  G  2 8  ? -48.607 10.562 11.429  1.00 30.24 ? 8   DT  G C4    1 
ATOM   2715 O O4    . DT  G  2 8  ? -47.815 11.006 10.598  1.00 28.20 ? 8   DT  G O4    1 
ATOM   2716 C C5    . DT  G  2 8  ? -48.474 10.706 12.870  1.00 31.55 ? 8   DT  G C5    1 
ATOM   2717 C C7    . DT  G  2 8  ? -47.302 11.453 13.425  1.00 33.07 ? 8   DT  G C7    1 
ATOM   2718 C C6    . DT  G  2 8  ? -49.428 10.179 13.643  1.00 32.97 ? 8   DT  G C6    1 
ATOM   2719 P P     . DA  G  2 9  ? -53.582 6.122  16.684  1.00 52.20 ? 9   DA  G P     1 
ATOM   2720 O OP1   . DA  G  2 9  ? -54.577 6.829  17.534  1.00 53.05 ? 9   DA  G OP1   1 
ATOM   2721 O OP2   . DA  G  2 9  ? -52.408 5.417  17.284  1.00 51.32 ? 9   DA  G OP2   1 
ATOM   2722 O "O5'" . DA  G  2 9  ? -54.388 5.116  15.760  1.00 50.95 ? 9   DA  G "O5'" 1 
ATOM   2723 C "C5'" . DA  G  2 9  ? -55.499 5.580  14.971  1.00 47.72 ? 9   DA  G "C5'" 1 
ATOM   2724 C "C4'" . DA  G  2 9  ? -55.586 4.756  13.708  1.00 46.12 ? 9   DA  G "C4'" 1 
ATOM   2725 O "O4'" . DA  G  2 9  ? -54.534 5.137  12.793  1.00 42.21 ? 9   DA  G "O4'" 1 
ATOM   2726 C "C3'" . DA  G  2 9  ? -55.418 3.257  13.932  1.00 47.12 ? 9   DA  G "C3'" 1 
ATOM   2727 O "O3'" . DA  G  2 9  ? -56.329 2.585  13.058  1.00 47.55 ? 9   DA  G "O3'" 1 
ATOM   2728 C "C2'" . DA  G  2 9  ? -53.937 3.024  13.661  1.00 44.83 ? 9   DA  G "C2'" 1 
ATOM   2729 C "C1'" . DA  G  2 9  ? -53.626 4.047  12.581  1.00 40.84 ? 9   DA  G "C1'" 1 
ATOM   2730 N N9    . DA  G  2 9  ? -52.271 4.606  12.563  1.00 37.37 ? 9   DA  G N9    1 
ATOM   2731 C C8    . DA  G  2 9  ? -51.496 5.007  13.625  1.00 37.25 ? 9   DA  G C8    1 
ATOM   2732 N N7    . DA  G  2 9  ? -50.351 5.537  13.272  1.00 35.14 ? 9   DA  G N7    1 
ATOM   2733 C C5    . DA  G  2 9  ? -50.382 5.507  11.885  1.00 32.74 ? 9   DA  G C5    1 
ATOM   2734 C C6    . DA  G  2 9  ? -49.467 5.933  10.911  1.00 31.60 ? 9   DA  G C6    1 
ATOM   2735 N N6    . DA  G  2 9  ? -48.291 6.497  11.198  1.00 31.51 ? 9   DA  G N6    1 
ATOM   2736 N N1    . DA  G  2 9  ? -49.804 5.759  9.611   1.00 30.17 ? 9   DA  G N1    1 
ATOM   2737 C C2    . DA  G  2 9  ? -50.976 5.181  9.326   1.00 30.45 ? 9   DA  G C2    1 
ATOM   2738 N N3    . DA  G  2 9  ? -51.928 4.757  10.154  1.00 32.85 ? 9   DA  G N3    1 
ATOM   2739 C C4    . DA  G  2 9  ? -51.565 4.951  11.435  1.00 33.94 ? 9   DA  G C4    1 
ATOM   2740 P P     . DG  G  2 10 ? -56.492 1.020  13.125  1.00 52.77 ? 10  DG  G P     1 
ATOM   2741 O OP1   . DG  G  2 10 ? -57.889 0.684  12.742  1.00 53.44 ? 10  DG  G OP1   1 
ATOM   2742 O OP2   . DG  G  2 10 ? -55.924 0.522  14.417  1.00 51.27 ? 10  DG  G OP2   1 
ATOM   2743 O "O5'" . DG  G  2 10 ? -55.515 0.533  11.963  1.00 48.26 ? 10  DG  G "O5'" 1 
ATOM   2744 C "C5'" . DG  G  2 10 ? -55.795 0.855  10.606  1.00 45.15 ? 10  DG  G "C5'" 1 
ATOM   2745 C "C4'" . DG  G  2 10 ? -54.648 0.407  9.733   1.00 43.16 ? 10  DG  G "C4'" 1 
ATOM   2746 O "O4'" . DG  G  2 10 ? -53.459 1.192  10.018  1.00 40.92 ? 10  DG  G "O4'" 1 
ATOM   2747 C "C3'" . DG  G  2 10 ? -54.232 -1.058 9.904   1.00 44.77 ? 10  DG  G "C3'" 1 
ATOM   2748 O "O3'" . DG  G  2 10 ? -53.987 -1.515 8.586   1.00 44.79 ? 10  DG  G "O3'" 1 
ATOM   2749 C "C2'" . DG  G  2 10 ? -52.939 -0.968 10.695  1.00 43.07 ? 10  DG  G "C2'" 1 
ATOM   2750 C "C1'" . DG  G  2 10 ? -52.360 0.313  10.146  1.00 40.43 ? 10  DG  G "C1'" 1 
ATOM   2751 N N9    . DG  G  2 10 ? -51.355 0.962  10.975  1.00 39.19 ? 10  DG  G N9    1 
ATOM   2752 C C8    . DG  G  2 10 ? -51.299 1.003  12.347  1.00 40.74 ? 10  DG  G C8    1 
ATOM   2753 N N7    . DG  G  2 10 ? -50.262 1.656  12.797  1.00 39.66 ? 10  DG  G N7    1 
ATOM   2754 C C5    . DG  G  2 10 ? -49.591 2.066  11.654  1.00 36.81 ? 10  DG  G C5    1 
ATOM   2755 C C6    . DG  G  2 10 ? -48.379 2.779  11.510  1.00 35.33 ? 10  DG  G C6    1 
ATOM   2756 O O6    . DG  G  2 10 ? -47.651 3.236  12.392  1.00 35.32 ? 10  DG  G O6    1 
ATOM   2757 N N1    . DG  G  2 10 ? -48.045 2.960  10.169  1.00 33.44 ? 10  DG  G N1    1 
ATOM   2758 C C2    . DG  G  2 10 ? -48.776 2.497  9.107   1.00 32.92 ? 10  DG  G C2    1 
ATOM   2759 N N2    . DG  G  2 10 ? -48.291 2.767  7.889   1.00 31.64 ? 10  DG  G N2    1 
ATOM   2760 N N3    . DG  G  2 10 ? -49.897 1.807  9.228   1.00 35.12 ? 10  DG  G N3    1 
ATOM   2761 C C4    . DG  G  2 10 ? -50.243 1.630  10.521  1.00 36.76 ? 10  DG  G C4    1 
ATOM   2762 P P     . DG  G  2 11 ? -53.900 -3.045 8.222   1.00 46.51 ? 11  DG  G P     1 
ATOM   2763 O OP1   . DG  G  2 11 ? -55.186 -3.434 7.615   1.00 50.49 ? 11  DG  G OP1   1 
ATOM   2764 O OP2   . DG  G  2 11 ? -53.396 -3.805 9.388   1.00 47.87 ? 11  DG  G OP2   1 
ATOM   2765 O "O5'" . DG  G  2 11 ? -52.824 -3.005 7.046   1.00 45.24 ? 11  DG  G "O5'" 1 
ATOM   2766 C "C5'" . DG  G  2 11 ? -52.821 -1.901 6.102   1.00 40.83 ? 11  DG  G "C5'" 1 
ATOM   2767 C "C4'" . DG  G  2 11 ? -51.503 -1.808 5.370   1.00 38.34 ? 11  DG  G "C4'" 1 
ATOM   2768 O "O4'" . DG  G  2 11 ? -50.551 -1.112 6.191   1.00 35.52 ? 11  DG  G "O4'" 1 
ATOM   2769 C "C3'" . DG  G  2 11 ? -50.857 -3.140 5.003   1.00 40.28 ? 11  DG  G "C3'" 1 
ATOM   2770 O "O3'" . DG  G  2 11 ? -50.312 -2.999 3.689   1.00 40.99 ? 11  DG  G "O3'" 1 
ATOM   2771 C "C2'" . DG  G  2 11 ? -49.819 -3.346 6.096   1.00 38.93 ? 11  DG  G "C2'" 1 
ATOM   2772 C "C1'" . DG  G  2 11 ? -49.410 -1.925 6.450   1.00 36.09 ? 11  DG  G "C1'" 1 
ATOM   2773 N N9    . DG  G  2 11 ? -49.017 -1.695 7.840   1.00 36.68 ? 11  DG  G N9    1 
ATOM   2774 C C8    . DG  G  2 11 ? -49.707 -2.072 8.971   1.00 37.59 ? 11  DG  G C8    1 
ATOM   2775 N N7    . DG  G  2 11 ? -49.132 -1.679 10.076  1.00 37.18 ? 11  DG  G N7    1 
ATOM   2776 C C5    . DG  G  2 11 ? -48.008 -0.985 9.651   1.00 35.65 ? 11  DG  G C5    1 
ATOM   2777 C C6    . DG  G  2 11 ? -46.997 -0.327 10.399  1.00 35.50 ? 11  DG  G C6    1 
ATOM   2778 O O6    . DG  G  2 11 ? -46.881 -0.236 11.627  1.00 35.96 ? 11  DG  G O6    1 
ATOM   2779 N N1    . DG  G  2 11 ? -46.048 0.262  9.569   1.00 34.48 ? 11  DG  G N1    1 
ATOM   2780 C C2    . DG  G  2 11 ? -46.061 0.212  8.196   1.00 34.47 ? 11  DG  G C2    1 
ATOM   2781 N N2    . DG  G  2 11 ? -45.050 0.832  7.572   1.00 34.30 ? 11  DG  G N2    1 
ATOM   2782 N N3    . DG  G  2 11 ? -46.987 -0.415 7.488   1.00 34.27 ? 11  DG  G N3    1 
ATOM   2783 C C4    . DG  G  2 11 ? -47.929 -0.976 8.273   1.00 34.98 ? 11  DG  G C4    1 
ATOM   2784 P P     . DC  G  2 12 ? -49.839 -4.267 2.855   1.00 43.66 ? 12  DC  G P     1 
ATOM   2785 O OP1   . DC  G  2 12 ? -49.857 -3.886 1.415   1.00 48.60 ? 12  DC  G OP1   1 
ATOM   2786 O OP2   . DC  G  2 12 ? -50.573 -5.472 3.305   1.00 44.46 ? 12  DC  G OP2   1 
ATOM   2787 O "O5'" . DC  G  2 12 ? -48.304 -4.391 3.237   1.00 44.79 ? 12  DC  G "O5'" 1 
ATOM   2788 C "C5'" . DC  G  2 12 ? -47.411 -3.323 2.877   1.00 42.43 ? 12  DC  G "C5'" 1 
ATOM   2789 C "C4'" . DC  G  2 12 ? -46.152 -3.397 3.704   1.00 40.99 ? 12  DC  G "C4'" 1 
ATOM   2790 O "O4'" . DC  G  2 12 ? -46.416 -3.022 5.067   1.00 37.74 ? 12  DC  G "O4'" 1 
ATOM   2791 C "C3'" . DC  G  2 12 ? -45.523 -4.772 3.826   1.00 42.06 ? 12  DC  G "C3'" 1 
ATOM   2792 O "O3'" . DC  G  2 12 ? -44.755 -5.124 2.665   1.00 45.92 ? 12  DC  G "O3'" 1 
ATOM   2793 C "C2'" . DC  G  2 12 ? -44.692 -4.641 5.097   1.00 39.95 ? 12  DC  G "C2'" 1 
ATOM   2794 C "C1'" . DC  G  2 12 ? -45.275 -3.409 5.811   1.00 37.17 ? 12  DC  G "C1'" 1 
ATOM   2795 N N1    . DC  G  2 12 ? -45.688 -3.630 7.209   1.00 35.71 ? 12  DC  G N1    1 
ATOM   2796 C C2    . DC  G  2 12 ? -44.979 -2.990 8.236   1.00 34.62 ? 12  DC  G C2    1 
ATOM   2797 O O2    . DC  G  2 12 ? -44.033 -2.245 7.941   1.00 34.56 ? 12  DC  G O2    1 
ATOM   2798 N N3    . DC  G  2 12 ? -45.338 -3.203 9.520   1.00 34.25 ? 12  DC  G N3    1 
ATOM   2799 C C4    . DC  G  2 12 ? -46.366 -4.005 9.800   1.00 35.91 ? 12  DC  G C4    1 
ATOM   2800 N N4    . DC  G  2 12 ? -46.692 -4.176 11.082  1.00 37.36 ? 12  DC  G N4    1 
ATOM   2801 C C5    . DC  G  2 12 ? -47.104 -4.672 8.777   1.00 36.87 ? 12  DC  G C5    1 
ATOM   2802 C C6    . DC  G  2 12 ? -46.730 -4.462 7.507   1.00 35.86 ? 12  DC  G C6    1 
ATOM   2803 O "O5'" . DG  H  3 1  ? -37.252 -1.831 17.023  1.00 59.49 ? 1   DG  H "O5'" 1 
ATOM   2804 C "C5'" . DG  H  3 1  ? -38.153 -0.741 16.844  1.00 56.20 ? 1   DG  H "C5'" 1 
ATOM   2805 C "C4'" . DG  H  3 1  ? -37.909 -0.086 15.504  1.00 54.19 ? 1   DG  H "C4'" 1 
ATOM   2806 O "O4'" . DG  H  3 1  ? -38.784 -0.666 14.509  1.00 50.87 ? 1   DG  H "O4'" 1 
ATOM   2807 C "C3'" . DG  H  3 1  ? -38.210 1.406  15.461  1.00 52.72 ? 1   DG  H "C3'" 1 
ATOM   2808 O "O3'" . DG  H  3 1  ? -37.442 1.962  14.393  1.00 55.24 ? 1   DG  H "O3'" 1 
ATOM   2809 C "C2'" . DG  H  3 1  ? -39.695 1.425  15.169  1.00 48.88 ? 1   DG  H "C2'" 1 
ATOM   2810 C "C1'" . DG  H  3 1  ? -39.829 0.259  14.187  1.00 47.15 ? 1   DG  H "C1'" 1 
ATOM   2811 N N9    . DG  H  3 1  ? -41.101 -0.460 14.228  1.00 44.39 ? 1   DG  H N9    1 
ATOM   2812 C C8    . DG  H  3 1  ? -41.813 -0.846 15.339  1.00 44.33 ? 1   DG  H C8    1 
ATOM   2813 N N7    . DG  H  3 1  ? -42.914 -1.481 15.046  1.00 43.08 ? 1   DG  H N7    1 
ATOM   2814 C C5    . DG  H  3 1  ? -42.926 -1.526 13.658  1.00 41.30 ? 1   DG  H C5    1 
ATOM   2815 C C6    . DG  H  3 1  ? -43.867 -2.099 12.763  1.00 39.61 ? 1   DG  H C6    1 
ATOM   2816 O O6    . DG  H  3 1  ? -44.919 -2.681 13.026  1.00 38.81 ? 1   DG  H O6    1 
ATOM   2817 N N1    . DG  H  3 1  ? -43.486 -1.921 11.436  1.00 38.45 ? 1   DG  H N1    1 
ATOM   2818 C C2    . DG  H  3 1  ? -42.349 -1.267 11.021  1.00 38.61 ? 1   DG  H C2    1 
ATOM   2819 N N2    . DG  H  3 1  ? -42.145 -1.203 9.695   1.00 38.26 ? 1   DG  H N2    1 
ATOM   2820 N N3    . DG  H  3 1  ? -41.467 -0.730 11.844  1.00 40.00 ? 1   DG  H N3    1 
ATOM   2821 C C4    . DG  H  3 1  ? -41.814 -0.899 13.139  1.00 41.85 ? 1   DG  H C4    1 
ATOM   2822 P P     . DC  H  3 2  ? -37.377 3.552  14.167  1.00 59.05 ? 2   DC  H P     1 
ATOM   2823 O OP1   . DC  H  3 2  ? -35.931 3.924  14.062  1.00 60.51 ? 2   DC  H OP1   1 
ATOM   2824 O OP2   . DC  H  3 2  ? -38.273 4.218  15.149  1.00 59.54 ? 2   DC  H OP2   1 
ATOM   2825 O "O5'" . DC  H  3 2  ? -38.040 3.744  12.737  1.00 53.91 ? 2   DC  H "O5'" 1 
ATOM   2826 C "C5'" . DC  H  3 2  ? -37.452 3.058  11.616  1.00 55.77 ? 2   DC  H "C5'" 1 
ATOM   2827 C "C4'" . DC  H  3 2  ? -38.382 3.112  10.432  1.00 52.89 ? 2   DC  H "C4'" 1 
ATOM   2828 O "O4'" . DC  H  3 2  ? -39.607 2.398  10.728  1.00 49.77 ? 2   DC  H "O4'" 1 
ATOM   2829 C "C3'" . DC  H  3 2  ? -38.790 4.534  10.047  1.00 51.73 ? 2   DC  H "C3'" 1 
ATOM   2830 O "O3'" . DC  H  3 2  ? -38.433 4.733  8.676   1.00 53.36 ? 2   DC  H "O3'" 1 
ATOM   2831 C "C2'" . DC  H  3 2  ? -40.281 4.593  10.366  1.00 48.68 ? 2   DC  H "C2'" 1 
ATOM   2832 C "C1'" . DC  H  3 2  ? -40.708 3.141  10.260  1.00 46.70 ? 2   DC  H "C1'" 1 
ATOM   2833 N N1    . DC  H  3 2  ? -41.887 2.721  11.045  1.00 42.63 ? 2   DC  H N1    1 
ATOM   2834 C C2    . DC  H  3 2  ? -42.955 2.102  10.385  1.00 38.35 ? 2   DC  H C2    1 
ATOM   2835 O O2    . DC  H  3 2  ? -42.907 1.975  9.153   1.00 37.84 ? 2   DC  H O2    1 
ATOM   2836 N N3    . DC  H  3 2  ? -44.001 1.648  11.105  1.00 37.52 ? 2   DC  H N3    1 
ATOM   2837 C C4    . DC  H  3 2  ? -44.006 1.779  12.433  1.00 39.97 ? 2   DC  H C4    1 
ATOM   2838 N N4    . DC  H  3 2  ? -45.068 1.328  13.100  1.00 41.19 ? 2   DC  H N4    1 
ATOM   2839 C C5    . DC  H  3 2  ? -42.931 2.401  13.134  1.00 41.09 ? 2   DC  H C5    1 
ATOM   2840 C C6    . DC  H  3 2  ? -41.893 2.838  12.408  1.00 42.60 ? 2   DC  H C6    1 
ATOM   2841 P P     . DC  H  3 3  ? -38.567 6.186  8.008   1.00 55.79 ? 3   DC  H P     1 
ATOM   2842 O OP1   . DC  H  3 3  ? -37.292 6.472  7.291   1.00 55.51 ? 3   DC  H OP1   1 
ATOM   2843 O OP2   . DC  H  3 3  ? -39.111 7.140  9.027   1.00 51.17 ? 3   DC  H OP2   1 
ATOM   2844 O "O5'" . DC  H  3 3  ? -39.754 5.976  6.980   1.00 49.33 ? 3   DC  H "O5'" 1 
ATOM   2845 C "C5'" . DC  H  3 3  ? -39.872 4.763  6.226   1.00 47.96 ? 3   DC  H "C5'" 1 
ATOM   2846 C "C4'" . DC  H  3 3  ? -41.257 4.698  5.633   1.00 44.89 ? 3   DC  H "C4'" 1 
ATOM   2847 O "O4'" . DC  H  3 3  ? -42.214 4.276  6.629   1.00 40.88 ? 3   DC  H "O4'" 1 
ATOM   2848 C "C3'" . DC  H  3 3  ? -41.762 6.034  5.086   1.00 44.51 ? 3   DC  H "C3'" 1 
ATOM   2849 O "O3'" . DC  H  3 3  ? -42.094 5.748  3.738   1.00 48.50 ? 3   DC  H "O3'" 1 
ATOM   2850 C "C2'" . DC  H  3 3  ? -42.905 6.423  6.018   1.00 40.19 ? 3   DC  H "C2'" 1 
ATOM   2851 C "C1'" . DC  H  3 3  ? -43.364 5.099  6.589   1.00 39.15 ? 3   DC  H "C1'" 1 
ATOM   2852 N N1    . DC  H  3 3  ? -43.915 5.149  7.957   1.00 36.94 ? 3   DC  H N1    1 
ATOM   2853 C C2    . DC  H  3 3  ? -45.168 4.583  8.210   1.00 35.56 ? 3   DC  H C2    1 
ATOM   2854 O O2    . DC  H  3 3  ? -45.820 4.122  7.266   1.00 35.80 ? 3   DC  H O2    1 
ATOM   2855 N N3    . DC  H  3 3  ? -45.653 4.588  9.474   1.00 35.03 ? 3   DC  H N3    1 
ATOM   2856 C C4    . DC  H  3 3  ? -44.932 5.118  10.460  1.00 35.39 ? 3   DC  H C4    1 
ATOM   2857 N N4    . DC  H  3 3  ? -45.456 5.117  11.683  1.00 36.77 ? 3   DC  H N4    1 
ATOM   2858 C C5    . DC  H  3 3  ? -43.649 5.694  10.232  1.00 37.18 ? 3   DC  H C5    1 
ATOM   2859 C C6    . DC  H  3 3  ? -43.177 5.673  8.979   1.00 37.08 ? 3   DC  H C6    1 
ATOM   2860 P P     . DT  H  3 4  ? -42.741 6.829  2.823   1.00 51.10 ? 4   DT  H P     1 
ATOM   2861 O OP1   . DT  H  3 4  ? -42.174 6.623  1.461   1.00 53.13 ? 4   DT  H OP1   1 
ATOM   2862 O OP2   . DT  H  3 4  ? -42.644 8.167  3.497   1.00 45.97 ? 4   DT  H OP2   1 
ATOM   2863 O "O5'" . DT  H  3 4  ? -44.257 6.354  2.800   1.00 46.26 ? 4   DT  H "O5'" 1 
ATOM   2864 C "C5'" . DT  H  3 4  ? -44.554 4.986  2.496   1.00 43.95 ? 4   DT  H "C5'" 1 
ATOM   2865 C "C4'" . DT  H  3 4  ? -46.048 4.775  2.503   1.00 41.66 ? 4   DT  H "C4'" 1 
ATOM   2866 O "O4'" . DT  H  3 4  ? -46.541 4.902  3.857   1.00 37.59 ? 4   DT  H "O4'" 1 
ATOM   2867 C "C3'" . DT  H  3 4  ? -46.861 5.758  1.650   1.00 40.79 ? 4   DT  H "C3'" 1 
ATOM   2868 O "O3'" . DT  H  3 4  ? -47.769 4.924  0.902   1.00 42.54 ? 4   DT  H "O3'" 1 
ATOM   2869 C "C2'" . DT  H  3 4  ? -47.438 6.732  2.675   1.00 38.03 ? 4   DT  H "C2'" 1 
ATOM   2870 C "C1'" . DT  H  3 4  ? -47.564 5.876  3.941   1.00 36.36 ? 4   DT  H "C1'" 1 
ATOM   2871 N N1    . DT  H  3 4  ? -47.423 6.522  5.274   1.00 32.91 ? 4   DT  H N1    1 
ATOM   2872 C C2    . DT  H  3 4  ? -48.262 6.091  6.280   1.00 30.23 ? 4   DT  H C2    1 
ATOM   2873 O O2    . DT  H  3 4  ? -49.176 5.315  6.097   1.00 30.59 ? 4   DT  H O2    1 
ATOM   2874 N N3    . DT  H  3 4  ? -48.013 6.639  7.505   1.00 29.46 ? 4   DT  H N3    1 
ATOM   2875 C C4    . DT  H  3 4  ? -47.013 7.532  7.833   1.00 30.31 ? 4   DT  H C4    1 
ATOM   2876 O O4    . DT  H  3 4  ? -46.918 7.937  8.985   1.00 31.97 ? 4   DT  H O4    1 
ATOM   2877 C C5    . DT  H  3 4  ? -46.154 7.927  6.740   1.00 31.53 ? 4   DT  H C5    1 
ATOM   2878 C C7    . DT  H  3 4  ? -45.040 8.893  7.003   1.00 32.15 ? 4   DT  H C7    1 
ATOM   2879 C C6    . DT  H  3 4  ? -46.378 7.383  5.536   1.00 32.47 ? 4   DT  H C6    1 
ATOM   2880 P P     . DA  H  3 5  ? -48.721 5.519  -0.245  1.00 44.13 ? 5   DA  H P     1 
ATOM   2881 O OP1   . DA  H  3 5  ? -49.209 4.386  -1.064  1.00 47.35 ? 5   DA  H OP1   1 
ATOM   2882 O OP2   . DA  H  3 5  ? -48.063 6.681  -0.888  1.00 46.39 ? 5   DA  H OP2   1 
ATOM   2883 O "O5'" . DA  H  3 5  ? -49.937 6.129  0.582   1.00 39.96 ? 5   DA  H "O5'" 1 
ATOM   2884 C "C5'" . DA  H  3 5  ? -50.874 5.276  1.240   1.00 37.53 ? 5   DA  H "C5'" 1 
ATOM   2885 C "C4'" . DA  H  3 5  ? -51.776 6.102  2.124   1.00 34.30 ? 5   DA  H "C4'" 1 
ATOM   2886 O "O4'" . DA  H  3 5  ? -51.019 6.612  3.237   1.00 31.90 ? 5   DA  H "O4'" 1 
ATOM   2887 C "C3'" . DA  H  3 5  ? -52.412 7.325  1.448   1.00 33.68 ? 5   DA  H "C3'" 1 
ATOM   2888 O "O3'" . DA  H  3 5  ? -53.757 6.966  1.123   1.00 34.66 ? 5   DA  H "O3'" 1 
ATOM   2889 C "C2'" . DA  H  3 5  ? -52.252 8.446  2.474   1.00 30.75 ? 5   DA  H "C2'" 1 
ATOM   2890 C "C1'" . DA  H  3 5  ? -51.664 7.767  3.712   1.00 29.69 ? 5   DA  H "C1'" 1 
ATOM   2891 N N9    . DA  H  3 5  ? -50.680 8.566  4.447   1.00 27.91 ? 5   DA  H N9    1 
ATOM   2892 C C8    . DA  H  3 5  ? -49.628 9.274  3.925   1.00 28.34 ? 5   DA  H C8    1 
ATOM   2893 N N7    . DA  H  3 5  ? -48.909 9.896  4.825   1.00 26.74 ? 5   DA  H N7    1 
ATOM   2894 C C5    . DA  H  3 5  ? -49.519 9.564  6.025   1.00 27.03 ? 5   DA  H C5    1 
ATOM   2895 C C6    . DA  H  3 5  ? -49.251 9.934  7.359   1.00 26.23 ? 5   DA  H C6    1 
ATOM   2896 N N6    . DA  H  3 5  ? -48.247 10.737 7.719   1.00 25.50 ? 5   DA  H N6    1 
ATOM   2897 N N1    . DA  H  3 5  ? -50.062 9.445  8.318   1.00 25.55 ? 5   DA  H N1    1 
ATOM   2898 C C2    . DA  H  3 5  ? -51.085 8.653  7.955   1.00 26.50 ? 5   DA  H C2    1 
ATOM   2899 N N3    . DA  H  3 5  ? -51.449 8.254  6.739   1.00 27.07 ? 5   DA  H N3    1 
ATOM   2900 C C4    . DA  H  3 5  ? -50.615 8.749  5.807   1.00 27.21 ? 5   DA  H C4    1 
HETATM 2901 N N1    . 5CM H  3 6  ? -53.723 10.964 5.341   1.00 26.39 ? 6   5CM H N1    1 
HETATM 2902 C C2    . 5CM H  3 6  ? -53.192 11.149 6.645   1.00 24.32 ? 6   5CM H C2    1 
HETATM 2903 N N3    . 5CM H  3 6  ? -52.045 11.811 6.855   1.00 24.29 ? 6   5CM H N3    1 
HETATM 2904 C C4    . 5CM H  3 6  ? -51.339 12.302 5.833   1.00 24.84 ? 6   5CM H C4    1 
HETATM 2905 C C5    . 5CM H  3 6  ? -51.874 12.089 4.425   1.00 25.82 ? 6   5CM H C5    1 
HETATM 2906 C C5A   . 5CM H  3 6  ? -51.159 12.603 3.212   1.00 27.75 ? 6   5CM H C5A   1 
HETATM 2907 C C6    . 5CM H  3 6  ? -53.069 11.423 4.262   1.00 25.63 ? 6   5CM H C6    1 
HETATM 2908 O O2    . 5CM H  3 6  ? -53.808 10.716 7.637   1.00 25.16 ? 6   5CM H O2    1 
HETATM 2909 N N4    . 5CM H  3 6  ? -50.193 12.944 6.104   1.00 24.51 ? 6   5CM H N4    1 
HETATM 2910 C "C1'" . 5CM H  3 6  ? -54.987 10.244 5.229   1.00 28.73 ? 6   5CM H "C1'" 1 
HETATM 2911 C "C2'" . 5CM H  3 6  ? -56.082 10.938 4.445   1.00 30.54 ? 6   5CM H "C2'" 1 
HETATM 2912 C "C3'" . 5CM H  3 6  ? -56.971 9.763  4.157   1.00 33.38 ? 6   5CM H "C3'" 1 
HETATM 2913 C "C4'" . 5CM H  3 6  ? -56.068 8.540  4.153   1.00 32.49 ? 6   5CM H "C4'" 1 
HETATM 2914 O "O4'" . 5CM H  3 6  ? -54.780 8.986  4.580   1.00 30.52 ? 6   5CM H "O4'" 1 
HETATM 2915 O "O3'" . 5CM H  3 6  ? -57.792 9.457  5.251   1.00 34.68 ? 6   5CM H "O3'" 1 
HETATM 2916 C "C5'" . 5CM H  3 6  ? -56.044 7.839  2.828   1.00 34.88 ? 6   5CM H "C5'" 1 
HETATM 2917 O "O5'" . 5CM H  3 6  ? -55.449 8.689  1.895   1.00 34.44 ? 6   5CM H "O5'" 1 
HETATM 2918 P P     . 5CM H  3 6  ? -54.844 8.057  0.569   1.00 35.65 ? 6   5CM H P     1 
HETATM 2919 O OP1   . 5CM H  3 6  ? -55.967 7.308  -0.087  1.00 38.79 ? 6   5CM H OP1   1 
HETATM 2920 O OP2   . 5CM H  3 6  ? -54.108 9.147  -0.177  1.00 36.01 ? 6   5CM H OP2   1 
ATOM   2921 P P     . DA  H  3 7  ? -59.180 10.162 5.477   1.00 35.48 ? 7   DA  H P     1 
ATOM   2922 O OP1   . DA  H  3 7  ? -60.203 9.139  5.383   1.00 38.57 ? 7   DA  H OP1   1 
ATOM   2923 O OP2   . DA  H  3 7  ? -59.266 11.360 4.639   1.00 35.39 ? 7   DA  H OP2   1 
ATOM   2924 O "O5'" . DA  H  3 7  ? -59.061 10.572 7.012   1.00 34.23 ? 7   DA  H "O5'" 1 
ATOM   2925 C "C5'" . DA  H  3 7  ? -58.530 9.636  7.984   1.00 32.75 ? 7   DA  H "C5'" 1 
ATOM   2926 C "C4'" . DA  H  3 7  ? -58.375 10.292 9.336   1.00 31.43 ? 7   DA  H "C4'" 1 
ATOM   2927 O "O4'" . DA  H  3 7  ? -57.132 11.037 9.415   1.00 29.87 ? 7   DA  H "O4'" 1 
ATOM   2928 C "C3'" . DA  H  3 7  ? -59.475 11.282 9.700   1.00 30.51 ? 7   DA  H "C3'" 1 
ATOM   2929 O "O3'" . DA  H  3 7  ? -59.661 11.164 11.112  1.00 33.34 ? 7   DA  H "O3'" 1 
ATOM   2930 C "C2'" . DA  H  3 7  ? -58.895 12.629 9.294   1.00 27.64 ? 7   DA  H "C2'" 1 
ATOM   2931 C "C1'" . DA  H  3 7  ? -57.403 12.449 9.582   1.00 26.55 ? 7   DA  H "C1'" 1 
ATOM   2932 N N9    . DA  H  3 7  ? -56.477 13.165 8.705   1.00 24.33 ? 7   DA  H N9    1 
ATOM   2933 C C8    . DA  H  3 7  ? -56.468 13.124 7.334   1.00 23.60 ? 7   DA  H C8    1 
ATOM   2934 N N7    . DA  H  3 7  ? -55.471 13.777 6.793   1.00 23.37 ? 7   DA  H N7    1 
ATOM   2935 C C5    . DA  H  3 7  ? -54.762 14.264 7.881   1.00 22.57 ? 7   DA  H C5    1 
ATOM   2936 C C6    . DA  H  3 7  ? -53.586 15.031 7.980   1.00 22.73 ? 7   DA  H C6    1 
ATOM   2937 N N6    . DA  H  3 7  ? -52.899 15.469 6.929   1.00 23.77 ? 7   DA  H N6    1 
ATOM   2938 N N1    . DA  H  3 7  ? -53.153 15.361 9.217   1.00 21.89 ? 7   DA  H N1    1 
ATOM   2939 C C2    . DA  H  3 7  ? -53.858 14.940 10.272  1.00 20.90 ? 7   DA  H C2    1 
ATOM   2940 N N3    . DA  H  3 7  ? -54.957 14.189 10.307  1.00 21.10 ? 7   DA  H N3    1 
ATOM   2941 C C4    . DA  H  3 7  ? -55.361 13.881 9.066   1.00 21.90 ? 7   DA  H C4    1 
ATOM   2942 P P     . DT  H  3 8  ? -60.891 11.907 11.816  1.00 31.85 ? 8   DT  H P     1 
ATOM   2943 O OP1   . DT  H  3 8  ? -61.347 11.051 12.906  1.00 35.60 ? 8   DT  H OP1   1 
ATOM   2944 O OP2   . DT  H  3 8  ? -61.832 12.346 10.762  1.00 32.99 ? 8   DT  H OP2   1 
ATOM   2945 O "O5'" . DT  H  3 8  ? -60.224 13.246 12.383  1.00 28.56 ? 8   DT  H "O5'" 1 
ATOM   2946 C "C5'" . DT  H  3 8  ? -59.130 13.222 13.302  1.00 26.39 ? 8   DT  H "C5'" 1 
ATOM   2947 C "C4'" . DT  H  3 8  ? -58.534 14.603 13.476  1.00 25.06 ? 8   DT  H "C4'" 1 
ATOM   2948 O "O4'" . DT  H  3 8  ? -57.774 14.966 12.312  1.00 24.41 ? 8   DT  H "O4'" 1 
ATOM   2949 C "C3'" . DT  H  3 8  ? -59.528 15.753 13.690  1.00 24.30 ? 8   DT  H "C3'" 1 
ATOM   2950 O "O3'" . DT  H  3 8  ? -59.573 15.982 15.105  1.00 25.28 ? 8   DT  H "O3'" 1 
ATOM   2951 C "C2'" . DT  H  3 8  ? -59.004 16.878 12.808  1.00 21.91 ? 8   DT  H "C2'" 1 
ATOM   2952 C "C1'" . DT  H  3 8  ? -57.672 16.362 12.282  1.00 22.41 ? 8   DT  H "C1'" 1 
ATOM   2953 N N1    . DT  H  3 8  ? -57.271 16.744 10.907  1.00 21.67 ? 8   DT  H N1    1 
ATOM   2954 C C2    . DT  H  3 8  ? -56.049 17.370 10.755  1.00 21.85 ? 8   DT  H C2    1 
ATOM   2955 O O2    . DT  H  3 8  ? -55.354 17.719 11.698  1.00 22.02 ? 8   DT  H O2    1 
ATOM   2956 N N3    . DT  H  3 8  ? -55.691 17.620 9.450   1.00 21.17 ? 8   DT  H N3    1 
ATOM   2957 C C4    . DT  H  3 8  ? -56.388 17.272 8.311   1.00 20.44 ? 8   DT  H C4    1 
ATOM   2958 O O4    . DT  H  3 8  ? -55.940 17.571 7.213   1.00 21.09 ? 8   DT  H O4    1 
ATOM   2959 C C5    . DT  H  3 8  ? -57.637 16.573 8.536   1.00 20.80 ? 8   DT  H C5    1 
ATOM   2960 C C7    . DT  H  3 8  ? -58.480 16.192 7.355   1.00 21.53 ? 8   DT  H C7    1 
ATOM   2961 C C6    . DT  H  3 8  ? -58.018 16.356 9.808   1.00 20.93 ? 8   DT  H C6    1 
ATOM   2962 P P     . DT  H  3 9  ? -60.040 17.402 15.719  1.00 25.90 ? 9   DT  H P     1 
ATOM   2963 O OP1   . DT  H  3 9  ? -60.495 17.150 17.098  1.00 25.44 ? 9   DT  H OP1   1 
ATOM   2964 O OP2   . DT  H  3 9  ? -60.953 18.096 14.729  1.00 24.92 ? 9   DT  H OP2   1 
ATOM   2965 O "O5'" . DT  H  3 9  ? -58.699 18.254 15.741  1.00 25.53 ? 9   DT  H "O5'" 1 
ATOM   2966 C "C5'" . DT  H  3 9  ? -57.453 17.693 16.227  1.00 26.66 ? 9   DT  H "C5'" 1 
ATOM   2967 C "C4'" . DT  H  3 9  ? -56.324 18.707 16.143  1.00 27.14 ? 9   DT  H "C4'" 1 
ATOM   2968 O "O4'" . DT  H  3 9  ? -56.003 19.064 14.771  1.00 24.53 ? 9   DT  H "O4'" 1 
ATOM   2969 C "C3'" . DT  H  3 9  ? -56.539 20.038 16.874  1.00 27.83 ? 9   DT  H "C3'" 1 
ATOM   2970 O "O3'" . DT  H  3 9  ? -55.262 20.305 17.468  1.00 28.85 ? 9   DT  H "O3'" 1 
ATOM   2971 C "C2'" . DT  H  3 9  ? -56.937 21.001 15.752  1.00 26.03 ? 9   DT  H "C2'" 1 
ATOM   2972 C "C1'" . DT  H  3 9  ? -56.141 20.485 14.555  1.00 25.01 ? 9   DT  H "C1'" 1 
ATOM   2973 N N1    . DT  H  3 9  ? -56.652 20.661 13.156  1.00 23.40 ? 9   DT  H N1    1 
ATOM   2974 C C2    . DT  H  3 9  ? -55.743 21.005 12.167  1.00 23.92 ? 9   DT  H C2    1 
ATOM   2975 O O2    . DT  H  3 9  ? -54.596 21.357 12.396  1.00 24.83 ? 9   DT  H O2    1 
ATOM   2976 N N3    . DT  H  3 9  ? -56.243 20.963 10.895  1.00 23.24 ? 9   DT  H N3    1 
ATOM   2977 C C4    . DT  H  3 9  ? -57.513 20.590 10.504  1.00 23.77 ? 9   DT  H C4    1 
ATOM   2978 O O4    . DT  H  3 9  ? -57.811 20.593 9.304   1.00 26.87 ? 9   DT  H O4    1 
ATOM   2979 C C5    . DT  H  3 9  ? -58.410 20.235 11.580  1.00 24.15 ? 9   DT  H C5    1 
ATOM   2980 C C7    . DT  H  3 9  ? -59.818 19.843 11.251  1.00 23.90 ? 9   DT  H C7    1 
ATOM   2981 C C6    . DT  H  3 9  ? -57.926 20.245 12.835  1.00 23.48 ? 9   DT  H C6    1 
ATOM   2982 P P     . DC  H  3 10 ? -55.062 21.353 18.672  1.00 33.37 ? 10  DC  H P     1 
ATOM   2983 O OP1   . DC  H  3 10 ? -53.853 20.965 19.369  1.00 31.94 ? 10  DC  H OP1   1 
ATOM   2984 O OP2   . DC  H  3 10 ? -56.348 21.517 19.427  1.00 32.36 ? 10  DC  H OP2   1 
ATOM   2985 O "O5'" . DC  H  3 10 ? -54.803 22.698 17.890  1.00 30.31 ? 10  DC  H "O5'" 1 
ATOM   2986 C "C5'" . DC  H  3 10 ? -53.699 22.793 16.991  1.00 30.73 ? 10  DC  H "C5'" 1 
ATOM   2987 C "C4'" . DC  H  3 10 ? -53.722 24.126 16.283  1.00 30.90 ? 10  DC  H "C4'" 1 
ATOM   2988 O "O4'" . DC  H  3 10 ? -54.556 24.042 15.099  1.00 27.26 ? 10  DC  H "O4'" 1 
ATOM   2989 C "C3'" . DC  H  3 10 ? -54.257 25.302 17.102  1.00 32.58 ? 10  DC  H "C3'" 1 
ATOM   2990 O "O3'" . DC  H  3 10 ? -53.410 26.429 16.889  1.00 37.76 ? 10  DC  H "O3'" 1 
ATOM   2991 C "C2'" . DC  H  3 10 ? -55.642 25.530 16.526  1.00 30.68 ? 10  DC  H "C2'" 1 
ATOM   2992 C "C1'" . DC  H  3 10 ? -55.439 25.153 15.069  1.00 27.11 ? 10  DC  H "C1'" 1 
ATOM   2993 N N1    . DC  H  3 10 ? -56.619 24.751 14.274  1.00 24.30 ? 10  DC  H N1    1 
ATOM   2994 C C2    . DC  H  3 10 ? -56.528 24.805 12.870  1.00 22.62 ? 10  DC  H C2    1 
ATOM   2995 O O2    . DC  H  3 10 ? -55.515 25.295 12.353  1.00 22.78 ? 10  DC  H O2    1 
ATOM   2996 N N3    . DC  H  3 10 ? -57.583 24.409 12.123  1.00 20.91 ? 10  DC  H N3    1 
ATOM   2997 C C4    . DC  H  3 10 ? -58.661 23.896 12.718  1.00 21.22 ? 10  DC  H C4    1 
ATOM   2998 N N4    . DC  H  3 10 ? -59.665 23.492 11.945  1.00 21.07 ? 10  DC  H N4    1 
ATOM   2999 C C5    . DC  H  3 10 ? -58.763 23.787 14.142  1.00 21.72 ? 10  DC  H C5    1 
ATOM   3000 C C6    . DC  H  3 10 ? -57.733 24.227 14.871  1.00 22.70 ? 10  DC  H C6    1 
ATOM   3001 P P     . DC  H  3 11 ? -53.249 27.569 17.997  1.00 41.39 ? 11  DC  H P     1 
ATOM   3002 O OP1   . DC  H  3 11 ? -51.904 27.452 18.562  1.00 44.53 ? 11  DC  H OP1   1 
ATOM   3003 O OP2   . DC  H  3 11 ? -54.441 27.589 18.848  1.00 41.72 ? 11  DC  H OP2   1 
ATOM   3004 O "O5'" . DC  H  3 11 ? -53.320 28.908 17.148  1.00 44.29 ? 11  DC  H "O5'" 1 
ATOM   3005 C "C5'" . DC  H  3 11 ? -52.369 29.115 16.099  1.00 46.28 ? 11  DC  H "C5'" 1 
ATOM   3006 C "C4'" . DC  H  3 11 ? -53.061 29.587 14.845  1.00 43.28 ? 11  DC  H "C4'" 1 
ATOM   3007 O "O4'" . DC  H  3 11 ? -54.219 28.781 14.515  1.00 40.35 ? 11  DC  H "O4'" 1 
ATOM   3008 C "C3'" . DC  H  3 11 ? -53.555 31.027 14.919  1.00 44.63 ? 11  DC  H "C3'" 1 
ATOM   3009 O "O3'" . DC  H  3 11 ? -52.696 31.739 14.017  1.00 47.69 ? 11  DC  H "O3'" 1 
ATOM   3010 C "C2'" . DC  H  3 11 ? -55.023 30.938 14.512  1.00 40.95 ? 11  DC  H "C2'" 1 
ATOM   3011 C "C1'" . DC  H  3 11 ? -55.087 29.606 13.790  1.00 36.79 ? 11  DC  H "C1'" 1 
ATOM   3012 N N1    . DC  H  3 11 ? -56.399 28.920 13.698  1.00 31.70 ? 11  DC  H N1    1 
ATOM   3013 C C2    . DC  H  3 11 ? -56.905 28.598 12.428  1.00 28.43 ? 11  DC  H C2    1 
ATOM   3014 O O2    . DC  H  3 11 ? -56.268 28.928 11.436  1.00 27.83 ? 11  DC  H O2    1 
ATOM   3015 N N3    . DC  H  3 11 ? -58.086 27.942 12.327  1.00 27.46 ? 11  DC  H N3    1 
ATOM   3016 C C4    . DC  H  3 11 ? -58.752 27.597 13.429  1.00 27.85 ? 11  DC  H C4    1 
ATOM   3017 N N4    . DC  H  3 11 ? -59.905 26.941 13.281  1.00 26.92 ? 11  DC  H N4    1 
ATOM   3018 C C5    . DC  H  3 11 ? -58.264 27.913 14.739  1.00 29.46 ? 11  DC  H C5    1 
ATOM   3019 C C6    . DC  H  3 11 ? -57.090 28.564 14.824  1.00 30.94 ? 11  DC  H C6    1 
ATOM   3020 P P     . DG  H  3 12 ? -52.555 33.306 14.077  1.00 48.11 ? 12  DG  H P     1 
ATOM   3021 O OP1   . DG  H  3 12 ? -51.131 33.613 13.895  1.00 54.87 ? 12  DG  H OP1   1 
ATOM   3022 O OP2   . DG  H  3 12 ? -53.270 33.811 15.276  1.00 49.51 ? 12  DG  H OP2   1 
ATOM   3023 O "O5'" . DG  H  3 12 ? -53.372 33.786 12.791  1.00 47.25 ? 12  DG  H "O5'" 1 
ATOM   3024 C "C5'" . DG  H  3 12 ? -53.014 33.349 11.452  1.00 44.70 ? 12  DG  H "C5'" 1 
ATOM   3025 C "C4'" . DG  H  3 12 ? -54.089 33.711 10.450  1.00 43.32 ? 12  DG  H "C4'" 1 
ATOM   3026 O "O4'" . DG  H  3 12 ? -55.066 32.651 10.413  1.00 40.25 ? 12  DG  H "O4'" 1 
ATOM   3027 C "C3'" . DG  H  3 12 ? -54.884 34.973 10.761  1.00 44.12 ? 12  DG  H "C3'" 1 
ATOM   3028 O "O3'" . DG  H  3 12 ? -54.304 36.122 10.141  1.00 49.27 ? 12  DG  H "O3'" 1 
ATOM   3029 C "C2'" . DG  H  3 12 ? -56.274 34.677 10.215  1.00 40.96 ? 12  DG  H "C2'" 1 
ATOM   3030 C "C1'" . DG  H  3 12 ? -56.329 33.167 10.045  1.00 37.39 ? 12  DG  H "C1'" 1 
ATOM   3031 N N9    . DG  H  3 12 ? -57.333 32.482 10.850  1.00 33.37 ? 12  DG  H N9    1 
ATOM   3032 C C8    . DG  H  3 12 ? -57.421 32.427 12.220  1.00 32.38 ? 12  DG  H C8    1 
ATOM   3033 N N7    . DG  H  3 12 ? -58.422 31.703 12.639  1.00 29.62 ? 12  DG  H N7    1 
ATOM   3034 C C5    . DG  H  3 12 ? -59.025 31.250 11.476  1.00 28.51 ? 12  DG  H C5    1 
ATOM   3035 C C6    . DG  H  3 12 ? -60.161 30.427 11.293  1.00 26.87 ? 12  DG  H C6    1 
ATOM   3036 O O6    . DG  H  3 12 ? -60.894 29.925 12.151  1.00 26.11 ? 12  DG  H O6    1 
ATOM   3037 N N1    . DG  H  3 12 ? -60.438 30.230 9.943   1.00 27.31 ? 12  DG  H N1    1 
ATOM   3038 C C2    . DG  H  3 12 ? -59.703 30.748 8.902   1.00 29.06 ? 12  DG  H C2    1 
ATOM   3039 N N2    . DG  H  3 12 ? -60.117 30.438 7.661   1.00 29.70 ? 12  DG  H N2    1 
ATOM   3040 N N3    . DG  H  3 12 ? -58.648 31.524 9.063   1.00 30.20 ? 12  DG  H N3    1 
ATOM   3041 C C4    . DG  H  3 12 ? -58.363 31.725 10.364  1.00 29.56 ? 12  DG  H C4    1 
HETATM 3042 X UNK   . UNX I  4 .  ? -36.534 9.950  -16.697 1.00 26.35 ? 301 UNX A UNK   1 
HETATM 3043 X UNK   . UNX J  4 .  ? -26.511 13.978 -44.013 1.00 33.70 ? 302 UNX A UNK   1 
HETATM 3044 X UNK   . UNX K  4 .  ? -40.651 18.004 -26.908 1.00 41.34 ? 303 UNX A UNK   1 
HETATM 3045 X UNK   . UNX L  4 .  ? -20.649 20.632 -35.913 1.00 33.73 ? 304 UNX A UNK   1 
HETATM 3046 X UNK   . UNX M  4 .  ? -15.229 22.425 -25.298 1.00 36.04 ? 305 UNX A UNK   1 
HETATM 3047 X UNK   . UNX N  4 .  ? -20.218 17.953 -36.874 1.00 42.91 ? 306 UNX A UNK   1 
HETATM 3048 X UNK   . UNX O  4 .  ? -38.205 12.001 -26.198 1.00 35.57 ? 307 UNX A UNK   1 
HETATM 3049 X UNK   . UNX P  4 .  ? -24.500 12.726 -14.709 1.00 23.29 ? 308 UNX A UNK   1 
HETATM 3050 X UNK   . UNX Q  4 .  ? -20.430 8.864  -28.288 1.00 38.15 ? 309 UNX A UNK   1 
HETATM 3051 X UNK   . UNX R  4 .  ? -17.904 10.164 -29.344 1.00 40.03 ? 310 UNX A UNK   1 
HETATM 3052 X UNK   . UNX S  4 .  ? -26.835 17.670 -32.791 1.00 20.56 ? 311 UNX A UNK   1 
HETATM 3053 X UNK   . UNX T  4 .  ? -38.830 18.103 -23.865 1.00 26.23 ? 312 UNX A UNK   1 
HETATM 3054 X UNK   . UNX U  4 .  ? -52.363 15.971 -40.645 1.00 34.36 ? 301 UNX B UNK   1 
HETATM 3055 X UNK   . UNX V  4 .  ? -52.955 6.707  -30.600 1.00 35.04 ? 302 UNX B UNK   1 
HETATM 3056 X UNK   . UNX W  4 .  ? -54.749 8.976  -32.334 1.00 41.46 ? 303 UNX B UNK   1 
HETATM 3057 X UNK   . UNX X  4 .  ? -51.168 11.526 -31.529 1.00 37.16 ? 304 UNX B UNK   1 
HETATM 3058 X UNK   . UNX Y  4 .  ? -43.938 -3.127 -64.639 1.00 47.80 ? 305 UNX B UNK   1 
HETATM 3059 X UNK   . UNX Z  4 .  ? -55.848 4.946  -43.003 1.00 20.43 ? 306 UNX B UNK   1 
HETATM 3060 X UNK   . UNX AA 4 .  ? -57.820 7.038  -35.399 1.00 20.83 ? 307 UNX B UNK   1 
HETATM 3061 X UNK   . UNX BA 4 .  ? -49.966 2.430  -45.035 1.00 36.33 ? 308 UNX B UNK   1 
HETATM 3062 X UNK   . UNX CA 4 .  ? -51.430 0.194  -46.070 1.00 38.71 ? 309 UNX B UNK   1 
HETATM 3063 X UNK   . UNX DA 4 .  ? -33.538 9.347  -43.742 1.00 16.20 ? 101 UNX C UNK   1 
HETATM 3064 X UNK   . UNX EA 4 .  ? -37.568 10.161 -34.969 1.00 20.98 ? 102 UNX C UNK   1 
HETATM 3065 X UNK   . UNX FA 4 .  ? -35.387 13.180 -44.297 1.00 13.89 ? 103 UNX C UNK   1 
HETATM 3066 X UNK   . UNX GA 4 .  ? -43.162 8.421  -38.376 1.00 13.47 ? 104 UNX C UNK   1 
HETATM 3067 X UNK   . UNX HA 4 .  ? -34.571 5.449  -43.310 1.00 27.26 ? 101 UNX D UNK   1 
HETATM 3068 X UNK   . UNX IA 4 .  ? -28.246 19.455 -34.190 1.00 24.01 ? 102 UNX D UNK   1 
HETATM 3069 X UNK   . UNX JA 4 .  ? -34.579 -7.083 -43.290 1.00 50.01 ? 103 UNX D UNK   1 
HETATM 3070 X UNK   . UNX KA 4 .  ? -43.334 15.940 -36.946 1.00 25.27 ? 104 UNX D UNK   1 
HETATM 3071 X UNK   . UNX LA 4 .  ? -54.935 20.336 -13.877 1.00 26.04 ? 301 UNX E UNK   1 
HETATM 3072 X UNK   . UNX MA 4 .  ? -53.846 18.504 -18.169 1.00 34.43 ? 302 UNX E UNK   1 
HETATM 3073 X UNK   . UNX NA 4 .  ? -45.059 12.020 10.509  1.00 29.23 ? 303 UNX E UNK   1 
HETATM 3074 X UNK   . UNX OA 4 .  ? -44.589 16.507 13.390  1.00 32.49 ? 304 UNX E UNK   1 
HETATM 3075 X UNK   . UNX PA 4 .  ? -39.421 23.414 4.673   1.00 22.22 ? 305 UNX E UNK   1 
HETATM 3076 X UNK   . UNX QA 4 .  ? -43.130 12.785 -18.392 1.00 39.61 ? 306 UNX E UNK   1 
HETATM 3077 X UNK   . UNX RA 4 .  ? -59.187 12.430 -3.609  1.00 35.64 ? 307 UNX E UNK   1 
HETATM 3078 X UNK   . UNX SA 4 .  ? -46.815 23.597 1.578   1.00 35.14 ? 308 UNX E UNK   1 
HETATM 3079 X UNK   . UNX TA 4 .  ? -38.858 21.840 17.534  1.00 31.53 ? 309 UNX E UNK   1 
HETATM 3080 X UNK   . UNX UA 4 .  ? -45.211 12.677 2.216   1.00 23.63 ? 310 UNX E UNK   1 
HETATM 3081 X UNK   . UNX VA 4 .  ? -63.625 14.298 14.980  1.00 33.34 ? 301 UNX F UNK   1 
HETATM 3082 X UNK   . UNX WA 4 .  ? -62.091 34.389 33.353  1.00 34.63 ? 302 UNX F UNK   1 
HETATM 3083 X UNK   . UNX XA 4 .  ? -74.102 25.512 12.142  1.00 25.84 ? 303 UNX F UNK   1 
HETATM 3084 X UNK   . UNX YA 4 .  ? -67.454 16.168 17.968  1.00 31.67 ? 304 UNX F UNK   1 
HETATM 3085 X UNK   . UNX ZA 4 .  ? -51.801 21.191 13.118  1.00 24.48 ? 101 UNX G UNK   1 
HETATM 3086 X UNK   . UNX AB 4 .  ? -61.739 22.672 4.839   1.00 21.80 ? 102 UNX G UNK   1 
HETATM 3087 X UNK   . UNX BB 4 .  ? -53.755 26.842 6.643   1.00 30.70 ? 103 UNX G UNK   1 
HETATM 3088 X UNK   . UNX CB 4 .  ? -55.769 20.184 4.248   1.00 19.70 ? 104 UNX G UNK   1 
HETATM 3089 X UNK   . UNX DB 4 .  ? -61.324 21.912 7.629   1.00 15.90 ? 105 UNX G UNK   1 
HETATM 3090 X UNK   . UNX EB 4 .  ? -53.523 17.219 13.719  1.00 19.37 ? 106 UNX G UNK   1 
HETATM 3091 X UNK   . UNX FB 4 .  ? -58.827 22.571 1.914   1.00 19.58 ? 107 UNX G UNK   1 
HETATM 3092 X UNK   . UNX GB 4 .  ? -54.418 14.885 4.206   1.00 18.38 ? 101 UNX H UNK   1 
HETATM 3093 X UNK   . UNX HB 4 .  ? -61.876 14.274 9.057   1.00 26.98 ? 102 UNX H UNK   1 
HETATM 3094 O O     . HOH IB 5 .  ? -28.287 9.903  -35.902 1.00 31.57 ? 401 HOH A O     1 
HETATM 3095 O O     . HOH IB 5 .  ? -38.221 9.406  -32.294 1.00 28.87 ? 402 HOH A O     1 
HETATM 3096 O O     . HOH IB 5 .  ? -30.974 12.359 -12.441 1.00 38.26 ? 403 HOH A O     1 
HETATM 3097 O O     . HOH IB 5 .  ? -29.404 16.314 -32.334 1.00 24.60 ? 404 HOH A O     1 
HETATM 3098 O O     . HOH IB 5 .  ? -19.636 6.576  -45.408 1.00 23.58 ? 405 HOH A O     1 
HETATM 3099 O O     . HOH IB 5 .  ? -24.775 9.887  -15.858 1.00 31.59 ? 406 HOH A O     1 
HETATM 3100 O O     . HOH IB 5 .  ? -33.981 23.410 -18.073 1.00 35.76 ? 407 HOH A O     1 
HETATM 3101 O O     . HOH IB 5 .  ? -25.881 11.213 -36.956 1.00 23.89 ? 408 HOH A O     1 
HETATM 3102 O O     . HOH IB 5 .  ? -27.841 18.096 -36.833 1.00 31.65 ? 409 HOH A O     1 
HETATM 3103 O O     . HOH IB 5 .  ? -18.098 14.994 -37.166 1.00 38.09 ? 410 HOH A O     1 
HETATM 3104 O O     . HOH IB 5 .  ? -30.165 15.800 -34.885 1.00 20.15 ? 411 HOH A O     1 
HETATM 3105 O O     . HOH IB 5 .  ? -20.192 16.953 -18.505 1.00 26.69 ? 412 HOH A O     1 
HETATM 3106 O O     . HOH IB 5 .  ? -24.110 17.637 -12.597 1.00 43.34 ? 413 HOH A O     1 
HETATM 3107 O O     . HOH IB 5 .  ? -36.130 8.188  -30.926 1.00 40.47 ? 414 HOH A O     1 
HETATM 3108 O O     . HOH IB 5 .  ? -25.343 17.858 -37.803 1.00 37.80 ? 415 HOH A O     1 
HETATM 3109 O O     . HOH IB 5 .  ? -29.929 20.116 -31.884 1.00 23.16 ? 416 HOH A O     1 
HETATM 3110 O O     . HOH IB 5 .  ? -25.558 24.435 -26.818 1.00 24.20 ? 417 HOH A O     1 
HETATM 3111 O O     . HOH IB 5 .  ? -19.790 13.095 -21.640 1.00 36.13 ? 418 HOH A O     1 
HETATM 3112 O O     . HOH IB 5 .  ? -20.586 10.835 -26.023 1.00 44.46 ? 419 HOH A O     1 
HETATM 3113 O O     . HOH IB 5 .  ? -36.544 16.743 -32.614 1.00 31.08 ? 420 HOH A O     1 
HETATM 3114 O O     . HOH JB 5 .  ? -50.121 5.050  -43.912 1.00 20.30 ? 401 HOH B O     1 
HETATM 3115 O O     . HOH JB 5 .  ? -43.820 4.431  -46.004 1.00 18.17 ? 402 HOH B O     1 
HETATM 3116 O O     . HOH JB 5 .  ? -43.818 5.396  -48.516 1.00 18.33 ? 403 HOH B O     1 
HETATM 3117 O O     . HOH JB 5 .  ? -46.225 16.735 -42.254 1.00 40.02 ? 404 HOH B O     1 
HETATM 3118 O O     . HOH JB 5 .  ? -48.944 14.259 -48.276 1.00 35.67 ? 405 HOH B O     1 
HETATM 3119 O O     . HOH JB 5 .  ? -45.255 10.026 -42.989 1.00 18.78 ? 406 HOH B O     1 
HETATM 3120 O O     . HOH JB 5 .  ? -35.153 7.096  -62.512 1.00 44.09 ? 407 HOH B O     1 
HETATM 3121 O O     . HOH JB 5 .  ? -47.426 12.833 -43.830 1.00 26.69 ? 408 HOH B O     1 
HETATM 3122 O O     . HOH JB 5 .  ? -43.870 8.058  -44.140 1.00 18.11 ? 409 HOH B O     1 
HETATM 3123 O O     . HOH JB 5 .  ? -44.425 7.857  -47.665 1.00 24.44 ? 410 HOH B O     1 
HETATM 3124 O O     . HOH JB 5 .  ? -40.098 -1.691 -49.536 1.00 45.20 ? 411 HOH B O     1 
HETATM 3125 O O     . HOH JB 5 .  ? -39.247 13.733 -52.961 1.00 32.68 ? 412 HOH B O     1 
HETATM 3126 O O     . HOH JB 5 .  ? -44.828 9.877  -40.121 1.00 17.79 ? 413 HOH B O     1 
HETATM 3127 O O     . HOH JB 5 .  ? -56.634 4.581  -47.473 1.00 35.20 ? 414 HOH B O     1 
HETATM 3128 O O     . HOH KB 5 .  ? -32.234 38.107 -32.894 1.00 33.29 ? 201 HOH C O     1 
HETATM 3129 O O     . HOH KB 5 .  ? -30.395 11.151 -49.123 1.00 38.31 ? 202 HOH C O     1 
HETATM 3130 O O     . HOH KB 5 .  ? -31.496 13.529 -35.472 1.00 22.00 ? 203 HOH C O     1 
HETATM 3131 O O     . HOH KB 5 .  ? -27.033 18.491 -41.368 1.00 38.90 ? 204 HOH C O     1 
HETATM 3132 O O     . HOH KB 5 .  ? -35.624 3.650  -37.324 1.00 32.94 ? 205 HOH C O     1 
HETATM 3133 O O     . HOH KB 5 .  ? -43.583 7.628  -35.545 1.00 22.41 ? 206 HOH C O     1 
HETATM 3134 O O     . HOH KB 5 .  ? -35.717 26.276 -38.981 1.00 35.37 ? 207 HOH C O     1 
HETATM 3135 O O     . HOH KB 5 .  ? -40.445 7.672  -32.545 1.00 26.98 ? 208 HOH C O     1 
HETATM 3136 O O     . HOH KB 5 .  ? -48.149 3.152  -31.763 1.00 32.39 ? 209 HOH C O     1 
HETATM 3137 O O     . HOH KB 5 .  ? -40.417 10.666 -35.690 1.00 28.43 ? 210 HOH C O     1 
HETATM 3138 O O     . HOH KB 5 .  ? -37.763 15.942 -47.887 1.00 33.22 ? 211 HOH C O     1 
HETATM 3139 O O     . HOH KB 5 .  ? -41.935 9.151  -33.978 1.00 25.89 ? 212 HOH C O     1 
HETATM 3140 O O     . HOH LB 5 .  ? -37.416 13.162 -35.252 1.00 27.71 ? 201 HOH D O     1 
HETATM 3141 O O     . HOH LB 5 .  ? -43.791 16.118 -39.808 1.00 25.92 ? 202 HOH D O     1 
HETATM 3142 O O     . HOH LB 5 .  ? -36.857 22.018 -38.923 1.00 33.93 ? 203 HOH D O     1 
HETATM 3143 O O     . HOH LB 5 .  ? -39.391 11.263 -50.795 1.00 29.28 ? 204 HOH D O     1 
HETATM 3144 O O     . HOH LB 5 .  ? -35.278 18.807 -31.446 1.00 31.56 ? 205 HOH D O     1 
HETATM 3145 O O     . HOH LB 5 .  ? -36.746 17.087 -43.459 1.00 24.74 ? 206 HOH D O     1 
HETATM 3146 O O     . HOH LB 5 .  ? -41.910 11.510 -49.637 1.00 29.46 ? 207 HOH D O     1 
HETATM 3147 O O     . HOH LB 5 .  ? -44.326 12.525 -43.163 1.00 19.79 ? 208 HOH D O     1 
HETATM 3148 O O     . HOH LB 5 .  ? -41.345 10.712 -38.173 1.00 21.56 ? 209 HOH D O     1 
HETATM 3149 O O     . HOH LB 5 .  ? -36.100 15.491 -35.048 1.00 20.53 ? 210 HOH D O     1 
HETATM 3150 O O     . HOH LB 5 .  ? -42.181 9.541  -45.586 1.00 16.41 ? 211 HOH D O     1 
HETATM 3151 O O     . HOH LB 5 .  ? -40.190 7.507  -48.671 1.00 20.13 ? 212 HOH D O     1 
HETATM 3152 O O     . HOH LB 5 .  ? -22.292 29.288 -38.648 1.00 42.33 ? 213 HOH D O     1 
HETATM 3153 O O     . HOH LB 5 .  ? -37.072 15.355 -45.465 1.00 27.74 ? 214 HOH D O     1 
HETATM 3154 O O     . HOH LB 5 .  ? -42.150 9.337  -48.191 1.00 25.68 ? 215 HOH D O     1 
HETATM 3155 O O     . HOH LB 5 .  ? -43.279 13.758 -41.017 1.00 25.25 ? 216 HOH D O     1 
HETATM 3156 O O     . HOH LB 5 .  ? -43.462 12.172 -38.977 1.00 16.27 ? 217 HOH D O     1 
HETATM 3157 O O     . HOH MB 5 .  ? -38.173 17.482 -9.144  1.00 35.96 ? 401 HOH E O     1 
HETATM 3158 O O     . HOH MB 5 .  ? -46.468 20.556 5.239   1.00 34.43 ? 402 HOH E O     1 
HETATM 3159 O O     . HOH MB 5 .  ? -49.563 16.893 4.792   1.00 22.63 ? 403 HOH E O     1 
HETATM 3160 O O     . HOH MB 5 .  ? -43.995 19.035 6.509   1.00 28.41 ? 404 HOH E O     1 
HETATM 3161 O O     . HOH MB 5 .  ? -47.711 14.224 1.578   1.00 23.30 ? 405 HOH E O     1 
HETATM 3162 O O     . HOH MB 5 .  ? -52.402 6.851  -12.384 1.00 33.60 ? 406 HOH E O     1 
HETATM 3163 O O     . HOH MB 5 .  ? -43.156 20.279 -14.780 1.00 26.76 ? 407 HOH E O     1 
HETATM 3164 O O     . HOH MB 5 .  ? -58.961 13.408 -12.740 1.00 33.23 ? 408 HOH E O     1 
HETATM 3165 O O     . HOH MB 5 .  ? -48.388 14.576 4.236   1.00 22.19 ? 409 HOH E O     1 
HETATM 3166 O O     . HOH MB 5 .  ? -42.797 17.474 -15.961 1.00 31.59 ? 410 HOH E O     1 
HETATM 3167 O O     . HOH MB 5 .  ? -52.184 13.451 -17.601 1.00 44.21 ? 411 HOH E O     1 
HETATM 3168 O O     . HOH MB 5 .  ? -40.532 24.187 7.323   1.00 40.34 ? 412 HOH E O     1 
HETATM 3169 O O     . HOH MB 5 .  ? -51.361 15.933 -16.272 1.00 30.31 ? 413 HOH E O     1 
HETATM 3170 O O     . HOH MB 5 .  ? -57.346 12.341 -6.511  1.00 33.94 ? 414 HOH E O     1 
HETATM 3171 O O     . HOH MB 5 .  ? -48.372 10.278 1.090   1.00 21.94 ? 415 HOH E O     1 
HETATM 3172 O O     . HOH MB 5 .  ? -55.519 21.899 -4.243  1.00 29.67 ? 416 HOH E O     1 
HETATM 3173 O O     . HOH MB 5 .  ? -37.851 24.163 14.562  1.00 23.16 ? 417 HOH E O     1 
HETATM 3174 O O     . HOH MB 5 .  ? -38.462 13.436 -12.281 1.00 32.64 ? 418 HOH E O     1 
HETATM 3175 O O     . HOH NB 5 .  ? -61.914 25.314 17.769  1.00 27.69 ? 401 HOH F O     1 
HETATM 3176 O O     . HOH NB 5 .  ? -68.089 28.046 14.058  1.00 35.29 ? 402 HOH F O     1 
HETATM 3177 O O     . HOH NB 5 .  ? -61.990 26.026 15.126  1.00 24.29 ? 403 HOH F O     1 
HETATM 3178 O O     . HOH NB 5 .  ? -68.324 25.653 12.947  1.00 22.51 ? 404 HOH F O     1 
HETATM 3179 O O     . HOH NB 5 .  ? -71.206 28.491 5.771   1.00 37.80 ? 405 HOH F O     1 
HETATM 3180 O O     . HOH NB 5 .  ? -63.498 20.343 12.151  1.00 23.96 ? 406 HOH F O     1 
HETATM 3181 O O     . HOH NB 5 .  ? -58.592 23.073 17.939  1.00 25.29 ? 407 HOH F O     1 
HETATM 3182 O O     . HOH NB 5 .  ? -73.070 22.720 21.503  1.00 38.46 ? 408 HOH F O     1 
HETATM 3183 O O     . HOH NB 5 .  ? -64.260 13.834 11.681  1.00 27.52 ? 409 HOH F O     1 
HETATM 3184 O O     . HOH NB 5 .  ? -62.590 22.687 16.760  1.00 24.72 ? 410 HOH F O     1 
HETATM 3185 O O     . HOH NB 5 .  ? -65.674 17.522 13.268  1.00 29.95 ? 411 HOH F O     1 
HETATM 3186 O O     . HOH NB 5 .  ? -62.911 20.573 9.377   1.00 20.99 ? 412 HOH F O     1 
HETATM 3187 O O     . HOH OB 5 .  ? -50.458 -7.809 2.200   1.00 26.94 ? 201 HOH G O     1 
HETATM 3188 O O     . HOH OB 5 .  ? -52.983 28.362 1.495   1.00 40.47 ? 202 HOH G O     1 
HETATM 3189 O O     . HOH OB 5 .  ? -70.438 27.037 8.488   1.00 32.23 ? 203 HOH G O     1 
HETATM 3190 O O     . HOH OB 5 .  ? -54.074 4.054  8.314   1.00 38.93 ? 204 HOH G O     1 
HETATM 3191 O O     . HOH OB 5 .  ? -69.099 27.267 10.822  1.00 33.91 ? 205 HOH G O     1 
HETATM 3192 O O     . HOH OB 5 .  ? -58.558 19.498 5.031   1.00 26.21 ? 206 HOH G O     1 
HETATM 3193 O O     . HOH PB 5 .  ? -59.503 19.695 7.472   1.00 25.70 ? 201 HOH H O     1 
HETATM 3194 O O     . HOH PB 5 .  ? -62.689 17.816 12.710  1.00 23.13 ? 202 HOH H O     1 
HETATM 3195 O O     . HOH PB 5 .  ? -53.484 11.587 0.776   1.00 35.36 ? 203 HOH H O     1 
HETATM 3196 O O     . HOH PB 5 .  ? -60.527 20.755 14.825  1.00 21.83 ? 204 HOH H O     1 
HETATM 3197 O O     . HOH PB 5 .  ? -60.204 19.030 19.034  1.00 31.14 ? 205 HOH H O     1 
HETATM 3198 O O     . HOH PB 5 .  ? -52.511 37.395 11.750  1.00 48.56 ? 206 HOH H O     1 
HETATM 3199 O O     . HOH PB 5 .  ? -53.433 6.362  6.800   1.00 36.94 ? 207 HOH H O     1 
HETATM 3200 O O     . HOH PB 5 .  ? -57.592 19.188 20.218  1.00 29.57 ? 208 HOH H O     1 
HETATM 3201 O O     . HOH PB 5 .  ? -54.916 13.172 12.943  1.00 20.51 ? 209 HOH H O     1 
HETATM 3202 O O     . HOH PB 5 .  ? -61.938 22.377 13.327  1.00 19.40 ? 210 HOH H O     1 
HETATM 3203 O O     . HOH PB 5 .  ? -55.076 8.243  8.453   1.00 32.19 ? 211 HOH H O     1 
HETATM 3204 O O     . HOH PB 5 .  ? -55.255 15.161 14.654  1.00 25.22 ? 212 HOH H O     1 
HETATM 3205 O O     . HOH PB 5 .  ? -52.299 19.277 15.027  1.00 23.60 ? 213 HOH H O     1 
HETATM 3206 O O     . HOH PB 5 .  ? -60.311 21.096 17.530  1.00 23.64 ? 214 HOH H O     1 
HETATM 3207 O O     . HOH PB 5 .  ? -61.466 16.712 10.348  1.00 23.96 ? 215 HOH H O     1 
HETATM 3208 O O     . HOH PB 5 .  ? -61.746 18.364 8.381   1.00 20.51 ? 216 HOH H O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    C CA    . GLY A 6  ? 0.7537 0.6448 0.6566 0.0221  0.0411  -0.0034 147 GLY A CA    
2    C C     . GLY A 6  ? 0.7867 0.6732 0.6730 0.0366  0.0368  0.0121  147 GLY A C     
3    O O     . GLY A 6  ? 0.8130 0.6538 0.6720 0.0317  0.0488  0.0194  147 GLY A O     
4    N N     . LYS A 7  ? 0.7487 0.6844 0.6504 0.0533  0.0210  0.0159  148 LYS A N     
5    C CA    . LYS A 7  ? 0.7307 0.6749 0.6165 0.0713  0.0136  0.0285  148 LYS A CA    
6    C C     . LYS A 7  ? 0.6499 0.6185 0.5468 0.0482  0.0052  0.0249  148 LYS A C     
7    O O     . LYS A 7  ? 0.6036 0.6138 0.5299 0.0330  -0.0044 0.0140  148 LYS A O     
8    C CB    . LYS A 7  ? 0.7402 0.7357 0.6382 0.1012  0.0000  0.0298  148 LYS A CB    
9    N N     . ARG A 8  ? 0.6400 0.5782 0.5101 0.0465  0.0115  0.0345  149 ARG A N     
10   C CA    . ARG A 8  ? 0.5986 0.5593 0.4741 0.0307  0.0043  0.0319  149 ARG A CA    
11   C C     . ARG A 8  ? 0.5675 0.5650 0.4376 0.0528  -0.0106 0.0363  149 ARG A C     
12   O O     . ARG A 8  ? 0.6012 0.5803 0.4393 0.0783  -0.0078 0.0508  149 ARG A O     
13   C CB    . ARG A 8  ? 0.6402 0.5583 0.4920 0.0152  0.0198  0.0378  149 ARG A CB    
14   C CG    . ARG A 8  ? 0.6512 0.5537 0.5162 -0.0126 0.0310  0.0263  149 ARG A CG    
15   C CD    . ARG A 8  ? 0.6802 0.5585 0.5303 -0.0334 0.0456  0.0276  149 ARG A CD    
16   N NE    . ARG A 8  ? 0.6839 0.5528 0.5457 -0.0596 0.0571  0.0135  149 ARG A NE    
17   C CZ    . ARG A 8  ? 0.6824 0.5475 0.5431 -0.0847 0.0694  0.0072  149 ARG A CZ    
18   N NH1   . ARG A 8  ? 0.6970 0.5620 0.5441 -0.0872 0.0736  0.0157  149 ARG A NH1   
19   N NH2   . ARG A 8  ? 0.6918 0.5593 0.5656 -0.1077 0.0778  -0.0094 149 ARG A NH2   
20   N N     . MET A 9  ? 0.4892 0.5380 0.3886 0.0429  -0.0252 0.0228  150 MET A N     
21   C CA    . MET A 9  ? 0.4609 0.5579 0.3626 0.0574  -0.0412 0.0190  150 MET A CA    
22   C C     . MET A 9  ? 0.4304 0.5294 0.3207 0.0461  -0.0443 0.0169  150 MET A C     
23   O O     . MET A 9  ? 0.3787 0.4725 0.2822 0.0211  -0.0413 0.0084  150 MET A O     
24   C CB    . MET A 9  ? 0.4240 0.5732 0.3646 0.0467  -0.0517 0.0015  150 MET A CB    
25   C CG    . MET A 9  ? 0.4381 0.5934 0.3941 0.0565  -0.0481 0.0016  150 MET A CG    
26   S SD    . MET A 9  ? 0.5060 0.6533 0.4330 0.1021  -0.0475 0.0178  150 MET A SD    
27   C CE    . MET A 9  ? 0.5107 0.7362 0.4440 0.1214  -0.0690 0.0096  150 MET A CE    
28   N N     . ASP A 10 ? 0.4343 0.5429 0.2973 0.0683  -0.0502 0.0249  151 ASP A N     
29   C CA    . ASP A 10 ? 0.4264 0.5526 0.2809 0.0606  -0.0570 0.0183  151 ASP A CA    
30   C C     . ASP A 10 ? 0.3855 0.5528 0.2754 0.0375  -0.0678 -0.0056 151 ASP A C     
31   O O     . ASP A 10 ? 0.3585 0.5623 0.2758 0.0366  -0.0756 -0.0169 151 ASP A O     
32   C CB    . ASP A 10 ? 0.4580 0.6081 0.2815 0.0929  -0.0667 0.0262  151 ASP A CB    
33   C CG    . ASP A 10 ? 0.5078 0.6028 0.2852 0.1140  -0.0506 0.0528  151 ASP A CG    
34   O OD1   . ASP A 10 ? 0.5151 0.5683 0.2785 0.0961  -0.0355 0.0593  151 ASP A OD1   
35   O OD2   . ASP A 10 ? 0.5500 0.6425 0.3048 0.1482  -0.0510 0.0669  151 ASP A OD2   
36   N N     . CYS A 11 ? 0.3789 0.5372 0.2669 0.0186  -0.0655 -0.0132 152 CYS A N     
37   C CA    . CYS A 11 ? 0.3732 0.5557 0.2851 -0.0026 -0.0715 -0.0349 152 CYS A CA    
38   C C     . CYS A 11 ? 0.4054 0.6134 0.3000 0.0020  -0.0816 -0.0453 152 CYS A C     
39   O O     . CYS A 11 ? 0.4177 0.6041 0.2927 -0.0014 -0.0761 -0.0430 152 CYS A O     
40   C CB    . CYS A 11 ? 0.3555 0.5038 0.2756 -0.0236 -0.0592 -0.0361 152 CYS A CB    
41   S SG    . CYS A 11 ? 0.3754 0.5350 0.3182 -0.0478 -0.0602 -0.0597 152 CYS A SG    
42   N N     . PRO A 12 ? 0.4290 0.6899 0.3307 0.0113  -0.0968 -0.0584 153 PRO A N     
43   C CA    . PRO A 12 ? 0.4529 0.7460 0.3352 0.0185  -0.1085 -0.0706 153 PRO A CA    
44   C C     . PRO A 12 ? 0.4508 0.7316 0.3339 -0.0064 -0.1053 -0.0900 153 PRO A C     
45   O O     . PRO A 12 ? 0.4746 0.7623 0.3313 0.0008  -0.1096 -0.0945 153 PRO A O     
46   C CB    . PRO A 12 ? 0.4524 0.8168 0.3555 0.0250  -0.1257 -0.0893 153 PRO A CB    
47   C CG    . PRO A 12 ? 0.4478 0.8110 0.3652 0.0382  -0.1224 -0.0742 153 PRO A CG    
48   C CD    . PRO A 12 ? 0.4290 0.7302 0.3552 0.0191  -0.1044 -0.0629 153 PRO A CD    
49   N N     . ALA A 13 ? 0.4218 0.6833 0.3314 -0.0328 -0.0968 -0.1010 154 ALA A N     
50   C CA    . ALA A 13 ? 0.4352 0.6774 0.3446 -0.0549 -0.0910 -0.1203 154 ALA A CA    
51   C C     . ALA A 13 ? 0.4377 0.6363 0.3211 -0.0492 -0.0801 -0.1066 154 ALA A C     
52   O O     . ALA A 13 ? 0.4592 0.6481 0.3296 -0.0562 -0.0779 -0.1211 154 ALA A O     
53   C CB    . ALA A 13 ? 0.4282 0.6532 0.3672 -0.0804 -0.0808 -0.1307 154 ALA A CB    
54   N N     . LEU A 14 ? 0.4238 0.5985 0.3004 -0.0375 -0.0722 -0.0811 155 LEU A N     
55   C CA    . LEU A 14 ? 0.4277 0.5720 0.2829 -0.0327 -0.0608 -0.0678 155 LEU A CA    
56   C C     . LEU A 14 ? 0.4518 0.6061 0.2747 -0.0136 -0.0637 -0.0566 155 LEU A C     
57   O O     . LEU A 14 ? 0.4560 0.6370 0.2715 0.0003  -0.0746 -0.0550 155 LEU A O     
58   C CB    . LEU A 14 ? 0.4006 0.5191 0.2667 -0.0346 -0.0493 -0.0499 155 LEU A CB    
59   C CG    . LEU A 14 ? 0.3853 0.4915 0.2759 -0.0491 -0.0443 -0.0576 155 LEU A CG    
60   C CD1   . LEU A 14 ? 0.3795 0.4718 0.2816 -0.0494 -0.0366 -0.0431 155 LEU A CD1   
61   C CD2   . LEU A 14 ? 0.4004 0.4885 0.2834 -0.0544 -0.0367 -0.0666 155 LEU A CD2   
62   N N     . PRO A 15 ? 0.4591 0.5941 0.2614 -0.0111 -0.0523 -0.0477 156 PRO A N     
63   C CA    . PRO A 15 ? 0.4850 0.6234 0.2525 0.0061  -0.0501 -0.0338 156 PRO A CA    
64   C C     . PRO A 15 ? 0.4955 0.6222 0.2536 0.0193  -0.0463 -0.0106 156 PRO A C     
65   O O     . PRO A 15 ? 0.4655 0.5799 0.2477 0.0124  -0.0439 -0.0062 156 PRO A O     
66   C CB    . PRO A 15 ? 0.4857 0.6047 0.2432 0.0003  -0.0339 -0.0282 156 PRO A CB    
67   C CG    . PRO A 15 ? 0.4719 0.5893 0.2491 -0.0124 -0.0349 -0.0480 156 PRO A CG    
68   C CD    . PRO A 15 ? 0.4491 0.5644 0.2566 -0.0217 -0.0409 -0.0521 156 PRO A CD    
69   N N     . PRO A 16 ? 0.5233 0.6500 0.2433 0.0402  -0.0441 0.0047  157 PRO A N     
70   C CA    . PRO A 16 ? 0.5496 0.6562 0.2514 0.0586  -0.0382 0.0285  157 PRO A CA    
71   C C     . PRO A 16 ? 0.5398 0.6020 0.2522 0.0430  -0.0182 0.0418  157 PRO A C     
72   O O     . PRO A 16 ? 0.5348 0.5827 0.2493 0.0255  -0.0042 0.0416  157 PRO A O     
73   C CB    . PRO A 16 ? 0.6013 0.7039 0.2522 0.0817  -0.0322 0.0450  157 PRO A CB    
74   C CG    . PRO A 16 ? 0.6014 0.7451 0.2488 0.0815  -0.0466 0.0228  157 PRO A CG    
75   C CD    . PRO A 16 ? 0.5591 0.7058 0.2474 0.0519  -0.0483 -0.0006 157 PRO A CD    
76   N N     . GLY A 17 ? 0.5373 0.5836 0.2575 0.0492  -0.0172 0.0503  158 GLY A N     
77   C CA    . GLY A 17 ? 0.5489 0.5509 0.2725 0.0360  0.0025  0.0617  158 GLY A CA    
78   C C     . GLY A 17 ? 0.5047 0.5123 0.2719 0.0127  0.0003  0.0465  158 GLY A C     
79   O O     . GLY A 17 ? 0.5200 0.4976 0.2925 0.0039  0.0130  0.0521  158 GLY A O     
80   N N     . TRP A 18 ? 0.4607 0.5024 0.2542 0.0035  -0.0136 0.0273  159 TRP A N     
81   C CA    . TRP A 18 ? 0.4268 0.4741 0.2562 -0.0136 -0.0157 0.0148  159 TRP A CA    
82   C C     . TRP A 18 ? 0.4226 0.4749 0.2677 -0.0064 -0.0232 0.0143  159 TRP A C     
83   O O     . TRP A 18 ? 0.4149 0.4920 0.2574 0.0093  -0.0364 0.0119  159 TRP A O     
84   C CB    . TRP A 18 ? 0.4032 0.4744 0.2479 -0.0225 -0.0244 -0.0030 159 TRP A CB    
85   C CG    . TRP A 18 ? 0.4139 0.4806 0.2518 -0.0310 -0.0142 -0.0046 159 TRP A CG    
86   C CD1   . TRP A 18 ? 0.4430 0.5140 0.2570 -0.0255 -0.0113 -0.0032 159 TRP A CD1   
87   C CD2   . TRP A 18 ? 0.3907 0.4551 0.2456 -0.0434 -0.0058 -0.0085 159 TRP A CD2   
88   N NE1   . TRP A 18 ? 0.4429 0.5151 0.2603 -0.0343 -0.0009 -0.0064 159 TRP A NE1   
89   C CE2   . TRP A 18 ? 0.4066 0.4773 0.2492 -0.0444 0.0020  -0.0097 159 TRP A CE2   
90   C CE3   . TRP A 18 ? 0.3676 0.4300 0.2454 -0.0513 -0.0042 -0.0114 159 TRP A CE3   
91   C CZ2   . TRP A 18 ? 0.3892 0.4697 0.2440 -0.0515 0.0103  -0.0144 159 TRP A CZ2   
92   C CZ3   . TRP A 18 ? 0.3461 0.4167 0.2333 -0.0579 0.0033  -0.0156 159 TRP A CZ3   
93   C CH2   . TRP A 18 ? 0.3648 0.4468 0.2418 -0.0573 0.0100  -0.0173 159 TRP A CH2   
94   N N     . LYS A 19 ? 0.4007 0.4365 0.2624 -0.0169 -0.0153 0.0148  160 LYS A N     
95   C CA    . LYS A 19 ? 0.4001 0.4383 0.2760 -0.0097 -0.0194 0.0148  160 LYS A CA    
96   C C     . LYS A 19 ? 0.3718 0.4178 0.2773 -0.0259 -0.0192 0.0037  160 LYS A C     
97   O O     . LYS A 19 ? 0.3538 0.3962 0.2645 -0.0399 -0.0135 -0.0006 160 LYS A O     
98   C CB    . LYS A 19 ? 0.4462 0.4464 0.3013 0.0009  -0.0068 0.0295  160 LYS A CB    
99   C CG    . LYS A 19 ? 0.4900 0.4731 0.3064 0.0230  -0.0032 0.0459  160 LYS A CG    
100  C CD    . LYS A 19 ? 0.5376 0.4701 0.3281 0.0358  0.0131  0.0617  160 LYS A CD    
101  C CE    . LYS A 19 ? 0.5922 0.4972 0.3351 0.0609  0.0213  0.0825  160 LYS A CE    
102  N N     . LYS A 20 ? 0.3677 0.4290 0.2905 -0.0206 -0.0254 -0.0001 161 LYS A N     
103  C CA    . LYS A 20 ? 0.3619 0.4343 0.3103 -0.0323 -0.0254 -0.0093 161 LYS A CA    
104  C C     . LYS A 20 ? 0.3804 0.4430 0.3340 -0.0259 -0.0204 -0.0055 161 LYS A C     
105  O O     . LYS A 20 ? 0.4156 0.4749 0.3594 -0.0081 -0.0216 0.0012  161 LYS A O     
106  C CB    . LYS A 20 ? 0.3617 0.4677 0.3279 -0.0352 -0.0355 -0.0209 161 LYS A CB    
107  C CG    . LYS A 20 ? 0.3532 0.4638 0.3411 -0.0491 -0.0311 -0.0286 161 LYS A CG    
108  C CD    . LYS A 20 ? 0.3508 0.4916 0.3575 -0.0576 -0.0364 -0.0420 161 LYS A CD    
109  C CE    . LYS A 20 ? 0.3449 0.5191 0.3699 -0.0495 -0.0408 -0.0443 161 LYS A CE    
110  N N     . GLU A 21 ? 0.3776 0.4357 0.3433 -0.0367 -0.0144 -0.0098 162 GLU A N     
111  C CA    . GLU A 21 ? 0.3841 0.4354 0.3555 -0.0318 -0.0093 -0.0098 162 GLU A CA    
112  C C     . GLU A 21 ? 0.3303 0.3983 0.3206 -0.0410 -0.0084 -0.0167 162 GLU A C     
113  O O     . GLU A 21 ? 0.3173 0.3859 0.3083 -0.0511 -0.0066 -0.0192 162 GLU A O     
114  C CB    . GLU A 21 ? 0.4418 0.4588 0.3969 -0.0359 0.0021  -0.0076 162 GLU A CB    
115  C CG    . GLU A 21 ? 0.4717 0.4799 0.4313 -0.0336 0.0083  -0.0119 162 GLU A CG    
116  C CD    . GLU A 21 ? 0.5409 0.5111 0.4831 -0.0398 0.0215  -0.0139 162 GLU A CD    
117  O OE1   . GLU A 21 ? 0.5758 0.5362 0.5107 -0.0556 0.0275  -0.0163 162 GLU A OE1   
118  O OE2   . GLU A 21 ? 0.5906 0.5420 0.5275 -0.0303 0.0275  -0.0153 162 GLU A OE2   
119  N N     . GLU A 22 ? 0.3140 0.3955 0.3170 -0.0347 -0.0080 -0.0185 163 GLU A N     
120  C CA    . GLU A 22 ? 0.2967 0.3919 0.3143 -0.0419 -0.0039 -0.0227 163 GLU A CA    
121  C C     . GLU A 22 ? 0.2991 0.3853 0.3139 -0.0359 0.0027  -0.0237 163 GLU A C     
122  O O     . GLU A 22 ? 0.3184 0.4023 0.3318 -0.0233 0.0027  -0.0226 163 GLU A O     
123  C CB    . GLU A 22 ? 0.3070 0.4330 0.3443 -0.0427 -0.0068 -0.0266 163 GLU A CB    
124  C CG    . GLU A 22 ? 0.3156 0.4502 0.3648 -0.0513 0.0021  -0.0289 163 GLU A CG    
125  C CD    . GLU A 22 ? 0.3372 0.4982 0.4063 -0.0633 0.0037  -0.0355 163 GLU A CD    
126  O OE1   . GLU A 22 ? 0.3277 0.4878 0.4022 -0.0725 0.0152  -0.0354 163 GLU A OE1   
127  O OE2   . GLU A 22 ? 0.3902 0.5736 0.4680 -0.0648 -0.0051 -0.0420 163 GLU A OE2   
128  N N     . VAL A 23 ? 0.2759 0.3582 0.2875 -0.0424 0.0081  -0.0265 164 VAL A N     
129  C CA    . VAL A 23 ? 0.2826 0.3586 0.2894 -0.0385 0.0143  -0.0316 164 VAL A CA    
130  C C     . VAL A 23 ? 0.2509 0.3457 0.2651 -0.0377 0.0190  -0.0325 164 VAL A C     
131  O O     . VAL A 23 ? 0.2324 0.3333 0.2445 -0.0424 0.0207  -0.0301 164 VAL A O     
132  C CB    . VAL A 23 ? 0.2949 0.3567 0.2884 -0.0471 0.0171  -0.0383 164 VAL A CB    
133  C CG1   . VAL A 23 ? 0.3211 0.3766 0.3089 -0.0455 0.0237  -0.0486 164 VAL A CG1   
134  C CG2   . VAL A 23 ? 0.3114 0.3503 0.2950 -0.0508 0.0168  -0.0357 164 VAL A CG2   
135  N N     . ILE A 24 ? 0.2614 0.3618 0.2797 -0.0291 0.0232  -0.0352 165 ILE A N     
136  C CA    . ILE A 24 ? 0.2510 0.3699 0.2741 -0.0269 0.0307  -0.0353 165 ILE A CA    
137  C C     . ILE A 24 ? 0.2670 0.3827 0.2745 -0.0263 0.0340  -0.0419 165 ILE A C     
138  O O     . ILE A 24 ? 0.2663 0.3695 0.2654 -0.0246 0.0343  -0.0515 165 ILE A O     
139  C CB    . ILE A 24 ? 0.2549 0.3876 0.2888 -0.0155 0.0344  -0.0374 165 ILE A CB    
140  C CG1   . ILE A 24 ? 0.2512 0.3979 0.3009 -0.0119 0.0283  -0.0345 165 ILE A CG1   
141  C CG2   . ILE A 24 ? 0.2636 0.4177 0.3026 -0.0150 0.0449  -0.0364 165 ILE A CG2   
142  C CD1   . ILE A 24 ? 0.2374 0.4001 0.3004 -0.0265 0.0267  -0.0315 165 ILE A CD1   
143  N N     . ARG A 25 ? 0.2721 0.3990 0.2732 -0.0268 0.0379  -0.0376 166 ARG A N     
144  C CA    . ARG A 25 ? 0.2794 0.4166 0.2648 -0.0215 0.0404  -0.0450 166 ARG A CA    
145  C C     . ARG A 25 ? 0.3086 0.4537 0.2930 -0.0130 0.0474  -0.0513 166 ARG A C     
146  O O     . ARG A 25 ? 0.2887 0.4428 0.2809 -0.0088 0.0551  -0.0437 166 ARG A O     
147  C CB    . ARG A 25 ? 0.2776 0.4244 0.2501 -0.0163 0.0441  -0.0351 166 ARG A CB    
148  C CG    . ARG A 25 ? 0.2773 0.4169 0.2473 -0.0202 0.0385  -0.0302 166 ARG A CG    
149  C CD    . ARG A 25 ? 0.2785 0.4273 0.2280 -0.0074 0.0419  -0.0225 166 ARG A CD    
150  N NE    . ARG A 25 ? 0.2699 0.4126 0.2163 -0.0077 0.0372  -0.0187 166 ARG A NE    
151  C CZ    . ARG A 25 ? 0.2810 0.4360 0.2087 0.0075  0.0370  -0.0145 166 ARG A CZ    
152  N NH1   . ARG A 25 ? 0.2910 0.4665 0.1994 0.0251  0.0404  -0.0126 166 ARG A NH1   
153  N NH2   . ARG A 25 ? 0.2808 0.4307 0.2068 0.0086  0.0334  -0.0120 166 ARG A NH2   
154  N N     . LYS A 26 ? 0.3488 0.4914 0.3234 -0.0122 0.0464  -0.0673 167 LYS A N     
155  C CA    . LYS A 26 ? 0.3920 0.5364 0.3626 -0.0032 0.0531  -0.0768 167 LYS A CA    
156  C C     . LYS A 26 ? 0.3985 0.5687 0.3545 0.0055  0.0585  -0.0792 167 LYS A C     
157  O O     . LYS A 26 ? 0.4026 0.5800 0.3572 0.0152  0.0665  -0.0811 167 LYS A O     
158  C CB    . LYS A 26 ? 0.4303 0.5495 0.3931 -0.0078 0.0527  -0.0953 167 LYS A CB    
159  C CG    . LYS A 26 ? 0.4557 0.5435 0.4258 -0.0106 0.0507  -0.0895 167 LYS A CG    
160  N N     . SER A 27 ? 0.4175 0.6043 0.3612 0.0055  0.0548  -0.0775 168 SER A N     
161  C CA    . SER A 27 ? 0.4301 0.6448 0.3525 0.0180  0.0582  -0.0814 168 SER A CA    
162  C C     . SER A 27 ? 0.4522 0.6825 0.3603 0.0262  0.0564  -0.0674 168 SER A C     
163  O O     . SER A 27 ? 0.4190 0.6378 0.3344 0.0205  0.0523  -0.0578 168 SER A O     
164  C CB    . SER A 27 ? 0.4610 0.6876 0.3737 0.0137  0.0527  -0.1097 168 SER A CB    
165  O OG    . SER A 27 ? 0.4665 0.6977 0.3831 0.0004  0.0428  -0.1190 168 SER A OG    
166  N N     . GLY A 28 ? 0.5170 0.7734 0.4007 0.0433  0.0602  -0.0664 169 GLY A N     
167  C CA    . GLY A 28 ? 0.5341 0.8045 0.3961 0.0595  0.0603  -0.0515 169 GLY A CA    
168  C C     . GLY A 28 ? 0.5423 0.7831 0.3982 0.0652  0.0758  -0.0222 169 GLY A C     
169  O O     . GLY A 28 ? 0.4745 0.6950 0.3458 0.0551  0.0865  -0.0153 169 GLY A O     
170  N N     . LEU A 29 ? 0.5809 0.8207 0.4141 0.0814  0.0777  -0.0066 170 LEU A N     
171  C CA    . LEU A 29 ? 0.6043 0.8104 0.4184 0.0908  0.0972  0.0215  170 LEU A CA    
172  C C     . LEU A 29 ? 0.5678 0.7356 0.4102 0.0657  0.1044  0.0279  170 LEU A C     
173  O O     . LEU A 29 ? 0.5895 0.7372 0.4337 0.0584  0.1229  0.0397  170 LEU A O     
174  C CB    . LEU A 29 ? 0.6566 0.8627 0.4395 0.1156  0.0962  0.0351  170 LEU A CB    
175  C CG    . LEU A 29 ? 0.6819 0.9374 0.4313 0.1476  0.0888  0.0303  170 LEU A CG    
176  C CD1   . LEU A 29 ? 0.6949 0.9640 0.4253 0.1711  0.0806  0.0365  170 LEU A CD1   
177  C CD2   . LEU A 29 ? 0.7162 0.9656 0.4286 0.1696  0.1083  0.0490  170 LEU A CD2   
178  N N     . SER A 30 ? 0.5006 0.6642 0.3663 0.0512  0.0900  0.0179  171 SER A N     
179  C CA    . SER A 30 ? 0.4503 0.5855 0.3419 0.0291  0.0932  0.0208  171 SER A CA    
180  C C     . SER A 30 ? 0.4124 0.5584 0.3370 0.0119  0.0867  0.0061  171 SER A C     
181  O O     . SER A 30 ? 0.3747 0.5102 0.3217 -0.0031 0.0811  0.0027  171 SER A O     
182  C CB    . SER A 30 ? 0.4473 0.5704 0.3409 0.0266  0.0828  0.0204  171 SER A CB    
183  N N     . ALA A 31 ? 0.3823 0.5487 0.3064 0.0175  0.0887  -0.0018 172 ALA A N     
184  C CA    . ALA A 31 ? 0.3566 0.5314 0.3056 0.0089  0.0835  -0.0157 172 ALA A CA    
185  C C     . ALA A 31 ? 0.3348 0.5031 0.3094 -0.0048 0.0909  -0.0093 172 ALA A C     
186  O O     . ALA A 31 ? 0.3491 0.5153 0.3217 -0.0079 0.1067  0.0015  172 ALA A O     
187  C CB    . ALA A 31 ? 0.3560 0.5509 0.2955 0.0203  0.0890  -0.0242 172 ALA A CB    
188  N N     . GLY A 32 ? 0.3176 0.4855 0.3146 -0.0127 0.0801  -0.0174 173 GLY A N     
189  C CA    . GLY A 32 ? 0.3193 0.4944 0.3429 -0.0249 0.0840  -0.0154 173 GLY A CA    
190  C C     . GLY A 32 ? 0.3102 0.4689 0.3390 -0.0381 0.0792  -0.0116 173 GLY A C     
191  O O     . GLY A 32 ? 0.2962 0.4652 0.3468 -0.0470 0.0742  -0.0162 173 GLY A O     
192  N N     . LYS A 33 ? 0.3279 0.4642 0.3348 -0.0368 0.0809  -0.0040 174 LYS A N     
193  C CA    . LYS A 33 ? 0.3438 0.4610 0.3506 -0.0455 0.0750  -0.0025 174 LYS A CA    
194  C C     . LYS A 33 ? 0.3106 0.4302 0.3244 -0.0446 0.0563  -0.0112 174 LYS A C     
195  O O     . LYS A 33 ? 0.3099 0.4376 0.3224 -0.0369 0.0494  -0.0179 174 LYS A O     
196  C CB    . LYS A 33 ? 0.3682 0.4612 0.3455 -0.0372 0.0823  0.0085  174 LYS A CB    
197  C CG    . LYS A 33 ? 0.4145 0.4873 0.3793 -0.0410 0.1057  0.0210  174 LYS A CG    
198  C CD    . LYS A 33 ? 0.4339 0.5050 0.3669 -0.0199 0.1161  0.0325  174 LYS A CD    
199  N N     . SER A 34 ? 0.2965 0.4049 0.3140 -0.0530 0.0507  -0.0116 175 SER A N     
200  C CA    . SER A 34 ? 0.2914 0.3993 0.3112 -0.0520 0.0364  -0.0172 175 SER A CA    
201  C C     . SER A 34 ? 0.2836 0.3762 0.2889 -0.0519 0.0328  -0.0149 175 SER A C     
202  O O     . SER A 34 ? 0.3115 0.3900 0.3058 -0.0520 0.0406  -0.0090 175 SER A O     
203  C CB    . SER A 34 ? 0.2877 0.4075 0.3268 -0.0579 0.0298  -0.0220 175 SER A CB    
204  O OG    . SER A 34 ? 0.2962 0.4165 0.3437 -0.0709 0.0352  -0.0227 175 SER A OG    
205  N N     . ASP A 35 ? 0.2551 0.3484 0.2584 -0.0506 0.0233  -0.0194 176 ASP A N     
206  C CA    . ASP A 35 ? 0.2624 0.3489 0.2558 -0.0508 0.0192  -0.0191 176 ASP A CA    
207  C C     . ASP A 35 ? 0.2519 0.3348 0.2521 -0.0565 0.0114  -0.0217 176 ASP A C     
208  O O     . ASP A 35 ? 0.2549 0.3399 0.2609 -0.0555 0.0083  -0.0237 176 ASP A O     
209  C CB    . ASP A 35 ? 0.2526 0.3505 0.2366 -0.0458 0.0175  -0.0234 176 ASP A CB    
210  C CG    . ASP A 35 ? 0.2706 0.3794 0.2436 -0.0349 0.0233  -0.0210 176 ASP A CG    
211  O OD1   . ASP A 35 ? 0.2702 0.3861 0.2455 -0.0334 0.0260  -0.0238 176 ASP A OD1   
212  O OD2   . ASP A 35 ? 0.2819 0.3930 0.2407 -0.0245 0.0257  -0.0158 176 ASP A OD2   
213  N N     . VAL A 36 ? 0.2671 0.3428 0.2626 -0.0594 0.0094  -0.0210 177 VAL A N     
214  C CA    . VAL A 36 ? 0.2596 0.3344 0.2565 -0.0625 0.0020  -0.0229 177 VAL A CA    
215  C C     . VAL A 36 ? 0.2563 0.3277 0.2413 -0.0615 0.0006  -0.0228 177 VAL A C     
216  O O     . VAL A 36 ? 0.2593 0.3318 0.2367 -0.0583 0.0041  -0.0225 177 VAL A O     
217  C CB    . VAL A 36 ? 0.2683 0.3413 0.2689 -0.0690 0.0017  -0.0261 177 VAL A CB    
218  C CG1   . VAL A 36 ? 0.2689 0.3478 0.2677 -0.0695 -0.0075 -0.0296 177 VAL A CG1   
219  C CG2   . VAL A 36 ? 0.2671 0.3503 0.2833 -0.0744 0.0061  -0.0284 177 VAL A CG2   
220  N N     . TYR A 37 ? 0.2604 0.3287 0.2419 -0.0622 -0.0025 -0.0223 178 TYR A N     
221  C CA    . TYR A 37 ? 0.2748 0.3414 0.2461 -0.0651 -0.0007 -0.0226 178 TYR A CA    
222  C C     . TYR A 37 ? 0.2895 0.3490 0.2519 -0.0637 -0.0044 -0.0193 178 TYR A C     
223  O O     . TYR A 37 ? 0.2870 0.3438 0.2501 -0.0583 -0.0086 -0.0165 178 TYR A O     
224  C CB    . TYR A 37 ? 0.2776 0.3412 0.2477 -0.0704 0.0049  -0.0255 178 TYR A CB    
225  C CG    . TYR A 37 ? 0.2921 0.3685 0.2689 -0.0703 0.0071  -0.0311 178 TYR A CG    
226  C CD1   . TYR A 37 ? 0.2817 0.3797 0.2582 -0.0679 0.0076  -0.0348 178 TYR A CD1   
227  C CD2   . TYR A 37 ? 0.3050 0.3744 0.2854 -0.0687 0.0089  -0.0328 178 TYR A CD2   
228  C CE1   . TYR A 37 ? 0.2888 0.4032 0.2671 -0.0639 0.0089  -0.0394 178 TYR A CE1   
229  C CE2   . TYR A 37 ? 0.3072 0.3907 0.2905 -0.0674 0.0111  -0.0390 178 TYR A CE2   
230  C CZ    . TYR A 37 ? 0.2910 0.3981 0.2726 -0.0649 0.0106  -0.0420 178 TYR A CZ    
231  O OH    . TYR A 37 ? 0.2656 0.3909 0.2460 -0.0597 0.0119  -0.0472 178 TYR A OH    
232  N N     . TYR A 38 ? 0.2929 0.3542 0.2459 -0.0656 -0.0028 -0.0195 179 TYR A N     
233  C CA    . TYR A 38 ? 0.3156 0.3709 0.2546 -0.0629 -0.0048 -0.0155 179 TYR A CA    
234  C C     . TYR A 38 ? 0.3296 0.3770 0.2578 -0.0690 0.0046  -0.0121 179 TYR A C     
235  O O     . TYR A 38 ? 0.3133 0.3700 0.2481 -0.0776 0.0110  -0.0172 179 TYR A O     
236  C CB    . TYR A 38 ? 0.3212 0.3837 0.2552 -0.0605 -0.0092 -0.0201 179 TYR A CB    
237  C CG    . TYR A 38 ? 0.3138 0.3798 0.2573 -0.0600 -0.0160 -0.0258 179 TYR A CG    
238  C CD1   . TYR A 38 ? 0.3156 0.3789 0.2693 -0.0631 -0.0126 -0.0294 179 TYR A CD1   
239  C CD2   . TYR A 38 ? 0.3277 0.4027 0.2692 -0.0567 -0.0242 -0.0282 179 TYR A CD2   
240  C CE1   . TYR A 38 ? 0.3007 0.3651 0.2640 -0.0682 -0.0144 -0.0359 179 TYR A CE1   
241  C CE2   . TYR A 38 ? 0.3239 0.4110 0.2791 -0.0615 -0.0293 -0.0378 179 TYR A CE2   
242  C CZ    . TYR A 38 ? 0.3108 0.3901 0.2777 -0.0698 -0.0229 -0.0418 179 TYR A CZ    
243  O OH    . TYR A 38 ? 0.3200 0.4090 0.3003 -0.0794 -0.0238 -0.0523 179 TYR A OH    
244  N N     . PHE A 39 ? 0.3518 0.3837 0.2619 -0.0645 0.0068  -0.0038 180 PHE A N     
245  C CA    . PHE A 39 ? 0.3813 0.3982 0.2766 -0.0728 0.0204  0.0009  180 PHE A CA    
246  C C     . PHE A 39 ? 0.4004 0.4174 0.2749 -0.0662 0.0208  0.0073  180 PHE A C     
247  O O     . PHE A 39 ? 0.4031 0.4208 0.2670 -0.0515 0.0111  0.0116  180 PHE A O     
248  C CB    . PHE A 39 ? 0.4092 0.3919 0.2937 -0.0728 0.0300  0.0080  180 PHE A CB    
249  C CG    . PHE A 39 ? 0.4000 0.3830 0.3025 -0.0788 0.0301  -0.0004 180 PHE A CG    
250  C CD1   . PHE A 39 ? 0.3802 0.3707 0.2937 -0.0664 0.0190  -0.0010 180 PHE A CD1   
251  C CD2   . PHE A 39 ? 0.4088 0.3906 0.3178 -0.0982 0.0419  -0.0101 180 PHE A CD2   
252  C CE1   . PHE A 39 ? 0.3738 0.3661 0.3012 -0.0703 0.0201  -0.0084 180 PHE A CE1   
253  C CE2   . PHE A 39 ? 0.4075 0.3930 0.3303 -0.1023 0.0412  -0.0198 180 PHE A CE2   
254  C CZ    . PHE A 39 ? 0.3794 0.3682 0.3098 -0.0870 0.0305  -0.0177 180 PHE A CZ    
255  N N     . SER A 40 ? 0.4021 0.4261 0.2719 -0.0770 0.0319  0.0059  181 SER A N     
256  C CA    . SER A 40 ? 0.4147 0.4386 0.2614 -0.0716 0.0360  0.0126  181 SER A CA    
257  C C     . SER A 40 ? 0.4605 0.4482 0.2786 -0.0668 0.0472  0.0285  181 SER A C     
258  O O     . SER A 40 ? 0.4983 0.4579 0.3151 -0.0705 0.0548  0.0329  181 SER A O     
259  C CB    . SER A 40 ? 0.4095 0.4557 0.2616 -0.0851 0.0476  0.0061  181 SER A CB    
260  O OG    . SER A 40 ? 0.4238 0.4586 0.2772 -0.1053 0.0663  0.0069  181 SER A OG    
261  N N     . PRO A 41 ? 0.5100 0.4937 0.3000 -0.0563 0.0503  0.0381  182 PRO A N     
262  C CA    . PRO A 41 ? 0.5647 0.5060 0.3203 -0.0477 0.0644  0.0571  182 PRO A CA    
263  C C     . PRO A 41 ? 0.6003 0.5088 0.3517 -0.0723 0.0916  0.0605  182 PRO A C     
264  O O     . PRO A 41 ? 0.6550 0.5148 0.3832 -0.0685 0.1056  0.0735  182 PRO A O     
265  C CB    . PRO A 41 ? 0.5990 0.5475 0.3223 -0.0310 0.0634  0.0665  182 PRO A CB    
266  C CG    . PRO A 41 ? 0.5642 0.5559 0.3069 -0.0371 0.0531  0.0499  182 PRO A CG    
267  C CD    . PRO A 41 ? 0.5007 0.5121 0.2833 -0.0467 0.0407  0.0332  182 PRO A CD    
268  N N     . SER A 42 ? 0.5867 0.5226 0.3599 -0.0967 0.1000  0.0473  183 SER A N     
269  C CA    . SER A 42 ? 0.6239 0.5416 0.4024 -0.1279 0.1256  0.0426  183 SER A CA    
270  C C     . SER A 42 ? 0.6201 0.5341 0.4241 -0.1400 0.1223  0.0294  183 SER A C     
271  O O     . SER A 42 ? 0.6678 0.5579 0.4722 -0.1654 0.1432  0.0239  183 SER A O     
272  C CB    . SER A 42 ? 0.6060 0.5701 0.4028 -0.1493 0.1350  0.0298  183 SER A CB    
273  N N     . GLY A 43 ? 0.5671 0.5047 0.3918 -0.1244 0.0980  0.0227  184 GLY A N     
274  C CA    . GLY A 43 ? 0.5492 0.4823 0.3936 -0.1311 0.0942  0.0119  184 GLY A CA    
275  C C     . GLY A 43 ? 0.4903 0.4756 0.3706 -0.1430 0.0848  -0.0084 184 GLY A C     
276  O O     . GLY A 43 ? 0.4672 0.4512 0.3610 -0.1501 0.0837  -0.0184 184 GLY A O     
277  N N     . LYS A 44 ? 0.4533 0.4837 0.3452 -0.1414 0.0784  -0.0139 185 LYS A N     
278  C CA    . LYS A 44 ? 0.4017 0.4830 0.3213 -0.1431 0.0687  -0.0298 185 LYS A CA    
279  C C     . LYS A 44 ? 0.3752 0.4553 0.3016 -0.1232 0.0501  -0.0282 185 LYS A C     
280  O O     . LYS A 44 ? 0.3869 0.4492 0.3023 -0.1066 0.0408  -0.0181 185 LYS A O     
281  C CB    . LYS A 44 ? 0.3867 0.5124 0.3118 -0.1391 0.0678  -0.0343 185 LYS A CB    
282  C CG    . LYS A 44 ? 0.4202 0.5515 0.3364 -0.1564 0.0874  -0.0334 185 LYS A CG    
283  N N     . LYS A 45 ? 0.3401 0.4423 0.2843 -0.1262 0.0459  -0.0395 186 LYS A N     
284  C CA    . LYS A 45 ? 0.3202 0.4188 0.2704 -0.1115 0.0332  -0.0381 186 LYS A CA    
285  C C     . LYS A 45 ? 0.2947 0.4225 0.2504 -0.0957 0.0239  -0.0395 186 LYS A C     
286  O O     . LYS A 45 ? 0.2925 0.4568 0.2547 -0.0962 0.0260  -0.0473 186 LYS A O     
287  C CB    . LYS A 45 ? 0.3329 0.4380 0.2939 -0.1220 0.0362  -0.0495 186 LYS A CB    
288  C CG    . LYS A 45 ? 0.3240 0.4238 0.2894 -0.1082 0.0265  -0.0473 186 LYS A CG    
289  C CD    . LYS A 45 ? 0.3409 0.4341 0.3102 -0.1185 0.0315  -0.0575 186 LYS A CD    
290  C CE    . LYS A 45 ? 0.3321 0.4237 0.3051 -0.1039 0.0237  -0.0549 186 LYS A CE    
291  N NZ    . LYS A 45 ? 0.3572 0.4395 0.3309 -0.1117 0.0289  -0.0656 186 LYS A NZ    
292  N N     . PHE A 46 ? 0.2795 0.3908 0.2310 -0.0817 0.0153  -0.0326 187 PHE A N     
293  C CA    . PHE A 46 ? 0.2820 0.4053 0.2331 -0.0669 0.0107  -0.0331 187 PHE A CA    
294  C C     . PHE A 46 ? 0.2901 0.4037 0.2457 -0.0606 0.0070  -0.0313 187 PHE A C     
295  O O     . PHE A 46 ? 0.2935 0.3890 0.2525 -0.0649 0.0050  -0.0285 187 PHE A O     
296  C CB    . PHE A 46 ? 0.3096 0.4188 0.2487 -0.0605 0.0085  -0.0297 187 PHE A CB    
297  C CG    . PHE A 46 ? 0.3194 0.4407 0.2514 -0.0648 0.0140  -0.0305 187 PHE A CG    
298  C CD1   . PHE A 46 ? 0.3359 0.4433 0.2611 -0.0754 0.0182  -0.0258 187 PHE A CD1   
299  C CD2   . PHE A 46 ? 0.3276 0.4746 0.2575 -0.0562 0.0172  -0.0350 187 PHE A CD2   
300  C CE1   . PHE A 46 ? 0.3608 0.4776 0.2770 -0.0810 0.0270  -0.0251 187 PHE A CE1   
301  C CE2   . PHE A 46 ? 0.3383 0.5024 0.2635 -0.0613 0.0243  -0.0365 187 PHE A CE2   
302  C CZ    . PHE A 46 ? 0.3600 0.5079 0.2783 -0.0757 0.0300  -0.0313 187 PHE A CZ    
303  N N     . ARG A 47 ? 0.2965 0.4230 0.2502 -0.0479 0.0076  -0.0319 188 ARG A N     
304  C CA    . ARG A 47 ? 0.3149 0.4331 0.2697 -0.0419 0.0076  -0.0288 188 ARG A CA    
305  C C     . ARG A 47 ? 0.3174 0.4126 0.2603 -0.0292 0.0110  -0.0227 188 ARG A C     
306  O O     . ARG A 47 ? 0.3328 0.4155 0.2742 -0.0258 0.0144  -0.0183 188 ARG A O     
307  C CB    . ARG A 47 ? 0.3263 0.4772 0.2844 -0.0371 0.0081  -0.0341 188 ARG A CB    
308  C CG    . ARG A 47 ? 0.3489 0.5210 0.3178 -0.0544 0.0085  -0.0448 188 ARG A CG    
309  C CD    A ARG A 47 ? 0.3650 0.5817 0.3382 -0.0508 0.0078  -0.0558 188 ARG A CD    
310  C CD    B ARG A 47 ? 0.3252 0.5395 0.2994 -0.0534 0.0080  -0.0565 188 ARG A CD    
311  N NE    A ARG A 47 ? 0.3930 0.6288 0.3775 -0.0737 0.0112  -0.0706 188 ARG A NE    
312  N NE    B ARG A 47 ? 0.3172 0.5370 0.3015 -0.0774 0.0117  -0.0696 188 ARG A NE    
313  C CZ    A ARG A 47 ? 0.4070 0.6616 0.3966 -0.0855 0.0154  -0.0769 188 ARG A CZ    
314  C CZ    B ARG A 47 ? 0.3055 0.5200 0.2927 -0.0857 0.0128  -0.0772 188 ARG A CZ    
315  N NH1   A ARG A 47 ? 0.4251 0.6862 0.4096 -0.0733 0.0148  -0.0700 188 ARG A NH1   
316  N NH1   B ARG A 47 ? 0.2951 0.5061 0.2776 -0.0712 0.0096  -0.0724 188 ARG A NH1   
317  N NH2   A ARG A 47 ? 0.4331 0.6968 0.4316 -0.1112 0.0226  -0.0910 188 ARG A NH2   
318  N NH2   B ARG A 47 ? 0.3040 0.5132 0.2962 -0.1091 0.0198  -0.0902 188 ARG A NH2   
319  N N     . SER A 48 ? 0.3076 0.3935 0.2396 -0.0228 0.0125  -0.0228 189 SER A N     
320  C CA    . SER A 48 ? 0.3263 0.3786 0.2430 -0.0136 0.0194  -0.0191 189 SER A CA    
321  C C     . SER A 48 ? 0.3388 0.3729 0.2481 -0.0179 0.0190  -0.0244 189 SER A C     
322  O O     . SER A 48 ? 0.3103 0.3635 0.2221 -0.0211 0.0141  -0.0283 189 SER A O     
323  C CB    . SER A 48 ? 0.3425 0.3987 0.2413 0.0115  0.0261  -0.0135 189 SER A CB    
324  O OG    . SER A 48 ? 0.3564 0.4343 0.2490 0.0236  0.0249  -0.0173 189 SER A OG    
325  N N     . LYS A 49 ? 0.3619 0.3584 0.2597 -0.0186 0.0264  -0.0255 190 LYS A N     
326  C CA    . LYS A 49 ? 0.3966 0.3734 0.2836 -0.0220 0.0273  -0.0342 190 LYS A CA    
327  C C     . LYS A 49 ? 0.4013 0.3839 0.2707 -0.0015 0.0303  -0.0344 190 LYS A C     
328  O O     . LYS A 49 ? 0.4002 0.3965 0.2690 -0.0047 0.0251  -0.0407 190 LYS A O     
329  C CB    . LYS A 49 ? 0.4405 0.3732 0.3188 -0.0317 0.0377  -0.0394 190 LYS A CB    
330  C CG    . LYS A 49 ? 0.4602 0.3771 0.3306 -0.0420 0.0367  -0.0547 190 LYS A CG    
331  C CD    . LYS A 49 ? 0.5055 0.3795 0.3706 -0.0590 0.0493  -0.0643 190 LYS A CD    
332  C CE    . LYS A 49 ? 0.5388 0.3949 0.3920 -0.0688 0.0500  -0.0835 190 LYS A CE    
333  N NZ    . LYS A 49 ? 0.5815 0.3961 0.4319 -0.0925 0.0648  -0.0975 190 LYS A NZ    
334  N N     . PRO A 50 ? 0.4274 0.4037 0.2808 0.0223  0.0389  -0.0268 191 PRO A N     
335  C CA    . PRO A 50 ? 0.4358 0.4292 0.2752 0.0451  0.0409  -0.0281 191 PRO A CA    
336  C C     . PRO A 50 ? 0.4015 0.4548 0.2599 0.0412  0.0315  -0.0308 191 PRO A C     
337  O O     . PRO A 50 ? 0.4040 0.4731 0.2568 0.0483  0.0322  -0.0357 191 PRO A O     
338  C CB    . PRO A 50 ? 0.4668 0.4498 0.2853 0.0765  0.0510  -0.0176 191 PRO A CB    
339  C CG    . PRO A 50 ? 0.4879 0.4294 0.3020 0.0678  0.0585  -0.0107 191 PRO A CG    
340  C CD    . PRO A 50 ? 0.4455 0.3982 0.2880 0.0339  0.0488  -0.0165 191 PRO A CD    
341  N N     . GLN A 51 ? 0.3860 0.4697 0.2655 0.0284  0.0252  -0.0289 192 GLN A N     
342  C CA    . GLN A 51 ? 0.3773 0.5085 0.2745 0.0167  0.0203  -0.0334 192 GLN A CA    
343  C C     . GLN A 51 ? 0.3712 0.4907 0.2692 -0.0010 0.0178  -0.0366 192 GLN A C     
344  O O     . GLN A 51 ? 0.3802 0.5247 0.2786 -0.0031 0.0197  -0.0398 192 GLN A O     
345  C CB    . GLN A 51 ? 0.3664 0.5197 0.2821 0.0036  0.0163  -0.0332 192 GLN A CB    
346  C CG    . GLN A 51 ? 0.3846 0.5921 0.3153 -0.0034 0.0163  -0.0407 192 GLN A CG    
347  C CD    . GLN A 51 ? 0.3773 0.5949 0.3247 -0.0249 0.0143  -0.0445 192 GLN A CD    
348  O OE1   . GLN A 51 ? 0.4027 0.5951 0.3506 -0.0276 0.0118  -0.0404 192 GLN A OE1   
349  N NE2   . GLN A 51 ? 0.3854 0.6384 0.3457 -0.0414 0.0176  -0.0537 192 GLN A NE2   
350  N N     . LEU A 52 ? 0.3556 0.4417 0.2529 -0.0125 0.0144  -0.0360 193 LEU A N     
351  C CA    . LEU A 52 ? 0.3882 0.4661 0.2826 -0.0244 0.0103  -0.0388 193 LEU A CA    
352  C C     . LEU A 52 ? 0.4052 0.4727 0.2799 -0.0144 0.0133  -0.0455 193 LEU A C     
353  O O     . LEU A 52 ? 0.4028 0.4829 0.2713 -0.0169 0.0127  -0.0471 193 LEU A O     
354  C CB    . LEU A 52 ? 0.4020 0.4576 0.3024 -0.0355 0.0050  -0.0395 193 LEU A CB    
355  C CG    . LEU A 52 ? 0.4176 0.4738 0.3171 -0.0450 -0.0022 -0.0416 193 LEU A CG    
356  C CD1   . LEU A 52 ? 0.4031 0.4746 0.3071 -0.0495 -0.0026 -0.0337 193 LEU A CD1   
357  C CD2   . LEU A 52 ? 0.4273 0.4726 0.3369 -0.0534 -0.0070 -0.0456 193 LEU A CD2   
358  N N     . ALA A 53 ? 0.4263 0.4663 0.2880 -0.0024 0.0187  -0.0489 194 ALA A N     
359  C CA    . ALA A 53 ? 0.4588 0.4819 0.2985 0.0093  0.0239  -0.0572 194 ALA A CA    
360  C C     . ALA A 53 ? 0.4608 0.5182 0.2957 0.0264  0.0283  -0.0557 194 ALA A C     
361  O O     . ALA A 53 ? 0.4859 0.5486 0.3086 0.0295  0.0296  -0.0619 194 ALA A O     
362  C CB    . ALA A 53 ? 0.4920 0.4671 0.3146 0.0189  0.0334  -0.0603 194 ALA A CB    
363  N N     . ARG A 54 ? 0.4586 0.5469 0.3041 0.0370  0.0303  -0.0492 195 ARG A N     
364  C CA    . ARG A 54 ? 0.4660 0.6027 0.3132 0.0514  0.0345  -0.0506 195 ARG A CA    
365  C C     . ARG A 54 ? 0.4357 0.6029 0.2942 0.0306  0.0333  -0.0521 195 ARG A C     
366  O O     . ARG A 54 ? 0.4366 0.6290 0.2887 0.0376  0.0390  -0.0560 195 ARG A O     
367  C CB    . ARG A 54 ? 0.4797 0.6565 0.3391 0.0653  0.0352  -0.0470 195 ARG A CB    
368  C CG    . ARG A 54 ? 0.5493 0.7013 0.3873 0.0982  0.0407  -0.0426 195 ARG A CG    
369  C CD    . ARG A 54 ? 0.5613 0.7686 0.4081 0.1191  0.0397  -0.0398 195 ARG A CD    
370  N NE    . ARG A 54 ? 0.5428 0.7728 0.4125 0.0986  0.0326  -0.0388 195 ARG A NE    
371  C CZ    . ARG A 54 ? 0.6127 0.8134 0.4774 0.1007  0.0317  -0.0311 195 ARG A CZ    
372  N NH1   . ARG A 54 ? 0.6520 0.7928 0.4894 0.1190  0.0392  -0.0224 195 ARG A NH1   
373  N NH2   . ARG A 54 ? 0.5888 0.8171 0.4743 0.0827  0.0254  -0.0329 195 ARG A NH2   
374  N N     . TYR A 55 ? 0.3822 0.5432 0.2537 0.0070  0.0283  -0.0481 196 TYR A N     
375  C CA    . TYR A 55 ? 0.3571 0.5342 0.2323 -0.0112 0.0309  -0.0460 196 TYR A CA    
376  C C     . TYR A 55 ? 0.3759 0.5324 0.2297 -0.0114 0.0302  -0.0469 196 TYR A C     
377  O O     . TYR A 55 ? 0.3800 0.5564 0.2259 -0.0129 0.0376  -0.0465 196 TYR A O     
378  C CB    . TYR A 55 ? 0.3316 0.4988 0.2202 -0.0307 0.0275  -0.0405 196 TYR A CB    
379  C CG    . TYR A 55 ? 0.3306 0.5078 0.2198 -0.0485 0.0353  -0.0364 196 TYR A CG    
380  C CD1   . TYR A 55 ? 0.3155 0.5329 0.2179 -0.0584 0.0460  -0.0406 196 TYR A CD1   
381  C CD2   . TYR A 55 ? 0.3454 0.4929 0.2197 -0.0549 0.0338  -0.0288 196 TYR A CD2   
382  C CE1   . TYR A 55 ? 0.3400 0.5580 0.2401 -0.0789 0.0585  -0.0369 196 TYR A CE1   
383  C CE2   . TYR A 55 ? 0.3636 0.5094 0.2304 -0.0686 0.0454  -0.0216 196 TYR A CE2   
384  C CZ    . TYR A 55 ? 0.3644 0.5404 0.2438 -0.0827 0.0592  -0.0255 196 TYR A CZ    
385  O OH    . TYR A 55 ? 0.4157 0.5818 0.2862 -0.1000 0.0748  -0.0188 196 TYR A OH    
386  N N     . LEU A 56 ? 0.3858 0.5073 0.2307 -0.0113 0.0220  -0.0493 197 LEU A N     
387  C CA    . LEU A 56 ? 0.4097 0.5181 0.2343 -0.0115 0.0184  -0.0536 197 LEU A CA    
388  C C     . LEU A 56 ? 0.4349 0.5414 0.2389 0.0043  0.0231  -0.0644 197 LEU A C     
389  O O     . LEU A 56 ? 0.4552 0.5651 0.2399 0.0057  0.0230  -0.0680 197 LEU A O     
390  C CB    . LEU A 56 ? 0.4119 0.4952 0.2379 -0.0188 0.0073  -0.0577 197 LEU A CB    
391  C CG    . LEU A 56 ? 0.4037 0.4891 0.2447 -0.0304 0.0024  -0.0472 197 LEU A CG    
392  C CD1   . LEU A 56 ? 0.4008 0.4711 0.2522 -0.0361 -0.0064 -0.0526 197 LEU A CD1   
393  C CD2   . LEU A 56 ? 0.4179 0.5108 0.2436 -0.0315 0.0021  -0.0393 197 LEU A CD2   
394  N N     . GLY A 57 ? 0.4319 0.5302 0.2355 0.0188  0.0280  -0.0690 198 GLY A N     
395  C CA    . GLY A 57 ? 0.4690 0.5552 0.2499 0.0379  0.0344  -0.0798 198 GLY A CA    
396  C C     . GLY A 57 ? 0.4995 0.5506 0.2602 0.0326  0.0298  -0.0941 198 GLY A C     
397  O O     . GLY A 57 ? 0.4928 0.5168 0.2588 0.0196  0.0238  -0.0987 198 GLY A O     
398  N N     . ASN A 58 ? 0.5161 0.5746 0.2547 0.0406  0.0326  -0.1031 199 ASN A N     
399  C CA    . ASN A 58 ? 0.5414 0.5733 0.2584 0.0362  0.0282  -0.1220 199 ASN A CA    
400  C C     . ASN A 58 ? 0.5334 0.5858 0.2495 0.0211  0.0158  -0.1221 199 ASN A C     
401  O O     . ASN A 58 ? 0.5491 0.5954 0.2468 0.0178  0.0098  -0.1399 199 ASN A O     
402  C CB    . ASN A 58 ? 0.5785 0.6035 0.2666 0.0567  0.0383  -0.1350 199 ASN A CB    
403  C CG    . ASN A 58 ? 0.5714 0.6419 0.2519 0.0646  0.0418  -0.1279 199 ASN A CG    
404  O OD1   . ASN A 58 ? 0.5376 0.6389 0.2313 0.0530  0.0381  -0.1128 199 ASN A OD1   
405  N ND2   . ASN A 58 ? 0.5882 0.6594 0.2448 0.0847  0.0515  -0.1386 199 ASN A ND2   
406  N N     . THR A 59 ? 0.5010 0.5780 0.2344 0.0136  0.0124  -0.1031 200 THR A N     
407  C CA    . THR A 59 ? 0.4979 0.5906 0.2261 0.0059  0.0021  -0.0986 200 THR A CA    
408  C C     . THR A 59 ? 0.5112 0.5934 0.2500 -0.0063 -0.0111 -0.1095 200 THR A C     
409  O O     . THR A 59 ? 0.5299 0.6293 0.2590 -0.0078 -0.0222 -0.1139 200 THR A O     
410  C CB    . THR A 59 ? 0.4709 0.5804 0.2108 0.0017  0.0061  -0.0750 200 THR A CB    
411  O OG1   . THR A 59 ? 0.4278 0.5287 0.1966 -0.0066 0.0062  -0.0681 200 THR A OG1   
412  C CG2   . THR A 59 ? 0.4677 0.5964 0.1975 0.0085  0.0208  -0.0669 200 THR A CG2   
413  N N     . VAL A 60 ? 0.5142 0.5728 0.2720 -0.0137 -0.0089 -0.1135 201 VAL A N     
414  C CA    . VAL A 60 ? 0.5311 0.5817 0.3047 -0.0292 -0.0175 -0.1238 201 VAL A CA    
415  C C     . VAL A 60 ? 0.5819 0.5916 0.3575 -0.0339 -0.0073 -0.1360 201 VAL A C     
416  O O     . VAL A 60 ? 0.6107 0.6023 0.3864 -0.0227 0.0041  -0.1253 201 VAL A O     
417  C CB    . VAL A 60 ? 0.4947 0.5566 0.2937 -0.0345 -0.0214 -0.1046 201 VAL A CB    
418  C CG1   . VAL A 60 ? 0.5086 0.5697 0.3269 -0.0499 -0.0290 -0.1153 201 VAL A CG1   
419  C CG2   . VAL A 60 ? 0.4721 0.5600 0.2644 -0.0279 -0.0263 -0.0887 201 VAL A CG2   
420  N N     . ASP A 61 ? 0.6123 0.6080 0.3885 -0.0502 -0.0100 -0.1582 202 ASP A N     
421  C CA    . ASP A 61 ? 0.6340 0.5811 0.4112 -0.0597 0.0033  -0.1680 202 ASP A CA    
422  C C     . ASP A 61 ? 0.5954 0.5447 0.4020 -0.0748 0.0019  -0.1591 202 ASP A C     
423  O O     . ASP A 61 ? 0.5717 0.5495 0.3957 -0.0917 -0.0091 -0.1688 202 ASP A O     
424  C CB    . ASP A 61 ? 0.7037 0.6290 0.4648 -0.0753 0.0058  -0.2011 202 ASP A CB    
425  C CG    . ASP A 61 ? 0.7558 0.6209 0.5150 -0.0905 0.0240  -0.2124 202 ASP A CG    
426  O OD1   . ASP A 61 ? 0.7690 0.5970 0.5235 -0.0765 0.0384  -0.1936 202 ASP A OD1   
427  O OD2   . ASP A 61 ? 0.8281 0.6844 0.5892 -0.1171 0.0250  -0.2408 202 ASP A OD2   
428  N N     . LEU A 62 ? 0.5799 0.5046 0.3904 -0.0658 0.0131  -0.1413 203 LEU A N     
429  C CA    . LEU A 62 ? 0.5619 0.4877 0.3964 -0.0761 0.0140  -0.1306 203 LEU A CA    
430  C C     . LEU A 62 ? 0.5953 0.4700 0.4254 -0.0886 0.0312  -0.1385 203 LEU A C     
431  O O     . LEU A 62 ? 0.5832 0.4549 0.4294 -0.0956 0.0352  -0.1286 203 LEU A O     
432  C CB    . LEU A 62 ? 0.5299 0.4697 0.3713 -0.0577 0.0144  -0.1049 203 LEU A CB    
433  C CG    . LEU A 62 ? 0.5008 0.4854 0.3496 -0.0504 0.0024  -0.0933 203 LEU A CG    
434  C CD1   . LEU A 62 ? 0.4735 0.4689 0.3337 -0.0413 0.0053  -0.0745 203 LEU A CD1   
435  C CD2   . LEU A 62 ? 0.4899 0.5045 0.3522 -0.0626 -0.0114 -0.0972 203 LEU A CD2   
436  N N     . SER A 63 ? 0.6567 0.4867 0.4626 -0.0927 0.0436  -0.1571 204 SER A N     
437  C CA    . SER A 63 ? 0.7140 0.4793 0.5084 -0.1054 0.0664  -0.1635 204 SER A CA    
438  C C     . SER A 63 ? 0.7035 0.4812 0.5271 -0.1378 0.0670  -0.1708 204 SER A C     
439  O O     . SER A 63 ? 0.7269 0.4702 0.5506 -0.1408 0.0834  -0.1585 204 SER A O     
440  C CB    . SER A 63 ? 0.7882 0.5030 0.5525 -0.1119 0.0796  -0.1889 204 SER A CB    
441  O OG    . SER A 63 ? 0.8022 0.5587 0.5770 -0.1327 0.0636  -0.2159 204 SER A OG    
442  N N     . SER A 64 ? 0.6724 0.5055 0.5197 -0.1582 0.0490  -0.1895 205 SER A N     
443  C CA    . SER A 64 ? 0.6576 0.5201 0.5373 -0.1890 0.0471  -0.2015 205 SER A CA    
444  C C     . SER A 64 ? 0.5846 0.5055 0.4940 -0.1798 0.0307  -0.1810 205 SER A C     
445  O O     . SER A 64 ? 0.5485 0.5034 0.4869 -0.2004 0.0280  -0.1894 205 SER A O     
446  C CB    . SER A 64 ? 0.6798 0.5802 0.5684 -0.2137 0.0356  -0.2375 205 SER A CB    
447  O OG    . SER A 64 ? 0.6371 0.6081 0.5365 -0.1976 0.0087  -0.2330 205 SER A OG    
448  N N     . PHE A 65 ? 0.5455 0.4791 0.4475 -0.1501 0.0212  -0.1569 206 PHE A N     
449  C CA    . PHE A 65 ? 0.4988 0.4781 0.4221 -0.1395 0.0074  -0.1387 206 PHE A CA    
450  C C     . PHE A 65 ? 0.4835 0.4459 0.4187 -0.1420 0.0197  -0.1237 206 PHE A C     
451  O O     . PHE A 65 ? 0.5060 0.4263 0.4239 -0.1304 0.0340  -0.1102 206 PHE A O     
452  C CB    . PHE A 65 ? 0.4747 0.4640 0.3842 -0.1127 -0.0009 -0.1204 206 PHE A CB    
453  C CG    . PHE A 65 ? 0.4340 0.4635 0.3598 -0.1035 -0.0136 -0.1050 206 PHE A CG    
454  C CD1   . PHE A 65 ? 0.4244 0.4969 0.3601 -0.1054 -0.0289 -0.1121 206 PHE A CD1   
455  C CD2   . PHE A 65 ? 0.4166 0.4404 0.3444 -0.0911 -0.0097 -0.0847 206 PHE A CD2   
456  C CE1   . PHE A 65 ? 0.4005 0.4989 0.3445 -0.0933 -0.0374 -0.0968 206 PHE A CE1   
457  C CE2   . PHE A 65 ? 0.3853 0.4361 0.3241 -0.0843 -0.0183 -0.0729 206 PHE A CE2   
458  C CZ    . PHE A 65 ? 0.3785 0.4613 0.3237 -0.0844 -0.0310 -0.0776 206 PHE A CZ    
459  N N     . ASP A 66 ? 0.4637 0.4632 0.4266 -0.1543 0.0140  -0.1265 207 ASP A N     
460  C CA    . ASP A 66 ? 0.4520 0.4444 0.4274 -0.1568 0.0245  -0.1135 207 ASP A CA    
461  C C     . ASP A 66 ? 0.4095 0.4275 0.3896 -0.1338 0.0127  -0.0929 207 ASP A C     
462  O O     . ASP A 66 ? 0.3598 0.4224 0.3554 -0.1300 -0.0027 -0.0939 207 ASP A O     
463  C CB    . ASP A 66 ? 0.4673 0.4916 0.4721 -0.1830 0.0263  -0.1299 207 ASP A CB    
464  C CG    . ASP A 66 ? 0.4807 0.5017 0.4981 -0.1845 0.0382  -0.1157 207 ASP A CG    
465  O OD1   . ASP A 66 ? 0.5094 0.4791 0.5098 -0.1859 0.0588  -0.1063 207 ASP A OD1   
466  O OD2   . ASP A 66 ? 0.4777 0.5462 0.5183 -0.1807 0.0276  -0.1130 207 ASP A OD2   
467  N N     . PHE A 67 ? 0.3989 0.3886 0.3629 -0.1176 0.0208  -0.0758 208 PHE A N     
468  C CA    . PHE A 67 ? 0.3790 0.3875 0.3442 -0.0993 0.0126  -0.0600 208 PHE A CA    
469  C C     . PHE A 67 ? 0.3627 0.4002 0.3498 -0.1013 0.0077  -0.0560 208 PHE A C     
470  O O     . PHE A 67 ? 0.3210 0.3806 0.3122 -0.0920 -0.0029 -0.0509 208 PHE A O     
471  C CB    . PHE A 67 ? 0.3860 0.3692 0.3336 -0.0835 0.0230  -0.0465 208 PHE A CB    
472  C CG    . PHE A 67 ? 0.3470 0.3531 0.2950 -0.0690 0.0148  -0.0368 208 PHE A CG    
473  C CD1   . PHE A 67 ? 0.3457 0.3608 0.2847 -0.0618 0.0085  -0.0377 208 PHE A CD1   
474  C CD2   . PHE A 67 ? 0.3341 0.3528 0.2909 -0.0651 0.0155  -0.0290 208 PHE A CD2   
475  C CE1   . PHE A 67 ? 0.3225 0.3581 0.2632 -0.0548 0.0046  -0.0316 208 PHE A CE1   
476  C CE2   . PHE A 67 ? 0.3133 0.3515 0.2708 -0.0573 0.0099  -0.0249 208 PHE A CE2   
477  C CZ    . PHE A 67 ? 0.3171 0.3633 0.2676 -0.0540 0.0053  -0.0265 208 PHE A CZ    
478  N N     . ARG A 68 ? 0.3880 0.4208 0.3862 -0.1129 0.0185  -0.0578 209 ARG A N     
479  C CA    . ARG A 68 ? 0.3967 0.4579 0.4157 -0.1137 0.0167  -0.0548 209 ARG A CA    
480  C C     . ARG A 68 ? 0.3808 0.4859 0.4186 -0.1151 0.0017  -0.0642 209 ARG A C     
481  O O     . ARG A 68 ? 0.3839 0.5094 0.4284 -0.1023 -0.0052 -0.0574 209 ARG A O     
482  C CB    A ARG A 68 ? 0.4192 0.4668 0.4446 -0.1279 0.0347  -0.0554 209 ARG A CB    
483  C CB    B ARG A 68 ? 0.4347 0.4858 0.4626 -0.1298 0.0341  -0.0572 209 ARG A CB    
484  C CG    A ARG A 68 ? 0.4490 0.4540 0.4492 -0.1173 0.0501  -0.0409 209 ARG A CG    
485  C CG    B ARG A 68 ? 0.4706 0.4949 0.4839 -0.1197 0.0484  -0.0414 209 ARG A CG    
486  C CD    A ARG A 68 ? 0.4531 0.4584 0.4577 -0.1178 0.0634  -0.0321 209 ARG A CD    
487  C CD    B ARG A 68 ? 0.4816 0.5168 0.5112 -0.1323 0.0617  -0.0416 209 ARG A CD    
488  N NE    A ARG A 68 ? 0.4239 0.4696 0.4471 -0.1104 0.0516  -0.0310 209 ARG A NE    
489  N NE    B ARG A 68 ? 0.4791 0.5509 0.5236 -0.1206 0.0520  -0.0376 209 ARG A NE    
490  C CZ    A ARG A 68 ? 0.3948 0.4451 0.4099 -0.0928 0.0487  -0.0212 209 ARG A CZ    
491  C CZ    B ARG A 68 ? 0.4577 0.5730 0.5287 -0.1252 0.0435  -0.0469 209 ARG A CZ    
492  N NH1   A ARG A 68 ? 0.3660 0.4458 0.3962 -0.0877 0.0401  -0.0229 209 ARG A NH1   
493  N NH1   B ARG A 68 ? 0.4591 0.5976 0.5489 -0.1438 0.0419  -0.0626 209 ARG A NH1   
494  N NH2   A ARG A 68 ? 0.3983 0.4261 0.3893 -0.0791 0.0545  -0.0113 209 ARG A NH2   
495  N NH2   B ARG A 68 ? 0.4293 0.5668 0.5066 -0.1096 0.0370  -0.0418 209 ARG A NH2   
496  N N     . THR A 69 ? 0.3862 0.5057 0.4302 -0.1290 -0.0021 -0.0807 210 THR A N     
497  C CA    . THR A 69 ? 0.3813 0.5534 0.4431 -0.1283 -0.0170 -0.0923 210 THR A CA    
498  C C     . THR A 69 ? 0.3875 0.5687 0.4327 -0.1129 -0.0322 -0.0916 210 THR A C     
499  O O     . THR A 69 ? 0.4167 0.6390 0.4680 -0.1005 -0.0457 -0.0938 210 THR A O     
500  C CB    . THR A 69 ? 0.3989 0.5954 0.4799 -0.1554 -0.0133 -0.1164 210 THR A CB    
501  O OG1   . THR A 69 ? 0.4012 0.5626 0.4635 -0.1674 -0.0083 -0.1265 210 THR A OG1   
502  C CG2   . THR A 69 ? 0.3995 0.5928 0.4994 -0.1742 0.0050  -0.1180 210 THR A CG2   
503  N N     . GLY A 70 ? 0.3747 0.5201 0.3969 -0.1115 -0.0292 -0.0884 211 GLY A N     
504  C CA    . GLY A 70 ? 0.3744 0.5252 0.3777 -0.0984 -0.0402 -0.0872 211 GLY A CA    
505  C C     . GLY A 70 ? 0.3885 0.5668 0.3926 -0.1087 -0.0488 -0.1095 211 GLY A C     
506  O O     . GLY A 70 ? 0.3782 0.5760 0.3680 -0.0953 -0.0606 -0.1099 211 GLY A O     
507  N N     . LYS A 71 ? 0.4025 0.5797 0.4209 -0.1336 -0.0408 -0.1285 212 LYS A N     
508  C CA    . LYS A 71 ? 0.4231 0.6320 0.4488 -0.1512 -0.0471 -0.1566 212 LYS A CA    
509  C C     . LYS A 71 ? 0.4758 0.6349 0.4832 -0.1682 -0.0338 -0.1696 212 LYS A C     
510  O O     . LYS A 71 ? 0.4681 0.5755 0.4698 -0.1755 -0.0152 -0.1619 212 LYS A O     
511  C CB    . LYS A 71 ? 0.4122 0.6628 0.4729 -0.1726 -0.0446 -0.1731 212 LYS A CB    
512  C CG    . LYS A 71 ? 0.3900 0.7068 0.4684 -0.1535 -0.0614 -0.1694 212 LYS A CG    
513  C CD    . LYS A 71 ? 0.3882 0.7565 0.5050 -0.1755 -0.0580 -0.1884 212 LYS A CD    
514  N N     . MET A 72 ? 0.5215 0.6953 0.5158 -0.1707 -0.0430 -0.1888 213 MET A N     
515  C CA    . MET A 72 ? 0.6000 0.7330 0.5789 -0.1906 -0.0305 -0.2101 213 MET A CA    
516  C C     . MET A 72 ? 0.6520 0.7929 0.6558 -0.2284 -0.0193 -0.2374 213 MET A C     
517  O O     . MET A 72 ? 0.6509 0.8603 0.6829 -0.2396 -0.0316 -0.2544 213 MET A O     
518  C CB    . MET A 72 ? 0.6231 0.7799 0.5821 -0.1835 -0.0450 -0.2271 213 MET A CB    
519  C CG    . MET A 72 ? 0.5993 0.7420 0.5304 -0.1511 -0.0506 -0.2024 213 MET A CG    
520  S SD    . MET A 72 ? 0.6164 0.6783 0.5223 -0.1433 -0.0286 -0.1863 213 MET A SD    
521  C CE    . MET A 72 ? 0.5926 0.6673 0.4737 -0.1114 -0.0385 -0.1659 213 MET A CE    
522  N N     . MET A 73 ? 0.7207 0.7926 0.7124 -0.2470 0.0056  -0.2417 214 MET A N     
523  C CA    . MET A 73 ? 0.7803 0.8431 0.7920 -0.2869 0.0244  -0.2642 214 MET A CA    
524  C C     . MET A 73 ? 0.8394 0.8701 0.8362 -0.3167 0.0361  -0.3003 214 MET A C     
525  O O     . MET A 73 ? 0.8593 0.8758 0.8292 -0.3028 0.0285  -0.3068 214 MET A O     
526  C CB    . MET A 73 ? 0.8127 0.8111 0.8173 -0.2862 0.0499  -0.2391 214 MET A CB    
527  C CG    . MET A 73 ? 0.7815 0.8110 0.8025 -0.2630 0.0414  -0.2090 214 MET A CG    
528  S SD    . MET A 73 ? 0.8161 0.9379 0.8872 -0.2807 0.0300  -0.2227 214 MET A SD    
529  C CE    . MET A 73 ? 0.7586 0.8723 0.8338 -0.2549 0.0343  -0.1846 214 MET A CE    
530  N N     . LYS B 7  ? 0.7121 1.2752 0.6890 -0.0706 -0.1620 -0.1997 148 LYS B N     
531  C CA    . LYS B 7  ? 0.6991 1.2747 0.6526 -0.0208 -0.1741 -0.1628 148 LYS B CA    
532  C C     . LYS B 7  ? 0.7033 1.2144 0.6168 -0.0229 -0.1667 -0.1636 148 LYS B C     
533  O O     . LYS B 7  ? 0.6990 1.1442 0.5966 0.0060  -0.1596 -0.1338 148 LYS B O     
534  C CB    . LYS B 7  ? 0.6800 1.2109 0.6460 0.0210  -0.1685 -0.1231 148 LYS B CB    
535  N N     . ARG B 8  ? 0.7187 1.2510 0.6153 -0.0605 -0.1660 -0.2005 149 ARG B N     
536  C CA    . ARG B 8  ? 0.7159 1.2055 0.5719 -0.0623 -0.1598 -0.2049 149 ARG B CA    
537  C C     . ARG B 8  ? 0.7139 1.2869 0.5453 -0.0336 -0.1808 -0.1887 149 ARG B C     
538  O O     . ARG B 8  ? 0.7479 1.4133 0.5708 -0.0540 -0.1945 -0.2152 149 ARG B O     
539  C CB    . ARG B 8  ? 0.7580 1.2264 0.6017 -0.1144 -0.1447 -0.2530 149 ARG B CB    
540  C CG    . ARG B 8  ? 0.8056 1.2037 0.6100 -0.1155 -0.1294 -0.2574 149 ARG B CG    
541  C CD    . ARG B 8  ? 0.8424 1.1685 0.6382 -0.1574 -0.1003 -0.2949 149 ARG B CD    
542  N NE    . ARG B 8  ? 0.8294 1.0934 0.6557 -0.1605 -0.0834 -0.2869 149 ARG B NE    
543  C CZ    . ARG B 8  ? 0.8536 1.0391 0.6754 -0.1862 -0.0524 -0.3075 149 ARG B CZ    
544  N NH1   . ARG B 8  ? 0.8886 1.0346 0.6747 -0.2118 -0.0309 -0.3392 149 ARG B NH1   
545  N NH2   . ARG B 8  ? 0.8249 0.9657 0.6746 -0.1830 -0.0395 -0.2940 149 ARG B NH2   
546  N N     . MET B 9  ? 0.6857 1.2282 0.5044 0.0128  -0.1813 -0.1449 150 MET B N     
547  C CA    . MET B 9  ? 0.7070 1.3174 0.5004 0.0520  -0.1966 -0.1172 150 MET B CA    
548  C C     . MET B 9  ? 0.7296 1.2944 0.4791 0.0585  -0.1893 -0.1101 150 MET B C     
549  O O     . MET B 9  ? 0.7220 1.1902 0.4659 0.0502  -0.1709 -0.1089 150 MET B O     
550  C CB    . MET B 9  ? 0.6974 1.2946 0.5015 0.1020  -0.1950 -0.0703 150 MET B CB    
551  N N     . ASP B 10 ? 0.7558 1.3987 0.4745 0.0751  -0.2035 -0.1040 151 ASP B N     
552  C CA    . ASP B 10 ? 0.7748 1.3867 0.4481 0.0837  -0.1970 -0.0957 151 ASP B CA    
553  C C     . ASP B 10 ? 0.7675 1.2900 0.4306 0.1209  -0.1805 -0.0496 151 ASP B C     
554  O O     . ASP B 10 ? 0.7605 1.2836 0.4342 0.1570  -0.1802 -0.0144 151 ASP B O     
555  C CB    . ASP B 10 ? 0.8160 1.5425 0.4566 0.1015  -0.2168 -0.0914 151 ASP B CB    
556  N N     . CYS B 11 ? 0.7582 1.2037 0.4006 0.1097  -0.1637 -0.0522 152 CYS B N     
557  C CA    . CYS B 11 ? 0.7557 1.1202 0.3846 0.1342  -0.1453 -0.0150 152 CYS B CA    
558  C C     . CYS B 11 ? 0.8048 1.1830 0.3846 0.1550  -0.1430 0.0042  152 CYS B C     
559  O O     . CYS B 11 ? 0.8171 1.1710 0.3763 0.1360  -0.1347 -0.0127 152 CYS B O     
560  C CB    . CYS B 11 ? 0.7190 0.9983 0.3645 0.1065  -0.1270 -0.0300 152 CYS B CB    
561  S SG    . CYS B 11 ? 0.7171 0.9090 0.3498 0.1236  -0.1032 0.0072  152 CYS B SG    
562  N N     . PRO B 12 ? 0.8364 1.2528 0.3949 0.1978  -0.1475 0.0421  153 PRO B N     
563  C CA    . PRO B 12 ? 0.8868 1.3232 0.3942 0.2257  -0.1444 0.0684  153 PRO B CA    
564  C C     . PRO B 12 ? 0.9062 1.2491 0.3887 0.2236  -0.1182 0.0851  153 PRO B C     
565  O O     . PRO B 12 ? 0.9300 1.2870 0.3709 0.2335  -0.1145 0.0949  153 PRO B O     
566  C CB    . PRO B 12 ? 0.9171 1.3878 0.4148 0.2783  -0.1462 0.1140  153 PRO B CB    
567  N N     . ALA B 13 ? 0.8768 1.1342 0.3845 0.2094  -0.1002 0.0876  154 ALA B N     
568  C CA    . ALA B 13 ? 0.8847 1.0646 0.3760 0.2000  -0.0749 0.0991  154 ALA B CA    
569  C C     . ALA B 13 ? 0.8604 1.0363 0.3510 0.1672  -0.0728 0.0656  154 ALA B C     
570  O O     . ALA B 13 ? 0.8526 0.9884 0.3240 0.1630  -0.0539 0.0756  154 ALA B O     
571  C CB    . ALA B 13 ? 0.8734 0.9795 0.3919 0.1923  -0.0575 0.1093  154 ALA B CB    
572  N N     . LEU B 14 ? 0.8384 1.0511 0.3500 0.1437  -0.0879 0.0264  155 LEU B N     
573  C CA    . LEU B 14 ? 0.8379 1.0426 0.3439 0.1169  -0.0817 -0.0064 155 LEU B CA    
574  C C     . LEU B 14 ? 0.8776 1.1532 0.3503 0.1153  -0.0963 -0.0271 155 LEU B C     
575  O O     . LEU B 14 ? 0.8952 1.2356 0.3588 0.1330  -0.1146 -0.0172 155 LEU B O     
576  C CB    . LEU B 14 ? 0.7991 0.9794 0.3466 0.0897  -0.0801 -0.0366 155 LEU B CB    
577  C CG    . LEU B 14 ? 0.7646 0.8860 0.3458 0.0874  -0.0668 -0.0209 155 LEU B CG    
578  C CD1   . LEU B 14 ? 0.7274 0.8362 0.3456 0.0659  -0.0671 -0.0479 155 LEU B CD1   
579  C CD2   . LEU B 14 ? 0.7625 0.8423 0.3324 0.0870  -0.0453 -0.0067 155 LEU B CD2   
580  N N     . PRO B 15 ? 0.8949 1.1637 0.3469 0.0957  -0.0871 -0.0556 156 PRO B N     
581  C CA    . PRO B 15 ? 0.9309 1.2669 0.3485 0.0852  -0.0989 -0.0849 156 PRO B CA    
582  C C     . PRO B 15 ? 0.9207 1.3214 0.3570 0.0653  -0.1201 -0.1169 156 PRO B C     
583  O O     . PRO B 15 ? 0.8758 1.2520 0.3532 0.0515  -0.1201 -0.1269 156 PRO B O     
584  C CB    . PRO B 15 ? 0.9521 1.2429 0.3547 0.0626  -0.0774 -0.1153 156 PRO B CB    
585  C CG    . PRO B 15 ? 0.9341 1.1598 0.3449 0.0780  -0.0570 -0.0825 156 PRO B CG    
586  C CD    . PRO B 15 ? 0.8926 1.0968 0.3450 0.0871  -0.0624 -0.0570 156 PRO B CD    
587  N N     . PRO B 16 ? 0.9487 1.4398 0.3540 0.0626  -0.1377 -0.1328 157 PRO B N     
588  C CA    . PRO B 16 ? 0.9455 1.5193 0.3654 0.0374  -0.1582 -0.1680 157 PRO B CA    
589  C C     . PRO B 16 ? 0.9253 1.4502 0.3734 -0.0089 -0.1452 -0.2157 157 PRO B C     
590  O O     . PRO B 16 ? 0.9313 1.3773 0.3691 -0.0254 -0.1205 -0.2341 157 PRO B O     
591  N N     . GLY B 17 ? 0.9073 1.4769 0.3899 -0.0261 -0.1588 -0.2318 158 GLY B N     
592  C CA    . GLY B 17 ? 0.8938 1.4135 0.4040 -0.0689 -0.1438 -0.2726 158 GLY B CA    
593  C C     . GLY B 17 ? 0.8469 1.2742 0.3981 -0.0575 -0.1290 -0.2491 158 GLY B C     
594  O O     . GLY B 17 ? 0.8496 1.2426 0.4264 -0.0869 -0.1177 -0.2753 158 GLY B O     
595  N N     . TRP B 18 ? 0.8088 1.1961 0.3641 -0.0180 -0.1266 -0.2012 159 TRP B N     
596  C CA    . TRP B 18 ? 0.7662 1.0744 0.3574 -0.0096 -0.1127 -0.1805 159 TRP B CA    
597  C C     . TRP B 18 ? 0.7290 1.0711 0.3590 0.0002  -0.1289 -0.1643 159 TRP B C     
598  O O     . TRP B 18 ? 0.7289 1.1307 0.3546 0.0278  -0.1467 -0.1383 159 TRP B O     
599  C CB    . TRP B 18 ? 0.7502 1.0043 0.3296 0.0199  -0.1004 -0.1416 159 TRP B CB    
600  C CG    . TRP B 18 ? 0.7736 0.9711 0.3328 0.0100  -0.0763 -0.1556 159 TRP B CG    
601  C CD1   . TRP B 18 ? 0.8161 1.0228 0.3328 0.0108  -0.0698 -0.1640 159 TRP B CD1   
602  C CD2   . TRP B 18 ? 0.7614 0.8891 0.3409 0.0024  -0.0536 -0.1603 159 TRP B CD2   
603  N NE1   . TRP B 18 ? 0.8255 0.9703 0.3362 0.0050  -0.0434 -0.1741 159 TRP B NE1   
604  C CE2   . TRP B 18 ? 0.7953 0.8932 0.3441 0.0018  -0.0330 -0.1702 159 TRP B CE2   
605  C CE3   . TRP B 18 ? 0.7230 0.8149 0.3421 -0.0007 -0.0477 -0.1548 159 TRP B CE3   
606  C CZ2   . TRP B 18 ? 0.7934 0.8296 0.3512 0.0022  -0.0060 -0.1724 159 TRP B CZ2   
607  C CZ3   . TRP B 18 ? 0.7200 0.7528 0.3466 -0.0018 -0.0222 -0.1571 159 TRP B CZ3   
608  C CH2   . TRP B 18 ? 0.7577 0.7649 0.3545 0.0016  -0.0015 -0.1644 159 TRP B CH2   
609  N N     . LYS B 19 ? 0.6971 1.0012 0.3622 -0.0185 -0.1202 -0.1776 160 LYS B N     
610  C CA    . LYS B 19 ? 0.6596 0.9940 0.3626 -0.0125 -0.1327 -0.1668 160 LYS B CA    
611  C C     . LYS B 19 ? 0.6203 0.8827 0.3499 0.0010  -0.1201 -0.1410 160 LYS B C     
612  O O     . LYS B 19 ? 0.6070 0.8016 0.3320 -0.0024 -0.1012 -0.1395 160 LYS B O     
613  C CB    . LYS B 19 ? 0.6704 1.0427 0.3919 -0.0521 -0.1351 -0.2089 160 LYS B CB    
614  C CG    . LYS B 19 ? 0.7118 1.1746 0.4078 -0.0736 -0.1493 -0.2408 160 LYS B CG    
615  N N     . LYS B 20 ? 0.5977 0.8820 0.3538 0.0177  -0.1301 -0.1211 161 LYS B N     
616  C CA    . LYS B 20 ? 0.5718 0.7984 0.3527 0.0285  -0.1198 -0.0990 161 LYS B CA    
617  C C     . LYS B 20 ? 0.5436 0.7914 0.3622 0.0166  -0.1243 -0.1102 161 LYS B C     
618  O O     . LYS B 20 ? 0.5326 0.8524 0.3609 0.0188  -0.1399 -0.1157 161 LYS B O     
619  C CB    . LYS B 20 ? 0.5746 0.7921 0.3434 0.0646  -0.1208 -0.0591 161 LYS B CB    
620  C CG    . LYS B 20 ? 0.5565 0.7130 0.3433 0.0706  -0.1074 -0.0401 161 LYS B CG    
621  C CD    . LYS B 20 ? 0.5804 0.7175 0.3478 0.1017  -0.1019 -0.0045 161 LYS B CD    
622  C CE    . LYS B 20 ? 0.5718 0.6406 0.3446 0.0963  -0.0834 0.0072  161 LYS B CE    
623  N N     . GLU B 21 ? 0.5154 0.7081 0.3552 0.0055  -0.1102 -0.1122 162 GLU B N     
624  C CA    . GLU B 21 ? 0.4968 0.7016 0.3712 -0.0031 -0.1114 -0.1180 162 GLU B CA    
625  C C     . GLU B 21 ? 0.4552 0.6083 0.3439 0.0111  -0.1015 -0.0940 162 GLU B C     
626  O O     . GLU B 21 ? 0.4337 0.5346 0.3133 0.0104  -0.0882 -0.0868 162 GLU B O     
627  C CB    . GLU B 21 ? 0.5289 0.7225 0.4126 -0.0393 -0.1004 -0.1520 162 GLU B CB    
628  C CG    . GLU B 21 ? 0.5282 0.7399 0.4470 -0.0534 -0.0999 -0.1611 162 GLU B CG    
629  C CD    . GLU B 21 ? 0.5830 0.7784 0.5046 -0.0930 -0.0839 -0.1963 162 GLU B CD    
630  O OE1   . GLU B 21 ? 0.6732 0.8943 0.5754 -0.1157 -0.0846 -0.2241 162 GLU B OE1   
631  O OE2   . GLU B 21 ? 0.6409 0.7943 0.5802 -0.1028 -0.0676 -0.1971 162 GLU B OE2   
632  N N     . GLU B 22 ? 0.4297 0.6043 0.3396 0.0236  -0.1072 -0.0828 163 GLU B N     
633  C CA    . GLU B 22 ? 0.4052 0.5369 0.3287 0.0320  -0.0971 -0.0660 163 GLU B CA    
634  C C     . GLU B 22 ? 0.3792 0.5255 0.3345 0.0166  -0.0957 -0.0801 163 GLU B C     
635  O O     . GLU B 22 ? 0.3657 0.5695 0.3361 0.0153  -0.1063 -0.0892 163 GLU B O     
636  C CB    . GLU B 22 ? 0.4233 0.5550 0.3377 0.0625  -0.0985 -0.0397 163 GLU B CB    
637  C CG    . GLU B 22 ? 0.4398 0.5241 0.3632 0.0653  -0.0850 -0.0281 163 GLU B CG    
638  C CD    . GLU B 22 ? 0.4829 0.5324 0.3824 0.0890  -0.0750 -0.0034 163 GLU B CD    
639  O OE1   . GLU B 22 ? 0.5207 0.5248 0.4192 0.0836  -0.0607 0.0014  163 GLU B OE1   
640  O OE2   . GLU B 22 ? 0.5394 0.6055 0.4182 0.1122  -0.0786 0.0108  163 GLU B OE2   
641  N N     . VAL B 23 ? 0.3504 0.4526 0.3156 0.0055  -0.0822 -0.0807 164 VAL B N     
642  C CA    . VAL B 23 ? 0.3440 0.4498 0.3357 -0.0107 -0.0760 -0.0928 164 VAL B CA    
643  C C     . VAL B 23 ? 0.3067 0.3848 0.3094 -0.0022 -0.0678 -0.0774 164 VAL B C     
644  O O     . VAL B 23 ? 0.3029 0.3451 0.2952 -0.0009 -0.0590 -0.0681 164 VAL B O     
645  C CB    . VAL B 23 ? 0.3598 0.4380 0.3481 -0.0346 -0.0620 -0.1110 164 VAL B CB    
646  C CG1   . VAL B 23 ? 0.3604 0.4306 0.3720 -0.0504 -0.0498 -0.1190 164 VAL B CG1   
647  C CG2   . VAL B 23 ? 0.3806 0.4867 0.3562 -0.0506 -0.0674 -0.1338 164 VAL B CG2   
648  N N     . ILE B 24 ? 0.2928 0.3958 0.3167 0.0020  -0.0703 -0.0766 165 ILE B N     
649  C CA    . ILE B 24 ? 0.2810 0.3615 0.3119 0.0100  -0.0620 -0.0646 165 ILE B CA    
650  C C     . ILE B 24 ? 0.2779 0.3387 0.3198 -0.0067 -0.0499 -0.0699 165 ILE B C     
651  O O     . ILE B 24 ? 0.2833 0.3539 0.3365 -0.0230 -0.0464 -0.0836 165 ILE B O     
652  C CB    . ILE B 24 ? 0.2787 0.3930 0.3268 0.0245  -0.0659 -0.0611 165 ILE B CB    
653  C CG1   . ILE B 24 ? 0.3003 0.4364 0.3339 0.0501  -0.0750 -0.0494 165 ILE B CG1   
654  C CG2   . ILE B 24 ? 0.2814 0.3672 0.3330 0.0299  -0.0539 -0.0528 165 ILE B CG2   
655  C CD1   . ILE B 24 ? 0.3151 0.4032 0.3162 0.0625  -0.0692 -0.0340 165 ILE B CD1   
656  N N     . ARG B 25 ? 0.2830 0.3153 0.3169 -0.0039 -0.0415 -0.0590 166 ARG B N     
657  C CA    . ARG B 25 ? 0.2702 0.2900 0.3109 -0.0124 -0.0292 -0.0573 166 ARG B CA    
658  C C     . ARG B 25 ? 0.2652 0.3005 0.3256 -0.0128 -0.0268 -0.0594 166 ARG B C     
659  O O     . ARG B 25 ? 0.2489 0.2869 0.3078 -0.0028 -0.0290 -0.0552 166 ARG B O     
660  C CB    . ARG B 25 ? 0.2653 0.2702 0.2901 -0.0094 -0.0240 -0.0457 166 ARG B CB    
661  C CG    . ARG B 25 ? 0.2769 0.2723 0.2849 -0.0083 -0.0232 -0.0421 166 ARG B CG    
662  C CD    . ARG B 25 ? 0.2663 0.2633 0.2603 -0.0082 -0.0199 -0.0321 166 ARG B CD    
663  N NE    . ARG B 25 ? 0.2564 0.2525 0.2382 -0.0048 -0.0170 -0.0272 166 ARG B NE    
664  C CZ    . ARG B 25 ? 0.2610 0.2709 0.2401 -0.0011 -0.0083 -0.0171 166 ARG B CZ    
665  N NH1   . ARG B 25 ? 0.2487 0.2806 0.2343 -0.0018 -0.0028 -0.0098 166 ARG B NH1   
666  N NH2   . ARG B 25 ? 0.2732 0.2824 0.2413 0.0055  -0.0043 -0.0128 166 ARG B NH2   
667  N N     . LYS B 26 ? 0.2672 0.3074 0.3431 -0.0243 -0.0183 -0.0657 167 LYS B N     
668  C CA    A LYS B 26 ? 0.2674 0.3310 0.3657 -0.0271 -0.0156 -0.0701 167 LYS B CA    
669  C CA    B LYS B 26 ? 0.2709 0.3344 0.3689 -0.0269 -0.0158 -0.0700 167 LYS B CA    
670  C C     . LYS B 26 ? 0.2660 0.3201 0.3645 -0.0245 -0.0048 -0.0609 167 LYS B C     
671  O O     . LYS B 26 ? 0.2631 0.3343 0.3755 -0.0224 -0.0025 -0.0626 167 LYS B O     
672  C CB    A LYS B 26 ? 0.2800 0.3592 0.3958 -0.0470 -0.0097 -0.0851 167 LYS B CB    
673  C CB    B LYS B 26 ? 0.2883 0.3662 0.4027 -0.0465 -0.0102 -0.0848 167 LYS B CB    
674  C CG    A LYS B 26 ? 0.2975 0.3389 0.4042 -0.0610 0.0092  -0.0861 167 LYS B CG    
675  C CG    B LYS B 26 ? 0.3000 0.4010 0.4126 -0.0527 -0.0225 -0.0983 167 LYS B CG    
676  C CD    A LYS B 26 ? 0.3220 0.3701 0.4448 -0.0870 0.0230  -0.1031 167 LYS B CD    
677  C CD    B LYS B 26 ? 0.3267 0.4417 0.4515 -0.0818 -0.0138 -0.1196 167 LYS B CD    
678  C CE    A LYS B 26 ? 0.3458 0.3947 0.4619 -0.1074 0.0224  -0.1245 167 LYS B CE    
679  C CE    B LYS B 26 ? 0.3536 0.4104 0.4613 -0.0954 0.0085  -0.1213 167 LYS B CE    
680  N NZ    A LYS B 26 ? 0.3797 0.4119 0.5008 -0.1408 0.0464  -0.1434 167 LYS B NZ    
681  N NZ    B LYS B 26 ? 0.3872 0.4468 0.4979 -0.1292 0.0204  -0.1478 167 LYS B NZ    
682  N N     . SER B 27 ? 0.2722 0.3067 0.3545 -0.0232 0.0018  -0.0509 168 SER B N     
683  C CA    . SER B 27 ? 0.2772 0.3145 0.3574 -0.0220 0.0121  -0.0422 168 SER B CA    
684  C C     . SER B 27 ? 0.2789 0.3153 0.3386 -0.0179 0.0129  -0.0315 168 SER B C     
685  O O     . SER B 27 ? 0.2808 0.3103 0.3292 -0.0159 0.0072  -0.0300 168 SER B O     
686  C CB    . SER B 27 ? 0.2904 0.3231 0.3808 -0.0281 0.0277  -0.0393 168 SER B CB    
687  O OG    . SER B 27 ? 0.3130 0.3224 0.3928 -0.0275 0.0373  -0.0333 168 SER B OG    
688  N N     . GLY B 28 ? 0.2703 0.3218 0.3253 -0.0175 0.0202  -0.0244 169 GLY B N     
689  C CA    . GLY B 28 ? 0.2501 0.3224 0.2882 -0.0159 0.0212  -0.0148 169 GLY B CA    
690  C C     . GLY B 28 ? 0.2505 0.3295 0.2751 -0.0263 0.0143  -0.0249 169 GLY B C     
691  O O     . GLY B 28 ? 0.2612 0.3201 0.2862 -0.0301 0.0119  -0.0372 169 GLY B O     
692  N N     . LEU B 29 ? 0.2610 0.3696 0.2719 -0.0304 0.0141  -0.0193 170 LEU B N     
693  C CA    . LEU B 29 ? 0.2797 0.3950 0.2740 -0.0482 0.0118  -0.0313 170 LEU B CA    
694  C C     . LEU B 29 ? 0.2889 0.3625 0.2789 -0.0497 0.0075  -0.0389 170 LEU B C     
695  O O     . LEU B 29 ? 0.2995 0.3474 0.2770 -0.0601 0.0118  -0.0511 170 LEU B O     
696  C CB    . LEU B 29 ? 0.2959 0.4637 0.2811 -0.0529 0.0113  -0.0231 170 LEU B CB    
697  C CG    . LEU B 29 ? 0.3198 0.5461 0.3038 -0.0487 0.0158  -0.0121 170 LEU B CG    
698  C CD1   . LEU B 29 ? 0.3287 0.6248 0.3058 -0.0492 0.0140  -0.0013 170 LEU B CD1   
699  C CD2   . LEU B 29 ? 0.3274 0.5590 0.3026 -0.0671 0.0198  -0.0290 170 LEU B CD2   
700  N N     . SER B 30 ? 0.2826 0.3458 0.2793 -0.0376 0.0020  -0.0309 171 SER B N     
701  C CA    . SER B 30 ? 0.2951 0.3258 0.2856 -0.0355 -0.0029 -0.0351 171 SER B CA    
702  C C     . SER B 30 ? 0.2993 0.3074 0.3016 -0.0240 -0.0071 -0.0387 171 SER B C     
703  O O     . SER B 30 ? 0.3243 0.3176 0.3228 -0.0169 -0.0131 -0.0385 171 SER B O     
704  C CB    . SER B 30 ? 0.2843 0.3228 0.2720 -0.0301 -0.0063 -0.0269 171 SER B CB    
705  O OG    . SER B 30 ? 0.2591 0.3005 0.2590 -0.0176 -0.0048 -0.0198 171 SER B OG    
706  N N     . ALA B 31 ? 0.2727 0.2864 0.2890 -0.0217 -0.0039 -0.0414 172 ALA B N     
707  C CA    . ALA B 31 ? 0.2850 0.2939 0.3161 -0.0116 -0.0075 -0.0454 172 ALA B CA    
708  C C     . ALA B 31 ? 0.2917 0.2809 0.3108 -0.0011 -0.0097 -0.0458 172 ALA B C     
709  O O     . ALA B 31 ? 0.2915 0.2573 0.2914 -0.0035 -0.0009 -0.0468 172 ALA B O     
710  C CB    . ALA B 31 ? 0.2854 0.3042 0.3293 -0.0116 -0.0001 -0.0487 172 ALA B CB    
711  N N     . GLY B 32 ? 0.2897 0.2884 0.3167 0.0099  -0.0190 -0.0447 173 GLY B N     
712  C CA    . GLY B 32 ? 0.3238 0.3079 0.3365 0.0277  -0.0191 -0.0390 173 GLY B CA    
713  C C     . GLY B 32 ? 0.3352 0.2968 0.3226 0.0275  -0.0201 -0.0331 173 GLY B C     
714  O O     . GLY B 32 ? 0.3501 0.3068 0.3261 0.0457  -0.0224 -0.0251 173 GLY B O     
715  N N     . LYS B 33 ? 0.3204 0.2752 0.2991 0.0098  -0.0178 -0.0349 174 LYS B N     
716  C CA    . LYS B 33 ? 0.3280 0.2742 0.2889 0.0076  -0.0205 -0.0303 174 LYS B CA    
717  C C     . LYS B 33 ? 0.3127 0.2835 0.2852 0.0130  -0.0334 -0.0321 174 LYS B C     
718  O O     . LYS B 33 ? 0.3093 0.3014 0.3034 0.0119  -0.0377 -0.0387 174 LYS B O     
719  C CB    . LYS B 33 ? 0.3275 0.2768 0.2812 -0.0119 -0.0146 -0.0316 174 LYS B CB    
720  C CG    . LYS B 33 ? 0.3494 0.2834 0.2900 -0.0277 -0.0007 -0.0367 174 LYS B CG    
721  C CD    . LYS B 33 ? 0.3915 0.2792 0.3051 -0.0255 0.0120  -0.0348 174 LYS B CD    
722  C CE    . LYS B 33 ? 0.4260 0.2913 0.3207 -0.0501 0.0310  -0.0458 174 LYS B CE    
723  N NZ    . LYS B 33 ? 0.4886 0.2925 0.3510 -0.0490 0.0515  -0.0438 174 LYS B NZ    
724  N N     . SER B 34 ? 0.3087 0.2757 0.2650 0.0161  -0.0371 -0.0284 175 SER B N     
725  C CA    . SER B 34 ? 0.3068 0.2948 0.2675 0.0174  -0.0471 -0.0345 175 SER B CA    
726  C C     . SER B 34 ? 0.3159 0.2975 0.2629 0.0111  -0.0445 -0.0340 175 SER B C     
727  O O     . SER B 34 ? 0.2994 0.2675 0.2317 0.0078  -0.0375 -0.0262 175 SER B O     
728  C CB    . SER B 34 ? 0.3211 0.3252 0.2739 0.0340  -0.0565 -0.0311 175 SER B CB    
729  O OG    . SER B 34 ? 0.3474 0.3268 0.2735 0.0438  -0.0512 -0.0179 175 SER B OG    
730  N N     . ASP B 35 ? 0.3172 0.3095 0.2679 0.0077  -0.0477 -0.0443 176 ASP B N     
731  C CA    . ASP B 35 ? 0.3336 0.3191 0.2688 0.0061  -0.0436 -0.0458 176 ASP B CA    
732  C C     . ASP B 35 ? 0.3663 0.3653 0.2859 0.0102  -0.0536 -0.0522 176 ASP B C     
733  O O     . ASP B 35 ? 0.3405 0.3644 0.2684 0.0090  -0.0632 -0.0624 176 ASP B O     
734  C CB    . ASP B 35 ? 0.3403 0.3175 0.2840 -0.0006 -0.0330 -0.0541 176 ASP B CB    
735  C CG    . ASP B 35 ? 0.3414 0.3148 0.2968 0.0003  -0.0228 -0.0434 176 ASP B CG    
736  O OD1   . ASP B 35 ? 0.3227 0.2993 0.2703 0.0049  -0.0164 -0.0319 176 ASP B OD1   
737  O OD2   . ASP B 35 ? 0.3057 0.2813 0.2778 -0.0036 -0.0216 -0.0462 176 ASP B OD2   
738  N N     . VAL B 36 ? 0.3767 0.3680 0.2740 0.0145  -0.0512 -0.0461 177 VAL B N     
739  C CA    . VAL B 36 ? 0.4017 0.4081 0.2777 0.0205  -0.0596 -0.0489 177 VAL B CA    
740  C C     . VAL B 36 ? 0.4210 0.4204 0.2845 0.0128  -0.0521 -0.0622 177 VAL B C     
741  O O     . VAL B 36 ? 0.4129 0.3925 0.2745 0.0130  -0.0387 -0.0565 177 VAL B O     
742  C CB    . VAL B 36 ? 0.4188 0.4152 0.2741 0.0330  -0.0585 -0.0293 177 VAL B CB    
743  C CG1   . VAL B 36 ? 0.4637 0.4772 0.2918 0.0425  -0.0652 -0.0280 177 VAL B CG1   
744  C CG2   . VAL B 36 ? 0.4188 0.4115 0.2820 0.0427  -0.0602 -0.0182 177 VAL B CG2   
745  N N     . TYR B 37 ? 0.4480 0.4676 0.3035 0.0057  -0.0587 -0.0811 178 TYR B N     
746  C CA    . TYR B 37 ? 0.4854 0.4915 0.3241 -0.0048 -0.0476 -0.1001 178 TYR B CA    
747  C C     . TYR B 37 ? 0.5036 0.5378 0.3149 -0.0034 -0.0577 -0.1076 178 TYR B C     
748  O O     . TYR B 37 ? 0.5184 0.5945 0.3294 0.0019  -0.0751 -0.1050 178 TYR B O     
749  C CB    . TYR B 37 ? 0.5186 0.5181 0.3696 -0.0258 -0.0398 -0.1256 178 TYR B CB    
750  C CG    . TYR B 37 ? 0.5044 0.4794 0.3803 -0.0264 -0.0289 -0.1178 178 TYR B CG    
751  C CD1   . TYR B 37 ? 0.5091 0.4502 0.3839 -0.0154 -0.0113 -0.1031 178 TYR B CD1   
752  C CD2   . TYR B 37 ? 0.5154 0.5098 0.4162 -0.0361 -0.0359 -0.1236 178 TYR B CD2   
753  C CE1   . TYR B 37 ? 0.5079 0.4349 0.4034 -0.0129 -0.0017 -0.0929 178 TYR B CE1   
754  C CE2   . TYR B 37 ? 0.4993 0.4729 0.4208 -0.0357 -0.0253 -0.1150 178 TYR B CE2   
755  C CZ    . TYR B 37 ? 0.4917 0.4315 0.4090 -0.0240 -0.0085 -0.0995 178 TYR B CZ    
756  O OH    . TYR B 37 ? 0.4777 0.4054 0.4125 -0.0212 0.0013  -0.0890 178 TYR B OH    
757  N N     . TYR B 38 ? 0.5241 0.5396 0.3107 -0.0048 -0.0457 -0.1151 179 TYR B N     
758  C CA    . TYR B 38 ? 0.5471 0.5906 0.3028 -0.0063 -0.0531 -0.1266 179 TYR B CA    
759  C C     . TYR B 38 ? 0.5927 0.6232 0.3325 -0.0286 -0.0400 -0.1612 179 TYR B C     
760  O O     . TYR B 38 ? 0.6209 0.6024 0.3646 -0.0340 -0.0172 -0.1682 179 TYR B O     
761  C CB    . TYR B 38 ? 0.5430 0.5770 0.2762 0.0112  -0.0487 -0.1052 179 TYR B CB    
762  C CG    . TYR B 38 ? 0.5212 0.5674 0.2585 0.0287  -0.0595 -0.0755 179 TYR B CG    
763  C CD1   . TYR B 38 ? 0.5421 0.6272 0.2629 0.0406  -0.0751 -0.0673 179 TYR B CD1   
764  C CD2   . TYR B 38 ? 0.4909 0.5099 0.2458 0.0337  -0.0514 -0.0554 179 TYR B CD2   
765  C CE1   . TYR B 38 ? 0.5399 0.6214 0.2589 0.0605  -0.0777 -0.0372 179 TYR B CE1   
766  C CE2   . TYR B 38 ? 0.4859 0.5028 0.2391 0.0455  -0.0546 -0.0315 179 TYR B CE2   
767  C CZ    . TYR B 38 ? 0.5057 0.5461 0.2402 0.0602  -0.0655 -0.0216 179 TYR B CZ    
768  O OH    . TYR B 38 ? 0.5203 0.5438 0.2481 0.0747  -0.0615 0.0038  179 TYR B OH    
769  N N     . PHE B 39 ? 0.6229 0.6985 0.3418 -0.0413 -0.0519 -0.1829 180 PHE B N     
770  C CA    . PHE B 39 ? 0.6832 0.7493 0.3797 -0.0701 -0.0380 -0.2232 180 PHE B CA    
771  C C     . PHE B 39 ? 0.7265 0.8180 0.3805 -0.0685 -0.0411 -0.2329 180 PHE B C     
772  O O     . PHE B 39 ? 0.7158 0.8740 0.3605 -0.0597 -0.0653 -0.2248 180 PHE B O     
773  C CB    . PHE B 39 ? 0.6916 0.8014 0.4052 -0.1002 -0.0482 -0.2516 180 PHE B CB    
774  C CG    . PHE B 39 ? 0.6641 0.7414 0.4138 -0.1056 -0.0392 -0.2467 180 PHE B CG    
775  C CD1   . PHE B 39 ? 0.6946 0.7026 0.4416 -0.1248 -0.0076 -0.2661 180 PHE B CD1   
776  C CD2   . PHE B 39 ? 0.6238 0.7327 0.4069 -0.0878 -0.0582 -0.2197 180 PHE B CD2   
777  C CE1   . PHE B 39 ? 0.6738 0.6513 0.4514 -0.1268 0.0025  -0.2577 180 PHE B CE1   
778  C CE2   . PHE B 39 ? 0.5841 0.6643 0.3988 -0.0925 -0.0490 -0.2149 180 PHE B CE2   
779  C CZ    . PHE B 39 ? 0.6113 0.6288 0.4235 -0.1120 -0.0197 -0.2331 180 PHE B CZ    
780  N N     . SER B 40 ? 0.7693 0.8079 0.3957 -0.0729 -0.0146 -0.2476 181 SER B N     
781  C CA    . SER B 40 ? 0.8287 0.8857 0.4106 -0.0757 -0.0126 -0.2634 181 SER B CA    
782  C C     . SER B 40 ? 0.8805 0.9870 0.4437 -0.1142 -0.0205 -0.3096 181 SER B C     
783  O O     . SER B 40 ? 0.8794 1.0023 0.4668 -0.1385 -0.0251 -0.3279 181 SER B O     
784  C CB    . SER B 40 ? 0.8609 0.8445 0.4188 -0.0683 0.0225  -0.2676 181 SER B CB    
785  O OG    . SER B 40 ? 0.9054 0.8363 0.4493 -0.0962 0.0517  -0.3068 181 SER B OG    
786  N N     . PRO B 41 ? 0.9451 1.0838 0.4650 -0.1223 -0.0220 -0.3300 182 PRO B N     
787  C CA    . PRO B 41 ? 0.9948 1.1894 0.4941 -0.1660 -0.0279 -0.3804 182 PRO B CA    
788  C C     . PRO B 41 ? 1.0499 1.1750 0.5442 -0.2094 0.0064  -0.4271 182 PRO B C     
789  O O     . PRO B 41 ? 1.0616 1.2268 0.5679 -0.2487 0.0005  -0.4600 182 PRO B O     
790  C CB    . PRO B 41 ? 1.0381 1.2644 0.4859 -0.1628 -0.0294 -0.3909 182 PRO B CB    
791  C CG    . PRO B 41 ? 0.9925 1.2142 0.4443 -0.1124 -0.0388 -0.3352 182 PRO B CG    
792  C CD    . PRO B 41 ? 0.9531 1.0925 0.4407 -0.0951 -0.0206 -0.3091 182 PRO B CD    
793  N N     . SER B 42 ? 1.0894 1.1122 0.5653 -0.2007 0.0448  -0.4281 183 SER B N     
794  C CA    . SER B 42 ? 1.1539 1.0863 0.6204 -0.2322 0.0874  -0.4638 183 SER B CA    
795  C C     . SER B 42 ? 1.1236 1.0424 0.6373 -0.2397 0.0860  -0.4538 183 SER B C     
796  O O     . SER B 42 ? 1.1773 1.0623 0.6868 -0.2822 0.1090  -0.4924 183 SER B O     
797  C CB    . SER B 42 ? 1.1877 1.0160 0.6321 -0.2027 0.1287  -0.4494 183 SER B CB    
798  N N     . GLY B 43 ? 1.0400 0.9833 0.5953 -0.2010 0.0613  -0.4037 184 GLY B N     
799  C CA    . GLY B 43 ? 0.9962 0.9307 0.5966 -0.2016 0.0581  -0.3884 184 GLY B CA    
800  C C     . GLY B 43 ? 0.9636 0.8213 0.5823 -0.1649 0.0795  -0.3497 184 GLY B C     
801  O O     . GLY B 43 ? 0.9295 0.7643 0.5783 -0.1671 0.0857  -0.3406 184 GLY B O     
802  N N     . LYS B 44 ? 0.9668 0.7922 0.5670 -0.1317 0.0915  -0.3272 185 LYS B N     
803  C CA    . LYS B 44 ? 0.9371 0.7164 0.5572 -0.0931 0.1064  -0.2862 185 LYS B CA    
804  C C     . LYS B 44 ? 0.8504 0.6820 0.5144 -0.0757 0.0729  -0.2503 185 LYS B C     
805  O O     . LYS B 44 ? 0.8286 0.7235 0.4968 -0.0707 0.0412  -0.2399 185 LYS B O     
806  C CB    . LYS B 44 ? 0.9484 0.7114 0.5440 -0.0620 0.1193  -0.2684 185 LYS B CB    
807  N N     . LYS B 45 ? 0.8124 0.6135 0.5046 -0.0656 0.0835  -0.2315 186 LYS B N     
808  C CA    . LYS B 45 ? 0.7394 0.5799 0.4709 -0.0522 0.0576  -0.2013 186 LYS B CA    
809  C C     . LYS B 45 ? 0.6857 0.5258 0.4240 -0.0176 0.0589  -0.1635 186 LYS B C     
810  O O     . LYS B 45 ? 0.6878 0.4873 0.4179 0.0003  0.0866  -0.1533 186 LYS B O     
811  C CB    . LYS B 45 ? 0.7513 0.5654 0.5074 -0.0633 0.0691  -0.2039 186 LYS B CB    
812  C CG    . LYS B 45 ? 0.7120 0.5644 0.5064 -0.0539 0.0451  -0.1787 186 LYS B CG    
813  C CD    . LYS B 45 ? 0.7203 0.5430 0.5344 -0.0656 0.0610  -0.1827 186 LYS B CD    
814  C CE    . LYS B 45 ? 0.6688 0.5362 0.5180 -0.0648 0.0360  -0.1686 186 LYS B CE    
815  N N     . PHE B 46 ? 0.6225 0.5094 0.3745 -0.0083 0.0319  -0.1428 187 PHE B N     
816  C CA    . PHE B 46 ? 0.5820 0.4779 0.3409 0.0150  0.0322  -0.1112 187 PHE B CA    
817  C C     . PHE B 46 ? 0.5137 0.4308 0.3040 0.0172  0.0164  -0.0918 187 PHE B C     
818  O O     . PHE B 46 ? 0.4955 0.4358 0.2945 0.0080  -0.0038 -0.0959 187 PHE B O     
819  C CB    . PHE B 46 ? 0.5924 0.5128 0.3274 0.0203  0.0226  -0.1068 187 PHE B CB    
820  C CG    . PHE B 46 ? 0.6492 0.5477 0.3510 0.0211  0.0420  -0.1241 187 PHE B CG    
821  C CD1   . PHE B 46 ? 0.7004 0.5995 0.3777 0.0012  0.0396  -0.1564 187 PHE B CD1   
822  C CD2   . PHE B 46 ? 0.6633 0.5440 0.3579 0.0409  0.0651  -0.1103 187 PHE B CD2   
823  C CE1   . PHE B 46 ? 0.7575 0.6299 0.3989 -0.0009 0.0614  -0.1770 187 PHE B CE1   
824  C CE2   . PHE B 46 ? 0.7226 0.5766 0.3841 0.0446  0.0877  -0.1266 187 PHE B CE2   
825  C CZ    . PHE B 46 ? 0.7723 0.6165 0.4049 0.0224  0.0869  -0.1615 187 PHE B CZ    
826  N N     . ARG B 47 ? 0.4839 0.3983 0.2897 0.0306  0.0268  -0.0707 188 ARG B N     
827  C CA    . ARG B 47 ? 0.4502 0.3814 0.2837 0.0299  0.0165  -0.0557 188 ARG B CA    
828  C C     . ARG B 47 ? 0.4293 0.3883 0.2674 0.0348  0.0109  -0.0344 188 ARG B C     
829  O O     . ARG B 47 ? 0.4193 0.3915 0.2757 0.0299  0.0036  -0.0253 188 ARG B O     
830  C CB    . ARG B 47 ? 0.4481 0.3607 0.2962 0.0364  0.0340  -0.0514 188 ARG B CB    
831  C CG    . ARG B 47 ? 0.4800 0.3551 0.3210 0.0253  0.0459  -0.0743 188 ARG B CG    
832  C CD    . ARG B 47 ? 0.4774 0.3339 0.3355 0.0280  0.0594  -0.0678 188 ARG B CD    
833  N NE    . ARG B 47 ? 0.4851 0.3350 0.3407 0.0545  0.0814  -0.0448 188 ARG B NE    
834  C CZ    . ARG B 47 ? 0.4576 0.3181 0.3294 0.0683  0.0885  -0.0241 188 ARG B CZ    
835  N NH1   . ARG B 47 ? 0.4254 0.2967 0.3174 0.0560  0.0764  -0.0246 188 ARG B NH1   
836  N NH2   . ARG B 47 ? 0.4743 0.3409 0.3410 0.0975  0.1089  -0.0012 188 ARG B NH2   
837  N N     . SER B 48 ? 0.4267 0.3940 0.2465 0.0406  0.0163  -0.0290 189 SER B N     
838  C CA    . SER B 48 ? 0.4161 0.4090 0.2373 0.0384  0.0151  -0.0123 189 SER B CA    
839  C C     . SER B 48 ? 0.4503 0.4456 0.2455 0.0392  0.0160  -0.0106 189 SER B C     
840  O O     . SER B 48 ? 0.4677 0.4503 0.2426 0.0453  0.0198  -0.0221 189 SER B O     
841  C CB    . SER B 48 ? 0.4075 0.4272 0.2433 0.0470  0.0289  0.0009  189 SER B CB    
842  O OG    . SER B 48 ? 0.4206 0.4419 0.2431 0.0633  0.0452  0.0030  189 SER B OG    
843  N N     . LYS B 49 ? 0.4335 0.4425 0.2260 0.0306  0.0155  0.0018  190 LYS B N     
844  C CA    . LYS B 49 ? 0.4713 0.4810 0.2375 0.0306  0.0194  0.0073  190 LYS B CA    
845  C C     . LYS B 49 ? 0.4753 0.5063 0.2369 0.0398  0.0354  0.0105  190 LYS B C     
846  O O     . LYS B 49 ? 0.4882 0.5123 0.2255 0.0474  0.0394  0.0062  190 LYS B O     
847  C CB    . LYS B 49 ? 0.4851 0.4922 0.2453 0.0160  0.0214  0.0198  190 LYS B CB    
848  C CG    . LYS B 49 ? 0.5290 0.5266 0.2559 0.0184  0.0267  0.0277  190 LYS B CG    
849  C CD    . LYS B 49 ? 0.5605 0.5426 0.2761 0.0021  0.0372  0.0408  190 LYS B CD    
850  C CE    . LYS B 49 ? 0.6127 0.5790 0.2907 0.0090  0.0445  0.0522  190 LYS B CE    
851  N NZ    . LYS B 49 ? 0.6529 0.5842 0.3117 -0.0044 0.0600  0.0666  190 LYS B NZ    
852  N N     . PRO B 50 ? 0.4580 0.5214 0.2423 0.0416  0.0452  0.0186  191 PRO B N     
853  C CA    . PRO B 50 ? 0.4749 0.5624 0.2545 0.0588  0.0627  0.0239  191 PRO B CA    
854  C C     . PRO B 50 ? 0.5091 0.5618 0.2732 0.0787  0.0711  0.0113  191 PRO B C     
855  O O     . PRO B 50 ? 0.5284 0.5792 0.2708 0.0900  0.0841  0.0093  191 PRO B O     
856  C CB    . PRO B 50 ? 0.4505 0.5893 0.2595 0.0623  0.0700  0.0368  191 PRO B CB    
857  C CG    . PRO B 50 ? 0.4262 0.5727 0.2496 0.0359  0.0570  0.0366  191 PRO B CG    
858  C CD    . PRO B 50 ? 0.4355 0.5242 0.2470 0.0306  0.0427  0.0246  191 PRO B CD    
859  N N     . GLN B 51 ? 0.5088 0.5309 0.2804 0.0799  0.0666  0.0006  192 GLN B N     
860  C CA    . GLN B 51 ? 0.5618 0.5413 0.3152 0.0912  0.0799  -0.0164 192 GLN B CA    
861  C C     . GLN B 51 ? 0.5885 0.5484 0.3104 0.0806  0.0723  -0.0356 192 GLN B C     
862  O O     . GLN B 51 ? 0.6176 0.5547 0.3133 0.0880  0.0885  -0.0495 192 GLN B O     
863  C CB    . GLN B 51 ? 0.5834 0.5345 0.3517 0.0877  0.0782  -0.0249 192 GLN B CB    
864  C CG    . GLN B 51 ? 0.6401 0.5388 0.3890 0.0956  0.1010  -0.0430 192 GLN B CG    
865  C CD    . GLN B 51 ? 0.6612 0.5274 0.4196 0.0804  0.0973  -0.0587 192 GLN B CD    
866  O OE1   . GLN B 51 ? 0.5834 0.4695 0.3675 0.0709  0.0788  -0.0515 192 GLN B OE1   
867  N NE2   . GLN B 51 ? 0.7138 0.5272 0.4490 0.0755  0.1183  -0.0824 192 GLN B NE2   
868  N N     . LEU B 52 ? 0.5550 0.5253 0.2772 0.0651  0.0496  -0.0357 193 LEU B N     
869  C CA    . LEU B 52 ? 0.5835 0.5518 0.2772 0.0583  0.0387  -0.0481 193 LEU B CA    
870  C C     . LEU B 52 ? 0.6038 0.5858 0.2726 0.0657  0.0484  -0.0390 193 LEU B C     
871  O O     . LEU B 52 ? 0.6357 0.6118 0.2734 0.0669  0.0519  -0.0537 193 LEU B O     
872  C CB    . LEU B 52 ? 0.5600 0.5397 0.2614 0.0492  0.0161  -0.0410 193 LEU B CB    
873  C CG    . LEU B 52 ? 0.5862 0.5773 0.2607 0.0477  0.0012  -0.0469 193 LEU B CG    
874  C CD1   . LEU B 52 ? 0.6098 0.5997 0.2715 0.0398  -0.0016 -0.0772 193 LEU B CD1   
875  C CD2   . LEU B 52 ? 0.5670 0.5653 0.2539 0.0473  -0.0149 -0.0329 193 LEU B CD2   
876  N N     . ALA B 53 ? 0.5881 0.5921 0.2701 0.0672  0.0536  -0.0168 194 ALA B N     
877  C CA    . ALA B 53 ? 0.6144 0.6367 0.2771 0.0714  0.0653  -0.0057 194 ALA B CA    
878  C C     . ALA B 53 ? 0.6596 0.6803 0.3107 0.0883  0.0873  -0.0130 194 ALA B C     
879  O O     . ALA B 53 ? 0.7026 0.7269 0.3246 0.0930  0.0960  -0.0150 194 ALA B O     
880  C CB    . ALA B 53 ? 0.5766 0.6277 0.2595 0.0620  0.0691  0.0156  194 ALA B CB    
881  N N     . ARG B 54 ? 0.6693 0.6816 0.3396 0.1002  0.0994  -0.0152 195 ARG B N     
882  C CA    . ARG B 54 ? 0.7303 0.7297 0.3865 0.1231  0.1273  -0.0200 195 ARG B CA    
883  C C     . ARG B 54 ? 0.7686 0.7212 0.3869 0.1206  0.1344  -0.0494 195 ARG B C     
884  O O     . ARG B 54 ? 0.7983 0.7437 0.3891 0.1332  0.1550  -0.0552 195 ARG B O     
885  C CB    . ARG B 54 ? 0.7452 0.7441 0.4280 0.1431  0.1434  -0.0091 195 ARG B CB    
886  C CG    . ARG B 54 ? 0.7511 0.8139 0.4583 0.1591  0.1535  0.0187  195 ARG B CG    
887  C CD    . ARG B 54 ? 0.7844 0.8511 0.5061 0.1927  0.1775  0.0327  195 ARG B CD    
888  N NE    . ARG B 54 ? 0.8141 0.8381 0.5449 0.1897  0.1729  0.0256  195 ARG B NE    
889  C CZ    . ARG B 54 ? 0.7812 0.8276 0.5400 0.1725  0.1511  0.0315  195 ARG B CZ    
890  N NH1   . ARG B 54 ? 0.7944 0.7987 0.5584 0.1713  0.1507  0.0243  195 ARG B NH1   
891  N NH2   . ARG B 54 ? 0.7513 0.8581 0.5303 0.1540  0.1327  0.0426  195 ARG B NH2   
892  N N     . TYR B 55 ? 0.7560 0.6821 0.3723 0.1025  0.1192  -0.0699 196 TYR B N     
893  C CA    . TYR B 55 ? 0.8203 0.7113 0.3999 0.0912  0.1255  -0.1041 196 TYR B CA    
894  C C     . TYR B 55 ? 0.8404 0.7575 0.3870 0.0843  0.1140  -0.1095 196 TYR B C     
895  O O     . TYR B 55 ? 0.8741 0.7745 0.3830 0.0853  0.1310  -0.1300 196 TYR B O     
896  C CB    . TYR B 55 ? 0.8207 0.6945 0.4093 0.0686  0.1102  -0.1253 196 TYR B CB    
897  C CG    . TYR B 55 ? 0.8886 0.7336 0.4407 0.0481  0.1184  -0.1668 196 TYR B CG    
898  C CD1   . TYR B 55 ? 0.9543 0.7397 0.4831 0.0515  0.1558  -0.1878 196 TYR B CD1   
899  C CD2   . TYR B 55 ? 0.8974 0.7767 0.4363 0.0246  0.0913  -0.1856 196 TYR B CD2   
900  C CE1   . TYR B 55 ? 1.0282 0.7835 0.5198 0.0244  0.1673  -0.2320 196 TYR B CE1   
901  C CE2   . TYR B 55 ? 0.9608 0.8279 0.4659 -0.0008 0.0979  -0.2283 196 TYR B CE2   
902  C CZ    . TYR B 55 ? 1.0273 0.8295 0.5080 -0.0050 0.1365  -0.2543 196 TYR B CZ    
903  O OH    . TYR B 55 ? 1.0934 0.8791 0.5362 -0.0381 0.1473  -0.3028 196 TYR B OH    
904  N N     . LEU B 56 ? 0.7994 0.7535 0.3567 0.0789  0.0890  -0.0898 197 LEU B N     
905  C CA    . LEU B 56 ? 0.8209 0.8008 0.3454 0.0765  0.0786  -0.0875 197 LEU B CA    
906  C C     . LEU B 56 ? 0.8274 0.8213 0.3374 0.0907  0.0970  -0.0692 197 LEU B C     
907  O O     . LEU B 56 ? 0.8395 0.8421 0.3104 0.0921  0.1005  -0.0766 197 LEU B O     
908  C CB    . LEU B 56 ? 0.7928 0.7966 0.3277 0.0698  0.0507  -0.0712 197 LEU B CB    
909  C CG    . LEU B 56 ? 0.7926 0.8019 0.3281 0.0563  0.0305  -0.0938 197 LEU B CG    
910  C CD1   . LEU B 56 ? 0.7491 0.7755 0.3061 0.0570  0.0086  -0.0730 197 LEU B CD1   
911  C CD2   . LEU B 56 ? 0.8442 0.8752 0.3358 0.0496  0.0251  -0.1182 197 LEU B CD2   
912  N N     . GLY B 57 ? 0.7804 0.7850 0.3213 0.0997  0.1081  -0.0458 198 GLY B N     
913  C CA    . GLY B 57 ? 0.7805 0.8111 0.3145 0.1101  0.1262  -0.0273 198 GLY B CA    
914  C C     . GLY B 57 ? 0.7803 0.8293 0.2885 0.1023  0.1174  -0.0137 198 GLY B C     
915  O O     . GLY B 57 ? 0.7523 0.8013 0.2650 0.0913  0.0983  -0.0031 198 GLY B O     
916  N N     . ASN B 58 ? 0.8033 0.8638 0.2811 0.1108  0.1345  -0.0127 199 ASN B N     
917  C CA    A ASN B 58 ? 0.8228 0.8987 0.2698 0.1067  0.1327  0.0032  199 ASN B CA    
918  C CA    B ASN B 58 ? 0.8173 0.8931 0.2651 0.1064  0.1323  0.0037  199 ASN B CA    
919  C C     . ASN B 58 ? 0.8503 0.9194 0.2592 0.1044  0.1130  -0.0074 199 ASN B C     
920  O O     . ASN B 58 ? 0.8678 0.9482 0.2458 0.1060  0.1116  0.0098  199 ASN B O     
921  C CB    A ASN B 58 ? 0.8577 0.9527 0.2825 0.1178  0.1592  0.0071  199 ASN B CB    
922  C CB    B ASN B 58 ? 0.8448 0.9414 0.2727 0.1166  0.1586  0.0099  199 ASN B CB    
923  C CG    A ASN B 58 ? 0.8384 0.9658 0.2889 0.1123  0.1737  0.0342  199 ASN B CG    
924  C CG    B ASN B 58 ? 0.8769 0.9591 0.2779 0.1309  0.1736  -0.0173 199 ASN B CG    
925  O OD1   A ASN B 58 ? 0.7964 0.9306 0.2829 0.0992  0.1663  0.0462  199 ASN B OD1   
926  O OD1   B ASN B 58 ? 0.8940 0.9528 0.2728 0.1271  0.1629  -0.0435 199 ASN B OD1   
927  N ND2   A ASN B 58 ? 0.8650 1.0168 0.2961 0.1192  0.1956  0.0417  199 ASN B ND2   
928  N ND2   B ASN B 58 ? 0.8886 0.9864 0.2912 0.1462  0.2012  -0.0126 199 ASN B ND2   
929  N N     . THR B 59 ? 0.8443 0.9004 0.2524 0.1008  0.0999  -0.0349 200 THR B N     
930  C CA    . THR B 59 ? 0.8718 0.9416 0.2445 0.0975  0.0803  -0.0487 200 THR B CA    
931  C C     . THR B 59 ? 0.8551 0.9356 0.2377 0.0975  0.0577  -0.0255 200 THR B C     
932  O O     . THR B 59 ? 0.8673 0.9730 0.2175 0.1031  0.0434  -0.0218 200 THR B O     
933  C CB    . THR B 59 ? 0.8839 0.9436 0.2510 0.0864  0.0755  -0.0902 200 THR B CB    
934  O OG1   . THR B 59 ? 0.8342 0.8792 0.2437 0.0784  0.0638  -0.0931 200 THR B OG1   
935  C CG2   . THR B 59 ? 0.9140 0.9464 0.2659 0.0893  0.1054  -0.1141 200 THR B CG2   
936  N N     . VAL B 60 ? 0.8073 0.8712 0.2324 0.0935  0.0559  -0.0099 201 VAL B N     
937  C CA    . VAL B 60 ? 0.8042 0.8667 0.2388 0.0952  0.0405  0.0120  201 VAL B CA    
938  C C     . VAL B 60 ? 0.7905 0.8327 0.2522 0.0889  0.0541  0.0371  201 VAL B C     
939  O O     . VAL B 60 ? 0.7595 0.7967 0.2564 0.0803  0.0613  0.0302  201 VAL B O     
940  C CB    . VAL B 60 ? 0.7832 0.8492 0.2420 0.0900  0.0190  -0.0068 201 VAL B CB    
941  C CG1   . VAL B 60 ? 0.7662 0.8273 0.2384 0.0959  0.0073  0.0175  201 VAL B CG1   
942  C CG2   . VAL B 60 ? 0.8154 0.9126 0.2448 0.0886  0.0057  -0.0348 201 VAL B CG2   
943  N N     . ASP B 61 ? 0.8203 0.8519 0.2625 0.0926  0.0601  0.0658  202 ASP B N     
944  C CA    . ASP B 61 ? 0.8240 0.8326 0.2867 0.0785  0.0758  0.0853  202 ASP B CA    
945  C C     . ASP B 61 ? 0.7969 0.7860 0.2883 0.0746  0.0630  0.0857  202 ASP B C     
946  O O     . ASP B 61 ? 0.8125 0.7867 0.2873 0.0871  0.0557  0.0998  202 ASP B O     
947  C CB    . ASP B 61 ? 0.8782 0.8684 0.3026 0.0808  0.0949  0.1149  202 ASP B CB    
948  C CG    . ASP B 61 ? 0.8802 0.8438 0.3211 0.0566  0.1173  0.1296  202 ASP B CG    
949  O OD1   . ASP B 61 ? 0.8394 0.8034 0.3210 0.0401  0.1137  0.1184  202 ASP B OD1   
950  O OD2   . ASP B 61 ? 0.9246 0.8674 0.3348 0.0516  0.1404  0.1515  202 ASP B OD2   
951  N N     . LEU B 62 ? 0.7741 0.7667 0.3069 0.0604  0.0624  0.0727  203 LEU B N     
952  C CA    . LEU B 62 ? 0.7565 0.7332 0.3183 0.0545  0.0522  0.0708  203 LEU B CA    
953  C C     . LEU B 62 ? 0.7800 0.7342 0.3533 0.0342  0.0688  0.0843  203 LEU B C     
954  O O     . LEU B 62 ? 0.7746 0.7153 0.3715 0.0267  0.0632  0.0808  203 LEU B O     
955  C CB    . LEU B 62 ? 0.7060 0.6998 0.3032 0.0519  0.0416  0.0477  203 LEU B CB    
956  C CG    . LEU B 62 ? 0.7035 0.7086 0.2914 0.0637  0.0264  0.0272  203 LEU B CG    
957  C CD1   . LEU B 62 ? 0.6775 0.6845 0.2977 0.0591  0.0249  0.0075  203 LEU B CD1   
958  C CD2   . LEU B 62 ? 0.7107 0.7158 0.2879 0.0729  0.0081  0.0300  203 LEU B CD2   
959  N N     . SER B 63 ? 0.8281 0.7774 0.3826 0.0220  0.0911  0.0979  204 SER B N     
960  C CA    . SER B 63 ? 0.8432 0.7707 0.4040 -0.0068 0.1122  0.1061  204 SER B CA    
961  C C     . SER B 63 ? 0.8701 0.7447 0.4229 -0.0060 0.1136  0.1144  204 SER B C     
962  O O     . SER B 63 ? 0.9021 0.7687 0.4788 -0.0272 0.1169  0.1059  204 SER B O     
963  C CB    . SER B 63 ? 0.8889 0.8095 0.4195 -0.0198 0.1393  0.1213  204 SER B CB    
964  O OG    . SER B 63 ? 0.9359 0.8230 0.4208 0.0043  0.1427  0.1405  204 SER B OG    
965  N N     . SER B 64 ? 0.8948 0.7388 0.4132 0.0213  0.1114  0.1313  205 SER B N     
966  C CA    . SER B 64 ? 0.9125 0.7049 0.4195 0.0320  0.1161  0.1440  205 SER B CA    
967  C C     . SER B 64 ? 0.8575 0.6700 0.3923 0.0506  0.0869  0.1316  205 SER B C     
968  O O     . SER B 64 ? 0.8911 0.6687 0.4199 0.0640  0.0898  0.1419  205 SER B O     
969  C CB    . SER B 64 ? 0.9693 0.7236 0.4237 0.0603  0.1312  0.1750  205 SER B CB    
970  N N     . PHE B 65 ? 0.7892 0.6536 0.3516 0.0519  0.0631  0.1103  206 PHE B N     
971  C CA    . PHE B 65 ? 0.7485 0.6354 0.3332 0.0669  0.0375  0.0974  206 PHE B CA    
972  C C     . PHE B 65 ? 0.6974 0.5706 0.3166 0.0514  0.0367  0.0874  206 PHE B C     
973  O O     . PHE B 65 ? 0.6566 0.5433 0.3015 0.0290  0.0397  0.0742  206 PHE B O     
974  C CB    . PHE B 65 ? 0.7078 0.6411 0.3057 0.0678  0.0201  0.0754  206 PHE B CB    
975  C CG    . PHE B 65 ? 0.6802 0.6377 0.2961 0.0778  -0.0030 0.0596  206 PHE B CG    
976  C CD1   . PHE B 65 ? 0.6960 0.6726 0.2917 0.1003  -0.0160 0.0669  206 PHE B CD1   
977  C CD2   . PHE B 65 ? 0.6377 0.6050 0.2901 0.0648  -0.0103 0.0386  206 PHE B CD2   
978  C CE1   . PHE B 65 ? 0.6738 0.6842 0.2884 0.1043  -0.0368 0.0500  206 PHE B CE1   
979  C CE2   . PHE B 65 ? 0.6144 0.6026 0.2829 0.0689  -0.0283 0.0226  206 PHE B CE2   
980  C CZ    . PHE B 65 ? 0.6327 0.6454 0.2837 0.0860  -0.0420 0.0264  206 PHE B CZ    
981  N N     . ASP B 66 ? 0.7110 0.5633 0.3293 0.0664  0.0334  0.0952  207 ASP B N     
982  C CA    . ASP B 66 ? 0.6840 0.5267 0.3338 0.0544  0.0309  0.0840  207 ASP B CA    
983  C C     . ASP B 66 ? 0.6266 0.5135 0.3083 0.0601  0.0050  0.0647  207 ASP B C     
984  O O     . ASP B 66 ? 0.6360 0.5422 0.3150 0.0821  -0.0098 0.0666  207 ASP B O     
985  C CB    . ASP B 66 ? 0.7333 0.5292 0.3668 0.0697  0.0436  0.1008  207 ASP B CB    
986  C CG    . ASP B 66 ? 0.7072 0.4913 0.3696 0.0549  0.0440  0.0874  207 ASP B CG    
987  O OD1   . ASP B 66 ? 0.6981 0.4662 0.3673 0.0236  0.0586  0.0782  207 ASP B OD1   
988  O OD2   . ASP B 66 ? 0.7196 0.5201 0.3992 0.0725  0.0289  0.0844  207 ASP B OD2   
989  N N     . PHE B 67 ? 0.5662 0.4724 0.2767 0.0406  0.0018  0.0472  208 PHE B N     
990  C CA    . PHE B 67 ? 0.5314 0.4693 0.2666 0.0430  -0.0156 0.0286  208 PHE B CA    
991  C C     . PHE B 67 ? 0.5288 0.4679 0.2833 0.0496  -0.0265 0.0246  208 PHE B C     
992  O O     . PHE B 67 ? 0.5033 0.4696 0.2675 0.0563  -0.0417 0.0126  208 PHE B O     
993  C CB    . PHE B 67 ? 0.5072 0.4580 0.2655 0.0269  -0.0100 0.0179  208 PHE B CB    
994  C CG    . PHE B 67 ? 0.4779 0.4455 0.2553 0.0293  -0.0194 0.0007  208 PHE B CG    
995  C CD1   . PHE B 67 ? 0.4406 0.4084 0.2437 0.0264  -0.0259 -0.0066 208 PHE B CD1   
996  C CD2   . PHE B 67 ? 0.4738 0.4510 0.2402 0.0333  -0.0175 -0.0089 208 PHE B CD2   
997  C CE1   . PHE B 67 ? 0.4322 0.4071 0.2492 0.0257  -0.0292 -0.0224 208 PHE B CE1   
998  C CE2   . PHE B 67 ? 0.4634 0.4422 0.2415 0.0324  -0.0190 -0.0265 208 PHE B CE2   
999  C CZ    . PHE B 67 ? 0.4481 0.4243 0.2515 0.0277  -0.0241 -0.0328 208 PHE B CZ    
1000 N N     . ARG B 68 ? 0.5317 0.4435 0.2915 0.0445  -0.0167 0.0319  209 ARG B N     
1001 C CA    . ARG B 68 ? 0.5256 0.4379 0.3047 0.0512  -0.0238 0.0286  209 ARG B CA    
1002 C C     . ARG B 68 ? 0.5581 0.4822 0.3238 0.0794  -0.0326 0.0396  209 ARG B C     
1003 O O     . ARG B 68 ? 0.5397 0.4972 0.3258 0.0860  -0.0474 0.0303  209 ARG B O     
1004 C CB    . ARG B 68 ? 0.5128 0.3893 0.2948 0.0387  -0.0076 0.0320  209 ARG B CB    
1005 C CG    . ARG B 68 ? 0.5147 0.3886 0.3129 0.0498  -0.0120 0.0304  209 ARG B CG    
1006 C CD    . ARG B 68 ? 0.4858 0.3394 0.2966 0.0294  -0.0003 0.0225  209 ARG B CD    
1007 N NE    . ARG B 68 ? 0.4215 0.3084 0.2602 0.0120  -0.0089 0.0080  209 ARG B NE    
1008 C CZ    . ARG B 68 ? 0.3958 0.3080 0.2606 0.0163  -0.0213 -0.0007 209 ARG B CZ    
1009 N NH1   . ARG B 68 ? 0.4032 0.3236 0.2747 0.0346  -0.0303 0.0002  209 ARG B NH1   
1010 N NH2   . ARG B 68 ? 0.3445 0.2783 0.2286 0.0036  -0.0231 -0.0091 209 ARG B NH2   
1011 N N     . THR B 69 ? 0.6113 0.5118 0.3428 0.0964  -0.0213 0.0609  210 THR B N     
1012 C CA    . THR B 69 ? 0.6587 0.5789 0.3731 0.1318  -0.0278 0.0785  210 THR B CA    
1013 C C     . THR B 69 ? 0.6872 0.6589 0.3865 0.1416  -0.0442 0.0766  210 THR B C     
1014 O O     . THR B 69 ? 0.7065 0.7243 0.3990 0.1682  -0.0570 0.0852  210 THR B O     
1015 C CB    . THR B 69 ? 0.7248 0.5871 0.4019 0.1540  -0.0020 0.1089  210 THR B CB    
1016 O OG1   . THR B 69 ? 0.7612 0.5937 0.4079 0.1435  0.0133  0.1176  210 THR B OG1   
1017 C CG2   . THR B 69 ? 0.7300 0.5355 0.4140 0.1446  0.0185  0.1088  210 THR B CG2   
1018 N N     . GLY B 70 ? 0.6806 0.6504 0.3727 0.1217  -0.0425 0.0657  211 GLY B N     
1019 C CA    . GLY B 70 ? 0.7107 0.7214 0.3812 0.1280  -0.0535 0.0618  211 GLY B CA    
1020 C C     . GLY B 70 ? 0.7612 0.7626 0.3876 0.1533  -0.0435 0.0907  211 GLY B C     
1021 O O     . GLY B 70 ? 0.8144 0.8625 0.4201 0.1651  -0.0556 0.0900  211 GLY B O     
1022 N N     . LYS B 71 ? 0.7914 0.7310 0.3997 0.1591  -0.0190 0.1147  212 LYS B N     
1023 C CA    . LYS B 71 ? 0.8531 0.7682 0.4147 0.1868  -0.0020 0.1482  212 LYS B CA    
1024 C C     . LYS B 71 ? 0.8950 0.7543 0.4345 0.1651  0.0248  0.1553  212 LYS B C     
1025 O O     . LYS B 71 ? 0.8476 0.6800 0.4090 0.1321  0.0344  0.1396  212 LYS B O     
1026 C CB    . LYS B 71 ? 0.8964 0.7793 0.4472 0.2191  0.0114  0.1754  212 LYS B CB    
1027 C CG    . LYS B 71 ? 0.8760 0.8286 0.4463 0.2465  -0.0137 0.1741  212 LYS B CG    
1028 N N     . MET B 72 ? 0.9621 0.8142 0.4581 0.1834  0.0367  0.1789  213 MET B N     
1029 C CA    . MET B 72 ? 1.0139 0.8166 0.4847 0.1633  0.0655  0.1885  213 MET B CA    
1030 C C     . MET B 72 ? 1.0969 0.8136 0.5445 0.1642  0.1021  0.2119  213 MET B C     
1031 O O     . MET B 72 ? 1.1732 0.8650 0.5948 0.2022  0.1118  0.2397  213 MET B O     
1032 C CB    . MET B 72 ? 1.0471 0.8737 0.4763 0.1829  0.0667  0.2057  213 MET B CB    
1033 C CG    . MET B 72 ? 1.0049 0.9061 0.4466 0.1768  0.0379  0.1792  213 MET B CG    
1034 S SD    . MET B 72 ? 0.9494 0.8557 0.4283 0.1313  0.0384  0.1442  213 MET B SD    
1035 C CE    . MET B 72 ? 0.9234 0.8987 0.3956 0.1362  0.0145  0.1203  213 MET B CE    
1036 N N     . MET B 73 ? 1.1188 0.7925 0.5728 0.1225  0.1252  0.2006  214 MET B N     
1037 C CA    . MET B 73 ? 1.1951 0.7804 0.6280 0.1094  0.1645  0.2125  214 MET B CA    
1038 C C     . MET B 73 ? 1.2956 0.8214 0.6777 0.1034  0.2040  0.2368  214 MET B C     
1039 O O     . MET B 73 ? 1.2998 0.8559 0.6794 0.0842  0.2034  0.2317  214 MET B O     
1040 C CB    . MET B 73 ? 1.1584 0.7417 0.6299 0.0601  0.1665  0.1805  214 MET B CB    
1041 N N     . PRO B 74 ? 1.3832 0.8198 0.7226 0.1211  0.2424  0.2644  215 PRO B N     
1042 O "O5'" . DC  C 1  ? 0.2462 0.3199 0.4378 -0.0556 -0.0014 -0.0785 1   DC  C "O5'" 
1043 C "C5'" . DC  C 1  ? 0.2644 0.3399 0.4506 -0.0693 0.0243  -0.0822 1   DC  C "C5'" 
1044 C "C4'" . DC  C 1  ? 0.2576 0.3212 0.3901 -0.0738 0.0322  -0.0683 1   DC  C "C4'" 
1045 O "O4'" . DC  C 1  ? 0.2602 0.3117 0.3679 -0.0667 0.0181  -0.0558 1   DC  C "O4'" 
1046 C "C3'" . DC  C 1  ? 0.2635 0.3271 0.3784 -0.0700 0.0331  -0.0653 1   DC  C "C3'" 
1047 O "O3'" . DC  C 1  ? 0.2899 0.3458 0.3695 -0.0860 0.0483  -0.0593 1   DC  C "O3'" 
1048 C "C2'" . DC  C 1  ? 0.2492 0.3046 0.3426 -0.0562 0.0134  -0.0531 1   DC  C "C2'" 
1049 C "C1'" . DC  C 1  ? 0.2517 0.2977 0.3339 -0.0582 0.0109  -0.0464 1   DC  C "C1'" 
1050 N N1    . DC  C 1  ? 0.2417 0.2788 0.3167 -0.0491 -0.0032 -0.0454 1   DC  C N1    
1051 C C2    . DC  C 1  ? 0.2525 0.2775 0.3082 -0.0469 -0.0015 -0.0374 1   DC  C C2    
1052 O O2    . DC  C 1  ? 0.2851 0.3084 0.3368 -0.0503 0.0047  -0.0273 1   DC  C O2    
1053 N N3    . DC  C 1  ? 0.2516 0.2645 0.2949 -0.0435 -0.0069 -0.0415 1   DC  C N3    
1054 C C4    . DC  C 1  ? 0.2589 0.2687 0.2981 -0.0444 -0.0203 -0.0485 1   DC  C C4    
1055 N N4    . DC  C 1  ? 0.2808 0.2721 0.2927 -0.0478 -0.0244 -0.0527 1   DC  C N4    
1056 C C5    . DC  C 1  ? 0.2562 0.2792 0.3219 -0.0446 -0.0304 -0.0521 1   DC  C C5    
1057 C C6    . DC  C 1  ? 0.2478 0.2856 0.3358 -0.0459 -0.0181 -0.0526 1   DC  C C6    
1058 P P     . DG  C 2  ? 0.3077 0.3596 0.3578 -0.0887 0.0500  -0.0539 2   DG  C P     
1059 O OP1   . DG  C 2  ? 0.3529 0.3988 0.3803 -0.1141 0.0729  -0.0611 2   DG  C OP1   
1060 O OP2   . DG  C 2  ? 0.3180 0.3779 0.3921 -0.0725 0.0414  -0.0604 2   DG  C OP2   
1061 O "O5'" . DG  C 2  ? 0.3108 0.3512 0.3296 -0.0853 0.0339  -0.0313 2   DG  C "O5'" 
1062 C "C5'" . DG  C 2  ? 0.3224 0.3519 0.3294 -0.0945 0.0309  -0.0185 2   DG  C "C5'" 
1063 C "C4'" . DG  C 2  ? 0.3231 0.3424 0.3141 -0.0927 0.0153  0.0027  2   DG  C "C4'" 
1064 O "O4'" . DG  C 2  ? 0.3034 0.3249 0.3165 -0.0726 0.0067  0.0035  2   DG  C "O4'" 
1065 C "C3'" . DG  C 2  ? 0.3266 0.3449 0.2946 -0.0985 0.0116  0.0086  2   DG  C "C3'" 
1066 O "O3'" . DG  C 2  ? 0.3482 0.3526 0.3004 -0.1096 -0.0045 0.0319  2   DG  C "O3'" 
1067 C "C2'" . DG  C 2  ? 0.2831 0.3108 0.2706 -0.0768 0.0068  0.0038  2   DG  C "C2'" 
1068 C "C1'" . DG  C 2  ? 0.2740 0.2997 0.2841 -0.0637 0.0024  0.0048  2   DG  C "C1'" 
1069 N N9    . DG  C 2  ? 0.2448 0.2749 0.2658 -0.0500 0.0037  -0.0080 2   DG  C N9    
1070 C C8    . DG  C 2  ? 0.2499 0.2868 0.2772 -0.0483 0.0058  -0.0212 2   DG  C C8    
1071 N N7    . DG  C 2  ? 0.2365 0.2700 0.2672 -0.0397 -0.0009 -0.0265 2   DG  C N7    
1072 C C5    . DG  C 2  ? 0.2293 0.2533 0.2534 -0.0368 -0.0001 -0.0209 2   DG  C C5    
1073 C C6    . DG  C 2  ? 0.2385 0.2506 0.2535 -0.0335 -0.0004 -0.0262 2   DG  C C6    
1074 O O6    . DG  C 2  ? 0.2376 0.2427 0.2394 -0.0343 -0.0078 -0.0328 2   DG  C O6    
1075 N N1    . DG  C 2  ? 0.2375 0.2426 0.2602 -0.0323 0.0083  -0.0231 2   DG  C N1    
1076 C C2    . DG  C 2  ? 0.2384 0.2477 0.2812 -0.0327 0.0087  -0.0112 2   DG  C C2    
1077 N N2    . DG  C 2  ? 0.2358 0.2379 0.3026 -0.0299 0.0155  -0.0098 2   DG  C N2    
1078 N N3    . DG  C 2  ? 0.2292 0.2462 0.2696 -0.0383 0.0026  -0.0017 2   DG  C N3    
1079 C C4    . DG  C 2  ? 0.2335 0.2573 0.2614 -0.0408 0.0021  -0.0095 2   DG  C C4    
1080 P P     . DG  C 3  ? 0.3828 0.3794 0.3023 -0.1259 -0.0151 0.0441  3   DG  C P     
1081 O OP1   . DG  C 3  ? 0.4166 0.3923 0.3133 -0.1474 -0.0337 0.0691  3   DG  C OP1   
1082 O OP2   . DG  C 3  ? 0.3903 0.3922 0.2885 -0.1348 0.0044  0.0235  3   DG  C OP2   
1083 O "O5'" . DG  C 3  ? 0.3440 0.3499 0.2955 -0.1042 -0.0281 0.0504  3   DG  C "O5'" 
1084 C "C5'" . DG  C 3  ? 0.3322 0.3356 0.3224 -0.0920 -0.0423 0.0649  3   DG  C "C5'" 
1085 C "C4'" . DG  C 3  ? 0.2992 0.3135 0.3208 -0.0726 -0.0406 0.0594  3   DG  C "C4'" 
1086 O "O4'" . DG  C 3  ? 0.2808 0.3028 0.3047 -0.0587 -0.0222 0.0381  3   DG  C "O4'" 
1087 C "C3'" . DG  C 3  ? 0.2994 0.3180 0.3050 -0.0782 -0.0461 0.0617  3   DG  C "C3'" 
1088 O "O3'" . DG  C 3  ? 0.3071 0.3299 0.3529 -0.0681 -0.0550 0.0700  3   DG  C "O3'" 
1089 C "C2'" . DG  C 3  ? 0.2887 0.3160 0.2812 -0.0696 -0.0270 0.0398  3   DG  C "C2'" 
1090 C "C1'" . DG  C 3  ? 0.2655 0.2944 0.2829 -0.0534 -0.0182 0.0311  3   DG  C "C1'" 
1091 N N9    . DG  C 3  ? 0.2471 0.2792 0.2560 -0.0461 -0.0069 0.0138  3   DG  C N9    
1092 C C8    . DG  C 3  ? 0.2364 0.2722 0.2318 -0.0505 -0.0015 0.0032  3   DG  C C8    
1093 N N7    . DG  C 3  ? 0.2324 0.2693 0.2343 -0.0415 0.0007  -0.0075 3   DG  C N7    
1094 C C5    . DG  C 3  ? 0.2311 0.2616 0.2377 -0.0342 -0.0002 -0.0054 3   DG  C C5    
1095 C C6    . DG  C 3  ? 0.2379 0.2606 0.2392 -0.0291 -0.0003 -0.0130 3   DG  C C6    
1096 O O6    . DG  C 3  ? 0.2281 0.2486 0.2245 -0.0282 -0.0066 -0.0191 3   DG  C O6    
1097 N N1    . DG  C 3  ? 0.2563 0.2701 0.2603 -0.0277 0.0067  -0.0130 3   DG  C N1    
1098 C C2    . DG  C 3  ? 0.2556 0.2716 0.2822 -0.0271 0.0106  -0.0055 3   DG  C C2    
1099 N N2    . DG  C 3  ? 0.2628 0.2697 0.3034 -0.0256 0.0225  -0.0112 3   DG  C N2    
1100 N N3    . DG  C 3  ? 0.2460 0.2697 0.2819 -0.0305 0.0026  0.0064  3   DG  C N3    
1101 C C4    . DG  C 3  ? 0.2439 0.2731 0.2613 -0.0356 -0.0014 0.0054  3   DG  C C4    
1102 P P     . DA  C 4  ? 0.3415 0.3606 0.3955 -0.0814 -0.0828 0.0929  4   DA  C P     
1103 O OP1   . DA  C 4  ? 0.3719 0.3751 0.4077 -0.1005 -0.1040 0.1132  4   DA  C OP1   
1104 O OP2   . DA  C 4  ? 0.3517 0.3758 0.3766 -0.0874 -0.0793 0.0853  4   DA  C OP2   
1105 O "O5'" . DA  C 4  ? 0.3427 0.3696 0.4709 -0.0639 -0.0843 0.0959  4   DA  C "O5'" 
1106 C "C5'" . DA  C 4  ? 0.3212 0.3452 0.4988 -0.0525 -0.0791 0.0955  4   DA  C "C5'" 
1107 C "C4'" . DA  C 4  ? 0.3101 0.3419 0.5236 -0.0355 -0.0507 0.0738  4   DA  C "C4'" 
1108 O "O4'" . DA  C 4  ? 0.3070 0.3391 0.4690 -0.0324 -0.0280 0.0529  4   DA  C "O4'" 
1109 C "C3'" . DA  C 4  ? 0.3134 0.3550 0.5656 -0.0318 -0.0490 0.0730  4   DA  C "C3'" 
1110 O "O3'" . DA  C 4  ? 0.2984 0.3402 0.6089 -0.0207 -0.0247 0.0578  4   DA  C "O3'" 
1111 C "C2'" . DA  C 4  ? 0.2990 0.3438 0.4912 -0.0336 -0.0353 0.0596  4   DA  C "C2'" 
1112 C "C1'" . DA  C 4  ? 0.2829 0.3209 0.4368 -0.0296 -0.0169 0.0436  4   DA  C "C1'" 
1113 N N9    . DA  C 4  ? 0.2704 0.3081 0.3664 -0.0333 -0.0140 0.0362  4   DA  C N9    
1114 C C8    . DA  C 4  ? 0.2588 0.2979 0.3218 -0.0436 -0.0262 0.0425  4   DA  C C8    
1115 N N7    . DA  C 4  ? 0.2671 0.3058 0.2973 -0.0432 -0.0170 0.0300  4   DA  C N7    
1116 C C5    . DA  C 4  ? 0.2495 0.2846 0.2841 -0.0332 -0.0040 0.0189  4   DA  C C5    
1117 C C6    . DA  C 4  ? 0.2629 0.2933 0.2752 -0.0297 0.0025  0.0071  4   DA  C C6    
1118 N N6    . DA  C 4  ? 0.2610 0.2934 0.2573 -0.0318 -0.0005 0.0027  4   DA  C N6    
1119 N N1    . DA  C 4  ? 0.2575 0.2783 0.2674 -0.0262 0.0116  -0.0003 4   DA  C N1    
1120 C C2    . DA  C 4  ? 0.2736 0.2915 0.3083 -0.0250 0.0211  -0.0009 4   DA  C C2    
1121 N N3    . DA  C 4  ? 0.2675 0.2926 0.3407 -0.0244 0.0177  0.0082  4   DA  C N3    
1122 C C4    . DA  C 4  ? 0.2600 0.2931 0.3286 -0.0288 0.0011  0.0204  4   DA  C C4    
1123 P P     . DA  C 5  ? 0.3376 0.3889 0.7161 -0.0161 -0.0117 0.0509  5   DA  C P     
1124 O OP1   . DA  C 5  ? 0.3133 0.3624 0.7798 -0.0087 0.0002  0.0448  5   DA  C OP1   
1125 O OP2   . DA  C 5  ? 0.3104 0.3709 0.6913 -0.0233 -0.0402 0.0698  5   DA  C OP2   
1126 O "O5'" . DA  C 5  ? 0.3213 0.3693 0.6457 -0.0163 0.0225  0.0264  5   DA  C "O5'" 
1127 C "C5'" . DA  C 5  ? 0.3268 0.3617 0.6230 -0.0153 0.0515  0.0049  5   DA  C "C5'" 
1128 C "C4'" . DA  C 5  ? 0.3170 0.3445 0.5527 -0.0207 0.0715  -0.0094 5   DA  C "C4'" 
1129 O "O4'" . DA  C 5  ? 0.2736 0.3010 0.4432 -0.0224 0.0523  -0.0009 5   DA  C "O4'" 
1130 C "C3'" . DA  C 5  ? 0.3284 0.3625 0.5896 -0.0236 0.0818  -0.0114 5   DA  C "C3'" 
1131 O "O3'" . DA  C 5  ? 0.4028 0.4201 0.6472 -0.0308 0.1200  -0.0349 5   DA  C "O3'" 
1132 C "C2'" . DA  C 5  ? 0.2893 0.3267 0.4931 -0.0262 0.0618  -0.0001 5   DA  C "C2'" 
1133 C "C1'" . DA  C 5  ? 0.2905 0.3180 0.4321 -0.0261 0.0552  -0.0017 5   DA  C "C1'" 
1134 N N9    . DA  C 5  ? 0.2461 0.2791 0.3518 -0.0268 0.0317  0.0095  5   DA  C N9    
1135 C C8    . DA  C 5  ? 0.2569 0.3007 0.3756 -0.0292 0.0091  0.0245  5   DA  C C8    
1136 N N7    . DA  C 5  ? 0.2321 0.2756 0.3092 -0.0332 -0.0009 0.0263  5   DA  C N7    
1137 C C5    . DA  C 5  ? 0.2251 0.2595 0.2705 -0.0301 0.0112  0.0144  5   DA  C C5    
1138 C C6    . DA  C 5  ? 0.2328 0.2633 0.2446 -0.0306 0.0076  0.0099  5   DA  C C6    
1139 N N6    . DA  C 5  ? 0.2374 0.2733 0.2395 -0.0355 -0.0012 0.0117  5   DA  C N6    
1140 N N1    . DA  C 5  ? 0.2320 0.2505 0.2228 -0.0286 0.0133  0.0025  5   DA  C N1    
1141 C C2    . DA  C 5  ? 0.2497 0.2575 0.2391 -0.0298 0.0266  -0.0024 5   DA  C C2    
1142 N N3    . DA  C 5  ? 0.2491 0.2595 0.2692 -0.0299 0.0393  -0.0041 5   DA  C N3    
1143 C C4    . DA  C 5  ? 0.2479 0.2736 0.3023 -0.0280 0.0289  0.0057  5   DA  C C4    
1144 P P     . DT  C 6  ? 0.4684 0.4818 0.7250 -0.0399 0.1499  -0.0481 6   DT  C P     
1145 O OP1   . DT  C 6  ? 0.4948 0.4890 0.7583 -0.0500 0.1935  -0.0753 6   DT  C OP1   
1146 O OP2   . DT  C 6  ? 0.4221 0.4584 0.7525 -0.0343 0.1343  -0.0348 6   DT  C OP2   
1147 O "O5'" . DT  C 6  ? 0.4290 0.4280 0.5897 -0.0478 0.1430  -0.0442 6   DT  C "O5'" 
1148 C "C5'" . DT  C 6  ? 0.4256 0.3997 0.5116 -0.0568 0.1501  -0.0530 6   DT  C "C5'" 
1149 C "C4'" . DT  C 6  ? 0.4117 0.3762 0.4296 -0.0608 0.1309  -0.0418 6   DT  C "C4'" 
1150 O "O4'" . DT  C 6  ? 0.3482 0.3329 0.3756 -0.0477 0.0967  -0.0246 6   DT  C "O4'" 
1151 C "C3'" . DT  C 6  ? 0.4006 0.3582 0.4086 -0.0704 0.1439  -0.0418 6   DT  C "C3'" 
1152 O "O3'" . DT  C 6  ? 0.4333 0.3563 0.3641 -0.0890 0.1552  -0.0478 6   DT  C "O3'" 
1153 C "C2'" . DT  C 6  ? 0.3493 0.3260 0.3666 -0.0594 0.1123  -0.0238 6   DT  C "C2'" 
1154 C "C1'" . DT  C 6  ? 0.3272 0.3087 0.3265 -0.0503 0.0867  -0.0169 6   DT  C "C1'" 
1155 N N1    . DT  C 6  ? 0.2787 0.2813 0.2983 -0.0409 0.0608  -0.0043 6   DT  C N1    
1156 C C2    . DT  C 6  ? 0.2670 0.2661 0.2531 -0.0388 0.0430  0.0001  6   DT  C C2    
1157 O O2    . DT  C 6  ? 0.2702 0.2513 0.2183 -0.0423 0.0409  -0.0017 6   DT  C O2    
1158 N N3    . DT  C 6  ? 0.2352 0.2499 0.2357 -0.0354 0.0271  0.0066  6   DT  C N3    
1159 C C4    . DT  C 6  ? 0.2188 0.2490 0.2529 -0.0361 0.0209  0.0128  6   DT  C C4    
1160 O O4    . DT  C 6  ? 0.2196 0.2568 0.2491 -0.0389 0.0068  0.0174  6   DT  C O4    
1161 C C5    . DT  C 6  ? 0.2359 0.2705 0.3116 -0.0360 0.0321  0.0123  6   DT  C C5    
1162 C C7    . DT  C 6  ? 0.2398 0.2900 0.3636 -0.0374 0.0175  0.0231  6   DT  C C7    
1163 C C6    . DT  C 6  ? 0.2505 0.2727 0.3216 -0.0374 0.0546  0.0017  6   DT  C C6    
1164 P P     . DG  C 7  ? 0.4721 0.3735 0.3554 -0.1042 0.1592  -0.0421 7   DG  C P     
1165 O OP1   . DG  C 7  ? 0.5473 0.4098 0.3679 -0.1309 0.1876  -0.0557 7   DG  C OP1   
1166 O OP2   . DG  C 7  ? 0.4310 0.3551 0.3722 -0.0977 0.1646  -0.0389 7   DG  C OP2   
1167 O "O5'" . DG  C 7  ? 0.4559 0.3515 0.2965 -0.0977 0.1177  -0.0231 7   DG  C "O5'" 
1168 C "C5'" . DG  C 7  ? 0.4741 0.3566 0.2762 -0.0986 0.0982  -0.0209 7   DG  C "C5'" 
1169 C "C4'" . DG  C 7  ? 0.4786 0.3515 0.2527 -0.0960 0.0625  -0.0036 7   DG  C "C4'" 
1170 O "O4'" . DG  C 7  ? 0.4143 0.3200 0.2411 -0.0748 0.0448  0.0025  7   DG  C "O4'" 
1171 C "C3'" . DG  C 7  ? 0.5193 0.3644 0.2533 -0.1115 0.0617  0.0058  7   DG  C "C3'" 
1172 O "O3'" . DG  C 7  ? 0.5608 0.3828 0.2568 -0.1159 0.0261  0.0208  7   DG  C "O3'" 
1173 C "C2'" . DG  C 7  ? 0.4702 0.3433 0.2581 -0.0964 0.0608  0.0095  7   DG  C "C2'" 
1174 C "C1'" . DG  C 7  ? 0.4162 0.3206 0.2482 -0.0750 0.0408  0.0104  7   DG  C "C1'" 
1175 N N9    . DG  C 7  ? 0.3608 0.2977 0.2472 -0.0629 0.0462  0.0076  7   DG  C N9    
1176 C C8    . DG  C 7  ? 0.3497 0.3022 0.2712 -0.0628 0.0667  0.0004  7   DG  C C8    
1177 N N7    . DG  C 7  ? 0.3232 0.3012 0.2868 -0.0537 0.0579  0.0034  7   DG  C N7    
1178 C C5    . DG  C 7  ? 0.2924 0.2713 0.2438 -0.0487 0.0371  0.0087  7   DG  C C5    
1179 C C6    . DG  C 7  ? 0.2725 0.2688 0.2447 -0.0442 0.0243  0.0105  7   DG  C C6    
1180 O O6    . DG  C 7  ? 0.2515 0.2644 0.2504 -0.0449 0.0224  0.0120  7   DG  C O6    
1181 N N1    . DG  C 7  ? 0.2760 0.2653 0.2355 -0.0415 0.0123  0.0102  7   DG  C N1    
1182 C C2    . DG  C 7  ? 0.3000 0.2695 0.2373 -0.0413 0.0051  0.0125  7   DG  C C2    
1183 N N2    . DG  C 7  ? 0.2944 0.2618 0.2420 -0.0369 -0.0078 0.0114  7   DG  C N2    
1184 N N3    . DG  C 7  ? 0.3267 0.2772 0.2351 -0.0476 0.0099  0.0152  7   DG  C N3    
1185 C C4    . DG  C 7  ? 0.3305 0.2864 0.2440 -0.0520 0.0295  0.0111  7   DG  C C4    
1186 P P     . DT  C 8  ? 0.6414 0.4237 0.2860 -0.1344 0.0100  0.0381  8   DT  C P     
1187 O OP1   . DT  C 8  ? 0.7010 0.4537 0.3028 -0.1445 -0.0281 0.0523  8   DT  C OP1   
1188 O OP2   . DT  C 8  ? 0.6828 0.4437 0.2906 -0.1572 0.0471  0.0306  8   DT  C OP2   
1189 O "O5'" . DT  C 8  ? 0.6276 0.4331 0.3292 -0.1140 -0.0056 0.0467  8   DT  C "O5'" 
1190 C "C5'" . DT  C 8  ? 0.6106 0.4359 0.3587 -0.0936 -0.0352 0.0514  8   DT  C "C5'" 
1191 C "C4'" . DT  C 8  ? 0.6071 0.4446 0.3980 -0.0824 -0.0398 0.0549  8   DT  C "C4'" 
1192 O "O4'" . DT  C 8  ? 0.5500 0.4247 0.3842 -0.0703 -0.0168 0.0408  8   DT  C "O4'" 
1193 C "C3'" . DT  C 8  ? 0.6586 0.4655 0.4176 -0.0983 -0.0370 0.0662  8   DT  C "C3'" 
1194 O "O3'" . DT  C 8  ? 0.6997 0.5027 0.4937 -0.0894 -0.0604 0.0757  8   DT  C "O3'" 
1195 C "C2'" . DT  C 8  ? 0.6176 0.4475 0.3966 -0.0973 -0.0021 0.0531  8   DT  C "C2'" 
1196 C "C1'" . DT  C 8  ? 0.5205 0.3915 0.3589 -0.0754 -0.0050 0.0426  8   DT  C "C1'" 
1197 N N1    . DT  C 8  ? 0.4516 0.3539 0.3224 -0.0704 0.0175  0.0307  8   DT  C N1    
1198 C C2    . DT  C 8  ? 0.3877 0.3163 0.2992 -0.0588 0.0118  0.0253  8   DT  C C2    
1199 O O2    . DT  C 8  ? 0.3745 0.3027 0.3002 -0.0523 -0.0033 0.0254  8   DT  C O2    
1200 N N3    . DT  C 8  ? 0.3323 0.2853 0.2693 -0.0577 0.0245  0.0190  8   DT  C N3    
1201 C C4    . DT  C 8  ? 0.3589 0.3163 0.3019 -0.0631 0.0432  0.0163  8   DT  C C4    
1202 O O4    . DT  C 8  ? 0.3234 0.3035 0.3027 -0.0609 0.0466  0.0135  8   DT  C O4    
1203 C C5    . DT  C 8  ? 0.3978 0.3286 0.3029 -0.0745 0.0569  0.0167  8   DT  C C5    
1204 C C7    . DT  C 8  ? 0.4131 0.3457 0.3304 -0.0831 0.0861  0.0076  8   DT  C C7    
1205 C C6    . DT  C 8  ? 0.4422 0.3452 0.3054 -0.0794 0.0426  0.0246  8   DT  C C6    
1206 P P     . DA  C 9  ? 0.7681 0.5243 0.5320 -0.1027 -0.0965 0.1004  9   DA  C P     
1207 O OP1   . DA  C 9  ? 0.7891 0.5285 0.5214 -0.1100 -0.1210 0.1083  9   DA  C OP1   
1208 O OP2   . DA  C 9  ? 0.7903 0.5158 0.5067 -0.1237 -0.0826 0.1095  9   DA  C OP2   
1209 O "O5'" . DA  C 9  ? 0.6995 0.4699 0.5413 -0.0822 -0.1171 0.1007  9   DA  C "O5'" 
1210 C "C5'" . DA  C 9  ? 0.6492 0.4547 0.5525 -0.0619 -0.1188 0.0852  9   DA  C "C5'" 
1211 C "C4'" . DA  C 9  ? 0.5978 0.4235 0.5651 -0.0486 -0.1085 0.0720  9   DA  C "C4'" 
1212 O "O4'" . DA  C 9  ? 0.5434 0.3959 0.5046 -0.0482 -0.0744 0.0554  9   DA  C "O4'" 
1213 C "C3'" . DA  C 9  ? 0.6243 0.4209 0.6049 -0.0529 -0.1229 0.0855  9   DA  C "C3'" 
1214 O "O3'" . DA  C 9  ? 0.5986 0.4080 0.6599 -0.0378 -0.1279 0.0731  9   DA  C "O3'" 
1215 C "C2'" . DA  C 9  ? 0.5998 0.3991 0.5463 -0.0626 -0.0934 0.0808  9   DA  C "C2'" 
1216 C "C1'" . DA  C 9  ? 0.5301 0.3718 0.4906 -0.0543 -0.0658 0.0578  9   DA  C "C1'" 
1217 N N9    . DA  C 9  ? 0.5073 0.3597 0.4338 -0.0631 -0.0403 0.0536  9   DA  C N9    
1218 C C8    . DA  C 9  ? 0.5397 0.3737 0.4146 -0.0778 -0.0316 0.0625  9   DA  C C8    
1219 N N7    . DA  C 9  ? 0.5103 0.3645 0.3845 -0.0810 -0.0055 0.0523  9   DA  C N7    
1220 C C5    . DA  C 9  ? 0.4453 0.3308 0.3644 -0.0691 -0.0026 0.0396  9   DA  C C5    
1221 C C6    . DA  C 9  ? 0.4097 0.3242 0.3505 -0.0682 0.0126  0.0290  9   DA  C C6    
1222 N N6    . DA  C 9  ? 0.4024 0.3240 0.3397 -0.0752 0.0301  0.0279  9   DA  C N6    
1223 N N1    . DA  C 9  ? 0.3762 0.3104 0.3455 -0.0621 0.0087  0.0189  9   DA  C N1    
1224 C C2    . DA  C 9  ? 0.3813 0.3087 0.3650 -0.0560 -0.0023 0.0151  9   DA  C C2    
1225 N N3    . DA  C 9  ? 0.4163 0.3215 0.3993 -0.0523 -0.0171 0.0234  9   DA  C N3    
1226 C C4    . DA  C 9  ? 0.4473 0.3311 0.3933 -0.0596 -0.0201 0.0380  9   DA  C C4    
1227 P P     . DG  C 10 ? 0.6531 0.4344 0.7612 -0.0367 -0.1476 0.0839  10  DG  C P     
1228 O OP1   . DG  C 10 ? 0.6423 0.4325 0.8410 -0.0214 -0.1622 0.0740  10  DG  C OP1   
1229 O OP2   . DG  C 10 ? 0.6757 0.4117 0.7246 -0.0540 -0.1727 0.1159  10  DG  C OP2   
1230 O "O5'" . DG  C 10 ? 0.6046 0.4033 0.7230 -0.0368 -0.1118 0.0625  10  DG  C "O5'" 
1231 C "C5'" . DG  C 10 ? 0.5381 0.3723 0.6929 -0.0289 -0.0846 0.0320  10  DG  C "C5'" 
1232 C "C4'" . DG  C 10 ? 0.5217 0.3655 0.6600 -0.0366 -0.0574 0.0185  10  DG  C "C4'" 
1233 O "O4'" . DG  C 10 ? 0.5027 0.3539 0.5771 -0.0458 -0.0474 0.0266  10  DG  C "O4'" 
1234 C "C3'" . DG  C 10 ? 0.5480 0.3647 0.7055 -0.0411 -0.0624 0.0252  10  DG  C "C3'" 
1235 O "O3'" . DG  C 10 ? 0.5449 0.3789 0.7293 -0.0430 -0.0364 -0.0028 10  DG  C "O3'" 
1236 C "C2'" . DG  C 10 ? 0.5529 0.3570 0.6443 -0.0543 -0.0605 0.0440  10  DG  C "C2'" 
1237 C "C1'" . DG  C 10 ? 0.5183 0.3563 0.5779 -0.0557 -0.0401 0.0318  10  DG  C "C1'" 
1238 N N9    . DG  C 10 ? 0.5230 0.3573 0.5273 -0.0659 -0.0342 0.0450  10  DG  C N9    
1239 C C8    . DG  C 10 ? 0.5554 0.3594 0.5170 -0.0752 -0.0466 0.0668  10  DG  C C8    
1240 N N7    . DG  C 10 ? 0.5634 0.3709 0.4838 -0.0863 -0.0283 0.0682  10  DG  C N7    
1241 C C5    . DG  C 10 ? 0.5149 0.3587 0.4606 -0.0815 -0.0087 0.0498  10  DG  C C5    
1242 C C6    . DG  C 10 ? 0.4996 0.3638 0.4374 -0.0876 0.0127  0.0433  10  DG  C C6    
1243 O O6    . DG  C 10 ? 0.5313 0.3867 0.4405 -0.0985 0.0267  0.0481  10  DG  C O6    
1244 N N1    . DG  C 10 ? 0.4499 0.3457 0.4206 -0.0824 0.0179  0.0289  10  DG  C N1    
1245 C C2    . DG  C 10 ? 0.4288 0.3325 0.4249 -0.0760 0.0103  0.0182  10  DG  C C2    
1246 N N2    . DG  C 10 ? 0.4123 0.3404 0.4227 -0.0789 0.0156  0.0060  10  DG  C N2    
1247 N N3    . DG  C 10 ? 0.4512 0.3375 0.4604 -0.0699 -0.0015 0.0188  10  DG  C N3    
1248 C C4    . DG  C 10 ? 0.4869 0.3452 0.4750 -0.0712 -0.0134 0.0365  10  DG  C C4    
1249 P P     . DG  C 11 ? 0.5819 0.3984 0.8227 -0.0433 -0.0316 -0.0153 11  DG  C P     
1250 O OP1   . DG  C 11 ? 0.6095 0.4320 0.9232 -0.0331 -0.0276 -0.0367 11  DG  C OP1   
1251 O OP2   . DG  C 11 ? 0.5920 0.3734 0.8243 -0.0470 -0.0530 0.0123  11  DG  C OP2   
1252 O "O5'" . DG  C 11 ? 0.5416 0.3768 0.7568 -0.0566 -0.0020 -0.0387 11  DG  C "O5'" 
1253 C "C5'" . DG  C 11 ? 0.4866 0.3519 0.6726 -0.0618 0.0145  -0.0552 11  DG  C "C5'" 
1254 C "C4'" . DG  C 11 ? 0.4688 0.3450 0.6115 -0.0771 0.0249  -0.0577 11  DG  C "C4'" 
1255 O "O4'" . DG  C 11 ? 0.4488 0.3282 0.5530 -0.0765 0.0143  -0.0326 11  DG  C "O4'" 
1256 C "C3'" . DG  C 11 ? 0.4841 0.3440 0.6416 -0.0874 0.0321  -0.0662 11  DG  C "C3'" 
1257 O "O3'" . DG  C 11 ? 0.4864 0.3601 0.6222 -0.1052 0.0472  -0.0873 11  DG  C "O3'" 
1258 C "C2'" . DG  C 11 ? 0.4858 0.3339 0.6206 -0.0881 0.0197  -0.0384 11  DG  C "C2'" 
1259 C "C1'" . DG  C 11 ? 0.4552 0.3244 0.5507 -0.0862 0.0161  -0.0255 11  DG  C "C1'" 
1260 N N9    . DG  C 11 ? 0.4634 0.3186 0.5348 -0.0846 0.0067  0.0001  11  DG  C N9    
1261 C C8    . DG  C 11 ? 0.4885 0.3147 0.5615 -0.0794 -0.0090 0.0181  11  DG  C C8    
1262 N N7    . DG  C 11 ? 0.5000 0.3139 0.5327 -0.0860 -0.0117 0.0378  11  DG  C N7    
1263 C C5    . DG  C 11 ? 0.4671 0.3074 0.4843 -0.0923 0.0057  0.0304  11  DG  C C5    
1264 C C6    . DG  C 11 ? 0.4683 0.3102 0.4547 -0.1018 0.0173  0.0394  11  DG  C C6    
1265 O O6    . DG  C 11 ? 0.5028 0.3193 0.4541 -0.1103 0.0177  0.0548  11  DG  C O6    
1266 N N1    . DG  C 11 ? 0.4413 0.3153 0.4418 -0.1044 0.0301  0.0277  11  DG  C N1    
1267 C C2    . DG  C 11 ? 0.4299 0.3271 0.4549 -0.1022 0.0278  0.0126  11  DG  C C2    
1268 N N2    . DG  C 11 ? 0.4258 0.3491 0.4616 -0.1077 0.0328  0.0081  11  DG  C N2    
1269 N N3    . DG  C 11 ? 0.4307 0.3231 0.4699 -0.0977 0.0213  0.0019  11  DG  C N3    
1270 C C4    . DG  C 11 ? 0.4502 0.3159 0.4915 -0.0912 0.0126  0.0101  11  DG  C C4    
1271 P P     . DC  C 12 ? 0.5243 0.3827 0.6753 -0.1210 0.0604  -0.1084 12  DC  C P     
1272 O OP1   . DC  C 12 ? 0.6039 0.4726 0.7280 -0.1418 0.0761  -0.1354 12  DC  C OP1   
1273 O OP2   . DC  C 12 ? 0.5280 0.3609 0.7366 -0.1102 0.0619  -0.1130 12  DC  C OP2   
1274 O "O5'" . DC  C 12 ? 0.5428 0.4042 0.6672 -0.1299 0.0507  -0.0895 12  DC  C "O5'" 
1275 C "C5'" . DC  C 12 ? 0.5179 0.4043 0.6049 -0.1385 0.0445  -0.0818 12  DC  C "C5'" 
1276 C "C4'" . DC  C 12 ? 0.4955 0.3857 0.5783 -0.1385 0.0361  -0.0590 12  DC  C "C4'" 
1277 O "O4'" . DC  C 12 ? 0.4657 0.3474 0.5497 -0.1226 0.0317  -0.0381 12  DC  C "O4'" 
1278 C "C3'" . DC  C 12 ? 0.5073 0.3814 0.6055 -0.1495 0.0393  -0.0611 12  DC  C "C3'" 
1279 O "O3'" . DC  C 12 ? 0.5400 0.4265 0.6283 -0.1700 0.0375  -0.0730 12  DC  C "O3'" 
1280 C "C2'" . DC  C 12 ? 0.4892 0.3594 0.5868 -0.1440 0.0367  -0.0360 12  DC  C "C2'" 
1281 C "C1'" . DC  C 12 ? 0.4549 0.3324 0.5369 -0.1289 0.0325  -0.0233 12  DC  C "C1'" 
1282 N N1    . DC  C 12 ? 0.4556 0.3075 0.5312 -0.1209 0.0296  -0.0044 12  DC  C N1    
1283 C C2    . DC  C 12 ? 0.4437 0.2961 0.4974 -0.1237 0.0338  0.0122  12  DC  C C2    
1284 O O2    . DC  C 12 ? 0.4262 0.3039 0.4821 -0.1290 0.0407  0.0096  12  DC  C O2    
1285 N N3    . DC  C 12 ? 0.4584 0.2811 0.4904 -0.1231 0.0298  0.0303  12  DC  C N3    
1286 C C4    . DC  C 12 ? 0.4952 0.2899 0.5359 -0.1172 0.0154  0.0362  12  DC  C C4    
1287 N N4    . DC  C 12 ? 0.5404 0.3011 0.5531 -0.1209 0.0045  0.0587  12  DC  C N4    
1288 C C5    . DC  C 12 ? 0.4869 0.2842 0.5675 -0.1102 0.0117  0.0185  12  DC  C C5    
1289 C C6    . DC  C 12 ? 0.4638 0.2892 0.5559 -0.1137 0.0224  -0.0033 12  DC  C C6    
1290 O "O5'" . DG  D 1  ? 0.7751 0.6136 0.8662 -0.2980 0.2837  -0.0287 1   DG  D "O5'" 
1291 C "C5'" . DG  D 1  ? 0.7137 0.5767 0.8080 -0.2776 0.2805  -0.0337 1   DG  D "C5'" 
1292 C "C4'" . DG  D 1  ? 0.6438 0.5663 0.8190 -0.2524 0.2538  -0.0447 1   DG  D "C4'" 
1293 O "O4'" . DG  D 1  ? 0.5954 0.5106 0.7563 -0.2371 0.2129  -0.0354 1   DG  D "O4'" 
1294 C "C3'" . DG  D 1  ? 0.6065 0.5559 0.7940 -0.2302 0.2477  -0.0494 1   DG  D "C3'" 
1295 O "O3'" . DG  D 1  ? 0.5985 0.6025 0.8756 -0.2180 0.2316  -0.0606 1   DG  D "O3'" 
1296 C "C2'" . DG  D 1  ? 0.5784 0.5040 0.7056 -0.2108 0.2117  -0.0336 1   DG  D "C2'" 
1297 C "C1'" . DG  D 1  ? 0.5511 0.4737 0.6916 -0.2114 0.1878  -0.0307 1   DG  D "C1'" 
1298 N N9    . DG  D 1  ? 0.5447 0.4254 0.6265 -0.2050 0.1666  -0.0160 1   DG  D N9    
1299 C C8    . DG  D 1  ? 0.5842 0.4139 0.5993 -0.2134 0.1712  -0.0001 1   DG  D C8    
1300 N N7    . DG  D 1  ? 0.5851 0.3882 0.5765 -0.2023 0.1445  0.0108  1   DG  D N7    
1301 C C5    . DG  D 1  ? 0.5386 0.3758 0.5764 -0.1877 0.1273  -0.0017 1   DG  D C5    
1302 C C6    . DG  D 1  ? 0.5123 0.3409 0.5532 -0.1736 0.1035  -0.0028 1   DG  D C6    
1303 O O6    . DG  D 1  ? 0.5187 0.3112 0.5356 -0.1673 0.0906  0.0078  1   DG  D O6    
1304 N N1    . DG  D 1  ? 0.4793 0.3449 0.5588 -0.1687 0.0947  -0.0191 1   DG  D N1    
1305 C C2    . DG  D 1  ? 0.4635 0.3700 0.5813 -0.1745 0.1000  -0.0289 1   DG  D C2    
1306 N N2    . DG  D 1  ? 0.4432 0.3747 0.5864 -0.1726 0.0825  -0.0406 1   DG  D N2    
1307 N N3    . DG  D 1  ? 0.4635 0.3830 0.5956 -0.1836 0.1209  -0.0281 1   DG  D N3    
1308 C C4    . DG  D 1  ? 0.5110 0.3941 0.5986 -0.1904 0.1372  -0.0162 1   DG  D C4    
1309 P P     . DC  D 2  ? 0.6168 0.6579 0.9394 -0.1975 0.2260  -0.0679 2   DC  D P     
1310 O OP1   . DC  D 2  ? 0.5865 0.6701 1.0128 -0.2052 0.2464  -0.0849 2   DC  D OP1   
1311 O OP2   . DC  D 2  ? 0.6476 0.6584 0.8988 -0.1919 0.2383  -0.0628 2   DC  D OP2   
1312 O "O5'" . DC  D 2  ? 0.5527 0.6120 0.8820 -0.1766 0.1744  -0.0599 2   DC  D "O5'" 
1313 C "C5'" . DC  D 2  ? 0.5704 0.6525 0.9493 -0.1820 0.1501  -0.0624 2   DC  D "C5'" 
1314 C "C4'" . DC  D 2  ? 0.5563 0.6395 0.9085 -0.1674 0.1071  -0.0551 2   DC  D "C4'" 
1315 O "O4'" . DC  D 2  ? 0.5594 0.6015 0.8315 -0.1649 0.1055  -0.0475 2   DC  D "O4'" 
1316 C "C3'" . DC  D 2  ? 0.5442 0.6457 0.9057 -0.1478 0.0918  -0.0520 2   DC  D "C3'" 
1317 O "O3'" . DC  D 2  ? 0.5528 0.6789 0.9512 -0.1463 0.0524  -0.0503 2   DC  D "O3'" 
1318 C "C2'" . DC  D 2  ? 0.5260 0.5938 0.8049 -0.1371 0.0935  -0.0441 2   DC  D "C2'" 
1319 C "C1'" . DC  D 2  ? 0.5205 0.5594 0.7575 -0.1464 0.0886  -0.0418 2   DC  D "C1'" 
1320 N N1    . DC  D 2  ? 0.4904 0.4889 0.6615 -0.1432 0.0982  -0.0339 2   DC  D N1    
1321 C C2    . DC  D 2  ? 0.4631 0.4409 0.5996 -0.1376 0.0802  -0.0314 2   DC  D C2    
1322 O O2    . DC  D 2  ? 0.4380 0.4287 0.5871 -0.1379 0.0609  -0.0379 2   DC  D O2    
1323 N N3    . DC  D 2  ? 0.4546 0.3967 0.5466 -0.1339 0.0840  -0.0227 2   DC  D N3    
1324 C C4    . DC  D 2  ? 0.4966 0.4189 0.5633 -0.1389 0.1013  -0.0143 2   DC  D C4    
1325 N N4    . DC  D 2  ? 0.5252 0.4092 0.5479 -0.1367 0.0960  -0.0021 2   DC  D N4    
1326 C C5    . DC  D 2  ? 0.5021 0.4407 0.5889 -0.1484 0.1248  -0.0190 2   DC  D C5    
1327 C C6    . DC  D 2  ? 0.4893 0.4679 0.6356 -0.1488 0.1243  -0.0299 2   DC  D C6    
1328 P P     . DC  D 3  ? 0.5241 0.6666 0.9338 -0.1297 0.0243  -0.0434 3   DC  D P     
1329 O OP1   . DC  D 3  ? 0.5219 0.6978 1.0129 -0.1349 -0.0062 -0.0425 3   DC  D OP1   
1330 O OP2   . DC  D 3  ? 0.4670 0.6024 0.8606 -0.1159 0.0502  -0.0436 3   DC  D OP2   
1331 O "O5'" . DC  D 3  ? 0.4699 0.5874 0.8009 -0.1286 0.0001  -0.0375 3   DC  D "O5'" 
1332 C "C5'" . DC  D 3  ? 0.4675 0.5735 0.7775 -0.1443 -0.0150 -0.0410 3   DC  D "C5'" 
1333 C "C4'" . DC  D 3  ? 0.4481 0.5273 0.6837 -0.1413 -0.0241 -0.0403 3   DC  D "C4'" 
1334 O "O4'" . DC  D 3  ? 0.4229 0.4780 0.6202 -0.1321 0.0042  -0.0409 3   DC  D "O4'" 
1335 C "C3'" . DC  D 3  ? 0.4413 0.5266 0.6619 -0.1313 -0.0448 -0.0324 3   DC  D "C3'" 
1336 O "O3'" . DC  D 3  ? 0.4920 0.5630 0.6695 -0.1454 -0.0693 -0.0346 3   DC  D "O3'" 
1337 C "C2'" . DC  D 3  ? 0.4040 0.4761 0.5924 -0.1141 -0.0204 -0.0306 3   DC  D "C2'" 
1338 C "C1'" . DC  D 3  ? 0.4026 0.4505 0.5642 -0.1179 0.0019  -0.0364 3   DC  D "C1'" 
1339 N N1    . DC  D 3  ? 0.3744 0.4088 0.5216 -0.1076 0.0268  -0.0327 3   DC  D N1    
1340 C C2    . DC  D 3  ? 0.3708 0.3775 0.4754 -0.1022 0.0328  -0.0319 3   DC  D C2    
1341 O O2    . DC  D 3  ? 0.3628 0.3595 0.4483 -0.1045 0.0236  -0.0378 3   DC  D O2    
1342 N N3    . DC  D 3  ? 0.3722 0.3620 0.4590 -0.0965 0.0479  -0.0252 3   DC  D N3    
1343 C C4    . DC  D 3  ? 0.3800 0.3767 0.4801 -0.0985 0.0632  -0.0227 3   DC  D C4    
1344 N N4    . DC  D 3  ? 0.4041 0.3764 0.4716 -0.0982 0.0763  -0.0160 3   DC  D N4    
1345 C C5    . DC  D 3  ? 0.3863 0.4131 0.5362 -0.1027 0.0652  -0.0278 3   DC  D C5    
1346 C C6    . DC  D 3  ? 0.3731 0.4191 0.5499 -0.1059 0.0437  -0.0311 3   DC  D C6    
1347 P P     . DT  D 4  ? 0.5580 0.6236 0.6983 -0.1450 -0.0934 -0.0266 4   DT  D P     
1348 O OP1   . DT  D 4  ? 0.5929 0.6537 0.7192 -0.1695 -0.1307 -0.0250 4   DT  D OP1   
1349 O OP2   . DT  D 4  ? 0.4947 0.5778 0.6695 -0.1257 -0.0922 -0.0160 4   DT  D OP2   
1350 O "O5'" . DT  D 4  ? 0.5098 0.5471 0.5846 -0.1422 -0.0704 -0.0363 4   DT  D "O5'" 
1351 C "C5'" . DT  D 4  ? 0.5043 0.5207 0.5546 -0.1536 -0.0563 -0.0509 4   DT  D "C5'" 
1352 C "C4'" . DT  D 4  ? 0.4942 0.4887 0.5033 -0.1465 -0.0347 -0.0598 4   DT  D "C4'" 
1353 O "O4'" . DT  D 4  ? 0.4530 0.4517 0.4828 -0.1243 -0.0154 -0.0536 4   DT  D "O4'" 
1354 C "C3'" . DT  D 4  ? 0.4917 0.4795 0.4587 -0.1506 -0.0430 -0.0588 4   DT  D "C3'" 
1355 O "O3'" . DT  D 4  ? 0.5242 0.4858 0.4521 -0.1619 -0.0245 -0.0782 4   DT  D "O3'" 
1356 C "C2'" . DT  D 4  ? 0.4387 0.4397 0.4238 -0.1268 -0.0350 -0.0473 4   DT  D "C2'" 
1357 C "C1'" . DT  D 4  ? 0.4153 0.4148 0.4274 -0.1125 -0.0131 -0.0492 4   DT  D "C1'" 
1358 N N1    . DT  D 4  ? 0.3656 0.3778 0.4044 -0.0952 -0.0065 -0.0376 4   DT  D N1    
1359 C C2    . DT  D 4  ? 0.3508 0.3497 0.3864 -0.0841 0.0100  -0.0372 4   DT  D C2    
1360 O O2    . DT  D 4  ? 0.3503 0.3317 0.3735 -0.0836 0.0176  -0.0449 4   DT  D O2    
1361 N N3    . DT  D 4  ? 0.3434 0.3478 0.3922 -0.0750 0.0167  -0.0279 4   DT  D N3    
1362 C C4    . DT  D 4  ? 0.3415 0.3652 0.4155 -0.0741 0.0147  -0.0230 4   DT  D C4    
1363 O O4    . DT  D 4  ? 0.3581 0.3804 0.4370 -0.0687 0.0277  -0.0190 4   DT  D O4    
1364 C C5    . DT  D 4  ? 0.3486 0.3897 0.4422 -0.0820 -0.0041 -0.0234 4   DT  D C5    
1365 C C7    . DT  D 4  ? 0.3374 0.4015 0.4781 -0.0791 -0.0094 -0.0187 4   DT  D C7    
1366 C C6    . DT  D 4  ? 0.3519 0.3850 0.4226 -0.0933 -0.0165 -0.0289 4   DT  D C6    
1367 P P     . DA  D 5  ? 0.5510 0.4933 0.4188 -0.1793 -0.0228 -0.0871 5   DA  D P     
1368 O OP1   . DA  D 5  ? 0.6036 0.5178 0.4391 -0.2005 -0.0044 -0.1127 5   DA  D OP1   
1369 O OP2   . DA  D 5  ? 0.5728 0.5219 0.4213 -0.1899 -0.0561 -0.0692 5   DA  D OP2   
1370 O "O5'" . DA  D 5  ? 0.4917 0.4396 0.3711 -0.1565 -0.0021 -0.0854 5   DA  D "O5'" 
1371 C "C5'" . DA  D 5  ? 0.4620 0.4053 0.3708 -0.1400 0.0239  -0.0961 5   DA  D "C5'" 
1372 C "C4'" . DA  D 5  ? 0.4144 0.3699 0.3436 -0.1175 0.0296  -0.0859 5   DA  D "C4'" 
1373 O "O4'" . DA  D 5  ? 0.3784 0.3520 0.3346 -0.1021 0.0154  -0.0661 5   DA  D "O4'" 
1374 C "C3'" . DA  D 5  ? 0.4278 0.3839 0.3256 -0.1239 0.0286  -0.0842 5   DA  D "C3'" 
1375 O "O3'" . DA  D 5  ? 0.4463 0.3899 0.3420 -0.1266 0.0562  -0.1044 5   DA  D "O3'" 
1376 C "C2'" . DA  D 5  ? 0.3721 0.3479 0.2928 -0.1038 0.0156  -0.0632 5   DA  D "C2'" 
1377 C "C1'" . DA  D 5  ? 0.3507 0.3338 0.3089 -0.0891 0.0145  -0.0564 5   DA  D "C1'" 
1378 N N9    . DA  D 5  ? 0.3170 0.3165 0.2928 -0.0810 0.0002  -0.0399 5   DA  D N9    
1379 C C8    . DA  D 5  ? 0.3235 0.3334 0.3003 -0.0887 -0.0194 -0.0313 5   DA  D C8    
1380 N N7    . DA  D 5  ? 0.2903 0.3150 0.2991 -0.0774 -0.0234 -0.0210 5   DA  D N7    
1381 C C5    . DA  D 5  ? 0.2908 0.3109 0.3062 -0.0650 -0.0054 -0.0222 5   DA  D C5    
1382 C C6    . DA  D 5  ? 0.2803 0.3044 0.3134 -0.0545 0.0030  -0.0163 5   DA  D C6    
1383 N N6    . DA  D 5  ? 0.2663 0.3045 0.3268 -0.0522 0.0007  -0.0117 5   DA  D N6    
1384 N N1    . DA  D 5  ? 0.2796 0.2893 0.3023 -0.0486 0.0142  -0.0161 5   DA  D N1    
1385 C C2    . DA  D 5  ? 0.2924 0.2895 0.3042 -0.0487 0.0161  -0.0217 5   DA  D C2    
1386 N N3    . DA  D 5  ? 0.2948 0.2897 0.2988 -0.0562 0.0152  -0.0316 5   DA  D N3    
1387 C C4    . DA  D 5  ? 0.3032 0.3083 0.3015 -0.0659 0.0048  -0.0314 5   DA  D C4    
1388 N N1    . 5CM D 6  ? 0.3122 0.3142 0.2824 -0.0542 0.0145  -0.0339 6   5CM D N1    
1389 C C2    . 5CM D 6  ? 0.2898 0.2962 0.2764 -0.0424 0.0105  -0.0234 6   5CM D C2    
1390 N N3    . 5CM D 6  ? 0.2699 0.2852 0.2625 -0.0422 0.0025  -0.0153 6   5CM D N3    
1391 C C4    . 5CM D 6  ? 0.2661 0.2872 0.2544 -0.0512 -0.0098 -0.0128 6   5CM D C4    
1392 C C5    . 5CM D 6  ? 0.3075 0.3197 0.2662 -0.0659 -0.0122 -0.0194 6   5CM D C5    
1393 C C5A   . 5CM D 6  ? 0.3389 0.3490 0.2792 -0.0813 -0.0333 -0.0125 6   5CM D C5A   
1394 C C6    . 5CM D 6  ? 0.3174 0.3200 0.2660 -0.0677 0.0044  -0.0320 6   5CM D C6    
1395 O O2    . 5CM D 6  ? 0.2824 0.2814 0.2790 -0.0342 0.0145  -0.0221 6   5CM D O2    
1396 N N4    . 5CM D 6  ? 0.2443 0.2761 0.2555 -0.0486 -0.0194 -0.0050 6   5CM D N4    
1397 C "C1'" . 5CM D 6  ? 0.3338 0.3277 0.3133 -0.0536 0.0296  -0.0473 6   5CM D "C1'" 
1398 C "C2'" . 5CM D 6  ? 0.3667 0.3596 0.3343 -0.0611 0.0405  -0.0565 6   5CM D "C2'" 
1399 C "C3'" . 5CM D 6  ? 0.3841 0.3691 0.3763 -0.0620 0.0598  -0.0755 6   5CM D "C3'" 
1400 C "C4'" . 5CM D 6  ? 0.3759 0.3524 0.3704 -0.0644 0.0574  -0.0780 6   5CM D "C4'" 
1401 O "O4'" . 5CM D 6  ? 0.3597 0.3432 0.3399 -0.0628 0.0384  -0.0606 6   5CM D "O4'" 
1402 O "O3'" . 5CM D 6  ? 0.4058 0.3945 0.4397 -0.0443 0.0563  -0.0704 6   5CM D "O3'" 
1403 C "C5'" . 5CM D 6  ? 0.4152 0.3780 0.3861 -0.0851 0.0726  -0.0982 6   5CM D "C5'" 
1404 O "O5'" . 5CM D 6  ? 0.4276 0.3893 0.3492 -0.1028 0.0640  -0.0936 6   5CM D "O5'" 
1405 P P     . 5CM D 6  ? 0.4725 0.4154 0.3477 -0.1312 0.0679  -0.1076 6   5CM D P     
1406 O OP1   . 5CM D 6  ? 0.5145 0.4429 0.3953 -0.1403 0.1027  -0.1362 6   5CM D OP1   
1407 O OP2   . 5CM D 6  ? 0.4984 0.4374 0.3221 -0.1491 0.0460  -0.0934 6   5CM D OP2   
1408 P P     . DA  D 7  ? 0.3885 0.3852 0.4509 -0.0380 0.0618  -0.0737 7   DA  D P     
1409 O OP1   . DA  D 7  ? 0.4499 0.4425 0.5630 -0.0342 0.0764  -0.0907 7   DA  D OP1   
1410 O OP2   . DA  D 7  ? 0.3879 0.3889 0.4170 -0.0505 0.0685  -0.0755 7   DA  D OP2   
1411 O "O5'" . DA  D 7  ? 0.3680 0.3673 0.4394 -0.0228 0.0380  -0.0524 7   DA  D "O5'" 
1412 C "C5'" . DA  D 7  ? 0.3558 0.3439 0.4346 -0.0158 0.0257  -0.0425 7   DA  D "C5'" 
1413 C "C4'" . DA  D 7  ? 0.3402 0.3246 0.4051 -0.0096 0.0071  -0.0238 7   DA  D "C4'" 
1414 O "O4'" . DA  D 7  ? 0.3255 0.3136 0.3541 -0.0144 0.0074  -0.0177 7   DA  D "O4'" 
1415 C "C3'" . DA  D 7  ? 0.3218 0.3130 0.3999 -0.0054 -0.0004 -0.0208 7   DA  D "C3'" 
1416 O "O3'" . DA  D 7  ? 0.3396 0.3157 0.4149 -0.0013 -0.0215 -0.0054 7   DA  D "O3'" 
1417 C "C2'" . DA  D 7  ? 0.3011 0.3015 0.3455 -0.0104 0.0043  -0.0195 7   DA  D "C2'" 
1418 C "C1'" . DA  D 7  ? 0.3057 0.3009 0.3227 -0.0132 0.0037  -0.0133 7   DA  D "C1'" 
1419 N N9    . DA  D 7  ? 0.2851 0.2890 0.2840 -0.0191 0.0087  -0.0149 7   DA  D N9    
1420 C C8    . DA  D 7  ? 0.2705 0.2785 0.2632 -0.0281 0.0158  -0.0235 7   DA  D C8    
1421 N N7    . DA  D 7  ? 0.2915 0.3026 0.2672 -0.0338 0.0105  -0.0187 7   DA  D N7    
1422 C C5    . DA  D 7  ? 0.2552 0.2679 0.2362 -0.0260 0.0047  -0.0097 7   DA  D C5    
1423 C C6    . DA  D 7  ? 0.2529 0.2705 0.2374 -0.0254 -0.0011 -0.0032 7   DA  D C6    
1424 N N6    . DA  D 7  ? 0.2482 0.2698 0.2311 -0.0324 -0.0109 0.0000  7   DA  D N6    
1425 N N1    . DA  D 7  ? 0.2416 0.2571 0.2333 -0.0192 0.0028  -0.0007 7   DA  D N1    
1426 C C2    . DA  D 7  ? 0.2453 0.2502 0.2279 -0.0167 0.0068  -0.0009 7   DA  D C2    
1427 N N3    . DA  D 7  ? 0.2457 0.2447 0.2266 -0.0161 0.0045  -0.0022 7   DA  D N3    
1428 C C4    . DA  D 7  ? 0.2532 0.2591 0.2401 -0.0192 0.0056  -0.0081 7   DA  D C4    
1429 P P     . DT  D 8  ? 0.3698 0.3459 0.4604 0.0015  -0.0399 0.0016  8   DT  D P     
1430 O OP1   . DT  D 8  ? 0.3789 0.3325 0.4780 0.0032  -0.0656 0.0164  8   DT  D OP1   
1431 O OP2   . DT  D 8  ? 0.3334 0.3300 0.4637 0.0031  -0.0277 -0.0125 8   DT  D OP2   
1432 O "O5'" . DT  D 8  ? 0.3361 0.3110 0.3770 -0.0038 -0.0392 0.0072  8   DT  D "O5'" 
1433 C "C5'" . DT  D 8  ? 0.3378 0.2951 0.3347 -0.0093 -0.0406 0.0158  8   DT  D "C5'" 
1434 C "C4'" . DT  D 8  ? 0.3325 0.2923 0.2996 -0.0131 -0.0324 0.0141  8   DT  D "C4'" 
1435 O "O4'" . DT  D 8  ? 0.3089 0.2861 0.2815 -0.0115 -0.0159 0.0063  8   DT  D "O4'" 
1436 C "C3'" . DT  D 8  ? 0.3236 0.2867 0.2941 -0.0132 -0.0411 0.0138  8   DT  D "C3'" 
1437 O "O3'" . DT  D 8  ? 0.3505 0.2880 0.2863 -0.0215 -0.0560 0.0224  8   DT  D "O3'" 
1438 C "C2'" . DT  D 8  ? 0.2932 0.2706 0.2611 -0.0123 -0.0254 0.0068  8   DT  D "C2'" 
1439 C "C1'" . DT  D 8  ? 0.2989 0.2805 0.2625 -0.0120 -0.0128 0.0048  8   DT  D "C1'" 
1440 N N1    . DT  D 8  ? 0.2686 0.2658 0.2430 -0.0116 -0.0051 0.0004  8   DT  D N1    
1441 C C2    . DT  D 8  ? 0.2669 0.2665 0.2374 -0.0119 -0.0007 0.0013  8   DT  D C2    
1442 O O2    . DT  D 8  ? 0.2807 0.2730 0.2452 -0.0116 0.0037  0.0015  8   DT  D O2    
1443 N N3    . DT  D 8  ? 0.2615 0.2700 0.2367 -0.0147 -0.0018 0.0013  8   DT  D N3    
1444 C C4    . DT  D 8  ? 0.2451 0.2571 0.2179 -0.0206 -0.0005 -0.0023 8   DT  D C4    
1445 O O4    . DT  D 8  ? 0.2617 0.2743 0.2250 -0.0281 -0.0032 -0.0006 8   DT  D O4    
1446 C C5    . DT  D 8  ? 0.2417 0.2536 0.2254 -0.0192 0.0031  -0.0081 8   DT  D C5    
1447 C C7    . DT  D 8  ? 0.2428 0.2583 0.2324 -0.0269 0.0133  -0.0180 8   DT  D C7    
1448 C C6    . DT  D 8  ? 0.2596 0.2654 0.2485 -0.0133 -0.0025 -0.0049 8   DT  D C6    
1449 P P     . DT  D 9  ? 0.3526 0.2819 0.2660 -0.0279 -0.0615 0.0211  9   DT  D P     
1450 O OP1   . DT  D 9  ? 0.3879 0.2859 0.2660 -0.0402 -0.0855 0.0319  9   DT  D OP1   
1451 O OP2   . DT  D 9  ? 0.3361 0.2896 0.2888 -0.0215 -0.0604 0.0151  9   DT  D OP2   
1452 O "O5'" . DT  D 9  ? 0.3450 0.2726 0.2335 -0.0301 -0.0365 0.0128  9   DT  D "O5'" 
1453 C "C5'" . DT  D 9  ? 0.3801 0.2934 0.2422 -0.0361 -0.0222 0.0120  9   DT  D "C5'" 
1454 C "C4'" . DT  D 9  ? 0.3743 0.2913 0.2358 -0.0360 0.0019  0.0010  9   DT  D "C4'" 
1455 O "O4'" . DT  D 9  ? 0.3238 0.2686 0.2268 -0.0240 0.0066  -0.0013 9   DT  D "O4'" 
1456 C "C3'" . DT  D 9  ? 0.3991 0.2998 0.2377 -0.0431 0.0062  -0.0060 9   DT  D "C3'" 
1457 O "O3'" . DT  D 9  ? 0.4360 0.3254 0.2633 -0.0495 0.0334  -0.0173 9   DT  D "O3'" 
1458 C "C2'" . DT  D 9  ? 0.3661 0.2893 0.2421 -0.0316 0.0025  -0.0072 9   DT  D "C2'" 
1459 C "C1'" . DT  D 9  ? 0.3334 0.2800 0.2440 -0.0216 0.0092  -0.0059 9   DT  D "C1'" 
1460 N N1    . DT  D 9  ? 0.2936 0.2605 0.2313 -0.0146 0.0008  -0.0019 9   DT  D N1    
1461 C C2    . DT  D 9  ? 0.2834 0.2620 0.2431 -0.0100 0.0049  -0.0012 9   DT  D C2    
1462 O O2    . DT  D 9  ? 0.2771 0.2545 0.2494 -0.0082 0.0144  -0.0047 9   DT  D O2    
1463 N N3    . DT  D 9  ? 0.2596 0.2493 0.2277 -0.0100 -0.0027 0.0031  9   DT  D N3    
1464 C C4    . DT  D 9  ? 0.2615 0.2552 0.2270 -0.0130 -0.0069 0.0031  9   DT  D C4    
1465 O O4    . DT  D 9  ? 0.3124 0.3125 0.2802 -0.0171 -0.0071 0.0041  9   DT  D O4    
1466 C C5    . DT  D 9  ? 0.2785 0.2658 0.2389 -0.0137 -0.0114 0.0016  9   DT  D C5    
1467 C C7    . DT  D 9  ? 0.2609 0.2559 0.2381 -0.0154 -0.0167 0.0000  9   DT  D C7    
1468 C C6    . DT  D 9  ? 0.2824 0.2549 0.2247 -0.0151 -0.0107 0.0011  9   DT  D C6    
1469 P P     . DC  D 10 ? 0.5044 0.3621 0.2908 -0.0652 0.0511  -0.0313 10  DC  D P     
1470 O OP1   . DC  D 10 ? 0.5249 0.3679 0.2949 -0.0768 0.0811  -0.0420 10  DC  D OP1   
1471 O OP2   . DC  D 10 ? 0.5468 0.3799 0.2862 -0.0781 0.0269  -0.0248 10  DC  D OP2   
1472 O "O5'" . DC  D 10 ? 0.4673 0.3423 0.3003 -0.0518 0.0590  -0.0398 10  DC  D "O5'" 
1473 C "C5'" . DC  D 10 ? 0.4463 0.3424 0.3337 -0.0396 0.0755  -0.0453 10  DC  D "C5'" 
1474 C "C4'" . DC  D 10 ? 0.4310 0.3365 0.3576 -0.0281 0.0711  -0.0466 10  DC  D "C4'" 
1475 O "O4'" . DC  D 10 ? 0.3802 0.3052 0.3195 -0.0194 0.0447  -0.0307 10  DC  D "O4'" 
1476 C "C3'" . DC  D 10 ? 0.4679 0.3473 0.3688 -0.0368 0.0774  -0.0578 10  DC  D "C3'" 
1477 O "O3'" . DC  D 10 ? 0.5145 0.3922 0.4611 -0.0297 0.0969  -0.0707 10  DC  D "O3'" 
1478 C "C2'" . DC  D 10 ? 0.4505 0.3376 0.3475 -0.0333 0.0493  -0.0445 10  DC  D "C2'" 
1479 C "C1'" . DC  D 10 ? 0.3818 0.2988 0.3181 -0.0198 0.0364  -0.0306 10  DC  D "C1'" 
1480 N N1    . DC  D 10 ? 0.3387 0.2687 0.2701 -0.0191 0.0153  -0.0184 10  DC  D N1    
1481 C C2    . DC  D 10 ? 0.3178 0.2654 0.2756 -0.0124 0.0067  -0.0090 10  DC  D C2    
1482 O O2    . DC  D 10 ? 0.3169 0.2672 0.3013 -0.0065 0.0093  -0.0074 10  DC  D O2    
1483 N N3    . DC  D 10 ? 0.2842 0.2423 0.2386 -0.0148 -0.0042 -0.0026 10  DC  D N3    
1484 C C4    . DC  D 10 ? 0.2822 0.2389 0.2231 -0.0196 -0.0105 -0.0039 10  DC  D C4    
1485 N N4    . DC  D 10 ? 0.2701 0.2400 0.2230 -0.0211 -0.0171 -0.0008 10  DC  D N4    
1486 C C5    . DC  D 10 ? 0.3006 0.2393 0.2156 -0.0254 -0.0107 -0.0086 10  DC  D C5    
1487 C C6    . DC  D 10 ? 0.3322 0.2560 0.2359 -0.0269 0.0040  -0.0164 10  DC  D C6    
1488 P P     . DC  D 11 ? 0.5716 0.4159 0.5004 -0.0415 0.1230  -0.0940 11  DC  D P     
1489 O OP1   . DC  D 11 ? 0.6472 0.4862 0.6019 -0.0446 0.1603  -0.1142 11  DC  D OP1   
1490 O OP2   . DC  D 11 ? 0.6091 0.4274 0.4639 -0.0600 0.1116  -0.0940 11  DC  D OP2   
1491 O "O5'" . DC  D 11 ? 0.5802 0.4287 0.5578 -0.0277 0.1118  -0.0906 11  DC  D "O5'" 
1492 C "C5'" . DC  D 11 ? 0.5660 0.4366 0.6172 -0.0095 0.1064  -0.0826 11  DC  D "C5'" 
1493 C "C4'" . DC  D 11 ? 0.5177 0.3982 0.5799 -0.0013 0.0737  -0.0607 11  DC  D "C4'" 
1494 O "O4'" . DC  D 11 ? 0.5054 0.3957 0.5199 -0.0077 0.0538  -0.0468 11  DC  D "O4'" 
1495 C "C3'" . DC  D 11 ? 0.5430 0.4005 0.6086 -0.0027 0.0728  -0.0656 11  DC  D "C3'" 
1496 O "O3'" . DC  D 11 ? 0.5804 0.4431 0.7105 0.0113  0.0606  -0.0546 11  DC  D "O3'" 
1497 C "C2'" . DC  D 11 ? 0.5170 0.3762 0.5346 -0.0112 0.0506  -0.0523 11  DC  D "C2'" 
1498 C "C1'" . DC  D 11 ? 0.4594 0.3460 0.4733 -0.0075 0.0360  -0.0363 11  DC  D "C1'" 
1499 N N1    . DC  D 11 ? 0.4159 0.3117 0.3919 -0.0152 0.0213  -0.0276 11  DC  D N1    
1500 C C2    . DC  D 11 ? 0.3784 0.2914 0.3614 -0.0132 0.0049  -0.0114 11  DC  D C2    
1501 O O2    . DC  D 11 ? 0.3460 0.2619 0.3555 -0.0074 -0.0018 -0.0016 11  DC  D O2    
1502 N N3    . DC  D 11 ? 0.3402 0.2635 0.3026 -0.0196 -0.0034 -0.0075 11  DC  D N3    
1503 C C4    . DC  D 11 ? 0.3634 0.2810 0.3025 -0.0263 -0.0038 -0.0147 11  DC  D C4    
1504 N N4    . DC  D 11 ? 0.3547 0.2848 0.2907 -0.0306 -0.0148 -0.0103 11  DC  D N4    
1505 C C5    . DC  D 11 ? 0.4069 0.3026 0.3252 -0.0313 0.0068  -0.0274 11  DC  D C5    
1506 C C6    . DC  D 11 ? 0.4267 0.3121 0.3626 -0.0262 0.0232  -0.0356 11  DC  D C6    
1507 P P     . DG  D 12 ? 0.5692 0.4071 0.7495 0.0175  0.0696  -0.0651 12  DG  D P     
1508 O OP1   . DG  D 12 ? 0.5994 0.4459 0.8602 0.0310  0.0805  -0.0720 12  DG  D OP1   
1509 O OP2   . DG  D 12 ? 0.6127 0.4230 0.7487 0.0038  0.0915  -0.0875 12  DG  D OP2   
1510 O "O5'" . DG  D 12 ? 0.5493 0.3844 0.7333 0.0201  0.0338  -0.0370 12  DG  D "O5'" 
1511 C "C5'" . DG  D 12 ? 0.5144 0.3679 0.7108 0.0246  0.0042  -0.0102 12  DG  D "C5'" 
1512 C "C4'" . DG  D 12 ? 0.5065 0.3504 0.6664 0.0153  -0.0205 0.0116  12  DG  D "C4'" 
1513 O "O4'" . DG  D 12 ? 0.4725 0.3336 0.5743 0.0046  -0.0201 0.0135  12  DG  D "O4'" 
1514 C "C3'" . DG  D 12 ? 0.5253 0.3410 0.6765 0.0096  -0.0159 0.0059  12  DG  D "C3'" 
1515 O "O3'" . DG  D 12 ? 0.5932 0.3856 0.7915 0.0160  -0.0332 0.0199  12  DG  D "O3'" 
1516 C "C2'" . DG  D 12 ? 0.5090 0.3289 0.6016 -0.0057 -0.0250 0.0165  12  DG  D "C2'" 
1517 C "C1'" . DG  D 12 ? 0.4668 0.3165 0.5340 -0.0074 -0.0261 0.0196  12  DG  D "C1'" 
1518 N N9    . DG  D 12 ? 0.4323 0.2937 0.4617 -0.0152 -0.0139 0.0065  12  DG  D N9    
1519 C C8    . DG  D 12 ? 0.4210 0.2765 0.4392 -0.0166 0.0025  -0.0137 12  DG  D C8    
1520 N N7    . DG  D 12 ? 0.3969 0.2629 0.3817 -0.0252 0.0014  -0.0169 12  DG  D N7    
1521 C C5    . DG  D 12 ? 0.3765 0.2593 0.3579 -0.0280 -0.0106 -0.0016 12  DG  D C5    
1522 C C6    . DG  D 12 ? 0.3523 0.2529 0.3177 -0.0354 -0.0148 0.0000  12  DG  D C6    
1523 O O6    . DG  D 12 ? 0.3592 0.2646 0.3127 -0.0397 -0.0156 -0.0077 12  DG  D O6    
1524 N N1    . DG  D 12 ? 0.3463 0.2563 0.3122 -0.0396 -0.0193 0.0123  12  DG  D N1    
1525 C C2    . DG  D 12 ? 0.3681 0.2674 0.3381 -0.0395 -0.0257 0.0255  12  DG  D C2    
1526 N N2    . DG  D 12 ? 0.3683 0.2718 0.3222 -0.0504 -0.0285 0.0356  12  DG  D N2    
1527 N N3    . DG  D 12 ? 0.3882 0.2710 0.3781 -0.0311 -0.0298 0.0284  12  DG  D N3    
1528 C C4    . DG  D 12 ? 0.3881 0.2658 0.3880 -0.0243 -0.0190 0.0125  12  DG  D C4    
1529 N N     . LYS E 7  ? 0.7151 0.6668 0.5379 -0.0296 -0.0372 -0.0106 148 LYS E N     
1530 C CA    . LYS E 7  ? 0.6744 0.6865 0.5255 -0.0367 -0.0221 -0.0100 148 LYS E CA    
1531 C C     . LYS E 7  ? 0.6144 0.6381 0.4750 -0.0174 -0.0158 -0.0098 148 LYS E C     
1532 O O     . LYS E 7  ? 0.5789 0.6404 0.4685 -0.0017 -0.0081 -0.0156 148 LYS E O     
1533 C CB    . LYS E 7  ? 0.6433 0.7023 0.5286 -0.0302 -0.0177 -0.0179 148 LYS E CB    
1534 N N     . ARG E 8  ? 0.6208 0.6080 0.4533 -0.0194 -0.0209 -0.0028 149 ARG E N     
1535 C CA    . ARG E 8  ? 0.5994 0.5949 0.4356 -0.0048 -0.0167 -0.0023 149 ARG E CA    
1536 C C     . ARG E 8  ? 0.5685 0.5932 0.4024 -0.0240 -0.0046 0.0010  149 ARG E C     
1537 O O     . ARG E 8  ? 0.5828 0.5848 0.3848 -0.0464 -0.0070 0.0105  149 ARG E O     
1538 C CB    . ARG E 8  ? 0.6624 0.6085 0.4709 0.0071  -0.0307 0.0024  149 ARG E CB    
1539 C CG    . ARG E 8  ? 0.6702 0.6059 0.4896 0.0342  -0.0393 -0.0059 149 ARG E CG    
1540 C CD    . ARG E 8  ? 0.7153 0.6271 0.5213 0.0538  -0.0504 -0.0050 149 ARG E CD    
1541 N NE    . ARG E 8  ? 0.7119 0.6200 0.5276 0.0786  -0.0583 -0.0155 149 ARG E NE    
1542 C CZ    . ARG E 8  ? 0.7395 0.6414 0.5533 0.1017  -0.0682 -0.0195 149 ARG E CZ    
1543 N NH1   . ARG E 8  ? 0.7446 0.6389 0.5457 0.1039  -0.0736 -0.0126 149 ARG E NH1   
1544 N NH2   . ARG E 8  ? 0.7515 0.6606 0.5767 0.1232  -0.0730 -0.0319 149 ARG E NH2   
1545 N N     . MET E 9  ? 0.4968 0.5702 0.3614 -0.0151 0.0074  -0.0073 150 MET E N     
1546 C CA    . MET E 9  ? 0.4680 0.5801 0.3360 -0.0277 0.0210  -0.0096 150 MET E CA    
1547 C C     . MET E 9  ? 0.4323 0.5394 0.2928 -0.0157 0.0237  -0.0108 150 MET E C     
1548 O O     . MET E 9  ? 0.3834 0.4859 0.2570 0.0071  0.0208  -0.0157 150 MET E O     
1549 C CB    . MET E 9  ? 0.4478 0.6142 0.3529 -0.0189 0.0305  -0.0211 150 MET E CB    
1550 C CG    . MET E 9  ? 0.4610 0.6415 0.3795 -0.0281 0.0268  -0.0217 150 MET E CG    
1551 S SD    . MET E 9  ? 0.5232 0.6897 0.4116 -0.0701 0.0241  -0.0114 150 MET E SD    
1552 C CE    . MET E 9  ? 0.5370 0.7594 0.4257 -0.0918 0.0418  -0.0142 150 MET E CE    
1553 N N     . ASP E 10 ? 0.4452 0.5549 0.2819 -0.0346 0.0292  -0.0061 151 ASP E N     
1554 C CA    . ASP E 10 ? 0.4411 0.5623 0.2736 -0.0271 0.0359  -0.0110 151 ASP E CA    
1555 C C     . ASP E 10 ? 0.4072 0.5678 0.2748 -0.0049 0.0455  -0.0273 151 ASP E C     
1556 O O     . ASP E 10 ? 0.3852 0.5835 0.2783 -0.0035 0.0523  -0.0353 151 ASP E O     
1557 C CB    . ASP E 10 ? 0.4766 0.6114 0.2814 -0.0557 0.0449  -0.0063 151 ASP E CB    
1558 C CG    . ASP E 10 ? 0.5265 0.6066 0.2855 -0.0730 0.0312  0.0114  151 ASP E CG    
1559 O OD1   . ASP E 10 ? 0.5448 0.5892 0.2929 -0.0557 0.0187  0.0153  151 ASP E OD1   
1560 O OD2   . ASP E 10 ? 0.5610 0.6337 0.2932 -0.1042 0.0316  0.0216  151 ASP E OD2   
1561 N N     . CYS E 11 ? 0.3966 0.5447 0.2633 0.0125  0.0433  -0.0320 152 CYS E N     
1562 C CA    . CYS E 11 ? 0.3856 0.5552 0.2738 0.0322  0.0493  -0.0465 152 CYS E CA    
1563 C C     . CYS E 11 ? 0.4056 0.5867 0.2774 0.0294  0.0585  -0.0546 152 CYS E C     
1564 O O     . CYS E 11 ? 0.4130 0.5693 0.2677 0.0330  0.0532  -0.0533 152 CYS E O     
1565 C CB    . CYS E 11 ? 0.3723 0.5162 0.2693 0.0507  0.0390  -0.0463 152 CYS E CB    
1566 S SG    . CYS E 11 ? 0.3904 0.5458 0.3063 0.0732  0.0421  -0.0619 152 CYS E SG    
1567 N N     . PRO E 12 ? 0.4212 0.6452 0.2980 0.0223  0.0725  -0.0645 153 PRO E N     
1568 C CA    . PRO E 12 ? 0.4412 0.6819 0.2987 0.0167  0.0834  -0.0740 153 PRO E CA    
1569 C C     . PRO E 12 ? 0.4469 0.6699 0.3020 0.0385  0.0812  -0.0867 153 PRO E C     
1570 O O     . PRO E 12 ? 0.4855 0.7015 0.3148 0.0316  0.0840  -0.0893 153 PRO E O     
1571 C CB    . PRO E 12 ? 0.4382 0.7410 0.3139 0.0132  0.0996  -0.0881 153 PRO E CB    
1572 C CG    . PRO E 12 ? 0.4259 0.7420 0.3228 0.0064  0.0960  -0.0804 153 PRO E CG    
1573 C CD    . PRO E 12 ? 0.4111 0.6774 0.3120 0.0177  0.0792  -0.0686 153 PRO E CD    
1574 N N     . ALA E 13 ? 0.4253 0.6379 0.3027 0.0618  0.0751  -0.0936 154 ALA E N     
1575 C CA    . ALA E 13 ? 0.4457 0.6348 0.3176 0.0802  0.0712  -0.1058 154 ALA E CA    
1576 C C     . ALA E 13 ? 0.4519 0.5998 0.3035 0.0732  0.0596  -0.0947 154 ALA E C     
1577 O O     . ALA E 13 ? 0.4734 0.6018 0.3104 0.0787  0.0571  -0.1035 154 ALA E O     
1578 C CB    . ALA E 13 ? 0.4535 0.6371 0.3498 0.1042  0.0652  -0.1134 154 ALA E CB    
1579 N N     . LEU E 14 ? 0.4407 0.5763 0.2913 0.0620  0.0515  -0.0769 155 LEU E N     
1580 C CA    . LEU E 14 ? 0.4429 0.5509 0.2776 0.0568  0.0400  -0.0674 155 LEU E CA    
1581 C C     . LEU E 14 ? 0.4666 0.5748 0.2730 0.0404  0.0408  -0.0609 155 LEU E C     
1582 O O     . LEU E 14 ? 0.4743 0.6022 0.2723 0.0290  0.0508  -0.0612 155 LEU E O     
1583 C CB    . LEU E 14 ? 0.4152 0.5115 0.2637 0.0587  0.0295  -0.0549 155 LEU E CB    
1584 C CG    . LEU E 14 ? 0.4039 0.4954 0.2729 0.0719  0.0265  -0.0595 155 LEU E CG    
1585 C CD1   . LEU E 14 ? 0.3919 0.4798 0.2743 0.0728  0.0191  -0.0494 155 LEU E CD1   
1586 C CD2   . LEU E 14 ? 0.4146 0.4876 0.2743 0.0750  0.0212  -0.0653 155 LEU E CD2   
1587 N N     . PRO E 15 ? 0.4739 0.5631 0.2638 0.0372  0.0296  -0.0546 156 PRO E N     
1588 C CA    . PRO E 15 ? 0.4969 0.5811 0.2565 0.0225  0.0260  -0.0454 156 PRO E CA    
1589 C C     . PRO E 15 ? 0.5064 0.5838 0.2579 0.0119  0.0225  -0.0297 156 PRO E C     
1590 O O     . PRO E 15 ? 0.4793 0.5556 0.2516 0.0170  0.0214  -0.0262 156 PRO E O     
1591 C CB    . PRO E 15 ? 0.4956 0.5646 0.2479 0.0260  0.0108  -0.0416 156 PRO E CB    
1592 C CG    . PRO E 15 ? 0.4854 0.5555 0.2518 0.0348  0.0137  -0.0555 156 PRO E CG    
1593 C CD    . PRO E 15 ? 0.4663 0.5419 0.2605 0.0445  0.0202  -0.0578 156 PRO E CD    
1594 N N     . PRO E 16 ? 0.5477 0.6166 0.2641 -0.0050 0.0199  -0.0200 157 PRO E N     
1595 C CA    . PRO E 16 ? 0.5667 0.6201 0.2660 -0.0201 0.0155  -0.0042 157 PRO E CA    
1596 C C     . PRO E 16 ? 0.5473 0.5716 0.2560 -0.0071 -0.0020 0.0057  157 PRO E C     
1597 O O     . PRO E 16 ? 0.5346 0.5485 0.2460 0.0074  -0.0152 0.0064  157 PRO E O     
1598 C CB    . PRO E 16 ? 0.6171 0.6559 0.2704 -0.0385 0.0100  0.0064  157 PRO E CB    
1599 C CG    . PRO E 16 ? 0.6238 0.6860 0.2734 -0.0371 0.0199  -0.0086 157 PRO E CG    
1600 C CD    . PRO E 16 ? 0.5771 0.6478 0.2635 -0.0139 0.0205  -0.0231 157 PRO E CD    
1601 N N     . GLY E 17 ? 0.5415 0.5579 0.2561 -0.0123 -0.0015 0.0112  158 GLY E N     
1602 C CA    . GLY E 17 ? 0.5497 0.5346 0.2660 -0.0013 -0.0181 0.0193  158 GLY E CA    
1603 C C     . GLY E 17 ? 0.5020 0.5013 0.2584 0.0184  -0.0164 0.0092  158 GLY E C     
1604 O O     . GLY E 17 ? 0.5018 0.4803 0.2615 0.0265  -0.0268 0.0128  158 GLY E O     
1605 N N     . TRP E 18 ? 0.4693 0.4994 0.2513 0.0258  -0.0047 -0.0034 159 TRP E N     
1606 C CA    . TRP E 18 ? 0.4458 0.4889 0.2613 0.0403  -0.0023 -0.0115 159 TRP E CA    
1607 C C     . TRP E 18 ? 0.4472 0.4983 0.2753 0.0342  0.0045  -0.0118 159 TRP E C     
1608 O O     . TRP E 18 ? 0.4646 0.5349 0.2909 0.0211  0.0162  -0.0142 159 TRP E O     
1609 C CB    . TRP E 18 ? 0.4280 0.4915 0.2589 0.0473  0.0057  -0.0232 159 TRP E CB    
1610 C CG    . TRP E 18 ? 0.4326 0.4918 0.2598 0.0540  -0.0032 -0.0243 159 TRP E CG    
1611 C CD1   . TRP E 18 ? 0.4532 0.5098 0.2597 0.0487  -0.0064 -0.0240 159 TRP E CD1   
1612 C CD2   . TRP E 18 ? 0.4188 0.4817 0.2632 0.0645  -0.0103 -0.0264 159 TRP E CD2   
1613 N NE1   . TRP E 18 ? 0.4446 0.5046 0.2564 0.0553  -0.0159 -0.0258 159 TRP E NE1   
1614 C CE2   . TRP E 18 ? 0.4243 0.4905 0.2597 0.0642  -0.0177 -0.0274 159 TRP E CE2   
1615 C CE3   . TRP E 18 ? 0.3867 0.4544 0.2519 0.0719  -0.0109 -0.0277 159 TRP E CE3   
1616 C CZ2   . TRP E 18 ? 0.4064 0.4856 0.2551 0.0696  -0.0247 -0.0301 159 TRP E CZ2   
1617 C CZ3   . TRP E 18 ? 0.3746 0.4527 0.2503 0.0775  -0.0170 -0.0301 159 TRP E CZ3   
1618 C CH2   . TRP E 18 ? 0.3871 0.4733 0.2559 0.0758  -0.0234 -0.0314 159 TRP E CH2   
1619 N N     . LYS E 19 ? 0.4309 0.4733 0.2724 0.0430  -0.0021 -0.0111 160 LYS E N     
1620 C CA    . LYS E 19 ? 0.4250 0.4750 0.2785 0.0367  0.0020  -0.0118 160 LYS E CA    
1621 C C     . LYS E 19 ? 0.4028 0.4687 0.2849 0.0511  0.0034  -0.0193 160 LYS E C     
1622 O O     . LYS E 19 ? 0.3981 0.4649 0.2878 0.0634  0.0004  -0.0228 160 LYS E O     
1623 C CB    . LYS E 19 ? 0.4609 0.4771 0.2931 0.0280  -0.0087 -0.0028 160 LYS E CB    
1624 C CG    . LYS E 19 ? 0.5125 0.5107 0.3105 0.0054  -0.0095 0.0074  160 LYS E CG    
1625 C CD    . LYS E 19 ? 0.5596 0.5051 0.3250 0.0011  -0.0267 0.0180  160 LYS E CD    
1626 C CE    . LYS E 19 ? 0.6081 0.5283 0.3311 -0.0223 -0.0304 0.0312  160 LYS E CE    
1627 N N     . LYS E 20 ? 0.3896 0.4699 0.2850 0.0462  0.0075  -0.0212 161 LYS E N     
1628 C CA    . LYS E 20 ? 0.3674 0.4637 0.2862 0.0569  0.0083  -0.0268 161 LYS E CA    
1629 C C     . LYS E 20 ? 0.3921 0.4843 0.3125 0.0498  0.0039  -0.0246 161 LYS E C     
1630 O O     . LYS E 20 ? 0.4051 0.4977 0.3162 0.0329  0.0055  -0.0212 161 LYS E O     
1631 C CB    . LYS E 20 ? 0.3618 0.4882 0.2968 0.0603  0.0175  -0.0341 161 LYS E CB    
1632 C CG    . LYS E 20 ? 0.3488 0.4848 0.3031 0.0737  0.0148  -0.0384 161 LYS E CG    
1633 C CD    . LYS E 20 ? 0.3482 0.5112 0.3183 0.0829  0.0202  -0.0472 161 LYS E CD    
1634 C CE    . LYS E 20 ? 0.3511 0.5486 0.3368 0.0759  0.0233  -0.0493 161 LYS E CE    
1635 N N     . GLU E 21 ? 0.3834 0.4717 0.3122 0.0597  -0.0015 -0.0267 162 GLU E N     
1636 C CA    . GLU E 21 ? 0.4181 0.5043 0.3486 0.0543  -0.0059 -0.0270 162 GLU E CA    
1637 C C     . GLU E 21 ? 0.3958 0.5014 0.3447 0.0633  -0.0060 -0.0306 162 GLU E C     
1638 O O     . GLU E 21 ? 0.3915 0.4971 0.3439 0.0743  -0.0065 -0.0318 162 GLU E O     
1639 C CB    . GLU E 21 ? 0.4670 0.5208 0.3801 0.0579  -0.0153 -0.0270 162 GLU E CB    
1640 C CG    . GLU E 21 ? 0.5006 0.5426 0.4069 0.0485  -0.0207 -0.0284 162 GLU E CG    
1641 C CD    . GLU E 21 ? 0.5537 0.5603 0.4413 0.0575  -0.0311 -0.0323 162 GLU E CD    
1642 O OE1   . GLU E 21 ? 0.5781 0.5760 0.4619 0.0732  -0.0344 -0.0341 162 GLU E OE1   
1643 O OE2   . GLU E 21 ? 0.5798 0.5692 0.4565 0.0497  -0.0369 -0.0350 162 GLU E OE2   
1644 N N     . GLU E 22 ? 0.3771 0.4992 0.3352 0.0565  -0.0068 -0.0316 163 GLU E N     
1645 C CA    . GLU E 22 ? 0.3603 0.4975 0.3315 0.0644  -0.0102 -0.0334 163 GLU E CA    
1646 C C     . GLU E 22 ? 0.3580 0.4867 0.3219 0.0574  -0.0166 -0.0345 163 GLU E C     
1647 O O     . GLU E 22 ? 0.3753 0.5013 0.3333 0.0431  -0.0179 -0.0345 163 GLU E O     
1648 C CB    . GLU E 22 ? 0.3667 0.5370 0.3573 0.0670  -0.0078 -0.0355 163 GLU E CB    
1649 C CG    . GLU E 22 ? 0.3927 0.5716 0.3925 0.0785  -0.0150 -0.0355 163 GLU E CG    
1650 C CD    . GLU E 22 ? 0.4025 0.6127 0.4223 0.0888  -0.0162 -0.0391 163 GLU E CD    
1651 O OE1   . GLU E 22 ? 0.4274 0.6464 0.4537 0.0963  -0.0253 -0.0381 163 GLU E OE1   
1652 O OE2   . GLU E 22 ? 0.4457 0.6732 0.4737 0.0909  -0.0088 -0.0439 163 GLU E OE2   
1653 N N     . VAL E 23 ? 0.3274 0.4514 0.2886 0.0652  -0.0206 -0.0360 164 VAL E N     
1654 C CA    . VAL E 23 ? 0.3271 0.4427 0.2783 0.0608  -0.0262 -0.0399 164 VAL E CA    
1655 C C     . VAL E 23 ? 0.3042 0.4377 0.2614 0.0629  -0.0304 -0.0392 164 VAL E C     
1656 O O     . VAL E 23 ? 0.2860 0.4231 0.2438 0.0704  -0.0304 -0.0365 164 VAL E O     
1657 C CB    . VAL E 23 ? 0.3482 0.4427 0.2847 0.0687  -0.0272 -0.0453 164 VAL E CB    
1658 C CG1   . VAL E 23 ? 0.3791 0.4638 0.3029 0.0662  -0.0329 -0.0531 164 VAL E CG1   
1659 C CG2   . VAL E 23 ? 0.3435 0.4163 0.2712 0.0702  -0.0265 -0.0444 164 VAL E CG2   
1660 N N     . ILE E 24 ? 0.3175 0.4582 0.2741 0.0533  -0.0357 -0.0413 165 ILE E N     
1661 C CA    . ILE E 24 ? 0.3068 0.4655 0.2669 0.0529  -0.0425 -0.0400 165 ILE E CA    
1662 C C     . ILE E 24 ? 0.3268 0.4739 0.2690 0.0532  -0.0446 -0.0447 165 ILE E C     
1663 O O     . ILE E 24 ? 0.3416 0.4713 0.2702 0.0491  -0.0447 -0.0527 165 ILE E O     
1664 C CB    . ILE E 24 ? 0.3146 0.4906 0.2807 0.0392  -0.0479 -0.0418 165 ILE E CB    
1665 C CG1   . ILE E 24 ? 0.3086 0.5051 0.2928 0.0350  -0.0433 -0.0399 165 ILE E CG1   
1666 C CG2   . ILE E 24 ? 0.3096 0.5065 0.2787 0.0399  -0.0578 -0.0401 165 ILE E CG2   
1667 C CD1   . ILE E 24 ? 0.3009 0.5170 0.3034 0.0519  -0.0414 -0.0367 165 ILE E CD1   
1668 N N     . ARG E 25 ? 0.3296 0.4847 0.2681 0.0576  -0.0471 -0.0403 166 ARG E N     
1669 C CA    . ARG E 25 ? 0.3429 0.4964 0.2629 0.0550  -0.0477 -0.0457 166 ARG E CA    
1670 C C     . ARG E 25 ? 0.3754 0.5342 0.2875 0.0455  -0.0555 -0.0504 166 ARG E C     
1671 O O     . ARG E 25 ? 0.3755 0.5492 0.2951 0.0422  -0.0635 -0.0439 166 ARG E O     
1672 C CB    . ARG E 25 ? 0.3306 0.4902 0.2432 0.0558  -0.0489 -0.0373 166 ARG E CB    
1673 C CG    . ARG E 25 ? 0.3047 0.4584 0.2198 0.0608  -0.0416 -0.0343 166 ARG E CG    
1674 C CD    . ARG E 25 ? 0.3041 0.4599 0.2034 0.0545  -0.0427 -0.0266 166 ARG E CD    
1675 N NE    . ARG E 25 ? 0.2924 0.4430 0.1936 0.0556  -0.0367 -0.0240 166 ARG E NE    
1676 C CZ    . ARG E 25 ? 0.2991 0.4556 0.1860 0.0457  -0.0334 -0.0211 166 ARG E CZ    
1677 N NH1   . ARG E 25 ? 0.3035 0.4721 0.1709 0.0333  -0.0343 -0.0198 166 ARG E NH1   
1678 N NH2   . ARG E 25 ? 0.2975 0.4504 0.1879 0.0452  -0.0289 -0.0196 166 ARG E NH2   
1679 N N     . LYS E 26 ? 0.4080 0.5548 0.3043 0.0427  -0.0544 -0.0630 167 LYS E N     
1680 C CA    . LYS E 26 ? 0.4453 0.5911 0.3295 0.0313  -0.0623 -0.0700 167 LYS E CA    
1681 C C     . LYS E 26 ? 0.4529 0.6143 0.3219 0.0271  -0.0667 -0.0703 167 LYS E C     
1682 O O     . LYS E 26 ? 0.4668 0.6356 0.3292 0.0164  -0.0759 -0.0715 167 LYS E O     
1683 C CB    . LYS E 26 ? 0.4809 0.5969 0.3479 0.0312  -0.0616 -0.0855 167 LYS E CB    
1684 C CG    . LYS E 26 ? 0.4974 0.5899 0.3711 0.0327  -0.0594 -0.0836 167 LYS E CG    
1685 N N     . SER E 27 ? 0.4703 0.6388 0.3317 0.0326  -0.0606 -0.0689 168 SER E N     
1686 C CA    . SER E 27 ? 0.4990 0.6824 0.3385 0.0252  -0.0629 -0.0693 168 SER E CA    
1687 C C     . SER E 27 ? 0.5012 0.6950 0.3354 0.0250  -0.0575 -0.0591 168 SER E C     
1688 O O     . SER E 27 ? 0.5097 0.7003 0.3556 0.0319  -0.0500 -0.0569 168 SER E O     
1689 C CB    . SER E 27 ? 0.5322 0.7132 0.3522 0.0255  -0.0581 -0.0901 168 SER E CB    
1690 O OG    . SER E 27 ? 0.5319 0.7114 0.3565 0.0384  -0.0469 -0.0998 168 SER E OG    
1691 N N     . GLY E 28 ? 0.5436 0.7487 0.3556 0.0138  -0.0619 -0.0533 169 GLY E N     
1692 C CA    . GLY E 28 ? 0.5552 0.7673 0.3525 0.0059  -0.0583 -0.0426 169 GLY E CA    
1693 C C     . GLY E 28 ? 0.5801 0.7790 0.3707 0.0014  -0.0731 -0.0206 169 GLY E C     
1694 O O     . GLY E 28 ? 0.5350 0.7272 0.3393 0.0085  -0.0851 -0.0155 169 GLY E O     
1695 N N     . LEU E 29 ? 0.6222 0.8182 0.3903 -0.0106 -0.0731 -0.0081 170 LEU E N     
1696 C CA    . LEU E 29 ? 0.6391 0.8095 0.3955 -0.0123 -0.0888 0.0138  170 LEU E CA    
1697 C C     . LEU E 29 ? 0.6147 0.7672 0.4028 0.0081  -0.0940 0.0174  170 LEU E C     
1698 O O     . LEU E 29 ? 0.6437 0.7831 0.4341 0.0175  -0.1109 0.0279  170 LEU E O     
1699 C CB    . LEU E 29 ? 0.6872 0.8500 0.4142 -0.0314 -0.0849 0.0254  170 LEU E CB    
1700 C CG    . LEU E 29 ? 0.7096 0.8911 0.3972 -0.0564 -0.0829 0.0270  170 LEU E CG    
1701 N N     . SER E 30 ? 0.5462 0.7023 0.3589 0.0166  -0.0803 0.0071  171 SER E N     
1702 C CA    . SER E 30 ? 0.5040 0.6485 0.3453 0.0344  -0.0828 0.0081  171 SER E CA    
1703 C C     . SER E 30 ? 0.4552 0.6153 0.3248 0.0441  -0.0809 -0.0036 171 SER E C     
1704 O O     . SER E 30 ? 0.4311 0.5891 0.3233 0.0545  -0.0766 -0.0065 171 SER E O     
1705 C CB    . SER E 30 ? 0.5055 0.6395 0.3521 0.0355  -0.0719 0.0077  171 SER E CB    
1706 O OG    . SER E 30 ? 0.5469 0.6528 0.3759 0.0333  -0.0815 0.0224  171 SER E OG    
1707 N N     . ALA E 31 ? 0.4273 0.6019 0.2920 0.0379  -0.0850 -0.0098 172 ALA E N     
1708 C CA    . ALA E 31 ? 0.4038 0.5897 0.2882 0.0397  -0.0836 -0.0210 172 ALA E CA    
1709 C C     . ALA E 31 ? 0.3818 0.5773 0.2932 0.0499  -0.0912 -0.0163 172 ALA E C     
1710 O O     . ALA E 31 ? 0.3732 0.5742 0.2858 0.0562  -0.1046 -0.0073 172 ALA E O     
1711 C CB    . ALA E 31 ? 0.4102 0.6066 0.2787 0.0281  -0.0890 -0.0286 172 ALA E CB    
1712 N N     . GLY E 32 ? 0.3772 0.5764 0.3088 0.0521  -0.0829 -0.0232 173 GLY E N     
1713 C CA    . GLY E 32 ? 0.3717 0.5900 0.3304 0.0607  -0.0867 -0.0216 173 GLY E CA    
1714 C C     . GLY E 32 ? 0.3575 0.5653 0.3257 0.0754  -0.0821 -0.0174 173 GLY E C     
1715 O O     . GLY E 32 ? 0.3417 0.5661 0.3320 0.0823  -0.0795 -0.0204 173 GLY E O     
1716 N N     . LYS E 33 ? 0.3704 0.5526 0.3202 0.0782  -0.0811 -0.0112 174 LYS E N     
1717 C CA    . LYS E 33 ? 0.3790 0.5449 0.3329 0.0874  -0.0744 -0.0098 174 LYS E CA    
1718 C C     . LYS E 33 ? 0.3542 0.5191 0.3148 0.0821  -0.0593 -0.0178 174 LYS E C     
1719 O O     . LYS E 33 ? 0.3533 0.5212 0.3097 0.0722  -0.0550 -0.0238 174 LYS E O     
1720 C CB    . LYS E 33 ? 0.4077 0.5456 0.3362 0.0854  -0.0778 -0.0007 174 LYS E CB    
1721 C CG    . LYS E 33 ? 0.4365 0.5628 0.3521 0.0925  -0.0963 0.0100  174 LYS E CG    
1722 N N     . SER E 34 ? 0.3299 0.4867 0.2973 0.0895  -0.0534 -0.0182 175 SER E N     
1723 C CA    . SER E 34 ? 0.3231 0.4763 0.2934 0.0855  -0.0419 -0.0237 175 SER E CA    
1724 C C     . SER E 34 ? 0.3164 0.4509 0.2765 0.0870  -0.0367 -0.0219 175 SER E C     
1725 O O     . SER E 34 ? 0.3329 0.4540 0.2841 0.0904  -0.0412 -0.0164 175 SER E O     
1726 C CB    . SER E 34 ? 0.3191 0.4888 0.3079 0.0879  -0.0377 -0.0278 175 SER E CB    
1727 O OG    . SER E 34 ? 0.3053 0.4822 0.3048 0.1018  -0.0410 -0.0273 175 SER E OG    
1728 N N     . ASP E 35 ? 0.2884 0.4200 0.2467 0.0833  -0.0292 -0.0265 176 ASP E N     
1729 C CA    . ASP E 35 ? 0.2864 0.4086 0.2391 0.0839  -0.0244 -0.0264 176 ASP E CA    
1730 C C     . ASP E 35 ? 0.2761 0.3969 0.2364 0.0864  -0.0191 -0.0294 176 ASP E C     
1731 O O     . ASP E 35 ? 0.2913 0.4158 0.2553 0.0831  -0.0182 -0.0319 176 ASP E O     
1732 C CB    . ASP E 35 ? 0.2729 0.3988 0.2165 0.0798  -0.0221 -0.0302 176 ASP E CB    
1733 C CG    . ASP E 35 ? 0.2897 0.4218 0.2217 0.0731  -0.0256 -0.0274 176 ASP E CG    
1734 O OD1   . ASP E 35 ? 0.2861 0.4237 0.2161 0.0714  -0.0290 -0.0292 176 ASP E OD1   
1735 O OD2   . ASP E 35 ? 0.3040 0.4356 0.2260 0.0666  -0.0251 -0.0233 176 ASP E OD2   
1736 N N     . VAL E 36 ? 0.2797 0.3932 0.2383 0.0892  -0.0162 -0.0287 177 VAL E N     
1737 C CA    . VAL E 36 ? 0.2752 0.3877 0.2365 0.0900  -0.0108 -0.0310 177 VAL E CA    
1738 C C     . VAL E 36 ? 0.2703 0.3754 0.2228 0.0885  -0.0092 -0.0317 177 VAL E C     
1739 O O     . VAL E 36 ? 0.2603 0.3642 0.2074 0.0871  -0.0106 -0.0308 177 VAL E O     
1740 C CB    . VAL E 36 ? 0.2799 0.3926 0.2457 0.0968  -0.0095 -0.0325 177 VAL E CB    
1741 C CG1   . VAL E 36 ? 0.2872 0.4030 0.2524 0.0952  -0.0024 -0.0359 177 VAL E CG1   
1742 C CG2   . VAL E 36 ? 0.2862 0.4142 0.2646 0.1023  -0.0130 -0.0335 177 VAL E CG2   
1743 N N     . TYR E 37 ? 0.2776 0.3788 0.2268 0.0871  -0.0078 -0.0326 178 TYR E N     
1744 C CA    . TYR E 37 ? 0.2820 0.3779 0.2235 0.0890  -0.0091 -0.0335 178 TYR E CA    
1745 C C     . TYR E 37 ? 0.2885 0.3766 0.2229 0.0864  -0.0069 -0.0318 178 TYR E C     
1746 O O     . TYR E 37 ? 0.2896 0.3763 0.2230 0.0809  -0.0042 -0.0303 178 TYR E O     
1747 C CB    . TYR E 37 ? 0.2934 0.3852 0.2307 0.0932  -0.0140 -0.0365 178 TYR E CB    
1748 C CG    . TYR E 37 ? 0.2929 0.3957 0.2344 0.0944  -0.0151 -0.0400 178 TYR E CG    
1749 C CD1   . TYR E 37 ? 0.2827 0.4028 0.2263 0.0943  -0.0141 -0.0419 178 TYR E CD1   
1750 C CD2   . TYR E 37 ? 0.2971 0.3946 0.2373 0.0923  -0.0171 -0.0415 178 TYR E CD2   
1751 C CE1   . TYR E 37 ? 0.2914 0.4240 0.2346 0.0923  -0.0141 -0.0447 178 TYR E CE1   
1752 C CE2   . TYR E 37 ? 0.2993 0.4074 0.2397 0.0924  -0.0182 -0.0454 178 TYR E CE2   
1753 C CZ    . TYR E 37 ? 0.2932 0.4193 0.2345 0.0926  -0.0162 -0.0468 178 TYR E CZ    
1754 O OH    . TYR E 37 ? 0.2771 0.4164 0.2148 0.0895  -0.0164 -0.0501 178 TYR E OH    
1755 N N     . TYR E 38 ? 0.3005 0.3874 0.2288 0.0880  -0.0082 -0.0320 179 TYR E N     
1756 C CA    . TYR E 38 ? 0.3295 0.4079 0.2457 0.0847  -0.0076 -0.0299 179 TYR E CA    
1757 C C     . TYR E 38 ? 0.3526 0.4224 0.2587 0.0898  -0.0163 -0.0284 179 TYR E C     
1758 O O     . TYR E 38 ? 0.3591 0.4395 0.2715 0.0977  -0.0210 -0.0320 179 TYR E O     
1759 C CB    . TYR E 38 ? 0.3323 0.4149 0.2465 0.0826  -0.0036 -0.0324 179 TYR E CB    
1760 C CG    . TYR E 38 ? 0.3259 0.4124 0.2466 0.0827  0.0029  -0.0357 179 TYR E CG    
1761 C CD1   . TYR E 38 ? 0.3269 0.4145 0.2566 0.0867  0.0017  -0.0371 179 TYR E CD1   
1762 C CD2   . TYR E 38 ? 0.3417 0.4334 0.2589 0.0795  0.0097  -0.0379 179 TYR E CD2   
1763 C CE1   . TYR E 38 ? 0.3270 0.4169 0.2630 0.0921  0.0045  -0.0410 179 TYR E CE1   
1764 C CE2   . TYR E 38 ? 0.3425 0.4457 0.2697 0.0845  0.0152  -0.0442 179 TYR E CE2   
1765 C CZ    . TYR E 38 ? 0.3460 0.4464 0.2832 0.0932  0.0113  -0.0459 179 TYR E CZ    
1766 O OH    . TYR E 38 ? 0.3562 0.4663 0.3034 0.1032  0.0133  -0.0528 179 TYR E OH    
1767 N N     . PHE E 39 ? 0.3870 0.4395 0.2757 0.0853  -0.0191 -0.0233 180 PHE E N     
1768 C CA    . PHE E 39 ? 0.4136 0.4504 0.2874 0.0926  -0.0309 -0.0205 180 PHE E CA    
1769 C C     . PHE E 39 ? 0.4274 0.4601 0.2842 0.0867  -0.0325 -0.0161 180 PHE E C     
1770 O O     . PHE E 39 ? 0.4144 0.4422 0.2594 0.0732  -0.0254 -0.0124 180 PHE E O     
1771 C CB    . PHE E 39 ? 0.4439 0.4500 0.3022 0.0924  -0.0386 -0.0165 180 PHE E CB    
1772 C CG    . PHE E 39 ? 0.4440 0.4534 0.3156 0.0970  -0.0375 -0.0223 180 PHE E CG    
1773 C CD1   . PHE E 39 ? 0.4424 0.4601 0.3226 0.0849  -0.0283 -0.0221 180 PHE E CD1   
1774 C CD2   . PHE E 39 ? 0.4568 0.4666 0.3330 0.1145  -0.0458 -0.0297 180 PHE E CD2   
1775 C CE1   . PHE E 39 ? 0.4359 0.4578 0.3262 0.0880  -0.0284 -0.0272 180 PHE E CE1   
1776 C CE2   . PHE E 39 ? 0.4552 0.4694 0.3404 0.1177  -0.0442 -0.0364 180 PHE E CE2   
1777 C CZ    . PHE E 39 ? 0.4342 0.4525 0.3252 0.1031  -0.0358 -0.0342 180 PHE E CZ    
1778 N N     . SER E 40 ? 0.4203 0.4610 0.2767 0.0964  -0.0417 -0.0177 181 SER E N     
1779 C CA    . SER E 40 ? 0.4440 0.4806 0.2818 0.0921  -0.0467 -0.0134 181 SER E CA    
1780 C C     . SER E 40 ? 0.4818 0.4823 0.2892 0.0886  -0.0563 -0.0028 181 SER E C     
1781 O O     . SER E 40 ? 0.4981 0.4751 0.2996 0.0916  -0.0612 0.0000  181 SER E O     
1782 C CB    . SER E 40 ? 0.4321 0.4899 0.2778 0.1044  -0.0578 -0.0176 181 SER E CB    
1783 O OG    . SER E 40 ? 0.4467 0.4921 0.2871 0.1225  -0.0739 -0.0163 181 SER E OG    
1784 N N     . PRO E 41 ? 0.5328 0.5252 0.3163 0.0802  -0.0602 0.0033  182 PRO E N     
1785 C CA    . PRO E 41 ? 0.5969 0.5483 0.3440 0.0754  -0.0732 0.0160  182 PRO E CA    
1786 C C     . PRO E 41 ? 0.6280 0.5553 0.3710 0.0986  -0.0944 0.0173  182 PRO E C     
1787 O O     . PRO E 41 ? 0.6872 0.5744 0.4109 0.0977  -0.1020 0.0233  182 PRO E O     
1788 C CB    . PRO E 41 ? 0.6011 0.5552 0.3250 0.0654  -0.0756 0.0210  182 PRO E CB    
1789 C CG    . PRO E 41 ? 0.5676 0.5572 0.3112 0.0560  -0.0559 0.0105  182 PRO E CG    
1790 C CD    . PRO E 41 ? 0.5162 0.5292 0.2977 0.0700  -0.0518 -0.0001 182 PRO E CD    
1791 N N     . SER E 42 ? 0.6239 0.5777 0.3856 0.1194  -0.1036 0.0096  183 SER E N     
1792 C CA    . SER E 42 ? 0.6533 0.5977 0.4201 0.1488  -0.1225 0.0047  183 SER E CA    
1793 C C     . SER E 42 ? 0.6536 0.5978 0.4398 0.1570  -0.1162 -0.0044 183 SER E C     
1794 O O     . SER E 42 ? 0.7132 0.6367 0.4951 0.1799  -0.1313 -0.0091 183 SER E O     
1795 C CB    . SER E 42 ? 0.6405 0.6333 0.4317 0.1673  -0.1302 -0.0049 183 SER E CB    
1796 N N     . GLY E 43 ? 0.5901 0.5563 0.3959 0.1405  -0.0955 -0.0081 184 GLY E N     
1797 C CA    . GLY E 43 ? 0.5590 0.5237 0.3789 0.1439  -0.0893 -0.0152 184 GLY E CA    
1798 C C     . GLY E 43 ? 0.4945 0.5072 0.3492 0.1565  -0.0829 -0.0291 184 GLY E C     
1799 O O     . GLY E 43 ? 0.4640 0.4760 0.3273 0.1639  -0.0813 -0.0366 184 GLY E O     
1800 N N     . LYS E 44 ? 0.4572 0.5109 0.3280 0.1552  -0.0794 -0.0323 185 LYS E N     
1801 C CA    . LYS E 44 ? 0.4122 0.5150 0.3119 0.1565  -0.0708 -0.0429 185 LYS E CA    
1802 C C     . LYS E 44 ? 0.3894 0.4901 0.2954 0.1390  -0.0548 -0.0414 185 LYS E C     
1803 O O     . LYS E 44 ? 0.3951 0.4776 0.2912 0.1240  -0.0481 -0.0340 185 LYS E O     
1804 C CB    . LYS E 44 ? 0.4029 0.5430 0.3114 0.1498  -0.0706 -0.0441 185 LYS E CB    
1805 C CG    . LYS E 44 ? 0.4165 0.5659 0.3193 0.1650  -0.0878 -0.0445 185 LYS E CG    
1806 N N     . LYS E 45 ? 0.3717 0.4928 0.2932 0.1424  -0.0497 -0.0491 186 LYS E N     
1807 C CA    . LYS E 45 ? 0.3505 0.4675 0.2764 0.1293  -0.0384 -0.0473 186 LYS E CA    
1808 C C     . LYS E 45 ? 0.3384 0.4823 0.2743 0.1156  -0.0300 -0.0474 186 LYS E C     
1809 O O     . LYS E 45 ? 0.3418 0.5192 0.2870 0.1164  -0.0310 -0.0530 186 LYS E O     
1810 C CB    . LYS E 45 ? 0.3597 0.4784 0.2901 0.1392  -0.0394 -0.0552 186 LYS E CB    
1811 C CG    . LYS E 45 ? 0.3437 0.4536 0.2750 0.1276  -0.0314 -0.0527 186 LYS E CG    
1812 C CD    . LYS E 45 ? 0.3684 0.4700 0.2967 0.1380  -0.0354 -0.0612 186 LYS E CD    
1813 C CE    . LYS E 45 ? 0.3705 0.4742 0.3016 0.1262  -0.0286 -0.0600 186 LYS E CE    
1814 N NZ    . LYS E 45 ? 0.3935 0.4824 0.3167 0.1323  -0.0328 -0.0680 186 LYS E NZ    
1815 N N     . PHE E 46 ? 0.3223 0.4518 0.2549 0.1029  -0.0229 -0.0419 187 PHE E N     
1816 C CA    . PHE E 46 ? 0.3328 0.4730 0.2675 0.0901  -0.0179 -0.0410 187 PHE E CA    
1817 C C     . PHE E 46 ? 0.3301 0.4621 0.2667 0.0859  -0.0136 -0.0389 187 PHE E C     
1818 O O     . PHE E 46 ? 0.3505 0.4662 0.2868 0.0892  -0.0122 -0.0369 187 PHE E O     
1819 C CB    . PHE E 46 ? 0.3464 0.4726 0.2713 0.0829  -0.0168 -0.0383 187 PHE E CB    
1820 C CG    . PHE E 46 ? 0.3703 0.5062 0.2911 0.0853  -0.0228 -0.0395 187 PHE E CG    
1821 C CD1   . PHE E 46 ? 0.3849 0.5081 0.2987 0.0949  -0.0280 -0.0373 187 PHE E CD1   
1822 C CD2   . PHE E 46 ? 0.3762 0.5343 0.2978 0.0765  -0.0253 -0.0421 187 PHE E CD2   
1823 C CE1   . PHE E 46 ? 0.4227 0.5533 0.3303 0.0992  -0.0368 -0.0373 187 PHE E CE1   
1824 C CE2   . PHE E 46 ? 0.4015 0.5747 0.3211 0.0797  -0.0329 -0.0437 187 PHE E CE2   
1825 C CZ    . PHE E 46 ? 0.4236 0.5825 0.3364 0.0931  -0.0394 -0.0411 187 PHE E CZ    
1826 N N     . ARG E 47 ? 0.3172 0.4620 0.2537 0.0765  -0.0124 -0.0387 188 ARG E N     
1827 C CA    . ARG E 47 ? 0.3354 0.4745 0.2706 0.0726  -0.0112 -0.0358 188 ARG E CA    
1828 C C     . ARG E 47 ? 0.3374 0.4568 0.2614 0.0620  -0.0122 -0.0299 188 ARG E C     
1829 O O     . ARG E 47 ? 0.3705 0.4809 0.2901 0.0597  -0.0141 -0.0258 188 ARG E O     
1830 C CB    . ARG E 47 ? 0.3428 0.5108 0.2810 0.0698  -0.0103 -0.0400 188 ARG E CB    
1831 C CG    . ARG E 47 ? 0.3553 0.5405 0.3025 0.0849  -0.0116 -0.0490 188 ARG E CG    
1832 C CD    A ARG E 47 ? 0.3709 0.5902 0.3220 0.0860  -0.0095 -0.0577 188 ARG E CD    
1833 C CD    B ARG E 47 ? 0.3543 0.5744 0.3055 0.0857  -0.0096 -0.0576 188 ARG E CD    
1834 N NE    A ARG E 47 ? 0.3940 0.6183 0.3508 0.1071  -0.0131 -0.0689 188 ARG E NE    
1835 N NE    B ARG E 47 ? 0.3609 0.5883 0.3186 0.1066  -0.0132 -0.0688 188 ARG E NE    
1836 C CZ    A ARG E 47 ? 0.3945 0.6108 0.3483 0.1158  -0.0140 -0.0753 188 ARG E CZ    
1837 C CZ    B ARG E 47 ? 0.3531 0.5988 0.3179 0.1187  -0.0175 -0.0753 188 ARG E CZ    
1838 N NH1   A ARG E 47 ? 0.3900 0.5994 0.3375 0.1049  -0.0110 -0.0713 188 ARG E NH1   
1839 N NH1   B ARG E 47 ? 0.3475 0.6118 0.3157 0.1087  -0.0173 -0.0720 188 ARG E NH1   
1840 N NH2   A ARG E 47 ? 0.3957 0.6073 0.3499 0.1366  -0.0199 -0.0864 188 ARG E NH2   
1841 N NH2   B ARG E 47 ? 0.3686 0.6112 0.3350 0.1412  -0.0240 -0.0855 188 ARG E NH2   
1842 N N     . SER E 48 ? 0.3295 0.4385 0.2452 0.0558  -0.0132 -0.0297 189 SER E N     
1843 C CA    . SER E 48 ? 0.3481 0.4255 0.2479 0.0492  -0.0167 -0.0258 189 SER E CA    
1844 C C     . SER E 48 ? 0.3563 0.4162 0.2483 0.0500  -0.0168 -0.0295 189 SER E C     
1845 O O     . SER E 48 ? 0.3277 0.4038 0.2247 0.0510  -0.0146 -0.0333 189 SER E O     
1846 C CB    . SER E 48 ? 0.3774 0.4549 0.2614 0.0287  -0.0201 -0.0206 189 SER E CB    
1847 O OG    . SER E 48 ? 0.4001 0.4966 0.2812 0.0147  -0.0194 -0.0233 189 SER E OG    
1848 N N     . LYS E 49 ? 0.3762 0.4011 0.2526 0.0501  -0.0211 -0.0292 190 LYS E N     
1849 C CA    . LYS E 49 ? 0.4063 0.4098 0.2694 0.0497  -0.0218 -0.0352 190 LYS E CA    
1850 C C     . LYS E 49 ? 0.4098 0.4168 0.2592 0.0288  -0.0244 -0.0349 190 LYS E C     
1851 O O     . LYS E 49 ? 0.3932 0.4071 0.2412 0.0280  -0.0226 -0.0404 190 LYS E O     
1852 C CB    . LYS E 49 ? 0.4592 0.4201 0.3068 0.0592  -0.0277 -0.0377 190 LYS E CB    
1853 C CG    . LYS E 49 ? 0.4922 0.4361 0.3311 0.0681  -0.0258 -0.0490 190 LYS E CG    
1854 C CD    . LYS E 49 ? 0.5312 0.4403 0.3616 0.0874  -0.0318 -0.0550 190 LYS E CD    
1855 C CE    . LYS E 49 ? 0.5630 0.4475 0.3773 0.0958  -0.0316 -0.0688 190 LYS E CE    
1856 N NZ    . LYS E 49 ? 0.6161 0.4622 0.4195 0.1181  -0.0407 -0.0763 190 LYS E NZ    
1857 N N     . PRO E 50 ? 0.4287 0.4334 0.2656 0.0086  -0.0290 -0.0284 191 PRO E N     
1858 C CA    . PRO E 50 ? 0.4487 0.4653 0.2743 -0.0143 -0.0312 -0.0297 191 PRO E CA    
1859 C C     . PRO E 50 ? 0.4187 0.4907 0.2683 -0.0113 -0.0265 -0.0336 191 PRO E C     
1860 O O     . PRO E 50 ? 0.4239 0.5062 0.2697 -0.0186 -0.0285 -0.0378 191 PRO E O     
1861 C CB    . PRO E 50 ? 0.4822 0.4913 0.2885 -0.0410 -0.0361 -0.0212 191 PRO E CB    
1862 C CG    . PRO E 50 ? 0.4981 0.4673 0.2943 -0.0298 -0.0404 -0.0153 191 PRO E CG    
1863 C CD    . PRO E 50 ? 0.4547 0.4381 0.2784 0.0012  -0.0344 -0.0200 191 PRO E CD    
1864 N N     . GLN E 51 ? 0.3966 0.4985 0.2682 0.0022  -0.0223 -0.0329 192 GLN E N     
1865 C CA    . GLN E 51 ? 0.3868 0.5318 0.2790 0.0125  -0.0208 -0.0373 192 GLN E CA    
1866 C C     . GLN E 51 ? 0.3858 0.5188 0.2779 0.0261  -0.0214 -0.0404 192 GLN E C     
1867 O O     . GLN E 51 ? 0.3828 0.5388 0.2785 0.0263  -0.0249 -0.0432 192 GLN E O     
1868 C CB    . GLN E 51 ? 0.3846 0.5481 0.2938 0.0271  -0.0176 -0.0375 192 GLN E CB    
1869 C CG    . GLN E 51 ? 0.4018 0.6096 0.3290 0.0378  -0.0188 -0.0437 192 GLN E CG    
1870 C CD    . GLN E 51 ? 0.3973 0.6175 0.3369 0.0533  -0.0166 -0.0467 192 GLN E CD    
1871 O OE1   . GLN E 51 ? 0.3790 0.5758 0.3152 0.0557  -0.0140 -0.0431 192 GLN E OE1   
1872 N NE2   . GLN E 51 ? 0.4300 0.6878 0.3836 0.0656  -0.0190 -0.0547 192 GLN E NE2   
1873 N N     . LEU E 52 ? 0.3790 0.4797 0.2661 0.0365  -0.0185 -0.0399 193 LEU E N     
1874 C CA    . LEU E 52 ? 0.3999 0.4893 0.2829 0.0458  -0.0169 -0.0426 193 LEU E CA    
1875 C C     . LEU E 52 ? 0.4179 0.4926 0.2815 0.0347  -0.0194 -0.0470 193 LEU E C     
1876 O O     . LEU E 52 ? 0.3962 0.4794 0.2555 0.0355  -0.0210 -0.0488 193 LEU E O     
1877 C CB    . LEU E 52 ? 0.4122 0.4815 0.2973 0.0576  -0.0116 -0.0429 193 LEU E CB    
1878 C CG    . LEU E 52 ? 0.4229 0.4901 0.3063 0.0656  -0.0071 -0.0451 193 LEU E CG    
1879 C CD1   . LEU E 52 ? 0.4161 0.4993 0.3057 0.0695  -0.0094 -0.0406 193 LEU E CD1   
1880 C CD2   . LEU E 52 ? 0.4243 0.4833 0.3139 0.0747  -0.0015 -0.0472 193 LEU E CD2   
1881 N N     . ALA E 53 ? 0.4420 0.4902 0.2901 0.0237  -0.0214 -0.0484 194 ALA E N     
1882 C CA    . ALA E 53 ? 0.4805 0.5086 0.3051 0.0095  -0.0257 -0.0537 194 ALA E CA    
1883 C C     . ALA E 53 ? 0.4874 0.5491 0.3127 -0.0078 -0.0311 -0.0531 194 ALA E C     
1884 O O     . ALA E 53 ? 0.5151 0.5759 0.3281 -0.0131 -0.0340 -0.0579 194 ALA E O     
1885 C CB    . ALA E 53 ? 0.5132 0.4970 0.3159 0.0000  -0.0301 -0.0542 194 ALA E CB    
1886 N N     . ARG E 54 ? 0.4851 0.5813 0.3253 -0.0159 -0.0325 -0.0485 195 ARG E N     
1887 C CA    . ARG E 54 ? 0.5077 0.6504 0.3547 -0.0310 -0.0378 -0.0497 195 ARG E CA    
1888 C C     . ARG E 54 ? 0.4865 0.6594 0.3485 -0.0127 -0.0405 -0.0517 195 ARG E C     
1889 O O     . ARG E 54 ? 0.5182 0.7200 0.3797 -0.0213 -0.0476 -0.0546 195 ARG E O     
1890 C CB    . ARG E 54 ? 0.5309 0.7139 0.3933 -0.0414 -0.0366 -0.0469 195 ARG E CB    
1891 C CG    . ARG E 54 ? 0.5990 0.7603 0.4399 -0.0706 -0.0374 -0.0425 195 ARG E CG    
1892 C CD    . ARG E 54 ? 0.6039 0.8197 0.4590 -0.0859 -0.0348 -0.0407 195 ARG E CD    
1893 N NE    . ARG E 54 ? 0.5840 0.8199 0.4617 -0.0623 -0.0288 -0.0406 195 ARG E NE    
1894 C CZ    . ARG E 54 ? 0.6175 0.8279 0.4885 -0.0611 -0.0254 -0.0348 195 ARG E CZ    
1895 N NH1   . ARG E 54 ? 0.6435 0.8015 0.4848 -0.0790 -0.0286 -0.0272 195 ARG E NH1   
1896 N NH2   . ARG E 54 ? 0.5853 0.8186 0.4768 -0.0402 -0.0205 -0.0369 195 ARG E NH2   
1897 N N     . TYR E 55 ? 0.4243 0.5890 0.2966 0.0108  -0.0367 -0.0495 196 TYR E N     
1898 C CA    . TYR E 55 ? 0.3898 0.5696 0.2681 0.0274  -0.0419 -0.0491 196 TYR E CA    
1899 C C     . TYR E 55 ? 0.4055 0.5593 0.2615 0.0254  -0.0430 -0.0499 196 TYR E C     
1900 O O     . TYR E 55 ? 0.4040 0.5743 0.2548 0.0255  -0.0517 -0.0501 196 TYR E O     
1901 C CB    . TYR E 55 ? 0.3584 0.5312 0.2482 0.0479  -0.0388 -0.0458 196 TYR E CB    
1902 C CG    . TYR E 55 ? 0.3576 0.5389 0.2488 0.0647  -0.0476 -0.0438 196 TYR E CG    
1903 C CD1   . TYR E 55 ? 0.3490 0.5697 0.2555 0.0748  -0.0574 -0.0470 196 TYR E CD1   
1904 C CD2   . TYR E 55 ? 0.3717 0.5219 0.2465 0.0704  -0.0474 -0.0390 196 TYR E CD2   
1905 C CE1   . TYR E 55 ? 0.3671 0.5871 0.2708 0.0942  -0.0695 -0.0449 196 TYR E CE1   
1906 C CE2   . TYR E 55 ? 0.3855 0.5333 0.2537 0.0836  -0.0585 -0.0346 196 TYR E CE2   
1907 C CZ    . TYR E 55 ? 0.3889 0.5670 0.2704 0.0972  -0.0708 -0.0374 196 TYR E CZ    
1908 O OH    . TYR E 55 ? 0.4483 0.6159 0.3194 0.1137  -0.0853 -0.0329 196 TYR E OH    
1909 N N     . LEU E 56 ? 0.4090 0.5257 0.2519 0.0251  -0.0347 -0.0515 197 LEU E N     
1910 C CA    . LEU E 56 ? 0.4367 0.5322 0.2575 0.0242  -0.0328 -0.0549 197 LEU E CA    
1911 C C     . LEU E 56 ? 0.4514 0.5391 0.2511 0.0065  -0.0372 -0.0620 197 LEU E C     
1912 O O     . LEU E 56 ? 0.4636 0.5465 0.2442 0.0036  -0.0390 -0.0652 197 LEU E O     
1913 C CB    . LEU E 56 ? 0.4381 0.5069 0.2557 0.0329  -0.0216 -0.0576 197 LEU E CB    
1914 C CG    . LEU E 56 ? 0.4223 0.4979 0.2546 0.0463  -0.0179 -0.0506 197 LEU E CG    
1915 C CD1   . LEU E 56 ? 0.4186 0.4807 0.2564 0.0532  -0.0078 -0.0537 197 LEU E CD1   
1916 C CD2   . LEU E 56 ? 0.4306 0.5086 0.2491 0.0473  -0.0206 -0.0461 197 LEU E CD2   
1917 N N     . GLY E 57 ? 0.4500 0.5333 0.2486 -0.0080 -0.0393 -0.0641 198 GLY E N     
1918 C CA    . GLY E 57 ? 0.4871 0.5541 0.2608 -0.0293 -0.0446 -0.0711 198 GLY E CA    
1919 C C     . GLY E 57 ? 0.5151 0.5391 0.2627 -0.0245 -0.0394 -0.0811 198 GLY E C     
1920 O O     . GLY E 57 ? 0.5035 0.5030 0.2531 -0.0091 -0.0313 -0.0837 198 GLY E O     
1921 N N     . ASN E 58 ? 0.5368 0.5583 0.2613 -0.0356 -0.0442 -0.0879 199 ASN E N     
1922 C CA    . ASN E 58 ? 0.5654 0.5499 0.2612 -0.0324 -0.0393 -0.1013 199 ASN E CA    
1923 C C     . ASN E 58 ? 0.5605 0.5564 0.2562 -0.0160 -0.0304 -0.1024 199 ASN E C     
1924 O O     . ASN E 58 ? 0.5880 0.5647 0.2597 -0.0135 -0.0246 -0.1155 199 ASN E O     
1925 C CB    . ASN E 58 ? 0.6029 0.5742 0.2672 -0.0559 -0.0488 -0.1103 199 ASN E CB    
1926 C CG    . ASN E 58 ? 0.5917 0.6045 0.2554 -0.0647 -0.0567 -0.1057 199 ASN E CG    
1927 O OD1   . ASN E 58 ? 0.5470 0.5922 0.2297 -0.0516 -0.0561 -0.0957 199 ASN E OD1   
1928 N ND2   . ASN E 58 ? 0.6289 0.6365 0.2668 -0.0876 -0.0663 -0.1132 199 ASN E ND2   
1929 N N     . THR E 59 ? 0.5286 0.5546 0.2468 -0.0066 -0.0294 -0.0896 200 THR E N     
1930 C CA    . THR E 59 ? 0.5264 0.5592 0.2389 0.0029  -0.0215 -0.0883 200 THR E CA    
1931 C C     . THR E 59 ? 0.5409 0.5603 0.2593 0.0165  -0.0076 -0.0958 200 THR E C     
1932 O O     . THR E 59 ? 0.5464 0.5709 0.2543 0.0201  0.0016  -0.1004 200 THR E O     
1933 C CB    . THR E 59 ? 0.4996 0.5568 0.2283 0.0088  -0.0265 -0.0724 200 THR E CB    
1934 O OG1   . THR E 59 ? 0.4703 0.5324 0.2283 0.0181  -0.0253 -0.0663 200 THR E OG1   
1935 C CG2   . THR E 59 ? 0.4972 0.5737 0.2202 0.0006  -0.0421 -0.0666 200 THR E CG2   
1936 N N     . VAL E 60 ? 0.5597 0.5661 0.2952 0.0236  -0.0068 -0.0966 201 VAL E N     
1937 C CA    . VAL E 60 ? 0.5804 0.5758 0.3229 0.0396  0.0035  -0.1055 201 VAL E CA    
1938 C C     . VAL E 60 ? 0.6307 0.5914 0.3698 0.0428  -0.0016 -0.1124 201 VAL E C     
1939 O O     . VAL E 60 ? 0.6591 0.6109 0.3988 0.0304  -0.0114 -0.1046 201 VAL E O     
1940 C CB    . VAL E 60 ? 0.5319 0.5501 0.3023 0.0496  0.0094  -0.0949 201 VAL E CB    
1941 C CG1   . VAL E 60 ? 0.5032 0.5441 0.2740 0.0429  0.0082  -0.0821 201 VAL E CG1   
1942 C CG2   . VAL E 60 ? 0.5220 0.5346 0.3126 0.0530  0.0038  -0.0871 201 VAL E CG2   
1943 N N     . ASP E 61 ? 0.6578 0.6002 0.3922 0.0597  0.0041  -0.1270 202 ASP E N     
1944 C CA    . ASP E 61 ? 0.6782 0.5780 0.4048 0.0679  -0.0030 -0.1335 202 ASP E CA    
1945 C C     . ASP E 61 ? 0.6386 0.5507 0.3941 0.0857  -0.0001 -0.1275 202 ASP E C     
1946 O O     . ASP E 61 ? 0.6283 0.5614 0.3969 0.1038  0.0094  -0.1363 202 ASP E O     
1947 C CB    . ASP E 61 ? 0.7385 0.6072 0.4378 0.0802  -0.0014 -0.1572 202 ASP E CB    
1948 C CG    . ASP E 61 ? 0.7932 0.6051 0.4775 0.0938  -0.0122 -0.1658 202 ASP E CG    
1949 O OD1   . ASP E 61 ? 0.8170 0.6084 0.5051 0.0867  -0.0223 -0.1515 202 ASP E OD1   
1950 O OD2   . ASP E 61 ? 0.8575 0.6432 0.5230 0.1128  -0.0113 -0.1880 202 ASP E OD2   
1951 N N     . LEU E 62 ? 0.6235 0.5274 0.3881 0.0783  -0.0082 -0.1131 203 LEU E N     
1952 C CA    . LEU E 62 ? 0.5957 0.5105 0.3851 0.0919  -0.0076 -0.1058 203 LEU E CA    
1953 C C     . LEU E 62 ? 0.6417 0.5101 0.4188 0.1038  -0.0183 -0.1094 203 LEU E C     
1954 O O     . LEU E 62 ? 0.6186 0.4906 0.4115 0.1117  -0.0215 -0.1010 203 LEU E O     
1955 C CB    . LEU E 62 ? 0.5658 0.5042 0.3716 0.0768  -0.0097 -0.0877 203 LEU E CB    
1956 C CG    . LEU E 62 ? 0.5310 0.5092 0.3494 0.0688  -0.0039 -0.0811 203 LEU E CG    
1957 C CD1   . LEU E 62 ? 0.5118 0.5074 0.3459 0.0609  -0.0078 -0.0676 203 LEU E CD1   
1958 C CD2   . LEU E 62 ? 0.5147 0.5184 0.3465 0.0811  0.0066  -0.0846 203 LEU E CD2   
1959 N N     . SER E 63 ? 0.7056 0.5257 0.4509 0.1050  -0.0257 -0.1217 204 SER E N     
1960 C CA    . SER E 63 ? 0.7623 0.5244 0.4874 0.1196  -0.0395 -0.1265 204 SER E CA    
1961 C C     . SER E 63 ? 0.7507 0.5274 0.5001 0.1529  -0.0385 -0.1317 204 SER E C     
1962 O O     . SER E 63 ? 0.7724 0.5226 0.5197 0.1589  -0.0506 -0.1223 204 SER E O     
1963 C CB    . SER E 63 ? 0.8365 0.5489 0.5252 0.1246  -0.0450 -0.1458 204 SER E CB    
1964 O OG    . SER E 63 ? 0.8284 0.5791 0.5286 0.1401  -0.0304 -0.1633 204 SER E OG    
1965 N N     . SER E 64 ? 0.7114 0.5342 0.4828 0.1716  -0.0245 -0.1460 205 SER E N     
1966 C CA    . SER E 64 ? 0.6974 0.5499 0.4967 0.2031  -0.0218 -0.1548 205 SER E CA    
1967 C C     . SER E 64 ? 0.6240 0.5396 0.4613 0.1963  -0.0116 -0.1411 205 SER E C     
1968 O O     . SER E 64 ? 0.5966 0.5489 0.4607 0.2175  -0.0082 -0.1476 205 SER E O     
1969 C CB    . SER E 64 ? 0.7351 0.6089 0.5355 0.2259  -0.0112 -0.1816 205 SER E CB    
1970 O OG    . SER E 64 ? 0.7150 0.6397 0.5244 0.2071  0.0066  -0.1813 205 SER E OG    
1971 N N     . PHE E 65 ? 0.5758 0.5039 0.4147 0.1677  -0.0082 -0.1237 206 PHE E N     
1972 C CA    . PHE E 65 ? 0.5170 0.4957 0.3838 0.1586  0.0008  -0.1124 206 PHE E CA    
1973 C C     . PHE E 65 ? 0.5049 0.4799 0.3846 0.1622  -0.0083 -0.1001 206 PHE E C     
1974 O O     . PHE E 65 ? 0.5064 0.4443 0.3695 0.1527  -0.0197 -0.0899 206 PHE E O     
1975 C CB    . PHE E 65 ? 0.4829 0.4701 0.3433 0.1322  0.0048  -0.1008 206 PHE E CB    
1976 C CG    . PHE E 65 ? 0.4398 0.4676 0.3222 0.1235  0.0116  -0.0896 206 PHE E CG    
1977 C CD1   . PHE E 65 ? 0.4226 0.4870 0.3154 0.1242  0.0233  -0.0946 206 PHE E CD1   
1978 C CD2   . PHE E 65 ? 0.4126 0.4399 0.3014 0.1126  0.0059  -0.0748 206 PHE E CD2   
1979 C CE1   . PHE E 65 ? 0.3945 0.4849 0.2999 0.1133  0.0272  -0.0838 206 PHE E CE1   
1980 C CE2   . PHE E 65 ? 0.3819 0.4373 0.2857 0.1061  0.0103  -0.0666 206 PHE E CE2   
1981 C CZ    . PHE E 65 ? 0.3772 0.4594 0.2877 0.1058  0.0198  -0.0702 206 PHE E CZ    
1982 N N     . ASP E 66 ? 0.4774 0.4933 0.3846 0.1730  -0.0035 -0.1012 207 ASP E N     
1983 C CA    . ASP E 66 ? 0.4668 0.4845 0.3866 0.1771  -0.0124 -0.0908 207 ASP E CA    
1984 C C     . ASP E 66 ? 0.4170 0.4615 0.3488 0.1560  -0.0069 -0.0768 207 ASP E C     
1985 O O     . ASP E 66 ? 0.3746 0.4594 0.3243 0.1522  0.0028  -0.0780 207 ASP E O     
1986 C CB    . ASP E 66 ? 0.4874 0.5350 0.4302 0.2030  -0.0136 -0.1017 207 ASP E CB    
1987 C CG    . ASP E 66 ? 0.5075 0.5519 0.4590 0.2081  -0.0265 -0.0905 207 ASP E CG    
1988 O OD1   . ASP E 66 ? 0.5374 0.5335 0.4661 0.2048  -0.0399 -0.0808 207 ASP E OD1   
1989 O OD2   . ASP E 66 ? 0.5187 0.6086 0.4966 0.2124  -0.0237 -0.0911 207 ASP E OD2   
1990 N N     . PHE E 67 ? 0.4067 0.4280 0.3263 0.1419  -0.0138 -0.0644 208 PHE E N     
1991 C CA    . PHE E 67 ? 0.3815 0.4222 0.3081 0.1249  -0.0099 -0.0542 208 PHE E CA    
1992 C C     . PHE E 67 ? 0.3725 0.4446 0.3207 0.1276  -0.0080 -0.0516 208 PHE E C     
1993 O O     . PHE E 67 ? 0.3402 0.4334 0.2958 0.1182  -0.0013 -0.0495 208 PHE E O     
1994 C CB    . PHE E 67 ? 0.3825 0.4005 0.2937 0.1114  -0.0176 -0.0442 208 PHE E CB    
1995 C CG    . PHE E 67 ? 0.3606 0.3996 0.2773 0.0977  -0.0134 -0.0382 208 PHE E CG    
1996 C CD1   . PHE E 67 ? 0.3584 0.4027 0.2701 0.0891  -0.0093 -0.0396 208 PHE E CD1   
1997 C CD2   . PHE E 67 ? 0.3477 0.4014 0.2738 0.0956  -0.0148 -0.0328 208 PHE E CD2   
1998 C CE1   . PHE E 67 ? 0.3443 0.4076 0.2615 0.0822  -0.0079 -0.0361 208 PHE E CE1   
1999 C CE2   . PHE E 67 ? 0.3367 0.4076 0.2668 0.0876  -0.0119 -0.0306 208 PHE E CE2   
2000 C CZ    . PHE E 67 ? 0.3276 0.4031 0.2540 0.0828  -0.0090 -0.0326 208 PHE E CZ    
2001 N N     . ARG E 68 ? 0.4101 0.4815 0.3650 0.1397  -0.0160 -0.0513 209 ARG E N     
2002 C CA    . ARG E 68 ? 0.4147 0.5167 0.3890 0.1407  -0.0165 -0.0492 209 ARG E CA    
2003 C C     . ARG E 68 ? 0.3982 0.5403 0.3912 0.1416  -0.0062 -0.0574 209 ARG E C     
2004 O O     . ARG E 68 ? 0.3971 0.5612 0.3987 0.1289  -0.0025 -0.0537 209 ARG E O     
2005 C CB    . ARG E 68 ? 0.4626 0.5563 0.4388 0.1562  -0.0299 -0.0478 209 ARG E CB    
2006 C CG    . ARG E 68 ? 0.4834 0.6106 0.4785 0.1556  -0.0328 -0.0453 209 ARG E CG    
2007 C CD    . ARG E 68 ? 0.5141 0.6222 0.5000 0.1616  -0.0488 -0.0371 209 ARG E CD    
2008 N NE    . ARG E 68 ? 0.5420 0.6271 0.5073 0.1423  -0.0498 -0.0261 209 ARG E NE    
2009 C CZ    . ARG E 68 ? 0.5253 0.6274 0.4934 0.1276  -0.0463 -0.0223 209 ARG E CZ    
2010 N NH1   . ARG E 68 ? 0.5138 0.6494 0.5012 0.1260  -0.0429 -0.0263 209 ARG E NH1   
2011 N NH2   . ARG E 68 ? 0.5225 0.6092 0.4725 0.1131  -0.0462 -0.0157 209 ARG E NH2   
2012 N N     . THR E 69 ? 0.4060 0.5565 0.4020 0.1543  -0.0015 -0.0691 210 THR E N     
2013 C CA    . THR E 69 ? 0.3976 0.5951 0.4110 0.1537  0.0096  -0.0786 210 THR E CA    
2014 C C     . THR E 69 ? 0.4015 0.6010 0.4025 0.1378  0.0218  -0.0795 210 THR E C     
2015 O O     . THR E 69 ? 0.4181 0.6543 0.4271 0.1267  0.0316  -0.0825 210 THR E O     
2016 C CB    . THR E 69 ? 0.4074 0.6245 0.4332 0.1802  0.0090  -0.0952 210 THR E CB    
2017 O OG1   . THR E 69 ? 0.4165 0.5941 0.4213 0.1905  0.0075  -0.1015 210 THR E OG1   
2018 C CG2   . THR E 69 ? 0.4089 0.6310 0.4493 0.2000  -0.0055 -0.0951 210 THR E CG2   
2019 N N     . GLY E 70 ? 0.3964 0.5586 0.3760 0.1347  0.0203  -0.0767 211 GLY E N     
2020 C CA    . GLY E 70 ? 0.4013 0.5626 0.3657 0.1213  0.0291  -0.0772 211 GLY E CA    
2021 C C     . GLY E 70 ? 0.4326 0.6100 0.3939 0.1302  0.0381  -0.0929 211 GLY E C     
2022 O O     . GLY E 70 ? 0.4208 0.6056 0.3684 0.1168  0.0468  -0.0937 211 GLY E O     
2023 N N     . LYS E 71 ? 0.4407 0.6206 0.4112 0.1541  0.0349  -0.1060 212 LYS E N     
2024 C CA    . LYS E 71 ? 0.4578 0.6582 0.4284 0.1694  0.0433  -0.1262 212 LYS E CA    
2025 C C     . LYS E 71 ? 0.4902 0.6405 0.4391 0.1851  0.0349  -0.1347 212 LYS E C     
2026 O O     . LYS E 71 ? 0.4880 0.5973 0.4303 0.1921  0.0208  -0.1278 212 LYS E O     
2027 C CB    . LYS E 71 ? 0.4661 0.7122 0.4660 0.1908  0.0439  -0.1389 212 LYS E CB    
2028 C CG    . LYS E 71 ? 0.4463 0.7528 0.4679 0.1734  0.0540  -0.1355 212 LYS E CG    
2029 C CD    . LYS E 71 ? 0.4443 0.7969 0.4987 0.1957  0.0498  -0.1462 212 LYS E CD    
2030 N N     . MET E 72 ? 0.5376 0.6898 0.4715 0.1883  0.0433  -0.1499 213 MET E N     
2031 C CA    . MET E 72 ? 0.6078 0.7141 0.5195 0.2069  0.0357  -0.1643 213 MET E CA    
2032 C C     . MET E 72 ? 0.6587 0.7749 0.5863 0.2437  0.0303  -0.1832 213 MET E C     
2033 O O     . MET E 72 ? 0.6583 0.8367 0.6111 0.2546  0.0416  -0.1963 213 MET E O     
2034 C CB    . MET E 72 ? 0.6334 0.7450 0.5237 0.1993  0.0474  -0.1776 213 MET E CB    
2035 C CG    . MET E 72 ? 0.6126 0.7124 0.4841 0.1672  0.0495  -0.1608 213 MET E CG    
2036 S SD    . MET E 72 ? 0.6475 0.6790 0.4951 0.1572  0.0316  -0.1477 213 MET E SD    
2037 C CE    . MET E 72 ? 0.6328 0.6707 0.4631 0.1265  0.0356  -0.1352 213 MET E CE    
2038 N N     . MET E 73 ? 0.7240 0.7804 0.6354 0.2624  0.0123  -0.1849 214 MET E N     
2039 C CA    . MET E 73 ? 0.7817 0.8369 0.7052 0.3028  0.0011  -0.2013 214 MET E CA    
2040 C C     . MET E 73 ? 0.8440 0.8627 0.7440 0.3324  -0.0034 -0.2285 214 MET E C     
2041 O O     . MET E 73 ? 0.8515 0.8419 0.7229 0.3184  0.0018  -0.2339 214 MET E O     
2042 C CB    . MET E 73 ? 0.8089 0.8194 0.7284 0.3062  -0.0199 -0.1827 214 MET E CB    
2043 C CG    . MET E 73 ? 0.7918 0.8413 0.7359 0.2840  -0.0165 -0.1611 214 MET E CG    
2044 S SD    . MET E 73 ? 0.8116 0.9635 0.8031 0.2889  0.0002  -0.1706 214 MET E SD    
2045 C CE    . MET E 73 ? 0.7561 0.9180 0.7634 0.2698  -0.0077 -0.1449 214 MET E CE    
2046 N N     . PRO E 74 ? 0.8777 0.8990 0.7899 0.3757  -0.0143 -0.2472 215 PRO E N     
2047 C CA    . PRO E 74 ? 0.9486 0.9383 0.8435 0.4168  -0.0223 -0.2780 215 PRO E CA    
2048 N N     . LYS F 7  ? 0.7315 0.9453 0.6406 0.1348  0.1689  -0.0939 148 LYS F N     
2049 C CA    . LYS F 7  ? 0.7581 0.9767 0.6264 0.1422  0.1891  -0.1071 148 LYS F CA    
2050 C C     . LYS F 7  ? 0.7679 0.9373 0.5852 0.1200  0.1788  -0.1049 148 LYS F C     
2051 O O     . LYS F 7  ? 0.7390 0.8916 0.5587 0.0945  0.1627  -0.0874 148 LYS F O     
2052 C CB    . LYS F 7  ? 0.7303 1.0276 0.6182 0.1355  0.2145  -0.0984 148 LYS F CB    
2053 N N     . ARG F 8  ? 0.8144 0.9616 0.5847 0.1321  0.1876  -0.1237 149 ARG F N     
2054 C CA    . ARG F 8  ? 0.8443 0.9454 0.5627 0.1146  0.1755  -0.1246 149 ARG F CA    
2055 C C     . ARG F 8  ? 0.8716 1.0044 0.5579 0.0980  0.1930  -0.1168 149 ARG F C     
2056 O O     . ARG F 8  ? 0.8968 1.0374 0.5455 0.1117  0.2114  -0.1352 149 ARG F O     
2057 C CB    . ARG F 8  ? 0.9348 0.9807 0.6118 0.1345  0.1694  -0.1519 149 ARG F CB    
2058 C CG    . ARG F 8  ? 0.9527 0.9495 0.6446 0.1431  0.1467  -0.1571 149 ARG F CG    
2059 C CD    . ARG F 8  ? 1.0466 0.9808 0.6846 0.1541  0.1394  -0.1831 149 ARG F CD    
2060 N NE    . ARG F 8  ? 1.0759 0.9581 0.7219 0.1636  0.1198  -0.1894 149 ARG F NE    
2061 C CZ    . ARG F 8  ? 1.1666 0.9810 0.7672 0.1698  0.1081  -0.2108 149 ARG F CZ    
2062 N NH1   . ARG F 8  ? 1.2128 1.0029 0.7540 0.1693  0.1138  -0.2314 149 ARG F NH1   
2063 N NH2   . ARG F 8  ? 1.1936 0.9609 0.8041 0.1743  0.0891  -0.2110 149 ARG F NH2   
2064 N N     . MET F 9  ? 0.8209 0.9675 0.5167 0.0691  0.1870  -0.0902 150 MET F N     
2065 C CA    . MET F 9  ? 0.8315 1.0007 0.4929 0.0479  0.1995  -0.0763 150 MET F CA    
2066 C C     . MET F 9  ? 0.8624 0.9860 0.4640 0.0394  0.1855  -0.0798 150 MET F C     
2067 O O     . MET F 9  ? 0.8320 0.9108 0.4309 0.0370  0.1600  -0.0796 150 MET F O     
2068 C CB    . MET F 9  ? 0.8079 0.9932 0.4956 0.0195  0.1936  -0.0453 150 MET F CB    
2069 N N     . ASP F 10 ? 0.9097 1.0510 0.4633 0.0341  0.2023  -0.0824 151 ASP F N     
2070 C CA    . ASP F 10 ? 0.9280 1.0355 0.4205 0.0198  0.1883  -0.0797 151 ASP F CA    
2071 C C     . ASP F 10 ? 0.8890 0.9773 0.3904 -0.0044 0.1639  -0.0479 151 ASP F C     
2072 O O     . ASP F 10 ? 0.8558 0.9645 0.3908 -0.0173 0.1673  -0.0249 151 ASP F O     
2073 C CB    . ASP F 10 ? 0.9924 1.1335 0.4333 0.0130  0.2128  -0.0804 151 ASP F CB    
2074 C CG    . ASP F 10 ? 1.0462 1.1834 0.4468 0.0391  0.2296  -0.1185 151 ASP F CG    
2075 O OD1   . ASP F 10 ? 1.0332 1.1460 0.4529 0.0648  0.2265  -0.1438 151 ASP F OD1   
2076 O OD2   . ASP F 10 ? 1.1044 1.2598 0.4492 0.0341  0.2460  -0.1232 151 ASP F OD2   
2077 N N     . CYS F 11 ? 0.8742 0.9231 0.3454 -0.0098 0.1387  -0.0474 152 CYS F N     
2078 C CA    . CYS F 11 ? 0.8362 0.8669 0.3093 -0.0264 0.1145  -0.0189 152 CYS F CA    
2079 C C     . CYS F 11 ? 0.8831 0.9088 0.2920 -0.0415 0.1085  -0.0079 152 CYS F C     
2080 O O     . CYS F 11 ? 0.9033 0.9074 0.2781 -0.0410 0.0913  -0.0194 152 CYS F O     
2081 C CB    . CYS F 11 ? 0.7921 0.7931 0.2910 -0.0191 0.0880  -0.0238 152 CYS F CB    
2082 S SG    . CYS F 11 ? 0.7774 0.7625 0.2853 -0.0302 0.0594  0.0086  152 CYS F SG    
2083 N N     . PRO F 12 ? 0.8976 0.9436 0.2878 -0.0580 0.1209  0.0160  153 PRO F N     
2084 C CA    . PRO F 12 ? 0.9637 1.0090 0.2872 -0.0726 0.1176  0.0271  153 PRO F CA    
2085 C C     . PRO F 12 ? 0.9752 0.9897 0.2781 -0.0792 0.0822  0.0449  153 PRO F C     
2086 O O     . PRO F 12 ? 1.0323 1.0448 0.2767 -0.0882 0.0748  0.0468  153 PRO F O     
2087 C CB    . PRO F 12 ? 0.9804 1.0526 0.2981 -0.0920 0.1365  0.0557  153 PRO F CB    
2088 C CG    . PRO F 12 ? 0.9219 0.9922 0.3038 -0.0919 0.1355  0.0673  153 PRO F CG    
2089 C CD    . PRO F 12 ? 0.8746 0.9461 0.2986 -0.0678 0.1382  0.0348  153 PRO F CD    
2090 N N     . ALA F 13 ? 0.9202 0.9155 0.2687 -0.0737 0.0608  0.0575  154 ALA F N     
2091 C CA    . ALA F 13 ? 0.9333 0.9094 0.2704 -0.0750 0.0274  0.0747  154 ALA F CA    
2092 C C     . ALA F 13 ? 0.9456 0.9176 0.2657 -0.0706 0.0118  0.0499  154 ALA F C     
2093 O O     . ALA F 13 ? 0.9798 0.9484 0.2680 -0.0776 -0.0127 0.0605  154 ALA F O     
2094 C CB    . ALA F 13 ? 0.8888 0.8503 0.2790 -0.0661 0.0120  0.0919  154 ALA F CB    
2095 N N     . LEU F 14 ? 0.9223 0.8932 0.2608 -0.0607 0.0247  0.0180  155 LEU F N     
2096 C CA    . LEU F 14 ? 0.9494 0.9069 0.2638 -0.0602 0.0127  -0.0095 155 LEU F CA    
2097 C C     . LEU F 14 ? 1.0213 0.9783 0.2694 -0.0642 0.0305  -0.0321 155 LEU F C     
2098 O O     . LEU F 14 ? 1.0295 1.0059 0.2601 -0.0652 0.0558  -0.0264 155 LEU F O     
2099 C CB    . LEU F 14 ? 0.9053 0.8527 0.2694 -0.0467 0.0156  -0.0302 155 LEU F CB    
2100 C CG    . LEU F 14 ? 0.8479 0.7992 0.2725 -0.0421 -0.0001 -0.0109 155 LEU F CG    
2101 C CD1   . LEU F 14 ? 0.8109 0.7544 0.2793 -0.0306 0.0045  -0.0299 155 LEU F CD1   
2102 C CD2   . LEU F 14 ? 0.8555 0.8097 0.2752 -0.0503 -0.0326 0.0057  155 LEU F CD2   
2103 N N     . PRO F 15 ? 1.0611 0.9963 0.2697 -0.0676 0.0173  -0.0583 156 PRO F N     
2104 C CA    . PRO F 15 ? 1.1402 1.0695 0.2806 -0.0678 0.0351  -0.0848 156 PRO F CA    
2105 C C     . PRO F 15 ? 1.1298 1.0653 0.2840 -0.0461 0.0721  -0.1098 156 PRO F C     
2106 O O     . PRO F 15 ? 1.0633 1.0061 0.2827 -0.0330 0.0807  -0.1060 156 PRO F O     
2107 C CB    . PRO F 15 ? 1.1881 1.0819 0.2900 -0.0769 0.0084  -0.1094 156 PRO F CB    
2108 C CG    . PRO F 15 ? 1.1404 1.0390 0.2819 -0.0889 -0.0261 -0.0835 156 PRO F CG    
2109 C CD    . PRO F 15 ? 1.0624 0.9793 0.2794 -0.0755 -0.0158 -0.0623 156 PRO F CD    
2110 N N     . PRO F 16 ? 1.1855 1.1229 0.2788 -0.0407 0.0940  -0.1346 157 PRO F N     
2111 C CA    . PRO F 16 ? 1.1846 1.1366 0.2910 -0.0151 0.1304  -0.1592 157 PRO F CA    
2112 C C     . PRO F 16 ? 1.1702 1.0813 0.3024 0.0050  0.1245  -0.1892 157 PRO F C     
2113 O O     . PRO F 16 ? 1.1801 1.0443 0.2888 -0.0038 0.0961  -0.2024 157 PRO F O     
2114 C CB    . PRO F 16 ? 1.2791 1.2397 0.3027 -0.0133 0.1516  -0.1815 157 PRO F CB    
2115 C CG    . PRO F 16 ? 1.3173 1.2687 0.2842 -0.0417 0.1252  -0.1646 157 PRO F CG    
2116 C CD    . PRO F 16 ? 1.2687 1.1998 0.2775 -0.0566 0.0861  -0.1407 157 PRO F CD    
2117 N N     . GLY F 17 ? 1.1451 1.0759 0.3265 0.0296  0.1493  -0.1968 158 GLY F N     
2118 C CA    . GLY F 17 ? 1.1362 1.0305 0.3487 0.0519  0.1454  -0.2202 158 GLY F CA    
2119 C C     . GLY F 17 ? 1.0580 0.9552 0.3455 0.0466  0.1281  -0.1954 158 GLY F C     
2120 O O     . GLY F 17 ? 1.0368 0.9329 0.3703 0.0677  0.1363  -0.2032 158 GLY F O     
2121 N N     . TRP F 18 ? 1.0259 0.9277 0.3250 0.0208  0.1039  -0.1658 159 TRP F N     
2122 C CA    . TRP F 18 ? 0.9464 0.8510 0.3117 0.0167  0.0872  -0.1439 159 TRP F CA    
2123 C C     . TRP F 18 ? 0.8985 0.8442 0.3211 0.0271  0.1084  -0.1288 159 TRP F C     
2124 O O     . TRP F 18 ? 0.8978 0.8805 0.3173 0.0202  0.1250  -0.1124 159 TRP F O     
2125 C CB    . TRP F 18 ? 0.9199 0.8268 0.2853 -0.0073 0.0592  -0.1160 159 TRP F CB    
2126 C CG    . TRP F 18 ? 0.9549 0.8277 0.2851 -0.0210 0.0310  -0.1265 159 TRP F CG    
2127 C CD1   . TRP F 18 ? 1.0244 0.8825 0.2859 -0.0338 0.0226  -0.1379 159 TRP F CD1   
2128 C CD2   . TRP F 18 ? 0.9260 0.7782 0.2848 -0.0275 0.0061  -0.1258 159 TRP F CD2   
2129 N NE1   . TRP F 18 ? 1.0407 0.8696 0.2885 -0.0495 -0.0079 -0.1444 159 TRP F NE1   
2130 C CE2   . TRP F 18 ? 0.9906 0.8172 0.2984 -0.0467 -0.0179 -0.1362 159 TRP F CE2   
2131 C CE3   . TRP F 18 ? 0.8635 0.7191 0.2837 -0.0213 0.0014  -0.1168 159 TRP F CE3   
2132 C CZ2   . TRP F 18 ? 0.9825 0.7900 0.3031 -0.0623 -0.0463 -0.1360 159 TRP F CZ2   
2133 C CZ3   . TRP F 18 ? 0.8580 0.6952 0.2892 -0.0345 -0.0248 -0.1164 159 TRP F CZ3   
2134 C CH2   . TRP F 18 ? 0.9224 0.7374 0.3058 -0.0559 -0.0483 -0.1251 159 TRP F CH2   
2135 N N     . LYS F 19 ? 0.8517 0.7902 0.3239 0.0404  0.1060  -0.1329 160 LYS F N     
2136 C CA    . LYS F 19 ? 0.8006 0.7759 0.3294 0.0488  0.1212  -0.1204 160 LYS F CA    
2137 C C     . LYS F 19 ? 0.7407 0.7120 0.3154 0.0389  0.1005  -0.0992 160 LYS F C     
2138 O O     . LYS F 19 ? 0.7147 0.6572 0.2857 0.0319  0.0769  -0.0986 160 LYS F O     
2139 C CB    . LYS F 19 ? 0.8074 0.7840 0.3551 0.0772  0.1377  -0.1436 160 LYS F CB    
2140 N N     . LYS F 20 ? 0.7134 0.7172 0.3288 0.0370  0.1102  -0.0821 161 LYS F N     
2141 C CA    . LYS F 20 ? 0.6710 0.6751 0.3315 0.0322  0.0964  -0.0656 161 LYS F CA    
2142 C C     . LYS F 20 ? 0.6500 0.6769 0.3554 0.0461  0.1091  -0.0710 161 LYS F C     
2143 O O     . LYS F 20 ? 0.6496 0.7094 0.3591 0.0523  0.1311  -0.0751 161 LYS F O     
2144 C CB    . LYS F 20 ? 0.6599 0.6760 0.3212 0.0145  0.0941  -0.0395 161 LYS F CB    
2145 C CG    . LYS F 20 ? 0.6170 0.6306 0.3194 0.0113  0.0820  -0.0246 161 LYS F CG    
2146 C CD    A LYS F 20 ? 0.6239 0.6390 0.3212 -0.0045 0.0812  -0.0005 161 LYS F CD    
2147 C CD    B LYS F 20 ? 0.6285 0.6411 0.3235 -0.0044 0.0794  -0.0004 161 LYS F CD    
2148 C CE    A LYS F 20 ? 0.5903 0.6179 0.3271 -0.0087 0.0865  0.0067  161 LYS F CE    
2149 C CE    B LYS F 20 ? 0.6028 0.5959 0.3197 -0.0032 0.0597  0.0110  161 LYS F CE    
2150 N N     . GLU F 21 ? 0.6014 0.6168 0.3401 0.0504  0.0951  -0.0694 162 GLU F N     
2151 C CA    . GLU F 21 ? 0.5859 0.6229 0.3685 0.0616  0.1016  -0.0706 162 GLU F CA    
2152 C C     . GLU F 21 ? 0.5331 0.5671 0.3450 0.0514  0.0858  -0.0550 162 GLU F C     
2153 O O     . GLU F 21 ? 0.5187 0.5293 0.3206 0.0451  0.0691  -0.0503 162 GLU F O     
2154 C CB    . GLU F 21 ? 0.6344 0.6508 0.4182 0.0826  0.0996  -0.0896 162 GLU F CB    
2155 C CG    . GLU F 21 ? 0.6464 0.6873 0.4740 0.0992  0.1054  -0.0909 162 GLU F CG    
2156 C CD    . GLU F 21 ? 0.7075 0.7154 0.5333 0.1209  0.0986  -0.1060 162 GLU F CD    
2157 O OE1   . GLU F 21 ? 0.7632 0.7235 0.5597 0.1166  0.0838  -0.1124 162 GLU F OE1   
2158 O OE2   . GLU F 21 ? 0.7335 0.7625 0.5876 0.1415  0.1061  -0.1097 162 GLU F OE2   
2159 N N     . GLU F 22 ? 0.4944 0.5555 0.3407 0.0497  0.0913  -0.0479 163 GLU F N     
2160 C CA    . GLU F 22 ? 0.4658 0.5227 0.3372 0.0428  0.0777  -0.0376 163 GLU F CA    
2161 C C     . GLU F 22 ? 0.4305 0.5074 0.3360 0.0536  0.0793  -0.0425 163 GLU F C     
2162 O O     . GLU F 22 ? 0.4374 0.5471 0.3584 0.0582  0.0930  -0.0449 163 GLU F O     
2163 C CB    . GLU F 22 ? 0.4613 0.5242 0.3333 0.0250  0.0791  -0.0227 163 GLU F CB    
2164 C CG    . GLU F 22 ? 0.4603 0.5109 0.3494 0.0204  0.0654  -0.0160 163 GLU F CG    
2165 C CD    . GLU F 22 ? 0.4813 0.5158 0.3576 0.0044  0.0623  -0.0022 163 GLU F CD    
2166 O OE1   . GLU F 22 ? 0.5159 0.5325 0.3988 0.0035  0.0511  0.0006  163 GLU F OE1   
2167 O OE2   . GLU F 22 ? 0.5070 0.5439 0.3635 -0.0068 0.0708  0.0057  163 GLU F OE2   
2168 N N     . VAL F 23 ? 0.3970 0.4596 0.3144 0.0579  0.0653  -0.0426 164 VAL F N     
2169 C CA    . VAL F 23 ? 0.3803 0.4578 0.3258 0.0692  0.0634  -0.0455 164 VAL F CA    
2170 C C     . VAL F 23 ? 0.3380 0.4193 0.3011 0.0603  0.0520  -0.0373 164 VAL F C     
2171 O O     . VAL F 23 ? 0.3348 0.3962 0.2888 0.0571  0.0413  -0.0348 164 VAL F O     
2172 C CB    . VAL F 23 ? 0.3926 0.4437 0.3283 0.0837  0.0568  -0.0539 164 VAL F CB    
2173 C CG1   . VAL F 23 ? 0.3864 0.4504 0.3492 0.0982  0.0537  -0.0541 164 VAL F CG1   
2174 C CG2   . VAL F 23 ? 0.4435 0.4807 0.3516 0.0930  0.0671  -0.0663 164 VAL F CG2   
2175 N N     . ILE F 24 ? 0.3201 0.4312 0.3080 0.0569  0.0546  -0.0342 165 ILE F N     
2176 C CA    . ILE F 24 ? 0.3102 0.4241 0.3095 0.0470  0.0441  -0.0293 165 ILE F CA    
2177 C C     . ILE F 24 ? 0.3071 0.4175 0.3146 0.0580  0.0337  -0.0301 165 ILE F C     
2178 O O     . ILE F 24 ? 0.3177 0.4335 0.3333 0.0721  0.0350  -0.0324 165 ILE F O     
2179 C CB    . ILE F 24 ? 0.3111 0.4604 0.3331 0.0360  0.0477  -0.0258 165 ILE F CB    
2180 C CG1   . ILE F 24 ? 0.3417 0.4974 0.3547 0.0205  0.0590  -0.0214 165 ILE F CG1   
2181 C CG2   . ILE F 24 ? 0.3074 0.4556 0.3358 0.0253  0.0347  -0.0240 165 ILE F CG2   
2182 C CD1   . ILE F 24 ? 0.3700 0.4858 0.3535 0.0086  0.0556  -0.0172 165 ILE F CD1   
2183 N N     . ARG F 25 ? 0.2957 0.3945 0.2978 0.0526  0.0236  -0.0278 166 ARG F N     
2184 C CA    . ARG F 25 ? 0.2754 0.3751 0.2826 0.0583  0.0136  -0.0252 166 ARG F CA    
2185 C C     . ARG F 25 ? 0.2725 0.3994 0.2986 0.0550  0.0094  -0.0234 166 ARG F C     
2186 O O     . ARG F 25 ? 0.2652 0.3984 0.2916 0.0427  0.0092  -0.0250 166 ARG F O     
2187 C CB    . ARG F 25 ? 0.2792 0.3652 0.2717 0.0541  0.0075  -0.0237 166 ARG F CB    
2188 C CG    . ARG F 25 ? 0.2855 0.3524 0.2619 0.0552  0.0079  -0.0231 166 ARG F CG    
2189 C CD    . ARG F 25 ? 0.2906 0.3580 0.2591 0.0531  0.0029  -0.0204 166 ARG F CD    
2190 N NE    . ARG F 25 ? 0.2907 0.3496 0.2482 0.0516  0.0002  -0.0175 166 ARG F NE    
2191 C CZ    . ARG F 25 ? 0.2831 0.3520 0.2396 0.0485  -0.0061 -0.0116 166 ARG F CZ    
2192 N NH1   . ARG F 25 ? 0.2656 0.3540 0.2290 0.0487  -0.0084 -0.0082 166 ARG F NH1   
2193 N NH2   . ARG F 25 ? 0.2966 0.3603 0.2437 0.0432  -0.0105 -0.0087 166 ARG F NH2   
2194 N N     . LYS F 26 ? 0.2709 0.4118 0.3112 0.0651  0.0042  -0.0195 167 LYS F N     
2195 C CA    . LYS F 26 ? 0.2811 0.4577 0.3442 0.0636  0.0000  -0.0166 167 LYS F CA    
2196 C C     . LYS F 26 ? 0.2726 0.4560 0.3324 0.0570  -0.0130 -0.0127 167 LYS F C     
2197 O O     . LYS F 26 ? 0.2571 0.4702 0.3314 0.0510  -0.0195 -0.0106 167 LYS F O     
2198 C CB    . LYS F 26 ? 0.3210 0.5160 0.4047 0.0832  0.0016  -0.0136 167 LYS F CB    
2199 C CG    . LYS F 26 ? 0.3520 0.5418 0.4342 0.0932  0.0168  -0.0204 167 LYS F CG    
2200 C CD    . LYS F 26 ? 0.3884 0.5840 0.4836 0.1203  0.0187  -0.0210 167 LYS F CD    
2201 C CE    . LYS F 26 ? 0.4138 0.5633 0.4902 0.1318  0.0078  -0.0184 167 LYS F CE    
2202 N NZ    . LYS F 26 ? 0.4631 0.6168 0.5547 0.1606  0.0044  -0.0161 167 LYS F NZ    
2203 N N     . SER F 27 ? 0.2624 0.4236 0.3027 0.0569  -0.0170 -0.0111 168 SER F N     
2204 C CA    . SER F 27 ? 0.2763 0.4477 0.3094 0.0521  -0.0278 -0.0067 168 SER F CA    
2205 C C     . SER F 27 ? 0.2731 0.4275 0.2836 0.0489  -0.0265 -0.0078 168 SER F C     
2206 O O     . SER F 27 ? 0.2870 0.4231 0.2905 0.0503  -0.0192 -0.0111 168 SER F O     
2207 C CB    . SER F 27 ? 0.2748 0.4569 0.3187 0.0624  -0.0374 0.0055  168 SER F CB    
2208 O OG    . SER F 27 ? 0.2891 0.4437 0.3274 0.0722  -0.0357 0.0103  168 SER F OG    
2209 N N     . GLY F 28 ? 0.2767 0.4434 0.2763 0.0448  -0.0333 -0.0046 169 GLY F N     
2210 C CA    . GLY F 28 ? 0.2677 0.4330 0.2486 0.0429  -0.0308 -0.0049 169 GLY F CA    
2211 C C     . GLY F 28 ? 0.2792 0.4369 0.2477 0.0429  -0.0240 -0.0195 169 GLY F C     
2212 O O     . GLY F 28 ? 0.2756 0.4240 0.2448 0.0393  -0.0236 -0.0294 169 GLY F O     
2213 N N     . LEU F 29 ? 0.2998 0.4615 0.2569 0.0468  -0.0191 -0.0196 170 LEU F N     
2214 C CA    . LEU F 29 ? 0.3313 0.4850 0.2749 0.0540  -0.0126 -0.0331 170 LEU F CA    
2215 C C     . LEU F 29 ? 0.3195 0.4449 0.2666 0.0570  -0.0088 -0.0390 170 LEU F C     
2216 O O     . LEU F 29 ? 0.3307 0.4357 0.2654 0.0595  -0.0079 -0.0508 170 LEU F O     
2217 C CB    . LEU F 29 ? 0.3415 0.5178 0.2799 0.0607  -0.0071 -0.0287 170 LEU F CB    
2218 C CG    . LEU F 29 ? 0.3743 0.5842 0.3028 0.0570  -0.0078 -0.0221 170 LEU F CG    
2219 C CD1   . LEU F 29 ? 0.3875 0.6284 0.3170 0.0621  -0.0001 -0.0161 170 LEU F CD1   
2220 C CD2   . LEU F 29 ? 0.4048 0.6161 0.3119 0.0593  -0.0087 -0.0369 170 LEU F CD2   
2221 N N     . SER F 30 ? 0.3287 0.4490 0.2883 0.0558  -0.0076 -0.0305 171 SER F N     
2222 C CA    . SER F 30 ? 0.3175 0.4141 0.2778 0.0565  -0.0038 -0.0331 171 SER F CA    
2223 C C     . SER F 30 ? 0.3233 0.4137 0.2933 0.0480  -0.0038 -0.0332 171 SER F C     
2224 O O     . SER F 30 ? 0.3066 0.3840 0.2776 0.0463  0.0007  -0.0321 171 SER F O     
2225 C CB    . SER F 30 ? 0.2941 0.3916 0.2575 0.0591  -0.0024 -0.0252 171 SER F CB    
2226 O OG    . SER F 30 ? 0.2774 0.3821 0.2489 0.0541  -0.0056 -0.0172 171 SER F OG    
2227 N N     . ALA F 31 ? 0.2963 0.4020 0.2738 0.0423  -0.0085 -0.0335 172 ALA F N     
2228 C CA    . ALA F 31 ? 0.3045 0.4183 0.2969 0.0343  -0.0085 -0.0327 172 ALA F CA    
2229 C C     . ALA F 31 ? 0.3147 0.4092 0.3007 0.0251  -0.0039 -0.0368 172 ALA F C     
2230 O O     . ALA F 31 ? 0.3131 0.3852 0.2815 0.0219  -0.0061 -0.0432 172 ALA F O     
2231 C CB    . ALA F 31 ? 0.3101 0.4463 0.3086 0.0271  -0.0176 -0.0333 172 ALA F CB    
2232 N N     . GLY F 32 ? 0.3198 0.4207 0.3172 0.0217  0.0026  -0.0326 173 GLY F N     
2233 C CA    . GLY F 32 ? 0.3403 0.4232 0.3286 0.0087  0.0068  -0.0325 173 GLY F CA    
2234 C C     . GLY F 32 ? 0.3315 0.3848 0.3011 0.0150  0.0116  -0.0305 173 GLY F C     
2235 O O     . GLY F 32 ? 0.3523 0.3945 0.3149 0.0053  0.0165  -0.0261 173 GLY F O     
2236 N N     . LYS F 33 ? 0.3124 0.3580 0.2744 0.0292  0.0095  -0.0317 174 LYS F N     
2237 C CA    . LYS F 33 ? 0.3140 0.3438 0.2635 0.0361  0.0124  -0.0276 174 LYS F CA    
2238 C C     . LYS F 33 ? 0.2932 0.3371 0.2496 0.0366  0.0187  -0.0248 174 LYS F C     
2239 O O     . LYS F 33 ? 0.2759 0.3399 0.2480 0.0372  0.0206  -0.0262 174 LYS F O     
2240 C CB    . LYS F 33 ? 0.3043 0.3342 0.2488 0.0492  0.0078  -0.0282 174 LYS F CB    
2241 C CG    . LYS F 33 ? 0.3397 0.3584 0.2749 0.0558  0.0036  -0.0345 174 LYS F CG    
2242 C CD    . LYS F 33 ? 0.3800 0.3613 0.2977 0.0525  0.0023  -0.0360 174 LYS F CD    
2243 C CE    . LYS F 33 ? 0.4094 0.3717 0.3128 0.0637  -0.0019 -0.0460 174 LYS F CE    
2244 N NZ    . LYS F 33 ? 0.4526 0.3656 0.3334 0.0650  -0.0054 -0.0463 174 LYS F NZ    
2245 N N     . SER F 34 ? 0.3064 0.3380 0.2483 0.0384  0.0211  -0.0216 175 SER F N     
2246 C CA    . SER F 34 ? 0.3051 0.3429 0.2445 0.0405  0.0269  -0.0225 175 SER F CA    
2247 C C     . SER F 34 ? 0.3303 0.3569 0.2538 0.0447  0.0219  -0.0212 175 SER F C     
2248 O O     . SER F 34 ? 0.3147 0.3340 0.2300 0.0464  0.0150  -0.0166 175 SER F O     
2249 C CB    . SER F 34 ? 0.3312 0.3704 0.2629 0.0319  0.0370  -0.0199 175 SER F CB    
2250 O OG    . SER F 34 ? 0.3355 0.3529 0.2466 0.0269  0.0342  -0.0129 175 SER F OG    
2251 N N     . ASP F 35 ? 0.3326 0.3587 0.2512 0.0471  0.0246  -0.0259 176 ASP F N     
2252 C CA    . ASP F 35 ? 0.3455 0.3594 0.2451 0.0462  0.0191  -0.0266 176 ASP F CA    
2253 C C     . ASP F 35 ? 0.3791 0.3863 0.2570 0.0441  0.0279  -0.0300 176 ASP F C     
2254 O O     . ASP F 35 ? 0.3887 0.4048 0.2711 0.0472  0.0402  -0.0350 176 ASP F O     
2255 C CB    . ASP F 35 ? 0.3349 0.3426 0.2376 0.0488  0.0138  -0.0313 176 ASP F CB    
2256 C CG    . ASP F 35 ? 0.3174 0.3358 0.2373 0.0480  0.0054  -0.0254 176 ASP F CG    
2257 O OD1   . ASP F 35 ? 0.3077 0.3323 0.2249 0.0430  -0.0028 -0.0194 176 ASP F OD1   
2258 O OD2   . ASP F 35 ? 0.2880 0.3143 0.2242 0.0524  0.0072  -0.0259 176 ASP F OD2   
2259 N N     . VAL F 36 ? 0.3944 0.3919 0.2489 0.0391  0.0215  -0.0265 177 VAL F N     
2260 C CA    . VAL F 36 ? 0.4343 0.4249 0.2596 0.0354  0.0282  -0.0290 177 VAL F CA    
2261 C C     . VAL F 36 ? 0.4703 0.4450 0.2727 0.0335  0.0201  -0.0380 177 VAL F C     
2262 O O     . VAL F 36 ? 0.4508 0.4238 0.2551 0.0282  0.0046  -0.0335 177 VAL F O     
2263 C CB    . VAL F 36 ? 0.4452 0.4341 0.2561 0.0292  0.0248  -0.0154 177 VAL F CB    
2264 C CG1   . VAL F 36 ? 0.4935 0.4768 0.2672 0.0229  0.0298  -0.0156 177 VAL F CG1   
2265 C CG2   . VAL F 36 ? 0.4408 0.4337 0.2681 0.0276  0.0315  -0.0081 177 VAL F CG2   
2266 N N     . TYR F 37 ? 0.5013 0.4662 0.2822 0.0375  0.0306  -0.0513 178 TYR F N     
2267 C CA    . TYR F 37 ? 0.5485 0.4872 0.2991 0.0358  0.0239  -0.0646 178 TYR F CA    
2268 C C     . TYR F 37 ? 0.5870 0.5213 0.2964 0.0329  0.0320  -0.0711 178 TYR F C     
2269 O O     . TYR F 37 ? 0.5938 0.5467 0.3027 0.0371  0.0494  -0.0698 178 TYR F O     
2270 C CB    . TYR F 37 ? 0.5655 0.4880 0.3233 0.0499  0.0301  -0.0793 178 TYR F CB    
2271 C CG    . TYR F 37 ? 0.5505 0.4780 0.3450 0.0529  0.0230  -0.0719 178 TYR F CG    
2272 C CD1   . TYR F 37 ? 0.5461 0.4658 0.3450 0.0404  0.0050  -0.0637 178 TYR F CD1   
2273 C CD2   . TYR F 37 ? 0.5361 0.4828 0.3612 0.0665  0.0342  -0.0715 178 TYR F CD2   
2274 C CE1   . TYR F 37 ? 0.5242 0.4522 0.3528 0.0417  -0.0002 -0.0555 178 TYR F CE1   
2275 C CE2   . TYR F 37 ? 0.5133 0.4655 0.3674 0.0681  0.0264  -0.0638 178 TYR F CE2   
2276 C CZ    . TYR F 37 ? 0.4965 0.4375 0.3499 0.0559  0.0100  -0.0561 178 TYR F CZ    
2277 O OH    . TYR F 37 ? 0.4783 0.4280 0.3557 0.0559  0.0035  -0.0475 178 TYR F OH    
2278 N N     . TYR F 38 ? 0.6108 0.5235 0.2840 0.0229  0.0189  -0.0774 179 TYR F N     
2279 C CA    . TYR F 38 ? 0.6637 0.5680 0.2894 0.0209  0.0265  -0.0881 179 TYR F CA    
2280 C C     . TYR F 38 ? 0.7282 0.5932 0.3206 0.0254  0.0244  -0.1131 179 TYR F C     
2281 O O     . TYR F 38 ? 0.7353 0.5741 0.3325 0.0196  0.0075  -0.1165 179 TYR F O     
2282 C CB    . TYR F 38 ? 0.6631 0.5746 0.2648 0.0040  0.0113  -0.0739 179 TYR F CB    
2283 C CG    . TYR F 38 ? 0.6207 0.5595 0.2438 0.0031  0.0149  -0.0507 179 TYR F CG    
2284 C CD1   . TYR F 38 ? 0.5804 0.5312 0.2421 0.0033  0.0030  -0.0344 179 TYR F CD1   
2285 C CD2   . TYR F 38 ? 0.6390 0.5891 0.2406 0.0017  0.0302  -0.0448 179 TYR F CD2   
2286 C CE1   . TYR F 38 ? 0.5560 0.5198 0.2319 0.0045  0.0047  -0.0152 179 TYR F CE1   
2287 C CE2   . TYR F 38 ? 0.6169 0.5808 0.2333 -0.0017 0.0309  -0.0220 179 TYR F CE2   
2288 C CZ    . TYR F 38 ? 0.5733 0.5393 0.2260 0.0008  0.0175  -0.0085 179 TYR F CZ    
2289 O OH    . TYR F 38 ? 0.5591 0.5269 0.2212 -0.0004 0.0168  0.0116  179 TYR F OH    
2290 N N     . PHE F 39 ? 0.7881 0.6469 0.3440 0.0355  0.0419  -0.1307 180 PHE F N     
2291 C CA    . PHE F 39 ? 0.8553 0.6678 0.3688 0.0436  0.0412  -0.1590 180 PHE F CA    
2292 C C     . PHE F 39 ? 0.9059 0.7085 0.3574 0.0326  0.0402  -0.1695 180 PHE F C     
2293 O O     . PHE F 39 ? 0.9041 0.7415 0.3457 0.0311  0.0544  -0.1606 180 PHE F O     
2294 C CB    . PHE F 39 ? 0.8784 0.6927 0.4042 0.0741  0.0655  -0.1758 180 PHE F CB    
2295 C CG    . PHE F 39 ? 0.8496 0.6703 0.4308 0.0850  0.0635  -0.1665 180 PHE F CG    
2296 C CD1   . PHE F 39 ? 0.8920 0.6641 0.4729 0.0875  0.0467  -0.1742 180 PHE F CD1   
2297 C CD2   . PHE F 39 ? 0.8033 0.6760 0.4341 0.0893  0.0761  -0.1483 180 PHE F CD2   
2298 C CE1   . PHE F 39 ? 0.8417 0.6209 0.4707 0.0966  0.0438  -0.1631 180 PHE F CE1   
2299 C CE2   . PHE F 39 ? 0.7706 0.6508 0.4494 0.0981  0.0726  -0.1398 180 PHE F CE2   
2300 C CZ    . PHE F 39 ? 0.7933 0.6286 0.4711 0.1027  0.0568  -0.1467 180 PHE F CZ    
2301 N N     . SER F 40 ? 0.9564 0.7097 0.3628 0.0219  0.0219  -0.1874 181 SER F N     
2302 C CA    . SER F 40 ? 1.0220 0.7600 0.3595 0.0101  0.0184  -0.2017 181 SER F CA    
2303 C C     . SER F 40 ? 1.0730 0.7975 0.3727 0.0374  0.0469  -0.2318 181 SER F C     
2304 O O     . SER F 40 ? 1.0564 0.7837 0.3880 0.0653  0.0658  -0.2401 181 SER F O     
2305 C CB    . SER F 40 ? 1.0618 0.7504 0.3629 -0.0151 -0.0141 -0.2110 181 SER F CB    
2306 O OG    . SER F 40 ? 1.1070 0.7348 0.3960 -0.0038 -0.0167 -0.2354 181 SER F OG    
2307 N N     . PRO F 41 ? 1.1431 0.8589 0.3753 0.0314  0.0506  -0.2478 182 PRO F N     
2308 C CA    . PRO F 41 ? 1.2159 0.9125 0.4042 0.0604  0.0772  -0.2829 182 PRO F CA    
2309 C C     . PRO F 41 ? 1.2713 0.8920 0.4414 0.0778  0.0689  -0.3144 182 PRO F C     
2310 O O     . PRO F 41 ? 1.2931 0.9061 0.4673 0.1152  0.0930  -0.3357 182 PRO F O     
2311 C CB    . PRO F 41 ? 1.2845 0.9795 0.3951 0.0438  0.0759  -0.2934 182 PRO F CB    
2312 C CG    . PRO F 41 ? 1.2491 0.9599 0.3654 0.0062  0.0451  -0.2625 182 PRO F CG    
2313 C CD    . PRO F 41 ? 1.1557 0.8944 0.3548 0.0033  0.0369  -0.2310 182 PRO F CD    
2314 N N     . SER F 42 ? 1.2926 0.8600 0.4450 0.0506  0.0341  -0.3149 183 SER F N     
2315 C CA    . SER F 42 ? 1.3520 0.8375 0.4871 0.0591  0.0199  -0.3386 183 SER F CA    
2316 C C     . SER F 42 ? 1.2876 0.7766 0.4954 0.0767  0.0218  -0.3230 183 SER F C     
2317 O O     . SER F 42 ? 1.3388 0.7592 0.5348 0.0887  0.0125  -0.3399 183 SER F O     
2318 C CB    . SER F 42 ? 1.4001 0.8341 0.4959 0.0163  -0.0198 -0.3391 183 SER F CB    
2319 N N     . GLY F 43 ? 1.1802 0.7433 0.4575 0.0762  0.0311  -0.2905 184 GLY F N     
2320 C CA    . GLY F 43 ? 1.1172 0.6977 0.4629 0.0959  0.0378  -0.2757 184 GLY F CA    
2321 C C     . GLY F 43 ? 1.0527 0.6355 0.4424 0.0686  0.0114  -0.2473 184 GLY F C     
2322 O O     . GLY F 43 ? 1.0029 0.5965 0.4434 0.0814  0.0137  -0.2347 184 GLY F O     
2323 N N     . LYS F 44 ? 1.0577 0.6362 0.4274 0.0315  -0.0131 -0.2370 185 LYS F N     
2324 C CA    . LYS F 44 ? 1.0180 0.6006 0.4224 0.0040  -0.0385 -0.2127 185 LYS F CA    
2325 C C     . LYS F 44 ? 0.9277 0.5857 0.3968 0.0052  -0.0299 -0.1821 185 LYS F C     
2326 O O     . LYS F 44 ? 0.8982 0.6017 0.3694 0.0062  -0.0184 -0.1739 185 LYS F O     
2327 C CB    . LYS F 44 ? 1.0548 0.6211 0.4195 -0.0352 -0.0671 -0.2111 185 LYS F CB    
2328 N N     . LYS F 45 ? 0.8923 0.5580 0.4091 0.0045  -0.0364 -0.1656 186 LYS F N     
2329 C CA    . LYS F 45 ? 0.8143 0.5415 0.3900 0.0098  -0.0275 -0.1411 186 LYS F CA    
2330 C C     . LYS F 45 ? 0.7675 0.5313 0.3607 -0.0168 -0.0457 -0.1180 186 LYS F C     
2331 O O     . LYS F 45 ? 0.7786 0.5257 0.3635 -0.0407 -0.0681 -0.1135 186 LYS F O     
2332 C CB    . LYS F 45 ? 0.8141 0.5338 0.4283 0.0236  -0.0254 -0.1358 186 LYS F CB    
2333 C CG    . LYS F 45 ? 0.7527 0.5302 0.4233 0.0288  -0.0173 -0.1138 186 LYS F CG    
2334 C CD    . LYS F 45 ? 0.7595 0.5289 0.4618 0.0418  -0.0168 -0.1092 186 LYS F CD    
2335 C CE    . LYS F 45 ? 0.7783 0.5586 0.4959 0.0733  0.0047  -0.1188 186 LYS F CE    
2336 N NZ    . LYS F 45 ? 0.7504 0.5471 0.5105 0.0829  0.0041  -0.1059 186 LYS F NZ    
2337 N N     . PHE F 46 ? 0.7146 0.5289 0.3327 -0.0124 -0.0365 -0.1024 187 PHE F N     
2338 C CA    . PHE F 46 ? 0.6669 0.5206 0.3058 -0.0288 -0.0516 -0.0801 187 PHE F CA    
2339 C C     . PHE F 46 ? 0.5895 0.4819 0.2787 -0.0162 -0.0418 -0.0633 187 PHE F C     
2340 O O     . PHE F 46 ? 0.5758 0.4776 0.2743 -0.0001 -0.0232 -0.0646 187 PHE F O     
2341 C CB    . PHE F 46 ? 0.6954 0.5602 0.2992 -0.0379 -0.0566 -0.0782 187 PHE F CB    
2342 C CG    . PHE F 46 ? 0.7646 0.5931 0.3170 -0.0568 -0.0728 -0.0939 187 PHE F CG    
2343 C CD1   . PHE F 46 ? 0.8243 0.6077 0.3316 -0.0481 -0.0617 -0.1203 187 PHE F CD1   
2344 C CD2   . PHE F 46 ? 0.7822 0.6214 0.3316 -0.0833 -0.0996 -0.0836 187 PHE F CD2   
2345 C CE1   . PHE F 46 ? 0.9062 0.6456 0.3589 -0.0661 -0.0779 -0.1386 187 PHE F CE1   
2346 C CE2   . PHE F 46 ? 0.8534 0.6551 0.3522 -0.1060 -0.1177 -0.0988 187 PHE F CE2   
2347 C CZ    . PHE F 46 ? 0.9182 0.6642 0.3653 -0.0978 -0.1074 -0.1276 187 PHE F CZ    
2348 N N     . ARG F 47 ? 0.5493 0.4657 0.2694 -0.0247 -0.0543 -0.0481 188 ARG F N     
2349 C CA    . ARG F 47 ? 0.5033 0.4485 0.2666 -0.0120 -0.0457 -0.0366 188 ARG F CA    
2350 C C     . ARG F 47 ? 0.4760 0.4629 0.2610 -0.0118 -0.0525 -0.0186 188 ARG F C     
2351 O O     . ARG F 47 ? 0.4435 0.4508 0.2594 -0.0008 -0.0464 -0.0113 188 ARG F O     
2352 C CB    . ARG F 47 ? 0.4892 0.4265 0.2720 -0.0152 -0.0497 -0.0360 188 ARG F CB    
2353 C CG    . ARG F 47 ? 0.5280 0.4171 0.2882 -0.0116 -0.0463 -0.0527 188 ARG F CG    
2354 C CD    . ARG F 47 ? 0.5114 0.3944 0.2957 -0.0082 -0.0471 -0.0480 188 ARG F CD    
2355 N NE    . ARG F 47 ? 0.5105 0.3996 0.2998 -0.0313 -0.0650 -0.0354 188 ARG F NE    
2356 C CZ    . ARG F 47 ? 0.4800 0.3901 0.2971 -0.0350 -0.0675 -0.0216 188 ARG F CZ    
2357 N NH1   . ARG F 47 ? 0.4409 0.3661 0.2827 -0.0164 -0.0551 -0.0196 188 ARG F NH1   
2358 N NH2   . ARG F 47 ? 0.4956 0.4162 0.3144 -0.0602 -0.0833 -0.0089 188 ARG F NH2   
2359 N N     . SER F 48 ? 0.4915 0.4900 0.2585 -0.0220 -0.0658 -0.0124 189 SER F N     
2360 C CA    . SER F 48 ? 0.4739 0.5126 0.2609 -0.0168 -0.0741 0.0051  189 SER F CA    
2361 C C     . SER F 48 ? 0.5155 0.5568 0.2728 -0.0212 -0.0837 0.0107  189 SER F C     
2362 O O     . SER F 48 ? 0.5361 0.5555 0.2561 -0.0361 -0.0897 0.0009  189 SER F O     
2363 C CB    . SER F 48 ? 0.4515 0.5257 0.2639 -0.0280 -0.0883 0.0147  189 SER F CB    
2364 O OG    . SER F 48 ? 0.4777 0.5485 0.2669 -0.0529 -0.1061 0.0133  189 SER F OG    
2365 N N     . LYS F 49 ? 0.5185 0.5820 0.2879 -0.0070 -0.0858 0.0260  190 LYS F N     
2366 C CA    . LYS F 49 ? 0.5554 0.6253 0.2979 -0.0097 -0.0982 0.0367  190 LYS F CA    
2367 C C     . LYS F 49 ? 0.5774 0.6732 0.3107 -0.0302 -0.1218 0.0406  190 LYS F C     
2368 O O     . LYS F 49 ? 0.5928 0.6748 0.2852 -0.0440 -0.1304 0.0372  190 LYS F O     
2369 C CB    . LYS F 49 ? 0.5482 0.6334 0.3072 0.0121  -0.0998 0.0549  190 LYS F CB    
2370 C CG    . LYS F 49 ? 0.5931 0.6730 0.3175 0.0110  -0.1101 0.0677  190 LYS F CG    
2371 C CD    . LYS F 49 ? 0.5961 0.6774 0.3315 0.0347  -0.1129 0.0869  190 LYS F CD    
2372 C CE    . LYS F 49 ? 0.6381 0.7165 0.3365 0.0314  -0.1274 0.1034  190 LYS F CE    
2373 N NZ    . LYS F 49 ? 0.6562 0.7283 0.3603 0.0559  -0.1343 0.1251  190 LYS F NZ    
2374 N N     . PRO F 50 ? 0.5642 0.7004 0.3337 -0.0350 -0.1323 0.0476  191 PRO F N     
2375 C CA    . PRO F 50 ? 0.5954 0.7621 0.3574 -0.0608 -0.1571 0.0533  191 PRO F CA    
2376 C C     . PRO F 50 ? 0.6517 0.7751 0.3742 -0.0904 -0.1622 0.0343  191 PRO F C     
2377 O O     . PRO F 50 ? 0.6838 0.8068 0.3730 -0.1117 -0.1811 0.0334  191 PRO F O     
2378 C CB    . PRO F 50 ? 0.5583 0.7832 0.3718 -0.0597 -0.1625 0.0658  191 PRO F CB    
2379 C CG    . PRO F 50 ? 0.5135 0.7395 0.3570 -0.0266 -0.1422 0.0676  191 PRO F CG    
2380 C CD    . PRO F 50 ? 0.5228 0.6848 0.3383 -0.0201 -0.1234 0.0518  191 PRO F CD    
2381 N N     . GLN F 51 ? 0.6572 0.7418 0.3807 -0.0902 -0.1470 0.0190  192 GLN F N     
2382 C CA    . GLN F 51 ? 0.7143 0.7422 0.3958 -0.1101 -0.1490 -0.0023 192 GLN F CA    
2383 C C     . GLN F 51 ? 0.7531 0.7441 0.3822 -0.1062 -0.1433 -0.0165 192 GLN F C     
2384 O O     . GLN F 51 ? 0.8076 0.7691 0.3902 -0.1271 -0.1562 -0.0298 192 GLN F O     
2385 C CB    . GLN F 51 ? 0.7237 0.7179 0.4200 -0.1005 -0.1316 -0.0133 192 GLN F CB    
2386 C CG    . GLN F 51 ? 0.7894 0.7224 0.4496 -0.1173 -0.1360 -0.0330 192 GLN F CG    
2387 C CD    . GLN F 51 ? 0.7768 0.6783 0.4536 -0.1018 -0.1193 -0.0409 192 GLN F CD    
2388 O OE1   . GLN F 51 ? 0.7102 0.6307 0.4183 -0.0774 -0.1010 -0.0362 192 GLN F OE1   
2389 N NE2   . GLN F 51 ? 0.8353 0.6850 0.4880 -0.1165 -0.1277 -0.0525 192 GLN F NE2   
2390 N N     . LEU F 52 ? 0.7158 0.7086 0.3496 -0.0814 -0.1241 -0.0134 193 LEU F N     
2391 C CA    . LEU F 52 ? 0.7486 0.7183 0.3359 -0.0772 -0.1154 -0.0220 193 LEU F CA    
2392 C C     . LEU F 52 ? 0.7865 0.7765 0.3426 -0.0927 -0.1379 -0.0114 193 LEU F C     
2393 O O     . LEU F 52 ? 0.8493 0.8129 0.3508 -0.1052 -0.1417 -0.0256 193 LEU F O     
2394 C CB    . LEU F 52 ? 0.7126 0.6889 0.3181 -0.0532 -0.0936 -0.0135 193 LEU F CB    
2395 C CG    . LEU F 52 ? 0.7453 0.7051 0.3096 -0.0486 -0.0789 -0.0181 193 LEU F CG    
2396 C CD1   . LEU F 52 ? 0.7862 0.7087 0.3120 -0.0513 -0.0662 -0.0462 193 LEU F CD1   
2397 C CD2   . LEU F 52 ? 0.7056 0.6727 0.2973 -0.0306 -0.0596 -0.0068 193 LEU F CD2   
2398 N N     . ALA F 53 ? 0.7628 0.8016 0.3531 -0.0898 -0.1529 0.0130  194 ALA F N     
2399 C CA    . ALA F 53 ? 0.8027 0.8728 0.3736 -0.1008 -0.1774 0.0289  194 ALA F CA    
2400 C C     . ALA F 53 ? 0.8456 0.9215 0.3955 -0.1344 -0.2037 0.0218  194 ALA F C     
2401 O O     . ALA F 53 ? 0.8943 0.9721 0.4002 -0.1510 -0.2217 0.0225  194 ALA F O     
2402 C CB    . ALA F 53 ? 0.7634 0.8865 0.3835 -0.0813 -0.1851 0.0568  194 ALA F CB    
2403 N N     . ARG F 54 ? 0.8414 0.9192 0.4198 -0.1473 -0.2073 0.0165  195 ARG F N     
2404 C CA    . ARG F 54 ? 0.9101 0.9850 0.4683 -0.1857 -0.2330 0.0097  195 ARG F CA    
2405 C C     . ARG F 54 ? 0.9919 0.9947 0.4772 -0.2018 -0.2329 -0.0199 195 ARG F C     
2406 O O     . ARG F 54 ? 1.0773 1.0767 0.5214 -0.2310 -0.2577 -0.0244 195 ARG F O     
2407 C CB    . ARG F 54 ? 0.8725 0.9577 0.4741 -0.1972 -0.2341 0.0124  195 ARG F CB    
2408 N N     . TYR F 55 ? 0.9992 0.9484 0.4687 -0.1810 -0.2051 -0.0404 196 TYR F N     
2409 C CA    . TYR F 55 ? 1.0853 0.9658 0.4860 -0.1863 -0.1989 -0.0722 196 TYR F CA    
2410 C C     . TYR F 55 ? 1.1357 1.0210 0.4864 -0.1834 -0.1983 -0.0737 196 TYR F C     
2411 O O     . TYR F 55 ? 1.2218 1.0780 0.5098 -0.2052 -0.2137 -0.0908 196 TYR F O     
2412 C CB    . TYR F 55 ? 1.0711 0.9083 0.4788 -0.1585 -0.1672 -0.0903 196 TYR F CB    
2413 C CG    . TYR F 55 ? 1.1466 0.9118 0.4889 -0.1569 -0.1583 -0.1261 196 TYR F CG    
2414 C CD1   . TYR F 55 ? 1.2129 0.9206 0.5225 -0.1796 -0.1760 -0.1457 196 TYR F CD1   
2415 C CD2   . TYR F 55 ? 1.1605 0.9138 0.4729 -0.1320 -0.1315 -0.1404 196 TYR F CD2   
2416 C CE1   . TYR F 55 ? 1.2883 0.9224 0.5345 -0.1727 -0.1676 -0.1814 196 TYR F CE1   
2417 C CE2   . TYR F 55 ? 1.2313 0.9239 0.4845 -0.1246 -0.1205 -0.1752 196 TYR F CE2   
2418 C CZ    . TYR F 55 ? 1.2991 0.9287 0.5182 -0.1424 -0.1387 -0.1972 196 TYR F CZ    
2419 O OH    . TYR F 55 ? 1.3826 0.9444 0.5387 -0.1303 -0.1280 -0.2347 196 TYR F OH    
2420 N N     . LEU F 56 ? 1.0958 1.0137 0.4691 -0.1585 -0.1814 -0.0559 197 LEU F N     
2421 C CA    . LEU F 56 ? 1.1427 1.0681 0.4688 -0.1566 -0.1805 -0.0514 197 LEU F CA    
2422 C C     . LEU F 56 ? 1.1772 1.1392 0.4849 -0.1815 -0.2166 -0.0341 197 LEU F C     
2423 O O     . LEU F 56 ? 1.2234 1.1729 0.4667 -0.1950 -0.2256 -0.0423 197 LEU F O     
2424 C CB    . LEU F 56 ? 1.0933 1.0409 0.4483 -0.1285 -0.1573 -0.0318 197 LEU F CB    
2425 C CG    . LEU F 56 ? 1.0803 0.9972 0.4345 -0.1076 -0.1212 -0.0499 197 LEU F CG    
2426 C CD1   . LEU F 56 ? 1.0408 0.9815 0.4249 -0.0881 -0.1038 -0.0266 197 LEU F CD1   
2427 C CD2   . LEU F 56 ? 1.1606 1.0405 0.4432 -0.1115 -0.1089 -0.0786 197 LEU F CD2   
2428 N N     . GLY F 57 ? 1.1359 1.1473 0.4994 -0.1873 -0.2368 -0.0107 198 GLY F N     
2429 C CA    . GLY F 57 ? 1.1468 1.2057 0.5044 -0.2114 -0.2737 0.0075  198 GLY F CA    
2430 C C     . GLY F 57 ? 1.1640 1.2540 0.5039 -0.1988 -0.2801 0.0313  198 GLY F C     
2431 O O     . GLY F 57 ? 1.1146 1.2004 0.4674 -0.1697 -0.2572 0.0420  198 GLY F O     
2432 N N     . ASN F 58 ? 1.2094 1.3269 0.5152 -0.2232 -0.3127 0.0402  199 ASN F N     
2433 C CA    . ASN F 58 ? 1.2385 1.3883 0.5257 -0.2129 -0.3248 0.0675  199 ASN F CA    
2434 C C     . ASN F 58 ? 1.3070 1.4104 0.5156 -0.2117 -0.3082 0.0546  199 ASN F C     
2435 O O     . ASN F 58 ? 1.3298 1.4537 0.5030 -0.2139 -0.3240 0.0747  199 ASN F O     
2436 C CB    . ASN F 58 ? 1.2929 1.5001 0.5764 -0.2395 -0.3690 0.0853  199 ASN F CB    
2437 N N     . THR F 59 ? 1.3165 1.3626 0.4982 -0.2076 -0.2767 0.0226  200 THR F N     
2438 C CA    . THR F 59 ? 1.3576 1.3686 0.4719 -0.2024 -0.2536 0.0098  200 THR F CA    
2439 C C     . THR F 59 ? 1.3097 1.3170 0.4534 -0.1715 -0.2193 0.0238  200 THR F C     
2440 O O     . THR F 59 ? 1.3355 1.3312 0.4308 -0.1683 -0.2026 0.0254  200 THR F O     
2441 C CB    . THR F 59 ? 1.4065 1.3601 0.4663 -0.2142 -0.2391 -0.0359 200 THR F CB    
2442 N N     . VAL F 60 ? 1.2158 1.2332 0.4350 -0.1521 -0.2091 0.0332  201 VAL F N     
2443 C CA    . VAL F 60 ? 1.1665 1.1852 0.4205 -0.1263 -0.1852 0.0526  201 VAL F CA    
2444 C C     . VAL F 60 ? 1.1139 1.1688 0.4347 -0.1107 -0.2023 0.0830  201 VAL F C     
2445 O O     . VAL F 60 ? 1.1032 1.1769 0.4700 -0.1118 -0.2130 0.0785  201 VAL F O     
2446 C CB    . VAL F 60 ? 1.1320 1.1215 0.4114 -0.1129 -0.1499 0.0290  201 VAL F CB    
2447 C CG1   . VAL F 60 ? 1.0979 1.0864 0.3981 -0.0943 -0.1264 0.0478  201 VAL F CG1   
2448 C CG2   . VAL F 60 ? 1.1893 1.1446 0.4124 -0.1223 -0.1335 -0.0072 201 VAL F CG2   
2449 N N     . ASP F 61 ? 1.0956 1.1585 0.4197 -0.0955 -0.2041 0.1138  202 ASP F N     
2450 C CA    . ASP F 61 ? 1.0456 1.1343 0.4298 -0.0723 -0.2159 0.1405  202 ASP F CA    
2451 C C     . ASP F 61 ? 0.9994 1.0627 0.4232 -0.0529 -0.1866 0.1355  202 ASP F C     
2452 O O     . ASP F 61 ? 1.0092 1.0425 0.4089 -0.0512 -0.1657 0.1381  202 ASP F O     
2453 C CB    . ASP F 61 ? 1.0845 1.1833 0.4460 -0.0635 -0.2353 0.1767  202 ASP F CB    
2454 C CG    . ASP F 61 ? 1.0511 1.1813 0.4708 -0.0354 -0.2538 0.2033  202 ASP F CG    
2455 O OD1   . ASP F 61 ? 0.9896 1.1164 0.4633 -0.0158 -0.2395 0.1977  202 ASP F OD1   
2456 O OD2   . ASP F 61 ? 1.0593 1.2189 0.4685 -0.0310 -0.2831 0.2299  202 ASP F OD2   
2457 N N     . LEU F 62 ? 0.9438 1.0230 0.4269 -0.0409 -0.1855 0.1294  203 LEU F N     
2458 C CA    . LEU F 62 ? 0.9013 0.9579 0.4215 -0.0247 -0.1595 0.1218  203 LEU F CA    
2459 C C     . LEU F 62 ? 0.8764 0.9447 0.4438 0.0031  -0.1657 0.1424  203 LEU F C     
2460 O O     . LEU F 62 ? 0.8562 0.9154 0.4610 0.0156  -0.1500 0.1335  203 LEU F O     
2461 C CB    . LEU F 62 ? 0.8657 0.9219 0.4100 -0.0328 -0.1480 0.0933  203 LEU F CB    
2462 C CG    . LEU F 62 ? 0.8887 0.9214 0.3897 -0.0536 -0.1379 0.0664  203 LEU F CG    
2463 C CD1   . LEU F 62 ? 0.8546 0.8829 0.3852 -0.0574 -0.1317 0.0441  203 LEU F CD1   
2464 C CD2   . LEU F 62 ? 0.9125 0.9154 0.3823 -0.0513 -0.1115 0.0613  203 LEU F CD2   
2465 N N     . SER F 63 ? 0.9063 0.9923 0.4690 0.0149  -0.1886 0.1692  204 SER F N     
2466 C CA    . SER F 63 ? 0.8871 0.9830 0.4922 0.0476  -0.1962 0.1874  204 SER F CA    
2467 C C     . SER F 63 ? 0.8762 0.9199 0.4825 0.0609  -0.1753 0.1885  204 SER F C     
2468 O O     . SER F 63 ? 0.8900 0.9309 0.5361 0.0781  -0.1651 0.1797  204 SER F O     
2469 C CB    . SER F 63 ? 0.9401 1.0580 0.5334 0.0612  -0.2251 0.2181  204 SER F CB    
2470 O OG    . SER F 63 ? 0.9533 1.1221 0.5406 0.0429  -0.2470 0.2181  204 SER F OG    
2471 N N     . SER F 64 ? 0.8939 0.8975 0.4544 0.0492  -0.1684 0.1983  205 SER F N     
2472 C CA    . SER F 64 ? 0.8915 0.8444 0.4493 0.0543  -0.1503 0.2018  205 SER F CA    
2473 C C     . SER F 64 ? 0.8505 0.7919 0.4125 0.0358  -0.1214 0.1753  205 SER F C     
2474 O O     . SER F 64 ? 0.8561 0.7615 0.4139 0.0324  -0.1057 0.1775  205 SER F O     
2475 C CB    . SER F 64 ? 0.9592 0.8762 0.4667 0.0481  -0.1573 0.2306  205 SER F CB    
2476 O OG    . SER F 64 ? 0.9738 0.8996 0.4350 0.0194  -0.1514 0.2271  205 SER F OG    
2477 N N     . PHE F 65 ? 0.8125 0.7832 0.3832 0.0237  -0.1159 0.1514  206 PHE F N     
2478 C CA    . PHE F 65 ? 0.7807 0.7437 0.3592 0.0121  -0.0906 0.1265  206 PHE F CA    
2479 C C     . PHE F 65 ? 0.7351 0.6969 0.3642 0.0274  -0.0825 0.1159  206 PHE F C     
2480 O O     . PHE F 65 ? 0.6970 0.6848 0.3587 0.0384  -0.0924 0.1109  206 PHE F O     
2481 C CB    . PHE F 65 ? 0.7788 0.7621 0.3435 -0.0033 -0.0899 0.1047  206 PHE F CB    
2482 C CG    . PHE F 65 ? 0.7701 0.7422 0.3313 -0.0124 -0.0641 0.0812  206 PHE F CG    
2483 C CD1   . PHE F 65 ? 0.8051 0.7646 0.3302 -0.0231 -0.0466 0.0821  206 PHE F CD1   
2484 C CD2   . PHE F 65 ? 0.7351 0.7132 0.3302 -0.0091 -0.0570 0.0601  206 PHE F CD2   
2485 C CE1   . PHE F 65 ? 0.7973 0.7559 0.3241 -0.0270 -0.0220 0.0607  206 PHE F CE1   
2486 C CE2   . PHE F 65 ? 0.7224 0.6918 0.3165 -0.0126 -0.0348 0.0400  206 PHE F CE2   
2487 C CZ    . PHE F 65 ? 0.7487 0.7110 0.3111 -0.0197 -0.0169 0.0394  206 PHE F CZ    
2488 N N     . ASP F 66 ? 0.7204 0.6558 0.3535 0.0253  -0.0647 0.1137  207 ASP F N     
2489 C CA    . ASP F 66 ? 0.6884 0.6189 0.3604 0.0358  -0.0561 0.1028  207 ASP F CA    
2490 C C     . ASP F 66 ? 0.6531 0.5990 0.3371 0.0248  -0.0396 0.0787  207 ASP F C     
2491 O O     . ASP F 66 ? 0.6628 0.6024 0.3317 0.0115  -0.0226 0.0727  207 ASP F O     
2492 C CB    . ASP F 66 ? 0.7223 0.6139 0.3884 0.0352  -0.0490 0.1137  207 ASP F CB    
2493 C CG    . ASP F 66 ? 0.6928 0.5769 0.3938 0.0442  -0.0416 0.1008  207 ASP F CG    
2494 O OD1   . ASP F 66 ? 0.7017 0.5859 0.4231 0.0657  -0.0519 0.1012  207 ASP F OD1   
2495 O OD2   . ASP F 66 ? 0.6978 0.5810 0.4057 0.0305  -0.0253 0.0900  207 ASP F OD2   
2496 N N     . PHE F 67 ? 0.5967 0.5654 0.3071 0.0307  -0.0449 0.0666  208 PHE F N     
2497 C CA    . PHE F 67 ? 0.5717 0.5490 0.2913 0.0229  -0.0338 0.0458  208 PHE F CA    
2498 C C     . PHE F 67 ? 0.5401 0.5067 0.2749 0.0223  -0.0146 0.0375  208 PHE F C     
2499 O O     . PHE F 67 ? 0.5229 0.4908 0.2496 0.0150  -0.0006 0.0251  208 PHE F O     
2500 C CB    . PHE F 67 ? 0.5418 0.5419 0.2916 0.0282  -0.0440 0.0395  208 PHE F CB    
2501 C CG    . PHE F 67 ? 0.5312 0.5318 0.2841 0.0193  -0.0374 0.0211  208 PHE F CG    
2502 C CD1   . PHE F 67 ? 0.4987 0.4958 0.2759 0.0237  -0.0249 0.0113  208 PHE F CD1   
2503 C CD2   . PHE F 67 ? 0.5641 0.5643 0.2920 0.0064  -0.0458 0.0137  208 PHE F CD2   
2504 C CE1   . PHE F 67 ? 0.5073 0.4996 0.2860 0.0187  -0.0206 -0.0036 208 PHE F CE1   
2505 C CE2   . PHE F 67 ? 0.5671 0.5556 0.2930 0.0000  -0.0414 -0.0036 208 PHE F CE2   
2506 C CZ    . PHE F 67 ? 0.5323 0.5164 0.2847 0.0077  -0.0288 -0.0113 208 PHE F CZ    
2507 N N     . ARG F 68 ? 0.5190 0.4768 0.2753 0.0312  -0.0146 0.0433  209 ARG F N     
2508 C CA    . ARG F 68 ? 0.5064 0.4592 0.2804 0.0281  -0.0002 0.0353  209 ARG F CA    
2509 C C     . ARG F 68 ? 0.5250 0.4713 0.2794 0.0131  0.0141  0.0391  209 ARG F C     
2510 O O     . ARG F 68 ? 0.5065 0.4672 0.2732 0.0084  0.0282  0.0280  209 ARG F O     
2511 C CB    . ARG F 68 ? 0.4983 0.4372 0.2916 0.0384  -0.0048 0.0389  209 ARG F CB    
2512 C CG    . ARG F 68 ? 0.4928 0.4280 0.3025 0.0311  0.0068  0.0310  209 ARG F CG    
2513 C CD    . ARG F 68 ? 0.4615 0.3926 0.2934 0.0433  0.0018  0.0247  209 ARG F CD    
2514 N NE    . ARG F 68 ? 0.4158 0.3752 0.2697 0.0514  0.0007  0.0140  209 ARG F NE    
2515 C CZ    . ARG F 68 ? 0.4007 0.3771 0.2708 0.0461  0.0080  0.0038  209 ARG F CZ    
2516 N NH1   . ARG F 68 ? 0.4020 0.3790 0.2731 0.0348  0.0182  0.0015  209 ARG F NH1   
2517 N NH2   . ARG F 68 ? 0.3645 0.3605 0.2505 0.0519  0.0047  -0.0020 209 ARG F NH2   
2518 N N     . THR F 69 ? 0.5657 0.4946 0.2908 0.0062  0.0104  0.0566  210 THR F N     
2519 C CA    . THR F 69 ? 0.5910 0.5180 0.2955 -0.0120 0.0246  0.0648  210 THR F CA    
2520 C C     . THR F 69 ? 0.6260 0.5701 0.2988 -0.0192 0.0324  0.0621  210 THR F C     
2521 O O     . THR F 69 ? 0.6365 0.5946 0.2962 -0.0326 0.0498  0.0635  210 THR F O     
2522 C CB    . THR F 69 ? 0.6325 0.5249 0.3154 -0.0201 0.0166  0.0887  210 THR F CB    
2523 O OG1   . THR F 69 ? 0.6617 0.5413 0.3201 -0.0110 -0.0004 0.1019  210 THR F OG1   
2524 C CG2   . THR F 69 ? 0.6229 0.4886 0.3278 -0.0155 0.0106  0.0895  210 THR F CG2   
2525 N N     . GLY F 70 ? 0.6343 0.5798 0.2922 -0.0117 0.0195  0.0587  211 GLY F N     
2526 C CA    . GLY F 70 ? 0.6611 0.6159 0.2794 -0.0191 0.0234  0.0549  211 GLY F CA    
2527 C C     . GLY F 70 ? 0.7213 0.6664 0.2987 -0.0320 0.0219  0.0777  211 GLY F C     
2528 O O     . GLY F 70 ? 0.7347 0.6924 0.2776 -0.0424 0.0349  0.0748  211 GLY F O     
2529 N N     . LYS F 71 ? 0.7439 0.6652 0.3221 -0.0297 0.0062  0.1005  212 LYS F N     
2530 C CA    . LYS F 71 ? 0.8078 0.7108 0.3446 -0.0417 0.0004  0.1282  212 LYS F CA    
2531 C C     . LYS F 71 ? 0.8393 0.7302 0.3662 -0.0282 -0.0271 0.1430  212 LYS F C     
2532 O O     . LYS F 71 ? 0.7997 0.6887 0.3615 -0.0092 -0.0397 0.1384  212 LYS F O     
2533 C CB    . LYS F 71 ? 0.8197 0.6952 0.3637 -0.0517 0.0053  0.1457  212 LYS F CB    
2534 C CG    . LYS F 71 ? 0.8003 0.6965 0.3622 -0.0669 0.0305  0.1347  212 LYS F CG    
2535 C CD    . LYS F 71 ? 0.8323 0.7584 0.3604 -0.0859 0.0507  0.1370  212 LYS F CD    
2536 C CE    . LYS F 71 ? 0.8185 0.7713 0.3673 -0.1028 0.0747  0.1343  212 LYS F CE    
2537 N N     . MET F 72 ? 0.9044 0.7940 0.3847 -0.0371 -0.0362 0.1608  213 MET F N     
2538 C CA    . MET F 72 ? 0.9589 0.8375 0.4265 -0.0247 -0.0645 0.1833  213 MET F CA    
2539 C C     . MET F 72 ? 1.0296 0.8638 0.4989 -0.0174 -0.0733 0.2098  213 MET F C     
2540 O O     . MET F 72 ? 1.0712 0.8800 0.5141 -0.0363 -0.0632 0.2262  213 MET F O     
2541 C CB    . MET F 72 ? 1.0077 0.8959 0.4185 -0.0387 -0.0729 0.1974  213 MET F CB    
2542 C CG    . MET F 72 ? 0.9942 0.9157 0.3888 -0.0464 -0.0696 0.1719  213 MET F CG    
2543 S SD    . MET F 72 ? 0.9532 0.9001 0.3837 -0.0303 -0.0938 0.1576  213 MET F SD    
2544 C CE    . MET F 72 ? 0.9716 0.9376 0.3549 -0.0502 -0.0909 0.1326  213 MET F CE    
2545 N N     . MET F 73 ? 1.0692 0.8938 0.5668 0.0095  -0.0925 0.2147  214 MET F N     
2546 C CA    . MET F 73 ? 1.1450 0.9178 0.6382 0.0241  -0.1061 0.2394  214 MET F CA    
2547 C C     . MET F 73 ? 1.2188 0.9729 0.6650 0.0229  -0.1262 0.2737  214 MET F C     
2548 O O     . MET F 73 ? 1.2480 1.0390 0.6792 0.0233  -0.1384 0.2771  214 MET F O     
2549 C CB    . MET F 73 ? 1.1352 0.9107 0.6724 0.0597  -0.1191 0.2310  214 MET F CB    
2550 C CG    . MET F 73 ? 1.0907 0.8839 0.6719 0.0627  -0.1023 0.2002  214 MET F CG    
2551 S SD    . MET F 73 ? 1.1286 0.8855 0.7063 0.0365  -0.0784 0.1924  214 MET F SD    
2552 C CE    . MET F 73 ? 1.0285 0.7894 0.6577 0.0585  -0.0737 0.1658  214 MET F CE    
2553 N N     . PRO F 74 ? 1.2854 0.9788 0.7057 0.0197  -0.1318 0.3005  215 PRO F N     
2554 C CA    . PRO F 74 ? 1.3214 0.9869 0.6931 0.0183  -0.1524 0.3384  215 PRO F CA    
2555 O "O5'" . DC  G 1  ? 0.2856 0.3856 0.3543 0.1019  0.0067  -0.0569 1   DC  G "O5'" 
2556 C "C5'" . DC  G 1  ? 0.2976 0.4036 0.3572 0.1176  -0.0169 -0.0676 1   DC  G "C5'" 
2557 C "C4'" . DC  G 1  ? 0.3049 0.3924 0.3120 0.1197  -0.0240 -0.0576 1   DC  G "C4'" 
2558 O "O4'" . DC  G 1  ? 0.3113 0.3767 0.2830 0.1122  -0.0104 -0.0415 1   DC  G "O4'" 
2559 C "C3'" . DC  G 1  ? 0.3014 0.3905 0.3109 0.1113  -0.0268 -0.0567 1   DC  G "C3'" 
2560 O "O3'" . DC  G 1  ? 0.3291 0.4102 0.3062 0.1272  -0.0409 -0.0575 1   DC  G "O3'" 
2561 C "C2'" . DC  G 1  ? 0.2838 0.3567 0.2721 0.0953  -0.0101 -0.0400 1   DC  G "C2'" 
2562 C "C1'" . DC  G 1  ? 0.2983 0.3543 0.2560 0.1000  -0.0065 -0.0318 1   DC  G "C1'" 
2563 N N1    . DC  G 1  ? 0.2869 0.3266 0.2313 0.0905  0.0054  -0.0237 1   DC  G N1    
2564 C C2    . DC  G 1  ? 0.2973 0.3161 0.2150 0.0870  0.0030  -0.0151 1   DC  G C2    
2565 O O2    . DC  G 1  ? 0.3205 0.3362 0.2321 0.0897  -0.0021 -0.0106 1   DC  G O2    
2566 N N3    . DC  G 1  ? 0.3101 0.3097 0.2106 0.0834  0.0065  -0.0125 1   DC  G N3    
2567 C C4    . DC  G 1  ? 0.3210 0.3181 0.2205 0.0854  0.0187  -0.0138 1   DC  G C4    
2568 N N4    . DC  G 1  ? 0.3450 0.3152 0.2130 0.0887  0.0209  -0.0115 1   DC  G N4    
2569 C C5    . DC  G 1  ? 0.3186 0.3377 0.2520 0.0866  0.0295  -0.0182 1   DC  G C5    
2570 C C6    . DC  G 1  ? 0.2944 0.3362 0.2543 0.0879  0.0190  -0.0252 1   DC  G C6    
2571 P P     . DG  G 2  ? 0.3401 0.4181 0.3069 0.1259  -0.0445 -0.0557 2   DG  G P     
2572 O OP1   . DG  G 2  ? 0.3718 0.4482 0.3223 0.1523  -0.0658 -0.0698 2   DG  G OP1   
2573 O OP2   . DG  G 2  ? 0.3161 0.4047 0.3196 0.1062  -0.0379 -0.0579 2   DG  G OP2   
2574 O "O5'" . DG  G 2  ? 0.3331 0.3903 0.2619 0.1215  -0.0297 -0.0337 2   DG  G "O5'" 
2575 C "C5'" . DG  G 2  ? 0.3703 0.4108 0.2696 0.1340  -0.0247 -0.0239 2   DG  G "C5'" 
2576 C "C4'" . DG  G 2  ? 0.3748 0.3978 0.2570 0.1301  -0.0102 -0.0046 2   DG  G "C4'" 
2577 O "O4'" . DG  G 2  ? 0.3639 0.3840 0.2628 0.1082  -0.0031 0.0023  2   DG  G "O4'" 
2578 C "C3'" . DG  G 2  ? 0.3795 0.4034 0.2575 0.1324  -0.0085 -0.0015 2   DG  G "C3'" 
2579 O "O3'" . DG  G 2  ? 0.4151 0.4188 0.2704 0.1450  0.0076  0.0162  2   DG  G "O3'" 
2580 C "C2'" . DG  G 2  ? 0.3320 0.3648 0.2374 0.1072  -0.0060 0.0001  2   DG  G "C2'" 
2581 C "C1'" . DG  G 2  ? 0.3217 0.3465 0.2338 0.0951  -0.0016 0.0054  2   DG  G "C1'" 
2582 N N9    . DG  G 2  ? 0.2852 0.3149 0.2100 0.0808  -0.0048 -0.0009 2   DG  G N9    
2583 C C8    . DG  G 2  ? 0.2873 0.3295 0.2240 0.0799  -0.0071 -0.0117 2   DG  G C8    
2584 N N7    . DG  G 2  ? 0.2806 0.3170 0.2191 0.0712  -0.0020 -0.0113 2   DG  G N7    
2585 C C5    . DG  G 2  ? 0.2745 0.2937 0.1986 0.0673  -0.0036 -0.0040 2   DG  G C5    
2586 C C6    . DG  G 2  ? 0.2859 0.2869 0.1963 0.0636  -0.0050 -0.0033 2   DG  G C6    
2587 O O6    . DG  G 2  ? 0.2950 0.2881 0.1941 0.0653  0.0011  -0.0051 2   DG  G O6    
2588 N N1    . DG  G 2  ? 0.2791 0.2668 0.1896 0.0610  -0.0141 -0.0004 2   DG  G N1    
2589 C C2    . DG  G 2  ? 0.2872 0.2788 0.2145 0.0604  -0.0131 0.0059  2   DG  G C2    
2590 N N2    . DG  G 2  ? 0.2881 0.2661 0.2306 0.0559  -0.0202 0.0079  2   DG  G N2    
2591 N N3    . DG  G 2  ? 0.2789 0.2831 0.2083 0.0666  -0.0054 0.0097  2   DG  G N3    
2592 C C4    . DG  G 2  ? 0.2849 0.3023 0.2096 0.0706  -0.0047 0.0023  2   DG  G C4    
2593 P P     . DG  G 3  ? 0.4485 0.4452 0.2886 0.1571  0.0169  0.0245  3   DG  G P     
2594 O OP1   . DG  G 3  ? 0.4879 0.4577 0.2963 0.1803  0.0382  0.0434  3   DG  G OP1   
2595 O OP2   . DG  G 3  ? 0.4389 0.4479 0.2734 0.1658  -0.0036 0.0043  3   DG  G OP2   
2596 O "O5'" . DG  G 3  ? 0.3972 0.4018 0.2757 0.1301  0.0262  0.0341  3   DG  G "O5'" 
2597 C "C5'" . DG  G 3  ? 0.3831 0.3778 0.2849 0.1187  0.0411  0.0495  3   DG  G "C5'" 
2598 C "C4'" . DG  G 3  ? 0.3470 0.3529 0.2873 0.0957  0.0367  0.0488  3   DG  G "C4'" 
2599 O "O4'" . DG  G 3  ? 0.3197 0.3355 0.2630 0.0821  0.0178  0.0334  3   DG  G "O4'" 
2600 C "C3'" . DG  G 3  ? 0.3378 0.3517 0.2799 0.0988  0.0397  0.0502  3   DG  G "C3'" 
2601 O "O3'" . DG  G 3  ? 0.3442 0.3607 0.3271 0.0855  0.0457  0.0587  3   DG  G "O3'" 
2602 C "C2'" . DG  G 3  ? 0.3195 0.3474 0.2589 0.0893  0.0196  0.0328  3   DG  G "C2'" 
2603 C "C1'" . DG  G 3  ? 0.3023 0.3287 0.2551 0.0740  0.0113  0.0286  3   DG  G "C1'" 
2604 N N9    . DG  G 3  ? 0.2880 0.3204 0.2347 0.0677  0.0000  0.0157  3   DG  G N9    
2605 C C8    . DG  G 3  ? 0.2762 0.3180 0.2167 0.0730  -0.0046 0.0051  3   DG  G C8    
2606 N N7    . DG  G 3  ? 0.2726 0.3164 0.2192 0.0646  -0.0072 -0.0014 3   DG  G N7    
2607 C C5    . DG  G 3  ? 0.2712 0.3028 0.2148 0.0570  -0.0073 0.0039  3   DG  G C5    
2608 C C6    . DG  G 3  ? 0.2828 0.3033 0.2176 0.0527  -0.0079 0.0016  3   DG  G C6    
2609 O O6    . DG  G 3  ? 0.2724 0.2927 0.2054 0.0528  -0.0014 -0.0018 3   DG  G O6    
2610 N N1    . DG  G 3  ? 0.3061 0.3111 0.2354 0.0507  -0.0159 0.0037  3   DG  G N1    
2611 C C2    . DG  G 3  ? 0.3098 0.3146 0.2572 0.0487  -0.0200 0.0083  3   DG  G C2    
2612 N N2    . DG  G 3  ? 0.3225 0.3119 0.2754 0.0465  -0.0328 0.0054  3   DG  G N2    
2613 N N3    . DG  G 3  ? 0.2935 0.3088 0.2536 0.0513  -0.0114 0.0150  3   DG  G N3    
2614 C C4    . DG  G 3  ? 0.2810 0.3075 0.2308 0.0573  -0.0064 0.0121  3   DG  G C4    
2615 P P     . DA  G 4  ? 0.3719 0.3839 0.3706 0.0960  0.0710  0.0767  4   DA  G P     
2616 O OP1   . DA  G 4  ? 0.4138 0.4058 0.3897 0.1162  0.0951  0.0920  4   DA  G OP1   
2617 O OP2   . DA  G 4  ? 0.3808 0.4021 0.3649 0.1013  0.0657  0.0706  4   DA  G OP2   
2618 O "O5'" . DA  G 4  ? 0.3561 0.3738 0.4219 0.0754  0.0695  0.0804  4   DA  G "O5'" 
2619 C "C5'" . DA  G 4  ? 0.3504 0.3602 0.4472 0.0639  0.0646  0.0797  4   DA  G "C5'" 
2620 C "C4'" . DA  G 4  ? 0.3365 0.3541 0.4697 0.0458  0.0359  0.0643  4   DA  G "C4'" 
2621 O "O4'" . DA  G 4  ? 0.3267 0.3466 0.4149 0.0438  0.0126  0.0479  4   DA  G "O4'" 
2622 C "C3'" . DA  G 4  ? 0.3337 0.3638 0.5141 0.0403  0.0330  0.0649  4   DA  G "C3'" 
2623 O "O3'" . DA  G 4  ? 0.3305 0.3577 0.5612 0.0277  0.0090  0.0530  4   DA  G "O3'" 
2624 C "C2'" . DA  G 4  ? 0.3216 0.3598 0.4560 0.0429  0.0184  0.0545  4   DA  G "C2'" 
2625 C "C1'" . DA  G 4  ? 0.3114 0.3410 0.4024 0.0407  0.0007  0.0415  4   DA  G "C1'" 
2626 N N9    . DA  G 4  ? 0.3030 0.3356 0.3446 0.0459  -0.0014 0.0355  4   DA  G N9    
2627 C C8    . DA  G 4  ? 0.2880 0.3255 0.3048 0.0567  0.0112  0.0391  4   DA  G C8    
2628 N N7    . DA  G 4  ? 0.2916 0.3316 0.2813 0.0574  0.0029  0.0289  4   DA  G N7    
2629 C C5    . DA  G 4  ? 0.2734 0.3073 0.2626 0.0480  -0.0099 0.0219  4   DA  G C5    
2630 C C6    . DA  G 4  ? 0.2817 0.3113 0.2504 0.0459  -0.0157 0.0138  4   DA  G C6    
2631 N N6    . DA  G 4  ? 0.2650 0.3010 0.2252 0.0484  -0.0114 0.0091  4   DA  G N6    
2632 N N1    . DA  G 4  ? 0.2829 0.2982 0.2429 0.0434  -0.0254 0.0102  4   DA  G N1    
2633 C C2    . DA  G 4  ? 0.2921 0.3004 0.2694 0.0415  -0.0362 0.0100  4   DA  G C2    
2634 N N3    . DA  G 4  ? 0.2899 0.3054 0.3027 0.0391  -0.0334 0.0158  4   DA  G N3    
2635 C C4    . DA  G 4  ? 0.2877 0.3154 0.3024 0.0429  -0.0162 0.0241  4   DA  G C4    
2636 P P     . DA  G 5  ? 0.3508 0.3894 0.6558 0.0203  -0.0050 0.0475  5   DA  G P     
2637 O OP1   . DA  G 5  ? 0.3449 0.3762 0.7226 0.0107  -0.0170 0.0410  5   DA  G OP1   
2638 O OP2   . DA  G 5  ? 0.3266 0.3789 0.6479 0.0268  0.0233  0.0639  5   DA  G OP2   
2639 O "O5'" . DA  G 5  ? 0.3405 0.3781 0.6025 0.0214  -0.0414 0.0272  5   DA  G "O5'" 
2640 C "C5'" . DA  G 5  ? 0.3449 0.3649 0.5644 0.0224  -0.0685 0.0107  5   DA  G "C5'" 
2641 C "C4'" . DA  G 5  ? 0.3449 0.3600 0.5150 0.0291  -0.0886 0.0000  5   DA  G "C4'" 
2642 O "O4'" . DA  G 5  ? 0.3150 0.3321 0.4254 0.0327  -0.0692 0.0078  5   DA  G "O4'" 
2643 C "C3'" . DA  G 5  ? 0.3519 0.3788 0.5579 0.0305  -0.0989 -0.0023 5   DA  G "C3'" 
2644 O "O3'" . DA  G 5  ? 0.4089 0.4175 0.6089 0.0371  -0.1383 -0.0226 5   DA  G "O3'" 
2645 C "C2'" . DA  G 5  ? 0.3244 0.3571 0.4801 0.0350  -0.0813 0.0064  5   DA  G "C2'" 
2646 C "C1'" . DA  G 5  ? 0.3172 0.3376 0.4100 0.0367  -0.0732 0.0067  5   DA  G "C1'" 
2647 N N9    . DA  G 5  ? 0.2703 0.2997 0.3343 0.0381  -0.0495 0.0160  5   DA  G N9    
2648 C C8    . DA  G 5  ? 0.2637 0.3067 0.3430 0.0396  -0.0270 0.0275  5   DA  G C8    
2649 N N7    . DA  G 5  ? 0.2448 0.2899 0.2891 0.0444  -0.0168 0.0284  5   DA  G N7    
2650 C C5    . DA  G 5  ? 0.2453 0.2804 0.2592 0.0425  -0.0283 0.0197  5   DA  G C5    
2651 C C6    . DA  G 5  ? 0.2573 0.2903 0.2428 0.0440  -0.0236 0.0160  5   DA  G C6    
2652 N N6    . DA  G 5  ? 0.2594 0.3014 0.2410 0.0483  -0.0142 0.0158  5   DA  G N6    
2653 N N1    . DA  G 5  ? 0.2669 0.2850 0.2300 0.0435  -0.0289 0.0118  5   DA  G N1    
2654 C C2    . DA  G 5  ? 0.2954 0.2982 0.2517 0.0455  -0.0430 0.0090  5   DA  G C2    
2655 N N3    . DA  G 5  ? 0.2919 0.2958 0.2743 0.0446  -0.0567 0.0070  5   DA  G N3    
2656 C C4    . DA  G 5  ? 0.2760 0.2987 0.2936 0.0409  -0.0463 0.0136  5   DA  G C4    
2657 P P     . DT  G 6  ? 0.4553 0.4619 0.6692 0.0465  -0.1693 -0.0358 6   DT  G P     
2658 O OP1   . DT  G 6  ? 0.4520 0.4362 0.6735 0.0553  -0.2125 -0.0594 6   DT  G OP1   
2659 O OP2   . DT  G 6  ? 0.4350 0.4705 0.7197 0.0398  -0.1529 -0.0253 6   DT  G OP2   
2660 O "O5'" . DT  G 6  ? 0.4411 0.4322 0.5639 0.0574  -0.1628 -0.0318 6   DT  G "O5'" 
2661 C "C5'" . DT  G 6  ? 0.4521 0.4111 0.4995 0.0696  -0.1732 -0.0390 6   DT  G "C5'" 
2662 C "C4'" . DT  G 6  ? 0.4445 0.3928 0.4269 0.0767  -0.1544 -0.0290 6   DT  G "C4'" 
2663 O "O4'" . DT  G 6  ? 0.3962 0.3688 0.3893 0.0628  -0.1191 -0.0134 6   DT  G "O4'" 
2664 C "C3'" . DT  G 6  ? 0.4455 0.3874 0.4198 0.0880  -0.1680 -0.0314 6   DT  G "C3'" 
2665 O "O3'" . DT  G 6  ? 0.4784 0.3793 0.3736 0.1093  -0.1767 -0.0349 6   DT  G "O3'" 
2666 C "C2'" . DT  G 6  ? 0.3970 0.3646 0.3883 0.0759  -0.1363 -0.0158 6   DT  G "C2'" 
2667 C "C1'" . DT  G 6  ? 0.3847 0.3564 0.3561 0.0666  -0.1091 -0.0072 6   DT  G "C1'" 
2668 N N1    . DT  G 6  ? 0.3437 0.3417 0.3386 0.0555  -0.0825 0.0035  6   DT  G N1    
2669 C C2    . DT  G 6  ? 0.3429 0.3380 0.3072 0.0540  -0.0629 0.0086  6   DT  G C2    
2670 O O2    . DT  G 6  ? 0.3582 0.3320 0.2832 0.0594  -0.0596 0.0083  6   DT  G O2    
2671 N N3    . DT  G 6  ? 0.3132 0.3287 0.2965 0.0488  -0.0465 0.0136  6   DT  G N3    
2672 C C4    . DT  G 6  ? 0.2888 0.3228 0.3078 0.0476  -0.0415 0.0179  6   DT  G C4    
2673 O O4    . DT  G 6  ? 0.2881 0.3320 0.3069 0.0495  -0.0268 0.0217  6   DT  G O4    
2674 C C5    . DT  G 6  ? 0.2949 0.3324 0.3517 0.0470  -0.0546 0.0167  6   DT  G C5    
2675 C C7    . DT  G 6  ? 0.3037 0.3594 0.4100 0.0464  -0.0415 0.0252  6   DT  G C7    
2676 C C6    . DT  G 6  ? 0.3170 0.3382 0.3646 0.0498  -0.0775 0.0075  6   DT  G C6    
2677 P P     . DG  G 7  ? 0.5396 0.4175 0.3905 0.1275  -0.1806 -0.0320 7   DG  G P     
2678 O OP1   . DG  G 7  ? 0.5880 0.4186 0.3729 0.1574  -0.2088 -0.0441 7   DG  G OP1   
2679 O OP2   . DG  G 7  ? 0.4998 0.4076 0.4122 0.1197  -0.1880 -0.0326 7   DG  G OP2   
2680 O "O5'" . DG  G 7  ? 0.5308 0.4046 0.3450 0.1209  -0.1365 -0.0127 7   DG  G "O5'" 
2681 C "C5'" . DG  G 7  ? 0.5506 0.4041 0.3202 0.1242  -0.1157 -0.0068 7   DG  G "C5'" 
2682 C "C4'" . DG  G 7  ? 0.5509 0.3967 0.2987 0.1213  -0.0775 0.0094  7   DG  G "C4'" 
2683 O "O4'" . DG  G 7  ? 0.4771 0.3638 0.2816 0.0974  -0.0606 0.0138  7   DG  G "O4'" 
2684 C "C3'" . DG  G 7  ? 0.5977 0.4126 0.3063 0.1387  -0.0743 0.0163  7   DG  G "C3'" 
2685 O "O3'" . DG  G 7  ? 0.6411 0.4292 0.3139 0.1441  -0.0363 0.0319  7   DG  G "O3'" 
2686 C "C2'" . DG  G 7  ? 0.5340 0.3845 0.2988 0.1217  -0.0750 0.0167  7   DG  G "C2'" 
2687 C "C1'" . DG  G 7  ? 0.4718 0.3598 0.2840 0.0973  -0.0557 0.0187  7   DG  G "C1'" 
2688 N N9    . DG  G 7  ? 0.4015 0.3288 0.2700 0.0826  -0.0621 0.0149  7   DG  G N9    
2689 C C8    . DG  G 7  ? 0.3932 0.3389 0.2966 0.0811  -0.0842 0.0075  7   DG  G C8    
2690 N N7    . DG  G 7  ? 0.3481 0.3245 0.2956 0.0698  -0.0759 0.0098  7   DG  G N7    
2691 C C5    . DG  G 7  ? 0.3222 0.3003 0.2596 0.0646  -0.0538 0.0151  7   DG  G C5    
2692 C C6    . DG  G 7  ? 0.2856 0.2853 0.2468 0.0581  -0.0409 0.0166  7   DG  G C6    
2693 O O6    . DG  G 7  ? 0.2608 0.2803 0.2503 0.0573  -0.0401 0.0176  7   DG  G O6    
2694 N N1    . DG  G 7  ? 0.2786 0.2709 0.2282 0.0555  -0.0269 0.0167  7   DG  G N1    
2695 C C2    . DG  G 7  ? 0.3129 0.2814 0.2380 0.0569  -0.0182 0.0195  7   DG  G C2    
2696 N N2    . DG  G 7  ? 0.3010 0.2681 0.2370 0.0518  -0.0031 0.0187  7   DG  G N2    
2697 N N3    . DG  G 7  ? 0.3504 0.2954 0.2438 0.0655  -0.0234 0.0224  7   DG  G N3    
2698 C C4    . DG  G 7  ? 0.3521 0.3029 0.2502 0.0698  -0.0448 0.0181  7   DG  G C4    
2699 P P     . DT  G 8  ? 0.7707 0.5108 0.3874 0.1673  -0.0198 0.0454  8   DT  G P     
2700 O OP1   . DT  G 8  ? 0.8338 0.5353 0.4039 0.1808  0.0185  0.0609  8   DT  G OP1   
2701 O OP2   . DT  G 8  ? 0.7866 0.5056 0.3693 0.1907  -0.0589 0.0347  8   DT  G OP2   
2702 O "O5'" . DT  G 8  ? 0.7313 0.4981 0.4024 0.1454  -0.0005 0.0523  8   DT  G "O5'" 
2703 C "C5'" . DT  G 8  ? 0.7118 0.5078 0.4365 0.1207  0.0270  0.0561  8   DT  G "C5'" 
2704 C "C4'" . DT  G 8  ? 0.6906 0.5025 0.4567 0.1077  0.0335  0.0574  8   DT  G "C4'" 
2705 O "O4'" . DT  G 8  ? 0.6146 0.4709 0.4258 0.0931  0.0086  0.0441  8   DT  G "O4'" 
2706 C "C3'" . DT  G 8  ? 0.7416 0.5179 0.4698 0.1263  0.0318  0.0649  8   DT  G "C3'" 
2707 O "O3'" . DT  G 8  ? 0.8039 0.5763 0.5623 0.1165  0.0569  0.0726  8   DT  G "O3'" 
2708 C "C2'" . DT  G 8  ? 0.7044 0.5093 0.4530 0.1244  -0.0050 0.0515  8   DT  G "C2'" 
2709 C "C1'" . DT  G 8  ? 0.5997 0.4529 0.4119 0.0986  -0.0026 0.0438  8   DT  G "C1'" 
2710 N N1    . DT  G 8  ? 0.5276 0.4179 0.3746 0.0918  -0.0274 0.0330  8   DT  G N1    
2711 C C2    . DT  G 8  ? 0.4573 0.3793 0.3476 0.0773  -0.0220 0.0287  8   DT  G C2    
2712 O O2    . DT  G 8  ? 0.4502 0.3726 0.3551 0.0692  -0.0049 0.0292  8   DT  G O2    
2713 N N3    . DT  G 8  ? 0.4051 0.3555 0.3231 0.0751  -0.0373 0.0232  8   DT  G N3    
2714 C C4    . DT  G 8  ? 0.4235 0.3785 0.3468 0.0817  -0.0581 0.0200  8   DT  G C4    
2715 O O4    . DT  G 8  ? 0.3760 0.3578 0.3375 0.0781  -0.0637 0.0176  8   DT  G O4    
2716 C C5    . DT  G 8  ? 0.4643 0.3874 0.3468 0.0960  -0.0713 0.0194  8   DT  G C5    
2717 C C7    . DT  G 8  ? 0.4793 0.4043 0.3727 0.1058  -0.1025 0.0099  8   DT  G C7    
2718 C C6    . DT  G 8  ? 0.5077 0.3982 0.3467 0.1023  -0.0545 0.0267  8   DT  G C6    
2719 P P     . DA  G 9  ? 0.8494 0.5651 0.5687 0.1336  0.0939  0.0935  9   DA  G P     
2720 O OP1   . DA  G 9  ? 0.8780 0.5695 0.5679 0.1429  0.1203  0.1043  9   DA  G OP1   
2721 O OP2   . DA  G 9  ? 0.8662 0.5499 0.5338 0.1573  0.0772  0.0969  9   DA  G OP2   
2722 O "O5'" . DA  G 9  ? 0.8038 0.5359 0.5960 0.1100  0.1173  0.0941  9   DA  G "O5'" 
2723 C "C5'" . DA  G 9  ? 0.7297 0.4969 0.5865 0.0873  0.1267  0.0857  9   DA  G "C5'" 
2724 C "C4'" . DA  G 9  ? 0.6779 0.4732 0.6011 0.0685  0.1181  0.0723  9   DA  G "C4'" 
2725 O "O4'" . DA  G 9  ? 0.6173 0.4466 0.5395 0.0663  0.0806  0.0565  9   DA  G "O4'" 
2726 C "C3'" . DA  G 9  ? 0.7002 0.4621 0.6277 0.0728  0.1351  0.0819  9   DA  G "C3'" 
2727 O "O3'" . DA  G 9  ? 0.6738 0.4515 0.6812 0.0534  0.1437  0.0714  9   DA  G "O3'" 
2728 C "C2'" . DA  G 9  ? 0.6809 0.4483 0.5740 0.0829  0.1028  0.0755  9   DA  G "C2'" 
2729 C "C1'" . DA  G 9  ? 0.6057 0.4241 0.5216 0.0721  0.0719  0.0564  9   DA  G "C1'" 
2730 N N9    . DA  G 9  ? 0.5684 0.3997 0.4517 0.0826  0.0430  0.0523  9   DA  G N9    
2731 C C8    . DA  G 9  ? 0.5917 0.4014 0.4221 0.1010  0.0331  0.0592  9   DA  G C8    
2732 N N7    . DA  G 9  ? 0.5562 0.3901 0.3885 0.1043  0.0042  0.0499  9   DA  G N7    
2733 C C5    . DA  G 9  ? 0.4975 0.3685 0.3779 0.0890  0.0002  0.0399  9   DA  G C5    
2734 C C6    . DA  G 9  ? 0.4632 0.3686 0.3686 0.0868  -0.0179 0.0310  9   DA  G C6    
2735 N N6    . DA  G 9  ? 0.4602 0.3744 0.3623 0.0955  -0.0376 0.0295  9   DA  G N6    
2736 N N1    . DA  G 9  ? 0.4271 0.3551 0.3639 0.0779  -0.0147 0.0233  9   DA  G N1    
2737 C C2    . DA  G 9  ? 0.4285 0.3485 0.3797 0.0698  -0.0013 0.0201  9   DA  G C2    
2738 N N3    . DA  G 9  ? 0.4689 0.3628 0.4162 0.0666  0.0166  0.0269  9   DA  G N3    
2739 C C4    . DA  G 9  ? 0.5045 0.3732 0.4116 0.0772  0.0200  0.0391  9   DA  G C4    
2740 P P     . DG  G 10 ? 0.7402 0.4854 0.7792 0.0516  0.1651  0.0784  10  DG  G P     
2741 O OP1   . DG  G 10 ? 0.7158 0.4690 0.8456 0.0328  0.1858  0.0718  10  DG  G OP1   
2742 O OP2   . DG  G 10 ? 0.7629 0.4543 0.7306 0.0743  0.1885  0.1044  10  DG  G OP2   
2743 O "O5'" . DG  G 10 ? 0.6728 0.4420 0.7188 0.0495  0.1266  0.0580  10  DG  G "O5'" 
2744 C "C5'" . DG  G 10 ? 0.6033 0.4151 0.6971 0.0371  0.0988  0.0318  10  DG  G "C5'" 
2745 C "C4'" . DG  G 10 ? 0.5803 0.4033 0.6563 0.0443  0.0695  0.0195  10  DG  G "C4'" 
2746 O "O4'" . DG  G 10 ? 0.5685 0.4011 0.5850 0.0566  0.0552  0.0266  10  DG  G "O4'" 
2747 C "C3'" . DG  G 10 ? 0.6112 0.4004 0.6893 0.0494  0.0778  0.0247  10  DG  G "C3'" 
2748 O "O3'" . DG  G 10 ? 0.5965 0.4046 0.7005 0.0486  0.0511  0.0012  10  DG  G "O3'" 
2749 C "C2'" . DG  G 10 ? 0.6185 0.3922 0.6256 0.0673  0.0749  0.0411  10  DG  G "C2'" 
2750 C "C1'" . DG  G 10 ? 0.5773 0.3920 0.5668 0.0687  0.0493  0.0315  10  DG  G "C1'" 
2751 N N9    . DG  G 10 ? 0.5807 0.3915 0.5167 0.0827  0.0418  0.0428  10  DG  G N9    
2752 C C8    . DG  G 10 ? 0.6274 0.4026 0.5179 0.0954  0.0559  0.0604  10  DG  G C8    
2753 N N7    . DG  G 10 ? 0.6250 0.4049 0.4768 0.1092  0.0355  0.0612  10  DG  G N7    
2754 C C5    . DG  G 10 ? 0.5648 0.3876 0.4460 0.1026  0.0127  0.0466  10  DG  G C5    
2755 C C6    . DG  G 10 ? 0.5396 0.3866 0.4161 0.1101  -0.0119 0.0414  10  DG  G C6    
2756 O O6    . DG  G 10 ? 0.5521 0.3897 0.4002 0.1238  -0.0263 0.0441  10  DG  G O6    
2757 N N1    . DG  G 10 ? 0.4913 0.3749 0.4042 0.1026  -0.0199 0.0308  10  DG  G N1    
2758 C C2    . DG  G 10 ? 0.4733 0.3654 0.4121 0.0932  -0.0121 0.0228  10  DG  G C2    
2759 N N2    . DG  G 10 ? 0.4416 0.3619 0.3985 0.0946  -0.0204 0.0141  10  DG  G N2    
2760 N N3    . DG  G 10 ? 0.5046 0.3762 0.4533 0.0856  0.0028  0.0226  10  DG  G N3    
2761 C C4    . DG  G 10 ? 0.5445 0.3836 0.4685 0.0889  0.0174  0.0363  10  DG  G C4    
2762 P P     . DG  G 11 ? 0.6176 0.3993 0.7500 0.0497  0.0506  -0.0063 11  DG  G P     
2763 O OP1   . DG  G 11 ? 0.6409 0.4253 0.8519 0.0353  0.0486  -0.0265 11  DG  G OP1   
2764 O OP2   . DG  G 11 ? 0.6599 0.3997 0.7589 0.0580  0.0755  0.0188  11  DG  G OP2   
2765 O "O5'" . DG  G 11 ? 0.6033 0.4077 0.7079 0.0629  0.0179  -0.0232 11  DG  G "O5'" 
2766 C "C5'" . DG  G 11 ? 0.5372 0.3790 0.6348 0.0656  -0.0030 -0.0377 11  DG  G "C5'" 
2767 C "C4'" . DG  G 11 ? 0.5149 0.3698 0.5718 0.0830  -0.0191 -0.0402 11  DG  G "C4'" 
2768 O "O4'" . DG  G 11 ? 0.4893 0.3515 0.5089 0.0872  -0.0117 -0.0197 11  DG  G "O4'" 
2769 C "C3'" . DG  G 11 ? 0.5480 0.3807 0.6015 0.0941  -0.0247 -0.0459 11  DG  G "C3'" 
2770 O "O3'" . DG  G 11 ? 0.5576 0.4061 0.5937 0.1109  -0.0436 -0.0617 11  DG  G "O3'" 
2771 C "C2'" . DG  G 11 ? 0.5464 0.3658 0.5667 0.0998  -0.0118 -0.0223 11  DG  G "C2'" 
2772 C "C1'" . DG  G 11 ? 0.5087 0.3559 0.5064 0.0996  -0.0121 -0.0117 11  DG  G "C1'" 
2773 N N9    . DG  G 11 ? 0.5296 0.3626 0.5014 0.1010  -0.0016 0.0083  11  DG  G N9    
2774 C C8    . DG  G 11 ? 0.5536 0.3537 0.5208 0.0963  0.0177  0.0213  11  DG  G C8    
2775 N N7    . DG  G 11 ? 0.5656 0.3535 0.4934 0.1063  0.0201  0.0366  11  DG  G N7    
2776 C C5    . DG  G 11 ? 0.5385 0.3579 0.4581 0.1139  -0.0009 0.0314  11  DG  G C5    
2777 C C6    . DG  G 11 ? 0.5439 0.3681 0.4367 0.1263  -0.0141 0.0377  11  DG  G C6    
2778 O O6    . DG  G 11 ? 0.5710 0.3678 0.4272 0.1373  -0.0133 0.0481  11  DG  G O6    
2779 N N1    . DG  G 11 ? 0.5115 0.3736 0.4247 0.1286  -0.0301 0.0298  11  DG  G N1    
2780 C C2    . DG  G 11 ? 0.4944 0.3809 0.4341 0.1244  -0.0297 0.0200  11  DG  G C2    
2781 N N2    . DG  G 11 ? 0.4767 0.3938 0.4327 0.1306  -0.0378 0.0180  11  DG  G N2    
2782 N N3    . DG  G 11 ? 0.4910 0.3690 0.4418 0.1175  -0.0222 0.0119  11  DG  G N3    
2783 C C4    . DG  G 11 ? 0.5117 0.3588 0.4584 0.1105  -0.0099 0.0168  11  DG  G C4    
2784 P P     . DC  G 12 ? 0.5997 0.4274 0.6315 0.1274  -0.0560 -0.0771 12  DC  G P     
2785 O OP1   . DC  G 12 ? 0.6643 0.5040 0.6783 0.1463  -0.0752 -0.0979 12  DC  G OP1   
2786 O OP2   . DC  G 12 ? 0.6074 0.4029 0.6790 0.1161  -0.0527 -0.0832 12  DC  G OP2   
2787 O "O5'" . DC  G 12 ? 0.6250 0.4552 0.6217 0.1403  -0.0471 -0.0574 12  DC  G "O5'" 
2788 C "C5'" . DC  G 12 ? 0.5930 0.4531 0.5658 0.1507  -0.0455 -0.0486 12  DC  G "C5'" 
2789 C "C4'" . DC  G 12 ? 0.5773 0.4406 0.5392 0.1557  -0.0375 -0.0291 12  DC  G "C4'" 
2790 O "O4'" . DC  G 12 ? 0.5370 0.3957 0.5011 0.1410  -0.0308 -0.0148 12  DC  G "O4'" 
2791 C "C3'" . DC  G 12 ? 0.6014 0.4388 0.5577 0.1671  -0.0385 -0.0292 12  DC  G "C3'" 
2792 O "O3'" . DC  G 12 ? 0.6527 0.4947 0.5971 0.1890  -0.0424 -0.0378 12  DC  G "O3'" 
2793 C "C2'" . DC  G 12 ? 0.5772 0.4145 0.5261 0.1671  -0.0339 -0.0099 12  DC  G "C2'" 
2794 C "C1'" . DC  G 12 ? 0.5362 0.3883 0.4878 0.1514  -0.0307 -0.0023 12  DC  G "C1'" 
2795 N N1    . DC  G 12 ? 0.5308 0.3554 0.4705 0.1447  -0.0238 0.0097  12  DC  G N1    
2796 C C2    . DC  G 12 ? 0.5214 0.3501 0.4436 0.1505  -0.0285 0.0216  12  DC  G C2    
2797 O O2    . DC  G 12 ? 0.5069 0.3669 0.4390 0.1567  -0.0388 0.0206  12  DC  G O2    
2798 N N3    . DC  G 12 ? 0.5367 0.3318 0.4327 0.1521  -0.0214 0.0334  12  DC  G N3    
2799 C C4    . DC  G 12 ? 0.5694 0.3298 0.4651 0.1450  -0.0032 0.0373  12  DC  G C4    
2800 N N4    . DC  G 12 ? 0.6113 0.3334 0.4746 0.1511  0.0106  0.0532  12  DC  G N4    
2801 C C5    . DC  G 12 ? 0.5702 0.3303 0.5003 0.1342  0.0015  0.0245  12  DC  G C5    
2802 C C6    . DC  G 12 ? 0.5413 0.3329 0.4881 0.1359  -0.0125 0.0092  12  DC  G C6    
2803 O "O5'" . DG  H 1  ? 0.7500 0.6416 0.8684 0.3260  -0.2439 0.0156  1   DG  H "O5'" 
2804 C "C5'" . DG  H 1  ? 0.7099 0.6124 0.8131 0.2989  -0.2274 0.0159  1   DG  H "C5'" 
2805 C "C4'" . DG  H 1  ? 0.6434 0.5952 0.8201 0.2684  -0.2082 -0.0007 1   DG  H "C4'" 
2806 O "O4'" . DG  H 1  ? 0.6075 0.5473 0.7778 0.2481  -0.1698 0.0091  1   DG  H "O4'" 
2807 C "C3'" . DG  H 1  ? 0.6129 0.5912 0.7989 0.2484  -0.2085 -0.0101 1   DG  H "C3'" 
2808 O "O3'" . DG  H 1  ? 0.6022 0.6271 0.8697 0.2326  -0.1982 -0.0267 1   DG  H "O3'" 
2809 C "C2'" . DG  H 1  ? 0.5895 0.5434 0.7241 0.2280  -0.1758 0.0071  1   DG  H "C2'" 
2810 C "C1'" . DG  H 1  ? 0.5650 0.5103 0.7160 0.2229  -0.1506 0.0119  1   DG  H "C1'" 
2811 N N9    . DG  H 1  ? 0.5587 0.4643 0.6635 0.2164  -0.1278 0.0296  1   DG  H N9    
2812 C C8    . DG  H 1  ? 0.5920 0.4539 0.6382 0.2286  -0.1277 0.0498  1   DG  H C8    
2813 N N7    . DG  H 1  ? 0.5893 0.4245 0.6229 0.2163  -0.1002 0.0620  1   DG  H N7    
2814 C C5    . DG  H 1  ? 0.5421 0.4048 0.6222 0.1973  -0.0877 0.0454  1   DG  H C5    
2815 C C6    . DG  H 1  ? 0.5194 0.3721 0.6134 0.1808  -0.0650 0.0425  1   DG  H C6    
2816 O O6    . DG  H 1  ? 0.5242 0.3442 0.6059 0.1752  -0.0488 0.0546  1   DG  H O6    
2817 N N1    . DG  H 1  ? 0.4821 0.3670 0.6117 0.1724  -0.0617 0.0218  1   DG  H N1    
2818 C C2    . DG  H 1  ? 0.4635 0.3851 0.6184 0.1769  -0.0707 0.0100  1   DG  H C2    
2819 N N2    . DG  H 1  ? 0.4435 0.3868 0.6231 0.1719  -0.0584 -0.0055 1   DG  H N2    
2820 N N3    . DG  H 1  ? 0.4755 0.4100 0.6342 0.1879  -0.0901 0.0121  1   DG  H N3    
2821 C C4    . DG  H 1  ? 0.5227 0.4267 0.6405 0.1985  -0.1013 0.0280  1   DG  H C4    
2822 P P     . DC  H 2  ? 0.6260 0.6851 0.9324 0.2125  -0.1969 -0.0391 2   DC  H P     
2823 O OP1   . DC  H 2  ? 0.5996 0.6993 0.9999 0.2192  -0.2154 -0.0605 2   DC  H OP1   
2824 O OP2   . DC  H 2  ? 0.6617 0.6975 0.9029 0.2127  -0.2103 -0.0336 2   DC  H OP2   
2825 O "O5'" . DC  H 2  ? 0.5560 0.6239 0.8683 0.1868  -0.1510 -0.0317 2   DC  H "O5'" 
2826 C "C5'" . DC  H 2  ? 0.5609 0.6430 0.9151 0.1876  -0.1282 -0.0342 2   DC  H "C5'" 
2827 C "C4'" . DC  H 2  ? 0.5356 0.6115 0.8623 0.1712  -0.0911 -0.0268 2   DC  H "C4'" 
2828 O "O4'" . DC  H 2  ? 0.5309 0.5697 0.7903 0.1699  -0.0903 -0.0159 2   DC  H "O4'" 
2829 C "C3'" . DC  H 2  ? 0.5141 0.6059 0.8455 0.1528  -0.0761 -0.0262 2   DC  H "C3'" 
2830 O "O3'" . DC  H 2  ? 0.5186 0.6280 0.8807 0.1492  -0.0419 -0.0273 2   DC  H "O3'" 
2831 C "C2'" . DC  H 2  ? 0.5089 0.5721 0.7685 0.1435  -0.0753 -0.0161 2   DC  H "C2'" 
2832 C "C1'" . DC  H 2  ? 0.5031 0.5390 0.7321 0.1523  -0.0728 -0.0117 2   DC  H "C1'" 
2833 N N1    . DC  H 2  ? 0.4812 0.4832 0.6553 0.1505  -0.0785 -0.0006 2   DC  H N1    
2834 C C2    . DC  H 2  ? 0.4409 0.4243 0.5919 0.1431  -0.0613 0.0015  2   DC  H C2    
2835 O O2    . DC  H 2  ? 0.4260 0.4204 0.5912 0.1409  -0.0460 -0.0077 2   DC  H O2    
2836 N N3    . DC  H 2  ? 0.4522 0.4047 0.5685 0.1408  -0.0612 0.0126  2   DC  H N3    
2837 C C4    . DC  H 2  ? 0.4975 0.4334 0.5874 0.1493  -0.0746 0.0243  2   DC  H C4    
2838 N N4    . DC  H 2  ? 0.5355 0.4379 0.5915 0.1485  -0.0658 0.0389  2   DC  H N4    
2839 C C5    . DC  H 2  ? 0.5034 0.4552 0.6026 0.1612  -0.0974 0.0201  2   DC  H C5    
2840 C C6    . DC  H 2  ? 0.4944 0.4809 0.6432 0.1598  -0.1002 0.0061  2   DC  H C6    
2841 P P     . DC  H 3  ? 0.5382 0.6641 0.9174 0.1347  -0.0167 -0.0238 3   DC  H P     
2842 O OP1   . DC  H 3  ? 0.4995 0.6535 0.9560 0.1391  0.0067  -0.0271 3   DC  H OP1   
2843 O OP2   . DC  H 3  ? 0.4859 0.6082 0.8499 0.1238  -0.0390 -0.0235 3   DC  H OP2   
2844 O "O5'" . DC  H 3  ? 0.4855 0.5906 0.7982 0.1324  0.0070  -0.0168 3   DC  H "O5'" 
2845 C "C5'" . DC  H 3  ? 0.4806 0.5720 0.7693 0.1447  0.0164  -0.0203 3   DC  H "C5'" 
2846 C "C4'" . DC  H 3  ? 0.4703 0.5401 0.6952 0.1412  0.0227  -0.0195 3   DC  H "C4'" 
2847 O "O4'" . DC  H 3  ? 0.4359 0.4861 0.6310 0.1335  -0.0014 -0.0180 3   DC  H "O4'" 
2848 C "C3'" . DC  H 3  ? 0.4693 0.5444 0.6771 0.1334  0.0404  -0.0129 3   DC  H "C3'" 
2849 O "O3'" . DC  H 3  ? 0.5353 0.6003 0.7070 0.1470  0.0614  -0.0168 3   DC  H "O3'" 
2850 C "C2'" . DC  H 3  ? 0.4285 0.4921 0.6061 0.1191  0.0193  -0.0100 3   DC  H "C2'" 
2851 C "C1'" . DC  H 3  ? 0.4274 0.4716 0.5884 0.1220  0.0004  -0.0143 3   DC  H "C1'" 
2852 N N1    . DC  H 3  ? 0.4073 0.4401 0.5560 0.1137  -0.0200 -0.0081 3   DC  H N1    
2853 C C2    . DC  H 3  ? 0.4080 0.4180 0.5250 0.1090  -0.0242 -0.0067 3   DC  H C2    
2854 O O2    . DC  H 3  ? 0.4171 0.4202 0.5227 0.1104  -0.0165 -0.0149 3   DC  H O2    
2855 N N3    . DC  H 3  ? 0.4114 0.4066 0.5127 0.1052  -0.0357 0.0025  3   DC  H N3    
2856 C C4    . DC  H 3  ? 0.4120 0.4132 0.5194 0.1089  -0.0492 0.0067  3   DC  H C4    
2857 N N4    . DC  H 3  ? 0.4458 0.4272 0.5240 0.1108  -0.0591 0.0160  3   DC  H N4    
2858 C C5    . DC  H 3  ? 0.4129 0.4400 0.5596 0.1127  -0.0527 0.0002  3   DC  H C5    
2859 C C6    . DC  H 3  ? 0.3985 0.4410 0.5693 0.1135  -0.0348 -0.0052 3   DC  H C6    
2860 P P     . DT  H 4  ? 0.5826 0.6430 0.7157 0.1496  0.0822  -0.0105 4   DT  H P     
2861 O OP1   . DT  H 4  ? 0.6149 0.6715 0.7323 0.1731  0.1134  -0.0111 4   DT  H OP1   
2862 O OP2   . DT  H 4  ? 0.5045 0.5772 0.6647 0.1329  0.0838  0.0011  4   DT  H OP2   
2863 O "O5'" . DT  H 4  ? 0.5453 0.5858 0.6263 0.1477  0.0598  -0.0209 4   DT  H "O5'" 
2864 C "C5'" . DT  H 4  ? 0.5253 0.5515 0.5927 0.1578  0.0473  -0.0368 4   DT  H "C5'" 
2865 C "C4'" . DT  H 4  ? 0.5115 0.5228 0.5483 0.1526  0.0274  -0.0475 4   DT  H "C4'" 
2866 O "O4'" . DT  H 4  ? 0.4535 0.4652 0.5095 0.1313  0.0120  -0.0390 4   DT  H "O4'" 
2867 C "C3'" . DT  H 4  ? 0.5157 0.5241 0.5097 0.1600  0.0333  -0.0488 4   DT  H "C3'" 
2868 O "O3'" . DT  H 4  ? 0.5520 0.5448 0.5195 0.1734  0.0164  -0.0724 4   DT  H "O3'" 
2869 C "C2'" . DT  H 4  ? 0.4747 0.4904 0.4798 0.1379  0.0267  -0.0357 4   DT  H "C2'" 
2870 C "C1'" . DT  H 4  ? 0.4443 0.4567 0.4803 0.1224  0.0092  -0.0357 4   DT  H "C1'" 
2871 N N1    . DT  H 4  ? 0.3922 0.4113 0.4467 0.1057  0.0049  -0.0208 4   DT  H N1    
2872 C C2    . DT  H 4  ? 0.3615 0.3690 0.4178 0.0949  -0.0080 -0.0191 4   DT  H C2    
2873 O O2    . DT  H 4  ? 0.3709 0.3658 0.4253 0.0944  -0.0142 -0.0285 4   DT  H O2    
2874 N N3    . DT  H 4  ? 0.3490 0.3587 0.4115 0.0864  -0.0126 -0.0067 4   DT  H N3    
2875 C C4    . DT  H 4  ? 0.3499 0.3745 0.4271 0.0858  -0.0112 -0.0008 4   DT  H C4    
2876 O O4    . DT  H 4  ? 0.3711 0.3941 0.4495 0.0814  -0.0218 0.0050  4   DT  H O4    
2877 C C5    . DT  H 4  ? 0.3558 0.3947 0.4472 0.0930  0.0043  -0.0030 4   DT  H C5    
2878 C C7    . DT  H 4  ? 0.3457 0.4023 0.4732 0.0906  0.0095  0.0019  4   DT  H C7    
2879 C C6    . DT  H 4  ? 0.3750 0.4090 0.4498 0.1038  0.0141  -0.0106 4   DT  H C6    
2880 P P     . DA  H 5  ? 0.5933 0.5771 0.5063 0.1932  0.0117  -0.0847 5   DA  H P     
2881 O OP1   . DA  H 5  ? 0.6447 0.6132 0.5411 0.2130  -0.0086 -0.1158 5   DA  H OP1   
2882 O OP2   . DA  H 5  ? 0.6316 0.6177 0.5129 0.2071  0.0417  -0.0656 5   DA  H OP2   
2883 O "O5'" . DA  H 5  ? 0.5341 0.5230 0.4612 0.1707  -0.0050 -0.0818 5   DA  H "O5'" 
2884 C "C5'" . DA  H 5  ? 0.4932 0.4782 0.4545 0.1555  -0.0281 -0.0958 5   DA  H "C5'" 
2885 C "C4'" . DA  H 5  ? 0.4453 0.4375 0.4204 0.1349  -0.0321 -0.0847 5   DA  H "C4'" 
2886 O "O4'" . DA  H 5  ? 0.4068 0.4068 0.3985 0.1180  -0.0176 -0.0596 5   DA  H "O4'" 
2887 C "C3'" . DA  H 5  ? 0.4488 0.4443 0.3865 0.1455  -0.0326 -0.0847 5   DA  H "C3'" 
2888 O "O3'" . DA  H 5  ? 0.4594 0.4519 0.4056 0.1491  -0.0579 -0.1095 5   DA  H "O3'" 
2889 C "C2'" . DA  H 5  ? 0.4050 0.4101 0.3530 0.1257  -0.0190 -0.0592 5   DA  H "C2'" 
2890 C "C1'" . DA  H 5  ? 0.3786 0.3849 0.3645 0.1073  -0.0164 -0.0490 5   DA  H "C1'" 
2891 N N9    . DA  H 5  ? 0.3510 0.3655 0.3440 0.0986  -0.0026 -0.0284 5   DA  H N9    
2892 C C8    . DA  H 5  ? 0.3564 0.3774 0.3428 0.1067  0.0145  -0.0189 5   DA  H C8    
2893 N N7    . DA  H 5  ? 0.3253 0.3547 0.3356 0.0949  0.0194  -0.0058 5   DA  H N7    
2894 C C5    . DA  H 5  ? 0.3273 0.3526 0.3468 0.0818  0.0043  -0.0056 5   DA  H C5    
2895 C C6    . DA  H 5  ? 0.3123 0.3389 0.3454 0.0712  -0.0021 0.0028  5   DA  H C6    
2896 N N6    . DA  H 5  ? 0.2929 0.3298 0.3458 0.0691  0.0004  0.0083  5   DA  H N6    
2897 N N1    . DA  H 5  ? 0.3094 0.3246 0.3369 0.0652  -0.0111 0.0042  5   DA  H N1    
2898 C C2    . DA  H 5  ? 0.3252 0.3315 0.3499 0.0651  -0.0125 -0.0030 5   DA  H C2    
2899 N N3    . DA  H 5  ? 0.3331 0.3403 0.3549 0.0726  -0.0129 -0.0162 5   DA  H N3    
2900 C C4    . DA  H 5  ? 0.3354 0.3512 0.3471 0.0828  -0.0051 -0.0167 5   DA  H C4    
2901 N N1    . 5CM H 6  ? 0.3354 0.3545 0.3125 0.0784  -0.0143 -0.0236 6   5CM H N1    
2902 C C2    . 5CM H 6  ? 0.3049 0.3239 0.2954 0.0650  -0.0093 -0.0096 6   5CM H C2    
2903 N N3    . 5CM H 6  ? 0.3028 0.3262 0.2939 0.0645  -0.0016 0.0006  6   5CM H N3    
2904 C C4    . 5CM H 6  ? 0.3111 0.3382 0.2942 0.0745  0.0095  0.0027  6   5CM H C4    
2905 C C5    . 5CM H 6  ? 0.3344 0.3569 0.2896 0.0919  0.0103  -0.0070 6   5CM H C5    
2906 C C5A   . 5CM H 6  ? 0.3679 0.3869 0.2995 0.1102  0.0290  -0.0011 6   5CM H C5A   
2907 C C6    . 5CM H 6  ? 0.3342 0.3533 0.2863 0.0938  -0.0060 -0.0224 6   5CM H C6    
2908 O O2    . 5CM H 6  ? 0.3131 0.3264 0.3164 0.0558  -0.0120 -0.0074 6   5CM H O2    
2909 N N4    . 5CM H 6  ? 0.2988 0.3320 0.3005 0.0714  0.0192  0.0121  6   5CM H N4    
2910 C "C1'" . 5CM H 6  ? 0.3603 0.3772 0.3540 0.0775  -0.0278 -0.0400 6   5CM H "C1'" 
2911 C "C2'" . 5CM H 6  ? 0.3861 0.4071 0.3670 0.0874  -0.0383 -0.0520 6   5CM H "C2'" 
2912 C "C3'" . 5CM H 6  ? 0.4115 0.4312 0.4254 0.0887  -0.0556 -0.0757 6   5CM H "C3'" 
2913 C "C4'" . 5CM H 6  ? 0.3998 0.4114 0.4233 0.0889  -0.0530 -0.0779 6   5CM H "C4'" 
2914 O "O4'" . 5CM H 6  ? 0.3819 0.3933 0.3845 0.0861  -0.0359 -0.0557 6   5CM H "O4'" 
2915 O "O3'" . 5CM H 6  ? 0.4130 0.4336 0.4709 0.0701  -0.0518 -0.0723 6   5CM H "O3'" 
2916 C "C5'" . 5CM H 6  ? 0.4358 0.4428 0.4464 0.1105  -0.0696 -0.1036 6   5CM H "C5'" 
2917 O "O5'" . 5CM H 6  ? 0.4490 0.4552 0.4043 0.1310  -0.0640 -0.0988 6   5CM H "O5'" 
2918 P P     . 5CM H 6  ? 0.4803 0.4759 0.3983 0.1602  -0.0697 -0.1162 6   5CM H P     
2919 O OP1   . 5CM H 6  ? 0.5161 0.5086 0.4489 0.1729  -0.1027 -0.1530 6   5CM H OP1   
2920 O OP2   . 5CM H 6  ? 0.5059 0.4970 0.3651 0.1802  -0.0495 -0.0987 6   5CM H OP2   
2921 P P     . DA  H 7  ? 0.4124 0.4424 0.4932 0.0656  -0.0565 -0.0777 7   DA  H P     
2922 O OP1   . DA  H 7  ? 0.4309 0.4627 0.5719 0.0614  -0.0679 -0.0995 7   DA  H OP1   
2923 O OP2   . DA  H 7  ? 0.4233 0.4588 0.4624 0.0814  -0.0645 -0.0799 7   DA  H OP2   
2924 O "O5'" . DA  H 7  ? 0.3971 0.4225 0.4809 0.0484  -0.0333 -0.0511 7   DA  H "O5'" 
2925 C "C5'" . DA  H 7  ? 0.3787 0.3906 0.4750 0.0389  -0.0194 -0.0376 7   DA  H "C5'" 
2926 C "C4'" . DA  H 7  ? 0.3708 0.3754 0.4479 0.0321  -0.0021 -0.0145 7   DA  H "C4'" 
2927 O "O4'" . DA  H 7  ? 0.3646 0.3698 0.4005 0.0366  -0.0037 -0.0047 7   DA  H "O4'" 
2928 C "C3'" . DA  H 7  ? 0.3547 0.3663 0.4382 0.0290  0.0033  -0.0132 7   DA  H "C3'" 
2929 O "O3'" . DA  H 7  ? 0.3964 0.3928 0.4775 0.0240  0.0243  0.0053  7   DA  H "O3'" 
2930 C "C2'" . DA  H 7  ? 0.3293 0.3485 0.3721 0.0353  -0.0038 -0.0109 7   DA  H "C2'" 
2931 C "C1'" . DA  H 7  ? 0.3267 0.3383 0.3437 0.0367  -0.0025 -0.0006 7   DA  H "C1'" 
2932 N N9    . DA  H 7  ? 0.3035 0.3218 0.2990 0.0436  -0.0081 -0.0018 7   DA  H N9    
2933 C C8    . DA  H 7  ? 0.2944 0.3183 0.2839 0.0540  -0.0150 -0.0128 7   DA  H C8    
2934 N N7    . DA  H 7  ? 0.2980 0.3225 0.2674 0.0605  -0.0102 -0.0065 7   DA  H N7    
2935 C C5    . DA  H 7  ? 0.2873 0.3100 0.2599 0.0513  -0.0044 0.0053  7   DA  H C5    
2936 C C6    . DA  H 7  ? 0.2887 0.3128 0.2619 0.0507  0.0015  0.0134  7   DA  H C6    
2937 N N6    . DA  H 7  ? 0.3027 0.3285 0.2719 0.0589  0.0113  0.0165  7   DA  H N6    
2938 N N1    . DA  H 7  ? 0.2764 0.2982 0.2568 0.0436  -0.0019 0.0175  7   DA  H N1    
2939 C C2    . DA  H 7  ? 0.2686 0.2830 0.2426 0.0403  -0.0061 0.0178  7   DA  H C2    
2940 N N3    . DA  H 7  ? 0.2720 0.2828 0.2467 0.0394  -0.0042 0.0156  7   DA  H N3    
2941 C C4    . DA  H 7  ? 0.2780 0.2954 0.2587 0.0433  -0.0053 0.0075  7   DA  H C4    
2942 P P     . DT  H 8  ? 0.3726 0.3708 0.4667 0.0211  0.0396  0.0101  8   DT  H P     
2943 O OP1   . DT  H 8  ? 0.4204 0.3988 0.5332 0.0182  0.0664  0.0256  8   DT  H OP1   
2944 O OP2   . DT  H 8  ? 0.3689 0.3885 0.4961 0.0215  0.0249  -0.0101 8   DT  H OP2   
2945 O "O5'" . DT  H 8  ? 0.3503 0.3457 0.3890 0.0266  0.0377  0.0198  8   DT  H "O5'" 
2946 C "C5'" . DT  H 8  ? 0.3423 0.3208 0.3394 0.0317  0.0397  0.0328  8   DT  H "C5'" 
2947 C "C4'" . DT  H 8  ? 0.3355 0.3175 0.2990 0.0356  0.0294  0.0317  8   DT  H "C4'" 
2948 O "O4'" . DT  H 8  ? 0.3211 0.3174 0.2887 0.0344  0.0139  0.0229  8   DT  H "O4'" 
2949 C "C3'" . DT  H 8  ? 0.3249 0.3111 0.2873 0.0360  0.0354  0.0297  8   DT  H "C3'" 
2950 O "O3'" . DT  H 8  ? 0.3550 0.3213 0.2842 0.0438  0.0472  0.0398  8   DT  H "O3'" 
2951 C "C2'" . DT  H 8  ? 0.2925 0.2908 0.2490 0.0359  0.0200  0.0219  8   DT  H "C2'" 
2952 C "C1'" . DT  H 8  ? 0.2990 0.2991 0.2531 0.0357  0.0098  0.0213  8   DT  H "C1'" 
2953 N N1    . DT  H 8  ? 0.2835 0.2953 0.2444 0.0368  0.0029  0.0158  8   DT  H N1    
2954 C C2    . DT  H 8  ? 0.2875 0.2992 0.2433 0.0374  -0.0003 0.0180  8   DT  H C2    
2955 O O2    . DT  H 8  ? 0.2934 0.2989 0.2444 0.0365  -0.0042 0.0195  8   DT  H O2    
2956 N N3    . DT  H 8  ? 0.2762 0.2937 0.2342 0.0418  0.0013  0.0174  8   DT  H N3    
2957 C C4    . DT  H 8  ? 0.2668 0.2886 0.2211 0.0493  0.0000  0.0120  8   DT  H C4    
2958 O O4    . DT  H 8  ? 0.2789 0.3001 0.2223 0.0588  0.0037  0.0137  8   DT  H O4    
2959 C C5    . DT  H 8  ? 0.2664 0.2913 0.2325 0.0478  -0.0047 0.0039  8   DT  H C5    
2960 C C7    . DT  H 8  ? 0.2722 0.3033 0.2424 0.0581  -0.0146 -0.0094 8   DT  H C7    
2961 C C6    . DT  H 8  ? 0.2670 0.2873 0.2408 0.0399  0.0000  0.0077  8   DT  H C6    
2962 P P     . DT  H 9  ? 0.3715 0.3342 0.2781 0.0496  0.0495  0.0376  9   DT  H P     
2963 O OP1   . DT  H 9  ? 0.3841 0.3229 0.2596 0.0615  0.0704  0.0492  9   DT  H OP1   
2964 O OP2   . DT  H 9  ? 0.3413 0.3241 0.2811 0.0433  0.0479  0.0288  9   DT  H OP2   
2965 O "O5'" . DT  H 9  ? 0.3750 0.3365 0.2583 0.0524  0.0265  0.0303  9   DT  H "O5'" 
2966 C "C5'" . DT  H 9  ? 0.3990 0.3505 0.2631 0.0582  0.0141  0.0313  9   DT  H "C5'" 
2967 C "C4'" . DT  H 9  ? 0.4032 0.3592 0.2686 0.0583  -0.0077 0.0197  9   DT  H "C4'" 
2968 O "O4'" . DT  H 9  ? 0.3518 0.3270 0.2531 0.0468  -0.0102 0.0167  9   DT  H "O4'" 
2969 C "C3'" . DT  H 9  ? 0.4216 0.3679 0.2679 0.0651  -0.0134 0.0111  9   DT  H "C3'" 
2970 O "O3'" . DT  H 9  ? 0.4387 0.3787 0.2786 0.0726  -0.0377 -0.0005 9   DT  H "O3'" 
2971 C "C2'" . DT  H 9  ? 0.3830 0.3447 0.2612 0.0536  -0.0096 0.0085  9   DT  H "C2'" 
2972 C "C1'" . DT  H 9  ? 0.3549 0.3319 0.2634 0.0446  -0.0125 0.0109  9   DT  H "C1'" 
2973 N N1    . DT  H 9  ? 0.3236 0.3134 0.2519 0.0389  -0.0036 0.0147  9   DT  H N1    
2974 C C2    . DT  H 9  ? 0.3216 0.3177 0.2696 0.0359  -0.0044 0.0157  9   DT  H C2    
2975 O O2    . DT  H 9  ? 0.3281 0.3230 0.2921 0.0339  -0.0110 0.0124  9   DT  H O2    
2976 N N3    . DT  H 9  ? 0.3099 0.3126 0.2602 0.0379  0.0032  0.0199  9   DT  H N3    
2977 C C4    . DT  H 9  ? 0.3172 0.3245 0.2613 0.0416  0.0052  0.0184  9   DT  H C4    
2978 O O4    . DT  H 9  ? 0.3557 0.3672 0.2979 0.0483  0.0059  0.0184  9   DT  H O4    
2979 C C5    . DT  H 9  ? 0.3238 0.3288 0.2650 0.0400  0.0068  0.0162  9   DT  H C5    
2980 C C7    . DT  H 9  ? 0.3135 0.3267 0.2677 0.0421  0.0101  0.0122  9   DT  H C7    
2981 C C6    . DT  H 9  ? 0.3229 0.3175 0.2517 0.0395  0.0055  0.0168  9   DT  H C6    
2982 P P     . DC  H 10 ? 0.5123 0.4338 0.3215 0.0882  -0.0559 -0.0167 10  DC  H P     
2983 O OP1   . DC  H 10 ? 0.5004 0.4145 0.2987 0.1013  -0.0829 -0.0278 10  DC  H OP1   
2984 O OP2   . DC  H 10 ? 0.5200 0.4242 0.2853 0.0999  -0.0365 -0.0101 10  DC  H OP2   
2985 O "O5'" . DC  H 10 ? 0.4536 0.3879 0.3099 0.0743  -0.0619 -0.0273 10  DC  H "O5'" 
2986 C "C5'" . DC  H 10 ? 0.4357 0.3866 0.3453 0.0614  -0.0697 -0.0305 10  DC  H "C5'" 
2987 C "C4'" . DC  H 10 ? 0.4237 0.3785 0.3720 0.0507  -0.0646 -0.0340 10  DC  H "C4'" 
2988 O "O4'" . DC  H 10 ? 0.3732 0.3369 0.3255 0.0424  -0.0401 -0.0167 10  DC  H "O4'" 
2989 C "C3'" . DC  H 10 ? 0.4560 0.3943 0.3874 0.0585  -0.0724 -0.0475 10  DC  H "C3'" 
2990 O "O3'" . DC  H 10 ? 0.5041 0.4419 0.4886 0.0511  -0.0838 -0.0613 10  DC  H "O3'" 
2991 C "C2'" . DC  H 10 ? 0.4368 0.3760 0.3527 0.0556  -0.0476 -0.0328 10  DC  H "C2'" 
2992 C "C1'" . DC  H 10 ? 0.3756 0.3313 0.3229 0.0433  -0.0330 -0.0176 10  DC  H "C1'" 
2993 N N1    . DC  H 10 ? 0.3419 0.3050 0.2762 0.0427  -0.0149 -0.0039 10  DC  H N1    
2994 C C2    . DC  H 10 ? 0.3114 0.2831 0.2650 0.0383  -0.0042 0.0064  10  DC  H C2    
2995 O O2    . DC  H 10 ? 0.3044 0.2749 0.2862 0.0338  -0.0027 0.0080  10  DC  H O2    
2996 N N3    . DC  H 10 ? 0.2910 0.2699 0.2336 0.0417  0.0045  0.0133  10  DC  H N3    
2997 C C4    . DC  H 10 ? 0.2988 0.2803 0.2269 0.0448  0.0062  0.0111  10  DC  H C4    
2998 N N4    . DC  H 10 ? 0.2923 0.2840 0.2242 0.0478  0.0107  0.0133  10  DC  H N4    
2999 C C5    . DC  H 10 ? 0.3145 0.2862 0.2243 0.0479  0.0039  0.0058  10  DC  H C5    
3000 C C6    . DC  H 10 ? 0.3316 0.2929 0.2377 0.0489  -0.0082 -0.0019 10  DC  H C6    
3001 P P     . DC  H 11 ? 0.5563 0.4756 0.5405 0.0615  -0.1090 -0.0888 11  DC  H P     
3002 O OP1   . DC  H 11 ? 0.5842 0.5062 0.6015 0.0656  -0.1413 -0.1117 11  DC  H OP1   
3003 O OP2   . DC  H 11 ? 0.5887 0.4918 0.5046 0.0777  -0.1046 -0.0889 11  DC  H OP2   
3004 O "O5'" . DC  H 11 ? 0.5760 0.4928 0.6137 0.0477  -0.0951 -0.0865 11  DC  H "O5'" 
3005 C "C5'" . DC  H 11 ? 0.5742 0.5021 0.6819 0.0317  -0.0841 -0.0785 11  DC  H "C5'" 
3006 C "C4'" . DC  H 11 ? 0.5354 0.4614 0.6474 0.0244  -0.0503 -0.0529 11  DC  H "C4'" 
3007 O "O4'" . DC  H 11 ? 0.5161 0.4480 0.5689 0.0304  -0.0363 -0.0355 11  DC  H "O4'" 
3008 C "C3'" . DC  H 11 ? 0.5543 0.4605 0.6808 0.0248  -0.0465 -0.0584 11  DC  H "C3'" 
3009 O "O3'" . DC  H 11 ? 0.5709 0.4732 0.7677 0.0129  -0.0292 -0.0495 11  DC  H "O3'" 
3010 C "C2'" . DC  H 11 ? 0.5270 0.4313 0.5975 0.0323  -0.0287 -0.0407 11  DC  H "C2'" 
3011 C "C1'" . DC  H 11 ? 0.4755 0.3985 0.5237 0.0312  -0.0175 -0.0228 11  DC  H "C1'" 
3012 N N1    . DC  H 11 ? 0.4255 0.3554 0.4232 0.0390  -0.0104 -0.0136 11  DC  H N1    
3013 C C2    . DC  H 11 ? 0.3844 0.3215 0.3743 0.0405  0.0065  0.0049  11  DC  H C2    
3014 O O2    . DC  H 11 ? 0.3703 0.3038 0.3831 0.0382  0.0192  0.0166  11  DC  H O2    
3015 N N3    . DC  H 11 ? 0.3790 0.3255 0.3386 0.0469  0.0090  0.0084  11  DC  H N3    
3016 C C4    . DC  H 11 ? 0.3905 0.3380 0.3295 0.0503  0.0031  -0.0008 11  DC  H C4    
3017 N N4    . DC  H 11 ? 0.3797 0.3378 0.3053 0.0548  0.0095  0.0029  11  DC  H N4    
3018 C C5    . DC  H 11 ? 0.4171 0.3529 0.3493 0.0521  -0.0093 -0.0155 11  DC  H C5    
3019 C C6    . DC  H 11 ? 0.4288 0.3568 0.3900 0.0470  -0.0197 -0.0239 11  DC  H C6    
3020 P P     . DG  H 12 ? 0.5659 0.4452 0.8167 0.0084  -0.0264 -0.0587 12  DG  H P     
3021 O OP1   . DG  H 12 ? 0.6196 0.5018 0.9634 -0.0046 -0.0260 -0.0666 12  DG  H OP1   
3022 O OP2   . DG  H 12 ? 0.5996 0.4663 0.8151 0.0191  -0.0524 -0.0841 12  DG  H OP2   
3023 O "O5'" . DG  H 12 ? 0.5660 0.4325 0.7965 0.0112  0.0114  -0.0247 12  DG  H "O5'" 
3024 C "C5'" . DG  H 12 ? 0.5306 0.4014 0.7664 0.0098  0.0432  0.0056  12  DG  H "C5'" 
3025 C "C4'" . DG  H 12 ? 0.5342 0.3903 0.7215 0.0227  0.0677  0.0320  12  DG  H "C4'" 
3026 O "O4'" . DG  H 12 ? 0.5123 0.3863 0.6305 0.0325  0.0576  0.0337  12  DG  H "O4'" 
3027 C "C3'" . DG  H 12 ? 0.5528 0.3852 0.7384 0.0281  0.0663  0.0275  12  DG  H "C3'" 
3028 O "O3'" . DG  H 12 ? 0.6088 0.4134 0.8497 0.0246  0.0930  0.0423  12  DG  H "O3'" 
3029 C "C2'" . DG  H 12 ? 0.5360 0.3706 0.6495 0.0450  0.0704  0.0416  12  DG  H "C2'" 
3030 C "C1'" . DG  H 12 ? 0.4933 0.3561 0.5709 0.0461  0.0630  0.0427  12  DG  H "C1'" 
3031 N N9    . DG  H 12 ? 0.4501 0.3301 0.4873 0.0501  0.0420  0.0275  12  DG  H N9    
3032 C C8    . DG  H 12 ? 0.4365 0.3206 0.4728 0.0462  0.0212  0.0041  12  DG  H C8    
3033 N N7    . DG  H 12 ? 0.4103 0.3076 0.4072 0.0529  0.0145  0.0000  12  DG  H N7    
3034 C C5    . DG  H 12 ? 0.3995 0.3052 0.3785 0.0596  0.0261  0.0173  12  DG  H C5    
3035 C C6    . DG  H 12 ? 0.3820 0.3045 0.3342 0.0672  0.0240  0.0183  12  DG  H C6    
3036 O O6    . DG  H 12 ? 0.3729 0.3055 0.3135 0.0681  0.0185  0.0084  12  DG  H O6    
3037 N N1    . DG  H 12 ? 0.3904 0.3153 0.3317 0.0769  0.0307  0.0321  12  DG  H N1    
3038 C C2    . DG  H 12 ? 0.4170 0.3259 0.3611 0.0814  0.0441  0.0482  12  DG  H C2    
3039 N N2    . DG  H 12 ? 0.4340 0.3431 0.3512 0.0980  0.0477  0.0594  12  DG  H N2    
3040 N N3    . DG  H 12 ? 0.4273 0.3193 0.4008 0.0726  0.0540  0.0522  12  DG  H N3    
3041 C C4    . DG  H 12 ? 0.4115 0.3050 0.4065 0.0606  0.0416  0.0341  12  DG  H C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  142 ?   ?   ?   A . n 
A 1 2  ALA 2  143 ?   ?   ?   A . n 
A 1 3  THR 3  144 ?   ?   ?   A . n 
A 1 4  GLU 4  145 ?   ?   ?   A . n 
A 1 5  SER 5  146 ?   ?   ?   A . n 
A 1 6  GLY 6  147 147 GLY GLY A . n 
A 1 7  LYS 7  148 148 LYS LYS A . n 
A 1 8  ARG 8  149 149 ARG ARG A . n 
A 1 9  MET 9  150 150 MET MET A . n 
A 1 10 ASP 10 151 151 ASP ASP A . n 
A 1 11 CYS 11 152 152 CYS CYS A . n 
A 1 12 PRO 12 153 153 PRO PRO A . n 
A 1 13 ALA 13 154 154 ALA ALA A . n 
A 1 14 LEU 14 155 155 LEU LEU A . n 
A 1 15 PRO 15 156 156 PRO PRO A . n 
A 1 16 PRO 16 157 157 PRO PRO A . n 
A 1 17 GLY 17 158 158 GLY GLY A . n 
A 1 18 TRP 18 159 159 TRP TRP A . n 
A 1 19 LYS 19 160 160 LYS LYS A . n 
A 1 20 LYS 20 161 161 LYS LYS A . n 
A 1 21 GLU 21 162 162 GLU GLU A . n 
A 1 22 GLU 22 163 163 GLU GLU A . n 
A 1 23 VAL 23 164 164 VAL VAL A . n 
A 1 24 ILE 24 165 165 ILE ILE A . n 
A 1 25 ARG 25 166 166 ARG ARG A . n 
A 1 26 LYS 26 167 167 LYS LYS A . n 
A 1 27 SER 27 168 168 SER SER A . n 
A 1 28 GLY 28 169 169 GLY GLY A . n 
A 1 29 LEU 29 170 170 LEU LEU A . n 
A 1 30 SER 30 171 171 SER SER A . n 
A 1 31 ALA 31 172 172 ALA ALA A . n 
A 1 32 GLY 32 173 173 GLY GLY A . n 
A 1 33 LYS 33 174 174 LYS LYS A . n 
A 1 34 SER 34 175 175 SER SER A . n 
A 1 35 ASP 35 176 176 ASP ASP A . n 
A 1 36 VAL 36 177 177 VAL VAL A . n 
A 1 37 TYR 37 178 178 TYR TYR A . n 
A 1 38 TYR 38 179 179 TYR TYR A . n 
A 1 39 PHE 39 180 180 PHE PHE A . n 
A 1 40 SER 40 181 181 SER SER A . n 
A 1 41 PRO 41 182 182 PRO PRO A . n 
A 1 42 SER 42 183 183 SER SER A . n 
A 1 43 GLY 43 184 184 GLY GLY A . n 
A 1 44 LYS 44 185 185 LYS LYS A . n 
A 1 45 LYS 45 186 186 LYS LYS A . n 
A 1 46 PHE 46 187 187 PHE PHE A . n 
A 1 47 ARG 47 188 188 ARG ARG A . n 
A 1 48 SER 48 189 189 SER SER A . n 
A 1 49 LYS 49 190 190 LYS LYS A . n 
A 1 50 PRO 50 191 191 PRO PRO A . n 
A 1 51 GLN 51 192 192 GLN GLN A . n 
A 1 52 LEU 52 193 193 LEU LEU A . n 
A 1 53 ALA 53 194 194 ALA ALA A . n 
A 1 54 ARG 54 195 195 ARG ARG A . n 
A 1 55 TYR 55 196 196 TYR TYR A . n 
A 1 56 LEU 56 197 197 LEU LEU A . n 
A 1 57 GLY 57 198 198 GLY GLY A . n 
A 1 58 ASN 58 199 199 ASN ASN A . n 
A 1 59 THR 59 200 200 THR THR A . n 
A 1 60 VAL 60 201 201 VAL VAL A . n 
A 1 61 ASP 61 202 202 ASP ASP A . n 
A 1 62 LEU 62 203 203 LEU LEU A . n 
A 1 63 SER 63 204 204 SER SER A . n 
A 1 64 SER 64 205 205 SER SER A . n 
A 1 65 PHE 65 206 206 PHE PHE A . n 
A 1 66 ASP 66 207 207 ASP ASP A . n 
A 1 67 PHE 67 208 208 PHE PHE A . n 
A 1 68 ARG 68 209 209 ARG ARG A . n 
A 1 69 THR 69 210 210 THR THR A . n 
A 1 70 GLY 70 211 211 GLY GLY A . n 
A 1 71 LYS 71 212 212 LYS LYS A . n 
A 1 72 MET 72 213 213 MET MET A . n 
A 1 73 MET 73 214 214 MET MET A . n 
A 1 74 PRO 74 215 ?   ?   ?   A . n 
A 1 75 SER 75 216 ?   ?   ?   A . n 
A 1 76 LYS 76 217 ?   ?   ?   A . n 
A 1 77 LEU 77 218 ?   ?   ?   A . n 
A 1 78 GLN 78 219 ?   ?   ?   A . n 
A 1 79 LYS 79 220 ?   ?   ?   A . n 
B 1 1  GLY 1  142 ?   ?   ?   B . n 
B 1 2  ALA 2  143 ?   ?   ?   B . n 
B 1 3  THR 3  144 ?   ?   ?   B . n 
B 1 4  GLU 4  145 ?   ?   ?   B . n 
B 1 5  SER 5  146 ?   ?   ?   B . n 
B 1 6  GLY 6  147 ?   ?   ?   B . n 
B 1 7  LYS 7  148 148 LYS LYS B . n 
B 1 8  ARG 8  149 149 ARG ARG B . n 
B 1 9  MET 9  150 150 MET MET B . n 
B 1 10 ASP 10 151 151 ASP ASP B . n 
B 1 11 CYS 11 152 152 CYS CYS B . n 
B 1 12 PRO 12 153 153 PRO PRO B . n 
B 1 13 ALA 13 154 154 ALA ALA B . n 
B 1 14 LEU 14 155 155 LEU LEU B . n 
B 1 15 PRO 15 156 156 PRO PRO B . n 
B 1 16 PRO 16 157 157 PRO PRO B . n 
B 1 17 GLY 17 158 158 GLY GLY B . n 
B 1 18 TRP 18 159 159 TRP TRP B . n 
B 1 19 LYS 19 160 160 LYS LYS B . n 
B 1 20 LYS 20 161 161 LYS LYS B . n 
B 1 21 GLU 21 162 162 GLU GLU B . n 
B 1 22 GLU 22 163 163 GLU GLU B . n 
B 1 23 VAL 23 164 164 VAL VAL B . n 
B 1 24 ILE 24 165 165 ILE ILE B . n 
B 1 25 ARG 25 166 166 ARG ARG B . n 
B 1 26 LYS 26 167 167 LYS LYS B . n 
B 1 27 SER 27 168 168 SER SER B . n 
B 1 28 GLY 28 169 169 GLY GLY B . n 
B 1 29 LEU 29 170 170 LEU LEU B . n 
B 1 30 SER 30 171 171 SER SER B . n 
B 1 31 ALA 31 172 172 ALA ALA B . n 
B 1 32 GLY 32 173 173 GLY GLY B . n 
B 1 33 LYS 33 174 174 LYS LYS B . n 
B 1 34 SER 34 175 175 SER SER B . n 
B 1 35 ASP 35 176 176 ASP ASP B . n 
B 1 36 VAL 36 177 177 VAL VAL B . n 
B 1 37 TYR 37 178 178 TYR TYR B . n 
B 1 38 TYR 38 179 179 TYR TYR B . n 
B 1 39 PHE 39 180 180 PHE PHE B . n 
B 1 40 SER 40 181 181 SER SER B . n 
B 1 41 PRO 41 182 182 PRO PRO B . n 
B 1 42 SER 42 183 183 SER SER B . n 
B 1 43 GLY 43 184 184 GLY GLY B . n 
B 1 44 LYS 44 185 185 LYS LYS B . n 
B 1 45 LYS 45 186 186 LYS LYS B . n 
B 1 46 PHE 46 187 187 PHE PHE B . n 
B 1 47 ARG 47 188 188 ARG ARG B . n 
B 1 48 SER 48 189 189 SER SER B . n 
B 1 49 LYS 49 190 190 LYS LYS B . n 
B 1 50 PRO 50 191 191 PRO PRO B . n 
B 1 51 GLN 51 192 192 GLN GLN B . n 
B 1 52 LEU 52 193 193 LEU LEU B . n 
B 1 53 ALA 53 194 194 ALA ALA B . n 
B 1 54 ARG 54 195 195 ARG ARG B . n 
B 1 55 TYR 55 196 196 TYR TYR B . n 
B 1 56 LEU 56 197 197 LEU LEU B . n 
B 1 57 GLY 57 198 198 GLY GLY B . n 
B 1 58 ASN 58 199 199 ASN ASN B . n 
B 1 59 THR 59 200 200 THR THR B . n 
B 1 60 VAL 60 201 201 VAL VAL B . n 
B 1 61 ASP 61 202 202 ASP ASP B . n 
B 1 62 LEU 62 203 203 LEU LEU B . n 
B 1 63 SER 63 204 204 SER SER B . n 
B 1 64 SER 64 205 205 SER SER B . n 
B 1 65 PHE 65 206 206 PHE PHE B . n 
B 1 66 ASP 66 207 207 ASP ASP B . n 
B 1 67 PHE 67 208 208 PHE PHE B . n 
B 1 68 ARG 68 209 209 ARG ARG B . n 
B 1 69 THR 69 210 210 THR THR B . n 
B 1 70 GLY 70 211 211 GLY GLY B . n 
B 1 71 LYS 71 212 212 LYS LYS B . n 
B 1 72 MET 72 213 213 MET MET B . n 
B 1 73 MET 73 214 214 MET MET B . n 
B 1 74 PRO 74 215 215 PRO PRO B . n 
B 1 75 SER 75 216 ?   ?   ?   B . n 
B 1 76 LYS 76 217 ?   ?   ?   B . n 
B 1 77 LEU 77 218 ?   ?   ?   B . n 
B 1 78 GLN 78 219 ?   ?   ?   B . n 
B 1 79 LYS 79 220 ?   ?   ?   B . n 
C 2 1  DC  1  1   1   DC  DC  C . n 
C 2 2  DG  2  2   2   DG  DG  C . n 
C 2 3  DG  3  3   3   DG  DG  C . n 
C 2 4  DA  4  4   4   DA  DA  C . n 
C 2 5  DA  5  5   5   DA  DA  C . n 
C 2 6  DT  6  6   6   DT  DT  C . n 
C 2 7  DG  7  7   7   DG  DG  C . n 
C 2 8  DT  8  8   8   DT  DT  C . n 
C 2 9  DA  9  9   9   DA  DA  C . n 
C 2 10 DG  10 10  10  DG  DG  C . n 
C 2 11 DG  11 11  11  DG  DG  C . n 
C 2 12 DC  12 12  12  DC  DC  C . n 
D 3 1  DG  1  1   1   DG  DG  D . n 
D 3 2  DC  2  2   2   DC  DC  D . n 
D 3 3  DC  3  3   3   DC  DC  D . n 
D 3 4  DT  4  4   4   DT  DT  D . n 
D 3 5  DA  5  5   5   DA  DA  D . n 
D 3 6  5CM 6  6   6   5CM 5CM D . n 
D 3 7  DA  7  7   7   DA  DA  D . n 
D 3 8  DT  8  8   8   DT  DT  D . n 
D 3 9  DT  9  9   9   DT  DT  D . n 
D 3 10 DC  10 10  10  DC  DC  D . n 
D 3 11 DC  11 11  11  DC  DC  D . n 
D 3 12 DG  12 12  12  DG  DG  D . n 
E 1 1  GLY 1  142 ?   ?   ?   E . n 
E 1 2  ALA 2  143 ?   ?   ?   E . n 
E 1 3  THR 3  144 ?   ?   ?   E . n 
E 1 4  GLU 4  145 ?   ?   ?   E . n 
E 1 5  SER 5  146 ?   ?   ?   E . n 
E 1 6  GLY 6  147 ?   ?   ?   E . n 
E 1 7  LYS 7  148 148 LYS LYS E . n 
E 1 8  ARG 8  149 149 ARG ARG E . n 
E 1 9  MET 9  150 150 MET MET E . n 
E 1 10 ASP 10 151 151 ASP ASP E . n 
E 1 11 CYS 11 152 152 CYS CYS E . n 
E 1 12 PRO 12 153 153 PRO PRO E . n 
E 1 13 ALA 13 154 154 ALA ALA E . n 
E 1 14 LEU 14 155 155 LEU LEU E . n 
E 1 15 PRO 15 156 156 PRO PRO E . n 
E 1 16 PRO 16 157 157 PRO PRO E . n 
E 1 17 GLY 17 158 158 GLY GLY E . n 
E 1 18 TRP 18 159 159 TRP TRP E . n 
E 1 19 LYS 19 160 160 LYS LYS E . n 
E 1 20 LYS 20 161 161 LYS LYS E . n 
E 1 21 GLU 21 162 162 GLU GLU E . n 
E 1 22 GLU 22 163 163 GLU GLU E . n 
E 1 23 VAL 23 164 164 VAL VAL E . n 
E 1 24 ILE 24 165 165 ILE ILE E . n 
E 1 25 ARG 25 166 166 ARG ARG E . n 
E 1 26 LYS 26 167 167 LYS LYS E . n 
E 1 27 SER 27 168 168 SER SER E . n 
E 1 28 GLY 28 169 169 GLY GLY E . n 
E 1 29 LEU 29 170 170 LEU LEU E . n 
E 1 30 SER 30 171 171 SER SER E . n 
E 1 31 ALA 31 172 172 ALA ALA E . n 
E 1 32 GLY 32 173 173 GLY GLY E . n 
E 1 33 LYS 33 174 174 LYS LYS E . n 
E 1 34 SER 34 175 175 SER SER E . n 
E 1 35 ASP 35 176 176 ASP ASP E . n 
E 1 36 VAL 36 177 177 VAL VAL E . n 
E 1 37 TYR 37 178 178 TYR TYR E . n 
E 1 38 TYR 38 179 179 TYR TYR E . n 
E 1 39 PHE 39 180 180 PHE PHE E . n 
E 1 40 SER 40 181 181 SER SER E . n 
E 1 41 PRO 41 182 182 PRO PRO E . n 
E 1 42 SER 42 183 183 SER SER E . n 
E 1 43 GLY 43 184 184 GLY GLY E . n 
E 1 44 LYS 44 185 185 LYS LYS E . n 
E 1 45 LYS 45 186 186 LYS LYS E . n 
E 1 46 PHE 46 187 187 PHE PHE E . n 
E 1 47 ARG 47 188 188 ARG ARG E . n 
E 1 48 SER 48 189 189 SER SER E . n 
E 1 49 LYS 49 190 190 LYS LYS E . n 
E 1 50 PRO 50 191 191 PRO PRO E . n 
E 1 51 GLN 51 192 192 GLN GLN E . n 
E 1 52 LEU 52 193 193 LEU LEU E . n 
E 1 53 ALA 53 194 194 ALA ALA E . n 
E 1 54 ARG 54 195 195 ARG ARG E . n 
E 1 55 TYR 55 196 196 TYR TYR E . n 
E 1 56 LEU 56 197 197 LEU LEU E . n 
E 1 57 GLY 57 198 198 GLY GLY E . n 
E 1 58 ASN 58 199 199 ASN ASN E . n 
E 1 59 THR 59 200 200 THR THR E . n 
E 1 60 VAL 60 201 201 VAL VAL E . n 
E 1 61 ASP 61 202 202 ASP ASP E . n 
E 1 62 LEU 62 203 203 LEU LEU E . n 
E 1 63 SER 63 204 204 SER SER E . n 
E 1 64 SER 64 205 205 SER SER E . n 
E 1 65 PHE 65 206 206 PHE PHE E . n 
E 1 66 ASP 66 207 207 ASP ASP E . n 
E 1 67 PHE 67 208 208 PHE PHE E . n 
E 1 68 ARG 68 209 209 ARG ARG E . n 
E 1 69 THR 69 210 210 THR THR E . n 
E 1 70 GLY 70 211 211 GLY GLY E . n 
E 1 71 LYS 71 212 212 LYS LYS E . n 
E 1 72 MET 72 213 213 MET MET E . n 
E 1 73 MET 73 214 214 MET MET E . n 
E 1 74 PRO 74 215 215 PRO PRO E . n 
E 1 75 SER 75 216 ?   ?   ?   E . n 
E 1 76 LYS 76 217 ?   ?   ?   E . n 
E 1 77 LEU 77 218 ?   ?   ?   E . n 
E 1 78 GLN 78 219 ?   ?   ?   E . n 
E 1 79 LYS 79 220 ?   ?   ?   E . n 
F 1 1  GLY 1  142 ?   ?   ?   F . n 
F 1 2  ALA 2  143 ?   ?   ?   F . n 
F 1 3  THR 3  144 ?   ?   ?   F . n 
F 1 4  GLU 4  145 ?   ?   ?   F . n 
F 1 5  SER 5  146 ?   ?   ?   F . n 
F 1 6  GLY 6  147 ?   ?   ?   F . n 
F 1 7  LYS 7  148 148 LYS LYS F . n 
F 1 8  ARG 8  149 149 ARG ARG F . n 
F 1 9  MET 9  150 150 MET MET F . n 
F 1 10 ASP 10 151 151 ASP ASP F . n 
F 1 11 CYS 11 152 152 CYS CYS F . n 
F 1 12 PRO 12 153 153 PRO PRO F . n 
F 1 13 ALA 13 154 154 ALA ALA F . n 
F 1 14 LEU 14 155 155 LEU LEU F . n 
F 1 15 PRO 15 156 156 PRO PRO F . n 
F 1 16 PRO 16 157 157 PRO PRO F . n 
F 1 17 GLY 17 158 158 GLY GLY F . n 
F 1 18 TRP 18 159 159 TRP TRP F . n 
F 1 19 LYS 19 160 160 LYS LYS F . n 
F 1 20 LYS 20 161 161 LYS LYS F . n 
F 1 21 GLU 21 162 162 GLU GLU F . n 
F 1 22 GLU 22 163 163 GLU GLU F . n 
F 1 23 VAL 23 164 164 VAL VAL F . n 
F 1 24 ILE 24 165 165 ILE ILE F . n 
F 1 25 ARG 25 166 166 ARG ARG F . n 
F 1 26 LYS 26 167 167 LYS LYS F . n 
F 1 27 SER 27 168 168 SER SER F . n 
F 1 28 GLY 28 169 169 GLY GLY F . n 
F 1 29 LEU 29 170 170 LEU LEU F . n 
F 1 30 SER 30 171 171 SER SER F . n 
F 1 31 ALA 31 172 172 ALA ALA F . n 
F 1 32 GLY 32 173 173 GLY GLY F . n 
F 1 33 LYS 33 174 174 LYS LYS F . n 
F 1 34 SER 34 175 175 SER SER F . n 
F 1 35 ASP 35 176 176 ASP ASP F . n 
F 1 36 VAL 36 177 177 VAL VAL F . n 
F 1 37 TYR 37 178 178 TYR TYR F . n 
F 1 38 TYR 38 179 179 TYR TYR F . n 
F 1 39 PHE 39 180 180 PHE PHE F . n 
F 1 40 SER 40 181 181 SER SER F . n 
F 1 41 PRO 41 182 182 PRO PRO F . n 
F 1 42 SER 42 183 183 SER SER F . n 
F 1 43 GLY 43 184 184 GLY GLY F . n 
F 1 44 LYS 44 185 185 LYS LYS F . n 
F 1 45 LYS 45 186 186 LYS LYS F . n 
F 1 46 PHE 46 187 187 PHE PHE F . n 
F 1 47 ARG 47 188 188 ARG ARG F . n 
F 1 48 SER 48 189 189 SER SER F . n 
F 1 49 LYS 49 190 190 LYS LYS F . n 
F 1 50 PRO 50 191 191 PRO PRO F . n 
F 1 51 GLN 51 192 192 GLN GLN F . n 
F 1 52 LEU 52 193 193 LEU LEU F . n 
F 1 53 ALA 53 194 194 ALA ALA F . n 
F 1 54 ARG 54 195 195 ARG ARG F . n 
F 1 55 TYR 55 196 196 TYR TYR F . n 
F 1 56 LEU 56 197 197 LEU LEU F . n 
F 1 57 GLY 57 198 198 GLY GLY F . n 
F 1 58 ASN 58 199 199 ASN ASN F . n 
F 1 59 THR 59 200 200 THR THR F . n 
F 1 60 VAL 60 201 201 VAL VAL F . n 
F 1 61 ASP 61 202 202 ASP ASP F . n 
F 1 62 LEU 62 203 203 LEU LEU F . n 
F 1 63 SER 63 204 204 SER SER F . n 
F 1 64 SER 64 205 205 SER SER F . n 
F 1 65 PHE 65 206 206 PHE PHE F . n 
F 1 66 ASP 66 207 207 ASP ASP F . n 
F 1 67 PHE 67 208 208 PHE PHE F . n 
F 1 68 ARG 68 209 209 ARG ARG F . n 
F 1 69 THR 69 210 210 THR THR F . n 
F 1 70 GLY 70 211 211 GLY GLY F . n 
F 1 71 LYS 71 212 212 LYS LYS F . n 
F 1 72 MET 72 213 213 MET MET F . n 
F 1 73 MET 73 214 214 MET MET F . n 
F 1 74 PRO 74 215 215 PRO PRO F . n 
F 1 75 SER 75 216 ?   ?   ?   F . n 
F 1 76 LYS 76 217 ?   ?   ?   F . n 
F 1 77 LEU 77 218 ?   ?   ?   F . n 
F 1 78 GLN 78 219 ?   ?   ?   F . n 
F 1 79 LYS 79 220 ?   ?   ?   F . n 
G 2 1  DC  1  1   1   DC  DC  G . n 
G 2 2  DG  2  2   2   DG  DG  G . n 
G 2 3  DG  3  3   3   DG  DG  G . n 
G 2 4  DA  4  4   4   DA  DA  G . n 
G 2 5  DA  5  5   5   DA  DA  G . n 
G 2 6  DT  6  6   6   DT  DT  G . n 
G 2 7  DG  7  7   7   DG  DG  G . n 
G 2 8  DT  8  8   8   DT  DT  G . n 
G 2 9  DA  9  9   9   DA  DA  G . n 
G 2 10 DG  10 10  10  DG  DG  G . n 
G 2 11 DG  11 11  11  DG  DG  G . n 
G 2 12 DC  12 12  12  DC  DC  G . n 
H 3 1  DG  1  1   1   DG  DG  H . n 
H 3 2  DC  2  2   2   DC  DC  H . n 
H 3 3  DC  3  3   3   DC  DC  H . n 
H 3 4  DT  4  4   4   DT  DT  H . n 
H 3 5  DA  5  5   5   DA  DA  H . n 
H 3 6  5CM 6  6   6   5CM 5CM H . n 
H 3 7  DA  7  7   7   DA  DA  H . n 
H 3 8  DT  8  8   8   DT  DT  H . n 
H 3 9  DT  9  9   9   DT  DT  H . n 
H 3 10 DC  10 10  10  DC  DC  H . n 
H 3 11 DC  11 11  11  DC  DC  H . n 
H 3 12 DG  12 12  12  DG  DG  H . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I  4 UNX 1  301 1   UNX UNX A . 
J  4 UNX 1  302 4   UNX UNX A . 
K  4 UNX 1  303 6   UNX UNX A . 
L  4 UNX 1  304 17  UNX UNX A . 
M  4 UNX 1  305 19  UNX UNX A . 
N  4 UNX 1  306 37  UNX UNX A . 
O  4 UNX 1  307 40  UNX UNX A . 
P  4 UNX 1  308 45  UNX UNX A . 
Q  4 UNX 1  309 46  UNX UNX A . 
R  4 UNX 1  310 47  UNX UNX A . 
S  4 UNX 1  311 52  UNX UNX A . 
T  4 UNX 1  312 57  UNX UNX A . 
U  4 UNX 1  301 7   UNX UNX B . 
V  4 UNX 1  302 8   UNX UNX B . 
W  4 UNX 1  303 9   UNX UNX B . 
X  4 UNX 1  304 10  UNX UNX B . 
Y  4 UNX 1  305 12  UNX UNX B . 
Z  4 UNX 1  306 24  UNX UNX B . 
AA 4 UNX 1  307 28  UNX UNX B . 
BA 4 UNX 1  308 49  UNX UNX B . 
CA 4 UNX 1  309 51  UNX UNX B . 
DA 4 UNX 1  101 13  UNX UNX C . 
EA 4 UNX 1  102 34  UNX UNX C . 
FA 4 UNX 1  103 41  UNX UNX C . 
GA 4 UNX 1  104 54  UNX UNX C . 
HA 4 UNX 1  101 32  UNX UNX D . 
IA 4 UNX 1  102 39  UNX UNX D . 
JA 4 UNX 1  103 42  UNX UNX D . 
KA 4 UNX 1  104 58  UNX UNX D . 
LA 4 UNX 1  301 2   UNX UNX E . 
MA 4 UNX 1  302 18  UNX UNX E . 
NA 4 UNX 1  303 20  UNX UNX E . 
OA 4 UNX 1  304 21  UNX UNX E . 
PA 4 UNX 1  305 23  UNX UNX E . 
QA 4 UNX 1  306 26  UNX UNX E . 
RA 4 UNX 1  307 27  UNX UNX E . 
SA 4 UNX 1  308 50  UNX UNX E . 
TA 4 UNX 1  309 53  UNX UNX E . 
UA 4 UNX 1  310 55  UNX UNX E . 
VA 4 UNX 1  301 22  UNX UNX F . 
WA 4 UNX 1  302 29  UNX UNX F . 
XA 4 UNX 1  303 43  UNX UNX F . 
YA 4 UNX 1  304 56  UNX UNX F . 
ZA 4 UNX 1  101 14  UNX UNX G . 
AB 4 UNX 1  102 15  UNX UNX G . 
BB 4 UNX 1  103 31  UNX UNX G . 
CB 4 UNX 1  104 35  UNX UNX G . 
DB 4 UNX 1  105 36  UNX UNX G . 
EB 4 UNX 1  106 48  UNX UNX G . 
FB 4 UNX 1  107 59  UNX UNX G . 
GB 4 UNX 1  101 38  UNX UNX H . 
HB 4 UNX 1  102 44  UNX UNX H . 
IB 5 HOH 1  401 28  HOH HOH A . 
IB 5 HOH 2  402 175 HOH HOH A . 
IB 5 HOH 3  403 71  HOH HOH A . 
IB 5 HOH 4  404 3   HOH HOH A . 
IB 5 HOH 5  405 7   HOH HOH A . 
IB 5 HOH 6  406 76  HOH HOH A . 
IB 5 HOH 7  407 128 HOH HOH A . 
IB 5 HOH 8  408 69  HOH HOH A . 
IB 5 HOH 9  409 85  HOH HOH A . 
IB 5 HOH 10 410 97  HOH HOH A . 
IB 5 HOH 11 411 1   HOH HOH A . 
IB 5 HOH 12 412 66  HOH HOH A . 
IB 5 HOH 13 413 79  HOH HOH A . 
IB 5 HOH 14 414 176 HOH HOH A . 
IB 5 HOH 15 415 167 HOH HOH A . 
IB 5 HOH 16 416 5   HOH HOH A . 
IB 5 HOH 17 417 75  HOH HOH A . 
IB 5 HOH 18 418 99  HOH HOH A . 
IB 5 HOH 19 419 100 HOH HOH A . 
IB 5 HOH 20 420 169 HOH HOH A . 
JB 5 HOH 1  401 8   HOH HOH B . 
JB 5 HOH 2  402 19  HOH HOH B . 
JB 5 HOH 3  403 17  HOH HOH B . 
JB 5 HOH 4  404 183 HOH HOH B . 
JB 5 HOH 5  405 129 HOH HOH B . 
JB 5 HOH 6  406 14  HOH HOH B . 
JB 5 HOH 7  407 102 HOH HOH B . 
JB 5 HOH 8  408 130 HOH HOH B . 
JB 5 HOH 9  409 13  HOH HOH B . 
JB 5 HOH 10 410 18  HOH HOH B . 
JB 5 HOH 11 411 27  HOH HOH B . 
JB 5 HOH 12 412 137 HOH HOH B . 
JB 5 HOH 13 413 12  HOH HOH B . 
JB 5 HOH 14 414 171 HOH HOH B . 
KB 5 HOH 1  201 131 HOH HOH C . 
KB 5 HOH 2  202 24  HOH HOH C . 
KB 5 HOH 3  203 2   HOH HOH C . 
KB 5 HOH 4  204 78  HOH HOH C . 
KB 5 HOH 5  205 74  HOH HOH C . 
KB 5 HOH 6  206 181 HOH HOH C . 
KB 5 HOH 7  207 26  HOH HOH C . 
KB 5 HOH 8  208 180 HOH HOH C . 
KB 5 HOH 9  209 132 HOH HOH C . 
KB 5 HOH 10 210 125 HOH HOH C . 
KB 5 HOH 11 211 140 HOH HOH C . 
KB 5 HOH 12 212 179 HOH HOH C . 
LB 5 HOH 1  201 123 HOH HOH D . 
LB 5 HOH 2  202 21  HOH HOH D . 
LB 5 HOH 3  203 143 HOH HOH D . 
LB 5 HOH 4  204 178 HOH HOH D . 
LB 5 HOH 5  205 170 HOH HOH D . 
LB 5 HOH 6  206 20  HOH HOH D . 
LB 5 HOH 7  207 138 HOH HOH D . 
LB 5 HOH 8  208 134 HOH HOH D . 
LB 5 HOH 9  209 11  HOH HOH D . 
LB 5 HOH 10 210 23  HOH HOH D . 
LB 5 HOH 11 211 15  HOH HOH D . 
LB 5 HOH 12 212 16  HOH HOH D . 
LB 5 HOH 13 213 84  HOH HOH D . 
LB 5 HOH 14 214 141 HOH HOH D . 
LB 5 HOH 15 215 139 HOH HOH D . 
LB 5 HOH 16 216 22  HOH HOH D . 
LB 5 HOH 17 217 133 HOH HOH D . 
MB 5 HOH 1  401 144 HOH HOH E . 
MB 5 HOH 2  402 149 HOH HOH E . 
MB 5 HOH 3  403 35  HOH HOH E . 
MB 5 HOH 4  404 119 HOH HOH E . 
MB 5 HOH 5  405 33  HOH HOH E . 
MB 5 HOH 6  406 156 HOH HOH E . 
MB 5 HOH 7  407 106 HOH HOH E . 
MB 5 HOH 8  408 77  HOH HOH E . 
MB 5 HOH 9  409 34  HOH HOH E . 
MB 5 HOH 10 410 30  HOH HOH E . 
MB 5 HOH 11 411 39  HOH HOH E . 
MB 5 HOH 12 412 117 HOH HOH E . 
MB 5 HOH 13 413 173 HOH HOH E . 
MB 5 HOH 14 414 155 HOH HOH E . 
MB 5 HOH 15 415 38  HOH HOH E . 
MB 5 HOH 16 416 151 HOH HOH E . 
MB 5 HOH 17 417 31  HOH HOH E . 
MB 5 HOH 18 418 182 HOH HOH E . 
NB 5 HOH 1  401 114 HOH HOH F . 
NB 5 HOH 2  402 172 HOH HOH F . 
NB 5 HOH 3  403 52  HOH HOH F . 
NB 5 HOH 4  404 116 HOH HOH F . 
NB 5 HOH 5  405 162 HOH HOH F . 
NB 5 HOH 6  406 46  HOH HOH F . 
NB 5 HOH 7  407 51  HOH HOH F . 
NB 5 HOH 8  408 157 HOH HOH F . 
NB 5 HOH 9  409 54  HOH HOH F . 
NB 5 HOH 10 410 49  HOH HOH F . 
NB 5 HOH 11 411 53  HOH HOH F . 
NB 5 HOH 12 412 43  HOH HOH F . 
OB 5 HOH 1  201 40  HOH HOH G . 
OB 5 HOH 2  202 59  HOH HOH G . 
OB 5 HOH 3  203 159 HOH HOH G . 
OB 5 HOH 4  204 60  HOH HOH G . 
OB 5 HOH 5  205 160 HOH HOH G . 
OB 5 HOH 6  206 164 HOH HOH G . 
PB 5 HOH 1  201 44  HOH HOH H . 
PB 5 HOH 2  202 48  HOH HOH H . 
PB 5 HOH 3  203 37  HOH HOH H . 
PB 5 HOH 4  204 47  HOH HOH H . 
PB 5 HOH 5  205 158 HOH HOH H . 
PB 5 HOH 6  206 96  HOH HOH H . 
PB 5 HOH 7  207 165 HOH HOH H . 
PB 5 HOH 8  208 58  HOH HOH H . 
PB 5 HOH 9  209 62  HOH HOH H . 
PB 5 HOH 10 210 45  HOH HOH H . 
PB 5 HOH 11 211 61  HOH HOH H . 
PB 5 HOH 12 212 112 HOH HOH H . 
PB 5 HOH 13 213 120 HOH HOH H . 
PB 5 HOH 14 214 50  HOH HOH H . 
PB 5 HOH 15 215 56  HOH HOH H . 
PB 5 HOH 16 216 57  HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,IB,JB,KB,LB 
2 1 E,F,G,H,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,MB,NB,OB,PB 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-02-14 
2 'Structure model' 1 1 2018-04-18 
3 'Structure model' 1 2 2018-05-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.pdbx_database_id_DOI'    
7  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
8  2 'Structure model' '_citation.title'                   
9  2 'Structure model' '_citation.year'                    
10 3 'Structure model' '_citation.journal_volume'          
11 3 'Structure model' '_citation.page_first'              
12 3 'Structure model' '_citation.page_last'               
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -27.6912 15.6961 -25.5338 0.0708 0.1341 0.0283 -0.0634 -0.0115 -0.0285 3.5253 2.0427 6.3902 
-1.2335 -2.1366 1.2711  0.0127  0.0460  -0.0587 -0.2335 0.0816  -0.2068 0.1974  -0.1051 0.0746  
'X-RAY DIFFRACTION' 2 ? refined -44.8203 6.9078  -54.5318 0.2480 0.2556 0.0280 0.0300  -0.0494 -0.0531 4.5743 1.6712 7.7937 
-0.1450 -3.9166 -0.1447 -0.0211 -0.1998 0.2209  0.9185  -0.1650 0.1687  -0.6020 0.0811  -0.4677 
'X-RAY DIFFRACTION' 3 ? refined -34.5813 16.3692 -39.8828 0.0583 0.0584 0.0209 -0.0348 0.0048  0.0058  4.0734 7.7692 1.2114 3.7872 
0.0736  0.6101  -0.0473 -0.0408 0.0881  0.0271  0.0947  -0.0945 -0.3770 -0.1596 0.0643  
'X-RAY DIFFRACTION' 4 ? refined -33.1635 16.4958 -40.7212 0.0351 0.0505 0.0442 -0.0237 0.0143  -0.0030 3.7234 7.8941 1.9474 3.3393 
0.1521  0.6950  0.0555  -0.0080 -0.0475 -0.0730 0.0054  -0.4561 -0.1495 -0.1108 0.1873  
'X-RAY DIFFRACTION' 5 ? refined -45.9570 14.6354 -5.4009  0.0877 0.1756 0.0185 0.0871  0.0015  -0.0370 2.5753 2.0513 6.0800 0.9595 
1.5021  0.9154  -0.0314 0.0540  -0.0226 0.1302  -0.0839 -0.1463 -0.1767 0.1092  0.1060  
'X-RAY DIFFRACTION' 6 ? refined -63.4992 23.7365 23.8576  0.3124 0.2711 0.0081 0.0105  0.0088  -0.0308 3.6981 2.8069 6.4578 0.4901 
1.0826  -0.8501 0.0733  -0.2081 0.1348  -0.7515 0.0784  0.0596  0.8776  -0.2859 -0.0112 
'X-RAY DIFFRACTION' 7 ? refined -52.7839 13.9836 9.1459   0.0820 0.0874 0.0367 0.0482  -0.0190 0.0133  3.1538 7.5785 1.7035 
-4.0276 -0.2929 0.6306  -0.0828 -0.0090 0.0918  -0.0088 -0.1276 -0.0796 0.4425  0.1531  0.0531  
'X-RAY DIFFRACTION' 8 ? refined -51.3591 13.9083 9.9527   0.0571 0.0792 0.0589 0.0458  -0.0108 0.0173  4.4284 7.3619 1.8368 
-3.7394 -0.5692 1.1052  0.0661  -0.0286 -0.0374 0.0540  -0.0590 -0.4192 0.0988  0.0851  0.1346  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 147 A 214 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 148 B 215 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 1   C 12  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 1   D 12  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 E 148 E 215 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 F 148 F 215 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7 7 G 1   G 12  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8 8 H 1   H 12  ? ? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0189 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.32   2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             E 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_1              214 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             E 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              215 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             E 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              215 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.58 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            11.28 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLY 147 ? N   ? A GLY 6  N   
2   1 Y 1 A LYS 148 ? CG  ? A LYS 7  CG  
3   1 Y 1 A LYS 148 ? CD  ? A LYS 7  CD  
4   1 Y 1 A LYS 148 ? CE  ? A LYS 7  CE  
5   1 Y 1 A LYS 148 ? NZ  ? A LYS 7  NZ  
6   1 Y 1 A LYS 160 ? NZ  ? A LYS 19 NZ  
7   1 Y 1 A LYS 161 ? NZ  ? A LYS 20 NZ  
8   1 Y 1 A LYS 167 ? CD  ? A LYS 26 CD  
9   1 Y 1 A LYS 167 ? CE  ? A LYS 26 CE  
10  1 Y 1 A LYS 167 ? NZ  ? A LYS 26 NZ  
11  1 Y 1 A SER 171 ? OG  ? A SER 30 OG  
12  1 Y 1 A LYS 174 ? CE  ? A LYS 33 CE  
13  1 Y 1 A LYS 174 ? NZ  ? A LYS 33 NZ  
14  1 Y 1 A SER 183 ? OG  ? A SER 42 OG  
15  1 Y 1 A LYS 185 ? CD  ? A LYS 44 CD  
16  1 Y 1 A LYS 185 ? CE  ? A LYS 44 CE  
17  1 Y 1 A LYS 185 ? NZ  ? A LYS 44 NZ  
18  1 Y 1 A LYS 212 ? CE  ? A LYS 71 CE  
19  1 Y 1 A LYS 212 ? NZ  ? A LYS 71 NZ  
20  1 Y 1 B LYS 148 ? CG  ? B LYS 7  CG  
21  1 Y 1 B LYS 148 ? CD  ? B LYS 7  CD  
22  1 Y 1 B LYS 148 ? CE  ? B LYS 7  CE  
23  1 Y 1 B LYS 148 ? NZ  ? B LYS 7  NZ  
24  1 Y 1 B MET 150 ? CG  ? B MET 9  CG  
25  1 Y 1 B MET 150 ? SD  ? B MET 9  SD  
26  1 Y 1 B MET 150 ? CE  ? B MET 9  CE  
27  1 Y 1 B ASP 151 ? CG  ? B ASP 10 CG  
28  1 Y 1 B ASP 151 ? OD1 ? B ASP 10 OD1 
29  1 Y 1 B ASP 151 ? OD2 ? B ASP 10 OD2 
30  1 Y 1 B PRO 153 ? CG  ? B PRO 12 CG  
31  1 Y 1 B PRO 153 ? CD  ? B PRO 12 CD  
32  1 Y 1 B PRO 157 ? CB  ? B PRO 16 CB  
33  1 Y 1 B PRO 157 ? CG  ? B PRO 16 CG  
34  1 Y 1 B PRO 157 ? CD  ? B PRO 16 CD  
35  1 Y 1 B LYS 160 ? CD  ? B LYS 19 CD  
36  1 Y 1 B LYS 160 ? CE  ? B LYS 19 CE  
37  1 Y 1 B LYS 160 ? NZ  ? B LYS 19 NZ  
38  1 Y 1 B LYS 161 ? NZ  ? B LYS 20 NZ  
39  1 Y 1 B SER 183 ? OG  ? B SER 42 OG  
40  1 Y 1 B LYS 185 ? CG  ? B LYS 44 CG  
41  1 Y 1 B LYS 185 ? CD  ? B LYS 44 CD  
42  1 Y 1 B LYS 185 ? CE  ? B LYS 44 CE  
43  1 Y 1 B LYS 185 ? NZ  ? B LYS 44 NZ  
44  1 Y 1 B LYS 186 ? NZ  ? B LYS 45 NZ  
45  1 Y 1 B SER 205 ? OG  ? B SER 64 OG  
46  1 Y 1 B LYS 212 ? CD  ? B LYS 71 CD  
47  1 Y 1 B LYS 212 ? CE  ? B LYS 71 CE  
48  1 Y 1 B LYS 212 ? NZ  ? B LYS 71 NZ  
49  1 Y 1 B MET 214 ? CG  ? B MET 73 CG  
50  1 Y 1 B MET 214 ? SD  ? B MET 73 SD  
51  1 Y 1 B MET 214 ? CE  ? B MET 73 CE  
52  1 Y 1 B PRO 215 ? CA  ? B PRO 74 CA  
53  1 Y 1 B PRO 215 ? C   ? B PRO 74 C   
54  1 Y 1 B PRO 215 ? O   ? B PRO 74 O   
55  1 Y 1 B PRO 215 ? CB  ? B PRO 74 CB  
56  1 Y 1 B PRO 215 ? CG  ? B PRO 74 CG  
57  1 Y 1 B PRO 215 ? CD  ? B PRO 74 CD  
58  1 Y 1 E LYS 148 ? CG  ? E LYS 7  CG  
59  1 Y 1 E LYS 148 ? CD  ? E LYS 7  CD  
60  1 Y 1 E LYS 148 ? CE  ? E LYS 7  CE  
61  1 Y 1 E LYS 148 ? NZ  ? E LYS 7  NZ  
62  1 Y 1 E LYS 160 ? NZ  ? E LYS 19 NZ  
63  1 Y 1 E LYS 161 ? NZ  ? E LYS 20 NZ  
64  1 Y 1 E LYS 167 ? CD  ? E LYS 26 CD  
65  1 Y 1 E LYS 167 ? CE  ? E LYS 26 CE  
66  1 Y 1 E LYS 167 ? NZ  ? E LYS 26 NZ  
67  1 Y 1 E LEU 170 ? CD1 ? E LEU 29 CD1 
68  1 Y 1 E LEU 170 ? CD2 ? E LEU 29 CD2 
69  1 Y 1 E LYS 174 ? CD  ? E LYS 33 CD  
70  1 Y 1 E LYS 174 ? CE  ? E LYS 33 CE  
71  1 Y 1 E LYS 174 ? NZ  ? E LYS 33 NZ  
72  1 Y 1 E SER 183 ? OG  ? E SER 42 OG  
73  1 Y 1 E LYS 185 ? CD  ? E LYS 44 CD  
74  1 Y 1 E LYS 185 ? CE  ? E LYS 44 CE  
75  1 Y 1 E LYS 185 ? NZ  ? E LYS 44 NZ  
76  1 Y 1 E LYS 212 ? CE  ? E LYS 71 CE  
77  1 Y 1 E LYS 212 ? NZ  ? E LYS 71 NZ  
78  1 Y 1 E PRO 215 ? C   ? E PRO 74 C   
79  1 Y 1 E PRO 215 ? O   ? E PRO 74 O   
80  1 Y 1 E PRO 215 ? CB  ? E PRO 74 CB  
81  1 Y 1 E PRO 215 ? CG  ? E PRO 74 CG  
82  1 Y 1 E PRO 215 ? CD  ? E PRO 74 CD  
83  1 Y 1 F LYS 148 ? CG  ? F LYS 7  CG  
84  1 Y 1 F LYS 148 ? CD  ? F LYS 7  CD  
85  1 Y 1 F LYS 148 ? CE  ? F LYS 7  CE  
86  1 Y 1 F LYS 148 ? NZ  ? F LYS 7  NZ  
87  1 Y 1 F MET 150 ? CG  ? F MET 9  CG  
88  1 Y 1 F MET 150 ? SD  ? F MET 9  SD  
89  1 Y 1 F MET 150 ? CE  ? F MET 9  CE  
90  1 Y 1 F LYS 160 ? CG  ? F LYS 19 CG  
91  1 Y 1 F LYS 160 ? CD  ? F LYS 19 CD  
92  1 Y 1 F LYS 160 ? CE  ? F LYS 19 CE  
93  1 Y 1 F LYS 160 ? NZ  ? F LYS 19 NZ  
94  1 Y 1 F LYS 161 ? NZ  ? F LYS 20 NZ  
95  1 Y 1 F SER 183 ? OG  ? F SER 42 OG  
96  1 Y 1 F LYS 185 ? CG  ? F LYS 44 CG  
97  1 Y 1 F LYS 185 ? CD  ? F LYS 44 CD  
98  1 Y 1 F LYS 185 ? CE  ? F LYS 44 CE  
99  1 Y 1 F LYS 185 ? NZ  ? F LYS 44 NZ  
100 1 Y 1 F ARG 195 ? CG  ? F ARG 54 CG  
101 1 Y 1 F ARG 195 ? CD  ? F ARG 54 CD  
102 1 Y 1 F ARG 195 ? NE  ? F ARG 54 NE  
103 1 Y 1 F ARG 195 ? CZ  ? F ARG 54 CZ  
104 1 Y 1 F ARG 195 ? NH1 ? F ARG 54 NH1 
105 1 Y 1 F ARG 195 ? NH2 ? F ARG 54 NH2 
106 1 Y 1 F ASN 199 ? CG  ? F ASN 58 CG  
107 1 Y 1 F ASN 199 ? OD1 ? F ASN 58 OD1 
108 1 Y 1 F ASN 199 ? ND2 ? F ASN 58 ND2 
109 1 Y 1 F THR 200 ? OG1 ? F THR 59 OG1 
110 1 Y 1 F THR 200 ? CG2 ? F THR 59 CG2 
111 1 Y 1 F LYS 212 ? NZ  ? F LYS 71 NZ  
112 1 Y 1 F PRO 215 ? C   ? F PRO 74 C   
113 1 Y 1 F PRO 215 ? O   ? F PRO 74 O   
114 1 Y 1 F PRO 215 ? CB  ? F PRO 74 CB  
115 1 Y 1 F PRO 215 ? CG  ? F PRO 74 CG  
116 1 Y 1 F PRO 215 ? CD  ? F PRO 74 CD  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 142 ? A GLY 1  
2  1 Y 1 A ALA 143 ? A ALA 2  
3  1 Y 1 A THR 144 ? A THR 3  
4  1 Y 1 A GLU 145 ? A GLU 4  
5  1 Y 1 A SER 146 ? A SER 5  
6  1 Y 1 A PRO 215 ? A PRO 74 
7  1 Y 1 A SER 216 ? A SER 75 
8  1 Y 1 A LYS 217 ? A LYS 76 
9  1 Y 1 A LEU 218 ? A LEU 77 
10 1 Y 1 A GLN 219 ? A GLN 78 
11 1 Y 1 A LYS 220 ? A LYS 79 
12 1 Y 1 B GLY 142 ? B GLY 1  
13 1 Y 1 B ALA 143 ? B ALA 2  
14 1 Y 1 B THR 144 ? B THR 3  
15 1 Y 1 B GLU 145 ? B GLU 4  
16 1 Y 1 B SER 146 ? B SER 5  
17 1 Y 1 B GLY 147 ? B GLY 6  
18 1 Y 1 B SER 216 ? B SER 75 
19 1 Y 1 B LYS 217 ? B LYS 76 
20 1 Y 1 B LEU 218 ? B LEU 77 
21 1 Y 1 B GLN 219 ? B GLN 78 
22 1 Y 1 B LYS 220 ? B LYS 79 
23 1 Y 1 E GLY 142 ? E GLY 1  
24 1 Y 1 E ALA 143 ? E ALA 2  
25 1 Y 1 E THR 144 ? E THR 3  
26 1 Y 1 E GLU 145 ? E GLU 4  
27 1 Y 1 E SER 146 ? E SER 5  
28 1 Y 1 E GLY 147 ? E GLY 6  
29 1 Y 1 E SER 216 ? E SER 75 
30 1 Y 1 E LYS 217 ? E LYS 76 
31 1 Y 1 E LEU 218 ? E LEU 77 
32 1 Y 1 E GLN 219 ? E GLN 78 
33 1 Y 1 E LYS 220 ? E LYS 79 
34 1 Y 1 F GLY 142 ? F GLY 1  
35 1 Y 1 F ALA 143 ? F ALA 2  
36 1 Y 1 F THR 144 ? F THR 3  
37 1 Y 1 F GLU 145 ? F GLU 4  
38 1 Y 1 F SER 146 ? F SER 5  
39 1 Y 1 F GLY 147 ? F GLY 6  
40 1 Y 1 F SER 216 ? F SER 75 
41 1 Y 1 F LYS 217 ? F LYS 76 
42 1 Y 1 F LEU 218 ? F LEU 77 
43 1 Y 1 F GLN 219 ? F GLN 78 
44 1 Y 1 F LYS 220 ? F LYS 79 
# 
_ndb_struct_conf_na.entry_id   6C1A 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DC 1  1_555 D DG  12 1_555 0.283  -0.189 0.064  -7.774  2.669   -2.630 1  C_DC1:DG12_D C 1  ? D 12 ? 19 1 
1 C DG 2  1_555 D DC  11 1_555 -0.371 -0.137 0.028  1.383   -4.834  -1.123 2  C_DG2:DC11_D C 2  ? D 11 ? 19 1 
1 C DG 3  1_555 D DC  10 1_555 -0.268 -0.111 0.244  12.699  -7.743  1.394  3  C_DG3:DC10_D C 3  ? D 10 ? 19 1 
1 C DA 4  1_555 D DT  9  1_555 0.060  -0.104 -0.265 -0.874  -29.534 1.561  4  C_DA4:DT9_D  C 4  ? D 9  ? 20 1 
1 C DA 5  1_555 D DT  8  1_555 -0.188 -0.130 -0.006 -2.360  -11.538 3.465  5  C_DA5:DT8_D  C 5  ? D 8  ? 20 1 
1 C DT 6  1_555 D DA  7  1_555 0.081  -0.105 -0.042 3.558   -7.504  1.561  6  C_DT6:DA7_D  C 6  ? D 7  ? 20 1 
1 C DG 7  1_555 D 5CM 6  1_555 -0.175 -0.099 -0.285 -12.090 -4.654  -0.295 7  C_DG7:5CM6_D C 7  ? D 6  ? 19 1 
1 C DT 8  1_555 D DA  5  1_555 -0.088 -0.163 -0.038 2.707   -2.904  2.408  8  C_DT8:DA5_D  C 8  ? D 5  ? 20 1 
1 C DA 9  1_555 D DT  4  1_555 0.036  -0.106 0.134  2.902   -15.869 -1.226 9  C_DA9:DT4_D  C 9  ? D 4  ? 20 1 
1 C DG 10 1_555 D DC  3  1_555 -0.009 -0.135 0.504  8.850   -8.161  -1.310 10 C_DG10:DC3_D C 10 ? D 3  ? 19 1 
1 C DG 11 1_555 D DC  2  1_555 -0.246 -0.127 0.208  1.710   -7.896  -1.721 11 C_DG11:DC2_D C 11 ? D 2  ? 19 1 
1 C DC 12 1_555 D DG  1  1_555 0.347  -0.108 -0.115 6.121   -5.464  1.774  12 C_DC12:DG1_D C 12 ? D 1  ? 19 1 
1 G DC 1  1_555 H DG  12 1_555 0.419  -0.248 0.035  -4.229  2.039   -1.819 13 G_DC1:DG12_H G 1  ? H 12 ? 19 1 
1 G DG 2  1_555 H DC  11 1_555 -0.367 -0.096 0.208  2.252   -5.740  1.468  14 G_DG2:DC11_H G 2  ? H 11 ? 19 1 
1 G DG 3  1_555 H DC  10 1_555 -0.114 -0.164 0.240  9.952   -10.474 0.024  15 G_DG3:DC10_H G 3  ? H 10 ? 19 1 
1 G DA 4  1_555 H DT  9  1_555 -0.052 -0.165 -0.137 -0.947  -24.395 1.833  16 G_DA4:DT9_H  G 4  ? H 9  ? 20 1 
1 G DA 5  1_555 H DT  8  1_555 -0.013 -0.166 0.121  -5.263  -8.736  0.518  17 G_DA5:DT8_H  G 5  ? H 8  ? 20 1 
1 G DT 6  1_555 H DA  7  1_555 0.101  -0.072 -0.060 3.931   -7.901  1.781  18 G_DT6:DA7_H  G 6  ? H 7  ? 20 1 
1 G DG 7  1_555 H 5CM 6  1_555 -0.252 -0.066 -0.265 -13.296 -3.385  0.177  19 G_DG7:5CM6_H G 7  ? H 6  ? 19 1 
1 G DT 8  1_555 H DA  5  1_555 -0.013 -0.188 0.007  3.041   -4.677  2.407  20 G_DT8:DA5_H  G 8  ? H 5  ? 20 1 
1 G DA 9  1_555 H DT  4  1_555 -0.022 -0.091 0.207  2.018   -17.282 -2.530 21 G_DA9:DT4_H  G 9  ? H 4  ? 20 1 
1 G DG 10 1_555 H DC  3  1_555 0.016  -0.058 0.528  8.327   -6.173  -1.582 22 G_DG10:DC3_H G 10 ? H 3  ? 19 1 
1 G DG 11 1_555 H DC  2  1_555 -0.306 -0.180 0.211  4.068   -5.119  -2.990 23 G_DG11:DC2_H G 11 ? H 2  ? 19 1 
1 G DC 12 1_555 H DG  1  1_555 0.425  -0.093 -0.100 6.508   -6.246  1.573  24 G_DC12:DG1_H G 12 ? H 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DC 1  1_555 D DG  12 1_555 C DG 2  1_555 D DC  11 1_555 -0.173 0.080  3.089 -0.440 1.494  37.997 -0.056 0.213  3.091 2.293  
0.676  38.028 1  CC_DC1DG2:DC11DG12_DD C 1  ? D 12 ? C 2  ? D 11 ? 
1 C DG 2  1_555 D DC  11 1_555 C DG 3  1_555 D DC  10 1_555 0.182  0.825  3.079 -0.654 3.074  26.481 1.023  -0.557 3.147 6.681  
1.421  26.664 2  CC_DG2DG3:DC10DC11_DD C 2  ? D 11 ? C 3  ? D 10 ? 
1 C DG 3  1_555 D DC  10 1_555 C DA 4  1_555 D DT  9  1_555 -0.900 1.649  3.700 1.722  1.723  43.442 2.036  1.403  3.723 2.326  
-2.325 43.507 3  CC_DG3DA4:DT9DC10_DD  C 3  ? D 10 ? C 4  ? D 9  ? 
1 C DA 4  1_555 D DT  9  1_555 C DA 5  1_555 D DT  8  1_555 0.554  0.149  3.135 -3.716 -1.607 37.557 0.426  -1.312 3.059 -2.487 
5.752  37.767 4  CC_DA4DA5:DT8DT9_DD   C 4  ? D 9  ? C 5  ? D 8  ? 
1 C DA 5  1_555 D DT  8  1_555 C DT 6  1_555 D DA  7  1_555 0.120  -0.579 3.130 0.517  -2.364 30.895 -0.644 -0.129 3.166 -4.428 
-0.969 30.988 5  CC_DA5DT6:DA7DT8_DD   C 5  ? D 8  ? C 6  ? D 7  ? 
1 C DT 6  1_555 D DA  7  1_555 C DG 7  1_555 D 5CM 6  1_555 -0.016 -0.199 3.652 0.731  1.779  44.226 -0.448 0.098  3.641 2.362  
-0.970 44.265 6  CC_DT6DG7:5CM6DA7_DD  C 6  ? D 7  ? C 7  ? D 6  ? 
1 C DG 7  1_555 D 5CM 6  1_555 C DT 8  1_555 D DA  5  1_555 -0.132 -0.299 2.911 -1.379 3.088  24.438 -1.536 -0.064 2.855 7.251  
3.237  24.667 7  CC_DG7DT8:DA55CM6_DD  C 7  ? D 6  ? C 8  ? D 5  ? 
1 C DT 8  1_555 D DA  5  1_555 C DA 9  1_555 D DT  4  1_555 -1.371 1.066  3.333 -2.697 -1.926 39.083 1.824  1.713  3.362 -2.872 
4.023  39.218 8  CC_DT8DA9:DT4DA5_DD   C 8  ? D 5  ? C 9  ? D 4  ? 
1 C DA 9  1_555 D DT  4  1_555 C DG 10 1_555 D DC  3  1_555 0.647  0.434  3.147 -2.318 -1.615 35.230 0.941  -1.392 3.077 -2.662 
3.822  35.340 9  CC_DA9DG10:DC3DT4_DD  C 9  ? D 4  ? C 10 ? D 3  ? 
1 C DG 10 1_555 D DC  3  1_555 C DG 11 1_555 D DC  2  1_555 -0.219 0.260  3.549 1.577  -2.844 38.810 0.763  0.535  3.510 -4.271 
-2.368 38.941 10 CC_DG10DG11:DC2DC3_DD C 10 ? D 3  ? C 11 ? D 2  ? 
1 C DG 11 1_555 D DC  2  1_555 C DC 12 1_555 D DG  1  1_555 0.897  -0.148 3.281 2.508  -3.456 35.675 0.261  -1.092 3.334 -5.617 
-4.076 35.921 11 CC_DG11DC12:DG1DC2_DD C 11 ? D 2  ? C 12 ? D 1  ? 
1 G DC 1  1_555 H DG  12 1_555 G DG 2  1_555 H DC  11 1_555 -0.174 -0.034 3.180 -0.864 1.317  36.900 -0.227 0.161  3.180 2.080  
1.365  36.933 12 GG_DC1DG2:DC11DG12_HH G 1  ? H 12 ? G 2  ? H 11 ? 
1 G DG 2  1_555 H DC  11 1_555 G DG 3  1_555 H DC  10 1_555 0.179  0.813  3.162 0.876  3.278  28.623 0.915  -0.168 3.237 6.602  
-1.764 28.819 13 GG_DG2DG3:DC10DC11_HH G 2  ? H 11 ? G 3  ? H 10 ? 
1 G DG 3  1_555 H DC  10 1_555 G DA 4  1_555 H DT  9  1_555 -0.789 1.488  3.600 0.455  1.839  41.557 1.879  1.164  3.652 2.591  
-0.641 41.598 14 GG_DG3DA4:DT9DC10_HH  G 3  ? H 10 ? G 4  ? H 9  ? 
1 G DA 4  1_555 H DT  9  1_555 G DA 5  1_555 H DT  8  1_555 0.433  0.064  3.252 -3.788 -2.283 38.568 0.371  -1.109 3.188 -3.443 
5.712  38.811 15 GG_DA4DA5:DT8DT9_HH   G 4  ? H 9  ? G 5  ? H 8  ? 
1 G DA 5  1_555 H DT  8  1_555 G DT 6  1_555 H DA  7  1_555 0.131  -0.508 3.038 1.410  -2.003 30.522 -0.591 0.013  3.067 -3.797 
-2.674 30.618 16 GG_DA5DT6:DA7DT8_HH   G 5  ? H 8  ? G 6  ? H 7  ? 
1 G DT 6  1_555 H DA  7  1_555 G DG 7  1_555 H 5CM 6  1_555 0.022  -0.274 3.672 -0.065 2.295  43.406 -0.619 -0.036 3.654 3.100  
0.088  43.464 17 GG_DT6DG7:5CM6DA7_HH  G 6  ? H 7  ? G 7  ? H 6  ? 
1 G DG 7  1_555 H 5CM 6  1_555 G DT 8  1_555 H DA  5  1_555 -0.210 -0.253 2.924 -1.585 1.442  25.213 -0.952 0.068  2.913 3.296  
3.624  25.303 18 GG_DG7DT8:DA55CM6_HH  G 7  ? H 6  ? G 8  ? H 5  ? 
1 G DT 8  1_555 H DA  5  1_555 G DA 9  1_555 H DT  4  1_555 -1.440 1.000  3.377 -2.990 -0.917 38.812 1.616  1.781  3.450 -1.377 
4.490  38.933 19 GG_DT8DA9:DT4DA5_HH   G 8  ? H 5  ? G 9  ? H 4  ? 
1 G DA 9  1_555 H DT  4  1_555 G DG 10 1_555 H DC  3  1_555 0.616  0.337  3.132 -2.006 -3.068 35.645 0.966  -1.274 3.055 -4.996 
3.266  35.827 20 GG_DA9DG10:DC3DT4_HH  G 9  ? H 4  ? G 10 ? H 3  ? 
1 G DG 10 1_555 H DC  3  1_555 G DG 11 1_555 H DC  2  1_555 -0.307 0.118  3.468 1.102  -1.817 38.409 0.418  0.611  3.450 -2.759 
-1.673 38.465 21 GG_DG10DG11:DC2DC3_HH G 10 ? H 3  ? G 11 ? H 2  ? 
1 G DG 11 1_555 H DC  2  1_555 G DC 12 1_555 H DG  1  1_555 0.853  -0.193 3.308 3.181  -3.895 35.448 0.261  -0.918 3.371 -6.357 
-5.192 35.792 22 GG_DG11DC12:DG1DC2_HH G 11 ? H 2  ? G 12 ? H 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'UNKNOWN ATOM OR ION' UNX 
5 water                 HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#